2DAFA

Solution structure of the novel identified ubiquitin-like domain in the human hypothetical protein flj35834
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords FLJ35834 protein
publication title Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human Hypothetical Protein FLJ35834
rcsb
source organism Homo sapiens
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dafA01
2K25A 3QHTA 4YL8A 4P7IA 3VVWB 2Y5BB 3QIJA 3PHWB 2KLGA 1OQYA 3UIOB 3ZUNA 1MG8A 2D11A 4KVGB 2JUOA 2W9NA 4A3PA 4FJZA 5DCNA 1ZW7A 2DYOA 4W9HA 4AUQC 1UELA 4EFOA 3PS6A 3TBLD 2N9XA 4I6LB 2DZMA 4DHJD 5G2NA 1EF5A 2AWTA 3ALBA 4ICVA 3M95A 2RR9A 4FHKA 2M4NA 3DQVA 3JSVA 2KTRA 3DCGA 4NAWB 2MA9B 3NZUA 4KV2A 2JRIB 5AZGA 3UQBA 2LVQA 1RLFA 2J0MA 2JVCA 1WZ3A 5CTRC 1KJTA 3ZDMC 2ZVOA 1LM8B 1P1AA 4DHZE 1UH6A 1Q1OA 4EZLA 3A4SC 3HM6X 3QA8A 3QX1A 3A9KB 2L8JA 4PS3A 3ZTCA 3S2AA 1NI2A 3ECIA 4ZRJA 2EMTA 3RCZA 4IW0A 3IFWB 1OGWA 3A9JB 1V6EA 3H7SA 2KLCA 4ANUA 3MHSD 3NS8A 2MBHA 1UZXB 1SE9A 2IO2B 4MSQB 4HVBA 3C0RB 4MH0E 2CHWA 2KANA 4B9KA 1C3TA 4MGKE 2NBVB 1OTRB 2GBKA 1V49A 3ENEA 1QZEA 2C7HA 2DYBA 1RRBA 1TGZB 3TIXA 1WGYA 2Z0EB 3ZVVA 4BKSD 3V60A 3B1LX 2N1VA 2BYVE 5CHFA 1WJNA 3O65B 4FLHA 4WWOA 4KZCA 2C5LC 2PE6B 4JGHB 1WYWB 2KN5A 4BKSA 1UBIA 2LXCA 2IO3B 2KWUB 3WIMA 5AEKB 4BKGA 1WR1A 2LJ5A 3X23A 2N7DA 2KQSA 3PTFC 2MP2B 2MBBB 3ZTDA 2GBJA 4IWPA 4RM9A 3WAMA 3DBRI 4W9CA 2C7MB 4GDKA 2LI5A 3SD5A 4J6IA 5D94A 3K9OB 4AJYB 2RGFA 4G0NB 2L3ZA 1WFYA 1LFDA 1Y8RC 3HK0A 1WE7A 2JXXA 5IAAC 3RYTA 3UIPB 1E7VA 4FULA 1P3QU 3PLVA 2O6VB 3WAPA 4LDTB 2CR5A 1VCBA 5HKHA 1P9DU 2DAJA 4ANXA 3B08A 4DDGD 5DPWA 2AL6A 3HHMA 4HCPB 4EZJA 3EC8A 3LDZE 4NY0A 4TUUA 2GOWA 4IWOA 4NQKE 2J7QB 2LASA 2A4ZA 2XK5B 2N9PC 4AP4C 1UGMA 4HWIB 4I6PA 1OEYA 1XD3B 1R4NI 3A1QA 2WDTB 5AZHA 1WX7A 2QHOA 1LQBA 2NPTB 1EUVB 2R2OA 4AWJA 5C23A 2DYMA 3QJZA 4KIKB 2CU1A 5D6JB 3QARA 2HJ8A 3R7QA 4PYZA 2M8SA 5BO4B 3CSFA 4GDLA 2V3SA 2NR2A 2DZJA 4MEMA 2IYDB 2MLBA 3AXCA 4ICUA 3WA0A 3DOWA 2AL3A 2G4DB 1UD7A 3N3KB 2PJHA 4JIOU 5JZEB 2BWES 1KLVA 2KWCA 4MELA 4ZYNA 3SHQA 3PSEB 2I1KA 1WXSA 3KVFB 1H8CA 2KKCA 2KFKB 4GU2A 2KQ7A 5E6PA 5KHOA 5CX3A 2JZZA 4BFRA 3T8MA 1I42A 1WXVA 2LGDA 2IZVB 2PE9A 4W9LA 2JRHA 3A33B 3R7RA 2ZCCA 1WZ0A 4LJPB 3PRPB 4FADA 2KC1A 5FR6A 3L17A 1WRDB 1WGDA 3PT2B 3ZNGC 4XC2A 4ASWC 1I35A 1KOTA 5KHQA 2IO1B 3VTVA 4GIVA 1TTNA 2ZZPB 1ZKHA 2KTFA 3RT3B 2DAFA 3VTWA 5LLIA 2DENB 3H7PB 4WWNA 3H9DA 2K1FA 4NAWA 3OJ3A 3EFUA 3U8ZA 3VUXA 3QAQA 4NQLB 4EEWA 5C1ZA 4EZKA 3PGEA 1V86A 1S3SG 1C1YB 1YQBA 2FCNA 1YD8U 2OJRA 3R3MA 4JQWC 2CHZA 2N1WA 3K9PB 1IP9A 2KOXA 2LXAA 4LCDE 2FAZA 2ZPYA 4KDLB 3JVZX 2KD0A 1WM3A 3ONSA 3A9JA 1WXMA 4HDOA 3HIZA 1UBQA 3VHTC 1NDDA 3A4RA 4FHJA 2FCQA 2MBOA 1XT9B 2ZVNA 2KXJA 3IG3A 3PREA 4GB9A 2DX5B 3VUYA 4F7ZA 3N30A 3CMMB 4PYUA 2JZ3B 3DVGY 3NOBA 4IM3A 2C60A 2LGYA 4DBGA 4MGYE 2RSUA 1IPGA 3KH0A 4W9IA 4G50A 3VDZA 4EKUA 3PRZA 2FNJB 2C7NB 1GC7A 1YX6B 2O2VA 4E71A 2KX3A 2WX0A 1WGRA 2XEWA 3TMPB 1V80A 2A5UA 4B95A 4BKTA 4URKA 1Q0WB 2J0JA 3ZNHB 1A5RA 3JSVB 1WE6A 3NY5A 2KTRB 2LWPA 4NNJB 4DHJB 3AI5A 3UQAA 2D10A 2BPSA 3MTNB 3QWZB 1E8WA 2KK8A 3OJ4B 3IHPC 4GXBA 4LDTD 2PPHA 1WMHA 4IWQA 4ZDVA 2LD9A 3JW0X 4W9JA 3I3TB 4IUMB 4CO7A 1Z2MA 2JWZA 3T9LA 1E5WA 2N4FA 5GMVA 1OEYJ 2MBEA 4AOFA 4CHKA 3ZRFA 4IG7B 2Z59B 3KUCB 3V62A 4HPMB 2HD5B 2VRRB 1TBEA 3JYUA 5LXIB 2NS5A 3SDLC 5JHBA 2GBNA 1J0GA 2LVOA 2MBQA 4TQ1A 4BBNC 1GG3A 3W1SA 2GBRA 5J18A 3QQ8B 4WQOB 4NJ7A 1K8RB 2L05A 4WWPA 3VAWA 2DZKA 1E8YA 4G3XB 3M3JA 2KX0A 3APDA 1P98A 2HE7A 2YVCA 3DVNU 4MSMB 3B0AA 4TKNA 4W9GA 4MJSB 2DHZA 2C9WB 2KDIA 5D7GA 5E6OA 3DBLI 3KYDD 4LJOB 2OOBB 1JRUA 3R66C 2MQJA 4XX5A 1XQQA 3D32A 3LJ3A 3ZDTA 2ASQA 3BINA 4W9FA 3X0WA 4PS7A 4MDKE 4PS8A 2AYOB 1T0YA 4GGQA 3OAWA 2R2QA 3M62B 2BWFA 3GOEA 2LUEA 1EO6A 2WWZA 3VUWA 2N9EB 4KZ0A 1D3ZA 3Q3JA 2FIFA 2L00B 3VH3B 2NBUA 4IM0A 3VTUA 2LRWA 3TJPA 3UGBB 3V6EB 1WGHA 2G3QB 4DDID 5JHAA 2NVUI 1V81A 1E7UA 1WIAA 1ZGUB 4IC7B 4K7SA 4DXAB 4MGZE 4WJPA 3H6NA 3ZNZB 3CF6E 2K6QA 3W1YA 4DK5A 3IBEA 3RD2A 3RZFA 4BVUC 3A1QB 1WY8A 2KDFB 2MWSB 2IY0B 4G11A 3TCAA 1WH3A 1FXTB 2KC2A 1CMXB 3RZWC 4B6WA 2WYQA 1YX5B 2CHXA 2GBMA 4CYEA 2XBBC 2UWQA 3KW5B 2MW5A 3L54A 4KSKC 2GMIC 4GDLB 4TV3A 3SU8X 4E3CA 2M0XA 5IA7A 4WJOA 3APCA 2K6DB 3MJWA 1V9JA 3VQIA 4M8MA 4F1SA 4AJWA 4ZRIA 3VFKA 3EHVA 4JL9A 1GUAB 4ANWA 4HPLB 2LVPA 1WX8A 2BF8B 4M0WB 2FCSA 5D2MB 3PHXB 2KJHB 3A9KA 2G45B 2IBIB 1AARA 5J2RA 3PPAA 4A3OA 3RUIB 3HM3A 4I6NB 2D3GA 1PQSA 4II2B 1G6JA 2V1YA 1V5OA 3DBHI 3DVNV 4FN2A 2JPHA 4ANVA 5L95C 2IY1B 3H1UA 2NCNA 3ML9A 1L2NA 4EOYA 4BBNF 4RM8A 2LGXA 3PLUA 5DPSA 2MX2A 4XZ4A 5G55A 2J0KA 4HLEA 1WXAA 3PVLA 1X1MA 4HJKA 1F9JA 2ZJDA 2N7EA 2K8HA 2M17A 4X57B 2KDEB 3PRMB 4II3B 1WJUA 4K81A 2MCNB 4W9KA 3APFA 2LRUA 2K8CA 1EF1A 2CS4A 2MP2A 2MRPA 2FIDA 5CHVC 2KDBA 5JH5C 1V5TA 3CSTA 4GMVA 3UINB 4W9DA 2AEHA 4FBJB 2KZRA 2BYEA 4HXDA 4K7UA 3TL5A 1RFAA 4KDIC 2O6VD 1GJZA 3GZNI 3BY4B 5L83A 1E8XA 1Z5SB 2HTHA 4WJNA 2O6VA 1E8ZA 4ZRKA 3AULA 4K1RB 1M94A 3PZDA 1KM7A 4WAAA 3ZRCA 1L7YA 2PEAA 3U7DA 5E6NA 3KUDB 1SGHA 5TR5A 3AU4A 2B3AA 1WF9A 2BKRB 2KVRA 2RD0A 4HCNB 2O2VB 4E74A 3Q3FA 4FJYA 4JLCA 2XK5A 2KFJA 2ZPNA 5EDSA 3AU5A 4M8NA 3IVFA 3L13A 2EMSA 4MJSA 1P0RA 2FUHB 3DPDA 1J8CA 2G4SA 4A20A 3UF8A 1RAXA 2D07B 2M1MA 3DVGX 2ZEQA 3P2BA 5LXHA 2L76A 2NPTA 4GOCA 2ZNVC 3V61A 3L10B 2KWVB 2YLMA 4KIKA 2FCMA 2REXA 4DWFA 3DBSA 3VXWA 2DZIA 2KHWB 3PV1A 1WMHB 1WX9A 1SIFA 3QCAA 3QC8B 3W1SC 3EECA 1TZ1A 4GDKB 1YJ1A 3VH4B 1ISNA 2KMCA 4HDQA 4GSWA 4BOSC 1J19A 2BGFA 3L16A 2D2QA 2LZ6A 2ZCBA 1WGGA 4FJVB 1BT0A 1GNUA 2MSED 2ZNVB 4FA6A 3ZLZA 4N9F4 2KFKA 4W9EA 4TQ0A 4F8CB 4KSLC 2UYZB 2IO0B 5AZFA 1WJ6A 3ZIMA 4EUTA 4OVVA 3M63B 1H4RA 3ZO5B 4NJ6A 2BKFA 1VD2A 4WJQA 3ZW3A 4BOZB 2JT4B 3RULA 1YIWA 2KO3A 1R4MI 2K8BA 2V4LA 1NBFC 2JY6A 1GC6A 1S1QB 2EKEC 3U30A 1WJ4A 2RPQA 5J17A 1IYFA 2CKHB 3ZNID 2NBWB 4K7WA 3H7PA 3NHEB 4NPNA 3KYCD 3ZKJC 4IM2A 4OVUA 1Q5WB 4HK2A 4GN1A 3L08A 3WANA 3KUZA 2L0TA 4DHZB 1V2YA 3L0WB 3WALA 3N32A 1WI0A 3NZSA 5DPTA 1HE8A 5DPRA 2L0FA 3DDCB 5CHWA 2KNBA 1U4AA 3V6CB 1E90A 2KJRA 4MM3A 1LXDA 3OLMD 2KMAA 3ML8A 3WAOA 2JF5A 4RMAA 4MGIE 3QK0A 2K39A 2L7RA 1WM2A 2BYFA 1WR6E 2I1JA 2KJ6A 2Z0DB 2WX1A
chains in the Genus database with same CATH superfamily
