1WXVA

Solution structure of the ubiquitin domain of bcl-2 binding athanogene-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
b'GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-family molecular chaperone regulator-1
publication title Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxvA01
1RRBA 4WJOA 4DHZB 2ZNVC 2UYZB 1VCBA 1YD8U 4BVUC 4DHJB 2KN5A 4ANWA 3DBSA 1LXDA 3ALBA 4MGKE 4TUUA 4EEWA 2KTRA 3D32A 2JRHA 3DOWA 4K7WA 5J2RA 1WGHA 3ECIA 3DBRI 1WXSA 5EDSA 1PQSA 2ZCBA 2IBIB 4ANUA 1V80A 1XT9B 2DZMA 2L05A 4FBJB 3UF8A 5E6NA 1I35A 4MGIE 4G3XB 3PSEB 5HKHA 4HPLB 5E6OA 2JRIB 2AYOB 1H4RA 3H7PB 4NAWA 1P9DU 2AWTA 3AXCA 4TV3A 1UD7A 3NY5A 3VTWA 1EO6A 1WMHA 2KWUB 3VTVA 2K39A 1WY8A 3RT3B 5DPRA 4A20A 1WM3A 2RPQA 2DAJA 4MM3A 3DDCB 3ZRCA 2MW5A 1XD3B 2L7RA 2KWVB 3UIOB 3A1QB 4GN1A 2DYMA 3RULA 4GOCA 2NBUA 2O6VD 4FLHA 4WQOB 1L2NA 4TQ1A 3KH0A 5CHVC 2MP2A 2RD0A 2VRRB 3WALA 4AP4C 3TL5A 4IM2A 1S3SG 2FNJB 1YX5B 1GNUA 5D7GA 1KJTA 3HHMA 3WANA 1IYFA 3H1UA 1Y8RC 4BOZB 2JZZA 4EZLA 4DDID 4GIVA 4KIKA 3L16A 1A5RA 1TBEA 4WJPA 2M4NA 2KWCA 2ZJDA 5BO4B 1E8WA 3VDZA 2LGXA 1WE6A 1WJUA 2KX0A 4FADA 5JHAA 1NI2A 4OVVA 3N30A 3ZKJC 3MTNB 2XEWA 2LUEA 3KUCB 4IUMB 1WR1A 2BPSA 4ANXA 1IPGA 2LVPA 2JVCA 4W9KA 2AL3A 2Y5BB 4MSMB 2KNBA 2KFKB 4EKUA 5JZEB 2KZRA 3L10B 2V3SA 4FHJA 4WWOA 1J8CA 5DCNA 1TZ1A 3PLVA 1J19A 2KKCA 4KDLB 4MGYE 1WGYA 3K9OB 3Q3JA 1GC6A 4GDKA 3ZNHB 5C1ZA 3B0AA 3OAWA 3CMMB 4W9LA 3RZWC 1WF9A 4E71A 4ZYNA 1WE7A 1LQBA 1V2YA 1UBIA 1XQQA 4AUQC 1UBQA 1GG3A 2WX0A 2O2VB 2B3AA 4K1RB 4HDOA 4WAAA 4NQLB 1NDDA 4GDLA 2DENB 3M3JA 3KW5B 4ANVA 2J0MA 3ZNID 4F7ZA 2MBQA 4NY0A 2KMCA 1LM8B 2NPTB 4RMAA 4PS7A 2M17A 2N9EB 4IM0A 3NZSA 3VAWA 3DVNV 3AU4A 3N3KB 3R3MA 4I6PA 2KD0A 2ZVOA 5AZHA 3RUIB 3ML9A 3WAOA 2DYOA 2L00B 2J7QB 2W9NA 3B08A 2MSED 1WH3A 4N9F4 4B9KA 1V9JA 3VVWB 1E5WA 3UGBB 3OJ4B 3ONSA 4P7IA 2BWFA 1Q0WB 3A9JA 3R7QA 1GJZA 1ZW7A 2BYFA 3VH4B 2AL6A 3N32A 3U30A 2N7DA 1V5TA 4A3OA 4F1SA 2BYEA 3HIZA 2A4ZA 3KUZA 1KOTA 4E3CA 2YLMA 2QHOA 4I6LB 4B95A 1KLVA 2K8HA 3MHSD 2LVQA 2G4DB 4XX5A 4FJZA 4HXDA 2K8CA 4WWNA 4K7UA 1WXVA 2KDIA 3IVFA 4F8CB 3V6CB 5DPSA 4EZJA 2KTFA 5LXHA 1U4AA 1UELA 3V62A 1WXAA 1K8RB 2OOBB 2BWES 2EKEC 2RR9A 2MA9B 3S2AA 2C9WB 3OLMD 2JF5A 2MBBB 2EMSA 3IG3A 3NOBA 1YIWA 4HCNB 4TKNA 4KSKC 4MJSA 2V1YA 3VFKA 4MSQB 3PPAA 3IFWB 4II2B 3T9LA 4AWJA 3UQAA 1WRDB 1L7YA 4GMVA 3SHQA 4DXAB 3A9KA 2K1FA 2WX1A 2KC1A 1EUVB 3CSFA 3H9DA 4M0WB 1JRUA 5LXIB 3QK0A 5LLIA 2M8SA 3EECA 3L54A 5L83A 5DPWA 3DVNU 2DHZA 2ZNVB 4M8NA 3X0WA 2IZVB 2LVOA 4ICUA 1Q1OA 2XK5B 1Z2MA 3L0WB 1TTNA 1C1YB 3DBLI 2D10A 2FCMA 3QJZA 2LD9A 2G3QB 1SGHA 2K25A 5GMVA 5J18A 2CR5A 2CHZA 3KYCD 2DYBA 3TBLD 5TR5A 3RYTA 3ZNGC 5FR6A 4BKTA 3VH3B 3VUWA 3EFUA 4AJWA 2GBKA 2KTRB 1V6EA 1E8YA 2KLGA 1EF5A 1WGDA 3WA0A 4HJKA 2IY0B 2ZZPB 2RGFA 1RLFA 3ML8A 1BT0A 1WM2A 5AZGA 3L08A 2J0KA 1E7VA 3JYUA 2FUHB 3M95A 2BF8B 4JIOU 4PS8A 2BKFA 4CO7A 3X23A 2MCNB 4W9FA 3AU5A 4NAWB 1WX8A 2GOWA 2KK8A 2PE9A 5CHFA 4XZ4A 3RCZA 1V49A 3T8MA 3QIJA 4GGQA 1WMHB 3ZRFA 3GOEA 2PE6B 2KQ7A 4BKGA 1HE8A 3R7RA 2LXCA 3QA8A 2GBNA 3V61A 4IG7B 2N1WA 2LRWA 1IP9A 4J6IA 2L0TA 1SE9A 2LXAA 2C60A 2EMTA 2MP2B 2HTHA 5JHBA 3PGEA 1YJ1A 2LGYA 3V60A 4II3B 4RM8A 2C7MB 1V81A 3EC8A 3APDA 4B6WA 1J0GA 3R66C 1R4MI 4HWIB 3PS6A 5D6JB 1SIFA 1RFAA 4KIKB 4LCDE 4XC2A 4DDGD 1UZXB 4IWQA 4W9JA 2KVRA 2I1KA 5J17A 3VXWA 3TCAA 4IC7B 2MRPA 2O6VA 1AARA 2GBMA 2LWPA 3QC8B 3AI5A 2DZKA 4URKA 2K6DB 4LJPB 1P3QU 4DBGA 4NJ7A 3QCAA 2LRUA 2KANA 3JSVA 3QX1A 5G2NA 3QHTA 1ZKHA 4FA6A 4KDIC 2LI5A 2KJ6A 2Z0DB 2LZ6A 3ZNZB 2FCQA 4ZRJA 2MLBA 4PS3A 2JWZA 3HM6X 1Q5WB 4HVBA 2D3GA 3ZVVA 2N9XA 3VUYA 4CHKA 3NHEB 4M8MA 4W9CA 3ZUNA 3QAQA 3PTFC 2CHWA 3KVFB 5AZFA 3HK0A 1WGRA 1WR6E 2KX3A 3PT2B 4GDKB 2ZVNA 4W9IA 2V4LA 1GUAB 4MH0E 3IHPC 4W9HA 3V6EB 2DAFA 1OGWA 5C23A 2PJHA 3KYDD 3PREA 3H7PA 4LDTD 3ZTCA 2PPHA 3MJWA 3QARA 1V5OA 4GDLB 3M62B 4AJYB 2Z0EB 2RSUA 2MBHA 3VUXA 2FIFA 2R2QA 3A1QA 2L3ZA 3L17A 3W1YA 1S1QB 2KDFB 2LJ5A 2BGFA 1D3ZA 4DWFA 3RZFA 4MGZE 3A4SC 5IAAC 1WJNA 2NR2A 4AOFA 2CKHB 1E90A 1QZEA 1WYWB 3ZDTA 2JZ3B 1YX6B 2NCNA 2ZPNA 2CHXA 3EHVA 1WZ0A 4RM9A 1KM7A 3DVGX 4HCPB 1ISNA 2DZJA 2Z59B 5CX3A 3VHTC 2IO1B 2IO3B 4JL9A 4NQKE 2WYQA 1WZ3A 2KC2A 4MEMA 2BYVE 3CSTA 3A9JB 3B1LX 3DVGY 3ENEA 2IO0B 3ZLZA 3WAPA 5KHOA 3SDLC 5D2MB 3APFA 2CU1A 2KO3A 2ZEQA 4GU2A 4K81A 3HM3A 3W1SA 3PVLA 1TGZB 2KLCA 2YVCA 3A4RA 4GB9A 3BY4B 1NBFC 3BINA 3LDZE 4BKSA 2LGDA 1OTRB 2HJ8A 1OEYJ 2GBRA 4BFRA 1YQBA 3APCA 4G50A 3RD2A 2KFKA 3OJ3A 2DZIA 3W1SC 2NS5A 3I3TB 4IM3A 3AULA 3UIPB 1ZGUB 2C5LC 4K7SA 2A5UA 1P1AA 2JPHA 2FCSA 2UWQA 3CF6E 3PRZA 5CTRC 3UQBA 5G55A 2JUOA 4KZ0A 2FAZA 4FJVB 4WJNA 1C3TA 3DPDA 3P2BA 5KHQA 1Z5SB 1EF1A 2D07B 1M94A 3QWZB 4MJSB 1V86A 2OJRA 2KFJA 2JXXA 3LJ3A 1WX7A 3QQ8B 4KV2A 2O2VA 4BBNC 2KXJA 2PEAA 4FHKA 3GZNI 3U7DA 3DQVA 4HPMB 3A9KB 3NS8A 2M1MA 1WX9A 3PRMB 4DHJD 2L8JA 4W9DA 3U8ZA 2JY6A 1WIAA 3O65B 2GBJA 2NBWB 4KVGB 4FN2A 3PHWB 1MG8A 2NPTA 4EZKA 1WJ4A 4HK2A 4OVUA 1UGMA 1UH6A 1WXMA 4ASWC 2WDTB 2N9PC 1P98A 2GMIC 4BOSC 2C7NB 4GSWA 2N1VA 5L95C 4LDTB 4PYZA 2HD5B 4JQWC 4I6NB 2C7HA 2G45B 2ZCCA 2LASA 2G4SA 2L76A 2ZPYA 3ZW3A 2DX5B 1X1MA 3Q3FA 1E8ZA 4ZRKA 2IY1B 4FJYA 2MWSB 3SD5A 2KJRA 3A33B 1OEYA 2IO2B 2XBBC 5D94A 1RAXA 3NZUA 2BKRB 1OQYA 2I1JA 1WI0A 4HDQA 3JVZX 4DHZE 2K6QA 4A3PA 4JLCA 3ZDMC 2D2QA 4TQ0A 2HE7A 4IWPA 4EFOA 3TIXA 4BBNF 2KJHB 3L13A 2JT4B 2KMAA 2D11A 3PHXB 2MBEA 2WWZA 3H7SA 2FIDA 1E8XA 3ZTDA 3DBHI 2NBVB 2MQJA 5AEKB 4NNJB 3JW0X 3ZIMA 3K9PB 2J0JA 5IA7A 4ZRIA 1E7UA 5E6PA 4DK5A 3KUDB 2FCNA 4FULA 4LJOB 4EUTA 1WGGA 3TMPB 4G0NB 1I42A 2MX2A 1P0RA 1R4NI 4HLEA 4WWPA 4NJ6A 3UINB 4G11A 4PYUA 5CHWA 4E74A 2L0FA 3DCGA 4NPNA 3PLUA 5DPTA 1CMXB 1G6JA 4YL8A 4IW0A 3SU8X 4MDKE 1LFDA 3H6NA 2NVUI 4EOYA 4GXBA 2KHWB 2R2OA 3TJPA 4CYEA 1VD2A 1WFYA 4ICVA 4BKSD 3PV1A 4IWOA 2IYDB 4MELA 4ZDVA 1T0YA 2KDEB 2KOXA 4WJQA 3VQIA 1GC7A 3PRPB 3PZDA 4W9GA 3WAMA 2MBOA 4JGHB 3ZO5B 2O6VB 3C0RB 4KZCA 3M63B 2KDBA 2XK5A 2CS4A 2ASQA 3VTUA 1WJ6A 2AEHA 2KQSA 2N7EA 2K8BA 1F9JA 4X57B 3WIMA 3IBEA 2M0XA 1H8CA 5JH5C 4KSLC 1FXTB 2REXA 4W9EA 2N4FA 3JSVB
chains in the Genus database with same CATH superfamily
