2MJEA

Reduced yeast adrenodoxin homolog 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
b'GEELKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adrenodoxin homolog, mitochondrial
publication title Functional reconstitution of mitochondrial Fe/S cluster synthesis on Isu1 reveals the involvement of ferredoxin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Metal binding protein
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mjeA00
2K9XA 5EE9A 1GPXA 4HRSA 1JW9D 1YQ4B 4KX6B 5EE0A 4YTNB 1XO3A 5EE1A 3AE2B 3P63A 1WWTA 3DWGC 4C80A 3FAHA 1PDXA 2L83A 3AEGB 1NYQA 3RPFC 3NVVA 2HTME 4IDIA 1ZOYB 2WDVB 5H8YE 3WCQA 2BS3B 2H88B 4C7YA 2W3RA 3AEFB 4JWSC 2CJNA 4N58A 5C2TB 3AEAB 3LXFA 1KF6B 1SF0A 1FIQA 1JALA 1FRDA 1OQRA 1QOBA 2WQYB 4YSYB 2AX5A 1KRHA 3L4PA 3VR9B 1F0ZA 3W5VB 1QLBB 2MJEA 1OFFA 3NS1A 1YQ3B 3AE8B 1V97A 1N60A 3KWLA 2WLBA 4YT0B 3CWIA 1ZXIA 1NENB 1J7AA 1FM0D 1GAQB 1YJIA 2KMMA 3AE7B 1RWSA 1YJJA 2E3TA 3AEBB 4YSXB 2W54A 3CIRB 1FFVA 1IUEA 4N59A 1RFKA 3AMZA 2K5PA 3SR6A 5AUIA 1VDVA 1VJKA 3AE1B 1J7BA 1WYGA 3B2FA 1SIJA 3HRDD 1N63A 1RM6C 4ZOHC 2K22A 3DWMA 4N6EB 1L5PA 1E7PB 3P1MA 1FXAA 1JWAD 1NEKB 1PFDA 2N0SB 3NVWA 5H92C 2JQRB 4YTPB 1ROEA 1L6UA 1TKEA 1TKYA 1CZPA 1JRPA 4YSZB 4US8A 5GXGB 2BS2B 3NVYA 5G5HA 3AV8A 3W5UB 2G1EA 1EWYC 1QOAA 2WU2B 5MPOA 1A70A 3BIID 3P4QB 3NRZA 2BS4B 3VRBB 1AWDA 2BT6A 3AE6B 2PIAA 1PUTA 3ETRA 1JROA 3LB8C 3NVZA 3SFEB 3HVZA 1NYRA 2MJDA 1L6VA 1FRRA 2CJOA 3AEEB 5G5GA 1DOYA 2PVGC 1J7CA 3AE9B 2LEKA 1I7HA 1CJEA 1UWMA 4ITKA 4WWMA 1KFYB 3B9JA 1ZP0B 3P4SB 2Q5WD 5AUKA 3W9CB 1FMAD 4YTMB 2ACZB 3AH7A 2EKIA 3AE5B 3SFDB 1TKGA 1FFUA 1XLPA 4C7ZA 1DOXA 1QOGA 2JX5A 4JWUC 1TJEA 4FXCA 2PKOA 2PVOD 3AB5A 2Y5CA 1N5XA 2MJ3A 4LTUA 2H89B 2QJLA 2WDRB 2WDQB 2WS3B 3HUIA 1B9RA 1XLQA 1FXIA 2MH7A 2KAJA 1QT9A 1E9MA 1RYJA 1XLOA 1SB3C 4WQMA 2WP9B 3FC4A 1JWBD 1WGKA 2B76B 2M19A 1R7SA 1V8CA 1WRIA 3P4RB 1N5WA 2DWQA 2W55A 3ABVB 1VLBA 2CU3A 2WU5B 1XLNA 3AEDB 3AE3B 3AM9A 4US9A 4ZHOA 1E10A 1N61A 1NI3A 1QOFA 1E0ZA 1JQ4A 2M56B 1L0VB 3EUB2 1AYFA 3AE4B 1WXQA 3ZYYX 2FBWB 1TYGB 3B2GA 1QF6A 3AN1A 1DOIA 3VRAB 2W3SA 1T3QA 1NVID 2L52A 3P4PB 1DGJA 2QIEB 3PO0A 1E6EB 4YXDB 1ZUD2 5EE3A 1FO4A 2DBYA 4HROA 5C3JB 3VR8B 4A9AA 4ZHPA 4P6VF 3AECB 1OQQA 2OHFA 4JX1C 1N62A 4USAA
chains in the Genus database with same CATH superfamily
3Q6BA 1WJUA 4GOCA 3LYYA 2EELA 3FAHA 5L95C 5L83A 4DHZE 4AS1A 1QKZA 1ZOYB 2KTFA 1P7EA 2CJNA 3A4SC 1WX7A 2I2YA 1EF1A 3FILB 2FAZA 4URKA 4ZDVA 3IT4B 1P9DU 1YQ3B 1I4HA 2L0TA 1ZW7A 2KTRB 4NJCA 1EO6A 2D3GA 4HPPA 1PGAA 2MX2A 2ZNVC 1J7BA 3EFCA 4W9CA 4B6WA 1SIJA 4I6LB 1L5PA 2AL6A 4PYZA 3KWVA 3OJ4B 2K8BA 1LXDA 2AWTA 1E5WA 3NHEB 1AWDA 3VUXA 3ETRA 3VXWA 2FUG1 2ICIA 1CJEA 4PS7A 2EKEC 3R66C 4FHKA 1SXTA 2ZW0A 2EKIA 3AH7A 3SFDB 2JU6X 2WXJA 3AU4A 3CSFA 1JCKB 3N1XC 5D2MB 2PKOA 4ANXA 2FIDA 2GB1A 1ET9A 1I4QA 2DLBA 1FXIA 2MQJA 3IT6B 4GIVA 1BMLC 1MG4A 1CK1A 1SB3C 2WNMA 4C4VB 5G55A 2JVCA 4O1NA 5AEKB 2KDMA 3A9KA 5IA7A 1E10A 1E0ZA 1WX9A 2M56B 4GDKA 2FBWB 4MM3A 4LNNA 1JMLA 2IGHA 3UIPB 5J2RA 3HVDA 4UDUC 3VR8B 2D2QA 4ZHPA 4P6VF 2CR5A 4JLCA 2E6XA 2K39A 1C78A 1C4AA 3EGRA 2NPTA 1GNUA 2UYZB 1YN3A 2BYFA 4M8MA 3Q8AA 1F52A 2W3RA 5DPRA 3AEAB 4EOYA 2AEHA 3WAMA 5D7GA 4XX5A 2KJHB 1UD7A 2A4ZA 2WXIA 3KWLA 2WLBA 2N9PC 4RFBA 4AJWA 4K1RB 1C9FA 4HRSA 4LK0M 1RWSA 4A55A 4AOFA 2INNE 1FNWA 3PHXB 4NZLB 3NG0A 1WM2A 3RCZA 2LGIA 2LGYA 2ZJDA 3Q8CA 4YSZB 5BYQA 3HIZA 3BIID 3BK1A 2IJ0A 3AE6B 4MJSB 2LHDA 4H2AA 3HVZA 3EC8A 4K3BA 2WX1A 4NJ6A 2CKHB 4GLSC 1WM3A 1D5ZC 1LQBA 3DBRI 4YTMB 1ZXHA 1H8CA 2DYBA 3LJ3A 4ZRIA 2BYVE 2H89B 4TV3A 1L0XB 2KYWA 1GOZA 2O6VD 1QILA 3UQBA 1ZKHA 2KKCA 3ECIA 1AARA 3APFA 2B76B 5HHDG 2BW2A 3P4RB 2CU1A 3AE3B 5IAAC 1F77A 2KD0A 5DPSA 3V6EB 3EHVA 1HZ5A 3AE4B 4IM2A 1DOIA 2KO3A 1UF0A 2W3SA 3P4PB 3ZVVA 2DBYA 1EWCA 2NCNA 2BVCA 4M0WA 2N7EA 2KOXA 4KSKC 3V61A 2DAJA 2LGDA 3IAS1 1SEBD 2J0KA 4I6NB 4AJYB 2JWUA 1WYWB 3PTFC 3BINA 2M0AA 5JHAA 4KDLB 1YD8U 3V05A 2C9WB 3UGBB 1HXYD 2KC2A 2N1WA 2HE7A 3DBLB 3ZDTA 2JZ3B 1FFVA 3PRMB 2IDYA 5J17A 2KDFB 5J18A 4ZOHC 4B0EA 4N6EB 2C7MB 2DAFA 2MCNB 3HHMA 4A3OA 3ZKJC 2BGFA 4LJPB 4KZ0A 3W5UB 3SDLC 1TT5B 4MDKE 1TBEA 2ZVOA 1FRRA 3NUHB 3OJ3A 1WJ4A 3QHTA 2LRWA 1J7CA 1KFYB 4NAMA 1TTNA 5AUKA 2KXJA 4ICUA 2V3NA 2ACZB 1TKGA 3PT2B 2L7RA 3BVGA 1XQQA 4II2B 4W9DA 2J52A 3HUIA 4DDGD 4E3CA 2LZ6A 2W82A 2L8JA 3JW0X 2LI5A 3U30A 1WGKA 2XBBC 2FCMA 2DWQA 3EFUA 1WMHB 2ONQA 4AP4C 2QMTA 1KLVA 1VZ6A 4MGKE 1WIAA 3SHQA 1UZXB 3OLMD 4KIKA 1RLFA 1E8YA 2KJ6A 3IBEA 2K9XA 1VZ8A 4KX6B 4HPMB 2RPQA 3QX1A 4G3XB 4IW0A 4MELA 2LXCA 4CO7A 3R7QA 3JVZX 4Q2JA 3RULA 3C8YA 1U4AA 1MI0A 4LNFA 3APCA 3NS1A 1ACCA 1SE9A 1V97A 1UWXA 2IYDB 2WHIA 2K6DB 3TIXA 3E9SA 1Z5SB 3CIRB 3LDZE 4EKUA 4KGSA 2AQ1B 3MFGA 1A5RA 2LRUA 5LXHA 2INCC 5CX3A 4ZRQA 3Q14C 4BKGA 1L6UA 2G4SA 2OEDA 1OTRB 5D3DA 5MPOA 4JPSA 3NRZA 3IHPC 1PUTA 2Z59B 2UU7A 3NVZA 1T6BX 3KQ4A 4GU2A 2PVGC 3ONSA 1UBQA 3X0WA 2C7HA 3IXSA 4W9GA 2LFIA 4TSSA 4DHZB 1GB4A 3KYCD 4AQ7A 3BYTB 2KN5A 3QCAA 4NQLB 1AN8A 2NVUI 2WXOA 3AU5A 4K81A 3N9YC 2L3ZA 1ESFA 1V5OA 3QK0A 4GSWA 4A3PA 4KSLC 2BWFA 4N9F4 1L2NA 4ZHOA 3A9KB 3BVZA 1JQ4A 2HTHA 2WWZA 4GDKB 3U2SC 4MM3B 1V86A 3A4RA 4HROA 4NQKE 3R8BA 5I4DA 1OQQA 2OHFA 4M02A 5EE9A 1GPXA 1JW9D 2KNBA 3HM3A 1XO3A 4WIPA 2NMQA 2BBCA 2NPTB 2JPHA 1PGBA 2PTLA 3TCAA 5IKCM 2BYEA 2BTEA 1NYQA 4MT5A 3JYUA 5JHBA 4JWSC 3CSTA 2KMCA 1KF6B 1QOBA 1YIWA 3R2TA 3VTVA 2J0MA 3Q8FA 1BXTA 3APDA 1CMXB 3B1LX 2MBBB 4HPLB 2XK5A 3URYA 2AQ3B 2M4NA 3DOWA 4FJYA 3V3XA 1RFKA 3J9CA 2O6VA 3C0RB 1VDVA 4RMAA 1HTQA 1WYGA 1V9JA 3PZ8A 3DWMA 3P1MA 2JQRB 1TKEA 4B95A 2K3UA 