2KLGA 3ZUNA 1BUIC 3N1ZC 4YTPB 2KMMA 2JUOA 2W9NA 5DCNA 2GRIA 4W9HA 1UELA 4EFOA 4ICVA 2RR9A 4XGAB 2JWUA 4KV2A 3UQBA 2LVQA 2V3NA 2INNE 3A9KB 4PS3A 4ZRJA 3RCZA 3A9JB 1V6EA 1J8CA 2CJNA 3NS8A 4HVBA 1TS3A 2CHWA 2KANA 2OJWA 4B9KA 4MGKE 1OTRB 2GBKA 1TGZB 4C56C 2Z0EB 3SEBA 4BKSD 1ET9A 2N1VA 5CHFA 1TKEA 3AE7B 4YWGG 4JGHB 4BKSA 1RM6C 1ZXIA 4C80A 4BKGA 2QSDA 3PTFC 2D3BA 3Q14C 1FM0D 1N62A 2C7MB 4GDKA 5D94A 1MPEA 1TKGA 1TZOA 2K3UA 1Y8RC 2L3ZA 2KT7A 1FIQA 5AUIA 1HEZE 3WCQA 2PLPA 5IO9A 5IAAC 2M19A 4FULA 1P3QU 3PLVA 1EU3A 2RMMA 3WAPA 1VCBA 3NZ3A 2DAJA 2MJDA 1YQ4B 1HTQA 2VH2A 2OEDA 2PKOA 2LASA 2XK5B 3FILA 1R4NB 1STEA 2D3CA 4YXDB 2QHOA 1LQBA 1EUVB 4ZHOA 5C23A 3QJZA 3QARA 3R7QA 4KGTA 5BO4B 1D5MC 4GDLA 2V3SA 1WXQA 2DZJA 3AXCA 2G4DB 4UDUC 1UD7A 2PJHA 2BWES 1T0QC 2KWCA 3KVFB 2KKCA 5KHOA 1GB4A 3PZ8A 1V8CA 1FPYA 1FNVA 3T8MA 3AEBB 2Y5PA 3Q8CA 2DWQA 1TIFA 3A33B 4OHJA 1C78A 2ICIA 5FR6A 1IUEA 1WRDB 1WGDA 3PT2B 1KOTA 1L0VB 1KH0A 1TTNA 1ZKHA 1V1PA 3RT3B 2DAFA 3VTWA 2DENB 3H7PB 3H9DA 2L32A 3EFUA 3VUXA 5C1ZA 4NQLB 4EEWA 2PVOD 1S3SG 2OJRA 2KAJA 4KDLB 2INDC 3AH7A 2J52A 3A9JA 1WXMA 2B76B 1NDDA 1JW9D 4GB9A 1UWMA 5GXGB 1L0XB 4GLSC 3KH0A 3GP7A 1QOBA 2JXTA 2J4XA 3BYYB 3AECB 3TMPB 3GB1A 3KQ4A 1EM7A 3MC8A 1WE6A 4DHJB 1SF0A 2D10A 1E8WA 2KK8A 3IHPC 3LXFA 3Q69A 3LYYA 2LD9A 4OW0A 4W9JA 3OG5A 2JWZA 1OEYJ 2MBEA 4ZYSA 1VJKA 3KUCB 1TBEA 3BVMA 2LVOA 1QF6A 1GG3A 3P4QB 5J18A 3C8YA 4LNIA 3QQ8B 1K8RB 2DZKA 2M0AA 1E8YA 3AEFB 2HE7A 3DVNU 4MSMB 3Q8FA 4TKNA 4MJSB 1FFUA 2DHZA 2WLBA 1C4AA 3B2FA 3KYDD 2OOBB 1JRUA 2BTEA 2MQJA 1C77A 1T0RC 3D32A 3H8HA 4L23A 4PS8A 3M62B 2KACA 2WWZA 1D3ZA 3Q3JA 4OZAA 4YTNB 3V3XA 5HI1A 1UUPA 4IC7B 1ZGUB 4DXAB 3H6NA 2BT6A 1WY8A 2MWSB 1I4GA 3NS1A 3TCAA 1FXTB 2KC2A 1CMXB 3RZWC 2QJLA 4B6WA 4C7YA 2GBMA 4CYEA 2UWQA 3KW5B 3SU8X 2GMIC 1V9JA 4TMAB 3VQIA 4F1SA 3VFKA 2CU3A 3RMKC 1K53A 1WX8A 2BF8B 2FCSA 5D2MB 1F2RI 3PHXB 2IBIB 2RDBC 3PPAA 3ZYYX 2D3GA 1G6JA 3RNGC 2V1YA 3DBHI 1N61A 2NCNA 1L2NA 1IGDA 1EU4A 3PLUA 3W5VB 3TEZA 1D4BA 5G55A 1VDVA 3PVLA 4MH8A 2M17A 1N63A 4X57B 4II3B 1WJUA 2G9HD 4W9KA 3APFA 1MG4A 1EF1A 2WXJA 3ZJTA 2PMVA 5CHVC 3U4EG 2KDBA 3CSTA 2BS3B 2KZRA 4FBJB 2KVZA 2O6VD 2N9LA 2JX5A 3BY4B 5I4DA 1Z5SB 2O6VA 2WXRA 4K1RB 3ZRCA 1JROA 1MVKA 2PEAA 5E6NA 2WXKA 1GOZA 4HCNB 2KVRA 2O2VB 3GS2A 5EDSA 2QC8A 1AW7A 3AU5A 3IVFA 3N20C 4MJSA 4XDCA 1ET6A 3DPDA 2PIAA 3SFDB 3NVZA 3EGRA 2L76A 2NPTA 1IBXA 1I4HA 1SXTA 2UU7A 3MHZA 3QC8B 5T8IA 1YJ1A 3ZGZA 4PT5A 4GSWA 2JQRB 2D2QA 2ZCBA 4KKJA 1XXGA 1BT0A 1GNUA 4FA6A 3ZLZA 4N9F4 2KFKA 4TQ0A 4KSLC 2UYZB 2IO0B 5AZFA 4M01A 4BZAA 4S17A 1VD2A 2J53A 3ZW3A 1SJHD 2KO3A 2ZW0A 5FR3A 2WXPA 3P4PB 4BAXA 1OFFA 2LJIA 2BYTA 4K7WA 2GLSA 3NHEB 4IM2A 5HHDG 2I38A 4IDIA 3WALA 3N32A 2BS4B 2WXMA 1I4PA 3TSSA 1U4AA 4A6QA 1GPXA 5TSSA 4MM3A 2WDRB 2LHEA 3MFGA 2QCZA 2INCC 3QK0A 2K39A 1C79A 1V1OA 2K25A 3QIJA 4JPSA 3UIOB 5FKAC 4KVGB 1QOAA 2PVGC 4C4VA 1A70A 3B2GA 1FFVA 4AUQC 2MHJA 3PS6A 2N9XA 5G2NA 1EF5A 2RDHA 2LEKA 2WQYB 2M4NA 3DQVA 3JSVA 2KTRA 1C4CA 1C4PA 1RLFA 5CTRC 2ZVOA 2VZKB 1P1AA 3A4SC 3HM6X 1NI2A 3ECIA 3IAS1 5BMHA 3IFWB 3H7SA 4ANUA 3MHSD 1UZXB 5BMGA 2QMTA 1XCQL 1C3TA 1QZEA 2C7HA 3TIXA 1WGYA 1MHXA 1QOGA 2LUMA 3V60A 1SE2A 2LXCA 3Q8BA 1VZ8A 5AEKB 1TY0A 1WR1A 3Q6BA 2N7DA 2KQSA 2D3AA 3EUB2 2GBJA 3DBRI 4MT5A 4AJYB 2L52A 2RGFA 1WFYA 1LFDA 2HTME 4DQOC 3BK1A 1WE7A 2JXXA 2ON8A 4ZRPA 3UIPB 1E7VA 3BK2A 4RF1A 1K51A 1F77A 1P9DU 4DDGD 3HVZA 3ZXRA 4HCPB 4XDDA 1TY2A 3RNAC 3NRZA 4IWOA 4NQKE 2XN9C 1YJJA 2N9PC 4HWIB 1OEYA 1XD3B 3A1QA 5AZHA 2IGHA 2R2OA 2BBCA 2DYMA 2CU1A 1E10A 3B9JA 4S0RA 2IYDB 3DOWA 2AL3A 5H8YE 5JXVA 2IDYA 1KLVA 4JIOU 1HA5A 4MELA 4ZYNA 1H8CA 3BVGA 1NEKB 1TYGB 1FNWA 1WXVA 2PE9A 2JRHA 3PRPB 1GAQB 2AQ1B 4RNAA 3DHHC 1YN4A 1R7SA 5C3JB 3CIRB 3L17A 4ASWC 1I35A 1TJEA 4USAA 2V4IB 4L1BA 1EWCA 3QAQA 1CZPA 3PO0A 1YQBA 3R3MA 2CHZA 3K9PB 1IP9A 2KOXA 2LXAA 4LCDE 2ZPYA 4CQNA 2IGGA 2CJOA 4HDOA 1JALA 3VHTC 5D3DA 4H2AA 2K22A 2MBOA 1XT9B 2DX5B 3N30A 1MJDA 4PYUA 3NOBA 2C60A 4DBGA 2LMCA 2WP9B 4G50A 3VDZA 2IPKD 2C7NB 1YX6B 2WX0A 2JZPA 2XEWA 3W2DA 4URKA 2J0JA 1DOIA 4LK0M 4RCOA 4WURA 4NNJB 2Y3AA 3UQAA 2BPSA 3MTNB 2HJ1A 3QWZB 5EE3A 2PPHA 1FXIA 3LB8C 4CO7A 1E9MA 1FRDA 1Z2MA 1E5WA 5GMVA 4AOFA 3ZRFA 2Z59B 3IT4B 2NS5A 1NYRA 5JHBA 2FUG1 2LFIA 3AEAB 4BBNC 3W1SA 2GBRA 4WQOB 2BW2A 3NVWA 3M3JA 1F1HA 1P98A 1T0SC 2I2YA 3GE8C 4W9GA 3SFEB 3E9SA 2C9WB 2KDIA 5D7GA 2ACZB 4LJOB 4HEA1 3RFZB 1N5XA 4RFBA 2ASQA 4W9FA 2EELA 4PS7A 4MDKE 3TEYA 4GGQA 1MI0A 3RN9C 1ZPSA 4WH4A 2BWFA 2WXLA 1ZP0B 2LUEA 3AE2B 3VH3B 3AB5A 1MHHE 3VTUA 3UGBB 3V6EB 1V81A 1E7UA 2MJ3A 4WJPA 3ZNZB 2WXOA 3W1YA 1P7EA 2IY0B 1WH3A 3IAM1 4C7ZA 3ZXVA 1YX5B 4KSKC 2M0XA 1D5XC 3MJWA 1DOXA 4HPLB 4JE3B 4M0WB 3A9KA 1SB3C 2G45B 1FRRA 5J2RA 4HJGE 3DBHB 4A3OA 3RUIB 4RGOS 3N1YC 3RI7C 2N7JA 3AEEB 2JPHA 4P16A 3FKYA 1RFKA 2IY1B 3ML9A 2INPE 4BBNF 2MX2A 1JWAD 3Q3MC 4HJKA 1F9JA 2ZJDA 1TS4A 3AE6B 4NZLB 2WDVB 1UF0A 4JX1C 3PRMB 4K81A 2LRUA 3AEDB 2FIDA 1E6EB 5JH5C 1V5TA 4GMVA 3Q2AC 5BYQA 3IXSA 5LNK1 4C00A 1GJZA 3NUHB 3Q8EA 3Q3OC 2HTHA 1T6BX 4WJNA 1E8ZA 1JQ4A 4WAAA 1L7YA 1OQQA 3NG0A 2RD0A 2Q5WD 4JLCA 5E6JA 2XK5A 2KFJA 2ZPNA 3L13A 4KX6B 4WAFA 2G4SA 3DWGC 4M02A 4WWMA 2D07B 3P2BA 2ZEQA 2M56B 3V61A 4DWFA 3DBSA 3BYTB 3EFCA 2TSSA 3PV1A 1WMHB 1HZ6A 2AQ2B 2LGSA 3P4SB 3EECA 5G5GA 1TZ1A 1J19A 3DHGC 1YN5A 1JWBD 1AYFA 2MEKA 1ZDXA 5IP4D 2AX5A 1YQ3B 4EUTA 4OVVA 1H4RA 3ZO5B 4NJ6A 4WJQA 2W82A 2V4LA 3DWMA 2JYTA 2EKEC 1XLQA 1WJ4A 5J17A 3H7PA 3ZKJC 3WANA 3L08A 4DHZB 2L1AA 2JSVX 4A9AA 1N5WA 5DPTA 3W9CB 1HE8A 4FXCA 4YSXB 4R3DA 3TEXA 3OLMD 2QILA 3WAOA 1SIJA 2NTTA 1AN8A 4LNNA 3QHTA 4P7IA 1YNTE 3HRDD 1FCLA 2Y5BB 1OQYA 4HKQA 1MG8A 1I4QA 1TKYA 2D11A 4D2KA 1NYQA 1XCTL 2DYOA 1JMLA 3KWLA 4YTMB 3TBLD 4I6LB 4DHJD 3PZ7A 2L83A 2VH1A 3ALBA 5BMIA 1XLNA 5G5HA 4DXFA 4FHKA 1HQRD 4WQMA 2KN4A 4LTUA 2JRIB 2J0MA 1KJTA 3ZDMC 1LM8B 1UH6A 1Q1OA 4EZLA 3QX1A 3ZTCA 2L8JA 3S2AA 1E7PB 4IW0A 1OGWA 2KLCA 3C0RB 4MH0E 2MJEA 2X8XX 3ENEA 2DYBA 2JYEA 4YT0B 3I57A 3O65B 4FLHA 2C5LC 1CQVA 2KN5A 2IO3B 2KWUB 1I7HA 3WIMA 3DBRB 2MP2B 1PYWD 4IWPA 3WAMA 3SD5A 2LI5A 1ZXHA 1ZE3D 2KDMA 3ABVB 2SEBD 5HKHA 4ANXA 2WXIA 1BMLC 3Q8AA 3P42A 4EZJA 3EC8A 3LDZE 4TUUA 3R2TA 2J7QB 5EE0A 2A4ZA 1UGMA 4I6PA 1PDXA 4KGRA 2WDTB 1WX7A 4AWJA 4HKZE 4KIKB 4XWTA 1OQRA 2NR2A 2H88B 4ICUA 1HTOA 3N3KB 5JZEB 2HDEA 3PSEB 2I1KA 3J9CA 1HXYD 4GU2A 2KQ7A 5E6PA 5CX3A 4BFRA 4W9LA 5D3IB 3R7RA 4XWWA 1WZ0A 4LJPB 1UGJA 1K52A 4XC2A 4RH6A 2ZZPB 3FC4A 1K50A 4WWNA 2K1FA 3OJ3A 3U8ZA 3PGEA 1V86A 1C1YB 3RNBC 1YD8U 2N1WA 4US9A 1WGKA 2FAZA 2GI9A 1WM3A 3HIZA 3A4RA 4FHJA 2FCQA 3NVVA 2ZVNA 2KXJA 2W3SA 3IG3A 3PREA 4F7ZA 4IM3A 2LGYA 4ZHPA 2RSUA 1IPGA 2O2VA 4E71A 2KX3A 1WGRA 4LNKA 1MFWA 1V80A 4B95A 1ZOYB 4QAYA 1Q0WB 3MP9A 3MC0B 3VRAB 3URYA 1A5RA 2N9KA 1GB1A 2YEPB 3AI5A 2V0GA 4GXBA 1PGBA 4ZRQA 4IWQA 1XLOA 3T9LA 1V97A 4CHKA 2DBYA 4IG7B 5BYRA 4HPMB 5AUKA 4N59A 2BVCA 4ACFA 1J0GA 2MBQA 1T3QA 3VAWA 4P1CC 2KX0A 3ZQ4A 4US8A 5E6OA 3DBLI 3R66C 1BXTA 3LJ3A 3ZDTA 1ZDVA 2SAKA 1QILA 3BINA 2AYOB 3OAWA 2R2QA 3GOEA 3CWIA 2QDFA 1EO6A 2N9EB 4PK1A 2L00B 4LLGM 2PTLA 2NBUA 1ACCA 2LRWA 5JHAA 4ARCA 3AE9B 2YEPF 2NVUI 1WIAA 3FILB 1WSPA 4MGZE 4RGTA 3CF6E 3IBEA 3RD2A 1DOYA 3RZFA 4BVUC 1FO4A 1YOVB 1FEHA 2WYQA 2CHXA 2XBBC 4A90A 4GDLB 4TV3A 1PGXA 1TS5A 4E3CA 2VZKD 4AJWA 4ZRIA 3TUOA 3EHVA 3ETRA 3BIID 4JL9A 4ANWA 2LVPA 3ZJUA 5EE1A 4YSZB 1AARA 3HM3A 4I6NB 1PQSA 4II2B 1V5OA 4P1BC 4FN2A 4EOYA 3SR6A 2RDGA 4RM8A 2BB5A 2LGXA 3NVYA 4XZ4A 1D6EC 1V1PB 1X1MA 2N7EA 2K8HA 3BZDB 2E6XA 1KLUD 4O1NA 1J7BA 2K8CA 1LO5D 2CS4A 1CK1A 2MRPA 3NJTA 1QT9A 4W9DA 1L4DB 1PFDA 5H92C 1FMAD 4HXDA 4K7UA 3TL5A 1RFAA 1L0YB 3GZNI 3P63A 1SBBB 4DXGA 3DHIC 1I4XA 1ZUD2 1LGRA 1Y56A 2V9HA 1L4ZB 1N60A 3AULA 3PZDA 3ZJVA 1FXAA 2ZW1A 3U7DA 3KUDB 3T3NA 5TR5A 3KLSX 2AQ3B 3AU4A 2B3AA 1WF9A 4WIPA 4E74A 3Q3FA 4FJYA 2BQQA 1J7CA 4M8NA 2J42A 2EMSA 3VR9B 4XE0A 2FUHB 3W5UB 4A20A 3UF8A 1RAXA 2M1MA 3DVGX 1ROEA 5IKCM 4GOCA 2WXQA 3O13A 3L10B 2KWVB 2YLMA 2W3RA 2FCMA 4OZCA 2DLBA 3VXWA 1HZ5A 1TT5B 1WX9A 1ISNA 2KMCA 3MJ5A 4HDQA 4BOSC 3L16A 2LZ6A 2DNFA 4FJVB 4W9EA 4F8CB 2WXFA 2NMQA 1WJ6A 4ITKA 