1WXVA

Solution structure of the ubiquitin domain of bcl-2 binding athanogene-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG-family molecular chaperone regulator-1
publication title Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxvA01
1WX9A 5AZFA 2FUHB 3WAOA 4EZLA 2L7RA 1E5WA 2N1WA 2O2VA 3RZWC 2N9XA 2LI5A 4AOFA 1R4NI 1EUVB 2JZ3B 2KMAA 1V5OA 1UBQA 3PRPB 2DENB 1E90A 3H7PA 2BYVE 4EZKA 4II2B 3VVWB 2XK5B 1E7UA 3U7DA 1V86A 2GBMA 2PE6B 4GGQA 4FBJB 2L3ZA 2MP2A 2G4DB 4ICUA 4IG7B 4EEWA 3L54A 1WRDB 3QCAA 3DVNV 1EO6A 2O6VA 3MJWA 3QHTA 4FULA 1P3QU 2XBBC 1GUAB 1UBIA 4E71A 2LJ5A 2MBEA 4IW0A 2YVCA 1WR1A 4GDLA 4WJOA 2WWZA 4W9GA 2K25A 1PQSA 4JQWC 4KDLB 4G50A 3ZNID 4EFOA 1WM3A 2DZKA 3AU5A 2MBQA 4TQ1A 4GMVA 2N7EA 3DQVA 3LDZE 2NVUI 1GC7A 2DYBA 2HE7A 2JWZA 3O65B 3QWZB 3M95A 4MGYE 3ZNZB 5J17A 3A9JB 2WDTB 1WGGA 4XX5A 1FXTB 3V6EB 3ZRFA 4PS3A 3ZW3A 3DPDA 3N3KB 3JVZX 1K8RB 2N4FA 4W9JA 1EF5A 1V49A 1WF9A 2KWVB 1Z5SB 4WJPA 5GMVA 1I42A 3HM3A 3L17A 4JLCA 1ZW7A 3VUWA 2DZMA 3S2AA 3MHSD 4P7IA 3KUZA 3APDA 4HDOA 5DPWA 4LJPB 4NJ7A 2FAZA 3R7QA 3VUXA 4B6WA 4F8CB 1HE8A 1WMHA 3A4SC 2O6VD 1VD2A 3HHMA 3ML8A 3OJ3A 4M8MA 3B0AA 4KVGB 1V81A 2IY1B 3PV1A 4IUMB 3KVFB 2DZJA 1UELA 2KTRB 3QQ8B 3U8ZA 1C3TA 1TBEA 4NPNA 2CKHB 4BOSC 4DWFA 4WJNA 3W1YA 4KZCA 5J18A 3DBLI 3NHEB 2O2VB 2IO2B 2V1YA 2LGYA 4MGKE 4EOYA 2XEWA 3IG3A 1Q5WB 2D10A 3NZUA 2ZPYA 4MGZE 2NPTA 3R3MA 3Q3JA 3H7PB 2OOBB 2JT4B 4WWPA 3QAQA 2J7QB 2V3SA 2GBKA 3EHVA 2ZJDA 3DOWA 2KC2A 2KWCA 4BFRA 4OVUA 2B3AA 3DBRI 3OAWA 2MP2B 3KUCB 4K7SA 2K6DB 4GB9A 5JZEB 2NS5A 5LXIB 4HK2A 2O6VB 1WGYA 2G3QB 3AI5A 4K1RB 1L7YA 4MEMA 5AEKB 2CU1A 4GDLB 4ANUA 3QA8A 4HCPB 3N30A 4NY0A 5CHFA 3X23A 2L0TA 3ZTCA 1S1QB 2N7DA 1C1YB 1UD7A 2AEHA 3DBSA 1WJNA 1YD8U 2A5UA 2LVPA 2N9EB 4AP4C 4ZDVA 3ZRCA 5JH5C 4MDKE 2KWUB 1H8CA 2AWTA 1VCBA 2KXJA 1OEYA 1WXMA 4RMAA 4IWQA 2BWFA 1UGMA 1WX7A 5E6PA 4GSWA 4DHZB 4HPLB 3VH3B 2GBNA 1LQBA 3T8MA 3WALA 1IP9A 2KDFB 1D3ZA 1WYWB 2CHZA 1WXVA 4HPMB 4MM3A 3SDLC 4I6PA 3R66C 4K7WA 4KIKA 3MTNB 1YJ1A 3HK0A 3VAWA 2K8BA 1WMHB 2D3GA 2G4SA 2Y5BB 3LJ3A 2FCQA 2LVOA 5D7GA 4JL9A 4BBNF 4LJOB 2LRUA 5E6NA 3U30A 2I1JA 3TMPB 4DDID 1Q0WB 4AJWA 2WYQA 3DVGY 2BKFA 2J0JA 2KN5A 2IY0B 3PSEB 2HD5B 2LXAA 3VQIA 4TUUA 4F7ZA 1JRUA 3VTVA 3OLMD 4GDKA 4LDTD 4FLHA 2R2QA 4AUQC 3DVGX 1WE7A 2AL6A 1GG3A 2KFJA 2K8CA 3PTFC 2FIFA 4HLEA 2NBVB 3ML9A 4KSKC 2M1MA 2HJ8A 2NPTB 4TKNA 2LASA 4BVUC 2DYOA 3KW5B 3TJPA 4HVBA 1R4MI 3GOEA 4IWOA 4E3CA 2CR5A 3A1QA 4NQKE 2NCNA 4ASWC 3AXCA 2MW5A 3KYCD 1I35A 3RULA 1ZGUB 2RR9A 1M94A 1SE9A 1WI0A 2KK8A 3RD2A 1KLVA 1EF1A 2ZVNA 3ZDMC 4F1SA 2BWES 2JVCA 4A3PA 4I6NB 1P0RA 3ZO5B 1QZEA 3PRZA 2J0MA 2CS4A 2MQJA 1RAXA 2EKEC 2KVRA 3V60A 2RSUA 2MRPA 2PJHA 4FHKA 4GOCA 4HWIB 1P9DU 2REXA 2DYMA 4M0WB 5D6JB 3WA0A 2M0XA 2IO1B 4HJKA 1WFYA 3PREA 4AJYB 4IC7B 2EMTA 2JZZA 4ZRKA 2L05A 2ZPNA 3TIXA 5LXHA 2C7NB 2Z59B 3RCZA 2DX5B 1G6JA 5CHVC 3WAMA 3QK0A 1NBFC 3CF6E 3APFA 3NS8A 2KFKA 2L8JA 2R2OA 4WWNA 4MSMB 3UINB 3RZFA 4W9HA 1Q1OA 2LWPA 3JSVA 4KIKB 4ZRIA 5IA7A 1LM8B 2JF5A 4M8NA 1L2NA 5E6OA 2C7MB 2KJRA 5D2MB 3A33B 1X1MA 2OJRA 3DDCB 4YL8A 3VFKA 4KZ0A 1WM2A 4B95A 1U4AA 4CHKA 4EZJA 3EECA 2L76A 4NQLB 1E8ZA 4DHJD 1SGHA 3BINA 3KYDD 5CX3A 3VTUA 2KX0A 3ZLZA 2J0KA 1GC6A 3VDZA 3WANA 2WX1A 3IHPC 2G45B 2KMCA 4MSQB 1ISNA 4FHJA 4KDIC 2RPQA 4XC2A 4K7UA 4GDKB 4DHZE 3B1LX 3JW0X 5KHQA 1E7VA 1OTRB 3I3TB 1J0GA 2MBHA 1Y8RC 2K1FA 3L13A 2DHZA 5J2RA 1UZXB 3DBHI 2JUOA 1T0YA 3TL5A 1YQBA 4JGHB 4G11A 3A1QB 1H4RA 3SHQA 1Z2MA 4N9F4 1RLFA 3L10B 3OJ4B 5G55A 1KJTA 2LRWA 4ICVA 3UQBA 1V2YA 3ZIMA 2CHWA 5BO4B 2BYEA 2LUEA 2LGXA 5DPTA 2ZNVC 3W1SC 1WR6E 1WJUA 5D94A 4HXDA 1AARA 3HIZA 3SU8X 3V6CB 4DDGD 2MSED 2UYZB 4CO7A 2FCMA 4DXAB 2KOXA 4URKA 3QARA 2KJ6A 3DCGA 4WAAA 3TCAA 5CTRC 2KJHB 4A3OA 1WX8A 2YLMA 4GIVA 5JHBA 1UH6A 3TBLD 2MCNB 2NR2A 2C60A 2DAJA 3PLVA 3A9KA 3CSFA 3N32A 3EFUA 3M62B 3VUYA 2D2QA 2KFKB 3PPAA 1XQQA 4ZRJA 3ONSA 3VTWA 2NBWB 1WXSA 1NDDA 4FA6A 3H1UA 3JSVB 3NOBA 2IO3B 4TV3A 5AZGA 3WAPA 1KM7A 4DK5A 1WH3A 2LGDA 2KDEB 1J8CA 1P98A 1OQYA 2LXCA 3CMMB 4FN2A 4RM9A 1V6EA 3QIJA 5TR5A 1OGWA 1WJ4A 4W9EA 2WX0A 3PT2B 4EUTA 1RRBA 4ANVA 4PYUA 3VH4B 3QX1A 4CYEA 1XT9B 3K9OB 4GXBA 2AYOB 1YX5B 4NAWA 4J6IA 1WGHA 2KANA 2M4NA 3V61A 4DBGA 4PS8A 2KLCA 1SIFA 4BKTA 4XZ4A 2PPHA 2UWQA 2W9NA 1TTNA 2MWSB 2L00B 3NY5A 1F9JA 1P1AA 3W1SA 4IWPA 1V80A 4II3B 4JIOU 2ZEQA 3KUDB 3EC8A 2Z0EB 4HCNB 2HTHA 3PZDA 1XD3B 2BGFA 4NJ6A 2KLGA 5KHOA 3RUIB 1WE6A 5L95C 2Z0DB 2AL3A 4LDTB 4BKSD 2K39A 2M8SA 5AZHA 5C23A 5DCNA 2LD9A 2D11A 1WJ6A 2I1KA 4MJSA 4WWOA 4GU2A 2D07B 2K8HA 2K6QA 4EKUA 4WJQA 5L83A 2KQ7A 4GN1A 2KTFA 3SD5A 3ZVVA 2BKRB 4IM2A 4TQ0A 3ZKJC 2V4LA 4KV2A 5CHWA 2KZRA 3PHWB 2GOWA 3A9KB 2M17A 4K81A 2DZIA 2C7HA 5C1ZA 3A4RA 2JXXA 3M3JA 1GJZA 3NZSA 2KHWB 4BBNC 2RGFA 2MA9B 2PEAA 2FNJB 3PVLA 4B9KA 1RFAA 2KO3A 3IBEA 3JYUA 4FJZA 4PYZA 4X57B 3UF8A 3GZNI 4A20A 1E8YA 4W9KA 2KX3A 2BF8B 4IM0A 3H7SA 4MELA 3UQAA 4W9CA 3X0WA 1OEYJ 2MBBB 1WXAA 3VHTC 2KDIA 3WIMA 1WZ3A 1YIWA 4ANWA 1WY8A 2GBRA 3K9PB 2FCNA 3DVNU 4NNJB 2IO0B 3L0WB 1V9JA 3M63B 2C5LC 4E74A 2BPSA 2N9PC 3PRMB 4W9FA 3ZNHB 3V62A 1WGRA 2KD0A 4MH0E 2ASQA 2VRRB 3QJZA 2ZVOA 2MLBA 2FIDA 4RM8A 3RT3B 5DPRA 2ZZPB 3B08A 1A5RA 1J19A 4NAWB 4G0NB 2KKCA 4G3XB 2XK5A 2JRHA 4W9LA 3ALBA 2KC1A 4OVVA 2A4ZA 2JPHA 3UIOB 4BKGA 3T9LA 4ANXA 2ZNVB 5G2NA 2FCSA 1WZ0A 2GBJA 2KNBA 3HM6X 4MGIE 5FR6A 1V5TA 4DHJB 3PHXB 3PS6A 1E8XA 1IYFA 4W9IA 3BY4B 1BT0A 4ZYNA 2ZCCA 2JRIB 1YX6B 1GNUA 2DAFA 2JY6A 3PLUA 1ZKHA 4IM3A 4WQOB 2EMSA 2KQSA 3IFWB 1NI2A 2NBUA 2N1VA 2MBOA 4KSLC 1TGZB 1E8WA 4HDQA 4PS7A 3KH0A 4MJSB 4FADA 3ZTDA 2IZVB 3R7RA 3L08A 3AU4A 5LLIA 1CMXB 2CHXA 3A9JA 3Q3FA 5IAAC 4FJYA 3P2BA 2LVQA 2MX2A 2PE9A 4BOZB 1KOTA 3D32A 4FJVB 5DPSA 2C9WB 3ZDTA 4W9DA 5HKHA 1LXDA 3L16A 1TZ1A 3PGEA 2LZ6A 1WGDA 3AULA 3H9DA 2IBIB 4AWJA 2RD0A 2KDBA 3VXWA 2L0FA 4I6LB 4LCDE 3ZNGC 5EDSA 4BKSA 1IPGA 3APCA 3RYTA 1WIAA 3UIPB 3UGBB 2QHOA 5JHAA 2GMIC 1LFDA 2BYFA 1S3SG 3ENEA 3H6NA 3QC8B 3ZUNA 2ZCBA 2KTRA 3CSTA 3ECIA 2IYDB 3C0RB 3IVFA 1MG8A
chains in the Genus database with same CATH superfamily
