1WXVA

Solution structure of the ubiquitin domain of bcl-2 binding athanogene-1
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
92
structure length
92
Chain Sequence
GSSGSSGLTVTVTHSNEKHDLHVTSQQGSSEPVVQDLAQVVEEVIGVPQSFQKLIFKGKSLKEMETPLSALGIQDGCRVMLIGKKNSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords BAG-family molecular chaperone regulator-1
publication title Solution structure of the ubiquitin domain of BCL-2 binding athanogene-1
rcsb
source organism Homo sapiens
total genus 13
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2005-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wxvA01
3UIPB 3WAPA 4I6NB 3QX1A 2I1JA 4K7SA 4KIKB 4JLCA 2DYOA 1WJ4A 4F8CB 2R2OA 5CTRC 4IM2A 4AWJA 3ZTDA 4FHJA 2LUEA 3A9JB 2KWUB 3KYDD 3WAOA 3H1UA 5JH5C 2DAJA 1WX7A 4W9GA 4LCDE 3AU4A 1P0RA 2K8HA 3APCA 2NBWB 4ICVA 2IO0B 2NS5A 3LJ3A 4A3PA 2NBVB 3VXWA 3I3TB 2KDFB 4RMAA 3ZUNA 2D2QA 3L0WB 2JXXA 4OVUA 2KC1A 5BO4B 4W9CA 4MGYE 2C7MB 2BGFA 4F7ZA 1UD7A 3NY5A 1UZXB 4I6LB 4ASWC 4HJKA 3EFUA 3ECIA 5D6JB 1EO6A 2GBMA 4DHZE 1WGRA 2RSUA 4WWNA 3D32A 2REXA 3S2AA 1WGDA 2ZCCA 3ZW3A 4BVUC 2D07B 3ZO5B 4URKA 1J19A 1KOTA 1R4MI 4ZRIA 4AJYB 3UQBA 3UQAA 2ZNVC 1OTRB 1VD2A 4K7WA 3N32A 4PYZA 1ISNA 3KYCD 2Z0DB 4F1SA 2IBIB 2ZPYA 4W9DA 3EHVA 4YL8A 5DPTA 5KHQA 1WF9A 4IWPA 1LXDA 1ZKHA 2FCSA 3DVNU 3L17A 3NHEB 3BINA 3KUDB 4GOCA 2JUOA 1WXMA 3CMMB 4TQ1A 4GMVA 2IO3B 2N7EA 4WWPA 5D2MB 5LLIA 3RT3B 2UYZB 3JYUA 2ZJDA 3A9KA 3U30A 2G45B 1S3SG 3VVWB 2JT4B 2K8CA 5LXIB 5L83A 2J0MA 5L95C 1WM2A 5CX3A 2D3GA 4IC7B 3DCGA 2M17A 2DYBA 2C7NB 4BOSC 4LJPB 4MJSB 4GN1A 1WJUA 2L3ZA 3IFWB 2Y5BB 2KC2A 1OGWA 4KDIC 3K9OB 2BKRB 5C1ZA 2QHOA 2XEWA 5C23A 2BPSA 4HPLB 2BYVE 2KDEB 4TUUA 4A20A 1V5OA 3RYTA 2JF5A 2KWCA 3SU8X 2MCNB 1GJZA 4HDQA 4BKGA 2DZKA 2MBEA 3CF6E 3M3JA 4E74A 3DBHI 5CHVC 4NNJB 3R7RA 3Q3FA 3L10B 1P98A 1SGHA 4K1RB 4GXBA 3WAMA 2G4DB 2MA9B 2FNJB 4M8NA 2K25A 2K6QA 3PV1A 4GDLA 1A5RA 3QCAA 5DPSA 1JRUA 2DZJA 1WR1A 2LVPA 2JRIB 4W9HA 3PGEA 4EZLA 2N1VA 2GBRA 2KLCA 4W9EA 2AL3A 2RGFA 2KO3A 5JHBA 2D11A 3A1QA 3UF8A 4MSMB 4DXAB 3TL5A 4CO7A 3EC8A 3ZIMA 2AYOB 1IPGA 2JVCA 4HK2A 3NZUA 4NQLB 2XBBC 3WIMA 4KVGB 4WJPA 4JL9A 2A4ZA 3ZNHB 4KDLB 2FUHB 4HDOA 4LJOB 1KJTA 1S1QB 2L76A 2KX3A 2XK5A 4FBJB 2MBOA 4II2B 2NR2A 3VDZA 3KUZA 1C3TA 4FJVB 4DHJB 2GMIC 4IWOA 1TBEA 4W9LA 3V6CB 3ZNID 2GOWA 4WWOA 3RD2A 3PS6A 4XC2A 1UBIA 4WJQA 5DPRA 1I35A 1WI0A 4MM3A 3M63B 4MGZE 2R2QA 3R7QA 2K1FA 4HCPB 2Z59B 2ASQA 3PZDA 2DZIA 4LDTB 2IY1B 4FJZA 1WMHA 2EMSA 4B95A 2A5UA 2WWZA 5TR5A 1L7YA 1WR6E 1LM8B 4GDLB 4IG7B 4E71A 3PTFC 3R3MA 3VH4B 1H4RA 3H7SA 4GIVA 5E6OA 2LRUA 2IO2B 1GC7A 3W1SA 2KANA 2BWFA 1YIWA 1KM7A 4PYUA 4BKSD 1IP9A 3DVGY 2LXCA 1J0GA 1V49A 2CHXA 2UWQA 2G4SA 2C5LC 4P7IA 2KQSA 4KZCA 4NPNA 3A1QB 3CSFA 3QC8B 3X23A 5J17A 2O6VA 4KV2A 5J18A 3V60A 1BT0A 2KKCA 4M0WB 3A4RA 5DCNA 3PHXB 1T0YA 3SHQA 1OEYA 1WFYA 2LZ6A 2FIDA 3QAQA 2KWVB 2IO1B 3VH3B 2L05A 2CR5A 2MBHA 2CHWA 2MBBB 3DBSA 3QARA 2M8SA 2XK5B 2ZCBA 3AI5A 3BY4B 3PT2B 3TBLD 4B6WA 2MP2A 3B08A 4I6PA 4G50A 1LQBA 3P2BA 4W9JA 2LVQA 1P1AA 1PQSA 1Q0WB 3PLVA 2KJRA 4K81A 4ZRKA 1E7VA 1UH6A 2LWPA 3A4SC 4NJ7A 4HVBA 1U4AA 1TTNA 3CSTA 4ZYNA 5LXHA 3H6NA 3AULA 4G3XB 4G11A 2NCNA 2N9EB 4ICUA 3PPAA 1FXTB 5HKHA 2BYFA 4WJOA 4DK5A 2FAZA 2FCMA 2L0FA 2V1YA 2N9PC 4EZJA 5J2RA 1YX6B 2JWZA 2Z0EB 2YVCA 4OVVA 2JZ3B 2LI5A 3JSVA 1Q5WB 1ZGUB 1OQYA 1E8WA 2BKFA 1EF5A 2WX1A 4FJYA 3B0AA 4A3OA 1F9JA 2I1KA 3DQVA 5AZHA 4PS3A 3MHSD 1M94A 2PEAA 4FLHA 2O6VB 2WX0A 3V6EB 2DZMA 3QK0A 3ZNZB 2B3AA 4BBNC 4HWIB 2MLBA 1L2NA 1UGMA 3L08A 3K9PB 2DX5B 3R66C 2KMAA 4HXDA 5CHFA 3ZKJC 2LD9A 4GGQA 1R4NI 2K39A 3ONSA 5D7GA 4NAWA 4FADA 4KSLC 1WJ6A 4M8MA 4CHKA 1E90A 3PRZA 2MQJA 4KZ0A 2O2VA 2MP2B 2KFJA 3SDLC 3ZTCA 1WX8A 4WAAA 4BOZB 3HHMA 3IVFA 3RZFA 4TKNA 4W9IA 4ANVA 2NVUI 2NBUA 4KSKC 3PRPB 1Q1OA 2DENB 4JIOU 3T9LA 1V80A 4ZRJA 4EEWA 1H8CA 4MEMA 4KIKA 2OJRA 3A9KB 4JQWC 3VTUA 3PRMB 2ZNVB 2NPTA 4AP4C 4NJ6A 1SIFA 1WGYA 2EKEC 2VRRB 1K8RB 2KLGA 3DVGX 3O65B 3H9DA 3PVLA 3JSVB 4GB9A 3QHTA 2KXJA 2PE6B 2J0JA 2WDTB 3HM3A 3WALA 4EZKA 2PJHA 1EUVB 3RUIB 2MBQA 3EECA 2J0KA 1SE9A 1X1MA 3QQ8B 1WXAA 2WYQA 1Z2MA 4NY0A 5D94A 5AZFA 2FIFA 3TMPB 2RD0A 2IYDB 2KDBA 3VTVA 4HCNB 3VFKA 3L54A 3ML8A 1GNUA 1J8CA 3QJZA 3VUWA 3MTNB 1GUAB 3PREA 2HTHA 2L00B 4HPMB 1WY8A 2MRPA 3ALBA 3HK0A 3N3KB 1UELA 2N7DA 4MDKE 3RULA 4DDGD 1MG8A 2LVOA 2ZVNA 1I42A 1V5TA 2AL6A 4EFOA 1XT9B 2BWES 3DBRI 3VQIA 3VUXA 1LFDA 1V86A 4DWFA 4FA6A 2FCQA 4W9KA 1UBQA 1GC6A 4IM0A 4WJNA 3DVNV 3KW5B 4XX5A 2NPTB 3H7PA 3DOWA 2DHZA 4CYEA 2FCNA 1WGHA 3ZRFA 1YQBA 2C9WB 3OAWA 5GMVA 2LXAA 4N9F4 4IW0A 2M0XA 5EDSA 1WX9A 2KJHB 5JZEB 2N1WA 1WZ0A 3L13A 1CMXB 1WYWB 3U7DA 3T8MA 1E8ZA 4MJSA 3VUYA 2LGYA 1NBFC 3TIXA 1GG3A 1Z5SB 4GU2A 2ZVOA 1RLFA 1WE6A 1TGZB 3U8ZA 4BBNF 2KTFA 1YD8U 4K7UA 3VAWA 1V6EA 3ZNGC 3ZVVA 2HE7A 2JZZA 4MSQB 3W1YA 1IYFA 3UGBB 4BKSA 1WE7A 2GBJA 3WANA 4EOYA 4G0NB 3ENEA 3QIJA 2HD5B 2CKHB 4AUQC 1WMHB 1E8XA 5KHOA 3MJWA 4DHJD 1Y8RC 1WXSA 4TV3A 4MGIE 4IM3A 4EUTA 2RPQA 2W9NA 1V9JA 1YX5B 1AARA 1WH3A 2KNBA 2JY6A 4DBGA 3JW0X 4B9KA 4EKUA 4II3B 2V4LA 3JVZX 4GSWA 3VHTC 2ZEQA 3AXCA 2OOBB 3HIZA 4LDTD 5G55A 2KVRA 1WZ3A 4XZ4A 1XQQA 4FN2A 2ZZPB 2KTRA 4E3CA 4RM8A 3H7PB 2LGDA 2RR9A 2CHZA 4GDKA 3IG3A 4MELA 3TJPA 3DPDA 3HM6X 4DHZB 3PLUA 2ZPNA 1YJ1A 3RCZA 3C0RB 2JRHA 1G6JA 3QWZB 4J6IA 3M95A 4JGHB 3AU5A 4ANWA 3IHPC 2K8BA 2BYEA 3WA0A 2IY0B 1KLVA 2KJ6A 2CU1A 2DAFA 2LGXA 3IBEA 5AZGA 5CHWA 4BFRA 4WQOB 3B1LX 2LRWA 1NI2A 3V61A 2DYMA 4DDID 3NS8A 2KFKA 3X0WA 3L16A 4IWQA 2C7HA 3NOBA 4W9FA 4MH0E 3OJ3A 1QZEA 2MX2A 1E5WA 2L7RA 2MW5A 4BKTA 1WM3A 2J7QB 2KDIA 3PHWB 3UIOB 4AJWA 3APFA 1WRDB 2V3SA 4ANXA 3LDZE 2KN5A 2HJ8A 1E7UA 3DDCB 2YLMA 2PE9A 3A9JA 5IAAC 1C1YB 1V2YA 2LJ5A 3UINB 4RM9A 5JHAA 2KD0A 1E8YA 2M1MA 2EMTA 4FULA 4X57B 2K6DB 5E6PA 3NZSA 1VCBA 2MSED 2L8JA 3ZDTA 3ZLZA 3QA8A 1OEYJ 1D3ZA 2KQ7A 2N4FA 2AEHA 4NQKE 3SD5A 2PPHA 2LASA 1RFAA 3VTWA 5DPWA 1RAXA 2D10A 2KOXA 4IUMB 4ANUA 3M62B 1WJNA 4PS7A 5FR6A 2IZVB 2G3QB 2BF8B 3GZNI 3KH0A 3N30A 1WIAA 2KTRB 5G2NA 1V81A 1P9DU 4GDKB 5AEKB 2KMCA 5E6NA 1ZW7A 3A33B 1XD3B 2C60A 3GOEA 1RRBA 3ZDMC 2GBNA 3Q3JA 4NAWB 3OLMD 3ZRCA 3PSEB 1TZ1A 2O2VB 2MWSB 2KHWB 2O6VD 3V62A 4AOFA 2KZRA 2JPHA 2M4NA 4FHKA 2L0TA 1EF1A 1HE8A 3KUCB 1WGGA 2KX0A 1NDDA 3W1SC 3ML9A 2CS4A 4ZDVA 5IA7A 2KFKB 4MGKE 2AWTA 4PS8A 4TQ0A 4HLEA 1P3QU 3DBLI 1WXVA 2GBKA 3KVFB 3OJ4B 3RZWC 3TCAA 2N9XA 2KK8A 3APDA
chains in the Genus database with same CATH superfamily
