1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
2IJ0A 2J4XA 1I4XA 2WV6D 2RDGA 1M4VA 1HXYD 3OWEB 1EFID 1S5BD 1FNWA 4BWGB 1V1OA 2XNAC 1RD9D 3R2IA 1T5XD 1TS5A 4L6TB 2SEBD 4O1NA 3BVGA 4RFBA 1LTGD 1S5DD 1PTOD 1TY0A 3DWQA 1JR0D 1KLUD 1PTOH 1UUPA 2AQ1B 1EEID 3GP7A 1YN5A 2TSSA 1TS4A 1TS2A 2NTTA 1LO5D 3EFXD 3R8BA 2RDHA 1RDPD 3BYYB 4RH6A 1PRTD 4TSSA 1STEA 3SEBA 2G9HD 1KTKA 1SE4A 1UNSA 1XTCD 3V05A 4DXFA 1LTAD 1JWMD 4OHJA 3DWAA 5FK9C 4C56C 1ESFA 1MD2D 1JCKB 2NTSA 1PTOC 4RHRA 1ENFA 5I4DA 1CHQD 1I4QA 1CK1A 4RGMA 1ET6A 5ELFA 1BCPD 1I4GA 1YN4A 1PZKD 1SXTA 5ELBA 3MFGA 1CHPD 1EU3A 4RGOS 1DYQA 1RCVD 2O2LD 1V1PA 1PYWD 2AQ3B 1LTSD 1L0YB 1S5CD 1TY2A 1SE3A 3MC0B 5D3DA 4UDUC 5FKAC 1FD7D 3KLSX 1FGBD 1PTOF 2XRQD 5TSSA 1CQVA 1D5MC 1KLGD 3TSSA 1JQYD 1RF2D 2AQ2B 4K6LA 4RGTA 3DWPA 1SE2A 1JWUD 1PRTF 5ELDA 4DXGA 1SBBB 2ICIA 1LLRD 1BCPC 1EEFD 5ELCA 1D6EC 1BCPF 2Z8LA 2R61A 1TS3A 2IPKD 1D5ZC 1CT1D 1L0XB 2XN9C 1YN3A 3O13A 1PTOB 1LTTD 4RCOA 1I4PA 2QEJC 3EA6A 4ZYSA 1EU4A 1LT3D 1I4HA 1PZID 3BVZA 5D3IB 1LTID 4NZLB 1JWSD 1BCPB 1B44D 3URYA 1DJRD 3W2DA 1D5XC 4Z9CB 1LTRD 1SJED 1B1ZA 1LT5D 1PRTC 2QILA 1HA5A 1FNUA 1LT4D 1S5ED 1I4RA 1PRTB 1LTBD 1SEBD 5ELEA 4RHSA 1S5FD 3BVMA 1PZJD 4RGNA 1AW7A 1G8ZD 1HTLD 3BYTB 1LT6D 3CHBD 1FNVA 1SJHD 1BXTA 1EWCA 1QILA 1XXGA 1HQRD 1AN8A 2CHBD 1V1PB 2XRSD 1F77A 1ET9A 1GOZA 3R2TA 3BZDB 4L63B
chains in the Genus database with same CATH superfamily
3PRZA 2RA4A 3RZDB 2UUBQ 3ZKJC 4XX5A 3NG0A 4BBSG 1A6XA 2JWZA 1S5BD 3MTSA 3HOYG 1WTQA 1JALA 5JOBA 1PDQA 3CQZH 3L9AX 5IGFA 1EOTA 1T5XD 4HIMA 3CF6E 1CKOA 3W9CB 3PGEA 1JROA 1WJJA 2CU1A 4CYEA 4L23A 2J0TD 4LNNA 1ZXHA 3HOXG 4JLCA 4M8NA 3KJPA 3AEEB 4N8X1 4HCEA 2N8NA 1F9SA 2KDIA 3ZDTA 1JWAD 4DAYB 2VH1A 3RD4A 3VR4A 