2NBWB

Solution structure of the rpn1 t1 site with the rad23 ubl domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
b'MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 26S proteasome regulatory subunit RPN1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
molecule tags Protein binding
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbwB00
4HWIB 3CSTA 2MWSB 1WE7A 2R2QA 3A9KA 4KV2A 3TCAA 4CO7A 2ZNVC 4MDKE 4BOZB 3DVNV 4FA6A 2PPHA 2KVRA 3VUYA 1TBEA 1WMHB 2GBJA 2KZRA 3OAWA 2BYFA 2MBBB 2NR2A 4LCDE 4MJSB 2XBBC 2N1WA 2W9NA 2I1JA 3DCGA 2KX0A 1WJUA 4ZDVA 4DXAB 4FJZA 1WJ6A 5CHWA 1GC7A 1SGHA 5AZHA 5JZEB 4MH0E 2BGFA 2LWPA 3H7SA 1RFAA 2N9PC 4IM0A 2D3GA 2L7RA 3M95A 4FJYA 3L17A 1TGZB 4HPLB 1UH6A 2NS5A 1E8WA 1WXAA 1XT9B 3RT3B 2NBUA 2NBWB 4KSKC 3QQ8B 3W1SA 1UBIA 2UYZB 2PE6B 4RMAA 4HVBA 2GBKA 5KHOA 1OQYA 2MX2A 3EC8A 3QX1A 3RZWC 4BKGA 2BWFA 2YVCA 4E74A 3ENEA 2KN5A 2JY6A 1Z5SB 2UWQA 3KH0A 4KIKB 4NPNA 2I1KA 3WIMA 5LXIB 2CKHB 4JIOU 2CHZA 4EKUA 1H8CA 3O65B 3WAMA 3SHQA 4W9DA 2M0XA 4BFRA 3RCZA 3DVNU 4WQOB 5G2NA 2KO3A 3HM3A 4W9GA 2LXCA 4GIVA 4GU2A 3A1QA 4WWNA 5C1ZA 5TR5A 4MM3A 4JGHB 3NY5A 2MBEA 3P2BA 1Q0WB 3B0AA 2IO1B 4PS7A 3ML8A 2KWCA 3K9OB 1V81A 2KLCA 2M1MA 3PT2B 3U7DA 5CHVC 4AP4C 3DVGY 2IYDB 2ZJDA 4GMVA 3RZFA 3N3KB 3R7RA 1GC6A 1QZEA 1YX5B 5JHBA 4I6NB 5D94A 5AEKB 2DYBA 2D2QA 2O2VA 3N30A 4A3PA 1E5WA 2GBMA 1P98A 3NS8A 3R7QA 3WALA 3ZUNA 1EF5A 2O6VA 3HK0A 4FBJB 2V1YA 2FNJB 2CS4A 3A4RA 3MTNB 3PLUA 2KK8A 4MGKE 2MQJA 3U30A 4B6WA 4E3CA 2C7NB 1FXTB 4DK5A 2DYOA 5DPRA 1E8XA 2IY0B 3WAPA 1E7UA 1WM3A 2ZPNA 2BKRB 3X23A 2BYVE 4NJ7A 3LJ3A 1WE6A 2LRWA 2IO2B 3QIJA 2K39A 3TIXA 3SU8X 2KOXA 2GBRA 1S1QB 2K6DB 1C3TA 2K6QA 2J0JA 3APCA 3JW0X 4IM2A 3V6CB 2J0MA 2L0FA 3QCAA 3T8MA 1WMHA 2A4ZA 2JVCA 2M17A 3EHVA 3PRPB 1A5RA 4MJSA 2HD5B 4PYZA 4XX5A 2O6VD 2LXAA 4WJOA 4RM8A 4M8NA 4ZYNA 3VFKA 3M63B 4ANXA 1KOTA 4II3B 2KFKB 3GZNI 4HDOA 2K25A 1WX7A 2M8SA 4OVVA 3SDLC 2Y5BB 3ZRCA 1TTNA 2WX0A 3WAOA 3H6NA 3ZTDA 3K9PB 4KDIC 3ZNGC 4BKSA 2RD0A 2MW5A 1NI2A 5BO4B 2IZVB 1WJNA 5DCNA 4AOFA 2C5LC 4EEWA 5J2RA 4NQLB 1IYFA 4MSMB 1H4RA 1MG8A 3ALBA 4KIKA 4B9KA 2C7MB 4ANUA 1ZKHA 4GDKA 4IWQA 1J19A 5DPTA 3WA0A 1P3QU 2DAFA 2IY1B 3OJ3A 4FJVB 2HJ8A 4WJPA 3ML9A 2RPQA 3VH4B 3JSVB 2L00B 3V60A 3UGBB 1OGWA 2C60A 4DBGA 2JUOA 4RM9A 2Z0DB 2ZCBA 4BKSD 2DZJA 2IO3B 3PRMB 3R66C 1WZ0A 4KZ0A 4BKTA 3B08A 3V6EB 3TL5A 1D3ZA 4CHKA 3H7PB 3N32A 3PVLA 2CHWA 3V62A 2LGXA 1Q1OA 1WFYA 1WM2A 4GN1A 3ZDTA 1WGHA 1WI0A 3T9LA 3PGEA 5JH5C 5EDSA 4IC7B 2LGDA 4I6PA 2CHXA 4PS3A 3A9JB 2AEHA 1WR1A 3UQBA 2AWTA 2ZVNA 4XC2A 3Q3JA 1J8CA 2LVQA 2JZZA 1GG3A 2G4DB 2NBVB 3ONSA 3QARA 3A33B 2BWES 4WJNA 4B95A 5AZFA 2AYOB 2L8JA 2BPSA 3AULA 4DHZE 3APFA 4K81A 4GDKB 4FHKA 4DDGD 4W9EA 3UINB 4NAWB 4BBNF 4F8CB 2G3QB 1V6EA 3B1LX 2XEWA 2J0KA 4FLHA 1WXMA 3M3JA 4DHZB 2GMIC 2NPTB 4ZRIA 4URKA 4TV3A 1E90A 3QC8B 3PLVA 2Z59B 4FN2A 4NJ6A 4W9CA 3WANA 3QAQA 4ICUA 1Z2MA 1L7YA 2CR5A 2HTHA 2PJHA 3H9DA 1L2NA 2KFKA 3A4SC 5C23A 1YIWA 3Q3FA 3IVFA 2LJ5A 3L13A 3UIPB 4WWOA 3VDZA 4K7WA 2N9XA 3ZLZA 5KHQA 1U4AA 3RULA 2GBNA 3BY4B 1OEYA 3DDCB 2K8HA 2DZKA 2R2OA 4IUMB 4W9LA 3TBLD 1WF9A 4N9F4 2LVOA 5CHFA 2ASQA 3IG3A 2REXA 3PRZA 2ZEQA 1WX9A 3VTUA 2QHOA 1WH3A 2JRHA 3I3TB 1P1AA 3CSFA 4DWFA 1V5OA 1SIFA 2K1FA 2L3ZA 4CYEA 3ZNID 2FCSA 4EFOA 4E71A 5IA7A 3L16A 1LQBA 4MGYE 1YX6B 2ZCCA 1WX8A 1WRDB 3DBRI 1WGYA 3JSVA 1P0RA 2KNBA 5LLIA 3VTWA 3ZO5B 5FR6A 2FAZA 4WWPA 2IO0B 2MP2B 2D07B 4M8MA 2GOWA 5AZGA 4FHJA 3VUWA 1V5TA 5DPWA 3PTFC 1VCBA 5D2MB 1P9DU 4IM3A 3KUCB 3L0WB 2Z0EB 3VAWA 4NY0A 3ZNZB 4MGZE 2MRPA 1NDDA 1WY8A 3H7PA 3VTVA 2KDFB 4W9KA 1Q5WB 1UGMA 2DYMA 4GOCA 3VHTC 2IBIB 4M0WB 2KC2A 2KWVB 2JT4B 2DZIA 4IG7B 1OEYJ 1UD7A 3A9JA 2A5UA 5IAAC 5E6PA 3KW5B 1NBFC 2V3SA 5CX3A 1V9JA 1XD3B 2KJ6A 4XZ4A 3DVGX 2LRUA 3PHWB 2ZVOA 2LZ6A 2MBOA 3DPDA 4LJPB 3APDA 3X0WA 3HM6X 1IP9A 4WJQA 2DENB 3VXWA 2FUHB 2NCNA 1RRBA 2B3AA 1J0GA 2YLMA 2CU1A 3D32A 2MA9B 4LJOB 4KVGB 2LI5A 4NAWA 3TJPA 1OTRB 4FULA 4TQ1A 2JPHA 4JQWC 4TUUA 3ZDMC 2NPTA 5J17A 2KJRA 3NOBA 4WAAA 4GSWA 2KC1A 2G4SA 2FCQA 4IWPA 1EF1A 3JVZX 3PPAA 3ZRFA 2KANA 2WYQA 3IFWB 3PREA 1E8YA 1V2YA 2EMSA 4HCPB 3U8ZA 4F7ZA 1CMXB 4IWOA 1SE9A 1G6JA 5G55A 1AARA 3LDZE 5GMVA 1R4MI 4GB9A 3NHEB 2AL6A 3KVFB 4HCNB 5L83A 3ZKJC 4GGQA 4EUTA 4A3OA 4ANVA 2XK5A 2EMTA 4HDQA 4AJYB 3EECA 3GOEA 4HLEA 3QK0A 4AJWA 3HHMA 2KDEB 2KQSA 3ZIMA 4NQKE 3M62B 4W9HA 3UIOB 4X57B 3VVWB 3UF8A 1V80A 4ASWC 2LVPA 3AI5A 2LD9A 1LFDA 3IHPC 2RGFA 2PEAA 4IW0A 3OJ4B 2JF5A 2KX3A 4G50A 4LDTD 4GDLB 3SD5A 1WIAA 1RLFA 2MP2A 1ISNA 1UZXB 4ANWA 2KTRB 5JHAA 4BBNC 1V86A 4HPMB 4NNJB 1T0YA 3L10B 3QA8A 3MHSD 4I6LB 2FCMA 3S2AA 1WXSA 3DOWA 2BYEA 5E6NA 3HIZA 3VQIA 5J18A 5L95C 4ZRJA 3AU4A 3AXCA 5D6JB 4OVUA 1I35A 4G3XB 1KM7A 4GXBA 2VRRB 4MSQB 3JYUA 4LDTB 2KHWB 4MGIE 1IPGA 2L05A 3NZSA 1V49A 2JZ3B 1E8ZA 1KJTA 3PSEB 3PHXB 2N4FA 2XK5B 4W9IA 1WJ4A 1S3SG 2FIFA 3ZW3A 1GUAB 2KLGA 2WDTB 2M4NA 2N1VA 2V4LA 3A9KB 3DQVA 4II2B 5E6OA 4EOYA 1HE8A 1YD8U 3ZVVA 1YJ1A 3PZDA 2J7QB 2MBHA 3DBSA 4PS8A 4FADA 4MEMA 2N7EA 3QJZA 3UQAA 1WGRA 4TKNA 4EZKA 1YQBA 4PYUA 2L0TA 4K1RB 1GNUA 1LXDA 3MJWA 1XQQA 2DX5B 2RR9A 2JRIB 2BF8B 2KMAA 4P7IA 2KMCA 1ZGUB 1WXVA 3RYTA 2KDBA 3VH3B 4DDID 3L08A 1EUVB 3ZNHB 3RD2A 2C9WB 2KKCA 4TQ0A 5LXHA 3L54A 3ZTCA 1E7VA 3NZUA 2N7DA 2D11A 2FCNA 3DBLI 3IBEA 3TMPB 4EZJA 4BOSC 2KDIA 2G45B 2KXJA 2ZZPB 4A20A 3OLMD 2KFJA 4KDLB 1BT0A 4J6IA 3V61A 3C0RB 4JLCA 3ECIA 2OJRA 4HJKA 2EKEC 2RSUA 3R3MA 4W9FA 2AL3A 2KJHB 1WYWB 2L76A 1RAXA 3KUDB 4G11A 4KZCA 5CTRC 1F9JA 2K8CA 4YL8A 1ZW7A 3KYDD 5D7GA 1WGDA 2MBQA 1VD2A 1PQSA 4AUQC 2OOBB 2HE7A 4KSLC 1TZ1A 2DAJA 1R4NI 3W1SC 1WGGA 2JWZA 4F1SA 2MCNB 3RUIB 3PV1A 2MLBA 3A1QB 2K8BA 2LUEA 4BVUC 1K8RB 1EO6A 5DPSA 5HKHA 2MSED 4GDLA 2KWUB 4HXDA 4MELA 4DHJD 2C7HA 3VUXA 2KTRA 3DBHI 2KTFA 2FIDA 2BKFA 1Y8RC 2WX1A 3BINA 3KUZA 2ZPYA 3QHTA 3CMMB 2N9EB 2KQ7A 1UELA 2DZMA 3H1UA 1X1MA 2KD0A 2O2VB 1M94A 4JL9A 4AWJA 4HK2A 4W9JA 2JXXA 2O6VB 2WWZA 2ZNVB 3AU5A 4K7SA 1WR6E 3W1YA 1KLVA 2PE9A 3CF6E 3EFUA 4DHJB 4EZLA 1JRUA 1LM8B 1I42A 2LASA 2LGYA 4G0NB 3PS6A 4K7UA 1WZ3A 1GJZA 2NVUI 2DHZA 3KYCD 2D10A 3QWZB 4ZRKA 4ICVA 1UBQA 1C1YB
chains in the Genus database with same CATH superfamily
