2DAFA

Solution structure of the novel identified ubiquitin-like domain in the human hypothetical protein flj35834
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human Hypothetical Protein FLJ35834
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords FLJ35834 protein
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dafA01
2WX1A 2KJHB 4KVGB 1R4MI 1TGZB 2LUEA 2ZPYA 3O65B 2I1KA 1E7UA 2MW5A 4WWOA 4EZJA 5BO4B 5D7GA 4NAWA 2LVPA 2JY6A 2JUOA 1GG3A 2BYEA 4HLEA 2W9NA 3WAOA 2IO3B 4GMVA 5LLIA 3ZTDA 1YD8U 3Q3JA 1ZGUB 3T9LA 2K6DB 3H1UA 2KANA 5LXHA 2EMSA 4W9HA 4XX5A 2WYQA 1KLVA 4HXDA 3ONSA 1WZ0A 4K7SA 2O2VA 3VDZA 2KC1A 1FXTB 2KLCA 4G11A 1V2YA 5D6JB 1G6JA 3VQIA 1C1YB 2LVQA 4IC7B 3HHMA 1I35A 2QHOA 3ZIMA 3RCZA 2KTRB 2OOBB 4J6IA 3TCAA 3PS6A 4XC2A 5FR6A 5E6OA 4WJNA 3VFKA 2BF8B 1V5OA 2JF5A 2KO3A 2L00B 2NBUA 3N30A 3VTWA 4DXAB 1Z5SB 4W9EA 2KX3A 1PQSA 1WXMA 4JIOU 2GBNA 2NBVB 2RR9A 1IPGA 4GSWA 3DDCB 4FHJA 2NVUI 1WXVA 2M4NA 4AJWA 3EHVA 2YVCA 1EO6A 3R7RA 2YLMA 3HIZA 4MDKE 2JRHA 1A5RA 5J18A 1WGRA 4MH0E 2AL6A 1XT9B 4W9JA 2AWTA 3DPDA 5C1ZA 4HDOA 3RYTA 4FA6A 4IM2A 2RPQA 2JZ3B 3GOEA 2KNBA 3ECIA 4BKGA 3TJPA 2IO0B 4AJYB 2N9XA 3HM3A 4IM0A 2V3SA 4KSLC 3A4RA 4DDGD 2DHZA 3RD2A 2KDFB 4KZCA 4IG7B 5KHOA 2V1YA 1E90A 4B6WA 4E3CA 3VVWB 4W9LA 2PE6B 2L0TA 4XZ4A 1V9JA 4G0NB 2IYDB 2O2VB 3PT2B 3PPAA 4JL9A 2K8CA 2KDIA 4HDQA 2KLGA 4WJOA 2NCNA 2M8SA 3QCAA 4MJSB 4EKUA 3DBLI 4LJPB 3LDZE 2ASQA 5DPSA 1VCBA 4PS3A 5JHAA 2N1VA 4W9FA 1WRDB 4W9CA 4HVBA 1J0GA 1NI2A 1WM2A 3DBSA 2CS4A 1L2NA 5CHFA 1WXAA 3JVZX 4WWPA 2KD0A 4ASWC 2KJ6A 1OTRB 4MELA 4IUMB 4ZRJA 3DVNU 3X0WA 3PLVA 1VD2A 1UH6A 3JYUA 2LRWA 3KUDB 4N9F4 1C3TA 2KMAA 3APDA 3ZTCA 4ICVA 5L83A 1F9JA 3TBLD 2LRUA 1WX7A 3RULA 3VAWA 2ZNVB 4AWJA 2MCNB 5AZHA 3OLMD 5G2NA 2NBWB 1ZW7A 1R4NI 2M17A 4GDKA 1L7YA 2K8BA 2KWUB 4LDTB 2N4FA 1KM7A 1JRUA 4WQOB 4A3PA 3U8ZA 4TQ0A 1WX8A 3N32A 4KIKA 2L05A 3ZDMC 2AL3A 2BWES 2NPTB 4ANUA 2L76A 2VRRB 2XK5B 4IM3A 4NQKE 2N9PC 3V6CB 3SHQA 3A4SC 3NZSA 4FHKA 3L10B 3IG3A 4FJYA 3AU4A 3CMMB 2C60A 3B1LX 3QQ8B 5E6PA 1E5WA 2DYMA 4NJ7A 4BKSA 1WE6A 2RD0A 2EKEC 4MGIE 3H7PB 3R66C 3V62A 2CHXA 1GJZA 5JH5C 3M3JA 4AUQC 2JWZA 1WJUA 4W9GA 2MSED 4MGYE 4BOZB 2Y5BB 3ML8A 1UGMA 2D07B 1V81A 5DPWA 1KJTA 2NR2A 3VUWA 5LXIB 4I6LB 1XD3B 3UQAA 3NZUA 3Q3FA 2CHWA 3QHTA 3PRZA 4OVUA 3ZKJC 5DCNA 2LVOA 2JRIB 3KW5B 1RRBA 3K9PB 2WDTB 3DBRI 2MP2A 3AU5A 3T8MA 4MEMA 2KK8A 4EFOA 2ZNVC 4LCDE 3VUXA 2BKFA 2KZRA 4DHZB 2C7MB 4BOSC 2MBOA 2K6QA 3UF8A 3VTVA 5KHQA 1M94A 4WJPA 2KFKB 4HJKA 3SDLC 2L8JA 2LWPA 2B3AA 4PS7A 2G4SA 2DYOA 3QK0A 4BKTA 2KHWB 3DVNV 2MBQA 5AEKB 5CHWA 4BBNC 3W1SA 1Q1OA 4FLHA 4EOYA 1OQYA 1WX9A 3JSVA 4OVVA 2K39A 2D2QA 2KX0A 2LGXA 3DVGX 2EMTA 3VH3B 3ZUNA 4NQLB 4DHJD 3NS8A 1E7VA 3DBHI 2AEHA 1E8ZA 3U7DA 1QZEA 1YIWA 4MGKE 4RMAA 4ZYNA 1P0RA 3DOWA 3CSFA 2LJ5A 3A1QA 3VXWA 3ZO5B 2O6VB 3LJ3A 3PRMB 4I6NB 4CHKA 3QX1A 2MWSB 2LASA 3QC8B 3EECA 3KUCB 2K1FA 2DENB 2WWZA 1WXSA 1YQBA 1WIAA 1AARA 2PPHA 2JXXA 2KWCA 2Z59B 2BKRB 2D10A 5JHBA 2KXJA 4HPLB 2DX5B 1T0YA 3WANA 3AULA 3L16A 3UIPB 2FCQA 1IYFA 5TR5A 3ML9A 1WGDA 2FIFA 3I3TB 2KKCA 1D3ZA 4W9IA 4AOFA 3A33B 4IW0A 4BFRA 1WGGA 2JVCA 3EFUA 2LGYA 2K8HA 2FIDA 3PZDA 2LXAA 3A9JB 3H7SA 1H4RA 1WFYA 3TMPB 4RM8A 2MRPA 4LJOB 1E8WA 3NOBA 1LQBA 4P7IA 1UELA 3EC8A 4TQ1A 2MQJA 4DHZE 2KFJA 2WX0A 2FCNA 1E8YA 2MLBA 4IWOA 5J2RA 1U4AA 2LD9A 2DZKA 3RUIB 3AXCA 2FCSA 4BKSD 5DPTA 3L08A 1WR6E 2KWVB 5AZFA 4HPMB 2ZZPB 1J19A 2KC2A 1H8CA 2V4LA 1KOTA 3QJZA 3B0AA 2LXCA 5AZGA 3S2AA 5IA7A 3ENEA 4A20A 3ZW3A 4IWQA 5G55A 1Z2MA 2IO1B 2O6VA 3UGBB 4BBNF 1WZ3A 2GMIC 4JLCA 3R7QA 2PJHA 4ANVA 4EZKA 3UQBA 2CR5A 3PGEA 1V6EA 2UYZB 2N7EA 2GBRA 4FULA 4KV2A 2NS5A 1V5TA 2R2QA 4ICUA 2CKHB 5L95C 4WAAA 2HTHA 4GOCA 2G3QB 3B08A 4M8NA 2MA9B 3IHPC 2UWQA 3MJWA 3DCGA 5GMVA 4FN2A 1OEYJ 3HK0A 1WM3A 5CX3A 3W1YA 2L3ZA 4M8MA 3MTNB 2BYVE 4PS8A 1X1MA 3ZRCA 1WJ6A 4II3B 1ZKHA 2G4DB 3NHEB 2MX2A 3A9JA 3MHSD 3AI5A 2K25A 3C0RB 4CO7A 2KQ7A 2LGDA 3KVFB 2XEWA 2XK5A 3ZNHB 3WA0A 4B9KA 1GUAB 4ZRIA 1RLFA 4B95A 1LFDA 2RGFA 4NPNA 2J0MA 4FJZA 4II2B 1P1AA 4YL8A 4IWPA 3TL5A 2IBIB 3KH0A 2BWFA 2ZPNA 3WALA 4HK2A 1LXDA 4KSKC 4NAWB 3KYDD 3GZNI 3L54A 2DZMA 3HM6X 3PHXB 3L17A 1EUVB 2IO2B 2ZJDA 3RZWC 4DK5A 2KDEB 3ALBA 2JT4B 4HWIB 4W9KA 4MGZE 1GNUA 1OGWA 3IFWB 3WAMA 2KTFA 4LDTD 3DQVA 4G3XB 4WWNA 3RZFA 3A9KA 4X57B 3V61A 1NBFC 4ZRKA 2KN5A 4FBJB 4GB9A 2BYFA 3DVGY 4PYUA 1YJ1A 1WMHB 2KOXA 1RAXA 4EEWA 3KYCD 1EF5A 1K8RB 2KFKA 2C9WB 2ZCBA 1S3SG 1WGYA 2KJRA 3IBEA 4DHJB 4CYEA 1V80A 1WE7A 1V86A 1RFAA 2CHZA 4JGHB 2A5UA 4NJ6A 2L0FA 1YX6B 3H9DA 5EDSA 1GC6A 3QAQA 2RSUA 4GDKB 4EZLA 1E8XA 2N7DA 3PTFC 3NY5A 3OAWA 1J8CA 4KZ0A 1ISNA 4JQWC 1SIFA 1TBEA 4PYZA 2AYOB 2N1WA 2PEAA 2ZVOA 3QARA 4GIVA 4MSQB 3WIMA 4ANXA 3QA8A 4ZDVA 2IY1B 1UBIA 3U30A 1WI0A 2FNJB 3ZVVA 2I1JA 1V49A 2LI5A 2FUHB 2NPTA 1HE8A 1P98A 3V60A 1NDDA 2ZEQA 3QIJA 4DDID 2O6VD 2J7QB 3WAPA 3JW0X 1SGHA 2D11A 2L7RA 4E71A 5HKHA 4I6PA 1I42A 4GN1A 4K7UA 2PE9A 3W1SC 2CU1A 2DYBA 2HD5B 4F8CB 4F7ZA 2FCMA 3M62B 2D3GA 3PRPB 5DPRA 3CF6E 2XBBC 3ZRFA 4FADA 2GBKA 3L13A 3H7PA 5D94A 4G50A 4K7WA 1YX5B 4MM3A 1GC7A 3X23A 4GDLA 3VH4B 3APFA 2HE7A 1P9DU 2Z0EB 1UZXB 3PREA 2Z0DB 2MBHA 3N3KB 2REXA 4RM9A 5C23A 1WY8A 1WMHA 4MJSA 4NNJB 3TIXA 4URKA 2C7HA 2OJRA 3M95A 3VUYA 4HCNB 4TKNA 1OEYA 1TZ1A 1UD7A 2MP2B 4ANWA 1SE9A 1WR1A 4KDIC 1Y8RC 2C5LC 2DAJA 1WGHA 4HCPB 4W9DA 3R3MA 2J0JA 3BY4B 1UBQA 2LZ6A 3ZNGC 3V6EB 1MG8A 1XQQA 2MBEA 1LM8B 2GOWA 4EUTA 4GXBA 4A3OA 3VTUA 5CTRC 2BPSA 3PVLA 4GU2A 4BVUC 3QWZB 5JZEB 3UIOB 3SD5A 3KUZA 3M63B 2DAFA 4WJQA 5J17A 5IAAC 1BT0A 4GGQA 2JZZA 1WF9A 1P3QU 2FAZA 2IZVB 3OJ4B 3PSEB 4M0WB 3ZDTA 3BINA 3JSVB 4TUUA 2N9EB 2KVRA 2HJ8A 4TV3A 2ZCCA 3H6NA 5CHVC 2IY0B 3PLUA 2KQSA 3ZNID 2ZVNA 3K9OB 2DZIA 2G45B 2GBJA 3RT3B 4MSMB 2DZJA 2JPHA 2R2OA 3A1QB 4K81A 1S1QB 1CMXB 1WJ4A 4K1RB 1WYWB 2A4ZA 3PHWB 3VHTC 2KTRA 4FJVB 4GDLB 2BGFA 1Q5WB 5E6NA 3APCA 3OJ3A 3PV1A 3ZNZB 4F1SA 4NY0A 4E74A 3CSTA 1TTNA 3SU8X 1WJNA 1WH3A 1IP9A 4AP4C 1Q0WB 4DWFA 1EF1A 2C7NB 5D2MB 3A9KB 2GBMA 2M0XA 3P2BA 2KMCA 4DBGA 2J0KA 3IVFA 2KDBA 2M1MA 2MBBB 3D32A 3L0WB 3ZLZA 4KIKB 4KDLB 3UINB
chains in the Genus database with same CATH superfamily
