1P0RA

Solution structure of ubl5 a human ubiquitin-like protein
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
73
structure length
73
Chain Sequence
MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords ubiquitin-like 5
publication title Structural analysis of UBL5, a novel ubiquitin-like modifier
pubmed doi rcsb
source organism Homo sapiens
total genus 9
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2003-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1p0rA00
2LWPA 4IWOA 3Q3FA 3PGEA 3V61A 2O6VB 4WWPA 3WAPA 2KN5A 1WGDA 3VFKA 3RZWC 3V6EB 3KH0A 3WANA 1WM2A 2FAZA 1WJ4A 2NBVB 4G11A 3QCAA 1P9DU 4IM0A 3HIZA 4W9IA 3U30A 4PYUA 5J18A 3D32A 2CHZA 5E6OA 4BFRA 2BPSA 2KVRA 4M8MA 3A9JA 4KVGB 4EZLA 3AXCA 3M63B 2G4SA 4PS3A 2JVCA 4E71A 1WX7A 3A9KA 4BBNC 4ANXA 5BO4B 2AEHA 3H1UA 2M4NA 2M17A 2B3AA 3H7PB 4GGQA 4NAWA 3UIOB 4KZCA 3L54A 3PSEB 2D3GA 4TQ0A 3DCGA 4KDLB 1OEYA 4LDTD 2LVPA 5HKHA 5CX3A 3CSTA 4EZJA 1Q0WB 4YL8A 2V4LA 4GU2A 2M8SA 4KV2A 4P7IA 5L95C 2BWFA 4KZ0A 2O6VA 4FHKA 4PYZA 3DOWA 2IO0B 3W1SC 1V49A 4DHJB 4IC7B 3R7QA 4WWNA 2GBKA 2MWSB 1NI2A 2L0TA 4HXDA 3VDZA 2UYZB 4BVUC 2GBJA 3WAMA 2KNBA 2KWCA 1OQYA 3B0AA 1OEYJ 2KHWB 4GB9A 1WH3A 4IWPA 4NQKE 5DPWA 1GUAB 2FCNA 4OVVA 2K25A 4HDOA 3SD5A 4AJWA 1NBFC 5J17A 1UELA 1KOTA 1E7UA 1GNUA 2MA9B 3LJ3A 5AZGA 4AJYB 1QZEA 1J8CA 3L0WB 2C7MB 3KVFB 2BKFA 1GJZA 5DPSA 2J0MA 1C1YB 1HE8A 3VUXA 5JZEB 1PQSA 4LJOB 3H7PA 1Z2MA 2C7NB 2EKEC 1TGZB 2L3ZA 3H9DA 4G3XB 3UGBB 4IM2A 2DHZA 2L0FA 3WALA 3NZUA 3HK0A 1WM3A 3VQIA 2K8HA 3PRZA 5E6NA 2NS5A 2K6DB 3NS8A 2OOBB 2KC1A 2DZMA 4FJZA 2D07B 1V81A 2PJHA 1ISNA 2KDBA 2LD9A 4MGZE 1F9JA 4TQ1A 3U8ZA 3IHPC 4G0NB 1XQQA 1YQBA 3OJ3A 3VHTC 5JHAA 3ZIMA 1VD2A 4KDIC 5DPRA 2LXCA 1IYFA 2LGXA 3DBLI 3MTNB 3L17A 2NR2A 4NNJB 3DBHI 1KLVA 1J19A 4AOFA 4M8NA 1LFDA 2KLCA 3IVFA 3KYCD 4HVBA 2LRWA 2RGFA 4AWJA 4KSLC 1NDDA 2FCMA 3ZNZB 2JUOA 4JIOU 2FCQA 2JF5A 2M1MA 2QHOA 3NZSA 5D94A 4GOCA 3ZNID 2LXAA 3UINB 5GMVA 5C1ZA 1WJUA 2KTRB 1WJNA 4LJPB 3ZNHB 4HK2A 4HWIB 4DDGD 4ANWA 2ZEQA 2MBHA 2FIDA 3QK0A 3WAOA 1S1QB 2JZ3B 4X57B 2LRUA 3SU8X 1WMHA 2KOXA 3DPDA 2ZNVC 2BF8B 3V60A 2CHXA 3LDZE 2NBUA 5LXIB 4IM3A 4GDLA 4GSWA 3TJPA 2ZVNA 3WA0A 2KX0A 2D10A 1E8XA 2PPHA 2XK5B 3UF8A 2N9PC 4GXBA 4RM8A 4W9HA 3AI5A 3ZKJC 3EFUA 3X0WA 4ANVA 1J0GA 1H8CA 2DYBA 2JRIB 3KYDD 3VVWB 1SGHA 4TV3A 5CTRC 4A3OA 1V5TA 3QJZA 4BKTA 3X23A 3QC8B 4K7SA 2BWES 4MGIE 1SIFA 2HTHA 1LM8B 2J7QB 1LXDA 2PE6B 4BKGA 4W9FA 5KHOA 1WXSA 3N32A 2FUHB 1VCBA 3APDA 4HCNB 1UBIA 1UBQA 4URKA 4CHKA 2O2VB 3QA8A 5LLIA 3DVGX 2W9NA 2KTRA 2BKRB 2KKCA 5AEKB 1WE6A 3PHWB 3VUYA 3ZW3A 4F7ZA 2FNJB 1E90A 5IAAC 1IPGA 1P0RA 2KJ6A 3PV1A 2NCNA 2N9EB 2ZNVB 1ZW7A 4HLEA 4EOYA 5TR5A 2DAFA 2V3SA 2HE7A 2JT4B 3QHTA 4II3B 3NHEB 3RCZA 3HM3A 4BOZB 1G6JA 4CYEA 1WGRA 4ZRKA 1Q1OA 2V1YA 3OLMD 2YLMA 4PS7A 1XD3B 3ONSA 2XK5A 2A4ZA 2KQSA 3H6NA 2Z0DB 3ENEA 2MBQA 2WDTB 2LI5A 3JYUA 1C3TA 2GBMA 2WX1A 2A5UA 3BINA 3R66C 4NJ7A 3BY4B 3EC8A 4FADA 4FJYA 4JLCA 5EDSA 3GZNI 1WFYA 4MSMB 4ZDVA 1WF9A 2KTFA 1TZ1A 3ECIA 3PPAA 2C60A 3ZO5B 3L08A 3O65B 2IY0B 1I42A 1E8YA 5D6JB 2DENB 2GBRA 3HM6X 3OJ4B 2MQJA 3RUIB 1LQBA 2ZJDA 1GG3A 2KJRA 3VH3B 1EF1A 5J2RA 3A33B 3ML8A 4ANUA 5KHQA 3PLUA 2MP2B 2O2VA 4WJPA 5JHBA 1V5OA 3ZDTA 3CSFA 3QARA 1RAXA 2N1WA 2Z59B 1WY8A 1WZ3A 2XBBC 4BBNF 4K7UA 2AL6A 1I35A 4W9GA 2CS4A 1WGGA 2LGDA 4E74A 2RD0A 3L16A 3TL5A 2K6QA 4EKUA 3GOEA 1SE9A 4MJSB 3VTUA 1WYWB 2KDFB 2L7RA 2VRRB 3RYTA 4W9EA 2JXXA 2I1KA 3M62B 3QX1A 4MELA 4JQWC 3ZVVA 4DBGA 2KK8A 1L7YA 3N30A 4K81A 4W9LA 3JW0X 2IZVB 3DVGY 2N4FA 2HJ8A 2N7EA 1UD7A 1WIAA 2EMTA 2DZIA 4GDKB 1YX5B 1U4AA 3QIJA 2C7HA 2ZCCA 3JSVB 2G4DB 2CR5A 2N9XA 2D2QA 3KUDB 2IO1B 4HPMB 3B1LX 2DX5B 1WE7A 2CU1A 2UWQA 2LJ5A 4W9CA 3NOBA 2BGFA 2BYVE 3EHVA 1UGMA 3PRPB 4NY0A 3SDLC 1Z5SB 3PS6A 4NJ6A 2JZZA 4FBJB 2MP2A 2KZRA 2N7DA 4XC2A 4XX5A 4A3PA 3PZDA 2DYMA 3T8MA 2R2OA 2MSED 2XEWA 2D11A 2Z0EB 2NVUI 4DXAB 5G55A 1WR6E 3ZDMC 2GOWA 2C5LC 3OAWA 2KLGA 3ZNGC 2PEAA 4RM9A 4MJSA 2Y5BB 2ZPYA 4HDQA 3KUCB 2L00B 4IUMB 3AU4A 3L10B 4IWQA 2MLBA 4I6LB 5LXHA 4EFOA 4DHZB 2L05A 2KANA 1P1AA 3A9KB 1WXVA 3W1SA 4FLHA 4NAWB 3V62A 4B6WA 1TBEA 3ALBA 2C9WB 2WX0A 1WX8A 2L8JA 2NPTB 3UQAA 4FA6A 4MEMA 4JL9A 5C23A 2KDIA 2RSUA 2MBEA 2KQ7A 1V2YA 4ASWC 2MX2A 2IYDB 3TCAA 3ZUNA 4NPNA 2LVQA 2JWZA 4W9JA 2ZVOA 2ZPNA 2REXA 5L83A 4FULA 4BKSD 1YIWA 3PHXB 1E7VA 5CHFA 3VH4B 3NY5A 2GMIC 1E8WA 3VUWA 1WXMA 2LZ6A 1BT0A 3KW5B 2HD5B 1GC7A 1P98A 2IO3B 3B08A 2DAJA 4W9DA 3PREA 4FJVB 4AUQC 4EUTA 3W1YA 2M0XA 3UIPB 2OJRA 4WAAA 1RLFA 3RD2A 3ZRCA 4ICUA 4HCPB 1UZXB 3RULA 4CO7A 3RT3B 2AWTA 1MG8A 4WQOB 2N1VA 1KJTA 3V6CB 1E8ZA 2AYOB 2BYFA 3IBEA 3VTVA 4JGHB 2KFKB 4KIKB 3QQ8B 3WIMA 2AL3A 3TMPB 1WJ6A 2WWZA 2DZJA 4GN1A 2BYEA 1YX6B 4NQLB 3CMMB 4WJQA 4J6IA 3HHMA 2NPTA 4DDID 2J0JA 2CHWA 1A5RA 1R4MI 3DQVA 1WRDB 2ZZPB 1YD8U 3K9PB 3ML9A 1WR1A 2K8CA 5JH5C 1D3ZA 2ASQA 2K39A 2MBBB 1X1MA 2KC2A 3QAQA 4MGYE 2IY1B 3A1QB 1XT9B 2NBWB 1EF5A 4F1SA 5AZFA 3T9LA 3U7DA 3PT2B 1EUVB 4PS8A 3DBSA 5CHVC 4ZRJA 4DWFA 2LGYA 4GIVA 1Q5WB 3IFWB 4A20A 2ZCBA 3PRMB 4ZRIA 3PTFC 4EEWA 3ZTCA 4MDKE 1ZGUB 1CMXB 2FIFA 2G3QB 1WGHA 2L76A 4BOSC 2KDEB 3CF6E 2KMAA 3KUZA 4DK5A 2RR9A 3VAWA 2EMSA 1EO6A 1OGWA 5IA7A 4K7WA 2KD0A 3RZFA 1E5WA 1UH6A 5AZHA 2DYOA 2J0KA 2KWVB 2R2QA 4GMVA 4M0WB 3MHSD 2JPHA 3P2BA 1AARA 2KFKA 1V86A 2IO2B 4KIKA 4WJNA 3M95A 5D2MB 3TIXA 4LCDE 3UQBA 1Y8RC 3IG3A 3PLVA 5E6PA 3S2AA 2RPQA 2O6VD 5G2NA 1OTRB 1WMHB 1YJ1A 1K8RB 1M94A 4ZYNA 2GBNA 4DHZE 3AU5A 4K1RB 2WYQA 4GDLB 3Q3JA 2FCSA 4XZ4A 1ZKHA 2JY6A 1R4NI 3A1QA 3DVNU 4B9KA 1FXTB 3K9OB 2KXJA 1KM7A 4KSKC 1JRUA 1H4RA 4W9KA 2LUEA 3JVZX 5DCNA 3MJWA 2MBOA 3R3MA 1IP9A 3M3JA 2I1JA 4HJKA 4LDTB 1WZ0A 4I6NB 3SHQA 1WI0A 2KX3A 2MRPA 4TKNA 5D7GA 4I6PA 3H7SA 3APCA 1GC6A 4WWOA 4MGKE 3ZLZA 4TUUA 1RFAA 3A9JB 3PVLA 2K8BA 3ZRFA 1V6EA 2K1FA 3EECA 2LASA 2LVOA 4BKSA 1RRBA 4E3CA 2YVCA 4AP4C 4IG7B 4N9F4 4F8CB 1S3SG 2G45B 3VTWA 1WGYA 4II2B 5DPTA 3ZTDA 4OVUA 2MW5A 3I3TB 2MCNB 3VXWA 3N3KB 1V9JA 2KFJA 5CHWA 1P3QU 4G50A 3AULA 3C0RB 2CKHB 4GDKA 3A4RA 4ICVA 3DVNV 4HPLB 4WJOA 4DHJD 3TBLD 3QWZB 1L2NA 2JRHA 2KWUB 2KJHB 2KMCA 1WXAA 3DBRI 3JSVA 2IBIB 3DDCB 5FR6A 4RMAA 4FHJA 2DZKA 4EZKA 3APFA 1WX9A 4MSQB 2KO3A 4FN2A 4B95A 4IW0A 3A4SC 3R7RA 1V80A 1TTNA 1T0YA 4MM3A 2PE9A 3L13A 4MH0E
chains in the Genus database with same CATH superfamily