1C76A 4A8XC 4BOZB 2BKFA 2JT4B 3RULA 1R4MI 2LHDA 2K8BA 1NBFC 2JY6A 1S1QB 1SEBD 1IYFA 2CKHB 1M4VA 1F0ZA 4OVUA 1F2RC 3MC9A 4ZOHC 3KUZA 2L0TA 3L0WB 3NZSA 1JCKB 3N9YC 5CHWA 1I4RA 4Q2JA 3R8BA 1DYQA 2WXNA 2WXGA 2KJRA 1PUTA 2KMAA 1P7FA 4RMAA 4MGIE 2L7RA 3C19A 1WR6E 1YN3A 4JWUC 2Z0DB 2WX1A 4YL8A 3VVWB 3PHWB 5MPOA 2WDQB 5C2TB 4P6VF 2E3TA 1SE3A 4A3PA 4FJZA 1ZW7A 1SE4A 3VR8B 1UNSA 2DZMA 1KFYB 3P1MA 2AWTA 1C9FA 4AS1A 1VZ7A 1B9RA 3M95A 3DCGA 4NAWB 2MA9B 2W54A 3NZUA 5AZGA 2JVCA 1WZ3A 2NTSA 2QIEB 3VRBB 4DHZE 3QA8A 4RGMA 2EMTA 4OZBA 1XF5L 4MSQB 2K0PA 2IO2B 1SE9A 2MBHA 1NI3A 2NBVB 1V49A 1RRBA 3U2SC 3ZVVA 3B1LX 2BYVE 1WJNA 4WWOA 4KZCA 2PE6B 1WYWB 1UBIA 2KYWA 3I9V1 5BYSA 3X23A 2LJ5A 2D5GA 2MBBB 1EWYC 3ZTDA 4RM9A 4TSSA 4W9CA 3HVDA 2ONQA 3AE4B 2MH7A 4J6IA 1JWSD 3K9OB 4G0NB 3HK0A 2JU6X 4MACA 2LGIA 3RYTA 2O6VB 3AE1B 4LDTB 1FCCC 2CR5A 4RGNA 3B08A 5DPWA 2AL6A 3HHMA 4NY0A 1L6VA 2GOWA 2QEJC 1XEEA 4AP4C 4K3CA 1R4NI 4XYCA 3KWVA 2NPTB 1IBXB 3UI3A 5D6JB 2HJ8A 4PYZA 2WHIA 2M8SA 3CSFA 4REZA 3HUIA 4MEMA 2MLBA 3WA0A 4HPPA 4L2YA 2BS2B 3AE3B 3SHQA 4M0WA 1WXSA 5HFYA 2KFKB 2JZZA 4B0EA 1I42A 2LGDA 2IZVB 4LNOA 3OWEB 2EKIA 2V3PA 1CJEA 2ZCCA 4FADA 2KC1A 3T3OA 1XLPA 2K5PA 3ZNGC 3EA6A 5KHQA 2IO1B 3VTVA 4GIVA 2KTFA 5LLIA 4B0MA 1IGCA 4NAWA 1VLBA 1QKZA 3TEWA 4EZKA 1QOFA 1JRPA 3BVZA 2FCNA 4J3OD 4JQWC 2RPVA 4HRSA 4MM3B 3JVZX 2KD0A 3ONSA 1UBQA 3VUYA 3CMMB 2JZ3B 3DVGY 3AEGB 4MGYE 2PW9A 4W9IA 2GB1A 1KF6B 4EKUA 3PRZA 2FNJB 4C4VB 2X38A 1GC7A 1E0ZA 4M00A 2A5UA 4BKTA 3ZNHB 1SJED 3JSVB 3NY5A 2KTRB 4K3BA 2LWPA 3R2IA 4KGSA 2BB6A 3AN1A 3OJ4B 4LDTD 1RYJA 4ZDVA 1WMHA 2H89B 1RWSA 3JW0X 3I3TB 3Q3NC 1QQRA 4IUMB 3I63C 3RNEC 2N4FA 1UWXA 3V62A 1B1ZA 2HD5B 2VRRB 3JYUA 5LXIB 3SDLC 2GBNA 4TQ1A 1KTKA 4NJ7A 2L05A 4WWPA 4G3XB 3APDA 2YVCA 3B0AA 3DBLB 5FK9C 1QLBB 1KRHA 4XX5A 1VZ6A 1XQQA 4IOIE 2G1EA 3N1XC 3X0WA 1T0YA 2IGDA 3AE5B 2XNAC 2WXHA 3VUWA 4KZ0A 2FIFA 5HG2A 5EE9A 4OVZA 4IM0A 4EE2A 3TJPA 4AQ7A 1WGHA 2G3QB 4DDID 4JWSC 4K7SA 1ESFA 1XO3A 3RNCC 1ENFA 2K6QA 1NVID 4DK5A 4ARIA 3A1QB 2KDFB 4G11A 3U7ZA 2FE8A 2WNMA 1JWUD 3L54A 2MW5A 5IA7A 3GE3C 3P4RB 3APCA 4WJOA 2K6DB 4M8MA 2N0SB 1T5XD 1GUAB 1TS2A 1WYGA 2KJHB 3RNFC 2WU5B 2WU2B 3AE8B 3DVNV 4ANVA 5L95C 3H1UA 1J7AA 4NJCA 5DPSA 3V05A 1D5ZC 2J0KA 4HLEA 1WXAA 2KDEB 1FNUA 2MCNB 2KQ4X 2MP2A 1L5PA 3UINB 2AEHA 3AM9A 3GZNB 2BYEA 1VR9A 4KDIC 2OHFA 1YJIA 4IKGA 2R61A 5L83A 1E8XA 1WWTA 4ZRKA 1M94A 1KM7A 1JWMD 1SGHA 1PGAA 1YMHE 2BKRB 5IN7A 1N6ZA 3L4PA 4A55A 2Z8LA 1P0RA 5LXHA 1VRAB 2ZNVC 4N58A 4KIKA 1KLGD 2REXA 3AMZA 2DZIA 2KHWB 3QCAA 1SIFA 2Y5CA 3W1SC 2WS3B 4GDKB 1F52A 4N6EB 3VH4B 3AV8A 2BGFA 1WGGA 3E56A 2MSED 2ZNVB 1FD6A 3FAHA 2WGSA 3ZIMA 3M63B 1R4MB 2FBWB 1L6UA 1YIWA 2W55A 1GC6A 4LNFA 3U30A 4HROA 2RPQA 3ZNID 1AWDA 2NBWB 1Q10A 3U52E 4NPNA 3KYCD 1Q5WB 4HK2A 4GN1A 1DGJA 1V2YA 3I5JC 2K9XA 4NAMA 4YSYB 1WI0A 1SSNA 5IOIA 5DPRA 2L0FA 3DDCB 2KNBA 2KWDA 3V6CB 3RPFC 3BWUD 2IJ0A 1E90A 1LXDA 1NENB 3ML8A 2JF5A 3IT6B 4KKIA 1WM2A 2BYFA 1WRIA 2I1JA 4RF0A 2KJ6A
chains in the Genus database with same CATH topology
2K25A 3QHTA 4YL8A 4P7IA 3VVWB 2Y5BB 3QIJA 3PHWB 2KLGA 1OQYA 3UIOB 3ZUNA 1MG8A 2D11A 4KVGB 2JUOA 2W9NA 4A3PA 4FJZA 5DCNA 1ZW7A 2DYOA 4W9HA 4AUQC 1UELA 4EFOA 3PS6A 3TBLD 2N9XA 4I6LB 2DZMA 4DHJD 5G2NA 1EF5A 2AWTA 3ALBA 4ICVA 3M95A 2RR9A 4FHKA 2M4NA 3DQVA 3JSVA 2KTRA 3DCGA 4NAWB 2MA9B 3NZUA 4KV2A 2JRIB 5AZGA 3UQBA 2LVQA 1RLFA 2J0MA 2JVCA 1WZ3A 5CTRC 1KJTA 3ZDMC 2ZVOA 1LM8B 1P1AA 4DHZE 1UH6A 1Q1OA 4EZLA 3A4SC 3HM6X 3QA8A 3QX1A 3A9KB 2L8JA 4PS3A 3ZTCA 3S2AA 1NI2A 3ECIA 4ZRJA 2EMTA 3RCZA 4IW0A 3IFWB 1OGWA 3A9JB 1V6EA 3H7SA 2KLCA 4ANUA 3MHSD 3NS8A 2MBHA 1UZXB 1SE9A 2IO2B 4MSQB 4HVBA 3C0RB 4MH0E 2CHWA 2KANA 4B9KA 1C3TA 4MGKE 2NBVB 1OTRB 2GBKA 1V49A 3ENEA 1QZEA 2C7HA 2DYBA 1RRBA 1TGZB 3TIXA 1WGYA 2Z0EB 3ZVVA 4BKSD 3V60A 3B1LX 2N1VA 2BYVE 5CHFA 1WJNA 3O65B 4FLHA 4WWOA 4KZCA 2C5LC 2PE6B 4JGHB 1WYWB 2KN5A 4BKSA 1UBIA 2LXCA 2IO3B 2KWUB 3WIMA 5AEKB 4BKGA 1WR1A 2LJ5A 3X23A 2N7DA 2KQSA 3PTFC 2MP2B 2MBBB 3ZTDA 2GBJA 4IWPA 4RM9A 3WAMA 3DBRI 4W9CA 2C7MB 4GDKA 2LI5A 3SD5A 4J6IA 5D94A 3K9OB 4AJYB 2RGFA 4G0NB 2L3ZA 1WFYA 1LFDA 1Y8RC 3HK0A 1WE7A 2JXXA 5IAAC 3RYTA 3UIPB 1E7VA 4FULA 1P3QU 3PLVA 2O6VB 3WAPA 4LDTB 2CR5A 1VCBA 5HKHA 1P9DU 2DAJA 4ANXA 3B08A 4DDGD 5DPWA 2AL6A 3HHMA 4HCPB 4EZJA 3EC8A 3LDZE 4NY0A 4TUUA 2GOWA 4IWOA 4NQKE 2J7QB 2LASA 2A4ZA 2XK5B 2N9PC 4AP4C 1UGMA 4HWIB 4I6PA 1OEYA 1XD3B 1R4NI 3A1QA 2WDTB 5AZHA 1WX7A 2QHOA 1LQBA 2NPTB 1EUVB 2R2OA 4AWJA 5C23A 2DYMA 3QJZA 4KIKB 2CU1A 5D6JB 3QARA 2HJ8A 3R7QA 4PYZA 2M8SA 5BO4B 3CSFA 4GDLA 2V3SA 2NR2A 2DZJA 4MEMA 2IYDB 2MLBA 3AXCA 4ICUA 3WA0A 3DOWA 2AL3A 2G4DB 1UD7A 3N3KB 2PJHA 4JIOU 5JZEB 2BWES 1KLVA 2KWCA 4MELA 4ZYNA 3SHQA 3PSEB 2I1KA 1WXSA 3KVFB 1H8CA 2KKCA 2KFKB 4GU2A 2KQ7A 5E6PA 5KHOA 5CX3A 2JZZA 4BFRA 3T8MA 1I42A 1WXVA 2LGDA 2IZVB 2PE9A 4W9LA 2JRHA 3A33B 3R7RA 2ZCCA 1WZ0A 4LJPB 3PRPB 4FADA 2KC1A 5FR6A 3L17A 1WRDB 1WGDA 3PT2B 3ZNGC 4XC2A 4ASWC 1I35A 1KOTA 5KHQA 2IO1B 3VTVA 4GIVA 1TTNA 2ZZPB 1ZKHA 2KTFA 3RT3B 2DAFA 3VTWA 5LLIA 2DENB 3H7PB 4WWNA 3H9DA 2K1FA 4NAWA 3OJ3A 3EFUA 3U8ZA 3VUXA 3QAQA 4NQLB 4EEWA 5C1ZA 4EZKA 3PGEA 1V86A 1S3SG 1C1YB 1YQBA 2FCNA 1YD8U 2OJRA 3R3MA 4JQWC 2CHZA 2N1WA 3K9PB 1IP9A 2KOXA 2LXAA 4LCDE 2FAZA 2ZPYA 4KDLB 3JVZX 2KD0A 1WM3A 3ONSA 3A9JA 1WXMA 4HDOA 3HIZA 1UBQA 3VHTC 1NDDA 3A4RA 4FHJA 2FCQA 2MBOA 1XT9B 2ZVNA 2KXJA 3IG3A 3PREA 4GB9A 2DX5B 3VUYA 4F7ZA 3N30A 3CMMB 4PYUA 2JZ3B 3DVGY 3NOBA 4IM3A 2C60A 2LGYA 4DBGA 4MGYE 2RSUA 1IPGA 3KH0A 4W9IA 4G50A 3VDZA 4EKUA 3PRZA 2FNJB 2C7NB 1GC7A 1YX6B 2O2VA 4E71A 2KX3A 2WX0A 1WGRA 2XEWA 3TMPB 1V80A 2A5UA 4B95A 4BKTA 4URKA 1Q0WB 2J0JA 3ZNHB 1A5RA 3JSVB 1WE6A 3NY5A 2KTRB 2LWPA 4NNJB 4DHJB 3AI5A 3UQAA 2D10A 2BPSA 3MTNB 3QWZB 1E8WA 2KK8A 3OJ4B 3IHPC 4GXBA 4LDTD 2PPHA 1WMHA 4IWQA 4ZDVA 2LD9A 3JW0X 4W9JA 3I3TB 4IUMB 4CO7A 1Z2MA 2JWZA 3T9LA 1E5WA 2N4FA 5GMVA 1OEYJ 2MBEA 4AOFA 4CHKA 3ZRFA 4IG7B 2Z59B 3KUCB 3V62A 4HPMB 2HD5B 2VRRB 1TBEA 3JYUA 5LXIB 2NS5A 3SDLC 5JHBA 2GBNA 1J0GA 2LVOA 2MBQA 4TQ1A 4BBNC 1GG3A 3W1SA 2GBRA 5J18A 3QQ8B 4WQOB 4NJ7A 1K8RB 2L05A 4WWPA 3VAWA 2DZKA 1E8YA 4G3XB 3M3JA 2KX0A 3APDA 1P98A 2HE7A 2YVCA 3DVNU 4MSMB 3B0AA 4TKNA 4W9GA 4MJSB 2DHZA 2C9WB 2KDIA 5D7GA 5E6OA 3DBLI 3KYDD 4LJOB 2OOBB 1JRUA 3R66C 2MQJA 4XX5A 1XQQA 3D32A 3LJ3A 3ZDTA 2ASQA 3BINA 4W9FA 3X0WA 4PS7A 4MDKE 4PS8A 2AYOB 1T0YA 4GGQA 3OAWA 2R2QA 3M62B 2BWFA 3GOEA 2LUEA 1EO6A 2WWZA 3VUWA 2N9EB 4KZ0A 1D3ZA 3Q3JA 2FIFA 2L00B 3VH3B 2NBUA 4IM0A 3VTUA 2LRWA 3TJPA 3UGBB 3V6EB 1WGHA 2G3QB 4DDID 5JHAA 2NVUI 1V81A 1E7UA 1WIAA 1ZGUB 4IC7B 4K7SA 4DXAB 4MGZE 4WJPA 3H6NA 3ZNZB 3CF6E 2K6QA 3W1YA 4DK5A 3IBEA 3RD2A 3RZFA 4BVUC 3A1QB 1WY8A 2KDFB 2MWSB 2IY0B 4G11A 3TCAA 1WH3A 1FXTB 2KC2A 1CMXB 3RZWC 4B6WA 2WYQA 1YX5B 2CHXA 2GBMA 4CYEA 2XBBC 2UWQA 3KW5B 2MW5A 3L54A 4KSKC 2GMIC 4GDLB 4TV3A 3SU8X 4E3CA 2M0XA 5IA7A 4WJOA 3APCA 2K6DB 3MJWA 1V9JA 3VQIA 4M8MA 4F1SA 4AJWA 4ZRIA 3VFKA 3EHVA 4JL9A 1GUAB 4ANWA 4HPLB 2LVPA 1WX8A 2BF8B 4M0WB 2FCSA 5D2MB 3PHXB 2KJHB 3A9KA 2G45B 2IBIB 1AARA 5J2RA 3PPAA 4A3OA 3RUIB 3HM3A 4I6NB 2D3GA 1PQSA 4II2B 1G6JA 2V1YA 1V5OA 3DBHI 3DVNV 4FN2A 2JPHA 4ANVA 