1R4MI 2WLBA 2LUEA 5FKAC 2ZPYA 2MW5A 4PK1A 4NAWA 2LVPA 4HLEA 3J9CA 2V3PA 2X38A 4RGMA 3GS2A 5LLIA 3ZTDA 3T9LA 4ACFA 2K6DB 1VRAB 1ZUD2 2JSVX 5LXHA 3DHGC 3GE3C 4HXDA 1JQ4A 1V2YA 3EGRA 1C1YB 2M56B 2LVQA 1I35A 3HHMA 2J53A 4J6IA 3PS6A 1D4BA 5FR6A 1FNVA 3NVVA 4WJNA 3R2TA 3VTWA 2KO3A 4MM3B 1WXMA 2NBVB 4AJWA 4N6EB 2YLMA 3P63A 5J18A 4N58A 4W9JA 5C1ZA 3ZYYX 4FA6A 4IM2A 2RPQA 2JZ3B 3NUHB 4AJYB 3HM3A 2V3SA 4IG7B 1XF5L 2BB6A 1QOGA 3AV8A 2IYDB 3EFCA 2O2VB 2KLGA 4WJOA 1JWSD 1HTOA 1P7FA 4LJPB 2QCZA 5DPSA 4K3BA 1MHXA 1L2NA 4ASWC 2KD0A 1OTRB 1D5ZC 1VD2A 3P42A 2K22A 4N9F4 1JWAD 4B0MA 1C3TA 4WQMA 3APDA 2WS3B 3C19A 3ZTCA 1F9JA 3RULA 2RPVA 1YOVB 5AZHA 5MPOA 2LGSA 2NBWB 3WCQA 2M17A 3U8ZA 4KIKA 1PUTA 3ZDMC 2AL3A 2VRRB 1N5XA 3NZSA 2INCC 3QQ8B 1E5WA 3Q69A 3V62A 1F52A 2CHXA 2KT7A 2J52A 2JWZA 4BOZB 4W9GA 2MSED 2LFIA 4MGYE 1V81A 5DPWA 1KJTA 2NR2A 4LNKA 1RWSA 4I6LB 1CZPA 3ZKJC 5DCNA 3AEBB 2MJEA 2UU7A 2JRIB 3BVGA 3DBRI 1TS5A 3NG0A 2ZNVC 1JWUD 5JXVA 1YQ4B 2MBOA 2K6QA 3AN1A 1M94A 2LWPA 2G4SA 2WXOA 1VLBA 4BKTA 4MT5A 3TSSA 3DVNV 5AEKB 1R4NB 4HKQA 1KH0A 4BBNC 4FLHA 3JSVA 3SEBA 2LEKA 4M0WA 2KX0A 1QZEA 1FCLA 3DOWA 4P1CC 4I6NB 4CHKA 3QX1A 2MWSB 2LASA 3KUCB 2K1FA 2DENB 1WXSA 1SBBB 2KWCA 3B2GA 2WHIA 1SJED 3WANA 3AULA 1L0VB 3ML9A 1WGDA 1D3ZA 2LGYA 1GB4A 5AUIA 3PZDA 3A9JB 1WFYA 3TMPB 4RM8A 1E8WA 1UELA 1XLPA 3EC8A 4TQ1A 1N62A 2FCNA 1HXYD 3BWUD 5J2RA 2DZKA 1AW7A 2KWVB 1KOTA 2ZZPB 4YT0B 1RFKA 4OZBA 1EU4A 3ENEA 3ZW3A 5G55A 1XCTL 3RPFC 4YSZB 3UQBA 2PJHA 1UGJA 2CR5A 3DBHB 1V6EA 1SE2A 2GBRA 4ICUA 4WAAA 4P6VF 2MA9B 2UWQA 3MJWA 4BAXA 3ZXRA 3NZ3A 1GPXA 3HK0A 1WM3A 2K9XA 3W1YA 2L3ZA 2WXFA 4XGAB 2BYVE 4PS8A 4C56C 2G4DB 4CO7A 4KGSA 3KVFB 2XK5A 2QIEB 4B95A 1RLFA 1HZ6A 4NPNA 1P1AA 1JW9D 4YL8A 3TL5A 4R3DA 1C76A 2ZPNA 1XLNA 3KYDD 2N0SB 1SE3A 3GZNI 3Q14C 1EUVB 2WXMA 4DK5A 3ALBA 2JT4B 3IAM1 2ONQA 4W9KA 1OGWA 2GRIA 2KTFA 1JWBD 1E6EB 3AE5B 4ZRKA 4FBJB 4GB9A 2BYFA 4HROA 1WMHB 3BK1A 3R8BA 3KYCD 1EF5A 1MI0A 2C9WB 2ZCBA 4OZAA 1WE7A 2W3SA 3ZQ4A 4NJ6A 1STEA 3H9DA 3QAQA 2RSUA 4EZLA 2AX5A 1NEKB 2N7DA 2WXLA 1SIFA 4ANXA 3QARA 1I4RA 4GIVA 5EE9A 1DOIA 1UBIA 3U30A 1WI0A 2QC8A 3MP9A 2RDGA 1V49A 1OQQA 1HE8A 1NDDA 2O6VD 3AB5A 4E71A 1I42A 1MVKA 4IDIA 2D3GA 3ZRFA 4FADA 1SF0A 3L13A 1KF6B 5D94A 1EWCA 1RYJA 1XLQA 4K7WA 2AQ3B 4LNOA 4GDLA 3VH4B 3APFA 2Z0EB 3MC8A 2Z0DB 5C23A 1WMHA 3AEDB 3TIXA 2C7HA 4C4VA 4TKNA 2BVCA 2W82A 1V1OA 1SIJA 4KDIC 1AWDA 1WGHA 2Z8LA 2BS2B 3U52E 1UBQA 3ZNGC 1MG8A 1XQQA 1LM8B 4EUTA 1F1HA 4A3OA 4C7ZA 3PVLA 4GU2A 1MJDA 4YSXB 2JXTA 2EKIA 1BT0A 1P3QU 4M0WB 2N9EB 5CHVC 2KQSA 3P4QB 3NVZA 2ZVNA 3ZNID 2DZIA 2G45B 1WSPA 2JPHA 1IGDA 3EUB2 4GDLB 1Q5WB 2PLPA 3ZJTA 1FNWA 2WXQA 1RM6C 1Q10A 4NY0A 4ZOHC 3SU8X 1ZDXA 4NZLB 3A9KB 4JWUC 4KKJA 2M0XA 2WXRA 1YMHE 4QAYA 1IGCA 2J0KA 2KDBA 2KACA 3OWEB 1K52A 2KJHB 3MC0B 1JCKB 1F2RC 1TGZB 3O65B 1E7UA 5HFYA 2AQ1B 5BO4B 2JUOA 2BYEA 4OZCA 1YD8U 3H1UA 5TSSA 2EMSA 4W9HA 4XX5A 2WYQA 2DBYA 4K7SA 3Q2AC 1FXTB 2KLCA 2D3AA 1G6JA 1FXAA 4IC7B 4C7YA 3ZIMA 2V4IB 2OOBB 1VR9A 1L0YB 3VFKA 3TEYA 2BF8B 2L00B 3N30A 4HKZE 2KX3A 1PGXA 4JIOU 1I7HA 3OG5A 2GBNA 2RR9A 4LK0M 2WXIA 1D5XC 1IPGA 3UI3A 3DDCB 3HRDD 4FHJA 2NVUI 2YVCA 1A5RA 4L1BA 4MH0E 2AWTA 3DPDA 4ARCA 2IGHA 1K51A 4IM0A 1HEZE 4KSLC 4DDGD 1VZ8A 2KDFB 5KHOA 2JYEA 2V1YA 3U7ZA 4E3CA 3VVWB 2PE6B 3MC9A 4XZ4A 4G0NB 3PT2B 2LGIA 2GI9A 1CJEA 2NCNA 1FFVA 1XEEA 4OHJA 2ZW0A 3T3OA 2WQYB 2G9HD 1SB3C 2ASQA 3VR8B 4WH4A 1WM2A 3DBSA 1TT5B 2CS4A 2W54A 1WXAA 4WWPA 3HVZA 4ZRJA 4IUMB 3X0WA 3PLVA 4TSSA 1HA5A 4D2KA 2GB1A 3TBLD 2LRUA 4N59A 3VAWA 1L5PA 2ZNVB 1V8CA 3OLMD 1WWTA 2MHJA 5IOIA 4H2AA 4GDKA 1L7YA 2N4FA 2TSSA 4A3PA 3GZNB 4TQ0A 1N5WA 1WX8A 3N32A 1I4HA 1JRPA 2BWES 3Q8BA 2NPTB 3RNEC 3URYA 4IM3A 2L83A 2BB5A 3RNAC 3L10B 1SJHD 4FJYA 2C60A 1TIFA 4NJ7A 2RD0A 4DQOC 2ON8A 5JH5C 1YNTE 2LHDA 1YJIA 3RN9C 1KTKA 2D07B 1T0RC 2FE8A 1L4ZB 1FIQA 3NZUA 3PRZA 2QMTA 2BW2A 2X8XX 2LVOA 2WDQB 3AU5A 2BKFA 3VTVA 4XDCA 3AMZA 4RFBA 5H92C 3Q8AA 2L8JA 2ICIA 3W1SA 4EOYA 2J42A 3MHZA 2LGXA 3W9CB 1VJKA 1YIWA 4ZYNA 1P0RA 3CSFA 3A1QA 1FPYA 3ZO5B 2O6VB 3PRMB 3ABVB 3W5UB 2OEDA 4MACA 4WURA 2WWZA 1AARA 2PMVA 2DNFA 2WGSA 4UDUC 5JHBA 1T3QA 4HPLB 1UWMA 3L16A 3B9JA 4HRSA 2FIFA 3AE6B 4M01A 1ET6A 3A33B 4IW0A 4BFRA 2JVCA 3EFUA 1H4RA 4ITKA 1LQBA 2IGGA 1KLUD 1I4QA 1I4PA 3RNCC 2WX0A 3I5JC 2MLBA 1E8YA 1ZP0B 3LB8C 3RUIB 3AXCA 2Y3AA 5AZFA 1H8CA 2KC2A 3QJZA 2BBCA 1L0XB 4Q2JA 3BIID 3T3NA 1P7EA 4ANVA 3LYYA 4WWMA 2N7EA 2NS5A 5L95C 4GOCA 2G3QB 3KWLA 1ZOYB 4XDDA 4L2YA 2KYWA 2EELA 3AE3B 4FXCA 3MTNB 1QILA 1WJ6A 1ZKHA 2YEPB 3A9JA 4DXFA 3ZJVA 1C4CA 2SAKA 2KQ7A 2XEWA 3LXFA 3ZNHB 4ZRIA 3FILA 1MG4A 4FJZA 4LNFA 4IWPA 2BS3B 3V3XA 2PVGC 4HK2A 4KSKC 4NAWB 1BUIC 1NYQA 3GE8C 4HWIB 2VZKD 1WYGA 1J7AA 1ET9A 4LDTD 2L52A 4X57B 1NBFC 3E56A 1XXGA 4EEWA 3ZGZA 1BXTA 1UF0A 2KJRA 4DHJB 1WRIA 1V86A 1RFAA 4ARIA 2L0FA 1YX6B 5I4DA 5EDSA 4GDKB 1E8XA 1TY2A 4P1BC 4P16A 4KZ0A 1FRDA 3I9V1 1TBEA 4PYZA 2ZVOA 1JALA 2IY1B 2IGDA 2I1JA 2LI5A 2NPTA 4DDID 4NJCA 1TS4A 2PTLA 4I6PA 1KLGD 4GN1A 2PE9A 2CU1A 2DYBA 1TZOA 1LO5D 1J7CA 5DPRA 3CF6E 1FNUA 2KDMA 1I4XA 4XWWA 5BYQA 1PGAA 1GC7A 1P9DU 3IAS1 2MBHA 2R61A 4RM9A 3DHHC 4MJSA 2OJRA 1L6VA 2KQ4X 1UD7A 2MP2B 2DLBA 2SEBD 1SE9A 1WR1A 3Q8EA 2C5LC 3AE7B 3R3MA 2J0JA 2PVOD 2PKOA 4KGRA 4ZYSA 2BPSA 1NYRA 3KUZA 2WXHA 3HVDA 2CJNA 3PSEB 3BINA 4MH8A 4YTNB 2ZCCA 3H6NA 1ZE3D 3PLUA 3K9OB 4JPSA 4MSMB 2DZJA 1CMXB 3RI7C 1WYWB 3PHWB 3APCA 4RGNA 4A55A 3N20C 2W55A 1TTNA 1WH3A 4DWFA 2C7NB 2GBMA 2KVZA 1YN5A 3P2BA 2KMCA 3L0WB 4KIKB 3AE1B 1K53A 4KDLB 1E0ZA 2WX1A 3PO0A 4RF1A 2JY6A 2IO3B 4LTUA 3Q3JA 2K3UA 1ZGUB 4IKGA 2KANA 1KLVA 3ONSA 3ZJUA 2KC1A 4OVZA 2QHOA 4A90A 1OFFA 3TCAA 3KQ4A 3AEEB 2WU5B 1ZXHA 3MJ5A 4DXAB 1K50A 4LLGM 4GSWA 1GAQB 2M4NA 1AN8A 3EHVA 1B9RA 3R7RA 1QOFA 4MDKE 2AL6A 1XT9B 4ZHPA 3RYTA 1TKYA 4BKGA 3TJPA 1VZ6A 3FILB 3P4RB 3A4RA 2BT6A 2DHZA 1R4MB 2LJIA 3RD2A 3E9SA 3CWIA 1A70A 1E90A 4W9LA 2L0TA 1ACCA 1TS2A 1V9JA 3C8YA 3PPAA 3NRZA 2K8CA 3KWVA 3EA6A 1FMAD 2K5PA 3Q3MC 3FAHA 4PS3A 2N1VA 2INNE 4W9FA 1WRDB 4JE3B 1E10A 3N1YC 4W9CA 4YXDB 4TMAB 1J0GA 3IT6B 2MJ3A 2CU3A 4HEA1 4MELA 3RNBC 3DVNU 1UH6A 3KUDB 2H88B 1DGJA 2WDVB 2KMAA 5L83A 1CQVA 2MCNB 3U2SC 5G2NA 1F2RI 1R4NI 2Q5WD 1YJJA 1KM7A 1JRUA 4WQOB 2VH2A 4YWGG 1SSNA 4RH6A 2Y5PA 2XK5B 4RCOA 2N9PC 4EE2A 3V6CB 2JYTA 4FHKA 3SFEB 3IG3A 5E6PA 2DYMA 4RNAA 2EKEC 4MGIE 3R66C 1XLOA 5BMIA 2WDRB 3M3JA 1WJUA 5G5GA 3ML8A 1VDVA 1UGMA 3VUWA 5LXIB 1XD3B 3DWMA 3QHTA 1TYGB 3DBLB 2NTSA 3K9PB 2WDTB 3T8MA 2KK8A 4LCDE 3VUXA 1SE4A 4DHZB 2JX5A 1ROEA 4BOSC 2I2YA 4IOIE 3UF8A 5KHQA 2KFKB 5FK9C 4HJKA 1C77A 3SDLC 3U4EG 2H89B 4PS7A 1L4DB 2KHWB 1T0QC 3FKYA 3TEXA 1Q1OA 3AM9A 2WNMA 1OQYA 1WX9A 4OVVA 2E3TA 2EMTA 3VH3B 1MFWA 4NQLB 3ZUNA 3NS8A 3DBHI 2KAJA 2INDC 3VXWA 4J3OD 3LJ3A 3QC8B 1KRHA 1YQBA 1WIAA 1Y56A 2PPHA 4US8A 2BKRB 2D10A 2KXJA 2DX5B 3PZ8A 1T0YA 3UIPB 1IYFA 3I3TB 4W9IA 4RGOS 2IJ0A 1WGGA 2K8HA 1B1ZA 2LXAA 2Y5CA 2MRPA 4LJOB 3NOBA 3H8HA 2MQJA 2WP9B 2KFJA 4ZRPA 5FR3A 4IWOA 1U4AA 2LD9A 4BKSD 2FCSA 5DPTA 2OJWA 1WR6E 3IXSA 2V4LA 2LXCA 5AZGA 5IA7A 1ZXIA 1Z2MA 2IO1B 2O6VA 3AE2B 2GMIC 3BVZA 2HDEA 1DOXA 3N9YC 1PDXA 3PGEA 2UYZB 4FULA 1V5TA 2R2QA 4GLSC 2HTHA 4M8NA 3IHPC 5GMVA 3DCGA 1OEYJ 1T6BX 4M8MA 4NAMA 3ZRCA 1OQRA 4WAFA 4C00A 3C0RB 3W2DA 1C4PA 2V0GA 4B0EA 4II2B 5GXGB 4HPPA 2IBIB 1NENB 4XYCA 3PHXB 3L17A 2IO2B 4KX6B 2IPKD 1UWXA 1TKGA 1C78A 4MGZE 3WAMA 4WWNA 3DQVA 3DBRB 3A9KA 1FEHA 3BYYB 3DVGY 5HI1A 3BYTB 1F0ZA 2LUMA 3IBEA 4S17A 1J7BA 1V80A 2CHZA 4JGHB 2A5UA 4A9AA 2M0AA 3PTFC 3NY5A 1J8CA 1ISNA 2JU6X 2N1WA 4MSQB 3VR9B 3Q6BA 3QA8A 4L23A 3I57A 2LHEA 3V60A 2FUHB 1P98A 3QIJA 5D3DA 4REZA 2J7QB 2L7RA 2D11A 5HKHA 1XO3A 1N63A 4WIPA 4K7UA 3NS1A 2HD5B 4KGTA 1UNSA 3PRPB 2XBBC 4CQNA 2GBKA 3H7PA 3SFDB 1YX5B 3AH7A 4MM3A 2N7JA 3X23A 2HE7A 3DHIC 2FUG1 1UZXB 3PREA 3N3KB 1WY8A 3N1XC 4NNJB 4URKA 1D5MC 3P4PB 3VUYA 3DWGC 5EE3A 4HCNB 1SXTA 1OEYA 1TS3A 4ANWA 1T5XD 2V3NA 2DAJA 4W9DA 3BY4B 2LZ6A 3V6EB 1KFYB 3P1MA 2MBEA 4GXBA 2BS4B 5CTRC 5JZEB 3N1ZC 1E7PB 2DAFA 4WJQA 3TEZA 4GGQA 1WF9A 2FAZA 3JSVB 4TUUA 4TV3A 5AUKA 4BZAA 2CJOA 2GBJA 3RT3B 2R2OA 3AE9B 4K81A 1S1QB 1WJ4A 4K1RB 3VHTC 1ZPSA 2KTRA 