3WAPA 4K7SA 4JLCA 1WRIA 5C2TB 4F8CB 2W55A 1GB4A 4DQOC 1WX7A 4W9GA 3W5VB 2K8HA 4AS1A 2AQ2B 2NS5A 2I2YA 2JXXA 2C7MB 3NY5A 1T3QA 3EFUA 1EO6A 4WQMA 3RFZB 3S2AA 3ZW3A 4URKA 3ZO5B 1FCLA 2K0PA 1RFKA 4AJYB 1OQQA 5IOIA 3SFDB 2ZNVC 2ICIA 1VD2A 1I4RA 1A70A 1L4ZB 4WURA 3EHVA 4YL8A 5KHQA 1WF9A 2M19A 1T0QC 4KGTA 1LXDA 1ZKHA 2FCSA 4M00A 2N7JA 2V3PA 3NUHB 2JUOA 3IAS1 3JYUA 5MPOA 1CZPA 2LGIA 3TEXA 3VVWB 4LK0M 4IC7B 3DHHC 2M17A 5HI1A 2C7NB 3I5JC 3TEYA 2QHOA 1V5OA 2JF5A 3R2TA 2MCNB 4HDQA 3R7RA 3L10B 1SGHA 3NVYA 3PZ7A 3WAMA 2K22A 4M8NA 5G5GA 3ZXRA 4H2AA 2N9KA 5DPSA 2DZJA 1T0SC 4W9HA 2JRIB 3PGEA 2N1VA 1IBXB 3W5UB 2GBRA 5JXVA 1KRHA 2AL3A 5JHBA 2D3BA 4JE3B 4DXAB 2QJLA 3TL5A 2AYOB 4MACA 2FE8A 3CWIA 4HK2A 4NQLB 4AQ7A 4KVGB 3ZNHB 1K52A 4KDLB 2FUHB 2XK5A 3AE4B 4FBJB 1QF6A 3KUZA 1TBEA 3V6CB 4WWOA 2BYTA 3GE3C 2ACZB 2R2QA 4RCOA 4RH6A 4PK1A 1WMHA 3ABVB 2WXPA 4KKJA 4E71A 1L7YA 1T6BX 3R3MA 3H7SA 2IO2B 1GC7A 1BMLC 2KANA 2DLBA 1YIWA 1KM7A 1IP9A 1Y56A 1J0GA 2G4SA 4RFBA 2G9HD 4KZCA 4B0EA 5J17A 4KV2A 5J18A 1BT0A 4M0WB 1CJEA 1T0YA 1WFYA 2SEBD 3QAQA 2L52A 3AEAB 3DBSA 4IKGA 3TUOA 1JROA 2LJIA 2XK5B 3Q3MC 4BZAA 1FXIA 2KJRA 1EM7A 4K81A 1E7VA 4NJ7A 2LWPA 3AE8B 3VRAB 4ICUA 3RNFC 2WU5B 4WJOA 4DK5A 4EZJA 1FFVA 2JWUA 3AE5B 2J4XA 2WXNA 1XCQL 3JSVA 3AEBB 1E8WA 1FRRA 3B0AA 1N61A 3MHSD 3LYYA 2ON8A 1I4PA 2WX0A 2ZW1A 3ZNZB 4BBNC 1UGMA 1R4NI 5H92C 5D7GA 1WJ6A 3T3NA 2MQJA 2O2VA 1QOFA 3SDLC 1WX8A 2D3AA 4WAAA 1PDXA 4OHJA 2NVUI 3KWLA 3SR6A 1YN4A 4KSKC 4KIKA 3A9KB 4JQWC 2ZNVB 4MT5A 1K8RB 1SEBD 3JSVB 3QHTA 1NYQA 3RNGC 4P1CC 2WDTB 1C4PA 3HM3A 3BVMA 1EUVB 2MBQA 1OQRA 2BT6A 1FNUA 1X1MA 3QQ8B 1JW9D 3SFEB 4WWMA 3TMPB 2RD0A 3VFKA 3L54A 3ML8A 1D5XC 4K3CA 4XWWA 3KQ4A 4XYCA 2NTSA 3PREA 5FKAC 2MRPA 2N7DA 3RULA 3RNCC 2ZVNA 2AL6A 1Q10A 4LNKA 2BB5A 1B1ZA 3VUXA 4N6EB 4FA6A 4FXCA 4JPSA 1YQBA 2HTME 2M0XA 1WX9A 5JZEB 1CMXB 1ACCA 4DXFA 1R4NB 1FMAD 1L5PA 3TIXA 1GG3A 1Z5SB 4GU2A 1WE6A 3ETRA 4TMAB 2W82A 1YD8U 4K7UA 3VAWA 2HE7A 4MSQB 1STEA 3UGBB 4BKSA 4AUQC 3KWVA 3BWUD 5KHOA 1GB1A 4OZCA 1Y8RC 2WXKA 1VJKA 4ACFA 2W9NA 1YQ3B 3JW0X 4B9KA 2V4LA 2JYTA 1WZ3A 2FBWB 5E6JA 1AWDA 2KTRA 4E3CA 5T8IA 3IXSA 4MELA 1I4QA 2WXLA 3RCZA 3RI7C 3QWZB 2N9LA 2AX5A 4J6IA 3M95A 2K8BA 5BYRA 4C56C 3WA0A 1YJIA 3HVDA 3O13A 2DYMA 1GPXA 3NS8A 3X0WA 4IWQA 4ZHPA 3OJ3A 2MX2A 2L7RA 1WM3A 2J7QB 1LGRA 4A6QA 1WRDB 3PZ8A 2YLMA 2PIAA 1V2YA 5JHAA 2MJDA 2QCZA 2KD0A 2M1MA 3EGRA 4FULA 4X57B 1DGJA 2K6DB 1D3ZA 2L8JA 1OEYJ 3GS2A 4NQKE 3SD5A 2LASA 2INCC 5FR6A 4YTPB 2KTRB 4HKQA 1QLBB 2J53A 2C60A 3GOEA 4R3DA 1RRBA 3ZDMC 1TS5A 1PGAA 1TZ1A 3BYYB 3V62A 2BW2A 2LHEA 3GP7A 1EF1A 3ML9A 4M01A 5IP4D 1WXVA 2GBKA 3OJ4B 3TCAA 4ANXA 3APDA 3UIPB 4I6NB 2I1JA 2DYOA 1HZ6A 2R2OA 5CTRC 4AWJA 5BMGA 3KYDD 2DAJA 2YEPF 4L1BA 4IOIE 2WS3B 1YN5A 2D5GA 4C7ZA 3ZUNA 3AE3B 1I4XA 4OZAA 2KC1A 4OVUA 3I57A 4W9CA 5EE0A 4MGYE 5G5HA 3HUIA 2BGFA 4F7ZA 4I6LB 3P4SB 4ASWC 4HJKA 4DHZE 2RSUA 1N5WA 1DYQA 1TYGB 2ZCCA 2D07B 4ZRIA 1HTOA 3LB8C 1FNWA 1OTRB 4PYZA 3N32A 3AH7A 3KYCD 1C76A 3IT6B 2Y5PA 5DPTA 2RPVA 3AE9B 3DVNU 3L17A 5BMHA 4P6VF 3CMMB 4TQ1A 2IO3B 2INNE 3RT3B 2PKOA 2ZJDA 3U30A 4RF1A 1S3SG 2K8CA 5L83A 5L95C 5CX3A 2D3GA 3AE6B 1K53A 4MJSB 1WJUA 3IFWB 1GAQB 3OG5A 2KC2A 4ZOHC 1PGBA 3I63C 2BKRB 5C1ZA 5C23A 4TUUA 3NRZA 2BYVE 2KDEB 3VR9B 4ZHOA 3FAHA 4UDUC 2XNAC 1I4GA 4K1RB 2K25A 2K6QA 2WXGA 3QCAA 4EZLA 1TIFA 4LTUA 4N58A 4JWSC 2KLCA 2RGFA 2D11A 3UF8A 4MSMB 4CO7A 3EC8A 3MC8A 2JVCA 1KLGD 4HJGE 1MHHE 4ITKA 2XBBC 4WJPA 4HDOA 2L76A 1S1QB 4II2B 2NR2A 3ZYYX 1C3TA 4FJVB 4IWOA 1QILA 4W9LA 3PS6A 5DPRA 1WI0A 4MM3A 3FC4A 1SBBB 4LDTB 3AE2B 2IY1B 2EMSA 1WR6E 4RF0A 2LRUA 3AV8A 2RMMA 4BKSD 3DVGY 1R7SA 4P7IA 2IDYA 3J9CA 1IGDA 3CSFA 3QC8B 3V60A 2KKCA 4REZA 3PHXB 5D3IB 2IO1B 2L05A 4NZLB 3U7ZA 3N1YC 1MVKA 2MBBB 3BY4B 1FM0D 3PT2B 4B6WA 5AUIA 2BQQA 2KN4A 4G50A 3P2BA 2MHJA 1JCKB 3PLVA 2JZPA 2KAJA 1TTNA 3CSTA 4ZYNA 3H6NA 3AECB 1FXTB 3WCQA 1FFUA 2FAZA 5J2RA 2YVCA 4OVVA 2JZ3B 4YSZB 2WXOA 4A3OA 2PTLA 5AZHA 1C78A 2EELA 2CJOA 1M94A 2PEAA 4FLHA 3PO0A 5BYQA 3V6EB 3QK0A 2B3AA 4US8A 1L2NA 2W3RA 4A55A 3ZKJC 4GGQA 1QQRA 1J7BA 3FILA 4FADA 1XLPA 1E90A 3PRZA 4KZ0A 2QSDA 1KF6B 1ROEA 4RGMA 2WDVB 4W9IA 1SJHD 3P42A 2NBUA 2KACA 2DENB 4JIOU 1SIJA 1N62A 5C3JB 5BYSA 1VLBA 4MEMA 1T5XD 4AP4C 3AEDB 1C4AA 2VRRB 3NVVA 2UU7A 2X8XX 4GB9A 3B2GA 1YOVB 3WALA 3FKYA 2ONQA 1SE9A 1SE3A 5TSSA 5AZFA 4NY0A 4C00A 1SSNA 4RNAA 3FILB 1J8CA 3VUWA 2Y5CA 3MTNB 4HPMB 2L00B 2JYEA 3ALBA 3N3KB 1YN3A 1IGCA 1WXQA 3BZDB 2BWES 3DBRI 3VQIA 1LFDA 1PGXA 3TEZA 2WGSA 3DVNV 4LNFA 1WGHA 3OAWA 2LXAA 5EDSA 3T8MA 3VUYA 1K51A 1WWTA 4XE0A 1F52A 2JXTA 1RLFA 3U8ZA 2KTFA 1D4BA 1EWCA 3W1YA 3WANA 1C4CA 3E9SA 3ENEA 1KLUD 4Q2JA 1WMHB 3MJWA 3N1ZC 1E9MA 1WXSA 4TV3A 3RN9C 1JRPA 1E6EB 4EUTA 4ARCA 2K5PA 1V9JA 1YX5B 1UGJA 2G1EA 2BS3B 4EKUA 3JVZX 4LDTD 3HIZA 5G55A 2KVRA 4XZ4A 4FN2A 2ZZPB 1DOYA 4RM8A 2LGDA 4GDKA 3DPDA 2XN9C 3PLUA 2JRHA 2JQRB 4M02A 3IHPC 2VZKB 2BYEA 1ESFA 1KLVA 2WU2B 1YJJA 5AZGA 5CHWA 4BFRA 3B1LX 3V61A 2WXMA 1HZ5A 2KFKA 3ZJTA 4XGAB 2CJNA 1BUIC 2C7HA 4MH0E 1QZEA 1E5WA 4WAFA 3DBRB 4AJWA 2FUG1 2MJEA 3APFA 2LFIA 1E7UA 3DDCB 4JX1C 3UI3A 3A9JA 2M56B 2PMVA 3DWMA 3I9V1 2EMTA 3ZLZA 3QA8A 2V3NA 2N4FA 1XO3A 1F1HA 1RFAA 2BBCA 4ANUA 1B9RA 1JMLA 2BF8B 1SE4A 3KH0A 1WIAA 2WLBA 1J7CA 1MPEA 1V1PA 1VZ8A 5HFYA 1P9DU 4GDKB 5AEKB 5E6NA 2QIEB 3A33B 2YEPB 3BVGA 1NEKB 1QOAA 3Q3JA 1QT9A 4A9AA 1WGKA 1PFDA 2O2VB 2KHWB 1F2RI 2GRIA 3P4PB 1EWYC 4AOFA 2KZRA 4YT0B 2L0TA 3KUCB 1WGGA 1NDDA 3W1SC 4ZDVA 5IA7A 2CU3A 2KFKB 4HLEA 4TQ0A 3DBLI 3RZWC 2QDFA 1ZP0B 2NMQA 4KIKB 2BS4B 1TT5B 2LUEA 3A9JB 4JWUC 1KFYB 3WAOA 3MP9A 3H1UA 4C80A 1HTQA 4LCDE 4HRSA 3AU4A 3APCA 3Q8FA 2NBWB 3LJ3A 2NBVB 1J7AA 2KDFB 4RMAA 1BXTA 3L0WB 3N20C 1FPYA 1UZXB 1TS4A 5EE9A 1V1PB 1WGRA 1F77A 4YTNB 4WWNA 2V0GA 3D32A 2REXA 1J19A 3UQBA 5HG2A 3UQAA 2QC8A 2SAKA 2Z0DB 1VZ7A 2ZPYA 4W9DA 2KYWA 2QEJC 4IWPA 1K50A 3VRBB 4C4VA 2MEKA 3BINA 4HKZE 4GOCA 1L4DB 2N7EA 4WWPA 4LNOA 1N6ZA 2G45B 4OZBA 4L23A 5LXIB 2LGSA 3GE8C 3DCGA 2DYBA 4GN1A 2L3ZA 2Y5BB 1OGWA 3BVZA 4KDIC 1JWMD 3AE7B 2KWCA 3SU8X 4A8XC 1GJZA 3HRDD 4BKGA 2MBEA 3M3JA 1M4VA 3DBHI 4NNJB 2PW9A 2VH2A 1P98A 2H88B 3DBLB 3DHIC 1JWUD 1FRDA 2G4DB 2MA9B 2FNJB 4GDLA 2JU6X 1MHXA 1A5RA 4KKIA 4RGOS 1F0ZA 1WR1A 2LVPA 2Y3AA 4EE2A 1HQRD 4IDIA 4C4VB 4W9EA 2MH7A 1EU4A 3RNEC 3A1QA 1GOZA 1DOIA 1DOXA 3ZIMA 3ZXVA 1IPGA 1MI0A 3WIMA 2A4ZA 3U52E 2KX3A 2MBOA 4DHJB 3ZNID 4D2KA 3RD2A 1D6EC 1I35A 4MGZE 3R7QA 1FEHA 2ASQA 1JWBD 2RDGA 2VZKD 4C7YA 4FJZA 1V1OA 2A5UA 4HEA1 2R61A 3RMKC 1LM8B 4GDLB 3PTFC 1HEZE 2LHDA 3VH4B 5E6OA 3W1SA 2LMCA 4TSSA 2J42A 2LXCA 2WXRA 2UWQA 3C19A 2C5LC 2KQSA 3A1QB 2O6VA 2DWQA 4GLSC 1EU3A 3SHQA 5FK9C 1ENFA 2KWVB 4A90A 1UNSA 2MBHA 2CHWA 3AMZA 3QARA 4ARIA 2ZCBA 1ET9A 3TBLD 3B08A 1TKGA 4USAA 4W9JA 3DBHB 1NI3A 2LVQA 1P1AA 1PQSA 2W3SA 1Q0WB 4ZRKA 4O1NA 2L83A 1UH6A 4XWTA 4WH4A 3DWGC 3AULA 2NCNA 2N9EB 4WIPA 2INDC 2FCMA 2L0FA 2N9PC 1YX6B 4S0RA 2ZW0A 2Z0EB 4LLGM 1OQYA 2BKFA 1EF5A 2WX1A 4FJYA 4HROA 1F9JA 2I1KA 1QOBA 4PS3A 1VR9A 2O6VB 1JWSD 2DZMA 4HWIB 1VZ6A 3L08A 3K9PB 2DX5B 4HXDA 2KMAA 5CHFA 2K39A 3R2IA 1KH0A 3ONSA 4NAWA 1OFFA 4M8MA 1E10A 3BYTB 2KFJA 3C8YA 4BOZB 4L2YA 3HHMA 3IVFA 4TKNA 3GB1A 5H8YE 4ANVA 2IGDA 3AB5A 1Q1OA 3N1XC 2N0SB 4ZRJA 1H8CA 4LNIA 2QILA 4XDDA 3PRMB 3CIRB 2NPTA 4NJ6A 1WGYA 2WXIA 1NENB 1UWMA 3H9DA 3PVLA 3Q8BA 2PJHA 3RUIB 1V8CA 3EECA 2J0KA 2KDMA 3E56A 3NZ3A 4N59A 1WXAA 1Z2MA 5D94A 2FIFA 3VTVA 1QOGA 2IYDB 2I38A 1GNUA 1VRAB 3QJZA 3AEGB 2OJWA 2BVCA 1GUAB 2HTHA 3URYA 1WY8A 3HK0A 1LO5D 3AM9A 1UELA 2K3UA 4MDKE 4CQNA 4DDGD 1MG8A 1JALA 1V86A 4DWFA 3B2FA 2FCQA 4W9KA 1GC6A 4WJNA 1P7EA 4XX5A 2NPTB 4CYEA 3ZRFA 4N9F4 4YTMB 3RNAC 1WZ0A 5IO9A 3L13A 3U7DA 3Q8CA 4BBNF 1D5ZC 4MM3B 3HVZA 3W9CB 3ZNGC 3EA6A 1XLOA 1WE7A 4EOYA 1TY0A 4G0NB 3QIJA 1SB3C 2CKHB 2HD5B 3ZQ4A 1E8XA 4DHJD 2KQ4X 4MGIE 3SEBA 4IM3A 3W2DA 1KTKA 2RPQA 1TKEA 5BMIA 1RWSA 2WXQA 1IBXA 4GSWA 3VHTC 2ZEQA 1L0YB 1XQQA 