2NBWB

Solution structure of the rpn1 t1 site with the rad23 ubl domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
78
structure length
78
Chain Sequence
MVSLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQKKST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords 26S proteasome regulatory subunit RPN1
publication title Structures of Rpn1 T1:Rad23 and hRpn13:hPLIC2 Reveal Distinct Binding Mechanisms between Substrate Receptors and Shuttle Factors of the Proteasome.
pubmed doi rcsb
source organism Saccharomyces cerevisiae s288c
total genus 12
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 2016-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2nbwB00
2FCQA 4DK5A 3NHEB 3L0WB 4TQ1A 1V9JA 2O6VB 3VQIA 1RFAA 2K1FA 3QK0A 3QIJA 3ZNGC 1WXAA 2ASQA 3JSVA 2LGYA 2ZZPB 1LM8B 3SHQA 4KZ0A 1XT9B 3AU4A 3KUDB 1YQBA 2QHOA 3V6EB 4IC7B 2J0MA 4ZRKA 2KTRB 1WM2A 2BKRB 1UBQA 1WMHB 1WH3A 3VTVA 3U8ZA 1ISNA 3DVNU 3JW0X 4KZCA 3WANA 2ZCCA 1AARA 1CMXB 2JT4B 3EFUA 2EKEC 4BKGA 2RPQA 4BOZB 2KDEB 3KUZA 1V2YA 2D07B 2IBIB 2KFKB 2D10A 1WGYA 3NS8A 2LGXA 1SIFA 4WJPA 2J0KA 3ONSA 4CHKA 3RZWC 1V5OA 4EUTA 5C23A 2KO3A 2LVOA 3APDA 3QWZB 1WGGA 2EMSA 1H8CA 4WWNA 1L2NA 1H4RA 2NBWB 2M1MA 1WGHA 2KJ6A 2PEAA 2C7HA 2IO2B 4LDTD 3TBLD 2GBRA 2K6DB 1GC6A 2DAFA 2KJHB 1KM7A 2BGFA 4RM8A 1E8XA 1OTRB 4W9CA 4NAWB 2FCSA 2C60A 3IHPC 1WM3A 4WJOA 2KXJA 2L0TA 3PZDA 2AEHA 2MA9B 2KDBA 3UQAA 3LDZE 2FAZA 3H1UA 4MGKE 4P7IA 4GXBA 1X1MA 2CHZA 3A4SC 3KH0A 4B9KA 3ZUNA 1V86A 2I1KA 3QX1A 2BWFA 2LD9A 3QHTA 2RGFA 3ENEA 2M4NA 4EZLA 3U30A 3RCZA 3SD5A 3JVZX 3H7PB 4MJSB 2WWZA 2GBJA 3W1YA 1WJ6A 2J7QB 1QZEA 2JZZA 5GMVA 2BYEA 3DCGA 4FN2A 1IYFA 4PS8A 3R7RA 1V49A 1WXVA 2Y5BB 2LWPA 3ECIA 2MRPA 2WYQA 2KKCA 4ICVA 5G2NA 4F1SA 4DHZE 4JQWC 1OQYA 4EZKA 3UQBA 2BPSA 2KDFB 4W9HA 2KN5A 3GOEA 5AZGA 4WWOA 2M17A 3H9DA 1GUAB 2IYDB 3RD2A 4AOFA 1KOTA 1S3SG 2DYOA 2KTRA 4TUUA 3QJZA 4GDLB 1XD3B 3U7DA 2XEWA 1YJ1A 2CS4A 5DPTA 1RLFA 2V4LA 3L13A 2Z0EB 2ZNVC 3ALBA 3TIXA 4PS3A 2MLBA 4PS7A 2GBMA 1WIAA 5JHBA 1WRDB 2R2OA 4XC2A 3T9LA 2DZIA 4IM0A 1A5RA 3QQ8B 5BO4B 5HKHA 1TZ1A 3VXWA 1WYWB 2FNJB 2MBQA 2MSED 1E7VA 5CTRC 4II2B 4TV3A 4ANXA 2JRHA 2OJRA 3DVNV 3M62B 2KFJA 2LRWA 2LUEA 3N32A 4W9IA 4NAWA 2N4FA 5AEKB 4NNJB 3A9KB 4NJ6A 5KHQA 3IG3A 4FA6A 4FADA 4AUQC 4EOYA 4HCNB 2KD0A 4XZ4A 2LXCA 2C9WB 2KQ7A 3KYCD 3QC8B 1J8CA 5LXIB 4EKUA 5LLIA 4TQ0A 3WA0A 3KW5B 3M63B 2O6VD 1KJTA 4MEMA 2WX1A 2JF5A 3NZSA 2KWVB 1ZGUB 4WJQA 4BFRA 1WJUA 2JUOA 2ZNVB 2FIFA 2DAJA 2BWES 1OEYJ 3ZTCA 1V5TA 2D3GA 2HD5B 1JRUA 2KQSA 4XX5A 3PSEB 3VUXA 3H7PA 2RR9A 3IBEA 2HTHA 4GIVA 5D94A 4LJOB 2N9EB 3RZFA 3DBHI 1I35A 2DYMA 4JL9A 4W9KA 3RUIB 4CYEA 1EF5A 2NBVB 1C3TA 4N9F4 2HJ8A 4MGZE 4TKNA 2BKFA 3S2AA 4W9DA 3L10B 3X0WA 3SU8X 4GSWA 3PRZA 2N9XA 3V61A 2JZ3B 4BKSA 3A9JB 2N1VA 1GC7A 4IM3A 3HHMA 4ANVA 4OVVA 4GN1A 3BY4B 3ZNID 2O2VB 4GB9A 2CU1A 2KDIA 1E8ZA 3EC8A 3HIZA 4CO7A 1P3QU 2N7DA 4NPNA 4IG7B 4W9EA 4BOSC 2MQJA 2NPTB 2MX2A 3PLUA 1Q5WB 4M8NA 2K8BA 4HJKA 5KHOA 4M8MA 4ANUA 2MP2B 3PV1A 4E71A 1WXSA 3ML9A 1I42A 2KC2A 3EHVA 4HLEA 4JIOU 2ZPYA 3VTUA 2G4SA 3P2BA 2IO0B 2GOWA 4BVUC 1MG8A 1UH6A 1WX7A 1VD2A 4DDGD 4W9GA 2K25A 2VRRB 2D11A 3VUWA 1WE7A 4I6NB 2ZPNA 5JH5C 2C7NB 2CR5A 2L8JA 4RMAA 3SDLC 1UZXB 3X23A 1XQQA 4FJVB 1WR6E 1FXTB 2AL3A 1E5WA 4IWQA 3WALA 1Q0WB 3T8MA 5CX3A 3TL5A 4MGIE 2JY6A 2ZEQA 5DPWA 3NOBA 1L7YA 2XK5A 3M95A 3ML8A 2OOBB 2LVPA 4G11A 5FR6A 3BINA 1TTNA 4IW0A 1J0GA 1WY8A 1LFDA 3OJ4B 4DHZB 1UD7A 1S1QB 1Z5SB 2ZCBA 3HK0A 4K7SA 2KHWB 4NQKE 3V60A 3ZKJC 4BKSD 1WZ3A 4I6LB 2CHWA 3M3JA 2O6VA 3R66C 4I6PA 1OEYA 1SGHA 1U4AA 3AI5A 4PYUA 2W9NA 4FLHA 3TCAA 4OVUA 1V80A 5DPSA 3VUYA 4BBNF 1IPGA 4G3XB 1YX6B 3R3MA 4LJPB 3CF6E 2B3AA 2G4DB 2KOXA 3JYUA 4FHKA 5D2MB 3DBSA 3N30A 2J0JA 4II3B 1WMHA 3PT2B 2L00B 5JHAA 1J19A 1P1AA 3APFA 1EUVB 2L7RA 2PE6B 1EF1A 4IUMB 1GJZA 4MSMB 3DVGY 2KWCA 2BF8B 4MM3A 2KFKA 3W1SA 2D2QA 4KSKC 3WAOA 4K1RB 3MHSD 2LJ5A 3ZNHB 2DYBA 4B95A 2CKHB 2KX3A 4LCDE 4MH0E 1KLVA 1RRBA 4W9JA 3TJPA 3A9JA 4E74A 2DX5B 4WQOB 2MCNB 1WGRA 1E7UA 3GZNI 3VTWA 1LXDA 3PPAA 3UINB 3DBRI 3ZO5B 3K9OB 1E8YA 5AZHA 3CSTA 4HPLB 1G6JA 3OLMD 1ZKHA 3MJWA 4FJZA 2YLMA 4DDID 4IWOA 4GMVA 4MSQB 3DDCB 1LQBA 3RT3B 2FIDA 2GBNA 2DHZA 2KZRA 3QCAA 1RAXA 3UIOB 2V1YA 4AP4C 4HVBA 3IFWB 2GMIC 4WAAA 4NJ7A 2LZ6A 4HPMB 3V62A 1WX9A 3AULA 4FULA 4W9FA 2NS5A 4KIKB 4DHJB 3AU5A 5EDSA 1V6EA 2WDTB 5TR5A 3ZTDA 4PYZA 2G3QB 4AJWA 5D6JB 1EO6A 2KMAA 4GU2A 4BBNC 2LI5A 4F7ZA 2Z0DB 3ZVVA 2KLCA 4EEWA 4ZRJA 3HM6X 2L0FA 4A3OA 2JXXA 3WAMA 2G45B 4MJSA 2BYFA 3L17A 2KK8A 1R4NI 2GBKA 2NVUI 3H6NA 5C1ZA 3DVGX 2N1WA 3ZW3A 1C1YB 3IVFA 3HM3A 4E3CA 1WXMA 2KANA 4M0WB 3B0AA 3PHWB 3TMPB 2A5UA 1WX8A 2LASA 3UGBB 1PQSA 2IY1B 4RM9A 3ZLZA 3LJ3A 3K9PB 3OAWA 3I3TB 2DENB 3A4RA 4HDOA 2KX0A 4DWFA 4WWPA 4HCPB 4YL8A 2XBBC 4FJYA 2FUHB 4ZDVA 4IM2A 2DZJA 2V3SA 3PRPB 4KSLC 4NQLB 2PPHA 3PHXB 3VHTC 2LXAA 3KVFB 2ZJDA 3UIPB 4A3PA 5LXHA 1WE6A 4MDKE 4HXDA 1T0YA 4KVGB 4GDLA 2KMCA 2M8SA 1NDDA 3APCA 3D32A 3PRMB 2L05A 3ZDTA 2IY0B 4ANWA 3V6CB 1HE8A 3VFKA 1UBIA 3ZRCA 3R7QA 3A33B 1BT0A 1YD8U 3N3KB 1UGMA 5J17A 1WR1A 3PTFC 4JGHB 2UYZB 1VCBA 4BKTA 2C7MB 3ZIMA 2KJRA 5E6OA 1D3ZA 2BYVE 1K8RB 2L76A 1IP9A 3A1QB 3AXCA 5DPRA 4LDTB 2AL6A 5CHWA 2DZMA 3L16A 4F8CB 2UWQA 1OGWA 3KUCB 2MWSB 1P9DU 2K6QA 4HK2A 4AWJA 2A4ZA 5L95C 4X57B 3A9KA 4GDKB 2ZVOA 3CSFA 5IAAC 2K8HA 2M0XA 1SE9A 1Q1OA 1NBFC 1TBEA 3B1LX 2ZVNA 2MBEA 2MBBB 3VAWA 3JSVB 4KIKA 1P0RA 2FCNA 5D7GA 1P98A 1GNUA 1WFYA 3NZUA 2LVQA 3WIMA 4EFOA 3WAPA 2L3ZA 1Z2MA 3UF8A 4GGQA 4DBGA 1R4MI 3DOWA 4J6IA 2JPHA 4GOCA 4KDLB 4W9LA 2NBUA 4K7WA 4B6WA 5L83A 5J2RA 2JWZA 5E6NA 5IA7A 1WI0A 2MBHA 2IZVB 2AWTA 4AJYB 3Q3JA 1WF9A 3OJ3A 2RSUA 5JZEB 2KLGA 1M94A 5DCNA 4ZRIA 3VH3B 2DZKA 1WGDA 2EMTA 4ASWC 2KVRA 4ZYNA 3KYDD 3O65B 4IWPA 4FBJB 2N7EA 2NCNA 3RULA 2KWUB 1F9JA 1WZ0A 2KTFA 3VDZA 4FHJA 2WX0A 2K8CA 1E90A 1V81A 1GG3A 2YVCA 3QAQA 3C0RB 2JRIB 1NI2A 3MTNB 4K7UA 2O2VA 4K81A 3EECA 4URKA 1E8WA 5J18A 2R2QA 3PVLA 2NPTA 4MGYE 1YX5B 2C5LC 2CHXA 3QA8A 3QARA 1TGZB 2Z59B 2K39A 4ICUA 5CHVC 2MP2A 5CHFA 4JLCA 3CMMB 3Q3FA 4WJNA 3RYTA 1WJNA 1ZW7A 3B08A 3L08A 4A20A 4HDQA 3PGEA 3DBLI 2FCMA 2RD0A 4HWIB 1WJ4A 2KC1A 3VVWB 3H7SA 1YIWA 2LRUA 4NY0A 2N9PC 4DHJD 2JVCA 1Y8RC 4KV2A 5AZFA 2PE9A 4EZJA 2PJHA 2HE7A 2LGDA 4KDIC 2REXA 3W1SC 3DPDA 3A1QA 2AYOB 4G0NB 2MBOA 4G50A 3PREA 2IO1B 2KNBA 2MW5A 3DQVA 3NY5A 3ZNZB 3VH4B 3ZRFA 3L54A 3PS6A 5G55A 2IO3B 1UELA 4MELA 4DXAB 2XK5B 2NR2A 4GDKA 3ZDMC 5E6PA 2I1JA 3PLVA
chains in the Genus database with same CATH superfamily
