1P0RA

Solution structure of ubl5 a human ubiquitin-like protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
b'MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ubiquitin-like 5
publication title Structural analysis of UBL5, a novel ubiquitin-like modifier
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p0rA00
5CHVC 5DCNA 2LASA 4NNJB 4I6LB 5DPWA 1UBQA 3N30A 1WY8A 4M0WB 4LJPB 4MGIE 1MG8A 1V9JA 2J0JA 3ZNID 3L54A 4ZRKA 3OLMD 4N9F4 1WJ4A 4RM9A 1WIAA 2FIFA 3W1SA 4PS3A 1A5RA 2D07B 1S3SG 1P1AA 2Y5BB 2DZKA 3ML9A 4DHJB 2BF8B 1TTNA 1XQQA 4WWOA 2DYBA 2FAZA 5GMVA 3ZUNA 2DYMA 1WX8A 4B6WA 4XX5A 3APDA 1RAXA 5DPTA 3RZFA 1LM8B 4GU2A 3R7QA 1E5WA 1SIFA 2VRRB 3K9OB 2MBQA 3GOEA 3V61A 4TQ0A 1WYWB 1EF1A 3KW5B 3ZNZB 1IYFA 4WQOB 5D94A 3UF8A 2KK8A 3VH4B 3NHEB 2N1WA 3I3TB 1L7YA 3A9KA 4GMVA 3TMPB 2N9XA 2ASQA 1LXDA 4IWQA 3D32A 1M94A 2ZEQA 1V5TA 2KJ6A 3A1QB 4G11A 3A4SC 4CO7A 1K8RB 1XD3B 5DPSA 3S2AA 3DBRI 1WH3A 4GN1A 2KMAA 2KTFA 4FHJA 5FR6A 4NJ6A 1G6JA 1IPGA 4B95A 1Q5WB 4NAWA 4KDIC 4M8MA 2ZNVC 3RZWC 2JXXA 2KQSA 3PV1A 2CHXA 3VQIA 4YL8A 1WR1A 2CKHB 2KO3A 2LGYA 3B08A 3AULA 3VUXA 4BBNF 4NY0A 3PLUA 4CYEA 2FCSA 1WRDB 2CHWA 3AU5A 1UZXB 4HPLB 5J17A 4WJQA 2GBRA 5AEKB 3SU8X 3ZTCA 4DHZE 1GNUA 2KDBA 2WX1A 4ZYNA 4EKUA 3VAWA 3VTUA 2MX2A 2WDTB 3PHWB 4HWIB 3DBSA 4HVBA 3HM6X 4JGHB 4M8NA 4W9LA 4EEWA 1E90A 2CR5A 3UIPB 2IZVB 3BINA 3PGEA 3OJ4B 4LCDE 4EZLA 3Q3FA 2V3SA 1WR6E 1QZEA 2D11A 1EO6A 2M17A 4II2B 5JH5C 3L17A 1V6EA 4TUUA 3PRZA 4W9EA 1UELA 2YVCA 5JHBA 3CSTA 4JLCA 2D10A 4K1RB 3DBHI 1SGHA 1J0GA 3QJZA 4F1SA 3A9JA 3ZIMA 1WE6A 3ENEA 3QARA 1KJTA 2WX0A 3LDZE 2MWSB 4KSLC 3T9LA 2ZJDA 4FADA 4FJYA 2CU1A 2BGFA 4PS7A 1YD8U 3KYCD 3L13A 1H8CA 1UH6A 2N4FA 2BYEA 2L7RA 3K9PB 1X1MA 4G0NB 2I1JA 3A1QA 2FIDA 4AUQC 2AL6A 2K6QA 4TKNA 2MBEA 2BWES 2KWCA 2XBBC 3ZDTA 1I42A 5C23A 2KLGA 2LXCA 2XK5B 2HD5B 4IUMB 1HE8A 4JQWC 4W9CA 2KTRB 1JRUA 4AWJA 3QQ8B 4IWPA 2XEWA 1TBEA 2PPHA 2KJRA 1RFAA 5L95C 1OEYA 5J18A 1NDDA 3NS8A 2IO0B 3L08A 5KHQA 3QA8A 1WM2A 3WANA 3KH0A 1SE9A 3NZSA 1KM7A 1WXAA 1WJUA 2REXA 4LDTB 4ANWA 3NOBA 3DVGX 4CHKA 4P7IA 5G55A 4FJVB 1P3QU 4HPMB 2KKCA 4DBGA 4URKA 4OVVA 3V6CB 1ISNA 2K1FA 2L76A 2IO3B 4GB9A 2PEAA 4RM8A 4DWFA 2LD9A 3DQVA 2C5LC 2NBVB 4ZDVA 2HTHA 3M62B 2KX3A 4B9KA 3KUZA 1V86A 2G4DB 3H6NA 2DYOA 3PVLA 3ZRFA 5LXIB 1GC7A 4IC7B 3WIMA 3ZTDA 2JPHA 5AZGA 3SHQA 2GBNA 4BFRA 3QCAA 5E6OA 3UQBA 3ECIA 5CX3A 1D3ZA 3HM3A 2V1YA 3ML8A 2L3ZA 4E74A 2LUEA 3VFKA 2ZZPB 3JYUA 2LWPA 2RGFA 3QIJA 2KX0A 2LVPA 2N7DA 3H7PB 4BOSC 3ZNHB 2KFJA 3MTNB 1ZKHA 2KDFB 2MBOA 2YLMA 3N3KB 4W9GA 1WE7A 4EUTA 4GIVA 1WGDA 4A3OA 2GBMA 5L83A 2K25A 3IHPC 2LVQA 3ZLZA 2L0FA 2ZCCA 1WX7A 2KWVB 2NCNA 4HXDA 5IAAC 3WA0A 4FA6A 1V80A 2ZCBA 3M3JA 1NI2A 3U30A 3TCAA 1WJNA 2XK5A 1WF9A 3JW0X 4MELA 2KTRA 3SDLC 3JSVB 5G2NA 3DVNV 2W9NA 1OTRB 4AP4C 2A5UA 4DHZB 4IW0A 1J19A 3IVFA 4IG7B 2NS5A 3Q3JA 3QWZB 1WFYA 4TV3A 4E71A 3PT2B 5E6PA 1YJ1A 2NVUI 3PZDA 4I6PA 4IM0A 3UINB 3DBLI 5CHWA 5LLIA 2MBHA 2NPTB 2UWQA 3NY5A 2K8CA 3VDZA 2MBBB 2ZVOA 2DZJA 2BKFA 4MM3A 1TZ1A 2FCQA 3H9DA 5D2MB 1L2NA 2LGDA 2Z0EB 3CMMB 3C0RB 1WXSA 1E8WA 4ANUA 2RD0A 3PSEB 4KIKB 3U8ZA 2CS4A 2ZVNA 1OQYA 2L05A 4KZ0A 3WALA 2FUHB 2K6DB 3QHTA 5AZFA 2GBKA 3APCA 4MSQB 4EZKA 3TIXA 5IA7A 3W1YA 5J2RA 2EKEC 2BYFA 2J0MA 2QHOA 2KQ7A 2KXJA 2KN5A 4OVUA 4NQLB 2N7EA 4HK2A 4MEMA 1H4RA 3UGBB 2HJ8A 3H7SA 3VUWA 2M1MA 3H7PA 3DCGA 1WGRA 3L16A 2KJHB 2MQJA 4F7ZA 4MJSB 2MLBA 2MA9B 4HDOA 4X57B 1KLVA 3L10B 1P9DU 1GC6A 2KLCA 3VVWB 2ZPNA 1T0YA 2JVCA 2N9PC 2EMTA 4KZCA 2MCNB 3KUDB 2PE6B 2V4LA 2WWZA 1ZW7A 2LZ6A 3QAQA 4GOCA 4MGZE 3MJWA 3EECA 2KZRA 4IM2A 2AEHA 4FJZA 1UGMA 3R66C 2KHWB 3DPDA 4BOZB 1NBFC 3ZVVA 1UBIA 3MHSD 4II3B 4TQ1A 4PYUA 2RPQA 1WZ3A 3PLVA 2K8HA 2DZIA 2DENB 1J8CA 2M8SA 4GSWA 3TJPA 1YX5B 4K7WA 3AU4A 4XZ4A 3B1LX 1LFDA 4W9KA 3AXCA 3CF6E 2NBWB 3KVFB 2IY0B 3X0WA 1CMXB 4MH0E 1ZGUB 2K8BA 2IO2B 3ZW3A 2O6VB 1YIWA 1WGGA 2AWTA 3HK0A 4KIKA 4W9HA 3WAOA 4RMAA 4DHJD 2KDEB 1E7UA 1UD7A 1LQBA 3RUIB 1WZ0A 1WGHA 4WJPA 2LI5A 1S1QB 5D7GA 1EF5A 2N9EB 4ZRIA 3WAPA 2BWFA 1E8YA 2NR2A 2JY6A 3VH3B 4GDKB 2NBUA 4BBNC 1V81A 1Z5SB 3RT3B 3QC8B 4EOYA 3R3MA 4MJSA 2JRIB 2L0TA 2LRUA 1E8ZA 2C7NB 3X23A 3HIZA 3PS6A 3PREA 4W9FA 3EHVA 3R7RA 2DZMA 2L8JA 2D3GA 2DAFA 4WJOA 2C60A 3RD2A 4HCNB 3DOWA 2RR9A 4W9IA 2Z59B 2AYOB 3ALBA 2M4NA 4HJKA 3HHMA 4AOFA 2LGXA 3OAWA 4E3CA 3ZRCA 2OOBB 3APFA 3UIOB 3IFWB 3RYTA 3V62A 4DXAB 4GDLB 4IM3A 3VXWA 2BKRB 1I35A 1Y8RC 3W1SC 2UYZB 4MDKE 1V2YA 4HDQA 4NJ7A 1E7VA 3RULA 3VHTC 4AJWA 5JZEB 1GUAB 2GBJA 4HLEA 2LJ5A 2G45B 1RRBA 2MRPA 3VTVA 4GGQA 2GMIC 3EC8A 5D6JB 1U4AA 3PTFC 4NPNA 3O65B 4K7SA 2DHZA 3TL5A 3P2BA 5JHAA 2IY1B 5DPRA 3M63B 2JZZA 1KOTA 3A9JB 1AARA 3UQAA 2KANA 2DX5B 4EFOA 2KNBA 3B0AA 5CTRC 1WXMA 3WAMA 3SD5A 2KWUB 2OJRA 2FNJB 4KVGB 2O6VA 1C1YB 2JRHA 3A33B 4KV2A 2Z0DB 2EMSA 2C7HA 4J6IA 2B3AA 2J0KA 2BYVE 1F9JA 4W9DA 2KFKB 2MW5A 3ZNGC 1WI0A 4GXBA 2KD0A 3PPAA 2G3QB 4FHKA 5EDSA 2WYQA 1WJ6A 4FULA 2JZ3B 4KSKC 1GJZA 1E8XA 1P98A 2KMCA 4GDKA 4G50A 3ZO5B 4PYZA 3IG3A 4WAAA 4MGYE 5LXHA 2IBIB 2MP2B 2IO1B 1WMHB 1WXVA 3EFUA 1VD2A 1PQSA 1R4NI 3DVNU 3M95A 1Z2MA 5CHFA 2BPSA 1Q0WB 1OEYJ 4BVUC 4XC2A 3PHXB 4LJOB 2O2VB 3AI5A 1XT9B 4DDGD 1VCBA 3ONSA 1R4MI 2J7QB 4FBJB 3DDCB 3ZKJC 2LRWA 4I6NB 2KC2A 2C9WB 4BKSA 2MSED 4FN2A 4ANVA 3N32A 4K81A 4WJNA 3BY4B 4GDLA 1GG3A 2FCNA 1WM3A 1YX6B 3VTWA 4BKTA 3DVGY 4LDTD 4K7UA 4ASWC 2PJHA 3JSVA 4JL9A 5E6NA 2D2QA 4DDID 3T8MA 1OGWA 2O6VD 5BO4B 2IYDB 3VUYA 2AL3A 1RLFA 4ICVA 4A20A 4DK5A 1P0RA 3PRMB 4MGKE 3V60A 5AZHA 3RCZA 1FXTB 1WX9A 4WWNA 4JIOU 2ZPYA 4IWOA 2KVRA 2NPTA 2JF5A 3V6EB 3TBLD 2DAJA 3QK0A 1WGYA 1Q1OA 4KDLB 1IP9A 2JWZA 4EZJA 4AJYB 1C3TA 2KDIA 2L00B 2PE9A 3OJ3A 4F8CB 1YQBA 4G3XB 2CHZA 2KFKA 3L0WB 3A9KB 5C1ZA 3H1UA 2JUOA 4WWPA 3NZUA 2RSUA 1V49A 3IBEA 2LXAA 2C7MB 3PRPB 2G4SA 4PS8A 4BKGA 2MP2A 3KYDD 2N1VA 3CSFA 1WMHA 4BKSD 2M0XA 2FCMA 3GZNI 3A4RA 3JVZX 2I1KA 4NAWB 4ZRJA 4A3PA 1V5OA 4MSMB 3U7DA 2HE7A 5TR5A 2ZNVB 1TGZB 2GOWA 4FLHA 4ANXA 2O2VA 2R2OA 1BT0A 1EUVB 3LJ3A 2JT4B 4W9JA 2KC1A 2KOXA 2K39A 4NQKE 2R2QA 5KHOA 5HKHA 2LVOA 4ICUA 3ZDMC 4HCPB 3KUCB 3QX1A 2A4ZA
chains in the Genus database with same CATH superfamily