5L95C 2IY1B 3H1UA 2NCNA 3ML9A 1L2NA 4EOYA 4BBNF 4RM8A 2LGXA 3PLUA 5DPSA 2MX2A 4XZ4A 5G55A 2J0KA 4HLEA 1WXAA 3PVLA 1X1MA 4HJKA 1F9JA 2ZJDA 2N7EA 2K8HA 2M17A 4X57B 2KDEB 3PRMB 4II3B 1WJUA 4K81A 2MCNB 4W9KA 3APFA 2LRUA 2K8CA 1EF1A 2CS4A 2MP2A 2MRPA 2FIDA 5CHVC 2KDBA 5JH5C 1V5TA 3CSTA 4GMVA 3UINB 4W9DA 2AEHA 4FBJB 2KZRA 2BYEA 4HXDA 4K7UA 3TL5A 1RFAA 4KDIC 2O6VD 1GJZA 3GZNI 3BY4B 5L83A 1E8XA 1Z5SB 2HTHA 4WJNA 2O6VA 1E8ZA 4ZRKA 3AULA 4K1RB 1M94A 3PZDA 1KM7A 4WAAA 3ZRCA 1L7YA 2PEAA 3U7DA 5E6NA 3KUDB 1SGHA 5TR5A 3AU4A 2B3AA 1WF9A 2BKRB 2KVRA 2RD0A 4HCNB 2O2VB 4E74A 3Q3FA 4FJYA 4JLCA 2XK5A 2KFJA 2ZPNA 5EDSA 3AU5A 4M8NA 3IVFA 3L13A 2EMSA 4MJSA 1P0RA 2FUHB 3DPDA 1J8CA 2G4SA 4A20A 3UF8A 1RAXA 2D07B 2M1MA 3DVGX 2ZEQA 3P2BA 5LXHA 2L76A 2NPTA 4GOCA 2ZNVC 3V61A 3L10B 2KWVB 2YLMA 4KIKA 2FCMA 2REXA 4DWFA 3DBSA 3VXWA 2DZIA 2KHWB 3PV1A 1WMHB 1WX9A 1SIFA 3QCAA 3QC8B 3W1SC 3EECA 1TZ1A 4GDKB 1YJ1A 3VH4B 1ISNA 2KMCA 4HDQA 4GSWA 4BOSC 1J19A 2BGFA 3L16A 2D2QA 2LZ6A 2ZCBA 1WGGA 4FJVB 1BT0A 1GNUA 2MSED 2ZNVB 4FA6A 3ZLZA 4N9F4 2KFKA 4W9EA 4TQ0A 4F8CB 4KSLC 2UYZB 2IO0B 5AZFA 1WJ6A 3ZIMA 4EUTA 4OVVA 3M63B 1H4RA 3ZO5B 4NJ6A 2BKFA 1VD2A 4WJQA 3ZW3A 4BOZB 2JT4B 3RULA 1YIWA 2KO3A 1R4MI 2K8BA 2V4LA 1NBFC 2JY6A 1GC6A 1S1QB 2EKEC 3U30A 1WJ4A 2RPQA 5J17A 1IYFA 2CKHB 3ZNID 2NBWB 4K7WA 3H7PA 3NHEB 4NPNA 3KYCD 3ZKJC 4IM2A 4OVUA 1Q5WB 4HK2A 4GN1A 3L08A 3WANA 3KUZA 2L0TA 4DHZB 1V2YA 3L0WB 3WALA 3N32A 1WI0A 3NZSA 5DPTA 1HE8A 5DPRA 2L0FA 3DDCB 5CHWA 2KNBA 1U4AA 3V6CB 1E90A 2KJRA 4MM3A 1LXDA 3OLMD 2KMAA 3ML8A 3WAOA 2JF5A 4RMAA 4MGIE 3QK0A 2K39A 2L7RA 1WM2A 2BYFA 1WR6E 2I1JA 2KJ6A 2Z0DB 2WX1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K25 A;  3QHT A;  4YL8 A;  4P7I A;  3VVW B;  2Y5B B;  3QIJ A;  3PHW B;  2KLG A;  1OQY A;  3UIO B;  3ZUN A;  1MG8 A;  2D11 A;  4KVG B;  2JUO A;  2W9N A;  4A3P A;  4FJZ A;  5DCN A;  1ZW7 A;  2DYO A;  4W9H A;  4AUQ C;  1UEL A;  4EFO A;  3PS6 A;  3TBL D;  2N9X A;  4I6L B;  2DZM A;  4DHJ D;  5G2N A;  1EF5 A;  2AWT A;  3ALB A;  4ICV A;  3M95 A;  2RR9 A;  4FHK A;  2M4N A;  3DQV A;  3JSV A;  2KTR A;  3DCG A;  4NAW B;  2MA9 B;  3NZU A;  4KV2 A;  2JRI B;  5AZG A;  3UQB A;  2LVQ A;  1RLF A;  2J0M A;  2JVC A;  1WZ3 A;  5CTR C;  1KJT A;  3ZDM C;  2ZVO A;  1LM8 B;  1P1A A;  4DHZ E;  1UH6 A;  1Q1O A;  4EZL A;  3A4S C;  3HM6 X;  3QA8 A;  3QX1 A;  3A9K B;  2L8J A;  4PS3 A;  3ZTC A;  3S2A A;  1NI2 A;  3ECI A;  4ZRJ A;  2EMT A;  3RCZ A;  4IW0 A;  3IFW B;  1OGW A;  3A9J B;  1V6E A;  3H7S A;  2KLC A;  4ANU A;  3MHS D;  3NS8 A;  2MBH A;  1UZX B;  1SE9 A;  2IO2 B;  4MSQ B;  4HVB A;  3C0R B;  4MH0 E;  2CHW A;  2KAN A;  4B9K A;  1C3T A;  4MGK E;  2NBV B;  1OTR B;  2GBK A;  1V49 A;  3ENE A;  1QZE A;  2C7H A;  2DYB A;  1RRB A;  1TGZ B;  3TIX A;  1WGY A;  2Z0E B;  3ZVV A;  4BKS D;  3V60 A;  3B1L X;  2N1V A;  2BYV E;  5CHF A;  1WJN A;  3O65 B;  4FLH A;  4WWO A;  4KZC A;  2C5L C;  2PE6 B;  4JGH B;  1WYW B;  2KN5 A;  4BKS A;  1UBI A;  2LXC A;  2IO3 B;  2KWU B;  3WIM A;  5AEK B;  4BKG A;  1WR1 A;  2LJ5 A;  3X23 A;  2N7D A;  2KQS A;  3PTF C;  2MP2 B;  2MBB B;  3ZTD A;  2GBJ A;  4IWP A;  4RM9 A;  3WAM A;  3DBR I;  4W9C A;  2C7M B;  4GDK A;  2LI5 A;  3SD5 A;  4J6I A;  5D94 A;  3K9O B;  4AJY B;  2RGF A;  4G0N B;  2L3Z A;  1WFY A;  1LFD A;  1Y8R C;  3HK0 A;  1WE7 A;  2JXX A;  5IAA C;  3RYT A;  3UIP B;  1E7V A;  4FUL A;  1P3Q U;  3PLV A;  2O6V B;  3WAP A;  4LDT B;  2CR5 A;  1VCB A;  5HKH A;  1P9D U;  2DAJ A;  4ANX A;  3B08 A;  4DDG D;  5DPW A;  2AL6 A;  3HHM A;  4HCP B;  4EZJ A;  3EC8 A;  3LDZ E;  4NY0 A;  4TUU A;  2GOW A;  4IWO A;  4NQK E;  2J7Q B;  2LAS A;  2A4Z A;  2XK5 B;  2N9P C;  4AP4 C;  1UGM A;  4HWI B;  4I6P A;  1OEY A;  1XD3 B;  1R4N I;  3A1Q A;  2WDT B;  5AZH A;  1WX7 A;  2QHO A;  1LQB A;  2NPT B;  1EUV B;  2R2O A;  4AWJ A;  5C23 A;  2DYM A;  3QJZ A;  4KIK B;  2CU1 A;  5D6J B;  3QAR A;  2HJ8 A;  3R7Q A;  4PYZ A;  2M8S A;  5BO4 B;  3CSF A;  4GDL A;  2V3S A;  2NR2 A;  2DZJ A;  4MEM A;  2IYD B;  2MLB A;  3AXC A;  4ICU A;  3WA0 A;  3DOW A;  2AL3 A;  2G4D B;  1UD7 A;  3N3K B;  2PJH A;  4JIO U;  5JZE B;  2BWE S;  1KLV A;  2KWC A;  4MEL A;  4ZYN A;  3SHQ A;  3PSE B;  2I1K A;  1WXS A;  3KVF B;  1H8C A;  2KKC A;  2KFK B;  4GU2 A;  2KQ7 A;  5E6P A;  5KHO A;  5CX3 A;  2JZZ A;  4BFR A;  3T8M A;  1I42 A;  1WXV A;  2LGD A;  2IZV B;  2PE9 A;  4W9L A;  2JRH A;  3A33 B;  3R7R A;  2ZCC A;  1WZ0 A;  4LJP B;  3PRP B;  4FAD A;  2KC1 A;  5FR6 A;  3L17 A;  1WRD B;  1WGD A;  3PT2 B;  3ZNG C;  4XC2 A;  4ASW C;  1I35 A;  1KOT A;  5KHQ A;  2IO1 B;  3VTV A;  4GIV A;  1TTN A;  2ZZP B;  1ZKH A;  2KTF A;  3RT3 B;  2DAF A;  3VTW A;  5LLI A;  2DEN B;  3H7P B;  4WWN A;  3H9D A;  2K1F A;  4NAW A;  3OJ3 A;  3EFU A;  3U8Z A;  3VUX A;  3QAQ A;  4NQL B;  4EEW A;  5C1Z A;  4EZK A;  3PGE A;  1V86 A;  1S3S G;  1C1Y B;  1YQB A;  2FCN A;  1YD8 U;  2OJR A;  3R3M A;  4JQW C;  2CHZ A;  2N1W A;  3K9P B;  1IP9 A;  2KOX A;  2LXA A;  4LCD E;  2FAZ A;  2ZPY A;  4KDL B;  3JVZ X;  2KD0 A;  1WM3 A;  3ONS A;  3A9J A;  1WXM A;  4HDO A;  3HIZ A;  1UBQ A;  3VHT C;  1NDD A;  3A4R A;  4FHJ A;  2FCQ A;  2MBO A;  1XT9 B;  2ZVN A;  2KXJ A;  3IG3 A;  3PRE A;  4GB9 A;  2DX5 B;  3VUY A;  4F7Z A;  3N30 A;  3CMM B;  4PYU A;  2JZ3 B;  3DVG Y;  3NOB A;  4IM3 A;  2C60 A;  2LGY A;  4DBG A;  4MGY E;  2RSU A;  1IPG A;  3KH0 A;  4W9I A;  4G50 A;  3VDZ A;  4EKU A;  3PRZ A;  2FNJ B;  2C7N B;  1GC7 A;  1YX6 B;  2O2V A;  4E71 A;  2KX3 A;  2WX0 A;  1WGR A;  2XEW A;  3TMP B;  1V80 A;  2A5U A;  4B95 A;  4BKT A;  4URK A;  1Q0W B;  2J0J A;  3ZNH B;  1A5R A;  3JSV B;  1WE6 A;  3NY5 A;  2KTR B;  2LWP A;  4NNJ B;  4DHJ B;  3AI5 A;  3UQA A;  2D10 A;  2BPS A;  3MTN B;  3QWZ B;  1E8W A;  2KK8 A;  3OJ4 B;  3IHP C;  4GXB A;  4LDT D;  2PPH A;  1WMH A;  4IWQ A;  4ZDV A;  2LD9 A;  3JW0 X;  4W9J A;  3I3T B;  4IUM B;  4CO7 A;  1Z2M A;  2JWZ A;  3T9L A;  1E5W A;  2N4F A;  5GMV A;  1OEY J;  2MBE A;  4AOF A;  4CHK A;  3ZRF A;  4IG7 B;  2Z59 B;  3KUC B;  3V62 A;  4HPM B;  2HD5 B;  2VRR B;  1TBE A;  3JYU A;  5LXI B;  2NS5 A;  3SDL C;  5JHB A;  2GBN A;  1J0G A;  2LVO A;  2MBQ A;  4TQ1 A;  4BBN C;  1GG3 A;  3W1S A;  2GBR A;  5J18 A;  3QQ8 B;  4WQO B;  4NJ7 A;  1K8R B;  2L05 A;  4WWP A;  3VAW A;  2DZK A;  1E8Y A;  4G3X B;  3M3J A;  2KX0 A;  3APD A;  1P98 A;  2HE7 A;  2YVC A;  3DVN U;  4MSM B;  3B0A A;  4TKN A;  4W9G A;  4MJS B;  2DHZ A;  2C9W B;  2KDI A;  5D7G A;  5E6O A;  3DBL I;  3KYD D;  4LJO B;  2OOB B;  1JRU A;  3R66 C;  2MQJ A;  4XX5 A;  1XQQ A;  3D32 A;  3LJ3 A;  3ZDT A;  2ASQ A;  3BIN A;  4W9F A;  3X0W A;  4PS7 A;  4MDK E;  4PS8 A;  2AYO B;  1T0Y A;  4GGQ A;  3OAW A;  2R2Q A;  3M62 B;  2BWF A;  3GOE A;  2LUE A;  1EO6 A;  2WWZ A;  3VUW A;  2N9E B;  4KZ0 A;  1D3Z A;  3Q3J A;  2FIF A;  2L00 B;  3VH3 B;  2NBU A;  4IM0 A;  3VTU A;  2LRW A;  3TJP A;  3UGB B;  3V6E B;  1WGH A;  2G3Q B;  4DDI D;  5JHA A;  2NVU I;  1V81 A;  1E7U A;  1WIA A;  1ZGU B;  4IC7 B;  4K7S A;  4DXA B;  4MGZ E;  4WJP A;  3H6N A;  3ZNZ B;  3CF6 E;  2K6Q A;  3W1Y A;  4DK5 A;  3IBE A;  3RD2 A;  3RZF A;  4BVU C;  3A1Q B;  1WY8 A;  