4IWOA 3V61A 2LMCA 2KN5A 1N63A 4XWTA 2KN4A 3RZWC 3V6EB 4L23A 3AE9B 2NBVB 4G11A 1JWMD 4W9IA 3AEAB 3U30A 2CHZA 2IPKD 4BFRA 5G5GA 1NYRA 1FCLA 2K9XA 1RWSA 1TIFA 4EZLA 1C4AA 2G4SA 2CU3A 2FE8A 4ANXA 2AEHA 4NAWA 2R61A 4MH8A 3BIID 2WQYB 3P4RB 3ZGZA 1QOAA 3CSTA 4YL8A 2V4LA 1Q10A 2O6VA 3NRZA 4PYZA 3DOWA 3W1SC 1V49A 3R7QA 4HXDA 2PKOA 1JWUD 4NQKE 2FCNA 3H8HA 4OVVA 2K25A 4XYCA 1GJZA 3KVFB 2BKFA 4C80A 1PQSA 2H89B 2EKEC 2L3ZA 3H9DA 2V3NA 2KWDA 4DQOC 2L0FA 4RF0A 3NS8A 2K6DB 2JU6X 2OOBB 2X38A 1ISNA 4US9A 1F9JA 3U8ZA 1YQBA 3EA6A 2CJOA 4ZHPA 2DWQA 1IYFA 4XDDA 2NR2A 4OZBA 1IBXA 1KLVA 2KLCA 1MHXA 3IVFA 2XNAC 2H88B 2FCMA 2PLPA 4JIOU 5FKAC 2JF5A 1D4BA 1GB1A 3J9CA 4J3OD 2K3UA 4DDGD 1E10A 3QK0A 4X57B 4WURA 3SU8X 2KOXA 2BF8B 2QILA 2MHJA 3LDZE 4WWMA 2NBUA 5HI1A 4GDLA 1UGJA 1SIJA 3WA0A 3Q3NC 3EUB2 4RM8A 4W9HA 4ANVA 4NAMA 4TV3A 5CTRC 4Q2JA 1I4GA 1SF0A 3C8YA 1QOBA 2J7QB 1EWCA 2D5GA 2K22A 3DHHC 1WXSA 1PGBA 4HEA1 2FUHB 2E3TA 1UBIA 4TMAB 4URKA 1BXTA 3DVGX 4HPPA 3Q8EA 3ZW3A 4F7ZA 2BTEA 1IPGA 1VJKA 3R2IA 1FNUA 2DAFA 1NEKB 1L4DB 4II3B 3NHEB 3HM3A 4CYEA 2V1YA 4PS7A 2INDC 3NVWA 2MBQA 4C4VA 2A5UA 3BINA 3FILA 4FJYA 3Q69A 1TZ1A 1E8YA 1L6VA 2GBRA 3VH3B 2PVOD 1R4MB 4ANUA 4C7YA 4WJPA 2HJ1A 4BBNF 4K7UA 2TSSA 2AL6A 2OJWA 3Q2AC 2RD0A 3L16A 5H8YE 2ZW0A 2KACA 4P16A 4A9AA 1WYWB 1I4RA 4W9EA 1FNWA 3QX1A 3I9V1 1PUTA 4DBGA 1TS2A 1L7YA 4IDIA 3N30A 2HJ8A 1D5XC 2EMTA 2DZIA 2FBWB 1L0XB 2WXPA 2ZCCA 3JSVB 2KAJA 2N9XA 4HPMB 3B1LX 3P42A 3PRPB 3I5JC 3KQ4A 3N1ZC 4NJ6A 2JZZA 2MP2A 3MC0B 1HZ6A 2Z8LA 2KZRA 2N7DA 3GP7A 3RI7C 3T8MA 1ZPSA 2D11A 1FEHA 2NVUI 1WR6E 1QT9A 4MJSA 2L00B 4IUMB 4IWQA 3RMKC 1FRDA 5LXHA 1N6ZA 4DHZB 5BYRA 1WXVA 4LLGM 1TBEA 2WX0A 3NZ3A 3AEDB 4MEMA 4MACA 2KDIA 3AE1B 2IYDB 1ZUD2 4W9JA 2JWZA 1T0QC 2WP9B 5L83A 4FULA 1E7VA 3VH4B 2GMIC 3AE4B 1WXMA 1JCKB 2IO3B 1K50A 2AQ2B 4JX1C 4AUQC 4EUTA 3W1YA 2M0XA 2OJRA 1C4PA 1RLFA 4ICUA 1ZP0B 1UZXB 2NTSA 1L0YB 4WQOB 3I63C 1QOFA 2M0AA 3V6CB 4RCOA 4OVZA 1E8ZA 3IBEA 2G9HD 2WXRA 2LEKA 3AEEB 3MC9A 3WIMA 1KFYB 2AL3A 1IUEA 1WJ6A 4RNAA 2BYEA 2EKIA 4NQLB 3CMMB 1ET9A 3LXFA 2NPTA 2VH1A 1UNSA 1A5RA 3MFGA 3R2TA 1EM7A 1R4MI 5JH5C 2E6XA 1D3ZA 2ASQA 2K39A 4WAFA 1X1MA 5GXGB 1XT9B 1R7SA 4DXFA 2GLSA 3PT2B 4ZRJA 4DWFA 2LGYA 1Q5WB 4A20A 3MP9A 1CJEA 4MDKE 2FIFA 2L76A 3AM9A 3CF6E 3KUZA 4DXGA 2EMSA 4K7WA 1UH6A 3ZJTA 2J0KA 2RDHA 1V86A 3UQBA 4LCDE 5E6PA 3RNFC 3KLSX 4P1BC 1OTRB 1WMHB 1C78A 4ZRQA 3Q3JA 1ZKHA 2WXMA 3C19A 4KSKC 1H4RA 1TS4A 2LUEA 1JWSD 2MBOA 2SAKA 2I1JA 2W82A 3AE2B 4LDTB 1WI0A 2MRPA 4TKNA 1ET6A 1HTQA 1F0ZA 3DBLB 5D3IB 2K8BA 3ZRFA 2J4XA 2K1FA 3EECA 2LASA 2LVOA 4E3CA 2WDRB 5DPTA 2JQRB 4OVUA 3N3KB 4S17A 3C0RB 3VR9B 1Y56A 4ICVA 3DVNV 4HPLB 4WJOA 1PGXA 4DHJD 3VRAB 1AYFA 2DNFA 4JE3B 1WX9A 4FN2A 4IW0A 1F77A 3R7RA 2LUMA 1T0YA 3L13A 4WWPA 2WXHA 3WAPA 1I4QA 1WGDA 3VFKA 1ENFA 2OHFA 3KH0A 4NZLB 2INCC 4IM0A 4YSYB 3D32A 4M8MA 3VR8B 4S0RA 2WXFA 1YMHE 1T5XD 4BBNC 4HKQA 3H1UA 2M4NA 2B3AA 3H7PB 1TZOA 3UIOB 4KZCA 3L54A 1L6UA 4KDLB 1GAQB 1OEYA 4LDTD 2LVPA 3BYYB 4YWGG 5HKHA 1QKZA 4EZJA 4GU2A 4KV2A 2BWFA 2I2YA 2BS4B 2GBKA 2WXQA 2MWSB 2L0TA 3VDZA 4BVUC 1HZ5A 2MJDA 2KNBA 3P4PB 2KHWB 4KGTA 4GB9A 4JPSA 4IWPA 3E56A 1N5XA 3AN1A 3SD5A 1NBFC 1XEEA 3Q8CA 1E7UA 5AZGA 1J8CA 1QZEA 2C7MB 1FFVA 1PGAA 3GS2A 1HE8A 3T3OA 4LJOB 2C7NB 4C00A 4G3XB 3WALA 2I38A 3HK0A 5LNK1 4RF1A 4QAYA 2JWUA 1MHHE 2KC1A 1OQQA 3O13A 5BMGA 4RGMA 2LD9A 1CK1A 2HDEA 1I4XA 3UI3A 4XDCA 4P1CC 5IO9A 5DPRA 2LGXA 2WXOA 3DBLI 1AWDA 3OWEB 1SJED 3VRBB 1LFDA 3KYCD 2RGFA 3B2FA 1NDDA 4ITKA 3ZNZB 2SEBD 3W5UB 5D94A 5GMVA 1YQ3B 3ABVB 2OEDA 1WJNA 2DBYA 1SE3A 4P6VF 2QJLA 4ZRPA 2INPE 1XO3A 1N62A 1S1QB 3AH7A 1XLPA 1C76A 1XLNA 3GE3C 5H92C 3DPDA 3HRDD 2CHXA 2WXKA 1AW7A 2ZVNA 2KX0A 2D10A 1E8XA 1F2RC 3IAM1 4RH6A 2DYBA 2JRIB 3KYDD 4A3OA 4A6QA 4K7SA 2BWES 4MGIE 2KMMA 4W9FA 5KHOA 1YNTE 1UBQA 3BZDB 2O2VB 3QA8A 3V05A 2WDVB 3VUYA 5G5HA 3PV1A 4HLEA 2V3SA 1OFFA 3P1MA 1G6JA 1WGRA 4ZRKA 5BYQA 2G1EA 3R66C 4NJ7A 3CWIA 4JLCA 4LNIA 5EDSA 4MSMB 1WF9A 2IY0B 1I42A 5D6JB 3RUIB 1GG3A 3A33B 3ML8A 2N1WA 1TKGA 2Z59B 3AEFB 1K52A 3TEYA 3TL5A 3HUIA 1V97A 2VRRB 4OZAA 2JXXA 2D3CA 4JQWC 2KK8A 4K81A 4W9LA 3DVGY 2N4FA 1JW9D 1VZ7A 2Y3AA 1UD7A 1WIAA 1MG4A 1KF6B 4AS1A 1U4AA 2C7HA 4LNKA 3EGRA 4WQMA 2G4DB 2CR5A 1C9FA 2D2QA 1WE7A 3BWUD 3Q3OC 1VZ6A 2BGFA 3NOBA 2BYVE 4EE2A 3LYYA 3T3NA 3PS6A 4FBJB 3AE7B 2R2OA 2MSED 4DXAB 2C5LC 4RM9A 2K5PA 3KUCB 3L10B 3MC8A 4EFOA 2KANA 5AUIA 2LGIA 3W1SA 3N20C 4NAWB 4D2KA 2VH2A 3ALBA 1V8CA 2C9WB 3AE8B 5EE3A 4FA6A 2RSUA 2MBEA 2KQ7A 4ASWC 3ZJUA 1MPEA 3DBRB 1L5PA 4RGTA 4NPNA 1TS3A 2ZPNA 4BKSD 1YIWA 5CHFA 1E8WA 1P7FA 2HD5B 3PZ7A 2JZPA 1P98A 1E0ZA 3U4EG 4WAAA 3ZRCA 5AUKA 3RULA 2BB6A 2N1VA 3BVZA 2BYFA 2KFKB 2KVZA 4KIKB 1SB3C 1T0SC 2PW9A 2WWZA 1YX6B 4WJQA 1E9MA 3NJTA 4IOIE 4DDID 1WWTA 3K9PB 1YD8U 2WGSA 3QAQA 4MGYE 3A1QB 1EF5A 1WGKA 4BAXA 3ETRA 3L4PA 4PS8A 1EUVB 4GIVA 3PRMB 4TSSA 4ZRIA 3PTFC 3ZTCA 1SE4A 1IBXB 1XXGA 2WU5B 1LGRA 2G3QB 2N7JA 2KDEB 2KMAA 1YN5A 4M00A 4KX6B 5IA7A 3RZFA 1E5WA 2R2QA 3MHSD 1AARA 2IO2B 2INNE 3S2AA 2RPQA 2O6VD 5G2NA 4YSXB 1DOYA 5IKCM 1YJJA 4LNFA 1K8RB 1J7CA 1IGCA 4K1RB 2WYQA 4GDLB 2GB1A 4MM3B 4LTUA 4B9KA 1FXTB 1C79A 1JRUA 5C2TB 3JVZX 4OHJA 3MJWA 3AV8A 2LJIA 1PFDA 2WXGA 1D5MC 4I6NB 4M02A 5JXVA 3H7SA 3APCA 4MGKE 4A55A 1C4CA 1CQVA 1LO5D 2V3PA 3A9JB 3DBHB 2YVCA 4AP4C 2G45B 1UUPA 2MCNB 1VRAB 2KFJA 4KGRA 1P3QU 4G50A 1E6EB 1FIQA 4GDKA 3A4RA 3IAS1 2AQ1B 3QWZB 3DBRI 2IBIB 5FR6A 2DZKA 3APFA 4MSQB 2KO3A 4B95A 3A4SC 1V80A 2M56B 5BMHA 2LWPA 3AE3B 3PGEA 1FCCC 1STEA 3FILB 1WM2A 1WJ4A 3QCAA 3SR6A 4PYUA 5J18A 5E6OA 2KVRA 1F2RI 1WRIA 2EELA 1V1PB 4KVGB 1GPXA 3M63B 2MEKA 3A9KA 3PZ8A 3NVVA 4BZAA 2M17A 4GGQA 1OQRA 3PSEB 2D3GA 4TQ0A 1J7BA 3I57A 3OG5A 1VLBA 3CIRB 2JSVX 4US8A 5CX3A 2RPVA 2J52A 2M8SA 2CJNA 4KZ0A 4L2YA 2IO0B 4DHJB 2GRIA 4WWNA 3ZQ4A 1NI2A 2J42A 1ZDXA 2WXNA 2GBJA 3WAMA 1OQYA 3B0AA 3N1XC 1FPYA 4RGOS 1MVKA 1WH3A 3Q6BA 5DPWA 3RNBC 2WLBA 5J17A 1UELA 2DLBA 1YJIA 1KOTA 4AJYB 3L0WB 1WYGA 1JWAD 1C1YB 3SFEB 2W55A 2AX5A 3H7PA 1TGZB 4A8XC 1IGDA 1UWXA 1XLOA 2DHZA 1HA5A 3PRZA 2BS3B 4YSZB 1I4PA 4FJZA 1V81A 1I4HA 3VHTC 1XQQA 4XE0A 5JHAA 2BVCA 4KDIC 2LXCA 3MTNB 1TY2A 4NNJB 3DBHI 1J19A 4M8NA 1F1HA 1K53A 2LRWA 4KSLC 4JWSC 5T8IA 2FCQA 4GOCA 3ZNID 2J53A 2LXAA 3UINB 1FMAD 2KTRB 4LJPB 4C7ZA 3ZNHB 1BUIC 4HWIB 4ANWA 1NI3A 2JYEA 2MBHA 4YXDB 3Q3MC 3TEXA 3V60A 2NTTA 5LXIB 4IM3A 4GSWA 1ZDVA 5EE0A 1FO4A 2PPHA 2XK5B 2N9PC 2JXTA 4YTMB 4GXBA 3AI5A 3ZKJC 3EFUA 1J0GA 1H8CA 2KYWA 4XWWA 4BKTA 1KTKA 3RFZB 3QC8B 1LM8B 1HXYD 4BKGA 4AQ7A 1FD6A 2B76B 1D5ZC 3N32A 4OZCA 4K3BA 4ZYSA 1SXTA 4CHKA 5LLIA 2W9NA 1B9RA 2BKRB 1P7EA 4L1BA 5AEKB 1JALA 5IAAC 1JQ4A 1P0RA 2NCNA 2N9EB 2ZNVB 4EOYA 5TR5A 3Q14C 3B2GA 2HE7A 2JT4B 1XF5L 1Q1OA 4NJCA 5TSSA 2YLMA 3ONSA 2A4ZA 2KQSA 3H6NA 2Z0DB 4B0EA 1C3TA 1PYWD 3JYUA 2GBMA 2WX1A 1ACCA 2NMQA 1WFYA 4ZDVA 2GI9A 3PPAA 2C60A 3ZO5B 3L08A 1DGJA 1TS5A 3OJ4B 2MQJA 1LQBA 2KJRA 1EF1A 5J2RA 5KHQA 2O2VA 4H2AA 2N0SB 2XN9C 5JHBA 1V5OA 2V0GA 3CSFA 3QARA 1RAXA 1WY8A 1WZ3A 3IXSA 4W9GA 2CS4A 1WGGA 2LGDA 4E74A 3RNGC 2Q5WD 4EKUA 3N1YC 3GOEA 3NS1A 1SE9A 2KDFB 3R8BA 2L7RA 2D3BA 1YN4A 3M62B 2I1KA 2Y5CA 5FK9C 4IKGA 2IZVB 1VZ8A 1T0RC 2BQQA 2X8XX 1JRPA 2IGGA 1YN3A 5EE9A 3KUDB 2IO1B 2DX5B 2CU1A 2UWQA 2LJ5A 1DOXA 1KRHA 3EHVA 3N9YC 1UGMA 4HRSA 3SDLC 1JWBD 1R4NB 2ONQA 4XX5A 4A3PA 2DYMA 2L83A 2YEPB 2Z0EB 3W9CB 5G55A 3ZDMC 3RN9C 3ZNGC 2ZPYA 3W5VB 3AU4A 1XCQL 2MLBA 4I6LB 3P63A 3ZYYX 1JMLA 2L05A 2PIAA 3AMZA 1N60A 2RDGA 4C56C 4FLHA 3V62A 1ZXHA 2L8JA 4ZHOA 3AE6B 3UQAA 5C23A 1B1ZA 1V2YA 3ZUNA 2LVQA 3P4QB 3VUWA 3KW5B 3U7ZA 1GC7A 1FXIA 4CQNA 2WDQB 4OW0A 4FJVB 4HCPB 3U52E 4HKZE 3B9JA 2QDFA 4N58A 2L1AA 4B0MA 3KWLA 4ZOHC 2RDBC 3QQ8B 3TMPB 4YTNB 4GN1A 4J6IA 2QSDA 3BVGA 2QCZA 2BB5A 3NUHB 3HHMA 2J0JA 2QC8A 1J7AA 2ZZPB 3ML9A 1WR1A 2KC2A 2W3RA 4REZA 2LGSA 4GLSC 2NBWB 4F1SA 3RPFC 3DBSA 5CHVC 2ZCBA 4LNNA 1T6BX 4EEWA 3W2DA 1CMXB 1WGHA 3IT4B 2WXIA 4DK5A 2RR9A 1I7HA 1EO6A 2KD0A 5AZHA 4WH4A 2DYOA 2KWVB 4HROA 4GMVA 3SEBA 4M0WB 2KFKA 4KIKA 1Y8RC 1ZE3D 