5LNK1 2RR9A 4PT5A 1TY2A 3TJPA 1L0XB 2K9XA 4YSYB 4DHZB 2ZPNA 1YJ1A 1G6JA 3B9JA 4ANWA 2PVOD 3Q69A 2KJ6A 3T3OA 2DAFA 3AEEB 1SJED 1ZDXA 4WQOB 2LRWA 4W9FA 2KMMA 3V3XA 4BKTA 3LDZE 2KN5A 2HJ8A 2PE9A 4K3BA 5IAAC 1C1YB 2LJ5A 3UINB 4RM9A 2IPKD 2HJ1A 5E6PA 1VCBA 2MSED 3ZDTA 3U4EG 5DPWA 1NVID 1RAXA 2NTTA 2D10A 2DNFA 3M62B 4PS7A 4P1BC 2WNMA 3GZNI 3DHGC 4M0WA 3Q8EA 3IT4B 1XLNA 2KMCA 1XD3B 1MFWA 2GBNA 5IN7A 3OLMD 3L4PA 2O6VD 2M4NA 4FHKA 3V05A 2CS4A 3U2SC 3Q8AA 3MHZA 2KK8A 2WDQB 4RGNA 3ZGZA 2W54A 3QX1A 4HPPA 2LEKA 1WJ4A 4IM2A 1F2RC 3ZTDA 4FHJA 1UUPA 2TSSA 2KWUB 2WXFA 3BK1A 3NS1A 5JH5C 3RNBC 1P0RA 4ICVA 2IO0B 4A3PA 5AUKA 3I3TB 3VXWA 2D2QA 3R8BA 5BO4B 3P4QB 1UD7A 5FR3A 3ECIA 5D6JB 2GBMA 1FNVA 1ZPSA 4BAXA 2IGHA 1WGDA 1KOTA 4BVUC 1R4MI 1XF5L 4S17A 2V4IB 4K7WA 1ISNA 1TS3A 4F1SA 2IBIB 1N60A 3NHEB 3KUDB 1WXMA 4GMVA 5D2MB 5LLIA 2UYZB 2RDBC 3N9YC 1I7HA 3A9KA 3Q6BA 1SE2A 3AN1A 2JT4B 3NJTA 3GZNB 1ZDVA 2J0MA 1WM2A 2WP9B 4BOSC 4LJPB 3MJ5A 4RGTA 2WDRB 3K9OB 2XEWA 3MC9A 2BPSA 4HPLB 4A20A 3RYTA 1XXGA 3P4RB 2DZKA 4E74A 3CF6E 5CHVC 1E7PB 3ZJUA 3Q3FA 4P16A 4ZYSA 4GXBA 3H8HA 3PV1A 2JX5A 1N63A 1JRUA 2JSVX 1SF0A 2KO3A 1QKZA 2GI9A 5EE3A 4NAMA 4J3OD 1AN8A 4ZRPA 1FD6A 3NZUA 1FIQA 1FCCC 4JL9A 4LJOB 2IJ0A 1KJTA 4LNNA 3VDZA 1R4MB 2GMIC 4YXDB 1TS2A 2GOWA 4XC2A 1UBIA 4WJQA 1MJDA 3M63B 2E6XA 2K1FA 4ZRQA 4HCPB 2Z59B 2OEDA 3NVWA 1AYFA 3PZDA 2DZIA 2OHFA 3MFGA 2L1AA 4B95A 3TEWA 2WWZA 1ZXIA 4IG7B 5TR5A 2H89B 1H4RA 4GIVA 2GLSA 2BWFA 4PYUA 1T0RC 1V49A 2CHXA 2IGGA 1UF0A 4NPNA 2BTEA 5IKCM 3NG0A 3EFCA 3X23A 4XDCA 3A4RA 5DCNA 2INPE 1XCTL 1OEYA 2LZ6A 2FIDA 3VH3B 2CR5A 2VH1A 4YSXB 1D5MC 2M8SA 3AI5A 1C77A 2LUMA 2MP2A 4I6PA 1LQBA 1FO4A 4QAYA 4B0MA 2HDEA 3A4SC 4HVBA 3P63A 1U4AA 3AEFB 5LXHA 4G3XB 4G11A 2KT7A 3PPAA 1V97A 5HKHA 2BYFA 1WYGA 2E3TA 2V1YA 2JWZA 4OW0A 2WHIA 2LI5A 3OWEB 1E0ZA 1Q5WB 1ZGUB 2WXHA 2M0AA 3DQVA 4KX6B 3P1MA 2MLBA 3R66C 2LD9A 4KSLC 4CHKA 2MP2B 1NYRA 4KGRA 3ZTCA 1PYWD 1PUTA 3RZFA 3Q3OC 3Q2AC 3ZJVA 3PRPB 3T9LA 1IUEA 1V80A 4EEWA 2OJRA 3VTUA 1SIFA 2EKEC 5HHDG 3MC0B 3Q14C 2KLGA 3DVGX 4US9A 3O65B 2KVZA 2KXJA 5D3DA 1CK1A 2PE6B 2J0JA 1I4HA 4EZKA 2Z8LA 1ZOYB 1MG4A 5GXGB 2WYQA 2KDBA 4HCNB 1C9FA 1XEEA 1CQVA 3IAM1 1WSPA 1I42A 2LVOA 1V5TA 1JWAD 4EFOA 1XT9B 1YMHE 5EE1A 2PLPA 3BIID 4KGSA 1TJEA 1UBQA 4IM0A 1P7FA 3KW5B 3H7PA 3DOWA 2DHZA 2WXJA 2FCNA 1SXTA 4YWGG 2MJ3A 3RPFC 2C9WB 5GMVA 1L6VA 3BK2A 4IW0A 2KJHB 3KLSX 2N1WA 2PVGC 1WYWB 1ZUD2 1ZXHA 1E8ZA 4MJSA 2AQ1B 2LGYA 1NBFC 2ZVOA 1TGZB 2D3CA 2RDHA 1V6EA 3ZVVA 1YNTE 2JZZA 1IYFA 2L32A 2GBJA 3VR8B 1ZE3D 2KWDA 2J52A 2BB6A 3TSSA 2WQYB 1TZOA 1AARA 1WH3A 2KNBA 2JY6A 4DBGA 1TKYA 4II3B 3AXCA 2OOBB 3NVZA 2QMTA 3H7PB 2CHZA 2V9HA 3IG3A 2X38A 3HM6X 1HXYD 3C0RB 1YQ4B 4JGHB 3LXFA 3AU5A 1N5XA 1JQ4A 2BS2B 2IY0B 1HA5A 2CU1A 2LGXA 4OVZA 3IBEA 1XLQA 4DDID 1NI2A 1RM6C 3L16A 4DXGA 1UWXA 3NOBA 1ET6A 3EUB2 2MW5A 1C79A 2KDIA 3PHWB 3UIOB 2V3SA 1FXAA 2EKIA 2AQ3B 1L0VB 1E8YA 3NZSA 1AW7A 2KQ7A 2B76B 2AEHA 2PPHA 3VTWA 2KOXA 4IUMB 2DBYA 1WJNA 4NJCA 1L6UA 2IZVB 3AE1B 2G3QB 3N30A 5G2NA 1V81A 1ZW7A 1VDVA 5I4DA 3Q3NC 1RYJA 4NAWB 3ZRCA 3PSEB 2MWSB 2JPHA 4MH8A 1HE8A 2KX0A 2Q5WD 4MGKE 4PS8A 1P3QU 3KVFB 2GB1A 2N9XA 2AWTA
chains in the Genus database with same CATH topology
3UIPB 3WAPA 4I6NB 3QX1A 2I1JA 4K7SA 4KIKB 4JLCA 2DYOA 1WJ4A 4F8CB 2R2OA 5CTRC 4IM2A 4AWJA 3ZTDA 4FHJA 2LUEA 3A9JB 2KWUB 3KYDD 3WAOA 3H1UA 5JH5C 2DAJA 1WX7A 4W9GA 4LCDE 3AU4A 1P0RA 2K8HA 3APCA 2NBWB 4ICVA 2IO0B 2NS5A 3LJ3A 4A3PA 2NBVB 3VXWA 3I3TB 2KDFB 4RMAA 3ZUNA 2D2QA 3L0WB 2JXXA 4OVUA 2KC1A 5BO4B 4W9CA 4MGYE 2C7MB 2BGFA 4F7ZA 1UD7A 3NY5A 1UZXB 4I6LB 4ASWC 4HJKA 3EFUA 3ECIA 5D6JB 1EO6A 2GBMA 4DHZE 1WGRA 2RSUA 4WWNA 3D32A 2REXA 3S2AA 1WGDA 2ZCCA 3ZW3A 4BVUC 2D07B 3ZO5B 4URKA 1J19A 1KOTA 1R4MI 4ZRIA 4AJYB 3UQBA 3UQAA 2ZNVC 1OTRB 1VD2A 4K7WA 3N32A 4PYZA 1ISNA 3KYCD 2Z0DB 4F1SA 2IBIB 2ZPYA 4W9DA 3EHVA 4YL8A 5DPTA 5KHQA 1WF9A 4IWPA 1LXDA 1ZKHA 2FCSA 3DVNU 3L17A 3NHEB 3BINA 3KUDB 4GOCA 2JUOA 1WXMA 3CMMB 4TQ1A 4GMVA 2IO3B 2N7EA 4WWPA 5D2MB 5LLIA 3RT3B 2UYZB 3JYUA 2ZJDA 3A9KA 3U30A 2G45B 1S3SG 3VVWB 2JT4B 2K8CA 5LXIB 5L83A 2J0MA 5L95C 1WM2A 5CX3A 2D3GA 4IC7B 3DCGA 2M17A 2DYBA 2C7NB 4BOSC 4LJPB 4MJSB 4GN1A 1WJUA 2L3ZA 3IFWB 2Y5BB 2KC2A 1OGWA 4KDIC 3K9OB 2BKRB 5C1ZA 2QHOA 2XEWA 5C23A 2BPSA 4HPLB 2BYVE 2KDEB 4TUUA 4A20A 1V5OA 3RYTA 2JF5A 2KWCA 3SU8X 2MCNB 1GJZA 4HDQA 4BKGA 2DZKA 2MBEA 3CF6E 3M3JA 4E74A 3DBHI 5CHVC 4NNJB 3R7RA 3Q3FA 3L10B 1P98A 1SGHA 4K1RB 4GXBA 3WAMA 2G4DB 2MA9B 2FNJB 4M8NA 2K25A 2K6QA 3PV1A 4GDLA 1A5RA 3QCAA 5DPSA 1JRUA 2DZJA 1WR1A 2LVPA 2JRIB 4W9HA 3PGEA 4EZLA 2N1VA 2GBRA 2KLCA 4W9EA 2AL3A 2RGFA 2KO3A 5JHBA 2D11A 3A1QA 3UF8A 4MSMB 4DXAB 3TL5A 4CO7A 3EC8A 3ZIMA 2AYOB 1IPGA 2JVCA 4HK2A 3NZUA 4NQLB 2XBBC 3WIMA 4KVGB 4WJPA 4JL9A 2A4ZA 3ZNHB 4KDLB 2FUHB 4HDOA 4LJOB 1KJTA 1S1QB 2L76A 2KX3A 2XK5A 4FBJB 2MBOA 4II2B 2NR2A 3VDZA 3KUZA 1C3TA 4FJVB 4DHJB 2GMIC 4IWOA 1TBEA 4W9LA 3V6CB 3ZNID 2GOWA 4WWOA 3RD2A 3PS6A 4XC2A 1UBIA 4WJQA 5DPRA 1I35A 1WI0A 4MM3A 3M63B 4MGZE 2R2QA 3R7QA 2K1FA 4HCPB 2Z59B 2ASQA 3PZDA 2DZIA 4LDTB 2IY1B 4FJZA 1WMHA 2EMSA 4B95A 2A5UA 2WWZA 5TR5A 1L7YA 1WR6E 1LM8B 4GDLB 4IG7B 4E71A 3PTFC 3R3MA 3VH4B 1H4RA 3H7SA 4GIVA 5E6OA 2LRUA 2IO2B 1GC7A 3W1SA 2KANA 2BWFA 1YIWA 1KM7A 4PYUA 4BKSD 1IP9A 3DVGY 2LXCA 1J0GA 1V49A 2CHXA 2UWQA 2G4SA 2C5LC 4P7IA 2KQSA 4KZCA 4NPNA 3A1QB 3CSFA 3QC8B 3X23A 5J17A 2O6VA 4KV2A 5J18A 3V60A 1BT0A 2KKCA 4M0WB 3A4RA 5DCNA 3PHXB 1T0YA 3SHQA 1OEYA 1WFYA 2LZ6A 2FIDA 3QAQA 2KWVB 2IO1B 3VH3B 2L05A 2CR5A 2MBHA 2CHWA 2MBBB 3DBSA 3QARA 2M8SA 2XK5B 2ZCBA 3AI5A 3BY4B 3PT2B 3TBLD 4B6WA 2MP2A 3B08A 4I6PA 4G50A 1LQBA 3P2BA 4W9JA 2LVQA 1P1AA 1PQSA 1Q0WB 3PLVA 2KJRA 4K81A 4ZRKA 1E7VA 1UH6A 2LWPA 3A4SC 4NJ7A 4HVBA 1U4AA 1TTNA 3CSTA 4ZYNA 5LXHA 3H6NA 3AULA 4G3XB 4G11A 2NCNA 2N9EB 4ICUA 3PPAA 1FXTB 5HKHA 2BYFA 4WJOA 4DK5A 2FAZA 2FCMA 2L0FA 2V1YA 2N9PC 4EZJA 5J2RA 1YX6B 2JWZA 2Z0EB 2YVCA 4OVVA 2JZ3B 2LI5A 3JSVA 1Q5WB 1ZGUB 1OQYA 1E8WA 2BKFA 1EF5A 2WX1A 4FJYA 3B0AA 4A3OA 1F9JA 2I1KA 3DQVA 5AZHA 4PS3A 3MHSD 1M94A 2PEAA 4FLHA 2O6VB 2WX0A 3V6EB 2DZMA 3QK0A 3ZNZB 2B3AA 4BBNC 4HWIB 2MLBA 1L2NA 1UGMA 3L08A 3K9PB 2DX5B 3R66C 2KMAA 4HXDA 5CHFA 3ZKJC 2LD9A 4GGQA 1R4NI 2K39A 3ONSA 5D7GA 4NAWA 4FADA 4KSLC 1WJ6A 4M8MA 4CHKA 1E90A 3PRZA 2MQJA 4KZ0A 2O2VA 2MP2B 2KFJA 3SDLC 3ZTCA 1WX8A 4WAAA 4BOZB 3HHMA 3IVFA 3RZFA 4TKNA 4W9IA 4ANVA 2NVUI 2NBUA 4KSKC 3PRPB 1Q1OA 2DENB 4JIOU 3T9LA 1V80A 4ZRJA 4EEWA 1H8CA 4MEMA 4KIKA 2OJRA 3A9KB 4JQWC 3VTUA 3PRMB 2ZNVB 2NPTA 4AP4C 4NJ6A 1SIFA 1WGYA 2EKEC 2VRRB 1K8RB 2KLGA 3DVGX 3O65B 3H9DA 3PVLA 3JSVB 4GB9A 3QHTA 2KXJA 2PE6B 2J0JA 2WDTB 3HM3A 3WALA 4EZKA 2PJHA 1EUVB 3RUIB 2MBQA 3EECA 2J0KA 1SE9A 1X1MA 3QQ8B 1WXAA 2WYQA 1Z2MA 4NY0A 5D94A 5AZFA 2FIFA 3TMPB 2RD0A 2IYDB 2KDBA 3VTVA 4HCNB 3VFKA 3L54A 3ML8A 1GNUA 1J8CA 3QJZA 3VUWA 3MTNB 1GUAB 3PREA 2HTHA 2L00B 4HPMB 1WY8A 2MRPA 3ALBA 3HK0A 3N3KB 1UELA 2N7DA 4MDKE 3RULA 4DDGD 1MG8A 2LVOA 2ZVNA 1I42A 1V5TA 2AL6A 4EFOA 1XT9B 2BWES 3DBRI 3VQIA 3VUXA 1LFDA 1V86A 4DWFA 4FA6A 2FCQA 4W9KA 1UBQA 1GC6A 4IM0A 4WJNA 3DVNV 3KW5B 4XX5A 2NPTB 3H7PA 3DOWA 2DHZA 4CYEA 2FCNA 1WGHA 3ZRFA 1YQBA 2C9WB 3OAWA 5GMVA 2LXAA 