2NBWB

Solution structure of the rpn1 t1 site with the rad23 ubl domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Protein binding
molecule keywords 26S proteasome regulatory subunit RPN1
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbwB00
1WYWB 2AL6A 1WIAA 3OJ4B 1V86A 2L76A 3N32A 2KTRA 2L3ZA 4WWNA 4GSWA 4KSLC 2I1JA 4W9EA 4PS7A 3PRZA 3PGEA 1V2YA 2K8BA 2PE9A 3PZDA 2N4FA 3V60A 4F1SA 1VCBA 3A4RA 2O6VD 3UQAA 3EECA 4B9KA 3APFA 5CHFA 2MCNB 1P3QU 3DVGX 1F9JA 4MGIE 3D32A 1UD7A 5D6JB 1ZGUB 1P98A 1WR1A 2EMTA 2HE7A 2V4LA 3DBSA 3DVGY 3A9KB 2GBMA 4A20A 3CMMB 1V5OA 2KTRB 4GIVA 1WXSA 3PHXB 1WXAA 2KQSA 2N7DA 1XD3B 2KZRA 4W9KA 2YVCA 2J0JA 4HK2A 4ICUA 1WM2A 5C23A 4AUQC 2O2VA 3H6NA 2DZIA 2XK5B 2AL3A 1WJ6A 2NCNA 1QZEA 3HHMA 3GZNI 4FLHA 5DPRA 3Q3JA 4PYUA 4NQKE 3WAOA 3ZNID 1YIWA 5KHOA 2N7EA 2Z0EB 4IM0A 4KDIC 3ML8A 3T9LA 2UYZB 3V62A 3ZNHB 3K9PB 4AWJA 4RMAA 4NNJB 1UBIA 2JUOA 1E8WA 3PREA 4W9FA 1TTNA 4G3XB 4BOSC 1WMHB 4BOZB 2Z0DB 3M63B 4XZ4A 2ZNVC 3QQ8B 3IFWB 3L13A 5D7GA 1P0RA 4CO7A 1NDDA 2O6VB 1NBFC 3PLVA 4HDQA 1YJ1A 1EUVB 4GMVA 4BBNC 2JF5A 3QARA 2MQJA 3UIOB 2CHXA 2DYBA 2CR5A 1WY8A 1WRDB 1LQBA 4I6LB 4URKA 1I42A 4KVGB 3W1SC 2NBWB 2IO2B 3KH0A 2FCMA 3L0WB 5FR6A 2C7NB 1K8RB 2MBBB 3L17A 4GDLA 4JIOU 2WDTB 1J19A 1V49A 2LUEA 2IO0B 2RR9A 3L08A 3VAWA 2D07B 2AWTA 3A4SC 2BPSA 3ZIMA 2B3AA 2JT4B 3N30A 3SD5A 3WIMA 3RT3B 2KJRA 5KHQA 3A1QB 3V6EB 3DBLI 1Q0WB 1WZ0A 1J0GA 4KSKC 1BT0A 4DK5A 3KUCB 2BWFA 1KOTA 2XBBC 4II2B 3ZNZB 1OEYJ 4E3CA 2NR2A 4DHJB 3PLUA 2GMIC 1UBQA 3ONSA 4WJOA 1E8YA 4FBJB 4M0WB 2DYMA 1J8CA 2KQ7A 1X1MA 3PHWB 4MSMB 3W1SA 5E6OA 3U30A 1LM8B 1E8XA 3VTUA 5J17A 3WANA 4JLCA 1TGZB 2A5UA 1ZKHA 2G3QB 2IO3B 5G2NA 4WJPA 1IP9A 4OVVA 4NJ7A 3PRPB 4FJZA 4NAWB 5JH5C 1V9JA 2C7HA 4DBGA 1P1AA 2JZZA 3ML9A 4FHJA 3VH3B 5IAAC 1ZW7A 1XQQA 2Y5BB 3AULA 3H7PB 2K8HA 1WFYA 3MHSD 2M4NA 2LZ6A 2BWES 4W9DA 1WGDA 3PS6A 3M95A 2FNJB 2M1MA 2MRPA 3H7PA 4MELA 5HKHA 4XC2A 3A33B 1KLVA 3AU5A 3ZRFA 4K7WA 3R7RA 2FAZA 3EHVA 3VH4B 1Y8RC 2V3SA 2RSUA 4XX5A 2MX2A 5LXHA 4G50A 2BF8B 2JXXA 1GC7A 3B1LX 5G55A 1WX8A 4ANVA 2LASA 3LDZE 3L54A 4N9F4 2K6DB 4ZYNA 5AZFA 4GU2A 3BY4B 3ZDMC 5JHBA 2EKEC 3MJWA 3RD2A 2O2VB 5DPTA 4MDKE 4IC7B 3EC8A 4KDLB 3RYTA 5DPSA 1YD8U 2JRHA 2GBKA 4LJOB 1MG8A 5AZGA 4MSQB 3PSEB 2BYFA 4K1RB 4AOFA 1H8CA 4DXAB 1SGHA 1S1QB 1WJ4A 1LXDA 3L10B 4IWPA 4F7ZA 2DHZA 4B6WA 2IYDB 4TQ0A 2KWVB 3RZFA 3U8ZA 2R2QA 3R66C 4KIKA 4PS8A 4DHZE 2L00B 3ENEA 2BKFA 3QIJA 1UELA 1ISNA 2J0MA 2KLCA 3VUWA 4E71A 5J18A 4K81A 2CHWA 2FCQA 2MA9B 1GG3A 2KC1A 2G4DB 4WWOA 5JHAA 4TQ1A 1Z5SB 4FHKA 5DPWA 3AU4A 1WX7A 3OAWA 1WM3A 2LGXA 4GOCA 2N9PC 1GUAB 2DX5B 2DZKA 2NPTB 3UQBA 4HLEA 2N1VA 1WR6E 3TL5A 2MBOA 4TKNA 2JPHA 3SU8X 2FUHB 4RM9A 4MJSA 3KW5B 1C3TA 5BO4B 2KN5A 2KOXA 4FJVB 4BKSA 4JL9A 2PE6B 3H7SA 2DZMA 2N1WA 2KWUB 3PTFC 3P2BA 3TMPB 4DDID 1Z2MA 2RD0A 1G6JA 3UGBB 5L83A 3QX1A 1C1YB 2PEAA 3IG3A 3L16A 1KJTA 5C1ZA 4FADA 1JRUA 2J0KA 3WAPA 2KMAA 3I3TB 4KZCA 2UWQA 4W9CA 4DHZB 2M0XA 2DAJA 1OGWA 2CKHB 3H1UA 4FN2A 4NJ6A 4DDGD 2OJRA 4M8NA 4EUTA 2XEWA 2MW5A 3QK0A 3QA8A 1IYFA 3RULA 3T8MA 2RGFA 2KFJA 4ZRIA 3VVWB 3DVNU 1RFAA 2G4SA 1RLFA 3QC8B 4MGKE 4FA6A 5LXIB 3ZTCA 3VHTC 2FCSA 2KC2A 2YLMA 1GNUA 3NZSA 1VD2A 2ZJDA 2G45B 2IZVB 2N9EB 3TCAA 4A3PA 3VQIA 4EZJA 3NZUA 4EFOA 2FIFA 4PS3A 4IWOA 2DENB 4G0NB 3ZVVA 4DHJD 3DBHI 5CHWA 2LXAA 2K25A 1WGRA 4OVUA 3ZKJC 2ZNVB 1OTRB 4LCDE 5TR5A 3JSVB 3DDCB 3DVNV 3C0RB 1E7VA 2JZ3B 4BKTA 2OOBB 3R7QA 4G11A 2KDBA 4ZDVA 2KANA 3JYUA 3KUDB 5E6NA 2GOWA 4WQOB 4NY0A 1UH6A 1RAXA 2JWZA 3NOBA 2L0TA 4ASWC 4JQWC 4K7UA 2HD5B 3IBEA 2L0FA 2XK5A 1V5TA 4TUUA 5D2MB 1UZXB 1WI0A 1WXMA 4GDLB 3KYDD 2K39A 3VDZA 2KFKB 1OQYA 2IY0B 3CSFA 2C60A 2BYVE 3ZDTA 2LWPA 3PT2B 2L7RA 4GB9A 4MGYE 4GDKB 1YX6B 3RZWC 4BBNF 2JY6A 2LD9A 1WH3A 5CHVC 3ZO5B 3U7DA 1E8ZA 4BKGA 1Q5WB 2KLGA 3UIPB 2JRIB 2NBUA 1KM7A 2NVUI 4HCPB 4KIKB 2WYQA 3TBLD 3ZW3A 1NI2A 1EF5A 3AXCA 4BVUC 3X0WA 4HPMB 4RM8A 3ECIA 2MP2B 1OEYA 5L95C 1H4RA 4CYEA 3B08A 3HM6X 1FXTB 2LJ5A 4FJYA 3RUIB 4I6NB 2LVQA 3JW0X 2RPQA 5EDSA 2HJ8A 3NHEB 1XT9B 5AEKB 1PQSA 4ZRJA 2ZCBA 4X57B 5GMVA 5LLIA 4GDKA 2D10A 4F8CB 3ALBA 4EZLA 2HTHA 4TV3A 3PVLA 2CS4A 2I1KA 3JVZX 1GC6A 1L2NA 1IPGA 5AZHA 3H9DA 2KWCA 1V81A 3UINB 3V61A 4HDOA 4A3OA 2MSED 2LGDA 3ZLZA 2W9NA 4ANWA 2M17A 2N9XA 1LFDA 2IO1B 4HWIB 1E5WA 1WJUA 5CTRC 3KVFB 3UF8A 4YL8A 2KJHB 3LJ3A 1R4NI 3DQVA 4MH0E 2NBVB 4CHKA 3Q3FA 1D3ZA 4NAWA 4ICVA 3APCA 2CU1A 3TIXA 2J7QB 2ZEQA 1EF1A 2ASQA 3K9OB 3NS8A 3SHQA 3ZUNA 3X23A 1WGGA 3VFKA 3VTVA 4LJPB 4E74A 2LGYA 4W9HA 2LI5A 3GOEA 1Q1OA 3DOWA 4IWQA 4MEMA 2LRUA 1WE6A 3JSVA 4IG7B 3SDLC 4B95A 3OJ3A 3TJPA 3M62B 3VXWA 2KD0A 4BKSD 2FIDA 2KDFB 3BINA 2KVRA 3DCGA 2BKRB 2D2QA 2KNBA 2KTFA 2MWSB 2ZPYA 3W1YA 4ANUA 2WWZA 3QJZA 4W9LA 3WAMA 5IA7A 3ZRCA 3EFUA 4PYZA 1I35A 1WZ3A 2IY1B 2LVPA 4NPNA 3IVFA 3AI5A 1RRBA 1M94A 2KHWB 4HVBA 3CSTA 4LDTB 2KO3A 2A4ZA 2QHOA 1YQBA 2Z59B 3PRMB 1E90A 1CMXB 4K7SA 4W9JA 1EO6A 4AP4C 4EOYA 5CX3A 2FCNA 2KDEB 4WAAA 1HE8A 1U4AA 1WX9A 4BFRA 4II3B 5D94A 2MBQA 2KDIA 1WMHA 2GBNA 2AEHA 2L05A 2BGFA 3WA0A 1WJNA 4DWFA 5J2RA 2DYOA 3O65B 2BYEA 3A9KA 2KX0A 4GXBA 3OLMD 2PPHA 2R2OA 3QCAA 4KV2A 2NS5A 2O6VA 2ZCCA 3QAQA 3S2AA 2NPTA 4GN1A 3HIZA 2KJ6A 2MBHA 4HCNB 2IBIB 2LRWA 2WX0A 4GGQA 3R3MA 4M8MA 2KFKA 1V6EA 2PJHA 4EZKA 3DPDA 1UGMA 2AYOB 4HJKA 4IW0A 3A9JA 5JZEB 2JVCA 2K8CA 3VTWA 2VRRB 2ZVOA 2K6QA 2KK8A 4ANXA 5E6PA 1WGYA 2MBEA 2LVOA 3QHTA 1WF9A 4MGZE 2MP2A 2ZVNA 2REXA 1WGHA 3A9JB 3IHPC 3MTNB 1P9DU 4KZ0A 3VUYA 3ZTDA 1AARA 3DBRI 3WALA 3M3JA 1TZ1A 2C5LC 4AJWA 1S3SG 1V80A 2D11A 1GJZA 1SIFA 2KXJA 2DAFA 4ZRKA 3CF6E 5DCNA 3ZNGC 1R4MI 4IM2A 4EEWA 3KUZA 4MJSB 3N3KB 4I6PA 2DZJA 4WJQA 4W9IA 4FULA 3VUXA 4WWPA 4MM3A 1E7UA 4IUMB 1WE7A 2M8SA 4LDTD 3QWZB 4HXDA 3HM3A 3V6CB 3RCZA 1TBEA 1YX5B 3HK0A 2ZPNA 4AJYB 2K1FA 2WX1A 3KYCD 3PV1A 4HPLB 4NQLB 1WXVA 2CHZA 4P7IA 2D3GA 3PPAA 4J6IA 4WJNA 3NY5A 3APDA 1A5RA 2L8JA 4JGHB 2V1YA 2ZZPB 2KMCA 4EKUA 2C7MB 3B0AA 2GBJA 2C9WB 4IM3A 1L7YA 2MLBA 1T0YA 2KKCA 3A1QA 2GBRA 4W9GA 2LXCA 2EMSA 2KX3A 1SE9A
chains in the Genus database with same CATH superfamily