4CQNA 4F1SA 4IUMB 4TQ1A 2WU2B 2PEAA 2RMMA 1JROA 1KH0A 3AEEB 3ZJTA 1I7HA 3MC0B 2Q5WD 3QIJA 3W9CB 2R2QA 5LLIA 4YWGG 1UNSA 1IBXA 4OZBA 3I5JC 1WGDA 2LWPA 1B9RA 1FNVA 2MH7A 2IGGA 3FC4A 2NBVB 1ET6A 3RI7C 4WAAA 1NI3A 1X1MA 3B0AA 2WGSA 1RAXA 2JZZA 2B3AA 4CYEA 1C4CA 4HK2A 2QILA 2QIEB 3KUDB 4WAFA 1J8CA 2ZVNA 1KM7A 3ZNHB 2JSVX 1SJED 3WANA 3N1YC 4YTNB 4M0WB 1STEA 1V49A 2MWSB 4ZRJA 3U7DA 4LNKA 3TEYA 3PGEA 2LHEA 3TUOA 1WJ6A 4YL8A 1V6EA 1XEEA 2DZJA 3VUWA 4KZCA 5FKAC 3KH0A 5FR6A 3OG5A 2IZVB 1WRDB 1KTKA 1QLBB 2J7QB 4KKIA 2WXQA 3RZWC 1UUPA 1ISNA 3I9V1 4FHJA 3BK2A 1VZ7A 4JL9A 4XC2A 5CHWA 4YT0B 2SEBD 2KDIA 1YJJA 4WJOA 2MSED 3QWZB 4GN1A 3SR6A 4NAWA 4ANVA 1EM7A 5IP4D 1T5XD 2NTSA 1IGCA 3MHZA 3IAM1 5E6PA 2L05A 2LXAA 5GXGB 4M8NA 1MPEA 1FCLA 1A70A 2UWQA 2PIAA 3SFEB 1Y8RC 2MJDA 1YX5B 4K3CA 4OVUA 4PS8A 3V60A 2LVOA 4E74A 3DPDA 1P7FA 5KHOA 4X57B 4KGTA 4G50A 5FR3A 3KW5B 2IO1B 3W1SC 4REZA 2WXNA 4P16A 4W9HA 3TL5A 5BYRA 1UH6A 3N32A 3ZRCA 2BF8B 3ABVB 1XLNA 3AEDB 4WJNA 2BQQA 2QC8A 2LVPA 3PZ7A 2Y3AA 1TY2A 1ZDXA 3MC9A 4MH0E 1FO4A 4KIKB 3AECB 4IDIA 4DHJD 4M00A 5CTRC 2DYOA 3X23A 2J0JA 4P1CC 2PJHA 5KHQA 1TZOA 4W9FA 5HG2A 2Z0DB 2L0FA 2FCSA 5GMVA 3GS2A 2ZCBA 1ZDVA 1FRDA 1OQRA 2WXMA 4ACFA 1SSNA 3MC8A 3RN9C 2KFKA 3T3NA 1SJHD 1WGGA 2L1AA 3ML8A 1YNTE 4MSMB 3PRZA 5DPWA 1YOVB 2FCQA 1XF5L 4MGYE 3ZXVA 1FXAA 4JE3B 2IBIB 2LD9A 1S1QB 4RNAA 5D6JB 4HDOA 1CZPA 1V80A 2GRIA 3W1SA 2NS5A 3CMMB 2G1EA 1HZ6A 2CHZA 4OZAA 1NYRA 2KZRA 5G5GA 3H9DA 1D3ZA 3DVGY 3B9JA 2V3PA 4MEMA 2JZPA 1GG3A 2Y5CA 1HQRD 2N7JA 4K7WA 4R3DA 1WY8A 3AXCA 1XLQA 3QAQA 4LLGM 4W9JA 2N9LA 1M94A 3QARA 3W2DA 4MSQB 4TKNA 3VAWA 2Z8LA 5HFYA 3AI5A 4HJGE 3BZDB 1YQ4B 2G45B 1MHHE 3P63A 2VZKD 4IWPA 4EE2A 2O2VA 1YJ1A 3DBHI 2A5UA 1Q10A 4S0RA 2WYQA 1OEYA 1IP9A 3NZUA 2PE6B 3JSVA 2WXLA 2XNAC 3OAWA 1WE6A 2FUHB 2JYTA 1R4MI 3R2IA 1OQYA 4RGOS 2KC1A 3RNEC 4XDCA 1I4XA 1TS4A 1XCQL 1Q1OA 4RGNA 5BMIA 1LM8B 2XK5B 3N3KB 4NJ7A 2LMCA 2FNJB 4XYCA 2ZZPB 2O6VB 1YX6B 3HRDD 3U52E 1NI2A 3RFZB 2K8CA 4IOIE 5JXVA 4US8A 3VHTC 1QOAA 2BS4B 1K51A 5DPTA 3LB8C 3SU8X 2GBMA 1K50A 2AYOB 1JRUA 1WX8A 2M0XA 1E8WA 1TGZB 3P4SB 1Z2MA 2VH2A 1SGHA 4HEA1 3BY4B 1QOGA 4A8XC 4FXCA 4WJQA 3A9JA 2GI9A 3PREA 1IBXB 1AW7A 2LJ5A 3GZNB 3O13A 3ZGZA 3NOBA 1IGDA 1E9MA 2N9KA 4WQMA 3RNBC 2KHWB 1R4NI 2OJWA 1WRIA 2DENB 2KLCA 1VLBA 2YLMA 2RD0A 1MFWA 4JQWC 1TYGB 3AN1A 3VRAB 3TMPB 1F2RI 2MA9B 4A9AA 2HJ1A 4MGZE 2J53A 3T8MA 4USAA 3TBLD 1WWTA 2AQ2B 2CHXA 2MBQA 2WX0A 3T9LA 3WAOA 2M8SA 3AEGB 3T3OA 4ZRPA 2WDVB 4XGAB 1I4GA 1TZ1A 4L23A 4OVVA 1F9JA 2JXTA 4XWWA 3NY5A 2QCZA 5HKHA 4A6QA 2ZCCA 5G2NA 4DBGA 3EA6A 3CWIA 2N4FA 2NR2A 4NY0A 2EMSA 3VH3B 4FBJB 3H8HA 3PZDA 1VD2A 4NAWB 1N63A 1SE4A 4IM0A 4TQ0A 1JWAD 2N0SB 4RCOA 3VRBB 2BT6A 2I1JA 1L7YA 4KV2A 4ZYSA 3DBSA 3Q8BA 1C77A 3ALBA 1J19A 1SE2A 2LEKA 1C4PA 2L32A 4LNIA 3UQAA 5BMGA 4C7ZA 1FFUA 3TJPA 5IN7A 2HD5B 2MHJA 4QAYA 5D3IB 1ZE3D 4LTUA 2WDQB 1ZGUB 3Q69A 3NZSA 3SEBA 1RYJA 4S17A 2VRRB 3ZDMC 1HEZE 4BFRA 4EZJA 1K52A 1R7SA 4BZAA 2REXA 2OJRA 4WH4A 1LFDA 2IGDA 4ARIA 3PPAA 3W1YA 1DGJA 1ZUD2 5EE3A 3TEZA 1TS2A 3HM6X 3M62B 3ZJUA 1XT9B 2MP2A 4JX1C 3Q3OC 3C19A 2KVRA 3PLVA 3PLUA 4RM9A 1P98A 1SE3A 1HE8A 4WQOB 1E90A 2SAKA 3L10B 4LNOA 5C1ZA 4PK1A 3ENEA 2WXPA 5H8YE 2JT4B 3UI3A 4JIOU 3AULA 3L13A 2KWCA 4HCPB 4FJZA 3VR9B 3W5VB 5JZEB 2KWUB 2KFKB 4M01A 3UINB 2KMMA 4IM3A 1G6JA 2W54A 2ASQA 4BBNF 4W9IA 3PHWB 4LDTD 1IUEA 4N59A 3L54A 4L1BA 2KJRA 3QQ8B 4RGMA 1WZ0A 1NEKB 2G4DB 5CHFA 1FD6A 3OWEB 4KKJA 1GJZA 1QQRA 1EWYC 1D4BA 1OEYJ 3VUYA 3ZQ4A 2JRIB 2WXHA 4HJKA 3RMKC 2K25A 4K7SA 2DHZA 3M63B 3RNAC 3A33B 1NDDA 2D3AA 3IG3A 2MJ3A 4IC7B 4OW0A 4F8CB 3DBRB 1CQVA 2W9NA 3VH4B 1UGJA 1K53A 2WU5B 2WXFA 3AM9A 3QC8B 4MGIE 4K7UA 1L0VB 3EECA 4F7ZA 3PO0A 3PSEB 1BUIC 1LO5D 4AUQC 2LGXA 2OOBB 4PT5A 4HCNB 3U4EG 4G11A 4GMVA 3PS6A 3V6CB 3GE3C 1DYQA 1TS5A 4C80A 3TSSA 1SIFA 2O2VB 1QZEA 2IO2B 1KOTA 2V1YA 2X8XX 4NPNA 1FEHA 1NBFC 3DBLI 4C00A 3LXFA 1I4PA 4ICVA 3ZNID 2WQYB 3JSVB 3N20C 1WZ3A 4GXBA 3CF6E 3VTWA 2V4IB 4ZYNA 2KACA 1N6ZA 2N7DA 1YJIA 2M1MA 2GLSA 2LGSA 2E3TA 3N30A 4YSXB 1E7VA 4DXGA 1HTOA 3A1QA 1PFDA 1EU4A 4WWOA 2C5LC 3NVYA 1RRBA 1WXSA 4A20A 2YVCA 2YEPF 5TR5A 4FADA 1FPYA 2CJOA 2D11A 2RDHA 3ZXRA 3WAPA 2YEPB 3AE9B 4JGHB 4ITKA 3Q3JA 1I35A 5E6NA 2PPHA 4CHKA 2KQ7A 3V62A 4DXFA 1DOXA 3U7ZA 1XLPA 4JWUC 4BKSD 1T0QC 2PVOD 3A9JB 2WXGA 1H4RA 1EF5A 1MJDA 2QDFA 2D5GA 2WP9B 4GB9A 4HKQA 3ZIMA 2KK8A 5LNK1 1V8CA 2HDEA 3TEWA 1N5WA 1V1PA 3BVMA 5FK9C 4BBNC 4XE0A 2QHOA 2ZEQA 1KJTA 2LVQA 2LUMA 5IO9A 2N9XA 3VFKA 3VDZA 3VVWB 5EE0A 3BWUD 3WA0A 4NNJB 2I38A 2L83A 2INPE 4J6IA 1PGXA 2NTTA 3VTUA 3AEFB 3VQIA 1C76A 3QA8A 3L4PA 3M95A 1OGWA 3RUIB 1N60A 1HA5A 2KT7A 2DZMA 3Q8EA 3N1ZC 3P2BA 3GP7A 5AUIA 1VJKA 1RM6C 5H92C 2ZW1A 3L0WB 1TKYA 1JRPA 1EUVB 1FXTB 5C23A 2I1KA 1WGRA 2N1VA 4P1BC 2MRPA 3H7PA 1DOYA 4DHJB 2JF5A 1ZP0B 2KWVB 2DX5B 4GDLA 3KYDD 4DXAB 4WWPA 2IO0B 2WS3B 3PRPB 2RPVA 3H6NA 4FJVB 1F1HA 2XN9C 4BVUC 3IVFA 2GBRA 1QOFA 2Y5PA 3EUB2 4EFOA 3B2GA 4WURA 3L08A 2L52A 4TUUA 2K1FA 3K9OB 2ZPYA 3WIMA 2KX3A 2MP2B 3D32A 1ZPSA 5EE1A 2M17A 4HLEA 2PMVA 1V81A 5TSSA 1TS3A 2RR9A 2KWDA 1PDXA 3DVNU 4P7IA 1KLUD 2MBHA 1P0RA 3RPFC 2HTME 2ZPNA 2BS3B 2H88B 2JXXA 1GC7A 2MW5A 4N58A 2JWZA 4BOZB 2JYEA 1WE7A 4ANUA 2TSSA 3UF8A 2BB5A 4WWNA 2RDGA 1OFFA 2DZKA 4B9KA 5AZFA 4FA6A 1F2RC 1WI0A 1J7AA 3AE7B 4ZRKA 1C3TA 4RF0A 1WH3A 3KUCB 1I4RA 2CHWA 2C7NB 4LCDE 3ZNGC 4LJOB 1BT0A 4XWTA 3ZLZA 1MG8A 3ZTDA 1D6EC 2GMIC 3NS8A 4YTPB 1ROEA 4HVBA 1TIFA 3I3TB 1IYFA 2DZIA 2WXKA 2BYTA 4IKGA 3ZRFA 2MBOA 3I63C 4MH8A 2BPSA 3DCGA 1XCTL 2Y5BB 3RNCC 1V2YA 1UELA 1GB1A 2EMTA 1Q0WB 4HXDA 