4N9F4 4IW0A 2M0XA 5EDSA 1WX9A 2KJHB 5JZEB 2N1WA 1WZ0A 3L13A 1CMXB 1WYWB 3U7DA 3T8MA 1E8ZA 4MJSA 3VUYA 2LGYA 1NBFC 3TIXA 1GG3A 1Z5SB 4GU2A 2ZVOA 1RLFA 1WE6A 1TGZB 3U8ZA 4BBNF 2KTFA 1YD8U 4K7UA 3VAWA 1V6EA 3ZNGC 3ZVVA 2HE7A 2JZZA 4MSQB 3W1YA 1IYFA 3UGBB 4BKSA 1WE7A 2GBJA 3WANA 4EOYA 4G0NB 3ENEA 3QIJA 2HD5B 2CKHB 4AUQC 1WMHB 1E8XA 5KHOA 3MJWA 4DHJD 1Y8RC 1WXSA 4TV3A 4MGIE 4IM3A 4EUTA 2RPQA 2W9NA 1V9JA 1YX5B 1AARA 1WH3A 2KNBA 2JY6A 4DBGA 3JW0X 4B9KA 4EKUA 4II3B 2V4LA 3JVZX 4GSWA 3VHTC 2ZEQA 3AXCA 2OOBB 3HIZA 4LDTD 5G55A 2KVRA 1WZ3A 4XZ4A 1XQQA 4FN2A 2ZZPB 2KTRA 4E3CA 4RM8A 3H7PB 2LGDA 2RR9A 2CHZA 4GDKA 3IG3A 4MELA 3TJPA 3DPDA 3HM6X 4DHZB 3PLUA 2ZPNA 1YJ1A 3RCZA 3C0RB 2JRHA 1G6JA 3QWZB 4J6IA 3M95A 4JGHB 3AU5A 4ANWA 3IHPC 2K8BA 2BYEA 3WA0A 2IY0B 1KLVA 2KJ6A 2CU1A 2DAFA 2LGXA 3IBEA 5AZGA 5CHWA 4BFRA 4WQOB 3B1LX 2LRWA 1NI2A 3V61A 2DYMA 4DDID 3NS8A 2KFKA 3X0WA 3L16A 4IWQA 2C7HA 3NOBA 4W9FA 4MH0E 3OJ3A 1QZEA 2MX2A 1E5WA 2L7RA 2MW5A 4BKTA 1WM3A 2J7QB 2KDIA 3PHWB 3UIOB 4AJWA 3APFA 1WRDB 2V3SA 4ANXA 3LDZE 2KN5A 2HJ8A 1E7UA 3DDCB 2YLMA 2PE9A 3A9JA 5IAAC 1C1YB 1V2YA 2LJ5A 3UINB 4RM9A 5JHAA 2KD0A 1E8YA 2M1MA 2EMTA 4FULA 4X57B 2K6DB 5E6PA 3NZSA 1VCBA 2MSED 2L8JA 3ZDTA 3ZLZA 3QA8A 1OEYJ 1D3ZA 2KQ7A 2N4FA 2AEHA 4NQKE 3SD5A 2PPHA 2LASA 1RFAA 3VTWA 5DPWA 1RAXA 2D10A 2KOXA 4IUMB 4ANUA 3M62B 1WJNA 4PS7A 5FR6A 2IZVB 2G3QB 2BF8B 3GZNI 3KH0A 3N30A 1WIAA 2KTRB 5G2NA 1V81A 1P9DU 4GDKB 5AEKB 2KMCA 5E6NA 1ZW7A 3A33B 1XD3B 2C60A 3GOEA 1RRBA 3ZDMC 2GBNA 3Q3JA 4NAWB 3OLMD 3ZRCA 3PSEB 1TZ1A 2O2VB 2MWSB 2KHWB 2O6VD 3V62A 4AOFA 2KZRA 2JPHA 2M4NA 4FHKA 2L0TA 1EF1A 1HE8A 3KUCB 1WGGA 2KX0A 1NDDA 3W1SC 3ML9A 2CS4A 4ZDVA 5IA7A 2KFKB 4MGKE 2AWTA 4PS8A 4TQ0A 4HLEA 1P3QU 3DBLI 1WXVA 2GBKA 3KVFB 3OJ4B 3RZWC 3TCAA 2N9XA 2KK8A 3APDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UIP B;  3WAP A;  4I6N B;  3QX1 A;  2I1J A;  4K7S A;  4KIK B;  4JLC A;  2DYO A;  1WJ4 A;  4F8C B;  2R2O A;  5CTR C;  4IM2 A;  4AWJ A;  3ZTD A;  4FHJ A;  2LUE A;  3A9J B;  2KWU B;  3KYD D;  3WAO A;  3H1U A;  5JH5 C;  2DAJ A;  1WX7 A;  4W9G A;  4LCD E;  3AU4 A;  1P0R A;  2K8H A;  3APC A;  2NBW B;  4ICV A;  2IO0 B;  2NS5 A;  3LJ3 A;  4A3P A;  2NBV B;  3VXW A;  3I3T B;  2KDF B;  4RMA A;  3ZUN A;  2D2Q A;  3L0W B;  2JXX A;  4OVU A;  2KC1 A;  5BO4 B;  4W9C A;  4MGY E;  2C7M B;  2BGF A;  4F7Z A;  1UD7 A;  3NY5 A;  1UZX B;  4I6L B;  4ASW C;  4HJK A;  3EFU A;  3ECI A;  5D6J B;  1EO6 A;  2GBM A;  4DHZ E;  1WGR A;  2RSU A;  4WWN A;  3D32 A;  2REX A;  3S2A A;  1WGD A;  2ZCC A;  3ZW3 A;  4BVU C;  2D07 B;  3ZO5 B;  4URK A;  1J19 A;  1KOT A;  1R4M I;  4ZRI A;  4AJY B;  3UQB A;  3UQA A;  2ZNV C;  1OTR B;  1VD2 A;  4K7W A;  3N32 A;  4PYZ A;  1ISN A;  3KYC D;  2Z0D B;  4F1S A;  2IBI B;  2ZPY A;  4W9D A;  3EHV A;  4YL8 A;  5DPT A;  5KHQ A;  1WF9 A;  4IWP A;  1LXD A;  1ZKH A;  2FCS A;  3DVN U;  3L17 A;  3NHE B;  3BIN A;  3KUD B;  4GOC A;  2JUO A;  1WXM A;  3CMM B;  4TQ1 A;  4GMV A;  2IO3 B;  2N7E A;  4WWP A;  5D2M B;  5LLI A;  3RT3 B;  2UYZ B;  3JYU A;  2ZJD A;  3A9K A;  3U30 A;  2G45 B;  1S3S G;  3VVW B;  2JT4 B;  2K8C A;  5LXI B;  5L83 A;  2J0M A;  5L95 C;  1WM2 A;  5CX3 A;  2D3G A;  4IC7 B;  3DCG A;  2M17 A;  2DYB A;  2C7N B;  4BOS C;  4LJP B;  4MJS B;  4GN1 A;  1WJU A;  2L3Z A;  3IFW B;  2Y5B B;  2KC2 A;  1OGW A;  4KDI C;  3K9O B;  2BKR B;  5C1Z A;  2QHO A;  2XEW A;  5C23 A;  2BPS A;  4HPL B;  2BYV E;  2KDE B;  4TUU A;  4A20 A;  1V5O A;  3RYT A;  2JF5 A;  2KWC A;  3SU8 X;  2MCN B;  1GJZ A;  4HDQ A;  4BKG A;  2DZK A;  2MBE A;  3CF6 E;  3M3J A;  4E74 A;  3DBH I;  5CHV C;  4NNJ B;  3R7R A;  3Q3F A;  3L10 B;  1P98 A;  1SGH A;  4K1R B;  4GXB A;  3WAM A;  2G4D B;  2MA9 B;  2FNJ B;  4M8N A;  2K25 A;  2K6Q A;  3PV1 A;  4GDL A;  1A5R A;  3QCA A;  5DPS A;  1JRU A;  2DZJ A;  1WR1 A;  2LVP A;  2JRI B;  4W9H A;  3PGE A;  4EZL A;  2N1V A;  2GBR A;  2KLC A;  4W9E A;  2AL3 A;  2RGF A;  2KO3 A;  5JHB A;  2D11 A;  3A1Q A;  3UF8 A;  4MSM B;  4DXA B;  3TL5 A;  4CO7 A;  3EC8 A;  3ZIM A;  2AYO B;  1IPG A;  2JVC A;  4HK2 A;  3NZU A;  4NQL B;  2XBB C;  3WIM A;  4KVG B;  4WJP A;  4JL9 A;  2A4Z A;  3ZNH B;  4KDL B;  2FUH B;  4HDO A;  4LJO B;  1KJT A;  1S1Q B;  2L76 A;  2KX3 A;  2XK5 A;  4FBJ B;  2MBO A;  4II2 B;  2NR2 A;  3VDZ A;  3KUZ A;  1C3T A;  4FJV B;  4DHJ B;  2GMI C;  4IWO A;  1TBE A;  4W9L A;  3V6C B;  3ZNI D;  2GOW A;  4WWO A;  3RD2 A;  3PS6 A;  4XC2 A;  1UBI A;  4WJQ A;  5DPR A;  1I35 A;  1WI0 A;  4MM3 A;  3M63 B;  4MGZ E;  2R2Q A;  3R7Q A;  2K1F A;  4HCP B;  2Z59 B;  2ASQ A;  3PZD A;  2DZI A;  4LDT B;  2IY1 B;  4FJZ A;  1WMH A;  2EMS A;  4B95 A;  2A5U A;  2WWZ A;  5TR5 A;  1L7Y A;  1WR6 E;  1LM8 B;  4GDL B;  4IG7 B;  4E71 A;  3PTF C;  3R3M A;  3VH4 B;  1H4R A;  3H7S A;  4GIV A;  5E6O A;  2LRU A;  2IO2 B;  1GC7 A;  3W1S A;  2KAN A;  2BWF A;  1YIW A;  1KM7 A;  4PYU A;  4BKS D;  1IP9 A;  3DVG Y;  2LXC A;  1J0G A;  1V49 A;  2CHX A;  2UWQ A;  2G4S A;  2C5L C;  4P7I A;  2KQS A;  4KZC A;  4NPN A;  3A1Q B;  3CSF A;  3QC8 B;  3X23 A;  5J17 A;  2O6V A;  4KV2 A;  5J18 A;  3V60 A;  1BT0 A;  2KKC A;  4M0W B;  3A4R A;  5DCN A;  3PHX B;  1T0Y A;  3SHQ A;  1OEY A;  1WFY A;  2LZ6 A;  2FID A;  3QAQ A;  2KWV B;  2IO1 B;  3VH3 B;  2L05 A;  2CR5 A;  2MBH A;  2CHW A;  2MBB B;  3DBS A;  3QAR A;  2M8S A;  2XK5 B;  2ZCB A;  3AI5 A;  3BY4 B;  3PT2 B;  3TBL D;  4B6W A;  2MP2 A;  3B08 A;  4I6P A;  4G50 A;  1LQB A;  3P2B A;  4W9J A;  2LVQ A;  1P1A A;  1PQS A;  1Q0W B;  3PLV A;  2KJR A;  4K81 A;  4ZRK A;  1E7V A;  1UH6 A;  2LWP A;  3A4S C;  4NJ7 A;  4HVB A;  1U4A A;  1TTN A;  3CST A;  4ZYN A;  5LXH A;  3H6N A;  3AUL A;  4G3X B;  4G11 A;  2NCN A;  2N9E B;  4ICU A;  3PPA A;  1FXT B;  5HKH A;  2BYF A;  4WJO A;  4DK5 A;  2FAZ A;  2FCM A;  2L0F A;  2V1Y A;  2N9P C;  4EZJ A;  5J2R A;  1YX6 B;  2JWZ A;  2Z0E B;  2YVC A;  4OVV A;  2JZ3 B;  2LI5 A;  3JSV A;  1Q5W B;  1ZGU B;  1OQY A;  1E8W A;  2BKF A;  1EF5 A;  2WX1 A;  4FJY A;  3B0A A;  4A3O A;  1F9J A;  2I1K A;  3DQV A;  5AZH A;  4PS3 A;  3MHS D;  1M94 A;  2PEA A;  4FLH A;  2O6V B;  2WX0 A;  3V6E B;  2DZM A;  3QK0 A;  3ZNZ B;  2B3A A;  4BBN C;  4HWI B;  2MLB A;  1L2N A;  1UGM A;  3L08 A;  3K9P B;  2DX5 B;  3R66 C;  2KMA A;  4HXD A;  5CHF A;  3ZKJ C;  2LD9 A;  4GGQ A;  1R4N I;  2K39 A;  3ONS A;  5D7G A;  4NAW A;  4FAD A;  4KSL C;  1WJ6 A;  4M8M A;  4CHK A;  1E90 A;  3PRZ A;  2MQJ A;  4KZ0 A;  2O2V A;  2MP2 B;  2KFJ A;  3SDL C;  3ZTC A;  1WX8 A;  4WAA A;  4BOZ B;  3HHM A;  3IVF A;  3RZF A;  4TKN A;  4W9I A;  4ANV A;  2NVU I;  2NBU A;  4KSK C;  3PRP B;  1Q1O A;  2DEN B;  4JIO U;  3T9L A;  1V80 A;  4ZRJ A;  4EEW A;  1H8C A;  4MEM A;  4KIK A;  2OJR A;  3A9K B;  4JQW C;  3VTU A;  3PRM B;  2ZNV B;  2NPT A;  4AP4 C;  4NJ6 A;  1SIF A;  1WGY A;  2EKE C;  2VRR B;  1K8R B;  2KLG A;  3DVG X;  3O65 B;  3H9D A;  3PVL A;  3JSV B;  4GB9 A;  3QHT A;  2KXJ A;  2PE6 B;  2J0J A;  2WDT B;  3HM3 A;  3WAL A;  4EZK A;  2PJH A;  1EUV B;  3RUI B;  2MBQ A;  3EEC A;  2J0K A;  1SE9 A;  1X1M A;  3QQ8 B;  1WXA A;  2WYQ A;  1Z2M A;  4NY0 A;  5D94 A;  5AZF A;  2FIF A;  3TMP B;  2RD0 A;  2IYD B;  2KDB A;  3VTV