3CSTA 3TCAA 1YQ4B 3DVNV 3VUYA 2V3NA 2GBJA 1WMHB 2WXGA 4MJSB 3W5VB 5BMIA 3DCGA 1WJUA 4DXAB 1SGHA 1N6ZA 2M19A 1FO4A 3Q8CA 3RPFC 1STEA 2DNFA 4RMAA 1GB1A 1OQYA 3EC8A 3ENEA 1Z5SB 1JMLA 4KIKB 2I1KA 1XLQA 2PTLA 2LGSA 4IDIA 3O65B 3WAMA 4JWUC 4W9DA 3DVNU 4RNAA 5G2NA 2LXCA 4WWNA 4MM3A 1E10A 1E7PB 2KWDA 4PS7A 3U7DA 5CHVC 3DVGY 4GMVA 4ARIA 3R7RA 1GC6A 3AE9B 4I6NB 1RM6C 5D94A 2L32A 4A3PA 2GBMA 1P98A 2NTSA 4XWWA 1MHHE 2N9LA 2FNJB 3MTNB 3RFZB 2KK8A 4E3CA 2CJNA 1DOIA 1E7UA 4BAXA 1T0QC 1WE6A 2LRWA 2IO2B 3TIXA 1V1PA 2KDMA 2FUG1 2J0JA 2J0MA 1KLGD 2L0FA 1N60A 4L2YA 2YEPF 4XX5A 2O6VD 4ZYNA 4M8NA 3VFKA 5IN7A 3M63B 4OVVA 3NVVA 2IZVB 1WJNA 5DCNA 2NTTA 4EEWA 5D3IB 1QOGA 4P1CC 4MSMB 4B9KA 1MG8A 3J9CA 3LB8C 4XE0A 1N5WA 1ZKHA 2LUMA 3NVYA 2IY1B 3C19A 4WJPA 5IP4D 3ML9A 3VH4B 4XDDA 1L5PA 2L00B 4WWMA 2VZKB 3UGBB 2INCC 4RM9A 2ZCBA 2IO3B 1VJKA 3AEBB 3V6EB 2B76B 2GRIA 1Q1OA 4ZRPA 3OG5A 5JH5C 1AN8A 4I6PA 1TKGA 1C9FA 2WXIA 4XC2A 4D2KA 3Q3JA 2LVQA 1GG3A 4B95A 4RGMA 1JRPA 3T3NA 4US9A 4H2AA 2AQ1B 4DHZE 3APFA 4GDKB 4FHKA 3P1MA 3UINB 4DDGD 3DWMA 1L0YB 3B1LX 2JYEA 3NUHB 4URKA 4OW0A 4TV3A 2WDVB 2ZW1A 1M4VA 1PFDA 4W9CA 4ICUA 3IVFA 5HFYA 3UIPB 1EM7A 3SFEB 1U4AA 2BS3B 3RULA 3BY4B 1OEYA 2K8HA 2WXKA 4KX6B 4W9LA 2ZEQA 4LK0M 2K1FA 4EFOA 2BB5A 4E71A 4OZAA 2BW2A 1TS5A 3TSSA 1WRDB 1WGYA 1P0RA 1C77A 4PK1A 1TY2A 2WXRA 5E6JA 1V5TA 2WU2B 4TMAB 1TS2A 4TSSA 1SSNA 3KUCB 3L0WB 2Z0EB 3VAWA 3MP9A 2KDFB 2INDC 4M0WB 5IAAC 1V9JA 3RI7C 3PHWB 1JQ4A 1Q10A 2LZ6A 1FRDA 1IP9A 4WJQA 2DENB 2KYWA 1OTRB 4A55A 4WAFA 1TY0A 2WP9B 3N1XC 4DQOC 1C4PA 4JX1C 3JVZX 3ZRFA 3AB5A 3B2FA 2BS4B 2BB6A 1FCLA 4ZYSA 1N61A 1WSPA 4YTPB 1AARA 5JXVA 3LDZE 4GB9A 1WRIA 4OZBA 3KVFB 5D3DA 1ZXHA 4ANVA 3BK2A 2V3PA 4C4VA 3QK0A 4AJWA 1BXTA 2D3CA 2KDEB 4MT5A 1QILA 2KT7A 3IAS1 3IHPC 1SB3C 4IW0A 3RNBC 1GOZA 1L6UA 1MHXA 2JF5A 4LDTD 2MP2A 3Q3MC 3DWGC 4ANWA 4OHJA 1T0YA 1HZ6A 3MHSD 4I6LB 1TIFA 1FM0D 3S2AA 3DOWA 4M00A 2WXJA 2BYEA 2RPVA 2WXMA 2VRRB 3JYUA 1IBXB 4RGOS 3RN9C 2JZ3B 2WLBA 4JWSC 1I4HA 5FKAC 1C4AA 1NENB 2N4FA 4W9IA 3O13A 2X38A 3DQVA 4II2B 4IOIE 4PS8A 2MBHA 1P7EA 4FADA 2N7EA 1WGRA 1YQBA 4K1RB 3ZJUA 4LNKA 5BYQA 2DX5B 2RR9A 4LNFA 2KMCA 3RYTA 4C56C 3FC4A 2KDBA 2PLPA 4K3BA 1UWXA 3EUB2 4ZHOA 3TMPB 4EZJA 1NYQA 1WXQA 2KDIA 2KXJA 2ZZPB 2WXPA 3AE6B 3V61A 3ECIA 3OWEB 3P4PB 4ZRQA 1RAXA 4GLSC 1F9JA 4YL8A 3KYDD 1WGDA 4KSLC 1TZ1A 3HVDA 2D5GA 2K22A 3L4PA 5AUKA 2MLBA 3A1QB 2K8BA 3Q8EA 4C7ZA 3FILA 2MSED 4MELA 3AE3B 2BKFA 2WX1A 3KUZA 4AQ7A 2KQ7A 2K3UA 2WHIA 4JL9A 4HK2A 4W9JA 2J53A 1T6BX 4WIPA 3AU5A 4K7SA 2PE9A 3EFUA 1JRUA 1LM8B 1TKEA 1I42A 2LGYA 1UNSA 3I5JC 2KACA 2D10A 4ZRKA 1UBQA 1SF0A 2R2QA 4KGSA 1FFVA 3EFCA 2PPHA 2KVRA 5GXGB 2KZRA 2BYFA 2XBBC 2N1WA 2WGSA 2M0AA 5CHWA 5AZHA 1WGKA 2BGFA 4A8XC 1F0ZA 2D3GA 2TSSA 3M95A 4FJYA 2QEJC 4EE2A 4HPLB 1UH6A 3RT3B 4KSKC 3QQ8B 1UBIA 3N20C 3R2TA 3QX1A 2YVCA 3Q69A 2KN5A 3KH0A 1JROA 2RDHA 2WXQA 4EKUA 1XCTL 4BFRA 3RCZA 4W9GA 1ENFA 4JGHB 3P2BA 1SJHD 4YXDB 3ML8A 2KLCA 1PUTA 3PT2B 2H88B 3RZFA 1TT5B 1QZEA 1YX5B 5AEKB 2WXLA 2DYBA 2O2VA 1E5WA 3NS8A 3ZUNA 1EF5A 2BBCA 3PLUA 4N58A 2QILA 3W2DA 3PZ8A 3U30A 4QAYA 2DYOA 3X23A 2BKRB 3MC8A 3U52E 3AE4B 3LYYA 1C3TA 1LO5D 4IM2A 1AW7A 2ON8A 3T8MA 2JVCA 2A4ZA 2MJ3A 3EHVA 1A5RA 3E9SA 4ANXA 2K25A 3SDLC 4USAA 1SJED 2Y5BB 1MG4A 1TTNA 3Q6BA 4BKSA 1NI2A 5BO4B 1IGCA 2C5LC 2PVOD 4GDKA 3GE3C 4IWQA 1T3QA 3RNEC 3R2IA 3WA0A 1V97A 4MH8A 3JSVB 3U4EG 2C60A 3AEAB 2G1EA 3PRMB 1HA5A 3R66C 1RYJA 4HROA 1F1HA 3TL5A 1D3ZA 4CHKA 3BYYB 1WM2A 1WGHA 1WI0A 3PGEA 1L0XB 5EDSA 2WS3B 3KWLA 3TEXA 3AE2B 3UQBA 2G4DB 2NBVB 3ONSA 3A33B 2BWES 2AYOB 1D5ZC 3MHZA 3AEFB 1QF6A 4W9EA 3NVWA 4NAWB 1V6EA 1NI3A 2XEWA 4UDUC 1K51A 4FLHA 4Q2JA 4DHZB 4ZRIA 1ESFA 2GI9A 1E90A 3PLVA 2Z59B 1UF0A 3WANA 2HTHA 2PJHA 3P63A 2KFKA 2LJ5A 3L13A 5C3JB 1EWCA 3DHGC 1I4QA 3DDCB 1K53A 1F2RC 1WF9A 4P1BC 5CHFA 1ZOYB 3PRZA 1WX9A 2QHOA 3P4RB 2J4XA 4P16A 2JRHA 3I3TB 1P1AA 4DWFA 3ZJVA 3AM9A 2FCSA 5IA7A 1YX6B 2ZCCA 3VTWA 5LLIA 1DGJA 3URYA 3I63C 1VLBA 5FR3A 5FR6A 2FAZA 1VZ8A 4M8MA 2D07B 2GOWA 5AZGA 4FHJA 1NVID 3PTFC 1VCBA 5D2MB 4IM3A 4NY0A 3AEEB 4MGZE 2MRPA 1WY8A 3H7PA 4W9KA 1Q5WB 3R8BA 2IBIB 1GAQB 2JZPA 2KWVB 2DZIA 4IG7B 1OEYJ 3C8YA 4L1BA 4YTMB 3A9JA 5E6PA 2QCZA 3W5UB 4YWGG 4S0RA 1ET9A 3Q8AA 4JPSA 2ZVOA 2E6XA 2Y5PA 1EU4A 3VXWA 2FUHB 1VZ6A 2NCNA 3FKYA 2YLMA 3AE8B 2MA9B 2LI5A 1A70A 1TJEA 3W9CB 2JPHA 4JQWC 2NPTA 2KJRA 4WAAA 4GSWA 2G4SA 2KANA 2WYQA 2EMSA 1XEEA 1MVKA 1CMXB 1HQRD 5C2TB 1SE9A 5HI1A 5G55A 3ZKJC 2EELA 4GGQA 4EUTA 4A3OA 3AN1A 4AJYB 3GOEA 4HLEA 3HHMA 3SFDB 1SIJA 1QOFA 4ASWC 2ONQA 3AI5A 2KX3A 4G50A 2W54A 4GDLB 3SD5A 1WIAA 1RLFA 1ISNA 1FRRA 4XWTA 5JHAA 4BBNC 2XNAC 2FCMA 2PIAA 2L83A 1KM7A 4HKQA 1BUIC 4LDTB 2KHWB 1IPGA 3TEZA 1HZ5A 1QT9A 3PHXB 2FIFA 3ZW3A 2WDTB 2V4LA 2N1VA 1KRHA 3DBSA 5FK9C 4MEMA 3ZJTA 4RCOA 1FFUA 4M01A 4PYUA 2DBYA 1N63A 2BF8B 1UUPA 1ZGUB 3VH3B 3ZNHB 2QDFA 3NZUA 2N7DA 2RDGA 2SEBD 2EKIA 4RF1A 3EGRA 2G45B 3EA6A 4A20A 3C0RB 2OJRA 4HJKA 2J42A 1WYWB 2L76A 3KUDB 2Z8LA 2JXTA 1R4NB 5D7GA 4YSYB 2OOBB 1P7FA 1R4NI 2JWZA 1ZPSA 1B1ZA 3RUIB 3PV1A 2LUEA 4MM3B 5HKHA 4HXDA 1MJDA 4US8A 3ZYYX 2DLBA 2KTRA 4MACA 1K50A 1SE2A 1GB4A 3QHTA 2N9EB 1JCKB 1UELA 1M94A 3DHIC 2RDBC 1DOYA 2JXXA 2WWZA 2LEKA 3CF6E 4RGNA 4EZLA 3NJTA 2LASA 4G0NB 4K7UA 1WZ3A 1GJZA 1N5XA 2DHZA 2NVUI 1QOBA 1YMHE 3Q3OC 1ZXIA 5MPOA 1C1YB 4HWIB 4CO7A 2MWSB 3A9KA 1V1PB 4MDKE 4BOZB 4FA6A 3HRDD 2SAKA 2WU5B 1JWSD 1EWYC 2NR2A 1VDVA 2W9NA 1RWSA 1C4CA 1CZPA 5JZEB 1KLUD 4MH0E 3ZQ4A 4IM0A 2IDYA 1TGZB 1AYFA 1PGXA 1DYQA 2NBUA 1MI0A 2NBWB 3W1SA 4HVBA 2UYZB 5KHOA 4BKGA 3RZWC 2BWFA 2FE8A 2JY6A 2UWQA 3WIMA 2LMCA 1XXGA 1JWUD 4JIOU 2CHZA 3VR9B 1H8CA 1C76A 4LTUA 4WH4A 3SHQA 3PZ7A 2M0XA 2KO3A 2LFIA 3HM3A 4A6QA 4KKIA 5C1ZA 2MBEA 1K52A 3Q8FA 1Q0WB 2IO1B 2V9HA 1IGDA 3NG0A 3N3KB 1SEBD 3N30A 1JALA 4RF0A 2WXHA 3R7QA 5BYRA 3WALA 4NJCA 2BVCA 2O6VA 2HTME 4FBJB 2V1YA 4CQNA 2CS4A 3A4RA 3BVGA 1TS3A 2MQJA 2ACZB 4BZAA 1FXTB 2WNMA 3RMKC 2IY0B 2Y3AA 3GP7A 4NJ7A 3LJ3A 1F77A 3QIJA 2K39A 1YN5A 1FCCC 1J7CA 2K6DB 2K6QA 3APCA 3JW0X 2W3RA 4JE3B 1D6EC 3QCAA 3AE1B 1WMHA 1F52A 5H92C 4MJSA 2HD5B 3NRZA 1ET6A 1QKZA 1KOTA 3IT6B 3GZNI 3ZRCA 2WX0A 3WAOA 5LNK1 3H6NA 3ZTDA 4B0MA 4KDIC 3ZNGC 2RD0A 2MW5A 4LNNA 2KMMA 5J2RA 4NQLB 1IYFA 1H4RA 3ALBA 4KIKA 2C7MB 2M56B 1CJEA 3IXSA 1QOAA 4N59A 2DAFA 3OJ3A 2HJ8A 2WXOA 1ROEA 3V60A 2W55A 4DBGA 1N62A 3LXFA 2Z0DB 2FBWB 4ARCA 1WZ0A 4KZ0A 4BKTA 3B08A 1OQQA 1XLOA 1YNTE 2IPKD 3PVLA 1XLPA 2CHWA 2LGXA 4GN1A 4ZOHC 3ZDTA 3T9LA 1JWMD 2QSDA 2LGDA 2AEHA 3H8HA 3V3XA 3WCQA 2ZVNA 2OJWA 2JZZA 3PO0A 5AZFA 5IO9A 1TKYA 1FIQA 4K81A 4C7YA 4F8CB 1WXMA 1ZDVA 2K9XA 3KWVA 3QC8B 4FN2A 1FNUA 1F2RI 3QAQA 3A4SC 2WXFA 4WWOA 5EE9A 4K7WA 2N9XA 3BIID 5KHQA 2WQYB 3KLSX 4RGTA 3TBLD 4N9F4 2LVOA 2REXA 3UI3A 2MHJA 4C4VB 2BT6A 4RH6A 3CSFA 2CJOA 2L3ZA 4CYEA 3ZNID 3VR8B 3DBRB 1YN3A 3U7ZA 3TEWA 1WX8A 3DBRI 2KNBA 1YOVB 2IJ0A 2MP2B 4HRSA 2UU7A 3VUWA 3BVZA 2D3AA 1RFKA 1KF6B 2D3BA 1L0VB 1NDDA 2GLSA 1UGMA 2DYMA 2PVGC 4GOCA 3VHTC 3MFGA 2V4IB 2KC2A 2JT4B 5EE0A 1D5MC 1UD7A 3B9JA 2A5UA 3KW5B 3SR6A 3ZXRA 1NBFC 3ETRA 5CX3A 1XD3B 1SBBB 2KJ6A 2INNE 2LRUA 4NZLB 3Q14C 3DPDA 4LJPB 3APDA 4AS1A 1JW9D 3X0WA 2B3AA 2CU1A 3TJPA 1C79A 1V1OA 4FULA 3FAHA 1MFWA 2BYTA 4WQMA 4TQ1A 4TUUA 1TYGB 3ZDMC 3CWIA 3N1ZC 2KC1A 1IUEA 4IWPA 3PPAA 3IFWB 5EE3A 3PREA 3I9V1 1E8YA 1NEKB 3HUIA 1G6JA 5GMVA 3NHEB 2AL6A 1T5XD 3ZGZA 5L83A 2EMTA 2VH2A 3ZIMA 4NQKE 1PDXA 3UIOB 4NAMA 2NMQA 3AE7B 1V80A 2LVPA 1TZOA 2PEAA 1QLBB 3FILB 3OJ4B 3RNFC 1CQVA 1T0RC 1UWMA 2HJ1A 4HPMB 3VRBB 2KAJA 1WXSA 1EU3A 3VQIA 3GB1A 5J18A 5L95C 4ZRJA 2CU3A 4GXBA 4MSQB 2WDRB 4M0WA 2J52A 3NZSA 1V49A 1GPXA 1KJTA 3PSEB 3BK1A 2BQQA 2XK5B 1WJ4A 4KGTA 2M4NA 5E6OA 2MEKA 1HE8A 3ZVVA 1YJ1A 2J7QB 2L1AA 3QJZA 3UQAA 2MJEA 4TKNA 1LXDA 1XQQA 4OVZA 2JRIB 5HG2A 4DDID 3RD2A 2C9WB 2KKCA 4TQ0A 3ZTCA 1E7VA 3IBEA 4BOSC 1C78A 3Q2AC 5AUIA 1BT0A 2H89B 4J6IA 5IOIA 4JLCA 2AQ3B 3R3MA 5CTRC 2AL3A 2KJHB 4KZCA 3U8ZA 4AUQC 2MBQA 1PQSA 1OQRA 2DAJA 3W1SC 1WGGA 4F1SA 2MCNB 1QQRA 1PGAA 1K8RB 1MPEA 3RNCC 5DPSA 4DHJD 2C7HA 4XDCA 1BMLC 2KTFA 5BMHA 5TSSA 3AECB 2DZMA 1X1MA 2O2VB 5EE1A 2N0SB 4C80A 3MJ5A 