2X38A 3ZTCA 1D5XC 2KMAA 2VZKB 1FNUA 2JX5A 2C60A 4EUTA 2BKRB 4A90A 1MHXA 2G9HD 2QJLA 4B0MA 2WDRB 4IWOA 2KN4A 2JY6A 2L00B 2D07B 1QT9A 1XD3B 4J3OD 1E8XA 3KLSX 1M4VA 2KX0A 3MHSD 3Q3NC 2ON8A 1AYFA 5LXIB 3UIOB 1WR6E 4WJPA 1NVID 1T3QA 2WXRA 3MP9A 3Q3MC 1E6EB 1WSPA 2FE8A 2BB6A 1N62A 2LASA 3AE2B 5D94A 4EZLA 5BO4B 3SD5A 3H1UA 3DHHC 2GBJA 2QSDA 3E56A 4C7YA 1MVKA 4HWIB 3FILA 1JALA 1FIQA 2AX5A 2IPKD 2DYMA 4XDDA 2KDEB 2AL3A 4BKTA 2G3QB 2KTRA 2GBNA 4BKSA 2JRHA 1TY0A 1NENB 1FM0D 4RF1A 3DVGX 2K8HA 4KDIC 2V9HA 2IO3B 1ENFA 3AMZA 4W9EA 3A1QB 1T0RC 1E7PB 1FCCC 4RH6A 3FKYA 5G5HA 2R2OA 1JWMD 4ASWC 3ZNZB 1L6VA 1T0SC 1LGRA 3B08A 4ANWA 5E6JA 2D10A 2J4XA 2BKFA 5AZHA 4WWMA 4PS3A 5BYSA 4ARCA 3PVLA 1FMAD 4FULA 5E6OA 3Q3FA 3AB5A 2L76A 2IY0B 1T0YA 4MACA 4AWJA 2KAJA 4C4VA 4TMAB 2FCNA 3ZJVA 1GC6A 2V4LA 1C1YB 3NJTA 2CU3A 1V1PB 1JWUD 4RGTA 3I57A 4I6PA 3ZYYX 4E71A 1B1ZA 1QF6A 4EEWA 1S3SG 2LUEA 4OVZA 3L17A 5C3JB 4HKZE 1XXGA 5BMHA 2N9EB 1F0ZA 3IFWB 3DWGC 5DCNA 1VR9A 2RGFA 4RM8A 4FLHA 1PYWD 4C56C 3RYTA 4IWQA 4OHJA 5HI1A 2KLGA 3S2AA 3H7SA 1GUAB 3TEXA 2PW9A 3WCQA 5C2TB 3ZO5B 1SF0A 2KQSA 1IPGA 2MJEA 1YN4A 5EDSA 2XEWA 3AE8B 3R7RA 1PQSA 3KVFB 1ZXIA 4KGRA 3ZW3A 3M3JA 1KLGD 1E7UA 2KQ4X 2JUOA 2GBKA 3L16A 3AE1B 4PYUA 2K22A 1V1OA 1Q5WB 1WR1A 1Y56A 1VCBA 5JH5C 4BOSC 2LJIA 3MTNB 2PE9A 2BS2B 3AV8A 3BYYB 5T8IA 3DHIC 4MJSA 4BAXA 3WALA 2KFJA 3GB1A 4D2KA 1I42A 3H7PB 2CS4A 1WFYA 1WF9A 4KVGB 3NZ3A 4GDLB 3KUZA 3U8ZA 4FN2A 1TJEA 2RSUA 4HDQA 1D5MC 4W9LA 1N5XA 2R61A 1JWSD 2NBWB 1XLOA 2D3CA 3QJZA 4II3B 1YQBA 2NBUA 3RNFC 1N61A 2ZNVB 1WXQA 3DDCB 3DVNV 4YXDB 2KANA 4IG7B 4LDTB 3ZUNA 2BWES 2QEJC 4L2YA 2DNFA 1WJNA 3ML9A 2INDC 2KVZA 1P1AA 3HK0A 3MJ5A 1L4DB 2PLPA 4GGQA 1SBBB 3MJWA 3NVVA 1WXAA 2J42A 4YSYB 4OZCA 1L0YB 1KRHA 2VH1A 1UGMA 3RT3B 3DBHB 2MEKA 1RFAA 1VRAB 1WXMA 1GAQB 3AEBB 1WGYA 3DHGC 4W9KA 1R4MB 2K5PA 5AZGA 3B2FA 3NVWA 4DDID 1WGHA 2FIFA 2MBEA 3P4QB 1J0GA 4G0NB 1EU3A 2MLBA 3GOEA 2K6QA 2V3SA 4EZKA 4DK5A 1UWMA 3GZNI 5IOIA 2D3BA 1C79A 3AE5B 3RZFA 2IY1B 2KDBA 3GE8C 3P42A 1K8RB 2Z0EB 3R3MA 2GOWA 2HJ8A 2V0GA 1P3QU 3K9PB 1YN5A 2K0PA 1E8ZA 1JWBD 2M19A 4DQOC 3Q2AC 2W55A 3O65B 1WMHA 4US9A 4XZ4A 1UBIA 3DQVA 1YMHE 2WDTB 1L4ZB 3PV1A 5CHVC 1V5TA 3RD2A 1R4NB 1WXVA 3RNGC 2RDBC 4DWFA
chains in the Genus database with same CATH topology
5EE9A 1GPXA 1JW9D 1ZPSA 1XO3A 5EE1A 4WIPA 2PMVA 2NMQA 2BBCA 3LYYA 2EELA 5TSSA 1TS3A 1WWTA 1PGBA 2AQ2B 3FAHA 2PTLA 2KWDA 1PDXA 1KLUD 3AEGB 1NYQA 4MT5A 2BTEA 4ZRPA 3RPFC 3T3OA 4AS1A 2HTME 1QKZA 1ZOYB 2WDVB 2BS3B 1I4GA 2H88B 4N58A 4JWSC 1P7EA 2CJNA 4L23A 2JYEA 2JXTA 4XWWA 1KF6B 2TSSA 2I2YA 1QOBA 3R2TA 3FILB 2BB5A 3Q8FA 4A6QA 3IT4B 1BXTA 2RDGA 1OFFA 1YQ3B 1I4HA 3EA6A 1F2RC 3CWIA 4NJCA 1J7AA 3AE7B 3URYA 2AQ3B 4RF0A 1PGAA 1I4RA 3V3XA 1RFKA 3J9CA 3H8HA 1VDVA 1J7BA 4NAWB 1WYGA 1SIJA 3PZ8A 1N63A 1SE4A 4XWTA 3DWMA 4TQ0A 1L5PA 3P1MA 1D6EC 1JWAD 2N0SB 2JQRB 4YTPB 1ROEA 1TKEA 2K3UA 4CQNA 3KWVA 4TQ1A 2WU2B 2WXKA 4RCOA 3VRBB 1AWDA 2BYTA 2RMMA 2BT6A 3ETRA 4IKGA 1JROA 1KH0A 4MH8A 2FUG1 1XCTL 4ZYSA 3AEEB 1C77A 3Q8BA 3ZJTA 1SE2A 2ICIA 1GB1A 2LEKA 1I7HA 1CJEA 1C4PA 2L32A 3MC0B 2X38A 2Q5WD 3W9CB 1D5XC 5BMGA 1SXTA 2ZW0A 2EKIA 3AH7A 3SFDB 4YWGG 1FFUA 2JU6X 1FNUA 2VZKB 2WXJA 1JCKB 2JX5A 4C7ZA 1UNSA 4A90A 5D3IB 2PKOA 1ZE3D 1MHXA 1IBXA 2G9HD 4LTUA 2QJLA 4OZBA 4B0MA 2WDRB 2GB1A 1ET9A 2WDQB 1I4QA 2KN4A 1B9RA 2DLBA 1FXIA 3Q69A 3SEBA 1FNVA 3IT6B 2MH7A 1BMLC 1QT9A 1CK1A 1RYJA 1SB3C 2WNMA 2IGGA 3FC4A 4J3OD 1HEZE 1K52A 1R7SA 4O1NA 1ET6A 3KLSX 1M4VA 2KDMA 1E10A 1E0ZA 1NI3A 2ON8A 2M56B 1AYFA 2FBWB 4WH4A 1C4CA 2IGDA 1JMLA 4ARIA 2IGHA 1NVID 1T3QA 2WXRA 2QILA 1DGJA 2QIEB 3MP9A 1E6EB 3HVDA 1ZUD2 4WAFA 5EE3A 4UDUC 3TEZA 1WSPA 3VR8B 1TS2A 2FE8A 4ZHPA 3ZJUA 4P6VF 2BB6A 2JSVX 4JX1C 2E6XA 1N62A 1SJED 1C78A 4YTNB 1C4AA 3EGRA 1STEA 3AE2B 1YN3A 1SE3A 2SAKA 3TEYA 2LHEA 2QSDA 3E56A 3TUOA 3Q8AA 2WXPA 5H8YE 1XEEA 3UI3A 4C7YA 1MVKA 2W3RA 3AEAB 3FILA 1JALA 1FIQA 5FKAC 2AX5A 3VR9B 2IPKD 5D7GA 3W5VB 1KTKA 1QLBB 4KKIA 2DYMA 2WXQA 1UUPA 4XDDA 3I9V1 3BK2A 2WXIA 1VZ7A 3KWLA 2WLBA 4RFBA 1TY0A 4YT0B 1C9FA 1NENB 1FM0D 4HRSA 4RF1A 2KMMA 2SEBD 4LK0M 1RWSA 1YJJA 4A55A 2W54A 1IUEA 1ENFA 4N59A 3AMZA 3SR6A 2INNE 1FNWA 1EM7A 4NZLB 4L1BA 1T5XD 2NTSA 1IGCA 4RGMA 2LGIA 1E7PB 1NEKB 3MHZA 3IAM1 1FD6A 1FCCC 3OWEB 4RH6A 4KKJA 3Q8CA 4YSZB 5BYQA 5GXGB 5G5HA 1MPEA 1FCLA 1EWYC 1A70A 3BIID 3BK1A 2IJ0A 1D4BA 1JWMD 3AE6B 2PIAA 2LHDA 3SFEB 4H2AA 3HVZA 3ZQ4A 2MJDA 1L6VA 2WXHA 5E6JA 2J4XA 4GLSC 4WWMA 5BYSA 4ARCA 1D5ZC 1P7FA 1FMAD 4YTMB 1ZXHA 4KGTA 5FR3A 3AB5A 2MJ3A 2H89B 4MACA 4REZA 4OW0A 1L0XB 2WXNA 1GOZA 4P16A 2KAJA 1QILA 5BYRA 1CQVA 1UGJA 4TMAB 2B76B 5HHDG 3ZJVA 2BW2A 1K53A 3P4RB 3ABVB 2CU3A 2WU5B 2WXFA 1XLNA 3AEDB 3AE3B 1F77A 1V1PB 3AM9A 1JWUD 4RGTA 3I57A 1L0VB 1HZ5A 3AE4B 3PZ7A 3ZYYX 1B1ZA 1QF6A 1DOIA 2Y3AA 2W3SA 3P4PB 3PO0A 1TY2A 4OVZA 1BUIC 1ZDXA 1FO4A 1LO5D 2DBYA 5C3JB 4PT5A 4HKZE 1EWCA 3AECB 3U4EG 1XXGA 5BMHA 4IDIA 1F0ZA 2DYOA 4M0WA 1DYQA 3DWGC 1TS5A 4C80A 1VR9A 3TSSA 1PYWD 1TZOA 4C56C 4OHJA 3IAS1 5HI1A 1SEBD 2JWUA 3TEXA 2PW9A 3WCQA 5HG2A 1FEHA 5C2TB 3GS2A 3LXFA 1I4PA 2M0AA 1SF0A 1FRDA 1OQRA 1ZDVA 2WQYB 2WXMA 3V05A 1SSNA 2MJEA 1YN4A 3T3NA 1HXYD 1SJHD 2V4IB 3AE8B 2KACA 2L1AA 1ZXIA 1YNTE 4KGRA 1YJIA 2E3TA 4YSXB 1KLGD 2KQ4X 1FFVA 2IDYA 4DXGA 3AE1B 4ZOHC 2K22A 4B0EA 1V1OA 1XF5L 4N6EB 1Y56A 1FXAA 1PFDA 2LJIA 4JE3B 1EU4A 4RNAA 1CZPA 2GRIA 2BS2B 3NVYA 3AV8A 3W1SA 3W5UB 2G1EA 1HZ6A 3BYYB 5T8IA 2YEPF 3GB1A 4OZAA 1NYRA 2CJOA 1FRRA 3NUHB 4D2KA 2RDHA 5G5GA 2YEPB 1J7CA 3AE9B 4ITKA 1KFYB 4NAMA 3B9JA 5AUKA 2V3PA 4DXFA 2JZPA 2ACZB 2V3NA 3NZ3A 1DOXA 