1WXVA

Solution structure of the ubiquitin domain of bcl-2 binding athanogene-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords BAG-family molecular chaperone regulator-1
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxvA01
4PS8A 1KLVA 5JHBA 3QCAA 4FLHA 5GMVA 5DPTA 2ASQA 4KZ0A 2KXJA 1J8CA 1XD3B 2LGXA 2K6QA 1RAXA 1WJNA 3V62A 2KWCA 2M17A 1YQBA 1LFDA 3DBLI 2CS4A 3BY4B 3TJPA 1XQQA 2KDFB 4HCPB 1E8XA 1YX5B 4AJYB 3KYCD 3DCGA 5AZHA 2ZZPB 1V81A 2G4DB 4G11A 4BKSA 4RM8A 1KM7A 3V60A 3PZDA 5D6JB 4DWFA 1WM3A 2DZMA 4II2B 2L00B 3NS8A 3PRPB 3NY5A 2WWZA 4DHZE 2NBUA 1NDDA 1V49A 2J0KA 3QC8B 4TQ0A 2YVCA 4E71A 5JZEB 1TZ1A 4KV2A 4MJSA 2MBQA 2KC2A 4NPNA 3R3MA 2C7NB 2ZNVC 3WANA 4FJYA 1WF9A 1LM8B 2K39A 3ZVVA 4I6PA 3ZLZA 3W1SC 4OVVA 1GUAB 3OLMD 1QZEA 3OAWA 4GDKA 1ZKHA 4BOSC 3A9KB 1NBFC 2I1JA 1OGWA 3ZNHB 4F1SA 1H4RA 2N4FA 2MA9B 3HM3A 2DENB 4FJZA 1P0RA 5CHFA 2VRRB 2O2VB 1SGHA 2L7RA 1Q5WB 2L0FA 2AL3A 3APFA 3KUCB 4FADA 2MX2A 1UELA 1V2YA 2BYFA 3DQVA 4MSQB 4W9LA 5AZFA 4GDKB 4G50A 4LCDE 4KDIC 4MSMB 2ZEQA 4WQOB 3DBRI 1WMHB 3V6EB 1V80A 3QIJA 4NJ7A 4GSWA 1WGGA 1OEYJ 2J0JA 1UBQA 1SE9A 4IUMB 3VAWA 1IYFA 4M8NA 4KSKC 1WM2A 2KLGA 2N1VA 3TMPB 1E5WA 2W9NA 3H9DA 2C7HA 4PYUA 1I35A 5C1ZA 4DBGA 2FUHB 3RYTA 2K8HA 1TGZB 1UZXB 2CHWA 1E90A 1UD7A 2FCSA 3JSVA 2KX0A 4W9EA 2JRHA 4WWOA 5FR6A 1WGRA 3ZW3A 4KZCA 1WZ3A 4MH0E 4M0WB 3AI5A 3HIZA 2MCNB 2DZKA 2N7EA 1U4AA 1E8WA 1V5OA 2BWFA 2NVUI 2O6VD 2GBMA 5KHOA 1WX9A 4EEWA 5J18A 4HPMB 2BPSA 1C1YB 1TBEA 1WMHA 3EC8A 4KDLB 4PYZA 3R7RA 3QARA 4A20A 2D3GA 1KOTA 5L95C 3DOWA 4WJNA 3P2BA 1KJTA 1R4NI 3Q3JA 4X57B 3L17A 2Z59B 5CTRC 4JLCA 2KKCA 3ZRFA 2FCQA 4DK5A 2C7MB 4NY0A 3UIPB 3VUYA 3B1LX 2L0TA 3VH4B 1V6EA 2IZVB 2AEHA 1JRUA 2CHZA 2JZ3B 3L13A 4MGYE 2K8BA 4MM3A 1M94A 2K6DB 3OJ3A 2DAFA 4IWOA 4MDKE 2C5LC 2I1KA 3PPAA 3PTFC 4GMVA 3SDLC 3N30A 2DAJA 4ICUA 4BKGA 4BOZB 1K8RB 1IPGA 4I6LB 1XT9B 2M4NA 4BBNF 4HDOA 2BKFA 2NPTB 4KVGB 4FBJB 4DHJD 3M63B 2MBBB 4K7UA 1WI0A 3A9JB 4TQ1A 2LJ5A 3W1YA 2KQSA 4ZDVA 1V5TA 2OOBB 4B9KA 2MP2B 3ZIMA 2V3SA 3H7PB 3M62B 1OQYA 5IAAC 2EMSA 3VFKA 3L54A 3L16A 2HD5B 4M8MA 3TIXA 2FIDA 3VH3B 2LVQA 4NQLB 4ANXA 2KDEB 3WAOA 3L08A 4OVUA 1BT0A 5DCNA 3N3KB 2DX5B 4HLEA 5AEKB 3CF6E 4ANVA 1RFAA 2JF5A 3UQAA 5IA7A 4F8CB 2KFKA 3V6CB 2JVCA 1V86A 3ZTCA 4FN2A 3ZDMC 1P3QU 3K9OB 2LVOA 4HVBA 1WR1A 1S1QB 2CKHB 2PEAA 2R2OA 2WX0A 2JPHA 3CSTA 3ZTDA 3RD2A 2GMIC 4AWJA 2WDTB 2FIFA 2N9EB 2HTHA 3SHQA 1S3SG 3JVZX 3WAMA 4GN1A 2O2VA 2N9XA 4IWPA 3IVFA 1YIWA 5HKHA 2KFKB 3NZUA 4KSLC 4KIKA 3SD5A 4NJ6A 4GDLA 4EFOA 1R4MI 3CSFA 2L76A 3A9KA 4ZRJA 3PSEB 1G6JA 3VTWA 1H8CA 4IW0A 4I6NB 3B08A 4GGQA 1VD2A 3PGEA 2KZRA 2GBKA 2KOXA 2PPHA 3A4SC 4K7SA 4WWPA 3WAPA 4JL9A 2BGFA 4BKTA 3T8MA 2J0MA 3VDZA 1WJ6A 2D07B 1WXSA 1Z5SB 3RUIB 5LXHA 2C60A 2BKRB 2A4ZA 3VQIA 2CHXA 2N7DA 3AULA 3VXWA 4NAWA 3QK0A 1E8ZA 2PJHA 3VVWB 4NQKE 1WJ4A 4LJPB 1WXVA 1UBIA 5CX3A 2NPTA 3IHPC 2KHWB 4ZRIA 2KTRB 2WYQA 5CHVC 2G3QB 4HJKA 3TCAA 1WRDB 2HE7A 4W9KA 2FNJB 1D3ZA 3W1SA 2V1YA 4XC2A 3DVNU 4A3OA 2PE6B 2NR2A 4IM0A 2LUEA 4HPLB 5CHWA 4TKNA 4F7ZA 3SU8X 4DHZB 2CU1A 2LGYA 1EF5A 1P98A 2XBBC 3PLVA 2ZCBA 5BO4B 2KDBA 3T9LA 2BYEA 4AOFA 2LXCA 3V61A 2RPQA 4K1RB 2D11A 4LDTD 3ZDTA 4EZKA 4W9GA 4DHJB 2LXAA 4HWIB 3B0AA 2LRWA 3ZNZB 2KJHB 3Q3FA 5G2NA 3VTVA 1E7VA 2JT4B 2O6VA 3PHWB 1ZW7A 2KNBA 1F9JA 3A1QA 1L2NA 2CR5A 4II3B 3X0WA 4J6IA 3RZFA 1GC6A 3LDZE 4GIVA 2KTRA 5C23A 4W9CA 4G3XB 4E74A 3DBSA 2MP2A 2M1MA 2IO2B 2KK8A 3VUXA 2IY0B 5JHAA 1Z2MA 2KWUB 3DVNV 2ZVOA 4BBNC 4DDGD 5AZGA 4ZYNA 5KHQA 3KW5B 2DYOA 1WGHA 2WX1A 1FXTB 5DPSA 4ASWC 4XX5A 1WXMA 2IYDB 2MQJA 2V4LA 2RR9A 3QHTA 3KH0A 3DBHI 3VTUA 3AXCA 2K25A 5EDSA 2NBVB 1J0GA 3C0RB 2D2QA 3L10B 1TTNA 4HDQA 2G4SA 4W9DA 2KC1A 2LWPA 3O65B 1PQSA 1MG8A 1WXAA 3EFUA 3PLUA 1WE7A 2Z0DB 1V9JA 3A33B 4TV3A 3RZWC 2ZPYA 2N1WA 1WGYA 3LJ3A 1WH3A 2EKEC 1NI2A 2JWZA 2KMAA 2MBEA 2HJ8A 2J7QB 2LD9A 3HHMA 3K9PB 3VHTC 4MELA 2LI5A 3PRZA 4GOCA 4AUQC 4ZRKA 2REXA 4WJQA 3CMMB 1A5RA 4YL8A 3KVFB 1GNUA 3WIMA 2RGFA 2Y5BB 4ANWA 2IY1B 1WX8A 3H7SA 2FCNA 2MWSB 4MEMA 1WYWB 3AU4A 4EOYA 1L7YA 3H6NA 3R7QA 4FJVB 2KLCA 2KWVB 2L8JA 3ONSA 4EZJA 3PV1A 4WJOA 4E3CA 4EUTA 1LQBA 4GB9A 3UQBA 3QWZB 2JZZA 2L3ZA 1WJUA 2BWES 3RT3B 1I42A 3PHXB 1WGDA 4FULA 4GXBA 1RLFA 4RM9A 4WAAA 3OJ4B 4HK2A 1UGMA 1GG3A 2BF8B 2KJRA 2JXXA 1WIAA 3U7DA 3JW0X 2KD0A 4IWQA 3ZKJC 2BYVE 4RMAA 3UGBB 2M8SA 2C9WB 3U30A 5DPWA 3JYUA 3KYDD 1EF1A 2JUOA 5J2RA 2K1FA 2KN5A 2KX3A 2XK5A 4WJPA 1X1MA 1YX6B 2R2QA 2ZVNA 3RCZA 4B95A 3WALA 4W9IA 2KANA 4LDTB 4ANUA 2KO3A 2EMTA 3QJZA 1Q1OA 2AL6A 2NS5A 2UYZB 2YLMA 1P9DU 2AWTA 1YJ1A 4MJSB 3RULA 4W9HA 2G45B 4FA6A 2NCNA 3UF8A 3APDA 2JRIB 3ML8A 3M95A 2KDIA 5E6OA 2N9PC 2M0XA 4CO7A 4A3PA 2QHOA 1T0YA 4NAWB 2LASA 4XZ4A 4AP4C 4URKA 3EHVA 3EECA 1YD8U 3IBEA 4EZLA 3AU5A 2MBOA 3ML9A 3D32A 1HE8A 2IO1B 1OEYA 1WY8A 4MGKE 4HCNB 2ZPNA 3PVLA 2LGDA 1UH6A 3QAQA 2AYOB 4IM2A 3ZUNA 4N9F4 5G55A 3U8ZA 1LXDA 5D7GA 2DYMA 2L05A 2RSUA 1C3TA 1J19A 2MLBA 1EUVB 2PE9A 5JH5C 1VCBA 2GOWA 4DXAB 1CMXB 3JSVB 3GOEA 5E6PA 2ZCCA 4G0NB 1P1AA 3A9JA 3I3TB 3R66C 3UIOB 2GBRA 3DVGX 1ZGUB 2RD0A 4K81A 1WE6A 3X23A 2UWQA 3L0WB 3BINA 1GJZA 2OJRA 2IO0B 3ALBA 1E8YA 1EO6A 2KJ6A 2LRUA 4IC7B 3KUZA 2KVRA 3NZSA 4MGIE 1WFYA 1Q0WB 4EKUA 3MJWA 4WWNA 2MW5A 4JIOU 1AARA 2DZJA 1SIFA 3QA8A 3MHSD 4LJOB 2XK5B 3S2AA 4K7WA 3ENEA 3HK0A 2MBHA 4W9JA 3H1UA 4CYEA 4MGZE 2IO3B 3NOBA 3VUWA 2GBNA 3DVGY 4JQWC 2A5UA 2IBIB 5LLIA 5TR5A 2GBJA 3TBLD 3ZNGC 2DZIA 3PREA 3APCA 4GU2A 4JGHB 3NHEB 3PS6A 5DPRA 3QQ8B 2D10A 3QX1A 1OTRB 1WX7A 4B6WA 3IFWB 3UINB 4PS3A 5L83A 2KFJA 5D94A 3HM6X 4BFRA 2DHZA 4W9FA 3IG3A 2ZJDA 3DDCB 3A4RA 3MTNB 3PRMB 3ZO5B 2KQ7A 4FHKA 2FAZA 2K8CA 2LVPA 3M3JA 3H7PA 4HXDA 3DPDA 2KMCA 4TUUA 4AJWA 4BVUC 2JY6A 2FCMA 4GDLB 1E7UA 2MSED 1WZ0A 4KIKB 5J17A 3N32A 2ZNVB 1GC7A 3GZNI 1Y8RC 1ISNA 3ZNID 3WA0A 3KUDB 5E6NA 3A1QB 2Z0EB 4PS7A 4NNJB 3ZRCA 5LXIB 2KTFA 2O6VB 2XEWA 3TL5A 3ECIA 1WR6E 4IM3A 3PT2B 4P7IA 4BKSD 1RRBA 1IP9A 4DDID 2DYBA 2LZ6A 2B3AA 4CHKA 4ICVA 4IG7B 5D2MB 4FHJA 2NBWB 2MRPA
chains in the Genus database with same CATH superfamily
1KRHA 4N6EB 2QCZA 1J8CA 1XD3B 2LGXA 4FXCA 3B2FA 2M17A 2CS4A 3BY4B 1CK1A 1CQVA 3VRAB 4JPSA 2LGIA 2LMCA 3NZ3A 3DCGA 2ZZPB 1V81A 2G4DB 3URYA 4BKSA 1SBBB 4II2B 1SSNA 1NDDA 1V49A 4N59A 2KC2A 2ZNVC 3WANA 4RGNA 5FKAC 1LM8B 3ZLZA 1GUAB 1I4QA 1ZXHA 1OGWA 3ZNHB 2MA9B 1QOBA 2DENB 5CHFA 2L7RA 2L0FA 3APFA 2AL3A 3E9SA 2LFIA 4KGRA 4KKJA 3N9YC 1V2YA 4W9LA 5AZFA 2V4IB 4GDKB 4G50A 4LNNA 2ZEQA 1WMHB 1FFVA 2SEBD 4GSWA 4IUMB 3VAWA 1IYFA 4KSKC 3TMPB 4DBGA 2IGDA 2K8HA 1TGZB 2FCSA 3JSVA 4WWOA 2KX0A 5FR6A 4M0WB 4ZHOA 4EEWA 2NVUI 5IP4D 1WX9A 2WXNA 3TEZA 1C1YB 1TBEA 1VZ8A 1KJTA 1XCTL 1JCKB 4OZAA 4A8XC 2KKCA 2FCQA 1PGXA 4NY0A 4A6QA 2L0TA 3VH4B 3AE7B 1FIQA 4MM3A 1XLQA 1M94A 1T0QC 2K6DB 2YEPF 4MDKE 4GMVA 3PTFC 3SDLC 3N30A 4ICUA 3LYYA 1A70A 1R4NB 1I4RA 2QC8A 1IPGA 3SFDB 2M4NA 2IDYA 4K3CA 3M63B 4K7UA 3A9JB 2WXPA 2MH7A 3NUHB 2MP2B 4B9KA 5IAAC 4LLGM 2JU6X 2J52A 3L16A 1MG4A 1KF6B 2KWDA 2KYWA 4ANXA 2KDEB 1UUPA 4B0MA 2WXOA 5DCNA 2WLBA 3N3KB 2MJEA 5AEKB 2GB1A 2KFKA 2WDRB 2JVCA 3KQ4A 2DLBA 3K9OB 2PEAA 1S1QB 3CSTA 2M56B 3RD2A 1F1HA 2GMIC 