5AZFA 2L7RA 2N1WA 3RZWC 2N9XA 1EUVB 2JZ3B 1E90A 4II2B 5G5HA 2WU5B 2LEKA 2XK5B 1WRIA 1E7UA 1V86A 3HRDD 1I4QA 5D3IB 4EEWA 4FULA 1D5XC 2XBBC 4P6VF 1KRHA 1ROEA 4GDLA 1JMLA 2WWZA 1FD6A 1IUEA 2K25A 3AE8B 1PQSA 3PO0A 4JQWC 4G50A 4TQ1A 1J7CA 1B1ZA 1GC7A 1N61A 4OZCA 4MGYE 4ZHPA 1STEA 4XX5A 1FXTB 1MJDA 3V6EB 1VJKA 1K8RB 1Z5SB 1F2RI 1FFUA 4WJPA 4JLCA 4YTPB 4HDOA 4NJ7A 4B6WA 1HE8A 2O6VD 1VD2A 3OJ3A 2GB1A 4M8MA 2DZJA 3QQ8B 4XE0A 1TBEA 4DWFA 2CKHB 1SEBD 2V1YA 2WXQA 2XEWA 1XCTL 4RGMA 4MGZE 2NPTA 2WGSA 3R3MA 3H7PB 4IDIA 2J7QB 1XO3A 2ZJDA 2KC2A 2KWCA 2KVZA 4GB9A 3SFDB 1EU3A 2NS5A 2MH7A 2O6VB 1WGYA 3AI5A 1BUIC 1L7YA 4WAFA 1DGJA 3QA8A 1XF5L 1Q10A 3ZTCA 3Q8EA 4M0WA 3WCQA 4ZDVA 1JCKB 1OEYA 4LK0M 3RNCC 1C9FA 4DHZB 4HPLB 3VH3B 2CJOA 3Q8AA 3SDLC 4I6PA 4K7WA 1I4HA 1YJ1A 3Q6BA 1WMHB 2Y5BB 2VZKB 2LHEA 5E6JA 2LRUA 5E6NA 2WYQA 4KGRA 2J0JA 2IY0B 5FR3A 4J3OD 4KGSA 3P1MA 1PGXA 1JRUA 3OLMD 4LNFA 3EUB2 2NBVB 3ML9A 3N9YC 2HJ8A 3R2TA 1SXTA 3C19A 4HVBA 2JU6X 1R4MI 1RM6C 4ASWC 2HJ1A 3KYCD 2CU3A 3FILB 2BWES 1P0RA 1QZEA 3PRZA 1KTKA 4HJGE 2KVRA 4AQ7A 4FHKA 4GOCA 1P9DU 1FPYA 5D6JB 4A90A 2M0XA 3NJTA 2PVGC 2ZPNA 2SEBD 1G6JA 3V05A 4IKGA 2L8JA 3Q8CA 4MACA 3UINB 4ACFA 3I63C 1Q1OA 3JSVA 2W55A 4RF1A 1DOIA 3A33B 1HEZE 1U4AA 3EECA 4DHJD 3BINA 2PW9A 3ZLZA 1BMLC 1GC6A 3IHPC 4NAMA 4WURA 4KDIC 4GDKB 3B1LX 1OTRB 2N0SB 2DHZA 4ARCA 2JUOA 3A1QB 1Z2MA 3TEXA 1VRAB 3AB5A 3UQBA 3ZIMA 3RNEC 3N1XC 2YEPF 2KQ4X 5BO4B 2ZNVC 3W1SC 2HDEA 1JRPA 1K53A 3AM9A 1A70A 1F77A 5JHBA 3B2FA 3CSFA 4WIPA 2L52A 2ACZB 3VUYA 4YXDB 3ZJVA 1TYGB 2WXPA 3AEDB 3VTWA 2NBWB 1FO4A 1WXSA 3H1UA 2PKOA 1SIJA 3Q3MC 1J8CA 3HVDA 3CMMB 1R4MB 4M02A 1WJ4A 4EUTA 1RRBA 1C4AA 3N1ZC 1NVID 3QX1A 1XT9B 2JZPA 4NAWA 1WGHA 4OZBA 2ON8A 2LGIA 1TTNA 3KUDB 2Z0EB 5KHOA 3RUIB 2M8SA 3H8HA 1WJ6A 4WWOA 1GPXA 2NTTA 2K6QA 1QOGA 1TS2A 3SFEB 3ZVVA 1I7HA 3URYA 4TQ0A 3OG5A 2V4LA 5CHWA 1JWBD 2KZRA 3A9KB 4USAA 2M56B 3M3JA 2JXXA 3NZSA 2RGFA 1TZOA 2KO3A 1ZDXA 5AUKA 4RCOA 2KX3A 3UQAA 1FXIA 3AE2B 1V1PA 1FXAA 2KDIA 3WIMA 5H92C 4ANWA 4A9AA 3ZJTA 2FCNA 3DVNU 3AMZA 1ET6A 3P42A 2BB5A 1ZXHA 1VZ6A 4W9FA 4LNNA 1WGRA 2VRRB 2ZVOA 2MLBA 3RT3B 1KH0A 1V97A 2ZZPB 3TSSA 1HA5A 4HRSA 3CIRB 2KKCA 2XK5A 4W9LA 4XWWA 2A4ZA 2BB6A 3RN9C 2JPHA 2IJ0A 3HM6X 2KAJA 1V5TA 3PS6A 1E8XA 4ZYNA 4LNOA 3VRAB 4CQNA 1YX6B 2ICIA 2KYWA 4P16A 1SF0A 3R2IA 4P1CC 4HPPA 2KQSA 1E9MA 1NI2A 2NBUA 2MBOA 4KSLC 1ZE3D 1NENB 1E7PB 1RWSA 2QIEB 3IAS1 1HZ6A 2LVQA 2KACA 2MX2A 4FJVB 4W9DA 2PMVA 3L16A 2LZ6A 1QOBA 2KDBA 4I6LB 3ZNGC 5EDSA 1CJEA 3NVYA 1SE3A 1FCCC 2N9KA 3W9CB 4WH4A 2IGHA 3QC8B 2ZCBA 1ZP0B 1MG8A 1WX9A 2PVOD 1L4DB 3WAOA 4EZLA 2DBYA 3I9V1 2CJNA 2LI5A 1R4NI 4JE3B 1V5OA 3H7PA 2BYVE 3BVMA 4EZKA 3Q3NC 1XLOA 5LNK1 4HEA1 4FBJB 3CWIA 2G4DB 4IG7B 2J52A 4JX1C 2O6VA 1P3QU 1UBIA 4O1NA 2DLBA 1WR1A 4A8XC 3C8YA 1WM3A 2MBQA 1VDVA 1C79A 3RMKC 2JWZA 3O65B 2DNFA 3A9JB 5AUIA 1WGGA 2Y5CA 4PS3A 3ZW3A 3DPDA 4XWTA 3MHZA 3AEBB 4WQMA 1V49A 5GMVA 3VUWA 4LNKA 2PTLA 3MHSD 4P7IA 3APDA 1QOAA 3VUXA 1WMHA 1QOFA 4C56C 1TT5B 3HHMA 2JX5A 3E9SA 3MFGA 3DWMA 1RYJA 1XLPA 2WXLA 2IY1B 3PV1A 4IUMB 3KVFB 3ETRA 3KWVA 1F52A 2KTRB 1C3TA 1MFWA 4YSYB 4KZCA 5J18A 4RGNA 3RI7C 2O2VB 2IO2B 2LGYA 5IP4D 3IG3A 1HTQA 2D10A 2ZPYA 3BZDB 3Q3JA 3Q8BA 2JT4B 4WWPA 2JWUA 3QAQA 3U4EG 1ZDVA 3GE3C 3OAWA 3DBRI 2MP2B 3KUCB 1HZ5A 1EM7A 3FILA 2G3QB 4JPSA 2BTEA 3L4PA 4OVZA 1DOXA 4ANUA 1L0VB 2WXMA 2AEHA 2W3SA 2N9EB 1M4VA 4YTNB 2D3AA 2KXJA 3U2SC 3TEWA 4RMAA 4IWQA 2QCZA 1LQBA 3P4SB 1D3ZA 5FK9C 2R61A 4ITKA 1WYWB 2VH2A 3BK1A 4HPMB 1R4NB 3HK0A 3VAWA 2D3GA 5BYRA 2LVOA 3ZQ4A 4JL9A 4LJOB 3U30A 2I1JA 4AJWA 3R8BA 1WYGA 2BKFA 2KN5A 1IBXB 2YEPB 3PSEB 3VQIA 4F7ZA 2B76B 3NVZA 1C4PA 3VTVA 4GDKA 3DVGX 1WE7A 2AL6A 2KFJA 5IOIA 3PTFC 1L0XB 4TKNA 4US8A 1K52A 3KW5B 1GAQB 4E3CA 5IKCM 2CR5A 3A1QA 3RNAC 3AXCA 3RULA 1ZGUB 3Q2AC 2RR9A 1XLQA 1M94A 1SE9A 2KK8A 1KLVA 4F1SA 1L6UA 4YWGG 1FNWA 2J0MA 2PJHA 3B9JA 4HJKA 1WFYA 3PREA 4NZLB 2EMTA 3NS1A 2H88B 2MJDA 2L05A 4ZRKA 5BMHA 5LXHA 3RCZA 3WAMA 3NS8A 2BVCA 3APFA 1HQRD 4W9HA 3ZGZA 4ZRIA 1NYQA 2JF5A 4M8NA 5E6OA 1PGBA 1X1MA 3DDCB 1FNUA 3VFKA 2WDRB 1WM2A 4CHKA 4NQLB 1E8ZA 3P4QB 3J9CA 4ZRPA 2J0KA 2X8XX 3DBRB 3WANA 2OEDA 2WP9B 2D3BA 2G45B 2KMCA 4MSQB 1P7EA 4FHJA 2IDYA 4MT5A 3TEZA 1J0GA 1JROA 1AW7A 3TEYA 5J2RA 4RNAA 3DBHI 1T0YA 1YQBA 1YJIA 1T0QC 3SHQA 3VRBB 1QKZA 1V2YA 1CK1A 2BYEA 3RNBC 5DPTA 1FFVA 3BYTB 1JWMD 1TKGA 2AQ1B 4HXDA 2WXOA 4DDGD 3SU8X 4CO7A 2KOXA 3QARA 4WAAA 2KJHB 4A3OA 1WX8A 2YLMA 4GIVA 2MCNB 2C60A 2DAJA 3PLVA 3A9KA 3PPAA 3GE8C 4ZRJA 2M19A 4FA6A 1JQ4A 2IO3B 4DK5A 2LGDA 1QF6A 2W54A 2N9LA 1P98A 1OQYA 1WSPA 3QIJA 5TR5A 1OGWA 2OHFA 2WX0A 3TUOA 4M01A 2BS4B 4CYEA 2H89B 3K9OB 2QDFA 2AYOB 4J6IA 2PIAA 4DBGA 2WLBA 4BKTA 1F0ZA 2PPHA 4ZHOA 2I38A 4IWPA 2FBWB 3EGRA 4HCNB 1P7FA 3PZDA 4NJ6A 2BW2A 2GLSA 1ZUD2 4ZRQA 5DCNA 2LD9A 2I1KA 1UWMA 4GU2A 2K8HA 4EKUA 4WJQA 2KQ7A 1DOYA 4GN1A 3ZKJC 3AEEB 2M17A 4K81A 2DZIA 2W82A 2C7HA 1T0SC 1GJZA 2FNJB 1WGKA 3PVLA 1RFAA 3JYUA 3GZNI 1E8YA 4W9KA 1UF0A 4IM0A 4MELA 2BT6A 4W9CA 4JWUC 1OEYJ 1K51A 3ZYYX 4AS1A 3ZXVA 1AYFA 1YIWA 3MP9A 1UGJA 3DBHB 1WWTA 4NNJB 4TMAB 1SJED 2BPSA 2DWQA 5C3JB 2LGSA 2W3RA 5DPRA 2WXHA 1J19A 2BBCA 3ALBA 2KC1A 2MJEA 2Y5PA 2TSSA 1D6EC 3UIOB 2ZW1A 4ANXA 2ZNVB 1WZ0A 2GBJA 5FR6A 4DHJB 1YN5A 3DHGC 4EE2A 1IYFA 3BYYB 1ZXIA 2ZCCA 4DQOC 1ZOYB 3LXFA 4B0MA 1YN3A 3U52E 3IFWB 1FNVA 1PGAA 1LGRA 2WXIA 2N1VA 5HG2A 4MJSB 3ZTDA 2WDVB 3L08A 1CMXB 2AX5A 3A9JA 3Q3FA 4FJYA 3P2BA 1L5PA 2PE9A 1KOTA 2N7JA 1ZPSA 1LXDA 2L1AA 4LCDE 4BKSA 1IPGA 3RYTA 2MJ3A 3UGBB 4LTUA 2I2YA 2BYFA 1S3SG 3ENEA 3H6NA 2XNAC 2KTRA 3IVFA 5IAAC 2FUHB 2K22A 4H2AA 2O2VA 3W5UB 2KMAA 1UBQA 2DENB 1K50A 3VVWB 1J7BA 2RDHA 3HVZA 4L2YA 3U7DA 4OZAA 1TIFA 2L3ZA 2MP2A 3RNGC 3L54A 3QCAA 3DVNV 4L23A 3BIID 1EO6A 3MJ5A 3QHTA 4L1BA 1GUAB 2LJ5A 4IW0A 2WXGA 1KF6B 2QILA 4WJOA 3MC0B 4KDLB 3IXSA 1QQRA 2FE8A 3GZNB 3DQVA 3LDZE 2NVUI 2DYBA 2HE7A 3QWZB 3ZNZB 2K5PA 3ZRFA 4C7ZA 4PK1A 3B2GA 3N3KB 3JVZX 1EF5A 2K9XA 1HTOA 2KWVB 1I42A 3L17A 1ZW7A 4LJPB 3R7QA 4YT0B 3RFZB 1V1OA 3IT4B 2ZW0A 3B0AA 1V81A 1KLGD 3U8ZA 4NPNA 4DXGA 1IBXA 3VR8B 4WJNA 3W1YA 2RPVA 3NHEB 4LLGM 4MGKE 3EFCA 4EOYA 4ZYSA 1EU4A 3IT6B 3NZUA 1JWSD 2OOBB 4C80A 1Y56A 3EHVA 3DOWA 1VZ8A 4OVUA 2B3AA 2UU7A 3NVVA 2BQQA 1MG4A 5JZEB 4RFBA 2MEKA 4K1RB 3EA6A 4MEMA 5AEKB 2QEJC 3N30A 4NY0A 2L0TA 1S1QB 1C1YB 1WJNA 1YD8U 2A5UA 4AP4C 3ZRCA 5JH5C 2IGDA 2AWTA 1VCBA 1WXMA 2WXKA 2M0AA 1PDXA 2GBNA 1FRDA 3FAHA 1IP9A 4DXFA 2CHZA 1DYQA 1WXVA 1SB3C 1QLBB 1ESFA 2SAKA 3R66C 2G4SA 3LJ3A 2FCQA 4XDDA 3Q14C 4DDID 1Q0WB 4XGAB 3DVGY 2HD5B 5BMGA 4C00A 4LDTD 1ET9A 2R2QA 4AUQC 1GG3A 3AH7A 4KSKC 2EELA 2DYOA 3TJPA 4YSXB 3GOEA 3T3NA 4HROA 2NCNA 4NQKE 1I35A 3RNFC 1QT9A 1WI0A 1WXQA 2WHIA 3RD2A 1EF1A 3ZDMC 1XLNA 3NUHB 3ZO5B 3NVWA 2CS4A 4Q2JA 2MQJA 2EKEC 1FEHA 3V60A 2RSUA 2MRPA 4HWIB 1KFYB 3KQ4A 4C4VB 2IO1B 5C2TB 4IC7B 3UI3A 1L6VA 1UUPA 2JZZA 4REZA 2Q5WD 3Q8FA 2C7NB 2Z59B 1CZPA 3QK0A 3CF6E 1D4BA 2R2OA 4WWNA 4MSMB 4KGTA 1ACCA 4MM3B 1J7AA 2K3UA 4KX6B 2JYTA 4KIKB 2G1EA 3BVZA 3MC9A 2C7MB 2KJRA 2OJRA 4KZ0A 1GB4A 4EZJA 1YJJA 1SGHA 5CX3A 1YMHE 3VDZA 2WX1A 1XCQL 2E3TA 2RPQA 4K7UA 4DHZE 1EWCA 1PUTA 2LMCA 3I3TB 1Y8RC 2K1FA 1BXTA 3L13A 1UZXB 3TL5A 4JGHB 4A55A 4G11A 1TKEA 1H4RA 2QC8A 4US9A 2LJIA 3ZXRA 1KJTA 2LRWA 1TS3A 4OHJA 2LUEA 2LGXA 1WR6E 1WJUA 5D94A 2QJLA 1AARA 3HIZA 3KLSX 4QAYA 2FCMA 4URKA 5H8YE 3TCAA 2IPKD 3AEGB 2V0GA 1JWUD 2WNMA 2V9HA 3EFUA 2D2QA 2KFKB 2KWDA 4TV3A 1MI0A 5AZGA 3WAPA 1WH3A 2KN4A 3NG0A 2WXJA 4FN2A 5GXGB 2E6XA 1V6EA 2OJWA 4W9EA 1VZ7A 3PT2B 3V3XA 1N60A 2QMTA 4RF0A 4PYUA 5T8IA 4GXBA 1YNTE 3NZ3A 1MHXA 2M4NA 3V61A 4PS8A 1SIFA 4XZ4A 2W9NA 3DWGC 2MWSB 2L00B 3W1SA 1P1AA 4II3B 2ZEQA 3SR6A 4N59A 1XD3B 5L95C 3I57A 4MJSA 2J42A 2D07B 3OWEB 3SD5A 3MC8A 4IM2A 1LO5D 4KV2A 4UDUC 1YOVB 3VR9B 1N5XA 2KHWB 1QILA 4BBNC 1XEEA 2MA9B 4B9KA 4FJZA 4ARIA 4A20A 4BAXA 2BF8B 1VLBA 3H7SA 5TSSA 5JXVA 1WXAA 1WZ3A 3BK2A 3AE7B 1MVKA 1WY8A 2L32A 3GP7A 2C5LC 2WU2B 2N9PC 3PRMB 3ZNHB 4HKZE 5FKAC 3V62A 2KD0A 4RM8A 3T3OA 2G9HD 3B08A 3SEBA 2JRHA 4OVVA 1RFKA 1PFDA 2LHDA 4BKGA 3ABVB 3Q3OC 3T9LA 3W2DA 1I4PA 2AQ2B 2FCSA 5BYSA 1CQVA 3PHXB 1NYRA 2INNE 3I5JC 3BY4B 2J4XA 1GNUA 5BYQA 2DAFA 3PLUA 1ZKHA 1NEKB 3N1YC 1PYWD 4R3DA 2VZKD 