2MJEA

Reduced yeast adrenodoxin homolog 1
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
115
structure length
115
Chain Sequence
GEELKITFILKDGSQKTYEVCEGETILDIAQGHNLDMEGACGGSCACSTCHVIVDPDYYDALPEPEDDENDMLDLAYGLTETSRLGCQIKMSKDIDGIRVALPQMTRNVNNNDFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Adrenodoxin homolog, mitochondrial
publication title Functional reconstitution of mitochondrial Fe/S cluster synthesis on Isu1 reveals the involvement of ferredoxin.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 18
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2014-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2mjeA00
3AN1A 1NENB 2PVGC 1N5WA 3HVZA 2DWQA 1YJIA 2WDRB 4YT0B 3AE5B 1NI3A 2PKOA 4YSXB 2OHFA 1J7BA 1E9MA 1VDVA 1XO3A 2FBWB 3NVZA 4WWMA 1CJEA 1FRRA 1XLOA 2Q5WD 3AE9B 2PVOD 5C2TB 1OQQA 2ACZB 2QJLA 1QOAA 4YSZB 3AEAB 1UWMA 4C7ZA 3LB8C 1KF6B 2Y5CA 1TYGB 4YTNB 1FMAD 1QOBA 1L0VB 5GXGB 4C7YA 1QT9A 1WWTA 2WP9B 2JX5A 4US8A 3AM9A 2M19A 3AB5A 3FC4A 4ZHOA 2CU3A 2K22A 1PFDA 2AX5A 1NYRA 2EKIA 5EE0A 1QOGA 3P4QB 1YQ4B 3P1MA 1ZUD2 2W55A 3AEGB 4ITKA 4WQMA 5EE9A 1DOYA 4N59A 5EE3A 4KX6B 3AECB 2MJ3A 2E3TA 1SIJA 3HUIA 3VRBB 3VRAB 1ZOYB 1T3QA 1N5XA 1RYJA 4FXCA 3B2GA 4HRSA 2HTME 1FRDA 1KFYB 3B2FA 3AV8A 4YXDB 3WCQA 1KRHA 1SF0A 2BS2B 4JX1C 3AE8B 4A9AA 1QOFA 3SFEB 3W9CB 1E6EB 5AUIA 1FO4A 2QIEB 3W5UB 2PIAA 2DBYA 1FXIA 1L6UA 1JWBD 1L6VA 2N0SB 1V8CA 2JQRB 1GAQB 3EUB2 1VLBA 1XLNA 2BS3B 2K9XA 3AEEB 1B9RA 5C3JB 1FFVA 1VJKA 1SB3C 3VR8B 2WQYB 1NEKB 1E10A 1J7CA 2CJOA 4IDIA 1EWYC 4LTUA 4N58A 1A70A 1E7PB 1IUEA 1CZPA 4YSYB 1N60A 3FAHA 1ZP0B 2W3RA 1XLQA 3AE6B 1ROEA 3NVYA 2W54A 1YJJA 1FIQA 1JW9D 3B9JA 3CIRB 4YTPB 1TJEA 3AE3B 1AYFA 2MJEA 1JWAD 1PDXA 1DGJA 1TKYA 3P4SB 5H8YE 1N62A 1N61A 1TKEA 3PO0A 2H88B 3AE1B 3DWMA 3AEDB 4YTMB 1QF6A 2WLBA 1XLPA 4USAA 2L83A 1TKGA 3AEFB 1J7AA 1NVID 1WXQA 3ZYYX 1JROA 1JRPA 4P6VF 1E0ZA 1V97A 3SR6A 3L4PA 1WGKA 2WU5B 1I7HA 3CWIA 3ABVB 3AE2B 3ETRA 5AUKA 5H92C 3HRDD 4HROA 4US9A 1JALA 1FFUA 2BS4B 1N63A 2WS3B 1RFKA 5G5GA 2KMMA 1FM0D 2B76B 2WDQB 2WU2B 1OFFA 5MPOA 3P4PB 1F0ZA 2CJNA 4C80A 1RWSA 1AWDA 1QLBB 1RM6C 3DWGC 3P63A 3AE7B 1PUTA 3W5VB 1DOXA 1DOIA 1OQRA 2H89B 2L52A 5G5HA 1FXAA 1NYQA 3NRZA 2WDVB 2LEKA 2KAJA 2G1EA 4ZHPA 2K5PA 3LXFA 2M56B 3P4RB 2BT6A 4JWUC 1WYGA 5EE1A 3BIID 3RPFC 1L5PA 2MH7A 3KWLA 2W3SA 3AH7A 4N6EB 3AEBB 1WRIA 1R7SA 1GPXA 1YQ3B 3SFDB 3NVVA 2MJDA 3NS1A 3NVWA 1ZXIA 3VR9B 3AMZA 1JQ4A 3AE4B 4ZOHC 4JWSC
chains in the Genus database with same CATH superfamily
4IKGA 1XCQL 3EFUA 1V86A 3T3NA 4EEWA 3NG0A 2QDFA 4C7YA 1VD2A 2N4FA 1WGYA 3WANA 3MC8A 1N5XA 2IO2B 2KN5A 3T8MA 1E90A 4K7SA 4AOFA 5BYQA 2JF5A 1MFWA 2A4ZA 4KSKC 4A6QA 5D6JB 4FADA 3W5UB 2QCZA 1Q5WB 1ZPSA 3K9OB 3DBHB 4FJZA 3QC8B 4O1NA 2M17A 5HKHA 2IYDB 4N58A 3V61A 2IO1B 3ZIMA 3T9LA 1XLQA 1OQYA 3ZRFA 1WMHA 4IW0A 1LO5D 4NJ7A 2WXPA 3RNGC 2BWES 4F1SA 2XN9C 1LQBA 3ZXRA 2FCNA 3L4PA 5LXHA 5DPSA 4II2B 4XZ4A 2PJHA 2VH2A 3OLMD 2DYOA 1FXTB 2EKEC 2D3CA 1UWXA 3WALA 3I5JC 3H1UA 1UF0A 4F8CB 3L10B 2INNE 2DAFA 3BYTB 2M56B 1G6JA 2RDHA 3JSVB 2B3AA 3AMZA 4GSWA 2KTFA 3V60A 2DWQA 3KQ4A 4YT0B 3AE5B 3BVMA 2O2VA 1LGRA 2BF8B 1VDVA 4M8MA 1SJED 2LHDA 2ACZB 4DWFA 4YTNB 5HG2A 2KWUB 4RGMA 4NQLB 4EUTA 2CU3A 4HVBA 1QOGA 3PV1A 2ZZPB 4N59A 3W1SC 3O13A 2MJ3A 2DZMA 1DYQA 1TY2A 3QX1A 3T3OA 3MTNB 5D94A 3U52E 2XNAC 4BKTA 2INCC 5IA7A 1BMLC 2QIEB 2K3UA 4JQWC 2JQRB 2RMMA 4HK2A 3RZWC 1VZ7A 1WXAA 3WAMA 3DBLB 3BK1A 3N9YC 4LNNA 1E7PB 4AP4C 1CZPA 3WA0A 2W3RA 4DXAB 1HZ5A 3DBRI 2J53A 1N61A 4DXGA 4GXBA 5JHBA 4ACFA 3TJPA 4YWGG 1JROA 2SAKA 4ARIA 4FHJA 1TGZB 3ABVB 4Q2JA 1L4ZB 4II3B 4J6IA 4R3DA 5AZHA 3OG5A 2YEPB 1TS5A 2CJNA 5EDSA 3DWGC 2WNMA 1OQRA 1IGDA 3EGRA 2PE9A 3UINB 2V3NA 3B08A 3V6EB 2NTSA 3L08A 3LXFA 4BZAA 1GPXA 1WMHB 1HQRD 1LFDA 3NVWA 2JZ3B 3VUWA 4WAFA 5J17A 3PHWB 2Y5BB 4HLEA 3NVZA 5LLIA 4LDTD 4DK5A 4ZRKA 3VTUA 5JH5C 2RDGA 1JMLA 3UQAA 1WX8A 2Y3AA 3PLVA 1MJDA 1VRAB 5EE9A 2KOXA 1SE2A 1SIJA 1C3TA 1CQVA 3EA6A 5BMIA 1P7EA 1VCBA 4B6WA 2WXGA 2FUHB 2WGSA 2KYWA 3ECIA 1KLUD 3HHMA 1B9RA 4K3BA 2HDEA 4EZJA 1L4DB 4K1RB 2HD5B 4P7IA 3U8ZA 1L0XB 2J0JA 1WX9A 2ZNVC 3R2TA 3N3KB 1ACCA 1FNUA 3ZO5B 1WX7A 2L76A 3RNAC 1RAXA 2LGSA 2HJ8A 2KTRA 2L1AA 4W9LA 3DWMA 2WLBA 5CHWA 3I3TB 1XQQA 2L83A 2M4NA 2BB5A 4BOZB 2KDMA 1Y56A 4DHJB 4NQKE 5H92C 1E8WA 4ZYSA 3HRDD 3MC9A 3S2AA 1WE7A 4KKJA 4GDKB 3R66C 3ZQ4A 3Q3FA 2E6XA 2WDVB 3BINA 2CHXA 2PLPA 2WXNA 3HK0A 2JSVX 1ESFA 1I4HA 2K8HA 2KC1A 3ZNGC 5AZGA 4IM0A 4WH4A 4JWSC 3AN1A 3L54A 2KXJA 2PE6B 2MWSB 4E3CA 3DQVA 1E9MA 2ZJDA 5AEKB 4C7ZA 1KF6B 4IUMB 1QOBA 4OW0A 1HZ6A 1LXDA 2IY0B 1P0RA 1Q1OA 1SEBD 5CHFA 2BYFA 4B0EA 1XEEA 2KDBA 4OZCA 3C19A 2D07B 2KFKA 2DZIA 2LWPA 1ENFA 3ZJTA 1HE8A 1D5XC 2KZRA 4RF1A 2ON8A 2LUEA 4JX1C 2WXIA 3BY4B 3W9CB 3PGEA 2J4XA 4GLSC 1MVKA 3VUXA 4W9HA 2G45B 3PRMB 3ZDMC 1SB3C 3Q8CA 2DX5B 3QWZB 3URYA 4KSLC 2N7JA 3RULA 1ZP0B 1IGCA 4WIPA 1AYFA 4PYZA 4K7WA 4IWOA 3NS8A 1YN5A 3I57A 1TZ1A 2JUOA 1EF1A 3V3XA 3N30A 1AW7A 4GIVA 1MG8A 2KK8A 2C60A 3NY5A 3AEFB 1SIFA 3DPDA 4OZAA 2O6VA 3J9CA 1ET6A 3N20C 4HROA 2NPTA 1YNTE 2B76B 2QHOA 3Q69A 3KUCB 1PUTA 2KJ6A 2K8BA 2I38A 4FLHA 2JWZA 1AARA 5DCNA 1SSNA 4BKSD 4W9JA 4ZHPA 4KGTA 1EU3A 1YQ3B 2KTRB 3RNEC 5G55A 2DZKA 4KGRA 3X0WA 3EC8A 5C1ZA 4D2KA 2ICIA 4GB9A 3LB8C 4IM3A 2N7EA 1R4MI 3H8HA 4JE3B 4FHKA 5J18A 4BKGA 4KV2A 4W9IA 1NI2A 3VH4B 1KTKA 3SHQA 4W9CA 1I35A 3GS2A 4FULA 4EOYA 4FA6A 3IAM1 5FR3A 3ZW3A 4YXDB 1WXMA 2MW5A 3AE8B 1E6EB 2WHIA 2G4DB 2DBYA 2D10A 3JYUA 2CHZA 2M8SA 2LVQA 3EUB2 1VLBA 1K8RB 5C3JB 2FCQA 5IOIA 3QQ8B 1K52A 3Q2AC 2MEKA 3P4SB 3ZXVA 2KFKB 3HM6X 1XLPA 2X8XX 