A;  4HCN B;  3VFK A;  3L54 A;  3ML8 A;  1GNU A;  1J8C A;  3QJZ A;  3VUW A;  3MTN B;  1GUA B;  3PRE A;  2HTH A;  2L00 B;  4HPM B;  1WY8 A;  2MRP A;  3ALB A;  3HK0 A;  3N3K B;  1UEL A;  2N7D A;  4MDK E;  3RUL A;  4DDG D;  1MG8 A;  2LVO A;  2ZVN A;  1I42 A;  1V5T A;  2AL6 A;  4EFO A;  1XT9 B;  2BWE S;  3DBR I;  3VQI A;  3VUX A;  1LFD A;  1V86 A;  4DWF A;  4FA6 A;  2FCQ A;  4W9K A;  1UBQ A;  1GC6 A;  4IM0 A;  4WJN A;  3DVN V;  3KW5 B;  4XX5 A;  2NPT B;  3H7P A;  3DOW A;  2DHZ A;  4CYE A;  2FCN A;  1WGH A;  3ZRF A;  1YQB A;  2C9W B;  3OAW A;  5GMV A;  2LXA A;  4N9F 4;  4IW0 A;  2M0X A;  5EDS A;  1WX9 A;  2KJH B;  5JZE B;  2N1W A;  1WZ0 A;  3L13 A;  1CMX B;  1WYW B;  3U7D A;  3T8M A;  1E8Z A;  4MJS A;  3VUY A;  2LGY A;  1NBF C;  3TIX A;  1GG3 A;  1Z5S B;  4GU2 A;  2ZVO A;  1RLF A;  1WE6 A;  1TGZ B;  3U8Z A;  4BBN F;  2KTF A;  1YD8 U;  4K7U A;  3VAW A;  1V6E A;  3ZNG C;  3ZVV A;  2HE7 A;  2JZZ A;  4MSQ B;  3W1Y A;  1IYF A;  3UGB B;  4BKS A;  1WE7 A;  2GBJ A;  3WAN A;  4EOY A;  4G0N B;  3ENE A;  3QIJ A;  2HD5 B;  2CKH B;  4AUQ C;  1WMH B;  1E8X A;  5KHO A;  3MJW A;  4DHJ D;  1Y8R C;  1WXS A;  4TV3 A;  4MGI E;  4IM3 A;  4EUT A;  2RPQ A;  2W9N A;  1V9J A;  1YX5 B;  1AAR A;  1WH3 A;  2KNB A;  2JY6 A;  4DBG A;  3JW0 X;  4B9K A;  4EKU A;  4II3 B;  2V4L A;  3JVZ X;  4GSW A;  3VHT C;  2ZEQ A;  3AXC A;  2OOB B;  3HIZ A;  4LDT D;  5G55 A;  2KVR A;  1WZ3 A;  4XZ4 A;  1XQQ A;  4FN2 A;  2ZZP B;  2KTR A;  4E3C A;  4RM8 A;  3H7P B;  2LGD A;  2RR9 A;  2CHZ A;  4GDK A;  3IG3 A;  4MEL A;  3TJP A;  3DPD A;  3HM6 X;  4DHZ B;  3PLU A;  2ZPN A;  1YJ1 A;  3RCZ A;  3C0R B;  2JRH A;  1G6J A;  3QWZ B;  4J6I A;  3M95 A;  4JGH B;  3AU5 A;  4ANW A;  3IHP C;  2K8B A;  2BYE A;  3WA0 A;  2IY0 B;  1KLV A;  2KJ6 A;  2CU1 A;  2DAF A;  2LGX A;  3IBE A;  5AZG A;  5CHW A;  4BFR A;  4WQO B;  3B1L X;  2LRW A;  1NI2 A;  3V61 A;  2DYM A;  4DDI D;  3NS8 A;  2KFK A;  3X0W A;  3L16 A;  4IWQ A;  2C7H A;  3NOB A;  4W9F A;  4MH0 E;  3OJ3 A;  1QZE A;  2MX2 A;  1E5W A;  2L7R A;  2MW5 A;  4BKT A;  1WM3 A;  2J7Q B;  2KDI A;  3PHW B;  3UIO B;  4AJW A;  3APF A;  1WRD B;  2V3S A;  4ANX A;  3LDZ E;  2KN5 A;  2HJ8 A;  1E7U A;  3DDC B;  2YLM A;  2PE9 A;  3A9J A;  5IAA C;  1C1Y B;  1V2Y A;  2LJ5 A;  3UIN B;  4RM9 A;  5JHA A;  2KD0 A;  1E8Y A;  2M1M A;  2EMT A;  4FUL A;  4X57 B;  2K6D B;  5E6P A;  3NZS A;  1VCB A;  2MSE D;  2L8J A;  3ZDT A;  3ZLZ A;  3QA8 A;  1OEY J;  1D3Z A;  2KQ7 A;  2N4F A;  2AEH A;  4NQK E;  3SD5 A;  2PPH A;  2LAS A;  1RFA A;  3VTW A;  5DPW A;  1RAX A;  2D10 A;  2KOX A;  4IUM B;  4ANU A;  3M62 B;  1WJN A;  4PS7 A;  5FR6 A;  2IZV B;  2G3Q B;  2BF8 B;  3GZN I;  3KH0 A;  3N30 A;  1WIA A;  2KTR B;  5G2N A;  1V81 A;  1P9D U;  4GDK B;  5AEK B;  2KMC A;  5E6N A;  1ZW7 A;  3A33 B;  1XD3 B;  2C60 A;  3GOE A;  1RRB A;  3ZDM C;  2GBN A;  3Q3J A;  4NAW B;  3OLM D;  3ZRC A;  3PSE B;  1TZ1 A;  2O2V B;  2MWS B;  2KHW B;  2O6V D;  3V62 A;  4AOF A;  2KZR A;  2JPH A;  2M4N A;  4FHK A;  2L0T A;  1EF1 A;  1HE8 A;  3KUC B;  1WGG A;  2KX0 A;  1NDD A;  3W1S C;  3ML9 A;  2CS4 A;  4ZDV A;  5IA7 A;  2KFK B;  4MGK E;  2AWT A;  4PS8 A;  4TQ0 A;  4HLE A;  1P3Q U;  3DBL I;  1WXV A;  2GBK A;  3KVF B;  3OJ4 B;  3RZW C;  3TCA A;  2N9X A;  2KK8 A;  3APD A; 
#chains in the Genus database with same CATH topology
 3WAP A;  4K7S A;  4JLC A;  1WRI A;  5C2T B;  4F8C B;  2W55 A;  1GB4 A;  4DQO C;  1WX7 A;  4W9G A;  3W5V B;  2K8H A;  4AS1 A;  2AQ2 B;  2NS5 A;  2I2Y A;  2JXX A;  2C7M B;  3NY5 A;  1T3Q A;  3EFU A;  1EO6 A;  4WQM A;  3RFZ B;  3S2A A;  3ZW3 A;  4URK A;  3ZO5 B;  1FCL A;  2K0P A;  1RFK A;  4AJY B;  1OQQ A;  5IOI A;  3SFD B;  2ZNV C;  2ICI A;  1VD2 A;  1I4R A;  1A70 A;  1L4Z B;  4WUR A;  3EHV A;  4YL8 A;  5KHQ A;  1WF9 A;  2M19 A;  1T0Q C;  4KGT A;  1LXD A;  1ZKH A;  2FCS A;  4M00 A;  2N7J A;  2V3P A;  3NUH B;  2JUO A;  3IAS 1;  3JYU A;  5MPO A;  1CZP A;  2LGI A;  3TEX A;  3VVW B;  4LK0 M;  4IC7 B;  3DHH C;  2M17 A;  5HI1 A;  2C7N B;  3I5J C;  3TEY A;  2QHO A;  1V5O A;  2JF5 A;  3R2T A;  2MCN B;  4HDQ A;  3R7R A;  3L10 B;  1SGH A;  3NVY A;  3PZ7 A;  3WAM A;  2K22 A;  4M8N A;  5G5G A;  3ZXR A;  4H2A A;  2N9K A;  5DPS A;  2DZJ A;  1T0S C;  4W9H A;  2JRI B;  3PGE A;  2N1V A;  1IBX B;  3W5U B;  2GBR A;  5JXV A;  1KRH A;  2AL3 A;  5JHB A;  2D3B A;  4JE3 B;  4DXA B;  2QJL A;  3TL5 A;  2AYO B;  4MAC A;  2FE8 A;  3CWI A;  4HK2 A;  4NQL B;  4AQ7 A;  4KVG B;  3ZNH B;  1K52 A;  4KDL B;  2FUH B;  2XK5 A;  3AE4 B;  4FBJ B;  1QF6 A;  3KUZ A;  1TBE A;  3V6C B;  4WWO A;  2BYT A;  3GE3 C;  2ACZ B;  2R2Q A;  4RCO A;  4RH6 A;  4PK1 A;  1WMH A;  3ABV B;  2WXP A;  4KKJ A;  4E71 A;  1L7Y A;  1T6B X;  3R3M A;  3H7S A;  2IO2 B;  1GC7 A;  1BML C;  2KAN A;  2DLB A;  1YIW A;  1KM7 A;  1IP9 A;  1Y56 A;  1J0G A;  2G4S A;  4RFB A;  2G9H D;  4KZC A;  4B0E A;  5J17 A;  4KV2 A;  5J18 A;  1BT0 A;  4M0W B;  1CJE A;  1T0Y A;  1WFY A;  2SEB D;  3QAQ A;  2L52 A;  3AEA B;  3DBS A;  4IKG A;  3TUO A;  1JRO A;  2LJI A;  2XK5 B;  3Q3M C;  4BZA A;  1FXI A;  2KJR A;  1EM7 A;  4K81 A;  1E7V A;  4NJ7 A;  2LWP A;  3AE8 B;  3VRA B;  4ICU A;  3RNF C;  2WU5 B;  4WJO A;  4DK5 A;  4EZJ A;  1FFV A;  2JWU A;  3AE5 B;  2J4X A;  2WXN A;  1XCQ L;  3JSV A;  3AEB B;  1E8W A;  1FRR A;  3B0A A;  1N61 A;  3MHS D;  3LYY A;  2ON8 A;  1I4P A;  2WX0 A;  2ZW1 A;  3ZNZ B;  4BBN C;  1UGM A;  1R4N I;  5H92 C;  5D7G A;  1WJ6 A;  3T3N A;  2MQJ A;  2O2V A;  1QOF A;  3SDL C;  1WX8 A;  2D3A A;  4WAA A;  1PDX A;  4OHJ A;  2NVU I;  3KWL A;  3SR6 A;  1YN4 A;  4KSK C;  4KIK A;  3A9K B;  4JQW C;  2ZNV B;  4MT5 A;  1K8R B;  1SEB D;  3JSV B;  3QHT A;  1NYQ A;  3RNG C;  4P1C C;  2WDT B;  1C4P A;  3HM3 A;  3BVM A;  1EUV B;  2MBQ A;  1OQR A;  2BT6 A;  1FNU A;  1X1M A;  3QQ8 B;  1JW9 D;  3SFE B;  4WWM A;  3TMP B;  2RD0 A;  3VFK A;  3L54 A;  3ML8 A;  1D5X C;  4K3C A;  4XWW A;  3KQ4 A;  4XYC A;  2NTS A;  3PRE A;  5FKA C;  2MRP A;  2N7D A;  3RUL A;  3RNC C;  2ZVN A;  2AL6 A;  1Q10 A;  4LNK A;  2BB5 A;  1B1Z A;  3VUX A;  4N6E B;  4FA6 A;  4FXC A;  4JPS A;  1YQB A;  2HTM E;  2M0X A;  1WX9 A;  5JZE B;  1CMX B;  1ACC A;  4DXF A;  1R4N B;  1FMA D;  1L5P A;  3TIX A;  1GG3 A;  1Z5S B;  4GU2 A;  1WE6 A;  3ETR A;  4TMA B;  2W82 A;  1YD8 U;  4K7U A;  3VAW A;  2HE7 A;  4MSQ B;  1STE A;  3UGB B;  4BKS A;  4AUQ C;  3KWV A;  3BWU D;  5KHO A;  1GB1 A;  4OZC A;  1Y8R C;  2WXK A;  1VJK A;  4ACF A;  2W9N A;  1YQ3 B;  3JW0 X;  4B9K A;  2V4L A;  2JYT A;  1WZ3 A;  2FBW B;  5E6J A;  1AWD A;  2KTR A;  4E3C A;  5T8I A;  3IXS A;  4MEL A;  1I4Q A;  2WXL A;  3RCZ A;  3RI7 C;  3QWZ B;  2N9L A;  2AX5 A;  4J6I A;  3M95 A;  2K8B A;  5BYR A;  4C56 C;  3WA0 A;  1YJI A;  3HVD A;  3O13 A;  2DYM A;  1GPX A;  3NS8 A;  3X0W A;  4IWQ A;  4ZHP A;  3OJ3 A;  2MX2 A;  2L7R A;  1WM3 A;  2J7Q B;  1LGR A;  4A6Q A;  1WRD B;  3PZ8 A;  2YLM A;  2PIA A;  1V2Y A;  5JHA A;  2MJD A;  2QCZ A;  2KD0 A;  2M1M A;  3EGR A;  4FUL A;  4X57 B;  1DGJ A;  2K6D B;  1D3Z A;  2L8J A;  1OEY J;  3GS2 A;  4NQK E;  3SD5 A;  2LAS A;  2INC C;  5FR6 A;  4YTP B;  2KTR B;  4HKQ A;  1QLB B;  2J53 A;  2C60 A;  3GOE A;  4R3D A;  