2BS2B 1KLVA 1WR6E 1IBXA 3AEDB 1SE3A 1E6EB 3BVMA 3PS6A 3BZDB 2QMTA 2GB1A 3KYCD 3QWZB 4ICVA 1ZUD2 4KV2A 1WE7A 2ZNVC 2L52A 1VZ7A 1KTKA 1TBEA 3OAWA 2MBBB 4LCDE 1YJIA 4ZDVA 2I1JA 1FNWA 2KX0A 4FJZA 1WJ6A 1GC7A 3DHHC 2LWPA 1I4PA 3TEYA 3H7SA 1RFAA 2N9PC 2L7RA 3L17A 2NS5A 1E8WA 2G9HD 1WXAA 1XT9B 1KFYB 2PE6B 1J7AA 2GBKA 2MX2A 2ZW0A 4E74A 2VH1A 5LXIB 4NPNA 2MH7A 3AMZA 2CKHB 2MJDA 4KGRA 1FXIA 1VR9A 3MC9A 2JSVX 4WQOB 4GIVA 4GU2A 3A1QA 5TR5A 5H8YE 3P42A 3NY5A 1PYWD 2N9KA 3B0AA 2KWCA 2LHDA 3K9OB 1V81A 1ZP0B 2M1MA 1NYRA 4AP4C 2IYDB 2ZJDA 4HJGE 1L6VA 5JHBA 4PT5A 2D2QA 2X8XX 1FD6A 3HK0A 1HTOA 2R61A 4B6WA 4MGKE 1SXTA 2C7NB 4N6EB 2XN9C 4DK5A 5DPRA 1E8XA 3WAPA 1WM3A 4A90A 1OFFA 2ZPNA 2BYVE 2QIEB 2ICIA 3SU8X 2KOXA 4HPPA 2GBRA 1XF5L 1S1QB 4REZA 3V6CB 2M17A 3PRPB 3IAM1 2I2YA 4PYZA 2LXAA 4WJOA 4RM8A 4YSXB 4II3B 2KFKB 4OZCA 4HDOA 1WX7A 2M8SA 1JWBD 3K9PB 4WURA 3I57A 3IT4B 4AOFA 2VZKD 2Q5WD 4ANUA 5HHDG 1J19A 5DPTA 1ZE3D 2DWQA 1YQ3B 2PMVA 1P3QU 4FJVB 2RPQA 2KVZA 1OGWA 3ZXVA 2JUOA 2W3SA 4BKSD 2DZJA 3NS1A 3Q3NC 1FXAA 2Y5CA 4YSZB 3H7PB 1ZDXA 3N32A 2IGGA 2JYTA 3V62A 1WFYA 2KQ4X 4P6VF 4IC7B 2QC8A 2CHXA 1DOXA 4PS3A 3A9JB 1WR1A 4XGAB 3P4SB 3ABVB 2AWTA 1J8CA 1V8CA 4WJNA 3QARA 2WDQB 3NVZA 2AQ2B 3HVZA 2L8JA 2BPSA 1L4ZB 3AULA 4ZHPA 4LNIA 4BBNF 2G3QB 1E0ZA 2W82A 2LJIA 2J0KA 3M3JA 3RNGC 2GMIC 2NPTB 4LLGM 1FEHA 1CK1A 3Q8BA 1FPYA 1JWAD 4NJ6A 1Z2MA 1L7YA 2CR5A 3H9DA 1L2NA 5C23A 1YIWA 3Q3FA 1T0SC 3VDZA 3GE8C 3BWUD 3ZLZA 2JU6X 2GBNA 3AH7A 4LNOA 2DZKA 2R2OA 4IUMB 5G5GA 2ASQA 3IG3A 3VTUA 1WH3A 3T3OA 4RFBA 1V5OA 1SIFA 1I7HA 1ACCA 3L16A 1XLNA 1LQBA 4B0EA 4MGYE 2YEPB 3JSVA 3ZO5B 4WWPA 2IO0B 1L4DB 5DPWA 3TUOA 3KQ4A 2OHFA 2INPE 1P9DU 2K5PA 3ZNZB 4K3CA 4C00A 3VTVA 3GZNB 1SE4A 2PW9A 3RNAC 4KKJA 2V3SA 5T8IA 1HXYD 4XZ4A 3DVGX 2MBOA 4YT0B 2JWUA 3HM6X 1RRBA 1J0GA 3D32A 3CIRB 3MC0B 4LJOB 4KVGB 4NAWA 2QJLA 2K0PA 1FMAD 1I4XA 2OEDA 1I4GA 2BTEA 1YN4A 5J17A 1YJJA 3NOBA 2FCQA 1PGBA 1EF1A 2I38A 2AX5A 4M02A 5BMGA 1V2YA 4HCPB 4F7ZA 2HDEA 1R4MB 4IWOA 3B2GA 1J7BA 2E3TA 1R4MI 3NZ3A 2RMMA 4HCNB 3GS2A 2XK5A 4HDQA 3EECA 3SEBA 4DXFA 1R7SA 2PKOA 2KQSA 3N9YC 4J3OD 3M62B 4W9HA 2JQRB 4A9AA 2N7JA 4X57B 3VVWB 3UF8A 5IKCM 2LD9A 1LFDA 2RGFA 1WWTA 4FXCA 1UZXB 3E56A 2KTRB 1HTQA 4DXGA 1V86A 4NNJB 3L10B 3QA8A 1HEZE 4L23A 4YTNB 5BYSA 2V0GA 1AWDA 5E6NA 3HIZA 2KN4A 3AU4A 3AXCA 5D6JB 4OVUA 1I35A 4G3XB 1D5XC 4MGIE 4XYCA 2L05A 3BYTB 3V05A 1I4RA 5I4DA 1E8ZA 2LHEA 1S3SG 1GUAB 2KLGA 3A9KB 4EOYA 4R3DA 1YD8U 4IKGA 1XO3A 3PZDA 1UGJA 1B9RA 4EZKA 3P4QB 2L0TA 2JX5A 1GNUA 3AV8A 3MJWA 4HKZE 2LGIA 2KMAA 4P7IA 1WXVA 5G5HA 3L08A 3U2SC 1EUVB 3DBLB 2IGDA 5LXHA 3L54A 1FNVA 2D11A 2FCNA 3DBLI 1D4BA 3OLMD 2KFJA 4ITKA 4KDLB 2EKEC 2RSUA 4W9FA 4G11A 3VUXA 2K8CA 1XCQL 1ZW7A 1VD2A 2HE7A 4BVUC 1Y56A 1EO6A 1KH0A 3AEGB 4ACFA 4GDLA 2KWUB 3DBHB 1TS4A 1LGRA 3DBHI 2FIDA 4HEA1 1Y8RC 3BINA 2ZPYA 3CMMB 3H1UA 1WYGA 2KD0A 2IGHA 3N1YC 4AWJA 3VRAB 2O6VB 2ZNVB 3AE5B 3W1YA 1E9MA 4DHJB 2WXNA 1VRAB 4O1NA 4S17A
chains in the Genus database with same CATH topology
4HWIB 3CSTA 2MWSB 1WE7A 2R2QA 3A9KA 4KV2A 3TCAA 4CO7A 2ZNVC 4MDKE 4BOZB 3DVNV 4FA6A 2PPHA 2KVRA 3VUYA 1TBEA 1WMHB 2GBJA 2KZRA 3OAWA 2BYFA 2MBBB 2NR2A 4LCDE 4MJSB 2XBBC 2N1WA 2W9NA 2I1JA 3DCGA 2KX0A 1WJUA 4ZDVA 4DXAB 4FJZA 1WJ6A 5CHWA 1GC7A 1SGHA 5AZHA 5JZEB 4MH0E 2BGFA 2LWPA 3H7SA 1RFAA 2N9PC 4IM0A 2D3GA 2L7RA 3M95A 4FJYA 3L17A 1TGZB 4HPLB 1UH6A 2NS5A 1E8WA 1WXAA 1XT9B 3RT3B 2NBUA 2NBWB 4KSKC 3QQ8B 3W1SA 1UBIA 2UYZB 2PE6B 4RMAA 4HVBA 2GBKA 5KHOA 1OQYA 2MX2A 3EC8A 3QX1A 3RZWC 4BKGA 2BWFA 2YVCA 4E74A 3ENEA 2KN5A 2JY6A 1Z5SB 2UWQA 3KH0A 4KIKB 4NPNA 2I1KA 3WIMA 5LXIB 2CKHB 4JIOU 2CHZA 4EKUA 1H8CA 3O65B 3WAMA 3SHQA 4W9DA 2M0XA 4BFRA 3RCZA 3DVNU 4WQOB 5G2NA 2KO3A 3HM3A 4W9GA 2LXCA 4GIVA 4GU2A 3A1QA 4WWNA 5C1ZA 5TR5A 4MM3A 4JGHB 3NY5A 2MBEA 3P2BA 1Q0WB 3B0AA 2IO1B 4PS7A 3ML8A 2KWCA 3K9OB 1V81A 2KLCA 2M1MA 3PT2B 3U7DA 5CHVC 4AP4C 3DVGY 2IYDB 2ZJDA 4GMVA 3RZFA 3N3KB 3R7RA 1GC6A 1QZEA 1YX5B 5JHBA 4I6NB 5D94A 5AEKB 2DYBA 2D2QA 2O2VA 3N30A 4A3PA 1E5WA 2GBMA 1P98A 3NS8A 3R7QA 3WALA 3ZUNA 1EF5A 2O6VA 3HK0A 4FBJB 2V1YA 2FNJB 2CS4A 3A4RA 3MTNB 3PLUA 2KK8A 4MGKE 2MQJA 3U30A 4B6WA 4E3CA 2C7NB 1FXTB 4DK5A 2DYOA 5DPRA 1E8XA 2IY0B 3WAPA 1E7UA 1WM3A 2ZPNA 2BKRB 3X23A 2BYVE 4NJ7A 3LJ3A 1WE6A 2LRWA 2IO2B 3QIJA 2K39A 3TIXA 3SU8X 2KOXA 2GBRA 1S1QB 2K6DB 1C3TA 2K6QA 2J0JA 3APCA 3JW0X 4IM2A 3V6CB 2J0MA 2L0FA 3QCAA 3T8MA 1WMHA 2A4ZA 2JVCA 2M17A 3EHVA 3PRPB 1A5RA 4MJSA 2HD5B 4PYZA 4XX5A 2O6VD 2LXAA 4WJOA 4RM8A 4M8NA 4ZYNA 3VFKA 3M63B 4ANXA 1KOTA 4II3B 2KFKB 3GZNI 4HDOA 2K25A 1WX7A 2M8SA 4OVVA 3SDLC 2Y5BB 3ZRCA 1TTNA 2WX0A 3WAOA 3H6NA 3ZTDA 3K9PB 4KDIC 3ZNGC 4BKSA 2RD0A 2MW5A 1NI2A 5BO4B 2IZVB 1WJNA 5DCNA 4AOFA 2C5LC 4EEWA 5J2RA 4NQLB 1IYFA 4MSMB 1H4RA 1MG8A 3ALBA 4KIKA 4B9KA 2C7MB 4ANUA 1ZKHA 4GDKA 4IWQA 1J19A 5DPTA 3WA0A 1P3QU 2DAFA 2IY1B 3OJ3A 4FJVB 2HJ8A 4WJPA 3ML9A 2RPQA 3VH4B 3JSVB 2L00B 3V60A 3UGBB 1OGWA 2C60A 4DBGA 2JUOA 4RM9A 2Z0DB 2ZCBA 4BKSD 2DZJA 2IO3B 3PRMB 3R66C 1WZ0A 4KZ0A 4BKTA 3B08A 3V6EB 3TL5A 1D3ZA 4CHKA 3H7PB 3N32A 3PVLA 2CHWA 3V62A 2LGXA 1Q1OA 1WFYA 1WM2A 4GN1A 3ZDTA 1WGHA 1WI0A 3T9LA 3PGEA 5JH5C 5EDSA 4IC7B 2LGDA 4I6PA 2CHXA 4PS3A 3A9JB 2AEHA 1WR1A 3UQBA 2AWTA 2ZVNA 4XC2A 3Q3JA 1J8CA 2LVQA 2JZZA 1GG3A 2G4DB 2NBVB 3ONSA 3QARA 3A33B 2BWES 4WJNA 4B95A 5AZFA 2AYOB 2L8JA 2BPSA 3AULA 4DHZE 3APFA 4K81A 4GDKB 4FHKA 4DDGD 4W9EA 3UINB 4NAWB 4BBNF 4F8CB 2G3QB 1V6EA 3B1LX 2XEWA 2J0KA 4FLHA 1WXMA 3M3JA 4DHZB 2GMIC 2NPTB 4ZRIA 4URKA 4TV3A 1E90A 3QC8B 3PLVA 2Z59B 4FN2A 4NJ6A 4W9CA 3WANA 3QAQA 4ICUA 1Z2MA 1L7YA 2CR5A 2HTHA 2PJHA 3H9DA 1L2NA 2KFKA 3A4SC 5C23A 1YIWA 3Q3FA 3IVFA 2LJ5A 3L13A 3UIPB 4WWOA 3VDZA 4K7WA 2N9XA 3ZLZA 5KHQA 1U4AA 3RULA 2GBNA 3BY4B 1OEYA 3DDCB 2K8HA 2DZKA 2R2OA 4IUMB 4W9LA 3TBLD 1WF9A 4N9F4 2LVOA 5CHFA 2ASQA 3IG3A 2REXA 3PRZA 2ZEQA 1WX9A 3VTUA 2QHOA 1WH3A 2JRHA 3I3TB 1P1AA 3CSFA 4DWFA 1V5OA 1SIFA 2K1FA 2L3ZA 4CYEA 3ZNID 2FCSA 4EFOA 4E71A 5IA7A 3L16A 1LQBA 4MGYE 1YX6B 2ZCCA 1WX8A 1WRDB 3DBRI 1WGYA 3JSVA 1P0RA 2KNBA 5LLIA 3VTWA 3ZO5B 5FR6A 2FAZA 4WWPA 2IO0B 2MP2B 2D07B 4M8MA 2GOWA 5AZGA 4FHJA 3VUWA 1V5TA 5DPWA 3PTFC 1VCBA 5D2MB 1P9DU 4IM3A 3KUCB 3L0WB 2Z0EB 3VAWA 4NY0A 3ZNZB 4MGZE 2MRPA 1NDDA 1WY8A 3H7PA 3VTVA 2KDFB 4W9KA 1Q5WB 1UGMA 2DYMA 4GOCA 3VHTC 2IBIB 4M0WB 2KC2A 2KWVB 2JT4B 2DZIA 4IG7B 1OEYJ 1UD7A 3A9JA 2A5UA 5IAAC 5E6PA 3KW5B 1NBFC 2V3SA 5CX3A 1V9JA 1XD3B 2KJ6A 4XZ4A 3DVGX 2LRUA 3PHWB 2ZVOA 2LZ6A 2MBOA 3DPDA 4LJPB 3APDA 3X0WA 3HM6X 1IP9A 4WJQA 2DENB 3VXWA 2FUHB 2NCNA 1RRBA 2B3AA 1J0GA 2YLMA 2CU1A 3D32A 2MA9B 4LJOB 4KVGB 2LI5A 4NAWA 3TJPA 1OTRB 4FULA 4TQ1A 2JPHA 4JQWC 4TUUA 3ZDMC 2NPTA 5J17A 2KJRA 3NOBA 4WAAA 4GSWA 2KC1A 2G4SA 2FCQA 4IWPA 1EF1A 3JVZX 3PPAA 3ZRFA 2KANA 2WYQA 3IFWB 3PREA 1E8YA 1V2YA 2EMSA 4HCPB 3U8ZA 4F7ZA 1CMXB 4IWOA 1SE9A 1G6JA 5G55A 1AARA 3LDZE 5GMVA 1R4MI 4GB9A 3NHEB 2AL6A 3KVFB 4HCNB 5L83A 3ZKJC 4GGQA 4EUTA 4A3OA 4ANVA 2XK5A 2EMTA 4HDQA 4AJYB 3EECA 3GOEA 4HLEA 3QK0A 4AJWA 3HHMA 2KDEB 2KQSA 3ZIMA 4NQKE 3M62B 4W9HA 3UIOB 4X57B 3VVWB 3UF8A 1V80A 4ASWC 2LVPA 3AI5A 2LD9A 1LFDA 3IHPC 2RGFA 2PEAA 4IW0A 3OJ4B 2JF5A 2KX3A 