4F88A 1T5EA 1KTKA 5IGCA 4A3MB 2A68D 4TRDA 3L0OA 2A8VA 3GB1A 1HTOA 2HTME 4XE0A 3IBEA 1BBUA 1JE4A 4QQBX 2AL6A 3GTGB 1WMHA 4MGKE 3ZIMA 5IAAC 4F8CB 2OQ0A 4YL8A 2Z4IA 5BMGA 1I4QA 2RCFA 3EVQA 2ZVNA 5ELFA 5EBDA 1B2TA 1E3PA 1J19A 4RNAA 3V60A 5ISRA 4P72A 1HJPA 4OWTB 4BY7H 5AJ3L 3I57A 4M0WA 4CHKA 1EU3A 2NZOA 4RGOS 5I6WA 4BY7B 1J5EL 4IG7B 4YSZB 1SNPA 2JVCA 4F87A 3B08A 4DV0Q 5C3EH 1NR2A 4NPSA 2JA7H 1WRIA 5HKHA 1K3BC 1Y1WH 1TKEA 1FJGL 2PMVA 4MJSA 1R4NB 4ZUIA 1PH5A 4URKA 4ARIA 4A3DB 1J9OA 4K6LA 1AE2A 4QMGA 4F8MA 3JSVA 4DR7L 4TVAB 3MA2B 4H13C 5EBCA 4A3CG 1JJ2A 2E5LQ 3AI5A 1Y8OB 1X56A 2RHSB 4YY3L 3KUPA 4FA6A 4ZOHC 3NQIA 4E71A 2R6GA 3GTLB 4K5XA 1E5WA 3RMKC 4W9FA 2I2YA 1YNJC 3GTJH 1OXVA 1UWXA 3AU7A 1UWVA 1RAXA 1V5OA 4A3DG 1WX7A 4FJZA 2QEJC 1UE1A 3CMAA 1N60A 2G1EA 2W3RA 1J0GA 3A7LA 1WX9A 5D65A 1N5XA 1D1IA 4H0LC 1WD1A 5C3EG 1WJ6A 3K59A 2D0PA 5GMVA 1WGYA 2QILA 4IWOA 1PVOA 5HG2A 2EVBA 1C76A 5IT9L 3H94A 3H6NA 4DR3Q 3N9YC 4W9EA 5H92C 1FJGQ 1HRJA 3UQAA 5JAVA 4JI0Q 4NXNL 4I7AA 4MELA 2B2VA 1YEZA 3GTPB 4DDGD 3AEDB 3STBC 1WE7A 4MM3A 2PLPA 4A90A 4OWXB 1IYUA 5FJ8H 4BOSC 4C3HH 4GKKL 1B3QA 1WX8A 3R93A 4J6IA 4YSYB 4ANWA 1SJHD 3ULLA 3KOJA 2W9NA 3ITPA 3NPPA 3G71A 1V1PB 5EPKA 4C3IG 2OXPA 2HE7A 2R93B 1GOZA 5CV9A 5KYIA 3IFTA 4A3IG 2RVLA 2YU9H 1TGZB 2RF4A 3KYHC 2KKCA 4P7IA 1VQFA 3GDEA 3PUVA 3DLLA 4DV1Q 3IAYA 2IX3A 4A3GB 2IZVB 1PFMA 2FNJB 2DYBA 2UUCL 4KGSA 4JI6Q 1I94Q 1BUIC 2A68C 5EKLA 4GOCA 4WJPA 2WGSA 1VR9A 3AN1A 2L12A 3FAHA 2CH4W 4MEMA 1S3OA 4HJAA 2NBVB 3PSIA 1RLFA 2WP9B 2X69A 1AZPA 3MC9A 3DUZA 1ZE3D 4IDIA 5IWAL 2MBHA 1C78A 3TZDA 2TSSA 4IWQA 3H91A 3CMMB 3N32A 3RCZA 4W9GA 1F52A 2J42A 1WXVA 3ZLZA 4K8IA 1BKBA 5J22A 3S1QB 5HI1A 2YTYA 3HOUB 2JU6X 4GMVA 1U9RA 3KBXA 2OHFA 1XNRQ 2PQAB 