2WS3B 1KFYB 2PKOA 1XF5L 3VQIA 3ZNGC 1WXAA 1UF0A 4M01A 4ZRQA 1PGBA 2KTRB 2KWDA 2BKRB 1WMHB 1WH3A 3DVNU 3ZYYX 1IBXB 2E3TA 2EKEC 2WU5B 2RPQA 4BOZB 2KDEB 2D10A 3NS8A 3AE4B 2BBCA 2PVOD 3RZWC 1FCLA 3APDA 2EMSA 2KJ6A 2IO2B 3TBLD 2GBRA 2NTSA 4WJOA 1HZ5A 2AEHA 4LNNA 2OEDA 2RDGA 2FAZA 4MGKE 3A4SC 2I1KA 1FMAD 2RGFA 4EZLA 2DLBA 4H2AA 4D2KA 3U30A 2IJ0A 3FKYA 2W3RA 4MJSB 3N1XC 1WJ6A 5GMVA 5IO9A 2LWPA 5MPOA 4YXDB 1AW7A 2WYQA 4DHZE 3P4RB 2WDVB 4XWTA 4M0WA 3MP9A 4W9HA 3GOEA 1SE3A 1B9RA 5AZGA 5H8YE 3H9DA 1T0RC 3BVMA 1S3SG 2DYOA 4TUUA 2NTTA 1JWBD 1XD3B 1K52A 3L13A 2Z0EB 2ZNVC 2D5GA 4PS3A 3GB1A 1WIAA 3T9LA 1TZ1A 2X38A 3BIID 2FNJB 2JWUA 5CTRC 4YSZB 1PFDA 3BVZA 1MHHE 2KDMA 2LUEA 3N32A 5AEKB 1FNVA 2N4FA 3AEAB 2L32A 4NNJB 1FNWA 3KQ4A 3NVVA 2FBWB 3IG3A 1TIFA 4PT5A 2KD0A 2KQ7A 3QC8B 5LXIB 1JWUD 5LLIA 4TQ0A 2O6VD 1GPXA 3I57A 4BFRA 2ZNVB 2FIFA 1YNTE 1V5TA 4C00A 2INCC 1HXYD 4ARCA 3PSEB 3H7PA 3FILB 3V3XA 4GIVA 3RZFA 3AN1A 2NBVB 1IGCA 4C56C 4MGZE 3DBRB 3S2AA 2N0SB 1TS5A 3TSSA 3R2TA 1TKEA 4GSWA 1QILA 1EU3A 3ZNID 2O2VB 3EC8A 4CO7A 2N7DA 4IG7B 1RWSA 2NPTB 2MX2A 3DHIC 3EUB2 4M8MA 1QF6A 1WXSA 1I42A 4JIOU 4RH6A 2ZW1A 3Q8EA 2GOWA 2R61A 3I5JC 1UH6A 2QEJC 4DDGD 4RNAA 2K25A 1R4NB 4WIPA 5HI1A 1UWMA 3RN9C 1C78A 2CR5A 1RFKA 4R3DA 1E5WA 3P42A 4OVZA 3WALA 2B76B 2WXFA 1QOGA 2ZEQA 3NOBA 2WXPA 2XK5A 1J0GA 1TTNA 4OZBA 4RGNA 3HK0A 2KHWB 4NQKE 4I6LB 3M3JA 1HEZE 3R66C 2BVCA 4G3XB 3R3MA 4A8XC 2B3AA 2G4DB 1E7PB 2L52A 4II3B 1WMHA 4US9A 1EUVB 2L7RA 4YWGG 3AV8A 3HRDD 1N62A 4K1RB 3MHSD 1FFVA 2CKHB 2KX3A 3EGRA 1I4RA 1KLVA 4E74A 1WGRA 2KACA 3VTWA 2IGHA 3K9OB 1UNSA 2YEPB 2W54A 2MJ3A 4DDID 2FIDA 2M56B 2RDHA 1RAXA 3MJ5A 1R4MB 1WSPA 2WXMA 1JALA 2LZ6A 2PW9A 1WX9A 4XDDA 2MEKA 4DHJB 5TR5A 3ZTDA 1D5XC 3IXSA 1DGJA 2H88B 5D6JB 4BBNC 2LMCA 3N20C 4ZRJA 1FRRA 2L0FA 3WAMA 4MJSA 2NVUI 3ZW3A 3IVFA 3WCQA 1WXMA 2KANA 3P1MA 2A5UA 1EWYC 1DYQA 3P4SB 4HDOA 4WWPA 2FUHB 4ZDVA 3AE6B 3DBLB 2LXAA 4ANWA 3ZRCA 3R7QA 5HFYA 2LHDA 1UGMA 5J17A 1TS2A 2XN9C 3AE5B 3DWGC 3PTFC 1Y56A 1L0VB 2QILA 2L76A 3ZJVA 4F8CB 2UWQA 1OGWA 2MJDA 2LEKA 1ZUD2 5L95C 5I4DA 3AE7B 4X57B 4YSXB 4RF0A 3TEXA 2PMVA 4USAA 4WAFA 3UI3A 2MBBB 1KLUD 4IOIE 1P0RA 1HTOA 2FCNA 3Q69A 2QC8A 3WIMA 2I38A 5EE1A 4DBGA 4J6IA 4KDLB 1FEHA 4W9LA 4YTNB 2NBUA 4B6WA 4ZYSA 3FILA 5E6NA 2OJWA 1WF9A 3NG0A 2KLGA 3GE8C 5DCNA 2BS2B 1WGDA 1JWSD 1IGDA 4ZYNA 1YN3A 2KQ4X 4LNIA 2N7EA 3AEFB 3Q8CA 2KWUB 1T0SC 4A9AA 2SEBD 1GG3A 3QAQA 1NI2A 2O2VA 1E8WA 3PVLA 2NPTA 4MGYE 1TY0A 3RMKC 2DBYA 2C5LC 5T8IA 3QA8A 1TGZB 2K39A 3L08A 4A20A 4NY0A 1YIWA 4KV2A 2PJHA 4LTUA 4Q2JA 3W1SC 1XEEA 1FFUA 1SJHD 4A55A 2AYOB 3Q8FA 3PREA 3AEDB 3J9CA 3L54A 3PS6A 1UELA 3ZDMC 3HVZA 2I1JA 3IAS1 1KRHA 1SE4A 3NHEB 1FNUA 1QKZA 2H89B 2O6VB 3QK0A 2V0GA 4P6VF 1LM8B 3L4PA 1JROA 1XT9B 3AU4A 1HA5A 1YQBA 3V6EB 1WM2A 4OZCA 1ISNA 2JT4B 3ZGZA 2KFKB 3E9SA 2LGXA 3PO0A 2J0KA 2V3NA 3ONSA 5IN7A 3Q6BA 5C23A 3QWZB 2QCZA 4WWNA 2M1MA 2KT7A 2K6DB 2DAFA 2BGFA 4RM8A 1E8XA 1OTRB 4W9CA 2FCSA 2KXJA 1QQRA 3MC8A 5HG2A 2V3PA 2KDBA 1LO5D 4LNKA 3AEBB 3H1UA 3I63C 4P7IA 4B9KA 3ZUNA 1F2RI 3PZ8A 3QHTA 2M4NA 3DBHB 3RCZA 1L5PA 3H7PB 2WWZA 2GBJA 3W1YA 5G5GA 2J7QB 3BZDB 4FN2A 5G5HA 3R7RA 1V49A 3ECIA 4ICVA 5G2NA 4JPSA 4KX6B 1OQYA 4EZKA 2LHEA 2BPSA 3DHHC 5BMGA 2KN5A 3U2SC 4WWOA 2M17A 3MC9A 1VDVA 1GUAB 3RD2A 1KOTA 3VRBB 4N6EB 3QJZA 1I4XA 1JCKB 1ESFA 2XEWA 1YJ1A 5DPTA 1RLFA 1WRDB 4XC2A 2DZIA 1A5RA 5HKHA 1V97A 4JX1C 2MSED 1E7VA 1MHXA 4ANXA 3DVNV 3B9JA 1C9FA 4NJ6A 5KHQA 4EOYA 2C9WB 1J8CA 3KYCD 3WA0A 3KW5B 3M63B 1KJTA 4CQNA 1ZGUB 1ENFA 2JUOA 2DAJA 4B0MA 1OEYJ 3ZTCA 2HD5B 3RPFC 2W3SA 2KQSA 1L0XB 4XX5A 3VUXA 3URYA 3IBEA 2HTHA 5D94A 4LJOB 1I35A 4JL9A 2JYTA 3RUIB 1F52A 1N60A 1C3TA 4N59A 4N9F4 4TKNA 2BKFA 4W9DA 2D3AA 3L10B 3X0WA 1FO4A 3PZ7A 2N9XA 3V61A 1NI3A 1I4HA 3BY4B 4QAYA 1E8ZA 1V1PA 4W9EA 1OQQA 2MQJA 1HTQA 5KHOA 3Q3OC 4ANUA 3PV1A 2RMMA 4C4VB 4HLEA 1XLOA 3ZQ4A 3VTUA 2G4SA 3P2BA 4BVUC 1WX7A 4W9GA 4YTMB 2D11A 3N1ZC 2ZPNA 4RMAA 1C79A 3X23A 1FXTB 2AL3A 4AS1A 1LGRA 2JY6A 5DPWA 3M95A 4KKJA 1WY8A 1UD7A 2ZCBA 4BZAA 3TUOA 2O6VA 4I6PA 1SGHA 4OVUA 5DPSA 3VRAB 3BK2A 3SEBA 1YX6B 1L4DB 1N61A 1QOFA 5AUKA 3DBSA 2L00B 1J19A 4L23A 2PE6B 4MSMB 2M0AA 2BF8B 1QOBA 2KFKA 3W1SA 1ZDVA 2D2QA 4KSKC 4C7ZA 2LJ5A 3ZNHB 1SJED 3TJPA 2JSVX 2MCNB 4WQOB 3DBRI 3ZO5B 1E8YA 3CSTA 1L6UA 4HPLB 3OLMD 1ZKHA 3TEYA 4FJZA 2YLMA 1SEBD 2JU6X 4IWOA 1LQBA 2GLSA 3W2DA 2V1YA 4HVBA 3IFWB 1YN5A 4WAAA 4NJ7A 4REZA 3V62A 1FXIA 1Q10A 4LNOA 2INNE 1V6EA 3EFCA 4PYZA 1AN8A 2GRIA 4AJWA 2GB1A 1ET6A 2LI5A 2K9XA 4EEWA 2KAJA 3U4EG 2JXXA 2PTLA 1R4NI 4XGAB 5C1ZA 1C1YB 4HROA 4E3CA 4WURA 3B0AA 2AQ1B 2PVGC 1D4BA 1PQSA 1ROEA 2IY1B 1K51A 5EE3A 1UGJA 2WDQB 3LJ3A 3Q8BA 3OAWA 3A4RA 4P16A 1ZP0B 4YL8A 2XBBC 2BW2A 4RF1A 2DZJA 4BAXA 3PRPB 4KSLC 2QSDA 4NQLB 1MI0A 2ZJDA 2CU3A 4HXDA 2KMCA 2M8SA 3PRMB 2WXNA 2IY0B 3Q8AA 1HE8A 3V6CB 3VFKA 3W9CB 1BT0A 1YD8U 1E0ZA 1VCBA 1D3ZA 1T0QC 2N7JA 3AXCA 5DPRA 5CHWA 1N5XA 3L16A 1VZ6A 1EU4A 2HJ1A 4HK2A 2A4ZA 3AM9A 4NAMA 3N9YC 5IAAC 2WXIA 2ZVNA 2QMTA 2VH2A 4A90A 5D7GA 3KWLA 2WXLA 3WAPA 2L3ZA 1R4MI 3B2GA 3AE9B 2MBHA 2IZVB 4AJYB 1TS4A 2DZKA 2MJEA 2LUMA 1V1OA 3KYDD 3O65B 4IWPA 4FBJB 4C7YA 2WX0A 4ZOHC 4K81A 3MTNB 2JRIB 3B2FA 4K7UA 4YT0B 5CHVC 1NVID 1E6EB 3CMMB 1T6BX 3Q3FA 4C4VA 1ZW7A 4HDQA 3DBLI 2FCMA 2JYEA 2RD0A 3ZXVA 2WLBA 5AZFA 1D5ZC 4EZJA 3A1QA 1B1ZA 4S0RA 5JXVA 5FK9C 4RGOS 4G0NB 2MBOA 4G50A 4MT5A 3ZRFA 2IO1B 1F0ZA 2MW5A 3NVZA 3NY5A 3O13A 2IO3B 4MELA 4DXAB 5TSSA 2WHIA 3L0WB 5BYSA 1C77A 2Z8LA 2K1FA 3QIJA 3JSVA 2LGYA 3SHQA 1JRPA 4OHJA 3LYYA 2BT6A 2QHOA 2J0MA 4N58A 4ZRKA 4EE2A 2JXTA 3C19A 3WANA 3JW0X 2INDC 4KZCA 2ZCCA 1CMXB 3EFUA 4BKGA 3KUZA 1V2YA 2D07B 1WGYA 3FAHA 3C8YA 1T3QA 4WJPA 4CHKA 5AUIA 2LVOA 1WGGA 4M00A 1H4RA 2NBWB 1I4QA 1CK1A 4LDTD 1TY2A 1GC6A 1XCTL 4HKQA 3HVDA 1WM3A 2AQ2B 3PZDA 2MA9B 5FKAC 3UQAA 1MVKA 1YN4A 3LB8C 1ZDXA 4PK1A 4GXBA 2EELA 2CHZA 3KH0A 2JX5A 1V86A 2WGSA 2ICIA 3ENEA 1KH0A 3IAM1 4XYCA 2GI9A 2IGGA 3SD5A 1FPYA 1WWTA 1QZEA 3EA6A 2JZZA 1IYFA 3DCGA 4PS8A 1TKYA 1WXVA 2JQRB 2Y5BB 2MRPA 4F1SA 2KKCA 4JQWC 5BYRA 3UQBA 3AB5A 1VLBA 1V1PB 2IYDB 1EM7A 4GDLB 3U7DA 1SB3C 1DOIA 2WP9B 2V4LA 3R8BA 2J4XA 3ZJTA 3RNGC 4TSSA 1STEA 1WYWB 2MBQA 2BQQA 4II2B 2JRHA 2OJRA 2KFJA 2LRWA 2OHFA 4W9IA 4NAWA 3CWIA 4HEA1 3A9KB 2J42A 1L0YB 4AUQC 3T3OA 2LXCA 2TSSA 4DXGA 4ACFA 1KTKA 2WX1A 3Q2AC 3NZSA 4KGRA 3Q3NC 1P7FA 1WJUA 3OG5A 2D3GA 5FR3A 2BYTA 1K53A 2RR9A 5EE9A 2N9EB 3DBHI 4W9KA 3ETRA 1EF5A 2KVZA 2HJ8A 2YEPF 1JWMD 3BWUD 3IT6B 4TMAB 3PRZA 2IPKD 4WWMA 2JZ3B 2N1VA 3NRZA 4XDCA 1GC7A 4OVVA 4GN1A 3FC4A 4GB9A 2CU1A 2L83A 2QIEB 1P3QU 4NPNA 4BOSC 4HKZE 4M8NA 2K8BA 5IP4D 4HJKA 4E71A 2MP2B 1SBBB 2KC2A 1QOAA 2IO0B 1ZE3D 1VD2A 2VRRB 2BB6A 1JW9D 2C7NB 2L8JA 3SDLC 1UZXB 1XQQA 1WR6E 2WXGA 4IWQA 2W55A 1Q0WB 3T8MA 3DWMA 2KMMA 1FIQA 2J52A 4NJCA 2AX5A 1L7YA 3ML8A 5FR6A 2QDFA 2OOBB 2LVPA 4JWSC 4IW0A 4DHZB 3W5VB 3ZJUA 1OEYA 1U4AA 2W9NA 3TCAA 3VUYA 4BBNF 1R7SA 1IPGA 4LJPB 2G9HD 3JYUA 2K22A 3N30A 3PT2B 5JHAA 1P1AA 4O1NA 3R2IA 3AE1B 2WNMA 5C3JB 3DVGY 2KWCA 1YJJA 4MM3A 3RNCC 3WAOA 1FD6A 1WGKA 2DYBA 4B95A 2IGDA 4JWUC 3A9JA 2DX5B 1D5MC 3GZNI 3PPAA 3NJTA 3MFGA 4DQOC 1UWXA 1AYFA 3MJWA 3Q14C 1TKGA 4MSQB 3RT3B 2DHZA 2KZRA 4NZLB 3UIOB 3MC0B 4AP4C 2GMIC 3NVWA 1GAQB 1EWCA 3AULA 2NS5A 5EDSA 2G3QB 2KMAA 2Z0DB 3ZVVA 2KLCA 3AMZA 3NS1A 2XNAC 4A3OA 1N6ZA 2N9LA 1SSNA 1V8CA 1YQ4B 3DVGX 4OW0A 2N1WA 2N9KA 3HM3A 3GZNB 3U52E 2EKIA 2V9HA 3Q3MC 4WQMA 4RM9A 3ABVB 2Q5WD 2PLPA 4DWFA 2KX0A 4FJYA 2V3SA 2CJNA 2MH7A 1TZOA 3KVFB 3UIPB 1BUIC 1WE6A 1ZPSA 1NEKB 4KVGB 1T0YA 1XLQA 4GDLA 1VRAB 3APCA 3D32A 2Y3AA 3VR8B 3A33B 1XLPA 2Y5PA 1WR1A 1K50A 2WXHA 1HQRD 2UYZB 4BKTA 3AEGB 2C7MB 2KJRA 1MG4A 1K8RB 2ACZB 1IP9A 3A1QB 1YMHE 4LDTB 2AL6A 1ZXIA 3KUCB 4C80A 2JZPA 2K6QA 1WRIA 3AH7A 3A9KA 2ZVOA 3CSFA 1C4PA 3P63A 2J53A 2M0XA 3BYTB 3GE3C 4P1BC 2IDYA 3VAWA 3JSVB 4KIKA 1KF6B 1GNUA 1J7CA 1VR9A 4DXFA 