4G50A 4LDTD 4GDLB 3SD5A 1WIAA 1RLFA 2MP2A 1ISNA 1UZXB 4ANWA 2KTRB 5JHAA 4BBNC 1V86A 4HPMB 4NNJB 1T0YA 3L10B 3QA8A 3MHSD 4I6LB 2FCMA 3S2AA 1WXSA 3DOWA 2BYEA 5E6NA 3HIZA 3VQIA 5J18A 5L95C 4ZRJA 3AU4A 3AXCA 5D6JB 4OVUA 1I35A 4G3XB 1KM7A 4GXBA 2VRRB 4MSQB 3JYUA 4LDTB 2KHWB 4MGIE 1IPGA 2L05A 3NZSA 1V49A 2JZ3B 1E8ZA 1KJTA 3PSEB 3PHXB 2N4FA 2XK5B 4W9IA 1WJ4A 1S3SG 2FIFA 3ZW3A 1GUAB 2KLGA 2WDTB 2M4NA 2N1VA 2V4LA 3A9KB 3DQVA 4II2B 5E6OA 4EOYA 1HE8A 1YD8U 3ZVVA 1YJ1A 3PZDA 2J7QB 2MBHA 3DBSA 4PS8A 4FADA 4MEMA 2N7EA 3QJZA 3UQAA 1WGRA 4TKNA 4EZKA 1YQBA 4PYUA 2L0TA 4K1RB 1GNUA 1LXDA 3MJWA 1XQQA 2DX5B 2RR9A 2JRIB 2BF8B 2KMAA 4P7IA 2KMCA 1ZGUB 1WXVA 3RYTA 2KDBA 3VH3B 4DDID 3L08A 1EUVB 3ZNHB 3RD2A 2C9WB 2KKCA 4TQ0A 5LXHA 3L54A 3ZTCA 1E7VA 3NZUA 2N7DA 2D11A 2FCNA 3DBLI 3IBEA 3TMPB 4EZJA 4BOSC 2KDIA 2G45B 2KXJA 2ZZPB 4A20A 3OLMD 2KFJA 4KDLB 1BT0A 4J6IA 3V61A 3C0RB 4JLCA 3ECIA 2OJRA 4HJKA 2EKEC 2RSUA 3R3MA 4W9FA 2AL3A 2KJHB 1WYWB 2L76A 1RAXA 3KUDB 4G11A 4KZCA 5CTRC 1F9JA 2K8CA 4YL8A 1ZW7A 3KYDD 5D7GA 1WGDA 2MBQA 1VD2A 1PQSA 4AUQC 2OOBB 2HE7A 4KSLC 1TZ1A 2DAJA 1R4NI 3W1SC 1WGGA 2JWZA 4F1SA 2MCNB 3RUIB 3PV1A 2MLBA 3A1QB 2K8BA 2LUEA 4BVUC 1K8RB 1EO6A 5DPSA 5HKHA 2MSED 4GDLA 2KWUB 4HXDA 4MELA 4DHJD 2C7HA 3VUXA 2KTRA 3DBHI 2KTFA 2FIDA 2BKFA 1Y8RC 2WX1A 3BINA 3KUZA 2ZPYA 3QHTA 3CMMB 2N9EB 2KQ7A 1UELA 2DZMA 3H1UA 1X1MA 2KD0A 2O2VB 1M94A 4JL9A 4AWJA 4HK2A 4W9JA 2JXXA 2O6VB 2WWZA 2ZNVB 3AU5A 4K7SA 1WR6E 3W1YA 1KLVA 2PE9A 3CF6E 3EFUA 4DHJB 4EZLA 1JRUA 1LM8B 1I42A 2LASA 2LGYA 4G0NB 3PS6A 4K7UA 1WZ3A 1GJZA 2NVUI 2DHZA 3KYCD 2D10A 3QWZB 4ZRKA 4ICVA 1UBQA 1C1YB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HWI B;  3CST A;  2MWS B;  1WE7 A;  2R2Q A;  3A9K A;  4KV2 A;  3TCA A;  4CO7 A;  2ZNV C;  4MDK E;  4BOZ B;  3DVN V;  4FA6 A;  2PPH A;  2KVR A;  3VUY A;  1TBE A;  1WMH B;  2GBJ A;  2KZR A;  3OAW A;  2BYF A;  2MBB B;  2NR2 A;  4LCD E;  4MJS B;  2XBB C;  2N1W A;  2W9N A;  2I1J A;  3DCG A;  2KX0 A;  1WJU A;  4ZDV A;  4DXA B;  4FJZ A;  1WJ6 A;  5CHW A;  1GC7 A;  1SGH A;  5AZH A;  5JZE B;  4MH0 E;  2BGF A;  2LWP A;  3H7S A;  1RFA A;  2N9P C;  4IM0 A;  2D3G A;  2L7R A;  3M95 A;  4FJY A;  3L17 A;  1TGZ B;  4HPL B;  1UH6 A;  2NS5 A;  1E8W A;  1WXA A;  1XT9 B;  3RT3 B;  2NBU A;  2NBW B;  4KSK C;  3QQ8 B;  3W1S A;  1UBI A;  2UYZ B;  2PE6 B;  4RMA A;  4HVB A;  2GBK A;  5KHO A;  1OQY A;  2MX2 A;  3EC8 A;  3QX1 A;  3RZW C;  4BKG A;  2BWF A;  2YVC A;  4E74 A;  3ENE A;  2KN5 A;  2JY6 A;  1Z5S B;  2UWQ A;  3KH0 A;  4KIK B;  4NPN A;  2I1K A;  3WIM A;  5LXI B;  2CKH B;  4JIO U;  2CHZ A;  4EKU A;  1H8C A;  3O65 B;  3WAM A;  3SHQ A;  4W9D A;  2M0X A;  4BFR A;  3RCZ A;  3DVN U;  4WQO B;  5G2N A;  2KO3 A;  3HM3 A;  4W9G A;  2LXC A;  4GIV A;  4GU2 A;  3A1Q A;  4WWN A;  5C1Z A;  5TR5 A;  4MM3 A;  4JGH B;  3NY5 A;  2MBE A;  3P2B A;  1Q0W B;  3B0A A;  2IO1 B;  4PS7 A;  3ML8 A;  2KWC A;  3K9O B;  1V81 A;  2KLC A;  2M1M A;  3PT2 B;  3U7D A;  5CHV C;  4AP4 C;  3DVG Y;  2IYD B;  2ZJD A;  4GMV A;  3RZF A;  3N3K B;  3R7R A;  1GC6 A;  1QZE A;  1YX5 B;  5JHB A;  4I6N B;  5D94 A;  5AEK B;  2DYB A;  2D2Q A;  2O2V A;  3N30 A;  4A3P A;  1E5W A;  2GBM A;  1P98 A;  3NS8 A;  3R7Q A;  3WAL A;  3ZUN A;  1EF5 A;  2O6V A;  3HK0 A;  4FBJ B;  2V1Y A;  2FNJ B;  2CS4 A;  3A4R A;  3MTN B;  3PLU A;  2KK8 A;  4MGK E;  2MQJ A;  3U30 A;  4B6W A;  4E3C A;  2C7N B;  1FXT B;  4DK5 A;  2DYO A;  5DPR A;  1E8X A;  2IY0 B;  3WAP A;  1E7U A;  1WM3 A;  2ZPN A;  2BKR B;  3X23 A;  2BYV E;  4NJ7 A;  3LJ3 A;  1WE6 A;  2LRW A;  2IO2 B;  3QIJ A;  2K39 A;  3TIX A;  3SU8 X;  2KOX A;  2GBR A;  1S1Q B;  2K6D B;  1C3T A;  2K6Q A;  2J0J A;  3APC A;  3JW0 X;  4IM2 A;  3V6C B;  2J0M A;  2L0F A;  3QCA A;  3T8M A;  1WMH A;  2A4Z A;  2JVC A;  2M17 A;  3EHV A;  3PRP B;  1A5R A;  4MJS A;  2HD5 B;  4PYZ A;  4XX5 A;  2O6V D;  2LXA A;  4WJO A;  4RM8 A;  4M8N A;  4ZYN A;  3VFK A;  3M63 B;  4ANX A;  1KOT A;  4II3 B;  2KFK B;  3GZN I;  4HDO A;  2K25 A;  1WX7 A;  2M8S A;  4OVV A;  3SDL C;  2Y5B B;  3ZRC A;  1TTN A;  2WX0 A;  3WAO A;  3H6N A;  3ZTD A;  3K9P B;  4KDI C;  3ZNG C;  4BKS A;  2RD0 A;  2MW5 A;  1NI2 A;  5BO4 B;  2IZV B;  1WJN A;  5DCN A;  4AOF A;  2C5L C;  4EEW A;  5J2R A;  4NQL B;  1IYF A;  4MSM B;  1H4R A;  1MG8 A;  3ALB A;  4KIK A;  4B9K A;  2C7M B;  4ANU A;  1ZKH A;  4GDK A;  4IWQ A;  1J19 A;  5DPT A;  3WA0 A;  1P3Q U;  2DAF A;  2IY1 B;  3OJ3 A;  4FJV B;  2HJ8 A;  4WJP A;  3ML9 A;  2RPQ A;  3VH4 B;  3JSV B;  2L00 B;  3V60 A;  3UGB B;  1OGW A;  2C60 A;  4DBG A;  2JUO A;  4RM9 A;  2Z0D B;  2ZCB A;  4BKS D;  2DZJ A;  2IO3 B;  3PRM B;  3R66 C;  1WZ0 A;  4KZ0 A;  4BKT A;  3B08 A;  3V6E B;  3TL5 A;  1D3Z A;  4CHK A;  3H7P B;  3N32 A;  3PVL A;  2CHW A;  3V62 A;  2LGX A;  1Q1O A;  1WFY A;  1WM2 A;  4GN1 A;  3ZDT A;  1WGH A;  1WI0 A;  3T9L A;  3PGE A;  5JH5 C;  5EDS A;  4IC7 B;  2LGD A;  4I6P A;  2CHX A;  4PS3 A;  3A9J B;  2AEH A;  1WR1 A;  3UQB A;  2AWT A;  2ZVN A;  4XC2 A;  3Q3J A;  1J8C A;  2LVQ A;  2JZZ A;  1GG3 A;  2G4D B;  2NBV B;  3ONS A;  3QAR A;  3A33 B;  2BWE S;  4WJN A;  4B95 A;  5AZF A;  2AYO B;  2L8J A;  2BPS A;  3AUL A;  4DHZ E;  3APF A;  4K81 A;  4GDK B;  4FHK A;  4DDG D;  4W9E A;  3UIN B;  4NAW B;  4BBN F;  4F8C B;  2G3Q B;  1V6E A;  3B1L X;  2XEW A;  2J0K A;  4FLH A;  1WXM A;  3M3J A;  4DHZ B;  2GMI C;  2NPT B;  4ZRI A;  4URK A;  4TV3 A;  1E90 A;  3QC8 B;  3PLV A;  2Z59 B;  4FN2 A;  4NJ6 A;  4W9C A;  3WAN A;  3QAQ A;  4ICU A;  1Z2M A;  1L7Y A;  2CR5 A;  2HTH A;  2PJH A;  3H9D A;  1L2N A;  2KFK A;  3A4S C;  5C23 A;  1YIW A;  3Q3F A;  3IVF A;  2LJ5 A;  3L13 A;  3UIP B;  4WWO A;  3VDZ A;  4K7W A;  2N9X A;  3ZLZ A;  5KHQ A;  1U4A A;  3RUL A;  2GBN A;  3BY4 B;  1OEY A;  3DDC B;  2K8H A;  2DZK A;  2R2O A;  4IUM B;  4W9L A;  3TBL D;  1WF9 A;  4N9F 4;  2LVO A;  5CHF A;  2ASQ A;  3IG3 A;  2REX A;  3PRZ A;  2ZEQ A;  1WX9 A;  3VTU A;  2QHO A;  1WH3 A;  2JRH A;  3I3T B;  1P1A A;  3CSF A;  4DWF A;  1V5O A;  1SIF A;  2K1F A;  2L3Z A;  4CYE A;  3ZNI D;  2FCS A;  4EFO A;  4E71 A;  5IA7 A;  3L16 A;  1LQB A;  4MGY E;  1YX6 B;  2ZCC A;  1WX8 A;  1WRD B;  3DBR I;  1WGY A;  3JSV A;  1P0R A;  2KNB A;  5LLI A;  3VTW A;  3ZO5 B;  5FR6 A;  2FAZ A;  4WWP A;  2IO0 B;  2MP2 B;  2D07 B;  4M8M A;  2GOW A;  5AZG A;  4FHJ A;  3VUW A;  1V5T A;  5DPW A;  3PTF C;  1VCB A;  5D2M B;  1P9D U;  4IM3 A;  3KUC B;  3L0W B;  2Z0E B;  3VAW A;  4NY0 A;  3ZNZ B;  4MGZ E;  2MRP A;  1NDD A;  1WY8 A;  3H7P A;  3VTV A;  2KDF B;  4W9K A;  1Q5W B;  1UGM A;  2DYM A;  4GOC A;  3VHT C;  2IBI B;  4M0W B;  2KC2 A;  2KWV B;  2JT4 B;  2DZI A;  4IG7 B;  1OEY J;  1UD7 A;  3A9J A;  2A5U A;  5IAA C;  5E6P A;  3KW5 B;  1NBF C;  2V3S A;  5CX3 A;  1V9J A;  1XD3 B;  2KJ6 A;  4XZ4 A;  3DVG X;  2LRU A;  3PHW B;  2ZVO A;  2LZ6 A;  2MBO A;  3DPD A;  4LJP B;  3APD A;  3X0W A;  3HM6 X;  1IP9 A;  4WJQ A;  2DEN B;  3VXW A;  2FUH B;  2NCN A;  1RRB A;  2B3A A;  1J0G A;  2YLM A;  2CU1 A;  3D32 A;  2MA9 B;  4LJO B;  4KVG B;  2LI5 A;  4NAW A;  3TJP A;  1OTR B;  4FUL A;  4TQ1 A;  2JPH A;  4JQW C;  4TUU A;  3ZDM C;  2NPT A;  5J17 A;  