2DAFA

Solution structure of the novel identified ubiquitin-like domain in the human hypothetical protein flj35834
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
118
structure length
118
Chain Sequence
GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNETLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the Novel Identified Ubiquitin-like Domain in the Human Hypothetical Protein FLJ35834
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords FLJ35834 protein
total genus 12
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 2005-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2dafA01
3ZNHB 4FHKA 1GUAB 3ALBA 2MP2B 3KUCB 3M63B 2LGXA 1WE7A 4PYUA 2KWVB 2JVCA 4F7ZA 2LVQA 1WGYA 1ZW7A 2BWFA 2LRWA 3AI5A 1OEYJ 3RZWC 2Y5BB 4JIOU 3IVFA 3CSFA 2CR5A 2HJ8A 2MQJA 2LZ6A 4LJOB 4B95A 4PS3A 1C3TA 4GGQA 3N30A 3PTFC 3VVWB 1HE8A 2BF8B 1WGHA 3QHTA 3RT3B 1GG3A 3WAOA 4FADA 4HLEA 5BO4B 1RFAA 3VUYA 2WDTB 4WJPA 3NZSA 1LM8B 2V4LA 2C7MB 1V5OA 2MLBA 2B3AA 4LCDE 2O2VA 1R4MI 2C60A 2M17A 2UWQA 3B1LX 2KX3A 2MSED 3PHWB 4EOYA 2L8JA 2NBWB 5JHBA 3KUZA 4I6NB 3PV1A 1F9JA 4GDKB 2DZKA 1UGMA 2FCQA 4BKSD 2DENB 1RRBA 2HE7A 2MA9B 5AZHA 3ZNID 1E90A 2ZCBA 2LRUA 3NHEB 3BINA 3R3MA 4RM9A 1R4NI 2KDBA 3H7PB 4OVUA 4W9KA 1GJZA 1JRUA 3O65B 3KVFB 4WAAA 2N1VA 2PPHA 1U4AA 3ML8A 5AZFA 1Q1OA 2MW5A 1UBQA 2KN5A 1ISNA 1V6EA 3ZVVA 2AL3A 4ICVA 2GOWA 1C1YB 5KHOA 3OJ4B 1OQYA 2IY1B 3A4RA 4IC7B 5C1ZA 2RGFA 3CF6E 4CHKA 3RYTA 3T8MA 1J0GA 2N9EB 1I42A 2M1MA 3ZDMC 4A3OA 4HWIB 4DHZE 5E6PA 2L05A 3ZNZB 3DVGY 1E8YA 3VQIA 4TKNA 2C7HA 2PE6B 3PLUA 4EEWA 4M8MA 3HIZA 2R2OA 4NAWA 1WH3A 1Y8RC 2V1YA 3A1QA 3WALA 1ZGUB 3A9JB 3PREA 1WJNA 2KDIA 4E3CA 4WJQA 2LD9A 1FXTB 2ZJDA 1WIAA 2ZVOA 3VHTC 4BKGA 2PJHA 2LXAA 2IO0B 4ANUA 4I6PA 2K39A 5DPRA 2LASA 1UH6A 1E8XA 1YIWA 2DAFA 2GBNA 2JF5A 2JPHA 2JWZA 2Z59B 1UELA 2A5UA 4GDKA 3VH4B 1G6JA 2K8BA 4MJSA 1V9JA 3AXCA 3BY4B 1WXAA 2IO1B 2K8HA 3ECIA 3L17A 3PHXB 1VCBA 3EC8A 2O2VB 1AARA 2KD0A 2KTRB 4MSQB 5CHFA 2YLMA 4XX5A 5AZGA 4IM2A 4KIKB 2N7EA 4WJNA 4AUQC 4GXBA 4NY0A 4LJPB 2YVCA 4G50A 2OJRA 2DYOA 4BOZB 3V60A 1KOTA 3CMMB 2W9NA 5AEKB 5LXIB 1IYFA 4A3PA 1TZ1A 2KDFB 3HM3A 4FJYA 3ZW3A 1I35A 2A4ZA 5CHWA 2ZCCA 3IHPC 2KDEB 3VH3B 1UBIA 1WJ4A 3KYDD 2C7NB 1LFDA 1KLVA 3M3JA 1SGHA 3Q3JA 3A9JA 4PS8A 1L2NA 1KJTA 1LQBA 4NPNA 4F1SA 4GIVA 2AWTA 1Z2MA 2ZEQA 2L7RA 3DBRI 3SU8X 2K8CA 3SDLC 4K7UA 1WMHA 2JRHA 2KXJA 2ZPYA 4LDTB 3WAMA 2PE9A 4GN1A 2KLCA 1WXMA 3OJ3A 2NBVB 2KKCA 4II2B 4IWOA 3TBLD 4XZ4A 3U8ZA 3ZDTA 3HM6X 4IUMB 2EMSA 4W9LA 5DPWA 3EFUA 4X57B 1WGGA 3NS8A 1VD2A 3WANA 4KDIC 3KUDB 3R7QA 4MGYE 1H8CA 2ZVNA 3T9LA 2KQ7A 4MJSB 3DBHI 4ICUA 2GBJA 2LXCA 4DDID 4EZJA 2G3QB 2L00B 3Q3FA 1WXVA 2UYZB 3ONSA 4E71A 3VXWA 2KMAA 2FCSA 2EKEC 2HTHA 3AU4A 3RUIB 3WA0A 1WI0A 3VTUA 2LVOA 2MBHA 2KFKA 3PRZA 4HXDA 4IWPA 3UQBA 3D32A 1YD8U 2C9WB 2KHWB 2DZMA 2BPSA 2L76A 4K7SA 1V49A 2MRPA 4JQWC 1P9DU 2KQSA 2LGYA 4II3B 4DHJB 4G11A 2RSUA 3H1UA 2WX1A 5IAAC 4TQ1A 4BBNC 5D2MB 5IA7A 2MBOA 3QC8B 4CYEA 5J17A 1GNUA 2DZIA 4MSMB 5L83A 4EZLA 5DCNA 3EECA 2DX5B 5JH5C 1OTRB 2N1WA 2KC1A 2FIFA 3QK0A 2JT4B 3JW0X 3ZNGC 3S2AA 2NR2A 4FHJA 2WX0A 1WGDA 2C5LC 3MJWA 4FULA 4P7IA 2BYVE 3I3TB 2FUHB 3PRMB 4GU2A 4WJOA 4W9DA 1P98A 4CO7A 2NVUI 4MGZE 2JY6A 3TMPB 5CHVC 2IBIB 1SIFA 2M4NA 2REXA 2KK8A 4W9IA 2KWUB 4NJ6A 2LWPA 3A9KB 3SD5A 2MP2A 4HDOA 2FCMA 2L0TA 4J6IA 3QX1A 5E6NA 3L08A 4PS7A 1EF1A 1D3ZA 2BYFA 3PZDA 2IZVB 1WR6E 5J18A 2MWSB 2AYOB 5TR5A 4DDGD 4EKUA 5LXHA 3DCGA 2QHOA 4ANWA 2KJ6A 4IW0A 4W9GA 4AJWA 4HCPB 3RD2A 1V2YA 4IM0A 4HDQA 3APDA 1Z5SB 1V5TA 1WRDB 2FAZA 3M95A 1XD3B 2WYQA 3SHQA 3ZUNA 4AJYB 2DHZA 2KOXA 3PS6A 1S3SG 3GZNI 5DPSA 3NOBA 4GMVA 3LJ3A 1ZKHA 4G3XB 2BKRB 3V6EB 4WWNA 2XEWA 2GBKA 3ZIMA 3LDZE 1Q5WB 4ANVA 3IG3A 4W9CA 3UF8A 1UD7A 1EO6A 4W9EA 5DPTA 4MH0E 4KV2A 3PLVA 2IY0B 1WM2A 3PVLA 3ZKJC 2K25A 2BWES 2GBMA 2D07B 2NPTB 2PEAA 3A4SC 2ASQA 4XC2A 3VAWA 4K1RB 4DWFA 3TCAA 5E6OA 2J0MA 1E5WA 4YL8A 2L0FA 4M0WB 1E7VA 4WWPA 2IYDB 3A1QB 1WZ3A 3DBLI 3N3KB 4NAWB 3H6NA 3DBSA 2Z0EB 2D10A 3K9OB 3ZRFA 3QA8A 4IM3A 4TV3A 2DYBA 4DK5A 3DVNU 3L16A 4B6WA 4RM8A 1XQQA 3R66C 4ZRIA 3KW5B 2O6VA 1BT0A 5G2NA 1YQBA 2D11A 4HPLB 3TL5A 4BVUC 2XK5B 3V62A 3VUWA 4KZ0A 2BYEA 3NZUA 2JXXA 2KC2A 2M8SA 4EUTA 4FBJB 1TBEA 4BOSC 1SE9A 3C0RB 4K7WA 3ZRCA 1PQSA 3A9KA 4JGHB 1WM3A 1E8ZA 2NS5A 3MHSD 1E7UA 4B9KA 1LXDA 5FR6A 2XBBC 2LI5A 5G55A 4NNJB 3QAQA 2NCNA 1WX8A 2AL6A 4DXAB 5KHQA 2N9PC 4MDKE 4BKSA 1NBFC 2CU1A 1H4RA 1TTNA 1XT9B 2ZNVC 3VTVA 1EF5A 2D3GA 3UGBB 1WX9A 2GMIC 2ZNVB 2JUOA 2XK5A 2KANA 3PRPB 2JRIB 1E8WA 4N9F4 4BKTA 2D2QA 3QJZA 4MGKE 1IPGA 4K81A 3RULA 3JVZX 1WFYA 4FJVB 3AULA 5CX3A 4WWOA 1WJ6A 1GC6A 3DDCB 3QWZB 4GDLB 2JZZA 3K9PB 3ZTDA 3QIJA 1S1QB 3N32A 4M8NA 3VDZA 2N4FA 3APCA 2EMTA 4NQKE 4IG7B 2KMCA 1KM7A 1V81A 2DYMA 1QZEA 2G45B 4E74A 1L7YA 3UIOB 4EZKA 3DOWA 3PSEB 4AWJA 1WX7A 2N9XA 4RMAA 2KFKB 1J8CA 3GOEA 3W1YA 1TGZB 2V3SA 2MBEA 2R2QA 3WAPA 4GDLA 2KTFA 3NY5A 4JL9A 5D6JB 1RLFA 4PYZA 2FIDA 4ZYNA 1WXSA 2KX0A 3MTNB 4F8CB 2BGFA 5D7GA 3HHMA 4KVGB 4FN2A 1WGRA 4BBNF 2KTRA 3JSVB 2K1FA 4G0NB 1OEYA 1GC7A 1WJUA 3JSVA 3APFA 4HVBA 4TUUA 2G4DB 2IO3B 3KYCD 3X0WA 4BFRA 1NI2A 2VRRB 2WWZA 2CHZA 2LUEA 3OAWA 3WIMA 2OOBB 3QCAA 3PGEA 4MGIE 3A33B 3L0WB 2JZ3B 4DBGA 5EDSA 2J0JA 1OGWA 1WMHB 2I1KA 1YX6B 2CHWA 2CS4A 4GSWA 5GMVA 3TIXA 4ANXA 2J7QB 4MEMA 2IO2B 2J0KA 2BKFA 2Z0DB 3X23A 2KFJA 3L10B 5C23A 2MX2A 2RD0A 2CHXA 3JYUA 3L13A 4W9JA 3UINB 2GBRA 4ZRJA 3VFKA 2KJHB 4ZRKA 4AP4C 4ASWC 5J2RA 1MG8A 2AEHA 2HD5B 4GOCA 3R7RA 4LDTD 5JZEB 3W1SC 3DVNV 1IP9A 2DAJA 1A5RA 1WF9A 1YX5B 1P1AA 2O6VB 2MCNB 4HPMB 2DZJA 3VTWA 3CSTA 3OLMD 1CMXB 1J19A 5L95C 4KDLB 3W1SA 4EFOA 2RPQA 3PPAA 2MBBB 3U30A 2M0XA 2MBQA 4AOFA 1YJ1A 3RCZA 4TQ0A 2FNJB 4DHZB 5HKHA 2NBUA 3ENEA 2CKHB 4MELA 1RAXA 3ZO5B 2KJRA 3H7PA 3QQ8B 2K6DB 3V6CB 3DVGX 2ZZPB 3L54A 3KH0A 1M94A 1WZ0A 2NPTA 2I1JA 3B08A 3UIPB 2KNBA 2ZPNA 4W9HA 3EHVA 3TJPA 1V86A 3UQAA 3HK0A 4DHJD 3ZTCA 1P0RA 2KO3A 4URKA 5D94A 1NDDA 1X1MA 3V61A 4W9FA 2KZRA 1Q0WB 1WR1A 4WQOB 1V80A 2KLGA 2O6VD 4FLHA 4KSKC 1WE6A 2RR9A 5CTRC 3P2BA 2KWCA 2LJ5A 4JLCA 4I6LB 4KSLC 2L3ZA 3QARA 5JHAA 2FCNA 1T0YA 3M62B 3H9DA 3ML9A 4IWQA 3DPDA 4NQLB 4HCNB 2KVRA 4HJKA 3DQVA 4KZCA 4FJZA 1UZXB 4A20A 3H7SA 4GB9A 5LLIA 2N7DA 1K8RB 4MM3A 4OVVA 3VUXA 4KIKA 4HK2A 3U7DA 3IFWB 1P3QU 2K6QA 2G4SA 3IBEA 3RZFA 4ZDVA 3AU5A 2LGDA 4FA6A 1WY8A 1EUVB 3PT2B 3ZLZA 1WYWB 2LVPA 3B0AA 4NJ7A
chains in the Genus database with same CATH superfamily