4FJVB 2JQRB 1BMLC 4F1SA 4DXGA 1NVID 3CSTA 1WJNA 4AP4C 1Q0WB 1EF1A 1SEBD 4DBGA 3IVFA 2M1MA 2MBBB 2LMCA 3UINB 4ZRQA 4KVGB 2I1KA 1V1PB 4USAA 4WWOA 1WGKA 2YEPF 2ZW1A 4EZJA 5D7GA 2KMMA 1GG3A 2D3CA 2W9NA 3WAOA 4GMVA 1FFUA 2M19A 2VZKB 1YN4A 4A8XC 2K0PA 1WZ0A 1EWYC 2O2VA 3VDZA 3BVMA 1QOBA 4G11A 5D6JB 5C3JB 3VQIA 3L4PA 3Q3OC 3RCZA 2KTRB 2RDBC 4K3CA 1N6ZA 1V97A 4XC2A 5E6OA 1PGBA 4JX1C 1V5OA 2AQ2B 2JF5A 2NBUA 1Z5SB 4W9EA 4LNIA 1PQSA 2MJDA 3AEAB 1WXVA 1GB1A 3BZDB 1EO6A 4JWSC 3HIZA 4AS1A 2JRHA 2D3BA 4C4VB 1WGRA 4RF0A 4HDOA 5IN7A 2WXJA 1V1PA 3GOEA 2KNBA 3ECIA 2IO0B 2HJ1A 2N9XA 2QILA 1UUPA 4KZCA 2BTEA 5BYRA 2WXPA 3MFGA 4B6WA 2NMQA 4KKIA 2ACZB 4JL9A 4HDQA 2KDIA 1YN3A 2M8SA 3QCAA 4MJSB 4EKUA 1FXIA 3KLSX 1I4GA 4HJGE 2V9HA 3DBLI 3LDZE 1VCBA 4YTMB 5JHAA 3PZ7A 3Q8CA 2W3RA 2QEJC 5IP4D 4HVBA 1F77A 1NI2A 4ZHOA 5CHFA 3JVZX 2KJ6A 1LGRA 3JYUA 1JMLA 2LRWA 3VRBB 4ICVA 1WX7A 4AWJA 5D3IB 1ZW7A 2K8BA 2KWUB 4LDTB 3IT4B 2L1AA 2L05A 2J4XA 4ANUA 2L76A 1FRRA 4NQKE 3RNFC 3SHQA 3A4SC 4RGTA 3ZXVA 2PW9A 1FO4A 3AU4A 3CMMB 3B2FA 3B1LX 4BKSA 1WE6A 2XNAC 3H7PB 1DOYA 1GJZA 1FM0D 4AUQC 2WXGA 2Y5BB 5BMGA 1IBXB 3ETRA 3UQAA 3Q3FA 2CHWA 1EU3A 4OVUA 3KW5B 1RRBA 1CK1A 4US9A 2MP2A 2B76B 4MEMA 4EFOA 2KZRA 1GOZA 2C7MB 4PT5A 5E6JA 1T0SC 4WJPA 5BYSA 1HZ5A 2B3AA 2PIAA 2DYOA 3QK0A 2MBQA 5CHWA 2MH7A 2GLSA 2K39A 2D2QA 3DVGX 3AECB 2KN4A 4DHJD 1PFDA 5T8IA 1E7VA 2AEHA 1E8ZA 3U7DA 4MGKE 1PYWD 4RMAA 2N9LA 2LJ5A 2WU2B 1MPEA 2WXNA 3EECA 1IBXA 1QF6A 1C4AA 5IKCM 2JXXA 1NI3A 2Z59B 2INPE 2FCQA 2BYTA 5TR5A 2KKCA 2QSDA 3AE4B 4AOFA 3FC4A 3TEWA 2FIDA 2OHFA 1EM7A 3H7SA 2D5GA 3RNGC 1C9FA 1TKEA 1QQRA 4M00A 2HTME 4P7IA 4AQ7A 3TUOA 1ESFA 4DHZE 2DWQA 5LNK1 5BMHA 3L08A 4HPMB 1J19A 3AEFB 3B0AA 3S2AA 3HUIA 4A20A 4IWQA 3UGBB 4BBNF 1WZ3A 2IDYA 4JLCA 3R7QA 3P4SB 4EZKA 2BQQA 3GB1A 4KV2A 1ENFA 2CKHB 3I63C 3B08A 2RDHA 4FN2A 4M02A 1WXQA 1AYFA 5CX3A 1X1MA 4II3B 3NHEB 2MX2A 3MHSD 3AI5A 2K25A 2I38A 2LGDA 3WA0A 2JZPA 4B9KA 4YSYB 5H8YE 1GUAB 2MEKA 1LFDA 2RGFA 4S0RA 2J0MA 4A6QA 4XWTA 3KH0A 2BWFA 3WALA 1QOAA 1LXDA 3L54A 2DZMA 1N61A 3HM6X 1L6UA 2ZJDA 3RZWC 1VZ7A 4C80A 2KDEB 1GNUA 3IFWB 1D6EC 4G3XB 3RZFA 3V61A 2KWDA 2KN5A 1ZDVA 1YJ1A 4PYUA 2KOXA 1RAXA 1E9MA 1K8RB 1YQ3B 2KFKA 1S3SG 1WGYA 1QT9A 1M4VA 4CYEA 4OW0A 5IO9A 1GC6A 3NVYA 2N9KA 1HQRD 3OAWA 2G1EA 5EE1A 5EE0A 2L32A 4JQWC 5C2TB 2AYOB 2PEAA 3WIMA 2E6XA 4ZDVA 2FNJB 3ZVVA 1TY0A 3CIRB 2ZEQA 1R7SA 3WAPA 3JW0X 1C79A 1FCCC 1SGHA 1DYQA 3Q3NC 4O1NA 3W1SC 4F8CB 4F7ZA 2FCMA 3M62B 2RMMA 1XCQL 4G50A 3RMKC 2JWUA 2VH1A 4LNNA 3VRAB 2REXA 3RFZB 3M95A 3W5VB 2QDFA 1FD6A 1TZ1A 3SR6A 5G5HA 3BK2A 1Y8RC 3R2IA 2XN9C 3O13A 4HCPB 5HG2A 2NTTA 2GOWA 5HHDG 3VTUA 3Q8FA 4BVUC 3QWZB 3UIOB 3SD5A 3M63B 5J17A 5IAAC 3NVWA 1N60A 2JZZA 1JROA 2IZVB 3OJ4B 3GP7A 1IUEA 3ZDTA 1MHHE 2KVRA 2HJ8A 4YTPB 2IY0B 2FBWB 3AE8B 3A1QB 1HTQA 1QLBB 2A4ZA 3NJTA 4XE0A 2BGFA 5E6NA 3OJ3A 3PV1A 3ZNZB 4E74A 1QKZA 1IP9A 1JWMD 2QJLA 2WXKA 5D2MB 3AEGB 1TJEA 3ZLZA 3D32A 3V05A
chains in the Genus database with same CATH topology
2WX1A 2KJHB 4KVGB 1R4MI 1TGZB 2LUEA 2ZPYA 3O65B 2I1KA 1E7UA 2MW5A 4WWOA 4EZJA 5BO4B 5D7GA 4NAWA 2LVPA 2JY6A 2JUOA 1GG3A 2BYEA 4HLEA 2W9NA 3WAOA 2IO3B 4GMVA 5LLIA 3ZTDA 1YD8U 3Q3JA 1ZGUB 3T9LA 2K6DB 3H1UA 2KANA 5LXHA 2EMSA 4W9HA 4XX5A 2WYQA 1KLVA 4HXDA 3ONSA 1WZ0A 4K7SA 2O2VA 3VDZA 2KC1A 1FXTB 2KLCA 4G11A 1V2YA 5D6JB 1G6JA 3VQIA 1C1YB 2LVQA 4IC7B 3HHMA 1I35A 2QHOA 3ZIMA 3RCZA 2KTRB 2OOBB 4J6IA 3TCAA 3PS6A 4XC2A 5FR6A 5E6OA 4WJNA 3VFKA 2BF8B 1V5OA 2JF5A 2KO3A 2L00B 2NBUA 3N30A 3VTWA 4DXAB 1Z5SB 4W9EA 2KX3A 1PQSA 1WXMA 4JIOU 2GBNA 2NBVB 2RR9A 1IPGA 4GSWA 3DDCB 4FHJA 2NVUI 1WXVA 2M4NA 4AJWA 3EHVA 2YVCA 1EO6A 3R7RA 2YLMA 3HIZA 4MDKE 2JRHA 1A5RA 5J18A 1WGRA 4MH0E 2AL6A 1XT9B 4W9JA 2AWTA 3DPDA 5C1ZA 4HDOA 3RYTA 4FA6A 4IM2A 2RPQA 2JZ3B 3GOEA 2KNBA 3ECIA 4BKGA 3TJPA 2IO0B 4AJYB 2N9XA 3HM3A 4IM0A 2V3SA 4KSLC 3A4RA 4DDGD 2DHZA 3RD2A 2KDFB 4KZCA 4IG7B 5KHOA 2V1YA 1E90A 4B6WA 4E3CA 3VVWB 4W9LA 2PE6B 2L0TA 4XZ4A 1V9JA 4G0NB 2IYDB 2O2VB 3PT2B 3PPAA 4JL9A 2K8CA 2KDIA 4HDQA 2KLGA 4WJOA 2NCNA 2M8SA 3QCAA 4MJSB 4EKUA 3DBLI 4LJPB 3LDZE 2ASQA 5DPSA 1VCBA 4PS3A 5JHAA 2N1VA 4W9FA 1WRDB 4W9CA 4HVBA 1J0GA 1NI2A 1WM2A 3DBSA 2CS4A 1L2NA 5CHFA 1WXAA 3JVZX 4WWPA 2KD0A 4ASWC 2KJ6A 1OTRB 4MELA 4IUMB 4ZRJA 3DVNU 3X0WA 3PLVA 1VD2A 1UH6A 3JYUA 2LRWA 3KUDB 4N9F4 1C3TA 2KMAA 3APDA 3ZTCA 4ICVA 5L83A 1F9JA 3TBLD 2LRUA 1WX7A 3RULA 3VAWA 2ZNVB 4AWJA 2MCNB 5AZHA 3OLMD 5G2NA 2NBWB 1ZW7A 1R4NI 2M17A 4GDKA 1L7YA 2K8BA 2KWUB 4LDTB 2N4FA 1KM7A 1JRUA 4WQOB 4A3PA 3U8ZA 4TQ0A 1WX8A 3N32A 4KIKA 2L05A 3ZDMC 2AL3A 2BWES 2NPTB 4ANUA 2L76A 2VRRB 2XK5B 4IM3A 4NQKE 2N9PC 3V6CB 3SHQA 3A4SC 3NZSA 4FHKA 3L10B 3IG3A 4FJYA 3AU4A 3CMMB 2C60A 3B1LX 3QQ8B 5E6PA 1E5WA 2DYMA 4NJ7A 4BKSA 1WE6A 2RD0A 2EKEC 4MGIE 3H7PB 3R66C 3V62A 2CHXA 1GJZA 5JH5C 3M3JA 4AUQC 2JWZA 1WJUA 4W9GA 2MSED 4MGYE 4BOZB 2Y5BB 3ML8A 1UGMA 2D07B 1V81A 5DPWA 1KJTA 2NR2A 3VUWA 5LXIB 4I6LB 1XD3B 3UQAA 3NZUA 3Q3FA 2CHWA 3QHTA 3PRZA 4OVUA 3ZKJC 5DCNA 2LVOA 2JRIB 3KW5B 1RRBA 3K9PB 2WDTB 3DBRI 2MP2A 3AU5A 3T8MA 4MEMA 2KK8A 4EFOA 2ZNVC 4LCDE 3VUXA 2BKFA 2KZRA 4DHZB 2C7MB 4BOSC 2MBOA 2K6QA 3UF8A 3VTVA 5KHQA 1M94A 4WJPA 2KFKB 4HJKA 3SDLC 2L8JA 2LWPA 2B3AA 4PS7A 2G4SA 2DYOA 3QK0A 4BKTA 2KHWB 3DVNV 2MBQA 5AEKB 5CHWA 4BBNC 3W1SA 1Q1OA 4FLHA 4EOYA 1OQYA 1WX9A 3JSVA 4OVVA 2K39A 2D2QA 2KX0A 2LGXA 3DVGX 2EMTA 3VH3B 3ZUNA 4NQLB 4DHJD 3NS8A 1E7VA 3DBHI 2AEHA 1E8ZA 3U7DA 1QZEA 1YIWA 4MGKE 4RMAA 4ZYNA 1P0RA 3DOWA 3CSFA 2LJ5A 3A1QA 3VXWA 3ZO5B 2O6VB 3LJ3A 3PRMB 4I6NB 4CHKA 3QX1A 2MWSB 2LASA 3QC8B 3EECA 3KUCB 2K1FA 2DENB 2WWZA 1WXSA 1YQBA 1WIAA 1AARA 2PPHA 2JXXA 2KWCA 2Z59B 2BKRB 2D10A 5JHBA 2KXJA 4HPLB 2DX5B 1T0YA 3WANA 3AULA 3L16A 3UIPB 2FCQA 1IYFA 5TR5A 3ML9A 1WGDA 2FIFA 3I3TB 2KKCA 1D3ZA 4W9IA 4AOFA 3A33B 4IW0A 4BFRA 1WGGA 2JVCA 3EFUA 2LGYA 2K8HA 2FIDA 3PZDA 2LXAA 3A9JB 3H7SA 1H4RA 1WFYA 3TMPB 4RM8A 2MRPA 4LJOB 1E8WA 3NOBA 1LQBA 4P7IA 1UELA 3EC8A 4TQ1A 2MQJA 4DHZE 2KFJA 2WX0A 2FCNA 1E8YA 2MLBA 4IWOA 5J2RA 1U4AA 2LD9A 2DZKA 3RUIB 3AXCA 2FCSA 4BKSD 5DPTA 3L08A 1WR6E 2KWVB 5AZFA 4HPMB 2ZZPB 1J19A 2KC2A 1H8CA 2V4LA 1KOTA 3QJZA 3B0AA 2LXCA 5AZGA 3S2AA 5IA7A 3ENEA 4A20A 3ZW3A 4IWQA 5G55A 1Z2MA 2IO1B 2O6VA 3UGBB 4BBNF 1WZ3A 2GMIC 4JLCA 3R7QA 2PJHA 4ANVA 4EZKA 3UQBA 2CR5A 3PGEA 1V6EA 2UYZB 2N7EA 2GBRA 4FULA 4KV2A 2NS5A 1V5TA 2R2QA 4ICUA 2CKHB 5L95C 4WAAA 2HTHA 4GOCA 2G3QB 3B08A 4M8NA 2MA9B 3IHPC 2UWQA 3MJWA 3DCGA 5GMVA 4FN2A 1OEYJ 3HK0A 1WM3A 5CX3A 3W1YA 2L3ZA 4M8MA 3MTNB 2BYVE 4PS8A 1X1MA 3ZRCA 1WJ6A 4II3B 1ZKHA 2G4DB 3NHEB 2MX2A 3A9JA 3MHSD 3AI5A 2K25A 3C0RB 4CO7A 2KQ7A 2LGDA 3KVFB 2XEWA 2XK5A 3ZNHB 3WA0A 4B9KA 1GUAB 4ZRIA 1RLFA 4B95A 1LFDA 2RGFA 4NPNA 2J0MA 4FJZA 4II2B 1P1AA 4YL8A 4IWPA 3TL5A 2IBIB 3KH0A 2BWFA 2ZPNA 3WALA 4HK2A 1LXDA 4KSKC 4NAWB 3KYDD 3GZNI 3L54A 2DZMA 3HM6X 3PHXB 3L17A 1EUVB 2IO2B 2ZJDA 3RZWC 4DK5A 2KDEB 3ALBA 2JT4B 4HWIB 4W9KA 4MGZE 1GNUA 1OGWA 3IFWB 3WAMA 2KTFA 4LDTD 3DQVA 4G3XB 4WWNA 3RZFA 3A9KA 4X57B 3V61A 1NBFC 4ZRKA 2KN5A 4FBJB 4GB9A 2BYFA 3DVGY 4PYUA 1YJ1A 1WMHB 2KOXA 1RAXA 4EEWA 3KYCD 1EF5A 1K8RB 2KFKA 2C9WB 2ZCBA 1S3SG 1WGYA 2KJRA 3IBEA 