2KJR A;  3NOB A;  4WAA A;  4GSW A;  2KC1 A;  2G4S A;  2FCQ A;  4IWP A;  1EF1 A;  3JVZ X;  3PPA A;  3ZRF A;  2KAN A;  2WYQ A;  3IFW B;  3PRE A;  1E8Y A;  1V2Y A;  2EMS A;  4HCP B;  3U8Z A;  4F7Z A;  1CMX B;  4IWO A;  1SE9 A;  1G6J A;  5G55 A;  1AAR A;  3LDZ E;  5GMV A;  1R4M I;  4GB9 A;  3NHE B;  2AL6 A;  3KVF B;  4HCN B;  5L83 A;  3ZKJ C;  4GGQ A;  4EUT A;  4A3O A;  4ANV A;  2XK5 A;  2EMT A;  4HDQ A;  4AJY B;  3EEC A;  3GOE A;  4HLE A;  3QK0 A;  4AJW A;  3HHM A;  2KDE B;  2KQS A;  3ZIM A;  4NQK E;  3M62 B;  4W9H A;  3UIO B;  4X57 B;  3VVW B;  3UF8 A;  1V80 A;  4ASW C;  2LVP A;  3AI5 A;  2LD9 A;  1LFD A;  3IHP C;  2RGF A;  2PEA A;  4IW0 A;  3OJ4 B;  2JF5 A;  2KX3 A;  4G50 A;  4LDT D;  4GDL B;  3SD5 A;  1WIA A;  1RLF A;  2MP2 A;  1ISN A;  1UZX B;  4ANW A;  2KTR B;  5JHA A;  4BBN C;  1V86 A;  4HPM B;  4NNJ B;  1T0Y A;  3L10 B;  3QA8 A;  3MHS D;  4I6L B;  2FCM A;  3S2A A;  1WXS A;  3DOW A;  2BYE A;  5E6N A;  3HIZ A;  3VQI A;  5J18 A;  5L95 C;  4ZRJ A;  3AU4 A;  3AXC A;  5D6J B;  4OVU A;  1I35 A;  4G3X B;  1KM7 A;  4GXB A;  2VRR B;  4MSQ B;  3JYU A;  4LDT B;  2KHW B;  4MGI E;  1IPG A;  2L05 A;  3NZS A;  1V49 A;  2JZ3 B;  1E8Z A;  1KJT A;  3PSE B;  3PHX B;  2N4F A;  2XK5 B;  4W9I A;  1WJ4 A;  1S3S G;  2FIF A;  3ZW3 A;  1GUA B;  2KLG A;  2WDT B;  2M4N A;  2N1V A;  2V4L A;  3A9K B;  3DQV A;  4II2 B;  5E6O A;  4EOY A;  1HE8 A;  1YD8 U;  3ZVV A;  1YJ1 A;  3PZD A;  2J7Q B;  2MBH A;  3DBS A;  4PS8 A;  4FAD A;  4MEM A;  2N7E A;  3QJZ A;  3UQA A;  1WGR A;  4TKN A;  4EZK A;  1YQB A;  4PYU A;  2L0T A;  4K1R B;  1GNU A;  1LXD A;  3MJW A;  1XQQ A;  2DX5 B;  2RR9 A;  2JRI B;  2BF8 B;  2KMA A;  4P7I A;  2KMC A;  1ZGU B;  1WXV A;  3RYT A;  2KDB A;  3VH3 B;  4DDI D;  3L08 A;  1EUV B;  3ZNH B;  3RD2 A;  2C9W B;  2KKC A;  4TQ0 A;  5LXH A;  3L54 A;  3ZTC A;  1E7V A;  3NZU A;  2N7D A;  2D11 A;  2FCN A;  3DBL I;  3IBE A;  3TMP B;  4EZJ A;  4BOS C;  2KDI A;  2G45 B;  2KXJ A;  2ZZP B;  4A20 A;  3OLM D;  2KFJ A;  4KDL B;  1BT0 A;  4J6I A;  3V61 A;  3C0R B;  4JLC A;  3ECI A;  2OJR A;  4HJK A;  2EKE C;  2RSU A;  3R3M A;  4W9F A;  2AL3 A;  2KJH B;  1WYW B;  2L76 A;  1RAX A;  3KUD B;  4G11 A;  4KZC A;  5CTR C;  1F9J A;  2K8C A;  4YL8 A;  1ZW7 A;  3KYD D;  5D7G A;  1WGD A;  2MBQ A;  1VD2 A;  1PQS A;  4AUQ C;  2OOB B;  2HE7 A;  4KSL C;  1TZ1 A;  2DAJ A;  1R4N I;  3W1S C;  1WGG A;  2JWZ A;  4F1S A;  2MCN B;  3RUI B;  3PV1 A;  2MLB A;  3A1Q B;  2K8B A;  2LUE A;  4BVU C;  1K8R B;  1EO6 A;  5DPS A;  5HKH A;  2MSE D;  4GDL A;  2KWU B;  4HXD A;  4MEL A;  4DHJ D;  2C7H A;  3VUX A;  2KTR A;  3DBH I;  2KTF A;  2FID A;  2BKF A;  1Y8R C;  2WX1 A;  3BIN A;  3KUZ A;  2ZPY A;  3QHT A;  3CMM B;  2N9E B;  2KQ7 A;  1UEL A;  2DZM A;  3H1U A;  1X1M A;  2KD0 A;  2O2V B;  1M94 A;  4JL9 A;  4AWJ A;  4HK2 A;  4W9J A;  2JXX A;  2O6V B;  2WWZ A;  2ZNV B;  3AU5 A;  4K7S A;  1WR6 E;  3W1Y A;  1KLV A;  2PE9 A;  3CF6 E;  3EFU A;  4DHJ B;  4EZL A;  1JRU A;  1LM8 B;  1I42 A;  2LAS A;  2LGY A;  4G0N B;  3PS6 A;  4K7U A;  1WZ3 A;  1GJZ A;  2NVU I;  2DHZ A;  3KYC D;  2D10 A;  3QWZ B;  4ZRK A;  4ICV A;  1UBQ A;  1C1Y B; 
#chains in the Genus database with same CATH topology
 3CST A;  3TCA A;  1YQ4 B;  3DVN V;  3VUY A;  2V3N A;  2GBJ A;  1WMH B;  2WXG A;  4MJS B;  3W5V B;  5BMI A;  3DCG A;  1WJU A;  4DXA B;  1SGH A;  1N6Z A;  2M19 A;  1FO4 A;  3Q8C A;  3RPF C;  1STE A;  2DNF A;  4RMA A;  1GB1 A;  1OQY A;  3EC8 A;  3ENE A;  1Z5S B;  1JML A;  4KIK B;  2I1K A;  1XLQ A;  2PTL A;  2LGS A;  4IDI A;  3O65 B;  3WAM A;  4JWU C;  4W9D A;  3DVN U;  4RNA A;  5G2N A;  2LXC A;  4WWN A;  4MM3 A;  1E10 A;  1E7P B;  2KWD A;  4PS7 A;  3U7D A;  5CHV C;  3DVG Y;  4GMV A;  4ARI A;  3R7R A;  1GC6 A;  3AE9 B;  4I6N B;  1RM6 C;  5D94 A;  2L32 A;  4A3P A;  2GBM A;  1P98 A;  2NTS A;  4XWW A;  1MHH E;  2N9L A;  2FNJ B;  3MTN B;  3RFZ B;  2KK8 A;  4E3C A;  2CJN A;  1DOI A;  1E7U A;  4BAX A;  1T0Q C;  1WE6 A;  2LRW A;  2IO2 B;  3TIX A;  1V1P A;  2KDM A;  2FUG 1;  2J0J A;  2J0M A;  1KLG D;  2L0F A;  1N60 A;  4L2Y A;  2YEP F;  4XX5 A;  2O6V D;  4ZYN A;  4M8N A;  3VFK A;  5IN7 A;  3M63 B;  4OVV A;  3NVV A;  2IZV B;  1WJN A;  5DCN A;  2NTT A;  4EEW A;  5D3I B;  1QOG A;  4P1C C;  4MSM B;  4B9K A;  1MG8 A;  3J9C A;  3LB8 C;  4XE0 A;  1N5W A;  1ZKH A;  2LUM A;  3NVY A;  2IY1 B;  3C19 A;  4WJP A;  5IP4 D;  3ML9 A;  3VH4 B;  4XDD A;  1L5P A;  2L00 B;  4WWM A;  2VZK B;  3UGB B;  2INC C;  4RM9 A;  2ZCB A;  2IO3 B;  1VJK A;  3AEB B;  3V6E B;  2B76 B;  2GRI A;  1Q1O A;  4ZRP A;  3OG5 A;  5JH5 C;  1AN8 A;  4I6P A;  1TKG A;  1C9F A;  2WXI A;  4XC2 A;  4D2K A;  3Q3J A;  2LVQ A;  1GG3 A;  4B95 A;  4RGM A;  1JRP A;  3T3N A;  4US9 A;  4H2A A;  2AQ1 B;  4DHZ E;  3APF A;  4GDK B;  4FHK A;  3P1M A;  3UIN B;  4DDG D;  3DWM A;  1L0Y B;  3B1L X;  2JYE A;  3NUH B;  4URK A;  4OW0 A;  4TV3 A;  2WDV B;  2ZW1 A;  1M4V A;  1PFD A;  4W9C A;  4ICU A;  3IVF A;  5HFY A;  3UIP B;  1EM7 A;  3SFE B;  1U4A A;  2BS3 B;  3RUL A;  3BY4 B;  1OEY A;  2K8H A;  2WXK A;  4KX6 B;  4W9L A;  2ZEQ A;  4LK0 M;  2K1F A;  4EFO A;  2BB5 A;  4E71 A;  4OZA A;  2BW2 A;  1TS5 A;  3TSS A;  1WRD B;  1WGY A;  1P0R A;  1C77 A;  4PK1 A;  1TY2 A;  2WXR A;  5E6J A;  1V5T A;  2WU2 B;  4TMA B;  1TS2 A;  4TSS A;  1SSN A;  3KUC B;  3L0W B;  2Z0E B;  3VAW A;  3MP9 A;  2KDF B;  2IND C;  4M0W B;  5IAA C;  1V9J A;  3RI7 C;  3PHW B;  1JQ4 A;  1Q10 A;  2LZ6 A;  1FRD A;  1IP9 A;  4WJQ A;  2DEN B;  2KYW A;  1OTR B;  4A55 A;  4WAF A;  1TY0 A;  2WP9 B;  3N1X C;  4DQO C;  1C4P A;  4JX1 C;  3JVZ X;  3ZRF A;  3AB5 A;  3B2F A;  2BS4 B;  2BB6 A;  1FCL A;  4ZYS A;  1N61 A;  1WSP A;  4YTP B;  1AAR A;  5JXV A;  3LDZ E;  4GB9 A;  1WRI A;  4OZB A;  3KVF B;  5D3D A;  1ZXH A;  4ANV A;  3BK2 A;  2V3P A;  4C4V A;  3QK0 A;  4AJW A;  1BXT A;  2D3C A;  2KDE B;  4MT5 A;  1QIL A;  2KT7 A;  3IAS 1;  3IHP C;  1SB3 C;  4IW0 A;  3RNB C;  1GOZ A;  1L6U A;  1MHX A;  2JF5 A;  4LDT D;  2MP2 A;  3Q3M C;  3DWG C;  4ANW A;  4OHJ A;  1T0Y A;  1HZ6 A;  3MHS D;  4I6L B;  1TIF A;  1FM0 D;  3S2A A;  3DOW A;  4M00 A;  2WXJ A;  2BYE A;  2RPV A;  2WXM A;  2VRR B;  3JYU A;  1IBX B;  4RGO S;  3RN9 C;  2JZ3 B;  2WLB A;  4JWS C;  1I4H A;  5FKA C;  1C4A A;  1NEN B;  2N4F A;  4W9I A;  3O13 A;  2X38 A;  3DQV A;  4II2 B;  4IOI E;  4PS8 A;  2MBH A;  1P7E A;  4FAD A;  2N7E A;  1WGR A;  1YQB A;  4K1R B;  3ZJU A;  4LNK A;  5BYQ A;  2DX5 B;  2RR9 A;  4LNF A;  2KMC A;  3RYT A;  4C56 C;  3FC4 A;  2KDB A;  2PLP A;  4K3B A;  1UWX A;  3EUB 2;  4ZHO A;  3TMP B;  4EZJ A;  1NYQ A;  1WXQ A;  2KDI A;  2KXJ A;  2ZZP B;  2WXP A;  3AE6 B;  3V61 A;  3ECI A;  3OWE B;  3P4P B;  4ZRQ A;  1RAX A;  4GLS C;  1F9J A;  4YL8 A;  3KYD D;  1WGD A;  4KSL C;  1TZ1 A;  3HVD A;  2D5G A;  2K22 A;  3L4P A;  5AUK A;  2MLB A;  3A1Q B;  2K8B A;  3Q8E A;  4C7Z A;  3FIL A;  2MSE D;  4MEL A;  3AE3 B;  2BKF A;  2WX1 A;  3KUZ A;  4AQ7 A;  2KQ7 A;  2K3U A;  2WHI A;  4JL9 A;  4HK2 A;  4W9J A;  2J53 A;  1T6B X;  4WIP A;  3AU5 A;  4K7S A;  2PE9 A;  3EFU A;  1JRU A;  1LM8 B;  1TKE A;  1I42 A;  2LGY A;  1UNS A;  3I5J C;  2KAC A;  