1P7EA 3DOWA 1DOYA 2JPHA 1FM0D 4ZRPA 5L83A 4K7WA 5J2RA 5IA7A 1WI0A 2AWTA 3Q3JA 3OJ3A 2RSUA 2AQ3B 1GB1A 3VH3B 2ON8A 4ZRIA 2LJIA 2EMTA 4ASWC 2KVRA 4MH8A 2NCNA 1F9JA 1WZ0A 1I7HA 1E90A 1N5WA 2YVCA 4ITKA 4L1BA 3MHZA 3AE2B 4URKA 1NYRA 5J18A 2D3CA 2R2QA 4IDIA 1XLNA 1SXTA 2Z59B 5BMIA 4K3BA 1JMLA 4ICUA 2MP2A 1N63A 1CZPA 2WXJA 3B08A 4WH4A 4HWIB 1J7BA 4LK0M 1WJ4A 3H7SA 2L1AA 1PGAA 4XE0A 2WXOA 2HE7A 2LGDA 2REXA 3U7ZA 3RNAC 1YQ3B 1RYJA 2KNBA 3DQVA 2HTME 1XXGA 4GDKA 3PLVA 2FCQA 4DK5A 3BYYB 1ACCA 4TQ1A 1V9JA 1RFAA 1D6EC 2WXRA 2ASQA 1TYGB 2ZZPB 4KZ0A 1BMLC 4L2YA 3KUDB 4IC7B 3V05A 1UBQA 3VTVA 3U8ZA 2CJOA 1AARA 2IBIB 1OFFA 1SIFA 1V5OA 4EUTA 2WXQA 2KO3A 5D3IB 4ARIA 1H8CA 1L2NA 1WGHA 2PEAA 1OQRA 2C7HA 2SAKA 4J3OD 1GOZA 2VZKD 2KJHB 1KM7A 4IKGA 4NAWB 2C60A 3IHPC 4LLGM 2L0TA 2FE8A 2G1EA 1J7AA 4P1CC 3LDZE 1X1MA 3QX1A 4HPPA 2BWFA 4GLSC 2LD9A 1CJEA 3AE8B 1L6VA 1NYQA 3JVZX 3T3NA 3P4QB 2BYEA 4YTPB 1C4CA 2LGSA 2BB5A 2KDFB 1YJIA 1L4ZB 2DWQA 4HJGE 3TEWA 4AOFA 2KTRA 1VZ7A 2M19A 2K5PA 2CS4A 1IBXA 4MACA 3ALBA 5BYQA 3TIXA 2HDEA 2MLBA 4PS7A 2GBMA 1E10A 5JHBA 2R2OA 4IM0A 2UU7A 3HUIA 3QQ8B 5BO4B 3VXWA 3DHGC 3SFEB 4A6QA 3KWVA 4TV3A 4RFBA 4ZHOA 3M62B 3NVYA 2MHJA 2VH1A 4AQ7A 4FA6A 4FADA 3SR6A 4HCNB 3RNFC 4XZ4A 1VZ8A 4EKUA 3P4PB 1MJDA 3ZXRA 4MEMA 2JF5A 3RI7C 2KWVB 2ONQA 4WJQA 3E56A 4JE3B 1JWAD 1UUPA 2BWES 2LGIA 1CQVA 1PUTA 1JRUA 3RFZB 1I4PA 2DYMA 1C76A 4CYEA 4MM3B 3SU8X 3LXFA 3SFDB 4BKSA 3A9JB 4ANVA 4IM3A 3HHMA 1BXTA 2KDIA 5HHDG 3HIZA 2I2YA 3PLUA 1Q5WB 1M4VA 2RPVA 3ML9A 3EHVA 4UDUC 2ZPYA 1SF0A 1MG8A 2BS3B 1MFWA 3VUWA 1WE7A 4I6NB 5IKCM 3AEEB 1WYGA 5JH5C 3NZ3A 4FJVB 1WXQA 4ZHPA 5CX3A 3TL5A 4MGIE 1MPEA 2DNFA 4G11A 3BINA 1DOXA 1LFDA 1YOVB 2E6XA 3OJ4B 1S1QB 1Z5SB 4K7SA 3V60A 3ZKJC 4BKSD 1WZ3A 2CHWA 1TT5B 4PYUA 1F1HA 3AI5A 4FLHA 2ZW0A 1V80A 4OZAA 1HZ6A 2BTEA 3CF6E 4FHKA 2KOXA 5D2MB 2J0JA 1FCCC 4RGTA 1TJEA 3APFA 1EF1A 4IUMB 1GJZA 2KYWA 1IUEA 3H8HA 4LCDE 4MH0E 3BK1A 1RRBA 4W9JA 1RM6C 5LNK1 1E7UA 5H92C 1LXDA 1I4GA 3UINB 1ZOYB 4HRSA 5AZHA 1TS3A 1G6JA 1VJKA 4YSYB 4GMVA 3DDCB 2GBNA 3QCAA 3GP7A 2V4IB 2KN4A 4M02A 3I9V1 4HPMB 4FULA 4W9FA 4KIKB 2W82A 3AU5A 2WDTB 1EO6A 4GU2A 1XCQL 4S17A 4F7ZA 1FXAA 3HM6X 3KLSX 4LNFA 3N1YC 2G45B 1SIJA 2BYFA 3L17A 2KK8A 2GBKA 3H6NA 3TEZA 5E6JA 4M0WB 3PHWB 1NENB 3GS2A 3TMPB 1WX8A 2LASA 3UGBB 1JQ4A 3ZLZA 3K9PB 1PDXA 1GB4A 3I3TB 2DENB 3VR9B 3AE3B 4HCPB 2WDRB 4IM2A 1QLBB 2QJLA 2RDBC 2PPHA 3PHXB 2K0PA 3VHTC 4A3PA 5LXHA 4MDKE 1A70A 1NDDA 1QT9A 1PGXA 2L05A 3ZDTA 1FRDA 1UBIA 3N3KB 4JGHB 2X8XX 4US8A 5E6OA 4KGTA 2BYVE 1KLGD 5C2TB 3OWEB 2DZMA 2VZKB 5EE0A 2MWSB 1P9DU 4KKIA 4AWJA 4GDKB 1ZXHA 2K8HA 5BMHA 1F2RC 1SE9A 1Q1OA 1NBFC 1PYWD 1TBEA 1ET9A 3B1LX 4RGMA 2MBEA 1SE2A 2Y5CA 3AECB 1P98A 1WFYA 3NZUA 2LVQA 4EFOA 4RCOA 1AWDA 1Z2MA 2D3BA 2WU2B 3UF8A 4GGQA 2BS4B 3BVGA 4GOCA 2INPE 3CIRB 2FUG1 2JWZA 1F77A 2NMQA 5IOIA 5JZEB 3NUHB 1M94A 1XO3A 2LFIA 2PIAA 2WQYB 3RULA 2KTFA 3VDZA 4FHJA 2K8CA 5GXGB 1V81A 3RNBC 3C0RB 3W5UB 3EECA 4XWWA 1YX5B 2CHXA 3QARA 5D3DA 5CHFA 4JLCA 4B0EA 4WJNA 3RYTA 1WJNA 3IT4B 4K3CA 3PGEA 3RNEC 2KC1A 3VVWB 2LRUA 4KGSA 4DHJD 2N9PC 2JVCA 1Y8RC 1C4AA 2PE9A 1T5XD 4KDIC 3DPDA 2WXKA 4FXCA 3ZNZB 3ZIMA 3VH4B 1E9MA 5G55A 2XK5B 2NR2A 2K3UA 5E6PA
chains in the Genus database with same CATH topology
2FCQA 4DK5A 3NHEB 3L0WB 4TQ1A 1V9JA 2O6VB 3VQIA 1RFAA 2K1FA 3QK0A 3QIJA 3ZNGC 1WXAA 2ASQA 3JSVA 2LGYA 2ZZPB 1LM8B 3SHQA 4KZ0A 1XT9B 3AU4A 3KUDB 1YQBA 2QHOA 3V6EB 4IC7B 2J0MA 4ZRKA 2KTRB 1WM2A 2BKRB 1UBQA 1WMHB 1WH3A 3VTVA 3U8ZA 1ISNA 3DVNU 3JW0X 4KZCA 3WANA 2ZCCA 1AARA 1CMXB 2JT4B 3EFUA 2EKEC 4BKGA 2RPQA 4BOZB 2KDEB 3KUZA 1V2YA 2D07B 2IBIB 2KFKB 2D10A 1WGYA 3NS8A 2LGXA 1SIFA 4WJPA 2J0KA 3ONSA 4CHKA 3RZWC 1V5OA 4EUTA 5C23A 2KO3A 2LVOA 3APDA 3QWZB 1WGGA 2EMSA 1H8CA 4WWNA 1L2NA 1H4RA 2NBWB 2M1MA 1WGHA 2KJ6A 2PEAA 2C7HA 2IO2B 4LDTD 3TBLD 2GBRA 2K6DB 1GC6A 2DAFA 2KJHB 1KM7A 2BGFA 4RM8A 1E8XA 1OTRB 4W9CA 4NAWB 2FCSA 2C60A 3IHPC 1WM3A 4WJOA 2KXJA 2L0TA 3PZDA 2AEHA 2MA9B 2KDBA 3UQAA 3LDZE 2FAZA 3H1UA 4MGKE 4P7IA 4GXBA 1X1MA 2CHZA 3A4SC 3KH0A 4B9KA 3ZUNA 1V86A 2I1KA 3QX1A 2BWFA 2LD9A 3QHTA 2RGFA 3ENEA 2M4NA 4EZLA 3U30A 3RCZA 3SD5A 3JVZX 3H7PB 4MJSB 2WWZA 2GBJA 3W1YA 1WJ6A 2J7QB 1QZEA 2JZZA 5GMVA 2BYEA 3DCGA 4FN2A 1IYFA 4PS8A 3R7RA 1V49A 1WXVA 2Y5BB 2LWPA 3ECIA 2MRPA 2WYQA 2KKCA 4ICVA 5G2NA 4F1SA 4DHZE 4JQWC 1OQYA 4EZKA 3UQBA 2BPSA 2KDFB 4W9HA 2KN5A 3GOEA 5AZGA 4WWOA 2M17A 3H9DA 1GUAB 2IYDB 3RD2A 4AOFA 1KOTA 1S3SG 2DYOA 2KTRA 4TUUA 3QJZA 4GDLB 1XD3B 3U7DA 2XEWA 1YJ1A 2CS4A 5DPTA 1RLFA 2V4LA 3L13A 2Z0EB 2ZNVC 3ALBA 3TIXA 4PS3A 2MLBA 4PS7A 2GBMA 1WIAA 5JHBA 1WRDB 2R2OA 4XC2A 3T9LA 2DZIA 4IM0A 1A5RA 3QQ8B 5BO4B 5HKHA 1TZ1A 3VXWA 1WYWB 2FNJB 2MBQA 2MSED 1E7VA 5CTRC 4II2B 4TV3A 4ANXA 2JRHA 2OJRA 3DVNV 3M62B 2KFJA 2LRWA 2LUEA 3N32A 4W9IA 4NAWA 2N4FA 5AEKB 4NNJB 3A9KB 4NJ6A 5KHQA 3IG3A 4FA6A 4FADA 4AUQC 4EOYA 4HCNB 2KD0A 4XZ4A 2LXCA 2C9WB 2KQ7A 3KYCD 3QC8B 1J8CA 5LXIB 4EKUA 5LLIA 4TQ0A 3WA0A 3KW5B 3M63B 2O6VD 1KJTA 4MEMA 2WX1A 2JF5A 3NZSA 2KWVB 1ZGUB 4WJQA 4BFRA 1WJUA 2JUOA 2ZNVB 2FIFA 2DAJA 2BWES 1OEYJ 3ZTCA 1V5TA 2D3GA 2HD5B 1JRUA 2KQSA 4XX5A 3PSEB 3VUXA 3H7PA 2RR9A 3IBEA 2HTHA 4GIVA 5D94A 4LJOB 2N9EB 3RZFA 3DBHI 1I35A 2DYMA 4JL9A 4W9KA 3RUIB 4CYEA 1EF5A 2NBVB 1C3TA 4N9F4 2HJ8A 4MGZE 4TKNA 2BKFA 3S2AA 4W9DA 3L10B 3X0WA 3SU8X 4GSWA 3PRZA 2N9XA 3V61A 2JZ3B 4BKSA 3A9JB 2N1VA 1GC7A 4IM3A 3HHMA 4ANVA 4OVVA 4GN1A 3BY4B 3ZNID 2O2VB 4GB9A 2CU1A 2KDIA 1E8ZA 3EC8A 3HIZA 4CO7A 1P3QU 2N7DA 4NPNA 4IG7B 4W9EA 4BOSC 2MQJA 2NPTB 2MX2A 3PLUA 1Q5WB 4M8NA 2K8BA 4HJKA 5KHOA 4M8MA 4ANUA 2MP2B 3PV1A 4E71A 1WXSA 3ML9A 1I42A 2KC2A 3EHVA 4HLEA 4JIOU 2ZPYA 3VTUA 2G4SA 3P2BA 2IO0B 2GOWA 4BVUC 1MG8A 1UH6A 1WX7A 1VD2A 4DDGD 4W9GA 2K25A 2VRRB 2D11A 3VUWA 1WE7A 4I6NB 2ZPNA 5JH5C 2C7NB 2CR5A 2L8JA 4RMAA 3SDLC 1UZXB 3X23A 1XQQA 4FJVB 1WR6E 1FXTB 2AL3A 1E5WA 4IWQA 3WALA 1Q0WB 3T8MA 5CX3A 3TL5A 4MGIE 2JY6A 2ZEQA 5DPWA 3NOBA 1L7YA 2XK5A 3M95A 3ML8A 2OOBB 2LVPA 4G11A 5FR6A 3BINA 1TTNA 4IW0A 1J0GA 1WY8A 1LFDA 3OJ4B 4DHZB 1UD7A 1S1QB 1Z5SB 2ZCBA 3HK0A 4K7SA 2KHWB 4NQKE 3V60A 3ZKJC 4BKSD 1WZ3A 4I6LB 2CHWA 3M3JA 2O6VA 3R66C 4I6PA 1OEYA 1SGHA 1U4AA 3AI5A 4PYUA 2W9NA 4FLHA 3TCAA 4OVUA 1V80A 5DPSA 3VUYA 4BBNF 1IPGA 4G3XB 1YX6B 3R3MA 4LJPB 3CF6E 2B3AA 2G4DB 2KOXA 3JYUA 4FHKA 5D2MB 3DBSA 3N30A 2J0JA 4II3B 1WMHA 3PT2B 2L00B 5JHAA 1J19A 1P1AA 3APFA 1EUVB 2L7RA 2PE6B 1EF1A 4IUMB 1GJZA 4MSMB 3DVGY 2KWCA 2BF8B 4MM3A 2KFKA 3W1SA 2D2QA 4KSKC 3WAOA 4K1RB 3MHSD 2LJ5A 3ZNHB 2DYBA 4B95A 2CKHB 2KX3A 4LCDE 4MH0E 1KLVA 1RRBA 4W9JA 3TJPA 3A9JA 4E74A 2DX5B 4WQOB 2MCNB 1WGRA 1E7UA 3GZNI 3VTWA 1LXDA 3PPAA 3UINB 3DBRI 3ZO5B 3K9OB 1E8YA 5AZHA 3CSTA 4HPLB 1G6JA 3OLMD 1ZKHA 3MJWA 4FJZA 2YLMA 4DDID 4IWOA 4GMVA 4MSQB 3DDCB 1LQBA 3RT3B 2FIDA 2GBNA 2DHZA 2KZRA 3QCAA 1RAXA 3UIOB 2V1YA 4AP4C 4HVBA 3IFWB 2GMIC 4WAAA 4NJ7A 2LZ6A 4HPMB 3V62A 1WX9A 3AULA 4FULA 4W9FA 2NS5A 4KIKB 4DHJB 3AU5A 5EDSA 1V6EA 2WDTB 5TR5A 3ZTDA 4PYZA 2G3QB 4AJWA 5D6JB 1EO6A 2KMAA 4GU2A 4BBNC 2LI5A 4F7ZA 2Z0DB 3ZVVA 2KLCA 4EEWA 4ZRJA 3HM6X 2L0FA 4A3OA 2JXXA 3WAMA 2G45B 4MJSA 2BYFA 3L17A 2KK8A 1R4NI 2GBKA 2NVUI 3H6NA 5C1ZA 3DVGX 2N1WA 3ZW3A 1C1YB 3IVFA 3HM3A 4E3CA 