1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
4DXFA 1M4VA 4DXGA 1S5FD 2J4XA 2XNAC 4L63B 4L6TB 3MFGA 1SBBB 2AQ2B 1PTOD 1D6EC 2ICIA 5ELDA 1HTLD 2IPKD 1TS4A 1G8ZD 1JR0D 1SE3A 1JWUD 2NTTA 1PTOH 1ET9A 1RDPD 1SXTA 5I4DA 1EU4A 4UDUC 1LTRD 4ZYSA 1AN8A 1I4HA 3R2TA 1STEA 4TSSA 1D5XC 1LLRD 4RGOS 1TS5A 3MC0B 1FD7D 3CHBD 1ET6A 2RDGA 1KLGD 1DYQA 4RGNA 1ESFA 2WV6D 4BWGB 1SJHD 4Z9CB 2SEBD 1UNSA 3BVZA 4RGTA 3URYA 1I4GA 1JWMD 2IJ0A 1CHQD 1XXGA 1AW7A 1L0YB 1V1PB 1PZJD 2AQ1B 1EEID 3R2IA 4NZLB 1FNUA 3BVMA 3V05A 1JWSD 3BZDB 1FNVA 2XN9C 3GP7A 1PRTB 1RCVD 1D5ZC 1PYWD 5D3DA 4RH6A 1BCPB 1GOZA 1LO5D 1PZKD 5ELEA 1LTAD 1PTOB 1I4XA 1TY2A 3EFXD 1SEBD 1D5MC 1UUPA 2QILA 4RGMA 1T5XD 2R61A 5FK9C 1BCPC 1CQVA 4RCOA 1YN4A 1RD9D 1CK1A 4C56C 1I4PA 1TS3A 1V1PA 1S5CD 2O2LD 3W2DA 1LT6D 1KTKA 1PRTF 3BYTB 1YN5A 1L0XB 1LTSD 1LTBD 4RFBA 1BCPF 1MD2D 3DWPA 1JCKB 3EA6A 1B1ZA 1PTOF 1TY0A 4RHRA 1SJED 5ELBA 1XTCD 3DWAA 1HQRD 2TSSA 1RF2D 1B44D 5ELCA 1EEFD 2AQ3B 1LT4D 1S5DD 4O1NA 3DWQA 3BYYB 5FKAC 1HA5A 5TSSA 1LTID 3BVGA 4K6LA 1FNWA 1PZID 1PRTC 1EU3A 3KLSX 3R8BA 1PRTD 3OWEB 1SE2A 1CT1D 1PTOC 1BCPD 1I4RA 2G9HD 4OHJA 1F77A 3O13A 2RDHA 1TS2A 5ELFA 2CHBD 1QILA 1S5BD 1FGBD 2XRQD 2Z8LA 5D3IB 1LT3D 1YN3A 2QEJC 1SE4A 3SEBA 1EFID 1I4QA 1LT5D 1BXTA 1EWCA 1DJRD 1HXYD 1V1OA 2XRSD 3TSSA 1LTTD 1ENFA 4RHSA 1CHPD 1KLUD 1S5ED 1JQYD 2NTSA 1LTGD
chains in the Genus database with same CATH superfamily
5A35A 4DXFA 5H8YE 3VYRA 1T3QA 2UU7A 5I6YA 2CVRA 2WXPA 5KYIA 5DCNA 3CP0A 1FYCA 2BW2A 1OO9B 1HTLD 2ON8A 3HS0C 4KV2A 4P1CC 4B9KA 3NY5A 1ESRA 3HOVH 2V4DA 4ARIA 3CU7A 1K0RA 4JOIA 4KMUC 3ZJYC 1YJ9A 2EYPA 5BR8Q 5I4DA 4II3B 1IBMQ 2AL6A 3PLUA 2F0GA 2KO3A 1UH6A 4TSSA 1NBWA 2LFNA 5CHVC 3RNFC 1M94A 3VXWA 4R4OA 1LXDA 1X1MA 4K8JA 3UE0A 2EDGA 1NNXA 4EVOA 4ZHPA 1XF5L 4ID6A 4A4IA 3Q3JA 2K32A 1CSQA 5F2DA 3DWGC 5J2RA 2E75C 3H9DA 4JWUC 4KDLB 1GD7A 5HY6A 1FXIA 5TR5A 1OEYJ 1CA5A 1EOTA 4A3LG 3OJ3A 1HCZA 1KRSA 2NBWB 1FNUA 3PREA 1KDBA 3PUXA 1V86A 1H9KA 4X62L 4A3PA 2HHHQ 2CKZB 3D4RA 4UAIA 1PYWD 4DR3L 1NSNS 4EQ5A 1A3VA 2WIIB 2ATWA 5KRUA 2RKSA 3DVNU 4RF0A 4TRDA 4XQQA 2MSED 1RTOA 3HEJA 5LL6X 1D1KA 1T5EA 2F3IA 4G50A 5T8IA 4YSYB 4E71A 1BCPC 3GTLH 4US8A 2Q8IB 3Q8EA 1CK1A 4GOPB 4A3FH 1VQCA 3C3LA 1U4AA 4EQOA 2WYQA 3AE7B 3O65B 2JPHA 5C3EH 3K0YA 2M19A 3OHXC 3PIOA 2AWTA 1F9PA 1Q86C 1K28A 2MBOA 4PZ6A 2I46A 5CV9A 5C44B 1FPYA 1KM7A 1N6ZA 3KLRA 4DR3Q 1TKGA 4ALPA 1I35A 2DNCA 1EEFD 2L11A 2F0FA 2KJHB 2LXKA 4O1NA 1E8WA 1HZ6A 4GDLB 1IKMA 3UF8A 3NS8A 5FLXE 3MHZA 2INCC 4DDID 3NTHA 3ZKJC 2X38A 3HOZH 4K7UA 5KGUA 1FNWA 1X55A 2DHZA 4B08A 3OAWA 4KI0A 1IYUA 2OQ0A 3VFKA 1V5OA 2RDBC 2EJMA 2WXFA 2B2VA 1KLVA 5LNK1 2CW0C 2ZTCA 4I7ZC 3KBXA 3JVZX 4KZ0A 3S1NH 4FBJB 2K33A 2OF1A 1F2RC 4CKCA 3QIJA 2WDRB 4MELA 1XX8A 1H95A 1PFMA 2IHEA 1QZGA 2JSOA 4UP8A 2MBHA 4MGYE 5EQ0A 5FLXc 1RJTA 3IRBA 4DR5L 1R9TB 4HLEA 1WWTA 1EL0A 3ZJUA 2INDC 2RPQA 2L1AA 1BXTA 3VHTC 4L23A 3V61A 3NWTA 1VQLA 3JAME 2NVXB 2ZNVB 3FKIG 1QOBA 5K5PA 1JQYD 5M5WH 1QOAA 2WDVB 3N1XC 4DHJB 1S5FD 1G51A 2PVGC 3E56A 1D6EC 2KEEA 4GN4B 5IO9A 4HN7A 2EOTA 5EPLA 1WX7A 2F3VA 2F0TA 5COYA 3CCQA 4BY1H 1RDPD 3H0GG 1E7ZA 2FAZA 4POGA 2NVUI 4X6AH 4DR5Q 1F9JA 3H09A 3SR6A 1N34Q 4A3DH 4C1NI 3I3CA 1SYFA 2WWZA 2HIXA 3NS1A 1C9OA 2JA8G 3A8KE 4LFAQ 1NCVA 1GUAB 4OVZA 2K14A 2OCEA 4R4CA 2BPSA 2B2WC 2PEAA 1OXSC 3SK5A 3TREA 2QJLA 4XZ4A 2WV6D 4QMGA 1SNMA 2L5TA 1FCCC 4HTHA 4AYBG 2KN4A 2WX1A 2I5MX 5J39A 2D3BA 2M17A 4PNYA 2J42A 1SNPA 1RODA 2KQSA 1D7QA 1C4CA 3X3NA 4P7IA 3WA0A 3A4SC 3R3MA 1PYBA 2NVTH 2E74C 4K5VA 3I4NB 2AEHA 3S2DH 1XMOQ 2DY7A 3BZCA 2RQXA 3KF8B 1L2NA 1BQQT 2QGQA 4K81A 4KGRA 3AEVA 1RCVD 3SK4A 1T0QC 1L0WA 3QCAA 1WJ6A 2MQHA 5M9OA 2K3UA 2FUG1 4UHVA 1YQ4B 3LXFA 1Y69U 4IWOA 3RZDH 1B9NA 4G7HC 2UXDL 1N5XA 1WYWB 2F0KA 2PW7A 1CMXB 5CHFA 2C9WB 5EAYA 2RVLA 1CQVA 5C23A 2BBCA 1UAPA 4FJVB 2HIVA 4HIDA 1I4PA 1TBEA 3DHHC 1A3TA 2R3ZA 5LMNL 3OLMD 1STYA 2N1VA 3P63A 2WXRA 3PRPB 2UUCL 4IN3A 1EY9A 2GVAA 1XPRA 1G2TA 1HEZE 3EQLC 3MP9A 3BINA 1YD8U 1B1ZA 3QJYA 4K1RB 1EQRA 4W9IA 4C3HG 3MJ5A 3A0JA 3K59A 1MJEA 5KNDA 1E8XA 3AEFB 2VZKB 1LT4D 5CV5A 2FIDA 3IL8A 2KMAA 4RCNA 3A54A 4DUYL 1OQRA 1NTGA 1EWHA 4J1MA 3K57A 3OW2A 2UXDQ 1FFUA 4CQNA 5C4ZA 2LMCB 3A74A 3C0RB 1EU3A 4AJYB 5GADC 4DV1Q 1L1OA 1XCTL 2KVZA 4C2MH 3SFDB 3SFEB 1EQTA 1ML0D 4R1JA 2EVBA 1PYSB 2UUCQ 1Q46A 1JT8A 3HZXA 3S17H 1QLBB 2NS5A 2FFKB 4CDCC 2EKEC 3I4OA 4JGHB 3N6RA 2BDNA 3I73A 2WAQB 2RA4A 4LUVA 4YIJA 3K5MA 2PE9A 2YVCA 2G9DA 3HOYH 3K5LA 2CU3A 2EYHA 2IY5B 2N4FA 3W5UB 1Q0WB 1HNWL 3MXGA 1DONA 5IGCA 2XRSD 2VUMH 2LASA 2E5LQ 4OIJA 2C35B 1HH2P 2IX3A 4WQOB 4IUPA 1OXXK 3RLFA 3PF4A 3AE9B 5E6OA 3AFPA 1UEAB 4LK0M 1Y1VG 3CMEA 2JZPA 2F0VA 1R7SA 1RHPA 1IL8A 1PTOD 3I55A 2WGSA 1WH3A 3M85A 4DV2Q 4KVGB 4DBGA 3T4AC 4LNFA 3KDFA 3L2PA 1I6HB 3VR6A 1WJ4A 1FCLA 2JEAI 1V8QA 1FL0A 2ZJQA 3I4LA 4C4VB 4HKQA 1TU2B 1EIGA 1ZEQX 1JB7A 5LXHA 4DAMA 1HNWQ 1UF0A 3S2HH 2K5DA 4DR4L 3F8TA 2Q8RE 2KJRA 1VDZA 4RNAA 3QOJA 4MJSB 4NQLB 4E6IA 2DZJA 3I9V1 4OX9L 3NQIA 4W9FA 3MJWA 1N8RC 1UGMA 