3U52E 1IGDA 3DWGC 2HTHA 2WXQA 1S3SG 3JVZX 4ZYSA 2N9XA 2KFKB 4KIKA 1ZP0B 4KSLC 3SD5A 1K52A 1R4MI 2L76A 3PSEB 1G6JA 4GGQA 4LNOA 3HUIA 2L32A 1ZDVA 2PW9A 1P7FA 3PGEA 2GBKA 2KOXA 3T8MA 2D3CA 1WJ6A 5LXHA 4XDCA 5D3IB 2N7DA 1MHHE 3QK0A 1E8ZA 1WJ4A 5H92C 1WXVA 2KHWB 4ZRIA 2WQYB 3IAM1 3NG0A 3Q14C 1TIFA 1VZ6A 2HE7A 5BYRA 2FNJB 4WWMA 2W82A 4A3OA 2NR2A 4HPLB 1MHXA 1L6UA 5BYQA 4DHZB 2XBBC 2LGYA 1EF5A 1P98A 5BO4B 2ZCBA 1UWMA 2GLSA 4K1RB 2D11A 4AQ7A 3B9JA 3KLSX 3GZNB 3B0AA 3ZNZB 5G2NA 1QT9A 1PDXA 2KNBA 1UWXA 4XGAB 4YSXB 2N9KA 4GIVA 2CJOA 4W9CA 2BVCA 3ETRA 2M1MA 4LNIA 3VUXA 5JHAA 2KWUB 4UDUC 2ZVOA 3N20C 5KHQA 1WGHA 2LHDA 1FXTB 5BMIA 1FM0D 5DPSA 4C00A 4C7ZA 2BT6A 1FEHA 3T3OA 3V3XA 1QOGA 2K3UA 2JQRB 4HEA1 1N6ZA 1LGRA 1OQRA 3RNGC 3C19A 4HDQA 1WXAA 1TY0A 3AE1B 3EFUA 3DBRB 3PLUA 1WE7A 2ZPYA 2JWZA 1JWUD 2LD9A 3K9PB 4MELA 1FCCC 1T5XD 3PRZA 4GOCA 3RPFC 1ZPSA 4MT5A 2V0GA 3AU4A 1L7YA 1XCQL 4FJVB 2KWVB 3UQBA 3QWZB 2JZZA 1WJUA 3GE8C 1MJDA 4C80A 1C79A 4GXBA 4WAAA 3OJ4B 4P1BC 3U7DA 2KD0A 4RMAA 1NENB 2M8SA 2W3RA 5DPWA 3Q8CA 3KYDD 2JUOA 2K1FA 2KX3A 2XK5A 4WJPA 1X1MA 1YX6B 2R2QA 2ZVNA 3RCZA 2KANA 4LDTB 4ANUA 2KO3A 1Q1OA 3DHIC 4J3OD 4C4VA 2AQ3B 2G45B 2JRIB 1IUEA 4BAXA 2PKOA 3TSSA 1GOZA 1T0YA 2QHOA 4RFBA 1YD8U 3IBEA 3AU5A 4MGKE 3PVLA 2LGDA 3IT4B 2AYOB 1DOYA 4IM2A 3ZUNA 4DQOC 4N9F4 5G55A 3RNAC 2GOWA 3H8HA 1E10A 4K81A 3BINA 2OJRA 2IO0B 4IC7B 5T8IA 4MGIE 1Q0WB 2WXLA 3MJWA 2MW5A 2DZJA 4JWUC 3MHSD 3MP9A 2EELA 2PLPA 4K7WA 3ENEA 2MBHA 2G1EA 2IO3B 3VUWA 4JQWC 5LLIA 3ZNGC 2DZIA 3AE8B 2W54A 3QX1A 4EE2A 3Q3OC 5L83A 2NTTA 3HRDD 3FAHA 3DDCB 1XLPA 4LNFA 1MFWA 3MTNB 3AE5B 3PRMB 3ZO5B 2FAZA 2K8CA 3R2TA 2EKIA 3M3JA 3H7PA 4AJWA 1E7UA 2MSED 4KIKB 4PT5A 3AE4B 1YMHE 4S0RA 1SIJA 3ZNID 4US8A 3WA0A 3I63C 3KUDB 2Z0EB 3R2IA 2KTFA 4YWGG 3TL5A 3W5VB 4TSSA 1J7CA 4IKGA 4BKSD 1BXTA 1L6VA 1RRBA 4KGSA 3P1MA 5GMVA 5DPTA 4KZ0A 2ON8A 4DXGA 1QQRA 4IDIA 1RAXA 2KWCA 1E9MA 1LFDA 1D5ZC 3NVYA 3GP7A 2E6XA 1E8XA 2BTEA 5C3JB 2V9HA 3AE3B 4OZCA 4RM8A 1KM7A 4DWFA 3P63A 2L00B 3NS8A 3PRPB 3NY5A 4DHZE 3ABVB 2J0KA 4XWTA 3QC8B 1XEEA 5JZEB 3O13A 2QDFA 4NPNA 3R3MA 1WF9A 2K39A 3ZVVA 4I6PA 2IGGA 2LEKA 4GDKA 1QZEA 1ZKHA 1NBFC 3AEFB 3U7ZA 1HQRD 4JE3B 2J42A 1Q5WB 2MX2A 2BYFA 2WXIA 4MSQB 3Q3NC 4KDIC 5H8YE 4M01A 1ZDXA 3QIJA 4NJ7A 2D5GA 1WGGA 4XYCA 1QILA 1SE9A 1BUIC 2PTLA 1NYQA 4M8NA 4US9A 2W9NA 4PYUA 2C7HA 2FUHB 3RYTA 1UZXB 1WGRA 3ZW3A 2JYTA 2MCNB 1V5OA 5KHOA 2GBMA 5J18A 3R7RA 1WMHA 4PYZA 4A20A 1KOTA 5L95C 1TY2A 3L17A 5CTRC 2MJ3A 2PMVA 1N62A 2RPVA 3UIPB 3B1LX 2JZ3B 1LO5D 3OJ3A 2DAFA 3GB1A 4IWOA 2C5LC 1EWYC 3GS2A 4BKGA 1RYJA 4I6LB 1AN8A 1FCLA 3FILA 2BKFA 4KVGB 3P4SB 4USAA 3W1YA 1B9RA 3EFCA 4ZDVA 1TKYA 2L52A 3ZIMA 1VZ7A 2EMSA 3VFKA 3L54A 2HD5B 3AEBB 4HRSA 4HKZE 3L08A 4OVUA 2IPKD 1BT0A 2DX5B 2HDEA 1DOXA 2JF5A 1GPXA 2J53A 4LNKA 1XF5L 5IA7A 3V6CB 1SB3C 1P3QU 2LVOA 4HVBA 4C4VB 2CKHB 2WX0A 4L1BA 3WAMA 3V05A 4LTUA 2O2VA 3NS1A 3AN1A 2MEKA 4JX1C 3NZUA 4NJ6A 2OHFA 2QJLA 3A9KA 4ZRJA 4YSYB 2AQ2B 4I6NB 1MVKA 4K7SA 1WXSA 3VQIA 2ACZB 4R3DA 3VXWA 4HROA 1GAQB 2K9XA 3AE6B 1UBIA 5CX3A 2V3PA 3FILB 2HJ1A 2OJWA 5CHVC 4OW0A 3TCAA 1D3ZA 3NRZA 2V1YA 4XC2A 2CJNA 1T0SC 4YT0B 2LUEA 3AB5A 5IN7A 3PLVA 2KDBA 3T9LA 4AOFA 2KVZA 2RPQA 4EZKA 2KDMA 2LXAA 1WYGA 2KJHB 3SFEB 3VTVA 1E7VA 2JT4B 3AEGB 1F52A 1KTKA 3BK2A 3X0WA 3LDZE 2KTRA 4YSZB 3DBSA 2TSSA 1BMLC 1K51A 2MP2A 2INPE 2IY0B 2NTSA 1V1PB 3HVZA 2JYEA 4BBNC 4DDGD 5AZGA 3KW5B 1R4MB 4CQNA 2BYTA 1VR9A 2IYDB 5AUKA 2MQJA 4A90A 2RR9A 1PUTA 3DBHI 2K25A 2PIAA 1HZ5A 4P6VF 3L10B 4W9DA 2LWPA 1ZOYB 1PQSA 4ACFA 1FPYA 1NYRA 3A33B 4TV3A 3RZWC 1V8CA 1EU4A 1SXTA 1WGKA 5JXVA 3HHMA 4AUQC 4ZRKA 3CMMB 1A5RA 4YL8A 1GNUA 4RGTA 2RGFA 2Y5BB 1WRIA 1JW9D 2MWSB 4S17A 1K53A 4RCOA 2H89B 1T0RC 3Q3MC 3ONSA 2VH1A 4E3CA 4WJOA 3VR8B 4EUTA 1LQBA 4GB9A 2L3ZA 1E6EB 2BWES 3RT3B 1I42A 1WGDA 2JSVX 4FULA 4RM9A 1ACCA 5FR3A 1R7SA 3P4PB 1UGMA 2RMMA 2BF8B 2JXXA 1SE4A 3JW0X 4IWQA 3UGBB 2C9WB 2GI9A 1EF1A 4C56C 1AYFA 1OFFA 4B95A 3WALA 5BYSA 4ZOHC 3QJZA 2X8XX 2AL6A 2AWTA 4MJSB 3RULA 3Q8FA 4W9HA 4FA6A 2I2YA 3M95A 5E6OA 3MC0B 4O1NA 1YQ3B 4IOIE 3EHVA 3EECA 4EZLA 4P1CC 5MPOA 5BMGA 1TZOA 1LXDA 3Q8BA 3AM9A 2DYMA 5D7GA 1C3TA 2MLBA 1EUVB 2PE9A 1VCBA 1F77A 2J4XA 3R66C 1WE6A 1B1ZA 4ARCA 2KJ6A 3KUZA 3NZSA 4WWNA 4JIOU 4L2YA 1SIFA 2XK5B 3S2AA 3HK0A 4W9JA 2WGSA 3NOBA 2GBNA 1FNVA 4ITKA 4OZBA 4JGHB 3PREA 3NHEB 3T3NA 3QQ8B 1C9FA 1OTRB 2WU5B 4PS3A 4RH6A 5D94A 3HM6X 1F2RC 3TEWA 2YEPB 4FHKA 2LVPA 4M0WA 3EA6A 2JZPA 4HXDA 3DPDA 2D3AA 4TUUA 3NVVA 2JY6A 2FCMA 2Z8LA 3Q8AA 3RNBC 5J17A 3N32A 2RDBC 1RM6C 1ISNA 5E6NA 1WWTA 4NNJB 2WXFA 1D6EC 1WR6E 3Q6BA 2FE8A 4A55A 1HEZE 3PT2B 1IP9A 2LZ6A 5E6JA 2INDC 2PVOD 2WNMA 2WU2B 4PS8A 1UF0A 1KLVA 1MI0A 3PZ7A 2K6QA 3V62A 1L0XB 3DBLI 1ROEA 3TJPA 1CZPA 1XQQA 3W9CB 4HCPB 3DBHB 3I5JC 3BYYB 4G11A 4B0EA 3V60A 1J7BA 1WM3A 4N58A 1DYQA 4TQ0A 4E71A 3BVMA 1ESFA 1TZ1A 4YTPB 4MJSA 4FJYA 1DOIA 3W1SC 3OLMD 3OAWA 4BOSC 3A9KB 2I1JA 2RDHA 3UI3A 4F1SA 1H4RA 1TS2A 3HM3A 1P0RA 1M4VA 4WH4A 2VRRB 2O2VB 1YOVB 4REZA 3RNEC 3IAS1 5TSSA 4WQOB 4WQMA 1V80A 2BW2A 2J0JA 1WM2A 2KLGA 2N1VA 1I35A 1E5WA 3H9DA 4ZHPA 5C1ZA 2AQ1B 2CHWA 1E90A 3BVZA 2JRHA 3TUOA 1FXIA 1WZ3A 3AI5A 1U4AA 1E8WA 4D2KA 3FKYA 3EC8A 4KDLB 3QARA 4WJNA 1R4NI 2Z59B 4JLCA 1CJEA 3ZRFA 2E3TA 2C7MB 1FXAA 1KLUD 3OG5A 1FO4A 2IZVB 2AEHA 2MHJA 1JRUA 3L13A 4MGYE 2K8BA 3C8YA 1Y56A 3PPAA 3RI7C 2DAJA 1I4GA 4BOZB 4KX6B 4WAFA 3AMZA 4BBNF 2NPTB 4FBJB 1C4CA 2INNE 3U2SC 2MBBB 1WI0A 2DBYA 2KQSA 2PVGC 1V5TA 2OOBB 3CWIA 2V3SA 3H7PB 5D3DA 3EUB2 4M8MA 2FIDA 3VH3B 2LVQA 2M0AA 4HLEA 3CF6E 3VR9B 4ANVA 4F8CB 2BS2B 3MC8A 1V86A 3ZTCA 4FN2A 1WR1A 2R2OA 1QF6A 3DBLB 3ZTDA 1JROA 2XNAC 4AWJA 2WDTB 2WXMA 2FIFA 2N9EB 4WURA 5EE9A 4M02A 1TS3A 1D5MC 4LK0M 4IWPA 5IO9A 5HKHA 4C7YA 4H2AA 1QOAA 3CSFA 3AE2B 3VTWA 1H8CA 1V1OA 3B08A 1VD2A 1EU3A 1YQ4B 2PPHA 1QKZA 2WP9B 2J0MA 5EE3A 3VDZA 2D07B 2N9LA 2BKRB 2A4ZA 2CHXA 3RNCC 3VRBB 3AULA 4NAWA 3VVWB 4NQKE 4LJPB 3J9CA 1JWSD 4MACA 2NPTA 5IKCM 1FRDA 4M00A 2KTRB 1C4PA 3N1YC 2G3QB 4HJKA 4W9KA 3W1SA 2LGSA 2NMQA 2PE6B 3NVZA 4XDDA 3KWLA 1V97A 3P4RB 4MM3B 3SU8X 1N60A 2G9HD 1T3QA 2LXCA 3V61A 1I4XA 4DHJB 1FNWA 2LRWA 3MHZA 1VLBA 3PHWB 1ZW7A 1QLBB 1F9JA 3A1QA 2CR5A 4NZLB 2VZKB 1GC6A 5C23A 4G3XB 4E74A 3P4QB 4YTNB 1XXGA 3N1ZC 1NI3A 1XLOA 1FMAD 1PYWD 3RNFC 1RWSA 4ASWC 1WXMA 3CIRB 2V4LA 1J7AA 2N0SB 1VDVA 3VTUA 1PFDA 4HJGE 5EDSA 1J0GA 4NJCA 3C0RB 4RGOS 2D2QA 1JWAD 5HFYA 2X38A 2G4SA 2KC1A 2QEJC 1STEA 2Z0DB 1WGYA 2WXGA 1WH3A 1NI2A 3VHTC 3ZJUA 2LI5A 4WJQA 3KVFB 3WIMA 3ZYYX 1N5XA 1ZUD2 3DHGC 2FCNA 4MEMA 1WYWB 5G5HA 2KMMA 3H6NA 3R7QA 2JXTA 2BBCA 4EZJA 3PV1A 1VRAB 2B76B 2WXRA 4OVZA 2WXHA 3PHXB 1DGJA 3MFGA 1EWCA 1GG3A 2KJRA 4XE0A 1P7EA 3ZKJC 2BYVE 3NVWA 3U30A 1E0ZA 3JYUA 2GRIA 2KN5A 4W9IA 3PZ8A 1T6BX 1I4HA 1P9DU 1SJED 3UF8A 1HTOA 3APDA 1SF0A 2KDIA 1I7HA 2BB6A 2N9PC 2M0XA 5HHDG 4AP4C 4NAWB 4URKA 1KLGD 2MBOA 3ML9A 1HE8A 2Y5PA 1ENFA 1UH6A 3QAQA 3U8ZA 2L05A 2RSUA 1IBXB 2DWQA 4DXAB 1CMXB 5E6PA 1P1AA 2Y3AA 3UIOB 2ONQA 2GBRA 3DVGX 1ZGUB 2D3BA 2K22A 1GJZA 3ALBA 2QILA 1EO6A 2LRUA 5I4DA 2KVRA 2K0PA 4EKUA 1AARA 3QA8A 3AV8A 4LJOB 4MGZE 2FUG1 3APCA 1YN5A 3PS6A 2D10A 4YXDB 