3IG3A 5C3JB 5MPOA 2FUG1 4ZYNA 4DHZE 3AU5A 1FXAA 1KLUD 2FCSA 4YT0B 2JY6A 1N5WA 1R4NI 3A1QA 3K9OB 1KLGD 1KM7A 4PT5A 1ZOYB 4W9KA 1SBBB 3R3MA 1IP9A 1RM6C 3M3JA 3BYTB 3U2SC 4HJKA 1WZ0A 3SHQA 2KX3A 2YEPF 4WWOA 2QEJC 4KKIA 3ZLZA 1MI0A 4TUUA 2JX5A 1RFAA 3PVLA 2L52A 1V6EA 1RRBA 2WXJA 2N9KA 4F8CB 2MW5A 3VXWA 5CHWA 1WSPA 4K3CA 3TBLD 1L2NA 2KWUB 2KMCA 3JSVA 2BT6A 2LHDA 4RMAA 4FHJA 4EZKA 1CZPA 1TTNA 4MM3A 3VTWA 2PE9A 1JROA 2HTME 3Q3FA 2O6VB 3MHZA 2N9LA 3WANA 4XGAB 2FAZA 2V4IB 3AEBB 1P9DU 3HIZA 2BPSA 3SFDB 3A9JA 1TKEA 2IGDA 3AXCA 5HG2A 4PS3A 2JVCA 3TSSA 4E71A 1WX7A 1RFKA 5BO4B 3AECB 1BMLC 3DCGA 3DHGC 4ARIA 1QQRA 3FAHA 1Q0WB 2QIEB 2KDMA 4P7IA 5L95C 1YQ4B 3RNCC 4FHKA 3DHIC 3NVZA 4IC7B 2UYZB 2QMTA 2WS3B 1SJHD 2KWCA 1OEYJ 1GOZA 3GZNB 1GUAB 4HDOA 1V1PA 4AJWA 1GNUA 2MA9B 3AEGB 3LJ3A 4M01A 2MJ3A 2K0PA 5DPSA 2J0MA 5JZEB 3VUXA 2WHIA 1Z2MA 1EU3A 3UGBB 4IM2A 1TJEA 3NZUA 3NVYA 1WM3A 3VQIA 2K8HA 5E6NA 2Y5PA 2NS5A 2DZMA 2D07B 2MJEA 2PJHA 2KDBA 4MGZE 1FNVA 4R3DA 4TQ1A 3IHPC 4G0NB 3OJ3A 3Q8AA 2W54A 3ZIMA 1VD2A 3L17A 4AOFA 4N59A 1PDXA 1QLBB 3GB1A 4HVBA 1ROEA 4AWJA 2JUOA 2M1MA 2QHOA 3NZSA 1QOGA 5C1ZA 1WJUA 1F52A 4HK2A 2PVGC 2ZEQA 5HHDG 2FIDA 3WAOA 2JZ3B 2LRUA 1WMHA 2ZNVC 5HFYA 3TJPA 2L32A 3UF8A 4C4VB 1M4VA 2JYTA 3X0WA 3VVWB 1SGHA 1V5TA 1HTOA 3QJZA 5BYSA 3X23A 1VDVA 1SIFA 2HTHA 1LXDA 2PE6B 3TEZA 1UWMA 4N6EB 1VCBA 3APDA 4HCNB 1NYQA 1AN8A 1YOVB 2KTRA 2KKCA 3Q8FA 1WE6A 3PHWB 2FNJB 2AQ3B 1E90A 3DWMA 5E6JA 3TUOA 2KJ6A 1MFWA 1FRRA 4ARCA 1ZW7A 3RNAC 3QHTA 3HVZA 3RCZA 4BOZB 3OLMD 1XD3B 2XK5A 1TY0A 2ACZB 3ENEA 2WDTB 2LI5A 3V3XA 2WU2B 3BY4B 3EC8A 4FADA 3GZNI 4UDUC 2KTFA 3ECIA 3HVDA 3O65B 2RMMA 2BYTA 2DENB 3HM6X 5I4DA 2ZJDA 4MT5A 1K51A 3PLUA 1XCTL 2KT7A 2MP2B 1SEBD 3ZDTA 2ON8A 2XBBC 1I35A 4HJGE 2K6QA 4MJSB 1NENB 3VTUA 5BMIA 3RYTA 1QF6A 3GE8C 1A70A 4MELA 3ZVVA 3JW0X 1D6EC 2N7EA 1GB4A 4GDKB 1YX5B 3QIJA 3P4SB 1FM0D 3BK2A 5IOIA 2ICIA 3BK1A 2MH7A 3EFCA 4W9CA 2PMVA 1HEZE 4NY0A 4PK1A 1Z5SB 4XC2A 2BBCA 3PZDA 2XEWA 4KGSA 4USAA 2GOWA 3OAWA 2KLGA 2PEAA 2VZKB 1L0VB 2Y5BB 4HDQA 3TEWA 1P1AA 3A9KB 1UF0A 4B6WA 1EWYC 3FC4A 2KQ4X 1WX8A 1L4ZB 2NPTB 4JL9A 1NVID 3ZXVA 2V9HA 2MX2A 3TCAA 2ZVOA 2M19A 2REXA 3PHXB 1EU4A 3NY5A 3DWGC 2LZ6A 1BT0A 1V1OA 3LB8C 4O1NA 3B08A 2UU7A 2DAJA 3NG0A 3PREA 4KKJA 4W9DA 4ACFA 3UIPB 3RD2A 4CO7A 3RT3B 2AWTA 1MG8A 1KJTA 2AYOB 2W3SA 3VTVA 4JGHB 4RFBA 1HQRD 2DZJA 1ZXIA 2CHWA 3DQVA 1E7PB 1WRDB 2K8CA 1ESFA 4FXCA 2MBBB 1DOIA 2IY1B 3ZJVA 2VZKD 3Q8BA 5AZFA 5IP4D 3T9LA 3U7DA 1RYJA 3MJ5A 5D3DA 3IFWB 1MJDA 1QILA 3BVMA 1ZGUB 3E9SA 4BOSC 2BS2B 4RGNA 3PO0A 3VAWA 3ZXRA 2LFIA 1OGWA 3RNEC 2IGHA 3AB5A 5FR3A 2JPHA 1WXQA 3P2BA 4WJNA 3TIXA 3M95A 5D2MB 1TT5B 3KWVA 3PLVA 2WNMA 3IT6B 1KH0A 3AE5B 1TKYA 1YJ1A 1M94A 2GBNA 4XZ4A 2ZW1A 3DVNU 2KXJA 3FKYA 5DCNA 1C77A 1FFUA 3URYA 4A90A 2D3AA 5D7GA 4I6PA 2LHEA 2IJ0A 1GC6A 1SSNA 2IDYA 4LK0M 5IN7A 4BKSA 4IG7B 4N9F4 1S3SG 1N61A 1WGYA 4II2B 3ZTDA 4M0WA 2PTLA 3I3TB 2WXLA 1V9JA 1DYQA 3AULA 1XLQA 2CKHB 4LNOA 4YTPB 5EE1A 1VR9A 2JRHA 2KJHB 1WXAA 2BW2A 3DDCB 3WCQA 4WIPA 4JWUC 1TYGB 1SE2A 1T3QA 4MH0E
chains in the Genus database with same CATH topology
2LWPA 4IWOA 3Q3FA 3PGEA 3V61A 2O6VB 4WWPA 3WAPA 2KN5A 1WGDA 3VFKA 3RZWC 3V6EB 3KH0A 3WANA 1WM2A 2FAZA 1WJ4A 2NBVB 4G11A 3QCAA 1P9DU 4IM0A 3HIZA 4W9IA 3U30A 4PYUA 5J18A 3D32A 2CHZA 5E6OA 4BFRA 2BPSA 2KVRA 4M8MA 3A9JA 4KVGB 4EZLA 3AXCA 3M63B 2G4SA 4PS3A 2JVCA 4E71A 1WX7A 3A9KA 4BBNC 4ANXA 5BO4B 2AEHA 3H1UA 2M4NA 2M17A 2B3AA 3H7PB 4GGQA 4NAWA 3UIOB 4KZCA 3L54A 3PSEB 2D3GA 4TQ0A 3DCGA 4KDLB 1OEYA 4LDTD 2LVPA 5HKHA 5CX3A 3CSTA 4EZJA 1Q0WB 4YL8A 2V4LA 4GU2A 2M8SA 4KV2A 4P7IA 5L95C 2BWFA 4KZ0A 2O6VA 4FHKA 4PYZA 3DOWA 2IO0B 3W1SC 1V49A 4DHJB 4IC7B 3R7QA 4WWNA 2GBKA 2MWSB 1NI2A 2L0TA 4HXDA 3VDZA 2UYZB 4BVUC 2GBJA 3WAMA 2KNBA 2KWCA 1OQYA 3B0AA 1OEYJ 2KHWB 4GB9A 1WH3A 4IWPA 4NQKE 5DPWA 1GUAB 2FCNA 4OVVA 2K25A 4HDOA 3SD5A 4AJWA 1NBFC 5J17A 1UELA 1KOTA 1E7UA 1GNUA 2MA9B 3LJ3A 5AZGA 4AJYB 1QZEA 1J8CA 3L0WB 2C7MB 3KVFB 2BKFA 1GJZA 5DPSA 2J0MA 1C1YB 1HE8A 3VUXA 5JZEB 1PQSA 4LJOB 3H7PA 1Z2MA 2C7NB 2EKEC 1TGZB 2L3ZA 3H9DA 4G3XB 3UGBB 4IM2A 2DHZA 2L0FA 3WALA 3NZUA 3HK0A 1WM3A 3VQIA 2K8HA 3PRZA 5E6NA 2NS5A 2K6DB 3NS8A 2OOBB 2KC1A 2DZMA 4FJZA 2D07B 1V81A 2PJHA 1ISNA 2KDBA 2LD9A 4MGZE 1F9JA 4TQ1A 3U8ZA 3IHPC 4G0NB 1XQQA 1YQBA 3OJ3A 3VHTC 5JHAA 3ZIMA 1VD2A 4KDIC 5DPRA 2LXCA 1IYFA 2LGXA 3DBLI 3MTNB 3L17A 2NR2A 4NNJB 3DBHI 1KLVA 1J19A 4AOFA 4M8NA 1LFDA 2KLCA 3IVFA 3KYCD 4HVBA 2LRWA 2RGFA 4AWJA 4KSLC 1NDDA 2FCMA 3ZNZB 2JUOA 4JIOU 2FCQA 2JF5A 2M1MA 2QHOA 3NZSA 5D94A 4GOCA 3ZNID 2LXAA 3UINB 5GMVA 5C1ZA 1WJUA 2KTRB 1WJNA 4LJPB 3ZNHB 4HK2A 4HWIB 4DDGD 4ANWA 2ZEQA 2MBHA 2FIDA 3QK0A 3WAOA 1S1QB 2JZ3B 4X57B 2LRUA 3SU8X 1WMHA 2KOXA 3DPDA 2ZNVC 2BF8B 3V60A 2CHXA 3LDZE 2NBUA 5LXIB 4IM3A 4GDLA 4GSWA 3TJPA 2ZVNA 3WA0A 2KX0A 2D10A 1E8XA 2PPHA 2XK5B 3UF8A 2N9PC 4GXBA 4RM8A 4W9HA 3AI5A 3ZKJC 3EFUA 3X0WA 4ANVA 1J0GA 1H8CA 2DYBA 2JRIB 3KYDD 3VVWB 1SGHA 4TV3A 5CTRC 4A3OA 1V5TA 3QJZA 4BKTA 3X23A 3QC8B 4K7SA 2BWES 4MGIE 1SIFA 2HTHA 1LM8B 2J7QB 1LXDA 2PE6B 4BKGA 4W9FA 5KHOA 1WXSA 3N32A 2FUHB 1VCBA 3APDA 4HCNB 1UBIA 1UBQA 4URKA 4CHKA 2O2VB 3QA8A 5LLIA 3DVGX 2W9NA 2KTRA 2BKRB 2KKCA 5AEKB 1WE6A 3PHWB 3VUYA 3ZW3A 4F7ZA 2FNJB 1E90A 5IAAC 1IPGA 1P0RA 2KJ6A 3PV1A 2NCNA 2N9EB 2ZNVB 1ZW7A 4HLEA 4EOYA 5TR5A 2DAFA 2V3SA 2HE7A 2JT4B 3QHTA 4II3B 3NHEB 3RCZA 3HM3A 4BOZB 1G6JA 4CYEA 1WGRA 4ZRKA 1Q1OA 2V1YA 3OLMD 2YLMA 4PS7A 1XD3B 3ONSA 2XK5A 2A4ZA 2KQSA 3H6NA 2Z0DB 3ENEA 2MBQA 2WDTB 2LI5A 3JYUA 1C3TA 2GBMA 2WX1A 2A5UA 3BINA 3R66C 4NJ7A 3BY4B 3EC8A 4FADA 4FJYA 4JLCA 5EDSA 3GZNI 1WFYA 4MSMB 4ZDVA 1WF9A 2KTFA 1TZ1A 3ECIA 3PPAA 2C60A 3ZO5B 3L08A 3O65B 2IY0B 1I42A 1E8YA 5D6JB 2DENB 2GBRA 3HM6X 3OJ4B 2MQJA 3RUIB 1LQBA 2ZJDA 1GG3A 2KJRA 3VH3B 1EF1A 5J2RA 3A33B 3ML8A 4ANUA 5KHQA 3PLUA 2MP2B 2O2VA 4WJPA 5JHBA 1V5OA 3ZDTA 3CSFA 3QARA 1RAXA 2N1WA 2Z59B 1WY8A 1WZ3A 2XBBC 4BBNF 4K7UA 2AL6A 1I35A 4W9GA 2CS4A 1WGGA 2LGDA 4E74A 2RD0A 3L16A 3TL5A 2K6QA 4EKUA 3GOEA 1SE9A 4MJSB 3VTUA 1WYWB 2KDFB 2L7RA 2VRRB 3RYTA 4W9EA 2JXXA 2I1KA 3M62B 3QX1A 4MELA 4JQWC 3ZVVA 4DBGA 2KK8A 1L7YA 3N30A 4K81A 4W9LA 3JW0X 2IZVB 3DVGY 2N4FA 2HJ8A 2N7EA 1UD7A 1WIAA 2EMTA 2DZIA 4GDKB 1YX5B 1U4AA 3QIJA 2C7HA 2ZCCA 3JSVB 2G4DB 2CR5A 2N9XA 2D2QA 3KUDB 2IO1B 4HPMB 3B1LX 2DX5B 1WE7A 2CU1A 2UWQA 2LJ5A 4W9CA 3NOBA 2BGFA 2BYVE 3EHVA 1UGMA 3PRPB 4NY0A 3SDLC 1Z5SB 3PS6A 4NJ6A 2JZZA 4FBJB 2MP2A 2KZRA 2N7DA 4XC2A 4XX5A 4A3PA 3PZDA 2DYMA 3T8MA 2R2OA 2MSED 2XEWA 2D11A 2Z0EB 2NVUI 4DXAB 5G55A 1WR6E 3ZDMC 2GOWA 2C5LC 3OAWA 2KLGA 3ZNGC 2PEAA 4RM9A 4MJSA 2Y5BB 2ZPYA 4HDQA 3KUCB 2L00B 4IUMB 3AU4A 3L10B 4IWQA 2MLBA 4I6LB 5LXHA 4EFOA 4DHZB 2L05A 2KANA 1P1AA 3A9KB 1WXVA 3W1SA 4FLHA 4NAWB 3V62A 4B6WA 1TBEA 3ALBA 2C9WB 2WX0A 1WX8A 2L8JA 2NPTB 3UQAA 4FA6A 4MEMA 4JL9A 5C23A 2KDIA 2RSUA 2MBEA 2KQ7A 1V2YA 4ASWC 2MX2A 2IYDB 3TCAA 3ZUNA 4NPNA 2LVQA 2JWZA 4W9JA 2ZVOA 2ZPNA 2REXA 5L83A 4FULA 4BKSD 1YIWA 3PHXB 1E7VA 5CHFA 3VH4B 3NY5A 2GMIC 1E8WA 3VUWA 1WXMA 2LZ6A 1BT0A 3KW5B 2HD5B 1GC7A 1P98A 2IO3B 3B08A 2DAJA 4W9DA 3PREA 4FJVB 4AUQC 4EUTA 3W1YA 2M0XA 3UIPB 2OJRA 4WAAA 1RLFA 3RD2A 3ZRCA 4ICUA 