3U7ZA 1TKGA 4GDLB 1XLPA 4JWUC 3BVGA 1TJEA 2PVOD 1D5MC 2Y5CA 1HQRD 2WXGA 2N7JA 4R3DA 1N5XA 2R61A 1JWSD 2J52A 3HUIA 1XLQA 2D5GA 2W82A 1XLOA 2WP9B 4LLGM 4HKQA 1WGKA 5LNK1 2N9LA 1V8CA 2HDEA 3W2DA 3TEWA 1N5WA 2DWQA 1V1PA 1N61A 2ONQA 3BVMA 5FK9C 1WXQA 2QMTA 4XE0A 1VZ6A 2LUMA 4YXDB 2Z8LA 5HFYA 4HJGE 2K9XA 3BZDB 1YQ4B 1VZ8A 2QEJC 1MHHE 4KX6B 4L2YA 3BWUD 5EE0A 3P63A 3MJ5A 2VZKD 4EE2A 2I38A 1L4DB 2PLPA 2L83A 1SBBB 2INPE 3NVVA 1Q10A 1PGXA 2NTTA 2J42A 3AEFB 3VQIA 4Q2JA 4YSYB 2WXLA 1C76A 4OZCA 2XNAC 1L0YB 3C8YA 1KRHA 3L4PA 2JYTA 3R2IA 1MI0A 2MEKA 4RGOS 3NS1A 4XDCA 1ACCA 1I4XA 1TS4A 1V97A 1N60A 1XCQL 1UWXA 1HA5A 1VRAB 4RGNA 5BMIA 1GAQB 3AEBB 3Q8EA 2LMCA 3E9SA 3CIRB 4KGSA 2K5PA 2AQ1B 3GP7A 3MFGA 5AUIA 1VJKA 3B2FA 3HRDD 1RM6C 5H92C 3U52E 3NVWA 4ZRQA 3RFZB 4IOIE 2ZW1A 5JXVA 1L6UA 1TKYA 1JRPA 2OEDA 4US8A 5D3DA 1QOAA 5MPOA 4JPSA 3P4QB 3NRZA 2BS4B 1K51A 1PUTA 3LB8C 3NVZA 1EU3A 1T6BX 3KQ4A 1K50A 1DOYA 2PVGC 1UWMA 3IXSA 1ZP0B 3P4SB 2LFIA 4TSSA 1C79A 1GB4A 4HEA1 3AE5B 1QOGA 4AQ7A 4A8XC 3BYTB 3P42A 4FXCA 2GI9A 1IBXB 1AN8A 1AW7A 2WS3B 3O13A 2WXOA 2V0GA 3ZGZA 1YN5A 2K0PA 3N9YC 1IGDA 1ESFA 2RPVA 1E9MA 2N9KA 4WQMA 1JWBD 2M19A 1WRIA 2XN9C 4DQOC 2W55A 1VLBA 4US9A 4ZHOA 3BVZA 1QOFA 2Y5PA 1JQ4A 3EUB2 1YMHE 1L4ZB 1TYGB 3B2GA 4WURA 4GDKB 3AN1A 3VRAB 3U2SC 2L52A 1F2RI 4MM3B 4HROA 3R8BA 4A9AA 5I4DA 2J53A 1OQQA 2OHFA 1QQRA 4USAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9X A;  5EE9 A;  1GPX A;  4HRS A;  1JW9 D;  1YQ4 B;  4KX6 B;  5EE0 A;  4YTN B;  1XO3 A;  5EE1 A;  3AE2 B;  3P63 A;  1WWT A;  3DWG C;  4C80 A;  3FAH A;  1PDX A;  2L83 A;  3AEG B;  1NYQ A;  3RPF C;  3NVV A;  2HTM E;  4IDI A;  1ZOY B;  2WDV B;  5H8Y E;  3WCQ A;  2BS3 B;  2H88 B;  4C7Y A;  2W3R A;  3AEF B;  4JWS C;  2CJN A;  4N58 A;  5C2T B;  3AEA B;  3LXF A;  1KF6 B;  1SF0 A;  1FIQ A;  1JAL A;  1FRD A;  1OQR A;  1QOB A;  2WQY B;  4YSY B;  2AX5 A;  1KRH A;  3L4P A;  3VR9 B;  1F0Z A;  3W5V B;  1QLB B;  2MJE A;  1OFF A;  3NS1 A;  1YQ3 B;  3AE8 B;  1V97 A;  1N60 A;  3KWL A;  2WLB A;  4YT0 B;  3CWI A;  1ZXI A;  1NEN B;  1J7A A;  1FM0 D;  1GAQ B;  1YJI A;  2KMM A;  3AE7 B;  1RWS A;  1YJJ A;  2E3T A;  3AEB B;  4YSX B;  2W54 A;  3CIR B;  1FFV A;  1IUE A;  4N59 A;  1RFK A;  3AMZ A;  2K5P A;  3SR6 A;  5AUI A;  1VDV A;  1VJK A;  3AE1 B;  1J7B A;  1WYG A;  3B2F A;  1SIJ A;  3HRD D;  1N63 A;  1RM6 C;  4ZOH C;  2K22 A;  3DWM A;  4N6E B;  1L5P A;  1E7P B;  3P1M A;  1FXA A;  1JWA D;  1NEK B;  1PFD A;  2N0S B;  3NVW A;  5H92 C;  2JQR B;  4YTP B;  1ROE A;  1L6U A;  1TKE A;  1TKY A;  1CZP A;  1JRP A;  4YSZ B;  4US8 A;  5GXG B;  2BS2 B;  3NVY A;  5G5H A;  3AV8 A;  3W5U B;  2G1E A;  1EWY C;  1QOA A;  2WU2 B;  5MPO A;  1A70 A;  3BII D;  3P4Q B;  3NRZ A;  2BS4 B;  3VRB B;  1AWD A;  2BT6 A;  3AE6 B;  2PIA A;  1PUT A;  3ETR A;  1JRO A;  3LB8 C;  3NVZ A;  3SFE B;  3HVZ A;  1NYR A;  2MJD A;  1L6V A;  1FRR A;  2CJO A;  3AEE B;  5G5G A;  1DOY A;  2PVG C;  1J7C A;  3AE9 B;  2LEK A;  1I7H A;  1CJE A;  1UWM A;  4ITK A;  4WWM A;  1KFY B;  3B9J A;  1ZP0 B;  3P4S B;  2Q5W D;  5AUK A;  3W9C B;  1FMA D;  4YTM B;  2ACZ B;  3AH7 A;  2EKI A;  3AE5 B;  3SFD B;  1TKG A;  1FFU A;  1XLP A;  4C7Z A;  1DOX A;  1QOG A;  2JX5 A;  4JWU C;  1TJE A;  4FXC A;  2PKO A;  2PVO D;  3AB5 A;  2Y5C A;  1N5X A;  2MJ3 A;  4LTU A;  2H89 B;  2QJL A;  2WDR B;  2WDQ B;  2WS3 B;  3HUI A;  1B9R A;  1XLQ A;  1FXI A;  2MH7 A;  2KAJ A;  1QT9 A;  1E9M A;  1RYJ A;  1XLO A;  1SB3 C;  4WQM A;  2WP9 B;  3FC4 A;  1JWB D;  1WGK A;  2B76 B;  2M19 A;  1R7S A;  1V8C A;  1WRI A;  3P4R B;  1N5W A;  2DWQ A;  2W55 A;  3ABV B;  1VLB A;  2CU3 A;  2WU5 B;  1XLN A;  3AED B;  3AE3 B;  3AM9 A;  4US9 A;  4ZHO A;  1E10 A;  1N61 A;  1NI3 A;  1QOF A;  1E0Z A;  1JQ4 A;  2M56 B;  1L0V B;  3EUB 2;  1AYF A;  3AE4 B;  1WXQ A;  3ZYY X;  2FBW B;  1TYG B;  3B2G A;  1QF6 A;  3AN1 A;  1DOI A;  3VRA B;  2W3S A;  1T3Q A;  1NVI D;  2L52 A;  3P4P B;  1DGJ A;  2QIE B;  3PO0 A;  1E6E B;  4YXD B;  1ZUD 2;  5EE3 A;  1FO4 A;  2DBY A;  4HRO A;  5C3J B;  3VR8 B;  4A9A A;  4ZHP A;  4P6V F;  3AEC B;  1OQQ A;  2OHF A;  4JX1 C;  1N62 A;  4USA A; 
#chains in the Genus database with same CATH topology
 3Q6B A;  1WJU A;  4GOC A;  3LYY A;  2EEL A;  3FAH A;  5L95 C;  5L83 A;  4DHZ E;  4AS1 A;  1QKZ A;  1ZOY B;  2KTF A;  1P7E A;  2CJN A;  3A4S C;  1WX7 A;  2I2Y A;  1EF1 A;  3FIL B;  2FAZ A;  4URK A;  4ZDV A;  3IT4 B;  1P9D U;  1YQ3 B;  1I4H A;  2L0T A;  1ZW7 A;  2KTR B;  4NJC A;  1EO6 A;  2D3G A;  4HPP A;  1PGA A;  2MX2 A;  2ZNV C;  1J7B A;  3EFC A;  4W9C A;  4B6W A;  1SIJ A;  4I6L B;  1L5P A;  2AL6 A;  4PYZ A;  3KWV A;  3OJ4 B;  2K8B A;  1LXD A;  2AWT A;  1E5W A;  3NHE B;  1AWD A;  3VUX A;  3ETR A;  3VXW A;  2FUG 1;  2ICI A;  1CJE A;  4PS7 A;  2EKE C;  3R66 C;  4FHK A;  1SXT A;  2ZW0 A;  2EKI A;  3AH7 A;  3SFD B;  2JU6 X;  2WXJ A;  3AU4 A;  3CSF A;  1JCK B;  3N1X C;  5D2M B;  2PKO A;  4ANX A;  2FID A;  2GB1 A;  1ET9 A;  1I4Q A;  2DLB A;  1FXI A;  2MQJ A;  3IT6 B;  4GIV A;  1BML C;  1MG4 A;  1CK1 A;  1SB3 C;  2WNM A;  4C4V B;  5G55 A;  2JVC A;  4O1N A;  5AEK B;  2KDM A;  3A9K A;  5IA7 A;  1E10 A;  1E0Z A;  1WX9 A;  2M56 B;  4GDK A;  2FBW B;  4MM3 A;  4LNN A;  1JML A;  2IGH A;  3UIP B;  5J2R A;  3HVD A;  4UDU C;  3VR8 B;  2D2Q A;  4ZHP A;  4P6V F;  2CR5 A;  4JLC A;  2E6X A;  2K39 A;  1C78 A;  1C4A A;  3EGR A;  2NPT A;  1GNU A;  2UYZ B;  1YN3 A;  2BYF A;  4M8M A;  3Q8A A;  1F52 A;  2W3R A;  5DPR A;  3AEA B;  4EOY A;  2AEH A;  3WAM A;  5D7G A;  4XX5 A;  2KJH B;  1UD7 A;  2A4Z A;  2WXI A;  3KWL A;  