4DHZB 2K3UA 3KWLA 2KN5A 1N60A 1SJED 1XLOA 5HFYA 4KGTA 3ALBA 4TUUA 2WXMA 2JRHA 1T0QC 3ECIA 3DBRI 1KRHA 2DZMA 4HPPA 2WXPA 1I35A 4MGIE 4G3XB 1DOYA 4ZHPA 4FXCA 4OW0A 1JWMD 2FBWB 2AYOB 3H7PB 2AWTA 1HQRD 3VTWA 1YNTE 3VTVA 3RT3B 4EE2A 1XD3B 1BXTA 1SJHD 2KWVB 2DYMA 3RULA 1XLPA 1DOIA 3NUHB 1L2NA 1FCCC 2BB6A 2VRRB 3WALA 1EU4A 5D7GA 1L4DB 3H1UA 1Y8RC 3I63C 4BOZB 2WXQA 1MVKA 4GIVA 1TBEA 1SF0A 2ZJDA 3VDZA 4C00A 1WJUA 2KX0A 4FADA 5JHAA 1YN4A 1QOBA 2SAKA 1TS3A 3MTNB 1PGBA 2PKOA 3KUCB 4ANXA 2I38A 2AL3A 4MSMB 2KNBA 5JZEB 4QAYA 1F0ZA 3DHHC 4WWOA 1J8CA 3RPFC 5DCNA 4RGNA 4KDLB 1WGYA 1GC6A 3ZNHB 5C1ZA 1QOGA 4W9LA 4ZYNA 5IO9A 1LQBA 4M00A 3BK2A 1C76A 1NDDA 1TS4A 2WS3B 3M3JA 4D2KA 4ACFA 3MC9A 2PIAA 3SEBA 4RMAA 2GRIA 1LGRA 3Q8FA 2N9EB 4IM0A 3DVNV 3AU4A 3R3MA 4I6PA 4YWGG 2J7QB 2W9NA 4YSZB 1WH3A 3VVWB 2QJLA 4LNNA 4P7IA 2BWFA 1NYQA 4M02A 2WXRA 1YQ3B 2DNFA 3U30A 1D4BA 4A3OA 2A4ZA 5HHDG 2YLMA 2LGIA 2QHOA 3V3XA 3MHSD 5DPSA 3E9SA 2VZKD 3V62A 3IAM1 4YTMB 2EKEC 2RR9A 2LFIA 4JX1C 1PGXA 3Q69A 4NJCA 3NOBA 4MSQB 3PPAA 3IFWB 4II2B 3T9LA 4AWJA 1WRDB 2D5GA 3A9KA 4M0WB 1JRUA 3QK0A 1RM6C 2WDRB 2KWDA 1EWYC 2D3AA 1I4RA 2JQRB 1Q1OA 1RYJA 3L0WB 3W9CB 4A6QA 1UWMA 2DYBA 4YSYB 5TR5A 1GAQB 5FR6A 1AW7A 4BKTA 3VUWA 3EFUA 3IAS1 1V6EA 2RGFA 1RLFA 3KQ4A 3ML8A 1TZOA 3DWGC 2YEPF 1V1OA 2X38A 1WX8A 1SXTA 2N9LA 2KQ7A 3R7RA 3QA8A 2M56B 1E9MA 2JWUA 1DOXA 3AH7A 4IOIE 1SE9A 3C8YA 1FNWA 3FKYA 1L0XB 3V60A 4II3B 4RM8A 3IT6B 1J0GA 3R66C 1NENB 3HVDA 4ARCA 1RFAA 4LCDE 4XC2A 1UZXB 5J17A 2LWPA 2N7JA 3QC8B 3AI5A 3ZJVA 1UUPA 4HEA1 2DZKA 4OVZA 5AUIA 4WH4A 4DBGA 2KANA 3AMZA 3RI7C 1C4CA 4FA6A 2Z0DB 1KF6B 2FCQA 1GPXA 4PS3A 2PVGC 1XEEA 2IJ0A 4HVBA 2N9XA 3AE9B 4NZLB 2CHWA 2J52A 5AZFA 2V4LA 4KKIA 4W9HA 3IHPC 1VRAB 3N1ZC 5BMGA 1WWTA 4A55A 5C23A 3R8BA 3PREA 5HG2A 1T5XD 1DYQA 4LDTD 3RMKC 3AV8A 1MPEA 4AJYB 2CJNA 3L17A 3W1YA 2LJ5A 2KDFB 3NZ3A 3A4SC 4AOFA 1WJNA 2NR2A 1ROEA 4LK0M 4NAMA 1YX6B 2ZPNA 4L23A 3BIID 2G1EA 1KM7A 1V8CA 2KAJA 2Z59B 1TS2A 4NQKE 2WU5B 1WZ3A 2KC2A 4RH6A 1OQQA 3CSTA 3DVGY 1AYFA 3WAPA 5KHOA 5D2MB 2AQ2B 3HM3A 3PVLA 4RF1A 2YVCA 1NBFC 3LDZE 3DBHB 1OTRB 1OEYJ 4G50A 3RD2A 4LNOA 2BVCA 4B0EA 3UIPB 1ZGUB 2JPHA 3CF6E 5CTRC 2JYEA 4KZ0A 1JWUD 1C3TA 1Z5SB 1EF1A 1M94A 2KACA 2OJRA 3AN1A 2O2VA 2KXJA 3NVYA 3GZNI 3DQVA 3A9KB 3C19A 2M1MA 1WX9A 4S17A 1C78A 3RNFC 2JSVX 3TUOA 3LXFA 2XNAC 4FN2A 4HK2A 1UH6A 4ASWC 4C7ZA 4GSWA 4PYZA 3L4PA 3UI3A 4JE3B 3NVVA 4I6NB 2C7HA 2G45B 4TSSA 1JRPA 3TEYA 4IKGA 4AQ7A 4N59A 2NTTA 1LO5D 3SD5A 1JWSD 2KJRA 3A33B 1OEYA 2XBBC 2J53A 2WHIA 4YTPB 1T0SC 4HDQA 2K6QA 4A3PA 1STEA 3ZDMC 4LNFA 5D3DA 2KMAA 2D11A 1E8XA 4NNJB 3RFZB 4US8A 5FR3A 2INDC 4C80A 1TY2A 3KUDB 1WGGA 2BS2B 4G0NB 1N6ZA 3SFDB 1R4NI 1GOZA 5CHWA 1L0YB 1CMXB 3Q8EA 2INPE 4JWSC 1LFDA 3H6NA 2RDGA 3VQIA 2M19A 5G5HA 2KDBA 3BVGA 1H8CA 3IBEA 2EELA 4WJOA 2VH1A 1MFWA 4BVUC 4DHJB 4ANWA 3DBSA 1LXDA 2N9KA 1WGHA 5EDSA 1WRIA 2WU2B 1V80A 1XT9B 2PW9A 2L05A 3UF8A 1KLGD 3TSSA 4PT5A 4B0MA 2JZPA 3PSEB 3ZYYX 1B1ZA 1UD7A 2K39A 2JX5A 5DPRA 2Y5CA 3AE6B 2MW5A 4UDUC 5TSSA 2MH7A 2NBUA 2O6VD 1D5XC 4FLHA 5CHVC 2QSDA 4ZOHC 2MP2A 3ETRA 4AP4C 3TL5A 4GLSC 1S3SG 1C9FA 3AEEB 4DDID 4KIKA 3L16A 2M4NA 5BO4B 1E8WA 1WE6A 2CU3A 1NI2A 1ZXIA 1C77A 4REZA 2LUEA 5H92C 2BPSA 1IPGA 1ENFA 2JVCA 2Y5BB 4EKUA 1I4HA 1Q10A 2KZRA 2RDBC 5EE1A 3EA6A 3B9JA 2KKCA 4MGYE 3T3NA 3AEGB 2V3NA 1WF9A 4E71A 1L6UA 4J3OD 5BYQA 1UBIA 1FM0D 1TY0A 2O2VB 3AE1B 4K1RB 1HXYD 3KLSX 3MC8A 2DENB 1PUTA 1R7SA 4ITKA 3KW5B 3ZNID 2J4XA 2MBQA 2OEDA 4M01A 5C2TB 1LM8B 3RNGC 3BZDB 3N20C 4WURA 3VRAB 1E0ZA 1EWCA 3RUIB 3ML9A 1E7PB 1SB3C 4B9KA 1E5WA 1QOFA 1P7FA 3UGBB 3ONSA 2V4IB 1GJZA 1TS5A 2WXLA 4RGMA 1AWDA 2KVZA 2GLSA 2N7DA 4US9A 2BYEA 3KUZA 3Q3OC 4MT5A 1KOTA 2MJ3A 1EM7A 1KLVA 2LVQA 4XX5A 4P16A 4FJZA 4C56C 2KDIA 2WGSA 2KTFA 5IOIA 1WXAA 2JXTA 1Y56A 3BYYB 2AQ1B 3B2GA 4KKJA 2MBBB 3H8HA 4TKNA 1YIWA 3AEBB 2V1YA 4HKQA 1F2RI 3VFKA 3U2SC 1R4MB 4GMVA 5I4DA 3BWUD 4DXAB 2KC1A 3H9DA 3RNCC 2M8SA 3L54A 5L83A 2PLPA 2W3RA 2ZNVB 3X0WA 1TKYA 2LVOA 2E6XA 1K51A 4XYCA 3DBLI 2WDQB 5GMVA 2QIEB 3HUIA 3RYTA 2LGSA 2M0AA 1E8YA 1EF5A 1WGDA 1ACCA 4HJKA 2H88B 3NG0A 1BT0A 1KFYB 3Q8BA 2J0KA 1E7VA 2VH2A 3JYUA 3M95A 2NTSA 4JIOU 1FIQA 4CO7A 3LB8C 3ZJTA 3AU5A 5CHFA 4XZ4A 1V49A 3T8MA 3QIJA 4BKGA 1HE8A 2LXCA 2GBNA 2N1WA 2X8XX 1YJJA 3AEAB 3P63A 2L0TA 3W5VB 2LXAA 2KQ4X 2EMTA 2MP2B 5EE3A 5JXVA 3SFEB 1HA5A 1ZE3D 2C7MB 1V81A 4B6WA 2V0GA 4KIKB 4DDGD 5IN7A 2KVRA 2I1KA 4IC7B 1AARA 4URKA 1V1PA 1HZ5A 3FILB 3QCAA 3QHTA 3GP7A 2ZW1A 1ZKHA 3KWVA 3ZNZB 2KJ6A 2LZ6A 3U4EG 1T0RC 2BBCA 2JWZA 3ZVVA 3VUYA 3NHEB 4M8MA 3E56A 3ZUNA 3PTFC 1NEKB 3RN9C 2XN9C 1WR6E 2KX3A 3PT2B 2ZVNA 1SEBD 4WIPA 1GUAB 4MH0E 1HTOA 3V6EB 2PJHA 3ZTCA 2PPHA 3QARA 1TJEA 2BT6A 3VUXA 2FIFA 1E6EB 2DBYA 2ZW0A 3P4QB 1WSPA 2NCNA 3EHVA 1WZ0A 2OJWA 3DVGX 5C3JB 2PMVA 3EFCA 2ICIA 1SBBB 2NMQA 2BYVE 3R2IA 3B1LX 1FPYA 3ENEA 1N62A 2PTLA 2KN4A 1DGJA 2KO3A 2ZEQA 4K81A 3W1SA 1KTKA 2KLCA 3A4RA 3BY4B 2OHFA 4BKSA 3BINA 2GBRA 2KFKA 2V3PA 2L83A 3I3TB 2LEKA 2N0SB 1P1AA 2FCSA 2UWQA 3V05A 3DPDA 1L0VB 3P2BA 1ET9A 1V86A 2FE8A 3BVMA 2KFJA 2JXXA 1L6VA 1PDXA 3GE3C 2PEAA 1FD6A 4DHJD 4ZRQA 4W9DA 4XE0A 3O65B 2NBWB 2R61A 1E10A 1C4PA 2KT7A 2NPTA 1WJ4A 4EZKA 4OVUA 1WXMA 2QMTA 1P98A 2GMIC 3MC0B 1FFUA 2LASA 2FUG1 2G4SA 2DX5B 1TKEA 1ZOYB 1E8ZA 4YT0B 4FJYA 2K9XA 5D94A 1RAXA 3NZUA 1OQYA 3W2DA 3JVZX 4JLCA 3ZXVA 2D2QA 4TQ0A 4IWPA 4WWMA 2MJEA 2KJHB 3PHXB 1J7CA 2MBEA 2WWZA 3H7SA 5AEKB 4RFBA 3JW0X 3PZ8A 4DXFA 1I4PA 4ZRIA 1E7UA 4DK5A 4FULA 2FCNA 3VRBB 2D3BA 1I42A 1N5XA 2MX2A 1P0RA 3UINB 3TEXA 2L0FA 5BMHA 3AE2B 1FRRA 3AE7B 2L32A 4IW0A 3GE8C 4EOYA 3TJPA 1VD2A 1WFYA 2D3CA 4WJQA 3PRPB 1TT5B 2E3TA 1EU3A 4A90A 1WJ6A 1WGKA 2AEHA 1F9JA 1V1PB 2HDEA 3WIMA 2M0XA 2G9HD 5JH5C 4C7YA 2REXA 2BB5A 2ZNVC 1VCBA 1YD8U 2HJ1A 5H8YE 4ZYSA 3BVZA 1VLBA 4KGRA 2QEJC 3R2TA 2WNMA 1WXSA 2ZCBA 1NVID 5E6NA 3DHIC 4HPLB 4N58A 2JRIB 4NAWA 1P9DU 1EO6A 1WMHA 2KWUB 4KGSA 1WM3A 2DAJA 4MM3A 1T6BX 4XDCA 3UIOB 4GN1A 3NRZA 1KLUD 2WXJA 4TQ1A 3KH0A 2MHJA 3VR9B 3OWEB 3O13A 2FNJB 1IYFA 1GNUA 3HHMA 2DWQA 5G5GA 1A5RA 5GXGB 4WJPA 2KWCA 5LNK1 1K50A 4OVVA 3N30A 3T3OA 3MHZA 2XEWA 1WR1A 1CK1A 3MFGA 2KFKB 2WQYB 1L5PA 2V3SA 4FHJA 1J19A 4R3DA 4GDKA 3RZWC 4C4VA 1WE7A 1V2YA 2W82A 1XQQA 4AUQC 1UBQA 1GG3A 2WX0A 1WXQA 4NQLB 2RMMA 4ANVA 2J0MA 2WXIA 2KMCA 2NPTB 2CJOA 1B9RA 1KH0A 1YQ4B 1ZDXA 3NZSA 3VAWA 3WAOA 2LJIA 2J42A 3B08A 1QF6A 3OJ4B 1Q0WB 3A9JA 4N6EB 3R7QA 1ZW7A 3N32A 1OFFA 3HIZA 3ZQ4A 4E3CA 4I6LB 3CWIA 4B95A 2K8HA 2G4DB 2H89B 1T3QA 4HXDA 2K8CA 4WWNA 2TSSA 2KYWA 4BAXA 3V6CB 4EZJA 3U52E 1PGAA 5LXHA 1U4AA 1UELA 1K8RB 2OOBB 2BWES 1NYRA 4ZRPA 2MA9B 5EE0A 3PZ7A 2INNE 3IG3A 3RNBC 4KSKC 3WCQA 2WXKA 3SHQA 3P1MA 2QC8A 2K1FA 3CSFA 1FCLA 3I5JC 2DHZA 2IZVB 4ICUA 1ESFA 1FFVA 3Q2AC 1TTNA 2D10A 2FCMA 2EKIA 3QJZA 2LD9A 3RNAC 1SGHA 2K25A 4RGOS 1FNUA 2CR5A 3TBLD 4S0RA 4YSXB 2RDHA 3VH3B 4AJWA 2LHDA 1BMLC 1TYGB 1SE2A 4K3CA 2IY0B 2ZZPB 1WM2A 5AZGA 3L08A 1D5ZC 4PS8A 3VR8B 3X23A 4W9FA 4NAWB 2GOWA 2KK8A 3RCZA 1RWSA 1WMHB 2Y3AA 3ZRFA 2PE6B 3V61A 4MM3B 4IG7B 4KX6B 4DQOC 4WAFA 3TEWA 4J6IA 1F1HA 2B76B 1FXIA 4PK1A 1XLQA 2HTHA 5JHBA 3PGEA 3Q6BA 4AS1A 1HTQA 2LGYA 4HROA 1FXAA 3AE8B 1XCQL 3PS6A 2W55A 3LYYA 1VJKA 3AB5A 4BZAA 2O6VA 2GBMA 2W54A 2K6DB 2BYTA 1P3QU 4NJ7A 3QX1A 3BYTB 2LI5A 4MACA 4ZRJA 1Q5WB 4CHKA 1K53A 3HK0A 3N1XC 4GDKB 1J7BA 2DAFA 1OGWA 4C4VB 5IP4D 3KYDD 3GZNB 3MJWA 1JQ4A 3Q14C 1V5OA 1K52A 3FC4A 1XF5L 4RGTA 2Z0EB 2RSUA 2R2QA 3A1QA 1S1QB 1SE3A 5IAAC 1WYWB 1YJIA 1JMLA 2CHXA 1ISNA 5CX3A 3VHTC 2IO3B 2WXNA 4JL9A 4L1BA 4MEMA 3MP9A 3A9JB 4K3BA 2QILA 2IO0B 4WQMA 4LLGM 3APFA 1SE4A 2CU1A 4GU2A 1N5WA 4TMAB 3HRDD 1YQBA 2ACZB 3U7ZA 3OJ3A 3W1SC 2NS5A 1FRDA 5AUKA 2C5LC 4K7SA 1R4NB 3PRZA 3UQBA 1L4ZB 2JUOA 4HRSA 2FAZA 4FJVB 4WJNA 5KHQA 5HI1A 2D07B 3QQ8B 1WX7A 4P6VF 3U7DA 3PRMB 3NS8A 2GB1A 2L8JA 1YMHE 2JY6A 1WIAA 4KVGB 4YXDB 3PHWB 1MG8A 4BOSC 5BYSA 4OZAA 2C7NB 2N1VA 5L95C 4JQWC 2ZCCA 1PYWD 2IY1B 2IO2B 2GI9A 2BKRB 2L1AA 2I1JA 4DHZE 1I4XA 4HKZE 2INCC 4EFOA 3TIXA 2Y5PA 3L13A 1ZXHA 4CQNA 2FIDA 3ZTDA 3DBHI 2MQJA 3ZIMA 5IA7A 4LJOB 4EUTA 4NJ6A 4G11A 4PYUA 4NPNA 3PLUA 1ZDVA 1FNVA 5DPTA 1G6JA 2NVUI 4GXBA 2R2OA 4CYEA 3NVWA 4BKSD 