1WXMA 2KANA 4M0WB 3B0AA 3PHWB 3TMPB 2A5UA 1WX8A 2LASA 3UGBB 1PQSA 2IY1B 4RM9A 3ZLZA 3LJ3A 3K9PB 3OAWA 3I3TB 2DENB 3A4RA 4HDOA 2KX0A 4DWFA 4WWPA 4HCPB 4YL8A 2XBBC 4FJYA 2FUHB 4ZDVA 4IM2A 2DZJA 2V3SA 3PRPB 4KSLC 4NQLB 2PPHA 3PHXB 3VHTC 2LXAA 3KVFB 2ZJDA 3UIPB 4A3PA 5LXHA 1WE6A 4MDKE 4HXDA 1T0YA 4KVGB 4GDLA 2KMCA 2M8SA 1NDDA 3APCA 3D32A 3PRMB 2L05A 3ZDTA 2IY0B 4ANWA 3V6CB 1HE8A 3VFKA 1UBIA 3ZRCA 3R7QA 3A33B 1BT0A 1YD8U 3N3KB 1UGMA 5J17A 1WR1A 3PTFC 4JGHB 2UYZB 1VCBA 4BKTA 2C7MB 3ZIMA 2KJRA 5E6OA 1D3ZA 2BYVE 1K8RB 2L76A 1IP9A 3A1QB 3AXCA 5DPRA 4LDTB 2AL6A 5CHWA 2DZMA 3L16A 4F8CB 2UWQA 1OGWA 3KUCB 2MWSB 1P9DU 2K6QA 4HK2A 4AWJA 2A4ZA 5L95C 4X57B 3A9KA 4GDKB 2ZVOA 3CSFA 5IAAC 2K8HA 2M0XA 1SE9A 1Q1OA 1NBFC 1TBEA 3B1LX 2ZVNA 2MBEA 2MBBB 3VAWA 3JSVB 4KIKA 1P0RA 2FCNA 5D7GA 1P98A 1GNUA 1WFYA 3NZUA 2LVQA 3WIMA 4EFOA 3WAPA 2L3ZA 1Z2MA 3UF8A 4GGQA 4DBGA 1R4MI 3DOWA 4J6IA 2JPHA 4GOCA 4KDLB 4W9LA 2NBUA 4K7WA 4B6WA 5L83A 5J2RA 2JWZA 5E6NA 5IA7A 1WI0A 2MBHA 2IZVB 2AWTA 4AJYB 3Q3JA 1WF9A 3OJ3A 2RSUA 5JZEB 2KLGA 1M94A 5DCNA 4ZRIA 3VH3B 2DZKA 1WGDA 2EMTA 4ASWC 2KVRA 4ZYNA 3KYDD 3O65B 4IWPA 4FBJB 2N7EA 2NCNA 3RULA 2KWUB 1F9JA 1WZ0A 2KTFA 3VDZA 4FHJA 2WX0A 2K8CA 1E90A 1V81A 1GG3A 2YVCA 3QAQA 3C0RB 2JRIB 1NI2A 3MTNB 4K7UA 2O2VA 4K81A 3EECA 4URKA 1E8WA 5J18A 2R2QA 3PVLA 2NPTA 4MGYE 1YX5B 2C5LC 2CHXA 3QA8A 3QARA 1TGZB 2Z59B 2K39A 4ICUA 5CHVC 2MP2A 5CHFA 4JLCA 3CMMB 3Q3FA 4WJNA 3RYTA 1WJNA 1ZW7A 3B08A 3L08A 4A20A 4HDQA 3PGEA 3DBLI 2FCMA 2RD0A 4HWIB 1WJ4A 2KC1A 3VVWB 3H7SA 1YIWA 2LRUA 4NY0A 2N9PC 4DHJD 2JVCA 1Y8RC 4KV2A 5AZFA 2PE9A 4EZJA 2PJHA 2HE7A 2LGDA 4KDIC 2REXA 3W1SC 3DPDA 3A1QA 2AYOB 4G0NB 2MBOA 4G50A 3PREA 2IO1B 2KNBA 2MW5A 3DQVA 3NY5A 3ZNZB 3VH4B 3ZRFA 3L54A 3PS6A 5G55A 2IO3B 1UELA 4MELA 4DXAB 2XK5B 2NR2A 4GDKA 3ZDMC 5E6PA 2I1JA 3PLVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCQ A;  4DK5 A;  3NHE B;  3L0W B;  4TQ1 A;  1V9J A;  2O6V B;  3VQI A;  1RFA A;  2K1F A;  3QK0 A;  3QIJ A;  3ZNG C;  1WXA A;  2ASQ A;  3JSV A;  2LGY A;  2ZZP B;  1LM8 B;  3SHQ A;  4KZ0 A;  1XT9 B;  3AU4 A;  3KUD B;  1YQB A;  2QHO A;  3V6E B;  4IC7 B;  2J0M A;  4ZRK A;  2KTR B;  1WM2 A;  2BKR B;  1UBQ A;  1WMH B;  1WH3 A;  3VTV A;  3U8Z A;  1ISN A;  3DVN U;  3JW0 X;  4KZC A;  3WAN A;  2ZCC A;  1AAR A;  1CMX B;  2JT4 B;  3EFU A;  2EKE C;  4BKG A;  2RPQ A;  4BOZ B;  2KDE B;  3KUZ A;  1V2Y A;  2D07 B;  2IBI B;  2KFK B;  2D10 A;  1WGY A;  3NS8 A;  2LGX A;  1SIF A;  4WJP A;  2J0K A;  3ONS A;  4CHK A;  3RZW C;  1V5O A;  4EUT A;  5C23 A;  2KO3 A;  2LVO A;  3APD A;  3QWZ B;  1WGG A;  2EMS A;  1H8C A;  4WWN A;  1L2N A;  1H4R A;  2NBW B;  2M1M A;  1WGH A;  2KJ6 A;  2PEA A;  2C7H A;  2IO2 B;  4LDT D;  3TBL D;  2GBR A;  2K6D B;  1GC6 A;  2DAF A;  2KJH B;  1KM7 A;  2BGF A;  4RM8 A;  1E8X A;  1OTR B;  4W9C A;  4NAW B;  2FCS A;  2C60 A;  3IHP C;  1WM3 A;  4WJO A;  2KXJ A;  2L0T A;  3PZD A;  2AEH A;  2MA9 B;  2KDB A;  3UQA A;  3LDZ E;  2FAZ A;  3H1U A;  4MGK E;  4P7I A;  4GXB A;  1X1M A;  2CHZ A;  3A4S C;  3KH0 A;  4B9K A;  3ZUN A;  1V86 A;  2I1K A;  3QX1 A;  2BWF A;  2LD9 A;  3QHT A;  2RGF A;  3ENE A;  2M4N A;  4EZL A;  3U30 A;  3RCZ A;  3SD5 A;  3JVZ X;  3H7P B;  4MJS B;  2WWZ A;  2GBJ A;  3W1Y A;  1WJ6 A;  2J7Q B;  1QZE A;  2JZZ A;  5GMV A;  2BYE A;  3DCG A;  4FN2 A;  1IYF A;  4PS8 A;  3R7R A;  1V49 A;  1WXV A;  2Y5B B;  2LWP A;  3ECI A;  2MRP A;  2WYQ A;  2KKC A;  4ICV A;  5G2N A;  4F1S A;  4DHZ E;  4JQW C;  1OQY A;  4EZK A;  3UQB A;  2BPS A;  2KDF B;  4W9H A;  2KN5 A;  3GOE A;  5AZG A;  4WWO A;  2M17 A;  3H9D A;  1GUA B;  2IYD B;  3RD2 A;  4AOF A;  1KOT A;  1S3S G;  2DYO A;  2KTR A;  4TUU A;  3QJZ A;  4GDL B;  1XD3 B;  3U7D A;  2XEW A;  1YJ1 A;  2CS4 A;  5DPT A;  1RLF A;  2V4L A;  3L13 A;  2Z0E B;  2ZNV C;  3ALB A;  3TIX A;  4PS3 A;  2MLB A;  4PS7 A;  2GBM A;  1WIA A;  5JHB A;  1WRD B;  2R2O A;  4XC2 A;  3T9L A;  2DZI A;  4IM0 A;  1A5R A;  3QQ8 B;  5BO4 B;  5HKH A;  1TZ1 A;  3VXW A;  1WYW B;  2FNJ B;  2MBQ A;  2MSE D;  1E7V A;  5CTR C;  4II2 B;  4TV3 A;  4ANX A;  2JRH A;  2OJR A;  3DVN V;  3M62 B;  2KFJ A;  2LRW A;  2LUE A;  3N32 A;  4W9I A;  4NAW A;  2N4F A;  5AEK B;  4NNJ B;  3A9K B;  4NJ6 A;  5KHQ A;  3IG3 A;  4FA6 A;  4FAD A;  4AUQ C;  4EOY A;  4HCN B;  2KD0 A;  4XZ4 A;  2LXC A;  2C9W B;  2KQ7 A;  3KYC D;  3QC8 B;  1J8C A;  5LXI B;  4EKU A;  5LLI A;  4TQ0 A;  3WA0 A;  3KW5 B;  3M63 B;  2O6V D;  1KJT A;  4MEM A;  2WX1 A;  2JF5 A;  3NZS A;  2KWV B;  1ZGU B;  4WJQ A;  4BFR A;  1WJU A;  2JUO A;  2ZNV B;  2FIF A;  2DAJ A;  2BWE S;  1OEY J;  3ZTC A;  1V5T A;  2D3G A;  2HD5 B;  1JRU A;  2KQS A;  4XX5 A;  3PSE B;  3VUX A;  3H7P A;  2RR9 A;  3IBE A;  2HTH A;  4GIV A;  5D94 A;  4LJO B;  2N9E B;  3RZF A;  3DBH I;  1I35 A;  2DYM A;  4JL9 A;  4W9K A;  3RUI B;  4CYE A;  1EF5 A;  2NBV B;  1C3T A;  4N9F 4;  2HJ8 A;  4MGZ E;  4TKN A;  2BKF A;  3S2A A;  4W9D A;  3L10 B;  3X0W A;  3SU8 X;  4GSW A;  3PRZ A;  2N9X A;  3V61 A;  2JZ3 B;  4BKS A;  3A9J B;  2N1V A;  1GC7 A;  4IM3 A;  3HHM A;  4ANV A;  4OVV A;  4GN1 A;  3BY4 B;  3ZNI D;  2O2V B;  4GB9 A;  2CU1 A;  2KDI A;  1E8Z A;  3EC8 A;  3HIZ A;  4CO7 A;  1P3Q U;  2N7D A;  4NPN A;  4IG7 B;  4W9E A;  4BOS C;  2MQJ A;  2NPT B;  2MX2 A;  3PLU A;  1Q5W B;  4M8N A;  2K8B A;  4HJK A;  5KHO A;  4M8M A;  4ANU A;  2MP2 B;  3PV1 A;  4E71 A;  1WXS A;  3ML9 A;  1I42 A;  2KC2 A;  3EHV A;  4HLE A;  4JIO U;  2ZPY A;  3VTU A;  2G4S A;  3P2B A;  2IO0 B;  2GOW A;  4BVU C;  1MG8 A;  1UH6 A;  1WX7 A;  1VD2 A;  4DDG D;  4W9G A;  2K25 A;  2VRR B;  2D11 A;  3VUW A;  1WE7 A;  4I6N B;  2ZPN A;  5JH5 C;  2C7N B;  2CR5 A;  2L8J A;  4RMA A;  3SDL C;  1UZX B;  3X23 A;  1XQQ A;  4FJV B;  1WR6 E;  1FXT B;  2AL3 A;  1E5W A;  4IWQ A;  3WAL A;  1Q0W B;  3T8M A;  5CX3 A;  3TL5 A;  4MGI E;  2JY6 A;  2ZEQ A;  5DPW A;  3NOB A;  1L7Y A;  2XK5 A;  3M95 A;  3ML8 A;  2OOB B;  2LVP A;  4G11 A;  5FR6 A;  3BIN A;  1TTN A;  4IW0 A;  1J0G A;  1WY8 A;  1LFD A;  3OJ4 B;  4DHZ B;  1UD7 A;  1S1Q B;  1Z5S B;  2ZCB A;  3HK0 A;  4K7S A;  2KHW B;  4NQK E;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  4I6L B;  2CHW A;  3M3J A;  2O6V A;  3R66 C;  4I6P A;  1OEY A;  1SGH A;  1U4A A;  3AI5 A;  4PYU A;  2W9N A;  4FLH A;  3TCA A;  4OVU A;  1V80 A;  5DPS A;  3VUY A;  4BBN F;  1IPG A;  4G3X B;  1YX6 B;  3R3M A;  4LJP B;  3CF6 E;  2B3A A;  2G4D B;  2KOX A;  3JYU A;  4FHK A;  5D2M B;  3DBS A;  3N30 A;  2J0J A;  4II3 B;  1WMH A;  3PT2 B;  2L00 B;  5JHA A;  1J19 A;  1P1A A;  3APF A;  1EUV B;  2L7R A;  2PE6 B;  1EF1 A;  4IUM B;  1GJZ A;  4MSM B;  3DVG Y;  2KWC A;  2BF8 B;  4MM3 A;  2KFK A;  3W1S A;  2D2Q A;  4KSK C;  3WAO A;  4K1R B;  3MHS D;  2LJ5 A;  3ZNH B;  2DYB A;  4B95 A;  2CKH B;  2KX3 A;  4LCD E;  4MH0 E;  1KLV A;  1RRB A;  4W9J A;  3TJP A;  3A9J A;  4E74 A;  2DX5 B;  4WQO B;  2MCN B;  1WGR A;  1E7U A;  3GZN I;  3VTW A;  1LXD A;  3PPA A;  3UIN B;  3DBR I;  3ZO5 B;  3K9O B;  1E8Y A;  5AZH A;  3CST A;  4HPL B;  1G6J A;  3OLM D;  1ZKH A;  3MJW A;  4FJZ A;  2YLM A;  4DDI D;  4IWO A;  4GMV A;  4MSQ B;  3DDC B;  1LQB A;  3RT3 B;  2FID A;  2GBN A;  2DHZ A;  2KZR A;  3QCA A;  1RAX A;  