5CHVC 5DCNA 4I6LB 1WY8A 4LK0M 4MGIE 1FM0D 3H8HA 1XF5L 3FKYA 3ZNID 1VZ8A 1UGJA 4ZRKA 3R2IA 2FIFA 3U7ZA 3N1XC 1SJED 1TTNA 3ZUNA 5GMVA 2DYMA 1WX8A 1RAXA 1ZUD2 1SIFA 3GOEA 3V61A 4OW0A 3KW5B 3ZNZB 1IUEA 3UF8A 5BYRA 3NZ3A 2X8XX 4GMVA 3TMPB 2E3TA 2ASQA 4G11A 3A4SC 1K8RB 1XD3B 1D5XC 1WH3A 2KTFA 5FR6A 2WDRB 2VH1A 4B95A 4KDIC 1GPXA 2WXRA 3DBLB 2JXXA 2R61A 2CHXA 3B08A 3P63A 3AULA 2NTTA 4BBNF 4NY0A 3PLUA 4CYEA 1GAQB 4OHJA 1WRDB 3AU5A 1UZXB 5J17A 2GBRA 3ZTCA 3VR9B 3ZJVA 1I4GA 3HM6X 2WXJA 4M8NA 4KKJA 4RGMA 2JQRB 2ONQA 5JH5C 4O1NA 2YVCA 2J52A 4K1RB 1J0GA 2YEPF 5IKCM 3Q8BA 4FJYA 2BGFA 4PS7A 1YD8U 3L13A 1UH6A 2FIDA 2AL6A 2K6QA 3P42A 2BWES 3ZDTA 2BS3B 5C23A 2HD5B 3UI3A 1HE8A 4W9CA 4AWJA 2JYTA 3NVYA 4IWPA 1F1HA 3NS8A 2BB5A 2IO0B 5KHQA 4LDTB 4ANWA 3SFEB 4P7IA 3DWMA 4DBGA 4YSYB 1J7BA 4K3CA 4OZCA 1B1ZA 2Y3AA 4RM8A 1MVKA 3DQVA 3M62B 5BYQA 1JWMD 3ZRFA 3HM3A 2V1YA 1FD6A 2LUEA 2V3PA 2ZZPB 2LWPA 2RGFA 3QIJA 3VR8B 1FEHA 4BOSC 5G5GA 1FFUA 1ZKHA 2MBOA 3RNCC 2PMVA 2ZW1A 1WE7A 2JXTA 2GBMA 2K25A 4HXDA 5IAAC 2WXHA 3RPFC 1NI3A 3M3JA 1SE2A 1NI2A 3TCAA 1WJNA 5G2NA 4KKIA 1C4CA 2W9NA 1SIJA 2PLPA 1AWDA 4AP4C 1JW9D 3BZDB 1J19A 3IVFA 2NS5A 3QWZB 5AUIA 2M56B 4E71A 4KGRA 4OZAA 5E6PA 4ZHPA 3PZDA 5IN7A 2BKFA 4L1BA 1P7EA 1TZ1A 1N5XA 4P16A 1L2NA 2LGDA 2Z0EB 1E9MA 2RD0A 3CWIA 2LGIA 4KIKB 2GB1A 2K6DB 3QHTA 1JWAD 2GBKA 4MSQB 3GE3C 2EKEC 2J0MA 2KN5A 3UGBB 1XEEA 3VUWA 2AQ2B 3L16A 2KJHB 1KLVA 1JRPA 3BVZA 2WU2B 3VVWB 4RFBA 2WP9B 1D5MC 3KUDB 4BAXA 1ZW7A 4GOCA 1ZE3D 2WQYB 1NBFC 1JWUD 3ZVVA 1UBIA 3MHSD 4PYUA 3PLVA 3FAHA 4S17A 4XZ4A 2JZPA 3B1LX 1LFDA 3AXCA 1V8CA 2NBWB 2IY0B 3X0WA 1CMXB 4MH0E 2WHIA 1K53A 2IO2B 4D2KA 1YIWA 1WGGA 3WAOA 3RNGC 4RMAA 1N62A 1WZ0A 1WGHA 1CJEA 2LI5A 1T3QA 1NENB 2BWFA 4JWSC 2JY6A 2K5PA 4BBNC 3RT3B 4MJSA 2LRUA 2C7NB 1YN4A 3W9CB 3EHVA 1K52A 1TYGB 3RD2A 2DAFA 1HZ6A 4HCNB 4W9IA 1TS3A 2Z59B 2M4NA 2EELA 3HHMA 3RNFC 4DXAB 3VXWA 2BKRB 3O13A 1I35A 2JSVX 3W1SC 4MDKE 1D5ZC 1E7VA 4ZHOA 4OVZA 2GBJA 2LJ5A 2G45B 1RRBA 3VTVA 4DXFA 3EC8A 3O65B 1VRAB 3URYA 5JHAA 2INNE 2IY1B 2BS2B 2IGHA 3PZ8A 2DX5B 4EFOA 3SR6A 3OWEB 2OJRA 1E6EB 2O6VA 1TS2A 2EMSA 2MH7A 2BYVE 1F9JA 4RGOS 2KFKB 2LGSA 2N9LA 4GXBA 4S0RA 2G3QB 2WYQA 4KSKC 2JZ3B 1P98A 2KMCA 1JMLA 4GDKA 2MJ3A 3Q2AC 4WAAA 1ET9A 2MP2B 1L4ZB 2IO1B 5D3DA 2MEKA 1NVID 2V9HA 2O2VB 5BYSA 3HVZA 2BQQA 1VCBA 3ONSA 3I63C 1R4MI 2J7QB 4C00A 4FBJB 3ZKJC 2KC2A 4K3BA 3AEAB 4JX1C 1QLBB 4K81A 4WJNA 3BY4B 1WM3A 1QQRA 2FBWB 1YX6B 3NUHB 2L1AA 3JSVA 1QOBA 2IYDB 3VUYA 2ON8A 3P4QB 3DBHB 2JU6X 4A20A 2QEJC 1P0RA 1F2RI 3AV8A 1FXTB 1WX9A 2JF5A 2DAJA 3QK0A 1JALA 1WGYA 1EU4A 2LUMA 2KDIA 1XLNA 3OJ3A 4F8CB 2CHZA 4WWPA 1C4PA 1HTQA 4BKGA 4QAYA 1WMHA 5EE3A 2PKOA 3JVZX 2I1KA 3U7DA 2HE7A 4XDDA 2R2OA 1PUTA 2KC1A 1QKZA 2R2QA 4XYCA 2N7JA 3ZDMC 1I4RA 3KUCB 3AECB 4NNJB 3AEGB 1UBQA 4M0WB 1T0RC 1J7AA 2ZW0A 3NRZA 3L54A 5FR3A 3RNBC 3OLMD 4N9F4 4RM9A 3W1SA 4B0MA 1A5RA 2BTEA 1S3SG 2DZKA 4DHJB 4MACA 3V3XA 1QOFA 3B2GA 3APDA 4WWMA 1LM8B 3R7QA 2VRRB 3K9OB 3BVMA 3VH4B 1M4VA 3I3TB 3A9KA 2V4IB 1Y56A 4AQ7A 4IWQA 1M94A 2KJ6A 3A1QB 2WXMA 4CO7A 4FXCA 5DPSA 3S2AA 2WXIA 2OEDA 4GN1A 1G6JA 1IPGA 2W3RA 1DGJA 4HROA 2ZNVC 4M8MA 3BK1A 3AEDB 1FIQA 2CKHB 2KO3A 2ICIA 5FKAC 4TSSA 3AE6B 3AN1A 1Q10A 5BMIA 5AEKB 3SU8X 2IGDA 4MH8A 4ZYNA 2WDTB 3DBSA 3MHZA 3DHIC 3ZJUA 4EEWA 1E90A 1I4HA 2CR5A 3UIPB 2IZVB 3BINA 4EZLA 2WDQB 2V3SA 1QZEA 2D11A 3AE9B 4YT0B 4II2B 4RNAA 3PRZA 2D10A 1N61A 3QJZA 3ZIMA 1HA5A 3ENEA 1JROA 3QARA 4ARCA 3LDZE 2E6XA 3T9LA 1I4PA 4FADA 3Q8FA 1JQ4A 1AYFA 3KYCD 4WAFA 3NS1A 2WU5B 1H8CA 2L7RA 2X38A 4G0NB 2I1JA 2WXPA 3Q8CA 2MBEA 1I42A 2KLGA 2LXCA 2KTRB 2WNMA 2PPHA 1RFAA 2HDEA 1OEYA 2MJEA 3Q69A 5HG2A 4YSZB 2REXA 4CHKA 4FJVB 1P3QU 2KKCA 4J3OD 3V6CB 1ISNA 3Q6BA 4MM3B 2L76A 4GB9A 3MP9A 2PEAA 2NBVB 2HTHA 3J9CA 3KUZA 1T6BX 1V86A 2G4DB 1QILA 2DYOA 1XLOA 5LXIB 3WIMA 1TS5A 2JPHA 5AZGA 3SHQA 5E6OA 3KWVA 3ML8A 3EGRA 1YJJA 4XWTA 2LVPA 2N7DA 3H7PB 4DXGA 5D3IB 1TY2A 3NVWA 3MTNB 2KDFB 3N3KB 5L83A 3IHPC 2LVQA 5MPOA 3WA0A 4C4VA 1IGCA 2ZCBA 2WXOA 4MELA 2XK5A 1F2RC 3SDLC 3JSVB 4XWWA 3N1ZC 4IW0A 1A70A 1XCQL 1EWYC 4B0EA 3NG0A 1WFYA 1XO3A 4XE0A 2NVUI 4M01A 3BIID 3DBLI 5LLIA 4YTPB 2BW2A 1E0ZA 2MBHA 2ZVOA 2W55A 2FCQA 2FE8A 1E8WA 3E9SA 2L05A 3WALA 2FUHB 2VZKB 4EZKA 3Q3NC 3W1YA 5IA7A 5J2RA 1ZPSA 2KXJA 2N7EA 4MEMA 3H7SA 1C78A 1ACCA 2M1MA 2MQJA 2TSSA 2INPE 4HDOA 2V3NA 1AW7A 2QMTA 5EE0A 1TS4A 1P9DU 2JVCA 1SJHD 2V4LA 2LZ6A 2IPKD 4MGZE 2KZRA 4FJZA 4JWUC 3U4EG 2KHWB 4BOZB 2WDVB 1UWXA 2RPQA 2DZIA 3NVVA 2OJWA 1CQVA 1YNTE 2AX5A 2N0SB 1VZ6A 2BYTA 3EA6A 3KVFB 4M00A 2D3CA 1ZGUB 2QDFA 1B9RA 3RNEC 1LQBA 2PIAA 1EF5A 2N9EB 5AUKA 4N6EB 3GZNB 2L32A 2K3UA 2NR2A 1YN3A 3KWLA 3Q8EA 3P4PB 4EOYA 3R3MA 5IO9A 2L0TA 3HIZA 3PS6A 4W9FA 2K0PA 2KYWA 2L8JA 1E10A 5H8YE 2RR9A 1GB1A 2QC8A 3RNAC 4HJKA 1XCTL 5IP4D 3APFA 3RYTA 3LXFA 4IM3A 1Y8RC 2KQ4X 2UYZB 1V1PA 1FCCC 1GUAB 2GMIC 3HUIA 5D6JB 3PTFC 1N60A 4K7SA 2DHZA 5DPRA 2G1EA 1KOTA 1AARA 3UQAA 2MJDA 2KANA 3AEBB 1MHXA 4KVGB 3MC0B 5H92C 4KV2A 4J6IA 4HKQA 3DBRB 1FRDA 2MW5A 3T3OA 1FNVA 2KD0A 1GJZA 3N20C 3TUOA 3IG3A 2JYEA 5LXHA 1SE3A 3EFUA 3M95A 4L23A 4KX6B 2BBCA 4BVUC 3PHXB 4LJOB 2AQ3B 4ZYSA 4DDGD 1YQ4B 4FN2A 4GDLA 1I4XA 2LHDA 3VTWA 1WYGA 2GRIA 3GS2A 4YXDB 1OFFA 5HHDG 5AZHA 1L0VB 1TIFA 4JIOU 3AE4B 2KVRA 2NPTA 3V6EB 3TBLD 4LNNA 4YTNB 1Q1OA 2WXKA 2L00B 1YQBA 4DQOC 4REZA 3H1UA 2DNFA 2KDMA 3NZUA 2LXAA 2RDBC 2C7MB 4PS8A 3CSFA 3N1YC 4MT5A 2M0XA 2FCMA 1IBXA 2PTLA 1MG4A 3A4RA 4A3PA 4MSMB 2ZNVB 2GOWA 4ANXA 1PGBA 1BT0A 1EUVB 1VZ7A 2K39A 4NQKE 1PYWD 1KFYB 4HCPB 2H89B 2LASA 3N30A 2MHJA 2RDGA 4LJPB 1MG8A 2LFIA 1F52A 1V9JA 1F77A 3P4SB 4P1BC 4US9A 3DHGC 2SEBD 1SBBB 1WJ4A 1WIAA 2W82A 3ZXVA 4PS3A 2UU7A 2M19A 1P1AA 1JWBD 1JCKB 1MJDA 3OG5A 4WWOA 2FAZA 2M0AA 4XX5A 5I4DA 3RZFA 2I2YA 2XN9C 4GU2A 3DHHC 2MBQA 4TQ0A 2DLBA 4HPPA 5T8IA 2RPVA 2KK8A 3NVZA 4H2AA 2N9XA 4Q2JA 4ITKA 1I7HA 2ZEQA 3KQ4A 2KMAA 4FHJA 4NAWA 4C80A 3RZWC 2KQSA 3PV1A 3VQIA 2FCSA 2QJLA 4IOIE 4HPLB 2HJ1A 1YN5A 3LB8C 4RF0A 1EU3A 2INCC 2J53A 1GNUA 2WX1A 2GLSA 1RFKA 3VAWA 3VTUA 4JGHB 3PGEA 3OJ4B 2Y5CA 3Q3FA 1WR6E 1EO6A 5E6JA 4TUUA 1UELA 2K22A 5JHBA 2NTSA 3DBHI 1SGHA 4F1SA 1WE6A 1KJTA 2MWSB 4KSLC 2ZJDA 1N5WA 1YJIA 1KRHA 1HEZE 2BYEA 1X1MA 1XXGA 1STEA 2KWCA 4IUMB 3IAS1 1JRUA 1FCLA 1WWTA 3QQ8B 1TBEA 2CJOA 4KGSA 2KJRA 5J18A 1NDDA 3QA8A 4WQMA 3KH0A 1SE9A 3IT6B 3NZSA 3DVGX 1V1OA 5G55A 4HPMB 4OVVA 2LD9A 2C5LC 1WSPA 3ETRA 4IC7B 3ZTDA 4BFRA 3QCAA 3ECIA 5CX3A 1WXQA 2QIEB 1OQQA 2LHEA 3FC4A 1HZ5A 4RF1A 3ZNHB 5LNK1 3HVDA 3AE2B 2YLMA 4W9GA 4LTUA 3TEXA 4EUTA 4GIVA 1WGDA 4PK1A 3IT4B 2L0FA 1WX7A 2NCNA 3Q8AA 3RI7C 3U30A 3JW0X 1WF9A 1N6ZA 3DVNV 2A5UA 4USAA 1D6EC 3Q3JA 2FUG1 4TV3A 2LMCA 3PT2B 1YJ1A 4I6PA 3UINB 3I57A 2NPTB 2UWQA 3NY5A 2K8CA 3VDZA 2MBBB 2ACZB 2DZJA 2D3AA 3C0RB 4WIPA 1WXSA 1L6UA 3U8ZA 2CS4A 2OHFA 2ZVNA 4C7ZA 4KZ0A 4ACFA 1KH0A 5AZFA 4HKZE 3TIXA 1KLGD 2BYFA 2KQ7A 4OVUA 4NQLB 4GLSC 4HK2A 1R4NB 2HJ8A 1N63A 1IBXB 1WGRA 3MC9A 4MJSB 4YSXB 1T5XD 1K50A 3L10B 4A6QA 1T0QC 1GC6A 2KLCA 5HI1A 3I5JC 1T0YA 2N9PC 3KLSX 4KZCA 2V0GA 2MCNB 3PO0A 2PE6B 1MFWA 2WWZA 2D5GA 2AEHA 1ET6A 1UGMA 4II3B 4TQ1A 1WZ3A 2NMQA 2K8HA 3BVGA 2EKIA 2M8SA 4GSWA 3Q3OC 3TJPA 3AEEB 4K7WA 1TY0A 1NEKB 1WRIA 3P4RB 3TEZA 3AE3B 3ZW3A 2O6VB 2AWTA 4KIKA 1E7UA 3RUIB 5D7GA 3WAPA 1R7SA 1E8YA 3VH3B 4GDKB 1V81A 3QC8B 1L0XB 1MI0A 2JRIB 2N9KA 1E8ZA 1UUPA 4N59A 3R7RA 4N58A 2AYOB 1ZP0B 1BUIC 2KMMA 2WXNA 4AOFA 4E3CA 2OOBB 3UIOB 3IFWB 4YWGG 3R8BA 1HQRD 3B2FA 1V2YA 4HDQA 4AJWA 4HLEA 1LO5D 3U52E 1U4AA 3TL5A 2I38A 3EFCA 3P2BA 2VZKD 2JZZA 3IXSA 3B0AA 3WAMA 1WXMA 3SD5A 2KAJA 2FNJB 3V05A 3C19A 3W2DA 3A33B 2JRHA 1C77A 2C7HA 2IDYA 3ZJTA 3E56A 1DOYA 2JWUA 1WJ6A 1E8XA 4G50A 4RH6A 1J7CA 1WMHB 1VD2A 1EM7A 3DVNU 1Z2MA 2BPSA 5FK9C 1OEYJ 4XC2A 3P1MA 3DWGC 1RM6C 1XT9B 4C56C 2INDC 3DDCB 3ABVB 4I6NB 2LRWA 3C8YA 2C9WB 4ANVA 2FCNA 4BKTA 3DVGY 4LDTD 4K7UA 4DDID 1C79A 1OGWA 4XGAB 2AL3A 3ZQ4A 4DK5A 4KGTA 3SFDB 3V60A 4A8XC 3GE8C 1K51A 2YEPB 4WWNA 2ZPYA 4IWOA 2J42A 2WXLA 4KDLB 2JWZA 4EZJA 2PE9A 3Q3MC 3TEYA 4BZAA 3MFGA 2KFKA 3TEWA 3A9KB 3IAM1 1VJKA 2RSUA 3IBEA 3T3NA 1ZXIA 1OQRA 2G4SA 2MP2A 3KYDD 2W3SA 4BKSD 3Q14C 3GZNI 4ZRJA 