1GM5A 3ER0A 4RGNA 3KWLA 2BT6A 3AV8A 1UE6A 4M0WB 2B76B 3PIP3 1VR9A 1N60A 2KHWB 1WX9A 2OTJA 4BS9A 1MI2A 2C7NB 1C3TA 5C3EG 3VUXA 4WWPA 2UXCL 2ZJPA 3DLLA 4A3OA 2F3WA 3GTGH 3HOXB 1EUVB 2IY1B 3AU5A 1ISNA 1BUIC 4NZLB 1WE6A 1YX6B 3RN5A 2IGGA 2D62A 1PRTB 4IFDJ 4WFN3 1PQSA 1ZDVA 1JOKA 2E2HB 1NEKB 5HGTA 3NJTA 4O0AA 5JAVA 4EQPA 1VJKA 3EFXD 1N61A 4L1BA 3HOZG 2LS01 4OX9Q 1MG8A 2Y3AA 5FLXL 5C5LA 2PVOD 2WB1E 4RGMA 5GXGB 1DZ1A 3M9BA 5JVG3 2PNHA 2KN5A 2EY6A 1B7YB 4CYEA 3OYYA 1IHZA 4DGZA 2DYOA 1WTWA 5FOBB 2ZZPB 4LF8L 4ZKBB 1K51A 5GAHC 4LF6L 1A2UA 4TVAB 2UXCQ 3H1UA 3QJZA 3I7FA 1VQ7A 1B2TA 4XX5A 3RNEC 1PGAA 1QOHA 2AX5A 4C7ZA 2D07B 4XYQA 3EA6A 3PUZA 1TY0A 4NKLA 4HAEA 1F2YA 2N9EB 2F0QA 1TKEA 3L08A 1NI2A 3Q14C 2NPTB 1S5DD 1EYDA 2GBKA 1LGRA 4IPGA 1TJEA 3FP9A 2FBWB 4LF9Q 4NPNA 1AZPA 3BDLA 1KQSA 1E6EB 1VLBA 2W3RA 3VR9B 1IUEA 5JH5C 1WSPA 1AZQA 4L2YA 3NHHA 1SE2A 1I7HA 4AS1A 2JN4A 2JQRB 5G5GA 1VQ4A 2MP1A 4LF8Q 1A5RA 5JOBA 1TIID 3D4DA 3M4PA 2RDHA 5GAEC 4LF6Q 1C79A 1Q1EA 1YX5B 3IFWB 3P4PB 2ZW1A 1QILA 3T8MA 1XLNA 3S1MH 1Q8IA 1B3AA 4M8AA 4KDIC 1VQKA 4C3IB 1SYDA 4X3UA 2MBQA 1SE4A 2INPE 1YNJC 4TKNA 4A3DG 3OIQA 3X23A 3SE0A 3KW5B 4FF3A 1YHBA 3EBEA 4GN5A 2VXWA 3R3OA 5M3MG 3RPFC 3A56A 3ZQ4A 1LTTD 1WD0A 2NWGA 4N9F4 4YSZB 3A9KA 1IGDA 3NHEB 4EQNA 1QG7A 4BVUC 4HVBA 5BYSA 5AJ3Q 4L6TB 1WMHA 3D3RA 1DOLA 2O2VB 5C4JH 4CHKA 3W1SA 3ZXVA 5KIXA 5IWAL 2D3GA 2R7ZH 3RN2A 3QARA 3RD4A 2N88A 3K80C 5M3FB 2IGDA 3HVZA 2RD0A 1MSGA 2NTTA 3VR2A 4LTUA 1X9NA 1CI3M 5D14A 1SGHA 2C9OA 3ZDTA 2PW9A 1AN8A 3TUOA 3AEEB 1SDFA 4DN4M 2D10A 2W82A 4X57B 1Y56A 4ZDVA 2MO1A 4S0RA 2JA6B 3UINB 5C4HA 2RMMA 1IYJB 1VQGA 4X66L 2KTFA 1WFQA 1SLJA 5DM63 3GTQB 2IY0B 4FNFA 3PO3B 2BYEA 4DDGD 1DYQA 1KHIA 1ESFA 1L0VB 3WDNA 3TP5A 3NUCA 4DV3L 2R93H 4LJOB 1KOTA 3Q3OC 4PS7A 1XPOA 3DHIC 3N9YC 1L2FA 2R7FA 3HKSA 4QB4A 5AZGA 2F4IA 1EO6A 2WU2B 2KCNA 2BA1A 3CCMA 2PYKA 2BS4B 2XBBC 1WJJA 4HWIB 3Q3NC 4WORA 4CBVA 2N9KA 2G4DB 1OQYA 2PQAA 4MDKE 1PZKD 5CBEE 4XQJA 4KK7A 1V6EA 4EUTA 5HFYA 3VA5A 4LNQA 4XTCS 3Q8FA 2K9XA 4X66Q 1J0GA 3I2ZA 3TDQA 2R92B 4BBSH 4QF4A 1NDDA 3GZNI 3CRKC 1TWCB 2GVBA 3D6WA 4NW2A 4DV3Q 4CKBA 2WXLA 3DHQA 2M0AA 3TBLD 1J7CA 1F2ZA 4NXML 2L15A 1MJDA 3ZVVA 4JI6L 1ROEA 4MTNA 4RAUC 4C00A 3NENA 2RBMA 1LUZA 4R8NA 1HR0L 4A6QA 1YN5A 3HOUH 1BO0A 1L0XB 2OXPA 3T56B 4RFBA 2KJXA 2N9XA 2Z4HA 2BDOA 3KJPA 3I4MB 3NTIA 1ACCA 3T3OA 2TSSA 3G6EA 1JB3A 3HOYG 3TEWA 1GHJA 2D5GA 3M4QA 1NMFA 3VAWA 5L37A 4JI0Q 3VTWA 2X6GA 3BYYB 5TSSA 2FCNA 1E1TA 3KLSA 3PQIA 2QEXA 1VQIA 3BS1A 2BF8B 2IO3B 2ZW0A 3AM9A 1DGSA 2A73B 4GS3A 2VUMG 2DENB 4EOYA 3M3JA 1PRTC 2Z6KC 5IY0A 2BS2B 3J7YW 2J0TD 2JA7B 4JK1C 4NXMQ 2BB6A 4JI6Q 5JJKA 3EHVA 2A19A 1KNEA 4LF7L 1I4RA 4R3DA 5C44G 1J7AA 1HR0Q 1RWSA 2WHIA 3UI3A 1B3QA 4B0MA 2PI2E 1SFOB 2B8FA 1ZXTA 2L55A 2EXDA 2K01A 3KJOA 1GJZA 1RLFA 1PH7A 4BBNF 3GV6A 5HKHA 2LFIA 1IW7C 1V49A 3GOEA 3K9OB 2VQFQ 3IFTA 5C2TB 3C8YA 3I70A 3J7A5 3V60A 3T13A 1GHKA 2KWVB 3AN1A 4CO7A 4DAYB 1EIFA 1EWCA 3A8JE 1DJRD 2V0GA 2SDFA 1WJUA 2WB1B 2MW5A 1B8AA 3D8GA 4ABNA 2ZEQA 1K8AC 2KDBA 4MM3B 2JQOA 2O6VA 3PCOB 3LWEA 3QAQA 1QB5D 5IOIA 3S1RH 4YHHL 2FXQA 3U4VA 4HR7B 2K39A 2ICIA 4B95A 1SE9A 2E76C 3DEPA 3TZDA 4OVVA 1TKWB 2K5NA 4WWNA 3P4QB 1K3RA 3W5OA 2YLMA 3G4SA 1HFGA 2FCMA 3J81E 3SHQA 1D1IA 1QNKA 4ZYSA 4A3MB 1RKNA 4K2LA 1I50B 3TMEA 3HOVB 4LFBL 4TQ1A 3WWVA 4CDFC 3WAOA 4DHZB 3Q69A 2CU1A 2W9NA 1J7BA 2KNBA 3D32A 4K0KQ 4NY0A 1MPEA 1KABA 1ET6A 1KLGD 4W9GA 3QO2A 3ZW3A 2KOLA 2K75A 2RHQB 3OTOL 3ULPA 3OIPA 3LYYA 2B3GA 5EDSA 3TEYA 4YHHQ 3A1QB 1I5FA 5FO8B 1K8MA 4HPLB 1KDAA 4AUQC 5J1ZA 1YJNA 1DD2A 2RSUA 4MGKE 5HI1A 5GROA 1WRIA 2CHZA 1LABA 1H9SA 4KSLC 3T1YL 4NAWB 2KX3A 2C7MB 4S17A 3QQ8B 2E2JH 1FNVA 4LFBQ 4X3TA 3LJ3A 2MP2A 3W1YA 1D5ZC 2YTXA 3T51B 4DV7L 4RH6A 4HJGE 2H5XA 1BCPB 2L12A 2MFIA 2N8NA 2JA5B 2KANA 3FVQA 2E2DC 4JBJA 1GO3E 4YY3L 1C0AA 4F7ZA 3H15A 2JZ3B 4XXEA 2J52A 3MHBA 1XPUA 1GNUA 2KDIA 2KLGA 1V43A 3DUZA 5CYUA 1CUKA 4FF1A 4KHPL 4A3BB 3CWIA 3K7UC 3M3YH 2E2IB 2Z59B 2Z0EB 5BO4B 5BMHA 5CORA 1P3QU 3AU7A 5G2NA 2AL3A 1C48A 3T1YQ 1PVOA 1GUWA 3H7SA 4A3EB 2WFWA 4GDLA 3ZUNA 1SJED 2JJQA 2OQKA 1WTXA 1Q90A 1F1HA 1EFWA 2YU9H 3H0GH 4DV7Q 1WM3A 2X8XX 1B50A 3RULA 1VQDA 1Y8OB 5JEAJ 4DNRB 2PCFB 4LF4L 4YY3Q 5CV7A 4LWCA 2CHXA 2WINB 2DGYA 2F0IA 1J6QA 1SYEA 2OJRA 1ICFB 4MIUA 3SK8A 1GAQB 2PKOA 4KHPQ 1YIWA 1U4PA 4FJZA 1E2ZA 1ENAA 4Y7NB 3VH4B 5JHBA 5M5YH 1Y1WB 1UE1A 4DXAB 1T6BX 1E0BA 3VUWA 3R7QA 4J15A 3AEBB 1MFWA 1C4QA 2V1CC 3NQTA 3ML8A 1QQRA 3H7PB 1VQPA 1NR4A 3GTKH 1WZ3A 2R7ZG 3J80i 4B3ML 3GTOH 2Z8LA 3S1NB 5A2QE 4PZ8A 2K25A 4JQWC 4GLVB 5MPOA 3NVWA 2JF5A 1KJTA 1Z2MA 1XMQL 4G0NB 2D2CC 2NCNA 1IBXA 4LF4Q 1EFID 4U673 1Q3LA 3EN2A 2Q2TA 3P4SB 3UGBB 2FJ2A 2AMCB 4XDXA 2Q2HA 1SMXA 3I8ZA 5IKCM 3F2DA 1P1AA 1T0RC 4A76A 1WE7A 1C78A 3A9JB 3BJUA 1II3A 3G6JB 3M63B 3JYUA 4DXGA 2XNAC 2R93G 4GN3B 3F2BA 4JI3Q 3KUCB 2Y5CA 4GMVA 4R8IA 1QF6A 3M4OH 1ZXHA 4IDIA 4IUTA 4RG1A 5M5WB 3RMHA 2MEKA 2UYZB 3JC66 3PO2B 1E2VA 1O7ZA 2XWBB 3K6OA 3DOWA 2BKRB 2KX0A 1YNXA 2AYOB 1JC7A 3GTJH 