3UIO B;  2V1Y A;  4AP4 C;  4HVB A;  3IFW B;  2GMI C;  4WAA A;  4NJ7 A;  2LZ6 A;  4HPM B;  3V62 A;  1WX9 A;  3AUL A;  4FUL A;  4W9F A;  2NS5 A;  4KIK B;  4DHJ B;  3AU5 A;  5EDS A;  1V6E A;  2WDT B;  5TR5 A;  3ZTD A;  4PYZ A;  2G3Q B;  4AJW A;  5D6J B;  1EO6 A;  2KMA A;  4GU2 A;  4BBN C;  2LI5 A;  4F7Z A;  2Z0D B;  3ZVV A;  2KLC A;  4EEW A;  4ZRJ A;  3HM6 X;  2L0F A;  4A3O A;  2JXX A;  3WAM A;  2G45 B;  4MJS A;  2BYF A;  3L17 A;  2KK8 A;  1R4N I;  2GBK A;  2NVU I;  3H6N A;  5C1Z A;  3DVG X;  2N1W A;  3ZW3 A;  1C1Y B;  3IVF A;  3HM3 A;  4E3C A;  1WXM A;  2KAN A;  4M0W B;  3B0A A;  3PHW B;  3TMP B;  2A5U A;  1WX8 A;  2LAS A;  3UGB B;  1PQS A;  2IY1 B;  4RM9 A;  3ZLZ A;  3LJ3 A;  3K9P B;  3OAW A;  3I3T B;  2DEN B;  3A4R A;  4HDO A;  2KX0 A;  4DWF A;  4WWP A;  4HCP B;  4YL8 A;  2XBB C;  4FJY A;  2FUH B;  4ZDV A;  4IM2 A;  2DZJ A;  2V3S A;  3PRP B;  4KSL C;  4NQL B;  2PPH A;  3PHX B;  3VHT C;  2LXA A;  3KVF B;  2ZJD A;  3UIP B;  4A3P A;  5LXH A;  1WE6 A;  4MDK E;  4HXD A;  1T0Y A;  4KVG B;  4GDL A;  2KMC A;  2M8S A;  1NDD A;  3APC A;  3D32 A;  3PRM B;  2L05 A;  3ZDT A;  2IY0 B;  4ANW A;  3V6C B;  1HE8 A;  3VFK A;  1UBI A;  3ZRC A;  3R7Q A;  3A33 B;  1BT0 A;  1YD8 U;  3N3K B;  1UGM A;  5J17 A;  1WR1 A;  3PTF C;  4JGH B;  2UYZ B;  1VCB A;  4BKT A;  2C7M B;  3ZIM A;  2KJR A;  5E6O A;  1D3Z A;  2BYV E;  1K8R B;  2L76 A;  1IP9 A;  3A1Q B;  3AXC A;  5DPR A;  4LDT B;  2AL6 A;  5CHW A;  2DZM A;  3L16 A;  4F8C B;  2UWQ A;  1OGW A;  3KUC B;  2MWS B;  1P9D U;  2K6Q A;  4HK2 A;  4AWJ A;  2A4Z A;  5L95 C;  4X57 B;  3A9K A;  4GDK B;  2ZVO A;  3CSF A;  5IAA C;  2K8H A;  2M0X A;  1SE9 A;  1Q1O A;  1NBF C;  1TBE A;  3B1L X;  2ZVN A;  2MBE A;  2MBB B;  3VAW A;  3JSV B;  4KIK A;  1P0R A;  2FCN A;  5D7G A;  1P98 A;  1GNU A;  1WFY A;  3NZU A;  2LVQ A;  3WIM A;  4EFO A;  3WAP A;  2L3Z A;  1Z2M A;  3UF8 A;  4GGQ A;  4DBG A;  1R4M I;  3DOW A;  4J6I A;  2JPH A;  4GOC A;  4KDL B;  4W9L A;  2NBU A;  4K7W A;  4B6W A;  5L83 A;  5J2R A;  2JWZ A;  5E6N A;  5IA7 A;  1WI0 A;  2MBH A;  2IZV B;  2AWT A;  4AJY B;  3Q3J A;  1WF9 A;  3OJ3 A;  2RSU A;  5JZE B;  2KLG A;  1M94 A;  5DCN A;  4ZRI A;  3VH3 B;  2DZK A;  1WGD A;  2EMT A;  4ASW C;  2KVR A;  4ZYN A;  3KYD D;  3O65 B;  4IWP A;  4FBJ B;  2N7E A;  2NCN A;  3RUL A;  2KWU B;  1F9J A;  1WZ0 A;  2KTF A;  3VDZ A;  4FHJ A;  2WX0 A;  2K8C A;  1E90 A;  1V81 A;  1GG3 A;  2YVC A;  3QAQ A;  3C0R B;  2JRI B;  1NI2 A;  3MTN B;  4K7U A;  2O2V A;  4K81 A;  3EEC A;  4URK A;  1E8W A;  5J18 A;  2R2Q A;  3PVL A;  2NPT A;  4MGY E;  1YX5 B;  2C5L C;  2CHX A;  3QA8 A;  3QAR A;  1TGZ B;  2Z59 B;  2K39 A;  4ICU A;  5CHV C;  2MP2 A;  5CHF A;  4JLC A;  3CMM B;  3Q3F A;  4WJN A;  3RYT A;  1WJN A;  1ZW7 A;  3B08 A;  3L08 A;  4A20 A;  4HDQ A;  3PGE A;  3DBL I;  2FCM A;  2RD0 A;  4HWI B;  1WJ4 A;  2KC1 A;  3VVW B;  3H7S A;  1YIW A;  2LRU A;  4NY0 A;  2N9P C;  4DHJ D;  2JVC A;  1Y8R C;  4KV2 A;  5AZF A;  2PE9 A;  4EZJ A;  2PJH A;  2HE7 A;  2LGD A;  4KDI C;  2REX A;  3W1S C;  3DPD A;  3A1Q A;  2AYO B;  4G0N B;  2MBO A;  4G50 A;  3PRE A;  2IO1 B;  2KNB A;  2MW5 A;  3DQV A;  3NY5 A;  3ZNZ B;  3VH4 B;  3ZRF A;  3L54 A;  3PS6 A;  5G55 A;  2IO3 B;  1UEL A;  4MEL A;  4DXA B;  2XK5 B;  2NR2 A;  4GDK A;  3ZDM C;  5E6P A;  2I1J A;  3PLV A; 
#chains in the Genus database with same CATH topology
 2WS3 B;  1KFY B;  2PKO A;  1XF5 L;  3VQI A;  3ZNG C;  1WXA A;  1UF0 A;  4M01 A;  4ZRQ A;  1PGB A;  2KTR B;  2KWD A;  2BKR B;  1WMH B;  1WH3 A;  3DVN U;  3ZYY X;  1IBX B;  2E3T A;  2EKE C;  2WU5 B;  2RPQ A;  4BOZ B;  2KDE B;  2D10 A;  3NS8 A;  3AE4 B;  2BBC A;  2PVO D;  3RZW C;  1FCL A;  3APD A;  2EMS A;  2KJ6 A;  2IO2 B;  3TBL D;  2GBR A;  2NTS A;  4WJO A;  1HZ5 A;  2AEH A;  4LNN A;  2OED A;  2RDG A;  2FAZ A;  4MGK E;  3A4S C;  2I1K A;  1FMA D;  2RGF A;  4EZL A;  2DLB A;  4H2A A;  4D2K A;  3U30 A;  2IJ0 A;  3FKY A;  2W3R A;  4MJS B;  3N1X C;  1WJ6 A;  5GMV A;  5IO9 A;  2LWP A;  5MPO A;  4YXD B;  1AW7 A;  2WYQ A;  4DHZ E;  3P4R B;  2WDV B;  4XWT A;  4M0W A;  3MP9 A;  4W9H A;  3GOE A;  1SE3 A;  1B9R A;  5AZG A;  5H8Y E;  3H9D A;  1T0R C;  3BVM A;  1S3S G;  2DYO A;  4TUU A;  2NTT A;  1JWB D;  1XD3 B;  1K52 A;  3L13 A;  2Z0E B;  2ZNV C;  2D5G A;  4PS3 A;  3GB1 A;  1WIA A;  3T9L A;  1TZ1 A;  2X38 A;  3BII D;  2FNJ B;  2JWU A;  5CTR C;  4YSZ B;  1PFD A;  3BVZ A;  1MHH E;  2KDM A;  2LUE A;  3N32 A;  5AEK B;  1FNV A;  2N4F A;  3AEA B;  2L32 A;  4NNJ B;  1FNW A;  3KQ4 A;  3NVV A;  2FBW B;  3IG3 A;  1TIF A;  4PT5 A;  2KD0 A;  2KQ7 A;  3QC8 B;  5LXI B;  1JWU D;  5LLI A;  4TQ0 A;  2O6V D;  1GPX A;  3I57 A;  4BFR A;  2ZNV B;  2FIF A;  1YNT E;  1V5T A;  4C00 A;  2INC C;  1HXY D;  4ARC A;  3PSE B;  3H7P A;  3FIL B;  3V3X A;  4GIV A;  3RZF A;  3AN1 A;  2NBV B;  1IGC A;  4C56 C;  4MGZ E;  3DBR B;  3S2A A;  2N0S B;  1TS5 A;  3TSS A;  3R2T A;  1TKE A;  4GSW A;  1QIL A;  1EU3 A;  3ZNI D;  2O2V B;  3EC8 A;  4CO7 A;  2N7D A;  4IG7 B;  1RWS A;  2NPT B;  2MX2 A;  3DHI C;  3EUB 2;  4M8M A;  1QF6 A;  1WXS A;  1I42 A;  4JIO U;  4RH6 A;  2ZW1 A;  3Q8E A;  2GOW A;  2R61 A;  3I5J C;  1UH6 A;  2QEJ C;  4DDG D;  4RNA A;  2K25 A;  1R4N B;  4WIP A;  5HI1 A;  1UWM A;  3RN9 C;  1C78 A;  2CR5 A;  1RFK A;  4R3D A;  1E5W A;  3P42 A;  4OVZ A;  3WAL A;  2B76 B;  2WXF A;  1QOG A;  2ZEQ A;  3NOB A;  2WXP A;  2XK5 A;  1J0G A;  1TTN A;  4OZB A;  4RGN A;  3HK0 A;  2KHW B;  4NQK E;  4I6L B;  3M3J A;  1HEZ E;  3R66 C;  2BVC A;  4G3X B;  3R3M A;  4A8X C;  2B3A A;  2G4D B;  1E7P B;  2L52 A;  4II3 B;  1WMH A;  4US9 A;  1EUV B;  2L7R A;  4YWG G;  3AV8 A;  3HRD D;  1N62 A;  4K1R B;  3MHS D;  1FFV A;  2CKH B;  2KX3 A;  3EGR A;  1I4R A;  1KLV A;  4E74 A;  1WGR A;  2KAC A;  3VTW A;  2IGH A;  3K9O B;  1UNS A;  2YEP B;  2W54 A;  2MJ3 A;  4DDI D;  2FID A;  2M56 B;  2RDH A;  1RAX A;  3MJ5 A;  1R4M B;  1WSP A;  2WXM A;  1JAL A;  2LZ6 A;  2PW9 A;  1WX9 A;  4XDD A;  2MEK A;  4DHJ B;  5TR5 A;  3ZTD A;  1D5X C;  3IXS A;  1DGJ A;  2H88 B;  5D6J B;  4BBN C;  2LMC A;  3N20 C;  4ZRJ A;  1FRR A;  2L0F A;  3WAM A;  4MJS A;  2NVU I;  3ZW3 A;  3IVF A;  3WCQ A;  1WXM A;  2KAN A;  3P1M A;  2A5U A;  1EWY C;  1DYQ A;  3P4S B;  4HDO A;  4WWP A;  2FUH B;  4ZDV A;  3AE6 B;  3DBL B;  2LXA A;  4ANW A;  3ZRC A;  3R7Q A;  5HFY A;  2LHD A;  1UGM A;  5J17 A;  1TS2 A;  2XN9 C;  3AE5 B;  3DWG C;  3PTF C;  1Y56 A;  1L0V B;  2QIL A;  2L76 A;  3ZJV A;  4F8C B;  2UWQ A;  1OGW A;  2MJD A;  2LEK A;  1ZUD 2;  5L95 C;  5I4D A;  3AE7 B;  4X57 B;  4YSX B;  4RF0 A;  3TEX A;  2PMV A;  4USA A;  4WAF A;  3UI3 A;  2MBB B;  1KLU D;  4IOI E;  1P0R A;  1HTO A;  2FCN A;  3Q69 A;  2QC8 A;  3WIM A;  2I38 A;  5EE1 A;  4DBG A;  4J6I A;  4KDL B;  1FEH A;  4W9L A;  4YTN B;  2NBU A;  4B6W A;  4ZYS A;  3FIL A;  5E6N A;  2OJW A;  1WF9 A;  3NG0 A;  2KLG A;  3GE8 C;  5DCN A;  2BS2 B;  1WGD A;  1JWS D;  1IGD A;  4ZYN A;  1YN3 A;  2KQ4 X;  4LNI A;  2N7E A;  3AEF B;  3Q8C A;  2KWU B;  1T0S C;  4A9A A;  2SEB D;  1GG3 A;  3QAQ A;  1NI2 A;  2O2V A;  1E8W A;  3PVL A;  2NPT A;  4MGY E;  1TY0 A;  3RMK C;  2DBY A;  2C5L C;  5T8I A;  3QA8 A;  1TGZ B;  2K39 A;  3L08 