2LGDA 1F9JA 3QK0A 2ZCBA 2CS4A 3B0AA 1GNUA 4XWWA 2V4LA 3CWIA 1Z2MA 1WFYA 4LDTB 3SDLC 4X57B 4H2AA 2LUMA 3APDA 3UF8A 4NAWB 2VZKD 1AWDA 2GB1A 3IHPC 2OEDA 2IZVB 1WE6A 1NYQA 4MJSA 1WRDB 5DPTA 5T8IA 2L00B 2LJIA 4JWUC 4M8NA 2IGDA 1SXTA 4ANUA 3KLSX 4ZYNA 5L83A 3NVVA 1WR6E 1WJNA 3Q8AA 1UZXB 4ZHOA 3ZJUA 1IP9A 3N1YC 1NENB 2EELA 2PVGC 3HVZA 4XX5A 1WM2A 2FBWB 3RMKC 2YEPF 3AE9B 4LCDE 2BTEA 4ICUA 3A9KA 4HEA1 4RM9A 1TS2A 2O6VB 3GP7A 2KWVB 2NPTB 4BKSA 1YQ4B 2N9EB 3AEGB 4MGKE 3ALBA 1V5TA 2SEBD 2K1FA 1YX6B 3HUIA 2QILA 2JZPA 3APCA 3TEXA 3VTWA 2KVZA 3OJ3A 1MHHE 2BB6A 4W9FA 2RSUA 4M01A 3IXSA 2AEHA 2KLGA 5CTRC 4PK1A 4M0WA 3O65B 2DZJA 1QOFA 4PS8A 5AUIA 3EHVA 1FXIA 3V6CB 1WH3A 3ZNZB 2CU1A 2BW2A 2UU7A 4MSQB 4WJOA 3HIZA 2L0FA 2GI9A 1L7YA 1T0YA 4W9GA 3MJWA 3NZUA 4WWPA 2BWFA 1GOZA 1QF6A 1UELA 5IAAC 2I2YA 2K6DB 4G50A 4EFOA 2AYOB 1E0ZA 1E8YA 2KO3A 2DHZA 2QMTA 4GDLA 1F0ZA 2R2OA 2GBJA 1DOIA 4JL9A 4ANWA 4G11A 1C76A 1OEYJ 4URKA 4L23A 2IGGA 2FAZA 3VUYA 1H8CA 2BYEA 3AH7A 2PTLA 4HJKA 1P9DU 1M94A 4OHJA 3IAS1 1N5WA 1YJIA 3A9JA 2OJRA 2V9HA 3E9SA 2OHFA 1J7BA 3EFCA 2KLCA 1FRRA 3ONSA 3PT2B 5C2TB 1UWMA 4P1BC 1TYGB 3R3MA 5GXGB 4XGAB 2MCNB 3SD5A 3DVGX 1WF9A 3DHGC 1C1YB 2MBBB 4ITKA 2X38A 3AECB 3RN9C 4A90A 4MJSB 2NS5A 2LGXA 4MSMB 1Y8RC 4CQNA 3PRZA 3HVDA 2L3ZA 5DPRA 1T6BX 2NBVB 1FO4A 4XWTA 5C23A 5D2MB 2D3GA 1V8CA 3I63C 1S1QB 1SBBB 1XT9B 2ZCCA 3BWUD 3RI7C 4EKUA 2JPHA 4LJOB 4HDOA 4KIKA 1JWSD 4RFBA 5BMHA 5I4DA 3A4SC 2OOBB 3RZFA 2GMIC 3NVYA 1FIQA 1JW9D 1UD7A 2G3QB 1E7VA 1ET9A 1ZXHA 3TIXA 2LVPA 2ZVNA 3VAWA 5BMGA 4DXFA 1YJ1A 1STEA 1WGKA 2L0TA 2WU5B 4WJNA 4M0WB 2D2QA 1GC6A 1MHXA 3DBRB 2JWUA 3P63A 1HA5A 3PS6A 2VH1A 3VTVA 2KJHB 3Q8FA 2MBOA 2L8JA 2MBEA 4PS3A 3RPFC 4AWJA 2MBHA 3AEBB 2LGYA 2M0XA 1RFAA 3R8BA 4M02A 1J0GA 4HWIB 2FCMA 1NI3A 4HCPB 4YSXB 2FIFA 4P16A 4WWOA 1F52A 2A5UA 4ICVA 1YOVB 2JU6X 1ZUD2 5BYSA 4EE2A 5EE3A 4GDLB 3U7DA 1WZ0A 4RH6A 3KW5B 4A3OA 3M62B 2KANA 4MGYE 4G0NB 3AV8A 4C4VA 1SF0A 4WURA 4WQOB 4RM8A 4A9AA 3SFEB 3KVFB 2PIAA 1L6UA 4C56C 2N0SB 5D3DA 2WXMA 2C7NB 3ZJVA 4NPNA 1VJKA 3KUDB 1TS4A 2C5LC 1A70A 1AN8A 2VZKB 1U4AA 1P98A 5GMVA 3WAOA 2KKCA 3TMPB 3NZSA 2PMVA 5E6NA 2Z0DB 3X23A 3GZNI 3LYYA 1T0RC 3PSEB 1SE4A 3DHIC 2O2VB 2V1YA 3BVZA 3ZVVA 1V1OA 3DOWA 1I7HA 3DVGY 4KVGB 2KVRA 4KZ0A 1TS3A 5G5GA 3OWEB 4CHKA 4AS1A 1N63A 2RD0A 1FM0D 5TSSA 3H6NA 2BYVE 2DAJA 3Q8BA 4KIKB 2JT4B 2LEKA 2MX2A 2W82A 1GC7A 3TUOA 1GG3A 5EE1A 3LDZE 3DBSA 4C00A 3NJTA 1GUAB 3PTFC 3PZDA 1HEZE 4TQ0A 4S0RA 1UUPA 4LJPB 1OQQA 3GE8C 5HHDG 1WJ4A 2MRPA 2KX0A 1UGMA 2Z0EB 3AB5A 5EE0A 1QZEA 1PYWD 3DVNV 2KACA 1EU4A 3VRBB 3VRAB 2LASA 2NBUA 1T3QA 5E6OA 1V5OA 3RNBC 3VVWB 3MHZA 2GRIA 3ZNHB 1JCKB 1MI0A 1T5XD 1Q10A 2BS2B 3RUIB 3UIOB 4ZRPA 1FPYA 2ZVOA 3SU8X 4KGSA 2OJWA 4GN1A 3MJ5A 2K9XA 4KKIA 3H9DA 1KM7A 4ANXA 5AZFA 2DYMA 1NEKB 1XD3B 1X1MA 2CKHB 3VHTC 2GBMA 1FNVA 2RDBC 4ARCA 3PO0A 2WXQA 2KWCA 3BVGA 4MH8A 4LNOA 3UQBA 1NVID 1V97A 2N9KA 1V49A 3Q3OC 4C4VB 1I42A 2ZEQA 3ZDTA 3Q3MC 2WU2B 3CSFA 1PGBA 1VR9A 2JRIB 2GBRA 1WGGA 1L5PA 2AQ3B 4RMAA 5FK9C 2WXHA 1R7SA 2N9XA 2JVCA 3KYDD 1WGRA 2WDRB 3PRPB 4BBNF 2PKOA 3P42A 1BXTA 1CJEA 2YLMA 2AWTA 1FMAD 1L0VB 3RD2A 1WWTA 2M19A 2K22A 4DBGA 2EKIA 1P7FA 1PGXA 2NR2A 4ZDVA 4KX6B 2CR5A 3GE3C 3U4EG 1OTRB 4XDDA 2G4SA 3KWVA 2JXTA 3B1LX 3B2GA 1RRBA 5D3IB 3L17A 1ZKHA 2RGFA 1I4XA 3GOEA 1R4MB 2NBWB 3GB1A 4XC2A 1I4PA 3Q8EA 4JIOU 3TEZA 3U7ZA 4PYUA 4YSYB 3AI5A 3DVNU 3AE6B 1IPGA 4YTPB 4GMVA 1TJEA 3N1ZC 3M3JA 3QA8A 2KX3A 1D6EC 1XCTL 4A8XC 4WAAA 1YX5B 2Z8LA 4B9KA 2IO0B 2V3SA 4N9F4 2QSDA 3QJZA 3QCAA 4K3CA 1M4VA 4F7ZA 3BZDB 1KOTA 4TKNA 4US9A 2MHJA 2KMMA 4GU2A 1OFFA 4C80A 3W5VB 1DOXA 3PHXB 2K39A 4REZA 3C0RB 3P4RB 4OVZA 1TBEA 2W3SA 4TUUA 2BPSA 3VR9B 1E8XA 2KDIA 3D32A 2JYTA 1KLGD 4NJ6A 2WDTB 4PS7A 1TZOA 4IG7B 1XO3A 2PVOD 1WI0A 1SE3A 3N32A 3MHSD 4TQ1A 2J52A 2CHWA 4RCOA 1QT9A 2L32A 1WXVA 3FC4A 4TSSA 2DENB 2FUG1 3A4RA 1WIAA 1MG4A 3DDCB 2VRRB 3MFGA 1HTQA 5KHOA 1D5ZC 5LNK1 2RPQA 4IM2A 3ZTCA 4WJPA 1FEHA 1F2RC 3DHHC 4DDID 2KT7A 3W1SA 2K6QA 2GLSA 4GGQA 2KC2A 1JWBD 2WXFA 1C9FA 1F2RI 2IY1B 2ONQA 1L2NA 1FFVA 1EM7A 3TEYA 2FCSA 4FBJB 4XDCA 2BYTA 4ANVA 4HPLB 1PGAA 3KH0A 4MDKE 1QILA 2W54A 4MM3A 2KWDA 1YQBA 2MJEA 3AULA 3VXWA 3PZ7A 1N62A 4RGTA 4ASWC 1C4CA 2WWZA 4NAMA 4AUQC 1V81A 2KMAA 1J7AA 4JGHB 4LNKA 2IJ0A 3R7RA 3SR6A 2FE8A 2J0MA 1E7UA 3ETRA 5AUKA 2BKRB 2KHWB 3Q14C 4LK0M 2JZZA 1R4NB 3C8YA 4DHJD 1R4NI 5G5HA 4CO7A 2EMTA 1NDDA 2G1EA 2LGIA 2K5PA 5IKCM 2WXLA 3DCGA 3ZRCA 2N1VA 4N6EB 5E6JA 1UGJA 2MJDA 4J3OD 1XF5L 3QHTA 4ZRQA 3QIJA 4L1BA 2INDC 4NY0A 4YSZB 2WXOA 2TSSA 2NTTA 2G9HD 2N7DA 2PW9A 4US8A 1TY0A 1PFDA 1V9JA 2NMQA 1J19A 2W55A 3DBHI 1DOYA 4BBNC 3IFWB 3KUZA 1D4BA 1JRUA 2R61A 1RYJA 1FCLA 3IT4B 4P1CC 3CMMB 3VDZA 4M00A 1FRDA 4HJGE 3CSTA 4NZLB 4PT5A 2AL6A 2IO3B 1WSPA 1IBXA 3QARA 1V6EA 1XLNA 2JRHA 1UH6A 3TL5A 1D3ZA 1SJHD 1YD8U 1I4QA 1D5MC 1YIWA 2XK5A 1UNSA 1Q0WB 2CJOA 1EWYC 3V62A 1C77A 3ML8A 4CYEA 3L16A 2BQQA 3CIRB 4DHZB 4EZKA 3ZGZA 1FNWA 2K0PA 1TKEA 1QKZA 1WJ6A 1KLVA 3AEDB 2N1WA 4A20A 4USAA 2AL3A 4JPSA 4WJQA 3PVLA 2V4IB 5HI1A 1SE9A 4OVUA 2M0AA 2XBBC 2MP2A 2BS4B 3A9KB 1RFKA 2RR9A 4AJYB 2WX0A 1IYFA 1VZ6A 3RYTA 4W9DA 1MPEA 2KAJA 1V2YA 1T0SC 1N6ZA 1E5WA 2BGFA 2L05A 4MM3B 3AE4B 1BT0A 2RPVA 2GBNA 4L2YA 3RCZA 4IC7B 1PQSA 4JLCA 2FNJB 3N1XC 3VQIA 3E56A 2V3PA 2LVOA 2Z59B 5BYRA 4MGIE 3U2SC 3AM9A 3OJ4B 1TIFA 2AX5A 1NYRA 4GDKA 4IWQA 4WQMA 3V05A 2E3TA 4K7UA 2LD9A 3P2BA 4QAYA 3DBLI 2D11A 1QQRA 4HRSA 1H4RA 2HTME 2MA9B 4MACA 2LXAA 1LM8B 3WCQA 2XEWA 4A55A 4YL8A 2JYEA 2ZW1A 1YN4A 1GB4A 1F1HA 3AEEB 2QC8A 2ASQA 4RGNA 1WM3A 2WQYB 1ZGUB 4IDIA 2UWQA 4LNFA 1FD6A 1IUEA 5KHQA 3FAHA 