4GU2A 3K5NA 1R4NI 1WY8A 1RFAA 3AECB 1MD2D 3OWFA 5T1IA 1ZYRD 4DR6Q 2NTSA 2DAJA 5C44B 4RHRA 3U9OA 4DAVA 4EE2A 4IFDJ 1ISNA 4C2MH 4WJWA 5C3JB 4GS3A 3A54A 4P71A 1L0WA 4LNFA 2FE8A 3TN2A 1EL0A 3V6EB 2PQAA 4IOCA 3KUCB 1YN4A 4NXNQ 4DV3L 1WF9A 2YV5A 3KYCD 3JAML 1E2WA 3I2ZA 2BYFA 3HK0A 1NEKB 4A3BH 4RF1A 3WALA 1E0ZA 3DEOA 3QIJA 1EQQA 2DX5B 4AOFA 1L0YB 3CP0A 3UI3A 4G7ZC 4AQYQ 2KCTA 4GLSC 2OTLA 1FGBD 1X65A 2QDBA 4N6EB 5CHVC 2EZVA 1YMHE 1Q1OA 4OWWB 4ABNA 2JY6A 3I5JC 5M5YH 5JJIA 1Q12A 3I7FA 2ACZB 1KHIA 2RDFA 2F4VQ 4AH6A 1E0BA 2IY0B 1SRUA 2B63G 3PCOB 3PHXB 4CKCA 2KJRA 3Q8EA 4KZCA 3GD7A 2PYKA 1JRUA 5BN3A 4XT1B 1BCPF 4X66L 1YQ4B 3LWUA 3EGRA 4BBNC 1SNQA 2CFMA 3TS2A 2K14A 4DV2Q 1PH3A 1J7AA 3I9V1 3R3MA 1L2NA 3PZDA 4UPAA 4GSWA 3VYTA 1Q8IA 3NJTA 3M4OB 1EIHA 4FHJA 1ZDVA 2KVMA 3M95A 3P20A 2B2YA 1EYCA 3RZOB 2G9DA 4DU9A 1CFMA 1GD7A 1HNWQ 1YNTE 2WKDA 2OJWA 3NZ3A 1DJRD 1CKMA 1CUKA 1LUZA 4EOYA 1C9FA 2IDYA 4FXDA 4YWLA 2BGFA 1LT4D 2KYWA 1E1TA 2G5DA 4HMJA 5G3LD 2HDEA 4EQOA 4KZ0A 3MXGA 3RN5A 1Y8RC 2BBCA 3K5MA 2R2QA 5T1GA 5BR8Q 4ANVA 2UXBL 1S5FD 2KMMA 3Q6BA 3H09A 1ENAA 4RGNA 3HVDA 4DNTB 1C77A 1XLPA 2HJ1A 3I4NH 3GZNI 1GUTA 4NB3A 3I70A 1EWHA 1F9QA 1FNVA 5BN4A 3NHEB 1Y1VG 2QW7A 2E2HB 3KW5B 2K33A 3NZSA 4DK5A 4IM0A 3PREA 3K80C 5IP4D 3NEMA 2K8CA 2Z4HA 2Z6KC 4CGYB 4XZ4A 5AZFA 2WACA 2IJ0A 2JQOA 5IO9A 1I94L 1VZ8A 2EE1A 3C2PA 1PFSA 4FJVB 3C19A 2OOBB 4IO9A 2WLBA 2FCSA 4HJKA 3NSWA 3Q14C 5LMUL 4BWGB 2OEOA 3AE3B 1NCVA 5KYLA 1RD9D 4HDOA 3W1SC 3DEPA 4P75A 5K5PA 4US9A 4PZ8A 1FEHA 2VQEQ 2C5CA 1Y1WG 2HT1A 3AMUA 1H9JA 4DHZE 2L00B 2Z9HA 4ZKBB 5LXIB 3IFDA 2UXCQ 4BA2I 3A9KB 4B9KA 4X65L 3D6WA 3H3VH 4ZQ3A 4B08A 2JA5H 2C7MB 1Y1VB 4XT3B 2QKIC 3A8JE 5FO8B 4HCPB 4CKEA 2PO4A 3EBEA 4X3SA 4PS3A 4FYDA 