4HCPB 1UZXB 3RULA 4CO7A 3RT3B 2AWTA 1MG8A 4WQOB 2N1VA 1KJTA 3V6CB 1E8ZA 2AYOB 2BYFA 3IBEA 3VTVA 4JGHB 2KFKB 4KIKB 3QQ8B 3WIMA 2AL3A 3TMPB 1WJ6A 2WWZA 2DZJA 4GN1A 2BYEA 1YX6B 4NQLB 3CMMB 4WJQA 4J6IA 3HHMA 2NPTA 4DDID 2J0JA 2CHWA 1A5RA 1R4MI 3DQVA 1WRDB 2ZZPB 1YD8U 3K9PB 3ML9A 1WR1A 2K8CA 5JH5C 1D3ZA 2ASQA 2K39A 2MBBB 1X1MA 2KC2A 3QAQA 4MGYE 2IY1B 3A1QB 1XT9B 2NBWB 1EF5A 4F1SA 5AZFA 3T9LA 3U7DA 3PT2B 1EUVB 4PS8A 3DBSA 5CHVC 4ZRJA 4DWFA 2LGYA 4GIVA 1Q5WB 3IFWB 4A20A 2ZCBA 3PRMB 4ZRIA 3PTFC 4EEWA 3ZTCA 4MDKE 1ZGUB 1CMXB 2FIFA 2G3QB 1WGHA 2L76A 4BOSC 2KDEB 3CF6E 2KMAA 3KUZA 4DK5A 2RR9A 3VAWA 2EMSA 1EO6A 1OGWA 5IA7A 4K7WA 2KD0A 3RZFA 1E5WA 1UH6A 5AZHA 2DYOA 2J0KA 2KWVB 2R2QA 4GMVA 4M0WB 3MHSD 2JPHA 3P2BA 1AARA 2KFKA 1V86A 2IO2B 4KIKA 4WJNA 3M95A 5D2MB 3TIXA 4LCDE 3UQBA 1Y8RC 3IG3A 3PLVA 5E6PA 3S2AA 2RPQA 2O6VD 5G2NA 1OTRB 1WMHB 1YJ1A 1K8RB 1M94A 4ZYNA 2GBNA 4DHZE 3AU5A 4K1RB 2WYQA 4GDLB 3Q3JA 2FCSA 4XZ4A 1ZKHA 2JY6A 1R4NI 3A1QA 3DVNU 4B9KA 1FXTB 3K9OB 2KXJA 1KM7A 4KSKC 1JRUA 1H4RA 4W9KA 2LUEA 3JVZX 5DCNA 3MJWA 2MBOA 3R3MA 1IP9A 3M3JA 2I1JA 4HJKA 4LDTB 1WZ0A 4I6NB 3SHQA 1WI0A 2KX3A 2MRPA 4TKNA 5D7GA 4I6PA 3H7SA 3APCA 1GC6A 4WWOA 4MGKE 3ZLZA 4TUUA 1RFAA 3A9JB 3PVLA 2K8BA 3ZRFA 1V6EA 2K1FA 3EECA 2LASA 2LVOA 4BKSA 1RRBA 4E3CA 2YVCA 4AP4C 4IG7B 4N9F4 4F8CB 1S3SG 2G45B 3VTWA 1WGYA 4II2B 5DPTA 3ZTDA 4OVUA 2MW5A 3I3TB 2MCNB 3VXWA 3N3KB 1V9JA 2KFJA 5CHWA 1P3QU 4G50A 3AULA 3C0RB 2CKHB 4GDKA 3A4RA 4ICVA 3DVNV 4HPLB 4WJOA 4DHJD 3TBLD 3QWZB 1L2NA 2JRHA 2KWUB 2KJHB 2KMCA 1WXAA 3DBRI 3JSVA 2IBIB 3DDCB 5FR6A 4RMAA 4FHJA 2DZKA 4EZKA 3APFA 1WX9A 4MSQB 2KO3A 4FN2A 4B95A 4IW0A 3A4SC 3R7RA 1V80A 1TTNA 1T0YA 4MM3A 2PE9A 3L13A 4MH0E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LWP A;  4IWO A;  3Q3F A;  3PGE A;  3V61 A;  2O6V B;  4WWP A;  3WAP A;  2KN5 A;  1WGD A;  3VFK A;  3RZW C;  3V6E B;  3KH0 A;  3WAN A;  1WM2 A;  2FAZ A;  1WJ4 A;  2NBV B;  4G11 A;  3QCA A;  1P9D U;  4IM0 A;  3HIZ A;  4W9I A;  3U30 A;  4PYU A;  5J18 A;  3D32 A;  2CHZ A;  5E6O A;  4BFR A;  2BPS A;  2KVR A;  4M8M A;  3A9J A;  4KVG B;  4EZL A;  3AXC A;  3M63 B;  2G4S A;  4PS3 A;  2JVC A;  4E71 A;  1WX7 A;  3A9K A;  4BBN C;  4ANX A;  5BO4 B;  2AEH A;  3H1U A;  2M4N A;  2M17 A;  2B3A A;  3H7P B;  4GGQ A;  4NAW A;  3UIO B;  4KZC A;  3L54 A;  3PSE B;  2D3G A;  4TQ0 A;  3DCG A;  4KDL B;  1OEY A;  4LDT D;  2LVP A;  5HKH A;  5CX3 A;  3CST A;  4EZJ A;  1Q0W B;  4YL8 A;  2V4L A;  4GU2 A;  2M8S A;  4KV2 A;  4P7I A;  5L95 C;  2BWF A;  4KZ0 A;  2O6V A;  4FHK A;  4PYZ A;  3DOW A;  2IO0 B;  3W1S C;  1V49 A;  4DHJ B;  4IC7 B;  3R7Q A;  4WWN A;  2GBK A;  2MWS B;  1NI2 A;  2L0T A;  4HXD A;  3VDZ A;  2UYZ B;  4BVU C;  2GBJ A;  3WAM A;  2KNB A;  2KWC A;  1OQY A;  3B0A A;  1OEY J;  2KHW B;  4GB9 A;  1WH3 A;  4IWP A;  4NQK E;  5DPW A;  1GUA B;  2FCN A;  4OVV A;  2K25 A;  4HDO A;  3SD5 A;  4AJW A;  1NBF C;  5J17 A;  1UEL A;  1KOT A;  1E7U A;  1GNU A;  2MA9 B;  3LJ3 A;  5AZG A;  4AJY B;  1QZE A;  1J8C A;  3L0W B;  2C7M B;  3KVF B;  2BKF A;  1GJZ A;  5DPS A;  2J0M A;  1C1Y B;  1HE8 A;  3VUX A;  5JZE B;  1PQS A;  4LJO B;  3H7P A;  1Z2M A;  2C7N B;  2EKE C;  1TGZ B;  2L3Z A;  3H9D A;  4G3X B;  3UGB B;  4IM2 A;  2DHZ A;  2L0F A;  3WAL A;  3NZU A;  3HK0 A;  1WM3 A;  3VQI A;  2K8H A;  3PRZ A;  5E6N A;  2NS5 A;  2K6D B;  3NS8 A;  2OOB B;  2KC1 A;  2DZM A;  4FJZ A;  2D07 B;  1V81 A;  2PJH A;  1ISN A;  2KDB A;  2LD9 A;  4MGZ E;  1F9J A;  4TQ1 A;  3U8Z A;  3IHP C;  4G0N B;  1XQQ A;  1YQB A;  3OJ3 A;  3VHT C;  5JHA A;  3ZIM A;  1VD2 A;  4KDI C;  5DPR A;  2LXC A;  1IYF A;  2LGX A;  3DBL I;  3MTN B;  3L17 A;  2NR2 A;  4NNJ B;  3DBH I;  1KLV A;  1J19 A;  4AOF A;  4M8N A;  1LFD A;  2KLC A;  3IVF A;  3KYC D;  4HVB A;  2LRW A;  2RGF A;  4AWJ A;  4KSL C;  1NDD A;  2FCM A;  3ZNZ B;  2JUO A;  4JIO U;  2FCQ A;  2JF5 A;  2M1M A;  2QHO A;  3NZS A;  5D94 A;  4GOC A;  3ZNI D;  2LXA A;  3UIN B;  5GMV A;  5C1Z A;  1WJU A;  2KTR B;  1WJN A;  4LJP B;  3ZNH B;  4HK2 A;  4HWI B;  4DDG D;  4ANW A;  2ZEQ A;  2MBH A;  2FID A;  3QK0 A;  3WAO A;  1S1Q B;  2JZ3 B;  4X57 B;  2LRU A;  3SU8 X;  1WMH A;  2KOX A;  3DPD A;  2ZNV C;  2BF8 B;  3V60 A;  2CHX A;  3LDZ E;  2NBU A;  5LXI B;  4IM3 A;  4GDL A;  4GSW A;  3TJP A;  2ZVN A;  3WA0 A;  2KX0 A;  2D10 A;  1E8X A;  2PPH A;  2XK5 B;  3UF8 A;  2N9P C;  4GXB A;  4RM8 A;  4W9H A;  3AI5 A;  3ZKJ C;  3EFU A;  3X0W A;  4ANV A;  1J0G A;  1H8C A;  2DYB A;  2JRI B;  3KYD D;  3VVW B;  1SGH A;  4TV3 A;  5CTR C;  4A3O A;  1V5T A;  3QJZ A;  4BKT A;  3X23 A;  3QC8 B;  4K7S A;  2BWE S;  4MGI E;  1SIF A;  2HTH A;  1LM8 B;  2J7Q B;  1LXD A;  2PE6 B;  4BKG A;  4W9F A;  5KHO A;  1WXS A;  3N32 A;  2FUH B;  1VCB A;  3APD A;  4HCN B;  1UBI A;  1UBQ A;  4URK A;  4CHK A;  2O2V B;  3QA8 A;  5LLI A;  3DVG X;  2W9N A;  2KTR A;  2BKR B;  2KKC A;  5AEK B;  1WE6 A;  3PHW B;  3VUY A;  3ZW3 A;  4F7Z A;  2FNJ B;  1E90 A;  5IAA C;  1IPG A;  1P0R A;  2KJ6 A;  3PV1 A;  2NCN A;  2N9E B;  2ZNV B;  1ZW7 A;  4HLE A;  4EOY A;  5TR5 A;  2DAF A;  2V3S A;  2HE7 A;  2JT4 B;  3QHT A;  4II3 B;  3NHE B;  3RCZ A;  3HM3 A;  4BOZ B;  1G6J A;  4CYE A;  1WGR A;  4ZRK A;  1Q1O A;  2V1Y A;  3OLM D;  2YLM A;  4PS7 A;  1XD3 B;  3ONS A;  2XK5 A;  2A4Z A;  2KQS A;  3H6N A;  2Z0D B;  3ENE A;  2MBQ A;  2WDT B;  2LI5 A;  3JYU A;  1C3T A;  2GBM A;  2WX1 A;  2A5U A;  3BIN A;  3R66 C;  4NJ7 A;  3BY4 B;  3EC8 A;  4FAD A;  4FJY A;  4JLC A;  5EDS A;  3GZN I;  1WFY A;  4MSM B;  4ZDV A;  1WF9 A;  2KTF A;  1TZ1 A;  3ECI A;  3PPA A;  2C60 A;  3ZO5 B;  3L08 A;  3O65 B;  2IY0 B;  1I42 A;  1E8Y A;  5D6J B;  2DEN B;  2GBR A;  3HM6 X;  3OJ4 B;  2MQJ A;  3RUI B;  1LQB A;  2ZJD A;  1GG3 A;  2KJR A;  3VH3 B;  1EF1 A;  5J2R A;  3A33 B;  3ML8 A;  4ANU A;  5KHQ A;  3PLU A;  2MP2 B;  2O2V A;  4WJP A;  5JHB A;  1V5O A;  3ZDT A;  3CSF A;  3QAR A;  1RAX A;  2N1W A;  2Z59 B;  1WY8 A;  1WZ3 A;  2XBB C;  4BBN F;  4K7U A;  2AL6 A;  1I35 A;  4W9G A;  2CS4 A;  1WGG A;  2LGD A;  4E74 A;  2RD0 A;  3L16 A;  3TL5 A;  2K6Q A;  4EKU A;  3GOE A;  1SE9 A;  4MJS B;  3VTU A;  1WYW B;  2KDF B;  2L7R A;  2VRR B;  3RYT A;  4W9E A;  2JXX A;  2I1K A;  3M62 B;  3QX1 A;  4MEL A;  4JQW C;  3ZVV A;  4DBG A;  2KK8 A;  1L7Y A;  3N30 A;  4K81 A;  4W9L A;  3JW0 X;  2IZV B;  3DVG Y;  2N4F A;  2HJ8 A;  2N7E A;  1UD7 A;  1WIA A;  2EMT A;  2DZI A;  4GDK B;  1YX5 B;  1U4A A;  3QIJ A;  2C7H A;  2ZCC A;  3JSV B;  2G4D B;  2CR5 A;  2N9X A;  2D2Q A;  3KUD B;  2IO1 B;  4HPM B;  3B1L X;  2DX5 B;  1WE7 A;  2CU1 A;  2UWQ A;  2LJ5 A;  4W9C A;  3NOB A;  2BGF A;  2BYV E;  3EHV A;  1UGM A;  3PRP B;  4NY0 A;  3SDL C;  1Z5S B;  3PS6 A;  4NJ6 A;  2JZZ A;  4FBJ B;  2MP2 A;  2KZR A;  2N7D A;  4XC2 A;  4XX5 A;  4A3P A;  3PZD A;  2DYM A;  3T8M A;  2R2O A;  2MSE D;  2XEW A;  2D11 A;  2Z0E B;  2NVU I;  4DXA B;  5G55 A;  1WR6 E;  3ZDM C;  2GOW A;  2C5L C;  3OAW A;  2KLG A;  3ZNG C;  2PEA A;  4RM9 A;  4MJS A;  2Y5B B;  2ZPY A;  4HDQ A;  3KUC B;  2L00 B;  4IUM B;  3AU4 A;  3L10 B;  4IWQ A;  2MLB A;  4I6L B;  5LXH A;  4EFO A;  4DHZ B;  2L05 A;  2KAN A;  1P1A A;  3A9K B;  1WXV A;  3W1S