1ROEA 3NZ3A 1YJJA 3ZYYX 4W9KA 3APFA 4KDIC 1DGJA 1TKYA 1TT5B 1WYWB 5H8YE 4XE0A 2K25A 1XXGA 4RGOS 1C79A 3A9JB 1WXQA 1GB1A 3U30A 4NJCA 3H7SA 3L13A 3A1QA 3JVZX 2ZPNA 4DDGD 2KQ4X 4UDUC 4E71A 5BO4B 1IBXB 2WYQA 3P4PB 1QLBB 1ZE3D 2MBQA 4KZCA 1ZDVA 2L52A 2MQJA 5JHAA 2XK5B 4HCNB 3RT3B 2REXA 3GZNB 4HKZE 2KFJA 3KWLA 5FR6A 3H7PA 2D3AA 1WRIA 2J7QB 1Z5SB 3SFDB 2KN4A 3ZNID 1FCCC 4ZOHC 3IBEA 3ZLZA 3ML9A 3SEBA 3NHEB 3AU4A 4WWMA 3Q3JA 2QJLA 3MP9A 2ZNVB 1J8CA 4AQ7A 2Y5CA 3TBLD 2DYBA 4B0MA 2KD0A 1WGDA 1WR1A 2JXXA 3IVFA 4IOIE 2MP2B 3P4QB 3P1MA 2O6VD 2PPHA 5JZEB 3AU5A 4OZBA 2IPKD 2IDYA 3Q3NC 5DPWA 2INPE 4FXCA 5CHVC 2KDFB 1UBQA 1UBIA 4IWPA 3B2FA 2LI5A 2WXJA 1P3QU 1RLFA 2AQ1B 1L6VA 3BYYB 1GAQB 2J0KA 4LNIA 3WAPA 3TCAA 2PEAA 4K81A 3VR8B 3AXCA 4GOCA 4TV3A 3KYCD 1C78A 2LHEA 1N60A 2NVUI 3Q6BA 4HXDA 5G2NA 3K9PB 3HM3A 2KDEB 4ZRJA 2V0GA 3AE3B 2C7MB 1JWAD 3BK2A 3MC0B 4NNJB 1K53A 4DQOC 5CX3A 1OGWA 5IP4D 2H88B 4YTMB 2YVCA 1TKGA 4FN2A 4I6NB 1EF5A 4MH0E 3TSSA 4WWNA 1T0QC 3OAWA 2JY6A 1S3SG 1CMXB 3UIPB 2HE7A 1L0YB 2GBKA 1JALA 1FFUA 1K51A 5FKAC 3PZ8A 1B1ZA 2IGHA 1JWUD 4BAXA 1FXAA 2D3BA 1CK1A 2LJ5A 2DNFA 2MLBA 2BT6A 1WYGA 4BOSC 1P1AA 2LFIA 5LXIB 3IT6B 4MT5A 3NS1A 3RFZB 1ZXIA 2C7HA 3FILA 5IO9A 2WXRA 2I1JA 2WXKA 1K50A 2K8CA 4AJWA 1XLOA 2Q5WD 5MPOA 2AQ2B 1QOAA 2D5GA 3EECA 3A1QB 3IG3A 1ZDXA 2JX5A 4NAWA 2L7RA 4FJVB 1WXSA 2N9PC 1ISNA 2C9WB 4EZLA 3NOBA 2WX1A 3A33B 1KFYB 4FJYA 4B95A 1KRHA 1ZW7A 3H7PB 1V1PA 2KQ7A 3I9V1 1WJUA 1C4AA 1F77A 2BS3B 2DLBA 4MGZE 1J7CA 1WY8A 4LTUA 4W9EA 2LZ6A 2HJ1A 3JW0X 4ZRIA 5E6PA 2LRWA 2M1MA 1V80A 1NBFC 3VH3B 3L0WB 4MEMA 2IBIB 5HFYA 2EMSA 2FIDA 3W1YA 3AE2B 2KQSA 2WS3B 1JWMD 5J2RA 3VFKA 1RWSA 1RM6C 4MELA 4RF0A 5TR5A 1YN3A 3NRZA 1HTOA 3BIID 3ZKJC 2MH7A 3WIMA 4I6LB 1WZ3A 3ZTDA 1EWCA 2GOWA 3M63B 5JXVA 2Y5PA 1A5RA 1BUIC 2ZW0A 2UYZB 3AEAB 5IN7A 2KJRA 3CF6E 2LMCA 4OVVA 2WP9B 2LXCA 1GJZA 3R7QA 3R2IA 2BBCA 2BKFA 2HTHA 4S17A 3RNFC 1KH0A 1EO6A 1ZOYB 1WGHA 2KNBA 1OEYA 3UI3A 4RNAA 1TTNA 3ENEA 2N9LA 1YMHE 2KMCA 3PPAA 1E8ZA 1SGHA 3PREA 2NCNA 3W2DA 4HKQA 4TMAB 3FILB 4HPPA 1HXYD 2R2QA 5D7GA 2BVCA 3LJ3A 4G3XB 4DHZE 1E10A 3FKYA 1EUVB 3JSVA 3B9JA 3PLUA 1PDXA 2I1KA 2LRUA 3RNCC 3AE1B 4HPMB 4HDQA 1C4PA 3NUHB 1KJTA 2J42A 1I4RA 2QEJC 2ZPYA 4P6VF 1JRPA 3ZUNA 2MSED 4XYCA 1VZ8A 1V1PB 5L95C 2WDQB 4LLGM 3AE7B 3TEWA 2H89B 4A3PA 2W9NA 3UGBB 4E74A 4BFRA 3QAQA 1I4GA 3M95A 4BVUC 4KDLB 1JQ4A 4I6PA
chains in the Genus database with same CATH topology
2RPVA 4IKGA 1HEZE 4TQ0A 1XCQL 4KGRA 4L2YA 1UUPA 3T3NA 4D2KA 2ICIA 1OQQA 3VQIA 5HHDG 3E56A 2V3PA 3LB8C 4C7YA 3H8HA 4JE3B 5BYRA 3U2SC 3AM9A 3AB5A 5EE0A 2AX5A 1NYRA 1PYWD 4WQMA 3V05A 1KTKA 2KACA 2E3TA 1EU4A 3VRBB 3VRAB 1T3QA 3GS2A 1N5XA 3IAM1 5FR3A 3MHZA 1QQRA 2GRIA 4HRSA 2HTME 4MACA 1JCKB 5BYQA 4YXDB 3WCQA 1MI0A 1T5XD 1Q10A 2BS2B 3AE8B 4A6QA 4A55A 1E6EB 2JYEA 2ZW1A 3W5UB 1YN4A 2DBYA 1ZPSA 4ZRPA 4KGSA 1GB4A 3EUB2 1VLBA 3MJ5A 2K9XA 3AEEB 4KKIA 4RGNA 5C3JB 4O1NA 2DYMA 2WQYB 1NEKB 4IDIA 1K52A 4N58A 1FD6A 1IUEA 3FAHA 1XLQA 1ROEA 2MEKA 3NZ3A 1YJJA 3ZYYX 1LO5D 1DGJA 1FNVA 1TKYA 3P4SB 5H8YE 4ARCA 2WXPA 3PO0A 4XE0A 1XLPA 2WXQA 3BVGA 4MH8A 1XXGA 4RGOS 1C79A 1NVID 2XN9C 1WXQA 1GB1A 1V97A 2N9KA 4NJCA 4XWWA 3L4PA 3CWIA 2KQ4X 4UDUC 4H2AA 2DYOA 1IBXB 1UWXA 2WU2B 2LUMA 3P4PB 4NAWB 2VZKD 1AWDA 1QLBB 1ZE3D 2GB1A 1ZDVA 2L52A 2OEDA 1NYQA 1PGBA 1VR9A 2INNE 3BYTB 4HKZE 5T8IA 2M56B 2LJIA 4JWUC 2IGDA 1L5PA 2AQ3B 3KWLA 1SXTA 5FK9C 2RDHA 1WRIA 1R7SA 2WXHA 3KLSX 3SFDB 2KN4A 3NVVA 1FCCC 3AMZA 3Q8AA 4ZOHC 4ZHOA 3ZJUA 1NENB 2EELA 2PVGC 3HVZA 3SEBA 2DWQA 3KQ4A 2WDRB 4YT0B 3AE5B 3BVMA 2PKOA 3P42A 1VDVA 2FBWB 1BXTA 4WWMA 1CJEA 2YEPF 3AE9B 2BTEA 1SJED 2LHDA 2ACZB 2QJLA 3MP9A 4AQ7A 2Y5CA 4YTNB 5HG2A 4B0MA 1FMAD 4HEA1 1L0VB 4RGMA 1TS2A 1WWTA 2M19A 3GP7A 2CU3A 2K22A 2EKIA 4IOIE 1QOGA 3P4QB 1P7FA 1YQ4B 3P1MA 1PGXA 3AEGB 4N59A 4KX6B 4OZBA 3O13A 2MJ3A 2SEBD 2IPKD 3HUIA 2IDYA 2QILA 3U4EG 2JZPA 1DYQA 4XDDA 3TEXA 1MHHE 3KWVA 2BB6A 2INPE 1TY2A 4FXCA 2JXTA 3B2GA 5D3IB 3T3OA 3IXSA 3B2FA 1I4XA 3U52E 2WXJA 2XNAC 4M0WA 3GB1A 1QOFA 2AQ1B 1BMLC 5AUIA 2QIEB 1FXIA 1L6VA 2K3UA 3BYYB 2JQRB 1GAQB 2RMMA 1I4PA 3Q8EA 2BW2A 1VZ7A 3VR8B 3BK1A 2GI9A 3TEZA 3N9YC 3U7ZA 1E7PB 1C78A 2LHEA 1CZPA 4YSYB 1N60A 2W3RA 3AE6B 1HZ5A 4YTPB 2V0GA 1TJEA 3AE3B 1JWAD 3BK2A 3MC0B 2J53A 1K53A 4DQOC 1N61A 1GOZA 4DXGA 2H88B 1D6EC 1XCTL 4YTMB 4A8XC 1QF6A 4YWGG 1TKGA 2Z8LA 2I2YA 1JROA 2QSDA 2SAKA 3TSSA 4ARIA 1E0ZA 1M4VA 3ABVB 4Q2JA 1L4ZB 1L0YB 3BZDB 4US9A 1JALA 1FFUA 4R3DA 1K51A 2KMMA 2QMTA 2YEPB 1TS5A 1B1ZA 1OFFA 3PZ8A 5FKAC 2CJNA 2IGHA 3W5VB 3DWGC 4C80A 1F0ZA 1DOXA 1JWUD 2WNMA 1DOIA 1OQRA 1FXAA 1IGDA 1C76A 3EGRA 4L23A 1CK1A 2IGGA 4REZA 2V3NA 2NTSA 3LXFA 3P4RB 2BT6A 1WYGA 4OVZA 2LFIA 2W3SA 3AH7A 3IT6B 4MT5A 1GPXA 1HQRD 2PTLA 3NS1A 3NVWA 1ZXIA 3VR9B 3RFZB 3FILA 4OHJA 2WXRA 3IAS1 4WAFA 2WXKA 2JYTA 1KLGD 1N5WA 1YJIA 1K50A 3E9SA 1TZOA 2OHFA 1J7BA 1XO3A 3NVZA 1FRRA 1XLOA 2Q5WD 5MPOA 2AQ2B 2PVOD 5C2TB 1QOAA 2D5GA 1SE3A 4TQ1A 1UWMA 2RDGA 2J52A 1TYGB 1JMLA 4RCOA 5GXGB 1QT9A 1ZDXA 2L32A 2JX5A 3FC4A 4TSSA 2Y3AA 4ITKA 1VRAB 2X38A 5EE9A 1SE2A 3AECB 2FUG1 1SIJA 1CQVA 3EA6A 5BMIA 4A90A 3MFGA 1D5ZC 5LNK1 1KFYB 1P7EA 4CQNA 2WXGA 1KRHA 3HVDA 1T6BX 1FEHA 1F2RC 1V1PA 1FO4A 3W1SA 4XWTA 1KLUD 3I9V1 1JWBD 2WXFA 1V8CA 1C4AA 1F77A 1SBBB 1C9FA 2BS3B 1B9RA 1F2RI 2ONQA 3BWUD 1FFVA 1EM7A 2HDEA 1L4DB 2DLBA 3TEYA 2BYTA 4XDCA 1JWSD 1J7CA 4LTUA 4RFBA 1PGAA 1L0XB 5BMHA 5I4DA 3R2TA 1ACCA 1FNUA 1QILA 3NVYA 2W54A 1FIQA 1JW9D 2KWDA 2MJEA 1ET9A 1N62A 3PZ7A 1ZXHA 2L1AA 4RGTA 1C4CA 3DWMA 2WLBA 2L83A 4NAMA 5HFYA 2BB5A 5BMGA 4DXFA 1J7AA 2KDMA 2IJ0A 3SR6A 1Y56A 1STEA 