4HDQA 1TGZB 3AE9B 4PS7A 3KH0A 4FADA 1MPEA 3R7RA 1VR9A 5LLIA 3AU4A 4RGTA 3D32A 5DPSA 2C9WB 1R7SA 3PGEA 1TZ1A 1I4RA 2IBIB 4AWJA 3VXWA 2L0FA 3PZ7A 1WIAA 1SBBB 1YQ4B 3P63A 2QHOA 2GMIC 1LFDA 1NI3A 2K0PA 3CSTA 3C0RB 2GRIA 4K7SA 1E5WA 1T0RC 4AOFA 3BVGA 3PRPB 2KT7A 1FCLA 2WS3B 3AE5B 2KDMA 1N63A 1SSNA 2GBMA 2PE6B 4GGQA 4ICUA 1WRDB 1UWXA 3MJWA 4E71A 1TJEA 2MBEA 2YVCA 4W9GA 2VH1A 3DHIC 3ZNID 4EFOA 1GOZA 2DZKA 3AU5A 4GMVA 1JW9D 2N7EA 2QSDA 3M95A 5J17A 1F2RC 2JYEA 2WDTB 2BS3B 2WXRA 2N4FA 1ENFA 4W9JA 4YTMB 1WF9A 3HM3A 2DZMA 3S2AA 1GB1A 2J53A 3KUZA 1FM0D 4JWSC 5DPWA 4F8CB 2FAZA 4XYCA 3A4SC 5EE0A 3ML8A 3IAM1 4KVGB 1HXYD 3AE3B 4LNIA 1UELA 4BOSC 3DBLI 4IOIE 5I4DA 1Q5WB 5HFYA 2V3SA 2GBKA 4N6EB 4BFRA 4WWMA 2K6DB 5LXIB 4HK2A 4OW0A 1SE4A 4GLSC 1JALA 2CU1A 4GDLB 4HCPB 1OQQA 3PZ8A 5CHFA 4FXCA 3X23A 1N6ZA 2N7DA 1UD7A 3DBSA 4C4VA 2LVPA 4MDKE 2KWUB 1H8CA 1C77A 2XN9C 2BWFA 1UGMA 1TKYA 1WX7A 4M00A 5E6PA 4GSWA 3AN1A 3WALA 3T8MA 2KDFB 1T5XD 3P4PB 4KKIA 5BMIA 1AWDA 4MM3A 2INPE 4KIKA 3MTNB 2X38A 3AECB 2KMMA 5EE3A 2K8BA 5IN7A 3RPFC 5D7GA 4BBNF 3TMPB 4P1BC 4KKJA 4MH8A 1YN4A 2LXAA 3HUIA 4TUUA 4FLHA 3AE6B 1AN8A 2K8CA 2FIFA 5IO9A 4HLEA 2M1MA 2NPTB 2LASA 2MHJA 4BVUC 4TSSA 1E10A 4A6QA 4IWOA 4B0EA 1EWYC 4C7YA 2MW5A 2RDGA 2EKIA 2ZVNA 3FKYA 2Z8LA 2JVCA 2JXTA 4I6NB 4A3PA 4S17A 1RAXA 4K3CA 1FMAD 3NRZA 2REXA 2DYMA 4M0WB 3WA0A 4AJYB 1TS5A 3TIXA 4S0RA 2DX5B 5CHVC 1SE2A 1OQRA 1NBFC 2KFKA 3AE1B 3DBLB 3RZFA 2LWPA 5IA7A 1LM8B 1L2NA 1C76A 5D2MB 4K3BA 4YL8A 4B95A 2L76A 3AE4B 3KYDD 3VTUA 2RMMA 2KX0A 1N5WA 2JSVX 1IGCA 1ISNA 1E6EB 4XC2A 2AQ3B 3JW0X 5KHQA 1E7VA 2MBHA 2WXFA 2NMQA 2NTSA 1L0YB 3AV8A 2WDQB 1JWAD 3KWLA 3GB1A 4ZOHC 3N20C 4N9F4 1RLFA 3L10B 3OJ4B 5G55A 2PLPA 4ICVA 2CHWA 2V3PA 2BS2B 3V6CB 2MSED 2UYZB 4DXAB 3AEAB 2KJ6A 3DCGA 5CTRC 3U7ZA 1UH6A 3TBLD 2NR2A 3N32A 4HKQA 3M62B 2LUMA 4YSZB 1F1HA 1E0ZA 1XQQA 1YQ3B 3ONSA 4PT5A 4N58A 1NDDA 3JSVB 3NOBA 1TS4A 5EE1A 1KM7A 2KDEB 3Q69A 2LXCA 5EE9A 4RM9A 1N62A 1C78A 4ANVA 2HTME 2JQRB 3VH4B 1YX5B 2KANA 1UNSA 5HHDG 2KLCA 2UWQA 3NY5A 1F9JA 1L4ZB 3BWUD 1V80A 4D2KA 1B9RA 4JIOU 3EC8A 2HTHA 1MHHE 2BGFA 2KLGA 1WE6A 2Z0DB 2AL3A 4LDTB 4BKSD 2K39A 1V8CA 5AZHA 5C23A 2D11A 2D5GA 2V4IB 4NJCA 4RH6A 2LFIA 2GI9A 5L83A 1TY0A 2KTFA 2BKRB 2ONQA 3PHWB 2GOWA 1FIQA 5C1ZA 3A4RA 2PEAA 3IBEA 3P4RB 4PYZA 4X57B 3UF8A 2WQYB 3X0WA 2MBBB 2IGGA 3VHTC 1T6BX 3E56A 3AEFB 4XDCA 2GBRA 3K9PB 2V3NA 2IO0B 3L0WB 1V9JA 5MPOA 3M63B 4E74A 3LYYA 4MH0E 2ASQA 3QJZA 2L83A 2FIDA 4RGOS 1I4XA 1A5RA 4NAWB 4G0NB 3W5VB 4G3XB 1TY2A 1OFFA 3LB8C 1C4CA 2WXNA 5D3DA 1SJHD 3GS2A 5G2NA 4MGIE 2KNBA 1D5MC 5G5GA 2FUG1 1KLUD 3FC4A 4W9IA 4BZAA 1BT0A 2JRIB 2RDBC 1FRRA 1T3QA 2JY6A 4IM3A 4WQOB 2EMSA 3DHHC 3ZJUA 2Y3AA 1E8WA 2BYTA 1D5ZC 2IZVB 2CHXA 2D3CA 4BOZB 3ZDTA 5HKHA 1XXGA 3O13A 1WGDA 3AULA 3H9DA 2RD0A 5HI1A 3APCA 2INDC 1V1PB 1IGDA 3UIPB 5JHAA 3ZUNA 2INCC 1I4GA 3ECIA 2IYDB
chains in the Genus database with same CATH topology
1WX9A 5AZFA 2FUHB 3WAOA 4EZLA 2L7RA 1E5WA 2N1WA 2O2VA 3RZWC 2N9XA 2LI5A 4AOFA 1R4NI 1EUVB 2JZ3B 2KMAA 1V5OA 1UBQA 3PRPB 2DENB 1E90A 3H7PA 2BYVE 4EZKA 4II2B 3VVWB 2XK5B 1E7UA 3U7DA 1V86A 2GBMA 2PE6B 4GGQA 4FBJB 2L3ZA 2MP2A 2G4DB 4ICUA 4IG7B 4EEWA 3L54A 1WRDB 3QCAA 3DVNV 1EO6A 2O6VA 3MJWA 3QHTA 4FULA 1P3QU 2XBBC 1GUAB 1UBIA 4E71A 2LJ5A 2MBEA 4IW0A 2YVCA 1WR1A 4GDLA 4WJOA 2WWZA 4W9GA 2K25A 1PQSA 4JQWC 4KDLB 4G50A 3ZNID 4EFOA 1WM3A 2DZKA 3AU5A 2MBQA 4TQ1A 4GMVA 2N7EA 3DQVA 3LDZE 2NVUI 1GC7A 2DYBA 2HE7A 2JWZA 3O65B 3QWZB 3M95A 4MGYE 3ZNZB 5J17A 3A9JB 2WDTB 1WGGA 4XX5A 1FXTB 3V6EB 3ZRFA 4PS3A 3ZW3A 3DPDA 3N3KB 3JVZX 1K8RB 2N4FA 4W9JA 1EF5A 1V49A 1WF9A 2KWVB 1Z5SB 4WJPA 5GMVA 1I42A 3HM3A 3L17A 4JLCA 1ZW7A 3VUWA 2DZMA 3S2AA 3MHSD 4P7IA 3KUZA 3APDA 4HDOA 5DPWA 4LJPB 4NJ7A 2FAZA 3R7QA 3VUXA 4B6WA 4F8CB 1HE8A 1WMHA 3A4SC 2O6VD 1VD2A 3HHMA 3ML8A 3OJ3A 4M8MA 3B0AA 4KVGB 1V81A 2IY1B 3PV1A 4IUMB 3KVFB 2DZJA 1UELA 2KTRB 3QQ8B 3U8ZA 1C3TA 1TBEA 4NPNA 2CKHB 4BOSC 4DWFA 4WJNA 3W1YA 4KZCA 5J18A 3DBLI 3NHEB 2O2VB 2IO2B 2V1YA 2LGYA 4MGKE 4EOYA 2XEWA 3IG3A 1Q5WB 2D10A 3NZUA 2ZPYA 4MGZE 2NPTA 3R3MA 3Q3JA 3H7PB 2OOBB 2JT4B 4WWPA 3QAQA 2J7QB 2V3SA 2GBKA 3EHVA 2ZJDA 3DOWA 2KC2A 2KWCA 4BFRA 4OVUA 2B3AA 3DBRI 3OAWA 2MP2B 3KUCB 4K7SA 2K6DB 4GB9A 5JZEB 2NS5A 5LXIB 4HK2A 2O6VB 1WGYA 2G3QB 3AI5A 4K1RB 1L7YA 4MEMA 5AEKB 2CU1A 4GDLB 4ANUA 3QA8A 4HCPB 3N30A 4NY0A 5CHFA 3X23A 2L0TA 3ZTCA 1S1QB 2N7DA 1C1YB 1UD7A 2AEHA 3DBSA 1WJNA 1YD8U 2A5UA 2LVPA 2N9EB 4AP4C 4ZDVA 3ZRCA 5JH5C 4MDKE 2KWUB 1H8CA 2AWTA 1VCBA 2KXJA 1OEYA 1WXMA 4RMAA 4IWQA 2BWFA 1UGMA 1WX7A 5E6PA 4GSWA 4DHZB 4HPLB 3VH3B 2GBNA 1LQBA 3T8MA 3WALA 1IP9A 2KDFB 1D3ZA 1WYWB 2CHZA 1WXVA 4HPMB 4MM3A 3SDLC 4I6PA 3R66C 4K7WA 4KIKA 3MTNB 1YJ1A 3HK0A 3VAWA 2K8BA 1WMHB 2D3GA 2G4SA 2Y5BB 3LJ3A 2FCQA 2LVOA 5D7GA 4JL9A 4BBNF 4LJOB 2LRUA 5E6NA 3U30A 2I1JA 3TMPB 4DDID 1Q0WB 4AJWA 2WYQA 3DVGY 2BKFA 2J0JA 2KN5A 2IY0B 3PSEB 2HD5B 2LXAA 3VQIA 4TUUA 4F7ZA 1JRUA 3VTVA 3OLMD 4GDKA 4LDTD 4FLHA 2R2QA 4AUQC 3DVGX 1WE7A 2AL6A 1GG3A 2KFJA 2K8CA 3PTFC 2FIFA 4HLEA 2NBVB 3ML9A 4KSKC 2M1MA 2HJ8A 2NPTB 4TKNA 2LASA 4BVUC 2DYOA 3KW5B 3TJPA 4HVBA 1R4MI 3GOEA 4IWOA 4E3CA 2CR5A 3A1QA 4NQKE 2NCNA 4ASWC 3AXCA 2MW5A 3KYCD 1I35A 3RULA 1ZGUB 2RR9A 1M94A 1SE9A 1WI0A 2KK8A 3RD2A 1KLVA 1EF1A 2ZVNA 3ZDMC 4F1SA 2BWES 2JVCA 4A3PA 4I6NB 1P0RA 3ZO5B 1QZEA 3PRZA 2J0MA 2CS4A 2MQJA 1RAXA 2EKEC 2KVRA 3V60A 2RSUA 2MRPA 2PJHA 4FHKA 4GOCA 4HWIB 1P9DU 2REXA 2DYMA 4M0WB 5D6JB 3WA0A 2M0XA 2IO1B 4HJKA 1WFYA 3PREA 4AJYB 4IC7B 2EMTA 2JZZA 4ZRKA 2L05A 2ZPNA 3TIXA 5LXHA 2C7NB 2Z59B 3RCZA 2DX5B 1G6JA 5CHVC 3WAMA 3QK0A 1NBFC 3CF6E 3APFA 3NS8A 2KFKA 2L8JA 2R2OA 4WWNA 4MSMB 3UINB 3RZFA 4W9HA 1Q1OA 2LWPA 3JSVA 4KIKB 4ZRIA 5IA7A 1LM8B 2JF5A 4M8NA 1L2NA 5E6OA 2C7MB 2KJRA 5D2MB 3A33B 1X1MA 2OJRA 3DDCB 4YL8A 3VFKA 4KZ0A 1WM2A 4B95A 1U4AA 4CHKA 4EZJA 3EECA 2L76A 4NQLB 1E8ZA 4DHJD 1SGHA 3BINA 3KYDD 5CX3A 3VTUA 2KX0A 3ZLZA 2J0KA 1GC6A 3VDZA 3WANA 2WX1A 3IHPC 2G45B 2KMCA 4MSQB 1ISNA 4FHJA 4KDIC 2RPQA 4XC2A 4K7UA 4GDKB 4DHZE 3B1LX 3JW0X 5KHQA 1E7VA 1OTRB 3I3TB 1J0GA 2MBHA 1Y8RC 2K1FA 3L13A 2DHZA 5J2RA 1UZXB 3DBHI 2JUOA 1T0YA 3TL5A 1YQBA 4JGHB 4G11A 3A1QB 1H4RA 3SHQA 1Z2MA 4N9F4 1RLFA 3L10B 3OJ4B 5G55A 1KJTA 2LRWA 4ICVA 3UQBA 1V2YA 3ZIMA 2CHWA 5BO4B 2BYEA 2LUEA 2LGXA 5DPTA 2ZNVC 3W1SC 1WR6E 1WJUA 5D94A 4HXDA 1AARA 3HIZA 3SU8X 3V6CB 4DDGD 2MSED 2UYZB 4CO7A 2FCMA 4DXAB 2KOXA 4URKA 3QARA 2KJ6A 3DCGA 4WAAA 3TCAA 5CTRC 2KJHB 4A3OA 1WX8A 2YLMA 4GIVA 5JHBA 1UH6A 3TBLD 2MCNB 2NR2A 2C60A 2DAJA 3PLVA 3A9KA 3CSFA 3N32A 3EFUA 3M62B 3VUYA 2D2QA 2KFKB 3PPAA 1XQQA 4ZRJA 3ONSA 3VTWA 2NBWB 1WXSA 1NDDA 4FA6A 3H1UA 3JSVB 3NOBA 2IO3B 4TV3A 5AZGA 3WAPA 1KM7A 4DK5A 1WH3A 2LGDA 2KDEB 1J8CA 1P98A 1OQYA 2LXCA 3CMMB 4FN2A 4RM9A 1V6EA 3QIJA 5TR5A 1OGWA 1WJ4A 4W9EA 2WX0A 3PT2B 4EUTA 1RRBA 4ANVA 4PYUA 3VH4B 3QX1A 4CYEA 1XT9B 3K9OB 4GXBA 2AYOB 1YX5B 4NAWA 4J6IA 1WGHA 2KANA 2M4NA 3V61A 4DBGA 4PS8A 2KLCA 1SIFA 4BKTA 4XZ4A 2PPHA 2UWQA 2W9NA 1TTNA 2MWSB 2L00B 3NY5A 1F9JA 1P1AA 3W1SA 4IWPA 1V80A 4II3B 4JIOU 2ZEQA 3KUDB 3EC8A 2Z0EB 4HCNB 2HTHA 3PZDA 1XD3B 2BGFA 4NJ6A 2KLGA 5KHOA 3RUIB 1WE6A 5L95C 