4RH6A 3OJ4B 1MJDA 3V05A 2L76A 3PO0A 3C19A 2D3BA 2L3ZA 4WWNA 1FD6A 3PRZA 1V97A 3H8HA 3V60A 1VCBA 3A4RA 1R4NB 1YJIA 3APFA 2X38A 2WHIA 1V1OA 1P98A 1WR1A 2HE7A 3LXFA 4ZYSA 2RMMA 5T8IA 1SJHD 2GBMA 3AE9B 1OQRA 1JWUD 1T6BX 2KZRA 4AUQC 3H6NA 2XK5B 2AL3A 1WJ6A 2CJOA 1ACCA 3GZNI 2INNE 3TUOA 1HTQA 2UYZB 1FNWA 1C78A 1KTKA 2LEKA 2WU2B 4RMAA 5FKAC 4C7ZA 3LB8C 2WXQA 1J7BA 5BYRA 3RNBC 2WXKA 1SE4A 4CO7A 3MHZA 2O6VB 1EUVB 4S17A 3W5UB 4URKA 4KVGB 2WNMA 2IO2B 3L0WB 5FR6A 3L17A 2N7JA 4JIOU 4LNNA 2LUEA 1V49A 3EUB2 3ZIMA 2JT4B 3WIMA 4UDUC 1YN4A 3GZNB 4DK5A 2W3SA 4E3CA 1PFDA 2GMIC 1RM6C 2DYMA 1HTOA 4WURA 1X1MA 3W1SA 1F2RI 3U30A 1TIFA 5J17A 4WIPA 3NVYA 3LYYA 1YN5A 5G2NA 1N61A 4OVVA 4YTNB 2E3TA 5JH5C 2JZZA 1ZW7A 4YSXB 4LNOA 1JWSD 1WFYA 2KACA 2BWES 2XN9C 3H7PA 1KF6B 3A33B 3AU5A 3VH4B 1Y8RC 1FCCC 5BMGA 2H89B 5EE9A 2JXXA 2WXHA 5GXGB 1FNUA 1NI3A 2LASA 4ANVA 2DLBA 4N9F4 1D4BA 1N62A 3MJWA 2WXPA 2BQQA 4YSYB 3EC8A 3IT6B 5IP4D 3I57A 3PSEB 2QMTA 1H8CA 4DXAB 1S1QB 4P16A 3RFZB 1WJ4A 1LXDA 4B6WA 1RYJA 4DHZE 3QIJA 4E71A 2CHWA 2VZKD 3DBLB 2G4DB 5DPWA 3E56A 1L0VB 1WM3A 2N9PC 5H92C 2DX5B 3UQBA 1TS4A 2K0PA 4JWSC 1TY0A 3KW5B 1GAQB 4ZRQA 2PE6B 3H7SA 2DZMA 3R8BA 4XYCA 1MPEA 3QX1A 3IG3A 3L16A 1TZOA 4W9CA 2M0XA 1QKZA 1BMLC 1FXIA 2RDGA 4EUTA 5HI1A 3QA8A 3T8MA 2G4SA 2WXIA 4MGKE 3ZTCA 3VHTC 4KGSA 3SEBA 4P1CC 1VD2A 2ZJDA 2FE8A 3VQIA 1VDVA 4IWOA 4C56C 4DHJD 5JXVA 1K51A 4M01A 3MJ5A 2LXAA 2K25A 4OVUA 5HHDG 4LLGM 5LNK1 2QEJC 3DVNV 3C0RB 1E7VA 4BKTA 4IKGA 4RGMA 2G1EA 2VH1A 3AV8A 3BZDB 2K9XA 4ZDVA 3JYUA 1P7EA 1D5XC 1MG4A 3PZ8A 2JWZA 1E9MA 2LGSA 3NOBA 2X8XX 3OG5A 2HD5B 3L4PA 3NG0A 2L0FA 2XK5A 1V5TA 4TUUA 2IGHA 1UZXB 1MVKA 2HDEA 1ZDXA 2KFKB 1TJEA 1OQYA 2LWPA 2L7RA 1YX6B 2JRIB 2W55A 1F77A 2WYQA 3ZW3A 3AXCA 3X0WA 4HKZE 5L95C 4XWTA 2WQYB 1SBBB 3HM6X 3NVVA 1UF0A 4FJYA 3RUIB 1K52A 1C4CA 1TKEA 2EELA 4C00A 2EKIA 1TKYA 2ZCBA 4GDKA 2D10A 1MHXA 2HTHA 4TV3A 4EZLA 2CS4A 2I1KA 4A9AA 3ABVB 1I7HA 3V61A 1PGBA 2LGDA 4ANWA 4LNFA 3UF8A 2L52A 1FNVA 1KH0A 4MH0E 4CHKA 4NAWA 1JROA 2ZEQA 2ASQA 3SHQA 2H88B 2BVCA 3U7ZA 4E74A 4IWQA 3E9SA 3SDLC 2LRUA 1WE6A 4IG7B 3RNCC 3OJ3A 4USAA 4US9A 3VXWA 3DWMA 2PVOD 2MWSB 1C4AA 5E6JA 1WZ3A 3IVFA 1TS3A 2KHWB 4RF1A 4P1BC 2QHOA 4K7SA 4W9JA 4AP4C 3WCQA 2MBQA 3DBHB 3O65B 2KX0A 3KWVA 2PPHA 2R2OA 2NS5A 2LGIA 2ZCCA 4WQMA 1UUPA 2IBIB 4GGQA 1CJEA 4HJKA 3VTWA 2OJWA 4KKJA 2K6QA 2MBEA 1NENB 1WF9A 1WGHA 3DHIC 4KZ0A 1D6EC 2KVZA 4LTUA 2C5LC 1A70A 2BS3B 2KXJA 4ZRKA 5DCNA 4RF0A 1R4MI 4WJQA 1VRAB 4HXDA 3HM3A 1IUEA 3AEAB 4AJYB 3PV1A 1WXQA 2L8JA 2KMCA 2C7MB 4D2KA 1L7YA 1T0YA 4L1BA 2LXCA 1UNSA 4ZRIA 1PDXA 2YLMA 1SE9A 1WYWB 2AL6A 1AW7A 2GRIA 1EWYC 2KMMA 1V86A 1DYQA 4KSLC 2I1JA 2M56B 4W9EA 4PS7A 1JWMD 2K8BA 3NVZA 4QAYA 3O13A 3DVGX 4MGIE 3V3XA 3VR8B 3EFCA 4M00A 2V4LA 3DVGY 2KAJA 2KDMA 4RCOA 2J53A 3P4QB 2KTRB 3Q2AC 4GIVA 3PHXB 1WXAA 3BWUD 2YVCA 2ZW1A 1XLPA 4HK2A 3N1ZC 2DZIA 3HHMA 1TT5B 4FLHA 1CK1A 1YIWA 2Z0EB 2BB5A 3ZNHB 3K9PB 4ZOHC 4NNJB 3Q3MC 1E8WA 3PREA 1TTNA 4G3XB 4BOSC 4BOZB 3M63B 4XZ4A 2ZNVC 3L13A 2J42A 1NBFC 4HDQA 4BBNC 4GMVA 3UIOB 4YWGG 2DYBA 2CR5A 2WXOA 4I6LB 2N0SB 1ZUD2 1QOFA 2WDTB 4S0RA 2RR9A 3L08A 2AWTA 2BPSA 3N30A 1AWDA 4HROA 3DBLI 2ZW0A 1WZ0A 1BT0A 3KUCB 2BWFA 4LNKA 1FO4A 4II2B 3ZNZB 1OEYJ 3MC9A 3P4PB 1E8YA 4FBJB 4M0WB 3ZQ4A 3BIID 1TYGB 1J8CA 4JLCA 2W54A 4WJPA 4HEA1 4NJ7A 4NAWB 1EU3A 2C7HA 4TSSA 4DBGA 3IT4B 2INPE 1P1AA 1XO3A 4OVZA 1L4DB 3H7PB 3Q8FA 2K8HA 3MHSD 2M4NA 3CWIA 2V4IB 1JQ4A 4W9DA 3PS6A 2FNJB 2M1MA 2MRPA 2L83A 3ZYYX 1KLVA 1F52A 3ZRFA 2FAZA 2WXLA 3NUHB 4XX5A 2BF8B 2WU5B 4OHJA 1WX8A 3BVGA 3L54A 4GU2A 3GE8C 1GPXA 3BY4B 3ZDMC 3RD2A 3Q8BA 2O2VB 4KDLB 2JRHA 2MJDA 3AM9A 1MG8A 5AZGA 2K22A 4AOFA 4B0MA 1SGHA 1QQRA 2PW9A 4C80A 4IWPA 2WXRA 2IYDB 3T3OA 4KIKA 1N5WA 1R7SA 4AS1A 5J18A 2KLCA 2JWUA 2MA9B 2KC1A 4TQ1A 1Z5SB 4FHKA 3DHGC 4PK1A 2LGXA 1JW9D 1PGAA 2WDVB 1GUAB 2DZKA 2CJNA 3N20C 1WR6E 2BTEA 1LGRA 3AE5B 4RM9A 4ITKA 1XEEA 1YQ3B 2BYTA 5HFYA 4RGTA 2KN5A 3PTFC 3TMPB 1I4PA 1VR9A 2KWUB 3MFGA 4DDID 1F1HA 4M0WA 3UGBB 5L83A 5C1ZA 3WAPA 2KMAA 3I3TB 1E0ZA 1SEBD 2SAKA 1ET6A 2IPKD 3H1UA 4FN2A 5C3JB 4M8NA 1L6UA 3BYTB 1QOAA 2RGFA 2KFJA 4FA6A 5LXIB 1RWSA 1LO5D 1GNUA 2G45B 3TCAA 2BT6A 4ZRPA 2R61A 1T0RC 1SB3C 1Q10A 3TEXA 2MJ3A 4XGAB 4M02A 2JZ3B 3TSSA 4AQ7A 5C2TB 4BZAA 2ACZB 2KANA 5E6NA 3AE2B 1B9RA 1WSPA 5I4DA 2L0TA 4JQWC 5D2MB 1WXMA 4GDLB 2K39A 3VDZA 2ON8A 2IY0B 2Z8LA 2V9HA 2C60A 3NRZA 3FILA 4GDKB 2JY6A 2LD9A 1WH3A 2XNAC 2JU6X 1KM7A 1UGJA 1QILA 4XDDA 4KGTA 3B08A 1JCKB 2LJ5A 4I6NB 2LVQA 1UWMA 4L2YA 5EDSA 4ZRJA 3ZJTA 5GMVA 3ALBA 1C4PA 3PVLA 2WXGA 1GC6A 1L2NA 1C77A 5AZHA 4KX6B 3H9DA 4HDOA 2YEPB 4A3OA 3ZLZA 2IO1B 1E5WA 5TSSA 1WJUA 2J4XA 4JPSA 5CTRC 2KJHB 1R4NI 2NBVB 3Q3FA 1FEHA 2CU1A 3TIXA 5IO9A 2J7QB 1EF1A 2QIEB 4J3OD 3VFKA 4B0EA 1N6ZA 4W9HA 3MC8A 3DOWA 3R2TA 3JSVA 1TKGA 4MT5A 4BKSD 2FIDA 2KDFB 2BW2A 3BINA 3DCGA 2BKRB 2QILA 2D2QA 2KNBA 4ANUA 3WAMA 3EFUA 4PYZA 2LVPA 1QOGA 2IY1B 2KQ4X 3SR6A 4HVBA 1DOIA 1GOZA 2A4ZA 2MH7A 1IBXA 2Z59B 4EOYA 1EO6A 5CX3A 5AUKA 2MJEA 2Y5CA 4II3B 5D94A 1ET9A 4A90A 2BGFA 5J2RA 3B2FA 4FXCA 2BYEA 1SSNA 4KV2A 3QAQA 1XLOA 3RPFC 2MBHA 3FILB 1V6EA 3P63A 1YOVB 3AN1A 3Q3OC 4IW0A 3A9JA 5JZEB 1YQ4B 2JVCA 2K8CA 2MEKA 1PUTA 4ANXA 2LVOA 3QHTA 2ZVNA 1P9DU 3VUYA 1TZ1A 1FMAD 1XLQA 1SIFA 2JX5A 2DAFA 3KUZA 4MJSB 4I6PA 3VUXA 4WWPA 1WE7A 2M8SA 2J52A 3OWEB 3HK0A 4REZA 2K1FA 4HPLB 4P7IA 4NQLB 3PPAA 4J6IA 3APDA 4JGHB 4HKQA 2GBJA 3W9CB 1YN3A 2KKCA 4N6EB 4HLEA 1ZPSA 3IAM1 1GB4A 3N32A 4GSWA 2HTME 2JYTA 3PGEA 2PE9A 2O6VD 2WLBA 1ZDVA 3EECA 1VZ8A 2MCNB 1P3QU 2QSDA 1F9JA 5D6JB 1I4QA 3SFDB 3A9KB 3BK1A 3HVDA 1V5OA 2N7DA 3B2GA 4W9KA 3RNEC 5C23A 1WM2A 1FRDA 2G9HD 2NCNA 1QZEA 3HUIA 3Q3JA 2IJ0A 4PYUA 3ZNID 2RDHA 1E6EB 4KDIC 3ML8A 3T9LA 2NTTA 3V62A 4AWJA 2JUOA 3W2DA 1FIQA 2L32A 2LHEA 2N9KA 2Z0DB 3QQ8B 2MHJA 1L5PA 1YJ1A 3AE1B 1EU4A 1T5XD 2MQJA 1N63A 2CHXA 1I42A 3W1SC 2NBWB 1I4RA 1QLBB 1L6VA 2V3PA 4GDLA 1D5ZC 3NZ3A 2FUG1 2IO0B 4RGOS 2D07B 1N60A 3A4SC 2B3AA 3SD5A 2KJRA 5KHQA 3V6EB 2IGGA 1EWCA 2NMQA 3J9CA 4RNAA 4BAXA 1SF0A 2KYWA 1NYQA 4DHJB 3PLUA 3ONSA 3NVWA 3PHWB 1YJJA 1SJED 1LM8B 1ENFA 1FPYA 2G3QB 4RGNA 3PRPB 4FJZA 1EM7A 2JYEA 1V9JA 2WDRB 2Y5BB 3AULA 2E6XA 2JSVX 2OEDA 1WGDA 3M95A 4LK0M 4GLSC 4MELA 4XC2A 4K7WA 2MX2A 5LXHA 1WRIA 3LDZE 2B76B 1IGCA 1WGKA 2K6DB 5JHBA 2EKEC 1L0YB 4H2AA 2W3RA 4YSZB 4IC7B 3Q8CA 3RYTA 1NEKB 5FR3A 4XDCA 2LJIA 2BYFA 3RMKC 4F7ZA 4ZHPA 2RDBC 4TQ0A 2KWVB 2QCZA 3R66C 3U52E 4Q2JA 4DXFA 1UELA 2J0MA 2QC8A 3VUWA 4K81A 4HRSA 2FCQA 1GG3A 1HQRD 4WWOA 5JHAA 3AEEB 4GOCA 4IDIA 1KLGD 1ROEA 4L23A 4JWUC 4RFBA 3RI7C 3VRBB 2D5GA 1PGXA 2AX5A 4TKNA 2JPHA 3I63C 2FUHB 2V0GA 4MJSA 3MC0B 1C3TA 4XE0A 5BO4B 4FJVB 4BKSA 2NTSA 3P2BA 3AEGB 1Z2MA 2RD0A 1G6JA 1QF6A 2AQ1B 1JRUA 3URYA 4DHZB 1VJKA 2DAJA 4PT5A 2CKHB 1WWTA 2XEWA 3QK0A 4ACFA 2VH2A 3VVWB 1RFAA 3P4RB 1RLFA 3RNFC 2FCSA 2KC2A 3NZSA 4YXDB 4A3PA 5BYSA 4EFOA 1E10A 2I2YA 4G0NB 3ZVVA 3DBHI 5CHWA 1WGRA 2ZNVB 2K5PA 5TR5A 5D3IB 3DDCB 1XLNA 1SXTA 3IAS1 2KDBA 3I5JC 2GOWA 1M4VA 1UH6A 3BK2A 1T0SC 4ASWC 4K7UA 5IOIA 4C4VB 3KYDD 1VZ6A 3ZDTA 1V1PA 4MGYE 1FFVA 3PT2B 3U4EG 4KGRA 4BBNF 2SEBD 4HPPA 5CHVC 3U7DA 4BKGA 2KLGA 4C7YA 2NBUA 4KIKB 5BMHA 1EF5A 1DGJA 4RM8A 1OEYA 1H4RA 1BXTA 1FXTB 3AEFB 5D3DA 1KRHA 3JW0X 2RPQA 4OZCA 3RNAC 1XT9B 1PQSA 4X57B 4F8CB 4WWMA 2CU3A 2WS3B 3P4SB 2YEPF 4HJGE 2W9NA 2M17A 3EA6A 2WP9B 3AB5A 4HWIB 1FM0D 4YL8A 4KKIA 1D3ZA 1FFUA 3ZUNA 3X23A 3AE6B 3VTVA 4LJPB 2LGYA 2LI5A 4MEMA 2LUMA 2D3CA 4N58A 4B95A 2DWQA 2OHFA 2ONQA 3TJPA 3M62B 3N1YC 2KD0A 2BBCA 1I4HA 2WDQB 4DQOC 1E7PB 2KVRA 2W82A 2ZPYA 2WWZA 4W9LA 3Q8EA 4NPNA 3AI5A 1RRBA 1M94A 1AN8A 2KO3A 2WXJA 5EE3A 1QT9A 1E90A 1CMXB 4DXGA 2DNFA 2FCNA 2KDEB 1U4AA 1WX9A 5MPOA 2KDIA 2BS4B 1WMHA 3GS2A 3KWLA 3NJTA 1WJNA 2DYOA 3A9KA 3OLMD 3QCAA 3W5VB 1T3QA 3S2AA 4GN1A 3HIZA 1JWAD 1L0XB 2KJ6A 4HCNB 1V1PB 2LRWA 2WX0A 2M19A 2KFKA 3Q14C 3DPDA 4YTPB 2VRRB 2KK8A 3GB1A 5E6PA 1WGYA 4MGZE 2MP2A 3IHPC 5AUIA 2BS2B 3WALA 4AJWA 3N9YC 1GJZA 2WXFA 3DHHC 3ZNGC 4EEWA 3N3KB 3R2IA 2LMCA 4W9IA 2K3UA 4MM3A 4IUMB 4LDTD 5EE1A 3PZ7A 1TBEA 2ZPNA 1KLUD 1YNTE 2WX1A 4JX1C 1WXVA 1B1ZA 2D3GA 2KT7A 2PVGC 2V1YA 4YT0B 3B0AA 2MLBA 2LFIA 2GBRA 3JVZX 2KX3A 2XBBC 4LNIA 1NVID 1WIAA 