3ZYYX 1YQ3B 1TGZB 1HXYD 1UNSA 2O2VA 2BS4B 2JT4B 2KOXA 2DWQA 5KHOA 1SE4A 2K9XA 2QCZA 2A4ZA 4LNOA 4HEA1 5DPWA 2JX5A 3AE8B 1FNWA 2J0JA 3R2TA 5JXVA 2GI9A 5BMGA 2D3BA 2D07B 2Y5BB 3ML9A 2RDHA 2BF8B 3BWUD 1XLPA 1XQQA 3L4PA 3RN9C 2DYBA 4B6WA 5DPTA 1E5WA 1GB4A 1IYFA 1WYWB 1EF1A 4LNFA 4WQOB 2PVGC 5D94A 3FILA 3NHEB 2AQ1B 2N1WA 4C7YA 1C4AA 1L7YA 4UDUC 1LXDA 3D32A 1V5TA 4LNIA 1SSNA 1CK1A 1ZXHA 3DBRI 4NJ6A 1ZDXA 1L5PA 1C9FA 1Q5WB 1QF6A 2L52A 1TZOA 4LLGM 2KACA 1WR1A 4YL8A 2LGYA 3VUXA 1IGDA 3VRAB 2CHWA 1SXTA 4WJQA 1ZDVA 1YMHE 4DHZE 1TKGA 3LYYA 2KDBA 4M0WA 4EKUA 2MX2A 3PHWB 4HWIB 4HVBA 5GXGB 2WLBA 4W9LA 2IGGA 4LCDE 2QSDA 1C76A 2M17A 3L17A 1V6EA 4W9EA 1QOAA 2XNAC 3CSTA 4JLCA 4RCOA 3AMZA 3A9JA 2WX0A 2BT6A 3TSSA 3U2SC 2CU1A 1PDXA 4P6VF 2N4FA 2Z8LA 3K9PB 4C4VB 3A1QA 4AUQC 4TKNA 2LEKA 1DOXA 4JQWC 2XK5B 2XEWA 4CQNA 5L95C 1FMAD 3L08A 3AEFB 4LNKA 1WM2A 3WANA 1TKEA 1KM7A 1WXAA 1WJUA 4RGTA 3NOBA 1FXIA 4URKA 1JWSD 2K1FA 2IO3B 1ESFA 3AM9A 4DWFA 4ZDVA 2KX3A 4B9KA 3H6NA 3PVLA 1L0YB 4R3DA 1GC7A 4WH4A 4AS1A 1VR9A 2GBNA 3UQBA 1BXTA 3AB5A 1D3ZA 1PGXA 5EE1A 2L3ZA 4E74A 2RMMA 3VFKA 3JYUA 1XLQA 3MC8A 2KX0A 2KFJA 1BMLC 3RFZB 1I4QA 3GP7A 3B9JA 2J4XA 3HRDD 4A3OA 3ZLZA 4OZBA 2ZCCA 2KWVB 2IJ0A 4FA6A 1V80A 1L4DB 2DBYA 2KTRA 1FFVA 1OTRB 4DHZB 3BK2A 4IG7B 3CIRB 1SF0A 4IKGA 4XDCA 3AE5B 2CU3A 4IM0A 1L6VA 1ROEA 5CHWA 1HTOA 1WGKA 4A9AA 4MM3A 3H9DA 1VLBA 5D2MB 1KTKA 3CMMB 4NZLB 4ANUA 3PSEB 4HJGE 1OQYA 1PFDA 5BMHA 3APCA 4P1CC 2QHOA 5IOIA 3EUB2 4NAMA 1H4RA 3H7PA 3DCGA 1SB3C 4F7ZA 4WURA 2MLBA 2MA9B 4YTMB 5TSSA 4X57B 1R4MB 2KWDA 1FO4A 2PVOD 2ZPNA 2H88B 1TJEA 1YOVB 2EMTA 2KT7A 3QAQA 3MJWA 3EECA 4IM2A 4ARIA 3R66C 3DPDA 1VDVA 3ZXRA 1NYQA 1V1PB 2Q5WD 2DENB 2W54A 1J8CA 4ZOHC 3I9V1 1YX5B 3AU4A 1F0ZA 5C3JB 4W9KA 2WS3B 2BB6A 3CF6E 1NYRA 3ZGZA 2K8BA 3FILB 3HK0A 4W9HA 4DHJD 2KDEB 1UD7A 4WJPA 1FRRA 1DYQA 1S1QB 4PT5A 4ZRIA 2WGSA 1RYJA 4HRSA 1UF0A 2NBUA 1Z5SB 3VRBB 3W5UB 1DOIA 3X23A 2L83A 1KF6B 3PREA 3SEBA 2DZMA 4ZRPA 2D3GA 4WJOA 2C60A 1T0SC 3DOWA 2LJIA 1GOZA 3ALBA 3BYTB 1PGAA 2LGXA 3OAWA 3ZRCA 4JPSA 3V62A 4GDLB 1FXAA 4RGNA 4A55A 4NJ7A 3RULA 3VHTC 5JZEB 4ZRQA 1SEBD 1TT5B 2MRPA 4GGQA 1QOGA 4NPNA 4US8A 2B76B 4IDIA 3M63B 5G5HA 3A9JB 1MPEA 2KNBA 5CTRC 2KWUB 1C1YB 2PW9A 2Z0DB 2WXQA 2QILA 2B3AA 2J0KA 1RWSA 3GB1A 4W9DA 3AE1B 5HFYA 3AH7A 3ZNGC 2WXFA 1WI0A 3PPAA 4FHKA 5EDSA 4FULA 3ZO5B 4PYZA 1KLUD 4MGYE 2IBIB 1WXVA 1PQSA 1QT9A 1R4NI 2HTME 2KN4A 3NJTA 5CHFA 1Q0WB 3WCQA 1CZPA 1P7FA 1AN8A 2KVZA 3BYYB 3AI5A 4BKSA 1MHHE 1LGRA 1V97A 2MSED 2VH2A 3N32A 1GG3A 1E7PB 4ASWC 2PJHA 1TKYA 4JL9A 5E6NA 2D2QA 2WXGA 3T8MA 2O6VD 3RMKC 4EE2A 5BO4B 1RLFA 4ICVA 3PRMB 4MGKE 3N9YC 4L2YA 3RCZA 2CJNA 1D4BA 1ZOYB 3MJ5A 2Y5PA 1IP9A 4AJYB 1C3TA 1FNUA 4G3XB 3L0WB 2G9HD 5C1ZA 4NJCA 2JUOA 2BVCA 4M02A 1V49A 1FPYA 2SAKA 1UWMA 1ENFA 3PRPB 5C2TB 2N1VA 4NAWB 1V5OA 4JE3B 5TR5A 4FLHA 3W5VB 3LJ3A 4TMAB 4W9JA 3PZ7A 5HKHA 2LVOA 3AE7B 4ICUA 5EE9A 1EWCA 3QX1A 2XBBC 4A90A
chains in the Genus database with same CATH topology
5CHVC 5DCNA 2LASA 4NNJB 4I6LB 5DPWA 1UBQA 3N30A 1WY8A 4M0WB 4LJPB 4MGIE 1MG8A 1V9JA 2J0JA 3ZNID 3L54A 4ZRKA 3OLMD 4N9F4 1WJ4A 4RM9A 1WIAA 2FIFA 3W1SA 4PS3A 1A5RA 2D07B 1S3SG 1P1AA 2Y5BB 2DZKA 3ML9A 4DHJB 2BF8B 1TTNA 1XQQA 4WWOA 2DYBA 2FAZA 5GMVA 3ZUNA 2DYMA 1WX8A 4B6WA 4XX5A 3APDA 1RAXA 5DPTA 3RZFA 1LM8B 4GU2A 3R7QA 1E5WA 1SIFA 2VRRB 3K9OB 2MBQA 3GOEA 3V61A 4TQ0A 1WYWB 1EF1A 3KW5B 3ZNZB 1IYFA 4WQOB 5D94A 3UF8A 2KK8A 3VH4B 3NHEB 2N1WA 3I3TB 1L7YA 3A9KA 4GMVA 3TMPB 2N9XA 2ASQA 1LXDA 4IWQA 3D32A 1M94A 2ZEQA 1V5TA 2KJ6A 3A1QB 4G11A 3A4SC 4CO7A 1K8RB 1XD3B 5DPSA 3S2AA 3DBRI 1WH3A 4GN1A 2KMAA 2KTFA 4FHJA 5FR6A 4NJ6A 1G6JA 1IPGA 4B95A 1Q5WB 4NAWA 4KDIC 4M8MA 2ZNVC 3RZWC 2JXXA 2KQSA 3PV1A 2CHXA 3VQIA 4YL8A 1WR1A 2CKHB 2KO3A 2LGYA 3B08A 3AULA 3VUXA 4BBNF 4NY0A 3PLUA 4CYEA 2FCSA 1WRDB 2CHWA 3AU5A 1UZXB 4HPLB 5J17A 4WJQA 2GBRA 5AEKB 3SU8X 3ZTCA 4DHZE 1GNUA 2KDBA 2WX1A 4ZYNA 4EKUA 3VAWA 3VTUA 2MX2A 2WDTB 3PHWB 4HWIB 3DBSA 4HVBA 3HM6X 4JGHB 4M8NA 4W9LA 4EEWA 1E90A 2CR5A 3UIPB 2IZVB 3BINA 3PGEA 3OJ4B 4LCDE 4EZLA 3Q3FA 2V3SA 1WR6E 1QZEA 2D11A 1EO6A 2M17A 4II2B 5JH5C 3L17A 1V6EA 4TUUA 3PRZA 4W9EA 1UELA 2YVCA 5JHBA 3CSTA 4JLCA 2D10A 4K1RB 3DBHI 1SGHA 1J0GA 3QJZA 4F1SA 3A9JA 3ZIMA 1WE6A 3ENEA 3QARA 1KJTA 2WX0A 3LDZE 2MWSB 4KSLC 3T9LA 2ZJDA 4FADA 4FJYA 2CU1A 2BGFA 4PS7A 1YD8U 3KYCD 3L13A 1H8CA 1UH6A 2N4FA 2BYEA 2L7RA 3K9PB 1X1MA 4G0NB 2I1JA 3A1QA 2FIDA 4AUQC 2AL6A 2K6QA 4TKNA 2MBEA 2BWES 2KWCA 2XBBC 3ZDTA 1I42A 5C23A 2KLGA 2LXCA 2XK5B 2HD5B 4IUMB 1HE8A 4JQWC 4W9CA 2KTRB 1JRUA 4AWJA 3QQ8B 4IWPA 2XEWA 1TBEA 2PPHA 2KJRA 1RFAA 5L95C 1OEYA 5J18A 1NDDA 3NS8A 2IO0B 3L08A 5KHQA 3QA8A 1WM2A 3WANA 3KH0A 1SE9A 3NZSA 1KM7A 1WXAA 1WJUA 2REXA 4LDTB 4ANWA 3NOBA 3DVGX 4CHKA 4P7IA 5G55A 4FJVB 1P3QU 4HPMB 2KKCA 4DBGA 4URKA 4OVVA 3V6CB 1ISNA 2K1FA 2L76A 2IO3B 4GB9A 2PEAA 4RM8A 4DWFA 2LD9A 3DQVA 2C5LC 2NBVB 4ZDVA 2HTHA 3M62B 2KX3A 4B9KA 3KUZA 1V86A 2G4DB 3H6NA 2DYOA 3PVLA 3ZRFA 5LXIB 1GC7A 4IC7B 3WIMA 3ZTDA 2JPHA 5AZGA 3SHQA 2GBNA 4BFRA 3QCAA 5E6OA 3UQBA 3ECIA 5CX3A 1D3ZA 3HM3A 2V1YA 3ML8A 2L3ZA 4E74A 2LUEA 3VFKA 2ZZPB 3JYUA 2LWPA 2RGFA 3QIJA 2KX0A 2LVPA 2N7DA 3H7PB 4BOSC 3ZNHB 2KFJA 3MTNB 1ZKHA 2KDFB 2MBOA 2YLMA 3N3KB 4W9GA 1WE7A 4EUTA 4GIVA 1WGDA 4A3OA 2GBMA 5L83A 2K25A 3IHPC 2LVQA 3ZLZA 2L0FA 2ZCCA 1WX7A 2KWVB 2NCNA 4HXDA 5IAAC 3WA0A 4FA6A 1V80A 2ZCBA 3M3JA 1NI2A 3U30A 3TCAA 1WJNA 2XK5A 1WF9A 3JW0X 4MELA 2KTRA 3SDLC 3JSVB 5G2NA 3DVNV 2W9NA 1OTRB 4AP4C 2A5UA 4DHZB 4IW0A 1J19A 3IVFA 4IG7B 2NS5A 3Q3JA 3QWZB 1WFYA 4TV3A 4E71A 3PT2B 5E6PA 1YJ1A 2NVUI 3PZDA 4I6PA 4IM0A 3UINB 3DBLI 5CHWA 5LLIA 2MBHA 2NPTB 2UWQA 3NY5A 2K8CA 3VDZA 2MBBB 2ZVOA 2DZJA 2BKFA 4MM3A 1TZ1A 2FCQA 3H9DA 5D2MB 1L2NA 2LGDA 2Z0EB 3CMMB 3C0RB 1WXSA 1E8WA 4ANUA 2RD0A 3PSEB 4KIKB 3U8ZA 2CS4A 2ZVNA 1OQYA 2L05A 4KZ0A 3WALA 2FUHB 2K6DB 3QHTA 5AZFA 2GBKA 3APCA 4MSQB 4EZKA 3TIXA 5IA7A 3W1YA 5J2RA 2EKEC 2BYFA 2J0MA 2QHOA 2KQ7A 2KXJA 2KN5A 4OVUA 4NQLB 2N7EA 4HK2A 4MEMA 1H4RA 3UGBB 2HJ8A 3H7SA 3VUWA 2M1MA 3H7PA 3DCGA 1WGRA 3L16A 2KJHB 2MQJA 4F7ZA 4MJSB 2MLBA 2MA9B 4HDOA 4X57B 1KLVA 3L10B 1P9DU 1GC6A 2KLCA 3VVWB 2ZPNA 1T0YA 2JVCA 2N9PC 2EMTA 4KZCA 2MCNB 3KUDB 2PE6B 2V4LA 2WWZA 1ZW7A 2LZ6A 3QAQA 4GOCA 4MGZE 3MJWA 3EECA 2KZRA 4IM2A 2AEHA 4FJZA 1UGMA 3R66C 2KHWB 3DPDA 4BOZB 1NBFC 3ZVVA 1UBIA 3MHSD 4II3B 4TQ1A 4PYUA 2RPQA 1WZ3A 3PLVA 2K8HA 2DZIA 2DENB 1J8CA 2M8SA 4GSWA 3TJPA 1YX5B 4K7WA 3AU4A 4XZ4A 3B1LX 1LFDA 4W9KA 3AXCA 3CF6E 2NBWB 3KVFB 2IY0B 3X0WA 1CMXB 4MH0E 1ZGUB 2K8BA 2IO2B 3ZW3A 2O6VB 1YIWA 1WGGA 2AWTA 3HK0A 4KIKA 4W9HA 3WAOA 4RMAA 4DHJD 2KDEB 1E7UA 1UD7A 1LQBA 3RUIB 1WZ0A 1WGHA 4WJPA 2LI5A 1S1QB 5D7GA 1EF5A 2N9EB 4ZRIA 3WAPA 2BWFA 1E8YA 2NR2A 2JY6A 3VH3B 4GDKB 2NBUA 4BBNC 1V81A 1Z5SB 3RT3B 3QC8B 4EOYA 3R3MA 4MJSA 2JRIB 2L0TA 2LRUA 1E8ZA 2C7NB 3X23A 3HIZA 3PS6A 3PREA 4W9FA 3EHVA 3R7RA 2DZMA 2L8JA 2D3GA 2DAFA 4WJOA 2C60A 3RD2A 4HCNB 3DOWA 2RR9A 4W9IA 2Z59B 2AYOB 3ALBA 2M4NA 4HJKA 3HHMA 4AOFA 2LGXA 3OAWA 4E3CA 3ZRCA 2OOBB 3APFA 3UIOB 3IFWB 3RYTA 3V62A 4DXAB 4GDLB 4IM3A 3VXWA 2BKRB 1I35A 1Y8RC 3W1SC 2UYZB 4MDKE 1V2YA 4HDQA 4NJ7A 1E7VA 