2WLB A;  2N9P C;  4RFB A;  4AJW A;  4K1R B;  1C9F A;  4HRS A;  4LK0 M;  1RWS A;  4A55 A;  4AOF A;  2INN E;  1FNW A;  3PHX B;  4NZL B;  3NG0 A;  1WM2 A;  3RCZ A;  2LGI A;  2LGY A;  2ZJD A;  3Q8C A;  4YSZ B;  5BYQ A;  3HIZ A;  3BII D;  3BK1 A;  2IJ0 A;  3AE6 B;  4MJS B;  2LHD A;  4H2A A;  3HVZ A;  3EC8 A;  4K3B A;  2WX1 A;  4NJ6 A;  2CKH B;  4GLS C;  1WM3 A;  1D5Z C;  1LQB A;  3DBR I;  4YTM B;  1ZXH A;  1H8C A;  2DYB A;  3LJ3 A;  4ZRI A;  2BYV E;  2H89 B;  4TV3 A;  1L0X B;  2KYW A;  1GOZ A;  2O6V D;  1QIL A;  3UQB A;  1ZKH A;  2KKC A;  3ECI A;  1AAR A;  3APF A;  2B76 B;  5HHD G;  2BW2 A;  3P4R B;  2CU1 A;  3AE3 B;  5IAA C;  1F77 A;  2KD0 A;  5DPS A;  3V6E B;  3EHV A;  1HZ5 A;  3AE4 B;  4IM2 A;  1DOI A;  2KO3 A;  1UF0 A;  2W3S A;  3P4P B;  3ZVV A;  2DBY A;  1EWC A;  2NCN A;  2BVC A;  4M0W A;  2N7E A;  2KOX A;  4KSK C;  3V61 A;  2DAJ A;  2LGD A;  3IAS 1;  1SEB D;  2J0K A;  4I6N B;  4AJY B;  2JWU A;  1WYW B;  3PTF C;  3BIN A;  2M0A A;  5JHA A;  4KDL B;  1YD8 U;  3V05 A;  2C9W B;  3UGB B;  1HXY D;  2KC2 A;  2N1W A;  2HE7 A;  3DBL B;  3ZDT A;  2JZ3 B;  1FFV A;  3PRM B;  2IDY A;  5J17 A;  2KDF B;  5J18 A;  4ZOH C;  4B0E A;  4N6E B;  2C7M B;  2DAF A;  2MCN B;  3HHM A;  4A3O A;  3ZKJ C;  2BGF A;  4LJP B;  4KZ0 A;  3W5U B;  3SDL C;  1TT5 B;  4MDK E;  1TBE A;  2ZVO A;  1FRR A;  3NUH B;  3OJ3 A;  1WJ4 A;  3QHT A;  2LRW A;  1J7C A;  1KFY B;  4NAM A;  1TTN A;  5AUK A;  2KXJ A;  4ICU A;  2V3N A;  2ACZ B;  1TKG A;  3PT2 B;  2L7R A;  3BVG A;  1XQQ A;  4II2 B;  4W9D A;  2J52 A;  3HUI A;  4DDG D;  4E3C A;  2LZ6 A;  2W82 A;  2L8J A;  3JW0 X;  2LI5 A;  3U30 A;  1WGK A;  2XBB C;  2FCM A;  2DWQ A;  3EFU A;  1WMH B;  2ONQ A;  4AP4 C;  2QMT A;  1KLV A;  1VZ6 A;  4MGK E;  1WIA A;  3SHQ A;  1UZX B;  3OLM D;  4KIK A;  1RLF A;  1E8Y A;  2KJ6 A;  3IBE A;  2K9X A;  1VZ8 A;  4KX6 B;  4HPM B;  2RPQ A;  3QX1 A;  4G3X B;  4IW0 A;  4MEL A;  2LXC A;  4CO7 A;  3R7Q A;  3JVZ X;  4Q2J A;  3RUL A;  3C8Y A;  1U4A A;  1MI0 A;  4LNF A;  3APC A;  3NS1 A;  1ACC A;  1SE9 A;  1V97 A;  1UWX A;  2IYD B;  2WHI A;  2K6D B;  3TIX A;  3E9S A;  1Z5S B;  3CIR B;  3LDZ E;  4EKU A;  4KGS A;  2AQ1 B;  3MFG A;  1A5R A;  2LRU A;  5LXH A;  2INC C;  5CX3 A;  4ZRQ A;  3Q14 C;  4BKG A;  1L6U A;  2G4S A;  2OED A;  1OTR B;  5D3D A;  5MPO A;  4JPS A;  3NRZ A;  3IHP C;  1PUT A;  2Z59 B;  2UU7 A;  3NVZ A;  1T6B X;  3KQ4 A;  4GU2 A;  2PVG C;  3ONS A;  1UBQ A;  3X0W A;  2C7H A;  3IXS A;  4W9G A;  2LFI A;  4TSS A;  4DHZ B;  1GB4 A;  3KYC D;  4AQ7 A;  3BYT B;  2KN5 A;  3QCA A;  4NQL B;  1AN8 A;  2NVU I;  2WXO A;  3AU5 A;  4K81 A;  3N9Y C;  2L3Z A;  1ESF A;  1V5O A;  3QK0 A;  4GSW A;  4A3P A;  4KSL C;  2BWF A;  4N9F 4;  1L2N A;  4ZHO A;  3A9K B;  3BVZ A;  1JQ4 A;  2HTH A;  2WWZ A;  4GDK B;  3U2S C;  4MM3 B;  1V86 A;  3A4R A;  4HRO A;  4NQK E;  3R8B A;  5I4D A;  1OQQ A;  2OHF A;  4M02 A;  5EE9 A;  1GPX A;  1JW9 D;  2KNB A;  3HM3 A;  1XO3 A;  4WIP A;  2NMQ A;  2BBC A;  2NPT B;  2JPH A;  1PGB A;  2PTL A;  3TCA A;  5IKC M;  2BYE A;  2BTE A;  1NYQ A;  4MT5 A;  3JYU A;  5JHB A;  4JWS C;  3CST A;  2KMC A;  1KF6 B;  1QOB A;  1YIW A;  3R2T A;  3VTV A;  2J0M A;  3Q8F A;  1BXT A;  3APD A;  1CMX B;  3B1L X;  2MBB B;  4HPL B;  2XK5 A;  3URY A;  2AQ3 B;  2M4N A;  3DOW A;  4FJY A;  3V3X A;  1RFK A;  3J9C A;  2O6V A;  3C0R B;  1VDV A;  4RMA A;  1HTQ A;  1WYG A;  1V9J A;  3PZ8 A;  3DWM A;  3P1M A;  2JQR B;  1TKE A;  4B95 A;  2K3U A;  4CQN A;  4F1S A;  4IUM B;  4TQ1 A;  2WU2 B;  2PEA A;  2RMM A;  1JRO A;  1KH0 A;  3AEE B;  3ZJT A;  1I7H A;  3MC0 B;  2Q5W D;  3QIJ A;  3W9C B;  2R2Q A;  5LLI A;  4YWG G;  1UNS A;  1IBX A;  4OZB A;  3I5J C;  1WGD A;  2LWP A;  1B9R A;  1FNV A;  2MH7 A;  2IGG A;  3FC4 A;  2NBV B;  1ET6 A;  3RI7 C;  4WAA A;  1NI3 A;  1X1M A;  3B0A A;  2WGS A;  1RAX A;  2JZZ A;  2B3A A;  4CYE A;  1C4C A;  4HK2 A;  2QIL A;  2QIE B;  3KUD B;  4WAF A;  1J8C A;  2ZVN A;  1KM7 A;  3ZNH B;  2JSV X;  1SJE D;  3WAN A;  3N1Y C;  4YTN B;  4M0W B;  1STE A;  1V49 A;  2MWS B;  4ZRJ A;  3U7D A;  4LNK A;  3TEY A;  3PGE A;  2LHE A;  3TUO A;  1WJ6 A;  4YL8 A;  1V6E A;  1XEE A;  2DZJ A;  3VUW A;  4KZC A;  5FKA C;  3KH0 A;  5FR6 A;  3OG5 A;  2IZV B;  1WRD B;  1KTK A;  1QLB B;  2J7Q B;  4KKI A;  2WXQ A;  3RZW C;  1UUP A;  1ISN A;  3I9V 1;  4FHJ A;  3BK2 A;  1VZ7 A;  4JL9 A;  4XC2 A;  5CHW A;  4YT0 B;  2SEB D;  2KDI A;  1YJJ A;  4WJO A;  2MSE D;  3QWZ B;  4GN1 A;  3SR6 A;  4NAW A;  4ANV A;  1EM7 A;  5IP4 D;  1T5X D;  2NTS A;  1IGC A;  3MHZ A;  3IAM 1;  5E6P A;  2L05 A;  2LXA A;  5GXG B;  4M8N A;  1MPE A;  1FCL A;  1A70 A;  2UWQ A;  2PIA A;  3SFE B;  1Y8R C;  2MJD A;  1YX5 B;  4K3C A;  4OVU A;  4PS8 A;  3V60 A;  2LVO A;  4E74 A;  3DPD A;  1P7F A;  5KHO A;  4X57 B;  4KGT A;  4G50 A;  5FR3 A;  3KW5 B;  2IO1 B;  3W1S C;  4REZ A;  2WXN A;  4P16 A;  4W9H A;  3TL5 A;  5BYR A;  1UH6 A;  3N32 A;  3ZRC A;  2BF8 B;  3ABV B;  1XLN A;  3AED B;  4WJN A;  2BQQ A;  2QC8 A;  2LVP A;  3PZ7 A;  2Y3A A;  1TY2 A;  1ZDX A;  3MC9 A;  4MH0 E;  1FO4 A;  4KIK B;  3AEC B;  4IDI A;  4DHJ D;  4M00 A;  5CTR C;  2DYO A;  3X23 A;  2J0J A;  4P1C C;  2PJH A;  5KHQ A;  1TZO A;  4W9F A;  5HG2 A;  2Z0D B;  2L0F A;  2FCS A;  5GMV A;  3GS2 A;  2ZCB A;  1ZDV A;  1FRD A;  1OQR A;  2WXM A;  4ACF A;  1SSN A;  3MC8 A;  3RN9 C;  2KFK A;  3T3N A;  1SJH D;  1WGG A;  2L1A A;  3ML8 A;  1YNT E;  4MSM B;  3PRZ A;  5DPW A;  1YOV B;  2FCQ A;  1XF5 L;  4MGY E;  3ZXV A;  1FXA A;  4JE3 B;  2IBI B;  2LD9 A;  1S1Q B;  4RNA A;  5D6J B;  4HDO A;  1CZP A;  1V80 A;  2GRI