1TWHH 2RCNA 4DNIA 3U7DA 1LV9A 2LGYA 1EY8A 4DAPA 3MAQA 2K4KA 3STBC 2ZPNA 3S1QH 1RRBA 3PV0A 1XMQQ 1H9RA 1SMYD 3AE6B 2CKHB 3D0FA 5DLQE 2VRRB 1HPCA 4CDDC 3S14H 5H1SE 3B08A 2PLPA 4RGOS 3MC0B 2HD5B 2WXJA 4HJ8A 5IGDA 5D94A 4EEWA 4NMZA 1UELA 4K8IA 2VNUD 2I5LX 2G1EA 4ME3A 5LL6S 1BBUA 4BWGB 1GUNA 2V9HA 1HA6A 1W6KA 3JW0X 1C4PA 2Z0SA 4Z9CB 4MH8A 4USAA 5E1FA 4A9AA 4AWJA 2K5HA 1BMLC 3WOEA 2HT1A 4L5TA 3GTMH 1WY8A 1XJVA 3L54A 2L4NA 4ZUIA 3HOUG 1MHWC 1EYGA 1GVPA 1PDQA 1EEID 2B2TA 1VQ9A 2IL8A 2EYFA 4TV3A 5IGBA 2L3ZA 1NJIC 5C4XB 1OXVA 2F0WA 5ELEA 4TQUS 1JOOA 4YT0B 3TP7A 1YEZA 2O6VD 3S15B 4RF1A 4JE3B 5L83A 2VQEL 3P1HA 1MBYA 2KFJA 1L4ZB 5IA7A 2RSNA 3HOWB 3V2TA 1VS0A 1N33L 3HOXG 3PV1A 2A4ZA 4C3JH 1A2TA 2A68C 1Y1VH 3HRZC 5G5HA 1I94L 3DQVA 3HFZB 4LLGM 4RWSC 4YTPB 4RMAA 3V62A 1STBA 1NI3A 2SAKA 4IZ8A 4V0BA 3DWPA 4OO1G 5FLMH 1E9MA 3Q0AA 1OQQA 1YNND 1EQVA 2LXJA 1RYJA 5FR3A 5DM73 2KVMA 4KJNA 4GDKA 4ZUJA 2XVSA 4KTAA 2PTLA 1F2LA 5FKAC 1JJGA 2JWUA 3VRAB 1JMCA 1IPGA 2EY2A 2WNMA 4B0EA 4WWOA 4A93B 2JXMB 3CCVA 4GNXC 1N33Q 1QJOA 2QMTA 1OXTA 4DR7L 3ZTCA 1E1OA 3K9PB 1Z5SB 3WIMA 3D31A 1LM8B 4BBRH 3U8ZA 1GUGA 2CWPA 3DM1A 3KLWA 2E6XA 2A6ED 3CCLA 4X62Q 1XNRL 2DBYA 1K83B 2JWZA 2ZPYA 2CWAA 1HZCA 1YN3A 2HDLA 3NVVA 2J7QB 1QOFA 4A55A 3GE8C 1KL9A 2VL6A 3R66C 3FKYA 5CTRC 3NZ3A 4OZCA 3OWFA 1BOSA 2PNRC 1ZYRD 4CJ2C 2R6GA 4HK2A 1GUSA 4IFDH 4NJ7A 5JPMC 1FR3A 4DR7Q 4J3OD 1JORA 5KHQA 5I2XA 1WD1A 2HE7A 4MH0E 3AE2B 2UUAL 4NDXA 4BY7H 3N3KB 4ULLA 3NK9A 2IPKD 2EXZA 5EBDA 3RUZA 4RM8A 2KC2A 1L5PA 1VZ7A 2HQEA 3NSWA 4LFCL 1ICWA 4A3JB 1KRTA 1WYDA 1XNRQ 4GKJL 4A3IH 2LRUA 3NVZA 4W9KA 1ZP0B 2DJGC 1X3GA 1CZGA 1YNTE 5IGGA 3KQ4A 3VH3B 4N9PA 1LLRD 4BKSA 2ZTDA 4ANUA 1FD7D 5M5XB 3ND9A 1WM2A 3CC4A 4JYAL 1Q10A 4CJ1B 2LSSA 4N8FA 2UWQA 1EY7A 1TKYA 4DUZL 1SJHD 3WCQA 4JI7L 2ES2A 4XYOA 1UNSA 3NG0A 1XYIA 3BVZA 2UUAQ 1ONLA 4OELB 3TIXA 1T0SC 4KKUA 1GG3A 5HURA 1WF9A 1RAXA 2OJWA 1K3BC 3SD5A 4LFCQ 5IYBG 2OTLA 1JRPA 2WXIA 2GBNA 1TWAH 4NPSA 3Q8BA 3K5NA 5E6PA 1YVCA 3S2AA 1K8RB 4PMBA 1QUQB 2IT1A 4H7BA 4TMAB 3IG3A 3SU8X 4ME5A 4A3KB 3DBLB 3SDLC 2OEOA 2N7DA 1WGYA 4IOIE 3MTSA 2PPHA 2CFMA 5M3MH 5LMNW 4JYAQ 1FRRA 1K0SA 1EIHA 2CQAA 4ZLTF 3JAMc 3RNBC 4DUZQ 2XTIA 4JI7Q 4G3XB 1MI0A 1RFAA 4KIKA 4LNIA 5E4XA 1YJWA 1TS3A 1VQ5A 1V81A 3DBLI 2Y0SG 3CXCA 2W54A 1ASYA 2QSDA 1LT6D 1PLFA 3PGEA 2YV5A 1CKNB 1Z9FA 3VA7A 2MJDA 4ZKCB 4H2AA 3RNGC 2JU6X 3GTPH 2B63H 4LUOA 5BN4A 2QC8A 2NVYH 4XT3B 2R92G 2K22A 3ZNGC 3BZKA 4N6EB 2REXA 4BZAA 5A2QL 1G6ZA 1AE3A 1VQJA 1P0RA 2EQSA 4HSVA 1J8IA 2KMCA 4GSWA 4B3SL 3BK1A 4OWTB 4A75A 3KLSX 2A74C 1QVFA 1J8CA 3J80E 3NBHA 3L13A 2B2YC 4M01A 1WI0A 2NZOA 4LMQD 3TN2A 2ZXRA 1VQOA 3I4MG 3KVFB 3NOBA 4NJ6A 2ID0A 3AULA 1A15A 4NNJB 1JRUA 3U9SA 1LM0A 1BBWA 3GB1A 1FGBD 5I9OA 4JI1L 1SF0A 2PO4A 2C60A 3VRBB 4ACFA 1NE3A 2F0PA 1QT9A 3B9JA 4XDCA 3A5ZB 1LT3D 4LJZC 3S1MB 2K52A 2F0JA 3PIPA 4WJ3M 2ENBA 1E0ZA 3VQIA 5DPWA 3VR5A 2ZCBA 1LT5D 1SNDA 2M4NA 1NYQA 1WX8A 3PVLA 3CPWA 1UEBA 4RKLA 1R4MB 4O42A 4B9XA 2WXOA 3PZ8A 4EZLA 4BOZB 5IP9G 3J80c 4HCSA 3DWMA 3DPDA 2JT4B 5LMNQ 2VH2A 3B1LX 4MSQB 2M2LA 2KVRA 1KFYB 4JPSA 5HGQA 2XK5A 1V97A 5IYDG 1PH6A 2CH4W 1R4MI 2GOWA 2BTEA 3L10B 1TWFB 4I7AA 1QWYA 2KWCA 2B2UC 1IGCA 1N32L 4BAXA 3EC8A 4LNKA 4ZRQA 4HKZE 2EYJA 2KLCA 2EE1A 1L7YA 4DA2A 2GN5A 4DV6L 1P7FA 4DUYQ 1I3QB 4KKJA 3L17A 1B9RA 3PUWA 3TQYA 1VMCA 2ALYB 1TWGB 4B3TL 2KC1A 1RFKA 3NRZA 3UIOB 3J7AV 4LAAA 2NVQB 2JYTA 3HKZG 4N59A 1M1KC 1PDXA 4W9CA 3R7RA 4X64L 1X3EA 5D65A 2KHJA 4C3JG 3MA2B 2UXBL 5C44H 2LJIA 3DBHI 2ZM6L 2F1MA 3V6EB 1IZ6A 1B53A 3L3OC 1L0YB 1Q8KA 3DBRI 2EELA 2H89B 4HEA1 4P6VF 1EYCA 4H02A 3PUYA 4AYBE 4DQOC 2K8BA 1RIPA 5FLMG 1N32Q 4LDTB 1U5KA 2F0MA 2K05A 4DV6Q 4FVMA 4LUZA 1DOIA 2RPVA 1PTOB 1BBXC 4LCDE 3SDZA 5KNBA 2FUHB 1TY2A 4M8MA 1VZ8A 1ZPSA 4EKUA 2CS4A 1VQBA 1JICA 3MWYW 4FA6A 2L83A 3J81i 1UUPA 2ONQA 2DYBA 5CX3A 4X64Q 4O2DA 3A8IE 1YN4A 4C56C 3Q22A 1WCMB 2NBVB 2UXBQ 2K0PA 2AWNA 1Y8NB 3BWUD 3VTVA 2PPBC 2ZM6Q 3G48A 2L52A 2JX5A 2M00A 3QR8A 2RR9A 1G6PA 3MTNB 3EIVA 1MD2D 2NZ1D 2MUYA 4WJWA 4BBRG 1R9TH 1M90C 4FF4A 2GB1A 2K8CA 3KF6B 4AQYL 2ASBA 3PMFA 4BKSD 1K73C 1HHVA 4FADA 3CC7A 1FD6A 4QJFA 1B9MA 4IM0A 2NVXH 1R4PB 3TS0A 4DR4Q 5LMUL 2BCOA 5EPKA 1HA5A 1C4AA 2LJ5A 4YCUA 1EY4A 4GZYC 3L4PA 4L8JA 4KGSA 1PH4A 4WJNA 3J81j 1XNQL 4IFDG 4MGIE 1PRTD 1SNQA 2F0OA 2EZVA 3W3AA 1WXQA 4ICVA 5J18A 4OHJA 4AQ7A 1K8GA 3HGBA 1TS2A 2JEBI 4KKTA 1WTVA 4HJ7A 4BY7G 5C0XH 4QIWE 1MJCA 1GPXA 2BOSA 4AQYQ 4OIKA 2Q2UA 4A3IG 3SR1A 1OFFA 4NB3A 1WTHA 4DAYA 1Y8RC 4QQBX 1J19A 1NYRA 1UZXB 2C5LC 5LMUQ 3DHGC 2A1AA 2KENA 2HJ8A 4DK5A 4YTNB 1Y1WG 1C8CA 5EE9A 3DCGA 4HXDA 5J3BA 3K8AA 1PH9A 3S24A 2MNAA 2RF4A 3U2SC 4GB9A 2ZVNA 3JSVA 1LQBA 1W2BA 3BY4B 2MX2A 3RZFA 3I4NH 1GB4A 3JAML 1VRAB 1NVID 2D11A 3RZOB 3VR3A 3N32A 3CPFA 1BDOA 1OXUA 3DVNV 5E6NA 1CZPA 4H0LC 2YTVA 1FO4A 1A3UA 4W9JA 1EF5A 3PSIA 2OWOA 3I90A 5IT9E 3VR4A 1LYLA 4UDUC 1LTRD 3FEWX 3I56A 1FXTB 4PYZA 3AH7A 3EUB2 4OWWB 4XYCA 2A69D 3OPOA 3VYSA 1D5XC 1P8LA 2DUDA 2Z9HA 3NTKA 5AUKA 2DN8A 2B8GA 