2Z0DB 2AL3A 4LDTB 4BKSD 2K39A 2M8SA 5AZHA 5C23A 5DCNA 2LD9A 2D11A 1WJ6A 2I1KA 4MJSA 4WWOA 4GU2A 2D07B 2K8HA 2K6QA 4EKUA 4WJQA 5L83A 2KQ7A 4GN1A 2KTFA 3SD5A 3ZVVA 2BKRB 4IM2A 4TQ0A 3ZKJC 2V4LA 4KV2A 5CHWA 2KZRA 3PHWB 2GOWA 3A9KB 2M17A 4K81A 2DZIA 2C7HA 5C1ZA 3A4RA 2JXXA 3M3JA 1GJZA 3NZSA 2KHWB 4BBNC 2RGFA 2MA9B 2PEAA 2FNJB 3PVLA 4B9KA 1RFAA 2KO3A 3IBEA 3JYUA 4FJZA 4PYZA 4X57B 3UF8A 3GZNI 4A20A 1E8YA 4W9KA 2KX3A 2BF8B 4IM0A 3H7SA 4MELA 3UQAA 4W9CA 3X0WA 1OEYJ 2MBBB 1WXAA 3VHTC 2KDIA 3WIMA 1WZ3A 1YIWA 4ANWA 1WY8A 2GBRA 3K9PB 2FCNA 3DVNU 4NNJB 2IO0B 3L0WB 1V9JA 3M63B 2C5LC 4E74A 2BPSA 2N9PC 3PRMB 4W9FA 3ZNHB 3V62A 1WGRA 2KD0A 4MH0E 2ASQA 2VRRB 3QJZA 2ZVOA 2MLBA 2FIDA 4RM8A 3RT3B 5DPRA 2ZZPB 3B08A 1A5RA 1J19A 4NAWB 4G0NB 2KKCA 4G3XB 2XK5A 2JRHA 4W9LA 3ALBA 2KC1A 4OVVA 2A4ZA 2JPHA 3UIOB 4BKGA 3T9LA 4ANXA 2ZNVB 5G2NA 2FCSA 1WZ0A 2GBJA 2KNBA 3HM6X 4MGIE 5FR6A 1V5TA 4DHJB 3PHXB 3PS6A 1E8XA 1IYFA 4W9IA 3BY4B 1BT0A 4ZYNA 2ZCCA 2JRIB 1YX6B 1GNUA 2DAFA 2JY6A 3PLUA 1ZKHA 4IM3A 4WQOB 2EMSA 2KQSA 3IFWB 1NI2A 2NBUA 2N1VA 2MBOA 4KSLC 1TGZB 1E8WA 4HDQA 4PS7A 3KH0A 4MJSB 4FADA 3ZTDA 2IZVB 3R7RA 3L08A 3AU4A 5LLIA 1CMXB 2CHXA 3A9JA 3Q3FA 5IAAC 4FJYA 3P2BA 2LVQA 2MX2A 2PE9A 4BOZB 1KOTA 3D32A 4FJVB 5DPSA 2C9WB 3ZDTA 4W9DA 5HKHA 1LXDA 3L16A 1TZ1A 3PGEA 2LZ6A 1WGDA 3AULA 3H9DA 2IBIB 4AWJA 2RD0A 2KDBA 3VXWA 2L0FA 4I6LB 4LCDE 3ZNGC 5EDSA 4BKSA 1IPGA 3APCA 3RYTA 1WIAA 3UIPB 3UGBB 2QHOA 5JHAA 2GMIC 1LFDA 2BYFA 1S3SG 3ENEA 3H6NA 3QC8B 3ZUNA 2ZCBA 2KTRA 3CSTA 3ECIA 2IYDB 3C0RB 3IVFA 1MG8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WX9 A;  5AZF A;  2FUH B;  3WAO A;  4EZL A;  2L7R A;  1E5W A;  2N1W A;  2O2V A;  3RZW C;  2N9X A;  2LI5 A;  4AOF A;  1R4N I;  1EUV B;  2JZ3 B;  2KMA A;  1V5O A;  1UBQ A;  3PRP B;  2DEN B;  1E90 A;  3H7P A;  2BYV E;  4EZK A;  4II2 B;  3VVW B;  2XK5 B;  1E7U A;  3U7D A;  1V86 A;  2GBM A;  2PE6 B;  4GGQ A;  4FBJ B;  2L3Z A;  2MP2 A;  2G4D B;  4ICU A;  4IG7 B;  4EEW A;  3L54 A;  1WRD B;  3QCA A;  3DVN V;  1EO6 A;  2O6V A;  3MJW A;  3QHT A;  4FUL A;  1P3Q U;  2XBB C;  1GUA B;  1UBI A;  4E71 A;  2LJ5 A;  2MBE A;  4IW0 A;  2YVC A;  1WR1 A;  4GDL A;  4WJO A;  2WWZ A;  4W9G A;  2K25 A;  1PQS A;  4JQW C;  4KDL B;  4G50 A;  3ZNI D;  4EFO A;  1WM3 A;  2DZK A;  3AU5 A;  2MBQ A;  4TQ1 A;  4GMV A;  2N7E A;  3DQV A;  3LDZ E;  2NVU I;  1GC7 A;  2DYB A;  2HE7 A;  2JWZ A;  3O65 B;  3QWZ B;  3M95 A;  4MGY E;  3ZNZ B;  5J17 A;  3A9J B;  2WDT B;  1WGG A;  4XX5 A;  1FXT B;  3V6E B;  3ZRF A;  4PS3 A;  3ZW3 A;  3DPD A;  3N3K B;  3JVZ X;  1K8R B;  2N4F A;  4W9J A;  1EF5 A;  1V49 A;  1WF9 A;  2KWV B;  1Z5S B;  4WJP A;  5GMV A;  1I42 A;  3HM3 A;  3L17 A;  4JLC A;  1ZW7 A;  3VUW A;  2DZM A;  3S2A A;  3MHS D;  4P7I A;  3KUZ A;  3APD A;  4HDO A;  5DPW A;  4LJP B;  4NJ7 A;  2FAZ A;  3R7Q A;  3VUX A;  4B6W A;  4F8C B;  1HE8 A;  1WMH A;  3A4S C;  2O6V D;  1VD2 A;  3HHM A;  3ML8 A;  3OJ3 A;  4M8M A;  3B0A A;  4KVG B;  1V81 A;  2IY1 B;  3PV1 A;  4IUM B;  3KVF B;  2DZJ A;  1UEL A;  2KTR B;  3QQ8 B;  3U8Z A;  1C3T A;  1TBE A;  4NPN A;  2CKH B;  4BOS C;  4DWF A;  4WJN A;  3W1Y A;  4KZC A;  5J18 A;  3DBL I;  3NHE B;  2O2V B;  2IO2 B;  2V1Y A;  2LGY A;  4MGK E;  4EOY A;  2XEW A;  3IG3 A;  1Q5W B;  2D10 A;  3NZU A;  2ZPY A;  4MGZ E;  2NPT A;  3R3M A;  3Q3J A;  3H7P B;  2OOB B;  2JT4 B;  4WWP A;  3QAQ A;  2J7Q B;  2V3S A;  2GBK A;  3EHV A;  2ZJD A;  3DOW A;  2KC2 A;  2KWC A;  4BFR A;  4OVU A;  2B3A A;  3DBR I;  3OAW A;  2MP2 B;  3KUC B;  4K7S A;  2K6D B;  4GB9 A;  5JZE B;  2NS5 A;  5LXI B;  4HK2 A;  2O6V B;  1WGY A;  2G3Q B;  3AI5 A;  4K1R B;  1L7Y A;  4MEM A;  5AEK B;  2CU1 A;  4GDL B;  4ANU A;  3QA8 A;  4HCP B;  3N30 A;  4NY0 A;  5CHF A;  3X23 A;  2L0T A;  3ZTC A;  1S1Q B;  2N7D A;  1C1Y B;  1UD7 A;  2AEH A;  3DBS A;  1WJN A;  1YD8 U;  2A5U A;  2LVP A;  2N9E B;  4AP4 C;  4ZDV A;  3ZRC A;  5JH5 C;  4MDK E;  2KWU B;  1H8C A;  2AWT A;  1VCB A;  2KXJ A;  1OEY A;  1WXM A;  4RMA A;  4IWQ A;  2BWF A;  1UGM A;  1WX7 A;  5E6P A;  4GSW A;  4DHZ B;  4HPL B;  3VH3 B;  2GBN A;  1LQB A;  3T8M A;  3WAL A;  1IP9 A;  2KDF B;  1D3Z A;  1WYW B;  2CHZ A;  1WXV A;  4HPM B;  4MM3 A;  3SDL C;  4I6P A;  3R66 C;  4K7W A;  4KIK A;  3MTN B;  1YJ1 A;  3HK0 A;  3VAW A;  2K8B A;  1WMH B;  2D3G A;  2G4S A;  2Y5B B;  3LJ3 A;  2FCQ A;  2LVO A;  5D7G A;  4JL9 A;  4BBN F;  4LJO B;  2LRU A;  5E6N A;  3U30 A;  2I1J A;  3TMP B;  4DDI D;  1Q0W B;  4AJW A;  2WYQ A;  3DVG Y;  2BKF A;  2J0J A;  2KN5 A;  2IY0 B;  3PSE B;  2HD5 B;  2LXA A;  3VQI A;  4TUU A;  4F7Z A;  1JRU A;  3VTV A;  3OLM D;  4GDK A;  4LDT D;  4FLH A;  2R2Q A;  4AUQ C;  3DVG X;  1WE7 A;  2AL6 A;  1GG3 A;  2KFJ A;  2K8C A;  3PTF C;  2FIF A;  4HLE A;  2NBV B;  3ML9 A;  4KSK C;  2M1M A;  2HJ8 A;  2NPT B;  4TKN A;  2LAS A;  4BVU C;  2DYO A;  3KW5 B;  3TJP A;  4HVB A;  1R4M I;  3GOE A;  4IWO A;  4E3C A;  2CR5 A;  3A1Q A;  4NQK E;  2NCN A;  4ASW C;  3AXC A;  2MW5 A;  3KYC D;  1I35 A;  3RUL A;  1ZGU B;  2RR9 A;  1M94 A;  1SE9 A;  1WI0 A;  2KK8 A;  3RD2 A;  1KLV A;  1EF1 A;  2ZVN A;  3ZDM C;  4F1S A;  2BWE S;  2JVC A;  4A3P A;  4I6N B;  1P0R A;  3ZO5 B;  1QZE A;  3PRZ A;  2J0M A;  2CS4 A;  2MQJ A;  1RAX A;  2EKE C;  2KVR A;  3V60 A;  2RSU A;  2MRP A;  2PJH A;  4FHK A;  4GOC A;  4HWI B;  1P9D U;  2REX A;  2DYM A;  4M0W B;  5D6J B;  3WA0 A;  2M0X A;  2IO1 B;  4HJK A;  1WFY A;  3PRE A;  4AJY B;  4IC7 B;  2EMT A;  2JZZ A;  4ZRK A;  2L05 A;  2ZPN A;  3TIX A;  5LXH A;  2C7N B;  2Z59 B;  3RCZ A;  2DX5 B;  1G6J A;  5CHV C;  3WAM A;  3QK0 A;  1NBF C;  3CF6 E;  3APF A;  3NS8 A;  2KFK A;  2L8J A;  2R2O A;  4WWN A;  4MSM B;  3UIN B;  3RZF A;  4W9H A;  1Q1O A;  2LWP A;  3JSV A;  4KIK B;  4ZRI A;  5IA7 A;  1LM8 B;  2JF5 A;  4M8N A;  1L2N A;  5E6O A;  2C7M B;  2KJR A;  5D2M B;  3A33 B;  1X1M A;  2OJR A;  3DDC B;  4YL8 A;  3VFK A;  4KZ0 A;  1WM2 A;  4B95 A;  1U4A A;  4CHK A;  4EZJ A;  3EEC A;  2L76 A;  4NQL B;  1E8Z A;  4DHJ D;  1SGH A;  3BIN A;  3KYD D;  5CX3 A;  3VTU A;  2KX0 A;  3ZLZ A;  2J0K A;  1GC6 A;  3VDZ A;  3WAN A;  2WX1 A;  3IHP C;  2G45 B;  2KMC A;  4MSQ B;  1ISN A;  4FHJ A;  4KDI C;  2RPQ A;  4XC2 A;  4K7U A;  4GDK B;  4DHZ E;  3B1L X;  3JW0 X;  5KHQ A;  1E7V A;  1OTR B;  3I3T B;  1J0G A;  2MBH A;  1Y8R C;  2K1F A;  3L13 A;  2DHZ A;  5J2R A;  1UZX B;  3DBH I;  2JUO A;  1T0Y A;  3TL5 A;  1YQB A;  4JGH B;  4G11 A;  3A1Q B;  1H4R A;  3SHQ A;  1Z2M A;  4N9F 4;  1RLF A;  3L10 B;  3OJ4 B;  5G55 A;  1KJT A;  2LRW A;  4ICV A;  3UQB A;  1V2Y A;  3ZIM A;  2CHW A;  5BO4 B;  2BYE A;  2LUE A;  2LGX A;  5DPT A;  2ZNV C;  3W1S C;  1WR6 E;  1WJU A;  5D94 A;  4HXD A;  1AAR A;  3HIZ A;  3SU8 X;  3V6C B;  4DDG D;  2MSE D;  2UYZ B;  4CO7 A;  2FCM A;  4DXA B;  2KOX A;  4URK A;  3QAR A;  2KJ6 A;  3DCG A;  4WAA A;  3TCA A;  5CTR C;  2KJH B;  4A3O A;  1WX8 A;  2YLM A;  4GIV A;  5JHB A;  1UH6 A;  3TBL D;  2MCN B;  2NR2 A;  2C60 A;  2DAJ A;  3PLV A;  3A9K A;  3CSF A;  3N32 A;  3EFU A;  3M62 B;  3VUY A;  2D2Q A;  2KFK B;  3PPA A;  1XQQ A;  4ZRJ A;  3ONS A;  3VTW A;  2NBW B;  1WXS A;  1NDD A;  