3RULA 3VHTC 4AJWA 5JZEB 1GUAB 2GBJA 4HLEA 2LJ5A 2G45B 1RRBA 2MRPA 3VTVA 4GGQA 2GMIC 3EC8A 5D6JB 1U4AA 3PTFC 4NPNA 3O65B 4K7SA 2DHZA 3TL5A 3P2BA 5JHAA 2IY1B 5DPRA 3M63B 2JZZA 1KOTA 3A9JB 1AARA 3UQAA 2KANA 2DX5B 4EFOA 2KNBA 3B0AA 5CTRC 1WXMA 3WAMA 3SD5A 2KWUB 2OJRA 2FNJB 4KVGB 2O6VA 1C1YB 2JRHA 3A33B 4KV2A 2Z0DB 2EMSA 2C7HA 4J6IA 2B3AA 2J0KA 2BYVE 1F9JA 4W9DA 2KFKB 2MW5A 3ZNGC 1WI0A 4GXBA 2KD0A 3PPAA 2G3QB 4FHKA 5EDSA 2WYQA 1WJ6A 4FULA 2JZ3B 4KSKC 1GJZA 1E8XA 1P98A 2KMCA 4GDKA 4G50A 3ZO5B 4PYZA 3IG3A 4WAAA 4MGYE 5LXHA 2IBIB 2MP2B 2IO1B 1WMHB 1WXVA 3EFUA 1VD2A 1PQSA 1R4NI 3DVNU 3M95A 1Z2MA 5CHFA 2BPSA 1Q0WB 1OEYJ 4BVUC 4XC2A 3PHXB 4LJOB 2O2VB 3AI5A 1XT9B 4DDGD 1VCBA 3ONSA 1R4MI 2J7QB 4FBJB 3DDCB 3ZKJC 2LRWA 4I6NB 2KC2A 2C9WB 4BKSA 2MSED 4FN2A 4ANVA 3N32A 4K81A 4WJNA 3BY4B 4GDLA 1GG3A 2FCNA 1WM3A 1YX6B 3VTWA 4BKTA 3DVGY 4LDTD 4K7UA 4ASWC 2PJHA 3JSVA 4JL9A 5E6NA 2D2QA 4DDID 3T8MA 1OGWA 2O6VD 5BO4B 2IYDB 3VUYA 2AL3A 1RLFA 4ICVA 4A20A 4DK5A 1P0RA 3PRMB 4MGKE 3V60A 5AZHA 3RCZA 1FXTB 1WX9A 4WWNA 4JIOU 2ZPYA 4IWOA 2KVRA 2NPTA 2JF5A 3V6EB 3TBLD 2DAJA 3QK0A 1WGYA 1Q1OA 4KDLB 1IP9A 2JWZA 4EZJA 4AJYB 1C3TA 2KDIA 2L00B 2PE9A 3OJ3A 4F8CB 1YQBA 4G3XB 2CHZA 2KFKA 3L0WB 3A9KB 5C1ZA 3H1UA 2JUOA 4WWPA 3NZUA 2RSUA 1V49A 3IBEA 2LXAA 2C7MB 3PRPB 2G4SA 4PS8A 4BKGA 2MP2A 3KYDD 2N1VA 3CSFA 1WMHA 4BKSD 2M0XA 2FCMA 3GZNI 3A4RA 3JVZX 2I1KA 4NAWB 4ZRJA 4A3PA 1V5OA 4MSMB 3U7DA 2HE7A 5TR5A 2ZNVB 1TGZB 2GOWA 4FLHA 4ANXA 2O2VA 2R2OA 1BT0A 1EUVB 3LJ3A 2JT4B 4W9JA 2KC1A 2KOXA 2K39A 4NQKE 2R2QA 5KHOA 5HKHA 2LVOA 4ICUA 3ZDMC 4HCPB 3KUCB 3QX1A 2A4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHV C;  5DCN A;  2LAS A;  4NNJ B;  4I6L B;  5DPW A;  1UBQ A;  3N30 A;  1WY8 A;  4M0W B;  4LJP B;  4MGI E;  1MG8 A;  1V9J A;  2J0J A;  3ZNI D;  3L54 A;  4ZRK A;  3OLM D;  4N9F 4;  1WJ4 A;  4RM9 A;  1WIA A;  2FIF A;  3W1S A;  4PS3 A;  1A5R A;  2D07 B;  1S3S G;  1P1A A;  2Y5B B;  2DZK A;  3ML9 A;  4DHJ B;  2BF8 B;  1TTN A;  1XQQ A;  4WWO A;  2DYB A;  2FAZ A;  5GMV A;  3ZUN A;  2DYM A;  1WX8 A;  4B6W A;  4XX5 A;  3APD A;  1RAX A;  5DPT A;  3RZF A;  1LM8 B;  4GU2 A;  3R7Q A;  1E5W A;  1SIF A;  2VRR B;  3K9O B;  2MBQ A;  3GOE A;  3V61 A;  4TQ0 A;  1WYW B;  1EF1 A;  3KW5 B;  3ZNZ B;  1IYF A;  4WQO B;  5D94 A;  3UF8 A;  2KK8 A;  3VH4 B;  3NHE B;  2N1W A;  3I3T B;  1L7Y A;  3A9K A;  4GMV A;  3TMP B;  2N9X A;  2ASQ A;  1LXD A;  4IWQ A;  3D32 A;  1M94 A;  2ZEQ A;  1V5T A;  2KJ6 A;  3A1Q B;  4G11 A;  3A4S C;  4CO7 A;  1K8R B;  1XD3 B;  5DPS A;  3S2A A;  3DBR I;  1WH3 A;  4GN1 A;  2KMA A;  2KTF A;  4FHJ A;  5FR6 A;  4NJ6 A;  1G6J A;  1IPG A;  4B95 A;  1Q5W B;  4NAW A;  4KDI C;  4M8M A;  2ZNV C;  3RZW C;  2JXX A;  2KQS A;  3PV1 A;  2CHX A;  3VQI A;  4YL8 A;  1WR1 A;  2CKH B;  2KO3 A;  2LGY A;  3B08 A;  3AUL A;  3VUX A;  4BBN F;  4NY0 A;  3PLU A;  4CYE A;  2FCS A;  1WRD B;  2CHW A;  3AU5 A;  1UZX B;  4HPL B;  5J17 A;  4WJQ A;  2GBR A;  5AEK B;  3SU8 X;  3ZTC A;  4DHZ E;  1GNU A;  2KDB A;  2WX1 A;  4ZYN A;  4EKU A;  3VAW A;  3VTU A;  2MX2 A;  2WDT B;  3PHW B;  4HWI B;  3DBS A;  4HVB A;  3HM6 X;  4JGH B;  4M8N A;  4W9L A;  4EEW A;  1E90 A;  2CR5 A;  3UIP B;  2IZV B;  3BIN A;  3PGE A;  3OJ4 B;  4LCD E;  4EZL A;  3Q3F A;  2V3S A;  1WR6 E;  1QZE A;  2D11 A;  1EO6 A;  2M17 A;  4II2 B;  5JH5 C;  3L17 A;  1V6E A;  4TUU A;  3PRZ A;  4W9E A;  1UEL A;  2YVC A;  5JHB A;  3CST A;  4JLC A;  2D10 A;  4K1R B;  3DBH I;  1SGH A;  1J0G A;  3QJZ A;  4F1S A;  3A9J A;  3ZIM A;  1WE6 A;  3ENE A;  3QAR A;  1KJT A;  2WX0 A;  3LDZ E;  2MWS B;  4KSL C;  3T9L A;  2ZJD A;  4FAD A;  4FJY A;  2CU1 A;  2BGF A;  4PS7 A;  1YD8 U;  3KYC D;  3L13 A;  1H8C A;  1UH6 A;  2N4F A;  2BYE A;  2L7R A;  3K9P B;  1X1M A;  4G0N B;  2I1J A;  3A1Q A;  2FID A;  4AUQ C;  2AL6 A;  2K6Q A;  4TKN A;  2MBE A;  2BWE S;  2KWC A;  2XBB C;  3ZDT A;  1I42 A;  5C23 A;  2KLG A;  2LXC A;  2XK5 B;  2HD5 B;  4IUM B;  1HE8 A;  4JQW C;  4W9C A;  2KTR B;  1JRU A;  4AWJ A;  3QQ8 B;  4IWP A;  2XEW A;  1TBE A;  2PPH A;  2KJR A;  1RFA A;  5L95 C;  1OEY A;  5J18 A;  1NDD A;  3NS8 A;  2IO0 B;  3L08 A;  5KHQ A;  3QA8 A;  1WM2 A;  3WAN A;  3KH0 A;  1SE9 A;  3NZS A;  1KM7 A;  1WXA A;  1WJU A;  2REX A;  4LDT B;  4ANW A;  3NOB A;  3DVG X;  4CHK A;  4P7I A;  5G55 A;  4FJV B;  1P3Q U;  4HPM B;  2KKC A;  4DBG A;  4URK A;  4OVV A;  3V6C B;  1ISN A;  2K1F A;  2L76 A;  2IO3 B;  4GB9 A;  2PEA A;  4RM8 A;  4DWF A;  2LD9 A;  3DQV A;  2C5L C;  2NBV B;  4ZDV A;  2HTH A;  3M62 B;  2KX3 A;  4B9K A;  3KUZ A;  1V86 A;  2G4D B;  3H6N A;  2DYO A;  3PVL A;  3ZRF A;  5LXI B;  1GC7 A;  4IC7 B;  3WIM A;  3ZTD A;  2JPH A;  5AZG A;  3SHQ A;  2GBN A;  4BFR A;  3QCA A;  5E6O A;  3UQB A;  3ECI A;  5CX3 A;  1D3Z A;  3HM3 A;  2V1Y A;  3ML8 A;  2L3Z A;  4E74 A;  2LUE A;  3VFK A;  2ZZP B;  3JYU A;  2LWP A;  2RGF A;  3QIJ A;  2KX0 A;  2LVP A;  2N7D A;  3H7P B;  4BOS C;  3ZNH B;  2KFJ A;  3MTN B;  1ZKH A;  2KDF B;  2MBO A;  2YLM A;  3N3K B;  4W9G A;  1WE7 A;  4EUT A;  4GIV A;  1WGD A;  4A3O A;  2GBM A;  5L83 A;  2K25 A;  3IHP C;  2LVQ A;  3ZLZ A;  2L0F A;  2ZCC A;  1WX7 A;  2KWV B;  2NCN A;  4HXD A;  5IAA C;  3WA0 A;  4FA6 A;  1V80 A;  2ZCB A;  3M3J A;  1NI2 A;  3U30 A;  3TCA A;  1WJN A;  2XK5 A;  1WF9 A;  3JW0 X;  4MEL A;  2KTR A;  3SDL C;  3JSV B;  5G2N A;  3DVN V;  2W9N A;  1OTR B;  4AP4 C;  2A5U A;  4DHZ B;  4IW0 A;  1J19 A;  3IVF A;  4IG7 B;  2NS5 A;  3Q3J A;  3QWZ B;  1WFY A;  4TV3 A;  4E71 A;  3PT2 B;  5E6P A;  1YJ1 A;  2NVU I;  3PZD A;  4I6P A;  4IM0 A;  3UIN B;  3DBL I;  5CHW A;  5LLI A;  2MBH A;  2NPT B;  2UWQ A;  3NY5 A;  2K8C A;  3VDZ A;  2MBB B;  2ZVO A;  2DZJ A;  2BKF A;  4MM3 A;  1TZ1 A;  2FCQ A;  3H9D A;  5D2M B;  1L2N A;  2LGD A;  2Z0E B;  3CMM B;  3C0R B;  1WXS A;  1E8W A;  4ANU A;  2RD0 A;  3PSE B;  4KIK B;  3U8Z A;  2CS4 A;  2ZVN A;  1OQY A;  2L05 A;  4KZ0 A;  3WAL A;  2FUH B;  2K6D B;  3QHT A;  5AZF A;  2GBK A;  3APC A;  4MSQ B;  4EZK A;  3TIX A;  5IA7 A;  3W1Y A;  5J2R A;  2EKE C;  2BYF A;  2J0M A;  2QHO A;  2KQ7 A;  2KXJ A;  2KN5 A;  4OVU A;  4NQL B;  2N7E A;  4HK2 A;  4MEM A;  1H4R A;  3UGB B;  2HJ8 A;  3H7S A;  3VUW A;  2M1M A;  3H7P A;  3DCG A;  1WGR A;  3L16 A;  2KJH B;  2MQJ A;  4F7Z A;  4MJS B;  2MLB A;  2MA9 B;  4HDO A;  4X57 B;  1KLV A;  3L10 B;  1P9D U;  1GC6 A;  2KLC A;  3VVW B;  2ZPN A;  1T0Y A;  2JVC A;  2N9P C;  2EMT A;  4KZC A;  2MCN B;  3KUD B;  2PE6 B;  2V4L A;  2WWZ A;  1ZW7 A;  2LZ6 A;  3QAQ A;  4GOC A;  4MGZ E;  3MJW A;  3EEC A;  2KZR A;  4IM2 A;  2AEH A;  4FJZ A;  1UGM A;  3R66 C;  2KHW B;  3DPD A;  4BOZ B;  1NBF C;  3ZVV A;  1UBI A;  3MHS D;  4II3 B;  4TQ1 A;  4PYU A;  2RPQ A;  1WZ3 A;  3PLV A;  2K8H A;  2DZI A;  2DEN B;  1J8C A;  2M8S A;  4GSW A;  3TJP A;  1YX5 B;  4K7W A;  3AU4 A;  4XZ4 A;  3B1L X;  1LFD A;  4W9K A;  3AXC A;  3CF6 E;  2NBW B;  3KVF B;  2IY0 B;  3X0W A;  1CMX B;  4MH0 E;  1ZGU B;  2K8B A;  2IO2 B;  3ZW3 A;  2O6V B;  1YIW A;  1WGG A;  2AWT A;  3HK0 A;  4KIK A;  4W9H A;  3WAO A;  4RMA A;  4DHJ D;  2KDE B;  1E7U A;  1UD7 A;  1LQB A;  3RUI B;  1WZ0 A;  1WGH A;  4WJP