2KDF B;  2MWS B;  2IY0 B;  4G11 A;  3TCA A;  1WH3 A;  1FXT B;  2KC2 A;  1CMX B;  3RZW C;  4B6W A;  2WYQ A;  1YX5 B;  2CHX A;  2GBM A;  4CYE A;  2XBB C;  2UWQ A;  3KW5 B;  2MW5 A;  3L54 A;  4KSK C;  2GMI C;  4GDL B;  4TV3 A;  3SU8 X;  4E3C A;  2M0X A;  5IA7 A;  4WJO A;  3APC A;  2K6D B;  3MJW A;  1V9J A;  3VQI A;  4M8M A;  4F1S A;  4AJW A;  4ZRI A;  3VFK A;  3EHV A;  4JL9 A;  1GUA B;  4ANW A;  4HPL B;  2LVP A;  1WX8 A;  2BF8 B;  4M0W B;  2FCS A;  5D2M B;  3PHX B;  2KJH B;  3A9K A;  2G45 B;  2IBI B;  1AAR A;  5J2R A;  3PPA A;  4A3O A;  3RUI B;  3HM3 A;  4I6N B;  2D3G A;  1PQS A;  4II2 B;  1G6J A;  2V1Y A;  1V5O A;  3DBH I;  3DVN V;  4FN2 A;  2JPH A;  4ANV A;  5L95 C;  2IY1 B;  3H1U A;  2NCN A;  3ML9 A;  1L2N A;  4EOY A;  4BBN F;  4RM8 A;  2LGX A;  3PLU A;  5DPS A;  2MX2 A;  4XZ4 A;  5G55 A;  2J0K A;  4HLE A;  1WXA A;  3PVL A;  1X1M A;  4HJK A;  1F9J A;  2ZJD A;  2N7E A;  2K8H A;  2M17 A;  4X57 B;  2KDE B;  3PRM B;  4II3 B;  1WJU A;  4K81 A;  2MCN B;  4W9K A;  3APF A;  2LRU A;  2K8C A;  1EF1 A;  2CS4 A;  2MP2 A;  2MRP A;  2FID A;  5CHV C;  2KDB A;  5JH5 C;  1V5T A;  3CST A;  4GMV A;  3UIN B;  4W9D A;  2AEH A;  4FBJ B;  2KZR A;  2BYE A;  4HXD A;  4K7U A;  3TL5 A;  1RFA A;  4KDI C;  2O6V D;  1GJZ A;  3GZN I;  3BY4 B;  5L83 A;  1E8X A;  1Z5S B;  2HTH A;  4WJN A;  2O6V A;  1E8Z A;  4ZRK A;  3AUL A;  4K1R B;  1M94 A;  3PZD A;  1KM7 A;  4WAA A;  3ZRC A;  1L7Y A;  2PEA A;  3U7D A;  5E6N A;  3KUD B;  1SGH A;  5TR5 A;  3AU4 A;  2B3A A;  1WF9 A;  2BKR B;  2KVR A;  2RD0 A;  4HCN B;  2O2V B;  4E74 A;  3Q3F A;  4FJY A;  4JLC A;  2XK5 A;  2KFJ A;  2ZPN A;  5EDS A;  3AU5 A;  4M8N A;  3IVF A;  3L13 A;  2EMS A;  4MJS A;  1P0R A;  2FUH B;  3DPD A;  1J8C A;  2G4S A;  4A20 A;  3UF8 A;  1RAX A;  2D07 B;  2M1M A;  3DVG X;  2ZEQ A;  3P2B A;  5LXH A;  2L76 A;  2NPT A;  4GOC A;  2ZNV C;  3V61 A;  3L10 B;  2KWV B;  2YLM A;  4KIK A;  2FCM A;  2REX A;  4DWF A;  3DBS A;  3VXW A;  2DZI A;  2KHW B;  3PV1 A;  1WMH B;  1WX9 A;  1SIF A;  3QCA A;  3QC8 B;  3W1S C;  3EEC A;  1TZ1 A;  4GDK B;  1YJ1 A;  3VH4 B;  1ISN A;  2KMC A;  4HDQ A;  4GSW A;  4BOS C;  1J19 A;  2BGF A;  3L16 A;  2D2Q A;  2LZ6 A;  2ZCB A;  1WGG A;  4FJV B;  1BT0 A;  1GNU A;  2MSE D;  2ZNV B;  4FA6 A;  3ZLZ A;  4N9F 4;  2KFK A;  4W9E A;  4TQ0 A;  4F8C B;  4KSL C;  2UYZ B;  2IO0 B;  5AZF A;  1WJ6 A;  3ZIM A;  4EUT A;  4OVV A;  3M63 B;  1H4R A;  3ZO5 B;  4NJ6 A;  2BKF A;  1VD2 A;  4WJQ A;  3ZW3 A;  4BOZ B;  2JT4 B;  3RUL A;  1YIW A;  2KO3 A;  1R4M I;  2K8B A;  2V4L A;  1NBF C;  2JY6 A;  1GC6 A;  1S1Q B;  2EKE C;  3U30 A;  1WJ4 A;  2RPQ A;  5J17 A;  1IYF A;  2CKH B;  3ZNI D;  2NBW B;  4K7W A;  3H7P A;  3NHE B;  4NPN A;  3KYC D;  3ZKJ C;  4IM2 A;  4OVU A;  1Q5W B;  4HK2 A;  4GN1 A;  3L08 A;  3WAN A;  3KUZ A;  2L0T A;  4DHZ B;  1V2Y A;  3L0W B;  3WAL A;  3N32 A;  1WI0 A;  3NZS A;  5DPT A;  1HE8 A;  5DPR A;  2L0F A;  3DDC B;  5CHW A;  2KNB A;  1U4A A;  3V6C B;  1E90 A;  2KJR A;  4MM3 A;  1LXD A;  3OLM D;  2KMA A;  3ML8 A;  3WAO A;  2JF5 A;  4RMA A;  4MGI E;  3QK0 A;  2K39 A;  2L7R A;  1WM2 A;  2BYF A;  1WR6 E;  2I1J A;  2KJ6 A;  2Z0D B;  2WX1 A; 
#chains in the Genus database with same CATH topology
 2KLG A;  3ZUN A;  1BUI C;  3N1Z C;  4YTP B;  2KMM A;  2JUO A;  2W9N A;  5DCN A;  2GRI A;  4W9H A;  1UEL A;  4EFO A;  4ICV A;  2RR9 A;  4XGA B;  2JWU A;  4KV2 A;  3UQB A;  2LVQ A;  2V3N A;  2INN E;  3A9K B;  4PS3 A;  4ZRJ A;  3RCZ A;  3A9J B;  1V6E A;  1J8C A;  2CJN A;  3NS8 A;  4HVB A;  1TS3 A;  2CHW A;  2KAN A;  2OJW A;  4B9K A;  4MGK E;  1OTR B;  2GBK A;  1TGZ B;  4C56 C;  2Z0E B;  3SEB A;  4BKS D;  1ET9 A;  2N1V A;  5CHF A;  1TKE A;  3AE7 B;  4YWG G;  4JGH B;  4BKS A;  1RM6 C;  1ZXI A;  4C80 A;  4BKG A;  2QSD A;  3PTF C;  2D3B A;  3Q14 C;  1FM0 D;  1N62 A;  2C7M B;  4GDK A;  5D94 A;  1MPE A;  1TKG A;  1TZO A;  2K3U A;  1Y8R C;  2L3Z A;  2KT7 A;  1FIQ A;  5AUI A;  1HEZ E;  3WCQ A;  2PLP A;  5IO9 A;  5IAA C;  2M19 A;  4FUL A;  1P3Q U;  3PLV A;  1EU3 A;  2RMM A;  3WAP A;  1VCB A;  3NZ3 A;  2DAJ A;  2MJD A;  1YQ4 B;  1HTQ A;  2VH2 A;  2OED A;  2PKO A;  2LAS A;  2XK5 B;  3FIL A;  1R4N B;  1STE A;  2D3C A;  4YXD B;  2QHO A;  1LQB A;  1EUV B;  4ZHO A;  5C23 A;  3QJZ A;  3QAR A;  3R7Q A;  4KGT A;  5BO4 B;  1D5M C;  4GDL A;  2V3S A;  1WXQ A;  2DZJ A;  3AXC A;  2G4D B;  4UDU C;  1UD7 A;  2PJH A;  2BWE S;  1T0Q C;  2KWC A;  3KVF B;  2KKC A;  5KHO A;  1GB4 A;  3PZ8 A;  1V8C A;  1FPY A;  1FNV A;  3T8M A;  3AEB B;  2Y5P A;  3Q8C A;  2DWQ A;  1TIF A;  3A33 B;  4OHJ A;  1C78 A;  2ICI A;  5FR6 A;  1IUE A;  1WRD B;  1WGD A;  3PT2 B;  1KOT A;  1L0V B;  1KH0 A;  1TTN A;  1ZKH A;  1V1P A;  3RT3 B;  2DAF A;  3VTW A;  2DEN B;  3H7P B;  3H9D A;  2L32 A;  3EFU A;  3VUX A;  5C1Z A;  4NQL B;  4EEW A;  2PVO D;  1S3S G;  2OJR A;  2KAJ A;  4KDL B;  2IND C;  3AH7 A;  2J52 A;  3A9J A;  1WXM A;  2B76 B;  1NDD A;  1JW9 D;  4GB9 A;  1UWM A;  5GXG B;  1L0X B;  4GLS C;  3KH0 A;  3GP7 A;  1QOB A;  2JXT A;  2J4X A;  3BYY B;  3AEC B;  3TMP B;  3GB1 A;  3KQ4 A;  1EM7 A;  3MC8 A;  1WE6 A;  4DHJ B;  1SF0 A;  2D10 A;  1E8W A;  2KK8 A;  3IHP C;  3LXF A;  3Q69 A;  3LYY A;  2LD9 A;  4OW0 A;  4W9J A;  3OG5 A;  2JWZ A;  1OEY J;  2MBE A;  4ZYS A;  1VJK A;  3KUC B;  1TBE A;  3BVM A;  2LVO A;  1QF6 A;  1GG3 A;  3P4Q B;  5J18 A;  3C8Y A;  4LNI A;  3QQ8 B;  1K8R B;  2DZK A;  2M0A A;  1E8Y A;  3AEF B;  2HE7 A;  3DVN U;  4MSM B;  3Q8F A;  4TKN A;  4MJS B;  1FFU A;  2DHZ A;  2WLB A;  1C4A A;  3B2F A;  3KYD D;  2OOB B;  1JRU A;  2BTE A;  2MQJ A;  1C77 A;  1T0R C;  3D32 A;  3H8H A;  4L23 A;  4PS8 A;  3M62 B;  2KAC A;  2WWZ A;  1D3Z A;  3Q3J A;  4OZA A;  4YTN B;  3V3X A;  5HI1 A;  1UUP A;  4IC7 B;  1ZGU B;  4DXA B;  3H6N A;  2BT6 A;  1WY8 A;  2MWS B;  1I4G A;  3NS1 A;  3TCA A;  1FXT B;  2KC2 A;  1CMX B;  3RZW C;  2QJL A;  4B6W A;  4C7Y A;  2GBM A;  4CYE A;  2UWQ A;  3KW5 B;  3SU8 X;  2GMI C;  1V9J A;  4TMA B;  3VQI A;  4F1S A;  3VFK A;  2CU3 A;  3RMK C;  1K53 A;  1WX8 A;  2BF8 B;  2FCS A;  5D2M B;  1F2R I;  3PHX B;  2IBI B;  2RDB C;  3PPA A;  3ZYY X;  2D3G A;  1G6J A;  3RNG C;  2V1Y A;  3DBH I;  1N61 A;  2NCN A;  1L2N A;  1IGD A;  1EU4 A;  3PLU A;  3W5V B;  3TEZ A;  1D4B A;  5G55 A;  1VDV A;  3PVL A;  4MH8 A;  2M17 A;  1N63 A;  4X57 B;  4II3 B;  1WJU A;  2G9H D;  4W9K A;  3APF A;  1MG4 A;  1EF1 A;  2WXJ A;  3ZJT A;  2PMV A;  5CHV C;  3U4E G;  2KDB A;  3CST A;  2BS3 B;  2KZR A;  4FBJ B;  2KVZ A;  2O6V D;  2N9L A;  2JX5 A;  3BY4 B;  5I4D A;  1Z5S B;  2O6V A;  2WXR A;  4K1R B;  3ZRC A;  1JRO A;  1MVK A;  2PEA A;  5E6N A;  2WXK A;  1GOZ A;  4HCN B;  2KVR A;  2O2V B;  3GS2 A;  5EDS A;  2QC8 A;  1AW7 A;  3AU5 A;  3IVF A;  3N20 C;  4MJS A;  4XDC A;  1ET6 A;  3DPD A;  2PIA A;  3SFD B;  3NVZ A;  3EGR A;  2L76 A;  2NPT A;  1IBX A;  1I4H A;  1SXT A;  2UU7 A;  3MHZ A;  3QC8 B;  5T8I A;  1YJ1 A;  3ZGZ A;  4PT5 A;  4GSW A;  2JQR B;  2D2Q A;  2ZCB A;  4KKJ A;  1XXG A;  1BT0 A;  1GNU A;  4FA6 A;  3ZLZ A;  4N9F 4;  2KFK A;  4TQ0 A;  4KSL C;  2UYZ B;  2IO0 B;  5AZF A;  4M01 A;  4BZA A;  4S17 A;  1VD2 A;  2J53 A;  3ZW3 