4FA6 A;  3H1U A;  3JSV B;  3NOB A;  2IO3 B;  4TV3 A;  5AZG A;  3WAP A;  1KM7 A;  4DK5 A;  1WH3 A;  2LGD A;  2KDE B;  1J8C A;  1P98 A;  1OQY A;  2LXC A;  3CMM B;  4FN2 A;  4RM9 A;  1V6E A;  3QIJ A;  5TR5 A;  1OGW A;  1WJ4 A;  4W9E A;  2WX0 A;  3PT2 B;  4EUT A;  1RRB A;  4ANV A;  4PYU A;  3VH4 B;  3QX1 A;  4CYE A;  1XT9 B;  3K9O B;  4GXB A;  2AYO B;  1YX5 B;  4NAW A;  4J6I A;  1WGH A;  2KAN A;  2M4N A;  3V61 A;  4DBG A;  4PS8 A;  2KLC A;  1SIF A;  4BKT A;  4XZ4 A;  2PPH A;  2UWQ A;  2W9N A;  1TTN A;  2MWS B;  2L00 B;  3NY5 A;  1F9J A;  1P1A A;  3W1S A;  4IWP A;  1V80 A;  4II3 B;  4JIO U;  2ZEQ A;  3KUD B;  3EC8 A;  2Z0E B;  4HCN B;  2HTH A;  3PZD A;  1XD3 B;  2BGF A;  4NJ6 A;  2KLG A;  5KHO A;  3RUI B;  1WE6 A;  5L95 C;  2Z0D B;  2AL3 A;  4LDT B;  4BKS D;  2K39 A;  2M8S A;  5AZH A;  5C23 A;  5DCN A;  2LD9 A;  2D11 A;  1WJ6 A;  2I1K A;  4MJS A;  4WWO A;  4GU2 A;  2D07 B;  2K8H A;  2K6Q A;  4EKU A;  4WJQ A;  5L83 A;  2KQ7 A;  4GN1 A;  2KTF A;  3SD5 A;  3ZVV A;  2BKR B;  4IM2 A;  4TQ0 A;  3ZKJ C;  2V4L A;  4KV2 A;  5CHW A;  2KZR A;  3PHW B;  2GOW A;  3A9K B;  2M17 A;  4K81 A;  2DZI A;  2C7H A;  5C1Z A;  3A4R A;  2JXX A;  3M3J A;  1GJZ A;  3NZS A;  2KHW B;  4BBN C;  2RGF A;  2MA9 B;  2PEA A;  2FNJ B;  3PVL A;  4B9K A;  1RFA A;  2KO3 A;  3IBE A;  3JYU A;  4FJZ A;  4PYZ A;  4X57 B;  3UF8 A;  3GZN I;  4A20 A;  1E8Y A;  4W9K A;  2KX3 A;  2BF8 B;  4IM0 A;  3H7S A;  4MEL A;  3UQA A;  4W9C A;  3X0W A;  1OEY J;  2MBB B;  1WXA A;  3VHT C;  2KDI A;  3WIM A;  1WZ3 A;  1YIW A;  4ANW A;  1WY8 A;  2GBR A;  3K9P B;  2FCN A;  3DVN U;  4NNJ B;  2IO0 B;  3L0W B;  1V9J A;  3M63 B;  2C5L C;  4E74 A;  2BPS A;  2N9P C;  3PRM B;  4W9F A;  3ZNH B;  3V62 A;  1WGR A;  2KD0 A;  4MH0 E;  2ASQ A;  2VRR B;  3QJZ A;  2ZVO A;  2MLB A;  2FID A;  4RM8 A;  3RT3 B;  5DPR A;  2ZZP B;  3B08 A;  1A5R A;  1J19 A;  4NAW B;  4G0N B;  2KKC A;  4G3X B;  2XK5 A;  2JRH A;  4W9L A;  3ALB A;  2KC1 A;  4OVV A;  2A4Z A;  2JPH A;  3UIO B;  4BKG A;  3T9L A;  4ANX A;  2ZNV B;  5G2N A;  2FCS A;  1WZ0 A;  2GBJ A;  2KNB A;  3HM6 X;  4MGI E;  5FR6 A;  1V5T A;  4DHJ B;  3PHX B;  3PS6 A;  1E8X A;  1IYF A;  4W9I A;  3BY4 B;  1BT0 A;  4ZYN A;  2ZCC A;  2JRI B;  1YX6 B;  1GNU A;  2DAF A;  2JY6 A;  3PLU A;  1ZKH A;  4IM3 A;  4WQO B;  2EMS A;  2KQS A;  3IFW B;  1NI2 A;  2NBU A;  2N1V A;  2MBO A;  4KSL C;  1TGZ B;  1E8W A;  4HDQ A;  4PS7 A;  3KH0 A;  4MJS B;  4FAD A;  3ZTD A;  2IZV B;  3R7R A;  3L08 A;  3AU4 A;  5LLI A;  1CMX B;  2CHX A;  3A9J A;  3Q3F A;  5IAA C;  4FJY A;  3P2B A;  2LVQ A;  2MX2 A;  2PE9 A;  4BOZ B;  1KOT A;  3D32 A;  4FJV B;  5DPS A;  2C9W B;  3ZDT A;  4W9D A;  5HKH A;  1LXD A;  3L16 A;  1TZ1 A;  3PGE A;  2LZ6 A;  1WGD A;  3AUL A;  3H9D A;  2IBI B;  4AWJ A;  2RD0 A;  2KDB A;  3VXW A;  2L0F A;  4I6L B;  4LCD E;  3ZNG C;  5EDS A;  4BKS A;  1IPG A;  3APC A;  3RYT A;  1WIA A;  3UIP B;  3UGB B;  2QHO A;  5JHA A;  2GMI C;  1LFD A;  2BYF A;  1S3S G;  3ENE A;  3H6N A;  3QC8 B;  3ZUN A;  2ZCB A;  2KTR A;  3CST A;  3ECI A;  2IYD B;  3C0R B;  3IVF A;  1MG8 A; 
#chains in the Genus database with same CATH topology
 5AZF A;  2L7R A;  2N1W A;  3RZW C;  2N9X A;  1EUV B;  2JZ3 B;  1E90 A;  4II2 B;  5G5H A;  2WU5 B;  2LEK A;  2XK5 B;  1WRI A;  1E7U A;  1V86 A;  3HRD D;  1I4Q A;  5D3I B;  4EEW A;  4FUL A;  1D5X C;  2XBB C;  4P6V F;  1KRH A;  1ROE A;  4GDL A;  1JML A;  2WWZ A;  1FD6 A;  1IUE A;  2K25 A;  3AE8 B;  1PQS A;  3PO0 A;  4JQW C;  4G50 A;  4TQ1 A;  1J7C A;  1B1Z A;  1GC7 A;  1N61 A;  4OZC A;  4MGY E;  4ZHP A;  1STE A;  4XX5 A;  1FXT B;  1MJD A;  3V6E B;  1VJK A;  1K8R B;  1Z5S B;  1F2R I;  1FFU A;  4WJP A;  4JLC A;  4YTP B;  4HDO A;  4NJ7 A;  4B6W A;  1HE8 A;  2O6V D;  1VD2 A;  3OJ3 A;  2GB1 A;  4M8M A;  2DZJ A;  3QQ8 B;  4XE0 A;  1TBE A;  4DWF A;  2CKH B;  1SEB D;  2V1Y A;  2WXQ A;  2XEW A;  1XCT L;  4RGM A;  4MGZ E;  2NPT A;  2WGS A;  3R3M A;  3H7P B;  4IDI A;  2J7Q B;  1XO3 A;  2ZJD A;  2KC2 A;  2KWC A;  2KVZ A;  4GB9 A;  3SFD B;  1EU3 A;  2NS5 A;  2MH7 A;  2O6V B;  1WGY A;  3AI5 A;  1BUI C;  1L7Y A;  4WAF A;  1DGJ A;  3QA8 A;  1XF5 L;  1Q10 A;  3ZTC A;  3Q8E A;  4M0W A;  3WCQ A;  4ZDV A;  1JCK B;  1OEY A;  4LK0 M;  3RNC C;  1C9F A;  4DHZ B;  4HPL B;  3VH3 B;  2CJO A;  3Q8A A;  3SDL C;  4I6P A;  4K7W A;  1I4H A;  1YJ1 A;  3Q6B A;  1WMH B;  2Y5B B;  2VZK B;  2LHE A;  5E6J A;  2LRU A;  5E6N A;  2WYQ A;  4KGR A;  2J0J A;  2IY0 B;  5FR3 A;  4J3O D;  4KGS A;  3P1M A;  1PGX A;  1JRU A;  3OLM D;  4LNF A;  3EUB 2;  2NBV B;  3ML9 A;  3N9Y C;  2HJ8 A;  3R2T A;  1SXT A;  3C19 A;  4HVB A;  2JU6 X;  1R4M I;  1RM6 C;  4ASW C;  2HJ1 A;  3KYC D;  2CU3 A;  3FIL B;  2BWE S;  1P0R A;  1QZE A;  3PRZ A;  1KTK A;  4HJG E;  2KVR A;  4AQ7 A;  4FHK A;  4GOC A;  1P9D U;  1FPY A;  5D6J B;  4A90 A;  2M0X A;  3NJT A;  2PVG C;  2ZPN A;  2SEB D;  1G6J A;  3V05 A;  4IKG A;  2L8J A;  3Q8C A;  4MAC A;  3UIN B;  4ACF A;  3I63 C;  1Q1O A;  3JSV A;  2W55 A;  4RF1 A;  1DOI A;  3A33 B;  1HEZ E;  1U4A A;  3EEC A;  4DHJ D;  3BIN A;  2PW9 A;  3ZLZ A;  1BML C;  1GC6 A;  3IHP C;  4NAM A;  4WUR A;  4KDI C;  4GDK B;  3B1L X;  1OTR B;  2N0S B;  2DHZ A;  4ARC A;  2JUO A;  3A1Q B;  1Z2M A;  3TEX A;  1VRA B;  3AB5 A;  3UQB A;  3ZIM A;  3RNE C;  3N1X C;  2YEP F;  2KQ4 X;  5BO4 B;  2ZNV C;  3W1S C;  2HDE A;  1JRP A;  1K53 A;  3AM9 A;  1A70 A;  1F77 A;  5JHB A;  3B2F A;  3CSF A;  4WIP A;  2L52 A;  2ACZ B;  3VUY A;  4YXD B;  3ZJV A;  1TYG B;  2WXP A;  3AED B;  3VTW A;  2NBW B;  1FO4 A;  1WXS A;  3H1U A;  2PKO A;  1SIJ A;  3Q3M C;  1J8C A;  3HVD A;  3CMM B;  1R4M B;  4M02 A;  1WJ4 A;  4EUT A;  1RRB A;  1C4A A;  3N1Z C;  1NVI D;  3QX1 A;  1XT9 B;  2JZP A;  4NAW A;  1WGH A;  4OZB A;  2ON8 A;  2LGI A;  1TTN A;  3KUD B;  2Z0E B;  5KHO A;  3RUI B;  2M8S A;  3H8H A;  1WJ6 A;  4WWO A;  1GPX A;  2NTT A;  2K6Q A;  1QOG A;  1TS2 A;  3SFE B;  3ZVV A;  1I7H A;  3URY A;  4TQ0 A;  3OG5 A;  2V4L A;  5CHW A;  1JWB D;  2KZR A;  3A9K B;  4USA A;  2M56 B;  3M3J A;  2JXX A;  3NZS A;  2RGF A;  1TZO A;  2KO3 A;  1ZDX A;  5AUK A;  4RCO A;  2KX3 A;  3UQA A;  1FXI A;  3AE2 B;  1V1P A;  1FXA A;  2KDI A;  3WIM A;  5H92 C;  4ANW A;  4A9A A;  3ZJT A;  2FCN A;  3DVN U;  3AMZ A;  1ET6 A;  3P42 A;  2BB5 A;  1ZXH A;  1VZ6 A;  4W9F A;  4LNN A;  1WGR A;  2VRR B;  2ZVO A;  2MLB A;  3RT3 B;  1KH0 A;  1V97 A;  2ZZP B;  3TSS A;  1HA5 A;  4HRS A;  3CIR B;  2KKC A;  2XK5 A;  4W9L A;  4XWW A;  2A4Z A;  2BB6 A;  3RN9 C;  2JPH A;  2IJ0 A;  3HM6 X;  2KAJ A;  1V5T A;  3PS6 A;  1E8X A;  4ZYN A;  4LNO A;  3VRA B;  4CQN A;  1YX6 B;  2ICI A;  2KYW A;  4P16 A;  1SF0 A;  3R2I A;  4P1C C;  4HPP A;  2KQS A;  1E9M A;  1NI2 A;  2NBU A;  2MBO A;  4KSL C;  1ZE3 D;  1NEN B;  1E7P B;  1RWS A;  2QIE B;  3IAS 1;  1HZ6 A;  2LVQ A;  2KAC A;  2MX2 A;  4FJV B;  4W9D A;  2PMV A;  3L16 A;  2LZ6 A;  1QOB A;  2KDB A;  4I6L B;  3ZNG C;  5EDS A;  1CJE A;  3NVY A;  1SE3 A;  1FCC C;  2N9K A;  3W9C B;  4WH4 A;  2IGH A;  3QC8 B;  2ZCB A;  1ZP0 B;  1MG8 A;  1WX9 A;  2PVO D;  1L4D B;  3WAO A;  4EZL A;  2DBY A;  3I9V 1;  2CJN A;  2LI5 