4DHJB 4CYEA 1V80A 1WE7A 1V86A 1RFAA 2CHZA 4JGHB 2A5UA 4NJ6A 2L0FA 1YX6B 3H9DA 5EDSA 1GC6A 3QAQA 2RSUA 4GDKB 4EZLA 1E8XA 2N7DA 3PTFC 3NY5A 3OAWA 1J8CA 4KZ0A 1ISNA 4JQWC 1SIFA 1TBEA 4PYZA 2AYOB 2N1WA 2PEAA 2ZVOA 3QARA 4GIVA 4MSQB 3WIMA 4ANXA 3QA8A 4ZDVA 2IY1B 1UBIA 3U30A 1WI0A 2FNJB 3ZVVA 2I1JA 1V49A 2LI5A 2FUHB 2NPTA 1HE8A 1P98A 3V60A 1NDDA 2ZEQA 3QIJA 4DDID 2O6VD 2J7QB 3WAPA 3JW0X 1SGHA 2D11A 2L7RA 4E71A 5HKHA 4I6PA 1I42A 4GN1A 4K7UA 2PE9A 3W1SC 2CU1A 2DYBA 2HD5B 4F8CB 4F7ZA 2FCMA 3M62B 2D3GA 3PRPB 5DPRA 3CF6E 2XBBC 3ZRFA 4FADA 2GBKA 3L13A 3H7PA 5D94A 4G50A 4K7WA 1YX5B 4MM3A 1GC7A 3X23A 4GDLA 3VH4B 3APFA 2HE7A 1P9DU 2Z0EB 1UZXB 3PREA 2Z0DB 2MBHA 3N3KB 2REXA 4RM9A 5C23A 1WY8A 1WMHA 4MJSA 4NNJB 3TIXA 4URKA 2C7HA 2OJRA 3M95A 3VUYA 4HCNB 4TKNA 1OEYA 1TZ1A 1UD7A 2MP2B 4ANWA 1SE9A 1WR1A 4KDIC 1Y8RC 2C5LC 2DAJA 1WGHA 4HCPB 4W9DA 3R3MA 2J0JA 3BY4B 1UBQA 2LZ6A 3ZNGC 3V6EB 1MG8A 1XQQA 2MBEA 1LM8B 2GOWA 4EUTA 4GXBA 4A3OA 3VTUA 5CTRC 2BPSA 3PVLA 4GU2A 4BVUC 3QWZB 5JZEB 3UIOB 3SD5A 3KUZA 3M63B 2DAFA 4WJQA 5J17A 5IAAC 1BT0A 4GGQA 2JZZA 1WF9A 1P3QU 2FAZA 2IZVB 3OJ4B 3PSEB 4M0WB 3ZDTA 3BINA 3JSVB 4TUUA 2N9EB 2KVRA 2HJ8A 4TV3A 2ZCCA 3H6NA 5CHVC 2IY0B 3PLUA 2KQSA 3ZNID 2ZVNA 3K9OB 2DZIA 2G45B 2GBJA 3RT3B 4MSMB 2DZJA 2JPHA 2R2OA 3A1QB 4K81A 1S1QB 1CMXB 1WJ4A 4K1RB 1WYWB 2A4ZA 3PHWB 3VHTC 2KTRA 4FJVB 4GDLB 2BGFA 1Q5WB 5E6NA 3APCA 3OJ3A 3PV1A 3ZNZB 4F1SA 4NY0A 4E74A 3CSTA 1TTNA 3SU8X 1WJNA 1WH3A 1IP9A 4AP4C 1Q0WB 4DWFA 1EF1A 2C7NB 5D2MB 3A9KB 2GBMA 2M0XA 3P2BA 2KMCA 4DBGA 2J0KA 3IVFA 2KDBA 2M1MA 2MBBB 3D32A 3L0WB 3ZLZA 4KIKB 4KDLB 3UINB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX1 A;  2KJH B;  4KVG B;  1R4M I;  1TGZ B;  2LUE A;  2ZPY A;  3O65 B;  2I1K A;  1E7U A;  2MW5 A;  4WWO A;  4EZJ A;  5BO4 B;  5D7G A;  4NAW A;  2LVP A;  2JY6 A;  2JUO A;  1GG3 A;  2BYE A;  4HLE A;  2W9N A;  3WAO A;  2IO3 B;  4GMV A;  5LLI A;  3ZTD A;  1YD8 U;  3Q3J A;  1ZGU B;  3T9L A;  2K6D B;  3H1U A;  2KAN A;  5LXH A;  2EMS A;  4W9H A;  4XX5 A;  2WYQ A;  1KLV A;  4HXD A;  3ONS A;  1WZ0 A;  4K7S A;  2O2V A;  3VDZ A;  2KC1 A;  1FXT B;  2KLC A;  4G11 A;  1V2Y A;  5D6J B;  1G6J A;  3VQI A;  1C1Y B;  2LVQ A;  4IC7 B;  3HHM A;  1I35 A;  2QHO A;  3ZIM A;  3RCZ A;  2KTR B;  2OOB B;  4J6I A;  3TCA A;  3PS6 A;  4XC2 A;  5FR6 A;  5E6O A;  4WJN A;  3VFK A;  2BF8 B;  1V5O A;  2JF5 A;  2KO3 A;  2L00 B;  2NBU A;  3N30 A;  3VTW A;  4DXA B;  1Z5S B;  4W9E A;  2KX3 A;  1PQS A;  1WXM A;  4JIO U;  2GBN A;  2NBV B;  2RR9 A;  1IPG A;  4GSW A;  3DDC B;  4FHJ A;  2NVU I;  1WXV A;  2M4N A;  4AJW A;  3EHV A;  2YVC A;  1EO6 A;  3R7R A;  2YLM A;  3HIZ A;  4MDK E;  2JRH A;  1A5R A;  5J18 A;  1WGR A;  4MH0 E;  2AL6 A;  1XT9 B;  4W9J A;  2AWT A;  3DPD A;  5C1Z A;  4HDO A;  3RYT A;  4FA6 A;  4IM2 A;  2RPQ A;  2JZ3 B;  3GOE A;  2KNB A;  3ECI A;  4BKG A;  3TJP A;  2IO0 B;  4AJY B;  2N9X A;  3HM3 A;  4IM0 A;  2V3S A;  4KSL C;  3A4R A;  4DDG D;  2DHZ A;  3RD2 A;  2KDF B;  4KZC A;  4IG7 B;  5KHO A;  2V1Y A;  1E90 A;  4B6W A;  4E3C A;  3VVW B;  4W9L A;  2PE6 B;  2L0T A;  4XZ4 A;  1V9J A;  4G0N B;  2IYD B;  2O2V B;  3PT2 B;  3PPA A;  4JL9 A;  2K8C A;  2KDI A;  4HDQ A;  2KLG A;  4WJO A;  2NCN A;  2M8S A;  3QCA A;  4MJS B;  4EKU A;  3DBL I;  4LJP B;  3LDZ E;  2ASQ A;  5DPS A;  1VCB A;  4PS3 A;  5JHA A;  2N1V A;  4W9F A;  1WRD B;  4W9C A;  4HVB A;  1J0G A;  1NI2 A;  1WM2 A;  3DBS A;  2CS4 A;  1L2N A;  5CHF A;  1WXA A;  3JVZ X;  4WWP A;  2KD0 A;  4ASW C;  2KJ6 A;  1OTR B;  4MEL A;  4IUM B;  4ZRJ A;  3DVN U;  3X0W A;  3PLV A;  1VD2 A;  1UH6 A;  3JYU A;  2LRW A;  3KUD B;  4N9F 4;  1C3T A;  2KMA A;  3APD A;  3ZTC A;  4ICV A;  5L83 A;  1F9J A;  3TBL D;  2LRU A;  1WX7 A;  3RUL A;  3VAW A;  2ZNV B;  4AWJ A;  2MCN B;  5AZH A;  3OLM D;  5G2N A;  2NBW B;  1ZW7 A;  1R4N I;  2M17 A;  4GDK A;  1L7Y A;  2K8B A;  2KWU B;  4LDT B;  2N4F A;  1KM7 A;  1JRU A;  4WQO B;  4A3P A;  3U8Z A;  4TQ0 A;  1WX8 A;  3N32 A;  4KIK A;  2L05 A;  3ZDM C;  2AL3 A;  2BWE S;  2NPT B;  4ANU A;  2L76 A;  2VRR B;  2XK5 B;  4IM3 A;  4NQK E;  2N9P C;  3V6C B;  3SHQ A;  3A4S C;  3NZS A;  4FHK A;  3L10 B;  3IG3 A;  4FJY A;  3AU4 A;  3CMM B;  2C60 A;  3B1L X;  3QQ8 B;  5E6P A;  1E5W A;  2DYM A;  4NJ7 A;  4BKS A;  1WE6 A;  2RD0 A;  2EKE C;  4MGI E;  3H7P B;  3R66 C;  3V62 A;  2CHX A;  1GJZ A;  5JH5 C;  3M3J A;  4AUQ C;  2JWZ A;  1WJU A;  4W9G A;  2MSE D;  4MGY E;  4BOZ B;  2Y5B B;  3ML8 A;  1UGM A;  2D07 B;  1V81 A;  5DPW A;  1KJT A;  2NR2 A;  3VUW A;  5LXI B;  4I6L B;  1XD3 B;  3UQA A;  3NZU A;  3Q3F A;  2CHW A;  3QHT A;  3PRZ A;  4OVU A;  3ZKJ C;  5DCN A;  2LVO A;  2JRI B;  3KW5 B;  1RRB A;  3K9P B;  2WDT B;  3DBR I;  2MP2 A;  3AU5 A;  3T8M A;  4MEM A;  2KK8 A;  4EFO A;  2ZNV C;  4LCD E;  3VUX A;  2BKF A;  2KZR A;  4DHZ B;  2C7M B;  4BOS C;  2MBO A;  2K6Q A;  3UF8 A;  3VTV A;  5KHQ A;  1M94 A;  4WJP A;  2KFK B;  4HJK A;  3SDL C;  2L8J A;  2LWP A;  2B3A A;  4PS7 A;  2G4S A;  2DYO A;  3QK0 A;  4BKT A;  2KHW B;  3DVN V;  2MBQ A;  5AEK B;  5CHW A;  4BBN C;  3W1S A;  1Q1O A;  4FLH A;  4EOY A;  1OQY A;  1WX9 A;  3JSV A;  4OVV A;  2K39 A;  2D2Q A;  2KX0 A;  2LGX A;  3DVG X;  2EMT A;  3VH3 B;  3ZUN A;  4NQL B;  4DHJ D;  3NS8 A;  1E7V A;  3DBH I;  2AEH A;  1E8Z A;  3U7D A;  1QZE A;  1YIW A;  4MGK E;  4RMA A;  4ZYN A;  1P0R A;  3DOW A;  3CSF A;  2LJ5 A;  3A1Q A;  3VXW A;  3ZO5 B;  2O6V B;  3LJ3 A;  3PRM B;  4I6N B;  4CHK A;  3QX1 A;  2MWS B;  2LAS A;  3QC8 B;  3EEC A;  3KUC B;  2K1F A;  2DEN B;  2WWZ A;  1WXS A;  1YQB A;  1WIA A;  1AAR A;  2PPH A;  2JXX A;  2KWC A;  2Z59 B;  2BKR B;  2D10 A;  5JHB A;  2KXJ A;  4HPL B;  2DX5 B;  1T0Y A;  3WAN A;  3AUL A;  3L16 A;  3UIP B;  2FCQ A;  1IYF A;  5TR5 A;  3ML9 A;  1WGD A;  2FIF A;  3I3T B;  2KKC A;  1D3Z A;  4W9I A;  4AOF A;  3A33 B;  4IW0 A;  4BFR A;  1WGG A;  2JVC A;  3EFU A;  2LGY A;  2K8H A;  2FID A;  3PZD A;  2LXA A;  3A9J B;  3H7S A;  1H4R A;  1WFY A;  3TMP B;  4RM8 A;  2MRP A;  4LJO B;  1E8W A;  3NOB A;  1LQB A;  4P7I A;  1UEL A;  3EC8 A;  4TQ1 A;  2MQJ A;  4DHZ E;  2KFJ A;  2WX0 A;  2FCN A;  1E8Y A;  2MLB A;  4IWO A;  5J2R A;  1U4A A;  2LD9 A;  2DZK A;  3RUI B;  3AXC A;  2FCS A;  4BKS D;  5DPT A;  3L08 A;  1WR6 E;  2KWV B;  5AZF A;  4HPM B;  2ZZP B;  1J19 A;  2KC2 A;  1H8C A;  2V4L A;  1KOT A;  3QJZ A;  3B0A A;  2LXC A;  5AZG A;  3S2A A;  5IA7 A;  3ENE A;  4A20 A;  3ZW3 A;  4IWQ A;  5G55 A;  1Z2M A;  2IO1 B;  2O6V A;  3UGB B;  4BBN F;  1WZ3 A;  2GMI C;  4JLC A;  3R7Q A;  2PJH A;  4ANV A;  4EZK A;  3UQB A;  2CR5 A;  3PGE A;  1V6E A;  2UYZ B;  2N7E A;  2GBR A;  4FUL A;  4KV2 A;  2NS5 A;  1V5T A;  2R2Q A;  4ICU A;  2CKH B;  5L95 C;  4WAA A;  2HTH A;  4GOC A;  2G3Q B;  3B08 A;  4M8N A;  2MA9 B;  3IHP C;  2UWQ A;  3MJW A;  3DCG A;  5GMV A;  4FN2 A;  1OEY J;  3HK0 A;  1WM3 A;  5CX3 A;  3W1Y A;  2L3Z A;  4M8M A;  3MTN B;  2BYV E;  4PS8 A;  1X1M A;  3ZRC A;  1WJ6 A;  4II3 B;  1ZKH A;  2G4D B;  3NHE B;  2MX2 A;  3A9J A;  3MHS D;  3AI5 A;  2K25 A;  3C0R B;  4CO7 A;  2KQ7 A;  2LGD A;  3KVF B;  2XEW A;  2XK5 A;  3ZNH B;  3WA0 A;  4B9K A;  1GUA B;  