A;  2LI5 A;  1S1Q B;  5D7G A;  1EF5 A;  2N9E B;  4ZRI A;  3WAP A;  2BWF A;  1E8Y A;  2NR2 A;  2JY6 A;  3VH3 B;  4GDK B;  2NBU A;  4BBN C;  1V81 A;  1Z5S B;  3RT3 B;  3QC8 B;  4EOY A;  3R3M A;  4MJS A;  2JRI B;  2L0T A;  2LRU A;  1E8Z A;  2C7N B;  3X23 A;  3HIZ A;  3PS6 A;  3PRE A;  4W9F A;  3EHV A;  3R7R A;  2DZM A;  2L8J A;  2D3G A;  2DAF A;  4WJO A;  2C60 A;  3RD2 A;  4HCN B;  3DOW A;  2RR9 A;  4W9I A;  2Z59 B;  2AYO B;  3ALB A;  2M4N A;  4HJK A;  3HHM A;  4AOF A;  2LGX A;  3OAW A;  4E3C A;  3ZRC A;  2OOB B;  3APF A;  3UIO B;  3IFW B;  3RYT A;  3V62 A;  4DXA B;  4GDL B;  4IM3 A;  3VXW A;  2BKR B;  1I35 A;  1Y8R C;  3W1S C;  2UYZ B;  4MDK E;  1V2Y A;  4HDQ A;  4NJ7 A;  1E7V A;  3RUL A;  3VHT C;  4AJW A;  5JZE B;  1GUA B;  2GBJ A;  4HLE A;  2LJ5 A;  2G45 B;  1RRB A;  2MRP A;  3VTV A;  4GGQ A;  2GMI C;  3EC8 A;  5D6J B;  1U4A A;  3PTF C;  4NPN A;  3O65 B;  4K7S A;  2DHZ A;  3TL5 A;  3P2B A;  5JHA A;  2IY1 B;  5DPR A;  3M63 B;  2JZZ A;  1KOT A;  3A9J B;  1AAR A;  3UQA A;  2KAN A;  2DX5 B;  4EFO A;  2KNB A;  3B0A A;  5CTR C;  1WXM A;  3WAM A;  3SD5 A;  2KWU B;  2OJR A;  2FNJ B;  4KVG B;  2O6V A;  1C1Y B;  2JRH A;  3A33 B;  4KV2 A;  2Z0D B;  2EMS A;  2C7H A;  4J6I A;  2B3A A;  2J0K A;  2BYV E;  1F9J A;  4W9D A;  2KFK B;  2MW5 A;  3ZNG C;  1WI0 A;  4GXB A;  2KD0 A;  3PPA A;  2G3Q B;  4FHK A;  5EDS A;  2WYQ A;  1WJ6 A;  4FUL A;  2JZ3 B;  4KSK C;  1GJZ A;  1E8X A;  1P98 A;  2KMC A;  4GDK A;  4G50 A;  3ZO5 B;  4PYZ A;  3IG3 A;  4WAA A;  4MGY E;  5LXH A;  2IBI B;  2MP2 B;  2IO1 B;  1WMH B;  1WXV A;  3EFU A;  1VD2 A;  1PQS A;  1R4N I;  3DVN U;  3M95 A;  1Z2M A;  5CHF A;  2BPS A;  1Q0W B;  1OEY J;  4BVU C;  4XC2 A;  3PHX B;  4LJO B;  2O2V B;  3AI5 A;  1XT9 B;  4DDG D;  1VCB A;  3ONS A;  1R4M I;  2J7Q B;  4FBJ B;  3DDC B;  3ZKJ C;  2LRW A;  4I6N B;  2KC2 A;  2C9W B;  4BKS A;  2MSE D;  4FN2 A;  4ANV A;  3N32 A;  4K81 A;  4WJN A;  3BY4 B;  4GDL A;  1GG3 A;  2FCN A;  1WM3 A;  1YX6 B;  3VTW A;  4BKT A;  3DVG Y;  4LDT D;  4K7U A;  4ASW C;  2PJH A;  3JSV A;  4JL9 A;  5E6N A;  2D2Q A;  4DDI D;  3T8M A;  1OGW A;  2O6V D;  5BO4 B;  2IYD B;  3VUY A;  2AL3 A;  1RLF A;  4ICV A;  4A20 A;  4DK5 A;  1P0R A;  3PRM B;  4MGK E;  3V60 A;  5AZH A;  3RCZ A;  1FXT B;  1WX9 A;  4WWN A;  4JIO U;  2ZPY A;  4IWO A;  2KVR A;  2NPT A;  2JF5 A;  3V6E B;  3TBL D;  2DAJ A;  3QK0 A;  1WGY A;  1Q1O A;  4KDL B;  1IP9 A;  2JWZ A;  4EZJ A;  4AJY B;  1C3T A;  2KDI A;  2L00 B;  2PE9 A;  3OJ3 A;  4F8C B;  1YQB A;  4G3X B;  2CHZ A;  2KFK A;  3L0W B;  3A9K B;  5C1Z A;  3H1U A;  2JUO A;  4WWP A;  3NZU A;  2RSU A;  1V49 A;  3IBE A;  2LXA A;  2C7M B;  3PRP B;  2G4S A;  4PS8 A;  4BKG A;  2MP2 A;  3KYD D;  2N1V A;  3CSF A;  1WMH A;  4BKS D;  2M0X A;  2FCM A;  3GZN I;  3A4R A;  3JVZ X;  2I1K A;  4NAW B;  4ZRJ A;  4A3P A;  1V5O A;  4MSM B;  3U7D A;  2HE7 A;  5TR5 A;  2ZNV B;  1TGZ B;  2GOW A;  4FLH A;  4ANX A;  2O2V A;  2R2O A;  1BT0 A;  1EUV B;  3LJ3 A;  2JT4 B;  4W9J A;  2KC1 A;  2KOX A;  2K39 A;  4NQK E;  2R2Q A;  5KHO A;  5HKH A;  2LVO A;  4ICU A;  3ZDM C;  4HCP B;  3KUC B;  3QX1 A;  2A4Z A; 
#chains in the Genus database with same CATH topology
 5CHV C;  5DCN A;  4I6L B;  1WY8 A;  4LK0 M;  4MGI E;  1FM0 D;  3H8H A;  1XF5 L;  3FKY A;  3ZNI D;  1VZ8 A;  1UGJ A;  4ZRK A;  3R2I A;  2FIF A;  3U7Z A;  3N1X C;  1SJE D;  1TTN A;  3ZUN A;  5GMV A;  2DYM A;  1WX8 A;  1RAX A;  1ZUD 2;  1SIF A;  3GOE A;  3V61 A;  4OW0 A;  3KW5 B;  3ZNZ B;  1IUE A;  3UF8 A;  5BYR A;  3NZ3 A;  2X8X X;  4GMV A;  3TMP B;  2E3T A;  2ASQ A;  4G11 A;  3A4S C;  1K8R B;  1XD3 B;  1D5X C;  1WH3 A;  2KTF A;  5FR6 A;  2WDR B;  2VH1 A;  4B95 A;  4KDI C;  1GPX A;  2WXR A;  3DBL B;  2JXX A;  2R61 A;  2CHX A;  3B08 A;  3P63 A;  3AUL A;  2NTT A;  4BBN F;  4NY0 A;  3PLU A;  4CYE A;  1GAQ B;  4OHJ A;  1WRD B;  3AU5 A;  1UZX B;  5J17 A;  2GBR A;  3ZTC A;  3VR9 B;  3ZJV A;  1I4G A;  3HM6 X;  2WXJ A;  4M8N A;  4KKJ A;  4RGM A;  2JQR B;  2ONQ A;  5JH5 C;  4O1N A;  2YVC A;  2J52 A;  4K1R B;  1J0G A;  2YEP F;  5IKC M;  3Q8B A;  4FJY A;  2BGF A;  4PS7 A;  1YD8 U;  3L13 A;  1UH6 A;  2FID A;  2AL6 A;  2K6Q A;  3P42 A;  2BWE S;  3ZDT A;  2BS3 B;  5C23 A;  2HD5 B;  3UI3 A;  1HE8 A;  4W9C A;  4AWJ A;  2JYT A;  3NVY A;  4IWP A;  1F1H A;  3NS8 A;  2BB5 A;  2IO0 B;  5KHQ A;  4LDT B;  4ANW A;  3SFE B;  4P7I A;  3DWM A;  4DBG A;  4YSY B;  1J7B A;  4K3C A;  4OZC A;  1B1Z A;  2Y3A A;  4RM8 A;  1MVK A;  3DQV A;  3M62 B;  5BYQ A;  1JWM D;  3ZRF A;  3HM3 A;  2V1Y A;  1FD6 A;  2LUE A;  2V3P A;  2ZZP B;  2LWP A;  2RGF A;  3QIJ A;  3VR8 B;  1FEH A;  4BOS C;  5G5G A;  1FFU A;  1ZKH A;  2MBO A;  3RNC C;  2PMV A;  2ZW1 A;  1WE7 A;  2JXT A;  2GBM A;  2K25 A;  4HXD A;  5IAA C;  2WXH A;  3RPF C;  1NI3 A;  3M3J A;  1SE2 A;  1NI2 A;  3TCA A;  1WJN A;  5G2N A;  4KKI A;  1C4C A;  2W9N A;  1SIJ A;  2PLP A;  1AWD A;  4AP4 C;  1JW9 D;  3BZD B;  1J19 A;  3IVF A;  2NS5 A;  3QWZ B;  5AUI A;  2M56 B;  4E71 A;  4KGR A;  4OZA A;  5E6P A;  4ZHP A;  3PZD A;  5IN7 A;  2BKF A;  4L1B A;  1P7E A;  1TZ1 A;  1N5X A;  4P16 A;  1L2N A;  2LGD A;  2Z0E B;  1E9M A;  2RD0 A;  3CWI A;  2LGI A;  4KIK B;  2GB1 A;  2K6D B;  3QHT A;  1JWA D;  2GBK A;  4MSQ B;  3GE3 C;  2EKE C;  2J0M A;  2KN5 A;  3UGB B;  1XEE A;  3VUW A;  2AQ2 B;  3L16 A;  2KJH B;  1KLV A;  1JRP A;  3BVZ A;  2WU2 B;  3VVW B;  4RFB A;  2WP9 B;  1D5M C;  3KUD B;  4BAX A;  1ZW7 A;  4GOC A;  1ZE3 D;  2WQY B;  1NBF C;  1JWU D;  3ZVV A;  1UBI A;  3MHS D;  4PYU A;  3PLV A;  3FAH A;  4S17 A;  4XZ4 A;  2JZP A;  3B1L X;  1LFD A;  3AXC A;  1V8C A;  2NBW B;  2IY0 B;  3X0W A;  1CMX B;  4MH0 E;  2WHI A;  1K53 A;  2IO2 B;  4D2K A;  1YIW A;  1WGG A;  3WAO A;  3RNG C;  4RMA A;  1N62 A;  1WZ0 A;  1WGH A;  1CJE A;  2LI5 A;  1T3Q A;  1NEN B;  2BWF A;  4JWS C;  2JY6 A;  2K5P A;  4BBN C;  3RT3 B;  4MJS A;  2LRU A;  2C7N B;  1YN4 A;  3W9C B;  3EHV A;  1K52 A;  1TYG B;  3RD2 A;  2DAF A;  1HZ6 A;  4HCN B;  4W9I A;  1TS3 A;  2Z59 B;  2M4N A;  2EEL A;  3HHM A;  3RNF C;  4DXA B;  3VXW A;  2BKR B;  3O13 A;  1I35 A;  2JSV X;  3W1S C;  4MDK E;  1D5Z C;  1E7V A;  4ZHO A;  4OVZ A;  2GBJ A;  2LJ5 A;  2G45 B;  1RRB A;  3VTV A;  4DXF A;  3EC8 A;  3O65 B;  1VRA B;  3URY A;  5JHA A;  2INN E;  2IY1 B;  2BS2 B;  2IGH A;  3PZ8 A;  2DX5 B;  4EFO A;  3SR6 A;  3OWE B;  2OJR A;  1E6E B;  2O6V A;  1TS2 A;  2EMS A;  2MH7 A;  2BYV E;  1F9J A;  4RGO S;  2KFK B;  2LGS A;  2N9L A;  4GXB A;  4S0R A;  2G3Q B;  2WYQ A;  4KSK C;  2JZ3 B;  1P98 A;  2KMC A;  1JML A;  4GDK A;  2MJ3 A;  3Q2A C;  4WAA A;  1ET9 A;  2MP2 B;  1L4Z B;  2IO1 B;  5D3D A;  2MEK A;  1NVI D;  2V9H A;  2O2V B;  5BYS A;  3HVZ A;  2BQQ A;  1VCB A;  3ONS A;  3I63 C;  1R4M I;  2J7Q B;  4C00 A;  4FBJ B;  3ZKJ C;  2KC2 A;  4K3B A;  3AEA B;  4JX1 C;  1QLB B;  4K81 A;  4WJN A;  3BY4 B;  1WM3 A;  1QQR A;  2FBW B;  1YX6 B;  3NUH B;  2L1A A;  3JSV A;  1QOB A;  2IYD B;  3VUY A;  2ON8 A;  3P4Q B;  3DBH B;  2JU6 X;  4A20 A;  2QEJ C;  1P0R A;  1F2R I;  3AV8 A;  1FXT B;  1WX9 A;  2JF5 A;  2DAJ A;  3QK0 A;  1JAL A;  1WGY A;  1EU4 A;  2LUM A;  2KDI A;  