A;  1SJH D;  2KO3 A;  2ZW0 A;  5FR3 A;  2WXP A;  3P4P B;  4BAX A;  1OFF A;  2LJI A;  2BYT A;  4K7W A;  2GLS A;  3NHE B;  4IM2 A;  5HHD G;  2I38 A;  4IDI A;  3WAL A;  3N32 A;  2BS4 B;  2WXM A;  1I4P A;  3TSS A;  1U4A A;  4A6Q A;  1GPX A;  5TSS A;  4MM3 A;  2WDR B;  2LHE A;  3MFG A;  2QCZ A;  2INC C;  3QK0 A;  2K39 A;  1C79 A;  1V1O A;  2K25 A;  3QIJ A;  4JPS A;  3UIO B;  5FKA C;  4KVG B;  1QOA A;  2PVG C;  4C4V A;  1A70 A;  3B2G A;  1FFV A;  4AUQ C;  2MHJ A;  3PS6 A;  2N9X A;  5G2N A;  1EF5 A;  2RDH A;  2LEK A;  2WQY B;  2M4N A;  3DQV A;  3JSV A;  2KTR A;  1C4C A;  1C4P A;  1RLF A;  5CTR C;  2ZVO A;  2VZK B;  1P1A A;  3A4S C;  3HM6 X;  1NI2 A;  3ECI A;  3IAS 1;  5BMH A;  3IFW B;  3H7S A;  4ANU A;  3MHS D;  1UZX B;  5BMG A;  2QMT A;  1XCQ L;  1C3T A;  1QZE A;  2C7H A;  3TIX A;  1WGY A;  1MHX A;  1QOG A;  2LUM A;  3V60 A;  1SE2 A;  2LXC A;  3Q8B A;  1VZ8 A;  5AEK B;  1TY0 A;  1WR1 A;  3Q6B A;  2N7D A;  2KQS A;  2D3A A;  3EUB 2;  2GBJ A;  3DBR I;  4MT5 A;  4AJY B;  2L52 A;  2RGF A;  1WFY A;  1LFD A;  2HTM E;  4DQO C;  3BK1 A;  1WE7 A;  2JXX A;  2ON8 A;  4ZRP A;  3UIP B;  1E7V A;  3BK2 A;  4RF1 A;  1K51 A;  1F77 A;  1P9D U;  4DDG D;  3HVZ A;  3ZXR A;  4HCP B;  4XDD A;  1TY2 A;  3RNA C;  3NRZ A;  4IWO A;  4NQK E;  2XN9 C;  1YJJ A;  2N9P C;  4HWI B;  1OEY A;  1XD3 B;  3A1Q A;  5AZH A;  2IGH A;  2R2O A;  2BBC A;  2DYM A;  2CU1 A;  1E10 A;  3B9J A;  4S0R A;  2IYD B;  3DOW A;  2AL3 A;  5H8Y E;  5JXV A;  2IDY A;  1KLV A;  4JIO U;  1HA5 A;  4MEL A;  4ZYN A;  1H8C A;  3BVG A;  1NEK B;  1TYG B;  1FNW A;  1WXV A;  2PE9 A;  2JRH A;  3PRP B;  1GAQ B;  2AQ1 B;  4RNA A;  3DHH C;  1YN4 A;  1R7S A;  5C3J B;  3CIR B;  3L17 A;  4ASW C;  1I35 A;  1TJE A;  4USA A;  2V4I B;  4L1B A;  1EWC A;  3QAQ A;  1CZP A;  3PO0 A;  1YQB A;  3R3M A;  2CHZ A;  3K9P B;  1IP9 A;  2KOX A;  2LXA A;  4LCD E;  2ZPY A;  4CQN A;  2IGG A;  2CJO A;  4HDO A;  1JAL A;  3VHT C;  5D3D A;  4H2A A;  2K22 A;  2MBO A;  1XT9 B;  2DX5 B;  3N30 A;  1MJD A;  4PYU A;  3NOB A;  2C60 A;  4DBG A;  2LMC A;  2WP9 B;  4G50 A;  3VDZ A;  2IPK D;  2C7N B;  1YX6 B;  2WX0 A;  2JZP A;  2XEW A;  3W2D A;  4URK A;  2J0J A;  1DOI A;  4LK0 M;  4RCO A;  4WUR A;  4NNJ B;  2Y3A A;  3UQA A;  2BPS A;  3MTN B;  2HJ1 A;  3QWZ B;  5EE3 A;  2PPH A;  1FXI A;  3LB8 C;  4CO7 A;  1E9M A;  1FRD A;  1Z2M A;  1E5W A;  5GMV A;  4AOF A;  3ZRF A;  2Z59 B;  3IT4 B;  2NS5 A;  1NYR A;  5JHB A;  2FUG 1;  2LFI A;  3AEA B;  4BBN C;  3W1S A;  2GBR A;  4WQO B;  2BW2 A;  3NVW A;  3M3J A;  1F1H A;  1P98 A;  1T0S C;  2I2Y A;  3GE8 C;  4W9G A;  3SFE B;  3E9S A;  2C9W B;  2KDI A;  5D7G A;  2ACZ B;  4LJO B;  4HEA 1;  3RFZ B;  1N5X A;  4RFB A;  2ASQ A;  4W9F A;  2EEL A;  4PS7 A;  4MDK E;  3TEY A;  4GGQ A;  1MI0 A;  3RN9 C;  1ZPS A;  4WH4 A;  2BWF A;  2WXL A;  1ZP0 B;  2LUE A;  3AE2 B;  3VH3 B;  3AB5 A;  1MHH E;  3VTU A;  3UGB B;  3V6E B;  1V81 A;  1E7U A;  2MJ3 A;  4WJP A;  3ZNZ B;  2WXO A;  3W1Y A;  1P7E A;  2IY0 B;  1WH3 A;  3IAM 1;  4C7Z A;  3ZXV A;  1YX5 B;  4KSK C;  2M0X A;  1D5X C;  3MJW A;  1DOX A;  4HPL B;  4JE3 B;  4M0W B;  3A9K A;  1SB3 C;  2G45 B;  1FRR A;  5J2R A;  4HJG E;  3DBH B;  4A3O A;  3RUI B;  4RGO S;  3N1Y C;  3RI7 C;  2N7J A;  3AEE B;  2JPH A;  4P16 A;  3FKY A;  1RFK A;  2IY1 B;  3ML9 A;  2INP E;  4BBN F;  2MX2 A;  1JWA D;  3Q3M C;  4HJK A;  1F9J A;  2ZJD A;  1TS4 A;  3AE6 B;  4NZL B;  2WDV B;  1UF0 A;  4JX1 C;  3PRM B;  4K81 A;  2LRU A;  3AED B;  2FID A;  1E6E B;  5JH5 C;  1V5T A;  4GMV A;  3Q2A C;  5BYQ A;  3IXS A;  5LNK 1;  4C00 A;  1GJZ A;  3NUH B;  3Q8E A;  3Q3O C;  2HTH A;  1T6B X;  4WJN A;  1E8Z A;  1JQ4 A;  4WAA A;  1L7Y A;  1OQQ A;  3NG0 A;  2RD0 A;  2Q5W D;  4JLC A;  5E6J A;  2XK5 A;  2KFJ A;  2ZPN A;  3L13 A;  4KX6 B;  4WAF A;  2G4S A;  3DWG C;  4M02 A;  4WWM A;  2D07 B;  3P2B A;  2ZEQ A;  2M56 B;  3V61 A;  4DWF A;  3DBS A;  3BYT B;  3EFC A;  2TSS A;  3PV1 A;  1WMH B;  1HZ6 A;  2AQ2 B;  2LGS A;  3P4S B;  3EEC A;  5G5G A;  1TZ1 A;  1J19 A;  3DHG C;  1YN5 A;  1JWB D;  1AYF A;  2MEK A;  1ZDX A;  5IP4 D;  2AX5 A;  1YQ3 B;  4EUT A;  4OVV A;  1H4R A;  3ZO5 B;  4NJ6 A;  4WJQ A;  2W82 A;  2V4L A;  3DWM A;  2JYT A;  2EKE C;  1XLQ A;  1WJ4 A;  5J17 A;  3H7P A;  3ZKJ C;  3WAN A;  3L08 A;  4DHZ B;  2L1A A;  2JSV X;  4A9A A;  1N5W A;  5DPT A;  3W9C B;  1HE8 A;  4FXC A;  4YSX B;  4R3D A;  3TEX A;  3OLM D;  2QIL A;  3WAO A;  1SIJ A;  2NTT A;  1AN8 A;  4LNN A;  3QHT A;  4P7I A;  1YNT E;  3HRD D;  1FCL A;  2Y5B B;  1OQY A;  4HKQ A;  1MG8 A;  1I4Q A;  1TKY A;  2D11 A;  4D2K A;  1NYQ A;  1XCT L;  2DYO A;  1JML A;  3KWL A;  4YTM B;  3TBL D;  4I6L B;  4DHJ D;  3PZ7 A;  2L83 A;  2VH1 A;  3ALB A;  5BMI A;  1XLN A;  5G5H A;  4DXF A;  4FHK A;  1HQR D;  4WQM A;  2KN4 A;  4LTU A;  2JRI B;  2J0M A;  1KJT A;  3ZDM C;  1LM8 B;  1UH6 A;  1Q1O A;  4EZL A;  3QX1 A;  3ZTC A;  2L8J A;  3S2A A;  1E7P B;  4IW0 A;  1OGW A;  2KLC A;  3C0R B;  4MH0 E;  2MJE A;  2X8X X;  3ENE A;  2DYB A;  2JYE A;  4YT0 B;  3I57 A;  3O65 B;  4FLH A;  2C5L C;  1CQV A;  2KN5 A;  2IO3 B;  2KWU B;  1I7H A;  3WIM A;  3DBR B;  2MP2 B;  1PYW D;  4IWP A;  3WAM A;  3SD5 A;  2LI5 A;  1ZXH A;  1ZE3 D;  2KDM A;  3ABV B;  2SEB D;  5HKH A;  4ANX A;  2WXI A;  1BML C;  3Q8A A;  3P42 A;  4EZJ A;  3EC8 A;  3LDZ E;  4TUU A;  3R2T A;  2J7Q B;  5EE0 A;  2A4Z A;  1UGM A;  4I6P A;  1PDX A;  4KGR A;  2WDT B;  1WX7 A;  4AWJ A;  4HKZ E;  4KIK B;  4XWT A;  1OQR A;  2NR2 A;  2H88 B;  4ICU A;  1HTO A;  3N3K B;  5JZE B;  2HDE A;  3PSE B;  2I1K A;  3J9C A;  1HXY D;  4GU2 A;  2KQ7 A;  5E6P A;  5CX3 A;  4BFR A;  4W9L A;  5D3I B;  3R7R A;  4XWW A;  1WZ0 A;  4LJP B;  1UGJ A;  1K52 A;  4XC2 A;  4RH6 A;  2ZZP B;  3FC4 A;  1K50 A;  4WWN A;  2K1F A;  3OJ3 A;  3U8Z A;  3PGE A;  1V86 A;  1C1Y B;  3RNB C;  1YD8 U;  2N1W A;  4US9 A;  1WGK A;  2FAZ A;  2GI9 A;  1WM3 A;  3HIZ A;  3A4R A;  4FHJ A;  2FCQ A;  3NVV A;  2ZVN A;  2KXJ A;  2W3S A;  3IG3 A;  3PRE A;  4F7Z A;  4IM3 A;  2LGY A;  4ZHP A;  2RSU A;  1IPG A;  2O2V A;  4E71 A;  2KX3 A;  1WGR A;  4LNK A;  1MFW A;  1V80 A;  4B95 A;  1ZOY B;  4QAY A;  1Q0W B;  3MP9 A;  3MC0 B;  3VRA B;  3URY A;  1A5R A;  2N9K A;  1GB1 A;  2YEP B;  3AI5 A;  2V0G A;  4GXB A;  1PGB A;  4ZRQ A;  4IWQ A;  1XLO A;  3T9L A;  1V97 A;  4CHK A;  2DBY A;  4IG7 B;  5BYR A;  4HPM B;  5AUK A;  4N59 A;  2BVC A;  4ACF A;  1J0G A;  2MBQ A;  1T3Q A;  3VAW A;  4P1C C;  2KX0 A;  3ZQ4 A;  4US8 A;  5E6O A;  3DBL I;  3R66 C;  1BXT A;  3LJ3 A;  3ZDT A;  1ZDV A;  2SAK A;  1QIL A;  3BIN A;  2AYO B;  3OAW A;  2R2Q A;  3GOE A;  3CWI A;  2QDF A;  1EO6 A;  2N9E B;  4PK1 A;  2L00 B;  4LLG M;  2PTL A;  2NBU A;  1ACC A;  2LRW A;  5JHA A;  4ARC A;  3AE9 B;  2YEP F;  2NVU I;  1WIA A;  3FIL B;  1WSP A;  4MGZ E;  4RGT A;  3CF6 E;  3IBE A;  3RD2 A;  1DOY A;  3RZF A;  4BVU C;  1FO4 A;  1YOV B;  1FEH A;  2WYQ A;  2CHX A;  2XBB C;  4A90 A;  4GDL B;  4TV3 A;  1PGX A;  1TS5 A;  4E3C A;  2VZK D;  4AJW A;  4ZRI A;  3TUO A;  3EHV A;  3ETR A;  3BII D;  4JL9 A;  4ANW A;  2LVP A;  3ZJU A;  5EE1 A;  4YSZ B;  1AAR A;  3HM3 A;  4I6N B;  1PQS A;  4II2 B;  1V5O A;  