A;  4FLH A;  4NAW B;  3V62 A;  4B6W A;  1TBE A;  3ALB A;  2C9W B;  2WX0 A;  1WX8 A;  2L8J A;  2NPT B;  3UQA A;  4FA6 A;  4MEM A;  4JL9 A;  5C23 A;  2KDI A;  2RSU A;  2MBE A;  2KQ7 A;  1V2Y A;  4ASW C;  2MX2 A;  2IYD B;  3TCA A;  3ZUN A;  4NPN A;  2LVQ A;  2JWZ A;  4W9J A;  2ZVO A;  2ZPN A;  2REX A;  5L83 A;  4FUL A;  4BKS D;  1YIW A;  3PHX B;  1E7V A;  5CHF A;  3VH4 B;  3NY5 A;  2GMI C;  1E8W A;  3VUW A;  1WXM A;  2LZ6 A;  1BT0 A;  3KW5 B;  2HD5 B;  1GC7 A;  1P98 A;  2IO3 B;  3B08 A;  2DAJ A;  4W9D A;  3PRE A;  4FJV B;  4AUQ C;  4EUT A;  3W1Y A;  2M0X A;  3UIP B;  2OJR A;  4WAA A;  1RLF A;  3RD2 A;  3ZRC A;  4ICU A;  4HCP B;  1UZX B;  3RUL A;  4CO7 A;  3RT3 B;  2AWT A;  1MG8 A;  4WQO B;  2N1V A;  1KJT A;  3V6C B;  1E8Z A;  2AYO B;  2BYF A;  3IBE A;  3VTV A;  4JGH B;  2KFK B;  4KIK B;  3QQ8 B;  3WIM A;  2AL3 A;  3TMP B;  1WJ6 A;  2WWZ A;  2DZJ A;  4GN1 A;  2BYE A;  1YX6 B;  4NQL B;  3CMM B;  4WJQ A;  4J6I A;  3HHM A;  2NPT A;  4DDI D;  2J0J A;  2CHW A;  1A5R A;  1R4M I;  3DQV A;  1WRD B;  2ZZP B;  1YD8 U;  3K9P B;  3ML9 A;  1WR1 A;  2K8C A;  5JH5 C;  1D3Z A;  2ASQ A;  2K39 A;  2MBB B;  1X1M A;  2KC2 A;  3QAQ A;  4MGY E;  2IY1 B;  3A1Q B;  1XT9 B;  2NBW B;  1EF5 A;  4F1S A;  5AZF A;  3T9L A;  3U7D A;  3PT2 B;  1EUV B;  4PS8 A;  3DBS A;  5CHV C;  4ZRJ A;  4DWF A;  2LGY A;  4GIV A;  1Q5W B;  3IFW B;  4A20 A;  2ZCB A;  3PRM B;  4ZRI A;  3PTF C;  4EEW A;  3ZTC A;  4MDK E;  1ZGU B;  1CMX B;  2FIF A;  2G3Q B;  1WGH A;  2L76 A;  4BOS C;  2KDE B;  3CF6 E;  2KMA A;  3KUZ A;  4DK5 A;  2RR9 A;  3VAW A;  2EMS A;  1EO6 A;  1OGW A;  5IA7 A;  4K7W A;  2KD0 A;  3RZF A;  1E5W A;  1UH6 A;  5AZH A;  2DYO A;  2J0K A;  2KWV B;  2R2Q A;  4GMV A;  4M0W B;  3MHS D;  2JPH A;  3P2B A;  1AAR A;  2KFK A;  1V86 A;  2IO2 B;  4KIK A;  4WJN A;  3M95 A;  5D2M B;  3TIX A;  4LCD E;  3UQB A;  1Y8R C;  3IG3 A;  3PLV A;  5E6P A;  3S2A A;  2RPQ A;  2O6V D;  5G2N A;  1OTR B;  1WMH B;  1YJ1 A;  1K8R B;  1M94 A;  4ZYN A;  2GBN A;  4DHZ E;  3AU5 A;  4K1R B;  2WYQ A;  4GDL B;  3Q3J A;  2FCS A;  4XZ4 A;  1ZKH A;  2JY6 A;  1R4N I;  3A1Q A;  3DVN U;  4B9K A;  1FXT B;  3K9O B;  2KXJ A;  1KM7 A;  4KSK C;  1JRU A;  1H4R A;  4W9K A;  2LUE A;  3JVZ X;  5DCN A;  3MJW A;  2MBO A;  3R3M A;  1IP9 A;  3M3J A;  2I1J A;  4HJK A;  4LDT B;  1WZ0 A;  4I6N B;  3SHQ A;  1WI0 A;  2KX3 A;  2MRP A;  4TKN A;  5D7G A;  4I6P A;  3H7S A;  3APC A;  1GC6 A;  4WWO A;  4MGK E;  3ZLZ A;  4TUU A;  1RFA A;  3A9J B;  3PVL A;  2K8B A;  3ZRF A;  1V6E A;  2K1F A;  3EEC A;  2LAS A;  2LVO A;  4BKS A;  1RRB A;  4E3C A;  2YVC A;  4AP4 C;  4IG7 B;  4N9F 4;  4F8C B;  1S3S G;  2G45 B;  3VTW A;  1WGY A;  4II2 B;  5DPT A;  3ZTD A;  4OVU A;  2MW5 A;  3I3T B;  2MCN B;  3VXW A;  3N3K B;  1V9J A;  2KFJ A;  5CHW A;  1P3Q U;  4G50 A;  3AUL A;  3C0R B;  2CKH B;  4GDK A;  3A4R A;  4ICV A;  3DVN V;  4HPL B;  4WJO A;  4DHJ D;  3TBL D;  3QWZ B;  1L2N A;  2JRH A;  2KWU B;  2KJH B;  2KMC A;  1WXA A;  3DBR I;  3JSV A;  2IBI B;  3DDC B;  5FR6 A;  4RMA A;  4FHJ A;  2DZK A;  4EZK A;  3APF A;  1WX9 A;  4MSQ B;  2KO3 A;  4FN2 A;  4B95 A;  4IW0 A;  3A4S C;  3R7R A;  1V80 A;  1TTN A;  1T0Y A;  4MM3 A;  2PE9 A;  3L13 A;  4MH0 E; 
#chains in the Genus database with same CATH topology
 4IWO A;  3V61 A;  2LMC A;  2KN5 A;  1N63 A;  4XWT A;  2KN4 A;  3RZW C;  3V6E B;  4L23 A;  3AE9 B;  2NBV B;  4G11 A;  1JWM D;  4W9I A;  3AEA B;  3U30 A;  2CHZ A;  2IPK D;  4BFR A;  5G5G A;  1NYR A;  1FCL A;  2K9X A;  1RWS A;  1TIF A;  4EZL A;  1C4A A;  2G4S A;  2CU3 A;  2FE8 A;  4ANX A;  2AEH A;  4NAW A;  2R61 A;  4MH8 A;  3BII D;  2WQY B;  3P4R B;  3ZGZ A;  1QOA A;  3CST A;  4YL8 A;  2V4L A;  1Q10 A;  2O6V A;  3NRZ A;  4PYZ A;  3DOW A;  3W1S C;  1V49 A;  3R7Q A;  4HXD A;  2PKO A;  1JWU D;  4NQK E;  2FCN A;  3H8H A;  4OVV A;  2K25 A;  4XYC A;  1GJZ A;  3KVF B;  2BKF A;  4C80 A;  1PQS A;  2H89 B;  2EKE C;  2L3Z A;  3H9D A;  2V3N A;  2KWD A;  4DQO C;  2L0F A;  4RF0 A;  3NS8 A;  2K6D B;  2JU6 X;  2OOB B;  2X38 A;  1ISN A;  4US9 A;  1F9J A;  3U8Z A;  1YQB A;  3EA6 A;  2CJO A;  4ZHP A;  2DWQ A;  1IYF A;  4XDD A;  2NR2 A;  4OZB A;  1IBX A;  1KLV A;  2KLC A;  1MHX A;  3IVF A;  2XNA C;  2H88 B;  2FCM A;  2PLP A;  4JIO U;  5FKA C;  2JF5 A;  1D4B A;  1GB1 A;  3J9C A;  4J3O D;  2K3U A;  4DDG D;  1E10 A;  3QK0 A;  4X57 B;  4WUR A;  3SU8 X;  2KOX A;  2BF8 B;  2QIL A;  2MHJ A;  3LDZ E;  4WWM A;  2NBU A;  5HI1 A;  4GDL A;  1UGJ A;  1SIJ A;  3WA0 A;  3Q3N C;  3EUB 2;  4RM8 A;  4W9H A;  4ANV A;  4NAM A;  4TV3 A;  5CTR C;  4Q2J A;  1I4G A;  1SF0 A;  3C8Y A;  1QOB A;  2J7Q B;  1EWC A;  2D5G A;  2K22 A;  3DHH C;  1WXS A;  1PGB A;  4HEA 1;  2FUH B;  2E3T A;  1UBI A;  4TMA B;  4URK A;  1BXT A;  3DVG X;  4HPP A;  3Q8E A;  3ZW3 A;  4F7Z A;  2BTE A;  1IPG A;  1VJK A;  3R2I A;  1FNU A;  2DAF A;  1NEK B;  1L4D B;  4II3 B;  3NHE B;  3HM3 A;  4CYE A;  2V1Y A;  4PS7 A;  2IND C;  3NVW A;  2MBQ A;  4C4V A;  2A5U A;  3BIN A;  3FIL A;  4FJY A;  3Q69 A;  1TZ1 A;  1E8Y A;  1L6V A;  2GBR A;  3VH3 B;  2PVO D;  1R4M B;  4ANU A;  4C7Y A;  4WJP A;  2HJ1 A;  4BBN F;  4K7U A;  2TSS A;  2AL6 A;  2OJW A;  3Q2A C;  2RD0 A;  3L16 A;  5H8Y E;  2ZW0 A;  2KAC A;  4P16 A;  4A9A A;  1WYW B;  1I4R A;  4W9E A;  1FNW A;  3QX1 A;  3I9V 1;  1PUT A;  4DBG A;  1TS2 A;  1L7Y A;  4IDI A;  3N30 A;  2HJ8 A;  1D5X C;  2EMT A;  2DZI A;  2FBW B;  1L0X B;  2WXP A;  2ZCC A;  3JSV B;  2KAJ A;  2N9X A;  4HPM B;  3B1L X;  3P42 A;  3PRP B;  3I5J C;  3KQ4 A;  3N1Z C;  4NJ6 A;  2JZZ A;  2MP2 A;  3MC0 B;  1HZ6 A;  2Z8L A;  2KZR A;  2N7D A;  3GP7 A;  3RI7 C;  3T8M A;  1ZPS A;  2D11 A;  1FEH A;  2NVU I;  1WR6 E;  1QT9 A;  4MJS A;  2L00 B;  4IUM B;  4IWQ A;  3RMK C;  1FRD A;  5LXH A;  1N6Z A;  4DHZ B;  5BYR A;  1WXV A;  4LLG M;  1TBE A;  2WX0 A;  3NZ3 A;  3AED B;  4MEM A;  4MAC A;  2KDI A;  3AE1 B;  2IYD B;  1ZUD 2;  4W9J A;  2JWZ A;  1T0Q C;  2WP9 B;  5L83 A;  4FUL A;  1E7V A;  3VH4 B;  2GMI C;  3AE4 B;  1WXM A;  1JCK B;  2IO3 B;  1K50 A;  2AQ2 B;  4JX1 C;  4AUQ C;  4EUT A;  3W1Y A;  2M0X A;  2OJR A;  1C4P A;  1RLF A;  4ICU A;  1ZP0 B;  1UZX B;  2NTS A;  1L0Y B;  4WQO B;  3I63 C;  1QOF A;  2M0A A;  3V6C B;  4RCO A;  4OVZ A;  1E8Z A;  3IBE A;  2G9H D;  2WXR A;  2LEK A;  3AEE B;  3MC9 A;  3WIM A;  1KFY B;  2AL3 A;  1IUE A;  1WJ6 A;  4RNA A;  2BYE A;  2EKI A;  4NQL B;  3CMM B;  1ET9 A;  3LXF A;  2NPT A;  2VH1 A;  1UNS A;  1A5R A;  3MFG A;  3R2T A;  1EM7 A;  1R4M I;  5JH5 C;  2E6X A;  1D3Z A;  2ASQ A;  2K39 A;  4WAF A;  1X1M A;  5GXG B;  1XT9 B;  1R7S A;  4DXF A;  2GLS A;  3PT2 B;  4ZRJ A;  4DWF A;  2LGY A;  1Q5W B;  4A20 A;  3MP9 A;  1CJE A;  4MDK E;  2FIF A;  2L76 A;  3AM9 A;  3CF6 E;  3KUZ A;  4DXG A;  2EMS A;  4K7W A;  1UH6 A;  3ZJT A;  2J0K A;  2RDH A;  1V86 A;  3UQB A;  4LCD E;  5E6P A;  3RNF C;  3KLS X;  4P1B C;  1OTR B;  1WMH B;  1C78 A;  4ZRQ A;  3Q3J A;  1ZKH A;  2WXM A;  3C19 A;  4KSK C;  1H4R A;  1TS4 A;  2LUE A;  1JWS D;  2MBO A;  2SAK A;  2I1J A;  2W82 A;  3AE2 B;  4LDT B;  1WI0 A;  2MRP A;  4TKN A;  1ET6 A;  1HTQ A;  1F0Z A;  3DBL B;  5D3I B;  2K8B A;  3ZRF A;  2J4X A;  2K1F