A;  1R4N I;  4JE3 B;  1V5O A;  3H7P A;  2BYV E;  3BVM A;  4EZK A;  3Q3N C;  1XLO A;  5LNK 1;  4HEA 1;  4FBJ B;  3CWI A;  2G4D B;  4IG7 B;  2J52 A;  4JX1 C;  2O6V A;  1P3Q U;  1UBI A;  4O1N A;  2DLB A;  1WR1 A;  4A8X C;  3C8Y A;  1WM3 A;  2MBQ A;  1VDV A;  1C79 A;  3RMK C;  2JWZ A;  3O65 B;  2DNF A;  3A9J B;  5AUI A;  1WGG A;  2Y5C A;  4PS3 A;  3ZW3 A;  3DPD A;  4XWT A;  3MHZ A;  3AEB B;  4WQM A;  1V49 A;  5GMV A;  3VUW A;  4LNK A;  2PTL A;  3MHS D;  4P7I A;  3APD A;  1QOA A;  3VUX A;  1WMH A;  1QOF A;  4C56 C;  1TT5 B;  3HHM A;  2JX5 A;  3E9S A;  3MFG A;  3DWM A;  1RYJ A;  1XLP A;  2WXL A;  2IY1 B;  3PV1 A;  4IUM B;  3KVF B;  3ETR A;  3KWV A;  1F52 A;  2KTR B;  1C3T A;  1MFW A;  4YSY B;  4KZC A;  5J18 A;  4RGN A;  3RI7 C;  2O2V B;  2IO2 B;  2LGY A;  5IP4 D;  3IG3 A;  1HTQ A;  2D10 A;  2ZPY A;  3BZD B;  3Q3J A;  3Q8B A;  2JT4 B;  4WWP A;  2JWU A;  3QAQ A;  3U4E G;  1ZDV A;  3GE3 C;  3OAW A;  3DBR I;  2MP2 B;  3KUC B;  1HZ5 A;  1EM7 A;  3FIL A;  2G3Q B;  4JPS A;  2BTE A;  3L4P A;  4OVZ A;  1DOX A;  4ANU A;  1L0V B;  2WXM A;  2AEH A;  2W3S A;  2N9E B;  1M4V A;  4YTN B;  2D3A A;  2KXJ A;  3U2S C;  3TEW A;  4RMA A;  4IWQ A;  2QCZ A;  1LQB A;  3P4S B;  1D3Z A;  5FK9 C;  2R61 A;  4ITK A;  1WYW B;  2VH2 A;  3BK1 A;  4HPM B;  1R4N B;  3HK0 A;  3VAW A;  2D3G A;  5BYR A;  2LVO A;  3ZQ4 A;  4JL9 A;  4LJO B;  3U30 A;  2I1J A;  4AJW A;  3R8B A;  1WYG A;  2BKF A;  2KN5 A;  1IBX B;  2YEP B;  3PSE B;  3VQI A;  4F7Z A;  2B76 B;  3NVZ A;  1C4P A;  3VTV A;  4GDK A;  3DVG X;  1WE7 A;  2AL6 A;  2KFJ A;  5IOI A;  3PTF C;  1L0X B;  4TKN A;  4US8 A;  1K52 A;  3KW5 B;  1GAQ B;  4E3C A;  5IKC M;  2CR5 A;  3A1Q A;  3RNA C;  3AXC A;  3RUL A;  1ZGU B;  3Q2A C;  2RR9 A;  1XLQ A;  1M94 A;  1SE9 A;  2KK8 A;  1KLV A;  4F1S A;  1L6U A;  4YWG G;  1FNW A;  2J0M A;  2PJH A;  3B9J A;  4HJK A;  1WFY A;  3PRE A;  4NZL B;  2EMT A;  3NS1 A;  2H88 B;  2MJD A;  2L05 A;  4ZRK A;  5BMH A;  5LXH A;  3RCZ A;  3WAM A;  3NS8 A;  2BVC A;  3APF A;  1HQR D;  4W9H A;  3ZGZ A;  4ZRI A;  1NYQ A;  2JF5 A;  4M8N A;  5E6O A;  1PGB A;  1X1M A;  3DDC B;  1FNU A;  3VFK A;  2WDR B;  1WM2 A;  4CHK A;  4NQL B;  1E8Z A;  3P4Q B;  3J9C A;  4ZRP A;  2J0K A;  2X8X X;  3DBR B;  3WAN A;  2OED A;  2WP9 B;  2D3B A;  2G45 B;  2KMC A;  4MSQ B;  1P7E A;  4FHJ A;  2IDY A;  4MT5 A;  3TEZ A;  1J0G A;  1JRO A;  1AW7 A;  3TEY A;  5J2R A;  4RNA A;  3DBH I;  1T0Y A;  1YQB A;  1YJI A;  1T0Q C;  3SHQ A;  3VRB B;  1QKZ A;  1V2Y A;  1CK1 A;  2BYE A;  3RNB C;  5DPT A;  1FFV A;  3BYT B;  1JWM D;  1TKG A;  2AQ1 B;  4HXD A;  2WXO A;  4DDG D;  3SU8 X;  4CO7 A;  2KOX A;  3QAR A;  4WAA A;  2KJH B;  4A3O A;  1WX8 A;  2YLM A;  4GIV A;  2MCN B;  2C60 A;  2DAJ A;  3PLV A;  3A9K A;  3PPA A;  3GE8 C;  4ZRJ A;  2M19 A;  4FA6 A;  1JQ4 A;  2IO3 B;  4DK5 A;  2LGD A;  1QF6 A;  2W54 A;  2N9L A;  1P98 A;  1OQY A;  1WSP A;  3QIJ A;  5TR5 A;  1OGW A;  2OHF A;  2WX0 A;  3TUO A;  4M01 A;  2BS4 B;  4CYE A;  2H89 B;  3K9O B;  2QDF A;  2AYO B;  4J6I A;  2PIA A;  4DBG A;  2WLB A;  4BKT A;  1F0Z A;  2PPH A;  4ZHO A;  2I38 A;  4IWP A;  2FBW B;  3EGR A;  4HCN B;  1P7F A;  3PZD A;  4NJ6 A;  2BW2 A;  2GLS A;  1ZUD 2;  4ZRQ A;  5DCN A;  2LD9 A;  2I1K A;  1UWM A;  4GU2 A;  2K8H A;  4EKU A;  4WJQ A;  2KQ7 A;  1DOY A;  4GN1 A;  3ZKJ C;  3AEE B;  2M17 A;  4K81 A;  2DZI A;  2W82 A;  2C7H A;  1T0S C;  1GJZ A;  2FNJ B;  1WGK A;  3PVL A;  1RFA A;  3JYU A;  3GZN I;  1E8Y A;  4W9K A;  1UF0 A;  4IM0 A;  4MEL A;  2BT6 A;  4W9C A;  4JWU C;  1OEY J;  1K51 A;  3ZYY X;  4AS1 A;  3ZXV A;  1AYF A;  1YIW A;  3MP9 A;  1UGJ A;  3DBH B;  1WWT A;  4NNJ B;  4TMA B;  1SJE D;  2BPS A;  2DWQ A;  5C3J B;  2LGS A;  2W3R A;  5DPR A;  2WXH A;  1J19 A;  2BBC A;  3ALB A;  2KC1 A;  2MJE A;  2Y5P A;  2TSS A;  1D6E C;  3UIO B;  2ZW1 A;  4ANX A;  2ZNV B;  1WZ0 A;  2GBJ A;  5FR6 A;  4DHJ B;  1YN5 A;  3DHG C;  4EE2 A;  1IYF A;  3BYY B;  1ZXI A;  2ZCC A;  4DQO C;  1ZOY B;  3LXF A;  4B0M A;  1YN3 A;  3U52 E;  3IFW B;  1FNV A;  1PGA A;  1LGR A;  2WXI A;  2N1V A;  5HG2 A;  4MJS B;  3ZTD A;  2WDV B;  3L08 A;  1CMX B;  2AX5 A;  3A9J A;  3Q3F A;  4FJY A;  3P2B A;  1L5P A;  2PE9 A;  1KOT A;  2N7J A;  1ZPS A;  1LXD A;  2L1A A;  4LCD E;  4BKS A;  1IPG A;  3RYT A;  2MJ3 A;  3UGB B;  4LTU A;  2I2Y A;  2BYF A;  1S3S G;  3ENE A;  3H6N A;  2XNA C;  2KTR A;  3IVF A;  5IAA C;  2FUH B;  2K22 A;  4H2A A;  2O2V A;  3W5U B;  2KMA A;  1UBQ A;  2DEN B;  1K50 A;  3VVW B;  1J7B A;  2RDH A;  3HVZ A;  4L2Y A;  3U7D A;  4OZA A;  1TIF A;  2L3Z A;  2MP2 A;  3RNG C;  3L54 A;  3QCA A;  3DVN V;  4L23 A;  3BII D;  1EO6 A;  3MJ5 A;  3QHT A;  4L1B A;  1GUA B;  2LJ5 A;  4IW0 A;  2WXG A;  1KF6 B;  2QIL A;  4WJO A;  3MC0 B;  4KDL B;  3IXS A;  1QQR A;  2FE8 A;  3GZN B;  3DQV A;  3LDZ E;  2NVU I;  2DYB A;  2HE7 A;  3QWZ B;  3ZNZ B;  2K5P A;  3ZRF A;  4C7Z A;  4PK1 A;  3B2G A;  3N3K B;  3JVZ X;  1EF5 A;  2K9X A;  1HTO A;  2KWV B;  1I42 A;  3L17 A;  1ZW7 A;  4LJP B;  3R7Q A;  4YT0 B;  3RFZ B;  1V1O A;  3IT4 B;  2ZW0 A;  3B0A A;  1V81 A;  1KLG D;  3U8Z A;  4NPN A;  4DXG A;  1IBX A;  3VR8 B;  4WJN A;  3W1Y A;  2RPV A;  3NHE B;  4LLG M;  4MGK E;  3EFC A;  4EOY A;  4ZYS A;  1EU4 A;  3IT6 B;  3NZU A;  1JWS D;  2OOB B;  4C80 A;  1Y56 A;  3EHV A;  3DOW A;  1VZ8 A;  4OVU A;  2B3A A;  2UU7 A;  3NVV A;  2BQQ A;  1MG4 A;  5JZE B;  4RFB A;  2MEK A;  4K1R B;  3EA6 A;  4MEM A;  5AEK B;  2QEJ C;  3N30 A;  4NY0 A;  2L0T A;  1S1Q B;  1C1Y B;  1WJN A;  1YD8 U;  2A5U A;  4AP4 C;  3ZRC A;  5JH5 C;  2IGD A;  2AWT A;  1VCB A;  1WXM A;  2WXK A;  2M0A A;  1PDX A;  2GBN A;  1FRD A;  3FAH A;  1IP9 A;  4DXF A;  2CHZ A;  1DYQ A;  1WXV A;  1SB3 C;  1QLB B;  1ESF A;  2SAK A;  3R66 C;  2G4S A;  3LJ3 A;  2FCQ A;  4XDD A;  3Q14 C;  4DDI D;  1Q0W B;  4XGA B;  3DVG Y;  2HD5 B;  5BMG A;  4C00 A;  4LDT D;  1ET9 A;  2R2Q A;  4AUQ C;  1GG3 A;  3AH7 A;  4KSK C;  2EEL A;  2DYO A;  3TJP A;  4YSX B;  3GOE A;  3T3N A;  4HRO A;  2NCN A;  4NQK E;  1I35 A;  3RNF C;  1QT9 A;  1WI0 A;  1WXQ A;  2WHI A;  3RD2 A;  1EF1 A;  3ZDM C;  1XLN A;  3NUH B;  3ZO5 B;  3NVW A;  2CS4 A;  4Q2J A;  2MQJ A;  2EKE C;  1FEH A;  3V60 A;  2RSU A;  2MRP A;  4HWI B;  1KFY B;  3KQ4 A;  4C4V B;  2IO1 B;  5C2T B;  4IC7 B;  3UI3 A;  1L6V A;  1UUP A;  2JZZ A;  4REZ A;  2Q5W D;  3Q8F A;  2C7N B;  2Z59 B;  1CZP A;  3QK0 A;  3CF6 E;  1D4B A;  2R2O A;  4WWN A;  4MSM B;  4KGT A;  1ACC A;  4MM3 B;  1J7A A;  2K3U A;  4KX6 B;  2JYT A;  4KIK B;  2G1E A;  3BVZ A;  3MC9 A;  2C7M B;  2KJR A;  2OJR A;  4KZ0 A;  1GB4 A;  4EZJ A;  1YJJ A;  1SGH A;  5CX3 A;  1YMH E;  3VDZ A;  2WX1 A;  1XCQ L;  2E3T A;  2RPQ A;  4K7U A;  4DHZ E;  1EWC A;  1PUT A;  2LMC A;  3I3T B;  1Y8R C;  2K1F A;  1BXT A;  3L13 A;  1UZX B;  3TL5 A;  4JGH B;  4A55 A;  4G11 A;  1TKE A;  1H4R A;  2QC8 A;  4US9 A;  2LJI A;  3ZXR A;  1KJT A;  2LRW A;  1TS3 A;  4OHJ A;  2LUE A;  2LGX A;  1WR6 E;  1WJU A;  5D94 A;  2QJL A;  1AAR A;  3HIZ A;  3KLS X;  4QAY A;  2FCM A;  4URK A;  5H8Y E;  3TCA A;  2IPK D;  3AEG B;  2V0G A;  1JWU D;  2WNM A;  2V9H A;  3EFU A;  2D2Q A;  2KFK B;  