3ZNHB 1ZP0B 1GUAB 1WE7A 3DHHC 2KWVB 2B76B 2V0GA 1TKGA 3GE8C 1R7SA 3AECB 1ZW7A 1OEYJ 2LGSA 1UGJA 3CSFA 1EU3A 4PS3A 4GGQA 3PZ8A 1L0YB 5BYSA 3GB1A 2DWQA 1HE8A 1WGHA 3AE1B 3KQ4A 2DBYA 3VUYA 3HVDA 4MT5A 4K3BA 1C4CA 4LCDE 3RNAC 2UWQA 1GPXA 2L8JA 3KWVA 5JHBA 1WYGA 1F9JA 1A70A 2DZKA 2BVCA 2L1AA 2DENB 2ZCBA 3BINA 1KFYB 3H7PB 4W9KA 1N6ZA 2N1VA 4QAYA 1ISNA 4C56C 3OJ4B 1OQYA 3A4RA 1EWYC 2WU2B 3CF6E 4MH8A 4ITKA 3T8MA 1I42A 2ZW0A 3ZDMC 4A3OA 4HWIB 3B2FA 4TKNA 2PE6B 3HIZA 2R2OA 1WH3A 3WALA 2KDIA 2BB6A 4WJQA 2LD9A 2H89B 1FFVA 1YJIA 2LXAA 4ANUA 5DPRA 2LASA 1UH6A 2Y5CA 2V3PA 4WIPA 5HG2A 4JX1C 1G6JA 3AV8A 4MJSA 3EC8A 2KTRB 4RF1A 4XX5A 1TKYA 4IM2A 3LXFA 4LJPB 2YVCA 2OJRA 3WCQA 1T0RC 2WDVB 3BVMA 2VH1A 1I35A 4MACA 1KLUD 2J4XA 1UBIA 1LFDA 1KLVA 5EE1A 1L2NA 4US9A 1LQBA 2J52A 2L7RA 3SDLC 3RPFC 4K7UA 2LJIA 1TT5B 5EE0A 2KLCA 4IWOA 3OJ3A 3IT4B 1SF0A 3ABVB 3WANA 3R7QA 1TS2A 1VR9A 4DDID 4OZAA 2G3QB 2UYZB 1R4MB 2FCSA 2EKEC 3AU4A 1CK1A 3PRZA 1UNSA 4HXDA 4ACFA 2BPSA 2N9KA 1V49A 2LGYA 2WGSA 4DHJB 1I7HA 4BBNC 2MBOA 2WXRA 3QC8B 4CYEA 2BB5A 3QK0A 2JT4B 3JW0X 3ZNGC 3S2AA 2M56B 4XWTA 1L0XB 2WXPA 1MVKA 1XLPA 2WNMA 2JY6A 2E3TA 2MH7A 1F0ZA 1FNVA 5BYQA 2KWUB 1V1PA 2LWPA 3P63A 2WU5B 4M02A 4PS7A 2MJ3A 1WGKA 3PZDA 1K52A 5J18A 2MWSB 2AYOB 1DOIA 2D5GA 3DCGA 2WXNA 5H8YE 2JYTA 4HCPB 3RD2A 2Y5PA 4P16A 4JWUC 4LNKA 4IM0A 1HZ5A 1WRDB 2IPKD 4ZHPA 2BTEA 3RFZB 5DPSA 5GXGB 3LJ3A 2BKRB 3H8HA 3AE8B 3LDZE 1D5XC 1AW7A 4W9CA 5DPTA 4KV2A 3PLVA 2D07B 1Y56A 3A4SC 4DWFA 1E0ZA 1OQRA 3TCAA 4YL8A 1JW9D 2W82A 4WWPA 3A1QB 1N61A 2Z0EB 3K9OB 1IBXA 4WH4A 3QA8A 3ZRFA 1HTQA 2DYBA 1FD6A 3AM9A 1KLGD 1F52A 4HPLB 2XK5B 5BMGA 4XE0A 3VUWA 2JXXA 2WS3B 4FBJB 1TBEA 2NS5A 1C9FA 1E7UA 4LLGM 1LXDA 2LI5A 4NNJB 4PK1A 4NJCA 2QDFA 4MDKE 1FXIA 1TTNA 1XT9B 2ZNVC 2ZNVB 3TUOA 2KANA 4N9F4 3P4QB 2D2QA 3ETRA 1IPGA 3JVZX 1GAQB 2VZKB 1UF0A 3DDCB 1S1QB 5HFYA 3GS2A 4M8NA 4NAMA 3VDZA 2EMTA 2PVGC 3MHZA 4S17A 2KMCA 1C4PA 3N1YC 2R61A 2N9XA 4CQNA 2WXHA 3AEFB 2MBEA 4JL9A 1VZ6A 4ZYNA 2FIDA 1D5ZC 3HHMA 1D6EC 4N58A 4Q2JA 4BBNF 3RMKC 1OEYA 1GC7A 4A55A 1WJUA 3Q8BA 4BFRA 1NI2A 4USAA 1VLBA 2OOBB 2GB1A 1ESFA 3L0WB 3FC4A 2I1KA 1YX6B 2J7QB 2WLBA 2IO2B 4MEMA 2BKFA 2Z0DB 1XF5L 3VR9B 2MX2A 2L83A 2CHXA 1KF6B 2GBRA 3VFKA 4ASWC 2XNAC 1MG8A 2Z8LA 3R7RA 3DWMA 3DVNV 1IP9A 2O6VB 4M01A 4KGTA 1GOZA 3CSTA 1CMXB 3W1SA 1T5XD 3BYTB 2MJDA 3U30A 4AOFA 3RCZA 1MHXA 2NBUA 3ENEA 4OHJA 4MELA 1RAXA 2KJRA 3DVGX 3L54A 3KH0A 5IP4D 1FCCC 4W9HA 4C7YA 4J3OD 3SFEB 2V3NA 3ZTCA 1P0RA 5D94A 4FLHA 4KSKC 3CIRB 1QT9A 2L3ZA 3ML9A 4IWQA 1L4DB 5IKCM 1QOBA 2KWDA 1UZXB 3H7SA 4MM3A 1K8RB 3ZJUA 1I4RA 1HXYD 2MHJA 4HK2A 1P3QU 2K6QA 4FA6A 3PT2B 1EUVB 3ZLZA 1FRDA 3B0AA 3ZO5B 3Q8EA 1XXGA 3KUCB 3M63B 1KRHA 2KYWA 1ET6A 1J7AA 2LVQA 2BWFA 4YTMB 2CR5A 1XO3A 4LJOB 2GRIA 1C3TA 3N30A 2PW9A 5FR3A 3QHTA 4HLEA 1GG3A 1RFKA 2WXQA 2WDTB 1D4BA 2V4LA 3TEWA 1YNTE 2C7MB 1PUTA 4RCOA 2C60A 2M17A 2MSED 3PHWB 1CZPA 3PV1A 2FCQA 1RRBA 2MA9B 5AZHA 3ZNID 3NHEB 3R3MA 4RM9A 4OVUA 2MJEA 1U4AA 3NZ3A 2KN5A 4YTNB 1SEBD 2AL3A 1DOXA 1PGXA 2RGFA 1J0GA 1VDVA 2N9EB 4DHZE 5E6PA 3DVGY 1IGCA 4LK0M 2V1YA 3MP9A 3PREA 1WJNA 1K53A 2K39A 2OJWA 3P4PB 1SE4A 2CU3A 1YIWA 1E8XA 2JWZA 2A5UA 4GDKA 3NS1A 4P6VF 2K8BA 2OHFA 1V9JA 2IO1B 3L17A 1VCBA 1FM0D 1K50A 1SE3A 4MSQB 5CHFA 5AZGA 2KN4A 4XWWA 4WJNA 3NG0A 1AYFA 4NY0A 1ROEA 4BOZB 4YWGG 4HKQA 2AQ3B 5AEKB 1V1OA 4A3PA 2IJ0A 4FJYA 3R2TA 1SB3C 2KQ4X 3UI3A 3ZW3A 5CHWA 1SBBB 3IHPC 3KYDD 1T0SC 4IKGA 2W55A 4PS8A 3A9JA 4NPNA 4F1SA 1Z2MA 3SU8X 3KLSX 3PZ7A 3WAMA 5BMIA 1ET9A 4GN1A 2WP9B 2NBVB 3TBLD 4II2B 3DBLB 3ZGZA 1P7FA 3DWGC 2EMSA 2Q5WD 5DPWA 3EFUA 4X57B 2ZVNA 4ICUA 2L00B 3Q3FA 4JPSA 1C77A 5BYRA 1J7CA 4C4VA 1SJED 3VTUA 4KX6B 1LGRA 1N62A 2MBHA 4IWPA 1STEA 2QEJC 2RDBC 2WDRB 2INNE 2RSUA 1JWAD 2WX1A 1NVID 1GNUA 2DZIA 1I4GA 3EECA 1OTRB 1FNUA 2KC1A 2FIFA 2NR2A 4FHJA 5EE3A 1FIQA 3MJWA 2BYVE 1I4PA 4GU2A 1NYQA 1PFDA 3ZXVA 4MGZE 4WAFA 5CHVC 2IBIB 2REXA 4W9IA 4NJ6A 2X38A 3N9YC 2FCMA 4J6IA 2EELA 5H92C 4LNNA 5E6NA 2RMMA 1EF1A 1WR6E 1QQRA 2QHOA 3AEEB 1DGJA 4ANWA 4W9GA 3U52E 4AJWA 1FRRA 3L4PA 2FBWB 1V2YA 1I4XA 1M4VA 3M95A 1Z5SB 1V5TA 4O1NA 3RN9C 1XD3B 2WYQA 3SHQA 3ZUNA 3PS6A 1E10A 3KWLA 3TEZA 4YSXB 4G3XB 5JXVA 1HZ6A 4P1BC 3IG3A 1EO6A 2D3CA 1ZPSA 3RNCC 2IY0B 1WM2A 3PVLA 3ZKJC 2GBMA 2MEKA 2PEAA 3W9CB 1TY2A 4XC2A 1XLOA 1MG4A 3P4RB 2L0FA 4EE2A 1CQVA 3ZYYX 2D10A 4TV3A 4B6WA 4OZCA 1XQQA 1K51A 3CWIA 3R66C 2K3UA 5G2NA 3TL5A 4ZYSA 3V62A 2LHEA 1YQ4B 4KZ0A 2QJLA 2SEBD 3NZUA 2KC2A 2JZPA 3I9V1 3C0RB 4K7WA 3ZRCA 1PQSA 3A9KA 1WM3A 3Q69A 3MHSD 4B9KA 5G55A 5KHQA 2N9PC 3DHGC 5G5HA 4IDIA 3VTVA 1EF5A 2D3GA 3UGBB 1WX9A 4LNOA 4K81A 1WFYA 3AULA 1L6UA 4RF0A 3QWZB 4GDLB 3K9PB 3ZTDA 1J7BA 2FUG1 4IG7B 1ACCA 1WRIA 2G45B 1JCKB 3Q2AC 4EZKA 3DOWA 3PSEB 1J8CA 4A8XC 4L2YA 4FXCA 3GZNB 1TGZB 2V3SA 3WAPA 2VH2A 3NY5A 4F8CB 1WXSA 2BGFA 4KVGB 1WGRA 1UWMA 4HKZE 2GLSA 2KTRA 3JSVB 2K1FA 4G0NB 3JSVA 2JXTA 3APFA 2L52A 4PT5A 1NI3A 3X0WA 2VRRB 2WWZA 4MGIE 3PGEA 1WMHB 5GMVA 1YMHE 2J0KA 3P4SB 2QILA 5C23A 3JYUA 5D3DA 2QIEB 1XLQA 1RWSA 2QCZA 3SFDB 3W1SC 1BMLC 2DAJA 1WF9A 2IGDA 1P1AA 2DZJA 3NRZA 2K5PA 1YN5A 4TQ0A 4M0WA 4DHZB 2TSSA 1QOGA 2NMQA 2AQ2B 3H7PA 4ARCA 2M19A 4UDUC 4OW0A 3UIPB 3T3OA 3TJPA 3UQAA 4DHJD 1ENFA 4WQOB 1WR1A 4ZOHC 5G5GA 1WE6A 5CTRC 2KWCA 2FCNA 1T0YA 3H9DA 4B0MA 1E9MA 2KVRA 4KZCA 2JWUA 1C4AA 4FJZA 4A20A 4KKJA 2BQQA 4N6EB 3VUXA 1SJHD 4KIKA 1JMLA 3IFWB 2JX5A 3HVZA 1WY8A 1YJJA 4YSYB 4ZRPA 1BXTA 3U7ZA 2MP2B 2JVCA 3IAM1 1V97A 4IOIE 4F7ZA 1JQ4A 1XLNA 2JSVX 3U2SC 4WQMA 2LZ6A 4B95A 3VRBB 1TZOA 2JQRB 1RYJA 2BS3B 3VVWB 3WAOA 1FPYA 1FXAA 1RFAA 4WJPA 1LM8B 2INPE 2B3AA 3NUHB 2O2VA 1SXTA 2KX3A 2YEPB 1L4ZB 4EOYA 2NBWB 3KUZA 3BYYB 5IOIA 4GDKB 1UGMA 2W3RA 1FCLA 2LRUA 4HRSA 1R4NI 2KDBA 1GJZA 3O65B 3KVFB 4WAAA 1JRPA 3ML8A 3RNGC 3BWUD 1V6EA 3ZVVA 2K22A 3HRDD 4LTUA 4AQ7A 1F2RC 2M1MA 3VQIA 2C7HA 3NVZA 3PLUA 4EEWA 1JWBD 1Y8RC 3A1QA 3A9JB 4D2KA 4E3CA 4YXDB 1MI0A 1WIAA 4BZAA 2PJHA 1B9RA 2IO0B 3GP7A 4I6PA 2I2YA 2GBNA 2JF5A 2JPHA 1UUPA 3VH4B 1TKEA 3AXCA 3BY4B 1WXAA 2K8HA 3ECIA 4A90A 3PHXB 3AE4B 2O2VB 1AARA 2YEPF 1L0VB 2YLMA 1P7EA 4KIKB 4RGMA 4AUQC 4RNAA 2X8XX 4GXBA 4G50A 3V60A 3CMMB 1DOYA 1F2RI 4HROA 5LXIB 1IYFA 3ZJTA 3VH3B 1TS4A 2C7NB 3M3JA 2WHIA 1KJTA 2Y3AA 1KH0A 2ZEQA 1PYWD 2KXJA 4LDTB 2PE9A 3BVZA 1I4QA 3ZDTA 3TEYA 2QMTA 4XZ4A 3U8ZA 3HM6X 4IUMB 4C7ZA 1QILA 4W9LA 1ZUD2 3NS8A 1VD2A 4KDIC 2I38A 4MGYE 1H8CA 2KQ7A 3DBHI 4EZJA 1WXVA 4P1CC 3VXWA 4C00A 4K3CA 2KFKA 3D32A 2LUMA 2DZMA 2L76A 4K7SA 1TY0A 2MRPA 4JQWC 1P9DU 2KQSA 1OFFA 3H1UA 5D2MB 5IA7A 2PTLA 1PGAA 4MSMB 5L83A 4EZLA 3NVVA 4XDCA 2DX5B 5JH5C 1NYRA 3FAHA 4RGOS 1WGDA 2C5LC 4P7IA 1AWDA 2RDGA 4CO7A 2L32A 3TMPB 3C19A 1SIFA 2M4NA 3RNEC 2KK8A 1WSPA 3A9KB 3SD5A 2MP2A 2L0TA 2LHDA 4YSZB 1ZXIA 3QX1A 3FILA 4KGSA 3W5VB 3L08A 2BYFA 2IZVB 5LXHA 5TR5A 4EKUA 4DDGD 3R8BA 5MPOA 3AEBB 1L5PA 4HDQA 2FAZA 3DHIC 1VRAB 4HEA1 1HQRD 2DLBA 2BS4B 3B2GA 3NOBA 1ZKHA 3V6EB 2XEWA 3C8YA 2RDHA 3UF8A 2INDC 4W9EA 3MC0B 2SAKA 1FFUA 2K25A 2OEDA 2ASQA 4K1RB 3R2IA 5E6OA 3URYA 4M0WB 3N20C 1SIJA 2IYDB 3N3KB 1WZ3A 1SE2A 5TSSA 4NAWB 2WXKA 3H6NA 3DBSA 3ZQ4A 4IM3A 2PVOD 2W54A 2WXIA 2BBCA 3KW5B 3AB5A 1BT0A 2D11A 4HJGE 1CJEA 1D5MC 2LFIA 4XGAB 2BYEA 4EUTA 3IAS1 4JGHB 3B9JA 2PIAA 1QOAA 5FR6A 2XBBC 2NCNA 4DXAB 1XEEA 4BKSA 1NBFC 1C78A 1H4RA 2ONQA 3AE3B 3EA6A 2JUOA 2KVZA 3PRPB 2JRIB 4BKTA 3I57A 3QJZA 2HDEA 3SEBA 4MGKE 1TS3A 5CX3A 1WJ6A 2M0AA 2JZZA 2WXLA 3Q3OC 3N32A 4NQKE 3APCA 2WXJA 1KM7A 2DYMA 4E74A 1L7YA 3UIOB 1HTOA 2K0PA 2PMVA 4R3DA 2XN9C 4RMAA 3RNBC 3FILB 2KFKB 1SSNA 3ZXRA 3GOEA 3W1YA 4ARIA 4GDLA 5D6JB 1RLFA 4DQOC 2KX0A 1EWCA 2WXOA 2KT7A 4FN2A 4RGTA 4RGNA 5E6JA 1VZ7A 4HVBA 4TUUA 2G4DB 2IO3B 3WIMA 2LUEA 1WWTA 3QCAA 5FKAC 5LNK1 2V9HA 1OGWA 2J0JA 3Q8FA 2CHWA 2CS4A 3Q14C 4ANXA 3EFCA 3L10B 2G1EA 2H88B 3UINB 4AP4C 3Q8AA 2CJNA 2HD5B 4GOCA 5D3IB 2IGHA 3BK2A 1T0QC 2MCNB 2N7JA 4HPMB 5AUKA 3VTWA 2IDYA 3OLMD 1J19A 1VZ8A 3GE3C 