A;  3EEC A;  2LAS A;  2LVO A;  4E3C A;  2WDR B;  5DPT A;  2JQR B;  4OVU A;  3N3K B;  4S17 A;  3C0R B;  3VR9 B;  1Y56 A;  4ICV A;  3DVN V;  4HPL B;  4WJO A;  1PGX A;  4DHJ D;  3VRA B;  1AYF A;  2DNF A;  4JE3 B;  1WX9 A;  4FN2 A;  4IW0 A;  1F77 A;  3R7R A;  2LUM A;  1T0Y A;  3L13 A;  4WWP A;  2WXH A;  3WAP A;  1I4Q A;  1WGD A;  3VFK A;  1ENF A;  2OHF A;  3KH0 A;  4NZL B;  2INC C;  4IM0 A;  4YSY B;  3D32 A;  4M8M A;  3VR8 B;  4S0R A;  2WXF A;  1YMH E;  1T5X D;  4BBN C;  4HKQ A;  3H1U A;  2M4N A;  2B3A A;  3H7P B;  1TZO A;  3UIO B;  4KZC A;  3L54 A;  1L6U A;  4KDL B;  1GAQ B;  1OEY A;  4LDT D;  2LVP A;  3BYY B;  4YWG G;  5HKH A;  1QKZ A;  4EZJ A;  4GU2 A;  4KV2 A;  2BWF A;  2I2Y A;  2BS4 B;  2GBK A;  2WXQ A;  2MWS B;  2L0T A;  3VDZ A;  4BVU C;  1HZ5 A;  2MJD A;  2KNB A;  3P4P B;  2KHW B;  4KGT A;  4GB9 A;  4JPS A;  4IWP A;  3E56 A;  1N5X A;  3AN1 A;  3SD5 A;  1NBF C;  1XEE A;  3Q8C A;  1E7U A;  5AZG A;  1J8C A;  1QZE A;  2C7M B;  1FFV A;  1PGA A;  3GS2 A;  1HE8 A;  3T3O A;  4LJO B;  2C7N B;  4C00 A;  4G3X B;  3WAL A;  2I38 A;  3HK0 A;  5LNK 1;  4RF1 A;  4QAY A;  2JWU A;  1MHH E;  2KC1 A;  1OQQ A;  3O13 A;  5BMG A;  4RGM A;  2LD9 A;  1CK1 A;  2HDE A;  1I4X A;  3UI3 A;  4XDC A;  4P1C C;  5IO9 A;  5DPR A;  2LGX A;  2WXO A;  3DBL I;  1AWD A;  3OWE B;  1SJE D;  3VRB B;  1LFD A;  3KYC D;  2RGF A;  3B2F A;  1NDD A;  4ITK A;  3ZNZ B;  2SEB D;  3W5U B;  5D94 A;  5GMV A;  1YQ3 B;  3ABV B;  2OED A;  1WJN A;  2DBY A;  1SE3 A;  4P6V F;  2QJL A;  4ZRP A;  2INP E;  1XO3 A;  1N62 A;  1S1Q B;  3AH7 A;  1XLP A;  1C76 A;  1XLN A;  3GE3 C;  5H92 C;  3DPD A;  3HRD D;  2CHX A;  2WXK A;  1AW7 A;  2ZVN A;  2KX0 A;  2D10 A;  1E8X A;  1F2R C;  3IAM 1;  4RH6 A;  2DYB A;  2JRI B;  3KYD D;  4A3O A;  4A6Q A;  4K7S A;  2BWE S;  4MGI E;  2KMM A;  4W9F A;  5KHO A;  1YNT E;  1UBQ A;  3BZD B;  2O2V B;  3QA8 A;  3V05 A;  2WDV B;  3VUY A;  5G5H A;  3PV1 A;  4HLE A;  2V3S A;  1OFF A;  3P1M A;  1G6J A;  1WGR A;  4ZRK A;  5BYQ A;  2G1E A;  3R66 C;  4NJ7 A;  3CWI A;  4JLC A;  4LNI A;  5EDS A;  4MSM B;  1WF9 A;  2IY0 B;  1I42 A;  5D6J B;  3RUI B;  1GG3 A;  3A33 B;  3ML8 A;  2N1W A;  1TKG A;  2Z59 B;  3AEF B;  1K52 A;  3TEY A;  3TL5 A;  3HUI A;  1V97 A;  2VRR B;  4OZA A;  2JXX A;  2D3C A;  4JQW C;  2KK8 A;  4K81 A;  4W9L A;  3DVG Y;  2N4F A;  1JW9 D;  1VZ7 A;  2Y3A A;  1UD7 A;  1WIA A;  1MG4 A;  1KF6 B;  4AS1 A;  1U4A A;  2C7H A;  4LNK A;  3EGR A;  4WQM A;  2G4D B;  2CR5 A;  1C9F A;  2D2Q A;  1WE7 A;  3BWU D;  3Q3O C;  1VZ6 A;  2BGF A;  3NOB A;  2BYV E;  4EE2 A;  3LYY A;  3T3N A;  3PS6 A;  4FBJ B;  3AE7 B;  2R2O A;  2MSE D;  4DXA B;  2C5L C;  4RM9 A;  2K5P A;  3KUC B;  3L10 B;  3MC8 A;  4EFO A;  2KAN A;  5AUI A;  2LGI A;  3W1S A;  3N20 C;  4NAW B;  4D2K A;  2VH2 A;  3ALB A;  1V8C A;  2C9W B;  3AE8 B;  5EE3 A;  4FA6 A;  2RSU A;  2MBE A;  2KQ7 A;  4ASW C;  3ZJU A;  1MPE A;  3DBR B;  1L5P A;  4RGT A;  4NPN A;  1TS3 A;  2ZPN A;  4BKS D;  1YIW A;  5CHF A;  1E8W A;  1P7F A;  2HD5 B;  3PZ7 A;  2JZP A;  1P98 A;  1E0Z A;  3U4E G;  4WAA A;  3ZRC A;  5AUK A;  3RUL A;  2BB6 A;  2N1V A;  3BVZ A;  2BYF A;  2KFK B;  2KVZ A;  4KIK B;  1SB3 C;  1T0S C;  2PW9 A;  2WWZ A;  1YX6 B;  4WJQ A;  1E9M A;  3NJT A;  4IOI E;  4DDI D;  1WWT A;  3K9P B;  1YD8 U;  2WGS A;  3QAQ A;  4MGY E;  3A1Q B;  1EF5 A;  1WGK A;  4BAX A;  3ETR A;  3L4P A;  4PS8 A;  1EUV B;  4GIV A;  3PRM B;  4TSS A;  4ZRI A;  3PTF C;  3ZTC A;  1SE4 A;  1IBX B;  1XXG A;  2WU5 B;  1LGR A;  2G3Q B;  2N7J A;  2KDE B;  2KMA A;  1YN5 A;  4M00 A;  4KX6 B;  5IA7 A;  3RZF A;  1E5W A;  2R2Q A;  3MHS D;  1AAR A;  2IO2 B;  2INN E;  3S2A A;  2RPQ A;  2O6V D;  5G2N A;  4YSX B;  1DOY A;  5IKC M;  1YJJ A;  4LNF A;  1K8R B;  1J7C A;  1IGC A;  4K1R B;  2WYQ A;  4GDL B;  2GB1 A;  4MM3 B;  4LTU A;  4B9K A;  1FXT B;  1C79 A;  1JRU A;  5C2T B;  3JVZ X;  4OHJ A;  3MJW A;  3AV8 A;  2LJI A;  1PFD A;  2WXG A;  1D5M C;  4I6N B;  4M02 A;  5JXV A;  3H7S A;  3APC A;  4MGK E;  4A55 A;  1C4C A;  1CQV A;  1LO5 D;  2V3P A;  3A9J B;  3DBH B;  2YVC A;  4AP4 C;  2G45 B;  1UUP A;  2MCN B;  1VRA B;  2KFJ A;  4KGR A;  1P3Q U;  4G50 A;  1E6E B;  1FIQ A;  4GDK A;  3A4R A;  3IAS 1;  2AQ1 B;  3QWZ B;  3DBR I;  2IBI B;  5FR6 A;  2DZK A;  3APF A;  4MSQ B;  2KO3 A;  4B95 A;  3A4S C;  1V80 A;  2M56 B;  5BMH A;  2LWP A;  3AE3 B;  3PGE A;  1FCC C;  1STE A;  3FIL B;  1WM2 A;  1WJ4 A;  3QCA A;  3SR6 A;  4PYU A;  5J18 A;  5E6O A;  2KVR A;  1F2R I;  1WRI A;  2EEL A;  1V1P B;  4KVG B;  1GPX A;  3M63 B;  2MEK A;  3A9K A;  3PZ8 A;  3NVV A;  4BZA A;  2M17 A;  4GGQ A;  1OQR A;  3PSE B;  2D3G A;  4TQ0 A;  1J7B A;  3I57 A;  3OG5 A;  1VLB A;  3CIR B;  2JSV X;  4US8 A;  5CX3 A;  2RPV A;  2J52 A;  2M8S A;  2CJN A;  4KZ0 A;  4L2Y A;  2IO0 B;  4DHJ B;  2GRI A;  4WWN A;  3ZQ4 A;  1NI2 A;  2J42 A;  1ZDX A;  2WXN A;  2GBJ A;  3WAM A;  1OQY A;  3B0A A;  3N1X C;  1FPY A;  4RGO S;  1MVK A;  1WH3 A;  3Q6B A;  5DPW A;  3RNB C;  2WLB A;  5J17 A;  1UEL A;  2DLB A;  1YJI A;  1KOT A;  4AJY B;  3L0W B;  1WYG A;  1JWA D;  1C1Y B;  3SFE B;  2W55 A;  2AX5 A;  3H7P A;  1TGZ B;  4A8X C;  1IGD A;  1UWX A;  1XLO A;  2DHZ A;  1HA5 A;  3PRZ A;  2BS3 B;  4YSZ B;  1I4P A;  4FJZ A;  1V81 A;  1I4H A;  3VHT C;  1XQQ A;  4XE0 A;  5JHA A;  2BVC A;  4KDI C;  2LXC A;  3MTN B;  1TY2 A;  4NNJ B;  3DBH I;  1J19 A;  4M8N A;  1F1H A;  1K53 A;  2LRW A;  4KSL C;  4JWS C;  5T8I A;  2FCQ A;  4GOC A;  3ZNI D;  2J53 A;  2LXA A;  3UIN B;  1FMA D;  2KTR B;  4LJP B;  4C7Z A;  3ZNH B;  1BUI C;  4HWI B;  4ANW A;  1NI3 A;  2JYE A;  2MBH A;  4YXD B;  3Q3M C;  3TEX A;  3V60 A;  2NTT A;  5LXI B;  4IM3 A;  4GSW A;  1ZDV A;  5EE0 A;  1FO4 A;  2PPH A;  2XK5 B;  2N9P C;  2JXT A;  4YTM B;  4GXB A;  3AI5 A;  3ZKJ C;  3EFU A;  1J0G A;  1H8C A;  2KYW A;  4XWW A;  4BKT A;  1KTK A;  3RFZ B;  3QC8 B;  1LM8 B;  1HXY D;  4BKG A;  4AQ7 A;  1FD6 A;  2B76 B;  1D5Z C;  3N32 A;  4OZC A;  4K3B A;  4ZYS A;  1SXT A;  4CHK A;  5LLI A;  2W9N A;  1B9R A;  2BKR B;  1P7E A;  4L1B A;  5AEK B;  1JAL A;  5IAA C;  1JQ4 A;  1P0R A;  2NCN A;  2N9E B;  2ZNV B;  4EOY A;  5TR5 A;  3Q14 C;  3B2G A;  2HE7 A;  2JT4 B;  1XF5 L;  1Q1O A;  4NJC A;  5TSS A;  2YLM A;  3ONS A;  2A4Z A;  2KQS A;  3H6N A;  2Z0D B;  4B0E A;  1C3T A;  1PYW D;  3JYU A;  2GBM A;  2WX1 A;  1ACC A;  2NMQ A;  1WFY A;  4ZDV A;  2GI9 A;  3PPA A;  2C60 A;  3ZO5 B;  3L08 A;  1DGJ A;  1TS5 A;  3OJ4 B;  2MQJ A;  1LQB A;  2KJR A;  1EF1 A;  5J2R A;  5KHQ A;  2O2V A;  4H2A A;  2N0S B;  2XN9 C;  5JHB A;  1V5O A;  2V0G A;  3CSF A;  3QAR A;  1RAX A;  1WY8 A;  1WZ3 A;  3IXS A;  4W9G A;  2CS4 A;  1WGG A;  2LGD A;  4E74 A;  3RNG C;  2Q5W D;  4EKU A;  3N1Y C;  3GOE A;  3NS1 A;  1SE9 A;  2KDF B;  3R8B A;  2L7R A;  2D3B A;  1YN4 A;  3M62 B;  2I1K A;  2Y5C A;  5FK9 C;  4IKG A;  2IZV B;  1VZ8 A;  1T0R C;  2BQQ A;  2X8X X;  1JRP A;  2IGG A;  1YN3 A;  5EE9 A;  3KUD B;  2IO1 B;  2DX5 B;  2CU1 A;  2UWQ A;  2LJ5 A;  1DOX A;  1KRH A;  3EHV A;  3N9Y C;  1UGM A;  4HRS A;  3SDL C;  1JWB D;  1R4N B;  2ONQ A;  4XX5 A;  4A3P A;  2DYM A;  2L83 A;  2YEP B;  2Z0E B;  3W9C B;  5G55 A;  3ZDM C;  