1XLN A;  3OJ3 A;  4F8C B;  2CHZ A;  4WWP A;  1C4P A;  1HTQ A;  4BKG A;  4QAY A;  1WMH A;  5EE3 A;  2PKO A;  3JVZ X;  2I1K A;  3U7D A;  2HE7 A;  4XDD A;  2R2O A;  1PUT A;  2KC1 A;  1QKZ A;  2R2Q A;  4XYC A;  2N7J A;  3ZDM C;  1I4R A;  3KUC B;  3AEC B;  4NNJ B;  3AEG B;  1UBQ A;  4M0W B;  1T0R C;  1J7A A;  2ZW0 A;  3NRZ A;  3L54 A;  5FR3 A;  3RNB C;  3OLM D;  4N9F 4;  4RM9 A;  3W1S A;  4B0M A;  1A5R A;  2BTE A;  1S3S G;  2DZK A;  4DHJ B;  4MAC A;  3V3X A;  1QOF A;  3B2G A;  3APD A;  4WWM A;  1LM8 B;  3R7Q A;  2VRR B;  3K9O B;  3BVM A;  3VH4 B;  1M4V A;  3I3T B;  3A9K A;  2V4I B;  1Y56 A;  4AQ7 A;  4IWQ A;  1M94 A;  2KJ6 A;  3A1Q B;  2WXM A;  4CO7 A;  4FXC A;  5DPS A;  3S2A A;  2WXI A;  2OED A;  4GN1 A;  1G6J A;  1IPG A;  2W3R A;  1DGJ A;  4HRO A;  2ZNV C;  4M8M A;  3BK1 A;  3AED B;  1FIQ A;  2CKH B;  2KO3 A;  2ICI A;  5FKA C;  4TSS A;  3AE6 B;  3AN1 A;  1Q10 A;  5BMI A;  5AEK B;  3SU8 X;  2IGD A;  4MH8 A;  4ZYN A;  2WDT B;  3DBS A;  3MHZ A;  3DHI C;  3ZJU A;  4EEW A;  1E90 A;  1I4H A;  2CR5 A;  3UIP B;  2IZV B;  3BIN A;  4EZL A;  2WDQ B;  2V3S A;  1QZE A;  2D11 A;  3AE9 B;  4YT0 B;  4II2 B;  4RNA A;  3PRZ A;  2D10 A;  1N61 A;  3QJZ A;  3ZIM A;  1HA5 A;  3ENE A;  1JRO A;  3QAR A;  4ARC A;  3LDZ E;  2E6X A;  3T9L A;  1I4P A;  4FAD A;  3Q8F A;  1JQ4 A;  1AYF A;  3KYC D;  4WAF A;  3NS1 A;  2WU5 B;  1H8C A;  2L7R A;  2X38 A;  4G0N B;  2I1J A;  2WXP A;  3Q8C A;  2MBE A;  1I42 A;  2KLG A;  2LXC A;  2KTR B;  2WNM A;  2PPH A;  1RFA A;  2HDE A;  1OEY A;  2MJE A;  3Q69 A;  5HG2 A;  4YSZ B;  2REX A;  4CHK A;  4FJV B;  1P3Q U;  2KKC A;  4J3O D;  3V6C B;  1ISN A;  3Q6B A;  4MM3 B;  2L76 A;  4GB9 A;  3MP9 A;  2PEA A;  2NBV B;  2HTH A;  3J9C A;  3KUZ A;  1T6B X;  1V86 A;  2G4D B;  1QIL A;  2DYO A;  1XLO A;  5LXI B;  3WIM A;  1TS5 A;  2JPH A;  5AZG A;  3SHQ A;  5E6O A;  3KWV A;  3ML8 A;  3EGR A;  1YJJ A;  4XWT A;  2LVP A;  2N7D A;  3H7P B;  4DXG A;  5D3I B;  1TY2 A;  3NVW A;  3MTN B;  2KDF B;  3N3K B;  5L83 A;  3IHP C;  2LVQ A;  5MPO A;  3WA0 A;  4C4V A;  1IGC A;  2ZCB A;  2WXO A;  4MEL A;  2XK5 A;  1F2R C;  3SDL C;  3JSV B;  4XWW A;  3N1Z C;  4IW0 A;  1A70 A;  1XCQ L;  1EWY C;  4B0E A;  3NG0 A;  1WFY A;  1XO3 A;  4XE0 A;  2NVU I;  4M01 A;  3BII D;  3DBL I;  5LLI A;  4YTP B;  2BW2 A;  1E0Z A;  2MBH A;  2ZVO A;  2W55 A;  2FCQ A;  2FE8 A;  1E8W A;  3E9S A;  2L05 A;  3WAL A;  2FUH B;  2VZK B;  4EZK A;  3Q3N C;  3W1Y A;  5IA7 A;  5J2R A;  1ZPS A;  2KXJ A;  2N7E A;  4MEM A;  3H7S A;  1C78 A;  1ACC A;  2M1M A;  2MQJ A;  2TSS A;  2INP E;  4HDO A;  2V3N A;  1AW7 A;  2QMT A;  5EE0 A;  1TS4 A;  1P9D U;  2JVC A;  1SJH D;  2V4L A;  2LZ6 A;  2IPK D;  4MGZ E;  2KZR A;  4FJZ A;  4JWU C;  3U4E G;  2KHW B;  4BOZ B;  2WDV B;  1UWX A;  2RPQ A;  2DZI A;  3NVV A;  2OJW A;  1CQV A;  1YNT E;  2AX5 A;  2N0S B;  1VZ6 A;  2BYT A;  3EA6 A;  3KVF B;  4M00 A;  2D3C A;  1ZGU B;  2QDF A;  1B9R A;  3RNE C;  1LQB A;  2PIA A;  1EF5 A;  2N9E B;  5AUK A;  4N6E B;  3GZN B;  2L32 A;  2K3U A;  2NR2 A;  1YN3 A;  3KWL A;  3Q8E A;  3P4P B;  4EOY A;  3R3M A;  5IO9 A;  2L0T A;  3HIZ A;  3PS6 A;  4W9F A;  2K0P A;  2KYW A;  2L8J A;  1E10 A;  5H8Y E;  2RR9 A;  1GB1 A;  2QC8 A;  3RNA C;  4HJK A;  1XCT L;  5IP4 D;  3APF A;  3RYT A;  3LXF A;  4IM3 A;  1Y8R C;  2KQ4 X;  2UYZ B;  1V1P A;  1FCC C;  1GUA B;  2GMI C;  3HUI A;  5D6J B;  3PTF C;  1N60 A;  4K7S A;  2DHZ A;  5DPR A;  2G1E A;  1KOT A;  1AAR A;  3UQA A;  2MJD A;  2KAN A;  3AEB B;  1MHX A;  4KVG B;  3MC0 B;  5H92 C;  4KV2 A;  4J6I A;  4HKQ A;  3DBR B;  1FRD A;  2MW5 A;  3T3O A;  1FNV A;  2KD0 A;  1GJZ A;  3N20 C;  3TUO A;  3IG3 A;  2JYE A;  5LXH A;  1SE3 A;  3EFU A;  3M95 A;  4L23 A;  4KX6 B;  2BBC A;  4BVU C;  3PHX B;  4LJO B;  2AQ3 B;  4ZYS A;  4DDG D;  1YQ4 B;  4FN2 A;  4GDL A;  1I4X A;  2LHD A;  3VTW A;  1WYG A;  2GRI A;  3GS2 A;  4YXD B;  1OFF A;  5HHD G;  5AZH A;  1L0V B;  1TIF A;  4JIO U;  3AE4 B;  2KVR A;  2NPT A;  3V6E B;  3TBL D;  4LNN A;  4YTN B;  1Q1O A;  2WXK A;  2L00 B;  1YQB A;  4DQO C;  4REZ A;  3H1U A;  2DNF A;  2KDM A;  3NZU A;  2LXA A;  2RDB C;  2C7M B;  4PS8 A;  3CSF A;  3N1Y C;  4MT5 A;  2M0X A;  2FCM A;  1IBX A;  2PTL A;  1MG4 A;  3A4R A;  4A3P A;  4MSM B;  2ZNV B;  2GOW A;  4ANX A;  1PGB A;  1BT0 A;  1EUV B;  1VZ7 A;  2K39 A;  4NQK E;  1PYW D;  1KFY B;  4HCP B;  2H89 B;  2LAS A;  3N30 A;  2MHJ A;  2RDG A;  4LJP B;  1MG8 A;  2LFI A;  1F52 A;  1V9J A;  1F77 A;  3P4S B;  4P1B C;  4US9 A;  3DHG C;  2SEB D;  1SBB B;  1WJ4 A;  1WIA A;  2W82 A;  3ZXV A;  4PS3 A;  2UU7 A;  2M19 A;  1P1A A;  1JWB D;  1JCK B;  1MJD A;  3OG5 A;  4WWO A;  2FAZ A;  2M0A A;  4XX5 A;  5I4D A;  3RZF A;  2I2Y A;  2XN9 C;  4GU2 A;  3DHH C;  2MBQ A;  4TQ0 A;  2DLB A;  4HPP A;  5T8I A;  2RPV A;  2KK8 A;  3NVZ A;  4H2A A;  2N9X A;  4Q2J A;  4ITK A;  1I7H A;  2ZEQ A;  3KQ4 A;  2KMA A;  4FHJ A;  4NAW A;  4C80 A;  3RZW C;  2KQS A;  3PV1 A;  3VQI A;  2FCS A;  2QJL A;  4IOI E;  4HPL B;  2HJ1 A;  1YN5 A;  3LB8 C;  4RF0 A;  1EU3 A;  2INC C;  2J53 A;  1GNU A;  2WX1 A;  2GLS A;  1RFK A;  3VAW A;  3VTU A;  4JGH B;  3PGE A;  3OJ4 B;  2Y5C A;  3Q3F A;  1WR6 E;  1EO6 A;  5E6J A;  4TUU A;  1UEL A;  2K22 A;  5JHB A;  2NTS A;  3DBH I;  1SGH A;  4F1S A;  1WE6 A;  1KJT A;  2MWS B;  4KSL C;  2ZJD A;  1N5W A;  1YJI A;  1KRH A;  1HEZ E;  2BYE A;  1X1M A;  1XXG A;  1STE A;  2KWC A;  4IUM B;  3IAS 1;  1JRU A;  1FCL A;  1WWT A;  3QQ8 B;  1TBE A;  2CJO A;  4KGS A;  2KJR A;  5J18 A;  1NDD A;  3QA8 A;  4WQM A;  3KH0 A;  1SE9 A;  3IT6 B;  3NZS A;  3DVG X;  1V1O A;  5G55 A;  4HPM B;  4OVV A;  2LD9 A;  2C5L C;  1WSP A;  3ETR A;  4IC7 B;  3ZTD A;  4BFR A;  3QCA A;  3ECI A;  5CX3 A;  1WXQ A;  2QIE B;  1OQQ A;  2LHE A;  3FC4 A;  1HZ5 A;  4RF1 A;  3ZNH B;  5LNK 1;  3HVD A;  3AE2 B;  2YLM A;  4W9G A;  4LTU A;  3TEX A;  4EUT A;  4GIV A;  1WGD A;  4PK1 A;  3IT4 B;  2L0F A;  1WX7 A;  2NCN A;  3Q8A A;  3RI7 C;  3U30 A;  3JW0 X;  1WF9 A;  1N6Z A;  3DVN V;  2A5U A;  4USA A;  1D6E C;  3Q3J A;  2FUG 1;  4TV3 A;  2LMC A;  3PT2 B;  1YJ1 A;  4I6P A;  3UIN B;  3I57 A;  2NPT B;  2UWQ A;  3NY5 A;  2K8C A;  3VDZ A;  2MBB B;  2ACZ B;  2DZJ A;  2D3A A;  3C0R B;  4WIP A;  1WXS A;  1L6U A;  3U8Z A;  2CS4 A;  2OHF A;  2ZVN A;  4C7Z A;  4KZ0 A;  4ACF A;  1KH0 A;  5AZF A;  4HKZ E;  3TIX A;  1KLG D;  2BYF A;  2KQ7 A;  4OVU A;  4NQL B;  4GLS C;  4HK2 A;  1R4N B;  2HJ8 A;  1N63 A;  1IBX B;  1WGR A;  3MC9 A;  4MJS B;  4YSX B;  1T5X D;  1K50 A;  3L10 B;  4A6Q A;  1T0Q C;  1GC6 A;  2KLC A;  5HI1 A;  3I5J C;  1T0Y A;  2N9P C;  3KLS X;  4KZC A;  2V0G A;  2MCN B;  3PO0 A;  2PE6 B;  1MFW A;  2WWZ A;  2D5G A;  2AEH A;  1ET6 A;  1UGM A;  4II3 B;  4TQ1 A;  1WZ3 A;  2NMQ A;  2K8H A;  3BVG A;  2EKI A;  2M8S A;  4GSW A;  3Q3O C;  3TJP A;  3AEE B;  4K7W A;  1TY0 A;  1NEK B;  1WRI A;  3P4R B;  3TEZ A;  3AE3 B;  3ZW3 A;  2O6V B;  2AWT A;  4KIK A;  1E7U A;  3RUI B;  5D7G A;  3WAP A;  1R7S A;  1E8Y A;  3VH3 B;  4GDK B;  1V81 A;  3QC8 B;  1L0X B;  1MI0 A;  2JRI B;  2N9K A;  1E8Z A;  1UUP A;  4N59 A;  3R7R A;  4N58 A;  2AYO B;  1ZP0 B;  1BUI C;  2KMM A;  2WXN