1WGKA 2WU5B 3AE2B 2FE8A 3ETRA 5AUKA 5H92C 4ZYSA 3HRDD 2WS3B 4LK0M 1JWMD 1MHXA 3C8YA 4KKJA 2JWUA 1RWSA 1RM6C 3P63A 4GDKB 1HA5A 4RF0A 5G5HA 1YN3A 3ZQ4A 2E6XA 3NRZA 2WDVB 2G1EA 2PLPA 2LGIA 3Q8FA 2K5PA 2WXNA 2JSVX 1ESFA 1I4HA 2WXLA 3BIID 2MH7A 3RPFC 4N6EB 3AEBB 5E6JA 1UGJA 2MJDA 4J3OD 1EWCA 4WH4A 4JWSC 1XF5L 3AN1A 3R8BA 5JXVA 2Y5PA 4ZRQA 1NI3A 4YSXB 1E9MA 4L1BA 1BUIC 2ZW0A 4YSZB 4P16A 2WXOA 3AEAB 2TSSA 4C7ZA 1KF6B 2NTTA 4OW0A 1QOBA 2G9HD 1HZ6A 2LMCA 2PW9A 2WP9B 4US8A 2JU6X 1TY0A 1PFDA 1SEBD 3R2IA 4B0EA 2NMQA 1XEEA 1ZUD2 2W55A 5BYSA 4OZCA 4EE2A 2BBCA 1DOYA 5EE3A 4GDLB 1KH0A 1ZOYB 4RH6A 1D4BA 2R61A 1RYJA 1FCLA 3IT4B 3UI3A 4RNAA 2N9LA 1ENFA 3ZJTA 1D5XC 1YMHE 4RF1A 1FRDA 2ON8A 3AV8A 4HJGE 4NZLB 4PT5A 1SF0A 4WURA 4JX1C 2WXIA 3W2DA 4A9AA 3SFEB 3W9CB 4HKQA 2J4XA 2PIAA 4TMAB 1WSPA 1L6UA 3FILB 4C56C 1IBXA 2N0SB 5D3DA 2WXMA 4GLSC 1MVKA 1XLNA 1SJHD 1HXYD 3ZJVA 1VJKA 1I4QA 1SB3C 1D5MC 1TS4A 3Q8CA 5D7GA 1UNSA 1E10A 2CJOA 1EWYC 3URYA 1A70A 1AN8A 2VZKB 1C77A 2N7JA 1ZP0B 1IGCA 4WIPA 3CIRB 3B9JA 3ZGZA 1AYFA 1PDXA 2PMVA 1FNWA 2K0PA 1TKEA 1YN5A 1QKZA 3AE1B 3I57A 3AEDB 1C4PA 4USAA 3NUHB 3V3XA 2J42A 1AW7A 3LYYA 4JPSA 1I4RA 2QEJC 3AEFB 2V4IB 1SE4A 4P6VF 1JRPA 3BVZA 5HI1A 1V1OA 4OZAA 1I7HA 3J9CA 1VZ8A 2M0AA 1ET6A 1V1PB 1TS3A 4HROA 5G5GA 3OWEB 2BS4B 4AS1A 1N63A 1YNTE 1RFKA 1FM0D 2B76B 2WDQB 5TSSA 3Q69A 4LLGM 3AE7B 1PUTA 3TEWA 2H89B 2I38A 3Q8BA 1VZ6A 1MPEA 2LEKA 2KAJA 2W82A 1SSNA 3TUOA 4ZHPA 5EE1A 4KGTA 1I4GA 1EU3A 4MM3B 1YQ3B 1JQ4A 3AE4B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AN1 A;  1NEN B;  2PVG C;  1N5W A;  3HVZ A;  2DWQ A;  1YJI A;  2WDR B;  4YT0 B;  3AE5 B;  1NI3 A;  2PKO A;  4YSX B;  2OHF A;  1J7B A;  1E9M A;  1VDV A;  1XO3 A;  2FBW B;  3NVZ A;  4WWM A;  1CJE A;  1FRR A;  1XLO A;  2Q5W D;  3AE9 B;  2PVO D;  5C2T B;  1OQQ A;  2ACZ B;  2QJL A;  1QOA A;  4YSZ B;  3AEA B;  1UWM A;  4C7Z A;  3LB8 C;  1KF6 B;  2Y5C A;  1TYG B;  4YTN B;  1FMA D;  1QOB A;  1L0V B;  5GXG B;  4C7Y A;  1QT9 A;  1WWT A;  2WP9 B;  2JX5 A;  4US8 A;  3AM9 A;  2M19 A;  3AB5 A;  3FC4 A;  4ZHO A;  2CU3 A;  2K22 A;  1PFD A;  2AX5 A;  1NYR A;  2EKI A;  5EE0 A;  1QOG A;  3P4Q B;  1YQ4 B;  3P1M A;  1ZUD 2;  2W55 A;  3AEG B;  4ITK A;  4WQM A;  5EE9 A;  1DOY A;  4N59 A;  5EE3 A;  4KX6 B;  3AEC B;  2MJ3 A;  2E3T A;  1SIJ A;  3HUI A;  3VRB B;  3VRA B;  1ZOY B;  1T3Q A;  1N5X A;  1RYJ A;  4FXC A;  3B2G A;  4HRS A;  2HTM E;  1FRD A;  1KFY B;  3B2F A;  3AV8 A;  4YXD B;  3WCQ A;  1KRH A;  1SF0 A;  2BS2 B;  4JX1 C;  3AE8 B;  4A9A A;  1QOF A;  3SFE B;  3W9C B;  1E6E B;  5AUI A;  1FO4 A;  2QIE B;  3W5U B;  2PIA A;  2DBY A;  1FXI A;  1L6U A;  1JWB D;  1L6V A;  2N0S B;  1V8C A;  2JQR B;  1GAQ B;  3EUB 2;  1VLB A;  1XLN A;  2BS3 B;  2K9X A;  3AEE B;  1B9R A;  5C3J B;  1FFV A;  1VJK A;  1SB3 C;  3VR8 B;  2WQY B;  1NEK B;  1E10 A;  1J7C A;  2CJO A;  4IDI A;  1EWY C;  4LTU A;  4N58 A;  1A70 A;  1E7P B;  1IUE A;  1CZP A;  4YSY B;  1N60 A;  3FAH A;  1ZP0 B;  2W3R A;  1XLQ A;  3AE6 B;  1ROE A;  3NVY A;  2W54 A;  1YJJ A;  1FIQ A;  1JW9 D;  3B9J A;  3CIR B;  4YTP B;  1TJE A;  3AE3 B;  1AYF A;  2MJE A;  1JWA D;  1PDX A;  1DGJ A;  1TKY A;  3P4S B;  5H8Y E;  1N62 A;  1N61 A;  1TKE A;  3PO0 A;  2H88 B;  3AE1 B;  3DWM A;  3AED B;  4YTM B;  1QF6 A;  2WLB A;  1XLP A;  4USA A;  2L83 A;  1TKG A;  3AEF B;  1J7A A;  1NVI D;  1WXQ A;  3ZYY X;  1JRO A;  1JRP A;  4P6V F;  1E0Z A;  1V97 A;  3SR6 A;  3L4P A;  1WGK A;  2WU5 B;  1I7H A;  3CWI A;  3ABV B;  3AE2 B;  3ETR A;  5AUK A;  5H92 C;  3HRD D;  4HRO A;  4US9 A;  1JAL A;  1FFU A;  2BS4 B;  1N63 A;  2WS3 B;  1RFK A;  5G5G A;  2KMM A;  1FM0 D;  2B76 B;  2WDQ B;  2WU2 B;  1OFF A;  5MPO A;  3P4P B;  1F0Z A;  2CJN A;  4C80 A;  1RWS A;  1AWD A;  1QLB B;  1RM6 C;  3DWG C;  3P63 A;  3AE7 B;  1PUT A;  3W5V B;  1DOX A;  1DOI A;  1OQR A;  2H89 B;  2L52 A;  5G5H A;  1FXA A;  1NYQ A;  3NRZ A;  2WDV B;  2LEK A;  2KAJ A;  2G1E A;  4ZHP A;  2K5P A;  3LXF A;  2M56 B;  3P4R B;  2BT6 A;  4JWU C;  1WYG A;  5EE1 A;  3BII D;  3RPF C;  1L5P A;  2MH7 A;  3KWL A;  2W3S A;  3AH7 A;  4N6E B;  3AEB B;  1WRI A;  1R7S A;  1GPX A;  1YQ3 B;  3SFD B;  3NVV A;  2MJD A;  3NS1 A;  3NVW A;  1ZXI A;  3VR9 B;  3AMZ A;  1JQ4 A;  3AE4 B;  4ZOH C;  4JWS C; 
#chains in the Genus database with same CATH topology
 4IKG A;  1XCQ L;  3EFU A;  1V86 A;  3T3N A;  4EEW A;  3NG0 A;  2QDF A;  4C7Y A;  1VD2 A;  2N4F A;  1WGY A;  3WAN A;  3MC8 A;  1N5X A;  2IO2 B;  2KN5 A;  3T8M A;  1E90 A;  4K7S A;  4AOF A;  5BYQ A;  2JF5 A;  1MFW A;  2A4Z A;  4KSK C;  4A6Q A;  5D6J B;  4FAD A;  3W5U B;  2QCZ A;  1Q5W B;  1ZPS A;  3K9O B;  3DBH B;  4FJZ A;  3QC8 B;  4O1N A;  2M17 A;  5HKH A;  2IYD B;  4N58 A;  3V61 A;  2IO1 B;  3ZIM A;  3T9L A;  1XLQ A;  1OQY A;  3ZRF A;  1WMH A;  4IW0 A;  1LO5 D;  4NJ7 A;  2WXP A;  3RNG C;  2BWE S;  4F1S A;  2XN9 C;  1LQB A;  3ZXR A;  2FCN A;  3L4P A;  5LXH A;  5DPS A;  4II2 B;  4XZ4 A;  2PJH A;  2VH2 A;  3OLM D;  2DYO A;  1FXT B;  2EKE C;  2D3C A;  1UWX A;  3WAL A;  3I5J C;  3H1U A;  1UF0 A;  4F8C B;  3L10 B;  2INN E;  2DAF A;  3BYT B;  2M56 B;  1G6J A;  2RDH A;  3JSV B;  2B3A A;  3AMZ A;  4GSW A;  2KTF A;  3V60 A;  2DWQ A;  3KQ4 A;  4YT0 B;  3AE5 B;  3BVM A;  2O2V A;  1LGR A;  2BF8 B;  1VDV A;  4M8M A;  1SJE D;  2LHD A;  2ACZ B;  4DWF A;  4YTN B;  5HG2 A;  2KWU B;  4RGM A;  4NQL B;  4EUT A;  2CU3 A;  4HVB A;  1QOG A;  3PV1 A;  2ZZP B;  4N59 A;  3W1S C;  3O13 A;  2MJ3 A;  2DZM A;  1DYQ A;  1TY2 A;  3QX1 A;  3T3O A;  3MTN B;  5D94 A;  3U52 E;  2XNA C;  4BKT A;  2INC C;  5IA7 A;  1BML C;  2QIE B;  