3DWMA 4B6WA 3IFWB 2KFJA 2BQQA 4RF1A 2DHZA 4W9FA 5G5GA 2ZJDA 4PK1A 1ZE3D 4BVUC 3ZJTA 4AS1A 1HA5A 3LXFA 1TS4A 4BZAA 1C76A 2ZNVB 1D4BA 1AWDA 3GZNI 1Y8RC 2JWUA 2QSDA 2HTME 3A1QB 4PS7A 3ZRCA 2BS4B 5C2TB 2XEWA 1JQ4A 1D5XC 1SE3A 4P7IA 5BMHA 2DYBA 4ICVA 4IG7B 2VH2A 2C7NB 3MJ5A 5JHBA 3QCAA 4FLHA 2ASQA 2KXJA 1C77A 3N1XC 1WJNA 1FRRA 1YQBA 2KDFB 1YN3A 1YX5B 4AJYB 3KYCD 1F0ZA 1YJJA 2RDGA 5AZHA 3SEBA 2W3SA 2MJDA 3PZDA 3BWUD 5D6JB 2DZMA 1UGJA 2WWZA 1TYGB 2NBUA 3AECB 3W5UB 2YVCA 1E7PB 4KV2A 2KAJA 2KACA 2MBQA 1NVID 4OVVA 3I57A 1N61A 1WSPA 2H88B 2UU7A 2LUMA 2N4FA 1JRPA 4FJZA 1EM7A 1QOFA 1SGHA 3KUCB 4FADA 1UELA 3DQVA 4LCDE 4MSMB 3EGRA 1N5WA 3DBRI 3V6EB 3AEAB 1OEYJ 1UBQA 3FC4A 1SJHD 1UD7A 4W9EA 2FBWB 4KZCA 2WDVB 4MH0E 3ZGZA 3HIZA 2DZKA 2N7EA 5HG2A 1Q10A 1YN4A 2BWFA 2O6VD 3MC9A 4KGTA 1JMLA 2IGHA 4HPMB 2BPSA 1KH0A 5EE0A 2D3GA 2LHEA 5HI1A 3DOWA 3P2BA 2ZW1A 2CU3A 3Q3JA 4X57B 2KT7A 4DK5A 3VUYA 1V6EA 5FK9C 4RF0A 1FFUA 3BK1A 2CHZA 3R8BA 2LJIA 2I1KA 1K8RB 1XT9B 4HDOA 1KFYB 1TKEA 4DHJD 4TQ1A 2LJ5A 3E56A 2I38A 3RFZB 3M62B 1L5PA 1OQYA 3TIXA 1SEBD 4NQLB 3WAOA 3AEDB 3ZJVA 4KKIA 1RFAA 3UQAA 4P16A 4K3BA 3ZDMC 1NEKB 2JPHA 2ZW0A 3SHQA 4GN1A 3IVFA 1YIWA 3BIID 4GDLA 3TEXA 4EFOA 5GXGB 4IW0A 3KWVA 2KZRA 1MPEA 3WAPA 1AW7A 3A4SC 4WWPA 3ZXVA 4JL9A 2BGFA 1ET6A 4BKTA 2IJ0A 1L0YB 3RUIB 1Z5SB 4ARIA 1WXQA 2C60A 1F2RI 1UNSA 2PJHA 3AE9B 4XWWA 1L0VB 3IHPC 2SAKA 3BYTB 2WYQA 3LB8C 4ZRPA 1N63A 2KN4A 1WRDB 1TJEA 1ZXIA 3DVNU 1HXYD 4IM0A 5CHWA 1I4PA 4TKNA 4F7ZA 2CU1A 4NAMA 1HZ6A 2BYEA 3AH7A 3ZDTA 4LDTD 3W2DA 4RNAA 4W9GA 2N7JA 4HWIB 3Q3FA 4OHJA 2L83A 2O6VA 2KQ4X 2XN9C 1L2NA 4II3B 4J6IA 3RZFA 3WCQA 1JWMD 3IT6B 3AEEB 2M19A 3NJTA 2IO2B 2KK8A 2WXJA 2WXKA 1ET9A 1Z2MA 3DVNV 4ZYNA 2DYOA 2WX1A 1JWBD 2QIEB 1FD6A 4A9AA 4ZRQA 2L1AA 4XX5A 3QHTA 3KH0A 2R61A 3AXCA 3RN9C 2NBVB 3Q8EA 4WIPA 3BZDB 3OWEB 1TTNA 2Y5CA 3BVGA 1TS5A 3O65B 1MG8A 3Q2AC 1V9JA 2N1WA 2OEDA 1YJIA 3LJ3A 2KMAA 2EKEC 2MBEA 2HJ8A 2AX5A 2J7QB 5IOIA 5EE1A 1GB4A 2REXA 3I9V1 4ANWA 2IY1B 1WX8A 3H7SA 1RFKA 2K5PA 2INCC 4EOYA 4HKQA 3SR6A 1K50A 2KLCA 2L8JA 3B2GA 5AUIA 1HTQA 1JALA 1RLFA 1FNUA 4MH8A 1IGCA 4HK2A 1WIAA 4L23A 1PGAA 1OQQA 5J2RA 4GLSC 1SE2A 2VZKD 2EMTA 1YNTE 2NS5A 2UYZB 2YLMA 1YJ1A 3GE3C 2JX5A 3HVDA 1L4ZB 2NCNA 3TEYA 4YTMB 3ML8A 4JWSC 3P42A 4CO7A 4A3PA 1V1PA 4XZ4A 2WS3B 2LASA 1VJKA 3D32A 2IO1B 1OEYA 2QMTA 1WY8A 3IXSA 1IBXA 4HCNB 2ZPNA 1C78A 1J19A 4DXFA 3RMKC 5JH5C 1XO3A 3JSVB 3GOEA 2ZCCA 4G0NB 3A9JA 3I3TB 2RD0A 3X23A 2UWQA 3L0WB 1E8YA 2BB5A 1WFYA 3ZQ4A 3H1UA 4CYEA 3L4PA 4HPPA 4TMAB 3DVGY 2A5UA 2IBIB 5TR5A 3TBLD 2GBJA 4QAYA 3U4EG 4GU2A 2ICIA 5DPRA 1PGBA 1WX7A 2Q5WD 3UINB 1GB1A 1C4AA 4BFRA 3IG3A 5LNK1 2BS3B 3A4RA 2KQ7A 4RGMA 3Q69A 2KMCA 3PO0A 1L4DB 4GDLB 1WZ0A 1TT5B 2V3NA 1TKGA 2W55A 1GC7A 2DNFA 1XLNA 2WDQB 5LXIB 2O6VB 3ZXRA 4Q2JA 3ECIA 4IM3A 3DHHC 4DDID 2B3AA 2WHIA 4CHKA 5D2MB 4FHJA 2NBWB 2MRPA
chains in the Genus database with same CATH topology
4PS8A 1KLVA 5JHBA 3QCAA 4FLHA 5GMVA 5DPTA 2ASQA 4KZ0A 2KXJA 1J8CA 1XD3B 2LGXA 2K6QA 1RAXA 1WJNA 3V62A 2KWCA 2M17A 1YQBA 1LFDA 3DBLI 2CS4A 3BY4B 3TJPA 1XQQA 2KDFB 4HCPB 1E8XA 1YX5B 4AJYB 3KYCD 3DCGA 5AZHA 2ZZPB 1V81A 2G4DB 4G11A 4BKSA 4RM8A 1KM7A 3V60A 3PZDA 5D6JB 4DWFA 1WM3A 2DZMA 4II2B 2L00B 3NS8A 3PRPB 3NY5A 2WWZA 4DHZE 2NBUA 1NDDA 1V49A 2J0KA 3QC8B 4TQ0A 2YVCA 4E71A 5JZEB 1TZ1A 4KV2A 4MJSA 2MBQA 2KC2A 4NPNA 3R3MA 2C7NB 2ZNVC 3WANA 4FJYA 1WF9A 1LM8B 2K39A 3ZVVA 4I6PA 3ZLZA 3W1SC 4OVVA 1GUAB 3OLMD 1QZEA 3OAWA 4GDKA 1ZKHA 4BOSC 3A9KB 1NBFC 2I1JA 1OGWA 3ZNHB 4F1SA 1H4RA 2N4FA 2MA9B 3HM3A 2DENB 4FJZA 1P0RA 5CHFA 2VRRB 2O2VB 1SGHA 2L7RA 1Q5WB 2L0FA 2AL3A 3APFA 3KUCB 4FADA 2MX2A 1UELA 1V2YA 2BYFA 3DQVA 4MSQB 4W9LA 5AZFA 4GDKB 4G50A 4LCDE 4KDIC 4MSMB 2ZEQA 4WQOB 3DBRI 1WMHB 3V6EB 1V80A 3QIJA 4NJ7A 4GSWA 1WGGA 1OEYJ 2J0JA 1UBQA 1SE9A 4IUMB 3VAWA 1IYFA 4M8NA 4KSKC 1WM2A 2KLGA 2N1VA 3TMPB 1E5WA 2W9NA 3H9DA 2C7HA 4PYUA 1I35A 5C1ZA 4DBGA 2FUHB 3RYTA 2K8HA 1TGZB 1UZXB 2CHWA 1E90A 1UD7A 2FCSA 3JSVA 2KX0A 4W9EA 2JRHA 4WWOA 5FR6A 1WGRA 3ZW3A 4KZCA 1WZ3A 4MH0E 4M0WB 3AI5A 3HIZA 2MCNB 2DZKA 2N7EA 1U4AA 1E8WA 1V5OA 2BWFA 2NVUI 2O6VD 2GBMA 5KHOA 1WX9A 4EEWA 5J18A 4HPMB 2BPSA 1C1YB 1TBEA 1WMHA 3EC8A 4KDLB 4PYZA 3R7RA 3QARA 4A20A 2D3GA 1KOTA 5L95C 3DOWA 4WJNA 3P2BA 1KJTA 1R4NI 3Q3JA 4X57B 3L17A 2Z59B 5CTRC 4JLCA 2KKCA 3ZRFA 2FCQA 4DK5A 2C7MB 4NY0A 3UIPB 3VUYA 3B1LX 2L0TA 3VH4B 1V6EA 2IZVB 2AEHA 1JRUA 2CHZA 2JZ3B 3L13A 4MGYE 2K8BA 4MM3A 1M94A 2K6DB 3OJ3A 2DAFA 4IWOA 4MDKE 2C5LC 2I1KA 3PPAA 3PTFC 4GMVA 3SDLC 3N30A 2DAJA 4ICUA 4BKGA 4BOZB 1K8RB 1IPGA 4I6LB 1XT9B 2M4NA 4BBNF 4HDOA 2BKFA 2NPTB 4KVGB 4FBJB 4DHJD 3M63B 2MBBB 4K7UA 1WI0A 3A9JB 4TQ1A 2LJ5A 3W1YA 2KQSA 4ZDVA 1V5TA 2OOBB 4B9KA 2MP2B 3ZIMA 2V3SA 3H7PB 3M62B 1OQYA 5IAAC 2EMSA 3VFKA 3L54A 3L16A 2HD5B 4M8MA 3TIXA 2FIDA 3VH3B 2LVQA 4NQLB 4ANXA 2KDEB 3WAOA 3L08A 4OVUA 1BT0A 5DCNA 3N3KB 2DX5B 4HLEA 5AEKB 3CF6E 4ANVA 1RFAA 2JF5A 3UQAA 5IA7A 4F8CB 2KFKA 3V6CB 2JVCA 1V86A 3ZTCA 4FN2A 3ZDMC 1P3QU 3K9OB 2LVOA 4HVBA 1WR1A 1S1QB 2CKHB 2PEAA 2R2OA 2WX0A 2JPHA 3CSTA 3ZTDA 3RD2A 2GMIC 4AWJA 2WDTB 2FIFA 2N9EB 2HTHA 3SHQA 1S3SG 3JVZX 3WAMA 4GN1A 2O2VA 2N9XA 4IWPA 3IVFA 1YIWA 5HKHA 2KFKB 3NZUA 4KSLC 4KIKA 3SD5A 4NJ6A 4GDLA 4EFOA 1R4MI 3CSFA 2L76A 3A9KA 4ZRJA 3PSEB 1G6JA 3VTWA 1H8CA 4IW0A 4I6NB 3B08A 4GGQA 1VD2A 3PGEA 2KZRA 2GBKA 2KOXA 2PPHA 3A4SC 4K7SA 4WWPA 3WAPA 4JL9A 2BGFA 4BKTA 3T8MA 2J0MA 3VDZA 1WJ6A 2D07B 1WXSA 1Z5SB 3RUIB 5LXHA 2C60A 2BKRB 2A4ZA 3VQIA 2CHXA 2N7DA 3AULA 3VXWA 4NAWA 3QK0A 1E8ZA 2PJHA 3VVWB 4NQKE 1WJ4A 4LJPB 1WXVA 1UBIA 5CX3A 2NPTA 3IHPC 2KHWB 4ZRIA 2KTRB 2WYQA 5CHVC 2G3QB 4HJKA 3TCAA 1WRDB 2HE7A 4W9KA 2FNJB 1D3ZA 3W1SA 2V1YA 4XC2A 3DVNU 4A3OA 2PE6B 2NR2A 4IM0A 2LUEA 4HPLB 5CHWA 4TKNA 4F7ZA 3SU8X 4DHZB 2CU1A 2LGYA 1EF5A 1P98A 2XBBC 3PLVA 2ZCBA 5BO4B 2KDBA 3T9LA 2BYEA 4AOFA 2LXCA 3V61A 2RPQA 4K1RB 2D11A 4LDTD 3ZDTA 4EZKA 4W9GA 4DHJB 2LXAA 4HWIB 3B0AA 2LRWA 3ZNZB 2KJHB 3Q3FA 5G2NA 3VTVA 1E7VA 2JT4B 2O6VA 3PHWB 1ZW7A 2KNBA 1F9JA 3A1QA 1L2NA 2CR5A 4II3B 3X0WA 4J6IA 3RZFA 1GC6A 3LDZE 4GIVA 2KTRA 5C23A 4W9CA 4G3XB 4E74A 3DBSA 2MP2A 2M1MA 2IO2B 2KK8A 3VUXA 2IY0B 5JHAA 1Z2MA 2KWUB 3DVNV 2ZVOA 4BBNC 4DDGD 5AZGA 4ZYNA 5KHQA 3KW5B 2DYOA 1WGHA 2WX1A 1FXTB 5DPSA 4ASWC 4XX5A 1WXMA 2IYDB 2MQJA 2V4LA 2RR9A 3QHTA 3KH0A 3DBHI 3VTUA 3AXCA 2K25A 5EDSA 2NBVB 1J0GA 3C0RB 2D2QA 3L10B 1TTNA 4HDQA 2G4SA 4W9DA 2KC1A 2LWPA 3O65B 1PQSA 1MG8A 1WXAA 3EFUA 3PLUA 1WE7A 2Z0DB 1V9JA 3A33B 4TV3A 3RZWC 2ZPYA 2N1WA 1WGYA 3LJ3A 1WH3A 2EKEC 1NI2A 2JWZA 2KMAA 2MBEA 2HJ8A 2J7QB 2LD9A 3HHMA 3K9PB 3VHTC 4MELA 2LI5A 3PRZA 4GOCA 4AUQC 4ZRKA 2REXA 4WJQA 3CMMB 1A5RA 4YL8A 3KVFB 1GNUA 3WIMA 2RGFA 2Y5BB 4ANWA 2IY1B 1WX8A 3H7SA 2FCNA 2MWSB 4MEMA 1WYWB 3AU4A 4EOYA 1L7YA 3H6NA 3R7QA 4FJVB 2KLCA 2KWVB 2L8JA 3ONSA 4EZJA 3PV1A 4WJOA 4E3CA 4EUTA 1LQBA 4GB9A 3UQBA 3QWZB 2JZZA 2L3ZA 1WJUA 2BWES 3RT3B 1I42A 3PHXB 1WGDA 4FULA 4GXBA 1RLFA 4RM9A 4WAAA 3OJ4B 4HK2A 1UGMA 1GG3A 2BF8B 2KJRA 2JXXA 1WIAA 3U7DA 3JW0X 2KD0A 4IWQA 3ZKJC 2BYVE 4RMAA 3UGBB 2M8SA 2C9WB 3U30A 5DPWA 3JYUA 3KYDD 1EF1A 2JUOA 5J2RA 2K1FA 2KN5A 2KX3A 2XK5A 4WJPA 1X1MA 