2UU7A 3I9V1 1CQVA 2KTRA 3Q69A 5BMIA 4CQNA 1XXGA 1V2YA 3PZDA 2N4FA 3UQAA 4F1SA 4WH4A 2IDYA 1F2RC 4B9KA 5CHFA 3AEDB 2JXTA 3D32A 1UD7A 1GB1A 1ZGUB 2EMTA 3GP7A 1I4GA 1ZE3D 3DBSA 1HZ5A 4A20A 4NZLB 3CMMB 1MFWA 3Q8AA 5IKCM 1WXSA 2KQSA 1XD3B 1ZP0B 1K50A 2J0JA 4ICUA 2ICIA 2O2VA 3U2SC 3Q6BA 5G5HA 5DPRA 3VRAB 4NQKE 3WAOA 5KHOA 2N7EA 4IM0A 1RFKA 3DBRB 3RNGC 1UBIA 4W9FA 1WMHB 4A8XC 3KQ4A 1OFFA 3IFWB 5D7GA 1QOBA 2N9LA 1P0RA 1HXYD 1N5XA 3AEBB 1NDDA 3PLVA 2JF5A 3QARA 1WY8A 1WRDB 1LQBA 4NAMA 3KH0A 2FCMA 4IOIE 5BYQA 2JZPA 2C7NB 1K8RB 2GB1A 2MBBB 4C4VA 3MP9A 1J19A 1C9FA 4O1NA 3VAWA 3AE8B 3RT3B 3A1QB 4A55A 1Q0WB 1J0GA 4KSKC 1KOTA 2Y5PA 3BVZA 2NR2A 1C76A 1HA5A 1UBQA 3BVMA 4WJOA 1SIJA 5FK9C 2KQ7A 4MSMB 5E6OA 1E8XA 3VTUA 3WANA 1VZ7A 2FBWB 1TGZB 1CZPA 1V8CA 1ZKHA 2A5UA 4JE3B 3T3NA 2IO3B 1FCLA 1IP9A 5EE0A 2KN4A 3AMZA 4WAFA 5H8YE 3VH3B 3ML9A 4FHJA 5IAAC 1XQQA 3HVZA 3Q3NC 2LZ6A 5HKHA 3TEYA 2AQ2B 3R7RA 3EHVA 2V3SA 2RSUA 1BUIC 4G50A 3CIRB 2BB6A 3B9JA 1GC7A 3B1LX 5G55A 1WYGA 4ZYNA 5AZFA 3C8YA 5DPTA 4MDKE 4MACA 5DPSA 1PYWD 1YD8U 2GBKA 1STEA 1J7CA 1TS2A 4LJOB 3ZJVA 3AE4B 4MSQB 4K1RB 4OW0A 3GE3C 3L10B 4MM3B 2DHZA 3HRDD 3RZFA 3U8ZA 2R2QA 4PS8A 2L00B 1ZXHA 2BKFA 3ENEA 1ISNA 3AE7B 3ETRA 3AECB 2I38A 4ARCA 3AU4A 1WX7A 3OAWA 1XF5L 2HJ1A 2Q5WD 2NPTB 2N1VA 3TEZA 3TL5A 3KLSX 2MBOA 3SU8X 5HG2A 1F0ZA 1J7AA 2LHDA 2TSSA 2KOXA 4JL9A 4EE2A 2N1WA 2PIAA 3FC4A 3UI3A 2WXMA 1C1YB 2PEAA 1KJTA 4FADA 2J0KA 4KZCA 2UWQA 1OGWA 1DOXA 1VLBA 4NJ6A 3ZXRA 4DDGD 2OJRA 1MHHE 3FKYA 2AQ3B 4N59A 4TMAB 2MW5A 1IYFA 3RULA 4K3CA 3DVNU 3QC8B 3ZJUA 4R3DA 1JMLA 3N1XC 1IGDA 2IZVB 2INDC 2N9EB 1MI0A 4EZJA 3NZUA 1R4MB 2FIFA 4PS3A 1XCTL 2DENB 2PKOA 1FRRA 5IN7A 3ZKJC 1JWBD 1OTRB 4LCDE 2RPVA 1UWXA 3JSVB 2OOBB 3R7QA 4G11A 3KUDB 1C79A 1HZ6A 2VZKB 4WQOB 4NY0A 1RAXA 1XCQL 3IBEA 4P6VF 1TS5A 1WI0A 2L1AA 1FXAA 3CSFA 2BYVE 4GB9A 3RZWC 1D5MC 1SE2A 4NJCA 2PMVA 3ZO5B 1E8ZA 1ZOYB 1Q5WB 3UIPB 2NVUI 4HCPB 3TBLD 1SE3A 1NI2A 3NS1A 4BVUC 4HPMB 3ECIA 2MP2B 4XWWA 2PLPA 4CYEA 2PTLA 3SFEB 2QDFA 4OZAA 4OZBA 2HJ8A 3NHEB 4MH8A 5AEKB 5LLIA 4ARIA 2M0AA 1IPGA 1P7FA 3P1MA 2KWCA 1V81A 3UINB 3TEWA 2V3NA 2MSED 2N9XA 1LFDA 1OQQA 2WGSA 3BYYB 3KVFB 3LJ3A 3DQVA 1NYRA 1JRPA 3AE3B 1L4ZB 4ICVA 3APCA 3VR9B 3K9OB 3NS8A 2IGDA 1WGGA 3GOEA 1Q1OA 1K53A 1TY2A 4A6QA 1KFYB 1AYFA 2KTFA 3W1YA 3QJZA 5IA7A 2D3AA 3ZRCA 1I35A 2INCC 4US8A 3DWGC 3CSTA 4LDTB 3AH7A 3RN9C 4YTMB 3ZXVA 1YQBA 3PRMB 2Y3AA 4WAAA 1HE8A 1ZXIA 4BFRA 2GBNA 2AEHA 2L05A 1Y56A 3WA0A 2GI9A 4DWFA 1T0QC 2WXNA 4GXBA 3FAHA 2O6VA 2NPTA 3ZGZA 3R3MA 4M8MA 2PJHA 4EZKA 1UGMA 2AYOB 2JQRB 1JALA 1IBXB 2ZVOA 4K3BA 2DBYA 3EGRA 3MTNB 2REXA 3P42A 3A9JB 4ZHOA 3ZTDA 3IXSA 1AARA 3DBRI 3M3JA 1S3SG 1V80A 2D11A 3CF6E 4IM2A 2DZJA 4FULA 2KWDA 1E7UA 1YMHE 3QWZB 5G5GA 3V6CB 3RCZA 1YX5B 2GLSA 3KYCD 1I4XA 2CHZA 4WJNA 3NY5A 1A5RA 2QJLA 2ZZPB 4EKUA 2C9WB 4IM3A 1ESFA 3A1QA 4W9GA 1HEZE 2EMSA 1DOYA
chains in the Genus database with same CATH topology
1WYWB 2AL6A 1WIAA 3OJ4B 1V86A 2L76A 3N32A 2KTRA 2L3ZA 4WWNA 4GSWA 4KSLC 2I1JA 4W9EA 4PS7A 3PRZA 3PGEA 1V2YA 2K8BA 2PE9A 3PZDA 2N4FA 3V60A 4F1SA 1VCBA 3A4RA 2O6VD 3UQAA 3EECA 4B9KA 3APFA 5CHFA 2MCNB 1P3QU 3DVGX 1F9JA 4MGIE 3D32A 1UD7A 5D6JB 1ZGUB 1P98A 1WR1A 2EMTA 2HE7A 2V4LA 3DBSA 3DVGY 3A9KB 2GBMA 4A20A 3CMMB 1V5OA 2KTRB 4GIVA 1WXSA 3PHXB 1WXAA 2KQSA 2N7DA 1XD3B 2KZRA 4W9KA 2YVCA 2J0JA 4HK2A 4ICUA 1WM2A 5C23A 4AUQC 2O2VA 3H6NA 2DZIA 2XK5B 2AL3A 1WJ6A 2NCNA 1QZEA 3HHMA 3GZNI 4FLHA 5DPRA 3Q3JA 4PYUA 4NQKE 3WAOA 3ZNID 1YIWA 5KHOA 2N7EA 2Z0EB 4IM0A 4KDIC 3ML8A 3T9LA 2UYZB 3V62A 3ZNHB 3K9PB 4AWJA 4RMAA 4NNJB 1UBIA 2JUOA 1E8WA 3PREA 4W9FA 1TTNA 4G3XB 4BOSC 1WMHB 4BOZB 2Z0DB 3M63B 4XZ4A 2ZNVC 3QQ8B 3IFWB 3L13A 5D7GA 1P0RA 4CO7A 1NDDA 2O6VB 1NBFC 3PLVA 4HDQA 1YJ1A 1EUVB 4GMVA 4BBNC 2JF5A 3QARA 2MQJA 3UIOB 2CHXA 2DYBA 2CR5A 1WY8A 1WRDB 1LQBA 4I6LB 4URKA 1I42A 4KVGB 3W1SC 2NBWB 2IO2B 3KH0A 2FCMA 3L0WB 5FR6A 2C7NB 1K8RB 2MBBB 3L17A 4GDLA 4JIOU 2WDTB 1J19A 1V49A 2LUEA 2IO0B 2RR9A 3L08A 3VAWA 2D07B 2AWTA 3A4SC 2BPSA 3ZIMA 2B3AA 2JT4B 3N30A 3SD5A 3WIMA 3RT3B 2KJRA 5KHQA 3A1QB 3V6EB 3DBLI 1Q0WB 1WZ0A 1J0GA 4KSKC 1BT0A 4DK5A 3KUCB 2BWFA 1KOTA 2XBBC 4II2B 3ZNZB 1OEYJ 4E3CA 2NR2A 4DHJB 3PLUA 2GMIC 1UBQA 3ONSA 4WJOA 1E8YA 4FBJB 4M0WB 2DYMA 1J8CA 2KQ7A 1X1MA 3PHWB 4MSMB 3W1SA 5E6OA 3U30A 1LM8B 1E8XA 3VTUA 5J17A 3WANA 4JLCA 1TGZB 2A5UA 1ZKHA 2G3QB 2IO3B 5G2NA 4WJPA 1IP9A 4OVVA 4NJ7A 3PRPB 4FJZA 4NAWB 5JH5C 1V9JA 2C7HA 4DBGA 1P1AA 2JZZA 3ML9A 4FHJA 3VH3B 5IAAC 1ZW7A 1XQQA 2Y5BB 3AULA 3H7PB 2K8HA 1WFYA 3MHSD 2M4NA 2LZ6A 2BWES 4W9DA 1WGDA 3PS6A 3M95A 2FNJB 2M1MA 2MRPA 3H7PA 4MELA 5HKHA 4XC2A 3A33B 1KLVA 3AU5A 3ZRFA 4K7WA 3R7RA 2FAZA 3EHVA 3VH4B 1Y8RC 2V3SA 2RSUA 4XX5A 2MX2A 5LXHA 4G50A 2BF8B 2JXXA 1GC7A 3B1LX 5G55A 1WX8A 4ANVA 2LASA 3LDZE 3L54A 4N9F4 2K6DB 4ZYNA 5AZFA 4GU2A 3BY4B 3ZDMC 5JHBA 2EKEC 3MJWA 3RD2A 2O2VB 5DPTA 4MDKE 4IC7B 3EC8A 4KDLB 3RYTA 5DPSA 1YD8U 2JRHA 2GBKA 4LJOB 1MG8A 5AZGA 4MSQB 3PSEB 2BYFA 4K1RB 4AOFA 1H8CA 4DXAB 1SGHA 1S1QB 1WJ4A 1LXDA 3L10B 4IWPA 4F7ZA 2DHZA 4B6WA 2IYDB 4TQ0A 2KWVB 3RZFA 3U8ZA 2R2QA 3R66C 4KIKA 4PS8A 4DHZE 2L00B 3ENEA 2BKFA 3QIJA 1UELA 1ISNA 2J0MA 2KLCA 3VUWA 4E71A 5J18A 4K81A 2CHWA 2FCQA 2MA9B 1GG3A 2KC1A 2G4DB 4WWOA 5JHAA 4TQ1A 1Z5SB 4FHKA 5DPWA 3AU4A 1WX7A 3OAWA 1WM3A 2LGXA 4GOCA 2N9PC 1GUAB 2DX5B 2DZKA 2NPTB 3UQBA 4HLEA 2N1VA 1WR6E 3TL5A 2MBOA 4TKNA 2JPHA 3SU8X 2FUHB 4RM9A 4MJSA 3KW5B 1C3TA 5BO4B 2KN5A 2KOXA 4FJVB 4BKSA 4JL9A 2PE6B 3H7SA 2DZMA 2N1WA 2KWUB 3PTFC 3P2BA 3TMPB 4DDID 1Z2MA 2RD0A 1G6JA 3UGBB 5L83A 3QX1A 1C1YB 2PEAA 3IG3A 3L16A 1KJTA 5C1ZA 4FADA 1JRUA 2J0KA 3WAPA 2KMAA 3I3TB 4KZCA 2UWQA 4W9CA 4DHZB 2M0XA 2DAJA 1OGWA 2CKHB 3H1UA 4FN2A 4NJ6A 4DDGD 2OJRA 4M8NA 4EUTA 2XEWA 2MW5A 3QK0A 3QA8A 1IYFA 3RULA 3T8MA 2RGFA 2KFJA 4ZRIA 3VVWB 3DVNU 1RFAA 2G4SA 1RLFA 3QC8B 4MGKE 4FA6A 5LXIB 3ZTCA 3VHTC 2FCSA 2KC2A 2YLMA 1GNUA 3NZSA 1VD2A 2ZJDA 2G45B 2IZVB 2N9EB 3TCAA 4A3PA 3VQIA 4EZJA 3NZUA 4EFOA 2FIFA 4PS3A 4IWOA 2DENB 4G0NB 3ZVVA 4DHJD 3DBHI 5CHWA 2LXAA 2K25A 1WGRA 4OVUA 3ZKJC 2ZNVB 1OTRB 4LCDE 5TR5A 3JSVB 3DDCB 3DVNV 3C0RB 1E7VA 2JZ3B 4BKTA 2OOBB 3R7QA 4G11A 2KDBA 4ZDVA 2KANA 3JYUA 3KUDB 5E6NA 2GOWA 4WQOB 4NY0A 1UH6A 1RAXA 2JWZA 3NOBA 2L0TA 4ASWC 4JQWC 4K7UA 2HD5B 3IBEA 2L0FA 2XK5A 1V5TA 4TUUA 5D2MB 1UZXB 1WI0A 1WXMA 4GDLB 3KYDD 2K39A 3VDZA 2KFKB 1OQYA 2IY0B 3CSFA 2C60A 2BYVE 3ZDTA 2LWPA 3PT2B 2L7RA 4GB9A 4MGYE 4GDKB 1YX6B 3RZWC 4BBNF 2JY6A 2LD9A 1WH3A 5CHVC 3ZO5B 3U7DA 1E8ZA 4BKGA 1Q5WB 2KLGA 3UIPB 2JRIB 2NBUA 1KM7A 2NVUI 4HCPB 4KIKB 2WYQA 3TBLD 3ZW3A 1NI2A 1EF5A 3AXCA 4BVUC 3X0WA 4HPMB 4RM8A 3ECIA 2MP2B 1OEYA 5L95C 1H4RA 4CYEA 3B08A 3HM6X 1FXTB 2LJ5A 4FJYA 3RUIB 4I6NB 2LVQA 3JW0X 2RPQA 5EDSA 2HJ8A 3NHEB 1XT9B 5AEKB 1PQSA 4ZRJA 2ZCBA 4X57B 5GMVA 5LLIA 4GDKA 2D10A 4F8CB 3ALBA 4EZLA 2HTHA 4TV3A 3PVLA 2CS4A 2I1KA 3JVZX 1GC6A 1L2NA 1IPGA 5AZHA 3H9DA 2KWCA 1V81A 3UINB 3V61A 4HDOA 4A3OA 2MSED 2LGDA 3ZLZA 2W9NA 4ANWA 2M17A 2N9XA 1LFDA 2IO1B 4HWIB 1E5WA 1WJUA 5CTRC 3KVFB 3UF8A 4YL8A 2KJHB 3LJ3A 1R4NI 3DQVA 4MH0E 2NBVB 4CHKA 3Q3FA 1D3ZA 4NAWA 4ICVA 3APCA 2CU1A 3TIXA 2J7QB 2ZEQA 1EF1A 2ASQA 