1A62A 3FC4A 2B2TC 2I1KA 1PH5A 3TZUA 3PO2G 1C77A 1WOCA 1O7IA 3DVGY 4JOIC 3HM6X 3IAM1 3RN9C 5JEAH 1FXAA 1IP9A 2KZRA 5EJWA 3H91A 3L0OA 3ABVB 1BT0A 1YQ3B 2PMZE 1AYFA 4MTKA 2JSVX 4FYDA 4KY7A 1MIUA 1G91A 3TP6A 1SRUA 5AFWA 3VYTA 2LI5A 4GGQA 3A33B 2B63G 4IM2A 4HMIA 2P5ZX 3V05A 2MBBB 2LWPA 3U30A 4YWGG 4DFAA 3BDOA 1TIFA 4JCVE 4UY8C 1LTAD 2LY7A 4JC0A 2G5DA 3RD2A 2WACA 1TXYA 3D6CA 1X56A 3AI5A 2N7JA 1I6VC 4A3GB 1YJ1A 1D5MC 3AECB 1P9DU 1FM0D 1HR0W 3MC8A 1JWAD 1RD9D 3IFDA 2F52A 1AE2A 1G2SA 1GUTA 4HDQA 1V1PA 3P42A 4IWPA 3FKIB 3W2DA 3J80L 1KTKA 1PRTF 4IOAA 1JROA 3E9SA 5IWAQ 2KHIA 5BYQA 2KTRA 1RM6C 2IO2B 1HTQA 1E7UA 1EZ8A 4JBKA 1XTCD 3DWAA 4BFRA 2FE8A 2WKDA 3GZNB 2HDEA 2KCMA 2RCFA 1GC7A 4E74A 5EKIA 3PZ7A 1TZOA 4FF2A 1Z6HA 3G7LA 2F0HA 2KECA 1SROA 4R4IA 3IVFA 3PPAA 4UP9A 3W1GA 1FMAD 3HM3A 3OWEB 1EY0A 4X3KA 2KHSA 2JA8B 1P98A 1PTOC 5J17A 1VZ6A 3QWZB 1I6HH 2LGSA 2A6HD 1LFDA 2KAJA 4JWSC 4M1UB 3U4ZA 2DNEA 4QCLA 4K5XA 2BE5D 3CRLC 1N36L 4FHKA 3CCUA 4APVA 4B9WA 4GLSC 4EX5A 3GTKB 1UD7A 3KDFB 1IKLA 2EYLA 3SEBA 4A93G 2Q2IA 3T9LA 3CQZB 2B2VC 1TVXA 3ZYYX 2XIWA 1HUNA 3NXWA 4IPCA 3T1HL 1SYBA 4CJ0B 2LEKA 3NZUA 3K7AB 3RNUA 1P7EA 1WR6E 2N78A 1WIAA 1EY6A 2YEPF 3S16B 3MFGA 3CSFA 3HOXH 1A8VA 1VQFA 4P75A 3A5UA 2J0KA 1LTLA 3H3VH 1UE7A 4JLCA 4PT5A 2SNSA 4XE0A 1QVGA 3QC8B 2E2HH 2B2WA 2IO1B 4POFA 1N36Q 1VD2A 2L0TA 3T3NA 4I6NB 1ILQA 1N9WA 5T1GA 4OO1H 5EPJA 1C1YB 3DBSA 4NQKE 2KACA 4IKGA 4JBMA 3VDYA 2M9VA 3QIAA 1F52A 2BYVE 1I4HA 1NY4A 3ECIA 3N1ZC 1F9QA 1K9MC 2EY5A 4KN7C 2JE6I 4R9WA 4C3HB 4GLXA 1PGXA 1TS5A 3T1HQ 1WR1A 2KFKA 2KCTA 4B3RL 3LNNA 3E3XA 1YHQA 4ILWA 2O4XA 4A3JG 4LF7Q 3E9HA 1O78A 3GS2A 2IO0B 1AW7A 3QX1A 4R4TA 1TR5A 1QVCA 4ANVA 5EBCA 2V3SA 5FR6A 4HJ9A 1KXLA 3VUYA 4C7YA 3MC9A 3GP7A 4GN1A 3U50C 2I38A 1F9SA 1VF5C 4PZ7A 1GOZA 1UBIA 4S3SA 1YMHE 2CJOA 1XLPA 2L9HA 2BYTA 4B3RQ 2KDFB 2OOBB 2YYZA 2HCCA 2Z1CA 3LDZE 4IM3A 1V9JA 1EQQA 2DZKA 1QE6A 3CMMB 3SK6A 1ZDXA 4Q0FA 5EGTA 2A68D 4C3IH 2LXAA 1SR3A 3EJIA 5C0XG 2WKCA 3BYTB 3OW7A 3KFUA 3HHMA 1C9FA 3NEMA 5CMDA 1ZOYB 1IYFA 1CZWA 5GQOA 2IYDB 2K5PA 1NMGA 2K5QA 5ELOA 2NUCA 3J81c 2WP9B 1IYVA 1F2MA 1TYGB 2FMCA 2RDFA 4GNXB 2DX5B 1WGRA 1NR2A 4EZJA 2KMMA 3F2UA 3RCZA 2FMMA 2PZWA 1LTID 3T53B 3E0EA 4GOPA 1YZ6A 1Q1OA 4DR1L 5IE8A 2GRIA 3N1YC 4BBNC 3W9CB 3I3TB 1CT1D 3OTOQ 1BCPD 3I4NG 5M3FH 3MEHA 3SXHA 1X3FA 2BS3B 2ZXOA 3O13A 3TRZA 2QDBA 1AP0A 2DLBA 1QKZA 3GTLB 1A70A 3KYCD 2TMPA 3MXNB 4A3FB 1WMHB 2PMVA 4OWXB 1U0LA 1GC6A 5IYBH 3GQBA 1LACA 2MJ8A 4ZQ3A 5C3EB 2F0UA 2WS3B 4JI2L 3ZJTA 2QEJC 1L1OC 4OVUA 3GTQH 2ZJRA 1WXMA 1EYAA 2KK8A 2MGSA 3MEFA 5IP4D 1R4NI 2V4IB 1XTDA 2F4VL 2AUJD 3TSSA 3ERQA 3ZNHB 4DR1Q 3FILB 3CF5A 5HHDG 1XLOA 1CKOA 3C1FA 1H4RA 5CV4A 3V96A 2L8JA 5JEAG 1M8AA 3HOZB 1WYGA 3KK7A 2IWHA 1N5WA 4LNOA 3ERSX 1AEXA 1CM9A 4A90A 4FXDA 5C6AA 3W1BA 2CW0D 2FNJB 3L16A 4FN2A 2XSCA 3AE3B 1SE8A 2B39A 2HTME 2NN6H 2MRPA 4OEMB 3K58A 3ALBA 1MGSA 3Q3MC 2R92H 1EM7A 1WI5A 2M8SA 3L0WB 3CKIB 3OOCA 3SGIA 3PS6A 1TWCH 2VW9A 3X0WA 5FO7B 4ZRPA 1HZBA 5KHOA 1VQEA 3V6CB 4DKAC 4JV5L 2PQAB 1STNA 2DY8A 2FCQA 1F0ZA 1EY5A 2KQ7A 4RKBA 1S3OA 3B2GA 3Q8DA 4ODGA 4P74A 3WOFA 2HCIA 4MN3A 3TL5A 2WAQG 1X3QA 2D9UA 2F0LA 3GO5A 4IJHA 4RGTA 1H9MA 3I4MH 4JI4L 1DXMA 4IQZA 3P75A 1KD1C 2L0CA 2HTHA 2LHDA 2V4LA 2Z4IA 2LHEA 1VCIA 4YWLA 1BNZA 2B29A 4B3MQ 3PT2B 1I42A 5BN5A 3F2CA 3RR5A 2IX1A 4WJQA 4YWMA 1SNCA 3OSOA 1UWXA 5JJLA 4DK3C 3C19A 1D4BA 4BY1B 2JA7H 4JV5Q 2V3NA 3AXCA 4ARCA 4KX6B 4KHZA 4WRDA 2PQEA 3MHSD 1SEBD 1WGHA 3AEAB 1YBYA 4TKOB 4PMCA 1N62A 4AJWA 3U9OA 4A3DB 1SFOH 1HZAA 2N3SA 4HCEA 5IP9H 1DOXA 5M3MB 2X69A 3I72A 1XO3A 2YTYA 4JI4Q 4HCNB 3TS2A 3FPPA 2SOBA 3KF8A 4IUNA 5DNFA 4PYUA 4BOSC 4K2KA 4OGQC 3RLOA 2Z0DB 1BCPF 5IYDH 3P2BA 4F8CB 2BVCA 1S40A 4RHRA 5K36H 1HRJA 1SYCA 2KJ6A 2LUEA 4CKEA 4DV5L 2NVTB 1HFNA 2JXTA 3ZNID 2O5JC 3LWUA 3S2DB 2JRHA 1MKHA 3AYHB 4WH4A 2NVYB 4H44C 2L0FA 1KAAA 2IZVB 4CGYB 1S3SG 4JG2A 4GOCA 5BMIA 1PZID 1Q1BA 1CSPA 4DNTB 3EFCA 1QOGA 1UBQA 1V5TA 2DNFA 3ZIMA 4GU2A 1XCQL 3RZDB 1U4MA 2J53A 1X65A 4WJOA 4J6IA 4W9EA 5L95C 1CFMA 2O6VB 4A3MH 2K5VA 3KYHC 1I50H 2LXCA 2IX0A 2V3PA 1HE8A 2VH1A 3MXPA 4HMJA 2INNE 5D3IB 4DV5Q 3FPUB 1K50A 4ICUA 4IPDA 2HHHL 4WJ4A 3ITPA 3UDFA 1BF4A 3UE1A 2LMCA 3DEOA 4KGTA 1V80A 2N49A 1CQFA 3Q23A 2VQEQ 4A3CG 2GBMA 3IT6B 4RHSA 2BH2A 2ZTEA 2EPBA 2XGTA 2G9HD 1V8CA 3NVYA 2NTSA 1H8CA 4REZA 1WTOA 2UUBL 2N1WA 1M4VA 4BA2I 2DYMA 1SBBB 3V3XA 3APDA 2CH4A 1I94Q 4PQXA 2DWQA 1TGZB 2MJEA 5EKKA 3CSTA 2BGFA 1JALA 1TS4A 4DF7A 4W9LA 5I2YA 4XWTA 4C2MB 1E7PB 4M02A 2WAQE 2JA5H 2MLBA 5IGFA 1ENCA 4XC2A 3J7AF 1SXTA 3KUPA 3S17B 4GXBA 1W3SA 1H9SB 4XQNA 4X3SA 2N0SB 2QKIC 2W55A 5JXVA 2BKFA 3VVWB 4A3BH 3J81L 2C5CA 3HOYB 2MP2B 3PUVA 4PG3A 1GKHA 1PH3A 3DXJC 2E2IH 3W1SC 2GBRA 2UUBQ 3TCAA 1E24A 2H4OA 1OGWA 3HG9A 3TBIB 3EGRA 1ZKHA 2VUMB 4A3EH 2ZJDA 5AUIA 3DM3A 4IG7B 4ZAIA 2K8HA 4J6HA 4MGZE 3URYA 1I4GA 5BYRA 1PFNA 3N30A 4C3IG 4G7ZC 4W9HA 1GUOA 4C4VA 4M8NA 1PZJD 3ML9A 3R2IA 3RLNA 4AH6A 3AMZA 3LB8C 3HVDA 1WZ0A 1KDCA 2G3QB 5CGKA 1JWBD 1O80A 2K7VA 1WTRA 