1YX6B 2R2QA 2ZVNA 3RCZA 4B95A 3WALA 4W9IA 2KANA 4LDTB 4ANUA 2KO3A 2EMTA 3QJZA 1Q1OA 2AL6A 2NS5A 2UYZB 2YLMA 1P9DU 2AWTA 1YJ1A 4MJSB 3RULA 4W9HA 2G45B 4FA6A 2NCNA 3UF8A 3APDA 2JRIB 3ML8A 3M95A 2KDIA 5E6OA 2N9PC 2M0XA 4CO7A 4A3PA 2QHOA 1T0YA 4NAWB 2LASA 4XZ4A 4AP4C 4URKA 3EHVA 3EECA 1YD8U 3IBEA 4EZLA 3AU5A 2MBOA 3ML9A 3D32A 1HE8A 2IO1B 1OEYA 1WY8A 4MGKE 4HCNB 2ZPNA 3PVLA 2LGDA 1UH6A 3QAQA 2AYOB 4IM2A 3ZUNA 4N9F4 5G55A 3U8ZA 1LXDA 5D7GA 2DYMA 2L05A 2RSUA 1C3TA 1J19A 2MLBA 1EUVB 2PE9A 5JH5C 1VCBA 2GOWA 4DXAB 1CMXB 3JSVB 3GOEA 5E6PA 2ZCCA 4G0NB 1P1AA 3A9JA 3I3TB 3R66C 3UIOB 2GBRA 3DVGX 1ZGUB 2RD0A 4K81A 1WE6A 3X23A 2UWQA 3L0WB 3BINA 1GJZA 2OJRA 2IO0B 3ALBA 1E8YA 1EO6A 2KJ6A 2LRUA 4IC7B 3KUZA 2KVRA 3NZSA 4MGIE 1WFYA 1Q0WB 4EKUA 3MJWA 4WWNA 2MW5A 4JIOU 1AARA 2DZJA 1SIFA 3QA8A 3MHSD 4LJOB 2XK5B 3S2AA 4K7WA 3ENEA 3HK0A 2MBHA 4W9JA 3H1UA 4CYEA 4MGZE 2IO3B 3NOBA 3VUWA 2GBNA 3DVGY 4JQWC 2A5UA 2IBIB 5LLIA 5TR5A 2GBJA 3TBLD 3ZNGC 2DZIA 3PREA 3APCA 4GU2A 4JGHB 3NHEB 3PS6A 5DPRA 3QQ8B 2D10A 3QX1A 1OTRB 1WX7A 4B6WA 3IFWB 3UINB 4PS3A 5L83A 2KFJA 5D94A 3HM6X 4BFRA 2DHZA 4W9FA 3IG3A 2ZJDA 3DDCB 3A4RA 3MTNB 3PRMB 3ZO5B 2KQ7A 4FHKA 2FAZA 2K8CA 2LVPA 3M3JA 3H7PA 4HXDA 3DPDA 2KMCA 4TUUA 4AJWA 4BVUC 2JY6A 2FCMA 4GDLB 1E7UA 2MSED 1WZ0A 4KIKB 5J17A 3N32A 2ZNVB 1GC7A 3GZNI 1Y8RC 1ISNA 3ZNID 3WA0A 3KUDB 5E6NA 3A1QB 2Z0EB 4PS7A 4NNJB 3ZRCA 5LXIB 2KTFA 2O6VB 2XEWA 3TL5A 3ECIA 1WR6E 4IM3A 3PT2B 4P7IA 4BKSD 1RRBA 1IP9A 4DDID 2DYBA 2LZ6A 2B3AA 4CHKA 4ICVA 4IG7B 5D2MB 4FHJA 2NBWB 2MRPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PS8 A;  1KLV A;  5JHB A;  3QCA A;  4FLH A;  5GMV A;  5DPT A;  2ASQ A;  4KZ0 A;  2KXJ A;  1J8C A;  1XD3 B;  2LGX A;  2K6Q A;  1RAX A;  1WJN A;  3V62 A;  2KWC A;  2M17 A;  1YQB A;  1LFD A;  3DBL I;  2CS4 A;  3BY4 B;  3TJP A;  1XQQ A;  2KDF B;  4HCP B;  1E8X A;  1YX5 B;  4AJY B;  3KYC D;  3DCG A;  5AZH A;  2ZZP B;  1V81 A;  2G4D B;  4G11 A;  4BKS A;  4RM8 A;  1KM7 A;  3V60 A;  3PZD A;  5D6J B;  4DWF A;  1WM3 A;  2DZM A;  4II2 B;  2L00 B;  3NS8 A;  3PRP B;  3NY5 A;  2WWZ A;  4DHZ E;  2NBU A;  1NDD A;  1V49 A;  2J0K A;  3QC8 B;  4TQ0 A;  2YVC A;  4E71 A;  5JZE B;  1TZ1 A;  4KV2 A;  4MJS A;  2MBQ A;  2KC2 A;  4NPN A;  3R3M A;  2C7N B;  2ZNV C;  3WAN A;  4FJY A;  1WF9 A;  1LM8 B;  2K39 A;  3ZVV A;  4I6P A;  3ZLZ A;  3W1S C;  4OVV A;  1GUA B;  3OLM D;  1QZE A;  3OAW A;  4GDK A;  1ZKH A;  4BOS C;  3A9K B;  1NBF C;  2I1J A;  1OGW A;  3ZNH B;  4F1S A;  1H4R A;  2N4F A;  2MA9 B;  3HM3 A;  2DEN B;  4FJZ A;  1P0R A;  5CHF A;  2VRR B;  2O2V B;  1SGH A;  2L7R A;  1Q5W B;  2L0F A;  2AL3 A;  3APF A;  3KUC B;  4FAD A;  2MX2 A;  1UEL A;  1V2Y A;  2BYF A;  3DQV A;  4MSQ B;  4W9L A;  5AZF A;  4GDK B;  4G50 A;  4LCD E;  4KDI C;  4MSM B;  2ZEQ A;  4WQO B;  3DBR I;  1WMH B;  3V6E B;  1V80 A;  3QIJ A;  4NJ7 A;  4GSW A;  1WGG A;  1OEY J;  2J0J A;  1UBQ A;  1SE9 A;  4IUM B;  3VAW A;  1IYF A;  4M8N A;  4KSK C;  1WM2 A;  2KLG A;  2N1V A;  3TMP B;  1E5W A;  2W9N A;  3H9D A;  2C7H A;  4PYU A;  1I35 A;  5C1Z A;  4DBG A;  2FUH B;  3RYT A;  2K8H A;  1TGZ B;  1UZX B;  2CHW A;  1E90 A;  1UD7 A;  2FCS A;  3JSV A;  2KX0 A;  4W9E A;  2JRH A;  4WWO A;  5FR6 A;  1WGR A;  3ZW3 A;  4KZC A;  1WZ3 A;  4MH0 E;  4M0W B;  3AI5 A;  3HIZ A;  2MCN B;  2DZK A;  2N7E A;  1U4A A;  1E8W A;  1V5O A;  2BWF A;  2NVU I;  2O6V D;  2GBM A;  5KHO A;  1WX9 A;  4EEW A;  5J18 A;  4HPM B;  2BPS A;  1C1Y B;  1TBE A;  1WMH A;  3EC8 A;  4KDL B;  4PYZ A;  3R7R A;  3QAR A;  4A20 A;  2D3G A;  1KOT A;  5L95 C;  3DOW A;  4WJN A;  3P2B A;  1KJT A;  1R4N I;  3Q3J A;  4X57 B;  3L17 A;  2Z59 B;  5CTR C;  4JLC A;  2KKC A;  3ZRF A;  2FCQ A;  4DK5 A;  2C7M B;  4NY0 A;  3UIP B;  3VUY A;  3B1L X;  2L0T A;  3VH4 B;  1V6E A;  2IZV B;  2AEH A;  1JRU A;  2CHZ A;  2JZ3 B;  3L13 A;  4MGY E;  2K8B A;  4MM3 A;  1M94 A;  2K6D B;  3OJ3 A;  2DAF A;  4IWO A;  4MDK E;  2C5L C;  2I1K A;  3PPA A;  3PTF C;  4GMV A;  3SDL C;  3N30 A;  2DAJ A;  4ICU A;  4BKG A;  4BOZ B;  1K8R B;  1IPG A;  4I6L B;  1XT9 B;  2M4N A;  4BBN F;  4HDO A;  2BKF A;  2NPT B;  4KVG B;  4FBJ B;  4DHJ D;  3M63 B;  2MBB B;  4K7U A;  1WI0 A;  3A9J B;  4TQ1 A;  2LJ5 A;  3W1Y A;  2KQS A;  4ZDV A;  1V5T A;  2OOB B;  4B9K A;  2MP2 B;  3ZIM A;  2V3S A;  3H7P B;  3M62 B;  1OQY A;  5IAA C;  2EMS A;  3VFK A;  3L54 A;  3L16 A;  2HD5 B;  4M8M A;  3TIX A;  2FID A;  3VH3 B;  2LVQ A;  4NQL B;  4ANX A;  2KDE B;  3WAO A;  3L08 A;  4OVU A;  1BT0 A;  5DCN A;  3N3K B;  2DX5 B;  4HLE A;  5AEK B;  3CF6 E;  4ANV A;  1RFA A;  2JF5 A;  3UQA A;  5IA7 A;  4F8C B;  2KFK A;  3V6C B;  2JVC A;  1V86 A;  3ZTC A;  4FN2 A;  3ZDM C;  1P3Q U;  3K9O B;  2LVO A;  4HVB A;  1WR1 A;  1S1Q B;  2CKH B;  2PEA A;  2R2O A;  2WX0 A;  2JPH A;  3CST A;  3ZTD A;  3RD2 A;  2GMI C;  4AWJ A;  2WDT B;  2FIF A;  2N9E B;  2HTH A;  3SHQ A;  1S3S G;  3JVZ X;  3WAM A;  4GN1 A;  2O2V A;  2N9X A;  4IWP A;  3IVF A;  1YIW A;  5HKH A;  2KFK B;  3NZU A;  4KSL C;  4KIK A;  3SD5 A;  4NJ6 A;  4GDL A;  4EFO A;  1R4M I;  3CSF A;  2L76 A;  3A9K A;  4ZRJ A;  3PSE B;  1G6J A;  3VTW A;  1H8C A;  4IW0 A;  4I6N B;  3B08 A;  4GGQ A;  1VD2 A;  3PGE A;  2KZR A;  2GBK A;  2KOX A;  2PPH A;  3A4S C;  4K7S A;  4WWP A;  3WAP A;  4JL9 A;  2BGF A;  4BKT A;  3T8M A;  2J0M A;  3VDZ A;  1WJ6 A;  2D07 B;  1WXS A;  1Z5S B;  3RUI B;  5LXH A;  2C60 A;  2BKR B;  2A4Z A;  3VQI A;  2CHX A;  2N7D A;  3AUL A;  3VXW A;  4NAW A;  3QK0 A;  1E8Z A;  2PJH A;  3VVW B;  4NQK E;  1WJ4 A;  4LJP B;  1WXV A;  1UBI A;  5CX3 A;  2NPT A;  3IHP C;  2KHW B;  4ZRI A;  2KTR B;  2WYQ A;  5CHV C;  2G3Q B;  4HJK A;  3TCA A;  1WRD B;  2HE7 A;  4W9K A;  2FNJ B;  1D3Z A;  3W1S A;  2V1Y A;  4XC2 A;  3DVN U;  4A3O A;  2PE6 B;  2NR2 A;  4IM0 A;  2LUE A;  4HPL B;  5CHW A;  4TKN A;  4F7Z A;  3SU8 X;  4DHZ B;  2CU1 A;  2LGY A;  1EF5 A;  1P98 A;  2XBB C;  3PLV A;  2ZCB A;  5BO4 B;  2KDB A;  3T9L A;  2BYE A;  4AOF A;  2LXC A;  3V61 A;  2RPQ A;  4K1R B;  2D11 A;  4LDT D;  3ZDT A;  4EZK A;  4W9G A;  4DHJ B;  2LXA A;  4HWI B;  3B0A A;  2LRW A;  3ZNZ B;  2KJH B;  3Q3F A;  5G2N A;  3VTV A;  1E7V A;  2JT4 B;  2O6V A;  3PHW B;  1ZW7 A;  2KNB A;  1F9J A;  3A1Q A;  1L2N A;  2CR5 A;  4II3 B;  3X0W A;  4J6I A;  3RZF A;  1GC6 A;  3LDZ E;  4GIV A;  2KTR A;  5C23 A;  4W9C A;  4G3X B;  4E74 A;  3DBS A;  2MP2 A;  2M1M A;  2IO2 B;  2KK8 A;  3VUX A;  2IY0 B;  5JHA A;  1Z2M A;  2KWU B;  3DVN V;  2ZVO A;  4BBN C;  4DDG D;  5AZG A;  4ZYN A;  5KHQ A;  3KW5 B;  2DYO A;  1WGH A;  2WX1 A;  1FXT B;  5DPS A;  4ASW C;  4XX5 A;  1WXM A;  2IYD B;  2MQJ A;  2V4L A;  2RR9 A;  3QHT A;  3KH0 A;  3DBH I;  3VTU A;  3AXC A;  2K25 A;  5EDS A;  2NBV B;  1J0G A;  3C0R B;  2D2Q A;  3L10 B;  1TTN A;  4HDQ A;  2G4S A;  4W9D A;  2KC1 A;  2LWP A;  3O65 B;  1PQS A;  1MG8 A;  1WXA A;  3EFU A;  3PLU A;  1WE7 A;  2Z0D B;  1V9J A;  3A33 B;  4TV3 A;  3RZW C;  2ZPY A;  2N1W A;  1WGY A;  3LJ3 A;  1WH3 A;  2EKE C;  1NI2 A;  2JWZ A;  2KMA A;  2MBE A;  2HJ8 A;  2J7Q B;  2LD9 A;  3HHM A;  3K9P B;  3VHT C;  4MEL A;  2LI5 A;  3PRZ A;  4GOC A;  4AUQ C;  4ZRK