3K9OB 3NS8A 3SHQA 3ZUNA 3X23A 1WGGA 3VFKA 3VTVA 4LJPB 4E74A 2LGYA 4W9HA 2LI5A 3GOEA 1Q1OA 3DOWA 4IWQA 4MEMA 2LRUA 1WE6A 3JSVA 4IG7B 3SDLC 4B95A 3OJ3A 3TJPA 3M62B 3VXWA 2KD0A 4BKSD 2FIDA 2KDFB 3BINA 2KVRA 3DCGA 2BKRB 2D2QA 2KNBA 2KTFA 2MWSB 2ZPYA 3W1YA 4ANUA 2WWZA 3QJZA 4W9LA 3WAMA 5IA7A 3ZRCA 3EFUA 4PYZA 1I35A 1WZ3A 2IY1B 2LVPA 4NPNA 3IVFA 3AI5A 1RRBA 1M94A 2KHWB 4HVBA 3CSTA 4LDTB 2KO3A 2A4ZA 2QHOA 1YQBA 2Z59B 3PRMB 1E90A 1CMXB 4K7SA 4W9JA 1EO6A 4AP4C 4EOYA 5CX3A 2FCNA 2KDEB 4WAAA 1HE8A 1U4AA 1WX9A 4BFRA 4II3B 5D94A 2MBQA 2KDIA 1WMHA 2GBNA 2AEHA 2L05A 2BGFA 3WA0A 1WJNA 4DWFA 5J2RA 2DYOA 3O65B 2BYEA 3A9KA 2KX0A 4GXBA 3OLMD 2PPHA 2R2OA 3QCAA 4KV2A 2NS5A 2O6VA 2ZCCA 3QAQA 3S2AA 2NPTA 4GN1A 3HIZA 2KJ6A 2MBHA 4HCNB 2IBIB 2LRWA 2WX0A 4GGQA 3R3MA 4M8MA 2KFKA 1V6EA 2PJHA 4EZKA 3DPDA 1UGMA 2AYOB 4HJKA 4IW0A 3A9JA 5JZEB 2JVCA 2K8CA 3VTWA 2VRRB 2ZVOA 2K6QA 2KK8A 4ANXA 5E6PA 1WGYA 2MBEA 2LVOA 3QHTA 1WF9A 4MGZE 2MP2A 2ZVNA 2REXA 1WGHA 3A9JB 3IHPC 3MTNB 1P9DU 4KZ0A 3VUYA 3ZTDA 1AARA 3DBRI 3WALA 3M3JA 1TZ1A 2C5LC 4AJWA 1S3SG 1V80A 2D11A 1GJZA 1SIFA 2KXJA 2DAFA 4ZRKA 3CF6E 5DCNA 3ZNGC 1R4MI 4IM2A 4EEWA 3KUZA 4MJSB 3N3KB 4I6PA 2DZJA 4WJQA 4W9IA 4FULA 3VUXA 4WWPA 4MM3A 1E7UA 4IUMB 1WE7A 2M8SA 4LDTD 3QWZB 4HXDA 3HM3A 3V6CB 3RCZA 1TBEA 1YX5B 3HK0A 2ZPNA 4AJYB 2K1FA 2WX1A 3KYCD 3PV1A 4HPLB 4NQLB 1WXVA 2CHZA 4P7IA 2D3GA 3PPAA 4J6IA 4WJNA 3NY5A 3APDA 1A5RA 2L8JA 4JGHB 2V1YA 2ZZPB 2KMCA 4EKUA 2C7MB 3B0AA 2GBJA 2C9WB 4IM3A 1L7YA 2MLBA 1T0YA 2KKCA 3A1QA 2GBRA 4W9GA 2LXCA 2EMSA 2KX3A 1SE9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYW B;  2AL6 A;  1WIA A;  3OJ4 B;  1V86 A;  2L76 A;  3N32 A;  2KTR A;  2L3Z A;  4WWN A;  4GSW A;  4KSL C;  2I1J A;  4W9E A;  4PS7 A;  3PRZ A;  3PGE A;  1V2Y A;  2K8B A;  2PE9 A;  3PZD A;  2N4F A;  3V60 A;  4F1S A;  1VCB A;  3A4R A;  2O6V D;  3UQA A;  3EEC A;  4B9K A;  3APF A;  5CHF A;  2MCN B;  1P3Q U;  3DVG X;  1F9J A;  4MGI E;  3D32 A;  1UD7 A;  5D6J B;  1ZGU B;  1P98 A;  1WR1 A;  2EMT A;  2HE7 A;  2V4L A;  3DBS A;  3DVG Y;  3A9K B;  2GBM A;  4A20 A;  3CMM B;  1V5O A;  2KTR B;  4GIV A;  1WXS A;  3PHX B;  1WXA A;  2KQS A;  2N7D A;  1XD3 B;  2KZR A;  4W9K A;  2YVC A;  2J0J A;  4HK2 A;  4ICU A;  1WM2 A;  5C23 A;  4AUQ C;  2O2V A;  3H6N A;  2DZI A;  2XK5 B;  2AL3 A;  1WJ6 A;  2NCN A;  1QZE A;  3HHM A;  3GZN I;  4FLH A;  5DPR A;  3Q3J A;  4PYU A;  4NQK E;  3WAO A;  3ZNI D;  1YIW A;  5KHO A;  2N7E A;  2Z0E B;  4IM0 A;  4KDI C;  3ML8 A;  3T9L A;  2UYZ B;  3V62 A;  3ZNH B;  3K9P B;  4AWJ A;  4RMA A;  4NNJ B;  1UBI A;  2JUO A;  1E8W A;  3PRE A;  4W9F A;  1TTN A;  4G3X B;  4BOS C;  1WMH B;  4BOZ B;  2Z0D B;  3M63 B;  4XZ4 A;  2ZNV C;  3QQ8 B;  3IFW B;  3L13 A;  5D7G A;  1P0R A;  4CO7 A;  1NDD A;  2O6V B;  1NBF C;  3PLV A;  4HDQ A;  1YJ1 A;  1EUV B;  4GMV A;  4BBN C;  2JF5 A;  3QAR A;  2MQJ A;  3UIO B;  2CHX A;  2DYB A;  2CR5 A;  1WY8 A;  1WRD B;  1LQB A;  4I6L B;  4URK A;  1I42 A;  4KVG B;  3W1S C;  2NBW B;  2IO2 B;  3KH0 A;  2FCM A;  3L0W B;  5FR6 A;  2C7N B;  1K8R B;  2MBB B;  3L17 A;  4GDL A;  4JIO U;  2WDT B;  1J19 A;  1V49 A;  2LUE A;  2IO0 B;  2RR9 A;  3L08 A;  3VAW A;  2D07 B;  2AWT A;  3A4S C;  2BPS A;  3ZIM A;  2B3A A;  2JT4 B;  3N30 A;  3SD5 A;  3WIM A;  3RT3 B;  2KJR A;  5KHQ A;  3A1Q B;  3V6E B;  3DBL I;  1Q0W B;  1WZ0 A;  1J0G A;  4KSK C;  1BT0 A;  4DK5 A;  3KUC B;  2BWF A;  1KOT A;  2XBB C;  4II2 B;  3ZNZ B;  1OEY J;  4E3C A;  2NR2 A;  4DHJ B;  3PLU A;  2GMI C;  1UBQ A;  3ONS A;  4WJO A;  1E8Y A;  4FBJ B;  4M0W B;  2DYM A;  1J8C A;  2KQ7 A;  1X1M A;  3PHW B;  4MSM B;  3W1S A;  5E6O A;  3U30 A;  1LM8 B;  1E8X A;  3VTU A;  5J17 A;  3WAN A;  4JLC A;  1TGZ B;  2A5U A;  1ZKH A;  2G3Q B;  2IO3 B;  5G2N A;  4WJP A;  1IP9 A;  4OVV A;  4NJ7 A;  3PRP B;  4FJZ A;  4NAW B;  5JH5 C;  1V9J A;  2C7H A;  4DBG A;  1P1A A;  2JZZ A;  3ML9 A;  4FHJ A;  3VH3 B;  5IAA C;  1ZW7 A;  1XQQ A;  2Y5B B;  3AUL A;  3H7P B;  2K8H A;  1WFY A;  3MHS D;  2M4N A;  2LZ6 A;  2BWE S;  4W9D A;  1WGD A;  3PS6 A;  3M95 A;  2FNJ B;  2M1M A;  2MRP A;  3H7P A;  4MEL A;  5HKH A;  4XC2 A;  3A33 B;  1KLV A;  3AU5 A;  3ZRF A;  4K7W A;  3R7R A;  2FAZ A;  3EHV A;  3VH4 B;  1Y8R C;  2V3S A;  2RSU A;  4XX5 A;  2MX2 A;  5LXH A;  4G50 A;  2BF8 B;  2JXX A;  1GC7 A;  3B1L X;  5G55 A;  1WX8 A;  4ANV A;  2LAS A;  3LDZ E;  3L54 A;  4N9F 4;  2K6D B;  4ZYN A;  5AZF A;  4GU2 A;  3BY4 B;  3ZDM C;  5JHB A;  2EKE C;  3MJW A;  3RD2 A;  2O2V B;  5DPT A;  4MDK E;  4IC7 B;  3EC8 A;  4KDL B;  3RYT A;  5DPS A;  1YD8 U;  2JRH A;  2GBK A;  4LJO B;  1MG8 A;  5AZG A;  4MSQ B;  3PSE B;  2BYF A;  4K1R B;  4AOF A;  1H8C A;  4DXA B;  1SGH A;  1S1Q B;  1WJ4 A;  1LXD A;  3L10 B;  4IWP A;  4F7Z A;  2DHZ A;  4B6W A;  2IYD B;  4TQ0 A;  2KWV B;  3RZF A;  3U8Z A;  2R2Q A;  3R66 C;  4KIK A;  4PS8 A;  4DHZ E;  2L00 B;  3ENE A;  2BKF A;  3QIJ A;  1UEL A;  1ISN A;  2J0M A;  2KLC A;  3VUW A;  4E71 A;  5J18 A;  4K81 A;  2CHW A;  2FCQ A;  2MA9 B;  1GG3 A;  2KC1 A;  2G4D B;  4WWO A;  5JHA A;  4TQ1 A;  1Z5S B;  4FHK A;  5DPW A;  3AU4 A;  1WX7 A;  3OAW A;  1WM3 A;  2LGX A;  4GOC A;  2N9P C;  1GUA B;  2DX5 B;  2DZK A;  2NPT B;  3UQB A;  4HLE A;  2N1V A;  1WR6 E;  3TL5 A;  2MBO A;  4TKN A;  2JPH A;  3SU8 X;  2FUH B;  4RM9 A;  4MJS A;  3KW5 B;  1C3T A;  5BO4 B;  2KN5 A;  2KOX A;  4FJV B;  4BKS A;  4JL9 A;  2PE6 B;  3H7S A;  2DZM A;  2N1W A;  2KWU B;  3PTF C;  3P2B A;  3TMP B;  4DDI D;  1Z2M A;  2RD0 A;  1G6J A;  3UGB B;  5L83 A;  3QX1 A;  1C1Y B;  2PEA A;  3IG3 A;  3L16 A;  1KJT A;  5C1Z A;  4FAD A;  1JRU A;  2J0K A;  3WAP A;  2KMA A;  3I3T B;  4KZC A;  2UWQ A;  4W9C A;  4DHZ B;  2M0X A;  2DAJ A;  1OGW A;  2CKH B;  3H1U A;  4FN2 A;  4NJ6 A;  4DDG D;  2OJR A;  4M8N A;  4EUT A;  2XEW A;  2MW5 A;  3QK0 A;  3QA8 A;  1IYF A;  3RUL A;  3T8M A;  2RGF A;  2KFJ A;  4ZRI A;  3VVW B;  3DVN U;  1RFA A;  2G4S A;  1RLF A;  3QC8 B;  4MGK E;  4FA6 A;  5LXI B;  3ZTC A;  3VHT C;  2FCS A;  2KC2 A;  2YLM A;  1GNU A;  3NZS A;  1VD2 A;  2ZJD A;  2G45 B;  2IZV B;  2N9E B;  3TCA A;  4A3P A;  3VQI A;  4EZJ A;  3NZU A;  4EFO A;  2FIF A;  4PS3 A;  4IWO A;  2DEN B;  4G0N B;  3ZVV A;  4DHJ D;  3DBH I;  5CHW A;  2LXA A;  2K25 A;  1WGR A;  4OVU A;  3ZKJ C;  2ZNV B;  1OTR B;  4LCD E;  5TR5 A;  3JSV B;  3DDC B;  3DVN V;  3C0R B;  1E7V A;  2JZ3 B;  4BKT A;  2OOB B;  3R7Q A;  4G11 A;  2KDB A;  4ZDV A;  2KAN A;  3JYU A;  3KUD B;  5E6N A;  2GOW A;  4WQO B;  4NY0 A;  1UH6 A;  1RAX A;  2JWZ A;  3NOB A;  2L0T A;  4ASW C;  4JQW C;  4K7U A;  2HD5 B;  3IBE A;  2L0F A;  2XK5 A;  1V5T A;  4TUU A;  5D2M B;  1UZX B;  1WI0 A;  1WXM A;  4GDL B;  3KYD D;  2K39 A;  3VDZ A;  2KFK B;  1OQY A;  2IY0 B;  3CSF A;  2C60 A;  2BYV E;  3ZDT A;  2LWP A;  3PT2 B;  2L7R A;  4GB9 A;  4MGY E;  4GDK B;  1YX6 B;  3RZW C;  4BBN F;  2JY6 A;  2LD9 A;  1WH3 A;  5CHV C;  3ZO5 B;  3U7D A;  1E8Z A;  4BKG A;  1Q5W B;  2KLG A;  3UIP B;  2JRI B;  2NBU A;  1KM7 A;  2NVU I;  4HCP B;  4KIK B;  2WYQ A;  3TBL D;  3ZW3 A;  1NI2 A;  1EF5 A;  3AXC A;  4BVU C;  3X0W A;  4HPM B;  4RM8 A;  3ECI A;  2MP2 B;  1OEY