1DOMA 2MCNB 4MJSA 3ZRCA 4LJPB 4Y7NH 5I9PA 1Y1WH 3K0XA 5G3LD 1PFSA 3BU2A 5IYCH 2CCZA 2O5IC 4URKA 4M0WA 2N9PC 4WIPA 1ZW7A 3AFQA 2I0QA 1PFBA 3S2HB 3TEXA 4A20A 3UQAA 1YHAA 4ZRIA 2JRIB 2PZUA 4HJAA 4XWWA 3MXUA 5M3FG 3CCSA 3E6ZX 2W3SA 2D2QA 2K6AA 1E8ZA 3KF6A 1AH9A 2JZZA 2FINB 2QCPX 3GD7A 5CR3A 4N8X1 3EROA 3I63C 2Z6KA 3FAHA 2N55A 4GKJQ 2SNMA 3AE5B 4DHJD 4P2CB 3RFZB 4QUFA 2JA6G 1B44D 3NP8A 1SAPA 5JJZA 2PZTA 2AQ3B 4A3GG 1EF1A 2QHOA 2K6DB 3GTGB 4PS8A 3PO3G 1UWMA 1N34L 2KDEB 3H6NA 4FO2A 1FFVA 1OEYA 3AU4A 1PHJA 4P16A 4TUUA 2BYFA 4LFAL 1IBXB 2EJFC 4DR2L 2EYOA 3PO2H 2WP8J 3RT3B 3ICEA 1YITA 2I1JA 5DPSA 3CC2A 1N63A 1F77A 2IGHA 1E10A 2I2YA 3HRDD 1TT5B 1EZ6A 2VB2X 4OXPA 2KT7A 1JMLA 2QW7A 1IL2A 1XMOL 5IOCA 2NN6G 2NPTA 1SMYC 2PE6B 4OZAA 4K5WA 1E2WA 1HTPA 4FP5D 3G71A 1UWVA 1BKBA 5J22A 2QIEB 3P4RB 4I6LB 1VQAA 5NUCA 4ZRJA 2JXXA 2KQ3A 4W9DA 3IHPC 3PIO3 2ACZB 1A63A 2L7RA 4DR2Q 1AWDA 3L7ZC 2GLSA 4NP5A 5C0XI 1S5ED 3LX0A 2AWOA 2M1MA 3P20A 3N52A 2C7HA 3M62B 5IAAC 1XT9B 2AQ2B 1F9RA 1A6XA 4L5SA 4QAYA 3TEZA 2OEDA 4PMWA 4XGAB 2KUMA 5C4XH 2WQYB 1SE3A 4YCVA 2WXMA 1BUVT 1FJGL 3TEHB 2GMIC 1ET9A 3I57A 1VF7A 4WAFA 3S15H 4JI5L 4BA1I 3VR8B 5C3WA 2KYWA 1PMRA 3AB5A 1OTRB 1YNJD 2MO0A 3HOWH 3CW2C 3H94A 4KV6A 2JA7G 1YJIA 4B3SQ 1QZEA 2O2VA 4LNNA 4DV1L 1Q12A 4WJPA 2EYMA 3Q24A 1PXUA 4HIOA 1CA6A 1ILPA 1NBFC 2K50A 1EIYB 3VTUA 2VZKD 5G3LF 3CF6E 2WXNA 1BVSA 1S4ZA 1HUMA 3B6YA 1C7YA 2HD3A 1CKMA 2JP1A 5C5MA 2WU5B 4ANWA 4HDOA 4I65A 4QGUA 1YNNC 4JI1Q 2KA7A 1FJGQ 1DGJA 5C4JB 3NELA 2PW5A 5LHY1 3K81C 3CMAA 2QA4A 4JI5Q 5K36G 3DDCB 3RNCC 4QUCA 2D3AA 1C76A 1WXSA 1BR9A 2KCCA 2R7ZB 2WB1G 4HPPA 4A93H 1KF6B 1U4LA 4MHEA 4AP4C 1I4XA 2L05A 4DAVA 3DBHB 4A8XC 3H8HA 4GDKB 3DBRB 2E5LL 2QILA 1HZ9A 1T5XD 5FK9C 3UI2A 3J7ZC 2MH7A 3S9WA 4F8MA 4Q2JA 3U4EG 3SHLA 1JOQA 1FGUA 3AE1B 3KOJA 2O2LD 1SIFA 4HCPB 4H13C 3FDTA 1ASZA 1JW9D 1EOVA 1K83H 5IGEA 2NBUA 2Y5BB 4DV2L 3HOVG 2R93B 4A3MG 5IN7A 2A6EC 4EGVA 4DV0L 4GOPC 3F1ZA 4FXCA 3PF5A 3ND8A 3IKJA 4MZ9A 3Q2AC 2Y0SE 4MEMA 5EE3A 3PZDA 1KNAA 1JE5A 5DPRA 3AEGB 3BDCA 4HIMA 2VZAA 4KN4C 1J5EL 3DWQA 4HSPA 2Q5WD 4D2KA 1ZYRC 4C1NK 3H6MA 1DCZA 4KY6A 3HP3A 2LGIA 4B3TQ 4G57A 2OT2A 3BVGA 3QA8A 1TTNA 2VY3A 1STGA 2K03A 3T16A 3C1EA 1T9HA 5KEEA 1WVLA 4LDTD 1QCBD 5G55A 5CV8A 1J9OA 3UDXA 4A3JH 1SIJA 2I5HA 4BBSB 2CHWA 3DMUA 3MFYA 2EMSA 4EFOA 1HQMC 2WDTB 1L6VA 1HNXL 4DV0Q 1UE5A 4FULA 4WWMA 2XRQD 3VYUA 4ZK9B 2K6QA 2ZVOA 3MZ5A 2JA5G 5JPNC 1YJJA 4DWFA 5FO9B 2D5DA 1E7VA 1X6OA 5M5XH 3HOUB 2LGXA 1J5EQ 1Y8PB 3UDGA 1CTMA 4R4QA 2WXKA 4G11A 2NBFA 2D3CA 2FIFA 4A3BG 1VQ8A 3ZXRA 1HXYD 3QK0A 1T0YA 1KRHA 3PRMB 1KLUD 4CHTB 4A3FG 2KDMA 4N9TA 2EMTA 4L63B 4RM9A 2R7DA 2D0PA 4A3EG 2H88B 2MJ3A 2NB0A 5ELDA 1HNXQ 2ZNVC 3KUZA 2H1EA 2MPMA 1QZHA 1GB1A 3ULLA 4A3KH 1WFYA 1XD3B 4K6DA 1JWUD 5EKLA 5D2MB 4OZBA 3ONSA 1EU4A 4KY5A 1XLQA 1IW7D 3EVQA 4HEDA 2ZXPA 4F88A 1PH2A 1Z47A 1PUTA 2R2OA 4LF9L 5IODA 2MQJA 5IYCG 3CIRB 2CQOA 4MM3A 3H3VI 3BIID 3WAMA 3CCJA 4GLAC 4HPMB 5KNCA 1XNQQ 3A55A 1ZXIA 4NXNL 3A7LA 1IBLL 4OO1I 1SN8A 4PV1C 2N9LA 1JWMD 1MVKA 5IIFA 4K14A 3HKZE 1ZKOA 4KIKB 4IUUA 3B2FA 4RA8A 1O7YA 4U68A 2KOXA 2I07B 3S1RB 4K3BA 5I6WA 3QOLA 1JWSD 3OJ4B 1AARA 5HG2A 2XN9C 4MT5A 3TMPB 2BWFA 2JUOA 3ZTDA 4DHZE 1X3PA 2IW3A 3ZNZB 3RMKC 2NZHA 2KWUB 1XQQA 4ZRKA 2BA0A 4DU9A 1RTNA 4BKTA 3A1QA 4NJCA 2R61A 1G6JA 4NXNQ 1IBLQ 1B70B 4KJOA 1GJXA 5AJ3L 2DAJA 1S5CD 2F03A 3UQBA 4NAWA 2JA9A 1L4DB 1PA6A 1WXAA 2HDMA 3BG3A 3UDIA 2A5HA 1HNZL 2R2QA 2Q8TA 3NBHB 1R4QB 2WXHA 2YEPB 4KKIA 5E3FA 4GNXA 4ANXA 3KH0A 1JCKB 1PTOF 4JVZA 4BY1G 1FEHA 3TP8A 5ELBA 3N20C 4IUMB 4OW0A 5EE1A 5IT9c 2KQ4X 5ELCA 2J0MA 4FDBA 2AKWB 3QB3A 3P7JA 4NAMA 4KLKA 2E2JB 4L5RC 3IBEA 5IP7H 4QY7A 4L5QA 4DK1A 2K1BA 1TQOA 4ZRZA 3R8BA 1ZUD2 1WGDA 4LW1A 4XT1B 1JJ2A 2LRWA 2V1YA 2WX0A 2DJFC 3Q8AA 1ZE3D 2F0DA 3MXNA 5JHAA 4FHJA 4BXXH 1KAWA 3WALA 1V9PA 3KBGA 3AB9A 4DV4L 1OTCA 3WAPA 1TWFH 4B6WA 3PHXB 3Q6BA 1HNZQ 4YXDB 1L1OB 1XWEA 1VQNA 5ELNA 1S5BD 2GA4B 1PH1A 4LF5L 3M3YB 5C4XG 2KBNA 2LKVA 4DK0A 1I3QH 3PHWB 4BKGA 2XK5B 3M7NA 2X6LA 2LUMA 1TWGH 3I91A 5D6JB 4UP7A 1ZGUB 2BWES 1K8OA 1WRDB 4HIKA 4J8QA 2NVQH 2IBIB 3FILA 3OG5A 2JK8A 5ISRA 3HOWG 3QG1A 3DVGX 3ZRFA 4IC7B 2YU9B 3H0GB 1V1OA 1EWYC 1ENFA 4XDDA 3E9IA 3NWSA 4IJLA 2RHSB 2K1FA 3GDEA 3KYDD 3VDZA 4DV4Q 4JI8L 2NYZD 3H7PA 3KUDB 3A7AB 2QDFA 3TJPA 4EE2A 1QNUA 3OMCA 4EZKA 3OMGA 4WQMA 3SVMA 5FJ8H 3IT4B 3D4WA 4LF5Q 3U58A 4I6PA 2DZMA 5M5YB 4AYBB 2Y0SB 1PTOH 3R93A 2UU9L 3C46A 3E0JA 1KC8C 2BH8A 2J7ZA 1HTOA 2HJ1A 4HROA 4K7SA 1VCBA 1WXVA 2DZIA 3GTOB 4F87A 2K28A 1V2YA 3R2TA 3C2PA 3ZGZA 4JI0L 1JQ4A 1E5WA 3IAYA 3A9JA 3CAMA 1WCMH 4WAAA 1K53A 2L1BA 3QWNA 4ITKA 3BK2A 1YIJA 4JI8Q 1Y14B 1A0IA 1U4RA 1Q82C 5CC4A 1PFDA 2SEBD 2NN6I 4XIGS 4KHVA 2WLBA 4KSKC 3AQQA 4II2B 2MA9B 5KYLA 1PV4A 2VS1A 3CCEA 2BB5A 1H9JA 3FHWA 1STHA 2JVCA 2PJHA 1DOKA 2UU9Q 3M4OB 5JZEB 1D8LA 5JJIA 1W6JA 5CHWA 1P16A 3NPPA 2VQFL 4QL5A 2JYEA 2GBJA 4M00A 2ICEC 2L32A 3RNAC 4AOFA 4YTMB 2NR2A 3GTJB 4RMFA 1TWHB 1FVIA 5DEHA 3STBD 1Q81C 2ASQA 2WXQA 5D7GA 3ULJA 