A;  2REX A;  4WJQ A;  3CMM B;  1A5R A;  4YL8 A;  3KVF B;  1GNU A;  3WIM A;  2RGF A;  2Y5B B;  4ANW A;  2IY1 B;  1WX8 A;  3H7S A;  2FCN A;  2MWS B;  4MEM A;  1WYW B;  3AU4 A;  4EOY A;  1L7Y A;  3H6N A;  3R7Q A;  4FJV B;  2KLC A;  2KWV B;  2L8J A;  3ONS A;  4EZJ A;  3PV1 A;  4WJO A;  4E3C A;  4EUT A;  1LQB A;  4GB9 A;  3UQB A;  3QWZ B;  2JZZ A;  2L3Z A;  1WJU A;  2BWE S;  3RT3 B;  1I42 A;  3PHX B;  1WGD A;  4FUL A;  4GXB A;  1RLF A;  4RM9 A;  4WAA A;  3OJ4 B;  4HK2 A;  1UGM A;  1GG3 A;  2BF8 B;  2KJR A;  2JXX A;  1WIA A;  3U7D A;  3JW0 X;  2KD0 A;  4IWQ A;  3ZKJ C;  2BYV E;  4RMA A;  3UGB B;  2M8S A;  2C9W B;  3U30 A;  5DPW A;  3JYU A;  3KYD D;  1EF1 A;  2JUO A;  5J2R A;  2K1F A;  2KN5 A;  2KX3 A;  2XK5 A;  4WJP A;  1X1M A;  1YX6 B;  2R2Q A;  2ZVN A;  3RCZ A;  4B95 A;  3WAL A;  4W9I A;  2KAN A;  4LDT B;  4ANU A;  2KO3 A;  2EMT A;  3QJZ A;  1Q1O A;  2AL6 A;  2NS5 A;  2UYZ B;  2YLM A;  1P9D U;  2AWT A;  1YJ1 A;  4MJS B;  3RUL A;  4W9H A;  2G45 B;  4FA6 A;  2NCN A;  3UF8 A;  3APD A;  2JRI B;  3ML8 A;  3M95 A;  2KDI A;  5E6O A;  2N9P C;  2M0X A;  4CO7 A;  4A3P A;  2QHO A;  1T0Y A;  4NAW B;  2LAS A;  4XZ4 A;  4AP4 C;  4URK A;  3EHV A;  3EEC A;  1YD8 U;  3IBE A;  4EZL A;  3AU5 A;  2MBO A;  3ML9 A;  3D32 A;  1HE8 A;  2IO1 B;  1OEY A;  1WY8 A;  4MGK E;  4HCN B;  2ZPN A;  3PVL A;  2LGD A;  1UH6 A;  3QAQ A;  2AYO B;  4IM2 A;  3ZUN A;  4N9F 4;  5G55 A;  3U8Z A;  1LXD A;  5D7G A;  2DYM A;  2L05 A;  2RSU A;  1C3T A;  1J19 A;  2MLB A;  1EUV B;  2PE9 A;  5JH5 C;  1VCB A;  2GOW A;  4DXA B;  1CMX B;  3JSV B;  3GOE A;  5E6P A;  2ZCC A;  4G0N B;  1P1A A;  3A9J A;  3I3T B;  3R66 C;  3UIO B;  2GBR A;  3DVG X;  1ZGU B;  2RD0 A;  4K81 A;  1WE6 A;  3X23 A;  2UWQ A;  3L0W B;  3BIN A;  1GJZ A;  2OJR A;  2IO0 B;  3ALB A;  1E8Y A;  1EO6 A;  2KJ6 A;  2LRU A;  4IC7 B;  3KUZ A;  2KVR A;  3NZS A;  4MGI E;  1WFY A;  1Q0W B;  4EKU A;  3MJW A;  4WWN A;  2MW5 A;  4JIO U;  1AAR A;  2DZJ A;  1SIF A;  3QA8 A;  3MHS D;  4LJO B;  2XK5 B;  3S2A A;  4K7W A;  3ENE A;  3HK0 A;  2MBH A;  4W9J A;  3H1U A;  4CYE A;  4MGZ E;  2IO3 B;  3NOB A;  3VUW A;  2GBN A;  3DVG Y;  4JQW C;  2A5U A;  2IBI B;  5LLI A;  5TR5 A;  2GBJ A;  3TBL D;  3ZNG C;  2DZI A;  3PRE A;  3APC A;  4GU2 A;  4JGH B;  3NHE B;  3PS6 A;  5DPR A;  3QQ8 B;  2D10 A;  3QX1 A;  1OTR B;  1WX7 A;  4B6W A;  3IFW B;  3UIN B;  4PS3 A;  5L83 A;  2KFJ A;  5D94 A;  3HM6 X;  4BFR A;  2DHZ A;  4W9F A;  3IG3 A;  2ZJD A;  3DDC B;  3A4R A;  3MTN B;  3PRM B;  3ZO5 B;  2KQ7 A;  4FHK A;  2FAZ A;  2K8C A;  2LVP A;  3M3J A;  3H7P A;  4HXD A;  3DPD A;  2KMC A;  4TUU A;  4AJW A;  4BVU C;  2JY6 A;  2FCM A;  4GDL B;  1E7U A;  2MSE D;  1WZ0 A;  4KIK B;  5J17 A;  3N32 A;  2ZNV B;  1GC7 A;  3GZN I;  1Y8R C;  1ISN A;  3ZNI D;  3WA0 A;  3KUD B;  5E6N A;  3A1Q B;  2Z0E B;  4PS7 A;  4NNJ B;  3ZRC A;  5LXI B;  2KTF A;  2O6V B;  2XEW A;  3TL5 A;  3ECI A;  1WR6 E;  4IM3 A;  3PT2 B;  4P7I A;  4BKS D;  1RRB A;  1IP9 A;  4DDI D;  2DYB A;  2LZ6 A;  2B3A A;  4CHK A;  4ICV A;  4IG7 B;  5D2M B;  4FHJ A;  2NBW B;  2MRP A; 
#chains in the Genus database with same CATH topology
 1KRH A;  4N6E B;  2QCZ A;  1J8C A;  1XD3 B;  2LGX A;  4FXC A;  3B2F A;  2M17 A;  2CS4 A;  3BY4 B;  1CK1 A;  1CQV A;  3VRA B;  4JPS A;  2LGI A;  2LMC A;  3NZ3 A;  3DCG A;  2ZZP B;  1V81 A;  2G4D B;  3URY A;  4BKS A;  1SBB B;  4II2 B;  1SSN A;  1NDD A;  1V49 A;  4N59 A;  2KC2 A;  2ZNV C;  3WAN A;  4RGN A;  5FKA C;  1LM8 B;  3ZLZ A;  1GUA B;  1I4Q A;  1ZXH A;  1OGW A;  3ZNH B;  2MA9 B;  1QOB A;  2DEN B;  5CHF A;  2L7R A;  2L0F A;  3APF A;  2AL3 A;  3E9S A;  2LFI A;  4KGR A;  4KKJ A;  3N9Y C;  1V2Y A;  4W9L A;  5AZF A;  2V4I B;  4GDK B;  4G50 A;  4LNN A;  2ZEQ A;  1WMH B;  1FFV A;  2SEB D;  4GSW A;  4IUM B;  3VAW A;  1IYF A;  4KSK C;  3TMP B;  4DBG A;  2IGD A;  2K8H A;  1TGZ B;  2FCS A;  3JSV A;  4WWO A;  2KX0 A;  5FR6 A;  4M0W B;  4ZHO A;  4EEW A;  2NVU I;  5IP4 D;  1WX9 A;  2WXN A;  3TEZ A;  1C1Y B;  1TBE A;  1VZ8 A;  1KJT A;  1XCT L;  1JCK B;  4OZA A;  4A8X C;  2KKC A;  2FCQ A;  1PGX A;  4NY0 A;  4A6Q A;  2L0T A;  3VH4 B;  3AE7 B;  1FIQ A;  4MM3 A;  1XLQ A;  1M94 A;  1T0Q C;  2K6D B;  2YEP F;  4MDK E;  4GMV A;  3PTF C;  3SDL C;  3N30 A;  4ICU A;  3LYY A;  1A70 A;  1R4N B;  1I4R A;  2QC8 A;  1IPG A;  3SFD B;  2M4N A;  2IDY A;  4K3C A;  3M63 B;  4K7U A;  3A9J B;  2WXP A;  2MH7 A;  3NUH B;  2MP2 B;  4B9K A;  5IAA C;  4LLG M;  2JU6 X;  2J52 A;  3L16 A;  1MG4 A;  1KF6 B;  2KWD A;  2KYW A;  4ANX A;  2KDE B;  1UUP A;  4B0M A;  2WXO A;  5DCN A;  2WLB A;  3N3K B;  2MJE A;  5AEK B;  2GB1 A;  2KFK A;  2WDR B;  2JVC A;  3KQ4 A;  2DLB A;  3K9O B;  2PEA A;  1S1Q B;  3CST A;  2M56 B;  3RD2 A;  1F1H A;  2GMI C;  3U52 E;  1IGD A;  3DWG C;  2HTH A;  2WXQ A;  1S3S G;  3JVZ X;  4ZYS A;  2N9X A;  2KFK B;  4KIK A;  1ZP0 B;  4KSL C;  3SD5 A;  1K52 A;  1R4M I;  2L76 A;  3PSE B;  1G6J A;  4GGQ A;  4LNO A;  3HUI A;  2L32 A;  1ZDV A;  2PW9 A;  1P7F A;  3PGE A;  2GBK A;  2KOX A;  3T8M A;  2D3C A;  1WJ6 A;  5LXH A;  4XDC A;  5D3I B;  2N7D A;  1MHH E;  3QK0 A;  1E8Z A;  1WJ4 A;  5H92 C;  1WXV A;  2KHW B;  4ZRI A;  2WQY B;  3IAM 1;  3NG0 A;  3Q14 C;  1TIF A;  1VZ6 A;  2HE7 A;  5BYR A;  2FNJ B;  4WWM A;  2W82 A;  4A3O A;  2NR2 A;  4HPL B;  1MHX A;  1L6U A;  5BYQ A;  4DHZ B;  2XBB C;  2LGY A;  1EF5 A;  1P98 A;  5BO4 B;  2ZCB A;  1UWM A;  2GLS A;  4K1R B;  2D11 A;  4AQ7 A;  3B9J A;  3KLS X;  3GZN B;  3B0A A;  3ZNZ B;  5G2N A;  1QT9 A;  1PDX A;  2KNB A;  1UWX A;  4XGA B;  4YSX B;  2N9K A;  4GIV A;  2CJO A;  4W9C A;  2BVC A;  3ETR A;  2M1M A;  4LNI A;  3VUX A;  5JHA A;  2KWU B;  4UDU C;  2ZVO A;  3N20 C;  5KHQ A;  1WGH A;  2LHD A;  1FXT B;  5BMI A;  1FM0 D;  5DPS A;  4C00 A;  4C7Z A;  2BT6 A;  1FEH A;  3T3O A;  3V3X A;  1QOG A;  2K3U A;  2JQR B;  4HEA 1;  1N6Z A;  1LGR A;  1OQR A;  3RNG C;  3C19 A;  4HDQ A;  1WXA A;  1TY0 A;  3AE1 B;  3EFU A;  3DBR B;  3PLU A;  1WE7 A;  2ZPY A;  2JWZ A;  1JWU D;  2LD9 A;  3K9P B;  4MEL A;  1FCC C;  1T5X D;  3PRZ A;  4GOC A;  3RPF C;  1ZPS A;  4MT5 A;  2V0G A;  3AU4 A;  1L7Y A;  1XCQ L;  4FJV B;  2KWV B;  3UQB A;  3QWZ B;  2JZZ A;  1WJU A;  3GE8 C;  1MJD A;  4C80 A;  1C79 A;  4GXB A;  4WAA A;  3OJ4 B;  4P1B C;  3U7D A;  2KD0 A;  4RMA A;  1NEN B;  2M8S A;  2W3R A;  5DPW A;  3Q8C A;  3KYD D;  2JUO A;  2K1F A;  2KX3 A;  2XK5 A;  4WJP A;  1X1M A;  1YX6 B;  2R2Q A;  2ZVN A;  3RCZ A;  2KAN A;  4LDT B;  4ANU A;  2KO3 A;  1Q1O A;  3DHI C;  4J3O D;  4C4V A;  2AQ3 B;  2G45 B;  2JRI B;  1IUE A;  4BAX A;  2PKO A;  3TSS A;  1GOZ A;  1T0Y A;  2QHO A;  4RFB A;  1YD8 U;  3IBE A;  3AU5 A;  4MGK E;  3PVL A;  2LGD A;  3IT4 B;  2AYO B;  1DOY A;  4IM2 A;  3ZUN A;  4DQO C;  4N9F 4;  5G55 A;  3RNA C;  2GOW A;  3H8H A;  1E10 A;  4K81 A;  3BIN A;  2OJR A;  2IO0 B;  4IC7 B;  5T8I A;  4MGI E;  1Q0W B;  2WXL A;  3MJW A;  2MW5 A;  2DZJ A;  4JWU C;  3MHS D;  3MP9 A;  2EEL A;  2PLP A;  4K7W A;  3ENE A;  2MBH A;  2G1E A;  2IO3 B;  3VUW A;  4JQW C;  5LLI A;  3ZNG C;  2DZI A;  3AE8 B;  2W54 A;  3QX1 A;  4EE2 A;  3Q3O C;  5L83 A;  2NTT