A;  5L95 C;  1H4R A;  4CYE A;  3B08 A;  3HM6 X;  1FXT B;  2LJ5 A;  4FJY A;  3RUI B;  4I6N B;  2LVQ A;  3JW0 X;  2RPQ A;  5EDS A;  2HJ8 A;  3NHE B;  1XT9 B;  5AEK B;  1PQS A;  4ZRJ A;  2ZCB A;  4X57 B;  5GMV A;  5LLI A;  4GDK A;  2D10 A;  4F8C B;  3ALB A;  4EZL A;  2HTH A;  4TV3 A;  3PVL A;  2CS4 A;  2I1K A;  3JVZ X;  1GC6 A;  1L2N A;  1IPG A;  5AZH A;  3H9D A;  2KWC A;  1V81 A;  3UIN B;  3V61 A;  4HDO A;  4A3O A;  2MSE D;  2LGD A;  3ZLZ A;  2W9N A;  4ANW A;  2M17 A;  2N9X A;  1LFD A;  2IO1 B;  4HWI B;  1E5W A;  1WJU A;  5CTR C;  3KVF B;  3UF8 A;  4YL8 A;  2KJH B;  3LJ3 A;  1R4N I;  3DQV A;  4MH0 E;  2NBV B;  4CHK A;  3Q3F A;  1D3Z A;  4NAW A;  4ICV A;  3APC A;  2CU1 A;  3TIX A;  2J7Q B;  2ZEQ A;  1EF1 A;  2ASQ A;  3K9O B;  3NS8 A;  3SHQ A;  3ZUN A;  3X23 A;  1WGG A;  3VFK A;  3VTV A;  4LJP B;  4E74 A;  2LGY A;  4W9H A;  2LI5 A;  3GOE A;  1Q1O A;  3DOW A;  4IWQ A;  4MEM A;  2LRU A;  1WE6 A;  3JSV A;  4IG7 B;  3SDL C;  4B95 A;  3OJ3 A;  3TJP A;  3M62 B;  3VXW A;  2KD0 A;  4BKS D;  2FID A;  2KDF B;  3BIN A;  2KVR A;  3DCG A;  2BKR B;  2D2Q A;  2KNB A;  2KTF A;  2MWS B;  2ZPY A;  3W1Y A;  4ANU A;  2WWZ A;  3QJZ A;  4W9L A;  3WAM A;  5IA7 A;  3ZRC A;  3EFU A;  4PYZ A;  1I35 A;  1WZ3 A;  2IY1 B;  2LVP A;  4NPN A;  3IVF A;  3AI5 A;  1RRB A;  1M94 A;  2KHW B;  4HVB A;  3CST A;  4LDT B;  2KO3 A;  2A4Z A;  2QHO A;  1YQB A;  2Z59 B;  3PRM B;  1E90 A;  1CMX B;  4K7S A;  4W9J A;  1EO6 A;  4AP4 C;  4EOY A;  5CX3 A;  2FCN A;  2KDE B;  4WAA A;  1HE8 A;  1U4A A;  1WX9 A;  4BFR A;  4II3 B;  5D94 A;  2MBQ A;  2KDI A;  1WMH A;  2GBN A;  2AEH A;  2L05 A;  2BGF A;  3WA0 A;  1WJN A;  4DWF A;  5J2R A;  2DYO A;  3O65 B;  2BYE A;  3A9K A;  2KX0 A;  4GXB A;  3OLM D;  2PPH A;  2R2O A;  3QCA A;  4KV2 A;  2NS5 A;  2O6V A;  2ZCC A;  3QAQ A;  3S2A A;  2NPT A;  4GN1 A;  3HIZ A;  2KJ6 A;  2MBH A;  4HCN B;  2IBI B;  2LRW A;  2WX0 A;  4GGQ A;  3R3M A;  4M8M A;  2KFK A;  1V6E A;  2PJH A;  4EZK A;  3DPD A;  1UGM A;  2AYO B;  4HJK A;  4IW0 A;  3A9J A;  5JZE B;  2JVC A;  2K8C A;  3VTW A;  2VRR B;  2ZVO A;  2K6Q A;  2KK8 A;  4ANX A;  5E6P A;  1WGY A;  2MBE A;  2LVO A;  3QHT A;  1WF9 A;  4MGZ E;  2MP2 A;  2ZVN A;  2REX A;  1WGH A;  3A9J B;  3IHP C;  3MTN B;  1P9D U;  4KZ0 A;  3VUY A;  3ZTD A;  1AAR A;  3DBR I;  3WAL A;  3M3J A;  1TZ1 A;  2C5L C;  4AJW A;  1S3S G;  1V80 A;  2D11 A;  1GJZ A;  1SIF A;  2KXJ A;  2DAF A;  4ZRK A;  3CF6 E;  5DCN A;  3ZNG C;  1R4M I;  4IM2 A;  4EEW A;  3KUZ A;  4MJS B;  3N3K B;  4I6P A;  2DZJ A;  4WJQ A;  4W9I A;  4FUL A;  3VUX A;  4WWP A;  4MM3 A;  1E7U A;  4IUM B;  1WE7 A;  2M8S A;  4LDT D;  3QWZ B;  4HXD A;  3HM3 A;  3V6C B;  3RCZ A;  1TBE A;  1YX5 B;  3HK0 A;  2ZPN A;  4AJY B;  2K1F A;  2WX1 A;  3KYC D;  3PV1 A;  4HPL B;  4NQL B;  1WXV A;  2CHZ A;  4P7I A;  2D3G A;  3PPA A;  4J6I A;  4WJN A;  3NY5 A;  3APD A;  1A5R A;  2L8J A;  4JGH B;  2V1Y A;  2ZZP B;  2KMC A;  4EKU A;  2C7M B;  3B0A A;  2GBJ A;  2C9W B;  4IM3 A;  1L7Y A;  2MLB A;  1T0Y A;  2KKC A;  3A1Q A;  2GBR A;  4W9G A;  2LXC A;  2EMS A;  2KX3 A;  1SE9 A; 
#chains in the Genus database with same CATH topology
 4RH6 A;  3OJ4 B;  1MJD A;  3V05 A;  2L76 A;  3PO0 A;  3C19 A;  2D3B A;  2L3Z A;  4WWN A;  1FD6 A;  3PRZ A;  1V97 A;  3H8H A;  3V60 A;  1VCB A;  3A4R A;  1R4N B;  1YJI A;  3APF A;  2X38 A;  2WHI A;  1V1O A;  1P98 A;  1WR1 A;  2HE7 A;  3LXF A;  4ZYS A;  2RMM A;  5T8I A;  1SJH D;  2GBM A;  3AE9 B;  1OQR A;  1JWU D;  1T6B X;  2KZR A;  4AUQ C;  3H6N A;  2XK5 B;  2AL3 A;  1WJ6 A;  2CJO A;  1ACC A;  3GZN I;  2INN E;  3TUO A;  1HTQ A;  2UYZ B;  1FNW A;  1C78 A;  1KTK A;  2LEK A;  2WU2 B;  4RMA A;  5FKA C;  4C7Z A;  3LB8 C;  2WXQ A;  1J7B A;  5BYR A;  3RNB C;  2WXK A;  1SE4 A;  4CO7 A;  3MHZ A;  2O6V B;  1EUV B;  4S17 A;  3W5U B;  4URK A;  4KVG B;  2WNM A;  2IO2 B;  3L0W B;  5FR6 A;  3L17 A;  2N7J A;  4JIO U;  4LNN A;  2LUE A;  1V49 A;  3EUB 2;  3ZIM A;  2JT4 B;  3WIM A;  4UDU C;  1YN4 A;  3GZN B;  4DK5 A;  2W3S A;  4E3C A;  1PFD A;  2GMI C;  1RM6 C;  2DYM A;  1HTO A;  4WUR A;  1X1M A;  3W1S A;  1F2R I;  3U30 A;  1TIF A;  5J17 A;  4WIP A;  3NVY A;  3LYY A;  1YN5 A;  5G2N A;  1N61 A;  4OVV A;  4YTN B;  2E3T A;  5JH5 C;  2JZZ A;  1ZW7 A;  4YSX B;  4LNO A;  1JWS D;  1WFY A;  2KAC A;  2BWE S;  2XN9 C;  3H7P A;  1KF6 B;  3A33 B;  3AU5 A;  3VH4 B;  1Y8R C;  1FCC C;  5BMG A;  2H89 B;  5EE9 A;  2JXX A;  2WXH A;  5GXG B;  1FNU A;  1NI3 A;  2LAS A;  4ANV A;  2DLB A;  4N9F 4;  1D4B A;  1N62 A;  3MJW A;  2WXP A;  2BQQ A;  4YSY B;  3EC8 A;  3IT6 B;  5IP4 D;  3I57 A;  3PSE B;  2QMT A;  1H8C A;  4DXA B;  1S1Q B;  4P16 A;  3RFZ B;  1WJ4 A;  1LXD A;  4B6W A;  1RYJ A;  4DHZ E;  3QIJ A;  4E71 A;  2CHW A;  2VZK D;  3DBL B;  2G4D B;  5DPW A;  3E56 A;  1L0V B;  1WM3 A;  2N9P C;  5H92 C;  2DX5 B;  3UQB A;  1TS4 A;  2K0P A;  4JWS C;  1TY0 A;  3KW5 B;  1GAQ B;  4ZRQ A;  2PE6 B;  3H7S A;  2DZM A;  3R8B A;  4XYC A;  1MPE A;  3QX1 A;  3IG3 A;  3L16 A;  1TZO A;  4W9C A;  2M0X A;  1QKZ A;  1BML C;  1FXI A;  2RDG A;  4EUT A;  5HI1 A;  3QA8 A;  3T8M A;  2G4S A;  2WXI A;  4MGK E;  3ZTC A;  3VHT C;  4KGS A;  3SEB A;  4P1C C;  1VD2 A;  2ZJD A;  2FE8 A;  3VQI A;  1VDV A;  4IWO A;  4C56 C;  4DHJ D;  5JXV A;  1K51 A;  4M01 A;  3MJ5 A;  2LXA A;  2K25 A;  4OVU A;  5HHD G;  4LLG M;  5LNK 1;  2QEJ C;  3DVN V;  3C0R B;  1E7V A;  4BKT A;  4IKG A;  4RGM A;  2G1E A;  2VH1 A;  3AV8 A;  3BZD B;  2K9X A;  4ZDV A;  3JYU A;  1P7E A;  1D5X C;  1MG4 A;  3PZ8 A;  2JWZ A;  1E9M A;  2LGS A;  3NOB A;  2X8X X;  3OG5 A;  2HD5 B;  3L4P A;  3NG0 A;  2L0F A;  2XK5 A;  1V5T A;  4TUU A;  2IGH A;  1UZX B;  1MVK A;  2HDE A;  1ZDX A;  2KFK B;  1TJE A;  1OQY A;  2LWP A;  2L7R A;  1YX6 B;  2JRI B;  2W55 A;  1F77 A;  2WYQ A;  3ZW3 A;  3AXC A;  3X0W A;  4HKZ E;  5L95 C;  4XWT A;  2WQY B;  1SBB B;  3HM6 X;  3NVV A;  1UF0 A;  4FJY A;  3RUI B;  1K52 A;  1C4C A;  1TKE A;  2EEL A;  4C00 A;  2EKI A;  1TKY A;  2ZCB A;  4GDK A;  2D10 A;  1MHX A;  2HTH A;  4TV3 A;  4EZL A;  2CS4 A;  2I1K A;  4A9A A;  3ABV B;  1I7H A;  3V61 A;  1PGB A;  2LGD A;  4ANW A;  4LNF A;  3UF8 A;  2L52 A;  1FNV A;  1KH0 A;  4MH0 E;  4CHK A;  4NAW A;  1JRO A;  2ZEQ A;  2ASQ A;  3SHQ A;  2H88 B;  2BVC A;  3U7Z A;  4E74 A;  4IWQ A;  3E9S A;  3SDL C;  2LRU A;  1WE6 A;  4IG7 B;  3RNC C;  3OJ3 A;  4USA A;  4US9 A;  3VXW A;  3DWM A;  2PVO D;  2MWS B;  1C4A A;  5E6J A;  1WZ3 A;  3IVF A;  1TS3 A;  2KHW B;  4RF1 A;  4P1B C;  2QHO A;  4K7S A;  4W9J A;  4AP4 C;  3WCQ A;  2MBQ A;  3DBH B;  3O65 B;  2KX0 A;  3KWV A;  2PPH A;  2R2O A;  2NS5 A;  2LGI A;  2ZCC A;  4WQM A;  1UUP A;  2IBI B;  4GGQ A;  1CJE A;  4HJK A;  3VTW A;  2OJW A;  4KKJ A;  2K6Q A;  2MBE A;  1NEN B;  1WF9 A;  1WGH A;  3DHI C;  4KZ0 A;  1D6E C;  2KVZ A;  4LTU A;  2C5L C;  1A70 A;  2BS3 B;  2KXJ A;  4ZRK A;  5DCN A;  4RF0 A;  1R4M I;  4WJQ A;  1VRA B;  4HXD A;  3HM3 A;  1IUE A;  3AEA B;  4AJY B;  3PV1 A;  1WXQ A;  2L8J A;  2KMC A;  2C7M B;  4D2K A;  1L7Y A;  1T0Y A;  4L1B A;  2LXC A;  1UNS A;  4ZRI A;  1PDX A;  2YLM A;  1SE9 A;  1WYW B;  2AL6 A;  1AW7 A;  