1RRB A;  3ZDM C;  1TS5 A;  1PGA A;  1TZ1 A;  3BYY B;  3V62 A;  2BW2 A;  2LHE A;  3GP7 A;  1EF1 A;  3ML9 A;  4M01 A;  5IP4 D;  1WXV A;  2GBK A;  3OJ4 B;  3TCA A;  4ANX A;  3APD A;  3UIP B;  4I6N B;  2I1J A;  2DYO A;  1HZ6 A;  2R2O A;  5CTR C;  4AWJ A;  5BMG A;  3KYD D;  2DAJ A;  2YEP F;  4L1B A;  4IOI E;  2WS3 B;  1YN5 A;  2D5G A;  4C7Z A;  3ZUN A;  3AE3 B;  1I4X A;  4OZA A;  2KC1 A;  4OVU A;  3I57 A;  4W9C A;  5EE0 A;  4MGY E;  5G5H A;  3HUI A;  2BGF A;  4F7Z A;  4I6L B;  3P4S B;  4ASW C;  4HJK A;  4DHZ E;  2RSU A;  1N5W A;  1DYQ A;  1TYG B;  2ZCC A;  2D07 B;  4ZRI A;  1HTO A;  3LB8 C;  1FNW A;  1OTR B;  4PYZ A;  3N32 A;  3AH7 A;  3KYC D;  1C76 A;  3IT6 B;  2Y5P A;  5DPT A;  2RPV A;  3AE9 B;  3DVN U;  3L17 A;  5BMH A;  4P6V F;  3CMM B;  4TQ1 A;  2IO3 B;  2INN E;  3RT3 B;  2PKO A;  2ZJD A;  3U30 A;  4RF1 A;  1S3S G;  2K8C A;  5L83 A;  5L95 C;  5CX3 A;  2D3G A;  3AE6 B;  1K53 A;  4MJS B;  1WJU A;  3IFW B;  1GAQ B;  3OG5 A;  2KC2 A;  4ZOH C;  1PGB A;  3I63 C;  2BKR B;  5C1Z A;  5C23 A;  4TUU A;  3NRZ A;  2BYV E;  2KDE B;  3VR9 B;  4ZHO A;  3FAH A;  4UDU C;  2XNA C;  1I4G A;  4K1R B;  2K25 A;  2K6Q A;  2WXG A;  3QCA A;  4EZL A;  1TIF A;  4LTU A;  4N58 A;  4JWS C;  2KLC A;  2RGF A;  2D11 A;  3UF8 A;  4MSM B;  4CO7 A;  3EC8 A;  3MC8 A;  2JVC A;  1KLG D;  4HJG E;  1MHH E;  4ITK A;  2XBB C;  4WJP A;  4HDO A;  2L76 A;  1S1Q B;  4II2 B;  2NR2 A;  3ZYY X;  1C3T A;  4FJV B;  4IWO A;  1QIL A;  4W9L A;  3PS6 A;  5DPR A;  1WI0 A;  4MM3 A;  3FC4 A;  1SBB B;  4LDT B;  3AE2 B;  2IY1 B;  2EMS A;  1WR6 E;  4RF0 A;  2LRU A;  3AV8 A;  2RMM A;  4BKS D;  3DVG Y;  1R7S A;  4P7I A;  2IDY A;  3J9C A;  1IGD A;  3CSF A;  3QC8 B;  3V60 A;  2KKC A;  4REZ A;  3PHX B;  5D3I B;  2IO1 B;  2L05 A;  4NZL B;  3U7Z A;  3N1Y C;  1MVK A;  2MBB B;  3BY4 B;  1FM0 D;  3PT2 B;  4B6W A;  5AUI A;  2BQQ A;  2KN4 A;  4G50 A;  3P2B A;  2MHJ A;  1JCK B;  3PLV A;  2JZP A;  2KAJ A;  1TTN A;  3CST A;  4ZYN A;  3H6N A;  3AEC B;  1FXT B;  3WCQ A;  1FFU A;  2FAZ A;  5J2R A;  2YVC A;  4OVV A;  2JZ3 B;  4YSZ B;  2WXO A;  4A3O A;  2PTL A;  5AZH A;  1C78 A;  2EEL A;  2CJO A;  1M94 A;  2PEA A;  4FLH A;  3PO0 A;  5BYQ A;  3V6E B;  3QK0 A;  2B3A A;  4US8 A;  1L2N A;  2W3R A;  4A55 A;  3ZKJ C;  4GGQ A;  1QQR A;  1J7B A;  3FIL A;  4FAD A;  1XLP A;  1E90 A;  3PRZ A;  4KZ0 A;  2QSD A;  1KF6 B;  1ROE A;  4RGM A;  2WDV B;  4W9I A;  1SJH D;  3P42 A;  2NBU A;  2KAC A;  2DEN B;  4JIO U;  1SIJ A;  1N62 A;  5C3J B;  5BYS A;  1VLB A;  4MEM A;  1T5X D;  4AP4 C;  3AED B;  1C4A A;  2VRR B;  3NVV A;  2UU7 A;  2X8X X;  4GB9 A;  3B2G A;  1YOV B;  3WAL A;  3FKY A;  2ONQ A;  1SE9 A;  1SE3 A;  5TSS A;  5AZF A;  4NY0 A;  4C00 A;  1SSN A;  4RNA A;  3FIL B;  1J8C A;  3VUW A;  2Y5C A;  3MTN B;  4HPM B;  2L00 B;  2JYE A;  3ALB A;  3N3K B;  1YN3 A;  1IGC A;  1WXQ A;  3BZD B;  2BWE S;  3DBR I;  3VQI A;  1LFD A;  1PGX A;  3TEZ A;  2WGS A;  3DVN V;  4LNF A;  1WGH A;  3OAW A;  2LXA A;  5EDS A;  3T8M A;  3VUY A;  1K51 A;  1WWT A;  4XE0 A;  1F52 A;  2JXT A;  1RLF A;  3U8Z A;  2KTF A;  1D4B A;  1EWC A;  3W1Y A;  3WAN A;  1C4C A;  3E9S A;  3ENE A;  1KLU D;  4Q2J A;  1WMH B;  3MJW A;  3N1Z C;  1E9M A;  1WXS A;  4TV3 A;  3RN9 C;  1JRP A;  1E6E B;  4EUT A;  4ARC A;  2K5P A;  1V9J A;  1YX5 B;  1UGJ A;  2G1E A;  2BS3 B;  4EKU A;  3JVZ X;  4LDT D;  3HIZ A;  5G55 A;  2KVR A;  4XZ4 A;  4FN2 A;  2ZZP B;  1DOY A;  4RM8 A;  2LGD A;  4GDK A;  3DPD A;  2XN9 C;  3PLU A;  2JRH A;  2JQR B;  4M02 A;  3IHP C;  2VZK B;  2BYE A;  1ESF A;  1KLV A;  2WU2 B;  1YJJ A;  5AZG A;  5CHW A;  4BFR A;  3B1L X;  3V61 A;  2WXM A;  1HZ5 A;  2KFK A;  3ZJT A;  4XGA B;  2CJN A;  1BUI C;  2C7H A;  4MH0 E;  1QZE A;  1E5W A;  4WAF A;  3DBR B;  4AJW A;  2FUG 1;  2MJE A;  3APF A;  2LFI A;  1E7U A;  3DDC B;  4JX1 C;  3UI3 A;  3A9J A;  2M56 B;  2PMV A;  3DWM A;  3I9V 1;  2EMT A;  3ZLZ A;  3QA8 A;  2V3N A;  2N4F A;  1XO3 A;  1F1H A;  1RFA A;  2BBC A;  4ANU A;  1B9R A;  1JML A;  2BF8 B;  1SE4 A;  3KH0 A;  1WIA A;  2WLB A;  1J7C A;  1MPE A;  1V1P A;  1VZ8 A;  5HFY A;  1P9D U;  4GDK B;  5AEK B;  5E6N A;  2QIE B;  3A33 B;  2YEP B;  3BVG A;  1NEK B;  1QOA A;  3Q3J A;  1QT9 A;  4A9A A;  1WGK A;  1PFD A;  2O2V B;  2KHW B;  1F2R I;  2GRI A;  3P4P B;  1EWY C;  4AOF A;  2KZR A;  4YT0 B;  2L0T A;  3KUC B;  1WGG A;  1NDD A;  3W1S C;  4ZDV A;  5IA7 A;  2CU3 A;  2KFK B;  4HLE A;  4TQ0 A;  3DBL I;  3RZW C;  2QDF A;  1ZP0 B;  2NMQ A;  4KIK B;  2BS4 B;  1TT5 B;  2LUE A;  3A9J B;  4JWU C;  1KFY B;  3WAO A;  3MP9 A;  3H1U A;  4C80 A;  1HTQ A;  4LCD E;  4HRS A;  3AU4 A;  3APC A;  3Q8F A;  2NBW B;  3LJ3 A;  2NBV B;  1J7A A;  2KDF B;  4RMA A;  1BXT A;  3L0W B;  3N20 C;  1FPY A;  1UZX B;  1TS4 A;  5EE9 A;  1V1P B;  1WGR A;  1F77 A;  4YTN B;  4WWN A;  2V0G A;  3D32 A;  2REX A;  1J19 A;  3UQB A;  5HG2 A;  3UQA A;  2QC8 A;  2SAK A;  2Z0D B;  1VZ7 A;  2ZPY A;  4W9D A;  2KYW A;  2QEJ C;  4IWP A;  1K50 A;  3VRB B;  4C4V A;  2MEK A;  3BIN A;  4HKZ E;  4GOC A;  1L4D B;  2N7E A;  4WWP A;  4LNO A;  1N6Z A;  2G45 B;  4OZB A;  4L23 A;  5LXI B;  2LGS A;  3GE8 C;  3DCG A;  2DYB A;  4GN1 A;  2L3Z A;  2Y5B B;  1OGW A;  3BVZ A;  4KDI C;  1JWM D;  3AE7 B;  2KWC A;  3SU8 X;  4A8X C;  1GJZ A;  3HRD D;  4BKG A;  2MBE A;  3M3J A;  1M4V A;  3DBH I;  4NNJ B;  2PW9 A;  2VH2 A;  1P98 A;  2H88 B;  3DBL B;  3DHI C;  1JWU D;  1FRD A;  2G4D B;  2MA9 B;  2FNJ B;  4GDL A;  2JU6 X;  1MHX A;  1A5R A;  4KKI A;  4RGO S;  1F0Z A;  1WR1 A;  2LVP A;  2Y3A A;  4EE2 A;  1HQR D;  4IDI A;  4C4V B;  4W9E A;  2MH7 A;  1EU4 A;  3RNE C;  3A1Q A;  1GOZ A;  1DOI A;  1DOX A;  3ZIM A;  3ZXV A;  1IPG A;  1MI0 A;  3WIM A;  2A4Z A;  3U52 E;  2KX3 A;  2MBO A;  4DHJ B;  3ZNI D;  4D2K A;  3RD2 A;  1D6E C;  1I35 A;  4MGZ E;  3R7Q A;  1FEH A;  2ASQ A;  1JWB D;  2RDG A;  2VZK D;  4C7Y A;  4FJZ A;  1V1O A;  2A5U A;  4HEA 1;  2R61 A;  3RMK C;  1LM8 B;  4GDL B;  3PTF C;  1HEZ E;  2LHD A;  3VH4 B;  5E6O A;  3W1S A;  2LMC A;  4TSS A;  2J42 A;  2LXC A;  2WXR A;  2UWQ A;  3C19 A;  2C5L C;  2KQS A;  3A1Q B;  2O6V A;  2DWQ A;  4GLS C;  1EU3 A;  3SHQ A;  5FK9 C;  1ENF A;  2KWV B;  4A90 A;  1UNS A;  2MBH A;  2CHW A;  3AMZ A;  3QAR A;  4ARI A;  2ZCB A;  1ET9 A;  3TBL D;  3B08 A;  1TKG A;  4USA A;  4W9J A;  3DBH B;  1NI3 A;  2LVQ A;  1P1A A;  1PQS A;  2W3S A;  1Q0W B;  4ZRK A;  4O1N A;  2L83 A;  1UH6 A;  4XWT A;  4WH4 A;  3DWG C;  3AUL A;  2NCN A;  2N9E B;  4WIP A;  2IND C;  2FCM A;  2L0F A;  2N9P C;  1YX6 B;  4S0R A;  2ZW0 A;  2Z0E B;  4LLG M;  1OQY A;  2BKF A;  1EF5 A;  2WX1 A;  4FJY A;  4HRO A;  1F9J A;  2I1K A;  1QOB A;  4PS3 A;  1VR9 A;  2O6V B;  1JWS D;  2DZM A;  4HWI B;  1VZ6 A;  3L08 A;  3K9P B;  2DX5 B;  4HXD A;  2KMA A;  5CHF A;  2K39 A;  3R2I A;  1KH0 A;  3ONS A;  4NAW A;  1OFF A;  4M8M A;  1E10 A;  3BYT B;  2KFJ A;  3C8Y A;  4BOZ B;  4L2Y A;  3HHM A;  3IVF A;  4TKN A;  3GB1 A;  5H8Y E;  4ANV A;  2IGD A;  3AB5 A;  1Q1O A;  3N1X C;  2N0S B;  4ZRJ A;  1H8C A;  4LNI A;  2QIL A;  4XDD A;  3PRM B;  3CIR B;  2NPT A;  4NJ6 A;  1WGY A;  2WXI A;  1NEN B;  1UWM A;  3H9D A;  3PVL A;  3Q8B A;  2PJH A;  3RUI B;  1V8C A;  3EEC