4PS3A 1MSHA 3H3VC 3S1QB 2MBEA 2EJGC 1S72A 3RUIB 4KKSA 4DPGA 4YWKA 4A3CH 4ZHOA 3S14B 2PI2A 3RYTA 2HUGA 1WJNA 1EUJA 2EIFA 4IWQA 3CCRA 1O7LA 3CD6A 4MNOA 3EFUA 4ASWC 1XEEA 2IDYA 1NUCA 1CJEA 1IBKL 4N58A 4P1BC 4A3LH 4QIWB 3IAS1 5CBAE 3P1MA 4V190 2LD9A 5C1ZA 1DOYA 1HQRD 5E4WC 3GTMB 2B2YA 2HQLA 2MHJA 2L00B 3KWVA 1TZ1A 2Y5PA 4K0KL 1YI2A 3GV3A 3U7ZA 2EY1A 3RZOH 4FLHA 5E6JA 2K04A 3PO0A 3Q3FA 4K7WA 2ZT9C 2FCSA 2N7EA 1SSOA 5C3XA 2M56B 4FXGC 1PGBA 3I5JC 3PRZA 2KXJA 3HKZB 1IBKQ 3JSVB 2WDQB 2WXGA 2RGFA 4IUQA 1SNOA 1SSNA 4Q5VA 3AE8B 4A3KG 4C3JB 1Y1VB 2E3TA 4MSMB 3ZDMC 2KD0A 1VQHA 3A4RA 4KD3A 2LVOA 5AEKB 2A69C 2GI9A 4YCWA 3NUHB 5CV6A 1S1QB 1NAPA 1I4QA 4IALA 1VDVA 2KWDA 4YL8A 3PGZA 4X65L 2JYOA 3K5OA 4TQ0A 5C0XJ 1V1QA 2XWJB 2KKCA 1K52A 2B2UA 1Q7YC 1CHPD 2G45B 1LTGD 2E8GA 3AEDB 3APCA 2J4XA 1E3PA 1WTQA 3J9CA 1GXDC 4OL7A 3ETRA 5DAUA 3NBIA 3JAMi 3A9KB 3APFA 1E22A 2F0EA 2PMZB 3LGJA 4P71A 1D2BA 2MWSB 5LLIA 4YSXB 1G8ZD 1JR0D 1VMPA 4K3CA 1STAA 1R4NB 2PIAA 4G7OC 3Q8CA 2QF7A 1SB3C 1YQBA 1X32A 4JW0A 3AMUA 2JA6H 3GE3C 4A3GH 4IURA 3EECA 5DPTA 1KIXA 2IHFA 4BBRB 4F1SA 4X65Q 1STEA 2F0NA 3PO3H 1RL2A 5IT9L 3HIZA 1JE4A 4UPAA 4FJYA 3CHBD 3ZJVA 4Y52H 3U52E 4DR6L 2RDGA 3FKIH 3NE5B 4HJ5A 2RSOA 1HZ5A 4IPHA 1FIQA 3PTFC 1D3ZA 4JIOU 4ZOHC 4JPBW 1UGJA 5BMGA 2NMQA 5BN3A 4KZCA 2IJ0A 3WANA 5GAGC 1CHQD 1E90A 3ZO5B 1XXGA 3RI7C 2OHFA 3NZSA 1V1PB 3HUIA 2AQ1B 4JBWA 3RZWC 1L6UA 5H92C 5LXIB 3BVMA 4BY7B 3BZDB 4P72A 5JVH3 1Q5WB 4JI2Q 1WGKA 2KTRB 3FMCA 1VQMA 5D3DA 4ZYNA 1LO5D 4IUVA 4IFDI 1NENB 2F0SA 4A3IB 4P73A 4GIVA 4JX1C 2JA8H 1MHXA 5IP7G 2M0XA 2F4VQ 1MG4A 4DR6Q 3Q6SA 1B4OA 2LVPA 1WGGA 2FHTA 4RCOA 2EKIA 4IOCA 2A6HC 4JI3L 2J0JA 4BXXG 2G4SA 3AE4B 3HK0A 1HJPA 2CJNA 3PLVA 3ZLZA 2BE5C 1AFPA 1LTSD 1LTBD 1EWIA 1QUQA 3E5SA 1F2RI 4WURA 3CQZH 2DAFA 2MHVA 1IXRA 4IO9A 5AZHA 4PK1A 2A8VA 2QCZA 4JL9A 1RF2D 4OONA 3ONAB 2A5UA 4MACA 4C80A 1X54A 3K7AH 4G4KA 1KH0A 3M7GA 2B3AA 3QHTA 1TWAB 5AZFA 4F7XA 4E3CA 2LZ6A 2AUKA 1VQ6A 4FXKC 3S16H 1DM0B 4K6LA 4KD4A 4GKKL 3IXSA 4HRSA 4DK6C 1YOVB 5T1IA 5E7NA 3M4YA 4CDEC 2QDLA 4ZCKA 2BQQA 3PSEB 1PH8A 1JJCB 2CR5A 1G291 2JY6A 5GMVA 2K5WA 3UIPB 1CKNA 2XEWA 3W5VB 1SYGA 2LVQA 5ELFA 5FJ8G 2CHBD 3L9AX 4AIMA 2ZCCA 2KEDA 3B0AA 3M95A 4HJKA 3X3MA 4C3HH 1TT2A 5BR8L 2LGDA 1FRDA 2D0OA 3FRPB 1Z7TA 3MVVA 1WTPA 1IBML 2AHOB 3GTPB 2VB3X 2B63B 1E8YA 1U9RA 1MHHE 5C3JB 5EE0A 1WCMG 4US9A 4GKKQ 4IW0A 4BBSG 2L76A 2Z6BA 4LK1C 3ENEA 2KFKB
chains in the Genus database with same CATH topology
5A35A 4DXFA 5H8YE 3VYRA 1T3QA 5I6YA 2CVRA 2WXPA 5KYIA 1FYCA 2BW2A 1OO9B 1HTLD 2ON8A 3HS0C 1ESRA 4ARIA 2V4DA 3CU7A 4KMUC 2EYPA 5I4DA 2F0GA 4TSSA 2LFNA 4K8JA 2EDGA 4EVOA 4ZHPA 1XF5L 4ID6A 2K32A 5F2DA 3DWGC 2E75C 4JWUC 1FXIA 1CA5A 1EOTA 1HCZA 1FNUA 1KDBA 3PUXA 1H9KA 3D4RA 4UAIA 1PYWD 1NSNS 1A3VA 2WIIB 5KRUA 2RKSA 4RF0A 4TRDA 4XQQA 1RTOA 3HEJA 5LL6X 1D1KA 1T5EA 5T8IA 4YSYB 1BCPC 2Q8IB 3Q8EA 1CK1A 3C3LA 3AE7B 4EQOA 3K0YA 2M19A 3OHXC 1F9PA 2I46A 5CV9A 5C44B 3KLRA 1TKGA 2DNCA 1EEFD 2L11A 2F0FA 4O1NA 1HZ6A 4GDLB 1IKMA 5FLXE 3MHZA 3NTHA 2X38A 5KGUA 1FNWA 4B08A 4KI0A 1IYUA 2EJMA 2WXFA 2B2VA 5LNK1 2CW0C 4I7ZC 3KBXA 2K33A 2OF1A 1F2RC 4CKCA 2WDRB 1XX8A 1PFMA 2JSOA 5EQ0A 1RJTA 1R9TB 3ZJUA 1WWTA 1EL0A 2L1AA 1BXTA 4L23A 3NWTA 2NVXB 3JAME 1QOBA 1QOAA 5K5PA 1JQYD 2WDVB 1S5FD 2PVGC 3E56A 1D6EC 2KEEA 4HN7A 2EOTA 5EPLA 2F3VA 2F0TA 5COYA 1RDPD 3H09A 3SR6A 4C1NI 3I3CA 1SYFA 3NS1A 3A8KE 1NCVA 4OVZA 2B2WC 2QJLA 1OXSC 3SK5A 2WV6D 4QMGA 1SNMA 2L5TA 1FCCC 4HTHA 2KN4A 5J39A 4PNYA 2J42A 1SNPA 1RODA 1C4CA 3X3NA 2E74C 4K5VA 3I4NB 2DY7A 2RQXA 1BQQT 4KGRA 1RCVD 3SK4A 5M9OA 2K3UA 2FUG1 3LXFA 1YQ4B 1Y69U 1B9NA 4G7HC 1N5XA 2F0KA 2PW7A 2RVLA 1CQVA 2BBCA 1UAPA 1I4PA 1A3TA 2R3ZA 1STYA 3P63A 2WXRA 4IN3A 1EY9A 1G2TA 1HEZE 3EQLC 3MP9A 1B1ZA 3QJYA 4C3HG 3MJ5A 3K59A 5KNDA 3AEFB 2VZKB 1LT4D 5CV5A 3IL8A 4RCNA 3A54A 1OQRA 1EWHA 4J1MA 3K57A 1FFUA 4CQNA 5C4ZA 2LMCB 1EU3A 1XCTL 3SFDB 3SFEB 1EQTA 1ML0D 2EVBA 3HZXA 1QLBB 2FFKB 3N6RA 2BDNA 3I73A 2WAQB 2RA4A 4YIJA 3K5MA 2G9DA 2CU3A 3K5LA 2EYHA 3W5UB 3MXGA 1DONA 5IGCA 2XRSD 4OIJA 2IX3A 4IUPA 1OXXK 3RLFA 3AE9B 1UEAB 4LK0M 2JZPA 2F0VA 1R7SA 1RHPA 1IL8A 1PTOD 3M85A 3T4AC 1I6HB 3VR6A 1FCLA 2JEAI 1V8QA 4HKQA 3I4LA 1TU2B 1EIGA 1ZEQX 2K5DA 2Q8RE 1VDZA 4RNAA 3QOJA 4E6IA 3I9V1 3NQIA 4RGNA 3KWLA 2BT6A 3AV8A 2B76B 3PIP3 1VR9A 1N60A 4BS9A 1MI2A 2F3WA 3HOXB 1BUIC 4NZLB 2IGGA 2D62A 1PRTB 4IFDJ 4WFN3 1ZDVA 1JOKA 2E2HB 1NEKB 5HGTA 5JAVA 4EQPA 1VJKA 3EFXD 1N61A 4L1BA 2LS01 2Y3AA 5FLXL 5C5LA 2PVOD 4RGMA 5GXGB 1DZ1A 5JVG3 2EY6A 1IHZA 4DGZA 2DYOA 1WTWA 5FOBB 1K51A 4ZKBB 1A2UA 1B2TA 1PGAA 1QOHA 2AX5A 4C7ZA 4XYQA 3EA6A 3PUZA 1TY0A 4NKLA 4HAEA 1F2YA 2F0QA 1TKEA 1S5DD 1EYDA 1TJEA 2FBWB 1AZPA 3BDLA 1E6EB 1VLBA 2W3RA 3VR9B 1IUEA 1WSPA 1AZQA 4L2YA 3NHHA 1SE2A 1I7HA 4AS1A 2JQRB 5G5GA 2MP1A 5JOBA 1TIID 3D4DA 1C79A 2RDHA 3P4PB 1Q1EA 2ZW1A 1QILA 1XLNA 1Q8IA 1B3AA 4M8AA 4C3IB 1SYDA 4X3UA 1SE4A 2INPE 1YNJC 3OIQA 3SE0A 4FF3A 3R3OA 2VXWA 3RPFC 3ZQ4A 3A56A 1LTTD 1WD0A 2NWGA 4YSZB 1IGDA 4EQNA 