A;  3W1S A;  2NS5 A;  3CMM B;  2G1E A;  1HZ6 A;  2CHZ A;  4OZA A;  1NYR A;  2KZR A;  5G5G A;  3H9D A;  1D3Z A;  3DVG Y;  3B9J A;  2V3P A;  4MEM A;  2JZP A;  1GG3 A;  2Y5C A;  1HQR D;  2N7J A;  4K7W A;  4R3D A;  1WY8 A;  3AXC A;  1XLQ A;  3QAQ A;  4LLG M;  4W9J A;  2N9L A;  1M94 A;  3QAR A;  3W2D A;  4MSQ B;  4TKN A;  3VAW A;  2Z8L A;  5HFY A;  3AI5 A;  4HJG E;  3BZD B;  1YQ4 B;  2G45 B;  1MHH E;  3P63 A;  2VZK D;  4IWP A;  4EE2 A;  2O2V A;  1YJ1 A;  3DBH I;  2A5U A;  1Q10 A;  4S0R A;  2WYQ A;  1OEY A;  1IP9 A;  3NZU A;  2PE6 B;  3JSV A;  2WXL A;  2XNA C;  3OAW A;  1WE6 A;  2FUH B;  2JYT A;  1R4M I;  3R2I A;  1OQY A;  4RGO S;  2KC1 A;  3RNE C;  4XDC A;  1I4X A;  1TS4 A;  1XCQ L;  1Q1O A;  4RGN A;  5BMI A;  1LM8 B;  2XK5 B;  3N3K B;  4NJ7 A;  2LMC A;  2FNJ B;  4XYC A;  2ZZP B;  2O6V B;  1YX6 B;  3HRD D;  3U52 E;  1NI2 A;  3RFZ B;  2K8C A;  4IOI E;  5JXV A;  4US8 A;  3VHT C;  1QOA A;  2BS4 B;  1K51 A;  5DPT A;  3LB8 C;  3SU8 X;  2GBM A;  1K50 A;  2AYO B;  1JRU A;  1WX8 A;  2M0X A;  1E8W A;  1TGZ B;  3P4S B;  1Z2M A;  2VH2 A;  1SGH A;  4HEA 1;  3BY4 B;  1QOG A;  4A8X C;  4FXC A;  4WJQ A;  3A9J A;  2GI9 A;  3PRE A;  1IBX B;  1AW7 A;  2LJ5 A;  3GZN B;  3O13 A;  3ZGZ A;  3NOB A;  1IGD A;  1E9M A;  2N9K A;  4WQM A;  3RNB C;  2KHW B;  1R4N I;  2OJW A;  1WRI A;  2DEN B;  2KLC A;  1VLB A;  2YLM A;  2RD0 A;  1MFW A;  4JQW C;  1TYG B;  3AN1 A;  3VRA B;  3TMP B;  1F2R I;  2MA9 B;  4A9A A;  2HJ1 A;  4MGZ E;  2J53 A;  3T8M A;  4USA A;  3TBL D;  1WWT A;  2AQ2 B;  2CHX A;  2MBQ A;  2WX0 A;  3T9L A;  3WAO A;  2M8S A;  3AEG B;  3T3O A;  4ZRP A;  2WDV B;  4XGA B;  1I4G A;  1TZ1 A;  4L23 A;  4OVV A;  1F9J A;  2JXT A;  4XWW A;  3NY5 A;  2QCZ A;  5HKH A;  4A6Q A;  2ZCC A;  5G2N A;  4DBG A;  3EA6 A;  3CWI A;  2N4F A;  2NR2 A;  4NY0 A;  2EMS A;  3VH3 B;  4FBJ B;  3H8H A;  3PZD A;  1VD2 A;  4NAW B;  1N63 A;  1SE4 A;  4IM0 A;  4TQ0 A;  1JWA D;  2N0S B;  4RCO A;  3VRB B;  2BT6 A;  2I1J A;  1L7Y A;  4KV2 A;  4ZYS A;  3DBS A;  3Q8B A;  1C77 A;  3ALB A;  1J19 A;  1SE2 A;  2LEK A;  1C4P A;  2L32 A;  4LNI A;  3UQA A;  5BMG A;  4C7Z A;  1FFU A;  3TJP A;  5IN7 A;  2HD5 B;  2MHJ A;  4QAY A;  5D3I B;  1ZE3 D;  4LTU A;  2WDQ B;  1ZGU B;  3Q69 A;  3NZS A;  3SEB A;  1RYJ A;  4S17 A;  2VRR B;  3ZDM C;  1HEZ E;  4BFR A;  4EZJ A;  1K52 A;  1R7S A;  4BZA A;  2REX A;  2OJR A;  4WH4 A;  1LFD A;  2IGD A;  4ARI A;  3PPA A;  3W1Y A;  1DGJ A;  1ZUD 2;  5EE3 A;  3TEZ A;  1TS2 A;  3HM6 X;  3M62 B;  3ZJU A;  1XT9 B;  2MP2 A;  4JX1 C;  3Q3O C;  3C19 A;  2KVR A;  3PLV A;  3PLU A;  4RM9 A;  1P98 A;  1SE3 A;  1HE8 A;  4WQO B;  1E90 A;  2SAK A;  3L10 B;  4LNO A;  5C1Z A;  4PK1 A;  3ENE A;  2WXP A;  5H8Y E;  2JT4 B;  3UI3 A;  4JIO U;  3AUL A;  3L13 A;  2KWC A;  4HCP B;  4FJZ A;  3VR9 B;  3W5V B;  5JZE B;  2KWU B;  2KFK B;  4M01 A;  3UIN B;  2KMM A;  4IM3 A;  1G6J A;  2W54 A;  2ASQ A;  4BBN F;  4W9I A;  3PHW B;  4LDT D;  1IUE A;  4N59 A;  3L54 A;  4L1B A;  2KJR A;  3QQ8 B;  4RGM A;  1WZ0 A;  1NEK B;  2G4D B;  5CHF A;  1FD6 A;  3OWE B;  4KKJ A;  1GJZ A;  1QQR A;  1EWY C;  1D4B A;  1OEY J;  3VUY A;  3ZQ4 A;  2JRI B;  2WXH A;  4HJK A;  3RMK C;  2K25 A;  4K7S A;  2DHZ A;  3M63 B;  3RNA C;  3A33 B;  1NDD A;  2D3A A;  3IG3 A;  2MJ3 A;  4IC7 B;  4OW0 A;  4F8C B;  3DBR B;  1CQV A;  2W9N A;  3VH4 B;  1UGJ A;  1K53 A;  2WU5 B;  2WXF A;  3AM9 A;  3QC8 B;  4MGI E;  4K7U A;  1L0V B;  3EEC A;  4F7Z A;  3PO0 A;  3PSE B;  1BUI C;  1LO5 D;  4AUQ C;  2LGX A;  2OOB B;  4PT5 A;  4HCN B;  3U4E G;  4G11 A;  4GMV A;  3PS6 A;  3V6C B;  3GE3 C;  1DYQ A;  1TS5 A;  4C80 A;  3TSS A;  1SIF A;  2O2V B;  1QZE A;  2IO2 B;  1KOT A;  2V1Y A;  2X8X X;  4NPN A;  1FEH A;  1NBF C;  3DBL I;  4C00 A;  3LXF A;  1I4P A;  4ICV A;  3ZNI D;  2WQY B;  3JSV B;  3N20 C;  1WZ3 A;  4GXB A;  3CF6 E;  3VTW A;  2V4I B;  4ZYN A;  2KAC A;  1N6Z A;  2N7D A;  1YJI A;  2M1M A;  2GLS A;  2LGS A;  2E3T A;  3N30 A;  4YSX B;  1E7V A;  4DXG A;  1HTO A;  3A1Q A;  1PFD A;  1EU4 A;  4WWO A;  2C5L C;  3NVY A;  1RRB A;  1WXS A;  4A20 A;  2YVC A;  2YEP F;  5TR5 A;  4FAD A;  1FPY A;  2CJO A;  2D11 A;  2RDH A;  3ZXR A;  3WAP A;  2YEP B;  3AE9 B;  4JGH B;  4ITK A;  3Q3J A;  1I35 A;  5E6N A;  2PPH A;  4CHK A;  2KQ7 A;  3V62 A;  4DXF A;  1DOX A;  3U7Z A;  1XLP A;  4JWU C;  4BKS D;  1T0Q C;  2PVO D;  3A9J B;  2WXG A;  1H4R A;  1EF5 A;  1MJD A;  2QDF A;  2D5G A;  2WP9 B;  4GB9 A;  4HKQ A;  3ZIM A;  2KK8 A;  5LNK 1;  1V8C A;  2HDE A;  3TEW A;  1N5W A;  1V1P A;  3BVM A;  5FK9 C;  4BBN C;  4XE0 A;  2QHO A;  2ZEQ A;  1KJT A;  2LVQ A;  2LUM A;  5IO9 A;  2N9X A;  3VFK A;  3VDZ A;  3VVW B;  5EE0 A;  3BWU D;  3WA0 A;  4NNJ B;  2I38 A;  2L83 A;  2INP E;  4J6I A;  1PGX A;  2NTT A;  3VTU A;  3AEF B;  3VQI A;  1C76 A;  3QA8 A;  3L4P A;  3M95 A;  1OGW A;  3RUI B;  1N60 A;  1HA5 A;  2KT7 A;  2DZM A;  3Q8E A;  3N1Z C;  3P2B A;  3GP7 A;  5AUI A;  1VJK A;  1RM6 C;  5H92 C;  2ZW1 A;  3L0W B;  1TKY A;  1JRP A;  1EUV B;  1FXT B;  5C23 A;  2I1K A;  1WGR A;  2N1V A;  4P1B C;  2MRP A;  3H7P A;  1DOY A;  4DHJ B;  2JF5 A;  1ZP0 B;  2KWV B;  2DX5 B;  4GDL A;  3KYD D;  4DXA B;  4WWP A;  2IO0 B;  2WS3 B;  3PRP B;  2RPV A;  3H6N A;  4FJV B;  1F1H A;  2XN9 C;  4BVU C;  3IVF A;  2GBR A;  1QOF A;  2Y5P A;  3EUB 2;  4EFO A;  3B2G A;  4WUR A;  3L08 A;  2L52 A;  4TUU A;  2K1F A;  3K9O B;  2ZPY A;  3WIM A;  2KX3 A;  2MP2 B;  3D32 A;  1ZPS A;  5EE1 A;  2M17 A;  4HLE A;  2PMV A;  1V81 A;  5TSS A;  1TS3 A;  2RR9 A;  2KWD A;  1PDX A;  3DVN U;  4P7I A;  1KLU D;  2MBH A;  1P0R A;  