3PV1A 4LNKA 2IYDB 3B2FA 4ZDVA 1T0YA 2KDEB 2KOXA 3WAMA 1GC7A 3PZDA 4W9GA 4JGHB 1CZPA 3J9CA 2O6VB 3C0RB 4KZCA 3M63B 2XK5A 2CS4A 2ASQA 3VTUA 4XDDA 4X57B 2IGHA 2AX5A 4KSLC 4W9EA 2N4FA 3DWMA 1RRBA 4YTNB 2UYZB 1C79A 1HZ6A 4EEWA 4MGKE 1FEHA 1I4GA 2KTRA 3D32A 2WP9B 3DOWA 4K7WA 2IGDA 5J2RA 1PQSA 2IBIB 4ANUA 5FK9C 4FBJB 1NI3A 5HKHA 2MEKA 2BS3B 3AE4B 5E6OA 5BYRA 1H4RA 4IDIA 2PVOD 3AXCA 4TV3A 3NY5A 1WY8A 1ZUD2 4A20A 2RPQA 2BS4B 3DDCB 3ZRCA 2L7RA 3A1QB 1P7EA 4GOCA 4Q2JA 4WQOB 4ZHOA 1IGCA 2WXOA 1YOVB 3P4RB 2RD0A 4IM2A 1YX5B 3WANA 1F52A 1KJTA 2JZZA 4EZLA 4RF0A 2ONQA 3ZXRA 3URYA 2LGXA 3ZKJC 3BK1A 1JWBD 3AEDB 4IUMB 2IPKD 2LVPA 4W9KA 1N61A 3DBRB 1A70A 1YN5A 3L10B 3CIRB 1JCKB 1JW9D 4USAA 1TZ1A 3PLVA 3K9OB 3Q3JA 1V97A 3B0AA 3OAWA 3CMMB 3W5UB 2MJDA 4LNIA 1F77A 3AEFB 2QDFA 2B3AA 4HDOA 4WAAA 4A8XC 4GDLA 1QT9A 4F7ZA 4RCOA 4NY0A 3DBLB 4H2AA 4PS7A 1OQRA 3NVZA 2M17A 1VDVA 3GB1A 3N3KB 2KDMA 2KD0A 2ZVOA 5AZHA 1MJDA 2DYOA 1QOAA 2L00B 1IGDA 1CQVA 2MSED 4N9F4 2W3SA 1V9JA 1JWAD 3N1YC 1PFDA 2RPVA 2BYFA 1FMAD 2AL6A 3VH4B 3TEZA 1GB4A 1V5TA 4F1SA 3IXSA 2ON8A 3AE3B 2V9HA 2L52A 3P42A 4K7UA 1WXVA 1XCTL 3IVFA 4F8CB 3EUB2 4P1CC 3Q3MC 1SSNA 3I9V1 3S2AA 2C9WB 1UNSA 3OLMD 2JF5A 4JWUC 2EMSA 3Q8AA 4HCNB 4MJSA 2HTME 5IKCM 3UQAA 3MJ5A 1L7YA 2IDYA 2Z8LA 2WX1A 1EUVB 5LXIB 5LLIA 2K22A 3EECA 5DPWA 3DVNU 4M8NA 3AECB 1XO3A 4OZBA 2XK5B 1Z2MA 1C1YB 2SEBD 2IGGA 2Q5WD 3RNEC 2G3QB 3NS1A 1M4VA 5J18A 1D5MC 2CHZA 3KYCD 4LTUA 3ZNGC 1ZP0B 2GBKA 2K5PA 2KTRB 2WXHA 2KLGA 3WA0A 2UU7A 2FUHB 2BF8B 3IT4B 2BKFA 1IBXA 3HVZA 2MCNB 4A9AA 1CJEA 2PE9A 3I57A 5T8IA 4GGQA 3ZGZA 1WYGA 3GOEA 3P4SB 3P4PB 2LRWA 1IP9A 1UWXA 2C60A 1YJ1A 5MPOA 1D6EC 2VZKB 3EC8A 3APDA 1QKZA 1R4MI 4HWIB 5D6JB 1SIFA 4IWQA 4W9JA 3VXWA 3TCAA 4XWTA 2MRPA 1VR9A 1VZ7A 1J7AA 4LJPB 2WXFA 2LRUA 3JSVA 1MG4A 5G2NA 3AM9A 4ARIA 4KDIC 1XLNA 4OZCA 2MLBA 3HM6X 2D3GA 3EGRA 4W9CA 1SIJA 4JPSA 3QAQA 4P1BC 3KVFB 4XWWA 1WGRA 3PO0A 1I7HA 4W9IA 1I4QA 3H7PA 1ZPSA 4XGAB 2BW2A 4GDLB 3M62B 2MBHA 4MH8A 1VZ6A 1JALA 2L3ZA 4O1NA 1D3ZA 2BGFA 4DWFA 1FO4A 3RZFA 4MGZE 1VZ8A 2CKHB 1E90A 1QZEA 3ZDTA 2JZ3B 2WLBA 4RM9A 4HCPB 5FKAC 3ZJUA 2DZJA 1QLBB 2IO1B 2WYQA 2AQ3B 3ZLZA 1UF0A 3SDLC 3ABVB 1TGZB 4GB9A 2LHEA 2K0PA 4HJGE 2LGDA 2HJ8A 4BFRA 4DXGA 3APCA 2JU6X 2DZIA 4IM3A 3AULA 3OG5A 2YEPB 2A5UA 1GB1A 5G55A 3Q8CA 1N63A 4OHJA 1TIFA 5BMIA 2DLBA 2WXGA 3GS2A 3QWZB 4MJSB 1ET6A 1XXGA 4KV2A 3LJ3A 4BBNC 2BTEA 3FAHA 4FHKA 4HPMB 1F2RC 3U8ZA 2GBJA 3DHGC 1BUIC 1TKGA 4L2YA 1IUEA 1MHHE 1MHXA 2LMCA 1HEZE 1UGMA 2WDTB 2N9PC 1RFKA 3FILA 2BQQA 4LDTB 2HD5B 2WDVB 2JYTA 2L76A 2ZPYA 3AE5B 3ZW3A 1X1MA 3Q3FA 4ZRKA 2MWSB 2QCZA 1WI0A 1QQRA 2HE7A 2LUMA 1IBXB 4BBNF 2JT4B 1QILA 1UGJA 1C4AA 2NBVB 3NJTA 3K9PB 2J0JA 5E6PA 3TMPB 5EE9A 3Q3NC 5D3IB 4HLEA 4WWPA 4E74A 3DCGA 3SR6A 1MI0A 1YN3A 4YL8A 3SU8X 4MDKE 1JROA 2KHWB 1AN8A 4RNAA 4ICVA 4IWOA 4MELA 5E6JA 4M0WA 2MBOA 2KMMA 3ZO5B 2KQSA 2N7EA 2I2YA 2K8BA 1FXTB 3N9YC 3JSVB
chains in the Genus database with same CATH topology
1RRBA 4WJOA 4DHZB 2ZNVC 2UYZB 1VCBA 1YD8U 4BVUC 4DHJB 2KN5A 4ANWA 3DBSA 1LXDA 3ALBA 4MGKE 4TUUA 4EEWA 2KTRA 3D32A 2JRHA 3DOWA 4K7WA 5J2RA 1WGHA 3ECIA 3DBRI 1WXSA 5EDSA 1PQSA 2ZCBA 2IBIB 4ANUA 1V80A 1XT9B 2DZMA 2L05A 4FBJB 3UF8A 5E6NA 1I35A 4MGIE 4G3XB 3PSEB 5HKHA 4HPLB 5E6OA 2JRIB 2AYOB 1H4RA 3H7PB 4NAWA 1P9DU 2AWTA 3AXCA 4TV3A 1UD7A 3NY5A 3VTWA 1EO6A 1WMHA 2KWUB 3VTVA 2K39A 1WY8A 3RT3B 5DPRA 4A20A 1WM3A 2RPQA 2DAJA 4MM3A 3DDCB 3ZRCA 2MW5A 1XD3B 2L7RA 2KWVB 3UIOB 3A1QB 4GN1A 2DYMA 3RULA 4GOCA 2NBUA 2O6VD 4FLHA 4WQOB 1L2NA 4TQ1A 3KH0A 5CHVC 2MP2A 2RD0A 2VRRB 3WALA 4AP4C 3TL5A 4IM2A 1S3SG 2FNJB 1YX5B 1GNUA 5D7GA 1KJTA 3HHMA 3WANA 1IYFA 3H1UA 1Y8RC 4BOZB 2JZZA 4EZLA 4DDID 4GIVA 4KIKA 3L16A 1A5RA 1TBEA 4WJPA 2M4NA 2KWCA 2ZJDA 5BO4B 1E8WA 3VDZA 2LGXA 1WE6A 1WJUA 2KX0A 4FADA 5JHAA 1NI2A 4OVVA 3N30A 3ZKJC 3MTNB 2XEWA 2LUEA 3KUCB 4IUMB 1WR1A 2BPSA 4ANXA 1IPGA 2LVPA 2JVCA 4W9KA 2AL3A 2Y5BB 4MSMB 2KNBA 2KFKB 4EKUA 5JZEB 2KZRA 3L10B 2V3SA 4FHJA 4WWOA 1J8CA 5DCNA 1TZ1A 3PLVA 1J19A 2KKCA 4KDLB 4MGYE 1WGYA 3K9OB 3Q3JA 1GC6A 4GDKA 3ZNHB 5C1ZA 3B0AA 3OAWA 3CMMB 4W9LA 3RZWC 1WF9A 4E71A 4ZYNA 1WE7A 1LQBA 1V2YA 1UBIA 1XQQA 4AUQC 1UBQA 1GG3A 2WX0A 2O2VB 2B3AA 4K1RB 4HDOA 4WAAA 4NQLB 1NDDA 4GDLA 2DENB 3M3JA 3KW5B 4ANVA 2J0MA 3ZNID 4F7ZA 2MBQA 4NY0A 2KMCA 1LM8B 2NPTB 4RMAA 4PS7A 2M17A 2N9EB 4IM0A 3NZSA 3VAWA 3DVNV 3AU4A 3N3KB 3R3MA 4I6PA 2KD0A 2ZVOA 5AZHA 3RUIB 3ML9A 3WAOA 2DYOA 2L00B 2J7QB 2W9NA 3B08A 2MSED 1WH3A 4N9F4 4B9KA 1V9JA 3VVWB 1E5WA 3UGBB 3OJ4B 3ONSA 4P7IA 2BWFA 1Q0WB 3A9JA 3R7QA 1GJZA 1ZW7A 2BYFA 3VH4B 2AL6A 3N32A 3U30A 2N7DA 1V5TA 4A3OA 4F1SA 2BYEA 3HIZA 2A4ZA 3KUZA 1KOTA 4E3CA 2YLMA 2QHOA 4I6LB 4B95A 1KLVA 2K8HA 3MHSD 2LVQA 2G4DB 4XX5A 4FJZA 4HXDA 2K8CA 4WWNA 4K7UA 1WXVA 2KDIA 3IVFA 4F8CB 3V6CB 5DPSA 4EZJA 2KTFA 5LXHA 1U4AA 1UELA 3V62A 1WXAA 1K8RB 2OOBB 2BWES 2EKEC 2RR9A 2MA9B 3S2AA 2C9WB 3OLMD 2JF5A 2MBBB 2EMSA 3IG3A 3NOBA 1YIWA 4HCNB 4TKNA 4KSKC 4MJSA 2V1YA 3VFKA 4MSQB 3PPAA 3IFWB 4II2B 3T9LA 4AWJA 3UQAA 1WRDB 1L7YA 4GMVA 3SHQA 4DXAB 3A9KA 2K1FA 2WX1A 2KC1A 1EUVB 3CSFA 3H9DA 4M0WB 1JRUA 5LXIB 3QK0A 5LLIA 2M8SA 3EECA 3L54A 5L83A 5DPWA 3DVNU 2DHZA 2ZNVB 4M8NA 3X0WA 2IZVB 2LVOA 4ICUA 1Q1OA 2XK5B 1Z2MA 3L0WB 1TTNA 1C1YB 3DBLI 2D10A 2FCMA 3QJZA 2LD9A 2G3QB 1SGHA 2K25A 5GMVA 5J18A 2CR5A 2CHZA 3KYCD 2DYBA 3TBLD 5TR5A 3RYTA 3ZNGC 5FR6A 4BKTA 3VH3B 3VUWA 3EFUA 4AJWA 2GBKA 2KTRB 1V6EA 1E8YA 2KLGA 1EF5A 1WGDA 3WA0A 4HJKA 2IY0B 2ZZPB 2RGFA 1RLFA 3ML8A 1BT0A 1WM2A 5AZGA 3L08A 2J0KA 1E7VA 3JYUA 2FUHB 3M95A 2BF8B 4JIOU 4PS8A 2BKFA 4CO7A 3X23A 2MCNB 4W9FA 3AU5A 4NAWB 1WX8A 2GOWA 2KK8A 2PE9A 5CHFA 4XZ4A 3RCZA 1V49A 3T8MA 3QIJA 4GGQA 1WMHB 3ZRFA 3GOEA 2PE6B 2KQ7A 4BKGA 1HE8A 3R7RA 2LXCA 3QA8A 2GBNA 3V61A 4IG7B 2N1WA 2LRWA 1IP9A 4J6IA 2L0TA 1SE9A 2LXAA 2C60A 2EMTA 2MP2B 2HTHA 5JHBA 3PGEA 1YJ1A 2LGYA 3V60A 4II3B 4RM8A 2C7MB 1V81A 3EC8A 3APDA 4B6WA 1J0GA 3R66C 1R4MI 4HWIB 3PS6A 5D6JB 1SIFA 1RFAA 4KIKB 4LCDE 4XC2A 4DDGD 1UZXB 4IWQA 4W9JA 2KVRA 2I1KA 5J17A 3VXWA 3TCAA 4IC7B 2MRPA 2O6VA 1AARA 2GBMA 2LWPA 3QC8B 3AI5A 2DZKA 4URKA 2K6DB 4LJPB 1P3QU 4DBGA 4NJ7A 3QCAA 2LRUA 2KANA 3JSVA 3QX1A 5G2NA 3QHTA 1ZKHA 4FA6A 4KDIC 2LI5A 2KJ6A 2Z0DB 2LZ6A 3ZNZB 2FCQA 4ZRJA 2MLBA 4PS3A 2JWZA 3HM6X 1Q5WB 4HVBA 2D3GA 3ZVVA 2N9XA 3VUYA 4CHKA 3NHEB 4M8MA 4W9CA 3ZUNA 3QAQA 3PTFC 2CHWA 3KVFB 5AZFA 3HK0A 1WGRA 1WR6E 2KX3A 3PT2B 4GDKB 2ZVNA 4W9IA 2V4LA 1GUAB 4MH0E 3IHPC 4W9HA 3V6EB 2DAFA 1OGWA 5C23A 2PJHA 3KYDD 3PREA 3H7PA 4LDTD 3ZTCA 2PPHA 3MJWA 3QARA 1V5OA 4GDLB 3M62B 4AJYB 2Z0EB 2RSUA 2MBHA 3VUXA 2FIFA 2R2QA 3A1QA 2L3ZA 3L17A 3W1YA 1S1QB 2KDFB 2LJ5A 2BGFA 1D3ZA 4DWFA 3RZFA 4MGZE 3A4SC 5IAAC 1WJNA 2NR2A 4AOFA 2CKHB 1E90A 1QZEA 1WYWB 3ZDTA 2JZ3B 1YX6B 2NCNA 2ZPNA 2CHXA 3EHVA 1WZ0A 4RM9A 1KM7A 3DVGX 4HCPB 1ISNA 2DZJA 2Z59B 5CX3A 3VHTC 2IO1B 2IO3B 4JL9A 4NQKE 2WYQA 1WZ3A 2KC2A 4MEMA 2BYVE 3CSTA 3A9JB 3B1LX 3DVGY 3ENEA 2IO0B 3ZLZA 3WAPA 5KHOA 3SDLC 5D2MB 3APFA 2CU1A 2KO3A 2ZEQA 4GU2A 4K81A 3HM3A 3W1SA 3PVLA 1TGZB 2KLCA 2YVCA 3A4RA 4GB9A 3BY4B 1NBFC 3BINA 3LDZE 4BKSA 2LGDA 1OTRB 2HJ8A 1OEYJ 2GBRA 4BFRA 1YQBA 3APCA 4G50A 3RD2A 