4ZRI A;  1RLF A;  4B95 A;  1LFD A;  2RGF A;  4NPN A;  2J0M A;  4FJZ A;  4II2 B;  1P1A A;  4YL8 A;  4IWP A;  3TL5 A;  2IBI B;  3KH0 A;  2BWF A;  2ZPN A;  3WAL A;  4HK2 A;  1LXD A;  4KSK C;  4NAW B;  3KYD D;  3GZN I;  3L54 A;  2DZM A;  3HM6 X;  3PHX B;  3L17 A;  1EUV B;  2IO2 B;  2ZJD A;  3RZW C;  4DK5 A;  2KDE B;  3ALB A;  2JT4 B;  4HWI B;  4W9K A;  4MGZ E;  1GNU A;  1OGW A;  3IFW B;  3WAM A;  2KTF A;  4LDT D;  3DQV A;  4G3X B;  4WWN A;  3RZF A;  3A9K A;  4X57 B;  3V61 A;  1NBF C;  4ZRK A;  2KN5 A;  4FBJ B;  4GB9 A;  2BYF A;  3DVG Y;  4PYU A;  1YJ1 A;  1WMH B;  2KOX A;  1RAX A;  4EEW A;  3KYC D;  1EF5 A;  1K8R B;  2KFK A;  2C9W B;  2ZCB A;  1S3S G;  1WGY A;  2KJR A;  3IBE A;  4DHJ B;  4CYE A;  1V80 A;  1WE7 A;  1V86 A;  1RFA A;  2CHZ A;  4JGH B;  2A5U A;  4NJ6 A;  2L0F A;  1YX6 B;  3H9D A;  5EDS A;  1GC6 A;  3QAQ A;  2RSU A;  4GDK B;  4EZL A;  1E8X A;  2N7D A;  3PTF C;  3NY5 A;  3OAW A;  1J8C A;  4KZ0 A;  1ISN A;  4JQW C;  1SIF A;  1TBE A;  4PYZ A;  2AYO B;  2N1W A;  2PEA A;  2ZVO A;  3QAR A;  4GIV A;  4MSQ B;  3WIM A;  4ANX A;  3QA8 A;  4ZDV A;  2IY1 B;  1UBI A;  3U30 A;  1WI0 A;  2FNJ B;  3ZVV A;  2I1J A;  1V49 A;  2LI5 A;  2FUH B;  2NPT A;  1HE8 A;  1P98 A;  3V60 A;  1NDD A;  2ZEQ A;  3QIJ A;  4DDI D;  2O6V D;  2J7Q B;  3WAP A;  3JW0 X;  1SGH A;  2D11 A;  2L7R A;  4E71 A;  5HKH A;  4I6P A;  1I42 A;  4GN1 A;  4K7U A;  2PE9 A;  3W1S C;  2CU1 A;  2DYB A;  2HD5 B;  4F8C B;  4F7Z A;  2FCM A;  3M62 B;  2D3G A;  3PRP B;  5DPR A;  3CF6 E;  2XBB C;  3ZRF A;  4FAD A;  2GBK A;  3L13 A;  3H7P A;  5D94 A;  4G50 A;  4K7W A;  1YX5 B;  4MM3 A;  1GC7 A;  3X23 A;  4GDL A;  3VH4 B;  3APF A;  2HE7 A;  1P9D U;  2Z0E B;  1UZX B;  3PRE A;  2Z0D B;  2MBH A;  3N3K B;  2REX A;  4RM9 A;  5C23 A;  1WY8 A;  1WMH A;  4MJS A;  4NNJ B;  3TIX A;  4URK A;  2C7H A;  2OJR A;  3M95 A;  3VUY A;  4HCN B;  4TKN A;  1OEY A;  1TZ1 A;  1UD7 A;  2MP2 B;  4ANW A;  1SE9 A;  1WR1 A;  4KDI C;  1Y8R C;  2C5L C;  2DAJ A;  1WGH A;  4HCP B;  4W9D A;  3R3M A;  2J0J A;  3BY4 B;  1UBQ A;  2LZ6 A;  3ZNG C;  3V6E B;  1MG8 A;  1XQQ A;  2MBE A;  1LM8 B;  2GOW A;  4EUT A;  4GXB A;  4A3O A;  3VTU A;  5CTR C;  2BPS A;  3PVL A;  4GU2 A;  4BVU C;  3QWZ B;  5JZE B;  3UIO B;  3SD5 A;  3KUZ A;  3M63 B;  2DAF A;  4WJQ A;  5J17 A;  5IAA C;  1BT0 A;  4GGQ A;  2JZZ A;  1WF9 A;  1P3Q U;  2FAZ A;  2IZV B;  3OJ4 B;  3PSE B;  4M0W B;  3ZDT A;  3BIN A;  3JSV B;  4TUU A;  2N9E B;  2KVR A;  2HJ8 A;  4TV3 A;  2ZCC A;  3H6N A;  5CHV C;  2IY0 B;  3PLU A;  2KQS A;  3ZNI D;  2ZVN A;  3K9O B;  2DZI A;  2G45 B;  2GBJ A;  3RT3 B;  4MSM B;  2DZJ A;  2JPH A;  2R2O A;  3A1Q B;  4K81 A;  1S1Q B;  1CMX B;  1WJ4 A;  4K1R B;  1WYW B;  2A4Z A;  3PHW B;  3VHT C;  2KTR A;  4FJV B;  4GDL B;  2BGF A;  1Q5W B;  5E6N A;  3APC A;  3OJ3 A;  3PV1 A;  3ZNZ B;  4F1S A;  4NY0 A;  4E74 A;  3CST A;  1TTN A;  3SU8 X;  1WJN A;  1WH3 A;  1IP9 A;  4AP4 C;  1Q0W B;  4DWF A;  1EF1 A;  2C7N B;  5D2M B;  3A9K B;  2GBM A;  2M0X A;  3P2B A;  2KMC A;  4DBG A;  2J0K A;  3IVF A;  2KDB A;  2M1M A;  2MBB B;  3D32 A;  3L0W B;  3ZLZ A;  4KIK B;  4KDL B;  3UIN B; 
#chains in the Genus database with same CATH topology
 1R4M I;  2WLB A;  2LUE A;  5FKA C;  2ZPY A;  2MW5 A;  4PK1 A;  4NAW A;  2LVP A;  4HLE A;  3J9C A;  2V3P A;  2X38 A;  4RGM A;  3GS2 A;  5LLI A;  3ZTD A;  3T9L A;  4ACF A;  2K6D B;  1VRA B;  1ZUD 2;  2JSV X;  5LXH A;  3DHG C;  3GE3 C;  4HXD A;  1JQ4 A;  1V2Y A;  3EGR A;  1C1Y B;  2M56 B;  2LVQ A;  1I35 A;  3HHM A;  2J53 A;  4J6I A;  3PS6 A;  1D4B A;  5FR6 A;  1FNV A;  3NVV A;  4WJN A;  3R2T A;  3VTW A;  2KO3 A;  4MM3 B;  1WXM A;  2NBV B;  4AJW A;  4N6E B;  2YLM A;  3P63 A;  5J18 A;  4N58 A;  4W9J A;  5C1Z A;  3ZYY X;  4FA6 A;  4IM2 A;  2RPQ A;  2JZ3 B;  3NUH B;  4AJY B;  3HM3 A;  2V3S A;  4IG7 B;  1XF5 L;  2BB6 A;  1QOG A;  3AV8 A;  2IYD B;  3EFC A;  2O2V B;  2KLG A;  4WJO A;  1JWS D;  1HTO A;  1P7F A;  4LJP B;  2QCZ A;  5DPS A;  4K3B A;  1MHX A;  1L2N A;  4ASW C;  2KD0 A;  1OTR B;  1D5Z C;  1VD2 A;  3P42 A;  2K22 A;  4N9F 4;  1JWA D;  4B0M A;  1C3T A;  4WQM A;  3APD A;  2WS3 B;  3C19 A;  3ZTC A;  1F9J A;  3RUL A;  2RPV A;  1YOV B;  5AZH A;  5MPO A;  2LGS A;  2NBW B;  3WCQ A;  2M17 A;  3U8Z A;  4KIK A;  1PUT A;  3ZDM C;  2AL3 A;  2VRR B;  1N5X A;  3NZS A;  2INC C;  3QQ8 B;  1E5W A;  3Q69 A;  3V62 A;  1F52 A;  2CHX A;  2KT7 A;  2J52 A;  2JWZ A;  4BOZ B;  4W9G A;  2MSE D;  2LFI A;  4MGY E;  1V81 A;  5DPW A;  1KJT A;  2NR2 A;  4LNK A;  1RWS A;  4I6L B;  1CZP A;  3ZKJ C;  5DCN A;  3AEB B;  2MJE A;  2UU7 A;  2JRI B;  3BVG A;  3DBR I;  1TS5 A;  3NG0 A;  2ZNV C;  1JWU D;  5JXV A;  1YQ4 B;  2MBO A;  2K6Q A;  3AN1 A;  1M94 A;  2LWP A;  2G4S A;  2WXO A;  1VLB A;  4BKT A;  4MT5 A;  3TSS A;  3DVN V;  5AEK B;  1R4N B;  4HKQ A;  1KH0 A;  4BBN C;  4FLH A;  3JSV A;  3SEB A;  2LEK A;  4M0W A;  2KX0 A;  1QZE A;  1FCL A;  3DOW A;  4P1C C;  4I6N B;  4CHK A;  3QX1 A;  2MWS B;  2LAS A;  3KUC B;  2K1F A;  2DEN B;  1WXS A;  1SBB B;  2KWC A;  3B2G A;  2WHI A;  1SJE D;  3WAN A;  3AUL A;  1L0V B;  3ML9 A;  1WGD A;  1D3Z A;  2LGY A;  1GB4 A;  5AUI A;  3PZD A;  3A9J B;  1WFY A;  3TMP B;  4RM8 A;  1E8W A;  1UEL A;  1XLP A;  3EC8 A;  4TQ1 A;  1N62 A;  2FCN A;  1HXY D;  3BWU D;  5J2R A;  2DZK A;  1AW7 A;  2KWV B;  1KOT A;  2ZZP B;  4YT0 B;  1RFK A;  4OZB A;  1EU4 A;  3ENE A;  3ZW3 A;  5G55 A;  1XCT L;  3RPF C;  4YSZ B;  3UQB A;  2PJH A;  1UGJ A;  2CR5 A;  3DBH B;  1V6E A;  1SE2 A;  2GBR A;  4ICU A;  4WAA A;  4P6V F;  2MA9 B;  2UWQ A;  3MJW A;  4BAX A;  3ZXR A;  3NZ3 A;  1GPX A;  3HK0 A;  1WM3 A;  2K9X A;  3W1Y A;  2L3Z A;  2WXF A;  4XGA B;  2BYV E;  4PS8 A;  4C56 C;  2G4D B;  4CO7 A;  4KGS A;  3KVF B;  2XK5 A;  2QIE B;  4B95 A;  1RLF A;  1HZ6 A;  4NPN A;  1P1A A;  1JW9 D;  4YL8 A;  3TL5 A;  4R3D A;  1C76 A;  2ZPN A;  1XLN A;  3KYD D;  2N0S B;  1SE3 A;  3GZN I;  3Q14 C;  1EUV B;  2WXM A;  4DK5 A;  3ALB A;  2JT4 B;  3IAM 1;  2ONQ A;  4W9K A;  1OGW A;  2GRI A;  2KTF A;  1JWB D;  1E6E B;  3AE5 B;  4ZRK A;  4FBJ B;  4GB9 A;  2BYF A;  4HRO A;  1WMH B;  3BK1 A;  3R8B A;  3KYC D;  1EF5 A;  1MI0 A;  2C9W B;  2ZCB A;  4OZA A;  1WE7 A;  2W3S A;  3ZQ4 A;  4NJ6 A;  1STE A;  3H9D A;  3QAQ A;  2RSU A;  4EZL A;  2AX5 A;  1NEK B;  2N7D A;  2WXL A;  1SIF A;  4ANX A;  3QAR A;  1I4R A;  4GIV A;  5EE9 A;  1DOI A;  1UBI A;  3U30 A;  1WI0 A;  2QC8 A;  3MP9 A;  2RDG A;  1V49 A;  1OQQ A;  1HE8 A;  1NDD A;  2O6V D;  3AB5 A;  4E71 A;  1I42 A;  1MVK A;  4IDI A;  2D3G A;  3ZRF A;  4FAD A;  1SF0 A;  3L13 A;  1KF6 B;  5D94 A;  1EWC A;  1RYJ A;  1XLQ A;  4K7W A;  2AQ3 B;  4LNO A;  4GDL A;  3VH4 B;  3APF A;  2Z0E B;  3MC8 A;  2Z0D B;  5C23 A;  1WMH A;  3AED B;  3TIX A;  2C7H A;  4C4V A;  4TKN A;  2BVC A;  2W82 A;  1V1O A;  1SIJ A;  4KDI C;  1AWD A;  1WGH A;  2Z8L A;  2BS2 B;  3U52 E;  1UBQ A;  3ZNG C;  1MG8 A;  1XQQ A;  1LM8 B;  4EUT A;  1F1H A;  4A3O A;  4C7Z A;  3PVL A;  4GU2 A;  1MJD A;  4YSX B;  2JXT A;  2EKI A;  1BT0 A;  1P3Q U;  4M0W B;  2N9E B;  5CHV C;  2KQS A;  3P4Q B;  3NVZ A;  2ZVN A;  3ZNI D;  2DZI A;  2G45 B;  1WSP