A;  2J0K A;  2KDM A;  3E56 A;  3NZ3 A;  4N59 A;  1WXA A;  1Z2M A;  5D94 A;  2FIF A;  3VTV A;  1QOG A;  2IYD B;  2I38 A;  1GNU A;  1VRA B;  3QJZ A;  3AEG B;  2OJW A;  2BVC A;  1GUA B;  2HTH A;  3URY A;  1WY8 A;  3HK0 A;  1LO5 D;  3AM9 A;  1UEL A;  2K3U A;  4MDK E;  4CQN A;  4DDG D;  1MG8 A;  1JAL A;  1V86 A;  4DWF A;  3B2F A;  2FCQ A;  4W9K A;  1GC6 A;  4WJN A;  1P7E A;  4XX5 A;  2NPT B;  4CYE A;  3ZRF A;  4N9F 4;  4YTM B;  3RNA C;  1WZ0 A;  5IO9 A;  3L13 A;  3U7D A;  3Q8C A;  4BBN F;  1D5Z C;  4MM3 B;  3HVZ A;  3W9C B;  3ZNG C;  3EA6 A;  1XLO A;  1WE7 A;  4EOY A;  1TY0 A;  4G0N B;  3QIJ A;  1SB3 C;  2CKH B;  2HD5 B;  3ZQ4 A;  1E8X A;  4DHJ D;  2KQ4 X;  4MGI E;  3SEB A;  4IM3 A;  3W2D A;  1KTK A;  2RPQ A;  1TKE A;  5BMI A;  1RWS A;  2WXQ A;  1IBX A;  4GSW A;  3VHT C;  2ZEQ A;  1L0Y B;  1XQQ A;  5LNK 1;  2RR9 A;  4PT5 A;  1TY2 A;  3TJP A;  1L0X B;  2K9X A;  4YSY B;  4DHZ B;  2ZPN A;  1YJ1 A;  1G6J A;  3B9J A;  4ANW A;  2PVO D;  3Q69 A;  2KJ6 A;  3T3O A;  2DAF A;  3AEE B;  1SJE D;  1ZDX A;  4WQO B;  2LRW A;  4W9F A;  2KMM A;  3V3X A;  4BKT A;  3LDZ E;  2KN5 A;  2HJ8 A;  2PE9 A;  4K3B A;  5IAA C;  1C1Y B;  2LJ5 A;  3UIN B;  4RM9 A;  2IPK D;  2HJ1 A;  5E6P A;  1VCB A;  2MSE D;  3ZDT A;  3U4E G;  5DPW A;  1NVI D;  1RAX A;  2NTT A;  2D10 A;  2DNF A;  3M62 B;  4PS7 A;  4P1B C;  2WNM A;  3GZN I;  3DHG C;  4M0W A;  3Q8E A;  3IT4 B;  1XLN A;  2KMC A;  1XD3 B;  1MFW A;  2GBN A;  5IN7 A;  3OLM D;  3L4P A;  2O6V D;  2M4N A;  4FHK A;  3V05 A;  2CS4 A;  3U2S C;  3Q8A A;  3MHZ A;  2KK8 A;  2WDQ B;  4RGN A;  3ZGZ A;  2W54 A;  3QX1 A;  4HPP A;  2LEK A;  1WJ4 A;  4IM2 A;  1F2R C;  3ZTD A;  4FHJ A;  1UUP A;  2TSS A;  2KWU B;  2WXF A;  3BK1 A;  3NS1 A;  5JH5 C;  3RNB C;  1P0R A;  4ICV A;  2IO0 B;  4A3P A;  5AUK A;  3I3T B;  3VXW A;  2D2Q A;  3R8B A;  5BO4 B;  3P4Q B;  1UD7 A;  5FR3 A;  3ECI A;  5D6J B;  2GBM A;  1FNV A;  1ZPS A;  4BAX A;  2IGH A;  1WGD A;  1KOT A;  4BVU C;  1R4M I;  1XF5 L;  4S17 A;  2V4I B;  4K7W A;  1ISN A;  1TS3 A;  4F1S A;  2IBI B;  1N60 A;  3NHE B;  3KUD B;  1WXM A;  4GMV A;  5D2M B;  5LLI A;  2UYZ B;  2RDB C;  3N9Y C;  1I7H A;  3A9K A;  3Q6B A;  1SE2 A;  3AN1 A;  2JT4 B;  3NJT A;  3GZN B;  1ZDV A;  2J0M A;  1WM2 A;  2WP9 B;  4BOS C;  4LJP B;  3MJ5 A;  4RGT A;  2WDR B;  3K9O B;  2XEW A;  3MC9 A;  2BPS A;  4HPL B;  4A20 A;  3RYT A;  1XXG A;  3P4R B;  2DZK A;  4E74 A;  3CF6 E;  5CHV C;  1E7P B;  3ZJU A;  3Q3F A;  4P16 A;  4ZYS A;  4GXB A;  3H8H A;  3PV1 A;  2JX5 A;  1N63 A;  1JRU A;  2JSV X;  1SF0 A;  2KO3 A;  1QKZ A;  2GI9 A;  5EE3 A;  4NAM A;  4J3O D;  1AN8 A;  4ZRP A;  1FD6 A;  3NZU A;  1FIQ A;  1FCC C;  4JL9 A;  4LJO B;  2IJ0 A;  1KJT A;  4LNN A;  3VDZ A;  1R4M B;  2GMI C;  4YXD B;  1TS2 A;  2GOW A;  4XC2 A;  1UBI A;  4WJQ A;  1MJD A;  3M63 B;  2E6X A;  2K1F A;  4ZRQ A;  4HCP B;  2Z59 B;  2OED A;  3NVW A;  1AYF A;  3PZD A;  2DZI A;  2OHF A;  3MFG A;  2L1A A;  4B95 A;  3TEW A;  2WWZ A;  1ZXI A;  4IG7 B;  5TR5 A;  2H89 B;  1H4R A;  4GIV A;  2GLS A;  2BWF A;  4PYU A;  1T0R C;  1V49 A;  2CHX A;  2IGG A;  1UF0 A;  4NPN A;  2BTE A;  5IKC M;  3NG0 A;  3EFC A;  3X23 A;  4XDC A;  3A4R A;  5DCN A;  2INP E;  1XCT L;  1OEY A;  2LZ6 A;  2FID A;  3VH3 B;  2CR5 A;  2VH1 A;  4YSX B;  1D5M C;  2M8S A;  3AI5 A;  1C77 A;  2LUM A;  2MP2 A;  4I6P A;  1LQB A;  1FO4 A;  4QAY A;  4B0M A;  2HDE A;  3A4S C;  4HVB A;  3P63 A;  1U4A A;  3AEF B;  5LXH A;  4G3X B;  4G11 A;  2KT7 A;  3PPA A;  1V97 A;  5HKH A;  2BYF A;  1WYG A;  2E3T A;  2V1Y A;  2JWZ A;  4OW0 A;  2WHI A;  2LI5 A;  3OWE B;  1E0Z A;  1Q5W B;  1ZGU B;  2WXH A;  2M0A A;  3DQV A;  4KX6 B;  3P1M A;  2MLB A;  3R66 C;  2LD9 A;  4KSL C;  4CHK A;  2MP2 B;  1NYR A;  4KGR A;  3ZTC A;  1PYW D;  1PUT A;  3RZF A;  3Q3O C;  3Q2A C;  3ZJV A;  3PRP B;  3T9L A;  1IUE A;  1V80 A;  4EEW A;  2OJR A;  3VTU A;  1SIF A;  2EKE C;  5HHD G;  3MC0 B;  3Q14 C;  2KLG A;  3DVG X;  4US9 A;  3O65 B;  2KVZ A;  2KXJ A;  5D3D A;  1CK1 A;  2PE6 B;  2J0J A;  1I4H A;  4EZK A;  2Z8L A;  1ZOY B;  1MG4 A;  5GXG B;  2WYQ A;  2KDB A;  4HCN B;  1C9F A;  1XEE A;  1CQV A;  3IAM 1;  1WSP A;  1I42 A;  2LVO A;  1V5T A;  1JWA D;  4EFO A;  1XT9 B;  1YMH E;  5EE1 A;  2PLP A;  3BII D;  4KGS A;  1TJE A;  1UBQ A;  4IM0 A;  1P7F A;  3KW5 B;  3H7P A;  3DOW A;  2DHZ A;  2WXJ A;  2FCN A;  1SXT A;  4YWG G;  2MJ3 A;  3RPF C;  2C9W B;  5GMV A;  1L6V A;  3BK2 A;  4IW0 A;  2KJH B;  3KLS X;  2N1W A;  2PVG C;  1WYW B;  1ZUD 2;  1ZXH A;  1E8Z A;  4MJS A;  2AQ1 B;  2LGY A;  1NBF C;  2ZVO A;  1TGZ B;  2D3C A;  2RDH A;  1V6E A;  3ZVV A;  1YNT E;  2JZZ A;  1IYF A;  2L32 A;  2GBJ A;  3VR8 B;  1ZE3 D;  2KWD A;  2J52 A;  2BB6 A;  3TSS A;  2WQY B;  1TZO A;  1AAR A;  1WH3 A;  2KNB A;  2JY6 A;  4DBG A;  1TKY A;  4II3 B;  3AXC A;  2OOB B;  3NVZ A;  2QMT A;  3H7P B;  2CHZ A;  2V9H A;  3IG3 A;  2X38 A;  3HM6 X;  1HXY D;  3C0R B;  1YQ4 B;  4JGH B;  3LXF A;  3AU5 A;  1N5X A;  1JQ4 A;  2BS2 B;  2IY0 B;  1HA5 A;  2CU1 A;  2LGX A;  4OVZ A;  3IBE A;  1XLQ A;  4DDI D;  1NI2 A;  1RM6 C;  3L16 A;  4DXG A;  1UWX A;  3NOB A;  1ET6 A;  3EUB 2;  2MW5 A;  1C79 A;  2KDI A;  3PHW B;  3UIO B;  2V3S A;  1FXA A;  2EKI A;  2AQ3 B;  1L0V B;  1E8Y A;  3NZS A;  1AW7 A;  2KQ7 A;  2B76 B;  2AEH A;  2PPH A;  3VTW A;  2KOX A;  4IUM B;  2DBY A;  1WJN A;  4NJC A;  1L6U A;  2IZV B;  3AE1 B;  2G3Q B;  3N30 A;  5G2N A;  1V81 A;  1ZW7 A;  1VDV A;  5I4D A;  3Q3N C;  1RYJ A;  4NAW B;  3ZRC A;  3PSE B;  2MWS B;  2JPH A;  4MH8 A;  1HE8 A;  2KX0 A;  2Q5W D;  4MGK E;  4PS8 A;  1P3Q U;  3KVF B;  2GB1 A;  2N9X A;  2AWT A; 
#chains in the Genus database with same CATH homology
 3UIP B;  3WAP A;  4I6N B;  3QX1 A;  2I1J A;  4K7S A;  4KIK B;  4JLC A;  2DYO A;  1WJ4 A;  4F8C B;  2R2O A;  5CTR C;  4IM2 A;  4AWJ A;  3ZTD A;  4FHJ A;  2LUE A;  3A9J B;  2KWU B;  3KYD D;  3WAO A;  3H1U A;  5JH5 C;  2DAJ A;  1WX7 A;  4W9G A;  4LCD E;  3AU4 A;  1P0R A;  2K8H A;  3APC A;  2NBW B;  4ICV A;  2IO0 B;  2NS5 A;  3LJ3 A;  4A3P A;  2NBV B;  3VXW A;  3I3T B;  2KDF B;  4RMA A;  3ZUN A;  2D2Q A;  3L0W B;  2JXX A;  4OVU A;  2KC1 A;  5BO4 B;  4W9C A;  4MGY E;  2C7M B;  2BGF A;  4F7Z A;  1UD7 A;  3NY5 A;  1UZX B;  4I6L B;  4ASW C;  4HJK A;  3EFU A;  3ECI A;  5D6J B;  1EO6 A;  2GBM A;  4DHZ E;  1WGR A;  2RSU A;  4WWN A;  3D32 A;  2REX A;  3S2A A;  1WGD A;  2ZCC A;  3ZW3 A;  4BVU C;  2D07 B;  3ZO5 B;  4URK A;  1J19 A;  1KOT A;  1R4M I;  4ZRI A;  4AJY B;  3UQB A;  3UQA A;  2ZNV C;  1OTR B;  1VD2 A;  4K7W A;  3N32 A;  4PYZ A;  1ISN A;  3KYC D;  2Z0D B;  4F1S A;  2IBI B;  2ZPY A;  4W9D A;  3EHV A;  4YL8 A;  5DPT A;  5KHQ A;  1WF9 A;  4IWP A;  1LXD A;  1ZKH A;  2FCS A;  3DVN U;  3L17 A;  3NHE B;  3BIN A;  3KUD B;  4GOC A;  2JUO A;  1WXM A;  3CMM B;  4TQ1 A;  4GMV A;  2IO3 B;  2N7E A;  4WWP A;  5D2M B;  5LLI A;  3RT3 B;  2UYZ B;  3JYU A;  2ZJD A;  3A9K A;  3U30 A;  2G45 B;  1S3S G;  3VVW B;  2JT4 B;  2K8C A;  5LXI B;  5L83 A;  2J0M A;  5L95 C;  1WM2 A;  5CX3 A;  2D3G A;  4IC7 B;  3DCG A;  2M17 A;  2DYB A;  2C7N B;  4BOS C;  4LJP B;  4MJS B;  4GN1 A;  1WJU A;  2L3Z A;  3IFW B;  2Y5B B;  2KC2 A;  1OGW A;  