2KFKA 3OJ3A 2DZIA 3W1SC 2NS5A 3I3TB 4IM3A 3AULA 3UIPB 1ZGUB 2C5LC 4K7SA 2A5UA 1P1AA 2JPHA 2FCSA 2UWQA 3CF6E 3PRZA 5CTRC 3UQBA 5G55A 2JUOA 4KZ0A 2FAZA 4FJVB 4WJNA 1C3TA 3DPDA 3P2BA 5KHQA 1Z5SB 1EF1A 2D07B 1M94A 3QWZB 4MJSB 1V86A 2OJRA 2KFJA 2JXXA 3LJ3A 1WX7A 3QQ8B 4KV2A 2O2VA 4BBNC 2KXJA 2PEAA 4FHKA 3GZNI 3U7DA 3DQVA 4HPMB 3A9KB 3NS8A 2M1MA 1WX9A 3PRMB 4DHJD 2L8JA 4W9DA 3U8ZA 2JY6A 1WIAA 3O65B 2GBJA 2NBWB 4KVGB 4FN2A 3PHWB 1MG8A 2NPTA 4EZKA 1WJ4A 4HK2A 4OVUA 1UGMA 1UH6A 1WXMA 4ASWC 2WDTB 2N9PC 1P98A 2GMIC 4BOSC 2C7NB 4GSWA 2N1VA 5L95C 4LDTB 4PYZA 2HD5B 4JQWC 4I6NB 2C7HA 2G45B 2ZCCA 2LASA 2G4SA 2L76A 2ZPYA 3ZW3A 2DX5B 1X1MA 3Q3FA 1E8ZA 4ZRKA 2IY1B 4FJYA 2MWSB 3SD5A 2KJRA 3A33B 1OEYA 2IO2B 2XBBC 5D94A 1RAXA 3NZUA 2BKRB 1OQYA 2I1JA 1WI0A 4HDQA 3JVZX 4DHZE 2K6QA 4A3PA 4JLCA 3ZDMC 2D2QA 4TQ0A 2HE7A 4IWPA 4EFOA 3TIXA 4BBNF 2KJHB 3L13A 2JT4B 2KMAA 2D11A 3PHXB 2MBEA 2WWZA 3H7SA 2FIDA 1E8XA 3ZTDA 3DBHI 2NBVB 2MQJA 5AEKB 4NNJB 3JW0X 3ZIMA 3K9PB 2J0JA 5IA7A 4ZRIA 1E7UA 5E6PA 4DK5A 3KUDB 2FCNA 4FULA 4LJOB 4EUTA 1WGGA 3TMPB 4G0NB 1I42A 2MX2A 1P0RA 1R4NI 4HLEA 4WWPA 4NJ6A 3UINB 4G11A 4PYUA 5CHWA 4E74A 2L0FA 3DCGA 4NPNA 3PLUA 5DPTA 1CMXB 1G6JA 4YL8A 4IW0A 3SU8X 4MDKE 1LFDA 3H6NA 2NVUI 4EOYA 4GXBA 2KHWB 2R2OA 3TJPA 4CYEA 1VD2A 1WFYA 4ICVA 4BKSD 3PV1A 4IWOA 2IYDB 4MELA 4ZDVA 1T0YA 2KDEB 2KOXA 4WJQA 3VQIA 1GC7A 3PRPB 3PZDA 4W9GA 3WAMA 2MBOA 4JGHB 3ZO5B 2O6VB 3C0RB 4KZCA 3M63B 2KDBA 2XK5A 2CS4A 2ASQA 3VTUA 1WJ6A 2AEHA 2KQSA 2N7EA 2K8BA 1F9JA 4X57B 3WIMA 3IBEA 2M0XA 1H8CA 5JH5C 4KSLC 1FXTB 2REXA 4W9EA 2N4FA 3JSVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RRB A;  4WJO A;  4DHZ B;  2ZNV C;  2UYZ B;  1VCB A;  1YD8 U;  4BVU C;  4DHJ B;  2KN5 A;  4ANW A;  3DBS A;  1LXD A;  3ALB A;  4MGK E;  4TUU A;  4EEW A;  2KTR A;  3D32 A;  2JRH A;  3DOW A;  4K7W A;  5J2R A;  1WGH A;  3ECI A;  3DBR I;  1WXS A;  5EDS A;  1PQS A;  2ZCB A;  2IBI B;  4ANU A;  1V80 A;  1XT9 B;  2DZM A;  2L05 A;  4FBJ B;  3UF8 A;  5E6N A;  1I35 A;  4MGI E;  4G3X B;  3PSE B;  5HKH A;  4HPL B;  5E6O A;  2JRI B;  2AYO B;  1H4R A;  3H7P B;  4NAW A;  1P9D U;  2AWT A;  3AXC A;  4TV3 A;  1UD7 A;  3NY5 A;  3VTW A;  1EO6 A;  1WMH A;  2KWU B;  3VTV A;  2K39 A;  1WY8 A;  3RT3 B;  5DPR A;  4A20 A;  1WM3 A;  2RPQ A;  2DAJ A;  4MM3 A;  3DDC B;  3ZRC A;  2MW5 A;  1XD3 B;  2L7R A;  2KWV B;  3UIO B;  3A1Q B;  4GN1 A;  2DYM A;  3RUL A;  4GOC A;  2NBU A;  2O6V D;  4FLH A;  4WQO B;  1L2N A;  4TQ1 A;  3KH0 A;  5CHV C;  2MP2 A;  2RD0 A;  2VRR B;  3WAL A;  4AP4 C;  3TL5 A;  4IM2 A;  1S3S G;  2FNJ B;  1YX5 B;  1GNU A;  5D7G A;  1KJT A;  3HHM A;  3WAN A;  1IYF A;  3H1U A;  1Y8R C;  4BOZ B;  2JZZ A;  4EZL A;  4DDI D;  4GIV A;  4KIK A;  3L16 A;  1A5R A;  1TBE A;  4WJP A;  2M4N A;  2KWC A;  2ZJD A;  5BO4 B;  1E8W A;  3VDZ A;  2LGX A;  1WE6 A;  1WJU A;  2KX0 A;  4FAD A;  5JHA A;  1NI2 A;  4OVV A;  3N30 A;  3ZKJ C;  3MTN B;  2XEW A;  2LUE A;  3KUC B;  4IUM B;  1WR1 A;  2BPS A;  4ANX A;  1IPG A;  2LVP A;  2JVC A;  4W9K A;  2AL3 A;  2Y5B B;  4MSM B;  2KNB A;  2KFK B;  4EKU A;  5JZE B;  2KZR A;  3L10 B;  2V3S A;  4FHJ A;  4WWO A;  1J8C A;  5DCN A;  1TZ1 A;  3PLV A;  1J19 A;  2KKC A;  4KDL B;  4MGY E;  1WGY A;  3K9O B;  3Q3J A;  1GC6 A;  4GDK A;  3ZNH B;  5C1Z A;  3B0A A;  3OAW A;  3CMM B;  4W9L A;  3RZW C;  1WF9 A;  4E71 A;  4ZYN A;  1WE7 A;  1LQB A;  1V2Y A;  1UBI A;  1XQQ A;  4AUQ C;  1UBQ A;  1GG3 A;  2WX0 A;  2O2V B;  2B3A A;  4K1R B;  4HDO A;  4WAA A;  4NQL B;  1NDD A;  4GDL A;  2DEN B;  3M3J A;  3KW5 B;  4ANV A;  2J0M A;  3ZNI D;  4F7Z A;  2MBQ A;  4NY0 A;  2KMC A;  1LM8 B;  2NPT B;  4RMA A;  4PS7 A;  2M17 A;  2N9E B;  4IM0 A;  3NZS A;  3VAW A;  3DVN V;  3AU4 A;  3N3K B;  3R3M A;  4I6P A;  2KD0 A;  2ZVO A;  5AZH A;  3RUI B;  3ML9 A;  3WAO A;  2DYO A;  2L00 B;  2J7Q B;  2W9N A;  3B08 A;  2MSE D;  1WH3 A;  4N9F 4;  4B9K A;  1V9J A;  3VVW B;  1E5W A;  3UGB B;  3OJ4 B;  3ONS A;  4P7I A;  2BWF A;  1Q0W B;  3A9J A;  3R7Q A;  1GJZ A;  1ZW7 A;  2BYF A;  3VH4 B;  2AL6 A;  3N32 A;  3U30 A;  2N7D A;  1V5T A;  4A3O A;  4F1S A;  2BYE A;  3HIZ A;  2A4Z A;  3KUZ A;  1KOT A;  4E3C A;  2YLM A;  2QHO A;  4I6L B;  4B95 A;  1KLV A;  2K8H A;  3MHS D;  2LVQ A;  2G4D B;  4XX5 A;  4FJZ A;  4HXD A;  2K8C A;  4WWN A;  4K7U A;  1WXV A;  2KDI A;  3IVF A;  4F8C B;  3V6C B;  5DPS A;  4EZJ A;  2KTF A;  5LXH A;  1U4A A;  1UEL A;  3V62 A;  1WXA A;  1K8R B;  2OOB B;  2BWE S;  2EKE C;  2RR9 A;  2MA9 B;  3S2A A;  2C9W B;  3OLM D;  2JF5 A;  2MBB B;  2EMS A;  3IG3 A;  3NOB A;  1YIW A;  4HCN B;  4TKN A;  4KSK C;  4MJS A;  2V1Y A;  3VFK A;  4MSQ B;  3PPA A;  3IFW B;  4II2 B;  3T9L A;  4AWJ A;  3UQA A;  1WRD B;  1L7Y A;  4GMV A;  3SHQ A;  4DXA B;  3A9K A;  2K1F A;  2WX1 A;  2KC1 A;  1EUV B;  3CSF A;  3H9D A;  4M0W B;  1JRU A;  5LXI B;  3QK0 A;  5LLI A;  2M8S A;  3EEC A;  3L54 A;  5L83 A;  5DPW A;  3DVN U;  2DHZ A;  2ZNV B;  4M8N A;  3X0W A;  2IZV B;  2LVO A;  4ICU A;  1Q1O A;  2XK5 B;  1Z2M A;  3L0W B;  1TTN A;  1C1Y B;  3DBL I;  2D10 A;  2FCM A;  3QJZ A;  2LD9 A;  2G3Q B;  1SGH A;  2K25 A;  5GMV A;  5J18 A;  2CR5 A;  2CHZ A;  3KYC D;  2DYB A;  3TBL D;  5TR5 A;  3RYT A;  3ZNG C;  5FR6 A;  4BKT A;  3VH3 B;  3VUW A;  3EFU A;  4AJW A;  2GBK A;  2KTR B;  1V6E A;  1E8Y A;  2KLG A;  1EF5 A;  1WGD A;  3WA0 A;  4HJK A;  2IY0 B;  2ZZP B;  2RGF A;  1RLF A;  3ML8 A;  1BT0 A;  1WM2 A;  5AZG A;  3L08 A;  2J0K A;  1E7V A;  3JYU A;  2FUH B;  3M95 A;  2BF8 B;  4JIO U;  4PS8 A;  2BKF A;  4CO7 A;  3X23 A;  2MCN B;  4W9F A;  3AU5 A;  4NAW B;  1WX8 A;  2GOW A;  2KK8 A;  2PE9 A;  5CHF A;  4XZ4 A;  3RCZ A;  1V49 A;  3T8M A;  3QIJ A;  4GGQ A;  1WMH B;  3ZRF A;  3GOE A;  2PE6 B;  2KQ7 A;  4BKG A;  1HE8 A;  3R7R A;  2LXC A;  3QA8 A;  2GBN A;  3V61 A;  4IG7 B;  2N1W A;  2LRW A;  1IP9 A;  4J6I A;  2L0T A;  1SE9 A;  2LXA A;  2C60 A;  2EMT A;  2MP2 B;  2HTH A;  5JHB A;  3PGE A;  1YJ1 A;  2LGY A;  3V60 A;  4II3 B;  4RM8 A;  2C7M B;  1V81 A;  3EC8 A;  3APD A;  4B6W A;  1J0G A;  3R66 C;  1R4M I;  4HWI B;  3PS6 A;  5D6J B;  1SIF A;  1RFA A;  4KIK B;  4LCD E;  4XC2 A;  4DDG D;  1UZX B;  4IWQ A;  4W9J A;  2KVR A;  2I1K A;  5J17 A;  3VXW A;  3TCA A;  4IC7 B;  2MRP A;  2O6V A;  1AAR A;  2GBM A;  2LWP A;  3QC8 B;  3AI5 A;  2DZK A;  4URK A;  2K6D B;  4LJP B;  1P3Q U;  4DBG A;  4NJ7 A;  3QCA A;  2LRU A;  2KAN A;  3JSV A;  3QX1 A;  5G2N A;  3QHT A;  1ZKH A;  4FA6 A;  4KDI C;  2LI5 A;  2KJ6 A;  2Z0D B;  2LZ6 A;  3ZNZ B;  2FCQ A;  4ZRJ A;  2MLB A;  4PS3 A;  2JWZ A;  3HM6 X;  1Q5W B;  4HVB A;  2D3G A;  3ZVV A;  2N9X A;  3VUY A;  4CHK A;  3NHE B;  4M8M A;  4W9C A;  3ZUN A;  3QAQ A;  3PTF C;  2CHW A;  3KVF B;  5AZF A;  3HK0 A;  1WGR A;  1WR6 E;  2KX3 A;  3PT2 B;  4GDK B;  2ZVN A;  4W9I A;  2V4L A;  1GUA B;  4MH0 E;  3IHP C;  4W9H A;  3V6E B;  2DAF A;  1OGW A;  5C23 A;  2PJH A;  3KYD D;  3PRE A;  3H7P A;  4LDT D;  3ZTC A;  2PPH A;  3MJW A;  3QAR A;  1V5O A;  4GDL B;  3M62 B;  4AJY B;  2Z0E B;  2RSU A;  2MBH A;  3VUX A;  2FIF A;  2R2Q A;  3A1Q A;  2L3Z A;  3L17 A;  3W1Y A;  1S1Q B;  2KDF B;  2LJ5 A;  2BGF A;  1D3Z A;  