A;  2JPH A;  1IGD A;  3EUB 2;  4GDL B;  1Q5W B;  2PLP A;  3ZJT A;  1FNW A;  2WXQ A;  1RM6 C;  1Q10 A;  4NY0 A;  4ZOH C;  3SU8 X;  1ZDX A;  4NZL B;  3A9K B;  4JWU C;  4KKJ A;  2M0X A;  2WXR A;  1YMH E;  4QAY A;  1IGC A;  2J0K A;  2KDB A;  2KAC A;  3OWE B;  1K52 A;  2KJH B;  3MC0 B;  1JCK B;  1F2R C;  1TGZ B;  3O65 B;  1E7U A;  5HFY A;  2AQ1 B;  5BO4 B;  2JUO A;  2BYE A;  4OZC A;  1YD8 U;  3H1U A;  5TSS A;  2EMS A;  4W9H A;  4XX5 A;  2WYQ A;  2DBY A;  4K7S A;  3Q2A C;  1FXT B;  2KLC A;  2D3A A;  1G6J A;  1FXA A;  4IC7 B;  4C7Y A;  3ZIM A;  2V4I B;  2OOB B;  1VR9 A;  1L0Y B;  3VFK A;  3TEY A;  2BF8 B;  2L00 B;  3N30 A;  4HKZ E;  2KX3 A;  1PGX A;  4JIO U;  1I7H A;  3OG5 A;  2GBN A;  2RR9 A;  4LK0 M;  2WXI A;  1D5X C;  1IPG A;  3UI3 A;  3DDC B;  3HRD D;  4FHJ A;  2NVU I;  2YVC A;  1A5R A;  4L1B A;  4MH0 E;  2AWT A;  3DPD A;  4ARC A;  2IGH A;  1K51 A;  4IM0 A;  1HEZ E;  4KSL C;  4DDG D;  1VZ8 A;  2KDF B;  5KHO A;  2JYE A;  2V1Y A;  3U7Z A;  4E3C A;  3VVW B;  2PE6 B;  3MC9 A;  4XZ4 A;  4G0N B;  3PT2 B;  2LGI A;  2GI9 A;  1CJE A;  2NCN A;  1FFV A;  1XEE A;  4OHJ A;  2ZW0 A;  3T3O A;  2WQY B;  2G9H D;  1SB3 C;  2ASQ A;  3VR8 B;  4WH4 A;  1WM2 A;  3DBS A;  1TT5 B;  2CS4 A;  2W54 A;  1WXA A;  4WWP A;  3HVZ A;  4ZRJ A;  4IUM B;  3X0W A;  3PLV A;  4TSS A;  1HA5 A;  4D2K A;  2GB1 A;  3TBL D;  2LRU A;  4N59 A;  3VAW A;  1L5P A;  2ZNV B;  1V8C A;  3OLM D;  1WWT A;  2MHJ A;  5IOI A;  4H2A A;  4GDK A;  1L7Y A;  2N4F A;  2TSS A;  4A3P A;  3GZN B;  4TQ0 A;  1N5W A;  1WX8 A;  3N32 A;  1I4H A;  1JRP A;  2BWE S;  3Q8B A;  2NPT B;  3RNE C;  3URY A;  4IM3 A;  2L83 A;  2BB5 A;  3RNA C;  3L10 B;  1SJH D;  4FJY A;  2C60 A;  1TIF A;  4NJ7 A;  2RD0 A;  4DQO C;  2ON8 A;  5JH5 C;  1YNT E;  2LHD A;  1YJI A;  3RN9 C;  1KTK A;  2D07 B;  1T0R C;  2FE8 A;  1L4Z B;  1FIQ A;  3NZU A;  3PRZ A;  2QMT A;  2BW2 A;  2X8X X;  2LVO A;  2WDQ B;  3AU5 A;  2BKF A;  3VTV A;  4XDC A;  3AMZ A;  4RFB A;  5H92 C;  3Q8A A;  2L8J A;  2ICI A;  3W1S A;  4EOY A;  2J42 A;  3MHZ A;  2LGX A;  3W9C B;  1VJK A;  1YIW A;  4ZYN A;  1P0R A;  3CSF A;  3A1Q A;  1FPY A;  3ZO5 B;  2O6V B;  3PRM B;  3ABV B;  3W5U B;  2OED A;  4MAC A;  4WUR A;  2WWZ A;  1AAR A;  2PMV A;  2DNF A;  2WGS A;  4UDU C;  5JHB A;  1T3Q A;  4HPL B;  1UWM A;  3L16 A;  3B9J A;  4HRS A;  2FIF A;  3AE6 B;  4M01 A;  1ET6 A;  3A33 B;  4IW0 A;  4BFR A;  2JVC A;  3EFU A;  1H4R A;  4ITK A;  1LQB A;  2IGG A;  1KLU D;  1I4Q A;  1I4P A;  3RNC C;  2WX0 A;  3I5J C;  2MLB A;  1E8Y A;  1ZP0 B;  3LB8 C;  3RUI B;  3AXC A;  2Y3A A;  5AZF A;  1H8C A;  2KC2 A;  3QJZ A;  2BBC A;  1L0X B;  4Q2J A;  3BII D;  3T3N A;  1P7E A;  4ANV A;  3LYY A;  4WWM A;  2N7E A;  2NS5 A;  5L95 C;  4GOC A;  2G3Q B;  3KWL A;  1ZOY B;  4XDD A;  4L2Y A;  2KYW A;  2EEL A;  3AE3 B;  4FXC A;  3MTN B;  1QIL A;  1WJ6 A;  1ZKH A;  2YEP B;  3A9J A;  4DXF A;  3ZJV A;  1C4C A;  2SAK A;  2KQ7 A;  2XEW A;  3LXF A;  3ZNH B;  4ZRI A;  3FIL A;  1MG4 A;  4FJZ A;  4LNF A;  4IWP A;  2BS3 B;  3V3X A;  2PVG C;  4HK2 A;  4KSK C;  4NAW B;  1BUI C;  1NYQ A;  3GE8 C;  4HWI B;  2VZK D;  1WYG A;  1J7A A;  1ET9 A;  4LDT D;  2L52 A;  4X57 B;  1NBF C;  3E56 A;  1XXG A;  4EEW A;  3ZGZ A;  1BXT A;  1UF0 A;  2KJR A;  4DHJ B;  1WRI A;  1V86 A;  1RFA A;  4ARI A;  2L0F A;  1YX6 B;  5I4D A;  5EDS A;  4GDK B;  1E8X A;  1TY2 A;  4P1B C;  4P16 A;  4KZ0 A;  1FRD A;  3I9V 1;  1TBE A;  4PYZ A;  2ZVO A;  1JAL A;  2IY1 B;  2IGD A;  2I1J A;  2LI5 A;  2NPT A;  4DDI D;  4NJC A;  1TS4 A;  2PTL A;  4I6P A;  1KLG D;  4GN1 A;  2PE9 A;  2CU1 A;  2DYB A;  1TZO A;  1LO5 D;  1J7C A;  5DPR A;  3CF6 E;  1FNU A;  2KDM A;  1I4X A;  4XWW A;  5BYQ A;  1PGA A;  1GC7 A;  1P9D U;  3IAS 1;  2MBH A;  2R61 A;  4RM9 A;  3DHH C;  4MJS A;  2OJR A;  1L6V A;  2KQ4 X;  1UD7 A;  2MP2 B;  2DLB A;  2SEB D;  1SE9 A;  1WR1 A;  3Q8E A;  2C5L C;  3AE7 B;  3R3M A;  2J0J A;  2PVO D;  2PKO A;  4KGR A;  4ZYS A;  2BPS A;  1NYR A;  3KUZ A;  2WXH A;  3HVD A;  2CJN A;  3PSE B;  3BIN A;  4MH8 A;  4YTN B;  2ZCC A;  3H6N A;  1ZE3 D;  3PLU A;  3K9O B;  4JPS A;  4MSM B;  2DZJ A;  1CMX B;  3RI7 C;  1WYW B;  3PHW B;  3APC A;  4RGN A;  4A55 A;  3N20 C;  2W55 A;  1TTN A;  1WH3 A;  4DWF A;  2C7N B;  2GBM A;  2KVZ A;  1YN5 A;  3P2B A;  2KMC A;  3L0W B;  4KIK B;  3AE1 B;  1K53 A;  4KDL B;  1E0Z A;  2WX1 A;  3PO0 A;  4RF1 A;  2JY6 A;  2IO3 B;  4LTU A;  3Q3J A;  2K3U A;  1ZGU B;  4IKG A;  2KAN A;  1KLV A;  3ONS A;  3ZJU A;  2KC1 A;  4OVZ A;  2QHO A;  4A90 A;  1OFF A;  3TCA A;  3KQ4 A;  3AEE B;  2WU5 B;  1ZXH A;  3MJ5 A;  4DXA B;  1K50 A;  4LLG M;  4GSW A;  1GAQ B;  2M4N A;  1AN8 A;  3EHV A;  1B9R A;  3R7R A;  1QOF A;  4MDK E;  2AL6 A;  1XT9 B;  4ZHP A;  3RYT A;  1TKY A;  4BKG A;  3TJP A;  1VZ6 A;  3FIL B;  3P4R B;  3A4R A;  2BT6 A;  2DHZ A;  1R4M B;  2LJI A;  3RD2 A;  3E9S A;  3CWI A;  1A70 A;  1E90 A;  4W9L A;  2L0T A;  1ACC A;  1TS2 A;  1V9J A;  3C8Y A;  3PPA A;  3NRZ A;  2K8C A;  3KWV A;  3EA6 A;  1FMA D;  2K5P A;  3Q3M C;  3FAH A;  4PS3 A;  2N1V A;  2INN E;  4W9F A;  1WRD B;  4JE3 B;  1E10 A;  3N1Y C;  4W9C A;  4YXD B;  4TMA B;  1J0G A;  3IT6 B;  2MJ3 A;  2CU3 A;  4HEA 1;  4MEL A;  3RNB C;  3DVN U;  1UH6 A;  3KUD B;  2H88 B;  1DGJ A;  2WDV B;  2KMA A;  5L83 A;  1CQV A;  2MCN B;  3U2S C;  5G2N A;  1F2R I;  1R4N I;  2Q5W D;  1YJJ A;  1KM7 A;  1JRU A;  4WQO B;  2VH2 A;  4YWG G;  1SSN A;  4RH6 A;  2Y5P A;  2XK5 B;  4RCO A;  2N9P C;  4EE2 A;  3V6C B;  2JYT A;  4FHK A;  3SFE B;  3IG3 A;  5E6P A;  2DYM A;  4RNA A;  2EKE C;  4MGI E;  3R66 C;  1XLO A;  5BMI A;  2WDR B;  3M3J A;  1WJU A;  5G5G A;  3ML8 A;  1VDV A;  1UGM A;  3VUW A;  5LXI B;  1XD3 B;  3DWM A;  3QHT A;  1TYG B;  3DBL B;  2NTS A;  3K9P B;  2WDT B;  3T8M A;  2KK8 A;  4LCD E;  3VUX A;  1SE4 A;  4DHZ B;  2JX5 A;  1ROE A;  4BOS C;  2I2Y A;  4IOI E;  3UF8 A;  5KHQ A;  2KFK B;  5FK9 C;  4HJK A;  1C77 A;  3SDL C;  3U4E G;  2H89 B;  4PS7 A;  1L4D B;  2KHW B;  1T0Q C;  3FKY A;  3TEX A;  1Q1O A;  3AM9 A;  2WNM A;  1OQY A;  1WX9 A;  4OVV A;  2E3T A;  2EMT A;  3VH3 B;  1MFW A;  4NQL B;  3ZUN A;  3NS8 A;  3DBH I;  2KAJ A;  2IND C;  3VXW A;  4J3O D;  3LJ3 A;  3QC8 B;  1KRH A;  1YQB A;  1WIA A;  1Y56 A;  2PPH A;  4US8 A;  2BKR B;  2D10 A;  2KXJ A;  2DX5 B;  3PZ8 A;  1T0Y A;  3UIP B;  1IYF A;  3I3T B;  4W9I A;  4RGO S;  2IJ0 A;  1WGG A;  2K8H A;  1B1Z A;  2LXA A;  2Y5C A;  2MRP A;  4LJO B;  3NOB A;  3H8H A;  2MQJ A;  2WP9 B;  2KFJ A;  4ZRP A;  5FR3 A;  4IWO A;  1U4A A;  2LD9 A;  4BKS D;  2FCS A;  5DPT A;  2OJW A;  1WR6 E;  3IXS A;  2V4L A;  2LXC A;  5AZG A;  5IA7 A;  1ZXI A;  1Z2M A;  2IO1 B;  2O6V A;  3AE2 B;  2GMI C;  3BVZ A;  2HDE A;  1DOX A;  3N9Y C;  1PDX A;  3PGE A;  2UYZ B;  4FUL A;  1V5T A;  2R2Q A;  4GLS C;  2HTH A;  4M8N A;  3IHP C;  5GMV A;  3DCG A;  1OEY J;  1T6B X;  4M8M A;  4NAM A;  3ZRC A;  1OQR A;  4WAF A;  4C00 A;  3C0R B;  3W2D A;  1C4P A;  2V0G A;  4B0E A;  4II2 B;  5GXG B;  4HPP A;  2IBI B;  1NEN B;  4XYC A;  3PHX B;  3L17 A;  2IO2 B;  4KX6 B;  2IPK D;  1UWX A;  1TKG A;  1C78 A;  4MGZ E;  3WAM A;  4WWN A;  3DQV A;  3DBR B;  3A9K A;  1FEH