1QG7A 5BYSA 4L6TB 3D3RA 1DOLA 3W1SA 5KIXA 3RD4A 2N88A 5M3FB 2IGDA 3HVZA 1MSGA 2NTTA 3VR2A 4LTUA 1CI3M 5D14A 2C9OA 2PW9A 1AN8A 3TUOA 3AEEB 1SDFA 4DN4M 2W82A 1Y56A 2JA6B 5C4HA 2RMMA 5DM63 3GTQB 4FNFA 3PO3B 1DYQA 1ESFA 1L0VB 3WDNA 3TP5A 3NUCA 3N9YC 4QB4A 2F4IA 2WU2B 2KCNA 2BA1A 2PYKA 2BS4B 4WORA 4CBVA 2N9KA 1PZKD 5CBEE 4XQJA 4KK7A 5HFYA 3VA5A 4XTCS 3Q8FA 2K9XA 3TDQA 2R92B 4QF4A 3CRKC 1TWCB 3D6WA 4NW2A 4CKBA 2WXLA 3DHQA 2M0AA 1J7CA 1F2ZA 1ROEA 4RAUC 4R8NA 2RBMA 4A6QA 1YN5A 1BO0A 1L0XB 2OXPA 3T56B 4RFBA 2KJXA 2Z4HA 2BDOA 3I4MB 3NTIA 1ACCA 3T3OA 2TSSA 1JB3A 3TEWA 1GHJA 2D5GA 2X6GA 3BYYB 5TSSA 3KLSA 3BS1A 2ZW0A 3AM9A 2A73B 1PRTC 2BS2B 3J7YW 2J0TD 2JA7B 4JK1C 2BB6A 1KNEA 4R3DA 1I4RA 1J7AA 1RWSA 3UI3A 4B0MA 1SFOB 2B8FA 1ZXTA 2L55A 2K01A 3GV6A 2LFIA 1IW7C 3IFTA 5C2TB 3C8YA 3I70A 3T13A 1GHKA 3AN1A 3A8JE 1EWCA 1DJRD 2V0GA 2SDFA 2WB1B 3D8GA 4ABNA 4MM3B 3LWEA 1QB5D 4HR7B 2ICIA 2E76C 3DEPA 3TZDA 1TKWB 3P4QB 1HFGA 3J81E 1D1IA 1QNKA 4ZYSA 4A3MB 1RKNA 4K2LA 1I50B 3TMEA 3HOVB 4TQ1A 3Q69A 1J7BA 1MPEA 1KABA 1ET6A 1KLGD 3QO2A 2KOLA 3OIPA 3LYYA 3TEYA 5FO8B 1K8MA 1KDAA 5J1ZA 1DD2A 5HI1A 1WRIA 4NAWB 1LABA 1H9SA 1FNVA 4X3TA 1D5ZC 4HJGE 3T51B 4RH6A 2L12A 1BCPB 2JA5B 3FVQA 2E2DC 4XXEA 2J52A 3MHBA 1V43A 3DUZA 5CYUA 4FF1A 4A3BB 3CWIA 2E2IB 5BMHA 5CORA 3AU7A 1C48A 1GUWA 4A3EB 1SJED 1WTXA 1Q90A 1B50A 5JEAJ 1Y8OB 4DNRB 2PCFB 5CV7A 2WINB 2F0IA 1SYEA 4MIUA 3SK8A 1GAQB 2PKOA 1U4PA 1E2ZA 1ENAA 4Y7NB 1Y1WB 1T6BX 1E0BA 3AEBB 1C4QA 3NQTA 1QQRA 1NR4A 2Z8LA 3S1NB 5A2QE 5MPOA 3NVWA 2D2CC 1IBXA 1EFID 4U673 1Q3LA 3P4SB 2FJ2A 4XDXA 3I8ZA 1C78A 1II3A 3G6JB 4DXGA 2XNAC 2Y5CA 4R8IA 1QF6A 1ZXHA 4IDIA 4IUTA 5M5WB 3RMHA 2MEKA 3PO2B 1E2VA 1O7ZA 2XWBB 3K6OA 1JC7A 1LV9A 1EY8A 4DAPA 3MAQA 3PV0A 1H9RA 1SMYD 3AE6B 1HPCA 2PLPA 4RGOS 3MC0B 2WXJA 5IGDA 4NMZA 4K8IA 2VNUD 2G1EA 5LL6S 4BWGB 1GUNA 1HA6A 1W6KA 1C4PA 4Z9CB 4MH8A 4USAA 5E1FA 4A9AA 1BMLC 3WOEA 2L4NA 4ZUIA 1PDQA 1EEID 2B2TA 2IL8A 2EYFA 5IGBA 5C4XB 1OXVA 2F0WA 5ELEA 4TQUS 1JOOA 4YT0B 3TP7A 3S15B 4RF1A 4JE3B 3P1HA 1MBYA 1L4ZB 2RSNA 3HOWB 3V2TA 1A2TA 2A68C 3HRZC 5G5HA 4LLGM 4RWSC 4YTPB 1STBA 1NI3A 2SAKA 4IZ8A 4V0BA 3DWPA 4OO1G 1E9MA 1OQQA 3Q0AA 1YNND 1EQVA 1RYJA 5FR3A 5DM73 2KVMA 4KJNA 4ZUJA 2XVSA 4KTAA 2PTLA 1F2LA 5FKAC 2JWUA 3VRAB 2EY2A 2WNMA 4B0EA 4A93B 2JXMB 1QJOA 2QMTA 1OXTA 3D31A 1GUGA 3DM1A 2E6XA 2A6ED 2DBYA 1K83B 1YN3A 2HDLA 3NVVA 1QOFA 4A55A 3NZ3A 3OWFA 1BOSA 4CJ2C 1ZYRD 2PNRC 2R6GA 1GUSA 4IFDH 5JPMC 1FR3A 4J3OD 1JORA 5I2XA 1WD1A 3AE2B 4NDXA 4ULLA 3NK9A 2IPKD 2EXZA 5EBDA 3RUZA 1L5PA 1VZ7A 2HQEA 3NSWA 1ICWA 4A3JB 3NVZA 1ZP0B 1CZGA 1YNTE 5IGGA 3KQ4A 4N9PA 1LLRD 1FD7D 5M5XB 3ND9A 1Q10A 4CJ1B 1EY7A 1TKYA 1SJHD 3WCQA 4XYOA 1UNSA 1XYIA 3BVZA 1ONLA 4KKUA 5HURA 1JRPA 2WXIA 3Q8BA 3K5NA 4PMBA 4H7BA 2IT1A 4TMAB 4ME5A 4A3KB 2OEOA 4IOIE 3MTSA 1FRRA 1EIHA 2CQAA 4ZLTF 1MI0A 5E4XA 1TS3A 2W54A 2QSDA 1LT6D 1PLFA 3VA7A 2MJDA 4ZKCB 4H2AA 2JU6X 5BN4A 4XT3B 2K22A 4N6EB 5A2QL 1G6ZA 4HSVA 1J8IA 3BK1A 3KLSX 2A74C 3J80E 3NBHA 2B2YC 3TN2A 4LMQD 2ZXRA 2ID0A 1A15A 3U9SA 3GB1A 1FGBD 5I9OA 1SF0A 3VRBB 2PO4A 2F0PA 1QT9A 3B9JA 4XDCA 1LT3D 4LJZC 3S1MB 2F0JA 2ENBA 1E0ZA 3VQIA 3VR5A 1LT5D 1SNDA 1NYQA 4RKLA 2WXOA 4O42A 4B9XA 3PZ8A 4HCSA 3DWMA 2M2LA 1KFYB 4JPSA 1V97A 2BTEA 1TWFB 1QWYA 2B2UC 1IGCA 4ZRQA 4HKZE 2EYJA 2EE1A 4DA2A 1P7FA 1I3QB 4KKJA 1B9RA 3PUWA 1VMCA 1TWGB 3NRZA 1RFKA 3J7AV 4LAAA 2NVQB 2JYTA 4N59A 1PDXA 5D65A 4C3JG 3MA2B 2LJIA 2F1MA 1B53A 3L3OC 1L0YB 2EELA 2H89B 4HEA1 4P6VF 1EYCA 4DQOC 3PUYA 2F0MA 2K05A 4FVMA 1DOIA 2RPVA 1PTOB 1BBXC 3SDZA 5KNBA 1TY2A 1VZ8A 1ZPSA 1JICA 3MWYW 2L83A 1UUPA 2ONQA 3A8IE 1YN4A 4C56C 3Q22A 1WCMB 3BWUD 2K0PA 2AWNA 1Y8NB 2PPBC 2L52A 2JX5A 2M00A 2NZ1D 1MD2D 3IXSA 2MUYA 4WJWA 2GB1A 4FF4A 3PMFA 1FD6A 1HHVA 1B9MA 1R4PB 2BCOA 5EPKA 1HA5A 1C4AA 3L4PA 1EY4A 4GZYC 4L8JA 4KGSA 4IFDG 1PRTD 1SNQA 2F0OA 2EZVA 3W3AA 1WXQA 4OHJA 4AQ7A 3HGBA 1TS2A 2JEBI 4KKTA 1WTVA 5C0XH 1GPXA 2BOSA 4OIKA 3SR1A 1OFFA 4DAYA 1NYRA 4YTNB 1C8CA 5EE9A 3U2SC 1GB4A 3JAML 1VRAB 1NVID 3RZOB 3VR3A 1BDOA 1OXUA 1CZPA 4H0LC 1FO4A 1A3UA 3I90A 5IT9E 3VR4A 4UDUC 1LTRD 3FEWX 3AH7A 3EUB2 2A69D 3OPOA 3VYSA 1D5XC 3NTKA 5AUKA 2DN8A 2B8GA 3FC4A 2B2TC 3TZUA 1C77A 3IAM1 5JEAH 1FXAA 5EJWA 3H91A 3ABVB 1YQ3B 1AYFA 2JSVX 4FYDA 4KY7A 1G91A 3TP6A 5AFWA 3VYTA 4HMIA 3V05A 4YWGG 4DFAA 3BDOA 1LTAD 2LY7A 2WACA 3D6CA 2N7JA 1I6VC 4A3GB 1D5MC 3AECB 1FM0D 1JWAD 1RD9D 3IFDA 1G2SA 1GUTA 1V1PA 3P42A 3FKIB 3W2DA 3J80L 1KTKA 1PRTF 3E9SA 1JROA 5BYQA 1RM6C 1EZ8A 1XTCD 3DWAA 2FE8A 2WKDA 2HDEA 5EKIA 3PZ7A 1TZOA 4FF2A 1Z6HA 3G7LA 2F0HA 2KECA 1FMAD 3OWEB 1EY0A 4X3KA 2KHSA 2JA8B 1PTOC 1VZ6A 2A6HD 2KAJA 4JWSC 4M1UB 2DNEA 4QCLA 4K5XA 2BE5D 3CRLC 4B9WA 4GLSC 3GTKB 1IKLA 2EYLA 3SEBA 3CQZB 2B2VC 1TVXA 3ZYYX 2XIWA 1HUNA 3NXWA 1SYBA 4CJ0B 2LEKA 3K7AB 1P7EA 1EY6A 2YEPF 3S16B 3MFGA 4PT5A 2SNSA 4XE0A 2B2WA 3T3NA 1ILQA 4OO1H 5T1GA 5EPJA 2KACA 4IKGA 2M9VA 3QIAA 1I4HA 1F9QA 2EY5A 4KN7C 2JE6I 4R9WA 4C3HB 1PGXA 1TS5A 3LNNA 4ILWA 2O4XA 1O78A 3GS2A 1AW7A 1TR5A 5EBCA 4C7YA 