A;  4A20 A;  4NY0 A;  1YIW A;  4KV2 A;  2PJH A;  4LTU A;  4Q2J A;  3W1S C;  1XEE A;  1FFU A;  1SJH D;  4A55 A;  2AYO B;  3Q8F A;  3PRE A;  3AED B;  3J9C A;  3L54 A;  3PS6 A;  1UEL A;  3ZDM C;  3HVZ A;  2I1J A;  3IAS 1;  1KRH A;  1SE4 A;  3NHE B;  1FNU A;  1QKZ A;  2H89 B;  2O6V B;  3QK0 A;  2V0G A;  4P6V F;  1LM8 B;  3L4P A;  1JRO A;  1XT9 B;  3AU4 A;  1HA5 A;  1YQB A;  3V6E B;  1WM2 A;  4OZC A;  1ISN A;  2JT4 B;  3ZGZ A;  2KFK B;  3E9S A;  2LGX A;  3PO0 A;  2J0K A;  2V3N A;  3ONS A;  5IN7 A;  3Q6B A;  5C23 A;  3QWZ B;  2QCZ A;  4WWN A;  2M1M A;  2KT7 A;  2K6D B;  2DAF A;  2BGF A;  4RM8 A;  1E8X A;  1OTR B;  4W9C A;  2FCS A;  2KXJ A;  1QQR A;  3MC8 A;  5HG2 A;  2V3P A;  2KDB A;  1LO5 D;  4LNK A;  3AEB B;  3H1U A;  3I63 C;  4P7I A;  4B9K A;  3ZUN A;  1F2R I;  3PZ8 A;  3QHT A;  2M4N A;  3DBH B;  3RCZ A;  1L5P A;  3H7P B;  2WWZ A;  2GBJ A;  3W1Y A;  5G5G A;  2J7Q B;  3BZD B;  4FN2 A;  5G5H A;  3R7R A;  1V49 A;  3ECI A;  4ICV A;  5G2N A;  4JPS A;  4KX6 B;  1OQY A;  4EZK A;  2LHE A;  2BPS A;  3DHH C;  5BMG A;  2KN5 A;  3U2S C;  4WWO A;  2M17 A;  3MC9 A;  1VDV A;  1GUA B;  3RD2 A;  1KOT A;  3VRB B;  4N6E B;  3QJZ A;  1I4X A;  1JCK B;  1ESF A;  2XEW A;  1YJ1 A;  5DPT A;  1RLF A;  1WRD B;  4XC2 A;  2DZI A;  1A5R A;  5HKH A;  1V97 A;  4JX1 C;  2MSE D;  1E7V A;  1MHX A;  4ANX A;  3DVN V;  3B9J A;  1C9F A;  4NJ6 A;  5KHQ A;  4EOY A;  2C9W B;  1J8C A;  3KYC D;  3WA0 A;  3KW5 B;  3M63 B;  1KJT A;  4CQN A;  1ZGU B;  1ENF A;  2JUO A;  2DAJ A;  4B0M A;  1OEY J;  3ZTC A;  2HD5 B;  3RPF C;  2W3S A;  2KQS A;  1L0X B;  4XX5 A;  3VUX A;  3URY A;  3IBE A;  2HTH A;  5D94 A;  4LJO B;  1I35 A;  4JL9 A;  2JYT A;  3RUI B;  1F52 A;  1N60 A;  1C3T A;  4N59 A;  4N9F 4;  4TKN A;  2BKF A;  4W9D A;  2D3A A;  3L10 B;  3X0W A;  1FO4 A;  3PZ7 A;  2N9X A;  3V61 A;  1NI3 A;  1I4H A;  3BY4 B;  4QAY A;  1E8Z A;  1V1P A;  4W9E A;  1OQQ A;  2MQJ A;  1HTQ A;  5KHO A;  3Q3O C;  4ANU A;  3PV1 A;  2RMM A;  4C4V B;  4HLE A;  1XLO A;  3ZQ4 A;  3VTU A;  2G4S A;  3P2B A;  4BVU C;  1WX7 A;  4W9G A;  4YTM B;  2D11 A;  3N1Z C;  2ZPN A;  4RMA A;  1C79 A;  3X23 A;  1FXT B;  2AL3 A;  4AS1 A;  1LGR A;  2JY6 A;  5DPW A;  3M95 A;  4KKJ A;  1WY8 A;  1UD7 A;  2ZCB A;  4BZA A;  3TUO A;  2O6V A;  4I6P A;  1SGH A;  4OVU A;  5DPS A;  3VRA B;  3BK2 A;  3SEB A;  1YX6 B;  1L4D B;  1N61 A;  1QOF A;  5AUK A;  3DBS A;  2L00 B;  1J19 A;  4L23 A;  2PE6 B;  4MSM B;  2M0A A;  2BF8 B;  1QOB A;  2KFK A;  3W1S A;  1ZDV A;  2D2Q A;  4KSK C;  4C7Z A;  2LJ5 A;  3ZNH B;  1SJE D;  3TJP A;  2JSV X;  2MCN B;  4WQO B;  3DBR I;  3ZO5 B;  1E8Y A;  3CST A;  1L6U A;  4HPL B;  3OLM D;  1ZKH A;  3TEY A;  4FJZ A;  2YLM A;  1SEB D;  2JU6 X;  4IWO A;  1LQB A;  2GLS A;  3W2D A;  2V1Y A;  4HVB A;  3IFW B;  1YN5 A;  4WAA A;  4NJ7 A;  4REZ A;  3V62 A;  1FXI A;  1Q10 A;  4LNO A;  2INN E;  1V6E A;  3EFC A;  4PYZ A;  1AN8 A;  2GRI A;  4AJW A;  2GB1 A;  1ET6 A;  2LI5 A;  2K9X A;  4EEW A;  2KAJ A;  3U4E G;  2JXX A;  2PTL A;  1R4N I;  4XGA B;  5C1Z A;  1C1Y B;  4HRO A;  4E3C A;  4WUR A;  3B0A A;  2AQ1 B;  2PVG C;  1D4B A;  1PQS A;  1ROE A;  2IY1 B;  1K51 A;  5EE3 A;  1UGJ A;  2WDQ B;  3LJ3 A;  3Q8B A;  3OAW A;  3A4R A;  4P16 A;  1ZP0 B;  4YL8 A;  2XBB C;  2BW2 A;  4RF1 A;  2DZJ A;  4BAX A;  3PRP B;  4KSL C;  2QSD A;  4NQL B;  1MI0 A;  2ZJD A;  2CU3 A;  4HXD A;  2KMC A;  2M8S A;  3PRM B;  2WXN A;  2IY0 B;  3Q8A A;  1HE8 A;  3V6C B;  3VFK A;  3W9C B;  1BT0 A;  1YD8 U;  1E0Z A;  1VCB A;  1D3Z A;  1T0Q C;  2N7J A;  3AXC A;  5DPR A;  5CHW A;  1N5X A;  3L16 A;  1VZ6 A;  1EU4 A;  2HJ1 A;  4HK2 A;  2A4Z A;  3AM9 A;  4NAM A;  3N9Y C;  5IAA C;  2WXI A;  2ZVN A;  2QMT A;  2VH2 A;  4A90 A;  5D7G A;  3KWL A;  2WXL A;  3WAP A;  2L3Z A;  1R4M I;  3B2G A;  3AE9 B;  2MBH A;  2IZV B;  4AJY B;  1TS4 A;  2DZK A;  2MJE A;  2LUM A;  1V1O A;  3KYD D;  3O65 B;  4IWP A;  4FBJ B;  4C7Y A;  2WX0 A;  4ZOH C;  4K81 A;  3MTN B;  2JRI B;  3B2F A;  4K7U A;  4YT0 B;  5CHV C;  1NVI D;  1E6E B;  3CMM B;  1T6B X;  3Q3F A;  4C4V A;  1ZW7 A;  4HDQ A;  3DBL I;  2FCM A;  2JYE A;  2RD0 A;  3ZXV A;  2WLB A;  5AZF A;  1D5Z C;  4EZJ A;  3A1Q A;  1B1Z A;  4S0R A;  5JXV A;  5FK9 C;  4RGO S;  4G0N B;  2MBO A;  4G50 A;  4MT5 A;  3ZRF A;  2IO1 B;  1F0Z A;  2MW5 A;  3NVZ A;  3NY5 A;  3O13 A;  2IO3 B;  4MEL A;  4DXA B;  5TSS A;  2WHI A;  3L0W B;  5BYS A;  1C77 A;  2Z8L A;  2K1F A;  3QIJ A;  3JSV A;  2LGY A;  3SHQ A;  1JRP A;  4OHJ A;  3LYY A;  2BT6 A;  2QHO A;  2J0M A;  4N58 A;  4ZRK A;  4EE2 A;  2JXT A;  3C19 A;  3WAN A;  3JW0 X;  2IND C;  4KZC A;  2ZCC A;  1CMX B;  3EFU A;  4BKG A;  3KUZ A;  1V2Y A;  2D07 B;  1WGY A;  3FAH A;  3C8Y A;  1T3Q A;  4WJP A;  4CHK A;  5AUI A;  2LVO A;  1WGG A;  4M00 A;  1H4R A;  2NBW B;  1I4Q A;  1CK1 A;  4LDT D;  1TY2 A;  1GC6 A;  1XCT L;  4HKQ A;  3HVD A;  1WM3 A;  2AQ2 B;  3PZD A;  2MA9 B;  5FKA C;  3UQA A;  1MVK A;  1YN4 A;  3LB8 C;  1ZDX A;  4PK1 A;  4GXB A;  2EEL A;  2CHZ A;  3KH0 A;  2JX5 A;  1V86 A;  2WGS A;  2ICI A;  3ENE A;  1KH0 A;  3IAM 1;  4XYC A;  2GI9 A;  2IGG A;  3SD5 A;  1FPY A;  1WWT A;  1QZE A;  3EA6 A;  2JZZ A;  1IYF A;  3DCG A;  4PS8 A;  1TKY A;  1WXV A;  2JQR B;  2Y5B B;  2MRP A;  4F1S A;  2KKC A;  4JQW C;  5BYR A;  3UQB A;  3AB5 A;  1VLB A;  1V1P B;  2IYD B;  1EM7 A;  4GDL B;  3U7D A;  1SB3 C;  1DOI A;  2WP9 B;  2V4L A;  3R8B A;  2J4X A;  3ZJT A;  3RNG C;  4TSS A;  1STE A;  1WYW B;  2MBQ A;  2BQQ A;  4II2 B;  2JRH A;  2OJR A;  2KFJ A;  2LRW A;  2OHF A;  4W9I A;  4NAW A;  3CWI A;  4HEA 1;  3A9K B;  2J42 A;  1L0Y B;  4AUQ C;  3T3O A;  2LXC A;  2TSS A;  4DXG A;  4ACF A;  1KTK A;  2WX1 A;  3Q2A C;  3NZS A;  4KGR A;  3Q3N C;  1P7F A;  1WJU A;  3OG5 A;  2D3G A;  5FR3 A;  2BYT A;  1K53 A;  2RR9 A;  5EE9 A;  2N9E B;  3DBH I;  4W9K A;  3ETR A;  1EF5 A;  2KVZ A;  2HJ8 A;  2YEP F;  1JWM D;  3BWU D;  3IT6 B;  4TMA B;  3PRZ A;  2IPK D;  4WWM A;  2JZ3 B;  2N1V A;  3NRZ A;  4XDC A;  1GC7 A;  4OVV A;  4GN1 A;  3FC4 A;  4GB9 A;  2CU1 A;  2L83 A;  2QIE B;  1P3Q U;  4NPN A;  4BOS C;  4HKZ E;  4M8N A;  2K8B A;  5IP4 D;  4HJK A;  4E71 A;  2MP2 B;  1SBB B;  2KC2 A;  1QOA A;  2IO0 B;  1ZE3 D;  1VD2 A;  2VRR B;  2BB6 A;  1JW9 D;  2C7N B;  2L8J A;  3SDL C;  1UZX B;  1XQQ A;  1WR6 E;  2WXG A;  4IWQ A;  2W55 A;  1Q0W B;  3T8M A;  3DWM A;  2KMM A;  1FIQ A;  2J52 A;  4NJC A;  2AX5 A;  1L7Y A;  3ML8 A;  5FR6 A;  2QDF A;  2OOB B;  2LVP A;  4JWS C;  4IW0 A;  4DHZ B;  3W5V B;  3ZJU A;  1OEY A;  1U4A A;  2W9N A;  3TCA A;  3VUY A;  4BBN F;  1R7S A;  1IPG A;  4LJP B;  2G9H D;  3JYU A;  2K22 A;  3N30 A;  3PT2 B;  5JHA A;  1P1A A;  4O1N A;  3R2I A;  3AE1 B;  2WNM A;  5C3J B;  3DVG Y;  2KWC A;  1YJJ A;  4MM3 A;  3RNC C;  3WAO A;  1FD6 A;  1WGK A;  2DYB A;  4B95 A;  2IGD A;  4JWU C;  3A9J A;  2DX5 B;  1D5M C;  3GZN I;  3PPA A;  3NJT A;  3MFG A;  4DQO C;  1UWX A;  1AYF A;  3MJW A;  3Q14 C;  1TKG A;  4MSQ B;  3RT3 B;  2DHZ A;  2KZR A;  4NZL B;  3UIO B;  3MC0 B;  4AP4 C;  2GMI C;  3NVW A;  1GAQ B;  1EWC A;  3AUL A;  2NS5 A;  5EDS A;  2G3Q B;  2KMA A;  2Z0D B;  3ZVV A;  2KLC A;  3AMZ A;  3NS1 A;  2XNA C;  4A3O A;  1N6Z A;  2N9L A;  1SSN A;  1V8C