A;  3BYY B;  3DVG Y;  5HI1 A;  3BYT B;  1F0Z A;  2LUM A;  3IBE A;  4S17 A;  1J7B A;  1V80 A;  2CHZ A;  4JGH B;  2A5U A;  4A9A A;  2M0A A;  3PTF C;  3NY5 A;  1J8C A;  1ISN A;  2JU6 X;  2N1W A;  4MSQ B;  3VR9 B;  3Q6B A;  3QA8 A;  4L23 A;  3I57 A;  2LHE A;  3V60 A;  2FUH B;  1P98 A;  3QIJ A;  5D3D A;  4REZ A;  2J7Q B;  2L7R A;  2D11 A;  5HKH A;  1XO3 A;  1N63 A;  4WIP A;  4K7U A;  3NS1 A;  2HD5 B;  4KGT A;  1UNS A;  3PRP B;  2XBB C;  4CQN A;  2GBK A;  3H7P A;  3SFD B;  1YX5 B;  3AH7 A;  4MM3 A;  2N7J A;  3X23 A;  2HE7 A;  3DHI C;  2FUG 1;  1UZX B;  3PRE A;  3N3K B;  1WY8 A;  3N1X C;  4NNJ B;  4URK A;  1D5M C;  3P4P B;  3VUY A;  3DWG C;  5EE3 A;  4HCN B;  1SXT A;  1OEY A;  1TS3 A;  4ANW A;  1T5X D;  2V3N A;  2DAJ A;  4W9D A;  3BY4 B;  2LZ6 A;  3V6E B;  1KFY B;  3P1M A;  2MBE A;  4GXB A;  2BS4 B;  5CTR C;  5JZE B;  3N1Z C;  1E7P B;  2DAF A;  4WJQ A;  3TEZ A;  4GGQ A;  1WF9 A;  2FAZ A;  3JSV B;  4TUU A;  4TV3 A;  5AUK A;  4BZA A;  2CJO A;  2GBJ A;  3RT3 B;  2R2O A;  3AE9 B;  4K81 A;  1S1Q B;  1WJ4 A;  4K1R B;  3VHT C;  1ZPS A;  2KTR A;  4FJV B;  2JQR B;  1BML C;  4F1S A;  4DXG A;  1NVI D;  3CST A;  1WJN A;  4AP4 C;  1Q0W B;  1EF1 A;  1SEB D;  4DBG A;  3IVF A;  2M1M A;  2MBB B;  2LMC A;  3UIN B;  4ZRQ A;  4KVG B;  2I1K A;  1V1P B;  4USA A;  4WWO A;  1WGK A;  2YEP F;  2ZW1 A;  4EZJ A;  5D7G A;  2KMM A;  1GG3 A;  2D3C A;  2W9N A;  3WAO A;  4GMV A;  1FFU A;  2M19 A;  2VZK B;  1YN4 A;  4A8X C;  2K0P A;  1WZ0 A;  1EWY C;  2O2V A;  3VDZ A;  3BVM A;  1QOB A;  4G11 A;  5D6J B;  5C3J B;  3VQI A;  3L4P A;  3Q3O C;  3RCZ A;  2KTR B;  2RDB C;  4K3C A;  1N6Z A;  1V97 A;  4XC2 A;  5E6O A;  1PGB A;  4JX1 C;  1V5O A;  2AQ2 B;  2JF5 A;  2NBU A;  1Z5S B;  4W9E A;  4LNI A;  1PQS A;  2MJD A;  3AEA B;  1WXV A;  1GB1 A;  3BZD B;  1EO6 A;  4JWS C;  3HIZ A;  4AS1 A;  2JRH A;  2D3B A;  4C4V B;  1WGR A;  4RF0 A;  4HDO A;  5IN7 A;  2WXJ A;  1V1P A;  3GOE A;  2KNB A;  3ECI A;  2IO0 B;  2HJ1 A;  2N9X A;  2QIL A;  1UUP A;  4KZC A;  2BTE A;  5BYR A;  2WXP A;  3MFG A;  4B6W A;  2NMQ A;  4KKI A;  2ACZ B;  4JL9 A;  4HDQ A;  2KDI A;  1YN3 A;  2M8S A;  3QCA A;  4MJS B;  4EKU A;  1FXI A;  3KLS X;  1I4G A;  4HJG E;  2V9H A;  3DBL I;  3LDZ E;  1VCB A;  4YTM B;  5JHA A;  3PZ7 A;  3Q8C A;  2W3R A;  2QEJ C;  5IP4 D;  4HVB A;  1F77 A;  1NI2 A;  4ZHO A;  5CHF A;  3JVZ X;  2KJ6 A;  1LGR A;  3JYU A;  1JML A;  2LRW A;  3VRB B;  4ICV A;  1WX7 A;  4AWJ A;  5D3I B;  1ZW7 A;  2K8B A;  2KWU B;  4LDT B;  3IT4 B;  2L1A A;  2L05 A;  2J4X A;  4ANU A;  2L76 A;  1FRR A;  4NQK E;  3RNF C;  3SHQ A;  3A4S C;  4RGT A;  3ZXV A;  2PW9 A;  1FO4 A;  3AU4 A;  3CMM B;  3B2F A;  3B1L X;  4BKS A;  1WE6 A;  2XNA C;  3H7P B;  1DOY A;  1GJZ A;  1FM0 D;  4AUQ C;  2WXG A;  2Y5B B;  5BMG A;  1IBX B;  3ETR A;  3UQA A;  3Q3F A;  2CHW A;  1EU3 A;  4OVU A;  3KW5 B;  1RRB A;  1CK1 A;  4US9 A;  2MP2 A;  2B76 B;  4MEM A;  4EFO A;  2KZR A;  1GOZ A;  2C7M B;  4PT5 A;  5E6J A;  1T0S C;  4WJP A;  5BYS A;  1HZ5 A;  2B3A A;  2PIA A;  2DYO A;  3QK0 A;  2MBQ A;  5CHW A;  2MH7 A;  2GLS A;  2K39 A;  2D2Q A;  3DVG X;  3AEC B;  2KN4 A;  4DHJ D;  1PFD A;  5T8I A;  1E7V A;  2AEH A;  1E8Z A;  3U7D A;  4MGK E;  1PYW D;  4RMA A;  2N9L A;  2LJ5 A;  2WU2 B;  1MPE A;  2WXN A;  3EEC A;  1IBX A;  1QF6 A;  1C4A A;  5IKC M;  2JXX A;  1NI3 A;  2Z59 B;  2INP E;  2FCQ A;  2BYT A;  5TR5 A;  2KKC A;  2QSD A;  3AE4 B;  4AOF A;  3FC4 A;  3TEW A;  2FID A;  2OHF A;  1EM7 A;  3H7S A;  2D5G A;  3RNG C;  1C9F A;  1TKE A;  1QQR A;  4M00 A;  2HTM E;  4P7I A;  4AQ7 A;  3TUO A;  1ESF A;  4DHZ E;  2DWQ A;  5LNK 1;  5BMH A;  3L08 A;  4HPM B;  1J19 A;  3AEF B;  3B0A A;  3S2A A;  3HUI A;  4A20 A;  4IWQ A;  3UGB B;  4BBN F;  1WZ3 A;  2IDY A;  4JLC A;  3R7Q A;  3P4S B;  4EZK A;  2BQQ A;  3GB1 A;  4KV2 A;  1ENF A;  2CKH B;  3I63 C;  3B08 A;  2RDH A;  4FN2 A;  4M02 A;  1WXQ A;  1AYF A;  5CX3 A;  1X1M A;  4II3 B;  3NHE B;  2MX2 A;  3MHS D;  3AI5 A;  2K25 A;  2I38 A;  2LGD A;  3WA0 A;  2JZP A;  4B9K A;  4YSY B;  5H8Y E;  1GUA B;  2MEK A;  1LFD A;  2RGF A;  4S0R A;  2J0M A;  4A6Q A;  4XWT A;  3KH0 A;  2BWF A;  3WAL A;  1QOA A;  1LXD A;  3L54 A;  2DZM A;  1N61 A;  3HM6 X;  1L6U A;  2ZJD A;  3RZW C;  1VZ7 A;  4C80 A;  2KDE B;  1GNU A;  3IFW B;  1D6E C;  4G3X B;  3RZF A;  3V61 A;  2KWD A;  2KN5 A;  1ZDV A;  1YJ1 A;  4PYU A;  2KOX A;  1RAX A;  1E9M A;  1K8R B;  1YQ3 B;  2KFK A;  1S3S G;  1WGY A;  1QT9 A;  1M4V A;  4CYE A;  4OW0 A;  5IO9 A;  1GC6 A;  3NVY A;  2N9K A;  1HQR D;  3OAW A;  2G1E A;  5EE1 A;  5EE0 A;  2L32 A;  4JQW C;  5C2T B;  2AYO B;  2PEA A;  3WIM A;  2E6X A;  4ZDV A;  2FNJ B;  3ZVV A;  1TY0 A;  3CIR B;  2ZEQ A;  1R7S A;  3WAP A;  3JW0 X;  1C79 A;  1FCC C;  1SGH A;  1DYQ A;  3Q3N C;  4O1N A;  3W1S C;  4F8C B;  4F7Z A;  2FCM A;  3M62 B;  2RMM A;  1XCQ L;  4G50 A;  3RMK C;  2JWU A;  2VH1 A;  4LNN A;  3VRA B;  2REX A;  3RFZ B;  3M95 A;  3W5V B;  2QDF A;  1FD6 A;  1TZ1 A;  3SR6 A;  5G5H A;  3BK2 A;  1Y8R C;  3R2I A;  2XN9 C;  3O13 A;  4HCP B;  5HG2 A;  2NTT A;  2GOW A;  5HHD G;  3VTU A;  3Q8F A;  4BVU C;  3QWZ B;  3UIO B;  3SD5 A;  3M63 B;  5J17 A;  5IAA C;  3NVW A;  1N60 A;  2JZZ A;  1JRO A;  2IZV B;  3OJ4 B;  3GP7 A;  1IUE A;  3ZDT A;  1MHH E;  2KVR A;  2HJ8 A;  4YTP B;  2IY0 B;  2FBW B;  3AE8 B;  3A1Q B;  1HTQ A;  1QLB B;  2A4Z A;  3NJT A;  4XE0 A;  2BGF A;  5E6N A;  3OJ3 A;  3PV1 A;  3ZNZ B;  4E74 A;  1QKZ A;  1IP9 A;  1JWM D;  2QJL A;  2WXK A;  5D2M B;  3AEG B;  1TJE A;  3ZLZ A;  3D32 A;  3V05 A; 
#chains in the Genus database with same CATH homology
 2WX1 A;  2KJH B;  4KVG B;  1R4M I;  1TGZ B;  2LUE A;  2ZPY A;  3O65 B;  2I1K A;  1E7U A;  2MW5 A;  4WWO A;  4EZJ A;  5BO4 B;  5D7G A;  4NAW A;  2LVP A;  2JY6 A;  2JUO A;  1GG3 A;  2BYE A;  4HLE A;  2W9N A;  3WAO A;  2IO3 B;  4GMV A;  5LLI A;  3ZTD A;  1YD8 U;  3Q3J A;  1ZGU B;  3T9L A;  2K6D B;  3H1U A;  2KAN A;  5LXH A;  2EMS A;  4W9H A;  4XX5 A;  2WYQ A;  1KLV A;  4HXD A;  3ONS A;  1WZ0 A;  4K7S A;  2O2V A;  3VDZ A;  2KC1 A;  1FXT B;  2KLC A;  4G11 A;  1V2Y A;  5D6J B;  1G6J A;  3VQI A;  1C1Y B;  2LVQ A;  4IC7 B;  3HHM A;  1I35 A;  2QHO A;  3ZIM A;  3RCZ A;  2KTR B;  2OOB B;  4J6I A;  3TCA A;  3PS6 A;  4XC2 A;  5FR6 A;  5E6O A;  4WJN A;  3VFK A;  2BF8 B;  1V5O A;  2JF5 A;  2KO3 A;  2L00 B;  2NBU A;  3N30 A;  3VTW A;  4DXA B;  1Z5S B;  4W9E A;  2KX3 A;  1PQS A;  1WXM A;  4JIO U;  2GBN A;  2NBV B;  2RR9 A;  1IPG A;  4GSW A;  3DDC B;  4FHJ A;  2NVU I;  1WXV A;  2M4N A;  4AJW A;  3EHV A;  2YVC A;  1EO6 A;  3R7R A;  2YLM A;  3HIZ A;  4MDK E;  2JRH A;  1A5R A;  5J18 A;  1WGR A;  4MH0 E;  2AL6 A;  1XT9 B;  4W9J A;  2AWT A;  3DPD A;  5C1Z A;  4HDO A;  3RYT A;  4FA6 A;  4IM2 A;  2RPQ A;  2JZ3 B;  3GOE A;  2KNB A;  3ECI A;  4BKG A;  3TJP A;  2IO0 B;  4AJY B;  2N9X A;  3HM3 A;  4IM0 A;  2V3S A;  4KSL C;  3A4R A;  4DDG D;  2DHZ A;  3RD2 A;  2KDF B;  4KZC A;  4IG7 B;  5KHO A;  2V1Y A;  1E90 A;  4B6W A;  4E3C A;  3VVW B;  4W9L A;  2PE6 B;  2L0T A;  4XZ4 A;  1V9J A;  4G0N B;  2IYD B;  2O2V B;  3PT2 B;  3PPA A;  4JL9 A;  2K8C A;  2KDI A;  4HDQ A;  