4EFOA 3PPAA 2M0XA 2FNJB 3V6CB 2K6DB 1ZDXA 2ZZPB 1WZ0A 4L1BA 3B08A 4H2AA 4GLSC 1BUIC 3HK0A 2KO3A 2D3BA 3V61A 4W9FA 1PDXA 1Q0WB 2KLGA 4KSLC 5JHAA 3QARA 3M62B 3DPDA 1YN4A 1L6VA 4NQLB 4KGRA 1JROA 1QOFA 3T3NA 4GB9A 5LLIA 4DXGA 2N7DA 4OVVA 5AUIA 3U7DA 1ZE3D 2G4SA 4RFBA 3V05A 4ZDVA 3AU5A 2LGDA 1WYWB 2LVPA 2EKIA 4NJ7A 4FHKA 3ALBA 2LGXA 4PYUA 1GB1A 1WXQA 3SR6A 3AH7A 1WGYA 3AI5A 2LRWA 4DXFA 3RZWC 2Y5BB 4JIOU 3IVFA 2W3SA 2HJ8A 2MQJA 3AMZA 2ICIA 2J42A 2JU6X 2WXGA 1N63A 3PTFC 2BF8B 4FADA 3RT3B 5BO4B 3NZSA 5EE9A 1V5OA 2MLBA 3OWEB 1FO4A 1R4MI 3B1LX 4WWMA 2E6XA 1ZXHA 4I6NB 4C80A 4NZLB 2BYTA 4BKSD 2HE7A 1NEKB 1E90A 2QSDA 1JRUA 2PPHA 5AZFA 1Q1OA 2MW5A 4REZA 1UBQA 1RM6C 1NENB 4ICVA 2GOWA 1C1YB 5KHOA 4YT0B 5C1ZA 2IY1B 4IC7B 4CHKA 3RYTA 2N0SB 1R4NB 2ZW1A 2PLPA 2L05A 3ZNZB 1E8YA 1FEHA 4M8MA 3AEGB 4NAWA 3HUIA 1ZGUB 4HPPA 3FKYA 1FXTB 5C2TB 2ZJDA 2ZVOA 3VHTC 4BKGA 4S0RA 1N60A 1YOVB 2DAFA 2LEKA 2GI9A 2Z59B 1UELA 5IO9A 4OZBA 1UWXA 2KD0A 1QF6A 4LNFA 3BZDB 5I4DA 3MC8A 2N7EA 1YN3A 4US8A 2DYOA 3DBRB 2NTSA 1KOTA 2W9NA 1TZ1A 2KDFB 3HM3A 2A4ZA 1HA5A 2ZCCA 2KDEB 1WJ4A 1SGHA 3Q3JA 1FMAD 3V3XA 4GIVA 2AWTA 2WDQB 3DBRI 2K8CA 1WMHA 2JRHA 1V8CA 3DBHB 2INCC 2ZPYA 3Q6BA 3W2DA 2KDMA 3RNFC 1JWUD 2D3AA 1WXMA 2K9XA 2KKCA 1C76A 1WGGA 3KUDB 4M00A 3E9SA 5IN7A 3T9LA 1F77A 2LGIA 4MJSB 3P42A 2GBJA 2LXCA 1I4HA 3U4EG 3ONSA 4E71A 2KMAA 2HTHA 3RUIB 3WA0A 1WI0A 5FK9C 2LVOA 3I5JC 3UQBA 1IUEA 1YD8U 2C9WB 2KHWB 2WXFA 2HJ1A 2UU7A 3J9CA 3AE5B 1OQQA 4II3B 4G11A 5IAAC 3EUB2 4TQ1A 3MC9A 5J17A 2KMMA 1QKZA 5DCNA 2ON8A 1N5XA 4JWSC 2N1WA 4WURA 3Q3MC 2RPVA 2WX0A 4FULA 1TS5A 3I3TB 2FUHB 3PRMB 4RH6A 4WJOA 4W9DA 2BT6A 1P98A 2NVUI 5T8IA 3MJ5A 5C3JB 1T3QA 4HDOA 4KKIA 1TYGB 1KTKA 1D3ZA 4XDDA 3NVWA 2KJ6A 4IW0A 3LB8C 3AN1A 1Q10A 1GB4A 3P1MA 3APDA 2N9LA 4AJYB 1PGBA 2DHZA 3I63C 2KOXA 1IGDA 1S3SG 3GZNI 4GMVA 4WWNA 2GBKA 3ZIMA 1EM7A 3Q8CA 4ANVA 1Q5WB 1UD7A 1E6EB 4MH0E 3N1XC 4JE3B 3NVYA 2BWES 2BW2A 4OVZA 2NPTB 2QC8A 3VAWA 2ACZB 3N1ZC 4A6QA 2J0MA 1E5WA 3EGRA 1E7VA 3DBLI 4LNIA 1TJEA 3O13A 4DK5A 3DVNU 2AX5A 3L16A 4RM8A 2V4IB 4ZRIA 1MHHE 2O6VA 4BVUC 1YQBA 3E56A 1QLBB 3TEXA 2M8SA 1JALA 4BOSC 1SE9A 3ZJVA 1V1PB 1JWMD 1E8ZA 1HEZE 4BAXA 3QAQA 1LO5D 4C4VB 1WX8A 2IGGA 4TSSA 1ZDVA 2AL6A 4AS1A 2WXMA 1T6BX 2CU1A 1MPEA 3BIID 3RI7C 2GMIC 2XK5A 3VR8B 4TMAB 2LMCA 1E8WA 1B1ZA 1TIFA 3RULA 4FJVB 4WWOA 5HI1A 1GC6A 1JWSD 1EU4A 3QIJA 2FE8A 2N4FA 4YTPB 1V81A 1QZEA 1N5WA 4AWJA 1WX7A 3OG5A 4N59A 2CJOA 2R2QA 4ZRQA 2KTFA 5HHDG 4PYZA 2HTME 3MTNB 5D7GA 3PO0A 1VJKA 1AN8A 3BK1A 2VZKD 3KYCD 4ZHOA 4L23A 2CHZA 3OAWA 3A33B 2JZ3B 1XCQL 4DBGA 5EDSA 3TIXA 3Q3NC 4GSWA 3AE2B 1XCTL 2BS2B 3TSSA 2KFJA 1C79A 3X23A 1DYQA 2RD0A 3L13A 4W9JA 2NTTA 2KACA 4ZRJA 2KJHB 4ZRKA 2DNFA 1F1HA 5J2RA 5BMHA 2AEHA 4A9AA 3VRAB 1E7PB 4LDTD 5JZEB 1A5RA 1YX5B 3AE7B 2KAJA 1YQ3B 4B0EA 3LYYA 1MFWA 1IBXB 2JYEA 5L95C 4KDLB 1ZOYB 2RPQA 2MBBB 2MBQA 1YJ1A 5HKHA 2PKOA 2CKHB 3NJTA 4MM3B 3QQ8B 3MFGA 3W5UB 1M94A 2NPTA 2I1JA 2KNBA 2ZPNA 2G9HD 3EHVA 1V86A 4URKA 1FNWA 1NDDA 1X1MA 2KZRA 1V80A 2O6VD 2AQ1B 2RR9A 3P2BA 3AE9B 2LJ5A 4JLCA 4I6LB 4HCNB 4HJKA 3DQVA 2WQYB 1MJDA 3IT6B 2J53A 3AEAB 3AE6B 3BVGA 3AEDB 3IXSA 4XYCA 3IBEA 3RZFA
chains in the Genus database with same CATH topology
3ZNHB 4FHKA 1GUAB 3ALBA 2MP2B 3KUCB 3M63B 2LGXA 1WE7A 4PYUA 2KWVB 2JVCA 4F7ZA 2LVQA 1WGYA 1ZW7A 2BWFA 2LRWA 3AI5A 1OEYJ 3RZWC 2Y5BB 4JIOU 3IVFA 3CSFA 2CR5A 2HJ8A 2MQJA 2LZ6A 4LJOB 4B95A 4PS3A 1C3TA 4GGQA 3N30A 3PTFC 3VVWB 1HE8A 2BF8B 1WGHA 3QHTA 3RT3B 1GG3A 3WAOA 4FADA 4HLEA 5BO4B 1RFAA 3VUYA 2WDTB 4WJPA 3NZSA 1LM8B 2V4LA 2C7MB 1V5OA 2MLBA 2B3AA 4LCDE 2O2VA 1R4MI 2C60A 2M17A 2UWQA 3B1LX 2KX3A 2MSED 3PHWB 4EOYA 2L8JA 2NBWB 5JHBA 3KUZA 4I6NB 3PV1A 1F9JA 4GDKB 2DZKA 1UGMA 2FCQA 4BKSD 2DENB 1RRBA 2HE7A 2MA9B 5AZHA 3ZNID 1E90A 2ZCBA 2LRUA 3NHEB 3BINA 3R3MA 4RM9A 1R4NI 2KDBA 3H7PB 4OVUA 4W9KA 1GJZA 1JRUA 3O65B 3KVFB 4WAAA 2N1VA 2PPHA 1U4AA 3ML8A 5AZFA 1Q1OA 2MW5A 1UBQA 2KN5A 1ISNA 1V6EA 3ZVVA 2AL3A 4ICVA 2GOWA 1C1YB 5KHOA 3OJ4B 1OQYA 2IY1B 3A4RA 4IC7B 5C1ZA 2RGFA 3CF6E 4CHKA 3RYTA 3T8MA 1J0GA 2N9EB 1I42A 2M1MA 3ZDMC 4A3OA 4HWIB 4DHZE 5E6PA 2L05A 3ZNZB 3DVGY 1E8YA 3VQIA 4TKNA 2C7HA 2PE6B 3PLUA 4EEWA 4M8MA 3HIZA 2R2OA 4NAWA 1WH3A 1Y8RC 2V1YA 3A1QA 3WALA 1ZGUB 3A9JB 3PREA 1WJNA 2KDIA 4E3CA 4WJQA 2LD9A 1FXTB 2ZJDA 1WIAA 2ZVOA 3VHTC 4BKGA 2PJHA 2LXAA 2IO0B 4ANUA 4I6PA 2K39A 5DPRA 2LASA 1UH6A 1E8XA 1YIWA 2DAFA 2GBNA 2JF5A 2JPHA 2JWZA 2Z59B 1UELA 2A5UA 4GDKA 3VH4B 1G6JA 2K8BA 4MJSA 1V9JA 3AXCA 3BY4B 1WXAA 2IO1B 2K8HA 3ECIA 3L17A 3PHXB 1VCBA 3EC8A 2O2VB 1AARA 2KD0A 2KTRB 4MSQB 5CHFA 2YLMA 4XX5A 5AZGA 4IM2A 4KIKB 2N7EA 4WJNA 4AUQC 4GXBA 4NY0A 4LJPB 2YVCA 4G50A 2OJRA 2DYOA 4BOZB 3V60A 1KOTA 3CMMB 2W9NA 5AEKB 5LXIB 1IYFA 4A3PA 1TZ1A 2KDFB 3HM3A 4FJYA 3ZW3A 1I35A 2A4ZA 5CHWA 2ZCCA 3IHPC 2KDEB 3VH3B 1UBIA 1WJ4A 3KYDD 2C7NB 1LFDA 1KLVA 3M3JA 1SGHA 3Q3JA 3A9JA 4PS8A 1L2NA 1KJTA 1LQBA 4NPNA 4F1SA 4GIVA 2AWTA 1Z2MA 2ZEQA 2L7RA 3DBRI 3SU8X 2K8CA 3SDLC 4K7UA 1WMHA 2JRHA 2KXJA 2ZPYA 4LDTB 3WAMA 2PE9A 4GN1A 2KLCA 1WXMA 3OJ3A 2NBVB 2KKCA 4II2B 4IWOA 3TBLD 4XZ4A 3U8ZA 3ZDTA 3HM6X 4IUMB 2EMSA 4W9LA 5DPWA 3EFUA 4X57B 1WGGA 3NS8A 1VD2A 3WANA 4KDIC 3KUDB 3R7QA 4MGYE 1H8CA 2ZVNA 3T9LA 2KQ7A 4MJSB 3DBHI 4ICUA 2GBJA 2LXCA 4DDID 4EZJA 2G3QB 2L00B 3Q3FA 1WXVA 2UYZB 3ONSA 4E71A 3VXWA 2KMAA 2FCSA 2EKEC 2HTHA 3AU4A 3RUIB 3WA0A 1WI0A 3VTUA 2LVOA 2MBHA 2KFKA 3PRZA 4HXDA 4IWPA 3UQBA 3D32A 1YD8U 2C9WB 2KHWB 2DZMA 2BPSA 2L76A 4K7SA 1V49A 2MRPA 4JQWC 1P9DU 2KQSA 2LGYA 4II3B 4DHJB 4G11A 2RSUA 3H1UA 2WX1A 5IAAC 4TQ1A 4BBNC 5D2MB 5IA7A 2MBOA 3QC8B 4CYEA 5J17A 1GNUA 2DZIA 4MSMB 5L83A 4EZLA 5DCNA 3EECA 2DX5B 5JH5C 1OTRB 2N1WA 2KC1A 2FIFA 3QK0A 2JT4B 3JW0X 3ZNGC 3S2AA 2NR2A 4FHJA 2WX0A 1WGDA 2C5LC 3MJWA 4FULA 4P7IA 2BYVE 3I3TB 2FUHB 3PRMB 4GU2A 4WJOA 4W9DA 1P98A 4CO7A 2NVUI 4MGZE 2JY6A 3TMPB 5CHVC 2IBIB 1SIFA 2M4NA 2REXA 2KK8A 4W9IA 2KWUB 4NJ6A 2LWPA 3A9KB 3SD5A 2MP2A 4HDOA 2FCMA 2L0TA 4J6IA 3QX1A 5E6NA 3L08A 4PS7A 1EF1A 1D3ZA 2BYFA 3PZDA 2IZVB 1WR6E 5J18A 2MWSB 2AYOB 5TR5A 4DDGD 4EKUA 5LXHA 3DCGA 2QHOA 4ANWA 2KJ6A 4IW0A 4W9GA 4AJWA 4HCPB 3RD2A 1V2YA 4IM0A 4HDQA 3APDA 1Z5SB 1V5TA 1WRDB 2FAZA 3M95A 1XD3B 2WYQA 3SHQA 3ZUNA 4AJYB 2DHZA 2KOXA 3PS6A 1S3SG 3GZNI 5DPSA 3NOBA 4GMVA 3LJ3A 1ZKHA 4G3XB 2BKRB 3V6EB 4WWNA 2XEWA 2GBKA 3ZIMA 3LDZE 1Q5WB 4ANVA 3IG3A 4W9CA 3UF8A 1UD7A 1EO6A 4W9EA 5DPTA 4MH0E 4KV2A 3PLVA 2IY0B 1WM2A 3PVLA 3ZKJC 2K25A 2BWES 2GBMA 2D07B 2NPTB 2PEAA 3A4SC 2ASQA 4XC2A 3VAWA 4K1RB 4DWFA 3TCAA 5E6OA 2J0MA 1E5WA 4YL8A 2L0FA 4M0WB 1E7VA 4WWPA 2IYDB 3A1QB 1WZ3A 3DBLI 3N3KB 4NAWB 3H6NA 3DBSA 2Z0EB 2D10A 3K9OB 3ZRFA 3QA8A 4IM3A 4TV3A 2DYBA 4DK5A 3DVNU 3L16A 4B6WA 4RM8A 1XQQA 3R66C 4ZRIA 3KW5B 2O6VA 1BT0A 5G2NA 1YQBA 2D11A 4HPLB 3TL5A 4BVUC 2XK5B 3V62A 3VUWA 4KZ0A 2BYEA 3NZUA 2JXXA 2KC2A 2M8SA 4EUTA 4FBJB 1TBEA 4BOSC 1SE9A 3C0RB 4K7WA 3ZRCA 1PQSA 3A9KA 4JGHB 1WM3A 1E8ZA 2NS5A 3MHSD 1E7UA 4B9KA 1LXDA 5FR6A 2XBBC 2LI5A 5G55A 4NNJB 3QAQA 2NCNA 1WX8A 2AL6A 4DXAB 5KHQA 2N9PC 4MDKE 4BKSA 1NBFC 2CU1A 1H4RA 1TTNA 1XT9B 2ZNVC 3VTVA 1EF5A 2D3GA 3UGBB 1WX9A 2GMIC 2ZNVB 2JUOA 2XK5A 2KANA 3PRPB 2JRIB 1E8WA 4N9F4 4BKTA 2D2QA 3QJZA 4MGKE 