2K3U A;  4JQW C;  2JQR B;  2RMM A;  4HK2 A;  3RZW C;  1VZ7 A;  1WXA A;  3WAM A;  3DBL B;  3BK1 A;  3N9Y C;  4LNN A;  1E7P B;  4AP4 C;  1CZP A;  3WA0 A;  2W3R A;  4DXA B;  1HZ5 A;  3DBR I;  2J53 A;  1N61 A;  4DXG A;  4GXB A;  5JHB A;  4ACF A;  3TJP A;  4YWG G;  1JRO A;  2SAK A;  4ARI A;  4FHJ A;  1TGZ B;  3ABV B;  4Q2J A;  1L4Z B;  4II3 B;  4J6I A;  4R3D A;  5AZH A;  3OG5 A;  2YEP B;  1TS5 A;  2CJN A;  5EDS A;  3DWG C;  2WNM A;  1OQR A;  1IGD A;  3EGR A;  2PE9 A;  3UIN B;  2V3N A;  3B08 A;  3V6E B;  2NTS A;  3L08 A;  3LXF A;  4BZA A;  1GPX A;  1WMH B;  1HQR D;  1LFD A;  3NVW A;  2JZ3 B;  3VUW A;  4WAF A;  5J17 A;  3PHW B;  2Y5B B;  4HLE A;  3NVZ A;  5LLI A;  4LDT D;  4DK5 A;  4ZRK A;  3VTU A;  5JH5 C;  2RDG A;  1JML A;  3UQA A;  1WX8 A;  2Y3A A;  3PLV A;  1MJD A;  1VRA B;  5EE9 A;  2KOX A;  1SE2 A;  1SIJ A;  1C3T A;  1CQV A;  3EA6 A;  5BMI A;  1P7E A;  1VCB A;  4B6W A;  2WXG A;  2FUH B;  2WGS A;  2KYW A;  3ECI A;  1KLU D;  3HHM A;  1B9R A;  4K3B A;  2HDE A;  4EZJ A;  1L4D B;  4K1R B;  2HD5 B;  4P7I A;  3U8Z A;  1L0X B;  2J0J A;  1WX9 A;  2ZNV C;  3R2T A;  3N3K B;  1ACC A;  1FNU A;  3ZO5 B;  1WX7 A;  2L76 A;  3RNA C;  1RAX A;  2LGS A;  2HJ8 A;  2KTR A;  2L1A A;  4W9L A;  3DWM A;  2WLB A;  5CHW A;  3I3T B;  1XQQ A;  2L83 A;  2M4N A;  2BB5 A;  4BOZ B;  2KDM A;  1Y56 A;  4DHJ B;  4NQK E;  5H92 C;  1E8W A;  4ZYS A;  3HRD D;  3MC9 A;  3S2A A;  1WE7 A;  4KKJ A;  4GDK B;  3R66 C;  3ZQ4 A;  3Q3F A;  2E6X A;  2WDV B;  3BIN A;  2CHX A;  2PLP A;  2WXN A;  3HK0 A;  2JSV X;  1ESF A;  1I4H A;  2K8H A;  2KC1 A;  3ZNG C;  5AZG A;  4IM0 A;  4WH4 A;  4JWS C;  3AN1 A;  3L54 A;  2KXJ A;  2PE6 B;  2MWS B;  4E3C A;  3DQV A;  1E9M A;  2ZJD A;  5AEK B;  4C7Z A;  1KF6 B;  4IUM B;  1QOB A;  4OW0 A;  1HZ6 A;  1LXD A;  2IY0 B;  1P0R A;  1Q1O A;  1SEB D;  5CHF A;  2BYF A;  4B0E A;  1XEE A;  2KDB A;  4OZC A;  3C19 A;  2D07 B;  2KFK A;  2DZI A;  2LWP A;  1ENF A;  3ZJT A;  1HE8 A;  1D5X C;  2KZR A;  4RF1 A;  2ON8 A;  2LUE A;  4JX1 C;  2WXI A;  3BY4 B;  3W9C B;  3PGE A;  2J4X A;  4GLS C;  1MVK A;  3VUX A;  4W9H A;  2G45 B;  3PRM B;  3ZDM C;  1SB3 C;  3Q8C A;  2DX5 B;  3QWZ B;  3URY A;  4KSL C;  2N7J A;  3RUL A;  1ZP0 B;  1IGC A;  4WIP A;  1AYF A;  4PYZ A;  4K7W A;  4IWO A;  3NS8 A;  1YN5 A;  3I57 A;  1TZ1 A;  2JUO A;  1EF1 A;  3V3X A;  3N30 A;  1AW7 A;  4GIV A;  1MG8 A;  2KK8 A;  2C60 A;  3NY5 A;  3AEF B;  1SIF A;  3DPD A;  4OZA A;  2O6V A;  3J9C A;  1ET6 A;  3N20 C;  4HRO A;  2NPT A;  1YNT E;  2B76 B;  2QHO A;  3Q69 A;  3KUC B;  1PUT A;  2KJ6 A;  2K8B A;  2I38 A;  4FLH A;  2JWZ A;  1AAR A;  5DCN A;  1SSN A;  4BKS D;  4W9J A;  4ZHP A;  4KGT A;  1EU3 A;  1YQ3 B;  2KTR B;  3RNE C;  5G55 A;  2DZK A;  4KGR A;  3X0W A;  3EC8 A;  5C1Z A;  4D2K A;  2ICI A;  4GB9 A;  3LB8 C;  4IM3 A;  2N7E A;  1R4M I;  3H8H A;  4JE3 B;  4FHK A;  5J18 A;  4BKG A;  4KV2 A;  4W9I A;  1NI2 A;  3VH4 B;  1KTK A;  3SHQ A;  4W9C A;  1I35 A;  3GS2 A;  4FUL A;  4EOY A;  4FA6 A;  3IAM 1;  5FR3 A;  3ZW3 A;  4YXD B;  1WXM A;  2MW5 A;  3AE8 B;  1E6E B;  2WHI A;  2G4D B;  2DBY A;  2D10 A;  3JYU A;  2CHZ A;  2M8S A;  2LVQ A;  3EUB 2;  1VLB A;  1K8R B;  5C3J B;  2FCQ A;  5IOI A;  3QQ8 B;  1K52 A;  3Q2A C;  2MEK A;  3P4S B;  3ZXV A;  2KFK B;  3HM6 X;  1XLP A;  2X8X X;  2LGD A;  1F9J A;  3QK0 A;  2ZCB A;  2CS4 A;  3B0A A;  1GNU A;  4XWW A;  2V4L A;  3CWI A;  1Z2M A;  1WFY A;  4LDT B;  3SDL C;  4X57 B;  4H2A A;  2LUM A;  3APD A;  3UF8 A;  4NAW B;  2VZK D;  1AWD A;  2GB1 A;  3IHP C;  2OED A;  2IZV B;  1WE6 A;  1NYQ A;  4MJS A;  1WRD B;  5DPT A;  5T8I A;  2L00 B;  2LJI A;  4JWU C;  4M8N A;  2IGD A;  1SXT A;  4ANU A;  3KLS X;  4ZYN A;  5L83 A;  3NVV A;  1WR6 E;  1WJN A;  3Q8A A;  1UZX B;  4ZHO A;  3ZJU A;  1IP9 A;  3N1Y C;  1NEN B;  2EEL A;  2PVG C;  3HVZ A;  4XX5 A;  1WM2 A;  2FBW B;  3RMK C;  2YEP F;  3AE9 B;  4LCD E;  2BTE A;  4ICU A;  3A9K A;  4HEA 1;  4RM9 A;  1TS2 A;  2O6V B;  3GP7 A;  2KWV B;  2NPT B;  4BKS A;  1YQ4 B;  2N9E B;  3AEG B;  4MGK E;  3ALB A;  1V5T A;  2SEB D;  2K1F A;  1YX6 B;  3HUI A;  2QIL A;  2JZP A;  3APC A;  3TEX A;  3VTW A;  2KVZ A;  3OJ3 A;  1MHH E;  2BB6 A;  4W9F A;  2RSU A;  4M01 A;  3IXS A;  2AEH A;  2KLG A;  5CTR C;  4PK1 A;  4M0W A;  3O65 B;  2DZJ A;  1QOF A;  4PS8 A;  5AUI A;  3EHV A;  1FXI A;  3V6C B;  1WH3 A;  3ZNZ B;  2CU1 A;  2BW2 A;  2UU7 A;  4MSQ B;  4WJO A;  3HIZ A;  2L0F A;  2GI9 A;  1L7Y A;  1T0Y A;  4W9G A;  3MJW A;  3NZU A;  4WWP A;  2BWF A;  1GOZ A;  1QF6 A;  1UEL A;  5IAA C;  2I2Y A;  2K6D B;  4G50 A;  4EFO A;  2AYO B;  1E0Z A;  1E8Y A;  2KO3 A;  2DHZ A;  2QMT A;  4GDL A;  1F0Z A;  2R2O A;  2GBJ A;  1DOI A;  4JL9 A;  4ANW A;  4G11 A;  1C76 A;  1OEY J;  4URK A;  4L23 A;  2IGG A;  2FAZ A;  3VUY A;  1H8C A;  2BYE A;  3AH7 A;  2PTL A;  4HJK A;  1P9D U;  1M94 A;  4OHJ A;  3IAS 1;  1N5W A;  1YJI A;  3A9J A;  2OJR A;  2V9H A;  3E9S A;  2OHF A;  1J7B A;  3EFC A;  2KLC A;  1FRR A;  3ONS A;  3PT2 B;  5C2T B;  1UWM A;  4P1B C;  1TYG B;  3R3M A;  5GXG B;  4XGA B;  2MCN B;  3SD5 A;  3DVG X;  1WF9 A;  3DHG C;  1C1Y B;  2MBB B;  4ITK A;  2X38 A;  3AEC B;  3RN9 C;  4A90 A;  4MJS B;  2NS5 A;  2LGX A;  4MSM B;  1Y8R C;  4CQN A;  3PRZ A;  3HVD A;  2L3Z A;  5DPR A;  1T6B X;  2NBV B;  1FO4 A;  4XWT A;  5C23 A;  5D2M B;  2D3G A;  1V8C A;  3I63 C;  1S1Q B;  1SBB B;  1XT9 B;  2ZCC A;  3BWU D;  3RI7 C;  4EKU A;  2JPH A;  4LJO B;  4HDO A;  4KIK A;  1JWS D;  4RFB A;  5BMH A;  5I4D A;  3A4S C;  2OOB B;  3RZF A;  2GMI C;  3NVY A;  1FIQ A;  1JW9 D;  1UD7 A;  2G3Q B;  1E7V A;  1ET9 A;  1ZXH A;  3TIX