A;  1YQ4 B;  3DVG X;  4OW0 A;  2N1W A;  2N9K A;  3HM3 A;  3GZN B;  3U52 E;  2EKI A;  2V9H A;  3Q3M C;  4WQM A;  4RM9 A;  3ABV B;  2Q5W D;  2PLP A;  4DWF A;  2KX0 A;  4FJY A;  2V3S A;  2CJN A;  2MH7 A;  1TZO A;  3KVF B;  3UIP B;  1BUI C;  1WE6 A;  1ZPS A;  1NEK B;  4KVG B;  1T0Y A;  1XLQ A;  4GDL A;  1VRA B;  3APC A;  3D32 A;  2Y3A A;  3VR8 B;  3A33 B;  1XLP A;  2Y5P A;  1WR1 A;  1K50 A;  2WXH A;  1HQR D;  2UYZ B;  4BKT A;  3AEG B;  2C7M B;  2KJR A;  1MG4 A;  1K8R B;  2ACZ B;  1IP9 A;  3A1Q B;  1YMH E;  4LDT B;  2AL6 A;  1ZXI A;  3KUC B;  4C80 A;  2JZP A;  2K6Q A;  1WRI A;  3AH7 A;  3A9K A;  2ZVO A;  3CSF A;  1C4P A;  3P63 A;  2J53 A;  2M0X A;  3BYT B;  3GE3 C;  4P1B C;  2IDY A;  3VAW A;  3JSV B;  4KIK A;  1KF6 B;  1GNU A;  1J7C A;  1VR9 A;  4DXF A;  1P7E A;  3DOW A;  1DOY A;  2JPH A;  1FM0 D;  4ZRP A;  5L83 A;  4K7W A;  5J2R A;  5IA7 A;  1WI0 A;  2AWT A;  3Q3J A;  3OJ3 A;  2RSU A;  2AQ3 B;  1GB1 A;  3VH3 B;  2ON8 A;  4ZRI A;  2LJI A;  2EMT A;  4ASW C;  2KVR A;  4MH8 A;  2NCN A;  1F9J A;  1WZ0 A;  1I7H A;  1E90 A;  1N5W A;  2YVC A;  4ITK A;  4L1B A;  3MHZ A;  3AE2 B;  4URK A;  1NYR A;  5J18 A;  2D3C A;  2R2Q A;  4IDI A;  1XLN A;  1SXT A;  2Z59 B;  5BMI A;  4K3B A;  1JML A;  4ICU A;  2MP2 A;  1N63 A;  1CZP A;  2WXJ A;  3B08 A;  4WH4 A;  4HWI B;  1J7B A;  4LK0 M;  1WJ4 A;  3H7S A;  2L1A A;  1PGA A;  4XE0 A;  2WXO A;  2HE7 A;  2LGD A;  2REX A;  3U7Z A;  3RNA C;  1YQ3 B;  1RYJ A;  2KNB A;  3DQV A;  2HTM E;  1XXG A;  4GDK A;  3PLV A;  2FCQ A;  4DK5 A;  3BYY B;  1ACC A;  4TQ1 A;  1V9J A;  1RFA A;  1D6E C;  2WXR A;  2ASQ A;  1TYG B;  2ZZP B;  4KZ0 A;  1BML C;  4L2Y A;  3KUD B;  4IC7 B;  3V05 A;  1UBQ A;  3VTV A;  3U8Z A;  2CJO A;  1AAR A;  2IBI B;  1OFF A;  1SIF A;  1V5O A;  4EUT A;  2WXQ A;  2KO3 A;  5D3I B;  4ARI A;  1H8C A;  1L2N A;  1WGH A;  2PEA A;  1OQR A;  2C7H A;  2SAK A;  4J3O D;  1GOZ A;  2VZK D;  2KJH B;  1KM7 A;  4IKG A;  4NAW B;  2C60 A;  3IHP C;  4LLG M;  2L0T A;  2FE8 A;  2G1E A;  1J7A A;  4P1C C;  3LDZ E;  1X1M A;  3QX1 A;  4HPP A;  2BWF A;  4GLS C;  2LD9 A;  1CJE A;  3AE8 B;  1L6V A;  1NYQ A;  3JVZ X;  3T3N A;  3P4Q B;  2BYE A;  4YTP B;  1C4C A;  2LGS A;  2BB5 A;  2KDF B;  1YJI A;  1L4Z B;  2DWQ A;  4HJG E;  3TEW A;  4AOF A;  2KTR A;  1VZ7 A;  2M19 A;  2K5P A;  2CS4 A;  1IBX A;  4MAC A;  3ALB A;  5BYQ A;  3TIX A;  2HDE A;  2MLB A;  4PS7 A;  2GBM A;  1E10 A;  5JHB A;  2R2O A;  4IM0 A;  2UU7 A;  3HUI A;  3QQ8 B;  5BO4 B;  3VXW A;  3DHG C;  3SFE B;  4A6Q A;  3KWV A;  4TV3 A;  4RFB A;  4ZHO A;  3M62 B;  3NVY A;  2MHJ A;  2VH1 A;  4AQ7 A;  4FA6 A;  4FAD A;  3SR6 A;  4HCN B;  3RNF C;  4XZ4 A;  1VZ8 A;  4EKU A;  3P4P B;  1MJD A;  3ZXR A;  4MEM A;  2JF5 A;  3RI7 C;  2KWV B;  2ONQ A;  4WJQ A;  3E56 A;  4JE3 B;  1JWA D;  1UUP A;  2BWE S;  2LGI A;  1CQV A;  1PUT A;  1JRU A;  3RFZ B;  1I4P A;  2DYM A;  1C76 A;  4CYE A;  4MM3 B;  3SU8 X;  3LXF A;  3SFD B;  4BKS A;  3A9J B;  4ANV A;  4IM3 A;  3HHM A;  1BXT A;  2KDI A;  5HHD G;  3HIZ A;  2I2Y A;  3PLU A;  1Q5W B;  1M4V A;  2RPV A;  3ML9 A;  3EHV A;  4UDU C;  2ZPY A;  1SF0 A;  1MG8 A;  2BS3 B;  1MFW A;  3VUW A;  1WE7 A;  4I6N B;  5IKC M;  3AEE B;  1WYG A;  5JH5 C;  3NZ3 A;  4FJV B;  1WXQ A;  4ZHP A;  5CX3 A;  3TL5 A;  4MGI E;  1MPE A;  2DNF A;  4G11 A;  3BIN A;  1DOX A;  1LFD A;  1YOV B;  2E6X A;  3OJ4 B;  1S1Q B;  1Z5S B;  4K7S A;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  2CHW A;  1TT5 B;  4PYU A;  1F1H A;  3AI5 A;  4FLH A;  2ZW0 A;  1V80 A;  4OZA A;  1HZ6 A;  2BTE A;  3CF6 E;  4FHK A;  2KOX A;  5D2M B;  2J0J A;  1FCC C;  4RGT A;  1TJE A;  3APF A;  1EF1 A;  4IUM B;  1GJZ A;  2KYW A;  1IUE A;  3H8H A;  4LCD E;  4MH0 E;  3BK1 A;  1RRB A;  4W9J A;  1RM6 C;  5LNK 1;  1E7U A;  5H92 C;  1LXD A;  1I4G A;  3UIN B;  1ZOY B;  4HRS A;  5AZH A;  1TS3 A;  1G6J A;  1VJK A;  4YSY B;  4GMV A;  3DDC B;  2GBN A;  3QCA A;  3GP7 A;  2V4I B;  2KN4 A;  4M02 A;  3I9V 1;  4HPM B;  4FUL A;  4W9F A;  4KIK B;  2W82 A;  3AU5 A;  2WDT B;  1EO6 A;  4GU2 A;  1XCQ L;  4S17 A;  4F7Z A;  1FXA A;  3HM6 X;  3KLS X;  4LNF A;  3N1Y C;  2G45 B;  1SIJ A;  2BYF A;  3L17 A;  2KK8 A;  2GBK A;  3H6N A;  3TEZ A;  5E6J A;  4M0W B;  3PHW B;  1NEN B;  3GS2 A;  3TMP B;  1WX8 A;  2LAS A;  3UGB B;  1JQ4 A;  3ZLZ A;  3K9P B;  1PDX A;  1GB4 A;  3I3T B;  2DEN B;  3VR9 B;  3AE3 B;  4HCP B;  2WDR B;  4IM2 A;  1QLB B;  2QJL A;  2RDB C;  2PPH A;  3PHX B;  2K0P A;  3VHT C;  4A3P A;  5LXH A;  4MDK E;  1A70 A;  1NDD A;  1QT9 A;  1PGX A;  2L05 A;  3ZDT A;  1FRD A;  1UBI A;  3N3K B;  4JGH B;  2X8X X;  4US8 A;  5E6O A;  4KGT A;  2BYV E;  1KLG D;  5C2T B;  3OWE B;  2DZM A;  2VZK B;  5EE0 A;  2MWS B;  1P9D U;  4KKI A;  4AWJ A;  4GDK B;  1ZXH A;  2K8H A;  5BMH A;  1F2R C;  1SE9 A;  1Q1O A;  1NBF C;  1PYW D;  1TBE A;  1ET9 A;  3B1L X;  4RGM A;  2MBE A;  1SE2 A;  2Y5C A;  3AEC B;  1P98 A;  1WFY A;  3NZU A;  2LVQ A;  4EFO A;  4RCO A;  1AWD A;  1Z2M A;  2D3B A;  2WU2 B;  3UF8 A;  4GGQ A;  2BS4 B;  3BVG A;  4GOC A;  2INP E;  3CIR B;  2FUG 1;  2JWZ A;  1F77 A;  2NMQ A;  5IOI A;  5JZE B;  3NUH B;  1M94 A;  1XO3 A;  2LFI A;  2PIA A;  2WQY B;  3RUL A;  2KTF A;  3VDZ A;  4FHJ A;  2K8C A;  5GXG B;  1V81 A;  3RNB C;  3C0R B;  3W5U B;  3EEC A;  4XWW A;  1YX5 B;  2CHX A;  3QAR A;  5D3D A;  5CHF A;  4JLC A;  4B0E A;  4WJN A;  3RYT A;  1WJN A;  3IT4 B;  4K3C A;  3PGE A;  3RNE C;  2KC1 A;  3VVW B;  2LRU A;  4KGS A;  4DHJ D;  2N9P C;  2JVC A;  1Y8R C;  1C4A A;  2PE9 A;  1T5X D;  4KDI C;  3DPD A;  2WXK A;  4FXC A;  3ZNZ B;  3ZIM A;  3VH4 B;  1E9M A;  5G55 A;  2XK5 B;  2NR2 A;  2K3U A;  5E6P A; 
#chains in the Genus database with same CATH homology
 2FCQ A;  4DK5 A;  3NHE B;  3L0W B;  4TQ1 A;  1V9J A;  2O6V B;  3VQI A;  1RFA A;  2K1F A;  3QK0 A;  3QIJ A;  3ZNG C;  1WXA A;  2ASQ A;  3JSV A;  2LGY A;  2ZZP B;  1LM8 B;  3SHQ A;  4KZ0 A;  1XT9 B;  3AU4 A;  3KUD B;  1YQB A;  2QHO A;  3V6E B;  4IC7 B;  2J0M A;  4ZRK A;  2KTR B;  1WM2 A;  2BKR B;  1UBQ A;  1WMH B;  1WH3 A;  3VTV A;  3U8Z A;  1ISN A;  3DVN U;  3JW0 X;  4KZC A;  3WAN A;  2ZCC A;  1AAR A;  1CMX B;  2JT4 B;  3EFU A;  2EKE C;  4BKG A;  2RPQ A;  4BOZ B;  2KDE B;  3KUZ A;  1V2Y A;  2D07 B;  2IBI B;  2KFK B;  2D10 A;  1WGY A;  3NS8 A;  2LGX A;  1SIF A;  4WJP A;  2J0K A;  3ONS A;  4CHK A;  3RZW C;  1V5O A;  4EUT A;  5C23 A;  2KO3 A;  2LVO A;  3APD A;  3QWZ B;  1WGG A;  2EMS A;  1H8C A;  4WWN A;  1L2N A;  1H4R A;  2NBW B;  2M1M A;  1WGH A;  2KJ6 A;  2PEA A;  2C7H A;  2IO2 B;  4LDT D;  3TBL D;  2GBR A;  2K6D B;  1GC6 A;  2DAF A;  2KJH B;  1KM7 A;  2BGF A;  4RM8 A;  1E8X A;  1OTR B;  4W9C A;  4NAW B;  2FCS A;  2C60 A;  3IHP C;  1WM3 A;  4WJO A;  2KXJ A;  2L0T A;  3PZD A;  2AEH A;  2MA9 B;  2KDB A;  3UQA A;  3LDZ E;  2FAZ A;  3H1U A;  4MGK E;  4P7I A;  4GXB A;  1X1M A;  2CHZ A;  3A4S C;  3KH0 A;  4B9K A;  3ZUN A;  1V86 A;  2I1K A;  3QX1 A;  2BWF A;  2LD9 A;  3QHT A;  2RGF A;  3ENE A;  2M4N A;  4EZL A;  3U30 A;  3RCZ A;  3SD5 A;  3JVZ X;  3H7P B;  4MJS B;  2WWZ A;  2GBJ A;  3W1Y A;  1WJ6 A;  2J7Q B;  1QZE A;  2JZZ A;  5GMV A;  2BYE A;  3DCG A;  4FN2 A;  1IYF A;  4PS8 A;  3R7R A;  1V49 