4DWF A;  3RZF A;  4MGZ E;  3A4S C;  5IAA C;  1WJN A;  2NR2 A;  4AOF A;  2CKH B;  1E90 A;  1QZE A;  1WYW B;  3ZDT A;  2JZ3 B;  1YX6 B;  2NCN A;  2ZPN A;  2CHX A;  3EHV A;  1WZ0 A;  4RM9 A;  1KM7 A;  3DVG X;  4HCP B;  1ISN A;  2DZJ A;  2Z59 B;  5CX3 A;  3VHT C;  2IO1 B;  2IO3 B;  4JL9 A;  4NQK E;  2WYQ A;  1WZ3 A;  2KC2 A;  4MEM A;  2BYV E;  3CST A;  3A9J B;  3B1L X;  3DVG Y;  3ENE A;  2IO0 B;  3ZLZ A;  3WAP A;  5KHO A;  3SDL C;  5D2M B;  3APF A;  2CU1 A;  2KO3 A;  2ZEQ A;  4GU2 A;  4K81 A;  3HM3 A;  3W1S A;  3PVL A;  1TGZ B;  2KLC A;  2YVC A;  3A4R A;  4GB9 A;  3BY4 B;  1NBF C;  3BIN A;  3LDZ E;  4BKS A;  2LGD A;  1OTR B;  2HJ8 A;  1OEY J;  2GBR A;  4BFR A;  1YQB A;  3APC A;  4G50 A;  3RD2 A;  2KFK A;  3OJ3 A;  2DZI A;  3W1S C;  2NS5 A;  3I3T B;  4IM3 A;  3AUL A;  3UIP B;  1ZGU B;  2C5L C;  4K7S A;  2A5U A;  1P1A A;  2JPH A;  2FCS A;  2UWQ A;  3CF6 E;  3PRZ A;  5CTR C;  3UQB A;  5G55 A;  2JUO A;  4KZ0 A;  2FAZ A;  4FJV B;  4WJN A;  1C3T A;  3DPD A;  3P2B A;  5KHQ A;  1Z5S B;  1EF1 A;  2D07 B;  1M94 A;  3QWZ B;  4MJS B;  1V86 A;  2OJR A;  2KFJ A;  2JXX A;  3LJ3 A;  1WX7 A;  3QQ8 B;  4KV2 A;  2O2V A;  4BBN C;  2KXJ A;  2PEA A;  4FHK A;  3GZN I;  3U7D A;  3DQV A;  4HPM B;  3A9K B;  3NS8 A;  2M1M A;  1WX9 A;  3PRM B;  4DHJ D;  2L8J A;  4W9D A;  3U8Z A;  2JY6 A;  1WIA A;  3O65 B;  2GBJ A;  2NBW B;  4KVG B;  4FN2 A;  3PHW B;  1MG8 A;  2NPT A;  4EZK A;  1WJ4 A;  4HK2 A;  4OVU A;  1UGM A;  1UH6 A;  1WXM A;  4ASW C;  2WDT B;  2N9P C;  1P98 A;  2GMI C;  4BOS C;  2C7N B;  4GSW A;  2N1V A;  5L95 C;  4LDT B;  4PYZ A;  2HD5 B;  4JQW C;  4I6N B;  2C7H A;  2G45 B;  2ZCC A;  2LAS A;  2G4S A;  2L76 A;  2ZPY A;  3ZW3 A;  2DX5 B;  1X1M A;  3Q3F A;  1E8Z A;  4ZRK A;  2IY1 B;  4FJY A;  2MWS B;  3SD5 A;  2KJR A;  3A33 B;  1OEY A;  2IO2 B;  2XBB C;  5D94 A;  1RAX A;  3NZU A;  2BKR B;  1OQY A;  2I1J A;  1WI0 A;  4HDQ A;  3JVZ X;  4DHZ E;  2K6Q A;  4A3P A;  4JLC A;  3ZDM C;  2D2Q A;  4TQ0 A;  2HE7 A;  4IWP A;  4EFO A;  3TIX A;  4BBN F;  2KJH B;  3L13 A;  2JT4 B;  2KMA A;  2D11 A;  3PHX B;  2MBE A;  2WWZ A;  3H7S A;  2FID A;  1E8X A;  3ZTD A;  3DBH I;  2NBV B;  2MQJ A;  5AEK B;  4NNJ B;  3JW0 X;  3ZIM A;  3K9P B;  2J0J A;  5IA7 A;  4ZRI A;  1E7U A;  5E6P A;  4DK5 A;  3KUD B;  2FCN A;  4FUL A;  4LJO B;  4EUT A;  1WGG A;  3TMP B;  4G0N B;  1I42 A;  2MX2 A;  1P0R A;  1R4N I;  4HLE A;  4WWP A;  4NJ6 A;  3UIN B;  4G11 A;  4PYU A;  5CHW A;  4E74 A;  2L0F A;  3DCG A;  4NPN A;  3PLU A;  5DPT A;  1CMX B;  1G6J A;  4YL8 A;  4IW0 A;  3SU8 X;  4MDK E;  1LFD A;  3H6N A;  2NVU I;  4EOY A;  4GXB A;  2KHW B;  2R2O A;  3TJP A;  4CYE A;  1VD2 A;  1WFY A;  4ICV A;  4BKS D;  3PV1 A;  4IWO A;  2IYD B;  4MEL A;  4ZDV A;  1T0Y A;  2KDE B;  2KOX A;  4WJQ A;  3VQI A;  1GC7 A;  3PRP B;  3PZD A;  4W9G A;  3WAM A;  2MBO A;  4JGH B;  3ZO5 B;  2O6V B;  3C0R B;  4KZC A;  3M63 B;  2KDB A;  2XK5 A;  2CS4 A;  2ASQ A;  3VTU A;  1WJ6 A;  2AEH A;  2KQS A;  2N7E A;  2K8B A;  1F9J A;  4X57 B;  3WIM A;  3IBE A;  2M0X A;  1H8C A;  5JH5 C;  4KSL C;  1FXT B;  2REX A;  4W9E A;  2N4F A;  3JSV B; 
#chains in the Genus database with same CATH topology
 4DHZ B;  2K3U A;  3KWL A;  2KN5 A;  1N60 A;  1SJE D;  1XLO A;  5HFY A;  4KGT A;  3ALB A;  4TUU A;  2WXM A;  2JRH A;  1T0Q C;  3ECI A;  3DBR I;  1KRH A;  2DZM A;  4HPP A;  2WXP A;  1I35 A;  4MGI E;  4G3X B;  1DOY A;  4ZHP A;  4FXC A;  4OW0 A;  1JWM D;  2FBW B;  2AYO B;  3H7P B;  2AWT A;  1HQR D;  3VTW A;  1YNT E;  3VTV A;  3RT3 B;  4EE2 A;  1XD3 B;  1BXT A;  1SJH D;  2KWV B;  2DYM A;  3RUL A;  1XLP A;  1DOI A;  3NUH B;  1L2N A;  1FCC C;  2BB6 A;  2VRR B;  3WAL A;  1EU4 A;  5D7G A;  1L4D B;  3H1U A;  1Y8R C;  3I63 C;  4BOZ B;  2WXQ A;  1MVK A;  4GIV A;  1TBE A;  1SF0 A;  2ZJD A;  3VDZ A;  4C00 A;  1WJU A;  2KX0 A;  4FAD A;  5JHA A;  1YN4 A;  1QOB A;  2SAK A;  1TS3 A;  3MTN B;  1PGB A;  2PKO A;  3KUC B;  4ANX A;  2I38 A;  2AL3 A;  4MSM B;  2KNB A;  5JZE B;  4QAY A;  1F0Z A;  3DHH C;  4WWO A;  1J8C A;  3RPF C;  5DCN A;  4RGN A;  4KDL B;  1WGY A;  1GC6 A;  3ZNH B;  5C1Z A;  1QOG A;  4W9L A;  4ZYN A;  5IO9 A;  1LQB A;  4M00 A;  3BK2 A;  1C76 A;  1NDD A;  1TS4 A;  2WS3 B;  3M3J A;  4D2K A;  4ACF A;  3MC9 A;  2PIA A;  3SEB A;  4RMA A;  2GRI A;  1LGR A;  3Q8F A;  2N9E B;  4IM0 A;  3DVN V;  3AU4 A;  3R3M A;  4I6P A;  4YWG G;  2J7Q B;  2W9N A;  4YSZ B;  1WH3 A;  3VVW B;  2QJL A;  4LNN A;  4P7I A;  2BWF A;  1NYQ A;  4M02 A;  2WXR A;  1YQ3 B;  2DNF A;  3U30 A;  1D4B A;  4A3O A;  2A4Z A;  5HHD G;  2YLM A;  2LGI A;  2QHO A;  3V3X A;  3MHS D;  5DPS A;  3E9S A;  2VZK D;  3V62 A;  3IAM 1;  4YTM B;  2EKE C;  2RR9 A;  2LFI A;  4JX1 C;  1PGX A;  3Q69 A;  4NJC A;  3NOB A;  4MSQ B;  3PPA A;  3IFW B;  4II2 B;  3T9L A;  4AWJ A;  1WRD B;  2D5G A;  3A9K A;  4M0W B;  1JRU A;  3QK0 A;  1RM6 C;  2WDR B;  2KWD A;  1EWY C;  2D3A A;  1I4R A;  2JQR B;  1Q1O A;  1RYJ A;  3L0W B;  3W9C B;  4A6Q A;  1UWM A;  2DYB A;  4YSY B;  5TR5 A;  1GAQ B;  5FR6 A;  1AW7 A;  4BKT A;  3VUW A;  3EFU A;  3IAS 1;  1V6E A;  2RGF A;  1RLF A;  3KQ4 A;  3ML8 A;  1TZO A;  3DWG C;  2YEP F;  1V1O A;  2X38 A;  1WX8 A;  1SXT A;  2N9L A;  2KQ7 A;  3R7R A;  3QA8 A;  2M56 B;  1E9M A;  2JWU A;  1DOX A;  3AH7 A;  4IOI E;  1SE9 A;  3C8Y A;  1FNW A;  3FKY A;  1L0X B;  3V60 A;  4II3 B;  4RM8 A;  3IT6 B;  1J0G A;  3R66 C;  1NEN B;  3HVD A;  4ARC A;  1RFA A;  4LCD E;  4XC2 A;  1UZX B;  5J17 A;  2LWP A;  2N7J A;  3QC8 B;  3AI5 A;  3ZJV A;  1UUP A;  4HEA 1;  2DZK A;  4OVZ A;  5AUI A;  4WH4 A;  4DBG A;  2KAN A;  3AMZ A;  3RI7 C;  1C4C A;  4FA6 A;  2Z0D B;  1KF6 B;  2FCQ A;  1GPX A;  4PS3 A;  2PVG C;  1XEE A;  2IJ0 A;  4HVB A;  2N9X A;  3AE9 B;  4NZL B;  2CHW A;  2J52 A;  5AZF A;  2V4L A;  4KKI A;  4W9H A;  3IHP C;  1VRA B;  3N1Z C;  5BMG A;  1WWT A;  4A55 A;  5C23 A;  3R8B A;  3PRE A;  5HG2 A;  1T5X D;  1DYQ A;  4LDT D;  3RMK C;  3AV8 A;  1MPE A;  4AJY B;  2CJN A;  3L17 A;  3W1Y A;  2LJ5 A;  2KDF B;  3NZ3 A;  3A4S C;  4AOF A;  1WJN A;  2NR2 A;  1ROE A;  4LK0 M;  4NAM A;  1YX6 B;  2ZPN A;  4L23 A;  3BII D;  2G1E A;  1KM7 A;  1V8C A;  2KAJ A;  2Z59 B;  1TS2 A;  4NQK E;  2WU5 B;  1WZ3 A;  2KC2 A;  4RH6 A;  1OQQ A;  3CST A;  3DVG Y;  1AYF A;  3WAP A;  5KHO A;  5D2M B;  2AQ2 B;  3HM3 A;  3PVL A;  4RF1 A;  2YVC A;  1NBF C;  3LDZ E;  3DBH B;  1OTR B;  1OEY J;  4G50 A;  3RD2 A;  4LNO A;  2BVC A;  4B0E A;  3UIP B;  1ZGU B;  2JPH A;  3CF6 E;  5CTR C;  2JYE A;  4KZ0 A;  1JWU D;  1C3T A;  1Z5S B;  1EF1 A;  1M94 A;  2KAC A;  2OJR A;  3AN1 A;  2O2V A;  2KXJ A;  3NVY A;  3GZN I;  3DQV A;  3A9K B;  3C19 A;  2M1M A;  1WX9 A;  4S17 A;  1C78 A;  3RNF C;  2JSV X;  3TUO A;  3LXF A;  2XNA C;  4FN2 A;  4HK2 A;  1UH6 A;  4ASW C;  4C7Z A;  4GSW A;  4PYZ A;  3L4P A;  3UI3 A;  4JE3 B;  3NVV A;  4I6N B;  2C7H A;  2G45 B;  4TSS A;  1JRP A;  3TEY A;  4IKG A;  4AQ7 A;  4N59 A;  2NTT A;  1LO5 D;  3SD5 A;  1JWS D;  2KJR A;  3A33 B;  1OEY A;  2XBB C;  2J53 A;  2WHI A;  4YTP B;  1T0S C;  4HDQ A;  2K6Q A;  4A3P A;  1STE A;  3ZDM C;  4LNF A;  5D3D A;  2KMA A;  2D11 A;  1E8X A;  4NNJ B;  