A;  4AOF A;  4E3C A;  2OOB B;  3UIO B;  3IFW B;  4YWG G;  3R8B A;  1HQR D;  3B2F A;  1V2Y A;  4HDQ A;  4AJW A;  4HLE A;  1LO5 D;  3U52 E;  1U4A A;  3TL5 A;  2I38 A;  3EFC A;  3P2B A;  2VZK D;  2JZZ A;  3IXS A;  3B0A A;  3WAM A;  1WXM A;  3SD5 A;  2KAJ A;  2FNJ B;  3V05 A;  3C19 A;  3W2D A;  3A33 B;  2JRH A;  1C77 A;  2C7H A;  2IDY A;  3ZJT A;  3E56 A;  1DOY A;  2JWU A;  1WJ6 A;  1E8X A;  4G50 A;  4RH6 A;  1J7C A;  1WMH B;  1VD2 A;  1EM7 A;  3DVN U;  1Z2M A;  2BPS A;  5FK9 C;  1OEY J;  4XC2 A;  3P1M A;  3DWG C;  1RM6 C;  1XT9 B;  4C56 C;  2IND C;  3DDC B;  3ABV B;  4I6N B;  2LRW A;  3C8Y A;  2C9W B;  4ANV A;  2FCN A;  4BKT A;  3DVG Y;  4LDT D;  4K7U A;  4DDI D;  1C79 A;  1OGW A;  4XGA B;  2AL3 A;  3ZQ4 A;  4DK5 A;  4KGT A;  3SFD B;  3V60 A;  4A8X C;  3GE8 C;  1K51 A;  2YEP B;  4WWN A;  2ZPY A;  4IWO A;  2J42 A;  2WXL A;  4KDL B;  2JWZ A;  4EZJ A;  2PE9 A;  3Q3M C;  3TEY A;  4BZA A;  3MFG A;  2KFK A;  3TEW A;  3A9K B;  3IAM 1;  1VJK A;  2RSU A;  3IBE A;  3T3N A;  1ZXI A;  1OQR A;  2G4S A;  2MP2 A;  3KYD D;  2W3S A;  4BKS D;  3Q14 C;  3GZN I;  4ZRJ A;  3ZYY X;  1YQ3 B;  1TGZ B;  1HXY D;  1UNS A;  2O2V A;  2BS4 B;  2JT4 B;  2KOX A;  2DWQ A;  5KHO A;  1SE4 A;  2K9X A;  2QCZ A;  2A4Z A;  4LNO A;  4HEA 1;  5DPW A;  2JX5 A;  3AE8 B;  1FNW A;  2J0J A;  3R2T A;  5JXV A;  2GI9 A;  5BMG A;  2D3B A;  2D07 B;  2Y5B B;  3ML9 A;  2RDH A;  2BF8 B;  3BWU D;  1XLP A;  1XQQ A;  3L4P A;  3RN9 C;  2DYB A;  4B6W A;  5DPT A;  1E5W A;  1GB4 A;  1IYF A;  1WYW B;  1EF1 A;  4LNF A;  4WQO B;  2PVG C;  5D94 A;  3FIL A;  3NHE B;  2AQ1 B;  2N1W A;  4C7Y A;  1C4A A;  1L7Y A;  4UDU C;  1LXD A;  3D32 A;  1V5T A;  4LNI A;  1SSN A;  1CK1 A;  1ZXH A;  3DBR I;  4NJ6 A;  1ZDX A;  1L5P A;  1C9F A;  1Q5W B;  1QF6 A;  2L52 A;  1TZO A;  4LLG M;  2KAC A;  1WR1 A;  4YL8 A;  2LGY A;  3VUX A;  1IGD A;  3VRA B;  2CHW A;  1SXT A;  4WJQ A;  1ZDV A;  1YMH E;  4DHZ E;  1TKG A;  3LYY A;  2KDB A;  4M0W A;  4EKU A;  2MX2 A;  3PHW B;  4HWI B;  4HVB A;  5GXG B;  2WLB A;  4W9L A;  2IGG A;  4LCD E;  2QSD A;  1C76 A;  2M17 A;  3L17 A;  1V6E A;  4W9E A;  1QOA A;  2XNA C;  3CST A;  4JLC A;  4RCO A;  3AMZ A;  3A9J A;  2WX0 A;  2BT6 A;  3TSS A;  3U2S C;  2CU1 A;  1PDX A;  4P6V F;  2N4F A;  2Z8L A;  3K9P B;  4C4V B;  3A1Q A;  4AUQ C;  4TKN A;  2LEK A;  1DOX A;  4JQW C;  2XK5 B;  2XEW A;  4CQN A;  5L95 C;  1FMA D;  3L08 A;  3AEF B;  4LNK A;  1WM2 A;  3WAN A;  1TKE A;  1KM7 A;  1WXA A;  1WJU A;  4RGT A;  3NOB A;  1FXI A;  4URK A;  1JWS D;  2K1F A;  2IO3 B;  1ESF A;  3AM9 A;  4DWF A;  4ZDV A;  2KX3 A;  4B9K A;  3H6N A;  3PVL A;  1L0Y B;  4R3D A;  1GC7 A;  4WH4 A;  4AS1 A;  1VR9 A;  2GBN A;  3UQB A;  1BXT A;  3AB5 A;  1D3Z A;  1PGX A;  5EE1 A;  2L3Z A;  4E74 A;  2RMM A;  3VFK A;  3JYU A;  1XLQ A;  3MC8 A;  2KX0 A;  2KFJ A;  1BML C;  3RFZ B;  1I4Q A;  3GP7 A;  3B9J A;  2J4X A;  3HRD D;  4A3O A;  3ZLZ A;  4OZB A;  2ZCC A;  2KWV B;  2IJ0 A;  4FA6 A;  1V80 A;  1L4D B;  2DBY A;  2KTR A;  1FFV A;  1OTR B;  4DHZ B;  3BK2 A;  4IG7 B;  3CIR B;  1SF0 A;  4IKG A;  4XDC A;  3AE5 B;  2CU3 A;  4IM0 A;  1L6V A;  1ROE A;  5CHW A;  1HTO A;  1WGK A;  4A9A A;  4MM3 A;  3H9D A;  1VLB A;  5D2M B;  1KTK A;  3CMM B;  4NZL B;  4ANU A;  3PSE B;  4HJG E;  1OQY A;  1PFD A;  5BMH A;  3APC A;  4P1C C;  2QHO A;  5IOI A;  3EUB 2;  4NAM A;  1H4R A;  3H7P A;  3DCG A;  1SB3 C;  4F7Z A;  4WUR A;  2MLB A;  2MA9 B;  4YTM B;  5TSS A;  4X57 B;  1R4M B;  2KWD A;  1FO4 A;  2PVO D;  2ZPN A;  2H88 B;  1TJE A;  1YOV B;  2EMT A;  2KT7 A;  3QAQ A;  3MJW A;  3EEC A;  4IM2 A;  4ARI A;  3R66 C;  3DPD A;  1VDV A;  3ZXR A;  1NYQ A;  1V1P B;  2Q5W D;  2DEN B;  2W54 A;  1J8C A;  4ZOH C;  3I9V 1;  1YX5 B;  3AU4 A;  1F0Z A;  5C3J B;  4W9K A;  2WS3 B;  2BB6 A;  3CF6 E;  1NYR A;  3ZGZ A;  2K8B A;  3FIL B;  3HK0 A;  4W9H A;  4DHJ D;  2KDE B;  1UD7 A;  4WJP A;  1FRR A;  1DYQ A;  1S1Q B;  4PT5 A;  4ZRI A;  2WGS A;  1RYJ A;  4HRS A;  1UF0 A;  2NBU A;  1Z5S B;  3VRB B;  3W5U B;  1DOI A;  3X23 A;  2L83 A;  1KF6 B;  3PRE A;  3SEB A;  2DZM A;  4ZRP A;  2D3G A;  4WJO A;  2C60 A;  1T0S C;  3DOW A;  2LJI A;  1GOZ A;  3ALB A;  3BYT B;  1PGA A;  2LGX A;  3OAW A;  3ZRC A;  4JPS A;  3V62 A;  4GDL B;  1FXA A;  4RGN A;  4A55 A;  4NJ7 A;  3RUL A;  3VHT C;  5JZE B;  4ZRQ A;  1SEB D;  1TT5 B;  2MRP A;  4GGQ A;  1QOG A;  4NPN A;  4US8 A;  2B76 B;  4IDI A;  3M63 B;  5G5H A;  3A9J B;  1MPE A;  2KNB A;  5CTR C;  2KWU B;  1C1Y B;  2PW9 A;  2Z0D B;  2WXQ A;  2QIL A;  2B3A A;  2J0K A;  1RWS A;  3GB1 A;  4W9D A;  3AE1 B;  5HFY A;  3AH7 A;  3ZNG C;  2WXF A;  1WI0 A;  3PPA A;  4FHK A;  5EDS A;  4FUL A;  3ZO5 B;  4PYZ A;  1KLU D;  4MGY E;  2IBI B;  1WXV A;  1PQS A;  1QT9 A;  1R4N I;  2HTM E;  2KN4 A;  3NJT A;  5CHF A;  1Q0W B;  3WCQ A;  1CZP A;  1P7F A;  1AN8 A;  2KVZ A;  3BYY B;  3AI5 A;  4BKS A;  1MHH E;  1LGR A;  1V97 A;  2MSE D;  2VH2 A;  3N32 A;  1GG3 A;  1E7P B;  4ASW C;  2PJH A;  1TKY A;  4JL9 A;  5E6N A;  2D2Q A;  2WXG A;  3T8M A;  2O6V D;  3RMK C;  4EE2 A;  5BO4 B;  1RLF A;  4ICV A;  3PRM B;  4MGK E;  3N9Y C;  4L2Y A;  3RCZ A;  2CJN A;  1D4B A;  1ZOY B;  3MJ5 A;  2Y5P A;  1IP9 A;  4AJY B;  1C3T A;  1FNU A;  4G3X B;  3L0W B;  2G9H D;  5C1Z A;  4NJC A;  2JUO A;  2BVC A;  4M02 A;  1V49 A;  1FPY A;  2SAK A;  1UWM A;  1ENF A;  3PRP B;  5C2T B;  2N1V A;  4NAW B;  1V5O A;  4JE3 B;  5TR5 A;  4FLH A;  3W5V B;  3LJ3 A;  4TMA B;  4W9J A;  3PZ7 A;  5HKH A;  2LVO A;  3AE7 B;  4ICU A;  5EE9 A;  1EWC A;  3QX1 A;  2XBB C;  4A90 A; 
#chains in the Genus database with same CATH homology
 5CHV C;  5DCN A;  2LAS A;  4NNJ B;  4I6L B;  5DPW A;  1UBQ A;  3N30 A;  1WY8 A;  4M0W B;  4LJP B;  4MGI E;  1MG8 A;  1V9J A;  2J0J A;  3ZNI D;  3L54 A;  4ZRK A;  3OLM D;  4N9F 4;  1WJ4 A;  4RM9 A;  1WIA A;  2FIF A;  3W1S A;  4PS3 A;  1A5R A;  2D07 B;  1S3S G;  1P1A A;  2Y5B B;  2DZK A;  3ML9 A;  4DHJ B;  2BF8 B;  1TTN A;  1XQQ A;  4WWO A;  2DYB A;  2FAZ A;  5GMV A;  3ZUN A;  2DYM A;  1WX8 A;  4B6W A;  4XX5 A;  3APD A;  1RAX A;  5DPT A;  3RZF A;  1LM8 B;  4GU2 A;  3R7Q A;  1E5W A;  1SIF A;  2VRR B;  3K9O B;  2MBQ A;  3GOE A;  3V61 A;  4TQ0 A;  1WYW B;  1EF1 A;  3KW5 B;  3ZNZ B;  1IYF A;  4WQO B;  5D94 A;  3UF8 A;  2KK8 A;  3VH4 B;  3NHE B;  2N1W A;  3I3T B;  1L7Y A;  3A9K A;  4GMV A;  3TMP B;  2N9X A;  2ASQ A;  1LXD A;  4IWQ A;  3D32 A;  1M94 A;  2ZEQ A;  1V5T A;  2KJ6 A;  3A1Q B;  4G11 A;  3A4S C;  4CO7 A;  1K8R B;  1XD3 B;  5DPS A;  3S2A A;  3DBR I;  1WH3 A;  4GN1 A;  2KMA A;  2KTF A;  4FHJ A;  5FR6 A;  4NJ6 A;  1G6J A;  1IPG A;  4B95 A;  1Q5W B;  4NAW A;  4KDI C;  4M8M A;  2ZNV C;  3RZW C;  2JXX A;  2KQS A;  3PV1 A;  2CHX A;  3VQI A;  4YL8 A;  1WR1 A;  2CKH B;  2KO3 A;  2LGY A;  3B08 A;  3AUL A;  3VUX A;  4BBN F;  4NY0 A;  3PLU A;  4CYE A;  2FCS A;  1WRD B;  2CHW A;  3AU5 A;  1UZX B;  4HPL B;  5J17 A;  4WJQ A;  2GBR A;  5AEK B;  3SU8 X;  3ZTC A;  4DHZ E;  1GNU A;  2KDB A;  2WX1 A;  4ZYN A;  4EKU A;  3VAW A;  3VTU A;  2MX2 A;  2WDT B;  3PHW B;  4HWI B;  3DBS A;  4HVB A;  3HM6 X;  4JGH B;  4M8N A;  4W9L A;  4EEW A;  1E90 A;  2CR5 A;  