2GRI A;  1EWY C;  2KMM A;  1V86 A;  1DYQ A;  4KSL C;  2I1J A;  2M56 B;  4W9E A;  4PS7 A;  1JWM D;  2K8B A;  3NVZ A;  4QAY A;  3O13 A;  3DVG X;  4MGI E;  3V3X A;  3VR8 B;  3EFC A;  4M00 A;  2V4L A;  3DVG Y;  2KAJ A;  2KDM A;  4RCO A;  2J53 A;  3P4Q B;  2KTR B;  3Q2A C;  4GIV A;  3PHX B;  1WXA A;  3BWU D;  2YVC A;  2ZW1 A;  1XLP A;  4HK2 A;  3N1Z C;  2DZI A;  3HHM A;  1TT5 B;  4FLH A;  1CK1 A;  1YIW A;  2Z0E B;  2BB5 A;  3ZNH B;  3K9P B;  4ZOH C;  4NNJ B;  3Q3M C;  1E8W A;  3PRE A;  1TTN A;  4G3X B;  4BOS C;  4BOZ B;  3M63 B;  4XZ4 A;  2ZNV C;  3L13 A;  2J42 A;  1NBF C;  4HDQ A;  4BBN C;  4GMV A;  3UIO B;  4YWG G;  2DYB A;  2CR5 A;  2WXO A;  4I6L B;  2N0S B;  1ZUD 2;  1QOF A;  2WDT B;  4S0R A;  2RR9 A;  3L08 A;  2AWT A;  2BPS A;  3N30 A;  1AWD A;  4HRO A;  3DBL I;  2ZW0 A;  1WZ0 A;  1BT0 A;  3KUC B;  2BWF A;  4LNK A;  1FO4 A;  4II2 B;  3ZNZ B;  1OEY J;  3MC9 A;  3P4P B;  1E8Y A;  4FBJ B;  4M0W B;  3ZQ4 A;  3BII D;  1TYG B;  1J8C A;  4JLC A;  2W54 A;  4WJP A;  4HEA 1;  4NJ7 A;  4NAW B;  1EU3 A;  2C7H A;  4TSS A;  4DBG A;  3IT4 B;  2INP E;  1P1A A;  1XO3 A;  4OVZ A;  1L4D B;  3H7P B;  3Q8F A;  2K8H A;  3MHS D;  2M4N A;  3CWI A;  2V4I B;  1JQ4 A;  4W9D A;  3PS6 A;  2FNJ B;  2M1M A;  2MRP A;  2L83 A;  3ZYY X;  1KLV A;  1F52 A;  3ZRF A;  2FAZ A;  2WXL A;  3NUH B;  4XX5 A;  2BF8 B;  2WU5 B;  4OHJ A;  1WX8 A;  3BVG A;  3L54 A;  4GU2 A;  3GE8 C;  1GPX A;  3BY4 B;  3ZDM C;  3RD2 A;  3Q8B A;  2O2V B;  4KDL B;  2JRH A;  2MJD A;  3AM9 A;  1MG8 A;  5AZG A;  2K22 A;  4AOF A;  4B0M A;  1SGH A;  1QQR A;  2PW9 A;  4C80 A;  4IWP A;  2WXR A;  2IYD B;  3T3O A;  4KIK A;  1N5W A;  1R7S A;  4AS1 A;  5J18 A;  2KLC A;  2JWU A;  2MA9 B;  2KC1 A;  4TQ1 A;  1Z5S B;  4FHK A;  3DHG C;  4PK1 A;  2LGX A;  1JW9 D;  1PGA A;  2WDV B;  1GUA B;  2DZK A;  2CJN A;  3N20 C;  1WR6 E;  2BTE A;  1LGR A;  3AE5 B;  4RM9 A;  4ITK A;  1XEE A;  1YQ3 B;  2BYT A;  5HFY A;  4RGT A;  2KN5 A;  3PTF C;  3TMP B;  1I4P A;  1VR9 A;  2KWU B;  3MFG A;  4DDI D;  1F1H A;  4M0W A;  3UGB B;  5L83 A;  5C1Z A;  3WAP A;  2KMA A;  3I3T B;  1E0Z A;  1SEB D;  2SAK A;  1ET6 A;  2IPK D;  3H1U A;  4FN2 A;  5C3J B;  4M8N A;  1L6U A;  3BYT B;  1QOA A;  2RGF A;  2KFJ A;  4FA6 A;  5LXI B;  1RWS A;  1LO5 D;  1GNU A;  2G45 B;  3TCA A;  2BT6 A;  4ZRP A;  2R61 A;  1T0R C;  1SB3 C;  1Q10 A;  3TEX A;  2MJ3 A;  4XGA B;  4M02 A;  2JZ3 B;  3TSS A;  4AQ7 A;  5C2T B;  4BZA A;  2ACZ B;  2KAN A;  5E6N A;  3AE2 B;  1B9R A;  1WSP A;  5I4D A;  2L0T A;  4JQW C;  5D2M B;  1WXM A;  4GDL B;  2K39 A;  3VDZ A;  2ON8 A;  2IY0 B;  2Z8L A;  2V9H A;  2C60 A;  3NRZ A;  3FIL A;  4GDK B;  2JY6 A;  2LD9 A;  1WH3 A;  2XNA C;  2JU6 X;  1KM7 A;  1UGJ A;  1QIL A;  4XDD A;  4KGT A;  3B08 A;  1JCK B;  2LJ5 A;  4I6N B;  2LVQ A;  1UWM A;  4L2Y A;  5EDS A;  4ZRJ A;  3ZJT A;  5GMV A;  3ALB A;  1C4P A;  3PVL A;  2WXG A;  1GC6 A;  1L2N A;  1C77 A;  5AZH A;  4KX6 B;  3H9D A;  4HDO A;  2YEP B;  4A3O A;  3ZLZ A;  2IO1 B;  1E5W A;  5TSS A;  1WJU A;  2J4X A;  4JPS A;  5CTR C;  2KJH B;  1R4N I;  2NBV B;  3Q3F A;  1FEH A;  2CU1 A;  3TIX A;  5IO9 A;  2J7Q B;  1EF1 A;  2QIE B;  4J3O D;  3VFK A;  4B0E A;  1N6Z A;  4W9H A;  3MC8 A;  3DOW A;  3R2T A;  3JSV A;  1TKG A;  4MT5 A;  4BKS D;  2FID A;  2KDF B;  2BW2 A;  3BIN A;  3DCG A;  2BKR B;  2QIL A;  2D2Q A;  2KNB A;  4ANU A;  3WAM A;  3EFU A;  4PYZ A;  2LVP A;  1QOG A;  2IY1 B;  2KQ4 X;  3SR6 A;  4HVB A;  1DOI A;  1GOZ A;  2A4Z A;  2MH7 A;  1IBX A;  2Z59 B;  4EOY A;  1EO6 A;  5CX3 A;  5AUK A;  2MJE A;  2Y5C A;  4II3 B;  5D94 A;  1ET9 A;  4A90 A;  2BGF A;  5J2R A;  3B2F A;  4FXC A;  2BYE A;  1SSN A;  4KV2 A;  3QAQ A;  1XLO A;  3RPF C;  2MBH A;  3FIL B;  1V6E A;  3P63 A;  1YOV B;  3AN1 A;  3Q3O C;  4IW0 A;  3A9J A;  5JZE B;  1YQ4 B;  2JVC A;  2K8C A;  2MEK A;  1PUT A;  4ANX A;  2LVO A;  3QHT A;  2ZVN A;  1P9D U;  3VUY A;  1TZ1 A;  1FMA D;  1XLQ A;  1SIF A;  2JX5 A;  2DAF A;  3KUZ A;  4MJS B;  4I6P A;  3VUX A;  4WWP A;  1WE7 A;  2M8S A;  2J52 A;  3OWE B;  3HK0 A;  4REZ A;  2K1F A;  4HPL B;  4P7I A;  4NQL B;  3PPA A;  4J6I A;  3APD A;  4JGH B;  4HKQ A;  2GBJ A;  3W9C B;  1YN3 A;  2KKC A;  4N6E B;  4HLE A;  1ZPS A;  3IAM 1;  1GB4 A;  3N32 A;  4GSW A;  2HTM E;  2JYT A;  3PGE A;  2PE9 A;  2O6V D;  2WLB A;  1ZDV A;  3EEC A;  1VZ8 A;  2MCN B;  1P3Q U;  2QSD A;  1F9J A;  5D6J B;  1I4Q A;  3SFD B;  3A9K B;  3BK1 A;  3HVD A;  1V5O A;  2N7D A;  3B2G A;  4W9K A;  3RNE C;  5C23 A;  1WM2 A;  1FRD A;  2G9H D;  2NCN A;  1QZE A;  3HUI A;  3Q3J A;  2IJ0 A;  4PYU A;  3ZNI D;  2RDH A;  1E6E B;  4KDI C;  3ML8 A;  3T9L A;  2NTT A;  3V62 A;  4AWJ A;  2JUO A;  3W2D A;  1FIQ A;  2L32 A;  2LHE A;  2N9K A;  2Z0D B;  3QQ8 B;  2MHJ A;  1L5P A;  1YJ1 A;  3AE1 B;  1EU4 A;  1T5X D;  2MQJ A;  1N63 A;  2CHX A;  1I42 A;  3W1S C;  2NBW B;  1I4R A;  1QLB B;  1L6V A;  2V3P A;  4GDL A;  1D5Z C;  3NZ3 A;  2FUG 1;  2IO0 B;  4RGO S;  2D07 B;  1N60 A;  3A4S C;  2B3A A;  3SD5 A;  2KJR A;  5KHQ A;  3V6E B;  2IGG A;  1EWC A;  2NMQ A;  3J9C A;  4RNA A;  4BAX A;  1SF0 A;  2KYW A;  1NYQ A;  4DHJ B;  3PLU A;  3ONS A;  3NVW A;  3PHW B;  1YJJ A;  1SJE D;  1LM8 B;  1ENF A;  1FPY A;  2G3Q B;  4RGN A;  3PRP B;  4FJZ A;  1EM7 A;  2JYE A;  1V9J A;  2WDR B;  2Y5B B;  3AUL A;  2E6X A;  2JSV X;  2OED A;  1WGD A;  3M95 A;  4LK0 M;  4GLS C;  4MEL A;  4XC2 A;  4K7W A;  2MX2 A;  5LXH A;  1WRI A;  3LDZ E;  2B76 B;  1IGC A;  1WGK A;  2K6D B;  5JHB A;  2EKE C;  1L0Y B;  4H2A A;  2W3R A;  4YSZ B;  4IC7 B;  3Q8C A;  3RYT A;  1NEK B;  5FR3 A;  4XDC A;  2LJI A;  2BYF A;  3RMK C;  4F7Z A;  4ZHP A;  2RDB C;  4TQ0 A;  2KWV B;  2QCZ A;  3R66 C;  3U52 E;  4Q2J A;  4DXF A;  1UEL A;  2J0M A;  2QC8 A;  3VUW A;  4K81 A;  4HRS A;  2FCQ A;  1GG3 A;  1HQR D;  4WWO A;  5JHA A;  3AEE B;  4GOC A;  4IDI A;  1KLG D;  1ROE A;  4L23 A;  4JWU C;  4RFB A;  3RI7 C;  3VRB B;  2D5G A;  1PGX A;  2AX5 A;  4TKN A;  2JPH A;  3I63 C;  2FUH B;  2V0G A;  4MJS A;  3MC0 B;  1C3T A;  4XE0 A;  5BO4 B;  4FJV B;  4BKS A;  2NTS A;  3P2B A;  3AEG B;  1Z2M A;  2RD0 A;  1G6J A;  1QF6 A;  2AQ1 B;  1JRU A;  3URY A;  4DHZ B;  1VJK A;  2DAJ A;  4PT5 A;  2CKH B;  1WWT A;  2XEW A;  3QK0 A;  4ACF A;  2VH2 A;  3VVW B;  1RFA A;  3P4R B;  1RLF A;  3RNF C;  2FCS A;  2KC2 A;  3NZS A;  4YXD B;  4A3P A;  5BYS A;  4EFO A;  1E10 A;  2I2Y A;  4G0N B;  3ZVV A;  3DBH I;  5CHW A;  1WGR A;  2ZNV B;  2K5P A;  5TR5 A;  5D3I B;  3DDC B;  1XLN A;  1SXT A;  3IAS 1;  2KDB A;  3I5J C;  2GOW A;  1M4V A;  1UH6 A;  3BK2 A;  1T0S C;  4ASW C;  4K7U A;  5IOI A;  4C4V B;  3KYD D;  1VZ6 A;  3ZDT A;  1V1P A;  4MGY E;  1FFV A;  3PT2 B;  3U4E G;  4KGR A;  4BBN F;  2SEB D;  4HPP A;  5CHV C;  3U7D A;  4BKG A;  2KLG A;  4C7Y A;  2NBU A;  4KIK B;  5BMH A;  1EF5 A;  1DGJ A;  4RM8 A;  1OEY A;  1H4R A;  1BXT A;  1FXT B;  3AEF B;  5D3D A;  1KRH A;  3JW0 X;  2RPQ A;  4OZC A;  3RNA C;  1XT9 B;  1PQS A;  4X57 B;  4F8C B;  4WWM A;  2CU3 A;  2WS3 B;  3P4S B;  2YEP F;  4HJG E;  2W9N A;  2M17 A;  3EA6 A;  2WP9 B;  3AB5 A;  4HWI B;  1FM0 D;  4YL8 A;  4KKI A;  1D3Z A;  1FFU A;  3ZUN A;  3X23 