3RFZ B;  4US8 A;  5FR3 A;  2IND C;  4C80 A;  1TY2 A;  3KUD B;  1WGG A;  2BS2 B;  4G0N B;  1N6Z A;  3SFD B;  1R4N I;  1GOZ A;  5CHW A;  1L0Y B;  1CMX B;  3Q8E A;  2INP E;  4JWS C;  1LFD A;  3H6N A;  2RDG A;  3VQI A;  2M19 A;  5G5H A;  2KDB A;  3BVG A;  1H8C A;  3IBE A;  2EEL A;  4WJO A;  2VH1 A;  1MFW A;  4BVU C;  4DHJ B;  4ANW A;  3DBS A;  1LXD A;  2N9K A;  1WGH A;  5EDS A;  1WRI A;  2WU2 B;  1V80 A;  1XT9 B;  2PW9 A;  2L05 A;  3UF8 A;  1KLG D;  3TSS A;  4PT5 A;  4B0M A;  2JZP A;  3PSE B;  3ZYY X;  1B1Z A;  1UD7 A;  2K39 A;  2JX5 A;  5DPR A;  2Y5C A;  3AE6 B;  2MW5 A;  4UDU C;  5TSS A;  2MH7 A;  2NBU A;  2O6V D;  1D5X C;  4FLH A;  5CHV C;  2QSD A;  4ZOH C;  2MP2 A;  3ETR A;  4AP4 C;  3TL5 A;  4GLS C;  1S3S G;  1C9F A;  3AEE B;  4DDI D;  4KIK A;  3L16 A;  2M4N A;  5BO4 B;  1E8W A;  1WE6 A;  2CU3 A;  1NI2 A;  1ZXI A;  1C77 A;  4REZ A;  2LUE A;  5H92 C;  2BPS A;  1IPG A;  1ENF A;  2JVC A;  2Y5B B;  4EKU A;  1I4H A;  1Q10 A;  2KZR A;  2RDB C;  5EE1 A;  3EA6 A;  3B9J A;  2KKC A;  4MGY E;  3T3N A;  3AEG B;  2V3N A;  1WF9 A;  4E71 A;  1L6U A;  4J3O D;  5BYQ A;  1UBI A;  1FM0 D;  1TY0 A;  2O2V B;  3AE1 B;  4K1R B;  1HXY D;  3KLS X;  3MC8 A;  2DEN B;  1PUT A;  1R7S A;  4ITK A;  3KW5 B;  3ZNI D;  2J4X A;  2MBQ A;  2OED A;  4M01 A;  5C2T B;  1LM8 B;  3RNG C;  3BZD B;  3N20 C;  4WUR A;  3VRA B;  1E0Z A;  1EWC A;  3RUI B;  3ML9 A;  1E7P B;  1SB3 C;  4B9K A;  1E5W A;  1QOF A;  1P7F A;  3UGB B;  3ONS A;  2V4I B;  1GJZ A;  1TS5 A;  2WXL A;  4RGM A;  1AWD A;  2KVZ A;  2GLS A;  2N7D A;  4US9 A;  2BYE A;  3KUZ A;  3Q3O C;  4MT5 A;  1KOT A;  2MJ3 A;  1EM7 A;  1KLV A;  2LVQ A;  4XX5 A;  4P16 A;  4FJZ A;  4C56 C;  2KDI A;  2WGS A;  2KTF A;  5IOI A;  1WXA A;  2JXT A;  1Y56 A;  3BYY B;  2AQ1 B;  3B2G A;  4KKJ A;  2MBB B;  3H8H A;  4TKN A;  1YIW A;  3AEB B;  2V1Y A;  4HKQ A;  1F2R I;  3VFK A;  3U2S C;  1R4M B;  4GMV A;  5I4D A;  3BWU D;  4DXA B;  2KC1 A;  3H9D A;  3RNC C;  2M8S A;  3L54 A;  5L83 A;  2PLP A;  2W3R A;  2ZNV B;  3X0W A;  1TKY A;  2LVO A;  2E6X A;  1K51 A;  4XYC A;  3DBL I;  2WDQ B;  5GMV A;  2QIE B;  3HUI A;  3RYT A;  2LGS A;  2M0A A;  1E8Y A;  1EF5 A;  1WGD A;  1ACC A;  4HJK A;  2H88 B;  3NG0 A;  1BT0 A;  1KFY B;  3Q8B A;  2J0K A;  1E7V A;  2VH2 A;  3JYU A;  3M95 A;  2NTS A;  4JIO U;  1FIQ A;  4CO7 A;  3LB8 C;  3ZJT A;  3AU5 A;  5CHF A;  4XZ4 A;  1V49 A;  3T8M A;  3QIJ A;  4BKG A;  1HE8 A;  2LXC A;  2GBN A;  2N1W A;  2X8X X;  1YJJ A;  3AEA B;  3P63 A;  2L0T A;  3W5V B;  2LXA A;  2KQ4 X;  2EMT A;  2MP2 B;  5EE3 A;  5JXV A;  3SFE B;  1HA5 A;  1ZE3 D;  2C7M B;  1V81 A;  4B6W A;  2V0G A;  4KIK B;  4DDG D;  5IN7 A;  2KVR A;  2I1K A;  4IC7 B;  1AAR A;  4URK A;  1V1P A;  1HZ5 A;  3FIL B;  3QCA A;  3QHT A;  3GP7 A;  2ZW1 A;  1ZKH A;  3KWV A;  3ZNZ B;  2KJ6 A;  2LZ6 A;  3U4E G;  1T0R C;  2BBC A;  2JWZ A;  3ZVV A;  3VUY A;  3NHE B;  4M8M A;  3E56 A;  3ZUN A;  3PTF C;  1NEK B;  3RN9 C;  2XN9 C;  1WR6 E;  2KX3 A;  3PT2 B;  2ZVN A;  1SEB D;  4WIP A;  1GUA B;  4MH0 E;  1HTO A;  3V6E B;  2PJH A;  3ZTC A;  2PPH A;  3QAR A;  1TJE A;  2BT6 A;  3VUX A;  2FIF A;  1E6E B;  2DBY A;  2ZW0 A;  3P4Q B;  1WSP A;  2NCN A;  3EHV A;  1WZ0 A;  2OJW A;  3DVG X;  5C3J B;  2PMV A;  3EFC A;  2ICI A;  1SBB B;  2NMQ A;  2BYV E;  3R2I A;  3B1L X;  1FPY A;  3ENE A;  1N62 A;  2PTL A;  2KN4 A;  1DGJ A;  2KO3 A;  2ZEQ A;  4K81 A;  3W1S A;  1KTK A;  2KLC A;  3A4R A;  3BY4 B;  2OHF A;  4BKS A;  3BIN A;  2GBR A;  2KFK A;  2V3P A;  2L83 A;  3I3T B;  2LEK A;  2N0S B;  1P1A A;  2FCS A;  2UWQ A;  3V05 A;  3DPD A;  1L0V B;  3P2B A;  1ET9 A;  1V86 A;  2FE8 A;  3BVM A;  2KFJ A;  2JXX A;  1L6V A;  1PDX A;  3GE3 C;  2PEA A;  1FD6 A;  4DHJ D;  4ZRQ A;  4W9D A;  4XE0 A;  3O65 B;  2NBW B;  2R61 A;  1E10 A;  1C4P A;  2KT7 A;  2NPT A;  1WJ4 A;  4EZK A;  4OVU A;  1WXM A;  2QMT A;  1P98 A;  2GMI C;  3MC0 B;  1FFU A;  2LAS A;  2FUG 1;  2G4S A;  2DX5 B;  1TKE A;  1ZOY B;  1E8Z A;  4YT0 B;  4FJY A;  2K9X A;  5D94 A;  1RAX A;  3NZU A;  1OQY A;  3W2D A;  3JVZ X;  4JLC A;  3ZXV A;  2D2Q A;  4TQ0 A;  4IWP A;  4WWM A;  2MJE A;  2KJH B;  3PHX B;  1J7C A;  2MBE A;  2WWZ A;  3H7S A;  5AEK B;  4RFB A;  3JW0 X;  3PZ8 A;  4DXF A;  1I4P A;  4ZRI A;  1E7U A;  4DK5 A;  4FUL A;  2FCN A;  3VRB B;  2D3B A;  1I42 A;  1N5X A;  2MX2 A;  1P0R A;  3UIN B;  3TEX A;  2L0F A;  5BMH A;  3AE2 B;  1FRR A;  3AE7 B;  2L32 A;  4IW0 A;  3GE8 C;  4EOY A;  3TJP A;  1VD2 A;  1WFY A;  2D3C A;  4WJQ A;  3PRP B;  1TT5 B;  2E3T A;  1EU3 A;  4A90 A;  1WJ6 A;  1WGK A;  2AEH A;  1F9J A;  1V1P B;  2HDE A;  3WIM A;  2M0X A;  2G9H D;  5JH5 C;  4C7Y A;  2REX A;  2BB5 A;  2ZNV C;  1VCB A;  1YD8 U;  2HJ1 A;  5H8Y E;  4ZYS A;  3BVZ A;  1VLB A;  4KGR A;  2QEJ C;  3R2T A;  2WNM A;  1WXS A;  2ZCB A;  1NVI D;  5E6N A;  3DHI C;  4HPL B;  4N58 A;  2JRI B;  4NAW A;  1P9D U;  1EO6 A;  1WMH A;  2KWU B;  4KGS A;  1WM3 A;  2DAJ A;  4MM3 A;  1T6B X;  4XDC A;  3UIO B;  4GN1 A;  3NRZ A;  1KLU D;  2WXJ A;  4TQ1 A;  3KH0 A;  2MHJ A;  3VR9 B;  3OWE B;  3O13 A;  2FNJ B;  1IYF A;  1GNU A;  3HHM A;  2DWQ A;  5G5G A;  1A5R A;  5GXG B;  4WJP A;  2KWC A;  5LNK 1;  1K50 A;  4OVV A;  3N30 A;  3T3O A;  3MHZ A;  2XEW A;  1WR1 A;  1CK1 A;  3MFG A;  2KFK B;  2WQY B;  1L5P A;  2V3S A;  4FHJ A;  1J19 A;  4R3D A;  4GDK A;  3RZW C;  4C4V A;  1WE7 A;  1V2Y A;  2W82 A;  1XQQ A;  4AUQ C;  1UBQ A;  1GG3 A;  2WX0 A;  1WXQ A;  4NQL B;  2RMM A;  4ANV A;  2J0M A;  2WXI A;  2KMC A;  2NPT B;  2CJO A;  1B9R A;  1KH0 A;  1YQ4 B;  1ZDX A;  3NZS A;  3VAW A;  3WAO A;  2LJI A;  2J42 A;  3B08 A;  1QF6 A;  3OJ4 B;  1Q0W B;  3A9J A;  4N6E B;  3R7Q A;  1ZW7 A;  3N32 A;  1OFF A;  3HIZ A;  3ZQ4 A;  4E3C A;  4I6L B;  3CWI A;  4B95 A;  2K8H A;  2G4D B;  2H89 B;  1T3Q A;  4HXD A;  2K8C A;  4WWN A;  2TSS A;  2KYW A;  4BAX A;  3V6C B;  4EZJ A;  3U52 E;  1PGA A;  5LXH A;  1U4A A;  1UEL A;  1K8R B;  2OOB B;  2BWE S;  1NYR A;  4ZRP A;  2MA9 B;  5EE0 A;  3PZ7 A;  2INN E;  3IG3 A;  3RNB C;  4KSK C;  3WCQ A;  2WXK A;  3SHQ A;  3P1M A;  2QC8 A;  2K1F A;  3CSF A;  1FCL A;  3I5J C;  2DHZ A;  2IZV B;  4ICU A;  1ESF A;  1FFV A;  3Q2A C;  1TTN A;  2D10 A;  2FCM A;  2EKI A;  3QJZ A;  2LD9 A;  3RNA C;  1SGH A;  2K25 A;  4RGO S;  1FNU A;  2CR5 A;  3TBL D;  4S0R A;  4YSX B;  2RDH A;  3VH3 B;  4AJW A;  2LHD A;  1BML C;  1TYG B;  1SE2 A;  4K3C A;  2IY0 B;  2ZZP B;  1WM2 A;  5AZG A;  3L08 A;  1D5Z C;  4PS8 A;  3VR8 B;  3X23 A;  4W9F A;  4NAW B;  2GOW A;  2KK8 A;  3RCZ A;  1RWS A;  1WMH B;  2Y3A A;  3ZRF A;  2PE6 B;  3V61 A;  4MM3 B;  4IG7 B;  4KX6 B;  4DQO C;  4WAF A;  3TEW A;  4J6I A;  1F1H A;  2B76 B;  1FXI A;  4PK1 A;  1XLQ A;  2HTH A;  5JHB A;  3PGE A;  3Q6B A;  4AS1 A;  1HTQ A;  2LGY A;  4HRO A;  1FXA A;  3AE8 B;  1XCQ L;  3PS6 A;  2W55 A;  3LYY A;  1VJK A;  3AB5 A;  4BZA A;  2O6V A;  2GBM A;  2W54 A;  2K6D B;  2BYT A;  1P3Q U;  4NJ7 A;  3QX1 A;  3BYT B;  2LI5 A;  4MAC A;  4ZRJ A;  1Q5W B;  4CHK A;  1K53 A;  3HK0 A;  3N1X C;  4GDK B;  1J7B A;  2DAF A;  1OGW A;  4C4V B;  5IP4 D;  3KYD D;  3GZN B;  3MJW A;  1JQ4 A;  3Q14 C;  1V5O A;  1K52 A;  