2D10 A;  4ZRK A;  1UBQ A;  1SF0 A;  2R2Q A;  4KGS A;  1FFV A;  3EFC A;  2PPH A;  2KVR A;  5GXG B;  2KZR A;  2BYF A;  2XBB C;  2N1W A;  2WGS A;  2M0A A;  5CHW A;  5AZH A;  1WGK A;  2BGF A;  4A8X C;  1F0Z A;  2D3G A;  2TSS A;  3M95 A;  4FJY A;  2QEJ C;  4EE2 A;  4HPL B;  1UH6 A;  3RT3 B;  4KSK C;  3QQ8 B;  1UBI A;  3N20 C;  3R2T A;  3QX1 A;  2YVC A;  3Q69 A;  2KN5 A;  3KH0 A;  1JRO A;  2RDH A;  2WXQ A;  4EKU A;  1XCT L;  4BFR A;  3RCZ A;  4W9G A;  1ENF A;  4JGH B;  3P2B A;  1SJH D;  4YXD B;  3ML8 A;  2KLC A;  1PUT A;  3PT2 B;  2H88 B;  3RZF A;  1TT5 B;  1QZE A;  1YX5 B;  5AEK B;  2WXL A;  2DYB A;  2O2V A;  1E5W A;  3NS8 A;  3ZUN A;  1EF5 A;  2BBC A;  3PLU A;  4N58 A;  2QIL A;  3W2D A;  3PZ8 A;  3U30 A;  4QAY A;  2DYO A;  3X23 A;  2BKR B;  3MC8 A;  3U52 E;  3AE4 B;  3LYY A;  1C3T A;  1LO5 D;  4IM2 A;  1AW7 A;  2ON8 A;  3T8M A;  2JVC A;  2A4Z A;  2MJ3 A;  3EHV A;  1A5R A;  3E9S A;  4ANX A;  2K25 A;  3SDL C;  4USA A;  1SJE D;  2Y5B B;  1MG4 A;  1TTN A;  3Q6B A;  4BKS A;  1NI2 A;  5BO4 B;  1IGC A;  2C5L C;  2PVO D;  4GDK A;  3GE3 C;  4IWQ A;  1T3Q A;  3RNE C;  3R2I A;  3WA0 A;  1V97 A;  4MH8 A;  3JSV B;  3U4E G;  2C60 A;  3AEA B;  2G1E A;  3PRM B;  1HA5 A;  3R66 C;  1RYJ A;  4HRO A;  1F1H A;  3TL5 A;  1D3Z A;  4CHK A;  3BYY B;  1WM2 A;  1WGH A;  1WI0 A;  3PGE A;  1L0X B;  5EDS A;  2WS3 B;  3KWL A;  3TEX A;  3AE2 B;  3UQB A;  2G4D B;  2NBV B;  3ONS A;  3A33 B;  2BWE S;  2AYO B;  1D5Z C;  3MHZ A;  3AEF B;  1QF6 A;  4W9E A;  3NVW A;  4NAW B;  1V6E A;  1NI3 A;  2XEW A;  4UDU C;  1K51 A;  4FLH A;  4Q2J A;  4DHZ B;  4ZRI A;  1ESF A;  2GI9 A;  1E90 A;  3PLV A;  2Z59 B;  1UF0 A;  3WAN A;  2HTH A;  2PJH A;  3P63 A;  2KFK A;  2LJ5 A;  3L13 A;  5C3J B;  1EWC A;  3DHG C;  1I4Q A;  3DDC B;  1K53 A;  1F2R C;  1WF9 A;  4P1B C;  5CHF A;  1ZOY B;  3PRZ A;  1WX9 A;  2QHO A;  3P4R B;  2J4X A;  4P16 A;  2JRH A;  3I3T B;  1P1A A;  4DWF A;  3ZJV A;  3AM9 A;  2FCS A;  5IA7 A;  1YX6 B;  2ZCC A;  3VTW A;  5LLI A;  1DGJ A;  3URY A;  3I63 C;  1VLB A;  5FR3 A;  5FR6 A;  2FAZ A;  1VZ8 A;  4M8M A;  2D07 B;  2GOW A;  5AZG A;  4FHJ A;  1NVI D;  3PTF C;  1VCB A;  5D2M B;  4IM3 A;  4NY0 A;  3AEE B;  4MGZ E;  2MRP A;  1WY8 A;  3H7P A;  4W9K A;  1Q5W B;  3R8B A;  2IBI B;  1GAQ B;  2JZP A;  2KWV B;  2DZI A;  4IG7 B;  1OEY J;  3C8Y A;  4L1B A;  4YTM B;  3A9J A;  5E6P A;  2QCZ A;  3W5U B;  4YWG G;  4S0R A;  1ET9 A;  3Q8A A;  4JPS A;  2ZVO A;  2E6X A;  2Y5P A;  1EU4 A;  3VXW A;  2FUH B;  1VZ6 A;  2NCN A;  3FKY A;  2YLM A;  3AE8 B;  2MA9 B;  2LI5 A;  1A70 A;  1TJE A;  3W9C B;  2JPH A;  4JQW C;  2NPT A;  2KJR A;  4WAA A;  4GSW A;  2G4S A;  2KAN A;  2WYQ A;  2EMS A;  1XEE A;  1MVK A;  1CMX B;  1HQR D;  5C2T B;  1SE9 A;  5HI1 A;  5G55 A;  3ZKJ C;  2EEL A;  4GGQ A;  4EUT A;  4A3O A;  3AN1 A;  4AJY B;  3GOE A;  4HLE A;  3HHM A;  3SFD B;  1SIJ A;  1QOF A;  4ASW C;  2ONQ A;  3AI5 A;  2KX3 A;  4G50 A;  2W54 A;  4GDL B;  3SD5 A;  1WIA A;  1RLF A;  1ISN A;  1FRR A;  4XWT A;  5JHA A;  4BBN C;  2XNA C;  2FCM A;  2PIA A;  2L83 A;  1KM7 A;  4HKQ A;  1BUI C;  4LDT B;  2KHW B;  1IPG A;  3TEZ A;  1HZ5 A;  1QT9 A;  3PHX B;  2FIF A;  3ZW3 A;  2WDT B;  2V4L A;  2N1V A;  1KRH A;  3DBS A;  5FK9 C;  4MEM A;  3ZJT A;  4RCO A;  1FFU A;  4M01 A;  4PYU A;  2DBY A;  1N63 A;  2BF8 B;  1UUP A;  1ZGU B;  3VH3 B;  3ZNH B;  2QDF A;  3NZU A;  2N7D A;  2RDG A;  2SEB D;  2EKI A;  4RF1 A;  3EGR A;  2G45 B;  3EA6 A;  4A20 A;  3C0R B;  2OJR A;  4HJK A;  2J42 A;  1WYW B;  2L76 A;  3KUD B;  2Z8L A;  2JXT A;  1R4N B;  5D7G A;  4YSY B;  2OOB B;  1P7F A;  1R4N I;  2JWZ A;  1ZPS A;  1B1Z A;  3RUI B;  3PV1 A;  2LUE A;  4MM3 B;  5HKH A;  4HXD A;  1MJD A;  4US8 A;  3ZYY X;  2DLB A;  2KTR A;  4MAC A;  1K50 A;  1SE2 A;  1GB4 A;  3QHT A;  2N9E B;  1JCK B;  1UEL A;  1M94 A;  3DHI C;  2RDB C;  1DOY A;  2JXX A;  2WWZ A;  2LEK A;  3CF6 E;  4RGN A;  4EZL A;  3NJT A;  2LAS A;  4G0N B;  4K7U A;  1WZ3 A;  1GJZ A;  1N5X A;  2DHZ A;  2NVU I;  1QOB A;  1YMH E;  3Q3O C;  1ZXI A;  5MPO A;  1C1Y B;  4HWI B;  4CO7 A;  2MWS B;  3A9K A;  1V1P B;  4MDK E;  4BOZ B;  4FA6 A;  3HRD D;  2SAK A;  2WU5 B;  1JWS D;  1EWY C;  2NR2 A;  1VDV A;  2W9N A;  1RWS A;  1C4C A;  1CZP A;  5JZE B;  1KLU D;  4MH0 E;  3ZQ4 A;  4IM0 A;  2IDY A;  1TGZ B;  1AYF A;  1PGX A;  1DYQ A;  2NBU A;  1MI0 A;  2NBW B;  3W1S A;  4HVB A;  2UYZ B;  5KHO A;  4BKG A;  3RZW C;  2BWF A;  2FE8 A;  2JY6 A;  2UWQ A;  3WIM A;  2LMC A;  1XXG A;  1JWU D;  4JIO U;  2CHZ A;  3VR9 B;  1H8C A;  1C76 A;  4LTU A;  4WH4 A;  3SHQ A;  3PZ7 A;  2M0X A;  2KO3 A;  2LFI A;  3HM3 A;  4A6Q A;  4KKI A;  5C1Z A;  2MBE A;  1K52 A;  3Q8F A;  1Q0W B;  2IO1 B;  2V9H A;  1IGD A;  3NG0 A;  3N3K B;  1SEB D;  3N30 A;  1JAL A;  4RF0 A;  2WXH A;  3R7Q A;  5BYR A;  3WAL A;  4NJC A;  2BVC A;  2O6V A;  2HTM E;  4FBJ B;  2V1Y A;  4CQN A;  2CS4 A;  3A4R A;  3BVG A;  1TS3 A;  2MQJ A;  2ACZ B;  4BZA A;  1FXT B;  2WNM A;  3RMK C;  2IY0 B;  2Y3A A;  3GP7 A;  4NJ7 A;  3LJ3 A;  1F77 A;  3QIJ A;  2K39 A;  1YN5 A;  1FCC C;  1J7C A;  2K6D B;  2K6Q A;  3APC A;  3JW0 X;  2W3R A;  4JE3 B;  1D6E C;  3QCA A;  3AE1 B;  1WMH A;  1F52 A;  5H92 C;  4MJS A;  2HD5 B;  3NRZ A;  1ET6 A;  1QKZ A;  1KOT A;  3IT6 B;  3GZN I;  3ZRC A;  2WX0 A;  3WAO A;  5LNK 1;  3H6N A;  3ZTD A;  4B0M A;  4KDI C;  3ZNG C;  2RD0 A;  2MW5 A;  4LNN A;  2KMM A;  5J2R A;  4NQL B;  1IYF A;  1H4R A;  3ALB A;  4KIK A;  2C7M B;  2M56 B;  1CJE A;  3IXS A;  1QOA A;  4N59 A;  2DAF A;  3OJ3 A;  2HJ8 A;  2WXO A;  1ROE A;  3V60 A;  2W55 A;  4DBG A;  1N62 A;  3LXF A;  2Z0D B;  2FBW B;  4ARC A;  1WZ0 A;  4KZ0 A;  4BKT A;  3B08 A;  1OQQ A;  1XLO A;  1YNT E;  2IPK D;  3PVL A;  1XLP A;  2CHW A;  2LGX A;  4GN1 A;  4ZOH C;  3ZDT A;  3T9L A;  1JWM D;  2QSD A;  2LGD A;  2AEH A;  3H8H A;  3V3X A;  3WCQ A;  2ZVN A;  2OJW A;  2JZZ A;  3PO0 A;  5AZF A;  5IO9 A;  1TKY A;  1FIQ A;  4K81 A;  4C7Y A;  4F8C B;  1WXM A;  1ZDV A;  2K9X A;  3KWV A;  3QC8 B;  4FN2 A;  1FNU A;  1F2R I;  3QAQ A;  3A4S C;  2WXF A;  4WWO A;  5EE9 A;  4K7W A;  2N9X A;  3BII D;  5KHQ A;  2WQY B;  3KLS X;  4RGT A;  3TBL D;  4N9F 4;  2LVO A;  2REX A;  3UI3 A;  2MHJ A;  4C4V B;  2BT6 A;  4RH6 A;  3CSF A;  2CJO A;  2L3Z A;  4CYE A;  3ZNI D;  3VR8 B;  3DBR B;  1YN3 A;  3U7Z A;  3TEW A;  1WX8 A;  3DBR I;  2KNB A;  1YOV B;  2IJ0 A;  2MP2 B;  4HRS A;  2UU7 A;  3VUW A;  3BVZ A;  2D3A A;  1RFK A;  1KF6 B;  2D3B A;  1L0V B;  1NDD A;  2GLS A;  1UGM A;  2DYM A;  2PVG C;  4GOC A;  3VHT C;  3MFG A;  2V4I B;  2KC2 A;  2JT4 B;  5EE0 A;  1D5M C;  1UD7 A;  3B9J A;  2A5U A;  3KW5 B;  3SR6 A;  3ZXR A;  1NBF C;  3ETR A;  5CX3 A;  1XD3 B;  1SBB B;  2KJ6 A;  2INN E;  2LRU A;  4NZL B;  3Q14 C;  3DPD A;  4LJP B;  3APD A;  4AS1 A;  1JW9 D;  3X0W A;  2B3A A;  2CU1 A;  3TJP A;  1C79 A;  1V1O A;  4FUL A;  3FAH A;  1MFW A;  2BYT A;  4WQM A;  4TQ1 A;  4TUU A;  1TYG B;  3ZDM C;  3CWI A;  3N1Z C;  2KC1 A;  1IUE A;  4IWP A;  3PPA A;  3IFW B;  5EE3 A;  3PRE A;  3I9V 1;  1E8Y A;  1NEK B;  3HUI A;  1G6J A;  5GMV A;  3NHE B;  2AL6 A;  1T5X D;  3ZGZ A;  5L83 A;  2EMT A;  2VH2 A;  3ZIM A;  