4KDI C;  3K9O B;  2BKR B;  5C1Z A;  2QHO A;  2XEW A;  5C23 A;  2BPS A;  4HPL B;  2BYV E;  2KDE B;  4TUU A;  4A20 A;  1V5O A;  3RYT A;  2JF5 A;  2KWC A;  3SU8 X;  2MCN B;  1GJZ A;  4HDQ A;  4BKG A;  2DZK A;  2MBE A;  3CF6 E;  3M3J A;  4E74 A;  3DBH I;  5CHV C;  4NNJ B;  3R7R A;  3Q3F A;  3L10 B;  1P98 A;  1SGH A;  4K1R B;  4GXB A;  3WAM A;  2G4D B;  2MA9 B;  2FNJ B;  4M8N A;  2K25 A;  2K6Q A;  3PV1 A;  4GDL A;  1A5R A;  3QCA A;  5DPS A;  1JRU A;  2DZJ A;  1WR1 A;  2LVP A;  2JRI B;  4W9H A;  3PGE A;  4EZL A;  2N1V A;  2GBR A;  2KLC A;  4W9E A;  2AL3 A;  2RGF A;  2KO3 A;  5JHB A;  2D11 A;  3A1Q A;  3UF8 A;  4MSM B;  4DXA B;  3TL5 A;  4CO7 A;  3EC8 A;  3ZIM A;  2AYO B;  1IPG A;  2JVC A;  4HK2 A;  3NZU A;  4NQL B;  2XBB C;  3WIM A;  4KVG B;  4WJP A;  4JL9 A;  2A4Z A;  3ZNH B;  4KDL B;  2FUH B;  4HDO A;  4LJO B;  1KJT A;  1S1Q B;  2L76 A;  2KX3 A;  2XK5 A;  4FBJ B;  2MBO A;  4II2 B;  2NR2 A;  3VDZ A;  3KUZ A;  1C3T A;  4FJV B;  4DHJ B;  2GMI C;  4IWO A;  1TBE A;  4W9L A;  3V6C B;  3ZNI D;  2GOW A;  4WWO A;  3RD2 A;  3PS6 A;  4XC2 A;  1UBI A;  4WJQ A;  5DPR A;  1I35 A;  1WI0 A;  4MM3 A;  3M63 B;  4MGZ E;  2R2Q A;  3R7Q A;  2K1F A;  4HCP B;  2Z59 B;  2ASQ A;  3PZD A;  2DZI A;  4LDT B;  2IY1 B;  4FJZ A;  1WMH A;  2EMS A;  4B95 A;  2A5U A;  2WWZ A;  5TR5 A;  1L7Y A;  1WR6 E;  1LM8 B;  4GDL B;  4IG7 B;  4E71 A;  3PTF C;  3R3M A;  3VH4 B;  1H4R A;  3H7S A;  4GIV A;  5E6O A;  2LRU A;  2IO2 B;  1GC7 A;  3W1S A;  2KAN A;  2BWF A;  1YIW A;  1KM7 A;  4PYU A;  4BKS D;  1IP9 A;  3DVG Y;  2LXC A;  1J0G A;  1V49 A;  2CHX A;  2UWQ A;  2G4S A;  2C5L C;  4P7I A;  2KQS A;  4KZC A;  4NPN A;  3A1Q B;  3CSF A;  3QC8 B;  3X23 A;  5J17 A;  2O6V A;  4KV2 A;  5J18 A;  3V60 A;  1BT0 A;  2KKC A;  4M0W B;  3A4R A;  5DCN A;  3PHX B;  1T0Y A;  3SHQ A;  1OEY A;  1WFY A;  2LZ6 A;  2FID A;  3QAQ A;  2KWV B;  2IO1 B;  3VH3 B;  2L05 A;  2CR5 A;  2MBH A;  2CHW A;  2MBB B;  3DBS A;  3QAR A;  2M8S A;  2XK5 B;  2ZCB A;  3AI5 A;  3BY4 B;  3PT2 B;  3TBL D;  4B6W A;  2MP2 A;  3B08 A;  4I6P A;  4G50 A;  1LQB A;  3P2B A;  4W9J A;  2LVQ A;  1P1A A;  1PQS A;  1Q0W B;  3PLV A;  2KJR A;  4K81 A;  4ZRK A;  1E7V A;  1UH6 A;  2LWP A;  3A4S C;  4NJ7 A;  4HVB A;  1U4A A;  1TTN A;  3CST A;  4ZYN A;  5LXH A;  3H6N A;  3AUL A;  4G3X B;  4G11 A;  2NCN A;  2N9E B;  4ICU A;  3PPA A;  1FXT B;  5HKH A;  2BYF A;  4WJO A;  4DK5 A;  2FAZ A;  2FCM A;  2L0F A;  2V1Y A;  2N9P C;  4EZJ A;  5J2R A;  1YX6 B;  2JWZ A;  2Z0E B;  2YVC A;  4OVV A;  2JZ3 B;  2LI5 A;  3JSV A;  1Q5W B;  1ZGU B;  1OQY A;  1E8W A;  2BKF A;  1EF5 A;  2WX1 A;  4FJY A;  3B0A A;  4A3O A;  1F9J A;  2I1K A;  3DQV A;  5AZH A;  4PS3 A;  3MHS D;  1M94 A;  2PEA A;  4FLH A;  2O6V B;  2WX0 A;  3V6E B;  2DZM A;  3QK0 A;  3ZNZ B;  2B3A A;  4BBN C;  4HWI B;  2MLB A;  1L2N A;  1UGM A;  3L08 A;  3K9P B;  2DX5 B;  3R66 C;  2KMA A;  4HXD A;  5CHF A;  3ZKJ C;  2LD9 A;  4GGQ A;  1R4N I;  2K39 A;  3ONS A;  5D7G A;  4NAW A;  4FAD A;  4KSL C;  1WJ6 A;  4M8M A;  4CHK A;  1E90 A;  3PRZ A;  2MQJ A;  4KZ0 A;  2O2V A;  2MP2 B;  2KFJ A;  3SDL C;  3ZTC A;  1WX8 A;  4WAA A;  4BOZ B;  3HHM A;  3IVF A;  3RZF A;  4TKN A;  4W9I A;  4ANV A;  2NVU I;  2NBU A;  4KSK C;  3PRP B;  1Q1O A;  2DEN B;  4JIO U;  3T9L A;  1V80 A;  4ZRJ A;  4EEW A;  1H8C A;  4MEM A;  4KIK A;  2OJR A;  3A9K B;  4JQW C;  3VTU A;  3PRM B;  2ZNV B;  2NPT A;  4AP4 C;  4NJ6 A;  1SIF A;  1WGY A;  2EKE C;  2VRR B;  1K8R B;  2KLG A;  3DVG X;  3O65 B;  3H9D A;  3PVL A;  3JSV B;  4GB9 A;  3QHT A;  2KXJ A;  2PE6 B;  2J0J A;  2WDT B;  3HM3 A;  3WAL A;  4EZK A;  2PJH A;  1EUV B;  3RUI B;  2MBQ A;  3EEC A;  2J0K A;  1SE9 A;  1X1M A;  3QQ8 B;  1WXA A;  2WYQ A;  1Z2M A;  4NY0 A;  5D94 A;  5AZF A;  2FIF A;  3TMP B;  2RD0 A;  2IYD B;  2KDB A;  3VTV A;  4HCN B;  3VFK A;  3L54 A;  3ML8 A;  1GNU A;  1J8C A;  3QJZ A;  3VUW A;  3MTN B;  1GUA B;  3PRE A;  2HTH A;  2L00 B;  4HPM B;  1WY8 A;  2MRP A;  3ALB A;  3HK0 A;  3N3K B;  1UEL A;  2N7D A;  4MDK E;  3RUL A;  4DDG D;  1MG8 A;  2LVO A;  2ZVN A;  1I42 A;  1V5T A;  2AL6 A;  4EFO A;  1XT9 B;  2BWE S;  3DBR I;  3VQI A;  3VUX A;  1LFD A;  1V86 A;  4DWF A;  4FA6 A;  2FCQ A;  4W9K A;  1UBQ A;  1GC6 A;  4IM0 A;  4WJN A;  3DVN V;  3KW5 B;  4XX5 A;  2NPT B;  3H7P A;  3DOW A;  2DHZ A;  4CYE A;  2FCN A;  1WGH A;  3ZRF A;  1YQB A;  2C9W B;  3OAW A;  5GMV A;  2LXA A;  4N9F 4;  4IW0 A;  2M0X A;  5EDS A;  1WX9 A;  2KJH B;  5JZE B;  2N1W A;  1WZ0 A;  3L13 A;  1CMX B;  1WYW B;  3U7D A;  3T8M A;  1E8Z A;  4MJS A;  3VUY A;  2LGY A;  1NBF C;  3TIX A;  1GG3 A;  1Z5S B;  4GU2 A;  2ZVO A;  1RLF A;  1WE6 A;  1TGZ B;  3U8Z A;  4BBN F;  2KTF A;  1YD8 U;  4K7U A;  3VAW A;  1V6E A;  3ZNG C;  3ZVV A;  2HE7 A;  2JZZ A;  4MSQ B;  3W1Y A;  1IYF A;  3UGB B;  4BKS A;  1WE7 A;  2GBJ A;  3WAN A;  4EOY A;  4G0N B;  3ENE A;  3QIJ A;  2HD5 B;  2CKH B;  4AUQ C;  1WMH B;  1E8X A;  5KHO A;  3MJW A;  4DHJ D;  1Y8R C;  1WXS A;  4TV3 A;  4MGI E;  4IM3 A;  4EUT A;  2RPQ A;  2W9N A;  1V9J A;  1YX5 B;  1AAR A;  1WH3 A;  2KNB A;  2JY6 A;  4DBG A;  3JW0 X;  4B9K A;  4EKU A;  4II3 B;  2V4L A;  3JVZ X;  4GSW A;  3VHT C;  2ZEQ A;  3AXC A;  2OOB B;  3HIZ A;  4LDT D;  5G55 A;  2KVR A;  1WZ3 A;  4XZ4 A;  1XQQ A;  4FN2 A;  2ZZP B;  2KTR A;  4E3C A;  4RM8 A;  3H7P B;  2LGD A;  2RR9 A;  2CHZ A;  4GDK A;  3IG3 A;  4MEL A;  3TJP A;  3DPD A;  3HM6 X;  4DHZ B;  3PLU A;  2ZPN A;  1YJ1 A;  3RCZ A;  3C0R B;  2JRH A;  1G6J A;  3QWZ B;  4J6I A;  3M95 A;  4JGH B;  3AU5 A;  4ANW A;  3IHP C;  2K8B A;  2BYE A;  3WA0 A;  2IY0 B;  1KLV A;  2KJ6 A;  2CU1 A;  2DAF A;  2LGX A;  3IBE A;  5AZG A;  5CHW A;  4BFR A;  4WQO B;  3B1L X;  2LRW A;  1NI2 A;  3V61 A;  2DYM A;  4DDI D;  3NS8 A;  2KFK A;  3X0W A;  3L16 A;  4IWQ A;  2C7H A;  3NOB A;  4W9F A;  4MH0 E;  3OJ3 A;  1QZE A;  2MX2 A;  1E5W A;  2L7R A;  2MW5 A;  4BKT A;  1WM3 A;  2J7Q B;  2KDI A;  3PHW B;  3UIO B;  4AJW A;  3APF A;  1WRD B;  2V3S A;  4ANX A;  3LDZ E;  2KN5 A;  2HJ8 A;  1E7U A;  3DDC B;  2YLM A;  2PE9 A;  3A9J A;  5IAA C;  1C1Y B;  1V2Y A;  2LJ5 A;  3UIN B;  4RM9 A;  5JHA A;  2KD0 A;  1E8Y A;  2M1M A;  2EMT A;  4FUL A;  4X57 B;  2K6D B;  5E6P A;  3NZS A;  1VCB A;  2MSE D;  2L8J A;  3ZDT A;  3ZLZ A;  3QA8 A;  1OEY J;  1D3Z A;  2KQ7 A;  2N4F A;  2AEH A;  4NQK E;  3SD5 A;  2PPH A;  2LAS A;  1RFA A;  3VTW A;  5DPW A;  1RAX A;  2D10 A;  2KOX A;  4IUM B;  4ANU A;  3M62 B;  1WJN A;  4PS7 A;  5FR6 A;  2IZV B;  2G3Q B;  2BF8 B;  3GZN I;  3KH0 A;  3N30 A;  1WIA A;  2KTR B;  5G2N A;  1V81 A;  1P9D U;  4GDK B;  5AEK B;  2KMC A;  5E6N A;  1ZW7 A;  3A33 B;  1XD3 B;  2C60 A;  3GOE A;  1RRB A;  3ZDM C;  2GBN A;  3Q3J A;  4NAW B;  3OLM D;  3ZRC A;  3PSE B;  1TZ1 A;  2O2V B;  2MWS B;  2KHW B;  2O6V D;  3V62 A;  4AOF A;  2KZR A;  2JPH A;  2M4N A;  4FHK A;  2L0T A;  1EF1 A;  1HE8 A;  3KUC B;  1WGG A;  2KX0 A;  1NDD A;  3W1S C;  3ML9 A;  2CS4 A;  4ZDV A;  5IA7 A;  2KFK B;  4MGK E;  2AWT A;  4PS8 A;  4TQ0 A;  4HLE A;  1P3Q U;  3DBL I;  1WXV A;  2GBK A;  3KVF B;  3OJ4 B;  3RZW C;  3TCA A;  2N9X A;  2KK8 A;  3APD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...