A;  3HRD D;  3FAH A;  3DDC B;  1XLP A;  4LNF A;  1MFW A;  3MTN B;  3AE5 B;  3PRM B;  3ZO5 B;  2FAZ A;  2K8C A;  3R2T A;  2EKI A;  3M3J A;  3H7P A;  4AJW A;  1E7U A;  2MSE D;  4KIK B;  4PT5 A;  3AE4 B;  1YMH E;  4S0R A;  1SIJ A;  3ZNI D;  4US8 A;  3WA0 A;  3I63 C;  3KUD B;  2Z0E B;  3R2I A;  2KTF A;  4YWG G;  3TL5 A;  3W5V B;  4TSS A;  1J7C A;  4IKG A;  4BKS D;  1BXT A;  1L6V A;  1RRB A;  4KGS A;  3P1M A;  5GMV A;  5DPT A;  4KZ0 A;  2ON8 A;  4DXG A;  1QQR A;  4IDI A;  1RAX A;  2KWC A;  1E9M A;  1LFD A;  1D5Z C;  3NVY A;  3GP7 A;  2E6X A;  1E8X A;  2BTE A;  5C3J B;  2V9H A;  3AE3 B;  4OZC A;  4RM8 A;  1KM7 A;  4DWF A;  3P63 A;  2L00 B;  3NS8 A;  3PRP B;  3NY5 A;  4DHZ E;  3ABV B;  2J0K A;  4XWT A;  3QC8 B;  1XEE A;  5JZE B;  3O13 A;  2QDF A;  4NPN A;  3R3M A;  1WF9 A;  2K39 A;  3ZVV A;  4I6P A;  2IGG A;  2LEK A;  4GDK A;  1QZE A;  1ZKH A;  1NBF C;  3AEF B;  3U7Z A;  1HQR D;  4JE3 B;  2J42 A;  1Q5W B;  2MX2 A;  2BYF A;  2WXI A;  4MSQ B;  3Q3N C;  4KDI C;  5H8Y E;  4M01 A;  1ZDX A;  3QIJ A;  4NJ7 A;  2D5G A;  1WGG A;  4XYC A;  1QIL A;  1SE9 A;  1BUI C;  2PTL A;  1NYQ A;  4M8N A;  4US9 A;  2W9N A;  4PYU A;  2C7H A;  2FUH B;  3RYT A;  1UZX B;  1WGR A;  3ZW3 A;  2JYT A;  2MCN B;  1V5O A;  5KHO A;  2GBM A;  5J18 A;  3R7R A;  1WMH A;  4PYZ A;  4A20 A;  1KOT A;  5L95 C;  1TY2 A;  3L17 A;  5CTR C;  2MJ3 A;  2PMV A;  1N62 A;  2RPV A;  3UIP B;  3B1L X;  2JZ3 B;  1LO5 D;  3OJ3 A;  2DAF A;  3GB1 A;  4IWO A;  2C5L C;  1EWY C;  3GS2 A;  4BKG A;  1RYJ A;  4I6L B;  1AN8 A;  1FCL A;  3FIL A;  2BKF A;  4KVG B;  3P4S B;  4USA A;  3W1Y A;  1B9R A;  3EFC A;  4ZDV A;  1TKY A;  2L52 A;  3ZIM A;  1VZ7 A;  2EMS A;  3VFK A;  3L54 A;  2HD5 B;  3AEB B;  4HRS A;  4HKZ E;  3L08 A;  4OVU A;  2IPK D;  1BT0 A;  2DX5 B;  2HDE A;  1DOX A;  2JF5 A;  1GPX A;  2J53 A;  4LNK A;  1XF5 L;  5IA7 A;  3V6C B;  1SB3 C;  1P3Q U;  2LVO A;  4HVB A;  4C4V B;  2CKH B;  2WX0 A;  4L1B A;  3WAM A;  3V05 A;  4LTU A;  2O2V A;  3NS1 A;  3AN1 A;  2MEK A;  4JX1 C;  3NZU A;  4NJ6 A;  2OHF A;  2QJL A;  3A9K A;  4ZRJ A;  4YSY B;  2AQ2 B;  4I6N B;  1MVK A;  4K7S A;  1WXS A;  3VQI A;  2ACZ B;  4R3D A;  3VXW A;  4HRO A;  1GAQ B;  2K9X A;  3AE6 B;  1UBI A;  5CX3 A;  2V3P A;  3FIL B;  2HJ1 A;  2OJW A;  5CHV C;  4OW0 A;  3TCA A;  1D3Z A;  3NRZ A;  2V1Y A;  4XC2 A;  2CJN A;  1T0S C;  4YT0 B;  2LUE A;  3AB5 A;  5IN7 A;  3PLV A;  2KDB A;  3T9L A;  4AOF A;  2KVZ A;  2RPQ A;  4EZK A;  2KDM A;  2LXA A;  1WYG A;  2KJH B;  3SFE B;  3VTV A;  1E7V A;  2JT4 B;  3AEG B;  1F52 A;  1KTK A;  3BK2 A;  3X0W A;  3LDZ E;  2KTR A;  4YSZ B;  3DBS A;  2TSS A;  1BML C;  1K51 A;  2MP2 A;  2INP E;  2IY0 B;  2NTS A;  1V1P B;  3HVZ A;  2JYE A;  4BBN C;  4DDG D;  5AZG A;  3KW5 B;  1R4M B;  4CQN A;  2BYT A;  1VR9 A;  2IYD B;  5AUK A;  2MQJ A;  4A90 A;  2RR9 A;  1PUT A;  3DBH I;  2K25 A;  2PIA A;  1HZ5 A;  4P6V F;  3L10 B;  4W9D A;  2LWP A;  1ZOY B;  1PQS A;  4ACF A;  1FPY A;  1NYR A;  3A33 B;  4TV3 A;  3RZW C;  1V8C A;  1EU4 A;  1SXT A;  1WGK A;  5JXV A;  3HHM A;  4AUQ C;  4ZRK A;  3CMM B;  1A5R A;  4YL8 A;  1GNU A;  4RGT A;  2RGF A;  2Y5B B;  1WRI A;  1JW9 D;  2MWS B;  4S17 A;  1K53 A;  4RCO A;  2H89 B;  1T0R C;  3Q3M C;  3ONS A;  2VH1 A;  4E3C A;  4WJO A;  3VR8 B;  4EUT A;  1LQB A;  4GB9 A;  2L3Z A;  1E6E B;  2BWE S;  3RT3 B;  1I42 A;  1WGD A;  2JSV X;  4FUL A;  4RM9 A;  1ACC A;  5FR3 A;  1R7S A;  3P4P B;  1UGM A;  2RMM A;  2BF8 B;  2JXX A;  1SE4 A;  3JW0 X;  4IWQ A;  3UGB B;  2C9W B;  2GI9 A;  1EF1 A;  4C56 C;  1AYF A;  1OFF A;  4B95 A;  3WAL A;  5BYS A;  4ZOH C;  3QJZ A;  2X8X X;  2AL6 A;  2AWT A;  4MJS B;  3RUL A;  3Q8F A;  4W9H A;  4FA6 A;  2I2Y A;  3M95 A;  5E6O A;  3MC0 B;  4O1N A;  1YQ3 B;  4IOI E;  3EHV A;  3EEC A;  4EZL A;  4P1C C;  5MPO A;  5BMG A;  1TZO A;  1LXD A;  3Q8B A;  3AM9 A;  2DYM A;  5D7G A;  1C3T A;  2MLB A;  1EUV B;  2PE9 A;  1VCB A;  1F77 A;  2J4X A;  3R66 C;  1WE6 A;  1B1Z A;  4ARC A;  2KJ6 A;  3KUZ A;  3NZS A;  4WWN A;  4JIO U;  4L2Y A;  1SIF A;  2XK5 B;  3S2A A;  3HK0 A;  4W9J A;  2WGS A;  3NOB A;  2GBN A;  1FNV A;  4ITK A;  4OZB A;  4JGH B;  3PRE A;  3NHE B;  3T3N A;  3QQ8 B;  1C9F A;  1OTR B;  2WU5 B;  4PS3 A;  4RH6 A;  5D94 A;  3HM6 X;  1F2R C;  3TEW A;  2YEP B;  4FHK A;  2LVP A;  4M0W A;  3EA6 A;  2JZP A;  4HXD A;  3DPD A;  2D3A A;  4TUU A;  3NVV A;  2JY6 A;  2FCM A;  2Z8L A;  3Q8A A;  3RNB C;  5J17 A;  3N32 A;  2RDB C;  1RM6 C;  1ISN A;  5E6N A;  1WWT A;  4NNJ B;  2WXF A;  1D6E C;  1WR6 E;  3Q6B A;  2FE8 A;  4A55 A;  1HEZ E;  3PT2 B;  1IP9 A;  2LZ6 A;  5E6J A;  2IND C;  2PVO D;  2WNM A;  2WU2 B;  4PS8 A;  1UF0 A;  1KLV A;  1MI0 A;  3PZ7 A;  2K6Q A;  3V62 A;  1L0X B;  3DBL I;  1ROE A;  3TJP A;  1CZP A;  1XQQ A;  3W9C B;  4HCP B;  3DBH B;  3I5J C;  3BYY B;  4G11 A;  4B0E A;  3V60 A;  1J7B A;  1WM3 A;  4N58 A;  1DYQ A;  4TQ0 A;  4E71 A;  3BVM A;  1ESF A;  1TZ1 A;  4YTP B;  4MJS A;  4FJY A;  1DOI A;  3W1S C;  3OLM D;  3OAW A;  4BOS C;  3A9K B;  2I1J A;  2RDH A;  3UI3 A;  4F1S A;  1H4R A;  1TS2 A;  3HM3 A;  1P0R A;  1M4V A;  4WH4 A;  2VRR B;  2O2V B;  1YOV B;  4REZ A;  3RNE C;  3IAS 1;  5TSS A;  4WQO B;  4WQM A;  1V80 A;  2BW2 A;  2J0J A;  1WM2 A;  2KLG A;  2N1V A;  1I35 A;  1E5W A;  3H9D A;  4ZHP A;  5C1Z A;  2AQ1 B;  2CHW A;  1E90 A;  3BVZ A;  2JRH A;  3TUO A;  1FXI A;  1WZ3 A;  3AI5 A;  1U4A A;  1E8W A;  4D2K A;  3FKY A;  3EC8 A;  4KDL B;  3QAR A;  4WJN A;  1R4N I;  2Z59 B;  4JLC A;  1CJE A;  3ZRF A;  2E3T A;  2C7M B;  1FXA A;  1KLU D;  3OG5 A;  1FO4 A;  2IZV B;  2AEH A;  2MHJ A;  1JRU A;  3L13 A;  4MGY E;  2K8B A;  3C8Y A;  1Y56 A;  3PPA A;  3RI7 C;  2DAJ A;  1I4G A;  4BOZ B;  4KX6 B;  4WAF A;  3AMZ A;  4BBN F;  2NPT B;  4FBJ B;  1C4C A;  2INN E;  3U2S C;  2MBB B;  1WI0 A;  2DBY A;  2KQS A;  2PVG C;  1V5T A;  2OOB B;  3CWI A;  2V3S A;  3H7P B;  5D3D A;  3EUB 2;  4M8M A;  2FID A;  3VH3 B;  2LVQ A;  2M0A A;  4HLE A;  3CF6 E;  3VR9 B;  4ANV A;  4F8C B;  2BS2 B;  3MC8 A;  1V86 A;  3ZTC A;  4FN2 A;  1WR1 A;  2R2O A;  1QF6 A;  3DBL B;  3ZTD A;  1JRO A;  2XNA C;  4AWJ A;  2WDT B;  2WXM A;  2FIF A;  2N9E B;  4WUR A;  5EE9 A;  4M02 A;  1TS3 A;  1D5M C;  4LK0 M;  4IWP A;  5IO9 A;  5HKH A;  4C7Y A;  4H2A A;  1QOA A;  3CSF A;  3AE2 B;  3VTW A;  1H8C A;  1V1O A;  3B08 A;  1VD2 A;  1EU3 A;  1YQ4 B;  2PPH A;  1QKZ A;  2WP9 B;  2J0M A;  5EE3 A;  3VDZ A;  2D07 B;  2N9L A;  2BKR B;  2A4Z A;  2CHX A;  3RNC C;  3VRB B;  3AUL A;  4NAW A;  3VVW B;  4NQK E;  4LJP B;  3J9C A;  1JWS D;  4MAC A;  2NPT A;  5IKC M;  1FRD A;  4M00 A;  2KTR B;  1C4P A;  3N1Y C;  2G3Q B;  4HJK A;  4W9K A;  3W1S A;  2LGS A;  2NMQ A;  2PE6 B;  3NVZ A;  4XDD A;  3KWL A;  1V97 A;  3P4R B;  4MM3 B;  3SU8 X;  1N60 A;  2G9H D;  1T3Q A;  2LXC A;  3V61 A;  1I4X A;  4DHJ B;  1FNW A;  2LRW A;  3MHZ A;  1VLB A;  3PHW B;  1ZW7 A;  1QLB B;  1F9J A;  3A1Q A;  2CR5 A;  4NZL B;  2VZK B;  1GC6 A;  5C23 A;  4G3X B;  4E74 A;  3P4Q B;  4YTN B;  1XXG A;  3N1Z C;  1NI3 A;  1XLO A;  1FMA D;  1PYW D;  3RNF C;  1RWS A;  4ASW C;  1WXM A;  3CIR B;  2V4L A;  1J7A A;  2N0S B;  1VDV A;  