A;  3AE6 B;  3VTV A;  4LJP B;  2LGY A;  2LI5 A;  4MEM A;  2LUM A;  2D3C A;  4N58 A;  4B95 A;  2DWQ A;  2OHF A;  2ONQ A;  3TJP A;  3M62 B;  3N1Y C;  2KD0 A;  2BBC A;  1I4H A;  2WDQ B;  4DQO C;  1E7P B;  2KVR A;  2W82 A;  2ZPY A;  2WWZ A;  4W9L A;  3Q8E A;  4NPN A;  3AI5 A;  1RRB A;  1M94 A;  1AN8 A;  2KO3 A;  2WXJ A;  5EE3 A;  1QT9 A;  1E90 A;  1CMX B;  4DXG A;  2DNF A;  2FCN A;  2KDE B;  1U4A A;  1WX9 A;  5MPO A;  2KDI A;  2BS4 B;  1WMH A;  3GS2 A;  3KWL A;  3NJT A;  1WJN A;  2DYO A;  3A9K A;  3OLM D;  3QCA A;  3W5V B;  1T3Q A;  3S2A A;  4GN1 A;  3HIZ A;  1JWA D;  1L0X B;  2KJ6 A;  4HCN B;  1V1P B;  2LRW A;  2WX0 A;  2M19 A;  2KFK A;  3Q14 C;  3DPD A;  4YTP B;  2VRR B;  2KK8 A;  3GB1 A;  5E6P A;  1WGY A;  4MGZ E;  2MP2 A;  3IHP C;  5AUI A;  2BS2 B;  3WAL A;  4AJW A;  3N9Y C;  1GJZ A;  2WXF A;  3DHH C;  3ZNG C;  4EEW A;  3N3K B;  3R2I A;  2LMC A;  4W9I A;  2K3U A;  4MM3 A;  4IUM B;  4LDT D;  5EE1 A;  3PZ7 A;  1TBE A;  2ZPN A;  1KLU D;  1YNT E;  2WX1 A;  4JX1 C;  1WXV A;  1B1Z A;  2D3G A;  2KT7 A;  2PVG C;  2V1Y A;  4YT0 B;  3B0A A;  2MLB A;  2LFI A;  2GBR A;  3JVZ X;  2KX3 A;  2XBB C;  4LNI A;  1NVI D;  1WIA A;  2UU7 A;  3I9V 1;  1CQV A;  2KTR A;  3Q69 A;  5BMI A;  4CQN A;  1XXG A;  1V2Y A;  3PZD A;  2N4F A;  3UQA A;  4F1S A;  4WH4 A;  2IDY A;  1F2R C;  4B9K A;  5CHF A;  3AED B;  2JXT A;  3D32 A;  1UD7 A;  1GB1 A;  1ZGU B;  2EMT A;  3GP7 A;  1I4G A;  1ZE3 D;  3DBS A;  1HZ5 A;  4A20 A;  4NZL B;  3CMM B;  1MFW A;  3Q8A A;  5IKC M;  1WXS A;  2KQS A;  1XD3 B;  1ZP0 B;  1K50 A;  2J0J A;  4ICU A;  2ICI A;  2O2V A;  3U2S C;  3Q6B A;  5G5H A;  5DPR A;  3VRA B;  4NQK E;  3WAO A;  5KHO A;  2N7E A;  4IM0 A;  1RFK A;  3DBR B;  3RNG C;  1UBI A;  4W9F A;  1WMH B;  4A8X C;  3KQ4 A;  1OFF A;  3IFW B;  5D7G A;  1QOB A;  2N9L A;  1P0R A;  1HXY D;  1N5X A;  3AEB B;  1NDD A;  3PLV A;  2JF5 A;  3QAR A;  1WY8 A;  1WRD B;  1LQB A;  4NAM A;  3KH0 A;  2FCM A;  4IOI E;  5BYQ A;  2JZP A;  2C7N B;  1K8R B;  2GB1 A;  2MBB B;  4C4V A;  3MP9 A;  1J19 A;  1C9F A;  4O1N A;  3VAW A;  3AE8 B;  3RT3 B;  3A1Q B;  4A55 A;  1Q0W B;  1J0G A;  4KSK C;  1KOT A;  2Y5P A;  3BVZ A;  2NR2 A;  1C76 A;  1HA5 A;  1UBQ A;  3BVM A;  4WJO A;  1SIJ A;  5FK9 C;  2KQ7 A;  4MSM B;  5E6O A;  1E8X A;  3VTU A;  3WAN A;  1VZ7 A;  2FBW B;  1TGZ B;  1CZP A;  1V8C A;  1ZKH A;  2A5U A;  4JE3 B;  3T3N A;  2IO3 B;  1FCL A;  1IP9 A;  5EE0 A;  2KN4 A;  3AMZ A;  4WAF A;  5H8Y E;  3VH3 B;  3ML9 A;  4FHJ A;  5IAA C;  1XQQ A;  3HVZ A;  3Q3N C;  2LZ6 A;  5HKH A;  3TEY A;  2AQ2 B;  3R7R A;  3EHV A;  2V3S A;  2RSU A;  1BUI C;  4G50 A;  3CIR B;  2BB6 A;  3B9J A;  1GC7 A;  3B1L X;  5G55 A;  1WYG A;  4ZYN A;  5AZF A;  3C8Y A;  5DPT A;  4MDK E;  4MAC A;  5DPS A;  1PYW D;  1YD8 U;  2GBK A;  1STE A;  1J7C A;  1TS2 A;  4LJO B;  3ZJV A;  3AE4 B;  4MSQ B;  4K1R B;  4OW0 A;  3GE3 C;  3L10 B;  4MM3 B;  2DHZ A;  3HRD D;  3RZF A;  3U8Z A;  2R2Q A;  4PS8 A;  2L00 B;  1ZXH A;  2BKF A;  3ENE A;  1ISN A;  3AE7 B;  3ETR A;  3AEC B;  2I38 A;  4ARC A;  3AU4 A;  1WX7 A;  3OAW A;  1XF5 L;  2HJ1 A;  2Q5W D;  2NPT B;  2N1V A;  3TEZ A;  3TL5 A;  3KLS X;  2MBO A;  3SU8 X;  5HG2 A;  1F0Z A;  1J7A A;  2LHD A;  2TSS A;  2KOX A;  4JL9 A;  4EE2 A;  2N1W A;  2PIA A;  3FC4 A;  3UI3 A;  2WXM A;  1C1Y B;  2PEA A;  1KJT A;  4FAD A;  2J0K A;  4KZC A;  2UWQ A;  1OGW A;  1DOX A;  1VLB A;  4NJ6 A;  3ZXR A;  4DDG D;  2OJR A;  1MHH E;  3FKY A;  2AQ3 B;  4N59 A;  4TMA B;  2MW5 A;  1IYF A;  3RUL A;  4K3C A;  3DVN U;  3QC8 B;  3ZJU A;  4R3D A;  1JML A;  3N1X C;  1IGD A;  2IZV B;  2IND C;  2N9E B;  1MI0 A;  4EZJ A;  3NZU A;  1R4M B;  2FIF A;  4PS3 A;  1XCT L;  2DEN B;  2PKO A;  1FRR A;  5IN7 A;  3ZKJ C;  1JWB D;  1OTR B;  4LCD E;  2RPV A;  1UWX A;  3JSV B;  2OOB B;  3R7Q A;  4G11 A;  3KUD B;  1C79 A;  1HZ6 A;  2VZK B;  4WQO B;  4NY0 A;  1RAX A;  1XCQ L;  3IBE A;  4P6V F;  1TS5 A;  1WI0 A;  2L1A A;  1FXA A;  3CSF A;  2BYV E;  4GB9 A;  3RZW C;  1D5M C;  1SE2 A;  4NJC A;  2PMV A;  3ZO5 B;  1E8Z A;  1ZOY B;  1Q5W B;  3UIP B;  2NVU I;  4HCP B;  3TBL D;  1SE3 A;  1NI2 A;  3NS1 A;  4BVU C;  4HPM B;  3ECI A;  2MP2 B;  4XWW A;  2PLP A;  4CYE A;  2PTL A;  3SFE B;  2QDF A;  4OZA A;  4OZB A;  2HJ8 A;  3NHE B;  4MH8 A;  5AEK B;  5LLI A;  4ARI A;  2M0A A;  1IPG A;  1P7F A;  3P1M A;  2KWC A;  1V81 A;  3UIN B;  3TEW A;  2V3N A;  2MSE D;  2N9X A;  1LFD A;  1OQQ A;  2WGS A;  3BYY B;  3KVF B;  3LJ3 A;  3DQV A;  1NYR A;  1JRP A;  3AE3 B;  1L4Z B;  4ICV A;  3APC A;  3VR9 B;  3K9O B;  3NS8 A;  2IGD A;  1WGG A;  3GOE A;  1Q1O A;  1K53 A;  1TY2 A;  4A6Q A;  1KFY B;  1AYF A;  2KTF A;  3W1Y A;  3QJZ A;  5IA7 A;  2D3A A;  3ZRC A;  1I35 A;  2INC C;  4US8 A;  3DWG C;  3CST A;  4LDT B;  3AH7 A;  3RN9 C;  4YTM B;  3ZXV A;  1YQB A;  3PRM B;  2Y3A A;  4WAA A;  1HE8 A;  1ZXI A;  4BFR A;  2GBN A;  2AEH A;  2L05 A;  1Y56 A;  3WA0 A;  2GI9 A;  4DWF A;  1T0Q C;  2WXN A;  4GXB A;  3FAH A;  2O6V A;  2NPT A;  3ZGZ A;  3R3M A;  4M8M A;  2PJH A;  4EZK A;  1UGM A;  2AYO B;  2JQR B;  1JAL A;  1IBX B;  2ZVO A;  4K3B A;  2DBY A;  3EGR A;  3MTN B;  2REX A;  3P42 A;  3A9J B;  4ZHO A;  3ZTD A;  3IXS A;  1AAR A;  3DBR I;  3M3J A;  1S3S G;  1V80 A;  2D11 A;  3CF6 E;  4IM2 A;  2DZJ A;  4FUL A;  2KWD A;  1E7U A;  1YMH E;  3QWZ B;  5G5G A;  3V6C B;  3RCZ A;  1YX5 B;  2GLS A;  3KYC D;  1I4X A;  2CHZ A;  4WJN A;  3NY5 A;  1A5R A;  2QJL A;  2ZZP B;  4EKU A;  2C9W B;  4IM3 A;  1ESF A;  3A1Q A;  4W9G A;  1HEZ E;  2EMS A;  1DOY A; 
#chains in the Genus database with same CATH homology
 1WYW B;  2AL6 A;  1WIA A;  3OJ4 B;  1V86 A;  2L76 A;  3N32 A;  2KTR A;  2L3Z A;  4WWN A;  4GSW A;  4KSL C;  2I1J A;  4W9E A;  4PS7 A;  3PRZ A;  3PGE A;  1V2Y A;  2K8B A;  2PE9 A;  3PZD A;  2N4F A;  3V60 A;  4F1S A;  1VCB A;  3A4R A;  2O6V D;  3UQA A;  3EEC A;  4B9K A;  3APF A;  5CHF A;  2MCN B;  1P3Q U;  3DVG X;  1F9J A;  4MGI E;  3D32 A;  1UD7 A;  5D6J B;  1ZGU B;  1P98 A;  1WR1 A;  2EMT A;  2HE7 A;  2V4L A;  3DBS A;  3DVG Y;  3A9K B;  2GBM A;  4A20 A;  3CMM B;  1V5O A;  2KTR B;  4GIV A;  1WXS A;  3PHX B;  1WXA A;  2KQS A;  2N7D A;  1XD3 B;  2KZR A;  4W9K A;  2YVC A;  2J0J A;  4HK2 A;  4ICU A;  1WM2 A;  5C23 A;  4AUQ C;  2O2V A;  3H6N A;  2DZI A;  2XK5 B;  2AL3 A;  1WJ6 A;  2NCN A;  1QZE A;  3HHM A;  3GZN I;  4FLH A;  5DPR A;  3Q3J A;  4PYU A;  4NQK E;  3WAO A;  3ZNI D;  1YIW A;  5KHO A;  2N7E A;  2Z0E B;  4IM0 A;  4KDI C;  3ML8 A;  3T9L A;  2UYZ B;  3V62 A;  3ZNH B;  3K9P B;  4AWJ A;  4RMA A;  4NNJ B;  1UBI A;  2JUO A;  1E8W A;  3PRE A;  4W9F A;  1TTN A;  4G3X B;  4BOS C;  1WMH B;  4BOZ B;  2Z0D B;  3M63 B;  4XZ4 A;  2ZNV C;  3QQ8 B;  3IFW B;  3L13 A;  5D7G A;  1P0R A;  4CO7 A;  1NDD A;  2O6V B;  1NBF C;  3PLV A;  4HDQ A;  1YJ1 A;  1EUV B;  4GMV A;  4BBN C;  2JF5 A;  3QAR A;  2MQJ A;  3UIO B;  2CHX A;  2DYB A;  2CR5 A;  1WY8 A;  1WRD B;  1LQB A;  4I6L B;  4URK A;  1I42 A;  4KVG B;  3W1S C;  2NBW B;  2IO2 B;  3KH0 A;  2FCM A;  3L0W B;  5FR6 A;  2C7N B;  1K8R B;  2MBB B;  3L17 A;  4GDL A;  4JIO U;  2WDT B;  1J19 A;  1V49 A;  2LUE A;  2IO0 B;  