3ZGZA 3ABVB 4DK3C 2DZJA 3ZNID 3OOCA 3FKIG 2NYZD 3E5SA 5GROA 1QVGA 2HHHQ 3ONSA 2D3CA 2KWVB 3QOJA 3J81E 4MACA 1CZPA 3WA0A 3ZO5B 4A3EH 5G5HA 1SNOA 1MSHA 1L0VB 2WB1E 4B3ML 2K52A 1F2MA 2PCFB 1B9RA 5IY0A 3OHXC 1EQRA 1GUOA 5ELNA 5IYCH 1CK1A 1ILPA 2CHWA 1HH2P 5M3MG 5KHQA 2FBWB 3RR5A 3ZQ4A 1NMGA 4ILWA 3EHVA 3PO2H 4BXXH 3HOVB 4LFBL 3EQLC 3HOXH 4KIKA 3SXHA 4AYBB 4AQ7A 1LTSD 2I0QA 3OIQA 1SAPA 3SVMA 3KH0A 1IGDA 4YY3Q 4BA1I 4FLHA 2L7RA 1FFUA 2KENA 2XRQD 3H6MA 1U4AA 1RFKA 1RF2D 2BT6A 2ZTCA 4QIWE 4DV5Q 2KQ7A 4G0NB 2QSDA 3K9PB 3UDFA 4A3KB 1SBBB 3GOEA 1I3QB 5KRUA 1Y56A 1BCPC 1ZP0B 3SK6A 3S17B 2K05A 4QF4A 3J7AF 2K28A 3MHZA 2EMTA 2JZZA 4CJ0B 3U7ZA 3PV1A 2XN9C 2FCNA 3Q8CA 3GZNB 3OYYA 2K5DA 3J81c 3RZFA 4DV5L 1D8LA 2I5HA 5C5LA 2B2WC 4R9WA 3DM3A 1B7YB 3W1GA 1STAA 1LT3D 4QGUA 1EF1A 1PUTA 2N4FA 4BKGA 2I07B 3U7DA 2NBFA 3M9BA 2DN8A 3X3MA 4HJ5A 1IBMQ 2NVQH 1WFYA 1ZXIA 3E3XA 1IL2A 1N34Q 2YTVA 1JWSD 4MGZE 2C60A 2K5QA 2BH8A 2N1WA 4JCVE 2KN4A 1YITA 3VTUA 2F0EA 4LFCQ 1LTRD 2L11A 3J9CA 4QB4A 4QL5A 2HTHA 2JUOA 1WTRA 3N1YC 4DV6Q 1KDCA 4AS1A 3MHBA 1RKNA 1C1YB 5IE8A 2C5LC 3PZ8A 2BA1A 3I90A 1W3SA 1QE6A 3D3RA 2D3GA 3ZW3A 3MVVA 4HK2A 4EFOA 4OONA 2B29A 2RMMA 3RLOA 4DN4M 3NWSA 2MBBB 5M5YB 1HE8A 2R93H 2FXQA 1H95A 1GAQB 3L2PA 1GUWA 2DNFA 4JW0A 3NVWA 2Y0SB 2BS3B 3FILB 4M8AA 2K22A 2AHOB 4PS7A 2J4XA 1C3TA 3DOWA 4DR6L 1SIJA 2F0IA 2MQHA 3APDA 3WDNA 1N61A 4A3GG 2INCC 3AEGB 3PHWB 3PQIA 2K1BA 4IUNA 3R2IA 3JAMi 4GZYC 5J17A 3AYHB 2EYMA 2VL6A 2VB3X 2D62A 2KEEA 1LTGD 2VW9A 2R7FA 1LTLA 1HZ9A 4R4OA 1HR0L 4NXMQ 1JC7A 2QHOA 1HZ6A 4OW0A 4X64Q 3CW2C 3GP7A 2L9HA 4XQQA 4A3BB 1DD2A 3SK8A 4HIOA 1V6EA 3B9JA 2LASA 5JPNC 4DA2A 1XNQL 5EPJA 4OO1I 1HTPA 1VQ7A 1JOOA 2V0GA 1QUQB 3JC66 3H7PB 5J1ZA 1LTAD 4WURA 1EUJA 