1IPGA 4K81A 3RULA 3JVZX 1WFYA 4FJVB 3AULA 5CX3A 4WWOA 1WJ6A 1GC6A 3DDCB 3QWZB 4GDLB 2JZZA 3K9PB 3ZTDA 3QIJA 1S1QB 3N32A 4M8NA 3VDZA 2N4FA 3APCA 2EMTA 4NQKE 4IG7B 2KMCA 1KM7A 1V81A 2DYMA 1QZEA 2G45B 4E74A 1L7YA 3UIOB 4EZKA 3DOWA 3PSEB 4AWJA 1WX7A 2N9XA 4RMAA 2KFKB 1J8CA 3GOEA 3W1YA 1TGZB 2V3SA 2MBEA 2R2QA 3WAPA 4GDLA 2KTFA 3NY5A 4JL9A 5D6JB 1RLFA 4PYZA 2FIDA 4ZYNA 1WXSA 2KX0A 3MTNB 4F8CB 2BGFA 5D7GA 3HHMA 4KVGB 4FN2A 1WGRA 4BBNF 2KTRA 3JSVB 2K1FA 4G0NB 1OEYA 1GC7A 1WJUA 3JSVA 3APFA 4HVBA 4TUUA 2G4DB 2IO3B 3KYCD 3X0WA 4BFRA 1NI2A 2VRRB 2WWZA 2CHZA 2LUEA 3OAWA 3WIMA 2OOBB 3QCAA 3PGEA 4MGIE 3A33B 3L0WB 2JZ3B 4DBGA 5EDSA 2J0JA 1OGWA 1WMHB 2I1KA 1YX6B 2CHWA 2CS4A 4GSWA 5GMVA 3TIXA 4ANXA 2J7QB 4MEMA 2IO2B 2J0KA 2BKFA 2Z0DB 3X23A 2KFJA 3L10B 5C23A 2MX2A 2RD0A 2CHXA 3JYUA 3L13A 4W9JA 3UINB 2GBRA 4ZRJA 3VFKA 2KJHB 4ZRKA 4AP4C 4ASWC 5J2RA 1MG8A 2AEHA 2HD5B 4GOCA 3R7RA 4LDTD 5JZEB 3W1SC 3DVNV 1IP9A 2DAJA 1A5RA 1WF9A 1YX5B 1P1AA 2O6VB 2MCNB 4HPMB 2DZJA 3VTWA 3CSTA 3OLMD 1CMXB 1J19A 5L95C 4KDLB 3W1SA 4EFOA 2RPQA 3PPAA 2MBBB 3U30A 2M0XA 2MBQA 4AOFA 1YJ1A 3RCZA 4TQ0A 2FNJB 4DHZB 5HKHA 2NBUA 3ENEA 2CKHB 4MELA 1RAXA 3ZO5B 2KJRA 3H7PA 3QQ8B 2K6DB 3V6CB 3DVGX 2ZZPB 3L54A 3KH0A 1M94A 1WZ0A 2NPTA 2I1JA 3B08A 3UIPB 2KNBA 2ZPNA 4W9HA 3EHVA 3TJPA 1V86A 3UQAA 3HK0A 4DHJD 3ZTCA 1P0RA 2KO3A 4URKA 5D94A 1NDDA 1X1MA 3V61A 4W9FA 2KZRA 1Q0WB 1WR1A 4WQOB 1V80A 2KLGA 2O6VD 4FLHA 4KSKC 1WE6A 2RR9A 5CTRC 3P2BA 2KWCA 2LJ5A 4JLCA 4I6LB 4KSLC 2L3ZA 3QARA 5JHAA 2FCNA 1T0YA 3M62B 3H9DA 3ML9A 4IWQA 3DPDA 4NQLB 4HCNB 2KVRA 4HJKA 3DQVA 4KZCA 4FJZA 1UZXB 4A20A 3H7SA 4GB9A 5LLIA 2N7DA 1K8RB 4MM3A 4OVVA 3VUXA 4KIKA 4HK2A 3U7DA 3IFWB 1P3QU 2K6QA 2G4SA 3IBEA 3RZFA 4ZDVA 3AU5A 2LGDA 4FA6A 1WY8A 1EUVB 3PT2B 3ZLZA 1WYWB 2LVPA 3B0AA 4NJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZNH B;  4FHK A;  1GUA B;  3ALB A;  2MP2 B;  3KUC B;  3M63 B;  2LGX A;  1WE7 A;  4PYU A;  2KWV B;  2JVC A;  4F7Z A;  2LVQ A;  1WGY A;  1ZW7 A;  2BWF A;  2LRW A;  3AI5 A;  1OEY J;  3RZW C;  2Y5B B;  4JIO U;  3IVF A;  3CSF A;  2CR5 A;  2HJ8 A;  2MQJ A;  2LZ6 A;  4LJO B;  4B95 A;  4PS3 A;  1C3T A;  4GGQ A;  3N30 A;  3PTF C;  3VVW B;  1HE8 A;  2BF8 B;  1WGH A;  3QHT A;  3RT3 B;  1GG3 A;  3WAO A;  4FAD A;  4HLE A;  5BO4 B;  1RFA A;  3VUY A;  2WDT B;  4WJP A;  3NZS A;  1LM8 B;  2V4L A;  2C7M B;  1V5O A;  2MLB A;  2B3A A;  4LCD E;  2O2V A;  1R4M I;  2C60 A;  2M17 A;  2UWQ A;  3B1L X;  2KX3 A;  2MSE D;  3PHW B;  4EOY A;  2L8J A;  2NBW B;  5JHB A;  3KUZ A;  4I6N B;  3PV1 A;  1F9J A;  4GDK B;  2DZK A;  1UGM A;  2FCQ A;  4BKS D;  2DEN B;  1RRB A;  2HE7 A;  2MA9 B;  5AZH A;  3ZNI D;  1E90 A;  2ZCB A;  2LRU A;  3NHE B;  3BIN A;  3R3M A;  4RM9 A;  1R4N I;  2KDB A;  3H7P B;  4OVU A;  4W9K A;  1GJZ A;  1JRU A;  3O65 B;  3KVF B;  4WAA A;  2N1V A;  2PPH A;  1U4A A;  3ML8 A;  5AZF A;  1Q1O A;  2MW5 A;  1UBQ A;  2KN5 A;  1ISN A;  1V6E A;  3ZVV A;  2AL3 A;  4ICV A;  2GOW A;  1C1Y B;  5KHO A;  3OJ4 B;  1OQY A;  2IY1 B;  3A4R A;  4IC7 B;  5C1Z A;  2RGF A;  3CF6 E;  4CHK A;  3RYT A;  3T8M A;  1J0G A;  2N9E B;  1I42 A;  2M1M A;  3ZDM C;  4A3O A;  4HWI B;  4DHZ E;  5E6P A;  2L05 A;  3ZNZ B;  3DVG Y;  1E8Y A;  3VQI A;  4TKN A;  2C7H A;  2PE6 B;  3PLU A;  4EEW A;  4M8M A;  3HIZ A;  2R2O A;  4NAW A;  1WH3 A;  1Y8R C;  2V1Y A;  3A1Q A;  3WAL A;  1ZGU B;  3A9J B;  3PRE A;  1WJN A;  2KDI A;  4E3C A;  4WJQ A;  2LD9 A;  1FXT B;  2ZJD A;  1WIA A;  2ZVO A;  3VHT C;  4BKG A;  2PJH A;  2LXA A;  2IO0 B;  4ANU A;  4I6P A;  2K39 A;  5DPR A;  2LAS A;  1UH6 A;  1E8X A;  1YIW A;  2DAF A;  2GBN A;  2JF5 A;  2JPH A;  2JWZ A;  2Z59 B;  1UEL A;  2A5U A;  4GDK A;  3VH4 B;  1G6J A;  2K8B A;  4MJS A;  1V9J A;  3AXC A;  3BY4 B;  1WXA A;  2IO1 B;  2K8H A;  3ECI A;  3L17 A;  3PHX B;  1VCB A;  3EC8 A;  2O2V B;  1AAR A;  2KD0 A;  2KTR B;  4MSQ B;  5CHF A;  2YLM A;  4XX5 A;  5AZG A;  4IM2 A;  4KIK B;  2N7E A;  4WJN A;  4AUQ C;  4GXB A;  4NY0 A;  4LJP B;  2YVC A;  4G50 A;  2OJR A;  2DYO A;  4BOZ B;  3V60 A;  1KOT A;  3CMM B;  2W9N A;  5AEK B;  5LXI B;  1IYF A;  4A3P A;  1TZ1 A;  2KDF B;  3HM3 A;  4FJY A;  3ZW3 A;  1I35 A;  2A4Z A;  5CHW A;  2ZCC A;  3IHP C;  2KDE B;  3VH3 B;  1UBI A;  1WJ4 A;  3KYD D;  2C7N B;  1LFD A;  1KLV A;  3M3J A;  1SGH A;  3Q3J A;  3A9J A;  4PS8 A;  1L2N A;  1KJT A;  1LQB A;  4NPN A;  4F1S A;  4GIV A;  2AWT A;  1Z2M A;  2ZEQ A;  2L7R A;  3DBR I;  3SU8 X;  2K8C A;  3SDL C;  4K7U A;  1WMH A;  2JRH A;  2KXJ A;  2ZPY A;  4LDT B;  3WAM A;  2PE9 A;  4GN1 A;  2KLC A;  1WXM A;  3OJ3 A;  2NBV B;  2KKC A;  4II2 B;  4IWO A;  3TBL D;  4XZ4 A;  3U8Z A;  3ZDT A;  3HM6 X;  4IUM B;  2EMS A;  4W9L A;  5DPW A;  3EFU A;  4X57 B;  1WGG A;  3NS8 A;  1VD2 A;  3WAN A;  4KDI C;  3KUD B;  3R7Q A;  4MGY E;  1H8C A;  2ZVN A;  3T9L A;  2KQ7 A;  4MJS B;  3DBH I;  4ICU A;  2GBJ A;  2LXC A;  4DDI D;  4EZJ A;  2G3Q B;  2L00 B;  3Q3F A;  1WXV A;  2UYZ B;  3ONS A;  4E71 A;  3VXW A;  2KMA A;  2FCS A;  2EKE C;  2HTH A;  3AU4 A;  3RUI B;  3WA0 A;  1WI0 A;  3VTU A;  2LVO A;  2MBH A;  2KFK A;  3PRZ A;  4HXD A;  4IWP A;  3UQB A;  3D32 A;  1YD8 U;  2C9W B;  2KHW B;  2DZM A;  2BPS A;  2L76 A;  4K7S A;  1V49 A;  2MRP A;  4JQW C;  1P9D U;  2KQS A;  2LGY A;  4II3 B;  4DHJ B;  4G11 A;  2RSU A;  3H1U A;  2WX1 A;  5IAA C;  4TQ1 A;  4BBN C;  5D2M B;  5IA7 A;  2MBO A;  3QC8 B;  4CYE A;  5J17 A;  1GNU A;  2DZI A;  4MSM B;  5L83 A;  4EZL A;  5DCN A;  3EEC A;  2DX5 B;  5JH5 C;  1OTR B;  2N1W A;  2KC1 A;  2FIF A;  3QK0 A;  2JT4 B;  3JW0 X;  3ZNG C;  3S2A A;  2NR2 A;  4FHJ A;  2WX0 A;  1WGD A;  2C5L C;  3MJW A;  4FUL A;  4P7I A;  2BYV E;  3I3T B;  2FUH B;  3PRM B;  4GU2 A;  4WJO A;  4W9D A;  1P98 A;  4CO7 A;  2NVU I;  4MGZ E;  2JY6 A;  3TMP B;  5CHV C;  2IBI B;  1SIF A;  2M4N A;  2REX A;  2KK8 A;  4W9I A;  2KWU B;  4NJ6 A;  2LWP A;  3A9K B;  3SD5 A;  2MP2 A;  4HDO A;  2FCM A;  2L0T A;  4J6I A;  3QX1 A;  5E6N A;  3L08 A;  4PS7 A;  1EF1 A;  1D3Z A;  2BYF A;  3PZD A;  2IZV B;  1WR6 E;  5J18 A;  2MWS B;  2AYO B;  5TR5 A;  4DDG D;  4EKU A;  5LXH A;  3DCG A;  2QHO A;  4ANW A;  2KJ6 A;  4IW0 A;  4W9G A;  4AJW A;  4HCP B;  3RD2 A;  1V2Y A;  4IM0 A;  4HDQ A;  3APD A;  1Z5S B;  1V5T A;  1WRD B;  2FAZ A;  3M95 A;  1XD3 B;  2WYQ A;  3SHQ A;  3ZUN A;  4AJY B;  2DHZ A;  2KOX A;  3PS6 A;  1S3S G;  3GZN I;  5DPS A;  3NOB A;  4GMV A;  3LJ3 A;  1ZKH A;  4G3X B;  2BKR B;  3V6E B;  4WWN A;  2XEW A;  2GBK A;  3ZIM A;  3LDZ E;  1Q5W B;  4ANV A;  3IG3 A;  4W9C A;  3UF8 A;  1UD7 A;  1EO6 A;  4W9E A;  5DPT A;  4MH0 E;  4KV2 A;  3PLV A;  2IY0 B;  1WM2 A;  3PVL A;  3ZKJ C;  2K25 A;  2BWE S;  2GBM A;  2D07 B;  2NPT B;  2PEA A;  3A4S C;  2ASQ A;  4XC2 A;  3VAW A;  4K1R B;  4DWF A;  3TCA A;  5E6O A;  2J0M A;  1E5W A;  4YL8 A;  2L0F A;  4M0W B;  1E7V A;  4WWP A;  2IYD B;  3A1Q B;  1WZ3 A;  3DBL I;  3N3K B;  4NAW B;  3H6N A;  3DBS A;  2Z0E B;  2D10 A;  3K9O B;  3ZRF A;  3QA8 A;  4IM3 A;  4TV3 A;  2DYB A;  4DK5 A;  3DVN U;  3L16 A;  4B6W A;  4RM8 A;  1XQQ A;  3R66 C;  4ZRI A;  3KW5 B;  2O6V A;  1BT0 A;  5G2N A;  1YQB A;  2D11 A;  4HPL B;  3TL5 A;  4BVU C;  2XK5 B;  3V62 A;  3VUW