A;  1WXV A;  2Y5B B;  2LWP A;  3ECI A;  2MRP A;  2WYQ A;  2KKC A;  4ICV A;  5G2N A;  4F1S A;  4DHZ E;  4JQW C;  1OQY A;  4EZK A;  3UQB A;  2BPS A;  2KDF B;  4W9H A;  2KN5 A;  3GOE A;  5AZG A;  4WWO A;  2M17 A;  3H9D A;  1GUA B;  2IYD B;  3RD2 A;  4AOF A;  1KOT A;  1S3S G;  2DYO A;  2KTR A;  4TUU A;  3QJZ A;  4GDL B;  1XD3 B;  3U7D A;  2XEW A;  1YJ1 A;  2CS4 A;  5DPT A;  1RLF A;  2V4L A;  3L13 A;  2Z0E B;  2ZNV C;  3ALB A;  3TIX A;  4PS3 A;  2MLB A;  4PS7 A;  2GBM A;  1WIA A;  5JHB A;  1WRD B;  2R2O A;  4XC2 A;  3T9L A;  2DZI A;  4IM0 A;  1A5R A;  3QQ8 B;  5BO4 B;  5HKH A;  1TZ1 A;  3VXW A;  1WYW B;  2FNJ B;  2MBQ A;  2MSE D;  1E7V A;  5CTR C;  4II2 B;  4TV3 A;  4ANX A;  2JRH A;  2OJR A;  3DVN V;  3M62 B;  2KFJ A;  2LRW A;  2LUE A;  3N32 A;  4W9I A;  4NAW A;  2N4F A;  5AEK B;  4NNJ B;  3A9K B;  4NJ6 A;  5KHQ A;  3IG3 A;  4FA6 A;  4FAD A;  4AUQ C;  4EOY A;  4HCN B;  2KD0 A;  4XZ4 A;  2LXC A;  2C9W B;  2KQ7 A;  3KYC D;  3QC8 B;  1J8C A;  5LXI B;  4EKU A;  5LLI A;  4TQ0 A;  3WA0 A;  3KW5 B;  3M63 B;  2O6V D;  1KJT A;  4MEM A;  2WX1 A;  2JF5 A;  3NZS A;  2KWV B;  1ZGU B;  4WJQ A;  4BFR A;  1WJU A;  2JUO A;  2ZNV B;  2FIF A;  2DAJ A;  2BWE S;  1OEY J;  3ZTC A;  1V5T A;  2D3G A;  2HD5 B;  1JRU A;  2KQS A;  4XX5 A;  3PSE B;  3VUX A;  3H7P A;  2RR9 A;  3IBE A;  2HTH A;  4GIV A;  5D94 A;  4LJO B;  2N9E B;  3RZF A;  3DBH I;  1I35 A;  2DYM A;  4JL9 A;  4W9K A;  3RUI B;  4CYE A;  1EF5 A;  2NBV B;  1C3T A;  4N9F 4;  2HJ8 A;  4MGZ E;  4TKN A;  2BKF A;  3S2A A;  4W9D A;  3L10 B;  3X0W A;  3SU8 X;  4GSW A;  3PRZ A;  2N9X A;  3V61 A;  2JZ3 B;  4BKS A;  3A9J B;  2N1V A;  1GC7 A;  4IM3 A;  3HHM A;  4ANV A;  4OVV A;  4GN1 A;  3BY4 B;  3ZNI D;  2O2V B;  4GB9 A;  2CU1 A;  2KDI A;  1E8Z A;  3EC8 A;  3HIZ A;  4CO7 A;  1P3Q U;  2N7D A;  4NPN A;  4IG7 B;  4W9E A;  4BOS C;  2MQJ A;  2NPT B;  2MX2 A;  3PLU A;  1Q5W B;  4M8N A;  2K8B A;  4HJK A;  5KHO A;  4M8M A;  4ANU A;  2MP2 B;  3PV1 A;  4E71 A;  1WXS A;  3ML9 A;  1I42 A;  2KC2 A;  3EHV A;  4HLE A;  4JIO U;  2ZPY A;  3VTU A;  2G4S A;  3P2B A;  2IO0 B;  2GOW A;  4BVU C;  1MG8 A;  1UH6 A;  1WX7 A;  1VD2 A;  4DDG D;  4W9G A;  2K25 A;  2VRR B;  2D11 A;  3VUW A;  1WE7 A;  4I6N B;  2ZPN A;  5JH5 C;  2C7N B;  2CR5 A;  2L8J A;  4RMA A;  3SDL C;  1UZX B;  3X23 A;  1XQQ A;  4FJV B;  1WR6 E;  1FXT B;  2AL3 A;  1E5W A;  4IWQ A;  3WAL A;  1Q0W B;  3T8M A;  5CX3 A;  3TL5 A;  4MGI E;  2JY6 A;  2ZEQ A;  5DPW A;  3NOB A;  1L7Y A;  2XK5 A;  3M95 A;  3ML8 A;  2OOB B;  2LVP A;  4G11 A;  5FR6 A;  3BIN A;  1TTN A;  4IW0 A;  1J0G A;  1WY8 A;  1LFD A;  3OJ4 B;  4DHZ B;  1UD7 A;  1S1Q B;  1Z5S B;  2ZCB A;  3HK0 A;  4K7S A;  2KHW B;  4NQK E;  3V60 A;  3ZKJ C;  4BKS D;  1WZ3 A;  4I6L B;  2CHW A;  3M3J A;  2O6V A;  3R66 C;  4I6P A;  1OEY A;  1SGH A;  1U4A A;  3AI5 A;  4PYU A;  2W9N A;  4FLH A;  3TCA A;  4OVU A;  1V80 A;  5DPS A;  3VUY A;  4BBN F;  1IPG A;  4G3X B;  1YX6 B;  3R3M A;  4LJP B;  3CF6 E;  2B3A A;  2G4D B;  2KOX A;  3JYU A;  4FHK A;  5D2M B;  3DBS A;  3N30 A;  2J0J A;  4II3 B;  1WMH A;  3PT2 B;  2L00 B;  5JHA A;  1J19 A;  1P1A A;  3APF A;  1EUV B;  2L7R A;  2PE6 B;  1EF1 A;  4IUM B;  1GJZ A;  4MSM B;  3DVG Y;  2KWC A;  2BF8 B;  4MM3 A;  2KFK A;  3W1S A;  2D2Q A;  4KSK C;  3WAO A;  4K1R B;  3MHS D;  2LJ5 A;  3ZNH B;  2DYB A;  4B95 A;  2CKH B;  2KX3 A;  4LCD E;  4MH0 E;  1KLV A;  1RRB A;  4W9J A;  3TJP A;  3A9J A;  4E74 A;  2DX5 B;  4WQO B;  2MCN B;  1WGR A;  1E7U A;  3GZN I;  3VTW A;  1LXD A;  3PPA A;  3UIN B;  3DBR I;  3ZO5 B;  3K9O B;  1E8Y A;  5AZH A;  3CST A;  4HPL B;  1G6J A;  3OLM D;  1ZKH A;  3MJW A;  4FJZ A;  2YLM A;  4DDI D;  4IWO A;  4GMV A;  4MSQ B;  3DDC B;  1LQB A;  3RT3 B;  2FID A;  2GBN A;  2DHZ A;  2KZR A;  3QCA A;  1RAX A;  3UIO B;  2V1Y A;  4AP4 C;  4HVB A;  3IFW B;  2GMI C;  4WAA A;  4NJ7 A;  2LZ6 A;  4HPM B;  3V62 A;  1WX9 A;  3AUL A;  4FUL A;  4W9F A;  2NS5 A;  4KIK B;  4DHJ B;  3AU5 A;  5EDS A;  1V6E A;  2WDT B;  5TR5 A;  3ZTD A;  4PYZ A;  2G3Q B;  4AJW A;  5D6J B;  1EO6 A;  2KMA A;  4GU2 A;  4BBN C;  2LI5 A;  4F7Z A;  2Z0D B;  3ZVV A;  2KLC A;  4EEW A;  4ZRJ A;  3HM6 X;  2L0F A;  4A3O A;  2JXX A;  3WAM A;  2G45 B;  4MJS A;  2BYF A;  3L17 A;  2KK8 A;  1R4N I;  2GBK A;  2NVU I;  3H6N A;  5C1Z A;  3DVG X;  2N1W A;  3ZW3 A;  1C1Y B;  3IVF A;  3HM3 A;  4E3C A;  1WXM A;  2KAN A;  4M0W B;  3B0A A;  3PHW B;  3TMP B;  2A5U A;  1WX8 A;  2LAS A;  3UGB B;  1PQS A;  2IY1 B;  4RM9 A;  3ZLZ A;  3LJ3 A;  3K9P B;  3OAW A;  3I3T B;  2DEN B;  3A4R A;  4HDO A;  2KX0 A;  4DWF A;  4WWP A;  4HCP B;  4YL8 A;  2XBB C;  4FJY A;  2FUH B;  4ZDV A;  4IM2 A;  2DZJ A;  2V3S A;  3PRP B;  4KSL C;  4NQL B;  2PPH A;  3PHX B;  3VHT C;  2LXA A;  3KVF B;  2ZJD A;  3UIP B;  4A3P A;  5LXH A;  1WE6 A;  4MDK E;  4HXD A;  1T0Y A;  4KVG B;  4GDL A;  2KMC A;  2M8S A;  1NDD A;  3APC A;  3D32 A;  3PRM B;  2L05 A;  3ZDT A;  2IY0 B;  4ANW A;  3V6C B;  1HE8 A;  3VFK A;  1UBI A;  3ZRC A;  3R7Q A;  3A33 B;  1BT0 A;  1YD8 U;  3N3K B;  1UGM A;  5J17 A;  1WR1 A;  3PTF C;  4JGH B;  2UYZ B;  1VCB A;  4BKT A;  2C7M B;  3ZIM A;  2KJR A;  5E6O A;  1D3Z A;  2BYV E;  1K8R B;  2L76 A;  1IP9 A;  3A1Q B;  3AXC A;  5DPR A;  4LDT B;  2AL6 A;  5CHW A;  2DZM A;  3L16 A;  4F8C B;  2UWQ A;  1OGW A;  3KUC B;  2MWS B;  1P9D U;  2K6Q A;  4HK2 A;  4AWJ A;  2A4Z A;  5L95 C;  4X57 B;  3A9K A;  4GDK B;  2ZVO A;  3CSF A;  5IAA C;  2K8H A;  2M0X A;  1SE9 A;  1Q1O A;  1NBF C;  1TBE A;  3B1L X;  2ZVN A;  2MBE A;  2MBB B;  3VAW A;  3JSV B;  4KIK A;  1P0R A;  2FCN A;  5D7G A;  1P98 A;  1GNU A;  1WFY A;  3NZU A;  2LVQ A;  3WIM A;  4EFO A;  3WAP A;  2L3Z A;  1Z2M A;  3UF8 A;  4GGQ A;  4DBG A;  1R4M I;  3DOW A;  4J6I A;  2JPH A;  4GOC A;  4KDL B;  4W9L A;  2NBU A;  4K7W A;  4B6W A;  5L83 A;  5J2R A;  2JWZ A;  5E6N A;  5IA7 A;  1WI0 A;  2MBH A;  2IZV B;  2AWT A;  4AJY B;  3Q3J A;  1WF9 A;  3OJ3 A;  2RSU A;  5JZE B;  2KLG A;  1M94 A;  5DCN A;  4ZRI A;  3VH3 B;  2DZK A;  1WGD A;  2EMT A;  4ASW C;  2KVR A;  4ZYN A;  3KYD D;  3O65 B;  4IWP A;  4FBJ B;  2N7E A;  2NCN A;  3RUL A;  2KWU B;  1F9J A;  1WZ0 A;  2KTF A;  3VDZ A;  4FHJ A;  2WX0 A;  2K8C A;  1E90 A;  1V81 A;  1GG3 A;  2YVC A;  3QAQ A;  3C0R B;  2JRI B;  1NI2 A;  3MTN B;  4K7U A;  2O2V A;  4K81 A;  3EEC A;  4URK A;  1E8W A;  5J18 A;  2R2Q A;  3PVL A;  2NPT A;  4MGY E;  1YX5 B;  2C5L C;  2CHX A;  3QA8 A;  3QAR A;  1TGZ B;  2Z59 B;  2K39 A;  4ICU A;  5CHV C;  2MP2 A;  5CHF A;  4JLC A;  3CMM B;  3Q3F A;  4WJN A;  3RYT A;  1WJN A;  1ZW7 A;  3B08 A;  3L08 A;  4A20 A;  4HDQ A;  3PGE A;  3DBL I;  2FCM A;  2RD0 A;  4HWI B;  1WJ4 A;  2KC1 A;  3VVW B;  3H7S A;  1YIW A;  2LRU A;  4NY0 A;  2N9P C;  4DHJ D;  2JVC A;  1Y8R C;  4KV2 A;  5AZF A;  2PE9 A;  4EZJ A;  2PJH A;  2HE7 A;  2LGD A;  4KDI C;  2REX A;  3W1S C;  3DPD A;  3A1Q A;  2AYO B;  4G0N B;  2MBO A;  4G50 A;  3PRE A;  2IO1 B;  2KNB A;  2MW5 A;  3DQV A;  3NY5 A;  3ZNZ B;  3VH4 B;  3ZRF A;  3L54 A;  3PS6 A;  5G55 A;  2IO3 B;  1UEL A;  4MEL A;  4DXA B;  2XK5 B;  2NR2 A;  4GDK A;  3ZDM C;  5E6P A;  2I1J A;  3PLV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...