3DWGC 2W55A 1MBYA 2QMTA 3RT3B 4FADA 2ASBA 4CKBA 2CR5A 2BW2A 3CRLC 2JA8H 1CHQD 1DGJA 4BS9A 2LFNA 3T13A 1X54A 3H7SA 3I4OA 4DR1L 2YLMA 1U0LA 2AWNA 4OVVA 1STYA 2Q8RE 5JJZA 1Q0WB 5A2QL 5AUKA 1P1AA 4F7XA 2YU9B 1Z6HA 5C0XI 3PO3H 3ENEA 3T56B 2XWBB 4JYAQ 2J7QB 4MJSB 1O7LA 4A3CH 5CC4A 2KK8A 3AE6B 1AZQA 4ARCA 4PMCA 3A9JA 3CC7A 1IBKL 2GBKA 2QCZA 4DV2L 5C3WA 3D4WA 4JI2L 1TIID 2PVGC 1KDBA 4M0WB 1UBQA 3J7AV 5ELCA 3FKIH 2HQEA 4A3MH 1I6HB 3L4PA 1Q1BA 1WOCA 1X3FA 2FMCA 1EIYB 1ACCA 2JA5G 4G4KA 2IO1B 2F0KA 1G91A 1LTTD 3HOVG 3OW2A 1XPOA 1PH6A 4BY7G 3PO0A 4II3B 4KDIC 1IL8A 2KXJA 4C00A 2ENBA 1ZXTA 4S0RA 1H9SA 3Q8FA 5M3MB 3F2CA 1BT0A 4S17A 3H15A 3V96A 3U4VA 1SJED 5EE9A 3KVFB 1L6VA 2JEBI 2DZKA 1XX8A 1I4RA 3IRBA 3J80i 4MTNA 2JXXA 3W5UB 1T9HA 4HWIB 1SEBD 3CCUA 1NBWA 4YCUA 3C1FA 1D3ZA 1PZJD 1NY4A 2QJLA 3FKIB 2R7ZH 1G8ZD 3BYTB 3RULA 1F9RA 1N9WA 1Y8NB 4AYBE 2EKIA 2EXZA 4DR4L 3HVZA 4USAA 2LGYA 3NTHA 1RIPA 1WYGA 2M0XA 4MM3B 2K8HA 1HQRD 1Y14B 1K50A 1QWYA 1GUSA 1QZEA 2G4SA 2MX2A 4NXML 1Z5SB 4EZJA 4Q0FA 1EZ8A 2JQRB 2LHDA 3DBSA 4K5WA 4IPGA 1IW7C 2GOWA 3L13A 3L08A 4IJHA 4HR7B 3FKYA 2C9OA 5CMDA 3KWVA 3QK0A 2L5TA 1PYBA 5CHFA 5CTRC 1KDAA 3NVYA 1SE8A 1Z7TA 3B0AA 2KA7A 2LUEA 3I56A 2LVPA 2O2VA 1A2UA 1OFFA 2O4XA 1VZ7A 3TJPA 4BOZB 1FRRA 3G48A 1CKNB 1GC7A 1WJUA 1UH6A 2D10A 4W9CA 4HKQA 1WJNA 4DR3L 3WAMA 2WX0A 3DMUA 3RLNA 5C4ZA 1QT9A 1JQ4A 2LZ6A 1JW9D 1GO3E 4NAWA 2N9KA 2G9HD 2XTIA 4HEDA 1G6ZA 3H1UA 2GVAA 2R92B 2N7JA 4OHJA 1ESFA 4JPSA 1Z2MA 2A74C 3H3VI 2UUBL 4X62Q 4ACFA 2JK8A 3M85A 3ZDMC 3BU2A 1TWCB 2AWOA 2LRWA 3N3KB 3UDXA 4JI5Q 4JBJA 1N34L 1W6KA 3NVZA 3D4RA 3GTJB 2B76B 2A6ED 2A69C 3D31A 2MW5A 3F2BA 4TKOB 3FPPA 3QB3A 3TEWA 1SYBA 1QOAA 1V5TA 2N7DA 4Q5VA 4KN4C 1K0SA 3CKIB 3DBHI 1UWMA 1X55A 