3FC4 A;  1XF5 L;  4RGT A;  2Z0E B;  2RSU A;  2R2Q A;  3A1Q A;  1S1Q B;  1SE3 A;  5IAA C;  1WYW B;  1YJI A;  1JML A;  2CHX A;  1ISN A;  5CX3 A;  3VHT C;  2IO3 B;  2WXN A;  4JL9 A;  4L1B A;  4MEM A;  3MP9 A;  3A9J B;  4K3B A;  2QIL A;  2IO0 B;  4WQM A;  4LLG M;  3APF A;  1SE4 A;  2CU1 A;  4GU2 A;  1N5W A;  4TMA B;  3HRD D;  1YQB A;  2ACZ B;  3U7Z A;  3OJ3 A;  3W1S C;  2NS5 A;  1FRD A;  5AUK A;  2C5L C;  4K7S A;  1R4N B;  3PRZ A;  3UQB A;  1L4Z B;  2JUO A;  4HRS A;  2FAZ A;  4FJV B;  4WJN A;  5KHQ A;  5HI1 A;  2D07 B;  3QQ8 B;  1WX7 A;  4P6V F;  3U7D A;  3PRM B;  3NS8 A;  2GB1 A;  2L8J A;  1YMH E;  2JY6 A;  1WIA A;  4KVG B;  4YXD B;  3PHW B;  1MG8 A;  4BOS C;  5BYS A;  4OZA A;  2C7N B;  2N1V A;  5L95 C;  4JQW C;  2ZCC A;  1PYW D;  2IY1 B;  2IO2 B;  2GI9 A;  2BKR B;  2L1A A;  2I1J A;  4DHZ E;  1I4X A;  4HKZ E;  2INC C;  4EFO A;  3TIX A;  2Y5P A;  3L13 A;  1ZXH A;  4CQN A;  2FID A;  3ZTD A;  3DBH I;  2MQJ A;  3ZIM A;  5IA7 A;  4LJO B;  4EUT A;  4NJ6 A;  4G11 A;  4PYU A;  4NPN A;  3PLU A;  1ZDV A;  1FNV A;  5DPT A;  1G6J A;  2NVU I;  4GXB A;  2R2O A;  4CYE A;  3NVW A;  4BKS D;  3PV1 A;  4LNK A;  2IYD B;  3B2F A;  4ZDV A;  1T0Y A;  2KDE B;  2KOX A;  3WAM A;  1GC7 A;  3PZD A;  4W9G A;  4JGH B;  1CZP A;  3J9C A;  2O6V B;  3C0R B;  4KZC A;  3M63 B;  2XK5 A;  2CS4 A;  2ASQ A;  3VTU A;  4XDD A;  4X57 B;  2IGH A;  2AX5 A;  4KSL C;  4W9E A;  2N4F A;  3DWM A;  1RRB A;  4YTN B;  2UYZ B;  1C79 A;  1HZ6 A;  4EEW A;  4MGK E;  1FEH A;  1I4G A;  2KTR A;  3D32 A;  2WP9 B;  3DOW A;  4K7W A;  2IGD A;  5J2R A;  1PQS A;  2IBI B;  4ANU A;  5FK9 C;  4FBJ B;  1NI3 A;  5HKH A;  2MEK A;  2BS3 B;  3AE4 B;  5E6O A;  5BYR A;  1H4R A;  4IDI A;  2PVO D;  3AXC A;  4TV3 A;  3NY5 A;  1WY8 A;  1ZUD 2;  4A20 A;  2RPQ A;  2BS4 B;  3DDC B;  3ZRC A;  2L7R A;  3A1Q B;  1P7E A;  4GOC A;  4Q2J A;  4WQO B;  4ZHO A;  1IGC A;  2WXO A;  1YOV B;  3P4R B;  2RD0 A;  4IM2 A;  1YX5 B;  3WAN A;  1F52 A;  1KJT A;  2JZZ A;  4EZL A;  4RF0 A;  2ONQ A;  3ZXR A;  3URY A;  2LGX A;  3ZKJ C;  3BK1 A;  1JWB D;  3AED B;  4IUM B;  2IPK D;  2LVP A;  4W9K A;  1N61 A;  3DBR B;  1A70 A;  1YN5 A;  3L10 B;  3CIR B;  1JCK B;  1JW9 D;  4USA A;  1TZ1 A;  3PLV A;  3K9O B;  3Q3J A;  1V97 A;  3B0A A;  3OAW A;  3CMM B;  3W5U B;  2MJD A;  4LNI A;  1F77 A;  3AEF B;  2QDF A;  2B3A A;  4HDO A;  4WAA A;  4A8X C;  4GDL A;  1QT9 A;  4F7Z A;  4RCO A;  4NY0 A;  3DBL B;  4H2A A;  4PS7 A;  1OQR A;  3NVZ A;  2M17 A;  1VDV A;  3GB1 A;  3N3K B;  2KDM A;  2KD0 A;  2ZVO A;  5AZH A;  1MJD A;  2DYO A;  1QOA A;  2L00 B;  1IGD A;  1CQV A;  2MSE D;  4N9F 4;  2W3S A;  1V9J A;  1JWA D;  3N1Y C;  1PFD A;  2RPV A;  2BYF A;  1FMA D;  2AL6 A;  3VH4 B;  3TEZ A;  1GB4 A;  1V5T A;  4F1S A;  3IXS A;  2ON8 A;  3AE3 B;  2V9H A;  2L52 A;  3P42 A;  4K7U A;  1WXV A;  1XCT L;  3IVF A;  4F8C B;  3EUB 2;  4P1C C;  3Q3M C;  1SSN A;  3I9V 1;  3S2A A;  2C9W B;  1UNS A;  3OLM D;  2JF5 A;  4JWU C;  2EMS A;  3Q8A A;  4HCN B;  4MJS A;  2HTM E;  5IKC M;  3UQA A;  3MJ5 A;  1L7Y A;  2IDY A;  2Z8L A;  2WX1 A;  1EUV B;  5LXI B;  5LLI A;  2K22 A;  3EEC A;  5DPW A;  3DVN U;  4M8N A;  3AEC B;  1XO3 A;  4OZB A;  2XK5 B;  1Z2M A;  1C1Y B;  2SEB D;  2IGG A;  2Q5W D;  3RNE C;  2G3Q B;  3NS1 A;  1M4V A;  5J18 A;  1D5M C;  2CHZ A;  3KYC D;  4LTU A;  3ZNG C;  1ZP0 B;  2GBK A;  2K5P A;  2KTR B;  2WXH A;  2KLG A;  3WA0 A;  2UU7 A;  2FUH B;  2BF8 B;  3IT4 B;  2BKF A;  1IBX A;  3HVZ A;  2MCN B;  4A9A A;  1CJE A;  2PE9 A;  3I57 A;  5T8I A;  4GGQ A;  3ZGZ A;  1WYG A;  3GOE A;  3P4S B;  3P4P B;  2LRW A;  1IP9 A;  1UWX A;  2C60 A;  1YJ1 A;  5MPO A;  1D6E C;  2VZK B;  3EC8 A;  3APD A;  1QKZ A;  1R4M I;  4HWI B;  5D6J B;  1SIF A;  4IWQ A;  4W9J A;  3VXW A;  3TCA A;  4XWT A;  2MRP A;  1VR9 A;  1VZ7 A;  1J7A A;  4LJP B;  2WXF A;  2LRU A;  3JSV A;  1MG4 A;  5G2N A;  3AM9 A;  4ARI A;  4KDI C;  1XLN A;  4OZC A;  2MLB A;  3HM6 X;  2D3G A;  3EGR A;  4W9C A;  1SIJ A;  4JPS A;  3QAQ A;  4P1B C;  3KVF B;  4XWW A;  1WGR A;  3PO0 A;  1I7H A;  4W9I A;  1I4Q A;  3H7P A;  1ZPS A;  4XGA B;  2BW2 A;  4GDL B;  3M62 B;  2MBH A;  4MH8 A;  1VZ6 A;  1JAL A;  2L3Z A;  4O1N A;  1D3Z A;  2BGF A;  4DWF A;  1FO4 A;  3RZF A;  4MGZ E;  1VZ8 A;  2CKH B;  1E90 A;  1QZE A;  3ZDT A;  2JZ3 B;  2WLB A;  4RM9 A;  4HCP B;  5FKA C;  3ZJU A;  2DZJ A;  1QLB B;  2IO1 B;  2WYQ A;  2AQ3 B;  3ZLZ A;  1UF0 A;  3SDL C;  3ABV B;  1TGZ B;  4GB9 A;  2LHE A;  2K0P A;  4HJG E;  2LGD A;  2HJ8 A;  4BFR A;  4DXG A;  3APC A;  2JU6 X;  2DZI A;  4IM3 A;  3AUL A;  3OG5 A;  2YEP B;  2A5U A;  1GB1 A;  5G55 A;  3Q8C A;  1N63 A;  4OHJ A;  1TIF A;  5BMI A;  2DLB A;  2WXG A;  3GS2 A;  3QWZ B;  4MJS B;  1ET6 A;  1XXG A;  4KV2 A;  3LJ3 A;  4BBN C;  2BTE A;  3FAH A;  4FHK A;  4HPM B;  1F2R C;  3U8Z A;  2GBJ A;  3DHG C;  1BUI C;  1TKG A;  4L2Y A;  1IUE A;  1MHH E;  1MHX A;  2LMC A;  1HEZ E;  1UGM A;  2WDT B;  2N9P C;  1RFK A;  3FIL A;  2BQQ A;  4LDT B;  2HD5 B;  2WDV B;  2JYT A;  2L76 A;  2ZPY A;  3AE5 B;  3ZW3 A;  1X1M A;  3Q3F A;  4ZRK A;  2MWS B;  2QCZ A;  1WI0 A;  1QQR A;  2HE7 A;  2LUM A;  1IBX B;  4BBN F;  2JT4 B;  1QIL A;  1UGJ A;  1C4A A;  2NBV B;  3NJT A;  3K9P B;  2J0J A;  5E6P A;  3TMP B;  5EE9 A;  3Q3N C;  5D3I B;  4HLE A;  4WWP A;  4E74 A;  3DCG A;  3SR6 A;  1MI0 A;  1YN3 A;  4YL8 A;  3SU8 X;  4MDK E;  1JRO A;  2KHW B;  1AN8 A;  4RNA A;  4ICV A;  4IWO A;  4MEL A;  5E6J A;  4M0W A;  2MBO A;  2KMM A;  3ZO5 B;  2KQS A;  2N7E A;  2I2Y A;  2K8B A;  1FXT B;  3N9Y C;  3JSV B; 
#chains in the Genus database with same CATH homology
 1RRB A;  4WJO A;  4DHZ B;  2ZNV C;  2UYZ B;  1VCB A;  1YD8 U;  4BVU C;  4DHJ B;  2KN5 A;  4ANW A;  3DBS A;  1LXD A;  3ALB A;  4MGK E;  4TUU A;  4EEW A;  2KTR A;  3D32 A;  2JRH A;  3DOW A;  4K7W A;  5J2R A;  1WGH A;  3ECI A;  3DBR I;  1WXS A;  5EDS A;  1PQS A;  2ZCB A;  2IBI B;  4ANU A;  1V80 A;  1XT9 B;  2DZM A;  2L05 A;  4FBJ B;  3UF8 A;  5E6N A;  1I35 A;  4MGI E;  4G3X B;  3PSE B;  5HKH A;  4HPL B;  5E6O A;  2JRI B;  2AYO B;  1H4R A;  3H7P B;  4NAW A;  1P9D U;  2AWT A;  3AXC A;  4TV3 A;  1UD7 A;  3NY5 A;  3VTW A;  1EO6 A;  1WMH A;  2KWU B;  3VTV A;  2K39 A;  1WY8 A;  3RT3 B;  5DPR A;  4A20 A;  1WM3 A;  2RPQ A;  2DAJ A;  4MM3 A;  3DDC B;  3ZRC A;  2MW5 A;  1XD3 B;  2L7R A;  2KWV B;  3UIO B;  3A1Q B;  4GN1 A;  2DYM A;  3RUL A;  4GOC A;  2NBU A;  2O6V D;  4FLH A;  4WQO B;  1L2N A;  4TQ1 A;  3KH0 A;  5CHV C;  2MP2 A;  2RD0 A;  2VRR B;  3WAL A;  4AP4 C;  3TL5 A;  4IM2 A;  1S3S G;  2FNJ B;  1YX5 B;  1GNU A;  5D7G A;  1KJT A;  3HHM A;  3WAN A;  1IYF A;  3H1U A;  1Y8R C;  4BOZ B;  2JZZ A;  4EZL A;  4DDI D;  4GIV A;  4KIK A;  3L16 A;  1A5R A;  1TBE A;  4WJP A;  2M4N A;  2KWC A;  2ZJD A;  5BO4 B;  1E8W A;  3VDZ A;  2LGX A;  1WE6 A;  1WJU A;  2KX0 A;  4FAD A;  5JHA A;  1NI2 A;  4OVV A;  3N30 A;  3ZKJ C;  3MTN B;  2XEW A;  2LUE A;  3KUC B;  4IUM B;  1WR1 A;  2BPS A;  4ANX A;  1IPG A;  2LVP A;  2JVC A;  4W9K A;  2AL3 A;  2Y5B B;  4MSM B;  2KNB A;  2KFK B;  4EKU A;  5JZE B;  2KZR A;  3L10 B;  2V3S A;  4FHJ A;  4WWO A;  1J8C A;  5DCN A;  1TZ1 A;  3PLV