2KWD A;  4TV3 A;  1MI0 A;  5AZG A;  3WAP A;  1WH3 A;  2KN4 A;  3NG0 A;  2WXJ A;  4FN2 A;  5GXG B;  2E6X A;  1V6E A;  2OJW A;  4W9E A;  1VZ7 A;  3PT2 B;  3V3X A;  1N60 A;  2QMT A;  4RF0 A;  4PYU A;  5T8I A;  4GXB A;  1YNT E;  3NZ3 A;  1MHX A;  2M4N A;  3V61 A;  4PS8 A;  1SIF A;  4XZ4 A;  2W9N A;  3DWG C;  2MWS B;  2L00 B;  3W1S A;  1P1A A;  4II3 B;  2ZEQ A;  3SR6 A;  4N59 A;  1XD3 B;  5L95 C;  3I57 A;  4MJS A;  2J42 A;  2D07 B;  3OWE B;  3SD5 A;  3MC8 A;  4IM2 A;  1LO5 D;  4KV2 A;  4UDU C;  1YOV B;  3VR9 B;  1N5X A;  2KHW B;  1QIL A;  4BBN C;  1XEE A;  2MA9 B;  4B9K A;  4FJZ A;  4ARI A;  4A20 A;  4BAX A;  2BF8 B;  1VLB A;  3H7S A;  5TSS A;  5JXV A;  1WXA A;  1WZ3 A;  3BK2 A;  3AE7 B;  1MVK A;  1WY8 A;  2L32 A;  3GP7 A;  2C5L C;  2WU2 B;  2N9P C;  3PRM B;  3ZNH B;  4HKZ E;  5FKA C;  3V62 A;  2KD0 A;  4RM8 A;  3T3O A;  2G9H D;  3B08 A;  3SEB A;  2JRH A;  4OVV A;  1RFK A;  1PFD A;  2LHD A;  4BKG A;  3ABV B;  3Q3O C;  3T9L A;  3W2D A;  1I4P A;  2AQ2 B;  2FCS A;  5BYS A;  1CQV A;  3PHX B;  1NYR A;  2INN E;  3I5J C;  3BY4 B;  2J4X A;  1GNU A;  5BYQ A;  2DAF A;  3PLU A;  1ZKH A;  1NEK B;  3N1Y C;  1PYW D;  4R3D A;  2VZK D;  4HDQ A;  1TGZ B;  3AE9 B;  4PS7 A;  3KH0 A;  4FAD A;  1MPE A;  3R7R A;  1VR9 A;  5LLI A;  3AU4 A;  4RGT A;  3D32 A;  5DPS A;  2C9W B;  1R7S A;  3PGE A;  1TZ1 A;  1I4R A;  2IBI B;  4AWJ A;  3VXW A;  2L0F A;  3PZ7 A;  1WIA A;  1SBB B;  1YQ4 B;  3P63 A;  2QHO A;  2GMI C;  1LFD A;  1NI3 A;  2K0P A;  3CST A;  3C0R B;  2GRI A;  4K7S A;  1E5W A;  1T0R C;  4AOF A;  3BVG A;  3PRP B;  2KT7 A;  1FCL A;  2WS3 B;  3AE5 B;  2KDM A;  1N63 A;  1SSN A;  2GBM A;  2PE6 B;  4GGQ A;  4ICU A;  1WRD B;  1UWX A;  3MJW A;  4E71 A;  1TJE A;  2MBE A;  2YVC A;  4W9G A;  2VH1 A;  3DHI C;  3ZNI D;  4EFO A;  1GOZ A;  2DZK A;  3AU5 A;  4GMV A;  1JW9 D;  2N7E A;  2QSD A;  3M95 A;  5J17 A;  1F2R C;  2JYE A;  2WDT B;  2BS3 B;  2WXR A;  2N4F A;  1ENF A;  4W9J A;  4YTM B;  1WF9 A;  3HM3 A;  2DZM A;  3S2A A;  1GB1 A;  2J53 A;  3KUZ A;  1FM0 D;  4JWS C;  5DPW A;  4F8C B;  2FAZ A;  4XYC A;  3A4S C;  5EE0 A;  3ML8 A;  3IAM 1;  4KVG B;  1HXY D;  3AE3 B;  4LNI A;  1UEL A;  4BOS C;  3DBL I;  4IOI E;  5I4D A;  1Q5W B;  5HFY A;  2V3S A;  2GBK A;  4N6E B;  4BFR A;  4WWM A;  2K6D B;  5LXI B;  4HK2 A;  4OW0 A;  1SE4 A;  4GLS C;  1JAL A;  2CU1 A;  4GDL B;  4HCP B;  1OQQ A;  3PZ8 A;  5CHF A;  4FXC A;  3X23 A;  1N6Z A;  2N7D A;  1UD7 A;  3DBS A;  4C4V A;  2LVP A;  4MDK E;  2KWU B;  1H8C A;  1C77 A;  2XN9 C;  2BWF A;  1UGM A;  1TKY A;  1WX7 A;  4M00 A;  5E6P A;  4GSW A;  3AN1 A;  3WAL A;  3T8M A;  2KDF B;  1T5X D;  3P4P B;  4KKI A;  5BMI A;  1AWD A;  4MM3 A;  2INP E;  4KIK A;  3MTN B;  2X38 A;  3AEC B;  2KMM A;  5EE3 A;  2K8B A;  5IN7 A;  3RPF C;  5D7G A;  4BBN F;  3TMP B;  4P1B C;  4KKJ A;  4MH8 A;  1YN4 A;  2LXA A;  3HUI A;  4TUU A;  4FLH A;  3AE6 B;  1AN8 A;  2K8C A;  2FIF A;  5IO9 A;  4HLE A;  2M1M A;  2NPT B;  2LAS A;  2MHJ A;  4BVU C;  4TSS A;  1E10 A;  4A6Q A;  4IWO A;  4B0E A;  1EWY C;  4C7Y A;  2MW5 A;  2RDG A;  2EKI A;  2ZVN A;  3FKY A;  2Z8L A;  2JVC A;  2JXT A;  4I6N B;  4A3P A;  4S17 A;  1RAX A;  4K3C A;  1FMA D;  3NRZ A;  2REX A;  2DYM A;  4M0W B;  3WA0 A;  4AJY B;  1TS5 A;  3TIX A;  4S0R A;  2DX5 B;  5CHV C;  1SE2 A;  1OQR A;  1NBF C;  2KFK A;  3AE1 B;  3DBL B;  3RZF A;  2LWP A;  5IA7 A;  1LM8 B;  1L2N A;  1C76 A;  5D2M B;  4K3B A;  4YL8 A;  4B95 A;  2L76 A;  3AE4 B;  3KYD D;  3VTU A;  2RMM A;  2KX0 A;  1N5W A;  2JSV X;  1IGC A;  1ISN A;  1E6E B;  4XC2 A;  2AQ3 B;  3JW0 X;  5KHQ A;  1E7V A;  2MBH A;  2WXF A;  2NMQ A;  2NTS A;  1L0Y B;  3AV8 A;  2WDQ B;  1JWA D;  3KWL A;  3GB1 A;  4ZOH C;  3N20 C;  4N9F 4;  1RLF A;  3L10 B;  3OJ4 B;  5G55 A;  2PLP A;  4ICV A;  2CHW A;  2V3P A;  2BS2 B;  3V6C B;  2MSE D;  2UYZ B;  4DXA B;  3AEA B;  2KJ6 A;  3DCG A;  5CTR C;  3U7Z A;  1UH6 A;  3TBL D;  2NR2 A;  3N32 A;  4HKQ A;  3M62 B;  2LUM A;  4YSZ B;  1F1H A;  1E0Z A;  1XQQ A;  1YQ3 B;  3ONS A;  4PT5 A;  4N58 A;  1NDD A;  3JSV B;  3NOB A;  1TS4 A;  5EE1 A;  1KM7 A;  2KDE B;  3Q69 A;  2LXC A;  5EE9 A;  4RM9 A;  1N62 A;  1C78 A;  4ANV A;  2HTM E;  2JQR B;  3VH4 B;  1YX5 B;  2KAN A;  1UNS A;  5HHD G;  2KLC A;  2UWQ A;  3NY5 A;  1F9J A;  1L4Z B;  3BWU D;  1V80 A;  4D2K A;  1B9R A;  4JIO U;  3EC8 A;  2HTH A;  1MHH E;  2BGF A;  2KLG A;  1WE6 A;  2Z0D B;  2AL3 A;  4LDT B;  4BKS D;  2K39 A;  1V8C A;  5AZH A;  5C23 A;  2D11 A;  2D5G A;  2V4I B;  4NJC A;  4RH6 A;  2LFI A;  2GI9 A;  5L83 A;  1TY0 A;  2KTF A;  2BKR B;  2ONQ A;  3PHW B;  2GOW A;  1FIQ A;  5C1Z A;  3A4R A;  2PEA A;  3IBE A;  3P4R B;  4PYZ A;  4X57 B;  3UF8 A;  2WQY B;  3X0W A;  2MBB B;  2IGG A;  3VHT C;  1T6B X;  3E56 A;  3AEF B;  4XDC A;  2GBR A;  3K9P B;  2V3N A;  2IO0 B;  3L0W B;  1V9J A;  5MPO A;  3M63 B;  4E74 A;  3LYY A;  4MH0 E;  2ASQ A;  3QJZ A;  2L83 A;  2FID A;  4RGO S;  1I4X A;  1A5R A;  4NAW B;  4G0N B;  3W5V B;  4G3X B;  1TY2 A;  1OFF A;  3LB8 C;  1C4C A;  2WXN A;  5D3D A;  1SJH D;  3GS2 A;  5G2N A;  4MGI E;  2KNB A;  1D5M C;  5G5G A;  2FUG 1;  1KLU D;  3FC4 A;  4W9I A;  4BZA A;  1BT0 A;  2JRI B;  2RDB C;  1FRR A;  1T3Q A;  2JY6 A;  4IM3 A;  4WQO B;  2EMS A;  3DHH C;  3ZJU A;  2Y3A A;  1E8W A;  2BYT A;  1D5Z C;  2IZV B;  2CHX A;  2D3C A;  4BOZ B;  3ZDT A;  5HKH A;  1XXG A;  3O13 A;  1WGD A;  3AUL A;  3H9D A;  2RD0 A;  5HI1 A;  3APC A;  2IND C;  1V1P B;  1IGD A;  3UIP B;  5JHA A;  3ZUN A;  2INC C;  1I4G A;  3ECI A;  2IYD B; 
#chains in the Genus database with same CATH homology
 1WX9 A;  5AZF A;  2FUH B;  3WAO A;  4EZL A;  2L7R A;  1E5W A;  2N1W A;  2O2V A;  3RZW C;  2N9X A;  2LI5 A;  4AOF A;  1R4N I;  1EUV B;  2JZ3 B;  2KMA A;  1V5O A;  1UBQ A;  3PRP B;  2DEN B;  1E90 A;  3H7P A;  2BYV E;  4EZK A;  4II2 B;  3VVW B;  2XK5 B;  1E7U A;  3U7D A;  1V86 A;  2GBM A;  2PE6 B;  4GGQ A;  4FBJ B;  2L3Z A;  2MP2 A;  2G4D B;  4ICU A;  4IG7 B;  4EEW A;  3L54 A;  1WRD B;  3QCA A;  3DVN V;  1EO6 A;  2O6V A;  3MJW A;  3QHT A;  4FUL A;  1P3Q U;  2XBB C;  1GUA B;  1UBI A;  4E71 A;  2LJ5 A;  2MBE A;  4IW0 A;  2YVC A;  1WR1 A;  4GDL A;  4WJO A;  2WWZ A;  4W9G A;  2K25 A;  1PQS A;  4JQW C;  4KDL B;  4G50 A;  3ZNI D;  4EFO A;  1WM3 A;  2DZK A;  3AU5 A;  2MBQ A;  4TQ1 A;  4GMV A;  2N7E A;  3DQV A;  3LDZ E;  2NVU I;  1GC7 A;  2DYB A;  2HE7 A;  2JWZ A;  3O65 B;  3QWZ B;  3M95 A;  4MGY E;  3ZNZ B;  5J17 A;  3A9J B;  2WDT B;  1WGG A;  4XX5 A;  1FXT B;  3V6E B;  3ZRF A;  4PS3 A;  3ZW3 A;  3DPD A;  3N3K B;  3JVZ X;  1K8R B;  2N4F A;  4W9J A;  1EF5 A;  1V49 A;  1WF9 A;  2KWV B;  1Z5S B;  4WJP A;  5GMV A;  1I42 A;  3HM3 A;  3L17 A;  4JLC A;  1ZW7 A;  3VUW A;  2DZM A;  3S2A A;  3MHS D;  4P7I A;  3KUZ A;  3APD A;  4HDO A;  5DPW A;  4LJP B;  4NJ7 A;  2FAZ A;  3R7Q A;  3VUX A;  4B6W A;  4F8C B;  1HE8 A;  1WMH A;  3A4S C;  2O6V D;  1VD2 A;  3HHM A;  3ML8 A;  3OJ3 A;  4M8M A;  3B0A A;  4KVG B;  1V81 A;  2IY1 B;  3PV1 A;  4IUM B;  3KVF B;  2DZJ A;  1UEL A;  2KTR B;  3QQ8 B;  3U8Z A;  1C3T A;  1TBE A;  4NPN A;  2CKH B;  4BOS C;  4DWF A;  4WJN A;  3W1Y A;  