A;  4KZ0 A;  2BYE A;  3NZU A;  2JXX A;  2KC2 A;  2M8S A;  4EUT A;  4FBJ B;  1TBE A;  4BOS C;  1SE9 A;  3C0R B;  4K7W A;  3ZRC A;  1PQS A;  3A9K A;  4JGH B;  1WM3 A;  1E8Z A;  2NS5 A;  3MHS D;  1E7U A;  4B9K A;  1LXD A;  5FR6 A;  2XBB C;  2LI5 A;  5G55 A;  4NNJ B;  3QAQ A;  2NCN A;  1WX8 A;  2AL6 A;  4DXA B;  5KHQ A;  2N9P C;  4MDK E;  4BKS A;  1NBF C;  2CU1 A;  1H4R A;  1TTN A;  1XT9 B;  2ZNV C;  3VTV A;  1EF5 A;  2D3G A;  3UGB B;  1WX9 A;  2GMI C;  2ZNV B;  2JUO A;  2XK5 A;  2KAN A;  3PRP B;  2JRI B;  1E8W A;  4N9F 4;  4BKT A;  2D2Q A;  3QJZ A;  4MGK E;  1IPG A;  4K81 A;  3RUL A;  3JVZ X;  1WFY A;  4FJV B;  3AUL A;  5CX3 A;  4WWO A;  1WJ6 A;  1GC6 A;  3DDC B;  3QWZ B;  4GDL B;  2JZZ A;  3K9P B;  3ZTD A;  3QIJ A;  1S1Q B;  3N32 A;  4M8N A;  3VDZ A;  2N4F A;  3APC A;  2EMT A;  4NQK E;  4IG7 B;  2KMC A;  1KM7 A;  1V81 A;  2DYM A;  1QZE A;  2G45 B;  4E74 A;  1L7Y A;  3UIO B;  4EZK A;  3DOW A;  3PSE B;  4AWJ A;  1WX7 A;  2N9X A;  4RMA A;  2KFK B;  1J8C A;  3GOE A;  3W1Y A;  1TGZ B;  2V3S A;  2MBE A;  2R2Q A;  3WAP A;  4GDL A;  2KTF A;  3NY5 A;  4JL9 A;  5D6J B;  1RLF A;  4PYZ A;  2FID A;  4ZYN A;  1WXS A;  2KX0 A;  3MTN B;  4F8C B;  2BGF A;  5D7G A;  3HHM A;  4KVG B;  4FN2 A;  1WGR A;  4BBN F;  2KTR A;  3JSV B;  2K1F A;  4G0N B;  1OEY A;  1GC7 A;  1WJU A;  3JSV A;  3APF A;  4HVB A;  4TUU A;  2G4D B;  2IO3 B;  3KYC D;  3X0W A;  4BFR A;  1NI2 A;  2VRR B;  2WWZ A;  2CHZ A;  2LUE A;  3OAW A;  3WIM A;  2OOB B;  3QCA A;  3PGE A;  4MGI E;  3A33 B;  3L0W B;  2JZ3 B;  4DBG A;  5EDS A;  2J0J A;  1OGW A;  1WMH B;  2I1K A;  1YX6 B;  2CHW A;  2CS4 A;  4GSW A;  5GMV A;  3TIX A;  4ANX A;  2J7Q B;  4MEM A;  2IO2 B;  2J0K A;  2BKF A;  2Z0D B;  3X23 A;  2KFJ A;  3L10 B;  5C23 A;  2MX2 A;  2RD0 A;  2CHX A;  3JYU A;  3L13 A;  4W9J A;  3UIN B;  2GBR A;  4ZRJ A;  3VFK A;  2KJH B;  4ZRK A;  4AP4 C;  4ASW C;  5J2R A;  1MG8 A;  2AEH A;  2HD5 B;  4GOC A;  3R7R A;  4LDT D;  5JZE B;  3W1S C;  3DVN V;  1IP9 A;  2DAJ A;  1A5R A;  1WF9 A;  1YX5 B;  1P1A A;  2O6V B;  2MCN B;  4HPM B;  2DZJ A;  3VTW A;  3CST A;  3OLM D;  1CMX B;  1J19 A;  5L95 C;  4KDL B;  3W1S A;  4EFO A;  2RPQ A;  3PPA A;  2MBB B;  3U30 A;  2M0X A;  2MBQ A;  4AOF A;  1YJ1 A;  3RCZ A;  4TQ0 A;  2FNJ B;  4DHZ B;  5HKH A;  2NBU A;  3ENE A;  2CKH B;  4MEL A;  1RAX A;  3ZO5 B;  2KJR A;  3H7P A;  3QQ8 B;  2K6D B;  3V6C B;  3DVG X;  2ZZP B;  3L54 A;  3KH0 A;  1M94 A;  1WZ0 A;  2NPT A;  2I1J A;  3B08 A;  3UIP B;  2KNB A;  2ZPN A;  4W9H A;  3EHV A;  3TJP A;  1V86 A;  3UQA A;  3HK0 A;  4DHJ D;  3ZTC A;  1P0R A;  2KO3 A;  4URK A;  5D94 A;  1NDD A;  1X1M A;  3V61 A;  4W9F A;  2KZR A;  1Q0W B;  1WR1 A;  4WQO B;  1V80 A;  2KLG A;  2O6V D;  4FLH A;  4KSK C;  1WE6 A;  2RR9 A;  5CTR C;  3P2B A;  2KWC A;  2LJ5 A;  4JLC A;  4I6L B;  4KSL C;  2L3Z A;  3QAR A;  5JHA A;  2FCN A;  1T0Y A;  3M62 B;  3H9D A;  3ML9 A;  4IWQ A;  3DPD A;  4NQL B;  4HCN B;  2KVR A;  4HJK A;  3DQV A;  4KZC A;  4FJZ A;  1UZX B;  4A20 A;  3H7S A;  4GB9 A;  5LLI A;  2N7D A;  1K8R B;  4MM3 A;  4OVV A;  3VUX A;  4KIK A;  4HK2 A;  3U7D A;  3IFW B;  1P3Q U;  2K6Q A;  2G4S A;  3IBE A;  3RZF A;  4ZDV A;  3AU5 A;  2LGD A;  4FA6 A;  1WY8 A;  1EUV B;  3PT2 B;  3ZLZ A;  1WYW B;  2LVP A;  3B0A A;  4NJ7 A; 
#chains in the Genus database with same CATH topology
 3ZNH B;  1ZP0 B;  1GUA B;  1WE7 A;  3DHH C;  2KWV B;  2B76 B;  2V0G A;  1TKG A;  3GE8 C;  1R7S A;  3AEC B;  1ZW7 A;  1OEY J;  2LGS A;  1UGJ A;  3CSF A;  1EU3 A;  4PS3 A;  4GGQ A;  3PZ8 A;  1L0Y B;  5BYS A;  3GB1 A;  2DWQ A;  1HE8 A;  1WGH A;  3AE1 B;  3KQ4 A;  2DBY A;  3VUY A;  3HVD A;  4MT5 A;  4K3B A;  1C4C A;  4LCD E;  3RNA C;  2UWQ A;  1GPX A;  2L8J A;  3KWV A;  5JHB A;  1WYG A;  1F9J A;  1A70 A;  2DZK A;  2BVC A;  2L1A A;  2DEN B;  2ZCB A;  3BIN A;  1KFY B;  3H7P B;  4W9K A;  1N6Z A;  2N1V A;  4QAY A;  1ISN A;  4C56 C;  3OJ4 B;  1OQY A;  3A4R A;  1EWY C;  2WU2 B;  3CF6 E;  4MH8 A;  4ITK A;  3T8M A;  1I42 A;  2ZW0 A;  3ZDM C;  4A3O A;  4HWI B;  3B2F A;  4TKN A;  2PE6 B;  3HIZ A;  2R2O A;  1WH3 A;  3WAL A;  2KDI A;  2BB6 A;  4WJQ A;  2LD9 A;  2H89 B;  1FFV A;  1YJI A;  2LXA A;  4ANU A;  5DPR A;  2LAS A;  1UH6 A;  2Y5C A;  2V3P A;  4WIP A;  5HG2 A;  4JX1 C;  1G6J A;  3AV8 A;  4MJS A;  3EC8 A;  2KTR B;  4RF1 A;  4XX5 A;  1TKY A;  4IM2 A;  3LXF A;  4LJP B;  2YVC A;  2OJR A;  3WCQ A;  1T0R C;  2WDV B;  3BVM A;  2VH1 A;  1I35 A;  4MAC A;  1KLU D;  2J4X A;  1UBI A;  1LFD A;  1KLV A;  5EE1 A;  1L2N A;  4US9 A;  1LQB A;  2J52 A;  2L7R A;  3SDL C;  3RPF C;  4K7U A;  2LJI A;  1TT5 B;  5EE0 A;  2KLC A;  4IWO A;  3OJ3 A;  3IT4 B;  1SF0 A;  3ABV B;  3WAN A;  3R7Q A;  1TS2 A;  1VR9 A;  4DDI D;  4OZA A;  2G3Q B;  2UYZ B;  1R4M B;  2FCS A;  2EKE C;  3AU4 A;  1CK1 A;  3PRZ A;  1UNS A;  4HXD A;  4ACF A;  2BPS A;  2N9K A;  1V49 A;  2LGY A;  2WGS A;  4DHJ B;  1I7H A;  4BBN C;  2MBO A;  2WXR A;  3QC8 B;  4CYE A;  2BB5 A;  3QK0 A;  2JT4 B;  3JW0 X;  3ZNG C;  3S2A A;  2M56 B;  4XWT A;  1L0X B;  2WXP A;  1MVK A;  1XLP A;  2WNM A;  2JY6 A;  2E3T A;  2MH7 A;  1F0Z A;  1FNV A;  5BYQ A;  2KWU B;  1V1P A;  2LWP A;  3P63 A;  2WU5 B;  4M02 A;  4PS7 A;  2MJ3 A;  1WGK A;  3PZD A;  1K52 A;  5J18 A;  2MWS B;  2AYO B;  1DOI A;  2D5G A;  3DCG A;  2WXN A;  5H8Y E;  2JYT A;  4HCP B;  3RD2 A;  2Y5P A;  4P16 A;  4JWU C;  4LNK A;  4IM0 A;  1HZ5 A;  1WRD B;  2IPK D;  4ZHP A;  2BTE A;  3RFZ B;  5DPS A;  5GXG B;  3LJ3 A;  2BKR B;  3H8H A;  3AE8 B;  3LDZ E;  1D5X C;  1AW7 A;  4W9C A;  5DPT A;  4KV2 A;  3PLV A;  2D07 B;  1Y56 A;  3A4S C;  4DWF A;  1E0Z A;  1OQR A;  3TCA A;  4YL8 A;  1JW9 D;  2W82 A;  4WWP A;  3A1Q B;  1N61 A;  2Z0E B;  3K9O B;  1IBX A;  4WH4 A;  3QA8 A;  3ZRF A;  1HTQ A;  2DYB A;  1FD6 A;  3AM9 A;  1KLG D;  1F52 A;  4HPL B;  2XK5 B;  5BMG A;  4XE0 A;  3VUW A;  2JXX A;  2WS3 B;  4FBJ B;  1TBE A;  2NS5 A;  1C9F A;  1E7U A;  4LLG M;  1LXD A;  2LI5 A;  4NNJ B;  4PK1 A;  4NJC A;  2QDF A;  4MDK E;  1FXI A;  1TTN A;  1XT9 B;  2ZNV C;  2ZNV B;  3TUO A;  2KAN A;  4N9F 4;  3P4Q B;  2D2Q A;  3ETR A;  1IPG A;  3JVZ X;  1GAQ B;  2VZK B;  1UF0 A;  3DDC B;  1S1Q B;  5HFY A;  3GS2 A;  4M8N A;  4NAM A;  3VDZ A;  2EMT A;  2PVG C;  3MHZ A;  4S17 A;  2KMC A;  1C4P A;  3N1Y C;  2R61 A;  2N9X A;  4CQN A;  2WXH A;  3AEF B;  2MBE A;  4JL9 A;  1VZ6 A;  4ZYN A;  2FID A;  1D5Z C;  3HHM A;  1D6E C;  4N58 A;  4Q2J A;  4BBN F;  3RMK C;  1OEY A;  1GC7 A;  4A55 A;  1WJU A;  3Q8B A;  4BFR A;  1NI2 A;  4USA A;  1VLB A;  2OOB B;  2GB1 A;  1ESF A;  3L0W B;  3FC4 A;  2I1K A;  1YX6 B;  2J7Q B;  2WLB A;  2IO2 B;  4MEM A;  2BKF A;  2Z0D B;  1XF5 L;  3VR9 B;  2MX2 A;  2L83 A;  2CHX A;  1KF6 B;  2GBR A;  3VFK A;  4ASW C;  2XNA C;  1MG8 A;  2Z8L A;  3R7R A;  3DWM A;  3DVN V;  1IP9 A;  2O6V B;  4M01 A;  4KGT A;  1GOZ A;  3CST A;  1CMX B;  3W1S A;  1T5X D;  3BYT B;  2MJD A;  3U30 A;  4AOF A;  3RCZ A;  1MHX A;  2NBU A;  3ENE A;  4OHJ A;  4MEL A;  1RAX A;  2KJR A;  3DVG X;  3L54 A;  3KH0 A;  5IP4 D;  1FCC C;  4W9H A;  4C7Y A;  4J3O D;  3SFE B;  2V3N A;  3ZTC A;  1P0R A;  5D94 A;  4FLH A;  4KSK C;  3CIR B;  1QT9 A;  2L3Z A;  3ML9 A;  