A;  1J19 A;  2KKC A;  4KDL B;  4MGY E;  1WGY A;  3K9O B;  3Q3J A;  1GC6 A;  4GDK A;  3ZNH B;  5C1Z A;  3B0A A;  3OAW A;  3CMM B;  4W9L A;  3RZW C;  1WF9 A;  4E71 A;  4ZYN A;  1WE7 A;  1LQB A;  1V2Y A;  1UBI A;  1XQQ A;  4AUQ C;  1UBQ A;  1GG3 A;  2WX0 A;  2O2V B;  2B3A A;  4K1R B;  4HDO A;  4WAA A;  4NQL B;  1NDD A;  4GDL A;  2DEN B;  3M3J A;  3KW5 B;  4ANV A;  2J0M A;  3ZNI D;  4F7Z A;  2MBQ A;  4NY0 A;  2KMC A;  1LM8 B;  2NPT B;  4RMA A;  4PS7 A;  2M17 A;  2N9E B;  4IM0 A;  3NZS A;  3VAW A;  3DVN V;  3AU4 A;  3N3K B;  3R3M A;  4I6P A;  2KD0 A;  2ZVO A;  5AZH A;  3RUI B;  3ML9 A;  3WAO A;  2DYO A;  2L00 B;  2J7Q B;  2W9N A;  3B08 A;  2MSE D;  1WH3 A;  4N9F 4;  4B9K A;  1V9J A;  3VVW B;  1E5W A;  3UGB B;  3OJ4 B;  3ONS A;  4P7I A;  2BWF A;  1Q0W B;  3A9J A;  3R7Q A;  1GJZ A;  1ZW7 A;  2BYF A;  3VH4 B;  2AL6 A;  3N32 A;  3U30 A;  2N7D A;  1V5T A;  4A3O A;  4F1S A;  2BYE A;  3HIZ A;  2A4Z A;  3KUZ A;  1KOT A;  4E3C A;  2YLM A;  2QHO A;  4I6L B;  4B95 A;  1KLV A;  2K8H A;  3MHS D;  2LVQ A;  2G4D B;  4XX5 A;  4FJZ A;  4HXD A;  2K8C A;  4WWN A;  4K7U A;  1WXV A;  2KDI A;  3IVF A;  4F8C B;  3V6C B;  5DPS A;  4EZJ A;  2KTF A;  5LXH A;  1U4A A;  1UEL A;  3V62 A;  1WXA A;  1K8R B;  2OOB B;  2BWE S;  2EKE C;  2RR9 A;  2MA9 B;  3S2A A;  2C9W B;  3OLM D;  2JF5 A;  2MBB B;  2EMS A;  3IG3 A;  3NOB A;  1YIW A;  4HCN B;  4TKN A;  4KSK C;  4MJS A;  2V1Y A;  3VFK A;  4MSQ B;  3PPA A;  3IFW B;  4II2 B;  3T9L A;  4AWJ A;  3UQA A;  1WRD B;  1L7Y A;  4GMV A;  3SHQ A;  4DXA B;  3A9K A;  2K1F A;  2WX1 A;  2KC1 A;  1EUV B;  3CSF A;  3H9D A;  4M0W B;  1JRU A;  5LXI B;  3QK0 A;  5LLI A;  2M8S A;  3EEC A;  3L54 A;  5L83 A;  5DPW A;  3DVN U;  2DHZ A;  2ZNV B;  4M8N A;  3X0W A;  2IZV B;  2LVO A;  4ICU A;  1Q1O A;  2XK5 B;  1Z2M A;  3L0W B;  1TTN A;  1C1Y B;  3DBL I;  2D10 A;  2FCM A;  3QJZ A;  2LD9 A;  2G3Q B;  1SGH A;  2K25 A;  5GMV A;  5J18 A;  2CR5 A;  2CHZ A;  3KYC D;  2DYB A;  3TBL D;  5TR5 A;  3RYT A;  3ZNG C;  5FR6 A;  4BKT A;  3VH3 B;  3VUW A;  3EFU A;  4AJW A;  2GBK A;  2KTR B;  1V6E A;  1E8Y A;  2KLG A;  1EF5 A;  1WGD A;  3WA0 A;  4HJK A;  2IY0 B;  2ZZP B;  2RGF A;  1RLF A;  3ML8 A;  1BT0 A;  1WM2 A;  5AZG A;  3L08 A;  2J0K A;  1E7V A;  3JYU A;  2FUH B;  3M95 A;  2BF8 B;  4JIO U;  4PS8 A;  2BKF A;  4CO7 A;  3X23 A;  2MCN B;  4W9F A;  3AU5 A;  4NAW B;  1WX8 A;  2GOW A;  2KK8 A;  2PE9 A;  5CHF A;  4XZ4 A;  3RCZ A;  1V49 A;  3T8M A;  3QIJ A;  4GGQ A;  1WMH B;  3ZRF A;  3GOE A;  2PE6 B;  2KQ7 A;  4BKG A;  1HE8 A;  3R7R A;  2LXC A;  3QA8 A;  2GBN A;  3V61 A;  4IG7 B;  2N1W A;  2LRW A;  1IP9 A;  4J6I A;  2L0T A;  1SE9 A;  2LXA A;  2C60 A;  2EMT A;  2MP2 B;  2HTH A;  5JHB A;  3PGE A;  1YJ1 A;  2LGY A;  3V60 A;  4II3 B;  4RM8 A;  2C7M B;  1V81 A;  3EC8 A;  3APD A;  4B6W A;  1J0G A;  3R66 C;  1R4M I;  4HWI B;  3PS6 A;  5D6J B;  1SIF A;  1RFA A;  4KIK B;  4LCD E;  4XC2 A;  4DDG D;  1UZX B;  4IWQ A;  4W9J A;  2KVR A;  2I1K A;  5J17 A;  3VXW A;  3TCA A;  4IC7 B;  2MRP A;  2O6V A;  1AAR A;  2GBM A;  2LWP A;  3QC8 B;  3AI5 A;  2DZK A;  4URK A;  2K6D B;  4LJP B;  1P3Q U;  4DBG A;  4NJ7 A;  3QCA A;  2LRU A;  2KAN A;  3JSV A;  3QX1 A;  5G2N A;  3QHT A;  1ZKH A;  4FA6 A;  4KDI C;  2LI5 A;  2KJ6 A;  2Z0D B;  2LZ6 A;  3ZNZ B;  2FCQ A;  4ZRJ A;  2MLB A;  4PS3 A;  2JWZ A;  3HM6 X;  1Q5W B;  4HVB A;  2D3G A;  3ZVV A;  2N9X A;  3VUY A;  4CHK A;  3NHE B;  4M8M A;  4W9C A;  3ZUN A;  3QAQ A;  3PTF C;  2CHW A;  3KVF B;  5AZF A;  3HK0 A;  1WGR A;  1WR6 E;  2KX3 A;  3PT2 B;  4GDK B;  2ZVN A;  4W9I A;  2V4L A;  1GUA B;  4MH0 E;  3IHP C;  4W9H A;  3V6E B;  2DAF A;  1OGW A;  5C23 A;  2PJH A;  3KYD D;  3PRE A;  3H7P A;  4LDT D;  3ZTC A;  2PPH A;  3MJW A;  3QAR A;  1V5O A;  4GDL B;  3M62 B;  4AJY B;  2Z0E B;  2RSU A;  2MBH A;  3VUX A;  2FIF A;  2R2Q A;  3A1Q A;  2L3Z A;  3L17 A;  3W1Y A;  1S1Q B;  2KDF B;  2LJ5 A;  2BGF A;  1D3Z A;  4DWF A;  3RZF A;  4MGZ E;  3A4S C;  5IAA C;  1WJN A;  2NR2 A;  4AOF A;  2CKH B;  1E90 A;  1QZE A;  1WYW B;  3ZDT A;  2JZ3 B;  1YX6 B;  2NCN A;  2ZPN A;  2CHX A;  3EHV A;  1WZ0 A;  4RM9 A;  1KM7 A;  3DVG X;  4HCP B;  1ISN A;  2DZJ A;  2Z59 B;  5CX3 A;  3VHT C;  2IO1 B;  2IO3 B;  4JL9 A;  4NQK E;  2WYQ A;  1WZ3 A;  2KC2 A;  4MEM A;  2BYV E;  3CST A;  3A9J B;  3B1L X;  3DVG Y;  3ENE A;  2IO0 B;  3ZLZ A;  3WAP A;  5KHO A;  3SDL C;  5D2M B;  3APF A;  2CU1 A;  2KO3 A;  2ZEQ A;  4GU2 A;  4K81 A;  3HM3 A;  3W1S A;  3PVL A;  1TGZ B;  2KLC A;  2YVC A;  3A4R A;  4GB9 A;  3BY4 B;  1NBF C;  3BIN A;  3LDZ E;  4BKS A;  2LGD A;  1OTR B;  2HJ8 A;  1OEY J;  2GBR A;  4BFR A;  1YQB A;  3APC A;  4G50 A;  3RD2 A;  2KFK A;  3OJ3 A;  2DZI A;  3W1S C;  2NS5 A;  3I3T B;  4IM3 A;  3AUL A;  3UIP B;  1ZGU B;  2C5L C;  4K7S A;  2A5U A;  1P1A A;  2JPH A;  2FCS A;  2UWQ A;  3CF6 E;  3PRZ A;  5CTR C;  3UQB A;  5G55 A;  2JUO A;  4KZ0 A;  2FAZ A;  4FJV B;  4WJN A;  1C3T A;  3DPD A;  3P2B A;  5KHQ A;  1Z5S B;  1EF1 A;  2D07 B;  1M94 A;  3QWZ B;  4MJS B;  1V86 A;  2OJR A;  2KFJ A;  2JXX A;  3LJ3 A;  1WX7 A;  3QQ8 B;  4KV2 A;  2O2V A;  4BBN C;  2KXJ A;  2PEA A;  4FHK A;  3GZN I;  3U7D A;  3DQV A;  4HPM B;  3A9K B;  3NS8 A;  2M1M A;  1WX9 A;  3PRM B;  4DHJ D;  2L8J A;  4W9D A;  3U8Z A;  2JY6 A;  1WIA A;  3O65 B;  2GBJ A;  2NBW B;  4KVG B;  4FN2 A;  3PHW B;  1MG8 A;  2NPT A;  4EZK A;  1WJ4 A;  4HK2 A;  4OVU A;  1UGM A;  1UH6 A;  1WXM A;  4ASW C;  2WDT B;  2N9P C;  1P98 A;  2GMI C;  4BOS C;  2C7N B;  4GSW A;  2N1V A;  5L95 C;  4LDT B;  4PYZ A;  2HD5 B;  4JQW C;  4I6N B;  2C7H A;  2G45 B;  2ZCC A;  2LAS A;  2G4S A;  2L76 A;  2ZPY A;  3ZW3 A;  2DX5 B;  1X1M A;  3Q3F A;  1E8Z A;  4ZRK A;  2IY1 B;  4FJY A;  2MWS B;  3SD5 A;  2KJR A;  3A33 B;  1OEY A;  2IO2 B;  2XBB C;  5D94 A;  1RAX A;  3NZU A;  2BKR B;  1OQY A;  2I1J A;  1WI0 A;  4HDQ A;  3JVZ X;  4DHZ E;  2K6Q A;  4A3P A;  4JLC A;  3ZDM C;  2D2Q A;  4TQ0 A;  2HE7 A;  4IWP A;  4EFO A;  3TIX A;  4BBN F;  2KJH B;  3L13 A;  2JT4 B;  2KMA A;  2D11 A;  3PHX B;  2MBE A;  2WWZ A;  3H7S A;  2FID A;  1E8X A;  3ZTD A;  3DBH I;  2NBV B;  2MQJ A;  5AEK B;  4NNJ B;  3JW0 X;  3ZIM A;  3K9P B;  2J0J A;  5IA7 A;  4ZRI A;  1E7U A;  5E6P A;  4DK5 A;  3KUD B;  2FCN A;  4FUL A;  4LJO B;  4EUT A;  1WGG A;  3TMP B;  4G0N B;  1I42 A;  2MX2 A;  1P0R A;  1R4N I;  4HLE A;  4WWP A;  4NJ6 A;  3UIN B;  4G11 A;  4PYU A;  5CHW A;  4E74 A;  2L0F A;  3DCG A;  4NPN A;  3PLU A;  5DPT A;  1CMX B;  1G6J A;  4YL8 A;  4IW0 A;  3SU8 X;  4MDK E;  1LFD A;  3H6N A;  2NVU I;  4EOY A;  4GXB A;  2KHW B;  2R2O A;  3TJP A;  4CYE A;  1VD2 A;  1WFY A;  4ICV A;  4BKS D;  3PV1 A;  4IWO A;  2IYD B;  4MEL A;  4ZDV A;  1T0Y A;  2KDE B;  2KOX A;  4WJQ A;  3VQI A;  1GC7 A;  3PRP B;  3PZD A;  4W9G A;  3WAM A;  2MBO A;  4JGH B;  3ZO5 B;  2O6V B;  3C0R B;  4KZC A;  3M63 B;  2KDB A;  2XK5 A;  2CS4 A;  2ASQ A;  3VTU A;  1WJ6 A;  2AEH A;  2KQS A;  2N7E A;  2K8B A;  1F9J A;  4X57 B;  3WIM A;  3IBE A;  2M0X A;  1H8C A;  5JH5 C;  4KSL C;  1FXT B;  2REX A;  4W9E A;  2N4F A;  3JSV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...