3RN9 C;  3ZNG C;  2ZPY A;  3W5V B;  3AU4 A;  1XCQ L;  2MLB A;  4I6L B;  3P63 A;  3ZYY X;  1JML A;  2L05 A;  2PIA A;  3AMZ A;  1N60 A;  2RDG A;  4C56 C;  4FLH A;  3V62 A;  1ZXH A;  2L8J A;  4ZHO A;  3AE6 B;  3UQA A;  5C23 A;  1B1Z A;  1V2Y A;  3ZUN A;  2LVQ A;  3P4Q B;  3VUW A;  3KW5 B;  3U7Z A;  1GC7 A;  1FXI A;  4CQN A;  2WDQ B;  4OW0 A;  4FJV B;  4HCP B;  3U52 E;  4HKZ E;  3B9J A;  2QDF A;  4N58 A;  2L1A A;  4B0M A;  3KWL A;  4ZOH C;  2RDB C;  3QQ8 B;  3TMP B;  4YTN B;  4GN1 A;  4J6I A;  2QSD A;  3BVG A;  2QCZ A;  2BB5 A;  3NUH B;  3HHM A;  2J0J A;  2QC8 A;  1J7A A;  2ZZP B;  3ML9 A;  1WR1 A;  2KC2 A;  2W3R A;  4REZ A;  2LGS A;  4GLS C;  2NBW B;  4F1S A;  3RPF C;  3DBS A;  5CHV C;  2ZCB A;  4LNN A;  1T6B X;  4EEW A;  3W2D A;  1CMX B;  1WGH A;  3IT4 B;  2WXI A;  4DK5 A;  2RR9 A;  1I7H A;  1EO6 A;  2KD0 A;  5AZH A;  4WH4 A;  2DYO A;  2KWV B;  4HRO A;  4GMV A;  3SEB A;  4M0W B;  2KFK A;  4KIK A;  1Y8R C;  1ZE3 D;  3IG3 A;  5C3J B;  5MPO A;  2FUG 1;  4ZYN A;  4DHZ E;  3AU5 A;  1FXA A;  1KLU D;  2FCS A;  4YT0 B;  2JY6 A;  1N5W A;  1R4N I;  3A1Q A;  3K9O B;  1KLG D;  1KM7 A;  4PT5 A;  1ZOY B;  4W9K A;  1SBB B;  3R3M A;  1IP9 A;  1RM6 C;  3M3J A;  3BYT B;  3U2S C;  4HJK A;  1WZ0 A;  3SHQ A;  2KX3 A;  2YEP F;  4WWO A;  2QEJ C;  4KKI A;  3ZLZ A;  1MI0 A;  4TUU A;  2JX5 A;  1RFA A;  3PVL A;  2L52 A;  1V6E A;  1RRB A;  2WXJ A;  2N9K A;  4F8C B;  2MW5 A;  3VXW A;  5CHW A;  1WSP A;  4K3C A;  3TBL D;  1L2N A;  2KWU B;  2KMC A;  3JSV A;  2BT6 A;  2LHD A;  4RMA A;  4FHJ A;  4EZK A;  1CZP A;  1TTN A;  4MM3 A;  3VTW A;  2PE9 A;  1JRO A;  2HTM E;  3Q3F A;  2O6V B;  3MHZ A;  2N9L A;  3WAN A;  4XGA B;  2FAZ A;  2V4I B;  3AEB B;  1P9D U;  3HIZ A;  2BPS A;  3SFD B;  3A9J A;  1TKE A;  2IGD A;  3AXC A;  5HG2 A;  4PS3 A;  2JVC A;  3TSS A;  4E71 A;  1WX7 A;  1RFK A;  5BO4 B;  3AEC B;  1BML C;  3DCG A;  3DHG C;  4ARI A;  1QQR A;  3FAH A;  1Q0W B;  2QIE B;  2KDM A;  4P7I A;  5L95 C;  1YQ4 B;  3RNC C;  4FHK A;  3DHI C;  3NVZ A;  4IC7 B;  2UYZ B;  2QMT A;  2WS3 B;  1SJH D;  2KWC A;  1OEY J;  1GOZ A;  3GZN B;  1GUA B;  4HDO A;  1V1P A;  4AJW A;  1GNU A;  2MA9 B;  3AEG B;  3LJ3 A;  4M01 A;  2MJ3 A;  2K0P A;  5DPS A;  2J0M A;  5JZE B;  3VUX A;  2WHI A;  1Z2M A;  1EU3 A;  3UGB B;  4IM2 A;  1TJE A;  3NZU A;  3NVY A;  1WM3 A;  3VQI A;  2K8H A;  5E6N A;  2Y5P A;  2NS5 A;  2DZM A;  2D07 B;  2MJE A;  2PJH A;  2KDB A;  4MGZ E;  1FNV A;  4R3D A;  4TQ1 A;  3IHP C;  4G0N B;  3OJ3 A;  3Q8A A;  2W54 A;  3ZIM A;  1VD2 A;  3L17 A;  4AOF A;  4N59 A;  1PDX A;  1QLB B;  3GB1 A;  4HVB A;  1ROE A;  4AWJ A;  2JUO A;  2M1M A;  2QHO A;  3NZS A;  1QOG A;  5C1Z A;  1WJU A;  1F52 A;  4HK2 A;  2PVG C;  2ZEQ A;  5HHD G;  2FID A;  3WAO A;  2JZ3 B;  2LRU A;  1WMH A;  2ZNV C;  5HFY A;  3TJP A;  2L32 A;  3UF8 A;  4C4V B;  1M4V A;  2JYT A;  3X0W A;  3VVW B;  1SGH A;  1V5T A;  1HTO A;  3QJZ A;  5BYS A;  3X23 A;  1VDV A;  1SIF A;  2HTH A;  1LXD A;  2PE6 B;  3TEZ A;  1UWM A;  4N6E B;  1VCB A;  3APD A;  4HCN B;  1NYQ A;  1AN8 A;  1YOV B;  2KTR A;  2KKC A;  3Q8F A;  1WE6 A;  3PHW B;  2FNJ B;  2AQ3 B;  1E90 A;  3DWM A;  5E6J A;  3TUO A;  2KJ6 A;  1MFW A;  1FRR A;  4ARC A;  1ZW7 A;  3RNA C;  3QHT A;  3HVZ A;  3RCZ A;  4BOZ B;  3OLM D;  1XD3 B;  2XK5 A;  1TY0 A;  2ACZ B;  3ENE A;  2WDT B;  2LI5 A;  3V3X A;  2WU2 B;  3BY4 B;  3EC8 A;  4FAD A;  3GZN I;  4UDU C;  2KTF A;  3ECI A;  3HVD A;  3O65 B;  2RMM A;  2BYT A;  2DEN B;  3HM6 X;  5I4D A;  2ZJD A;  4MT5 A;  1K51 A;  3PLU A;  1XCT L;  2KT7 A;  2MP2 B;  1SEB D;  3ZDT A;  2ON8 A;  2XBB C;  1I35 A;  4HJG E;  2K6Q A;  4MJS B;  1NEN B;  3VTU A;  5BMI A;  3RYT A;  1QF6 A;  3GE8 C;  1A70 A;  4MEL A;  3ZVV A;  3JW0 X;  1D6E C;  2N7E A;  1GB4 A;  4GDK B;  1YX5 B;  3QIJ A;  3P4S B;  1FM0 D;  3BK2 A;  5IOI A;  2ICI A;  3BK1 A;  2MH7 A;  3EFC A;  4W9C A;  2PMV A;  1HEZ E;  4NY0 A;  4PK1 A;  1Z5S B;  4XC2 A;  2BBC A;  3PZD A;  2XEW A;  4KGS A;  4USA A;  2GOW A;  3OAW A;  2KLG A;  2PEA A;  2VZK B;  1L0V B;  2Y5B B;  4HDQ A;  3TEW A;  1P1A A;  3A9K B;  1UF0 A;  4B6W A;  1EWY C;  3FC4 A;  2KQ4 X;  1WX8 A;  1L4Z B;  2NPT B;  4JL9 A;  1NVI D;  3ZXV A;  2V9H A;  2MX2 A;  3TCA A;  2ZVO A;  2M19 A;  2REX A;  3PHX B;  1EU4 A;  3NY5 A;  3DWG C;  2LZ6 A;  1BT0 A;  1V1O A;  3LB8 C;  4O1N A;  3B08 A;  2UU7 A;  2DAJ A;  3NG0 A;  3PRE A;  4KKJ A;  4W9D A;  4ACF A;  3UIP B;  3RD2 A;  4CO7 A;  3RT3 B;  2AWT A;  1MG8 A;  1KJT A;  2AYO B;  2W3S A;  3VTV A;  4JGH B;  4RFB A;  1HQR D;  2DZJ A;  1ZXI A;  2CHW A;  3DQV A;  1E7P B;  1WRD B;  2K8C A;  1ESF A;  4FXC A;  2MBB B;  1DOI A;  2IY1 B;  3ZJV A;  2VZK D;  3Q8B A;  5AZF A;  5IP4 D;  3T9L A;  3U7D A;  1RYJ A;  3MJ5 A;  5D3D A;  3IFW B;  1MJD A;  1QIL A;  3BVM A;  1ZGU B;  3E9S A;  4BOS C;  2BS2 B;  4RGN A;  3PO0 A;  3VAW A;  3ZXR A;  2LFI A;  1OGW A;  3RNE C;  2IGH A;  3AB5 A;  5FR3 A;  2JPH A;  1WXQ A;  3P2B A;  4WJN A;  3TIX A;  3M95 A;  5D2M B;  1TT5 B;  3KWV A;  3PLV A;  2WNM A;  3IT6 B;  1KH0 A;  3AE5 B;  1TKY A;  1YJ1 A;  1M94 A;  2GBN A;  4XZ4 A;  2ZW1 A;  3DVN U;  2KXJ A;  3FKY A;  5DCN A;  1C77 A;  1FFU A;  3URY A;  4A90 A;  2D3A A;  5D7G A;  4I6P A;  2LHE A;  2IJ0 A;  1GC6 A;  1SSN A;  2IDY A;  4LK0 M;  5IN7 A;  4BKS A;  4IG7 B;  4N9F 4;  1S3S G;  1N61 A;  1WGY A;  4II2 B;  3ZTD A;  4M0W A;  2PTL A;  3I3T B;  2WXL A;  1V9J A;  1DYQ A;  3AUL A;  1XLQ A;  2CKH B;  4LNO A;  4YTP B;  5EE1 A;  1VR9 A;  2JRH A;  2KJH B;  1WXA A;  2BW2 A;  3DDC B;  3WCQ A;  4WIP A;  4JWU C;  1TYG B;  1SE2 A;  1T3Q A;  4MH0 E; 
#chains in the Genus database with same CATH homology
 2LWP A;  4IWO A;  3Q3F A;  3PGE A;  3V61 A;  2O6V B;  4WWP A;  3WAP A;  2KN5 A;  1WGD A;  3VFK A;  3RZW C;  3V6E B;  3KH0 A;  3WAN A;  1WM2 A;  2FAZ A;  1WJ4 A;  2NBV B;  4G11 A;  3QCA A;  1P9D U;  4IM0 A;  3HIZ A;  4W9I A;  3U30 A;  4PYU A;  5J18 A;  3D32 A;  2CHZ A;  5E6O A;  4BFR A;  2BPS A;  2KVR A;  4M8M A;  3A9J A;  4KVG B;  4EZL A;  3AXC A;  3M63 B;  2G4S A;  4PS3 A;  2JVC A;  4E71 A;  1WX7 A;  3A9K A;  4BBN C;  4ANX A;  5BO4 B;  2AEH A;  3H1U A;  2M4N A;  2M17 A;  2B3A A;  3H7P B;  4GGQ A;  4NAW A;  3UIO B;  4KZC A;  3L54 A;  3PSE B;  2D3G A;  4TQ0 A;  3DCG A;  4KDL B;  1OEY A;  4LDT D;  2LVP A;  5HKH A;  5CX3 A;  3CST A;  4EZJ A;  1Q0W B;  4YL8 A;  2V4L A;  4GU2 A;  2M8S A;  4KV2 A;  4P7I A;  5L95 C;  2BWF A;  4KZ0 A;  2O6V A;  4FHK A;  4PYZ A;  3DOW A;  2IO0 B;  3W1S C;  1V49 A;  4DHJ B;  4IC7 B;  3R7Q A;  4WWN A;  2GBK A;  2MWS B;  1NI2 A;  2L0T A;  4HXD A;  3VDZ A;  2UYZ B;  4BVU C;  2GBJ A;  3WAM A;  2KNB A;  2KWC A;  1OQY A;  3B0A A;  1OEY J;  2KHW B;  4GB9 A;  1WH3 A;  4IWP A;  4NQK E;  5DPW A;  1GUA B;  2FCN A;  4OVV A;  2K25 A;  4HDO A;  3SD5 A;  4AJW A;  1NBF C;  5J17 A;  1UEL A;  1KOT A;  1E7U A;  1GNU A;  2MA9 B;  3LJ3 A;  5AZG A;  4AJY B;  1QZE A;  1J8C A;  3L0W B;  2C7M B;  3KVF B;  2BKF A;  1GJZ A;  5DPS A;  2J0M A;  1C1Y B;  1HE8 A;  3VUX A;  5JZE B;  1PQS A;  4LJO B;  3H7P A;  1Z2M A;  2C7N B;  2EKE C;  1TGZ B;  2L3Z A;  3H9D A;  4G3X B;  3UGB B;  4IM2 A;  2DHZ A;  2L0F A;  3WAL A;  3NZU A;  