4IWQ A;  1L4D B;  5IKC M;  1QOB A;  2KWD A;  1UZX B;  3H7S A;  4MM3 A;  1K8R B;  3ZJU A;  1I4R A;  1HXY D;  2MHJ A;  4HK2 A;  1P3Q U;  2K6Q A;  4FA6 A;  3PT2 B;  1EUV B;  3ZLZ A;  1FRD A;  3B0A A;  3ZO5 B;  3Q8E A;  1XXG A;  3KUC B;  3M63 B;  1KRH A;  2KYW A;  1ET6 A;  1J7A A;  2LVQ A;  2BWF A;  4YTM B;  2CR5 A;  1XO3 A;  4LJO B;  2GRI A;  1C3T A;  3N30 A;  2PW9 A;  5FR3 A;  3QHT A;  4HLE A;  1GG3 A;  1RFK A;  2WXQ A;  2WDT B;  1D4B A;  2V4L A;  3TEW A;  1YNT E;  2C7M B;  1PUT A;  4RCO A;  2C60 A;  2M17 A;  2MSE D;  3PHW B;  1CZP A;  3PV1 A;  2FCQ A;  1RRB A;  2MA9 B;  5AZH A;  3ZNI D;  3NHE B;  3R3M A;  4RM9 A;  4OVU A;  2MJE A;  1U4A A;  3NZ3 A;  2KN5 A;  4YTN B;  1SEB D;  2AL3 A;  1DOX A;  1PGX A;  2RGF A;  1J0G A;  1VDV A;  2N9E B;  4DHZ E;  5E6P A;  3DVG Y;  1IGC A;  4LK0 M;  2V1Y A;  3MP9 A;  3PRE A;  1WJN A;  1K53 A;  2K39 A;  2OJW A;  3P4P B;  1SE4 A;  2CU3 A;  1YIW A;  1E8X A;  2JWZ A;  2A5U A;  4GDK A;  3NS1 A;  4P6V F;  2K8B A;  2OHF A;  1V9J A;  2IO1 B;  3L17 A;  1VCB A;  1FM0 D;  1K50 A;  1SE3 A;  4MSQ B;  5CHF A;  5AZG A;  2KN4 A;  4XWW A;  4WJN A;  3NG0 A;  1AYF A;  4NY0 A;  1ROE A;  4BOZ B;  4YWG G;  4HKQ A;  2AQ3 B;  5AEK B;  1V1O A;  4A3P A;  2IJ0 A;  4FJY A;  3R2T A;  1SB3 C;  2KQ4 X;  3UI3 A;  3ZW3 A;  5CHW A;  1SBB B;  3IHP C;  3KYD D;  1T0S C;  4IKG A;  2W55 A;  4PS8 A;  3A9J A;  4NPN A;  4F1S A;  1Z2M A;  3SU8 X;  3KLS X;  3PZ7 A;  3WAM A;  5BMI A;  1ET9 A;  4GN1 A;  2WP9 B;  2NBV B;  3TBL D;  4II2 B;  3DBL B;  3ZGZ A;  1P7F A;  3DWG C;  2EMS A;  2Q5W D;  5DPW A;  3EFU A;  4X57 B;  2ZVN A;  4ICU A;  2L00 B;  3Q3F A;  4JPS A;  1C77 A;  5BYR A;  1J7C A;  4C4V A;  1SJE D;  3VTU A;  4KX6 B;  1LGR A;  1N62 A;  2MBH A;  4IWP A;  1STE A;  2QEJ C;  2RDB C;  2WDR B;  2INN E;  2RSU A;  1JWA D;  2WX1 A;  1NVI D;  1GNU A;  2DZI A;  1I4G A;  3EEC A;  1OTR B;  1FNU A;  2KC1 A;  2FIF A;  2NR2 A;  4FHJ A;  5EE3 A;  1FIQ A;  3MJW A;  2BYV E;  1I4P A;  4GU2 A;  1NYQ A;  1PFD A;  3ZXV A;  4MGZ E;  4WAF A;  5CHV C;  2IBI B;  2REX A;  4W9I A;  4NJ6 A;  2X38 A;  3N9Y C;  2FCM A;  4J6I A;  2EEL A;  5H92 C;  4LNN A;  5E6N A;  2RMM A;  1EF1 A;  1WR6 E;  1QQR A;  2QHO A;  3AEE B;  1DGJ A;  4ANW A;  4W9G A;  3U52 E;  4AJW A;  1FRR A;  3L4P A;  2FBW B;  1V2Y A;  1I4X A;  1M4V A;  3M95 A;  1Z5S B;  1V5T A;  4O1N A;  3RN9 C;  1XD3 B;  2WYQ A;  3SHQ A;  3ZUN A;  3PS6 A;  1E10 A;  3KWL A;  3TEZ A;  4YSX B;  4G3X B;  5JXV A;  1HZ6 A;  4P1B C;  3IG3 A;  1EO6 A;  2D3C A;  1ZPS A;  3RNC C;  2IY0 B;  1WM2 A;  3PVL A;  3ZKJ C;  2GBM A;  2MEK A;  2PEA A;  3W9C B;  1TY2 A;  4XC2 A;  1XLO A;  1MG4 A;  3P4R B;  2L0F A;  4EE2 A;  1CQV A;  3ZYY X;  2D10 A;  4TV3 A;  4B6W A;  4OZC A;  1XQQ A;  1K51 A;  3CWI A;  3R66 C;  2K3U A;  5G2N A;  3TL5 A;  4ZYS A;  3V62 A;  2LHE A;  1YQ4 B;  4KZ0 A;  2QJL A;  2SEB D;  3NZU A;  2KC2 A;  2JZP A;  3I9V 1;  3C0R B;  4K7W A;  3ZRC A;  1PQS A;  3A9K A;  1WM3 A;  3Q69 A;  3MHS D;  4B9K A;  5G55 A;  5KHQ A;  2N9P C;  3DHG C;  5G5H A;  4IDI A;  3VTV A;  1EF5 A;  2D3G A;  3UGB B;  1WX9 A;  4LNO A;  4K81 A;  1WFY A;  3AUL A;  1L6U A;  4RF0 A;  3QWZ B;  4GDL B;  3K9P B;  3ZTD A;  1J7B A;  2FUG 1;  4IG7 B;  1ACC A;  1WRI A;  2G45 B;  1JCK B;  3Q2A C;  4EZK A;  3DOW A;  3PSE B;  1J8C A;  4A8X C;  4L2Y A;  4FXC A;  3GZN B;  1TGZ B;  2V3S A;  3WAP A;  2VH2 A;  3NY5 A;  4F8C B;  1WXS A;  2BGF A;  4KVG B;  1WGR A;  1UWM A;  4HKZ E;  2GLS A;  2KTR A;  3JSV B;  2K1F A;  4G0N B;  3JSV A;  2JXT A;  3APF A;  2L52 A;  4PT5 A;  1NI3 A;  3X0W A;  2VRR B;  2WWZ A;  4MGI E;  3PGE A;  1WMH B;  5GMV A;  1YMH E;  2J0K A;  3P4S B;  2QIL A;  5C23 A;  3JYU A;  5D3D A;  2QIE B;  1XLQ A;  1RWS A;  2QCZ A;  3SFD B;  3W1S C;  1BML C;  2DAJ A;  1WF9 A;  2IGD A;  1P1A A;  2DZJ A;  3NRZ A;  2K5P A;  1YN5 A;  4TQ0 A;  4M0W A;  4DHZ B;  2TSS A;  1QOG A;  2NMQ A;  2AQ2 B;  3H7P A;  4ARC A;  2M19 A;  4UDU C;  4OW0 A;  3UIP B;  3T3O A;  3TJP A;  3UQA A;  4DHJ D;  1ENF A;  4WQO B;  1WR1 A;  4ZOH C;  5G5G A;  1WE6 A;  5CTR C;  2KWC A;  2FCN A;  1T0Y A;  3H9D A;  4B0M A;  1E9M A;  2KVR A;  4KZC A;  2JWU A;  1C4A A;  4FJZ A;  4A20 A;  4KKJ A;  2BQQ A;  4N6E B;  3VUX A;  1SJH D;  4KIK A;  1JML A;  3IFW B;  2JX5 A;  3HVZ A;  1WY8 A;  1YJJ A;  4YSY B;  4ZRP A;  1BXT A;  3U7Z A;  2MP2 B;  2JVC A;  3IAM 1;  1V97 A;  4IOI E;  4F7Z A;  1JQ4 A;  1XLN A;  2JSV X;  3U2S C;  4WQM A;  2LZ6 A;  4B95 A;  3VRB B;  1TZO A;  2JQR B;  1RYJ A;  2BS3 B;  3VVW B;  3WAO A;  1FPY A;  1FXA A;  1RFA A;  4WJP A;  1LM8 B;  2INP E;  2B3A A;  3NUH B;  2O2V A;  1SXT A;  2KX3 A;  2YEP B;  1L4Z B;  4EOY A;  2NBW B;  3KUZ A;  3BYY B;  5IOI A;  4GDK B;  1UGM A;  2W3R A;  1FCL A;  2LRU A;  4HRS A;  1R4N I;  2KDB A;  1GJZ A;  3O65 B;  3KVF B;  4WAA A;  1JRP A;  3ML8 A;  3RNG C;  3BWU D;  1V6E A;  3ZVV A;  2K22 A;  3HRD D;  4LTU A;  4AQ7 A;  1F2R C;  2M1M A;  3VQI A;  2C7H A;  3NVZ A;  3PLU A;  4EEW A;  1JWB D;  1Y8R C;  3A1Q A;  3A9J B;  4D2K A;  4E3C A;  4YXD B;  1MI0 A;  1WIA A;  4BZA A;  2PJH A;  1B9R A;  2IO0 B;  3GP7 A;  4I6P A;  2I2Y A;  2GBN A;  2JF5 A;  2JPH A;  1UUP A;  3VH4 B;  1TKE A;  3AXC A;  3BY4 B;  1WXA A;  2K8H A;  3ECI A;  4A90 A;  3PHX B;  3AE4 B;  2O2V B;  1AAR A;  2YEP F;  1L0V B;  2YLM A;  1P7E A;  4KIK B;  4RGM A;  4AUQ C;  4RNA A;  2X8X X;  4GXB A;  4G50 A;  3V60 A;  3CMM B;  1DOY A;  1F2R I;  4HRO A;  5LXI B;  1IYF A;  3ZJT A;  3VH3 B;  1TS4 A;  2C7N B;  3M3J A;  2WHI A;  1KJT A;  2Y3A A;  1KH0 A;  2ZEQ A;  1PYW D;  2KXJ A;  4LDT B;  2PE9 A;  3BVZ A;  1I4Q A;  3ZDT A;  3TEY A;  2QMT A;  4XZ4 A;  3U8Z A;  3HM6 X;  4IUM B;  4C7Z A;  1QIL A;  4W9L A;  1ZUD 2;  3NS8 A;  1VD2 A;  4KDI C;  2I38 A;  4MGY E;  1H8C A;  2KQ7 A;  3DBH I;  4EZJ A;  1WXV A;  4P1C C;  3VXW A;  4C00 A;  4K3C A;  2KFK A;  3D32 A;  2LUM A;  2DZM A;  2L76 A;  4K7S A;  1TY0 A;  2MRP A;  4JQW C;  1P9D U;  2KQS A;  1OFF A;  3H1U A;  5D2M B;  5IA7 A;  2PTL A;  1PGA A;  4MSM B;  5L83 A;  4EZL A;  3NVV A;  4XDC A;  2DX5 B;  5JH5 C;  1NYR A;  3FAH A;  4RGO S;  1WGD A;  2C5L C;  4P7I A;  1AWD A;  2RDG A;  4CO7 A;  2L32 A;  3TMP B;  3C19 A;  1SIF A;  2M4N A;  3RNE C;  2KK8 A;  1WSP A;  3A9K B;  3SD5 A;  2MP2 A;  2L0T A;  2LHD A;  4YSZ B;  1ZXI A;  3QX1 A;  3FIL A;  4KGS A;  3W5V B;  3L08 A;  2BYF A;  2IZV B;  5LXH A;  5TR5 A;  4EKU A;  4DDG D;  3R8B A;  5MPO A;  3AEB B;  1L5P A;  4HDQ A;  2FAZ A;  3DHI C;  1VRA B;  4HEA 1;  1HQR D;  2DLB A;  2BS4 B;  3B2G A;  3NOB A;  1ZKH A;  3V6E B;  2XEW A;  3C8Y A;  2RDH A;  3UF8 A;  2IND C;  4W9E A;  3MC0 B;  2SAK A;  1FFU A;  2K25 A;  2OED A;  2ASQ A;  4K1R B;  3R2I A;  5E6O A;  3URY A;  4M0W B;  3N20 C;  1SIJ A;  2IYD B;  3N3K B;  1WZ3 A;  1SE2 A;  5TSS A;  4NAW B;  2WXK A;  3H6N A;  3DBS A;  3ZQ4 A;  4IM3 A;  2PVO D;  2W54 A;  2WXI A;  2BBC A;  3KW5 B;  3AB5 A;  1BT0 A;  2D11 A;  4HJG E;  1CJE A;  1D5M C;  2LFI A;  4XGA B;  2BYE A;  4EUT A;  3IAS 1;  4JGH B;  3B9J A;  2PIA A;  1QOA A;  5FR6 A;  2XBB C;  2NCN A;  4DXA B;  1XEE A;  4BKS A;  1NBF C;  1C78 A;  1H4R A;  2ONQ A;  3AE3 B;  3EA6 A;  2JUO A;  2KVZ A;  3PRP B;  2JRI B;  4BKT