A;  2LVP A;  2ZVN A;  3VAW A;  5BMG A;  4DXF A;  1YJ1 A;  1STE A;  1WGK A;  2L0T A;  2WU5 B;  4WJN A;  4M0W B;  2D2Q A;  1GC6 A;  1MHX A;  3DBR B;  2JWU A;  3P63 A;  1HA5 A;  3PS6 A;  2VH1 A;  3VTV A;  2KJH B;  3Q8F A;  2MBO A;  2L8J A;  2MBE A;  4PS3 A;  3RPF C;  4AWJ A;  2MBH A;  3AEB B;  2LGY A;  2M0X A;  1RFA A;  3R8B A;  4M02 A;  1J0G A;  4HWI B;  2FCM A;  1NI3 A;  4HCP B;  4YSX B;  2FIF A;  4P16 A;  4WWO A;  1F52 A;  2A5U A;  4ICV A;  1YOV B;  2JU6 X;  1ZUD 2;  5BYS A;  4EE2 A;  5EE3 A;  4GDL B;  3U7D A;  1WZ0 A;  4RH6 A;  3KW5 B;  4A3O A;  3M62 B;  2KAN A;  4MGY E;  4G0N B;  3AV8 A;  4C4V A;  1SF0 A;  4WUR A;  4WQO B;  4RM8 A;  4A9A A;  3SFE B;  3KVF B;  2PIA A;  1L6U A;  4C56 C;  2N0S B;  5D3D A;  2WXM A;  2C7N B;  3ZJV A;  4NPN A;  1VJK A;  3KUD B;  1TS4 A;  2C5L C;  1A70 A;  1AN8 A;  2VZK B;  1U4A A;  1P98 A;  5GMV A;  3WAO A;  2KKC A;  3TMP B;  3NZS A;  2PMV A;  5E6N A;  2Z0D B;  3X23 A;  3GZN I;  3LYY A;  1T0R C;  3PSE B;  1SE4 A;  3DHI C;  2O2V B;  2V1Y A;  3BVZ A;  3ZVV A;  1V1O A;  3DOW A;  1I7H A;  3DVG Y;  4KVG B;  2KVR A;  4KZ0 A;  1TS3 A;  5G5G A;  3OWE B;  4CHK A;  4AS1 A;  1N63 A;  2RD0 A;  1FM0 D;  5TSS A;  3H6N A;  2BYV E;  2DAJ A;  3Q8B A;  4KIK B;  2JT4 B;  2LEK A;  2MX2 A;  2W82 A;  1GC7 A;  3TUO A;  1GG3 A;  5EE1 A;  3LDZ E;  3DBS A;  4C00 A;  3NJT A;  1GUA B;  3PTF C;  3PZD A;  1HEZ E;  4TQ0 A;  4S0R A;  1UUP A;  4LJP B;  1OQQ A;  3GE8 C;  5HHD G;  1WJ4 A;  2MRP A;  2KX0 A;  1UGM A;  2Z0E B;  3AB5 A;  5EE0 A;  1QZE A;  1PYW D;  3DVN V;  2KAC A;  1EU4 A;  3VRB B;  3VRA B;  2LAS A;  2NBU A;  1T3Q A;  5E6O A;  1V5O A;  3RNB C;  3VVW B;  3MHZ A;  2GRI A;  3ZNH B;  1JCK B;  1MI0 A;  1T5X D;  1Q10 A;  2BS2 B;  3RUI B;  3UIO B;  4ZRP A;  1FPY A;  2ZVO A;  3SU8 X;  4KGS A;  2OJW A;  4GN1 A;  3MJ5 A;  2K9X A;  4KKI A;  3H9D A;  1KM7 A;  4ANX A;  5AZF A;  2DYM A;  1NEK B;  1XD3 B;  1X1M A;  2CKH B;  3VHT C;  2GBM A;  1FNV A;  2RDB C;  4ARC A;  3PO0 A;  2WXQ A;  2KWC A;  3BVG A;  4MH8 A;  4LNO A;  3UQB A;  1NVI D;  1V97 A;  2N9K A;  1V49 A;  3Q3O C;  4C4V B;  1I42 A;  2ZEQ A;  3ZDT A;  3Q3M C;  2WU2 B;  3CSF A;  1PGB A;  1VR9 A;  2JRI B;  2GBR A;  1WGG A;  1L5P A;  2AQ3 B;  4RMA A;  5FK9 C;  2WXH A;  1R7S A;  2N9X A;  2JVC A;  3KYD D;  1WGR A;  2WDR B;  3PRP B;  4BBN F;  2PKO A;  3P42 A;  1BXT A;  1CJE A;  2YLM A;  2AWT A;  1FMA D;  1L0V B;  3RD2 A;  1WWT A;  2M19 A;  2K22 A;  4DBG A;  2EKI A;  1P7F A;  1PGX A;  2NR2 A;  4ZDV A;  4KX6 B;  2CR5 A;  3GE3 C;  3U4E G;  1OTR B;  4XDD A;  2G4S A;  3KWV A;  2JXT A;  3B1L X;  3B2G A;  1RRB A;  5D3I B;  3L17 A;  1ZKH A;  2RGF A;  1I4X A;  3GOE A;  1R4M B;  2NBW B;  3GB1 A;  4XC2 A;  1I4P A;  3Q8E A;  4JIO U;  3TEZ A;  3U7Z A;  4PYU A;  4YSY B;  3AI5 A;  3DVN U;  3AE6 B;  1IPG A;  4YTP B;  4GMV A;  1TJE A;  3N1Z C;  3M3J A;  3QA8 A;  2KX3 A;  1D6E C;  1XCT L;  4A8X C;  4WAA A;  1YX5 B;  2Z8L A;  4B9K A;  2IO0 B;  2V3S A;  4N9F 4;  2QSD A;  3QJZ A;  3QCA A;  4K3C A;  1M4V A;  4F7Z A;  3BZD B;  1KOT A;  4TKN A;  4US9 A;  2MHJ A;  2KMM A;  4GU2 A;  1OFF A;  4C80 A;  3W5V B;  1DOX A;  3PHX B;  2K39 A;  4REZ A;  3C0R B;  3P4R B;  4OVZ A;  1TBE A;  2W3S A;  4TUU A;  2BPS A;  3VR9 B;  1E8X A;  2KDI A;  3D32 A;  2JYT A;  1KLG D;  4NJ6 A;  2WDT B;  4PS7 A;  1TZO A;  4IG7 B;  1XO3 A;  2PVO D;  1WI0 A;  1SE3 A;  3N32 A;  3MHS D;  4TQ1 A;  2J52 A;  2CHW A;  4RCO A;  1QT9 A;  2L32 A;  1WXV A;  3FC4 A;  4TSS A;  2DEN B;  2FUG 1;  3A4R A;  1WIA A;  1MG4 A;  3DDC B;  2VRR B;  3MFG A;  1HTQ A;  5KHO A;  1D5Z C;  5LNK 1;  2RPQ A;  4IM2 A;  3ZTC A;  4WJP A;  1FEH A;  1F2R C;  3DHH C;  4DDI D;  2KT7 A;  3W1S A;  2K6Q A;  2GLS A;  4GGQ A;  2KC2 A;  1JWB D;  2WXF A;  1C9F A;  1F2R I;  2IY1 B;  2ONQ A;  1L2N A;  1FFV A;  1EM7 A;  3TEY A;  2FCS A;  4FBJ B;  4XDC A;  2BYT A;  4ANV A;  4HPL B;  1PGA A;  3KH0 A;  4MDK E;  1QIL A;  2W54 A;  4MM3 A;  2KWD A;  1YQB A;  2MJE A;  3AUL A;  3VXW A;  3PZ7 A;  1N62 A;  4RGT A;  4ASW C;  1C4C A;  2WWZ A;  4NAM A;  4AUQ C;  1V81 A;  2KMA A;  1J7A A;  4JGH B;  4LNK A;  2IJ0 A;  3R7R A;  3SR6 A;  2FE8 A;  2J0M A;  1E7U A;  3ETR A;  5AUK A;  2BKR B;  2KHW B;  3Q14 C;  4LK0 M;  2JZZ A;  1R4N B;  3C8Y A;  4DHJ D;  1R4N I;  5G5H A;  4CO7 A;  2EMT A;  1NDD A;  2G1E A;  2LGI A;  2K5P A;  5IKC M;  2WXL A;  3DCG A;  3ZRC A;  2N1V A;  4N6E B;  5E6J A;  1UGJ A;  2MJD A;  4J3O D;  1XF5 L;  3QHT A;  4ZRQ A;  3QIJ A;  4L1B A;  2IND C;  4NY0 A;  4YSZ B;  2WXO A;  2TSS A;  2NTT A;  2G9H D;  2N7D A;  2PW9 A;  4US8 A;  1TY0 A;  1PFD A;  1V9J A;  2NMQ A;  1J19 A;  2W55 A;  3DBH I;  1DOY A;  4BBN C;  3IFW B;  3KUZ A;  1D4B A;  1JRU A;  2R61 A;  1RYJ A;  1FCL A;  3IT4 B;  4P1C C;  3CMM B;  3VDZ A;  4M00 A;  1FRD A;  4HJG E;  3CST A;  4NZL B;  4PT5 A;  2AL6 A;  2IO3 B;  1WSP A;  1IBX A;  3QAR A;  1V6E A;  1XLN A;  2JRH A;  1UH6 A;  3TL5 A;  1D3Z A;  1SJH D;  1YD8 U;  1I4Q A;  1D5M C;  1YIW A;  2XK5 A;  1UNS A;  1Q0W B;  2CJO A;  1EWY C;  3V62 A;  1C77 A;  3ML8 A;  4CYE A;  3L16 A;  2BQQ A;  3CIR B;  4DHZ B;  4EZK A;  3ZGZ A;  1FNW A;  2K0P A;  1TKE A;  1QKZ A;  1WJ6 A;  1KLV A;  3AED B;  2N1W A;  4A20 A;  4USA A;  2AL3 A;  4JPS A;  4WJQ A;  3PVL A;  2V4I B;  5HI1 A;  1SE9 A;  4OVU A;  2M0A A;  2XBB C;  2MP2 A;  2BS4 B;  3A9K B;  1RFK A;  2RR9 A;  4AJY B;  2WX0 A;  1IYF A;  1VZ6 A;  3RYT A;  4W9D A;  1MPE A;  2KAJ A;  1V2Y A;  1T0S C;  1N6Z A;  1E5W A;  2BGF A;  2L05 A;  4MM3 B;  3AE4 B;  1BT0 A;  2RPV A;  2GBN A;  4L2Y A;  3RCZ A;  4IC7 B;  1PQS A;  4JLC A;  2FNJ B;  3N1X C;  3VQI