4NQK E;  1PDX A;  3UIO B;  4NAM A;  2NMQ A;  3AE7 B;  1V80 A;  2LVP A;  1TZO A;  2PEA A;  1QLB B;  3FIL B;  3OJ4 B;  3RNF C;  1CQV A;  1T0R C;  1UWM A;  2HJ1 A;  4HPM B;  3VRB B;  2KAJ A;  1WXS A;  1EU3 A;  3VQI A;  3GB1 A;  5J18 A;  5L95 C;  4ZRJ A;  2CU3 A;  4GXB A;  4MSQ B;  2WDR B;  4M0W A;  2J52 A;  3NZS A;  1V49 A;  1GPX A;  1KJT A;  3PSE B;  3BK1 A;  2BQQ A;  2XK5 B;  1WJ4 A;  4KGT A;  2M4N A;  5E6O A;  2MEK A;  1HE8 A;  3ZVV A;  1YJ1 A;  2J7Q B;  2L1A A;  3QJZ A;  3UQA A;  2MJE A;  4TKN A;  1LXD A;  1XQQ A;  4OVZ A;  2JRI B;  5HG2 A;  4DDI D;  3RD2 A;  2C9W B;  2KKC A;  4TQ0 A;  3ZTC A;  1E7V A;  3IBE A;  4BOS C;  1C78 A;  3Q2A C;  5AUI A;  1BT0 A;  2H89 B;  4J6I A;  5IOI A;  4JLC A;  2AQ3 B;  3R3M A;  5CTR C;  2AL3 A;  2KJH B;  4KZC A;  3U8Z A;  4AUQ C;  2MBQ A;  1PQS A;  1OQR A;  2DAJ A;  3W1S C;  1WGG A;  4F1S A;  2MCN B;  1QQR A;  1PGA A;  1K8R B;  1MPE A;  3RNC C;  5DPS A;  4DHJ D;  2C7H A;  4XDC A;  1BML C;  2KTF A;  5BMH A;  5TSS A;  3AEC B;  2DZM A;  1X1M A;  2O2V B;  5EE1 A;  2N0S B;  4C80 A;  3MJ5 A;  2BS2 B;  1KLV A;  1WR6 E;  1IBX A;  3AED B;  1SE3 A;  1E6E B;  3BVM A;  3PS6 A;  3BZD B;  2QMT A;  2GB1 A;  3KYC D;  3QWZ B;  4ICV A;  1ZUD 2;  4KV2 A;  1WE7 A;  2ZNV C;  2L52 A;  1VZ7 A;  1KTK A;  1TBE A;  3OAW A;  2MBB B;  4LCD E;  1YJI A;  4ZDV A;  2I1J A;  1FNW A;  2KX0 A;  4FJZ A;  1WJ6 A;  1GC7 A;  3DHH C;  2LWP A;  1I4P A;  3TEY A;  3H7S A;  1RFA A;  2N9P C;  2L7R A;  3L17 A;  2NS5 A;  1E8W A;  2G9H D;  1WXA A;  1XT9 B;  1KFY B;  2PE6 B;  1J7A A;  2GBK A;  2MX2 A;  2ZW0 A;  4E74 A;  2VH1 A;  5LXI B;  4NPN A;  2MH7 A;  3AMZ A;  2CKH B;  2MJD A;  4KGR A;  1FXI A;  1VR9 A;  3MC9 A;  2JSV X;  4WQO B;  4GIV A;  4GU2 A;  3A1Q A;  5TR5 A;  5H8Y E;  3P42 A;  3NY5 A;  1PYW D;  2N9K A;  3B0A A;  2KWC A;  2LHD A;  3K9O B;  1V81 A;  1ZP0 B;  2M1M A;  1NYR A;  4AP4 C;  2IYD B;  2ZJD A;  4HJG E;  1L6V A;  5JHB A;  4PT5 A;  2D2Q A;  2X8X X;  1FD6 A;  3HK0 A;  1HTO A;  2R61 A;  4B6W A;  4MGK E;  1SXT A;  2C7N B;  4N6E B;  2XN9 C;  4DK5 A;  5DPR A;  1E8X A;  3WAP A;  1WM3 A;  4A90 A;  1OFF A;  2ZPN A;  2BYV E;  2QIE B;  2ICI A;  3SU8 X;  2KOX A;  4HPP A;  2GBR A;  1XF5 L;  1S1Q B;  4REZ A;  3V6C B;  2M17 A;  3PRP B;  3IAM 1;  2I2Y A;  4PYZ A;  2LXA A;  4WJO A;  4RM8 A;  4YSX B;  4II3 B;  2KFK B;  4OZC A;  4HDO A;  1WX7 A;  2M8S A;  1JWB D;  3K9P B;  4WUR A;  3I57 A;  3IT4 B;  4AOF A;  2VZK D;  2Q5W D;  4ANU A;  5HHD G;  1J19 A;  5DPT A;  1ZE3 D;  2DWQ A;  1YQ3 B;  2PMV A;  1P3Q U;  4FJV B;  2RPQ A;  2KVZ A;  1OGW A;  3ZXV A;  2JUO A;  2W3S A;  4BKS D;  2DZJ A;  3NS1 A;  3Q3N C;  1FXA A;  2Y5C A;  4YSZ B;  3H7P B;  1ZDX A;  3N32 A;  2IGG A;  2JYT A;  3V62 A;  1WFY A;  2KQ4 X;  4P6V F;  4IC7 B;  2QC8 A;  2CHX A;  1DOX A;  4PS3 A;  3A9J B;  1WR1 A;  4XGA B;  3P4S B;  3ABV B;  2AWT A;  1J8C A;  1V8C A;  4WJN A;  3QAR A;  2WDQ B;  3NVZ A;  2AQ2 B;  3HVZ A;  2L8J A;  2BPS A;  1L4Z B;  3AUL A;  4ZHP A;  4LNI A;  4BBN F;  2G3Q B;  1E0Z A;  2W82 A;  2LJI A;  2J0K A;  3M3J A;  3RNG C;  2GMI C;  2NPT B;  4LLG M;  1FEH A;  1CK1 A;  3Q8B A;  1FPY A;  1JWA D;  4NJ6 A;  1Z2M A;  1L7Y A;  2CR5 A;  3H9D A;  1L2N A;  5C23 A;  1YIW A;  3Q3F A;  1T0S C;  3VDZ A;  3GE8 C;  3BWU D;  3ZLZ A;  2JU6 X;  2GBN A;  3AH7 A;  4LNO A;  2DZK A;  2R2O A;  4IUM B;  5G5G A;  2ASQ A;  3IG3 A;  3VTU A;  1WH3 A;  3T3O A;  4RFB A;  1V5O A;  1SIF A;  1I7H A;  1ACC A;  3L16 A;  1XLN A;  1LQB A;  4B0E A;  4MGY E;  2YEP B;  3JSV A;  3ZO5 B;  4WWP A;  2IO0 B;  1L4D B;  5DPW A;  3TUO A;  3KQ4 A;  2OHF A;  2INP E;  1P9D U;  2K5P A;  3ZNZ B;  4K3C A;  4C00 A;  3VTV A;  3GZN B;  1SE4 A;  2PW9 A;  3RNA C;  4KKJ A;  2V3S A;  5T8I A;  1HXY D;  4XZ4 A;  3DVG X;  2MBO A;  4YT0 B;  2JWU A;  3HM6 X;  1RRB A;  1J0G A;  3D32 A;  3CIR B;  3MC0 B;  4LJO B;  4KVG B;  4NAW A;  2QJL A;  2K0P A;  1FMA D;  1I4X A;  2OED A;  1I4G A;  2BTE A;  1YN4 A;  5J17 A;  1YJJ A;  3NOB A;  2FCQ A;  1PGB A;  1EF1 A;  2I38 A;  2AX5 A;  4M02 A;  5BMG A;  1V2Y A;  4HCP B;  4F7Z A;  2HDE A;  1R4M B;  4IWO A;  3B2G A;  1J7B A;  2E3T A;  1R4M I;  3NZ3 A;  2RMM A;  4HCN B;  3GS2 A;  2XK5 A;  4HDQ A;  3EEC A;  3SEB A;  4DXF A;  1R7S A;  2PKO A;  2KQS A;  3N9Y C;  4J3O D;  3M62 B;  4W9H A;  2JQR B;  4A9A A;  2N7J A;  4X57 B;  3VVW B;  3UF8 A;  5IKC M;  2LD9 A;  1LFD A;  2RGF A;  1WWT A;  4FXC A;  1UZX B;  3E56 A;  2KTR B;  1HTQ A;  4DXG A;  1V86 A;  4NNJ B;  3L10 B;  3QA8 A;  1HEZ E;  4L23 A;  4YTN B;  5BYS A;  2V0G A;  1AWD A;  5E6N A;  3HIZ A;  2KN4 A;  3AU4 A;  3AXC A;  5D6J B;  4OVU A;  1I35 A;  4G3X B;  1D5X C;  4MGI E;  4XYC A;  2L05 A;  3BYT B;  3V05 A;  1I4R A;  5I4D A;  1E8Z A;  2LHE A;  1S3S G;  1GUA B;  2KLG A;  3A9K B;  4EOY A;  4R3D A;  1YD8 U;  4IKG A;  1XO3 A;  3PZD A;  1UGJ A;  1B9R A;  4EZK A;  3P4Q B;  2L0T A;  2JX5 A;  1GNU A;  3AV8 A;  3MJW A;  4HKZ E;  2LGI A;  2KMA A;  4P7I A;  1WXV A;  5G5H A;  3L08 A;  3U2S C;  1EUV B;  3DBL B;  2IGD A;  5LXH A;  3L54 A;  1FNV A;  2D11 A;  2FCN A;  3DBL I;  1D4B A;  3OLM D;  2KFJ A;  4ITK A;  4KDL B;  2EKE C;  2RSU A;  4W9F A;  4G11 A;  3VUX A;  2K8C A;  1XCQ L;  1ZW7 A;  1VD2 A;  2HE7 A;  4BVU C;  1Y56 A;  1EO6 A;  1KH0 A;  3AEG B;  4ACF A;  4GDL A;  2KWU B;  3DBH B;  1TS4 A;  1LGR A;  3DBH I;  2FID A;  4HEA 1;  1Y8R C;  3BIN A;  2ZPY A;  3CMM B;  3H1U A;  1WYG A;  2KD0 A;  2IGH A;  3N1Y C;  4AWJ A;  3VRA B;  2O6V B;  2ZNV B;  3AE5 B;  3W1Y A;  1E9M A;  4DHJ B;  2WXN A;  1VRA B;  4O1N A;  4S17 A; 
#chains in the Genus database with same CATH homology
 4HWI B;  3CST A;  2MWS B;  1WE7 A;  2R2Q A;  3A9K A;  4KV2 A;  3TCA A;  4CO7 A;  2ZNV C;  4MDK E;  4BOZ B;  3DVN V;  4FA6 A;  2PPH A;  2KVR A;  3VUY A;  1TBE A;  1WMH B;  2GBJ A;  2KZR A;  3OAW A;  2BYF A;  2MBB B;  2NR2 A;  4LCD E;  4MJS B;  2XBB C;  2N1W A;  2W9N A;  2I1J A;  3DCG A;  2KX0 A;  1WJU A;  4ZDV A;  4DXA B;  4FJZ A;  1WJ6 A;  5CHW A;  1GC7 A;  1SGH A;  5AZH A;  5JZE B;  4MH0 E;  2BGF A;  2LWP A;  3H7S A;  1RFA A;  2N9P C;  4IM0 A;  2D3G A;  2L7R A;  3M95 A;  4FJY A;  3L17 A;  1TGZ B;  4HPL B;  1UH6 A;  2NS5 A;  1E8W A;  1WXA A;  1XT9 B;  3RT3 B;  2NBU A;  2NBW B;  4KSK C;  3QQ8 B;  3W1S A;  1UBI A;  2UYZ B;  2PE6 B;  4RMA A;  4HVB A;  2GBK A;  5KHO A;  1OQY A;  2MX2 A;  3EC8 A;  3QX1 A;  3RZW C;  4BKG A;  2BWF A;  2YVC A;  4E74 A;  3ENE A;  2KN5 A;  2JY6 A;  1Z5S B;  2UWQ A;  3KH0 A;  4KIK B;  4NPN A;  2I1K A;  3WIM A;  5LXI B;  2CKH B;  4JIO U;  2CHZ A;  4EKU A;  1H8C A;  3O65 B;  3WAM A;  3SHQ A;  4W9D A;  2M0X A;  4BFR A;  3RCZ A;  3DVN U;  4WQO B;  5G2N A;  2KO3 A;  3HM3 A;  4W9G A;  2LXC A;  4GIV A;  4GU2 A;  3A1Q A;  4WWN A;  5C1Z A;  5TR5 A;  4MM3 A;  4JGH B;  3NY5 A;  2MBE A;  3P2B A;  1Q0W B;  3B0A A;  2IO1 B;  4PS7 A;  3ML8 A;  2KWC A;  3K9O B;  1V81 A;  2KLC A;  2M1M A;  3PT2 B;  3U7D A;  5CHV C;  4AP4 C;  3DVG Y;  2IYD B;  2ZJD A;  4GMV A;  3RZF A;  3N3K B;  3R7R A;  1GC6 A;  1QZE A;  1YX5 B;  5JHB A;  4I6N B;  5D94 A;  5AEK B;  2DYB A;  2D2Q A;  2O2V A;  3N30 A;  4A3P A;  1E5W A;  2GBM A;  1P98 A;  3NS8 A;  