4P1B C;  4FN2 A;  4EOY A;  3SR6 A;  2RDG A;  4RM8 A;  2BB5 A;  2LGX A;  3NVY A;  4XZ4 A;  1D6E C;  1V1P B;  1X1M A;  2N7E A;  2K8H A;  3BZD B;  2E6X A;  1KLU D;  4O1N A;  1J7B A;  2K8C A;  1LO5 D;  2CS4 A;  1CK1 A;  2MRP A;  3NJT A;  1QT9 A;  4W9D A;  1L4D B;  1PFD A;  5H92 C;  1FMA D;  4HXD A;  4K7U A;  3TL5 A;  1RFA A;  1L0Y B;  3GZN I;  3P63 A;  1SBB B;  4DXG A;  3DHI C;  1I4X A;  1ZUD 2;  1LGR A;  1Y56 A;  2V9H A;  1L4Z B;  1N60 A;  3AUL A;  3PZD A;  3ZJV A;  1FXA A;  2ZW1 A;  3U7D A;  3KUD B;  3T3N A;  5TR5 A;  3KLS X;  2AQ3 B;  3AU4 A;  2B3A A;  1WF9 A;  4WIP A;  4E74 A;  3Q3F A;  4FJY A;  2BQQ A;  1J7C A;  4M8N A;  2J42 A;  2EMS A;  3VR9 B;  4XE0 A;  2FUH B;  3W5U B;  4A20 A;  3UF8 A;  1RAX A;  2M1M A;  3DVG X;  1ROE A;  5IKC M;  4GOC A;  2WXQ A;  3O13 A;  3L10 B;  2KWV B;  2YLM A;  2W3R A;  2FCM A;  4OZC A;  2DLB A;  3VXW A;  1HZ5 A;  1TT5 B;  1WX9 A;  1ISN A;  2KMC A;  3MJ5 A;  4HDQ A;  4BOS C;  3L16 A;  2LZ6 A;  2DNF A;  4FJV B;  4W9E A;  4F8C B;  2WXF A;  2NMQ A;  1WJ6 A;  4ITK A;  1C76 A;  4A8X C;  4BOZ B;  2BKF A;  2JT4 B;  3RUL A;  1R4M I;  2LHD A;  2K8B A;  1NBF C;  2JY6 A;  1S1Q B;  1SEB D;  1IYF A;  2CKH B;  1M4V A;  1F0Z A;  4OVU A;  1F2R C;  3MC9 A;  4ZOH C;  3KUZ A;  2L0T A;  3L0W B;  3NZS A;  1JCK B;  3N9Y C;  5CHW A;  1I4R A;  4Q2J A;  3R8B A;  1DYQ A;  2WXN A;  2WXG A;  2KJR A;  1PUT A;  2KMA A;  1P7F A;  4RMA A;  4MGI E;  2L7R A;  3C19 A;  1WR6 E;  1YN3 A;  4JWU C;  2Z0D B;  2WX1 A;  4YL8 A;  3VVW B;  3PHW B;  5MPO A;  2WDQ B;  5C2T B;  4P6V F;  2E3T A;  1SE3 A;  4A3P A;  4FJZ A;  1ZW7 A;  1SE4 A;  3VR8 B;  1UNS A;  2DZM A;  1KFY B;  3P1M A;  2AWT A;  1C9F A;  4AS1 A;  1VZ7 A;  1B9R A;  3M95 A;  3DCG A;  4NAW B;  2MA9 B;  2W54 A;  3NZU A;  5AZG A;  2JVC A;  1WZ3 A;  2NTS A;  2QIE B;  3VRB B;  4DHZ E;  3QA8 A;  4RGM A;  2EMT A;  4OZB A;  1XF5 L;  4MSQ B;  2K0P A;  2IO2 B;  1SE9 A;  2MBH A;  1NI3 A;  2NBV B;  1V49 A;  1RRB A;  3U2S C;  3ZVV A;  3B1L X;  2BYV E;  1WJN A;  4WWO A;  4KZC A;  2PE6 B;  1WYW B;  1UBI A;  2KYW A;  3I9V 1;  5BYS A;  3X23 A;  2LJ5 A;  2D5G A;  2MBB B;  1EWY C;  3ZTD A;  4RM9 A;  4TSS A;  4W9C A;  3HVD A;  2ONQ A;  3AE4 B;  2MH7 A;  4J6I A;  1JWS D;  3K9O B;  4G0N B;  3HK0 A;  2JU6 X;  4MAC A;  2LGI A;  3RYT A;  2O6V B;  3AE1 B;  4LDT B;  1FCC C;  2CR5 A;  4RGN A;  3B08 A;  5DPW A;  2AL6 A;  3HHM A;  4NY0 A;  1L6V A;  2GOW A;  2QEJ C;  1XEE A;  4AP4 C;  4K3C A;  1R4N I;  4XYC A;  3KWV A;  2NPT B;  1IBX B;  3UI3 A;  5D6J B;  2HJ8 A;  4PYZ A;  2WHI A;  2M8S A;  3CSF A;  4REZ A;  3HUI A;  4MEM A;  2MLB A;  3WA0 A;  4HPP A;  4L2Y A;  2BS2 B;  3AE3 B;  3SHQ A;  4M0W A;  1WXS A;  5HFY A;  2KFK B;  2JZZ A;  4B0E A;  1I42 A;  2LGD A;  2IZV B;  4LNO A;  3OWE B;  2EKI A;  2V3P A;  1CJE A;  2ZCC A;  4FAD A;  2KC1 A;  3T3O A;  1XLP A;  2K5P A;  3ZNG C;  3EA6 A;  5KHQ A;  2IO1 B;  3VTV A;  4GIV A;  2KTF A;  5LLI A;  4B0M A;  1IGC A;  4NAW A;  1VLB A;  1QKZ A;  3TEW A;  4EZK A;  1QOF A;  1JRP A;  3BVZ A;  2FCN A;  4J3O D;  4JQW C;  2RPV A;  4HRS A;  4MM3 B;  3JVZ X;  2KD0 A;  3ONS A;  1UBQ A;  3VUY A;  3CMM B;  2JZ3 B;  3DVG Y;  3AEG B;  4MGY E;  2PW9 A;  4W9I A;  2GB1 A;  1KF6 B;  4EKU A;  3PRZ A;  2FNJ B;  4C4V B;  2X38 A;  1GC7 A;  1E0Z A;  4M00 A;  2A5U A;  4BKT A;  3ZNH B;  1SJE D;  3JSV B;  3NY5 A;  2KTR B;  4K3B A;  2LWP A;  3R2I A;  4KGS A;  2BB6 A;  3AN1 A;  3OJ4 B;  4LDT D;  1RYJ A;  4ZDV A;  1WMH A;  2H89 B;  1RWS A;  3JW0 X;  3I3T B;  3Q3N C;  1QQR A;  4IUM B;  3I63 C;  3RNE C;  2N4F A;  1UWX A;  3V62 A;  1B1Z A;  2HD5 B;  2VRR B;  3JYU A;  5LXI B;  3SDL C;  2GBN A;  4TQ1 A;  1KTK A;  4NJ7 A;  2L05 A;  4WWP A;  4G3X B;  3APD A;  2YVC A;  3B0A A;  3DBL B;  5FK9 C;  1QLB B;  1KRH A;  4XX5 A;  1VZ6 A;  1XQQ A;  4IOI E;  2G1E A;  3N1X C;  3X0W A;  1T0Y A;  2IGD A;  3AE5 B;  2XNA C;  2WXH A;  3VUW A;  4KZ0 A;  2FIF A;  5HG2 A;  5EE9 A;  4OVZ A;  4IM0 A;  4EE2 A;  3TJP A;  4AQ7 A;  1WGH A;  2G3Q B;  4DDI D;  4JWS C;  4K7S A;  1ESF A;  1XO3 A;  3RNC C;  1ENF A;  2K6Q A;  1NVI D;  4DK5 A;  4ARI A;  3A1Q B;  2KDF B;  4G11 A;  3U7Z A;  2FE8 A;  2WNM A;  1JWU D;  3L54 A;  2MW5 A;  5IA7 A;  3GE3 C;  3P4R B;  3APC A;  4WJO A;  2K6D B;  4M8M A;  2N0S B;  1T5X D;  1GUA B;  1TS2 A;  1WYG A;  2KJH B;  3RNF C;  2WU5 B;  2WU2 B;  3AE8 B;  3DVN V;  4ANV A;  5L95 C;  3H1U A;  1J7A A;  4NJC A;  5DPS A;  3V05 A;  1D5Z C;  2J0K A;  4HLE A;  1WXA A;  2KDE B;  1FNU A;  2MCN B;  2KQ4 X;  2MP2 A;  1L5P A;  3UIN B;  2AEH A;  3AM9 A;  3GZN B;  2BYE A;  1VR9 A;  4KDI C;  2OHF A;  1YJI A;  4IKG A;  2R61 A;  5L83 A;  1E8X A;  1WWT A;  4ZRK A;  1M94 A;  1KM7 A;  1JWM D;  1SGH A;  1PGA A;  1YMH E;  2BKR B;  5IN7 A;  1N6Z A;  3L4P A;  4A55 A;  2Z8L A;  1P0R A;  5LXH A;  1VRA B;  2ZNV C;  4N58 A;  4KIK A;  1KLG D;  2REX A;  3AMZ A;  2DZI A;  2KHW B;  3QCA A;  1SIF A;  2Y5C A;  3W1S C;  2WS3 B;  4GDK B;  1F52 A;  4N6E B;  3VH4 B;  3AV8 A;  2BGF A;  1WGG A;  3E56 A;  2MSE D;  2ZNV B;  1FD6 A;  3FAH A;  2WGS A;  3ZIM A;  3M63 B;  1R4M B;  2FBW B;  1L6U A;  1YIW A;  2W55 A;  1GC6 A;  4LNF A;  3U30 A;  4HRO A;  2RPQ A;  3ZNI D;  1AWD A;  2NBW B;  1Q10 A;  3U52 E;  4NPN A;  3KYC D;  1Q5W B;  4HK2 A;  4GN1 A;  1DGJ A;  1V2Y A;  3I5J C;  2K9X A;  4NAM A;  4YSY B;  1WI0 A;  1SSN A;  5IOI A;  5DPR A;  2L0F A;  3DDC B;  2KNB A;  2KWD A;  3V6C B;  3RPF C;  3BWU D;  2IJ0 A;  1E90 A;  1LXD A;  1NEN B;  3ML8 A;  2JF5 A;  3IT6 B;  4KKI A;  1WM2 A;  2BYF A;  1WRI A;  2I1J A;  4RF0 A;  2KJ6 A; 
#chains in the Genus database with same CATH homology
 2K25 A;  3QHT A;  4YL8 A;  4P7I A;  3VVW B;  2Y5B B;  3QIJ A;  3PHW B;  2KLG A;  1OQY A;  3UIO B;  3ZUN A;  1MG8 A;  2D11 A;  4KVG B;  2JUO A;  2W9N A;  4A3P A;  4FJZ A;  5DCN A;  1ZW7 A;  2DYO A;  4W9H A;  4AUQ C;  1UEL A;  4EFO A;  3PS6 A;  3TBL D;  2N9X A;  4I6L B;  2DZM A;  4DHJ D;  5G2N A;  1EF5 A;  2AWT A;  3ALB A;  4ICV A;  3M95 A;  2RR9 A;  4FHK A;  2M4N A;  3DQV A;  3JSV A;  2KTR A;  3DCG A;  4NAW B;  2MA9 B;  3NZU A;  4KV2 A;  2JRI B;  5AZG A;  3UQB A;  2LVQ A;  1RLF A;  2J0M A;  2JVC A;  1WZ3 A;  5CTR C;  1KJT A;  3ZDM C;  2ZVO A;  1LM8 B;  1P1A A;  4DHZ E;  1UH6 A;  1Q1O A;  4EZL A;  3A4S C;  3HM6 X;  3QA8 A;  3QX1 A;  3A9K B;  2L8J A;  4PS3 A;  3ZTC A;  3S2A A;  1NI2 A;  3ECI A;  4ZRJ A;  2EMT A;  3RCZ A;  4IW0 A;  3IFW B;  1OGW A;  3A9J B;  1V6E A;  3H7S A;  2KLC A;  4ANU A;  3MHS D;  3NS8 A;  2MBH A;  1UZX B;  1SE9 A;  2IO2 B;  4MSQ B;  4HVB A;  3C0R B;  4MH0 E;  2CHW A;  2KAN A;  4B9K A;  1C3T A;  4MGK E;  2NBV B;  1OTR B;  2GBK A;  1V49 A;  3ENE A;  1QZE A;  2C7H A;  2DYB A;  1RRB A;  1TGZ B;  3TIX A;  1WGY A;  2Z0E B;  3ZVV A;  4BKS D;  3V60 A;  3B1L X;  2N1V A;  2BYV E;  5CHF A;  1WJN A;  3O65 B;  4FLH A;  4WWO A;  4KZC A;  2C5L C;  2PE6 B;  4JGH B;  1WYW B;  2KN5 A;  4BKS A;  1UBI A;  2LXC A;  2IO3 B;  2KWU B;  3WIM A;  5AEK B;  4BKG A;  1WR1 A;  2LJ5 A;  3X23 A;  2N7D A;  2KQS A;  3PTF C;  2MP2 B;  2MBB B;  3ZTD A;  2GBJ A;  4IWP A;  4RM9 A;  3WAM A;  3DBR I;  4W9C A;  2C7M B;  4GDK A;  2LI5 A;  3SD5 A;  