A;  3E56 A;  2V3P A;  2LVO A;  2Z59 B;  5BYR A;  4MGI E;  3U2S C;  3AM9 A;  3OJ4 B;  1TIF A;  2AX5 A;  1NYR A;  4GDK A;  4IWQ A;  4WQM A;  3V05 A;  2E3T A;  4K7U A;  2LD9 A;  3P2B A;  4QAY A;  3DBL I;  2D11 A;  1QQR A;  4HRS A;  1H4R A;  2HTM E;  2MA9 B;  4MAC A;  2LXA A;  1LM8 B;  3WCQ A;  2XEW A;  4A55 A;  4YL8 A;  2JYE A;  2ZW1 A;  1YN4 A;  1GB4 A;  1F1H A;  3AEE B;  2QC8 A;  2ASQ A;  4RGN A;  1WM3 A;  2WQY B;  1ZGU B;  4IDI A;  2UWQ A;  4LNF A;  1FD6 A;  1IUE A;  5KHQ A;  3FAH A;  1ROE A;  3NZ3 A;  1YJJ A;  3ZYY X;  4W9K A;  3APF A;  4KDI C;  1DGJ A;  1TKY A;  1TT5 B;  1WYW B;  5H8Y E;  4XE0 A;  2K25 A;  1XXG A;  4RGO S;  1C79 A;  3A9J B;  1WXQ A;  1GB1 A;  3U30 A;  4NJC A;  3H7S A;  3L13 A;  3A1Q A;  3JVZ X;  2ZPN A;  4DDG D;  2KQ4 X;  4UDU C;  4E71 A;  5BO4 B;  1IBX B;  2WYQ A;  3P4P B;  1QLB B;  1ZE3 D;  2MBQ A;  4KZC A;  1ZDV A;  2L52 A;  2MQJ A;  5JHA A;  2XK5 B;  4HCN B;  3RT3 B;  2REX A;  3GZN B;  4HKZ E;  2KFJ A;  3KWL A;  5FR6 A;  3H7P A;  2D3A A;  1WRI A;  2J7Q B;  1Z5S B;  3SFD B;  2KN4 A;  3ZNI D;  1FCC C;  4ZOH C;  3IBE A;  3ZLZ A;  3ML9 A;  3SEB A;  3NHE B;  3AU4 A;  4WWM A;  3Q3J A;  2QJL A;  3MP9 A;  2ZNV B;  1J8C A;  4AQ7 A;  2Y5C A;  3TBL D;  2DYB A;  4B0M A;  2KD0 A;  1WGD A;  1WR1 A;  2JXX A;  3IVF A;  4IOI E;  2MP2 B;  3P4Q B;  3P1M A;  2O6V D;  2PPH A;  5JZE B;  3AU5 A;  4OZB A;  2IPK D;  2IDY A;  3Q3N C;  5DPW A;  2INP E;  4FXC A;  5CHV C;  2KDF B;  1UBQ A;  1UBI A;  4IWP A;  3B2F A;  2LI5 A;  2WXJ A;  1P3Q U;  1RLF A;  2AQ1 B;  1L6V A;  3BYY B;  1GAQ B;  2J0K A;  4LNI A;  3WAP A;  3TCA A;  2PEA A;  4K81 A;  3VR8 B;  3AXC A;  4GOC A;  4TV3 A;  3KYC D;  1C78 A;  2LHE A;  1N60 A;  2NVU I;  3Q6B A;  4HXD A;  5G2N A;  3K9P B;  3HM3 A;  2KDE B;  4ZRJ A;  2V0G A;  3AE3 B;  2C7M B;  1JWA D;  3BK2 A;  3MC0 B;  4NNJ B;  1K53 A;  4DQO C;  5CX3 A;  1OGW A;  5IP4 D;  2H88 B;  4YTM B;  2YVC A;  1TKG A;  4FN2 A;  4I6N B;  1EF5 A;  4MH0 E;  3TSS A;  4WWN A;  1T0Q C;  3OAW A;  2JY6 A;  1S3S G;  1CMX B;  3UIP B;  2HE7 A;  1L0Y B;  2GBK A;  1JAL A;  1FFU A;  1K51 A;  5FKA C;  3PZ8 A;  1B1Z A;  2IGH A;  1JWU D;  4BAX A;  1FXA A;  2D3B A;  1CK1 A;  2LJ5 A;  2DNF A;  2MLB A;  2BT6 A;  1WYG A;  4BOS C;  1P1A A;  2LFI A;  5LXI B;  3IT6 B;  4MT5 A;  3NS1 A;  3RFZ B;  1ZXI A;  2C7H A;  3FIL A;  5IO9 A;  2WXR A;  2I1J A;  2WXK A;  1K50 A;  2K8C A;  4AJW A;  1XLO A;  2Q5W D;  5MPO A;  2AQ2 B;  1QOA A;  2D5G A;  3EEC A;  3A1Q B;  3IG3 A;  1ZDX A;  2JX5 A;  4NAW A;  2L7R A;  4FJV B;  1WXS A;  2N9P C;  1ISN A;  2C9W B;  4EZL A;  3NOB A;  2WX1 A;  3A33 B;  1KFY B;  4FJY A;  4B95 A;  1KRH A;  1ZW7 A;  3H7P B;  1V1P A;  2KQ7 A;  3I9V 1;  1WJU A;  1C4A A;  1F77 A;  2BS3 B;  2DLB A;  4MGZ E;  1J7C A;  1WY8 A;  4LTU A;  4W9E A;  2LZ6 A;  2HJ1 A;  3JW0 X;  4ZRI A;  5E6P A;  2LRW A;  2M1M A;  1V80 A;  1NBF C;  3VH3 B;  3L0W B;  4MEM A;  2IBI B;  5HFY A;  2EMS A;  2FID A;  3W1Y A;  3AE2 B;  2KQS A;  2WS3 B;  1JWM D;  5J2R A;  3VFK A;  1RWS A;  1RM6 C;  4MEL A;  4RF0 A;  5TR5 A;  1YN3 A;  3NRZ A;  1HTO A;  3BII D;  3ZKJ C;  2MH7 A;  3WIM A;  4I6L B;  1WZ3 A;  3ZTD A;  1EWC A;  2GOW A;  3M63 B;  5JXV A;  2Y5P A;  1A5R A;  1BUI C;  2ZW0 A;  2UYZ B;  3AEA B;  5IN7 A;  2KJR A;  3CF6 E;  2LMC A;  4OVV A;  2WP9 B;  2LXC A;  1GJZ A;  3R7Q A;  3R2I A;  2BBC A;  2BKF A;  2HTH A;  4S17 A;  3RNF C;  1KH0 A;  1EO6 A;  1ZOY B;  1WGH A;  2KNB A;  1OEY A;  3UI3 A;  4RNA A;  1TTN A;  3ENE A;  2N9L A;  1YMH E;  2KMC A;  3PPA A;  1E8Z A;  1SGH A;  3PRE A;  2NCN A;  3W2D A;  4HKQ A;  4TMA B;  3FIL B;  4HPP A;  1HXY D;  2R2Q A;  5D7G A;  2BVC A;  3LJ3 A;  4G3X B;  4DHZ E;  1E10 A;  3FKY A;  1EUV B;  3JSV A;  3B9J A;  3PLU A;  1PDX A;  2I1K A;  2LRU A;  3RNC C;  3AE1 B;  4HPM B;  4HDQ A;  1C4P A;  3NUH B;  1KJT A;  2J42 A;  1I4R A;  2QEJ C;  2ZPY A;  4P6V F;  1JRP A;  3ZUN A;  2MSE D;  4XYC A;  1VZ8 A;  1V1P B;  5L95 C;  2WDQ B;  4LLG M;  3AE7 B;  3TEW A;  2H89 B;  4A3P A;  2W9N A;  3UGB B;  4E74 A;  4BFR A;  3QAQ A;  1I4G A;  3M95 A;  4BVU C;  4KDL B;  1JQ4 A;  4I6P A; 
#chains in the Genus database with same CATH homology
 2RPV A;  4IKG A;  1HEZ E;  4TQ0 A;  1XCQ L;  4KGR A;  4L2Y A;  1UUP A;  3T3N A;  4D2K A;  2ICI A;  1OQQ A;  3VQI A;  5HHD G;  3E56 A;  2V3P A;  3LB8 C;  4C7Y A;  3H8H A;  4JE3 B;  5BYR A;  3U2S C;  3AM9 A;  3AB5 A;  5EE0 A;  2AX5 A;  1NYR A;  1PYW D;  4WQM A;  3V05 A;  1KTK A;  2KAC A;  2E3T A;  1EU4 A;  3VRB B;  3VRA B;  1T3Q A;  3GS2 A;  1N5X A;  3IAM 1;  5FR3 A;  3MHZ A;  1QQR A;  2GRI A;  4HRS A;  2HTM E;  4MAC A;  1JCK B;  5BYQ A;  4YXD B;  3WCQ A;  1MI0 A;  1T5X D;  1Q10 A;  2BS2 B;  3AE8 B;  4A6Q A;  4A55 A;  1E6E B;  2JYE A;  2ZW1 A;  3W5U B;  1YN4 A;  2DBY A;  1ZPS A;  4ZRP A;  4KGS A;  1GB4 A;  3EUB 2;  1VLB A;  3MJ5 A;  2K9X A;  3AEE B;  4KKI A;  4RGN A;  5C3J B;  4O1N A;  2DYM A;  2WQY B;  1NEK B;  4IDI A;  1K52 A;  4N58 A;  1FD6 A;  1IUE A;  3FAH A;  1XLQ A;  1ROE A;  2MEK A;  3NZ3 A;  1YJJ A;  3ZYY X;  1LO5 D;  1DGJ A;  1FNV A;  1TKY A;  3P4S B;  5H8Y E;  4ARC A;  2WXP A;  3PO0 A;  4XE0 A;  1XLP A;  2WXQ A;  3BVG A;  4MH8 A;  1XXG A;  4RGO S;  1C79 A;  1NVI D;  2XN9 C;  1WXQ A;  1GB1 A;  1V97 A;  2N9K A;  4NJC A;  4XWW A;  3L4P A;  3CWI A;  2KQ4 X;  4UDU C;  4H2A A;  2DYO A;  1IBX B;  1UWX A;  2WU2 B;  2LUM A;  3P4P B;  4NAW B;  2VZK D;  1AWD A;  1QLB B;  1ZE3 D;  2GB1 A;  1ZDV A;  2L52 A;  2OED A;  1NYQ A;  1PGB A;  1VR9 A;  2INN E;  3BYT B;  4HKZ E;  5T8I A;  2M56 B;  2LJI A;  4JWU C;  2IGD A;  1L5P A;  2AQ3 B;  3KWL A;  1SXT