2RR9 A;  3L08 A;  3VAW A;  2D07 B;  2AWT A;  3A4S C;  2BPS A;  3ZIM A;  2B3A A;  2JT4 B;  3N30 A;  3SD5 A;  3WIM A;  3RT3 B;  2KJR A;  5KHQ A;  3A1Q B;  3V6E B;  3DBL I;  1Q0W B;  1WZ0 A;  1J0G A;  4KSK C;  1BT0 A;  4DK5 A;  3KUC B;  2BWF A;  1KOT A;  2XBB C;  4II2 B;  3ZNZ B;  1OEY J;  4E3C A;  2NR2 A;  4DHJ B;  3PLU A;  2GMI C;  1UBQ A;  3ONS A;  4WJO A;  1E8Y A;  4FBJ B;  4M0W B;  2DYM A;  1J8C A;  2KQ7 A;  1X1M A;  3PHW B;  4MSM B;  3W1S A;  5E6O A;  3U30 A;  1LM8 B;  1E8X A;  3VTU A;  5J17 A;  3WAN A;  4JLC A;  1TGZ B;  2A5U A;  1ZKH A;  2G3Q B;  2IO3 B;  5G2N A;  4WJP A;  1IP9 A;  4OVV A;  4NJ7 A;  3PRP B;  4FJZ A;  4NAW B;  5JH5 C;  1V9J A;  2C7H A;  4DBG A;  1P1A A;  2JZZ A;  3ML9 A;  4FHJ A;  3VH3 B;  5IAA C;  1ZW7 A;  1XQQ A;  2Y5B B;  3AUL A;  3H7P B;  2K8H A;  1WFY A;  3MHS D;  2M4N A;  2LZ6 A;  2BWE S;  4W9D A;  1WGD A;  3PS6 A;  3M95 A;  2FNJ B;  2M1M A;  2MRP A;  3H7P A;  4MEL A;  5HKH A;  4XC2 A;  3A33 B;  1KLV A;  3AU5 A;  3ZRF A;  4K7W A;  3R7R A;  2FAZ A;  3EHV A;  3VH4 B;  1Y8R C;  2V3S A;  2RSU A;  4XX5 A;  2MX2 A;  5LXH A;  4G50 A;  2BF8 B;  2JXX A;  1GC7 A;  3B1L X;  5G55 A;  1WX8 A;  4ANV A;  2LAS A;  3LDZ E;  3L54 A;  4N9F 4;  2K6D B;  4ZYN A;  5AZF A;  4GU2 A;  3BY4 B;  3ZDM C;  5JHB A;  2EKE C;  3MJW A;  3RD2 A;  2O2V B;  5DPT A;  4MDK E;  4IC7 B;  3EC8 A;  4KDL B;  3RYT A;  5DPS A;  1YD8 U;  2JRH A;  2GBK A;  4LJO B;  1MG8 A;  5AZG A;  4MSQ B;  3PSE B;  2BYF A;  4K1R B;  4AOF A;  1H8C A;  4DXA B;  1SGH A;  1S1Q B;  1WJ4 A;  1LXD A;  3L10 B;  4IWP A;  4F7Z A;  2DHZ A;  4B6W A;  2IYD B;  4TQ0 A;  2KWV B;  3RZF A;  3U8Z A;  2R2Q A;  3R66 C;  4KIK A;  4PS8 A;  4DHZ E;  2L00 B;  3ENE A;  2BKF A;  3QIJ A;  1UEL A;  1ISN A;  2J0M A;  2KLC A;  3VUW A;  4E71 A;  5J18 A;  4K81 A;  2CHW A;  2FCQ A;  2MA9 B;  1GG3 A;  2KC1 A;  2G4D B;  4WWO A;  5JHA A;  4TQ1 A;  1Z5S B;  4FHK A;  5DPW A;  3AU4 A;  1WX7 A;  3OAW A;  1WM3 A;  2LGX A;  4GOC A;  2N9P C;  1GUA B;  2DX5 B;  2DZK A;  2NPT B;  3UQB A;  4HLE A;  2N1V A;  1WR6 E;  3TL5 A;  2MBO A;  4TKN A;  2JPH A;  3SU8 X;  2FUH B;  4RM9 A;  4MJS A;  3KW5 B;  1C3T A;  5BO4 B;  2KN5 A;  2KOX A;  4FJV B;  4BKS A;  4JL9 A;  2PE6 B;  3H7S A;  2DZM A;  2N1W A;  2KWU B;  3PTF C;  3P2B A;  3TMP B;  4DDI D;  1Z2M A;  2RD0 A;  1G6J A;  3UGB B;  5L83 A;  3QX1 A;  1C1Y B;  2PEA A;  3IG3 A;  3L16 A;  1KJT A;  5C1Z A;  4FAD A;  1JRU A;  2J0K A;  3WAP A;  2KMA A;  3I3T B;  4KZC A;  2UWQ A;  4W9C A;  4DHZ B;  2M0X A;  2DAJ A;  1OGW A;  2CKH B;  3H1U A;  4FN2 A;  4NJ6 A;  4DDG D;  2OJR A;  4M8N A;  4EUT A;  2XEW A;  2MW5 A;  3QK0 A;  3QA8 A;  1IYF A;  3RUL A;  3T8M A;  2RGF A;  2KFJ A;  4ZRI A;  3VVW B;  3DVN U;  1RFA A;  2G4S A;  1RLF A;  3QC8 B;  4MGK E;  4FA6 A;  5LXI B;  3ZTC A;  3VHT C;  2FCS A;  2KC2 A;  2YLM A;  1GNU A;  3NZS A;  1VD2 A;  2ZJD A;  2G45 B;  2IZV B;  2N9E B;  3TCA A;  4A3P A;  3VQI A;  4EZJ A;  3NZU A;  4EFO A;  2FIF A;  4PS3 A;  4IWO A;  2DEN B;  4G0N B;  3ZVV A;  4DHJ D;  3DBH I;  5CHW A;  2LXA A;  2K25 A;  1WGR A;  4OVU A;  3ZKJ C;  2ZNV B;  1OTR B;  4LCD E;  5TR5 A;  3JSV B;  3DDC B;  3DVN V;  3C0R B;  1E7V A;  2JZ3 B;  4BKT A;  2OOB B;  3R7Q A;  4G11 A;  2KDB A;  4ZDV A;  2KAN A;  3JYU A;  3KUD B;  5E6N A;  2GOW A;  4WQO B;  4NY0 A;  1UH6 A;  1RAX A;  2JWZ A;  3NOB A;  2L0T A;  4ASW C;  4JQW C;  4K7U A;  2HD5 B;  3IBE A;  2L0F A;  2XK5 A;  1V5T A;  4TUU A;  5D2M B;  1UZX B;  1WI0 A;  1WXM A;  4GDL B;  3KYD D;  2K39 A;  3VDZ A;  2KFK B;  1OQY A;  2IY0 B;  3CSF A;  2C60 A;  2BYV E;  3ZDT A;  2LWP A;  3PT2 B;  2L7R A;  4GB9 A;  4MGY E;  4GDK B;  1YX6 B;  3RZW C;  4BBN F;  2JY6 A;  2LD9 A;  1WH3 A;  5CHV C;  3ZO5 B;  3U7D A;  1E8Z A;  4BKG A;  1Q5W B;  2KLG A;  3UIP B;  2JRI B;  2NBU A;  1KM7 A;  2NVU I;  4HCP B;  4KIK B;  2WYQ A;  3TBL D;  3ZW3 A;  1NI2 A;  1EF5 A;  3AXC A;  4BVU C;  3X0W A;  4HPM B;  4RM8 A;  3ECI A;  2MP2 B;  1OEY A;  5L95 C;  1H4R A;  4CYE A;  3B08 A;  3HM6 X;  1FXT B;  2LJ5 A;  4FJY A;  3RUI B;  4I6N B;  2LVQ A;  3JW0 X;  2RPQ A;  5EDS A;  2HJ8 A;  3NHE B;  1XT9 B;  5AEK B;  1PQS A;  4ZRJ A;  2ZCB A;  4X57 B;  5GMV A;  5LLI A;  4GDK A;  2D10 A;  4F8C B;  3ALB A;  4EZL A;  2HTH A;  4TV3 A;  3PVL A;  2CS4 A;  2I1K A;  3JVZ X;  1GC6 A;  1L2N A;  1IPG A;  5AZH A;  3H9D A;  2KWC A;  1V81 A;  3UIN B;  3V61 A;  4HDO A;  4A3O A;  2MSE D;  2LGD A;  3ZLZ A;  2W9N A;  4ANW A;  2M17 A;  2N9X A;  1LFD A;  2IO1 B;  4HWI B;  1E5W A;  1WJU A;  5CTR C;  3KVF B;  3UF8 A;  4YL8 A;  2KJH B;  3LJ3 A;  1R4N I;  3DQV A;  4MH0 E;  2NBV B;  4CHK A;  3Q3F A;  1D3Z A;  4NAW A;  4ICV A;  3APC A;  2CU1 A;  3TIX A;  2J7Q B;  2ZEQ A;  1EF1 A;  2ASQ A;  3K9O B;  3NS8 A;  3SHQ A;  3ZUN A;  3X23 A;  1WGG A;  3VFK A;  3VTV A;  4LJP B;  4E74 A;  2LGY A;  4W9H A;  2LI5 A;  3GOE A;  1Q1O A;  3DOW A;  4IWQ A;  4MEM A;  2LRU A;  1WE6 A;  3JSV A;  4IG7 B;  3SDL C;  4B95 A;  3OJ3 A;  3TJP A;  3M62 B;  3VXW A;  2KD0 A;  4BKS D;  2FID A;  2KDF B;  3BIN A;  2KVR A;  3DCG A;  2BKR B;  2D2Q A;  2KNB A;  2KTF A;  2MWS B;  2ZPY A;  3W1Y A;  4ANU A;  2WWZ A;  3QJZ A;  4W9L A;  3WAM A;  5IA7 A;  3ZRC A;  3EFU A;  4PYZ A;  1I35 A;  1WZ3 A;  2IY1 B;  2LVP A;  4NPN A;  3IVF A;  3AI5 A;  1RRB A;  1M94 A;  2KHW B;  4HVB A;  3CST A;  4LDT B;  2KO3 A;  2A4Z A;  2QHO A;  1YQB A;  2Z59 B;  3PRM B;  1E90 A;  1CMX B;  4K7S A;  4W9J A;  1EO6 A;  4AP4 C;  4EOY A;  5CX3 A;  2FCN A;  2KDE B;  4WAA A;  1HE8 A;  1U4A A;  1WX9 A;  4BFR A;  4II3 B;  5D94 A;  2MBQ A;  2KDI A;  1WMH A;  2GBN A;  2AEH A;  2L05 A;  2BGF A;  3WA0 A;  1WJN A;  4DWF A;  5J2R A;  2DYO A;  3O65 B;  2BYE A;  3A9K A;  2KX0 A;  4GXB A;  3OLM D;  2PPH A;  2R2O A;  3QCA A;  4KV2 A;  2NS5 A;  2O6V A;  2ZCC A;  3QAQ A;  3S2A A;  2NPT A;  4GN1 A;  3HIZ A;  2KJ6 A;  2MBH A;  4HCN B;  2IBI B;  2LRW A;  2WX0 A;  4GGQ A;  3R3M A;  4M8M A;  2KFK A;  1V6E A;  2PJH A;  4EZK A;  3DPD A;  1UGM A;  2AYO B;  4HJK A;  4IW0 A;  3A9J A;  5JZE B;  2JVC A;  2K8C A;  3VTW A;  2VRR B;  2ZVO A;  2K6Q A;  2KK8 A;  4ANX A;  5E6P A;  1WGY A;  2MBE A;  2LVO A;  3QHT A;  1WF9 A;  4MGZ E;  2MP2 A;  2ZVN A;  2REX A;  1WGH A;  3A9J B;  3IHP C;  3MTN B;  1P9D U;  4KZ0 A;  3VUY A;  3ZTD A;  1AAR A;  3DBR I;  3WAL A;  3M3J A;  1TZ1 A;  2C5L C;  4AJW A;  1S3S G;  1V80 A;  2D11 A;  1GJZ A;  1SIF A;  2KXJ A;  2DAF A;  4ZRK A;  3CF6 E;  5DCN A;  3ZNG C;  1R4M I;  4IM2 A;  4EEW A;  3KUZ A;  4MJS B;  3N3K B;  4I6P A;  2DZJ A;  4WJQ A;  4W9I A;  4FUL A;  3VUX A;  4WWP A;  4MM3 A;  1E7U A;  4IUM B;  1WE7 A;  2M8S A;  4LDT D;  3QWZ B;  4HXD A;  3HM3 A;  3V6C B;  3RCZ A;  1TBE A;  1YX5 B;  3HK0 A;  2ZPN A;  4AJY B;  2K1F A;  2WX1 A;  3KYC D;  3PV1 A;  4HPL B;  4NQL B;  1WXV A;  2CHZ A;  4P7I A;  2D3G A;  3PPA A;  4J6I A;  4WJN A;  3NY5 A;  3APD A;  1A5R A;  2L8J A;  4JGH B;  2V1Y A;  2ZZP B;  2KMC A;  4EKU A;  2C7M B;  3B0A A;  2GBJ A;  2C9W B;  4IM3 A;  1L7Y A;  2MLB A;  1T0Y A;  2KKC A;  3A1Q A;  2GBR A;  4W9G A;  2LXC A;  2EMS A;  2KX3 A;  1SE9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...