2LS01 4BBRB 1S1QB 1BQQT 2KAJA 2I5LX 1FD7D 3RMHA 4PT5A 2RSUA 4LNIA 1M90C 1KLGD 2LXAA 1P9DU 3R66C 4G7OC 2BE5D 2RDBC 4M1UB 3Q24A 4HIDA 3UQBA 2L05A 3LNNA 2WHIA 1ICWA 1PFDA 3OTOQ 1YBYA 1GXDC 4KKTA 4PZ7A 2UU9L 4NQKE 2C7NB 4IUMB 1RODA 3BY4B 4KJOA 4IFDH 1MFWA 1YNND 2Z8LA 4LUVA 1TBEA 2CKHB 4DDID 3BS1A 2IPKD 4C7YA 2PI2A 4LFAQ 3AFQA 3F1ZA 5E7NA 1EY0A 1RWSA 1V49A 4MH8A 1YHQA 5BYRA 1OTRB 3GTOB 5CBAE 2WXPA 2EIFA 3Q8AA 1ZKHA 1FR3A 4BBRG 4AYBG 4DR7Q 1CJEA 3BINA 4RWSC 4BZAA 2INPE 2PIAA 3N1ZC 2N55A 1YOVB 1Q1EA 1LQBA 4POFA 1RHPA 1TIFA 4WWPA 4YWGG 2F3IA 2M2LA 5IOCA 4FJYA 2KDMA 2E2DC 3SFEB 1I5FA 4KGRA 2F0VA 1U5KA 1NENB 3TS0A 5ELEA 5CV5A 4W9DA 4YTMB 1HR0Q 4RCNA 1G51A 3S16B 5FLXL 2KTRA 4FF4A 4C3IH 3K7AH 5C5MA 2Q8TA 2IX0A 1F9JA 2KMAA 3LYYA 4A9AA 4LF4Q 3I4MH 4K7WA 3IT4B 2Z0SA 1EWCA 3BZKA 3CCQA 3M63B 4IPDA 4HJ8A 4H02A 2R92G 2BS2B 3I63C 1K9MC 3HIZA 5DPSA 2FFKB 1M8AA 3BZDB 4XDCA 5E1FA 3AEBB 5JZEB 5EPLA 4JI3L 5IYCG 2NVUI 3DXJC 3SK5A 3LXFA 1M4VA 3HS0C 1K8MA 2ZJDA 5LMUQ 4ZAIA 5C4JB 1WTVA 1TQOA 4KKIA 3AFPA 4A3KH 2K04A 3PO2B 1GUAB 3CSTA 3GTKB 3VYSA 4DNIA 2C7HA 2GRIA 3KYDD 3TEHB 3ZNHB 2BA0A 3PUWA 3JAME 2EYOA 3H8HA 4WRDA 2PJHA 3U2SC 2EYLA 4OZBA 3A9KA 3Q3FA 2PZWA 4PS8A 3ZTDA 3ALBA 1TS4A 3VHTC 3M3JA 3CF5A 1QB5D 1N36Q 1U4MA 5JEAJ 3Q0AA 4BBSH 2WDQB 3DCGA 1TWFH 3TIXA 3NENA 3VQIA 1KC8C 1KLVA 4A3JH 4NW2A 3R3OA 4JQWC 4YIJA 2YEPF 3K8AA 5FK9C 3T8MA 3VH4B 3VTWA 4HJGE 2BDNA 4LNQA 3RNBC 4FF2A 5A35A 4EZLA 1PTOC 2WWZA 2DNEA 3MEFA 4LF4L 2BKFA 4KHPL 2IY1B 1YQBA 1DOKA 3RNEC 1VQEA 1ET6A 3A8KE 4LF5Q 1YHAA 3NHHA 3VH3B 2GLSA 3ZVVA 2JA6G 1Y1VH 2WXRA 2ZM6L 3LWEA 1KJTA 1AARA 1L4DB 2NPTA 1IBKQ 2KECA 3U58A 2Y3AA 2B3GA 1UZXB 1UF0A 3ZJVA 1E10A 1TWFB 3BDCA 4L8JA 3VR2A 5EE0A 2KTFA 5I2YA 5J39A 3NWTA 