3RPF C;  2HTM E;  2ZPN A;  2BS3 B;  2H88 B;  2JXX A;  1GC7 A;  2MW5 A;  4N58 A;  2JWZ A;  4BOZ B;  2JYE A;  1WE7 A;  4ANU A;  2TSS A;  3UF8 A;  2BB5 A;  4WWN A;  2RDG A;  1OFF A;  2DZK A;  4B9K A;  5AZF A;  4FA6 A;  1F2R C;  1WI0 A;  1J7A A;  3AE7 B;  4ZRK A;  1C3T A;  4RF0 A;  1WH3 A;  3KUC B;  1I4R A;  2CHW A;  2C7N B;  4LCD E;  3ZNG C;  4LJO B;  1BT0 A;  4XWT A;  3ZLZ A;  1MG8 A;  3ZTD A;  1D6E C;  2GMI C;  3NS8 A;  4YTP B;  1ROE A;  4HVB A;  1TIF A;  3I3T B;  1IYF A;  2DZI A;  2WXK A;  2BYT A;  4IKG A;  3ZRF A;  2MBO A;  3I63 C;  4MH8 A;  2BPS A;  3DCG A;  1XCT L;  2Y5B B;  3RNC C;  1V2Y A;  1UEL A;  1GB1 A;  2EMT A;  1Q0W B;  4HXD A;  2X38 A;  3ZTC A;  1D5X C;  2KMA A;  2VZK B;  1FNU A;  2JX5 A;  2C60 A;  4EUT A;  2BKR B;  4A90 A;  1MHX A;  2G9H D;  2QJL A;  4B0M A;  2WDR B;  4IWO A;  2KN4 A;  2JY6 A;  2L00 B;  2D07 B;  1QT9 A;  1XD3 B;  4J3O D;  1E8X A;  3KLS X;  1M4V A;  2KX0 A;  3MHS D;  3Q3N C;  2ON8 A;  1AYF A;  5LXI B;  3UIO B;  1WR6 E;  4WJP A;  1NVI D;  1T3Q A;  2WXR A;  3MP9 A;  3Q3M C;  1E6E B;  1WSP A;  2FE8 A;  2BB6 A;  1N62 A;  2LAS A;  3AE2 B;  5D94 A;  4EZL A;  5BO4 B;  3SD5 A;  3H1U A;  3DHH C;  2GBJ A;  2QSD A;  3E56 A;  4C7Y A;  1MVK A;  4HWI B;  3FIL A;  1JAL A;  1FIQ A;  2AX5 A;  2IPK D;  2DYM A;  4XDD A;  2KDE B;  2AL3 A;  4BKT A;  2G3Q B;  2KTR A;  2GBN A;  4BKS A;  2JRH A;  1TY0 A;  1NEN B;  1FM0 D;  4RF1 A;  3DVG X;  2K8H A;  4KDI C;  2V9H A;  2IO3 B;  1ENF A;  3AMZ A;  4W9E A;  3A1Q B;  1T0R C;  1E7P B;  1FCC C;  4RH6 A;  3FKY A;  5G5H A;  2R2O A;  1JWM D;  4ASW C;  3ZNZ B;  1L6V A;  1T0S C;  1LGR A;  3B08 A;  4ANW A;  5E6J A;  2D10 A;  2J4X A;  2BKF A;  5AZH A;  4WWM A;  4PS3 A;  5BYS A;  4ARC A;  3PVL A;  1FMA D;  4FUL A;  5E6O A;  3Q3F A;  3AB5 A;  2L76 A;  2IY0 B;  1T0Y A;  4MAC A;  4AWJ A;  2KAJ A;  4C4V A;  4TMA B;  2FCN A;  3ZJV A;  1GC6 A;  2V4L A;  1C1Y B;  3NJT A;  2CU3 A;  1V1P B;  1JWU D;  4RGT A;  3I57 A;  4I6P A;  3ZYY X;  4E71 A;  1B1Z A;  1QF6 A;  4EEW A;  1S3S G;  2LUE A;  4OVZ A;  3L17 A;  5C3J B;  4HKZ E;  1XXG A;  5BMH A;  2N9E B;  1F0Z A;  3IFW B;  3DWG C;  5DCN A;  1VR9 A;  2RGF A;  4RM8 A;  4FLH A;  1PYW D;  4C56 C;  3RYT A;  4IWQ A;  4OHJ A;  5HI1 A;  2KLG A;  3S2A A;  3H7S A;  1GUA B;  3TEX A;  2PW9 A;  3WCQ A;  5C2T B;  3ZO5 B;  1SF0 A;  2KQS A;  1IPG A;  2MJE A;  1YN4 A;  5EDS A;  2XEW A;  3AE8 B;  3R7R A;  1PQS A;  3KVF B;  1ZXI A;  4KGR A;  3ZW3 A;  3M3J A;  1KLG D;  1E7U A;  2KQ4 X;  2JUO A;  2GBK A;  3L16 A;  3AE1 B;  4PYU A;  2K22 A;  1V1O A;  1Q5W B;  1WR1 A;  1Y56 A;  1VCB A;  5JH5 C;  4BOS C;  2LJI A;  3MTN B;  2PE9 A;  2BS2 B;  3AV8 A;  3BYY B;  5T8I A;  3DHI C;  4MJS A;  4BAX A;  3WAL A;  2KFJ A;  3GB1 A;  4D2K A;  1I42 A;  3H7P B;  2CS4 A;  1WFY A;  1WF9 A;  4KVG B;  3NZ3 A;  4GDL B;  3KUZ A;  3U8Z A;  4FN2 A;  1TJE A;  2RSU A;  4HDQ A;  1D5M C;  4W9L A;  1N5X A;  2R61 A;  1JWS D;  2NBW B;  1XLO A;  2D3C A;  3QJZ A;  4II3 B;  1YQB A;  2NBU A;  3RNF C;  1N61 A;  2ZNV B;  1WXQ A;  3DDC B;  3DVN V;  4YXD B;  2KAN A;  4IG7 B;  4LDT B;  3ZUN A;  2BWE S;  2QEJ C;  4L2Y A;  2DNF A;  1WJN A;  3ML9 A;  2IND C;  2KVZ A;  1P1A A;  3HK0 A;  3MJ5 A;  1L4D B;  2PLP A;  4GGQ A;  1SBB B;  3MJW A;  3NVV A;  1WXA A;  2J42 A;  4YSY B;  4OZC A;  1L0Y B;  1KRH A;  2VH1 A;  1UGM A;  3RT3 B;  3DBH B;  2MEK A;  1RFA A;  1VRA B;  1WXM A;  1GAQ B;  3AEB B;  1WGY A;  3DHG C;  4W9K A;  1R4M B;  2K5P A;  5AZG A;  3B2F A;  3NVW A;  4DDI D;  1WGH A;  2FIF A;  2MBE A;  3P4Q B;  1J0G A;  4G0N B;  1EU3 A;  2MLB A;  3GOE A;  2K6Q A;  2V3S A;  4EZK A;  4DK5 A;  1UWM A;  3GZN I;  5IOI A;  2D3B A;  1C79 A;  3AE5 B;  3RZF A;  2IY1 B;  2KDB A;  3GE8 C;  3P42 A;  1K8R B;  2Z0E B;  3R3M A;  2GOW A;  2HJ8 A;  2V0G A;  1P3Q U;  3K9P B;  1YN5 A;  2K0P A;  1E8Z A;  1JWB D;  2M19 A;  4DQO C;  3Q2A C;  2W55 A;  3O65 B;  1WMH A;  4US9 A;  4XZ4 A;  1UBI A;  3DQV A;  1YMH E;  2WDT B;  1L4Z B;  3PV1 A;  5CHV C;  1V5T A;  3RD2 A;  1R4N B;  1WXV A;  3RNG C;  2RDB C;  4DWF A; 
#chains in the Genus database with same CATH homology
 5EE9 A;  1GPX A;  1JW9 D;  1ZPS A;  1XO3 A;  5EE1 A;  4WIP A;  2PMV A;  2NMQ A;  2BBC A;  3LYY A;  2EEL A;  5TSS A;  1TS3 A;  1WWT A;  1PGB A;  2AQ2 B;  3FAH A;  2PTL A;  2KWD A;  1PDX A;  1KLU D;  3AEG B;  1NYQ A;  4MT5 A;  2BTE A;  4ZRP A;  3RPF C;  3T3O A;  4AS1 A;  2HTM E;  1QKZ A;  1ZOY B;  2WDV B;  2BS3 B;  1I4G A;  2H88 B;  4N58 A;  4JWS C;  1P7E A;  2CJN A;  4L23 A;  2JYE A;  2JXT A;  4XWW A;  1KF6 B;  2TSS A;  2I2Y A;  1QOB A;  3R2T A;  3FIL B;  2BB5 A;  3Q8F A;  4A6Q A;  3IT4 B;  1BXT A;  2RDG A;  1OFF A;  1YQ3 B;  1I4H A;  3EA6 A;  1F2R C;  3CWI A;  4NJC A;  1J7A A;  3AE7 B;  3URY A;  2AQ3 B;  4RF0 A;  1PGA A;  1I4R A;  3V3X A;  1RFK A;  3J9C A;  3H8H A;  1VDV A;  1J7B A;  4NAW B;  1WYG A;  1SIJ A;  3PZ8 A;  1N63 A;  1SE4 A;  4XWT A;  3DWM A;  4TQ0 A;  1L5P A;  3P1M A;  1D6E C;  1JWA D;  2N0S B;  2JQR B;  4YTP B;  1ROE A;  1TKE A;  2K3U A;  4CQN A;  3KWV A;  4TQ1 A;  2WU2 B;  2WXK A;  4RCO A;  3VRB B;  1AWD A;  2BYT A;  2RMM A;  2BT6 A;  3ETR A;  4IKG A;  1JRO A;  1KH0 A;  4MH8 A;  2FUG 1;  1XCT L;  4ZYS A;  3AEE B;  1C77 A;  3Q8B A;  3ZJT A;  1SE2 A;  2ICI A;  1GB1 A;  2LEK A;  1I7H A;  1CJE A;  1C4P A;  2L32 A;  3MC0 B;  2X38 A;  2Q5W D;  3W9C B;  1D5X C;  5BMG A;  1SXT A;  2ZW0 A;  2EKI A;  3AH7 A;  3SFD B;  4YWG G;  1FFU A;  2JU6 X;  1FNU A;  2VZK B;  2WXJ A;  1JCK B;  2JX5 A;  4C7Z A;  1UNS A;  4A90 A;  5D3I B;  2PKO A;  1ZE3 D;  1MHX A;  1IBX A;  