3VTU A;  1PFD A;  4HJG E;  5EDS A;  1J0G A;  4NJC A;  3C0R B;  4RGO S;  2D2Q A;  1JWA D;  5HFY A;  2X38 A;  2G4S A;  2KC1 A;  2QEJ C;  1STE A;  2Z0D B;  1WGY A;  2WXG A;  1WH3 A;  1NI2 A;  3VHT C;  3ZJU A;  2LI5 A;  4WJQ A;  3KVF B;  3WIM A;  3ZYY X;  1N5X A;  1ZUD 2;  3DHG C;  2FCN A;  4MEM A;  1WYW B;  5G5H A;  2KMM A;  3H6N A;  3R7Q A;  2JXT A;  2BBC A;  4EZJ A;  3PV1 A;  1VRA B;  2B76 B;  2WXR A;  4OVZ A;  2WXH A;  3PHX B;  1DGJ A;  3MFG A;  1EWC A;  1GG3 A;  2KJR A;  4XE0 A;  1P7E A;  3ZKJ C;  2BYV E;  3NVW A;  3U30 A;  1E0Z A;  3JYU A;  2GRI A;  2KN5 A;  4W9I A;  3PZ8 A;  1T6B X;  1I4H A;  1P9D U;  1SJE D;  3UF8 A;  1HTO A;  3APD A;  1SF0 A;  2KDI A;  1I7H A;  2BB6 A;  2N9P C;  2M0X A;  5HHD G;  4AP4 C;  4NAW B;  4URK A;  1KLG D;  2MBO A;  3ML9 A;  1HE8 A;  2Y5P A;  1ENF A;  1UH6 A;  3QAQ A;  3U8Z A;  2L05 A;  2RSU A;  1IBX B;  2DWQ A;  4DXA B;  1CMX B;  5E6P A;  1P1A A;  2Y3A A;  3UIO B;  2ONQ A;  2GBR A;  3DVG X;  1ZGU B;  2D3B A;  2K22 A;  1GJZ A;  3ALB A;  2QIL A;  1EO6 A;  2LRU A;  5I4D A;  2KVR A;  2K0P A;  4EKU A;  1AAR A;  3QA8 A;  3AV8 A;  4LJO B;  4MGZ E;  2FUG 1;  3APC A;  1YN5 A;  3PS6 A;  2D10 A;  4YXD B;  3DWM A;  4B6W A;  3IFW B;  2KFJ A;  2BQQ A;  4RF1 A;  2DHZ A;  4W9F A;  5G5G A;  2ZJD A;  4PK1 A;  1ZE3 D;  4BVU C;  3ZJT A;  4AS1 A;  1HA5 A;  3LXF A;  1TS4 A;  4BZA A;  1C76 A;  2ZNV B;  1D4B A;  1AWD A;  3GZN I;  1Y8R C;  2JWU A;  2QSD A;  2HTM E;  3A1Q B;  4PS7 A;  3ZRC A;  2BS4 B;  5C2T B;  2XEW A;  1JQ4 A;  1D5X C;  1SE3 A;  4P7I A;  5BMH A;  2DYB A;  4ICV A;  4IG7 B;  2VH2 A;  2C7N B;  3MJ5 A;  5JHB A;  3QCA A;  4FLH A;  2ASQ A;  2KXJ A;  1C77 A;  3N1X C;  1WJN A;  1FRR A;  1YQB A;  2KDF B;  1YN3 A;  1YX5 B;  4AJY B;  3KYC D;  1F0Z A;  1YJJ A;  2RDG A;  5AZH A;  3SEB A;  2W3S A;  2MJD A;  3PZD A;  3BWU D;  5D6J B;  2DZM A;  1UGJ A;  2WWZ A;  1TYG B;  2NBU A;  3AEC B;  3W5U B;  2YVC A;  1E7P B;  4KV2 A;  2KAJ A;  2KAC A;  2MBQ A;  1NVI D;  4OVV A;  3I57 A;  1N61 A;  1WSP A;  2H88 B;  2UU7 A;  2LUM A;  2N4F A;  1JRP A;  4FJZ A;  1EM7 A;  1QOF A;  1SGH A;  3KUC B;  4FAD A;  1UEL A;  3DQV A;  4LCD E;  4MSM B;  3EGR A;  1N5W A;  3DBR I;  3V6E B;  3AEA B;  1OEY J;  1UBQ A;  3FC4 A;  1SJH D;  1UD7 A;  4W9E A;  2FBW B;  4KZC A;  2WDV B;  4MH0 E;  3ZGZ A;  3HIZ A;  2DZK A;  2N7E A;  5HG2 A;  1Q10 A;  1YN4 A;  2BWF A;  2O6V D;  3MC9 A;  4KGT A;  1JML A;  2IGH A;  4HPM B;  2BPS A;  1KH0 A;  5EE0 A;  2D3G A;  2LHE A;  5HI1 A;  3DOW A;  3P2B A;  2ZW1 A;  2CU3 A;  3Q3J A;  4X57 B;  2KT7 A;  4DK5 A;  3VUY A;  1V6E A;  5FK9 C;  4RF0 A;  1FFU A;  3BK1 A;  2CHZ A;  3R8B A;  2LJI A;  2I1K A;  1K8R B;  1XT9 B;  4HDO A;  1KFY B;  1TKE A;  4DHJ D;  4TQ1 A;  2LJ5 A;  3E56 A;  2I38 A;  3RFZ B;  3M62 B;  1L5P A;  1OQY A;  3TIX A;  1SEB D;  4NQL B;  3WAO A;  3AED B;  3ZJV A;  4KKI A;  1RFA A;  3UQA A;  4P16 A;  4K3B A;  3ZDM C;  1NEK B;  2JPH A;  2ZW0 A;  3SHQ A;  4GN1 A;  3IVF A;  1YIW A;  3BII D;  4GDL A;  3TEX A;  4EFO A;  5GXG B;  4IW0 A;  3KWV A;  2KZR A;  1MPE A;  3WAP A;  1AW7 A;  3A4S C;  4WWP A;  3ZXV A;  4JL9 A;  2BGF A;  1ET6 A;  4BKT A;  2IJ0 A;  1L0Y B;  3RUI B;  1Z5S B;  4ARI A;  1WXQ A;  2C60 A;  1F2R I;  1UNS A;  2PJH A;  3AE9 B;  4XWW A;  1L0V B;  3IHP C;  2SAK A;  3BYT B;  2WYQ A;  3LB8 C;  4ZRP A;  1N63 A;  2KN4 A;  1WRD B;  1TJE A;  1ZXI A;  3DVN U;  1HXY D;  4IM0 A;  5CHW A;  1I4P A;  4TKN A;  4F7Z A;  2CU1 A;  4NAM A;  1HZ6 A;  2BYE A;  3AH7 A;  3ZDT A;  4LDT D;  3W2D A;  4RNA A;  4W9G A;  2N7J A;  4HWI B;  3Q3F A;  4OHJ A;  2L83 A;  2O6V A;  2KQ4 X;  2XN9 C;  1L2N A;  4II3 B;  4J6I A;  3RZF A;  3WCQ A;  1JWM D;  3IT6 B;  3AEE B;  2M19 A;  3NJT A;  2IO2 B;  2KK8 A;  2WXJ A;  2WXK A;  1ET9 A;  1Z2M A;  3DVN V;  4ZYN A;  2DYO A;  2WX1 A;  1JWB D;  2QIE B;  1FD6 A;  4A9A A;  4ZRQ A;  2L1A A;  4XX5 A;  3QHT A;  3KH0 A;  2R61 A;  3AXC A;  3RN9 C;  2NBV B;  3Q8E A;  4WIP A;  3BZD B;  3OWE B;  1TTN A;  2Y5C A;  3BVG A;  1TS5 A;  3O65 B;  1MG8 A;  3Q2A C;  1V9J A;  2N1W A;  2OED A;  1YJI A;  3LJ3 A;  2KMA A;  2EKE C;  2MBE A;  2HJ8 A;  2AX5 A;  2J7Q B;  5IOI A;  5EE1 A;  1GB4 A;  2REX A;  3I9V 1;  4ANW A;  2IY1 B;  1WX8 A;  3H7S A;  1RFK A;  2K5P A;  2INC C;  4EOY A;  4HKQ A;  3SR6 A;  1K50 A;  2KLC A;  2L8J A;  3B2G A;  5AUI A;  1HTQ A;  1JAL A;  1RLF A;  1FNU A;  4MH8 A;  1IGC A;  4HK2 A;  1WIA A;  4L23 A;  1PGA A;  1OQQ A;  5J2R A;  4GLS C;  1SE2 A;  2VZK D;  2EMT A;  1YNT E;  2NS5 A;  2UYZ B;  2YLM A;  1YJ1 A;  3GE3 C;  2JX5 A;  3HVD A;  1L4Z B;  2NCN A;  3TEY A;  4YTM B;  3ML8 A;  4JWS C;  3P42 A;  4CO7 A;  4A3P A;  1V1P A;  4XZ4 A;  2WS3 B;  2LAS A;  1VJK A;  3D32 A;  2IO1 B;  1OEY A;  2QMT A;  1WY8 A;  3IXS A;  1IBX A;  4HCN B;  2ZPN A;  1C78 A;  1J19 A;  4DXF A;  3RMK C;  5JH5 C;  1XO3 A;  3JSV B;  3GOE A;  2ZCC A;  4G0N B;  3A9J A;  3I3T B;  2RD0 A;  3X23 A;  2UWQ A;  3L0W B;  1E8Y A;  2BB5 A;  1WFY A;  3ZQ4 A;  3H1U A;  4CYE A;  3L4P A;  4HPP A;  4TMA B;  3DVG Y;  2A5U A;  2IBI B;  5TR5 A;  3TBL D;  2GBJ A;  4QAY A;  3U4E G;  4GU2 A;  2ICI A;  5DPR A;  1PGB A;  1WX7 A;  2Q5W D;  3UIN B;  1GB1 A;  1C4A A;  4BFR A;  3IG3 A;  5LNK 1;  2BS3 B;  3A4R A;  2KQ7 A;  4RGM A;  3Q69 A;  2KMC A;  3PO0 A;  1L4D B;  4GDL B;  1WZ0 A;  1TT5 B;  2V3N A;  1TKG A;  2W55 A;  1GC7 A;  2DNF A;  1XLN A;  2WDQ B;  5LXI B;  2O6V B;  3ZXR A;  4Q2J A;  3ECI A;  4IM3 A;  3DHH C;  4DDI D;  2B3A A;  2WHI A;  4CHK A;  5D2M B;  4FHJ A;  2NBW B;  2MRP A; 
#chains in the Genus database with same CATH homology
 4PS8 A;  1KLV A;  5JHB A;  3QCA A;  4FLH A;  5GMV A;  5DPT A;  2ASQ A;  4KZ0 A;  2KXJ A;  1J8C A;  1XD3 B;  2LGX A;  2K6Q A;  1RAX A;  1WJN A;  3V62 A;  2KWC A;  2M17 A;  1YQB A;  1LFD A;  3DBL I;  2CS4 A;  3BY4 B;  3TJP A;  1XQQ A;  2KDF B;  4HCP B;  1E8X A;  1YX5 B;  4AJY B;  3KYC D;  3DCG A;  5AZH A;  2ZZP B;  1V81 A;  2G4D B;  4G11 A;  4BKS A;  4RM8 A;  1KM7 A;  3V60 A;  3PZD A;  5D6J B;  4DWF A;  1WM3 A;  2DZM A;  4II2 B;  2L00 B;  3NS8 A;  3PRP B;  3NY5 A;  2WWZ A;  4DHZ E;  2NBU A;  1NDD A;  1V49 A;  2J0K A;  3QC8 B;  4TQ0 A;  2YVC A;  4E71 A;  5JZE B;  1TZ1 A;  4KV2 A;  4MJS A;  2MBQ A;  2KC2 A;  4NPN A;  3R3M A;  2C7N B;  2ZNV C;  3WAN A;  4FJY A;  1WF9 A;  1LM8 B;  2K39 A;  3ZVV A;  4I6P A;  3ZLZ A;  3W1S C;  4OVV A;  1GUA B;  3OLM D;  1QZE A;  3OAW A;  4GDK A;  1ZKH A;  4BOS C;  3A9K B;  1NBF C;  2I1J A;  1OGW A;  3ZNH B;  4F1S A;  1H4R A;  2N4F A;  2MA9 B;  3HM3 A;  2DEN B;  4FJZ A;  1P0R A;  5CHF A;  2VRR B;  2O2V B;  1SGH A;  2L7R A;  1Q5W B;  2L0F A;  2AL3 A;  3APF A;  3KUC B;  4FAD A;  2MX2 A;  1UEL A;  1V2Y A;  2BYF A;  3DQV A;  4MSQ B;  4W9L A;  5AZF A;  4GDK B;  4G50 A;  4LCD E;  4KDI C;  4MSM B;  2ZEQ A;  4WQO B;  3DBR I;  1WMH B;  3V6E B;  1V80 A;  3QIJ A;  4NJ7 A;  4GSW A;  1WGG A;  1OEY J;  2J0J A;  1UBQ A;  1SE9 A;  4IUM B;  3VAW A;  1IYF A;  4M8N A;  4KSK C;  1WM2 A;  2KLG A;  2N1V A;  3TMP B;  1E5W A;  2W9N A;  3H9D A;  2C7H A;  4PYU A;  1I35 A;  5C1Z A;  4DBG A;  2FUH B;  3RYT A;  2K8H A;  1TGZ B;  1UZX B;  2CHW A;  1E90 