3CCSA 4P6VF 4L5SA 1CQVA 2PKOA 1SF0A 2DUDA 3ZNGC 1L1OA 3W1SA 3GTKH 4MDKE 4ICUA 4UP9A 3P4RB 2FAZA 3E6ZX 1QOFA 2CWPA 3H0GG 3OMCA 5M3FH 3HHMA 2SDFA 2MO1A 2CHZA 5M3FB 5KHOA 3Q8BA 3L3OC 1ESRA 1YN3A 3TRZA 1SMYC 2NB0A 3L16A 1SMYD 4EQPA 3GQBA 2TMPA 4DV3Q 1I4HA 2JJQA 2F0FA 4IUUA 4J1MA 1TWCH 2M9VA 3MJWA 4A3IH 3HKSA 1IBLQ 1B44D 2B2TC 3W2DA 2B63H 5DEHA 2BQQA 2XK5A 2F1MA 1UAPA 3BG3A 1YJJA 3GE8C 4DKAC 1R4QB 1T0RC 1SLJA 1HCZA 3PIPA 1ROEA 3RN2A 2M00A 4TQ0A 4EZKA 4B0EA 3T9LA 3QWNA 4JYAL 2BB5A 3OMGA 4WQOB 1G2SA 4LWCA 3DBRI 4X64L 2F0SA 5GAGC 1TWGB 3F2UA 1FGUA 3BDLA 4LK1C 1D2BA 3R7RA 1F0ZA 3HRZC 1XMOL 3PZ7A 4WFN3 1BXTA 2DENB 5D14A 2WX1A 3X3NA 5JJKA 1IBXB 2NBUA 4IZ8A 4I7ZC 2R7ZG 5D7GA 1B9NA 1U4PA 4BY1H 2KD0A 2KHWB 3RZWC 2RPQA 1HNZL 1IHZA 1VQCA 2DZIA 4A3JB 2Q2HA 1E8XA 4IC7B 1I4XA 3T1YL 1TXYA 4AIMA 4II2B 1SNCA 3AU5A 5M5XH 3ZRCA 3C1EA 2IO3B 2MSED 5CHWA 2KBNA 3HUIA 3S1MB 2L1BA 2IO2B 3WAOA 1DOXA 3ND9A 2JWUA 2KJ6A 2ZTDA 1SN8A 5K36H 2V3PA 2JA9A 4A3JG 4K0KQ 3HKZE 2K5NA 3AE4B 3MP9A 1TU2B 1OQRA 2ZVOA 1JR0D 1II3A 1PA6A 1UD7A 3MC8A 2KZRA 4HEA1 3MHSD 2KVRA 2IHEA 1S4ZA 3AV8A 2MQJA 2V1YA 2RD0A 5C0XJ 4LTUA 2RDHA 1RDPD 1PRTD 1QVCA 2BVCA 2WXGA 2Y0SG 2PW5A 1OXTA 3P4PB 1DCZA 1SE4A 1GUNA 2DY7A 5C0XH 1XYIA 1VQNA 3FRPB 4JI0L 2GB1A 4C56C 4JIOU 3PVLA 5KNDA 3ERQA 1DGSA 1SYCA 1JCKB 1TJEA 2VUMB 4R4TA 4HVBA 1O7IA 5C4XB 5JHAA 3PMFA 1C8CA 1ENFA 1NYRA 3DVGX 3QHTA 1OXUA 2BPSA 3M7NA 5AZGA 1WWTA 2AWTA 5HFYA 3QARA 2LI5A 3OSOA 2L0FA 3VR9B 3PTFC 1RYJA 5I2XA 2R92H 4OL7A 3S16H 1MG4A 3VFKA 4ME5A 3G4SA 1XLNA 3J80c 1Q10A 1DYQA 4GB9A 1VQ4A 2BYVE 2MA9B 1FYCA 2QA4A 1PMRA 4A75A 4HSPA 1TY2A 1VQOA 3PRMB 2JYTA 3KLSX 3Q22A 2N1VA 1ZW7A 2NCNA 3OTOL 4ZYNA 1BF4A 2KVZA 5I9PA 1P3QU 2BF8B 1S3SG 2RHQB 1NI3A 2QF7A 2LFIA 