A;  3I57 A;  3QJZ A;  2HDE A;  3SEB A;  4MGK E;  1TS3 A;  5CX3 A;  1WJ6 A;  2M0A A;  2JZZ A;  2WXL A;  3Q3O C;  3N32 A;  4NQK E;  3APC A;  2WXJ A;  1KM7 A;  2DYM A;  4E74 A;  1L7Y A;  3UIO B;  1HTO A;  2K0P A;  2PMV A;  4R3D A;  2XN9 C;  4RMA A;  3RNB C;  3FIL B;  2KFK B;  1SSN A;  3ZXR A;  3GOE A;  3W1Y A;  4ARI A;  4GDL A;  5D6J B;  1RLF A;  4DQO C;  2KX0 A;  1EWC A;  2WXO A;  2KT7 A;  4FN2 A;  4RGT A;  4RGN A;  5E6J A;  1VZ7 A;  4HVB A;  4TUU A;  2G4D B;  2IO3 B;  3WIM A;  2LUE A;  1WWT A;  3QCA A;  5FKA C;  5LNK 1;  2V9H A;  1OGW A;  2J0J A;  3Q8F A;  2CHW A;  2CS4 A;  3Q14 C;  4ANX A;  3EFC A;  3L10 B;  2G1E A;  2H88 B;  3UIN B;  4AP4 C;  3Q8A A;  2CJN A;  2HD5 B;  4GOC A;  5D3I B;  2IGH A;  3BK2 A;  1T0Q C;  2MCN B;  2N7J A;  4HPM B;  5AUK A;  3VTW A;  2IDY A;  3OLM D;  1J19 A;  1VZ8 A;  3GE3 C;  4EFO A;  3PPA A;  2M0X A;  2FNJ B;  3V6C B;  2K6D B;  1ZDX A;  2ZZP B;  1WZ0 A;  4L1B A;  3B08 A;  4H2A A;  4GLS C;  1BUI C;  3HK0 A;  2KO3 A;  2D3B A;  3V61 A;  4W9F A;  1PDX A;  1Q0W B;  2KLG A;  4KSL C;  5JHA A;  3QAR A;  3M62 B;  3DPD A;  1YN4 A;  1L6V A;  4NQL B;  4KGR A;  1JRO A;  1QOF A;  3T3N A;  4GB9 A;  5LLI A;  4DXG A;  2N7D A;  4OVV A;  5AUI A;  3U7D A;  1ZE3 D;  2G4S A;  4RFB A;  3V05 A;  4ZDV A;  3AU5 A;  2LGD A;  1WYW B;  2LVP A;  2EKI A;  4NJ7 A;  4FHK A;  3ALB A;  2LGX A;  4PYU A;  1GB1 A;  1WXQ A;  3SR6 A;  3AH7 A;  1WGY A;  3AI5 A;  2LRW A;  4DXF A;  3RZW C;  2Y5B B;  4JIO U;  3IVF A;  2W3S A;  2HJ8 A;  2MQJ A;  3AMZ A;  2ICI A;  2J42 A;  2JU6 X;  2WXG A;  1N63 A;  3PTF C;  2BF8 B;  4FAD A;  3RT3 B;  5BO4 B;  3NZS A;  5EE9 A;  1V5O A;  2MLB A;  3OWE B;  1FO4 A;  1R4M I;  3B1L X;  4WWM A;  2E6X A;  1ZXH A;  4I6N B;  4C80 A;  4NZL B;  2BYT A;  4BKS D;  2HE7 A;  1NEK B;  1E90 A;  2QSD A;  1JRU A;  2PPH A;  5AZF A;  1Q1O A;  2MW5 A;  4REZ A;  1UBQ A;  1RM6 C;  1NEN B;  4ICV A;  2GOW A;  1C1Y B;  5KHO A;  4YT0 B;  5C1Z A;  2IY1 B;  4IC7 B;  4CHK A;  3RYT A;  2N0S B;  1R4N B;  2ZW1 A;  2PLP A;  2L05 A;  3ZNZ B;  1E8Y A;  1FEH A;  4M8M A;  3AEG B;  4NAW A;  3HUI A;  1ZGU B;  4HPP A;  3FKY A;  1FXT B;  5C2T B;  2ZJD A;  2ZVO A;  3VHT C;  4BKG A;  4S0R A;  1N60 A;  1YOV B;  2DAF A;  2LEK A;  2GI9 A;  2Z59 B;  1UEL A;  5IO9 A;  4OZB A;  1UWX A;  2KD0 A;  1QF6 A;  4LNF A;  3BZD B;  5I4D A;  3MC8 A;  2N7E A;  1YN3 A;  4US8 A;  2DYO A;  3DBR B;  2NTS A;  1KOT A;  2W9N A;  1TZ1 A;  2KDF B;  3HM3 A;  2A4Z A;  1HA5 A;  2ZCC A;  2KDE B;  1WJ4 A;  1SGH A;  3Q3J A;  1FMA D;  3V3X A;  4GIV A;  2AWT A;  2WDQ B;  3DBR I;  2K8C A;  1WMH A;  2JRH A;  1V8C A;  3DBH B;  2INC C;  2ZPY A;  3Q6B A;  3W2D A;  2KDM A;  3RNF C;  1JWU D;  2D3A A;  1WXM A;  2K9X A;  2KKC A;  1C76 A;  1WGG A;  3KUD B;  4M00 A;  3E9S A;  5IN7 A;  3T9L A;  1F77 A;  2LGI A;  4MJS B;  3P42 A;  2GBJ A;  2LXC A;  1I4H A;  3U4E G;  3ONS A;  4E71 A;  2KMA A;  2HTH A;  3RUI B;  3WA0 A;  1WI0 A;  5FK9 C;  2LVO A;  3I5J C;  3UQB A;  1IUE A;  1YD8 U;  2C9W B;  2KHW B;  2WXF A;  2HJ1 A;  2UU7 A;  3J9C A;  3AE5 B;  1OQQ A;  4II3 B;  4G11 A;  5IAA C;  3EUB 2;  4TQ1 A;  3MC9 A;  5J17 A;  2KMM A;  1QKZ A;  5DCN A;  2ON8 A;  1N5X A;  4JWS C;  2N1W A;  4WUR A;  3Q3M C;  2RPV A;  2WX0 A;  4FUL A;  1TS5 A;  3I3T B;  2FUH B;  3PRM B;  4RH6 A;  4WJO A;  4W9D A;  2BT6 A;  1P98 A;  2NVU I;  5T8I A;  3MJ5 A;  5C3J B;  1T3Q A;  4HDO A;  4KKI A;  1TYG B;  1KTK A;  1D3Z A;  4XDD A;  3NVW A;  2KJ6 A;  4IW0 A;  3LB8 C;  3AN1 A;  1Q10 A;  1GB4 A;  3P1M A;  3APD A;  2N9L A;  4AJY B;  1PGB A;  2DHZ A;  3I63 C;  2KOX A;  1IGD A;  1S3S G;  3GZN I;  4GMV A;  4WWN A;  2GBK A;  3ZIM A;  1EM7 A;  3Q8C A;  4ANV A;  1Q5W B;  1UD7 A;  1E6E B;  4MH0 E;  3N1X C;  4JE3 B;  3NVY A;  2BWE S;  2BW2 A;  4OVZ A;  2NPT B;  2QC8 A;  3VAW A;  2ACZ B;  3N1Z C;  4A6Q A;  2J0M A;  1E5W A;  3EGR A;  1E7V A;  3DBL I;  4LNI A;  1TJE A;  3O13 A;  4DK5 A;  3DVN U;  2AX5 A;  3L16 A;  4RM8 A;  2V4I B;  4ZRI A;  1MHH E;  2O6V A;  4BVU C;  1YQB A;  3E56 A;  1QLB B;  3TEX A;  2M8S A;  1JAL A;  4BOS C;  1SE9 A;  3ZJV A;  1V1P B;  1JWM D;  1E8Z A;  1HEZ E;  4BAX A;  3QAQ A;  1LO5 D;  4C4V B;  1WX8 A;  2IGG A;  4TSS A;  1ZDV A;  2AL6 A;  4AS1 A;  2WXM A;  1T6B X;  2CU1 A;  1MPE A;  3BII D;  3RI7 C;  2GMI C;  2XK5 A;  3VR8 B;  4TMA B;  2LMC A;  1E8W A;  1B1Z A;  1TIF A;  3RUL A;  4FJV B;  4WWO A;  5HI1 A;  1GC6 A;  1JWS D;  1EU4 A;  3QIJ A;  2FE8 A;  2N4F A;  4YTP B;  1V81 A;  1QZE A;  1N5W A;  4AWJ A;  1WX7 A;  3OG5 A;  4N59 A;  2CJO A;  2R2Q A;  4ZRQ A;  2KTF A;  5HHD G;  4PYZ A;  2HTM E;  3MTN B;  5D7G A;  3PO0 A;  1VJK A;  1AN8 A;  3BK1 A;  2VZK D;  3KYC D;  4ZHO A;  4L23 A;  2CHZ A;  3OAW A;  3A33 B;  2JZ3 B;  1XCQ L;  4DBG A;  5EDS A;  3TIX A;  3Q3N C;  4GSW A;  3AE2 B;  1XCT L;  2BS2 B;  3TSS A;  2KFJ A;  1C79 A;  3X23 A;  1DYQ A;  2RD0 A;  3L13 A;  4W9J A;  2NTT A;  2KAC A;  4ZRJ A;  2KJH B;  4ZRK A;  2DNF A;  1F1H A;  5J2R A;  5BMH A;  2AEH A;  4A9A A;  3VRA B;  1E7P B;  4LDT D;  5JZE B;  1A5R A;  1YX5 B;  3AE7 B;  2KAJ A;  1YQ3 B;  4B0E A;  3LYY A;  1MFW A;  1IBX B;  2JYE A;  5L95 C;  4KDL B;  1ZOY B;  2RPQ A;  2MBB B;  2MBQ A;  1YJ1 A;  5HKH A;  2PKO A;  2CKH B;  3NJT A;  4MM3 B;  3QQ8 B;  3MFG A;  3W5U B;  1M94 A;  2NPT A;  2I1J A;  2KNB A;  2ZPN A;  2G9H D;  3EHV A;  1V86 A;  4URK A;  1FNW A;  1NDD A;  1X1M A;  2KZR A;  1V80 A;  2O6V D;  2AQ1 B;  2RR9 A;  3P2B A;  3AE9 B;  2LJ5 A;  4JLC A;  4I6L B;  4HCN B;  4HJK A;  3DQV A;  2WQY B;  1MJD A;  3IT6 B;  2J53 A;  3AEA B;  3AE6 B;  3BVG A;  3AED B;  3IXS A;  4XYC A;  3IBE A;  3RZF A; 
#chains in the Genus database with same CATH homology
 3ZNH B;  4FHK A;  1GUA B;  3ALB A;  2MP2 B;  3KUC B;  3M63 B;  2LGX A;  1WE7 A;  4PYU A;  2KWV B;  2JVC A;  4F7Z A;  2LVQ A;  1WGY A;  1ZW7 A;  2BWF A;  2LRW A;  3AI5 A;  1OEY J;  3RZW C;  2Y5B B;  4JIO U;  3IVF A;  3CSF A;  2CR5 A;  2HJ8 A;  2MQJ A;  2LZ6 A;  4LJO B;  4B95 A;  4PS3 A;  1C3T A;  4GGQ A;  3N30 A;  3PTF C;  3VVW B;  1HE8 A;  2BF8 B;  1WGH A;  3QHT A;  3RT3 B;  1GG3 A;  3WAO A;  4FAD A;  4HLE A;  5BO4 B;  1RFA A;  3VUY A;  2WDT B;  4WJP A;  3NZS A;  1LM8 B;  2V4L A;  2C7M B;  1V5O A;  2MLB A;  2B3A A;  4LCD E;  2O2V A;  1R4M I;  2C60 A;  2M17 A;  2UWQ A;  3B1L X;  2KX3 A;  2MSE D;  3PHW B;  4EOY A;  2L8J A;  2NBW B;  5JHB A;  3KUZ A;  4I6N B;  3PV1 A;  1F9J A;  4GDK B;  2DZK A;  1UGM A;  2FCQ A;  4BKS D;  2DEN B;  1RRB A;  2HE7 A;  2MA9 B;  5AZH A;  3ZNI D;  1E90 A;  2ZCB A;  2LRU A;  3NHE B;  3BIN A;  3R3M A;  4RM9 A;  1R4N I;  2KDB A;  3H7P B;  4OVU A;  4W9K A;  1GJZ A;  1JRU A;  3O65 B;  3KVF B;  4WAA A;  2N1V A;  2PPH A;  1U4A A;  3ML8 A;  5AZF A;  1Q1O A;  2MW5 A;  1UBQ A;  2KN5 A;  1ISN A;  1V6E A;  3ZVV A;  2AL3 A;  4ICV A;  2GOW A;  1C1Y B;  5KHO A;  3OJ4 B;  1OQY A;  2IY1 B;  3A4R A;  4IC7 B;  5C1Z A;  2RGF A;  3CF6 E;  4CHK A;  3RYT A;  3T8M A;  1J0G A;  2N9E B;  1I42 A;  2M1M A;  3ZDM C;  4A3O A;  4HWI B;  4DHZ E;  5E6P A;  2L05 A;  3ZNZ B;  3DVG Y;  1E8Y A;  3VQI A;  4TKN A;  2C7H A;  2PE6 B;  3PLU A;  4EEW A;  4M8M A;  3HIZ A;  2R2O A;  4NAW A;  1WH3 A;  1Y8R C;  2V1Y A;  