3HK0 A;  1WM3 A;  3VQI A;  2K8H A;  3PRZ A;  5E6N A;  2NS5 A;  2K6D B;  3NS8 A;  2OOB B;  2KC1 A;  2DZM A;  4FJZ A;  2D07 B;  1V81 A;  2PJH A;  1ISN A;  2KDB A;  2LD9 A;  4MGZ E;  1F9J A;  4TQ1 A;  3U8Z A;  3IHP C;  4G0N B;  1XQQ A;  1YQB A;  3OJ3 A;  3VHT C;  5JHA A;  3ZIM A;  1VD2 A;  4KDI C;  5DPR A;  2LXC A;  1IYF A;  2LGX A;  3DBL I;  3MTN B;  3L17 A;  2NR2 A;  4NNJ B;  3DBH I;  1KLV A;  1J19 A;  4AOF A;  4M8N A;  1LFD A;  2KLC A;  3IVF A;  3KYC D;  4HVB A;  2LRW A;  2RGF A;  4AWJ A;  4KSL C;  1NDD A;  2FCM A;  3ZNZ B;  2JUO A;  4JIO U;  2FCQ A;  2JF5 A;  2M1M A;  2QHO A;  3NZS A;  5D94 A;  4GOC A;  3ZNI D;  2LXA A;  3UIN B;  5GMV A;  5C1Z A;  1WJU A;  2KTR B;  1WJN A;  4LJP B;  3ZNH B;  4HK2 A;  4HWI B;  4DDG D;  4ANW A;  2ZEQ A;  2MBH A;  2FID A;  3QK0 A;  3WAO A;  1S1Q B;  2JZ3 B;  4X57 B;  2LRU A;  3SU8 X;  1WMH A;  2KOX A;  3DPD A;  2ZNV C;  2BF8 B;  3V60 A;  2CHX A;  3LDZ E;  2NBU A;  5LXI B;  4IM3 A;  4GDL A;  4GSW A;  3TJP A;  2ZVN A;  3WA0 A;  2KX0 A;  2D10 A;  1E8X A;  2PPH A;  2XK5 B;  3UF8 A;  2N9P C;  4GXB A;  4RM8 A;  4W9H A;  3AI5 A;  3ZKJ C;  3EFU A;  3X0W A;  4ANV A;  1J0G A;  1H8C A;  2DYB A;  2JRI B;  3KYD D;  3VVW B;  1SGH A;  4TV3 A;  5CTR C;  4A3O A;  1V5T A;  3QJZ A;  4BKT A;  3X23 A;  3QC8 B;  4K7S A;  2BWE S;  4MGI E;  1SIF A;  2HTH A;  1LM8 B;  2J7Q B;  1LXD A;  2PE6 B;  4BKG A;  4W9F A;  5KHO A;  1WXS A;  3N32 A;  2FUH B;  1VCB A;  3APD A;  4HCN B;  1UBI A;  1UBQ A;  4URK A;  4CHK A;  2O2V B;  3QA8 A;  5LLI A;  3DVG X;  2W9N A;  2KTR A;  2BKR B;  2KKC A;  5AEK B;  1WE6 A;  3PHW B;  3VUY A;  3ZW3 A;  4F7Z A;  2FNJ B;  1E90 A;  5IAA C;  1IPG A;  1P0R A;  2KJ6 A;  3PV1 A;  2NCN A;  2N9E B;  2ZNV B;  1ZW7 A;  4HLE A;  4EOY A;  5TR5 A;  2DAF A;  2V3S A;  2HE7 A;  2JT4 B;  3QHT A;  4II3 B;  3NHE B;  3RCZ A;  3HM3 A;  4BOZ B;  1G6J A;  4CYE A;  1WGR A;  4ZRK A;  1Q1O A;  2V1Y A;  3OLM D;  2YLM A;  4PS7 A;  1XD3 B;  3ONS A;  2XK5 A;  2A4Z A;  2KQS A;  3H6N A;  2Z0D B;  3ENE A;  2MBQ A;  2WDT B;  2LI5 A;  3JYU A;  1C3T A;  2GBM A;  2WX1 A;  2A5U A;  3BIN A;  3R66 C;  4NJ7 A;  3BY4 B;  3EC8 A;  4FAD A;  4FJY A;  4JLC A;  5EDS A;  3GZN I;  1WFY A;  4MSM B;  4ZDV A;  1WF9 A;  2KTF A;  1TZ1 A;  3ECI A;  3PPA A;  2C60 A;  3ZO5 B;  3L08 A;  3O65 B;  2IY0 B;  1I42 A;  1E8Y A;  5D6J B;  2DEN B;  2GBR A;  3HM6 X;  3OJ4 B;  2MQJ A;  3RUI B;  1LQB A;  2ZJD A;  1GG3 A;  2KJR A;  3VH3 B;  1EF1 A;  5J2R A;  3A33 B;  3ML8 A;  4ANU A;  5KHQ A;  3PLU A;  2MP2 B;  2O2V A;  4WJP A;  5JHB A;  1V5O A;  3ZDT A;  3CSF A;  3QAR A;  1RAX A;  2N1W A;  2Z59 B;  1WY8 A;  1WZ3 A;  2XBB C;  4BBN F;  4K7U A;  2AL6 A;  1I35 A;  4W9G A;  2CS4 A;  1WGG A;  2LGD A;  4E74 A;  2RD0 A;  3L16 A;  3TL5 A;  2K6Q A;  4EKU A;  3GOE A;  1SE9 A;  4MJS B;  3VTU A;  1WYW B;  2KDF B;  2L7R A;  2VRR B;  3RYT A;  4W9E A;  2JXX A;  2I1K A;  3M62 B;  3QX1 A;  4MEL A;  4JQW C;  3ZVV A;  4DBG A;  2KK8 A;  1L7Y A;  3N30 A;  4K81 A;  4W9L A;  3JW0 X;  2IZV B;  3DVG Y;  2N4F A;  2HJ8 A;  2N7E A;  1UD7 A;  1WIA A;  2EMT A;  2DZI A;  4GDK B;  1YX5 B;  1U4A A;  3QIJ A;  2C7H A;  2ZCC A;  3JSV B;  2G4D B;  2CR5 A;  2N9X A;  2D2Q A;  3KUD B;  2IO1 B;  4HPM B;  3B1L X;  2DX5 B;  1WE7 A;  2CU1 A;  2UWQ A;  2LJ5 A;  4W9C A;  3NOB A;  2BGF A;  2BYV E;  3EHV A;  1UGM A;  3PRP B;  4NY0 A;  3SDL C;  1Z5S B;  3PS6 A;  4NJ6 A;  2JZZ A;  4FBJ B;  2MP2 A;  2KZR A;  2N7D A;  4XC2 A;  4XX5 A;  4A3P A;  3PZD A;  2DYM A;  3T8M A;  2R2O A;  2MSE D;  2XEW A;  2D11 A;  2Z0E B;  2NVU I;  4DXA B;  5G55 A;  1WR6 E;  3ZDM C;  2GOW A;  2C5L C;  3OAW A;  2KLG A;  3ZNG C;  2PEA A;  4RM9 A;  4MJS A;  2Y5B B;  2ZPY A;  4HDQ A;  3KUC B;  2L00 B;  4IUM B;  3AU4 A;  3L10 B;  4IWQ A;  2MLB A;  4I6L B;  5LXH A;  4EFO A;  4DHZ B;  2L05 A;  2KAN A;  1P1A A;  3A9K B;  1WXV A;  3W1S A;  4FLH A;  4NAW B;  3V62 A;  4B6W A;  1TBE A;  3ALB A;  2C9W B;  2WX0 A;  1WX8 A;  2L8J A;  2NPT B;  3UQA A;  4FA6 A;  4MEM A;  4JL9 A;  5C23 A;  2KDI A;  2RSU A;  2MBE A;  2KQ7 A;  1V2Y A;  4ASW C;  2MX2 A;  2IYD B;  3TCA A;  3ZUN A;  4NPN A;  2LVQ A;  2JWZ A;  4W9J A;  2ZVO A;  2ZPN A;  2REX A;  5L83 A;  4FUL A;  4BKS D;  1YIW A;  3PHX B;  1E7V A;  5CHF A;  3VH4 B;  3NY5 A;  2GMI C;  1E8W A;  3VUW A;  1WXM A;  2LZ6 A;  1BT0 A;  3KW5 B;  2HD5 B;  1GC7 A;  1P98 A;  2IO3 B;  3B08 A;  2DAJ A;  4W9D A;  3PRE A;  4FJV B;  4AUQ C;  4EUT A;  3W1Y A;  2M0X A;  3UIP B;  2OJR A;  4WAA A;  1RLF A;  3RD2 A;  3ZRC A;  4ICU A;  4HCP B;  1UZX B;  3RUL A;  4CO7 A;  3RT3 B;  2AWT A;  1MG8 A;  4WQO B;  2N1V A;  1KJT A;  3V6C B;  1E8Z A;  2AYO B;  2BYF A;  3IBE A;  3VTV A;  4JGH B;  2KFK B;  4KIK B;  3QQ8 B;  3WIM A;  2AL3 A;  3TMP B;  1WJ6 A;  2WWZ A;  2DZJ A;  4GN1 A;  2BYE A;  1YX6 B;  4NQL B;  3CMM B;  4WJQ A;  4J6I A;  3HHM A;  2NPT A;  4DDI D;  2J0J A;  2CHW A;  1A5R A;  1R4M I;  3DQV A;  1WRD B;  2ZZP B;  1YD8 U;  3K9P B;  3ML9 A;  1WR1 A;  2K8C A;  5JH5 C;  1D3Z A;  2ASQ A;  2K39 A;  2MBB B;  1X1M A;  2KC2 A;  3QAQ A;  4MGY E;  2IY1 B;  3A1Q B;  1XT9 B;  2NBW B;  1EF5 A;  4F1S A;  5AZF A;  3T9L A;  3U7D A;  3PT2 B;  1EUV B;  4PS8 A;  3DBS A;  5CHV C;  4ZRJ A;  4DWF A;  2LGY A;  4GIV A;  1Q5W B;  3IFW B;  4A20 A;  2ZCB A;  3PRM B;  4ZRI A;  3PTF C;  4EEW A;  3ZTC A;  4MDK E;  1ZGU B;  1CMX B;  2FIF A;  2G3Q B;  1WGH A;  2L76 A;  4BOS C;  2KDE B;  3CF6 E;  2KMA A;  3KUZ A;  4DK5 A;  2RR9 A;  3VAW A;  2EMS A;  1EO6 A;  1OGW A;  5IA7 A;  4K7W A;  2KD0 A;  3RZF A;  1E5W A;  1UH6 A;  5AZH A;  2DYO A;  2J0K A;  2KWV B;  2R2Q A;  4GMV A;  4M0W B;  3MHS D;  2JPH A;  3P2B A;  1AAR A;  2KFK A;  1V86 A;  2IO2 B;  4KIK A;  4WJN A;  3M95 A;  5D2M B;  3TIX A;  4LCD E;  3UQB A;  1Y8R C;  3IG3 A;  3PLV A;  5E6P A;  3S2A A;  2RPQ A;  2O6V D;  5G2N A;  1OTR B;  1WMH B;  1YJ1 A;  1K8R B;  1M94 A;  4ZYN A;  2GBN A;  4DHZ E;  3AU5 A;  4K1R B;  2WYQ A;  4GDL B;  3Q3J A;  2FCS A;  4XZ4 A;  1ZKH A;  2JY6 A;  1R4N I;  3A1Q A;  3DVN U;  4B9K A;  1FXT B;  3K9O B;  2KXJ A;  1KM7 A;  4KSK C;  1JRU A;  1H4R A;  4W9K A;  2LUE A;  3JVZ X;  5DCN A;  3MJW A;  2MBO A;  3R3M A;  1IP9 A;  3M3J A;  2I1J A;  4HJK A;  4LDT B;  1WZ0 A;  4I6N B;  3SHQ A;  1WI0 A;  2KX3 A;  2MRP A;  4TKN A;  5D7G A;  4I6P A;  3H7S A;  3APC A;  1GC6 A;  4WWO A;  4MGK E;  3ZLZ A;  4TUU A;  1RFA A;  3A9J B;  3PVL A;  2K8B A;  3ZRF A;  1V6E A;  2K1F A;  3EEC A;  2LAS A;  2LVO A;  4BKS A;  1RRB A;  4E3C A;  2YVC A;  4AP4 C;  4IG7 B;  4N9F 4;  4F8C B;  1S3S G;  2G45 B;  3VTW A;  1WGY A;  4II2 B;  5DPT A;  3ZTD A;  4OVU A;  2MW5 A;  3I3T B;  2MCN B;  3VXW A;  3N3K B;  1V9J A;  2KFJ A;  5CHW A;  1P3Q U;  4G50 A;  3AUL A;  3C0R B;  2CKH B;  4GDK A;  3A4R A;  4ICV A;  3DVN V;  4HPL B;  4WJO A;  4DHJ D;  3TBL D;  3QWZ B;  1L2N A;  2JRH A;  2KWU B;  2KJH B;  2KMC A;  1WXA A;  3DBR I;  3JSV A;  2IBI B;  3DDC B;  5FR6 A;  4RMA A;  4FHJ A;  2DZK A;  4EZK A;  3APF A;  1WX9 A;  4MSQ B;  2KO3 A;  4FN2 A;  4B95 A;  4IW0 A;  3A4S C;  3R7R A;  1V80 A;  1TTN A;  1T0Y A;  4MM3 A;  2PE9 A;  3L13 A;  4MH0 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...