3GP7A 2I38A 1F9SA 1VF5C 1GOZA 4S3SA 1YMHE 2CJOA 1XLPA 2L9HA 2BYTA 2YYZA 2HCCA 2Z1CA 1QE6A 3SK6A 1ZDXA 4Q0FA 5EGTA 2A68D 3EJIA 5C0XG 2WKCA 3BYTB 3OW7A 1C9FA 5CMDA 1ZOYB 1CZWA 2K5PA 2K5QA 2NUCA 2WP9B 1IYVA 1F2MA 1TYGB 2FMCA 2RDFA 1NR2A 2KMMA 3F2UA 2FMMA 2PZWA 1LTID 3T53B 2GRIA 3W9CB 1CT1D 1BCPD 3MEHA 3SXHA 2BS3B 2ZXOA 3O13A 2QDBA 1AP0A 2DLBA 1QKZA 3GTLB 1A70A 2TMPA 4A3FB 2PMVA 3GQBA 1LACA 2MJ8A 4ZQ3A 5C3EB 2F0UA 2WS3B 3ZJTA 2QEJC 1EYAA 2MGSA 2V4IB 2AUJD 3TSSA 3ERQA 3FILB 5HHDG 1XLOA 3C1FA 5CV4A 3V96A 5JEAG 1M8AA 3HOZB 1WYGA 3KK7A 2IWHA 1N5WA 1AEXA 1CM9A 4A90A 4FXDA 5C6AA 2CW0D 2XSCA 3AE3B 2B39A 2HTME 2NN6H 3K58A 1MGSA 1EM7A 3CKIB 3OOCA 5FO7B 4ZRPA 1STNA 2DY8A 1F0ZA 1EY5A 4RKBA 3B2GA 4ODGA 3WOFA 2HCIA 4MN3A 1X3QA 2D9UA 2F0LA 3GO5A 4RGTA 2WU5B 1H9MA 1DXMA 4IQZA 3P75A 2L0CA 2LHDA 2Z4IA 2LHEA 1VCIA 1BNZA 5BN5A 2IX1A 1SNCA 3OSOA 1UWXA 1D4BA 4BY1B 2V3NA 4ARCA 4KX6B 4KHZA 4WRDA 2PQEA 1SEBD 3AEAB 4TKOB 4PMCA 1N62A 3U9OA 4A3DB 4HCEA 1DOXA 5M3MB 2X69A 3I72A 1XO3A 3FPPA 2SOBA 3KF8A 4IUNA 5DNFA 4K2KA 4OGQC 1BCPF 4RHRA 5K36H 1HRJA 1SYCA 4CKEA 2NVTB 2JXTA 1HFNA 2O5JC 3LWUA 3S2DB 4WH4A 2NVYB 4H44C 1KAAA 4CGYB 5BMIA 1PZID 1Q1BA 4DNTB 1QOGA 1XCQL 3RZDB 1U4MA 2J53A 1CFMA 2IX0A 2V3PA 3MXPA 4HMJA 2INNE 5D3IB 1K50A 3FPUB 3ITPA 1BF4A 2LMCA 3DEOA 4KGTA 3Q23A 1CQFA 3IT6B 4RHSA 1V8CA 3NVYA 2EPBA 2G9HD 2NTSA 4REZA 1WTOA 1M4VA 4BA2I 2DYMA 1SBBB 3V3XA 4PQXA 2DWQA 2MJEA 5EKKA 1JALA 1TS4A 4DF7A 4XWTA 5I2YA 4C2MB 1E7PB 5IGFA 1ENCA 3J7AF 1SXTA 3KUPA 3S17B 1H9SB 4XQNA 4X3SA 2N0SB 2QKIC 2W55A 5JXVA 3J81L 2C5CA 3HOYB 3PUVA 3DXJC 2H4OA 3HG9A 3TBIB 3EGRA 2VUMB 5AUIA 4ZAIA 5BYRA 4J6HA 3URYA 1I4GA 1PFNA 4C3IG 4G7ZC 1GUOA 1PZJD 3R2IA 3LB8C 3AMZA 3HVDA 1KDCA 5CGKA 1JWBD 1O80A 2K7VA 1WTRA 1DOMA 5I9PA 2O5IC 5G3LD 4M0WA 4WIPA 3S2HB 1PFBA 3TEXA 2PZUA 4XWWA 3MXUA 3E6ZX 2W3SA 2K6AA 2FINB 2QCPX 3GD7A 5CR3A 3EROA 3FAHA 2N55A 2SNMA 3AE5B 4P2CB 3RFZB 4QUFA 1B44D 3NP8A 1SAPA 5JJZA 2PZTA 2AQ3B 3GTGB 1UWMA 4FO2A 1FFVA 4P16A 1IBXB 2EJFC 2EYOA 2WP8J 1E10A 1N63A 1F77A 2IGHA 2I2YA 3HRDD 1EZ6A 2VB2X 1JMLA 5IOCA 2NN6G 1SMYC 4OZAA 4K5WA 1E2WA 1HTPA 4FP5D 2QIEB 3P4RB 5J22A 5NUCA 2KQ3A 3PIO3 2ACZB 1AWDA 3L7ZC 4NP5A 5C0XI 1S5ED 3LX0A 2AWOA 3P20A 3N52A 2AQ2B 1F9RA 1A6XA 3TEZA 2OEDA 4PMWA 2KUMA 2WQYB 1SE3A 2WXMA 1BUVT 1ET9A 3I57A 1VF7A 4WAFA 4BA1I 3VR8B 5C3WA 1PMRA 3AB5A 1YNJD 3H94A 4KV6A 1YJIA 1Q12A 2EYMA 3Q24A 1PXUA 1CA6A 1ILPA 2VZKD 5G3LF 2WXNA 1S4ZA 1HUMA 5C5MA 2JP1A 4I65A 1YNNC 1DGJA 2KA7A 5C4JB 5LHY1 2PW5A 5K36G 4QUCA 1C76A 1BR9A 2KCCA 2R7ZB 1KF6B 1U4LA 4MHEA 1I4XA 4DAVA 4A8XC 3H8HA 4GDKB 2QILA 1T5XD 5FK9C 2MH7A 3UI2A 3S9WA 4F8MA 4Q2JA 3U4EG 3SHLA 1JOQA 3AE1B 2O2LD 4H13C 3FDTA 1JW9D 5IGEA 2R93B 2A6EC 4EGVA 4FXCA 3ND8A 3IKJA 5EE3A 1KNAA 3AEGB 3BDCA 4KN4C 3DWQA 4HSPA 2Q5WD 4D2KA 1ZYRC 4C1NK 3H6MA 1DCZA 4KY6A 3HP3A 2LGIA 4G57A 2OT2A 3BVGA 1STGA 2K03A 3T16A 3C1EA 5KEEA 1WVLA 1QCBD 5CV8A 1J9OA 1SIJA 4BBSB 3DMUA 3MFYA 1HQMC 1L6VA 4WWMA 2XRQD 3VYUA 4ZK9B 3MZ5A 5JPNC 1YJJA 5FO9B 2D5DA 3HOUB 2WXKA 1Y8PB 1CTMA 2NBFA 1HXYD 1KRHA 1KLUD 4CHTB 2KDMA 4N9TA 4L63B 2H88B 2MJ3A 2NB0A 5ELDA 2H1EA 2MPMA 1GB1A 4K6DA 1JWUD 5EKLA 4OZBA 1EU4A 4KY5A 1XLQA 1IW7D 3EVQA 4HEDA 2ZXPA 4F88A 1Z47A 1PUTA 5IODA 3CIRB 3BIID 5KNCA 3A55A 1ZXIA 3A7LA 4OO1I 4PV1C 2N9LA 1JWMD 1MVKA 5IIFA 4K14A 1ZKOA 4IUUA 3B2FA 4RA8A 1O7YA 4U68A 2I07B 3S1RB 5I6WA 3QOLA 1JWSD 5HG2A 2XN9C 4MT5A 1X3PA 2IW3A 2BA0A 4DU9A 1RTNA 4NJCA 2R61A 4KJOA 1GJXA 1S5CD 2F03A 1L4DB 2HDMA 3BG3A 2A5HA 2YEPB 2Q8TA 2WXHA 1R4QB 4KKIA 5E3FA 1JCKB 1PTOF 1FEHA 4OW0A 3TP8A 5ELBA 5EE1A 2KQ4X 5ELCA 3QB3A 3P7JA 4NAMA 2E2JB 4DK1A 2K1BA 1TQOA 4ZRZA 3R8BA 1ZUD2 3Q8AA 4XT1B 1ZE3D 2F0DA 3MXNA 3KBGA 3AB9A 4YXDB 1XWEA 1S5BD 2GA4B 3M3YB 4DK0A 2LKVA 3M7NA 2X6LA 2LUMA 3I91A 3FILA 4OZCA 1K8OA 4J8QA 5ISRA 3QG1A 2YU9B 3H0GB 1V1OA 1EWYC 1ENFA 4XDDA 3NWSA 2NYZD 3A7AB 4EE2A 1QNUA 3OMCA 3OMGA 4WQMA 3SVMA 3IT4B 3D4WA 5M5YB 4AYBB 2Y0SB 1PTOH 3R93A 3C46A 3E0JA 2J7ZA 4HROA 3GTOB 4F87A 2K28A 3R2TA 3C2PA 3ZGZA 1JQ4A 3IAYA 1K53A 2L1BA 3QWNA 4ITKA 3BK2A 1U4RA 5CC4A 1PFDA 2SEBD 2NN6I 4XIGS 4KHVA 2WLBA 5KYLA 2BB5A 1H9JA 1STHA 1DOKA 3M4OB 1W6JA 3NPPA 2JYEA 2ICEC 2L32A 4YTMB 3GTJB 2WXQA 1TWHB 5DEHA 5D7GA 1MSHA 3H3VC 3S1QB 2EJGC 4KKSA 4ZHOA 3S14B 2HUGA 1O7LA 1XEEA 2IDYA 1NUCA 1CJEA 4N58A 4QIWB 3IAS1 5CBAE 3P1MA 4V190 1DOYA 1HQRD 5E4WC 3GTMB 2B2YA 3KWVA 2Y5PA 3GV3A 3U7ZA 2EY1A 5E6JA 2K04A 3PO0A 2ZT9C 1SSOA 5C3XA 2M56B 4FXGC 1PGBA 3HKZB 2WDQB 2WXGA 4IUQA 1SNOA 1SSNA 4Q5VA 3AE8B 4C3JB 1Y1VB 2E3TA 4KD3A 2A69C 2GI9A 3NUHB 5CV6A 1NAPA 1I4QA 4IALA 1VDVA 2KWDA 2JYOA 3K5OA 4TQ0A 5C0XJ 2XWJB 1K52A 2B2UA 1CHPD 1LTGD 3AEDB 2J4XA 1WTQA 3J9CA 1GXDC 4OL7A 3ETRA 5DAUA 3NBIA 2F0EA 2PMZB 1D2BA 4YSXB 1G8ZD 1JR0D 1VMPA 1STAA 2PIAA 3Q8CA 4G7OC 2QF7A 1SB3C 1X32A 3AMUA 4IURA 4BBRB 1STEA 2F0NA 5IT9L 1JE4A 3CHBD 3ZJVA 3U52E 2RDGA 3NE5B 2RSOA 1HZ5A 1FIQA 4ZOHC 1UGJA 5BMGA 2NMQA 5BN3A 2IJ0A 4US8A 1CHQD 1XXGA 2OHFA 1V1PB 3HUIA 2AQ1B 4JBWA 1L6UA 5H92C 3BVMA 4BY7B 3BZDB 5JVH3