3UIP B;  2IZV B;  3BIN A;  3PGE A;  3OJ4 B;  4LCD E;  4EZL A;  3Q3F A;  2V3S A;  1WR6 E;  1QZE A;  2D11 A;  1EO6 A;  2M17 A;  4II2 B;  5JH5 C;  3L17 A;  1V6E A;  4TUU A;  3PRZ A;  4W9E A;  1UEL A;  2YVC A;  5JHB A;  3CST A;  4JLC A;  2D10 A;  4K1R B;  3DBH I;  1SGH A;  1J0G A;  3QJZ A;  4F1S A;  3A9J A;  3ZIM A;  1WE6 A;  3ENE A;  3QAR A;  1KJT A;  2WX0 A;  3LDZ E;  2MWS B;  4KSL C;  3T9L A;  2ZJD A;  4FAD A;  4FJY A;  2CU1 A;  2BGF A;  4PS7 A;  1YD8 U;  3KYC D;  3L13 A;  1H8C A;  1UH6 A;  2N4F A;  2BYE A;  2L7R A;  3K9P B;  1X1M A;  4G0N B;  2I1J A;  3A1Q A;  2FID A;  4AUQ C;  2AL6 A;  2K6Q A;  4TKN A;  2MBE A;  2BWE S;  2KWC A;  2XBB C;  3ZDT A;  1I42 A;  5C23 A;  2KLG A;  2LXC A;  2XK5 B;  2HD5 B;  4IUM B;  1HE8 A;  4JQW C;  4W9C A;  2KTR B;  1JRU A;  4AWJ A;  3QQ8 B;  4IWP A;  2XEW A;  1TBE A;  2PPH A;  2KJR A;  1RFA A;  5L95 C;  1OEY A;  5J18 A;  1NDD A;  3NS8 A;  2IO0 B;  3L08 A;  5KHQ A;  3QA8 A;  1WM2 A;  3WAN A;  3KH0 A;  1SE9 A;  3NZS A;  1KM7 A;  1WXA A;  1WJU A;  2REX A;  4LDT B;  4ANW A;  3NOB A;  3DVG X;  4CHK A;  4P7I A;  5G55 A;  4FJV B;  1P3Q U;  4HPM B;  2KKC A;  4DBG A;  4URK A;  4OVV A;  3V6C B;  1ISN A;  2K1F A;  2L76 A;  2IO3 B;  4GB9 A;  2PEA A;  4RM8 A;  4DWF A;  2LD9 A;  3DQV A;  2C5L C;  2NBV B;  4ZDV A;  2HTH A;  3M62 B;  2KX3 A;  4B9K A;  3KUZ A;  1V86 A;  2G4D B;  3H6N A;  2DYO A;  3PVL A;  3ZRF A;  5LXI B;  1GC7 A;  4IC7 B;  3WIM A;  3ZTD A;  2JPH A;  5AZG A;  3SHQ A;  2GBN A;  4BFR A;  3QCA A;  5E6O A;  3UQB A;  3ECI A;  5CX3 A;  1D3Z A;  3HM3 A;  2V1Y A;  3ML8 A;  2L3Z A;  4E74 A;  2LUE A;  3VFK A;  2ZZP B;  3JYU A;  2LWP A;  2RGF A;  3QIJ A;  2KX0 A;  2LVP A;  2N7D A;  3H7P B;  4BOS C;  3ZNH B;  2KFJ A;  3MTN B;  1ZKH A;  2KDF B;  2MBO A;  2YLM A;  3N3K B;  4W9G A;  1WE7 A;  4EUT A;  4GIV A;  1WGD A;  4A3O A;  2GBM A;  5L83 A;  2K25 A;  3IHP C;  2LVQ A;  3ZLZ A;  2L0F A;  2ZCC A;  1WX7 A;  2KWV B;  2NCN A;  4HXD A;  5IAA C;  3WA0 A;  4FA6 A;  1V80 A;  2ZCB A;  3M3J A;  1NI2 A;  3U30 A;  3TCA A;  1WJN A;  2XK5 A;  1WF9 A;  3JW0 X;  4MEL A;  2KTR A;  3SDL C;  3JSV B;  5G2N A;  3DVN V;  2W9N A;  1OTR B;  4AP4 C;  2A5U A;  4DHZ B;  4IW0 A;  1J19 A;  3IVF A;  4IG7 B;  2NS5 A;  3Q3J A;  3QWZ B;  1WFY A;  4TV3 A;  4E71 A;  3PT2 B;  5E6P A;  1YJ1 A;  2NVU I;  3PZD A;  4I6P A;  4IM0 A;  3UIN B;  3DBL I;  5CHW A;  5LLI A;  2MBH A;  2NPT B;  2UWQ A;  3NY5 A;  2K8C A;  3VDZ A;  2MBB B;  2ZVO A;  2DZJ A;  2BKF A;  4MM3 A;  1TZ1 A;  2FCQ A;  3H9D A;  5D2M B;  1L2N A;  2LGD A;  2Z0E B;  3CMM B;  3C0R B;  1WXS A;  1E8W A;  4ANU A;  2RD0 A;  3PSE B;  4KIK B;  3U8Z A;  2CS4 A;  2ZVN A;  1OQY A;  2L05 A;  4KZ0 A;  3WAL A;  2FUH B;  2K6D B;  3QHT A;  5AZF A;  2GBK A;  3APC A;  4MSQ B;  4EZK A;  3TIX A;  5IA7 A;  3W1Y A;  5J2R A;  2EKE C;  2BYF A;  2J0M A;  2QHO A;  2KQ7 A;  2KXJ A;  2KN5 A;  4OVU A;  4NQL B;  2N7E A;  4HK2 A;  4MEM A;  1H4R A;  3UGB B;  2HJ8 A;  3H7S A;  3VUW A;  2M1M A;  3H7P A;  3DCG A;  1WGR A;  3L16 A;  2KJH B;  2MQJ A;  4F7Z A;  4MJS B;  2MLB A;  2MA9 B;  4HDO A;  4X57 B;  1KLV A;  3L10 B;  1P9D U;  1GC6 A;  2KLC A;  3VVW B;  2ZPN A;  1T0Y A;  2JVC A;  2N9P C;  2EMT A;  4KZC A;  2MCN B;  3KUD B;  2PE6 B;  2V4L A;  2WWZ A;  1ZW7 A;  2LZ6 A;  3QAQ A;  4GOC A;  4MGZ E;  3MJW A;  3EEC A;  2KZR A;  4IM2 A;  2AEH A;  4FJZ A;  1UGM A;  3R66 C;  2KHW B;  3DPD A;  4BOZ B;  1NBF C;  3ZVV A;  1UBI A;  3MHS D;  4II3 B;  4TQ1 A;  4PYU A;  2RPQ A;  1WZ3 A;  3PLV A;  2K8H A;  2DZI A;  2DEN B;  1J8C A;  2M8S A;  4GSW A;  3TJP A;  1YX5 B;  4K7W A;  3AU4 A;  4XZ4 A;  3B1L X;  1LFD A;  4W9K A;  3AXC A;  3CF6 E;  2NBW B;  3KVF B;  2IY0 B;  3X0W A;  1CMX B;  4MH0 E;  1ZGU B;  2K8B A;  2IO2 B;  3ZW3 A;  2O6V B;  1YIW A;  1WGG A;  2AWT A;  3HK0 A;  4KIK A;  4W9H A;  3WAO A;  4RMA A;  4DHJ D;  2KDE B;  1E7U A;  1UD7 A;  1LQB A;  3RUI B;  1WZ0 A;  1WGH A;  4WJP A;  2LI5 A;  1S1Q B;  5D7G A;  1EF5 A;  2N9E B;  4ZRI A;  3WAP A;  2BWF A;  1E8Y A;  2NR2 A;  2JY6 A;  3VH3 B;  4GDK B;  2NBU A;  4BBN C;  1V81 A;  1Z5S B;  3RT3 B;  3QC8 B;  4EOY A;  3R3M A;  4MJS A;  2JRI B;  2L0T A;  2LRU A;  1E8Z A;  2C7N B;  3X23 A;  3HIZ A;  3PS6 A;  3PRE A;  4W9F A;  3EHV A;  3R7R A;  2DZM A;  2L8J A;  2D3G A;  2DAF A;  4WJO A;  2C60 A;  3RD2 A;  4HCN B;  3DOW A;  2RR9 A;  4W9I A;  2Z59 B;  2AYO B;  3ALB A;  2M4N A;  4HJK A;  3HHM A;  4AOF A;  2LGX A;  3OAW A;  4E3C A;  3ZRC A;  2OOB B;  3APF A;  3UIO B;  3IFW B;  3RYT A;  3V62 A;  4DXA B;  4GDL B;  4IM3 A;  3VXW A;  2BKR B;  1I35 A;  1Y8R C;  3W1S C;  2UYZ B;  4MDK E;  1V2Y A;  4HDQ A;  4NJ7 A;  1E7V A;  3RUL A;  3VHT C;  4AJW A;  5JZE B;  1GUA B;  2GBJ A;  4HLE A;  2LJ5 A;  2G45 B;  1RRB A;  2MRP A;  3VTV A;  4GGQ A;  2GMI C;  3EC8 A;  5D6J B;  1U4A A;  3PTF C;  4NPN A;  3O65 B;  4K7S A;  2DHZ A;  3TL5 A;  3P2B A;  5JHA A;  2IY1 B;  5DPR A;  3M63 B;  2JZZ A;  1KOT A;  3A9J B;  1AAR A;  3UQA A;  2KAN A;  2DX5 B;  4EFO A;  2KNB A;  3B0A A;  5CTR C;  1WXM A;  3WAM A;  3SD5 A;  2KWU B;  2OJR A;  2FNJ B;  4KVG B;  2O6V A;  1C1Y B;  2JRH A;  3A33 B;  4KV2 A;  2Z0D B;  2EMS A;  2C7H A;  4J6I A;  2B3A A;  2J0K A;  2BYV E;  1F9J A;  4W9D A;  2KFK B;  2MW5 A;  3ZNG C;  1WI0 A;  4GXB A;  2KD0 A;  3PPA A;  2G3Q B;  4FHK A;  5EDS A;  2WYQ A;  1WJ6 A;  4FUL A;  2JZ3 B;  4KSK C;  1GJZ A;  1E8X A;  1P98 A;  2KMC A;  4GDK A;  4G50 A;  3ZO5 B;  4PYZ A;  3IG3 A;  4WAA A;  4MGY E;  5LXH A;  2IBI B;  2MP2 B;  2IO1 B;  1WMH B;  1WXV A;  3EFU A;  1VD2 A;  1PQS A;  1R4N I;  3DVN U;  3M95 A;  1Z2M A;  5CHF A;  2BPS A;  1Q0W B;  1OEY J;  4BVU C;  4XC2 A;  3PHX B;  4LJO B;  2O2V B;  3AI5 A;  1XT9 B;  4DDG D;  1VCB A;  3ONS A;  1R4M I;  2J7Q B;  4FBJ B;  3DDC B;  3ZKJ C;  2LRW A;  4I6N B;  2KC2 A;  2C9W B;  4BKS A;  2MSE D;  4FN2 A;  4ANV A;  3N32 A;  4K81 A;  4WJN A;  3BY4 B;  4GDL A;  1GG3 A;  2FCN A;  1WM3 A;  1YX6 B;  3VTW A;  4BKT A;  3DVG Y;  4LDT D;  4K7U A;  4ASW C;  2PJH A;  3JSV A;  4JL9 A;  5E6N A;  2D2Q A;  4DDI D;  3T8M A;  1OGW A;  2O6V D;  5BO4 B;  2IYD B;  3VUY A;  2AL3 A;  1RLF A;  4ICV A;  4A20 A;  4DK5 A;  1P0R A;  3PRM B;  4MGK E;  3V60 A;  5AZH A;  3RCZ A;  1FXT B;  1WX9 A;  4WWN A;  4JIO U;  2ZPY A;  4IWO A;  2KVR A;  2NPT A;  2JF5 A;  3V6E B;  3TBL D;  2DAJ A;  3QK0 A;  1WGY A;  1Q1O A;  4KDL B;  1IP9 A;  2JWZ A;  4EZJ A;  4AJY B;  1C3T A;  2KDI A;  2L00 B;  2PE9 A;  3OJ3 A;  4F8C B;  1YQB A;  4G3X B;  2CHZ A;  2KFK A;  3L0W B;  3A9K B;  5C1Z A;  3H1U A;  2JUO A;  4WWP A;  3NZU A;  2RSU A;  1V49 A;  3IBE A;  2LXA A;  2C7M B;  3PRP B;  2G4S A;  4PS8 A;  4BKG A;  2MP2 A;  3KYD D;  2N1V A;  3CSF A;  1WMH A;  4BKS D;  2M0X A;  2FCM A;  3GZN I;  3A4R A;  3JVZ X;  2I1K A;  4NAW B;  4ZRJ A;  4A3P A;  1V5O A;  4MSM B;  3U7D A;  2HE7 A;  5TR5 A;  2ZNV B;  1TGZ B;  2GOW A;  4FLH A;  4ANX A;  2O2V A;  2R2O A;  1BT0 A;  1EUV B;  3LJ3 A;  2JT4 B;  4W9J A;  2KC1 A;  2KOX A;  2K39 A;  4NQK E;  2R2Q A;  5KHO A;  5HKH A;  2LVO A;  4ICU A;  3ZDM C;  4HCP B;  3KUC B;  3QX1 A;  2A4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...