2KLG A;  4WJO A;  2NCN A;  2M8S A;  3QCA A;  4MJS B;  4EKU A;  3DBL I;  4LJP B;  3LDZ E;  2ASQ A;  5DPS A;  1VCB A;  4PS3 A;  5JHA A;  2N1V A;  4W9F A;  1WRD B;  4W9C A;  4HVB A;  1J0G A;  1NI2 A;  1WM2 A;  3DBS A;  2CS4 A;  1L2N A;  5CHF A;  1WXA A;  3JVZ X;  4WWP A;  2KD0 A;  4ASW C;  2KJ6 A;  1OTR B;  4MEL A;  4IUM B;  4ZRJ A;  3DVN U;  3X0W A;  3PLV A;  1VD2 A;  1UH6 A;  3JYU A;  2LRW A;  3KUD B;  4N9F 4;  1C3T A;  2KMA A;  3APD A;  3ZTC A;  4ICV A;  5L83 A;  1F9J A;  3TBL D;  2LRU A;  1WX7 A;  3RUL A;  3VAW A;  2ZNV B;  4AWJ A;  2MCN B;  5AZH A;  3OLM D;  5G2N A;  2NBW B;  1ZW7 A;  1R4N I;  2M17 A;  4GDK A;  1L7Y A;  2K8B A;  2KWU B;  4LDT B;  2N4F A;  1KM7 A;  1JRU A;  4WQO B;  4A3P A;  3U8Z A;  4TQ0 A;  1WX8 A;  3N32 A;  4KIK A;  2L05 A;  3ZDM C;  2AL3 A;  2BWE S;  2NPT B;  4ANU A;  2L76 A;  2VRR B;  2XK5 B;  4IM3 A;  4NQK E;  2N9P C;  3V6C B;  3SHQ A;  3A4S C;  3NZS A;  4FHK A;  3L10 B;  3IG3 A;  4FJY A;  3AU4 A;  3CMM B;  2C60 A;  3B1L X;  3QQ8 B;  5E6P A;  1E5W A;  2DYM A;  4NJ7 A;  4BKS A;  1WE6 A;  2RD0 A;  2EKE C;  4MGI E;  3H7P B;  3R66 C;  3V62 A;  2CHX A;  1GJZ A;  5JH5 C;  3M3J A;  4AUQ C;  2JWZ A;  1WJU A;  4W9G A;  2MSE D;  4MGY E;  4BOZ B;  2Y5B B;  3ML8 A;  1UGM A;  2D07 B;  1V81 A;  5DPW A;  1KJT A;  2NR2 A;  3VUW A;  5LXI B;  4I6L B;  1XD3 B;  3UQA A;  3NZU A;  3Q3F A;  2CHW A;  3QHT A;  3PRZ A;  4OVU A;  3ZKJ C;  5DCN A;  2LVO A;  2JRI B;  3KW5 B;  1RRB A;  3K9P B;  2WDT B;  3DBR I;  2MP2 A;  3AU5 A;  3T8M A;  4MEM A;  2KK8 A;  4EFO A;  2ZNV C;  4LCD E;  3VUX A;  2BKF A;  2KZR A;  4DHZ B;  2C7M B;  4BOS C;  2MBO A;  2K6Q A;  3UF8 A;  3VTV A;  5KHQ A;  1M94 A;  4WJP A;  2KFK B;  4HJK A;  3SDL C;  2L8J A;  2LWP A;  2B3A A;  4PS7 A;  2G4S A;  2DYO A;  3QK0 A;  4BKT A;  2KHW B;  3DVN V;  2MBQ A;  5AEK B;  5CHW A;  4BBN C;  3W1S A;  1Q1O A;  4FLH A;  4EOY A;  1OQY A;  1WX9 A;  3JSV A;  4OVV A;  2K39 A;  2D2Q A;  2KX0 A;  2LGX A;  3DVG X;  2EMT A;  3VH3 B;  3ZUN A;  4NQL B;  4DHJ D;  3NS8 A;  1E7V A;  3DBH I;  2AEH A;  1E8Z A;  3U7D A;  1QZE A;  1YIW A;  4MGK E;  4RMA A;  4ZYN A;  1P0R A;  3DOW A;  3CSF A;  2LJ5 A;  3A1Q A;  3VXW A;  3ZO5 B;  2O6V B;  3LJ3 A;  3PRM B;  4I6N B;  4CHK A;  3QX1 A;  2MWS B;  2LAS A;  3QC8 B;  3EEC A;  3KUC B;  2K1F A;  2DEN B;  2WWZ A;  1WXS A;  1YQB A;  1WIA A;  1AAR A;  2PPH A;  2JXX A;  2KWC A;  2Z59 B;  2BKR B;  2D10 A;  5JHB A;  2KXJ A;  4HPL B;  2DX5 B;  1T0Y A;  3WAN A;  3AUL A;  3L16 A;  3UIP B;  2FCQ A;  1IYF A;  5TR5 A;  3ML9 A;  1WGD A;  2FIF A;  3I3T B;  2KKC A;  1D3Z A;  4W9I A;  4AOF A;  3A33 B;  4IW0 A;  4BFR A;  1WGG A;  2JVC A;  3EFU A;  2LGY A;  2K8H A;  2FID A;  3PZD A;  2LXA A;  3A9J B;  3H7S A;  1H4R A;  1WFY A;  3TMP B;  4RM8 A;  2MRP A;  4LJO B;  1E8W A;  3NOB A;  1LQB A;  4P7I A;  1UEL A;  3EC8 A;  4TQ1 A;  2MQJ A;  4DHZ E;  2KFJ A;  2WX0 A;  2FCN A;  1E8Y A;  2MLB A;  4IWO A;  5J2R A;  1U4A A;  2LD9 A;  2DZK A;  3RUI B;  3AXC A;  2FCS A;  4BKS D;  5DPT A;  3L08 A;  1WR6 E;  2KWV B;  5AZF A;  4HPM B;  2ZZP B;  1J19 A;  2KC2 A;  1H8C A;  2V4L A;  1KOT A;  3QJZ A;  3B0A A;  2LXC A;  5AZG A;  3S2A A;  5IA7 A;  3ENE A;  4A20 A;  3ZW3 A;  4IWQ A;  5G55 A;  1Z2M A;  2IO1 B;  2O6V A;  3UGB B;  4BBN F;  1WZ3 A;  2GMI C;  4JLC A;  3R7Q A;  2PJH A;  4ANV A;  4EZK A;  3UQB A;  2CR5 A;  3PGE A;  1V6E A;  2UYZ B;  2N7E A;  2GBR A;  4FUL A;  4KV2 A;  2NS5 A;  1V5T A;  2R2Q A;  4ICU A;  2CKH B;  5L95 C;  4WAA A;  2HTH A;  4GOC A;  2G3Q B;  3B08 A;  4M8N A;  2MA9 B;  3IHP C;  2UWQ A;  3MJW A;  3DCG A;  5GMV A;  4FN2 A;  1OEY J;  3HK0 A;  1WM3 A;  5CX3 A;  3W1Y A;  2L3Z A;  4M8M A;  3MTN B;  2BYV E;  4PS8 A;  1X1M A;  3ZRC A;  1WJ6 A;  4II3 B;  1ZKH A;  2G4D B;  3NHE B;  2MX2 A;  3A9J A;  3MHS D;  3AI5 A;  2K25 A;  3C0R B;  4CO7 A;  2KQ7 A;  2LGD A;  3KVF B;  2XEW A;  2XK5 A;  3ZNH B;  3WA0 A;  4B9K A;  1GUA B;  4ZRI A;  1RLF A;  4B95 A;  1LFD A;  2RGF A;  4NPN A;  2J0M A;  4FJZ A;  4II2 B;  1P1A A;  4YL8 A;  4IWP A;  3TL5 A;  2IBI B;  3KH0 A;  2BWF A;  2ZPN A;  3WAL A;  4HK2 A;  1LXD A;  4KSK C;  4NAW B;  3KYD D;  3GZN I;  3L54 A;  2DZM A;  3HM6 X;  3PHX B;  3L17 A;  1EUV B;  2IO2 B;  2ZJD A;  3RZW C;  4DK5 A;  2KDE B;  3ALB A;  2JT4 B;  4HWI B;  4W9K A;  4MGZ E;  1GNU A;  1OGW A;  3IFW B;  3WAM A;  2KTF A;  4LDT D;  3DQV A;  4G3X B;  4WWN A;  3RZF A;  3A9K A;  4X57 B;  3V61 A;  1NBF C;  4ZRK A;  2KN5 A;  4FBJ B;  4GB9 A;  2BYF A;  3DVG Y;  4PYU A;  1YJ1 A;  1WMH B;  2KOX A;  1RAX A;  4EEW A;  3KYC D;  1EF5 A;  1K8R B;  2KFK A;  2C9W B;  2ZCB A;  1S3S G;  1WGY A;  2KJR A;  3IBE A;  4DHJ B;  4CYE A;  1V80 A;  1WE7 A;  1V86 A;  1RFA A;  2CHZ A;  4JGH B;  2A5U A;  4NJ6 A;  2L0F A;  1YX6 B;  3H9D A;  5EDS A;  1GC6 A;  3QAQ A;  2RSU A;  4GDK B;  4EZL A;  1E8X A;  2N7D A;  3PTF C;  3NY5 A;  3OAW A;  1J8C A;  4KZ0 A;  1ISN A;  4JQW C;  1SIF A;  1TBE A;  4PYZ A;  2AYO B;  2N1W A;  2PEA A;  2ZVO A;  3QAR A;  4GIV A;  4MSQ B;  3WIM A;  4ANX A;  3QA8 A;  4ZDV A;  2IY1 B;  1UBI A;  3U30 A;  1WI0 A;  2FNJ B;  3ZVV A;  2I1J A;  1V49 A;  2LI5 A;  2FUH B;  2NPT A;  1HE8 A;  1P98 A;  3V60 A;  1NDD A;  2ZEQ A;  3QIJ A;  4DDI D;  2O6V D;  2J7Q B;  3WAP A;  3JW0 X;  1SGH A;  2D11 A;  2L7R A;  4E71 A;  5HKH A;  4I6P A;  1I42 A;  4GN1 A;  4K7U A;  2PE9 A;  3W1S C;  2CU1 A;  2DYB A;  2HD5 B;  4F8C B;  4F7Z A;  2FCM A;  3M62 B;  2D3G A;  3PRP B;  5DPR A;  3CF6 E;  2XBB C;  3ZRF A;  4FAD A;  2GBK A;  3L13 A;  3H7P A;  5D94 A;  4G50 A;  4K7W A;  1YX5 B;  4MM3 A;  1GC7 A;  3X23 A;  4GDL A;  3VH4 B;  3APF A;  2HE7 A;  1P9D U;  2Z0E B;  1UZX B;  3PRE A;  2Z0D B;  2MBH A;  3N3K B;  2REX A;  4RM9 A;  5C23 A;  1WY8 A;  1WMH A;  4MJS A;  4NNJ B;  3TIX A;  4URK A;  2C7H A;  2OJR A;  3M95 A;  3VUY A;  4HCN B;  4TKN A;  1OEY A;  1TZ1 A;  1UD7 A;  2MP2 B;  4ANW A;  1SE9 A;  1WR1 A;  4KDI C;  1Y8R C;  2C5L C;  2DAJ A;  1WGH A;  4HCP B;  4W9D A;  3R3M A;  2J0J A;  3BY4 B;  1UBQ A;  2LZ6 A;  3ZNG C;  3V6E B;  1MG8 A;  1XQQ A;  2MBE A;  1LM8 B;  2GOW A;  4EUT A;  4GXB A;  4A3O A;  3VTU A;  5CTR C;  2BPS A;  3PVL A;  4GU2 A;  4BVU C;  3QWZ B;  5JZE B;  3UIO B;  3SD5 A;  3KUZ A;  3M63 B;  2DAF A;  4WJQ A;  5J17 A;  5IAA C;  1BT0 A;  4GGQ A;  2JZZ A;  1WF9 A;  1P3Q U;  2FAZ A;  2IZV B;  3OJ4 B;  3PSE B;  4M0W B;  3ZDT A;  3BIN A;  3JSV B;  4TUU A;  2N9E B;  2KVR A;  2HJ8 A;  4TV3 A;  2ZCC A;  3H6N A;  5CHV C;  2IY0 B;  3PLU A;  2KQS A;  3ZNI D;  2ZVN A;  3K9O B;  2DZI A;  2G45 B;  2GBJ A;  3RT3 B;  4MSM B;  2DZJ A;  2JPH A;  2R2O A;  3A1Q B;  4K81 A;  1S1Q B;  1CMX B;  1WJ4 A;  4K1R B;  1WYW B;  2A4Z A;  3PHW B;  3VHT C;  2KTR A;  4FJV B;  4GDL B;  2BGF A;  1Q5W B;  5E6N A;  3APC A;  3OJ3 A;  3PV1 A;  3ZNZ B;  4F1S A;  4NY0 A;  4E74 A;  3CST A;  1TTN A;  3SU8 X;  1WJN A;  1WH3 A;  1IP9 A;  4AP4 C;  1Q0W B;  4DWF A;  1EF1 A;  2C7N B;  5D2M B;  3A9K B;  2GBM A;  2M0X A;  3P2B A;  2KMC A;  4DBG A;  2J0K A;  3IVF A;  2KDB A;  2M1M A;  2MBB B;  3D32 A;  3L0W B;  3ZLZ A;  4KIK B;  4KDL B;  3UIN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...