A;  1UD7 A;  2FCS A;  3JSV A;  2KX0 A;  4W9E A;  2JRH A;  4WWO A;  5FR6 A;  1WGR A;  3ZW3 A;  4KZC A;  1WZ3 A;  4MH0 E;  4M0W B;  3AI5 A;  3HIZ A;  2MCN B;  2DZK A;  2N7E A;  1U4A A;  1E8W A;  1V5O A;  2BWF A;  2NVU I;  2O6V D;  2GBM A;  5KHO A;  1WX9 A;  4EEW A;  5J18 A;  4HPM B;  2BPS A;  1C1Y B;  1TBE A;  1WMH A;  3EC8 A;  4KDL B;  4PYZ A;  3R7R A;  3QAR A;  4A20 A;  2D3G A;  1KOT A;  5L95 C;  3DOW A;  4WJN A;  3P2B A;  1KJT A;  1R4N I;  3Q3J A;  4X57 B;  3L17 A;  2Z59 B;  5CTR C;  4JLC A;  2KKC A;  3ZRF A;  2FCQ A;  4DK5 A;  2C7M B;  4NY0 A;  3UIP B;  3VUY A;  3B1L X;  2L0T A;  3VH4 B;  1V6E A;  2IZV B;  2AEH A;  1JRU A;  2CHZ A;  2JZ3 B;  3L13 A;  4MGY E;  2K8B A;  4MM3 A;  1M94 A;  2K6D B;  3OJ3 A;  2DAF A;  4IWO A;  4MDK E;  2C5L C;  2I1K A;  3PPA A;  3PTF C;  4GMV A;  3SDL C;  3N30 A;  2DAJ A;  4ICU A;  4BKG A;  4BOZ B;  1K8R B;  1IPG A;  4I6L B;  1XT9 B;  2M4N A;  4BBN F;  4HDO A;  2BKF A;  2NPT B;  4KVG B;  4FBJ B;  4DHJ D;  3M63 B;  2MBB B;  4K7U A;  1WI0 A;  3A9J B;  4TQ1 A;  2LJ5 A;  3W1Y A;  2KQS A;  4ZDV A;  1V5T A;  2OOB B;  4B9K A;  2MP2 B;  3ZIM A;  2V3S A;  3H7P B;  3M62 B;  1OQY A;  5IAA C;  2EMS A;  3VFK A;  3L54 A;  3L16 A;  2HD5 B;  4M8M A;  3TIX A;  2FID A;  3VH3 B;  2LVQ A;  4NQL B;  4ANX A;  2KDE B;  3WAO A;  3L08 A;  4OVU A;  1BT0 A;  5DCN A;  3N3K B;  2DX5 B;  4HLE A;  5AEK B;  3CF6 E;  4ANV A;  1RFA A;  2JF5 A;  3UQA A;  5IA7 A;  4F8C B;  2KFK A;  3V6C B;  2JVC A;  1V86 A;  3ZTC A;  4FN2 A;  3ZDM C;  1P3Q U;  3K9O B;  2LVO A;  4HVB A;  1WR1 A;  1S1Q B;  2CKH B;  2PEA A;  2R2O A;  2WX0 A;  2JPH A;  3CST A;  3ZTD A;  3RD2 A;  2GMI C;  4AWJ A;  2WDT B;  2FIF A;  2N9E B;  2HTH A;  3SHQ A;  1S3S G;  3JVZ X;  3WAM A;  4GN1 A;  2O2V A;  2N9X A;  4IWP A;  3IVF A;  1YIW A;  5HKH A;  2KFK B;  3NZU A;  4KSL C;  4KIK A;  3SD5 A;  4NJ6 A;  4GDL A;  4EFO A;  1R4M I;  3CSF A;  2L76 A;  3A9K A;  4ZRJ A;  3PSE B;  1G6J A;  3VTW A;  1H8C A;  4IW0 A;  4I6N B;  3B08 A;  4GGQ A;  1VD2 A;  3PGE A;  2KZR A;  2GBK A;  2KOX A;  2PPH A;  3A4S C;  4K7S A;  4WWP A;  3WAP A;  4JL9 A;  2BGF A;  4BKT A;  3T8M A;  2J0M A;  3VDZ A;  1WJ6 A;  2D07 B;  1WXS A;  1Z5S B;  3RUI B;  5LXH A;  2C60 A;  2BKR B;  2A4Z A;  3VQI A;  2CHX A;  2N7D A;  3AUL A;  3VXW A;  4NAW A;  3QK0 A;  1E8Z A;  2PJH A;  3VVW B;  4NQK E;  1WJ4 A;  4LJP B;  1WXV A;  1UBI A;  5CX3 A;  2NPT A;  3IHP C;  2KHW B;  4ZRI A;  2KTR B;  2WYQ A;  5CHV C;  2G3Q B;  4HJK A;  3TCA A;  1WRD B;  2HE7 A;  4W9K A;  2FNJ B;  1D3Z A;  3W1S A;  2V1Y A;  4XC2 A;  3DVN U;  4A3O A;  2PE6 B;  2NR2 A;  4IM0 A;  2LUE A;  4HPL B;  5CHW A;  4TKN A;  4F7Z A;  3SU8 X;  4DHZ B;  2CU1 A;  2LGY A;  1EF5 A;  1P98 A;  2XBB C;  3PLV A;  2ZCB A;  5BO4 B;  2KDB A;  3T9L A;  2BYE A;  4AOF A;  2LXC A;  3V61 A;  2RPQ A;  4K1R B;  2D11 A;  4LDT D;  3ZDT A;  4EZK A;  4W9G A;  4DHJ B;  2LXA A;  4HWI B;  3B0A A;  2LRW A;  3ZNZ B;  2KJH B;  3Q3F A;  5G2N A;  3VTV A;  1E7V A;  2JT4 B;  2O6V A;  3PHW B;  1ZW7 A;  2KNB A;  1F9J A;  3A1Q A;  1L2N A;  2CR5 A;  4II3 B;  3X0W A;  4J6I A;  3RZF A;  1GC6 A;  3LDZ E;  4GIV A;  2KTR A;  5C23 A;  4W9C A;  4G3X B;  4E74 A;  3DBS A;  2MP2 A;  2M1M A;  2IO2 B;  2KK8 A;  3VUX A;  2IY0 B;  5JHA A;  1Z2M A;  2KWU B;  3DVN V;  2ZVO A;  4BBN C;  4DDG D;  5AZG A;  4ZYN A;  5KHQ A;  3KW5 B;  2DYO A;  1WGH A;  2WX1 A;  1FXT B;  5DPS A;  4ASW C;  4XX5 A;  1WXM A;  2IYD B;  2MQJ A;  2V4L A;  2RR9 A;  3QHT A;  3KH0 A;  3DBH I;  3VTU A;  3AXC A;  2K25 A;  5EDS A;  2NBV B;  1J0G A;  3C0R B;  2D2Q A;  3L10 B;  1TTN A;  4HDQ A;  2G4S A;  4W9D A;  2KC1 A;  2LWP A;  3O65 B;  1PQS A;  1MG8 A;  1WXA A;  3EFU A;  3PLU A;  1WE7 A;  2Z0D B;  1V9J A;  3A33 B;  4TV3 A;  3RZW C;  2ZPY A;  2N1W A;  1WGY A;  3LJ3 A;  1WH3 A;  2EKE C;  1NI2 A;  2JWZ A;  2KMA A;  2MBE A;  2HJ8 A;  2J7Q B;  2LD9 A;  3HHM A;  3K9P B;  3VHT C;  4MEL A;  2LI5 A;  3PRZ A;  4GOC A;  4AUQ C;  4ZRK A;  2REX A;  4WJQ A;  3CMM B;  1A5R A;  4YL8 A;  3KVF B;  1GNU A;  3WIM A;  2RGF A;  2Y5B B;  4ANW A;  2IY1 B;  1WX8 A;  3H7S A;  2FCN A;  2MWS B;  4MEM A;  1WYW B;  3AU4 A;  4EOY A;  1L7Y A;  3H6N A;  3R7Q A;  4FJV B;  2KLC A;  2KWV B;  2L8J A;  3ONS A;  4EZJ A;  3PV1 A;  4WJO A;  4E3C A;  4EUT A;  1LQB A;  4GB9 A;  3UQB A;  3QWZ B;  2JZZ A;  2L3Z A;  1WJU A;  2BWE S;  3RT3 B;  1I42 A;  3PHX B;  1WGD A;  4FUL A;  4GXB A;  1RLF A;  4RM9 A;  4WAA A;  3OJ4 B;  4HK2 A;  1UGM A;  1GG3 A;  2BF8 B;  2KJR A;  2JXX A;  1WIA A;  3U7D A;  3JW0 X;  2KD0 A;  4IWQ A;  3ZKJ C;  2BYV E;  4RMA A;  3UGB B;  2M8S A;  2C9W B;  3U30 A;  5DPW A;  3JYU A;  3KYD D;  1EF1 A;  2JUO A;  5J2R A;  2K1F A;  2KN5 A;  2KX3 A;  2XK5 A;  4WJP A;  1X1M A;  1YX6 B;  2R2Q A;  2ZVN A;  3RCZ A;  4B95 A;  3WAL A;  4W9I A;  2KAN A;  4LDT B;  4ANU A;  2KO3 A;  2EMT A;  3QJZ A;  1Q1O A;  2AL6 A;  2NS5 A;  2UYZ B;  2YLM A;  1P9D U;  2AWT A;  1YJ1 A;  4MJS B;  3RUL A;  4W9H A;  2G45 B;  4FA6 A;  2NCN A;  3UF8 A;  3APD A;  2JRI B;  3ML8 A;  3M95 A;  2KDI A;  5E6O A;  2N9P C;  2M0X A;  4CO7 A;  4A3P A;  2QHO A;  1T0Y A;  4NAW B;  2LAS A;  4XZ4 A;  4AP4 C;  4URK A;  3EHV A;  3EEC A;  1YD8 U;  3IBE A;  4EZL A;  3AU5 A;  2MBO A;  3ML9 A;  3D32 A;  1HE8 A;  2IO1 B;  1OEY A;  1WY8 A;  4MGK E;  4HCN B;  2ZPN A;  3PVL A;  2LGD A;  1UH6 A;  3QAQ A;  2AYO B;  4IM2 A;  3ZUN A;  4N9F 4;  5G55 A;  3U8Z A;  1LXD A;  5D7G A;  2DYM A;  2L05 A;  2RSU A;  1C3T A;  1J19 A;  2MLB A;  1EUV B;  2PE9 A;  5JH5 C;  1VCB A;  2GOW A;  4DXA B;  1CMX B;  3JSV B;  3GOE A;  5E6P A;  2ZCC A;  4G0N B;  1P1A A;  3A9J A;  3I3T B;  3R66 C;  3UIO B;  2GBR A;  3DVG X;  1ZGU B;  2RD0 A;  4K81 A;  1WE6 A;  3X23 A;  2UWQ A;  3L0W B;  3BIN A;  1GJZ A;  2OJR A;  2IO0 B;  3ALB A;  1E8Y A;  1EO6 A;  2KJ6 A;  2LRU A;  4IC7 B;  3KUZ A;  2KVR A;  3NZS A;  4MGI E;  1WFY A;  1Q0W B;  4EKU A;  3MJW A;  4WWN A;  2MW5 A;  4JIO U;  1AAR A;  2DZJ A;  1SIF A;  3QA8 A;  3MHS D;  4LJO B;  2XK5 B;  3S2A A;  4K7W A;  3ENE A;  3HK0 A;  2MBH A;  4W9J A;  3H1U A;  4CYE A;  4MGZ E;  2IO3 B;  3NOB A;  3VUW A;  2GBN A;  3DVG Y;  4JQW C;  2A5U A;  2IBI B;  5LLI A;  5TR5 A;  2GBJ A;  3TBL D;  3ZNG C;  2DZI A;  3PRE A;  3APC A;  4GU2 A;  4JGH B;  3NHE B;  3PS6 A;  5DPR A;  3QQ8 B;  2D10 A;  3QX1 A;  1OTR B;  1WX7 A;  4B6W A;  3IFW B;  3UIN B;  4PS3 A;  5L83 A;  2KFJ A;  5D94 A;  3HM6 X;  4BFR A;  2DHZ A;  4W9F A;  3IG3 A;  2ZJD A;  3DDC B;  3A4R A;  3MTN B;  3PRM B;  3ZO5 B;  2KQ7 A;  4FHK A;  2FAZ A;  2K8C A;  2LVP A;  3M3J A;  3H7P A;  4HXD A;  3DPD A;  2KMC A;  4TUU A;  4AJW A;  4BVU C;  2JY6 A;  2FCM A;  4GDL B;  1E7U A;  2MSE D;  1WZ0 A;  4KIK B;  5J17 A;  3N32 A;  2ZNV B;  1GC7 A;  3GZN I;  1Y8R C;  1ISN A;  3ZNI D;  3WA0 A;  3KUD B;  5E6N A;  3A1Q B;  2Z0E B;  4PS7 A;  4NNJ B;  3ZRC A;  5LXI B;  2KTF A;  2O6V B;  2XEW A;  3TL5 A;  3ECI A;  1WR6 E;  4IM3 A;  3PT2 B;  4P7I A;  4BKS D;  1RRB A;  1IP9 A;  4DDI D;  2DYB A;  2LZ6 A;  2B3A A;  4CHK A;  4ICV A;  4IG7 B;  5D2M B;  4FHJ A;  2NBW B;  2MRP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...