4J6I A;  5D94 A;  3K9O B;  4AJY B;  2RGF A;  4G0N B;  2L3Z A;  1WFY A;  1LFD A;  1Y8R C;  3HK0 A;  1WE7 A;  2JXX A;  5IAA C;  3RYT A;  3UIP B;  1E7V A;  4FUL A;  1P3Q U;  3PLV A;  2O6V B;  3WAP A;  4LDT B;  2CR5 A;  1VCB A;  5HKH A;  1P9D U;  2DAJ A;  4ANX A;  3B08 A;  4DDG D;  5DPW A;  2AL6 A;  3HHM A;  4HCP B;  4EZJ A;  3EC8 A;  3LDZ E;  4NY0 A;  4TUU A;  2GOW A;  4IWO A;  4NQK E;  2J7Q B;  2LAS A;  2A4Z A;  2XK5 B;  2N9P C;  4AP4 C;  1UGM A;  4HWI B;  4I6P A;  1OEY A;  1XD3 B;  1R4N I;  3A1Q A;  2WDT B;  5AZH A;  1WX7 A;  2QHO A;  1LQB A;  2NPT B;  1EUV B;  2R2O A;  4AWJ A;  5C23 A;  2DYM A;  3QJZ A;  4KIK B;  2CU1 A;  5D6J B;  3QAR A;  2HJ8 A;  3R7Q A;  4PYZ A;  2M8S A;  5BO4 B;  3CSF A;  4GDL A;  2V3S A;  2NR2 A;  2DZJ A;  4MEM A;  2IYD B;  2MLB A;  3AXC A;  4ICU A;  3WA0 A;  3DOW A;  2AL3 A;  2G4D B;  1UD7 A;  3N3K B;  2PJH A;  4JIO U;  5JZE B;  2BWE S;  1KLV A;  2KWC A;  4MEL A;  4ZYN A;  3SHQ A;  3PSE B;  2I1K A;  1WXS A;  3KVF B;  1H8C A;  2KKC A;  2KFK B;  4GU2 A;  2KQ7 A;  5E6P A;  5KHO A;  5CX3 A;  2JZZ A;  4BFR A;  3T8M A;  1I42 A;  1WXV A;  2LGD A;  2IZV B;  2PE9 A;  4W9L A;  2JRH A;  3A33 B;  3R7R A;  2ZCC A;  1WZ0 A;  4LJP B;  3PRP B;  4FAD A;  2KC1 A;  5FR6 A;  3L17 A;  1WRD B;  1WGD A;  3PT2 B;  3ZNG C;  4XC2 A;  4ASW C;  1I35 A;  1KOT A;  5KHQ A;  2IO1 B;  3VTV A;  4GIV A;  1TTN A;  2ZZP B;  1ZKH A;  2KTF A;  3RT3 B;  2DAF A;  3VTW A;  5LLI A;  2DEN B;  3H7P B;  4WWN A;  3H9D A;  2K1F A;  4NAW A;  3OJ3 A;  3EFU A;  3U8Z A;  3VUX A;  3QAQ A;  4NQL B;  4EEW A;  5C1Z A;  4EZK A;  3PGE A;  1V86 A;  1S3S G;  1C1Y B;  1YQB A;  2FCN A;  1YD8 U;  2OJR A;  3R3M A;  4JQW C;  2CHZ A;  2N1W A;  3K9P B;  1IP9 A;  2KOX A;  2LXA A;  4LCD E;  2FAZ A;  2ZPY A;  4KDL B;  3JVZ X;  2KD0 A;  1WM3 A;  3ONS A;  3A9J A;  1WXM A;  4HDO A;  3HIZ A;  1UBQ A;  3VHT C;  1NDD A;  3A4R A;  4FHJ A;  2FCQ A;  2MBO A;  1XT9 B;  2ZVN A;  2KXJ A;  3IG3 A;  3PRE A;  4GB9 A;  2DX5 B;  3VUY A;  4F7Z A;  3N30 A;  3CMM B;  4PYU A;  2JZ3 B;  3DVG Y;  3NOB A;  4IM3 A;  2C60 A;  2LGY A;  4DBG A;  4MGY E;  2RSU A;  1IPG A;  3KH0 A;  4W9I A;  4G50 A;  3VDZ A;  4EKU A;  3PRZ A;  2FNJ B;  2C7N B;  1GC7 A;  1YX6 B;  2O2V A;  4E71 A;  2KX3 A;  2WX0 A;  1WGR A;  2XEW A;  3TMP B;  1V80 A;  2A5U A;  4B95 A;  4BKT A;  4URK A;  1Q0W B;  2J0J A;  3ZNH B;  1A5R A;  3JSV B;  1WE6 A;  3NY5 A;  2KTR B;  2LWP A;  4NNJ B;  4DHJ B;  3AI5 A;  3UQA A;  2D10 A;  2BPS A;  3MTN B;  3QWZ B;  1E8W A;  2KK8 A;  3OJ4 B;  3IHP C;  4GXB A;  4LDT D;  2PPH A;  1WMH A;  4IWQ A;  4ZDV A;  2LD9 A;  3JW0 X;  4W9J A;  3I3T B;  4IUM B;  4CO7 A;  1Z2M A;  2JWZ A;  3T9L A;  1E5W A;  2N4F A;  5GMV A;  1OEY J;  2MBE A;  4AOF A;  4CHK A;  3ZRF A;  4IG7 B;  2Z59 B;  3KUC B;  3V62 A;  4HPM B;  2HD5 B;  2VRR B;  1TBE A;  3JYU A;  5LXI B;  2NS5 A;  3SDL C;  5JHB A;  2GBN A;  1J0G A;  2LVO A;  2MBQ A;  4TQ1 A;  4BBN C;  1GG3 A;  3W1S A;  2GBR A;  5J18 A;  3QQ8 B;  4WQO B;  4NJ7 A;  1K8R B;  2L05 A;  4WWP A;  3VAW A;  2DZK A;  1E8Y A;  4G3X B;  3M3J A;  2KX0 A;  3APD A;  1P98 A;  2HE7 A;  2YVC A;  3DVN U;  4MSM B;  3B0A A;  4TKN A;  4W9G A;  4MJS B;  2DHZ A;  2C9W B;  2KDI A;  5D7G A;  5E6O A;  3DBL I;  3KYD D;  4LJO B;  2OOB B;  1JRU A;  3R66 C;  2MQJ A;  4XX5 A;  1XQQ A;  3D32 A;  3LJ3 A;  3ZDT A;  2ASQ A;  3BIN A;  4W9F A;  3X0W A;  4PS7 A;  4MDK E;  4PS8 A;  2AYO B;  1T0Y A;  4GGQ A;  3OAW A;  2R2Q A;  3M62 B;  2BWF A;  3GOE A;  2LUE A;  1EO6 A;  2WWZ A;  3VUW A;  2N9E B;  4KZ0 A;  1D3Z A;  3Q3J A;  2FIF A;  2L00 B;  3VH3 B;  2NBU A;  4IM0 A;  3VTU A;  2LRW A;  3TJP A;  3UGB B;  3V6E B;  1WGH A;  2G3Q B;  4DDI D;  5JHA A;  2NVU I;  1V81 A;  1E7U A;  1WIA A;  1ZGU B;  4IC7 B;  4K7S A;  4DXA B;  4MGZ E;  4WJP A;  3H6N A;  3ZNZ B;  3CF6 E;  2K6Q A;  3W1Y A;  4DK5 A;  3IBE A;  3RD2 A;  3RZF A;  4BVU C;  3A1Q B;  1WY8 A;  2KDF B;  2MWS B;  2IY0 B;  4G11 A;  3TCA A;  1WH3 A;  1FXT B;  2KC2 A;  1CMX B;  3RZW C;  4B6W A;  2WYQ A;  1YX5 B;  2CHX A;  2GBM A;  4CYE A;  2XBB C;  2UWQ A;  3KW5 B;  2MW5 A;  3L54 A;  4KSK C;  2GMI C;  4GDL B;  4TV3 A;  3SU8 X;  4E3C A;  2M0X A;  5IA7 A;  4WJO A;  3APC A;  2K6D B;  3MJW A;  1V9J A;  3VQI A;  4M8M A;  4F1S A;  4AJW A;  4ZRI A;  3VFK A;  3EHV A;  4JL9 A;  1GUA B;  4ANW A;  4HPL B;  2LVP A;  1WX8 A;  2BF8 B;  4M0W B;  2FCS A;  5D2M B;  3PHX B;  2KJH B;  3A9K A;  2G45 B;  2IBI B;  1AAR A;  5J2R A;  3PPA A;  4A3O A;  3RUI B;  3HM3 A;  4I6N B;  2D3G A;  1PQS A;  4II2 B;  1G6J A;  2V1Y A;  1V5O A;  3DBH I;  3DVN V;  4FN2 A;  2JPH A;  4ANV A;  5L95 C;  2IY1 B;  3H1U A;  2NCN A;  3ML9 A;  1L2N A;  4EOY A;  4BBN F;  4RM8 A;  2LGX A;  3PLU A;  5DPS A;  2MX2 A;  4XZ4 A;  5G55 A;  2J0K A;  4HLE A;  1WXA A;  3PVL A;  1X1M A;  4HJK A;  1F9J A;  2ZJD A;  2N7E A;  2K8H A;  2M17 A;  4X57 B;  2KDE B;  3PRM B;  4II3 B;  1WJU A;  4K81 A;  2MCN B;  4W9K A;  3APF A;  2LRU A;  2K8C A;  1EF1 A;  2CS4 A;  2MP2 A;  2MRP A;  2FID A;  5CHV C;  2KDB A;  5JH5 C;  1V5T A;  3CST A;  4GMV A;  3UIN B;  4W9D A;  2AEH A;  4FBJ B;  2KZR A;  2BYE A;  4HXD A;  4K7U A;  3TL5 A;  1RFA A;  4KDI C;  2O6V D;  1GJZ A;  3GZN I;  3BY4 B;  5L83 A;  1E8X A;  1Z5S B;  2HTH A;  4WJN A;  2O6V A;  1E8Z A;  4ZRK A;  3AUL A;  4K1R B;  1M94 A;  3PZD A;  1KM7 A;  4WAA A;  3ZRC A;  1L7Y A;  2PEA A;  3U7D A;  5E6N A;  3KUD B;  1SGH A;  5TR5 A;  3AU4 A;  2B3A A;  1WF9 A;  2BKR B;  2KVR A;  2RD0 A;  4HCN B;  2O2V B;  4E74 A;  3Q3F A;  4FJY A;  4JLC A;  2XK5 A;  2KFJ A;  2ZPN A;  5EDS A;  3AU5 A;  4M8N A;  3IVF A;  3L13 A;  2EMS A;  4MJS A;  1P0R A;  2FUH B;  3DPD A;  1J8C A;  2G4S A;  4A20 A;  3UF8 A;  1RAX A;  2D07 B;  2M1M A;  3DVG X;  2ZEQ A;  3P2B A;  5LXH A;  2L76 A;  2NPT A;  4GOC A;  2ZNV C;  3V61 A;  3L10 B;  2KWV B;  2YLM A;  4KIK A;  2FCM A;  2REX A;  4DWF A;  3DBS A;  3VXW A;  2DZI A;  2KHW B;  3PV1 A;  1WMH B;  1WX9 A;  1SIF A;  3QCA A;  3QC8 B;  3W1S C;  3EEC A;  1TZ1 A;  4GDK B;  1YJ1 A;  3VH4 B;  1ISN A;  2KMC A;  4HDQ A;  4GSW A;  4BOS C;  1J19 A;  2BGF A;  3L16 A;  2D2Q A;  2LZ6 A;  2ZCB A;  1WGG A;  4FJV B;  1BT0 A;  1GNU A;  2MSE D;  2ZNV B;  4FA6 A;  3ZLZ A;  4N9F 4;  2KFK A;  4W9E A;  4TQ0 A;  4F8C B;  4KSL C;  2UYZ B;  2IO0 B;  5AZF A;  1WJ6 A;  3ZIM A;  4EUT A;  4OVV A;  3M63 B;  1H4R A;  3ZO5 B;  4NJ6 A;  2BKF A;  1VD2 A;  4WJQ A;  3ZW3 A;  4BOZ B;  2JT4 B;  3RUL A;  1YIW A;  2KO3 A;  1R4M I;  2K8B A;  2V4L A;  1NBF C;  2JY6 A;  1GC6 A;  1S1Q B;  2EKE C;  3U30 A;  1WJ4 A;  2RPQ A;  5J17 A;  1IYF A;  2CKH B;  3ZNI D;  2NBW B;  4K7W A;  3H7P A;  3NHE B;  4NPN A;  3KYC D;  3ZKJ C;  4IM2 A;  4OVU A;  1Q5W B;  4HK2 A;  4GN1 A;  3L08 A;  3WAN A;  3KUZ A;  2L0T A;  4DHZ B;  1V2Y A;  3L0W B;  3WAL A;  3N32 A;  1WI0 A;  3NZS A;  5DPT A;  1HE8 A;  5DPR A;  2L0F A;  3DDC B;  5CHW A;  2KNB A;  1U4A A;  3V6C B;  1E90 A;  2KJR A;  4MM3 A;  1LXD A;  3OLM D;  2KMA A;  3ML8 A;  3WAO A;  2JF5 A;  4RMA A;  4MGI E;  3QK0 A;  2K39 A;  2L7R A;  1WM2 A;  2BYF A;  1WR6 E;  2I1J A;  2KJ6 A;  2Z0D B;  2WX1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...