3A1Q A;  3WAL A;  1ZGU B;  3A9J B;  3PRE A;  1WJN A;  2KDI A;  4E3C A;  4WJQ A;  2LD9 A;  1FXT B;  2ZJD A;  1WIA A;  2ZVO A;  3VHT C;  4BKG A;  2PJH A;  2LXA A;  2IO0 B;  4ANU A;  4I6P A;  2K39 A;  5DPR A;  2LAS A;  1UH6 A;  1E8X A;  1YIW A;  2DAF A;  2GBN A;  2JF5 A;  2JPH A;  2JWZ A;  2Z59 B;  1UEL A;  2A5U A;  4GDK A;  3VH4 B;  1G6J A;  2K8B A;  4MJS A;  1V9J A;  3AXC A;  3BY4 B;  1WXA A;  2IO1 B;  2K8H A;  3ECI A;  3L17 A;  3PHX B;  1VCB A;  3EC8 A;  2O2V B;  1AAR A;  2KD0 A;  2KTR B;  4MSQ B;  5CHF A;  2YLM A;  4XX5 A;  5AZG A;  4IM2 A;  4KIK B;  2N7E A;  4WJN A;  4AUQ C;  4GXB A;  4NY0 A;  4LJP B;  2YVC A;  4G50 A;  2OJR A;  2DYO A;  4BOZ B;  3V60 A;  1KOT A;  3CMM B;  2W9N A;  5AEK B;  5LXI B;  1IYF A;  4A3P A;  1TZ1 A;  2KDF B;  3HM3 A;  4FJY A;  3ZW3 A;  1I35 A;  2A4Z A;  5CHW A;  2ZCC A;  3IHP C;  2KDE B;  3VH3 B;  1UBI A;  1WJ4 A;  3KYD D;  2C7N B;  1LFD A;  1KLV A;  3M3J A;  1SGH A;  3Q3J A;  3A9J A;  4PS8 A;  1L2N A;  1KJT A;  1LQB A;  4NPN A;  4F1S A;  4GIV A;  2AWT A;  1Z2M A;  2ZEQ A;  2L7R A;  3DBR I;  3SU8 X;  2K8C A;  3SDL C;  4K7U A;  1WMH A;  2JRH A;  2KXJ A;  2ZPY A;  4LDT B;  3WAM A;  2PE9 A;  4GN1 A;  2KLC A;  1WXM A;  3OJ3 A;  2NBV B;  2KKC A;  4II2 B;  4IWO A;  3TBL D;  4XZ4 A;  3U8Z A;  3ZDT A;  3HM6 X;  4IUM B;  2EMS A;  4W9L A;  5DPW A;  3EFU A;  4X57 B;  1WGG A;  3NS8 A;  1VD2 A;  3WAN A;  4KDI C;  3KUD B;  3R7Q A;  4MGY E;  1H8C A;  2ZVN A;  3T9L A;  2KQ7 A;  4MJS B;  3DBH I;  4ICU A;  2GBJ A;  2LXC A;  4DDI D;  4EZJ A;  2G3Q B;  2L00 B;  3Q3F A;  1WXV A;  2UYZ B;  3ONS A;  4E71 A;  3VXW A;  2KMA A;  2FCS A;  2EKE C;  2HTH A;  3AU4 A;  3RUI B;  3WA0 A;  1WI0 A;  3VTU A;  2LVO A;  2MBH A;  2KFK A;  3PRZ A;  4HXD A;  4IWP A;  3UQB A;  3D32 A;  1YD8 U;  2C9W B;  2KHW B;  2DZM A;  2BPS A;  2L76 A;  4K7S A;  1V49 A;  2MRP A;  4JQW C;  1P9D U;  2KQS A;  2LGY A;  4II3 B;  4DHJ B;  4G11 A;  2RSU A;  3H1U A;  2WX1 A;  5IAA C;  4TQ1 A;  4BBN C;  5D2M B;  5IA7 A;  2MBO A;  3QC8 B;  4CYE A;  5J17 A;  1GNU A;  2DZI A;  4MSM B;  5L83 A;  4EZL A;  5DCN A;  3EEC A;  2DX5 B;  5JH5 C;  1OTR B;  2N1W A;  2KC1 A;  2FIF A;  3QK0 A;  2JT4 B;  3JW0 X;  3ZNG C;  3S2A A;  2NR2 A;  4FHJ A;  2WX0 A;  1WGD A;  2C5L C;  3MJW A;  4FUL A;  4P7I A;  2BYV E;  3I3T B;  2FUH B;  3PRM B;  4GU2 A;  4WJO A;  4W9D A;  1P98 A;  4CO7 A;  2NVU I;  4MGZ E;  2JY6 A;  3TMP B;  5CHV C;  2IBI B;  1SIF A;  2M4N A;  2REX A;  2KK8 A;  4W9I A;  2KWU B;  4NJ6 A;  2LWP A;  3A9K B;  3SD5 A;  2MP2 A;  4HDO A;  2FCM A;  2L0T A;  4J6I A;  3QX1 A;  5E6N A;  3L08 A;  4PS7 A;  1EF1 A;  1D3Z A;  2BYF A;  3PZD A;  2IZV B;  1WR6 E;  5J18 A;  2MWS B;  2AYO B;  5TR5 A;  4DDG D;  4EKU A;  5LXH A;  3DCG A;  2QHO A;  4ANW A;  2KJ6 A;  4IW0 A;  4W9G A;  4AJW A;  4HCP B;  3RD2 A;  1V2Y A;  4IM0 A;  4HDQ A;  3APD A;  1Z5S B;  1V5T A;  1WRD B;  2FAZ A;  3M95 A;  1XD3 B;  2WYQ A;  3SHQ A;  3ZUN A;  4AJY B;  2DHZ A;  2KOX A;  3PS6 A;  1S3S G;  3GZN I;  5DPS A;  3NOB A;  4GMV A;  3LJ3 A;  1ZKH A;  4G3X B;  2BKR B;  3V6E B;  4WWN A;  2XEW A;  2GBK A;  3ZIM A;  3LDZ E;  1Q5W B;  4ANV A;  3IG3 A;  4W9C A;  3UF8 A;  1UD7 A;  1EO6 A;  4W9E A;  5DPT A;  4MH0 E;  4KV2 A;  3PLV A;  2IY0 B;  1WM2 A;  3PVL A;  3ZKJ C;  2K25 A;  2BWE S;  2GBM A;  2D07 B;  2NPT B;  2PEA A;  3A4S C;  2ASQ A;  4XC2 A;  3VAW A;  4K1R B;  4DWF A;  3TCA A;  5E6O A;  2J0M A;  1E5W A;  4YL8 A;  2L0F A;  4M0W B;  1E7V A;  4WWP A;  2IYD B;  3A1Q B;  1WZ3 A;  3DBL I;  3N3K B;  4NAW B;  3H6N A;  3DBS A;  2Z0E B;  2D10 A;  3K9O B;  3ZRF A;  3QA8 A;  4IM3 A;  4TV3 A;  2DYB A;  4DK5 A;  3DVN U;  3L16 A;  4B6W A;  4RM8 A;  1XQQ A;  3R66 C;  4ZRI A;  3KW5 B;  2O6V A;  1BT0 A;  5G2N A;  1YQB A;  2D11 A;  4HPL B;  3TL5 A;  4BVU C;  2XK5 B;  3V62 A;  3VUW A;  4KZ0 A;  2BYE A;  3NZU A;  2JXX A;  2KC2 A;  2M8S A;  4EUT A;  4FBJ B;  1TBE A;  4BOS C;  1SE9 A;  3C0R B;  4K7W A;  3ZRC A;  1PQS A;  3A9K A;  4JGH B;  1WM3 A;  1E8Z A;  2NS5 A;  3MHS D;  1E7U A;  4B9K A;  1LXD A;  5FR6 A;  2XBB C;  2LI5 A;  5G55 A;  4NNJ B;  3QAQ A;  2NCN A;  1WX8 A;  2AL6 A;  4DXA B;  5KHQ A;  2N9P C;  4MDK E;  4BKS A;  1NBF C;  2CU1 A;  1H4R A;  1TTN A;  1XT9 B;  2ZNV C;  3VTV A;  1EF5 A;  2D3G A;  3UGB B;  1WX9 A;  2GMI C;  2ZNV B;  2JUO A;  2XK5 A;  2KAN A;  3PRP B;  2JRI B;  1E8W A;  4N9F 4;  4BKT A;  2D2Q A;  3QJZ A;  4MGK E;  1IPG A;  4K81 A;  3RUL A;  3JVZ X;  1WFY A;  4FJV B;  3AUL A;  5CX3 A;  4WWO A;  1WJ6 A;  1GC6 A;  3DDC B;  3QWZ B;  4GDL B;  2JZZ A;  3K9P B;  3ZTD A;  3QIJ A;  1S1Q B;  3N32 A;  4M8N A;  3VDZ A;  2N4F A;  3APC A;  2EMT A;  4NQK E;  4IG7 B;  2KMC A;  1KM7 A;  1V81 A;  2DYM A;  1QZE A;  2G45 B;  4E74 A;  1L7Y A;  3UIO B;  4EZK A;  3DOW A;  3PSE B;  4AWJ A;  1WX7 A;  2N9X A;  4RMA A;  2KFK B;  1J8C A;  3GOE A;  3W1Y A;  1TGZ B;  2V3S A;  2MBE A;  2R2Q A;  3WAP A;  4GDL A;  2KTF A;  3NY5 A;  4JL9 A;  5D6J B;  1RLF A;  4PYZ A;  2FID A;  4ZYN A;  1WXS A;  2KX0 A;  3MTN B;  4F8C B;  2BGF A;  5D7G A;  3HHM A;  4KVG B;  4FN2 A;  1WGR A;  4BBN F;  2KTR A;  3JSV B;  2K1F A;  4G0N B;  1OEY A;  1GC7 A;  1WJU A;  3JSV A;  3APF A;  4HVB A;  4TUU A;  2G4D B;  2IO3 B;  3KYC D;  3X0W A;  4BFR A;  1NI2 A;  2VRR B;  2WWZ A;  2CHZ A;  2LUE A;  3OAW A;  3WIM A;  2OOB B;  3QCA A;  3PGE A;  4MGI E;  3A33 B;  3L0W B;  2JZ3 B;  4DBG A;  5EDS A;  2J0J A;  1OGW A;  1WMH B;  2I1K A;  1YX6 B;  2CHW A;  2CS4 A;  4GSW A;  5GMV A;  3TIX A;  4ANX A;  2J7Q B;  4MEM A;  2IO2 B;  2J0K A;  2BKF A;  2Z0D B;  3X23 A;  2KFJ A;  3L10 B;  5C23 A;  2MX2 A;  2RD0 A;  2CHX A;  3JYU A;  3L13 A;  4W9J A;  3UIN B;  2GBR A;  4ZRJ A;  3VFK A;  2KJH B;  4ZRK A;  4AP4 C;  4ASW C;  5J2R A;  1MG8 A;  2AEH A;  2HD5 B;  4GOC A;  3R7R A;  4LDT D;  5JZE B;  3W1S C;  3DVN V;  1IP9 A;  2DAJ A;  1A5R A;  1WF9 A;  1YX5 B;  1P1A A;  2O6V B;  2MCN B;  4HPM B;  2DZJ A;  3VTW A;  3CST A;  3OLM D;  1CMX B;  1J19 A;  5L95 C;  4KDL B;  3W1S A;  4EFO A;  2RPQ A;  3PPA A;  2MBB B;  3U30 A;  2M0X A;  2MBQ A;  4AOF A;  1YJ1 A;  3RCZ A;  4TQ0 A;  2FNJ B;  4DHZ B;  5HKH A;  2NBU A;  3ENE A;  2CKH B;  4MEL A;  1RAX A;  3ZO5 B;  2KJR A;  3H7P A;  3QQ8 B;  2K6D B;  3V6C B;  3DVG X;  2ZZP B;  3L54 A;  3KH0 A;  1M94 A;  1WZ0 A;  2NPT A;  2I1J A;  3B08 A;  3UIP B;  2KNB A;  2ZPN A;  4W9H A;  3EHV A;  3TJP A;  1V86 A;  3UQA A;  3HK0 A;  4DHJ D;  3ZTC A;  1P0R A;  2KO3 A;  4URK A;  5D94 A;  1NDD A;  1X1M A;  3V61 A;  4W9F A;  2KZR A;  1Q0W B;  1WR1 A;  4WQO B;  1V80 A;  2KLG A;  2O6V D;  4FLH A;  4KSK C;  1WE6 A;  2RR9 A;  5CTR C;  3P2B A;  2KWC A;  2LJ5 A;  4JLC A;  4I6L B;  4KSL C;  2L3Z A;  3QAR A;  5JHA A;  2FCN A;  1T0Y A;  3M62 B;  3H9D A;  3ML9 A;  4IWQ A;  3DPD A;  4NQL B;  4HCN B;  2KVR A;  4HJK A;  3DQV A;  4KZC A;  4FJZ A;  1UZX B;  4A20 A;  3H7S A;  4GB9 A;  5LLI A;  2N7D A;  1K8R B;  4MM3 A;  4OVV A;  3VUX A;  4KIK A;  4HK2 A;  3U7D A;  3IFW B;  1P3Q U;  2K6Q A;  2G4S A;  3IBE A;  3RZF A;  4ZDV A;  3AU5 A;  2LGD A;  4FA6 A;  1WY8 A;  1EUV B;  3PT2 B;  3ZLZ A;  1WYW B;  2LVP A;  3B0A A;  4NJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...