4KZC A;  5J18 A;  3DBL I;  3NHE B;  2O2V B;  2IO2 B;  2V1Y A;  2LGY A;  4MGK E;  4EOY A;  2XEW A;  3IG3 A;  1Q5W B;  2D10 A;  3NZU A;  2ZPY A;  4MGZ E;  2NPT A;  3R3M A;  3Q3J A;  3H7P B;  2OOB B;  2JT4 B;  4WWP A;  3QAQ A;  2J7Q B;  2V3S A;  2GBK A;  3EHV A;  2ZJD A;  3DOW A;  2KC2 A;  2KWC A;  4BFR A;  4OVU A;  2B3A A;  3DBR I;  3OAW A;  2MP2 B;  3KUC B;  4K7S A;  2K6D B;  4GB9 A;  5JZE B;  2NS5 A;  5LXI B;  4HK2 A;  2O6V B;  1WGY A;  2G3Q B;  3AI5 A;  4K1R B;  1L7Y A;  4MEM A;  5AEK B;  2CU1 A;  4GDL B;  4ANU A;  3QA8 A;  4HCP B;  3N30 A;  4NY0 A;  5CHF A;  3X23 A;  2L0T A;  3ZTC A;  1S1Q B;  2N7D A;  1C1Y B;  1UD7 A;  2AEH A;  3DBS A;  1WJN A;  1YD8 U;  2A5U A;  2LVP A;  2N9E B;  4AP4 C;  4ZDV A;  3ZRC A;  5JH5 C;  4MDK E;  2KWU B;  1H8C A;  2AWT A;  1VCB A;  2KXJ A;  1OEY A;  1WXM A;  4RMA A;  4IWQ A;  2BWF A;  1UGM A;  1WX7 A;  5E6P A;  4GSW A;  4DHZ B;  4HPL B;  3VH3 B;  2GBN A;  1LQB A;  3T8M A;  3WAL A;  1IP9 A;  2KDF B;  1D3Z A;  1WYW B;  2CHZ A;  1WXV A;  4HPM B;  4MM3 A;  3SDL C;  4I6P A;  3R66 C;  4K7W A;  4KIK A;  3MTN B;  1YJ1 A;  3HK0 A;  3VAW A;  2K8B A;  1WMH B;  2D3G A;  2G4S A;  2Y5B B;  3LJ3 A;  2FCQ A;  2LVO A;  5D7G A;  4JL9 A;  4BBN F;  4LJO B;  2LRU A;  5E6N A;  3U30 A;  2I1J A;  3TMP B;  4DDI D;  1Q0W B;  4AJW A;  2WYQ A;  3DVG Y;  2BKF A;  2J0J A;  2KN5 A;  2IY0 B;  3PSE B;  2HD5 B;  2LXA A;  3VQI A;  4TUU A;  4F7Z A;  1JRU A;  3VTV A;  3OLM D;  4GDK A;  4LDT D;  4FLH A;  2R2Q A;  4AUQ C;  3DVG X;  1WE7 A;  2AL6 A;  1GG3 A;  2KFJ A;  2K8C A;  3PTF C;  2FIF A;  4HLE A;  2NBV B;  3ML9 A;  4KSK C;  2M1M A;  2HJ8 A;  2NPT B;  4TKN A;  2LAS A;  4BVU C;  2DYO A;  3KW5 B;  3TJP A;  4HVB A;  1R4M I;  3GOE A;  4IWO A;  4E3C A;  2CR5 A;  3A1Q A;  4NQK E;  2NCN A;  4ASW C;  3AXC A;  2MW5 A;  3KYC D;  1I35 A;  3RUL A;  1ZGU B;  2RR9 A;  1M94 A;  1SE9 A;  1WI0 A;  2KK8 A;  3RD2 A;  1KLV A;  1EF1 A;  2ZVN A;  3ZDM C;  4F1S A;  2BWE S;  2JVC A;  4A3P A;  4I6N B;  1P0R A;  3ZO5 B;  1QZE A;  3PRZ A;  2J0M A;  2CS4 A;  2MQJ A;  1RAX A;  2EKE C;  2KVR A;  3V60 A;  2RSU A;  2MRP A;  2PJH A;  4FHK A;  4GOC A;  4HWI B;  1P9D U;  2REX A;  2DYM A;  4M0W B;  5D6J B;  3WA0 A;  2M0X A;  2IO1 B;  4HJK A;  1WFY A;  3PRE A;  4AJY B;  4IC7 B;  2EMT A;  2JZZ A;  4ZRK A;  2L05 A;  2ZPN A;  3TIX A;  5LXH A;  2C7N B;  2Z59 B;  3RCZ A;  2DX5 B;  1G6J A;  5CHV C;  3WAM A;  3QK0 A;  1NBF C;  3CF6 E;  3APF A;  3NS8 A;  2KFK A;  2L8J A;  2R2O A;  4WWN A;  4MSM B;  3UIN B;  3RZF A;  4W9H A;  1Q1O A;  2LWP A;  3JSV A;  4KIK B;  4ZRI A;  5IA7 A;  1LM8 B;  2JF5 A;  4M8N A;  1L2N A;  5E6O A;  2C7M B;  2KJR A;  5D2M B;  3A33 B;  1X1M A;  2OJR A;  3DDC B;  4YL8 A;  3VFK A;  4KZ0 A;  1WM2 A;  4B95 A;  1U4A A;  4CHK A;  4EZJ A;  3EEC A;  2L76 A;  4NQL B;  1E8Z A;  4DHJ D;  1SGH A;  3BIN A;  3KYD D;  5CX3 A;  3VTU A;  2KX0 A;  3ZLZ A;  2J0K A;  1GC6 A;  3VDZ A;  3WAN A;  2WX1 A;  3IHP C;  2G45 B;  2KMC A;  4MSQ B;  1ISN A;  4FHJ A;  4KDI C;  2RPQ A;  4XC2 A;  4K7U A;  4GDK B;  4DHZ E;  3B1L X;  3JW0 X;  5KHQ A;  1E7V A;  1OTR B;  3I3T B;  1J0G A;  2MBH A;  1Y8R C;  2K1F A;  3L13 A;  2DHZ A;  5J2R A;  1UZX B;  3DBH I;  2JUO A;  1T0Y A;  3TL5 A;  1YQB A;  4JGH B;  4G11 A;  3A1Q B;  1H4R A;  3SHQ A;  1Z2M A;  4N9F 4;  1RLF A;  3L10 B;  3OJ4 B;  5G55 A;  1KJT A;  2LRW A;  4ICV A;  3UQB A;  1V2Y A;  3ZIM A;  2CHW A;  5BO4 B;  2BYE A;  2LUE A;  2LGX A;  5DPT A;  2ZNV C;  3W1S C;  1WR6 E;  1WJU A;  5D94 A;  4HXD A;  1AAR A;  3HIZ A;  3SU8 X;  3V6C B;  4DDG D;  2MSE D;  2UYZ B;  4CO7 A;  2FCM A;  4DXA B;  2KOX A;  4URK A;  3QAR A;  2KJ6 A;  3DCG A;  4WAA A;  3TCA A;  5CTR C;  2KJH B;  4A3O A;  1WX8 A;  2YLM A;  4GIV A;  5JHB A;  1UH6 A;  3TBL D;  2MCN B;  2NR2 A;  2C60 A;  2DAJ A;  3PLV A;  3A9K A;  3CSF A;  3N32 A;  3EFU A;  3M62 B;  3VUY A;  2D2Q A;  2KFK B;  3PPA A;  1XQQ A;  4ZRJ A;  3ONS A;  3VTW A;  2NBW B;  1WXS A;  1NDD A;  4FA6 A;  3H1U A;  3JSV B;  3NOB A;  2IO3 B;  4TV3 A;  5AZG A;  3WAP A;  1KM7 A;  4DK5 A;  1WH3 A;  2LGD A;  2KDE B;  1J8C A;  1P98 A;  1OQY A;  2LXC A;  3CMM B;  4FN2 A;  4RM9 A;  1V6E A;  3QIJ A;  5TR5 A;  1OGW A;  1WJ4 A;  4W9E A;  2WX0 A;  3PT2 B;  4EUT A;  1RRB A;  4ANV A;  4PYU A;  3VH4 B;  3QX1 A;  4CYE A;  1XT9 B;  3K9O B;  4GXB A;  2AYO B;  1YX5 B;  4NAW A;  4J6I A;  1WGH A;  2KAN A;  2M4N A;  3V61 A;  4DBG A;  4PS8 A;  2KLC A;  1SIF A;  4BKT A;  4XZ4 A;  2PPH A;  2UWQ A;  2W9N A;  1TTN A;  2MWS B;  2L00 B;  3NY5 A;  1F9J A;  1P1A A;  3W1S A;  4IWP A;  1V80 A;  4II3 B;  4JIO U;  2ZEQ A;  3KUD B;  3EC8 A;  2Z0E B;  4HCN B;  2HTH A;  3PZD A;  1XD3 B;  2BGF A;  4NJ6 A;  2KLG A;  5KHO A;  3RUI B;  1WE6 A;  5L95 C;  2Z0D B;  2AL3 A;  4LDT B;  4BKS D;  2K39 A;  2M8S A;  5AZH A;  5C23 A;  5DCN A;  2LD9 A;  2D11 A;  1WJ6 A;  2I1K A;  4MJS A;  4WWO A;  4GU2 A;  2D07 B;  2K8H A;  2K6Q A;  4EKU A;  4WJQ A;  5L83 A;  2KQ7 A;  4GN1 A;  2KTF A;  3SD5 A;  3ZVV A;  2BKR B;  4IM2 A;  4TQ0 A;  3ZKJ C;  2V4L A;  4KV2 A;  5CHW A;  2KZR A;  3PHW B;  2GOW A;  3A9K B;  2M17 A;  4K81 A;  2DZI A;  2C7H A;  5C1Z A;  3A4R A;  2JXX A;  3M3J A;  1GJZ A;  3NZS A;  2KHW B;  4BBN C;  2RGF A;  2MA9 B;  2PEA A;  2FNJ B;  3PVL A;  4B9K A;  1RFA A;  2KO3 A;  3IBE A;  3JYU A;  4FJZ A;  4PYZ A;  4X57 B;  3UF8 A;  3GZN I;  4A20 A;  1E8Y A;  4W9K A;  2KX3 A;  2BF8 B;  4IM0 A;  3H7S A;  4MEL A;  3UQA A;  4W9C A;  3X0W A;  1OEY J;  2MBB B;  1WXA A;  3VHT C;  2KDI A;  3WIM A;  1WZ3 A;  1YIW A;  4ANW A;  1WY8 A;  2GBR A;  3K9P B;  2FCN A;  3DVN U;  4NNJ B;  2IO0 B;  3L0W B;  1V9J A;  3M63 B;  2C5L C;  4E74 A;  2BPS A;  2N9P C;  3PRM B;  4W9F A;  3ZNH B;  3V62 A;  1WGR A;  2KD0 A;  4MH0 E;  2ASQ A;  2VRR B;  3QJZ A;  2ZVO A;  2MLB A;  2FID A;  4RM8 A;  3RT3 B;  5DPR A;  2ZZP B;  3B08 A;  1A5R A;  1J19 A;  4NAW B;  4G0N B;  2KKC A;  4G3X B;  2XK5 A;  2JRH A;  4W9L A;  3ALB A;  2KC1 A;  4OVV A;  2A4Z A;  2JPH A;  3UIO B;  4BKG A;  3T9L A;  4ANX A;  2ZNV B;  5G2N A;  2FCS A;  1WZ0 A;  2GBJ A;  2KNB A;  3HM6 X;  4MGI E;  5FR6 A;  1V5T A;  4DHJ B;  3PHX B;  3PS6 A;  1E8X A;  1IYF A;  4W9I A;  3BY4 B;  1BT0 A;  4ZYN A;  2ZCC A;  2JRI B;  1YX6 B;  1GNU A;  2DAF A;  2JY6 A;  3PLU A;  1ZKH A;  4IM3 A;  4WQO B;  2EMS A;  2KQS A;  3IFW B;  1NI2 A;  2NBU A;  2N1V A;  2MBO A;  4KSL C;  1TGZ B;  1E8W A;  4HDQ A;  4PS7 A;  3KH0 A;  4MJS B;  4FAD A;  3ZTD A;  2IZV B;  3R7R A;  3L08 A;  3AU4 A;  5LLI A;  1CMX B;  2CHX A;  3A9J A;  3Q3F A;  5IAA C;  4FJY A;  3P2B A;  2LVQ A;  2MX2 A;  2PE9 A;  4BOZ B;  1KOT A;  3D32 A;  4FJV B;  5DPS A;  2C9W B;  3ZDT A;  4W9D A;  5HKH A;  1LXD A;  3L16 A;  1TZ1 A;  3PGE A;  2LZ6 A;  1WGD A;  3AUL A;  3H9D A;  2IBI B;  4AWJ A;  2RD0 A;  2KDB A;  3VXW A;  2L0F A;  4I6L B;  4LCD E;  3ZNG C;  5EDS A;  4BKS A;  1IPG A;  3APC A;  3RYT A;  1WIA A;  3UIP B;  3UGB B;  2QHO A;  5JHA A;  2GMI C;  1LFD A;  2BYF A;  1S3S G;  3ENE A;  3H6N A;  3QC8 B;  3ZUN A;  2ZCB A;  2KTR A;  3CST A;  3ECI A;  2IYD B;  3C0R B;  3IVF A;  1MG8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...