2G9H D;  4LTU A;  2QJL A;  4OZB A;  4B0M A;  2WDR B;  2GB1 A;  1ET9 A;  2WDQ B;  1I4Q A;  2KN4 A;  1B9R A;  2DLB A;  1FXI A;  3Q69 A;  3SEB A;  1FNV A;  3IT6 B;  2MH7 A;  1BML C;  1QT9 A;  1CK1 A;  1RYJ A;  1SB3 C;  2WNM A;  2IGG A;  3FC4 A;  4J3O D;  1HEZ E;  1K52 A;  1R7S A;  4O1N A;  1ET6 A;  3KLS X;  1M4V A;  2KDM A;  1E10 A;  1E0Z A;  1NI3 A;  2ON8 A;  2M56 B;  1AYF A;  2FBW B;  4WH4 A;  1C4C A;  2IGD A;  1JML A;  4ARI A;  2IGH A;  1NVI D;  1T3Q A;  2WXR A;  2QIL A;  1DGJ A;  2QIE B;  3MP9 A;  1E6E B;  3HVD A;  1ZUD 2;  4WAF A;  5EE3 A;  4UDU C;  3TEZ A;  1WSP A;  3VR8 B;  1TS2 A;  2FE8 A;  4ZHP A;  3ZJU A;  4P6V F;  2BB6 A;  2JSV X;  4JX1 C;  2E6X A;  1N62 A;  1SJE D;  1C78 A;  4YTN B;  1C4A A;  3EGR A;  1STE A;  3AE2 B;  1YN3 A;  1SE3 A;  2SAK A;  3TEY A;  2LHE A;  2QSD A;  3E56 A;  3TUO A;  3Q8A A;  2WXP A;  5H8Y E;  1XEE A;  3UI3 A;  4C7Y A;  1MVK A;  2W3R A;  3AEA B;  3FIL A;  1JAL A;  1FIQ A;  5FKA C;  2AX5 A;  3VR9 B;  2IPK D;  5D7G A;  3W5V B;  1KTK A;  1QLB B;  4KKI A;  2DYM A;  2WXQ A;  1UUP A;  4XDD A;  3I9V 1;  3BK2 A;  2WXI A;  1VZ7 A;  3KWL A;  2WLB A;  4RFB A;  1TY0 A;  4YT0 B;  1C9F A;  1NEN B;  1FM0 D;  4HRS A;  4RF1 A;  2KMM A;  2SEB D;  4LK0 M;  1RWS A;  1YJJ A;  4A55 A;  2W54 A;  1IUE A;  1ENF A;  4N59 A;  3AMZ A;  3SR6 A;  2INN E;  1FNW A;  1EM7 A;  4NZL B;  4L1B A;  1T5X D;  2NTS A;  1IGC A;  4RGM A;  2LGI A;  1E7P B;  1NEK B;  3MHZ A;  3IAM 1;  1FD6 A;  1FCC C;  3OWE B;  4RH6 A;  4KKJ A;  3Q8C A;  4YSZ B;  5BYQ A;  5GXG B;  5G5H A;  1MPE A;  1FCL A;  1EWY C;  1A70 A;  3BII D;  3BK1 A;  2IJ0 A;  1D4B A;  1JWM D;  3AE6 B;  2PIA A;  2LHD A;  3SFE B;  4H2A A;  3HVZ A;  3ZQ4 A;  2MJD A;  1L6V A;  2WXH A;  5E6J A;  2J4X A;  4GLS C;  4WWM A;  5BYS A;  4ARC A;  1D5Z C;  1P7F A;  1FMA D;  4YTM B;  1ZXH A;  4KGT A;  5FR3 A;  3AB5 A;  2MJ3 A;  2H89 B;  4MAC A;  4REZ A;  4OW0 A;  1L0X B;  2WXN A;  1GOZ A;  4P16 A;  2KAJ A;  1QIL A;  5BYR A;  1CQV A;  1UGJ A;  4TMA B;  2B76 B;  5HHD G;  3ZJV A;  2BW2 A;  1K53 A;  3P4R B;  3ABV B;  2CU3 A;  2WU5 B;  2WXF A;  1XLN A;  3AED B;  3AE3 B;  1F77 A;  1V1P B;  3AM9 A;  1JWU D;  4RGT A;  3I57 A;  1L0V B;  1HZ5 A;  3AE4 B;  3PZ7 A;  3ZYY X;  1B1Z A;  1QF6 A;  1DOI A;  2Y3A A;  2W3S A;  3P4P B;  3PO0 A;  1TY2 A;  4OVZ A;  1BUI C;  1ZDX A;  1FO4 A;  1LO5 D;  2DBY A;  5C3J B;  4PT5 A;  4HKZ E;  1EWC A;  3AEC B;  3U4E G;  1XXG A;  5BMH A;  4IDI A;  1F0Z A;  2DYO A;  4M0W A;  1DYQ A;  3DWG C;  1TS5 A;  4C80 A;  1VR9 A;  3TSS A;  1PYW D;  1TZO A;  4C56 C;  4OHJ A;  3IAS 1;  5HI1 A;  1SEB D;  2JWU A;  3TEX A;  2PW9 A;  3WCQ A;  5HG2 A;  1FEH A;  5C2T B;  3GS2 A;  3LXF A;  1I4P A;  2M0A A;  1SF0 A;  1FRD A;  1OQR A;  1ZDV A;  2WQY B;  2WXM A;  3V05 A;  1SSN A;  2MJE A;  1YN4 A;  3T3N A;  1HXY D;  1SJH D;  2V4I B;  3AE8 B;  2KAC A;  2L1A A;  1ZXI A;  1YNT E;  4KGR A;  1YJI A;  2E3T A;  4YSX B;  1KLG D;  2KQ4 X;  1FFV A;  2IDY A;  4DXG A;  3AE1 B;  4ZOH C;  2K22 A;  4B0E A;  1V1O A;  1XF5 L;  4N6E B;  1Y56 A;  1FXA A;  1PFD A;  2LJI A;  4JE3 B;  1EU4 A;  4RNA A;  1CZP A;  2GRI A;  2BS2 B;  3NVY A;  3AV8 A;  3W1S A;  3W5U B;  2G1E A;  1HZ6 A;  3BYY B;  5T8I A;  2YEP F;  3GB1 A;  4OZA A;  1NYR A;  2CJO A;  1FRR A;  3NUH B;  4D2K A;  2RDH A;  5G5G A;  2YEP B;  1J7C A;  3AE9 B;  4ITK A;  1KFY B;  4NAM A;  3B9J A;  5AUK A;  2V3P A;  4DXF A;  2JZP A;  2ACZ B;  2V3N A;  3NZ3 A;  1DOX A;  3U7Z A;  1TKG A;  4GDL B;  1XLP A;  4JWU C;  3BVG A;  1TJE A;  2PVO D;  1D5M C;  2Y5C A;  1HQR D;  2WXG A;  2N7J A;  4R3D A;  1N5X A;  2R61 A;  1JWS D;  2J52 A;  3HUI A;  1XLQ A;  2D5G A;  2W82 A;  1XLO A;  2WP9 B;  4LLG M;  4HKQ A;  1WGK A;  5LNK 1;  2N9L A;  1V8C A;  2HDE A;  3W2D A;  3TEW A;  1N5W A;  2DWQ A;  1V1P A;  1N61 A;  2ONQ A;  3BVM A;  5FK9 C;  1WXQ A;  2QMT A;  4XE0 A;  1VZ6 A;  2LUM A;  4YXD B;  2Z8L A;  5HFY A;  4HJG E;  2K9X A;  3BZD B;  1YQ4 B;  1VZ8 A;  2QEJ C;  1MHH E;  4KX6 B;  4L2Y A;  3BWU D;  5EE0 A;  3P63 A;  3MJ5 A;  2VZK D;  4EE2 A;  2I38 A;  1L4D B;  2PLP A;  2L83 A;  1SBB B;  2INP E;  3NVV A;  1Q10 A;  1PGX A;  2NTT A;  2J42 A;  3AEF B;  3VQI A;  4Q2J A;  4YSY B;  2WXL A;  1C76 A;  4OZC A;  2XNA C;  1L0Y B;  3C8Y A;  1KRH A;  3L4P A;  2JYT A;  3R2I A;  1MI0 A;  2MEK A;  4RGO S;  3NS1 A;  4XDC A;  1ACC A;  1I4X A;  1TS4 A;  1V97 A;  1N60 A;  1XCQ L;  1UWX A;  1HA5 A;  1VRA B;  4RGN A;  5BMI A;  1GAQ B;  3AEB B;  3Q8E A;  2LMC A;  3E9S A;  3CIR B;  4KGS A;  2K5P A;  2AQ1 B;  3GP7 A;  3MFG A;  5AUI A;  1VJK A;  3B2F A;  3HRD D;  1RM6 C;  5H92 C;  3U52 E;  3NVW A;  4ZRQ A;  3RFZ B;  4IOI E;  2ZW1 A;  5JXV A;  1L6U A;  1TKY A;  1JRP A;  2OED A;  4US8 A;  5D3D A;  1QOA A;  5MPO A;  4JPS A;  3P4Q B;  3NRZ A;  2BS4 B;  1K51 A;  1PUT A;  3LB8 C;  3NVZ A;  1EU3 A;  1T6B X;  3KQ4 A;  1K50 A;  1DOY A;  2PVG C;  1UWM A;  3IXS A;  1ZP0 B;  3P4S B;  2LFI A;  4TSS A;  1C79 A;  1GB4 A;  4HEA 1;  3AE5 B;  1QOG A;  4AQ7 A;  4A8X C;  3BYT B;  3P42 A;  4FXC A;  2GI9 A;  1IBX B;  1AN8 A;  1AW7 A;  2WS3 B;  3O13 A;  2WXO A;  2V0G A;  3ZGZ A;  1YN5 A;  2K0P A;  3N9Y C;  1IGD A;  1ESF A;  2RPV A;  1E9M A;  2N9K A;  4WQM A;  1JWB D;  2M19 A;  1WRI A;  2XN9 C;  4DQO C;  2W55 A;  1VLB A;  4US9 A;  4ZHO A;  3BVZ A;  1QOF A;  2Y5P A;  1JQ4 A;  3EUB 2;  1YMH E;  1L4Z B;  1TYG B;  3B2G A;  4WUR A;  4GDK B;  3AN1 A;  3VRA B;  3U2S C;  2L52 A;  1F2R I;  4MM3 B;  4HRO A;  3R8B A;  4A9A A;  5I4D A;  2J53 A;  1OQQ A;  2OHF A;  1QQR A;  4USA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...