A;  5FK9 C;  2RDH A;  1WRI A;  1R7S A;  2WXH A;  3KLS X;  3SFD B;  2KN4 A;  3NVV A;  1FCC C;  3AMZ A;  3Q8A A;  4ZOH C;  4ZHO A;  3ZJU A;  1NEN B;  2EEL A;  2PVG C;  3HVZ A;  3SEB A;  2DWQ A;  3KQ4 A;  2WDR B;  4YT0 B;  3AE5 B;  3BVM A;  2PKO A;  3P42 A;  1VDV A;  2FBW B;  1BXT A;  4WWM A;  1CJE A;  2YEP F;  3AE9 B;  2BTE A;  1SJE D;  2LHD A;  2ACZ B;  2QJL A;  3MP9 A;  4AQ7 A;  2Y5C A;  4YTN B;  5HG2 A;  4B0M A;  1FMA D;  4HEA 1;  1L0V B;  4RGM A;  1TS2 A;  1WWT A;  2M19 A;  3GP7 A;  2CU3 A;  2K22 A;  2EKI A;  4IOI E;  1QOG A;  3P4Q B;  1P7F A;  1YQ4 B;  3P1M A;  1PGX A;  3AEG B;  4N59 A;  4KX6 B;  4OZB A;  3O13 A;  2MJ3 A;  2SEB D;  2IPK D;  3HUI A;  2IDY A;  2QIL A;  3U4E G;  2JZP A;  1DYQ A;  4XDD A;  3TEX A;  1MHH E;  3KWV A;  2BB6 A;  2INP E;  1TY2 A;  4FXC A;  2JXT A;  3B2G A;  5D3I B;  3T3O A;  3IXS A;  3B2F A;  1I4X A;  3U52 E;  2WXJ A;  2XNA C;  4M0W A;  3GB1 A;  1QOF A;  2AQ1 B;  1BML C;  5AUI A;  2QIE B;  1FXI A;  1L6V A;  2K3U A;  3BYY B;  2JQR B;  1GAQ B;  2RMM A;  1I4P A;  3Q8E A;  2BW2 A;  1VZ7 A;  3VR8 B;  3BK1 A;  2GI9 A;  3TEZ A;  3N9Y C;  3U7Z A;  1E7P B;  1C78 A;  2LHE A;  1CZP A;  4YSY B;  1N60 A;  2W3R A;  3AE6 B;  1HZ5 A;  4YTP B;  2V0G A;  1TJE A;  3AE3 B;  1JWA D;  3BK2 A;  3MC0 B;  2J53 A;  1K53 A;  4DQO C;  1N61 A;  1GOZ A;  4DXG A;  2H88 B;  1D6E C;  1XCT L;  4YTM B;  4A8X C;  1QF6 A;  4YWG G;  1TKG A;  2Z8L A;  2I2Y A;  1JRO A;  2QSD A;  2SAK A;  3TSS A;  4ARI A;  1E0Z A;  1M4V A;  3ABV B;  4Q2J A;  1L4Z B;  1L0Y B;  3BZD B;  4US9 A;  1JAL A;  1FFU A;  4R3D A;  1K51 A;  2KMM A;  2QMT A;  2YEP B;  1TS5 A;  1B1Z A;  1OFF A;  3PZ8 A;  5FKA C;  2CJN A;  2IGH A;  3W5V B;  3DWG C;  4C80 A;  1F0Z A;  1DOX A;  1JWU D;  2WNM A;  1DOI A;  1OQR A;  1FXA A;  1IGD A;  1C76 A;  3EGR A;  4L23 A;  1CK1 A;  2IGG A;  4REZ A;  2V3N A;  2NTS A;  3LXF A;  3P4R B;  2BT6 A;  1WYG A;  4OVZ A;  2LFI A;  2W3S A;  3AH7 A;  3IT6 B;  4MT5 A;  1GPX A;  1HQR D;  2PTL A;  3NS1 A;  3NVW A;  1ZXI A;  3VR9 B;  3RFZ B;  3FIL A;  4OHJ A;  2WXR A;  3IAS 1;  4WAF A;  2WXK A;  2JYT A;  1KLG D;  1N5W A;  1YJI A;  1K50 A;  3E9S A;  1TZO A;  2OHF A;  1J7B A;  1XO3 A;  3NVZ A;  1FRR A;  1XLO A;  2Q5W D;  5MPO A;  2AQ2 B;  2PVO D;  5C2T B;  1QOA A;  2D5G A;  1SE3 A;  4TQ1 A;  1UWM A;  2RDG A;  2J52 A;  1TYG B;  1JML A;  4RCO A;  5GXG B;  1QT9 A;  1ZDX A;  2L32 A;  2JX5 A;  3FC4 A;  4TSS A;  2Y3A A;  4ITK A;  1VRA B;  2X38 A;  5EE9 A;  1SE2 A;  3AEC B;  2FUG 1;  1SIJ A;  1CQV A;  3EA6 A;  5BMI A;  4A90 A;  3MFG A;  1D5Z C;  5LNK 1;  1KFY B;  1P7E A;  4CQN A;  2WXG A;  1KRH A;  3HVD A;  1T6B X;  1FEH A;  1F2R C;  1V1P A;  1FO4 A;  3W1S A;  4XWT A;  1KLU D;  3I9V 1;  1JWB D;  2WXF A;  1V8C A;  1C4A A;  1F77 A;  1SBB B;  1C9F A;  2BS3 B;  1B9R A;  1F2R I;  2ONQ A;  3BWU D;  1FFV A;  1EM7 A;  2HDE A;  1L4D B;  2DLB A;  3TEY A;  2BYT A;  4XDC A;  1JWS D;  1J7C A;  4LTU A;  4RFB A;  1PGA A;  1L0X B;  5BMH A;  5I4D A;  3R2T A;  1ACC A;  1FNU A;  1QIL A;  3NVY A;  2W54 A;  1FIQ A;  1JW9 D;  2KWD A;  2MJE A;  1ET9 A;  1N62 A;  3PZ7 A;  1ZXH A;  2L1A A;  4RGT A;  1C4C A;  3DWM A;  2WLB A;  2L83 A;  4NAM A;  5HFY A;  2BB5 A;  5BMG A;  4DXF A;  1J7A A;  2KDM A;  2IJ0 A;  3SR6 A;  1Y56 A;  1STE A;  1WGK A;  2WU5 B;  3AE2 B;  2FE8 A;  3ETR A;  5AUK A;  5H92 C;  4ZYS A;  3HRD D;  2WS3 B;  4LK0 M;  1JWM D;  1MHX A;  3C8Y A;  4KKJ A;  2JWU A;  1RWS A;  1RM6 C;  3P63 A;  4GDK B;  1HA5 A;  4RF0 A;  5G5H A;  1YN3 A;  3ZQ4 A;  2E6X A;  3NRZ A;  2WDV B;  2G1E A;  2PLP A;  2LGI A;  3Q8F A;  2K5P A;  2WXN A;  2JSV X;  1ESF A;  1I4H A;  2WXL A;  3BII D;  2MH7 A;  3RPF C;  4N6E B;  3AEB B;  5E6J A;  1UGJ A;  2MJD A;  4J3O D;  1EWC A;  4WH4 A;  4JWS C;  1XF5 L;  3AN1 A;  3R8B A;  5JXV A;  2Y5P A;  4ZRQ A;  1NI3 A;  4YSX B;  1E9M A;  4L1B A;  1BUI C;  2ZW0 A;  4YSZ B;  4P16 A;  2WXO A;  3AEA B;  2TSS A;  4C7Z A;  1KF6 B;  2NTT A;  4OW0 A;  1QOB A;  2G9H D;  1HZ6 A;  2LMC A;  2PW9 A;  2WP9 B;  4US8 A;  2JU6 X;  1TY0 A;  1PFD A;  1SEB D;  3R2I A;  4B0E A;  2NMQ A;  1XEE A;  1ZUD 2;  2W55 A;  5BYS A;  4OZC A;  4EE2 A;  2BBC A;  1DOY A;  5EE3 A;  4GDL B;  1KH0 A;  1ZOY B;  4RH6 A;  1D4B A;  2R61 A;  1RYJ A;  1FCL A;  3IT4 B;  3UI3 A;  4RNA A;  2N9L A;  1ENF A;  3ZJT A;  1D5X C;  1YMH E;  4RF1 A;  1FRD A;  2ON8 A;  3AV8 A;  4HJG E;  4NZL B;  4PT5 A;  1SF0 A;  4WUR A;  4JX1 C;  2WXI A;  3W2D A;  4A9A A;  3SFE B;  3W9C B;  4HKQ A;  2J4X A;  2PIA A;  4TMA B;  1WSP A;  1L6U A;  3FIL B;  4C56 C;  1IBX A;  2N0S B;  5D3D A;  2WXM A;  4GLS C;  1MVK A;  1XLN A;  1SJH D;  1HXY D;  3ZJV A;  1VJK A;  1I4Q A;  1SB3 C;  1D5M C;  1TS4 A;  3Q8C A;  5D7G A;  1UNS A;  1E10 A;  2CJO A;  1EWY C;  3URY A;  1A70 A;  1AN8 A;  2VZK B;  1C77 A;  2N7J A;  1ZP0 B;  1IGC A;  4WIP A;  3CIR B;  3B9J A;  3ZGZ A;  1AYF A;  1PDX A;  2PMV A;  1FNW A;  2K0P A;  1TKE A;  1YN5 A;  1QKZ A;  3AE1 B;  3I57 A;  3AED B;  1C4P A;  4USA A;  3NUH B;  3V3X A;  2J42 A;  1AW7 A;  3LYY A;  4JPS A;  1I4R A;  2QEJ C;  3AEF B;  2V4I B;  1SE4 A;  4P6V F;  1JRP A;  3BVZ A;  5HI1 A;  1V1O A;  4OZA A;  1I7H A;  3J9C A;  1VZ8 A;  2M0A A;  1ET6 A;  1V1P B;  1TS3 A;  4HRO A;  5G5G A;  3OWE B;  2BS4 B;  4AS1 A;  1N63 A;  1YNT E;  1RFK A;  1FM0 D;  2B76 B;  2WDQ B;  5TSS A;  3Q69 A;  4LLG M;  3AE7 B;  1PUT A;  3TEW A;  2H89 B;  2I38 A;  3Q8B A;  1VZ6 A;  1MPE A;  2LEK A;  2KAJ A;  2W82 A;  1SSN A;  3TUO A;  4ZHP A;  5EE1 A;  4KGT A;  1I4G A;  1EU3 A;  4MM3 B;  1YQ3 B;  1JQ4 A;  3AE4 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...