3R7Q A;  3WAL A;  3ZUN A;  1EF5 A;  2O6V A;  3HK0 A;  4FBJ B;  2V1Y A;  2FNJ B;  2CS4 A;  3A4R A;  3MTN B;  3PLU A;  2KK8 A;  4MGK E;  2MQJ A;  3U30 A;  4B6W A;  4E3C A;  2C7N B;  1FXT B;  4DK5 A;  2DYO A;  5DPR A;  1E8X A;  2IY0 B;  3WAP A;  1E7U A;  1WM3 A;  2ZPN A;  2BKR B;  3X23 A;  2BYV E;  4NJ7 A;  3LJ3 A;  1WE6 A;  2LRW A;  2IO2 B;  3QIJ A;  2K39 A;  3TIX A;  3SU8 X;  2KOX A;  2GBR A;  1S1Q B;  2K6D B;  1C3T A;  2K6Q A;  2J0J A;  3APC A;  3JW0 X;  4IM2 A;  3V6C B;  2J0M A;  2L0F A;  3QCA A;  3T8M A;  1WMH A;  2A4Z A;  2JVC A;  2M17 A;  3EHV A;  3PRP B;  1A5R A;  4MJS A;  2HD5 B;  4PYZ A;  4XX5 A;  2O6V D;  2LXA A;  4WJO A;  4RM8 A;  4M8N A;  4ZYN A;  3VFK A;  3M63 B;  4ANX A;  1KOT A;  4II3 B;  2KFK B;  3GZN I;  4HDO A;  2K25 A;  1WX7 A;  2M8S A;  4OVV A;  3SDL C;  2Y5B B;  3ZRC A;  1TTN A;  2WX0 A;  3WAO A;  3H6N A;  3ZTD A;  3K9P B;  4KDI C;  3ZNG C;  4BKS A;  2RD0 A;  2MW5 A;  1NI2 A;  5BO4 B;  2IZV B;  1WJN A;  5DCN A;  4AOF A;  2C5L C;  4EEW A;  5J2R A;  4NQL B;  1IYF A;  4MSM B;  1H4R A;  1MG8 A;  3ALB A;  4KIK A;  4B9K A;  2C7M B;  4ANU A;  1ZKH A;  4GDK A;  4IWQ A;  1J19 A;  5DPT A;  3WA0 A;  1P3Q U;  2DAF A;  2IY1 B;  3OJ3 A;  4FJV B;  2HJ8 A;  4WJP A;  3ML9 A;  2RPQ A;  3VH4 B;  3JSV B;  2L00 B;  3V60 A;  3UGB B;  1OGW A;  2C60 A;  4DBG A;  2JUO A;  4RM9 A;  2Z0D B;  2ZCB A;  4BKS D;  2DZJ A;  2IO3 B;  3PRM B;  3R66 C;  1WZ0 A;  4KZ0 A;  4BKT A;  3B08 A;  3V6E B;  3TL5 A;  1D3Z A;  4CHK A;  3H7P B;  3N32 A;  3PVL A;  2CHW A;  3V62 A;  2LGX A;  1Q1O A;  1WFY A;  1WM2 A;  4GN1 A;  3ZDT A;  1WGH A;  1WI0 A;  3T9L A;  3PGE A;  5JH5 C;  5EDS A;  4IC7 B;  2LGD A;  4I6P A;  2CHX A;  4PS3 A;  3A9J B;  2AEH A;  1WR1 A;  3UQB A;  2AWT A;  2ZVN A;  4XC2 A;  3Q3J A;  1J8C A;  2LVQ A;  2JZZ A;  1GG3 A;  2G4D B;  2NBV B;  3ONS A;  3QAR A;  3A33 B;  2BWE S;  4WJN A;  4B95 A;  5AZF A;  2AYO B;  2L8J A;  2BPS A;  3AUL A;  4DHZ E;  3APF A;  4K81 A;  4GDK B;  4FHK A;  4DDG D;  4W9E A;  3UIN B;  4NAW B;  4BBN F;  4F8C B;  2G3Q B;  1V6E A;  3B1L X;  2XEW A;  2J0K A;  4FLH A;  1WXM A;  3M3J A;  4DHZ B;  2GMI C;  2NPT B;  4ZRI A;  4URK A;  4TV3 A;  1E90 A;  3QC8 B;  3PLV A;  2Z59 B;  4FN2 A;  4NJ6 A;  4W9C A;  3WAN A;  3QAQ A;  4ICU A;  1Z2M A;  1L7Y A;  2CR5 A;  2HTH A;  2PJH A;  3H9D A;  1L2N A;  2KFK A;  3A4S C;  5C23 A;  1YIW A;  3Q3F A;  3IVF A;  2LJ5 A;  3L13 A;  3UIP B;  4WWO A;  3VDZ A;  4K7W A;  2N9X A;  3ZLZ A;  5KHQ A;  1U4A A;  3RUL A;  2GBN A;  3BY4 B;  1OEY A;  3DDC B;  2K8H A;  2DZK A;  2R2O A;  4IUM B;  4W9L A;  3TBL D;  1WF9 A;  4N9F 4;  2LVO A;  5CHF A;  2ASQ A;  3IG3 A;  2REX A;  3PRZ A;  2ZEQ A;  1WX9 A;  3VTU A;  2QHO A;  1WH3 A;  2JRH A;  3I3T B;  1P1A A;  3CSF A;  4DWF A;  1V5O A;  1SIF A;  2K1F A;  2L3Z A;  4CYE A;  3ZNI D;  2FCS A;  4EFO A;  4E71 A;  5IA7 A;  3L16 A;  1LQB A;  4MGY E;  1YX6 B;  2ZCC A;  1WX8 A;  1WRD B;  3DBR I;  1WGY A;  3JSV A;  1P0R A;  2KNB A;  5LLI A;  3VTW A;  3ZO5 B;  5FR6 A;  2FAZ A;  4WWP A;  2IO0 B;  2MP2 B;  2D07 B;  4M8M A;  2GOW A;  5AZG A;  4FHJ A;  3VUW A;  1V5T A;  5DPW A;  3PTF C;  1VCB A;  5D2M B;  1P9D U;  4IM3 A;  3KUC B;  3L0W B;  2Z0E B;  3VAW A;  4NY0 A;  3ZNZ B;  4MGZ E;  2MRP A;  1NDD A;  1WY8 A;  3H7P A;  3VTV A;  2KDF B;  4W9K A;  1Q5W B;  1UGM A;  2DYM A;  4GOC A;  3VHT C;  2IBI B;  4M0W B;  2KC2 A;  2KWV B;  2JT4 B;  2DZI A;  4IG7 B;  1OEY J;  1UD7 A;  3A9J A;  2A5U A;  5IAA C;  5E6P A;  3KW5 B;  1NBF C;  2V3S A;  5CX3 A;  1V9J A;  1XD3 B;  2KJ6 A;  4XZ4 A;  3DVG X;  2LRU A;  3PHW B;  2ZVO A;  2LZ6 A;  2MBO A;  3DPD A;  4LJP B;  3APD A;  3X0W A;  3HM6 X;  1IP9 A;  4WJQ A;  2DEN B;  3VXW A;  2FUH B;  2NCN A;  1RRB A;  2B3A A;  1J0G A;  2YLM A;  2CU1 A;  3D32 A;  2MA9 B;  4LJO B;  4KVG B;  2LI5 A;  4NAW A;  3TJP A;  1OTR B;  4FUL A;  4TQ1 A;  2JPH A;  4JQW C;  4TUU A;  3ZDM C;  2NPT A;  5J17 A;  2KJR A;  3NOB A;  4WAA A;  4GSW A;  2KC1 A;  2G4S A;  2FCQ A;  4IWP A;  1EF1 A;  3JVZ X;  3PPA A;  3ZRF A;  2KAN A;  2WYQ A;  3IFW B;  3PRE A;  1E8Y A;  1V2Y A;  2EMS A;  4HCP B;  3U8Z A;  4F7Z A;  1CMX B;  4IWO A;  1SE9 A;  1G6J A;  5G55 A;  1AAR A;  3LDZ E;  5GMV A;  1R4M I;  4GB9 A;  3NHE B;  2AL6 A;  3KVF B;  4HCN B;  5L83 A;  3ZKJ C;  4GGQ A;  4EUT A;  4A3O A;  4ANV A;  2XK5 A;  2EMT A;  4HDQ A;  4AJY B;  3EEC A;  3GOE A;  4HLE A;  3QK0 A;  4AJW A;  3HHM A;  2KDE B;  2KQS A;  3ZIM A;  4NQK E;  3M62 B;  4W9H A;  3UIO B;  4X57 B;  3VVW B;  3UF8 A;  1V80 A;  4ASW C;  2LVP A;  3AI5 A;  2LD9 A;  1LFD A;  3IHP C;  2RGF A;  2PEA A;  4IW0 A;  3OJ4 B;  2JF5 A;  2KX3 A;  4G50 A;  4LDT D;  4GDL B;  3SD5 A;  1WIA A;  1RLF A;  2MP2 A;  1ISN A;  1UZX B;  4ANW A;  2KTR B;  5JHA A;  4BBN C;  1V86 A;  4HPM B;  4NNJ B;  1T0Y A;  3L10 B;  3QA8 A;  3MHS D;  4I6L B;  2FCM A;  3S2A A;  1WXS A;  3DOW A;  2BYE A;  5E6N A;  3HIZ A;  3VQI A;  5J18 A;  5L95 C;  4ZRJ A;  3AU4 A;  3AXC A;  5D6J B;  4OVU A;  1I35 A;  4G3X B;  1KM7 A;  4GXB A;  2VRR B;  4MSQ B;  3JYU A;  4LDT B;  2KHW B;  4MGI E;  1IPG A;  2L05 A;  3NZS A;  1V49 A;  2JZ3 B;  1E8Z A;  1KJT A;  3PSE B;  3PHX B;  2N4F A;  2XK5 B;  4W9I A;  1WJ4 A;  1S3S G;  2FIF A;  3ZW3 A;  1GUA B;  2KLG A;  2WDT B;  2M4N A;  2N1V A;  2V4L A;  3A9K B;  3DQV A;  4II2 B;  5E6O A;  4EOY A;  1HE8 A;  1YD8 U;  3ZVV A;  1YJ1 A;  3PZD A;  2J7Q B;  2MBH A;  3DBS A;  4PS8 A;  4FAD A;  4MEM A;  2N7E A;  3QJZ A;  3UQA A;  1WGR A;  4TKN A;  4EZK A;  1YQB A;  4PYU A;  2L0T A;  4K1R B;  1GNU A;  1LXD A;  3MJW A;  1XQQ A;  2DX5 B;  2RR9 A;  2JRI B;  2BF8 B;  2KMA A;  4P7I A;  2KMC A;  1ZGU B;  1WXV A;  3RYT A;  2KDB A;  3VH3 B;  4DDI D;  3L08 A;  1EUV B;  3ZNH B;  3RD2 A;  2C9W B;  2KKC A;  4TQ0 A;  5LXH A;  3L54 A;  3ZTC A;  1E7V A;  3NZU A;  2N7D A;  2D11 A;  2FCN A;  3DBL I;  3IBE A;  3TMP B;  4EZJ A;  4BOS C;  2KDI A;  2G45 B;  2KXJ A;  2ZZP B;  4A20 A;  3OLM D;  2KFJ A;  4KDL B;  1BT0 A;  4J6I A;  3V61 A;  3C0R B;  4JLC A;  3ECI A;  2OJR A;  4HJK A;  2EKE C;  2RSU A;  3R3M A;  4W9F A;  2AL3 A;  2KJH B;  1WYW B;  2L76 A;  1RAX A;  3KUD B;  4G11 A;  4KZC A;  5CTR C;  1F9J A;  2K8C A;  4YL8 A;  1ZW7 A;  3KYD D;  5D7G A;  1WGD A;  2MBQ A;  1VD2 A;  1PQS A;  4AUQ C;  2OOB B;  2HE7 A;  4KSL C;  1TZ1 A;  2DAJ A;  1R4N I;  3W1S C;  1WGG A;  2JWZ A;  4F1S A;  2MCN B;  3RUI B;  3PV1 A;  2MLB A;  3A1Q B;  2K8B A;  2LUE A;  4BVU C;  1K8R B;  1EO6 A;  5DPS A;  5HKH A;  2MSE D;  4GDL A;  2KWU B;  4HXD A;  4MEL A;  4DHJ D;  2C7H A;  3VUX A;  2KTR A;  3DBH I;  2KTF A;  2FID A;  2BKF A;  1Y8R C;  2WX1 A;  3BIN A;  3KUZ A;  2ZPY A;  3QHT A;  3CMM B;  2N9E B;  2KQ7 A;  1UEL A;  2DZM A;  3H1U A;  1X1M A;  2KD0 A;  2O2V B;  1M94 A;  4JL9 A;  4AWJ A;  4HK2 A;  4W9J A;  2JXX A;  2O6V B;  2WWZ A;  2ZNV B;  3AU5 A;  4K7S A;  1WR6 E;  3W1Y A;  1KLV A;  2PE9 A;  3CF6 E;  3EFU A;  4DHJ B;  4EZL A;  1JRU A;  1LM8 B;  1I42 A;  2LAS A;  2LGY A;  4G0N B;  3PS6 A;  4K7U A;  1WZ3 A;  1GJZ A;  2NVU I;  2DHZ A;  3KYC D;  2D10 A;  3QWZ B;  4ZRK A;  4ICV A;  1UBQ A;  1C1Y B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...