3K5OA 3M62B 3Q69A 3TZUA 4L1BA 1XCQL 1RTOA 1JB7A 2WXIA 3KLWA 5KGUA 4LF6Q 2K9XA 3ML8A 1FMAD 4JE3B 5L95C 5BN5A 5M5WB 1EEFD 3PF4A 4XC2A 1Z47A 1SYDA 2RPVA 4XWWA 1JMLA 3AU4A 5HGTA 2UUAQ 1P0RA 2IY5B 3I73A 2HIVA 2M0AA 2MEKA 3M7GA 3A0JA 3BVZA 3PPAA 4PK1A 5JH5C 3DBLB 5KEEA 4A3FG 3NXWA 2KJXA 2WIIB 2JA8B 3I4LA 1K51A 2H5XA 4BVUC 4C3HB 4LF9Q 4LNOA 2JT4B 1A63A 2J53A 1E2VA 2QIEB 3HOZB 2KUMA 1A3UA 1FNUA 1Q90A 1YJ9A 1P7FA 2LWPA 1A8VA 1E8ZA 4L5RC 1TT2A 4A3LG 1N36L 1MJDA 2LVOA 1LM0A 2XIWA 1C7YA 1QKZA 1T6BX 5FLMH 4H7BA 4ZRKA 4OX9Q 1M1KC 1MJEA 3SD5A 4C4VB 3RZDH 1ZOYB 2ZCBA 3HOWH 3NZUA 3FP9A 3CPWA 2LHEA 1AYFA 2ZJPA 2J0JA 1XXGA 2G4DB 4CO7A 5H8YE 4PYUA 4JC0A 1XWEA 3J7A5 5HURA 4X3UA 1HHVA 3CD6A 1YHBA 4KSLC 3R2TA 1ILQA 3ECIA 3ULJA 2PZUA 3GV6A 4LJZC 4JI3Q 4ANXA 2MPMA 4LW1A 2PNRC 1KABA 2B2UA 2UUCQ 1FCCC 2JYOA 3AULA 3RPFC 2OWOA 2BKRB 4R8NA 3M4QA 2DLBA 4GGQA 4TQ1A 4JVZA 1E9MA 3AEVA 5M5WH 4GDKA 2VXWA 5CR3A 4RKBA 1IZ6A 1IYVA 1Y1WB 4IFDI 3PUZA 3D0FA 3S2HB 2KANA 5A2QE 1S5DD 3S2DB 2WXMA 1AEXA 1PTOD 4GLXA 3I3TB 4M8MA 1XMQL 1QQRA 1QOGA 3I55A 1UELA 2WFWA 3ML9A 4B3TQ 4YXDB 1FPYA 3EFXD 3R8BA 1X3PA 4MTKA 3B6YA 4RH6A 3PO3B 3P2BA 1B8AA 1E7UA 1ZUD2 2IGDA 1IKLA 1STEA 3T1HQ 2M4NA 1X9NA 3RN9C 3G6EA 2X6LA 3CSFA 1YX5B 4Y52H 1JJGA 1VQ6A 2LKVA 3M3YB 4XQNA 4DAYA 2ZXRA 1IPGA 1K8RB 3K58A 2AUJD 2NVQB 3UI2A 1ZDXA 4ICVA 1PH4A 4OGQC 4WJ3M 1E24A 3NP8A 4DNRB 1BCPD 4DFAA 5C6AA 1JMCA 3W5VB 3EN2A 4ZUJA 2DZMA 1V43A 4LF7L 1K8OA 3PLUA 4J8QA 2E5LL 4K81A 5C4XH 2ZW1A 2KACA 4GNXA 2LSSA 3CQZB 1STNA 1OEYJ 2CS4A 1V9PA 2F0LA 2AQ3B 2K5HA 1WI0A 2OF1A 4QY7A 2C35B 2IWHA 2UXBQ 2B39A 1IBLL 5J2RA 2N88A 4CBVA 3E56A 4HTHA 2RBMA 1K53A 2MRPA 2G3QB 3UDIA 3TSSA 1TKGA 2V4LA 1JQYD 3L10B 4LNKA 1V97A 3VR6A 2EJMA 2MBQA 1PV4A 2Y5BB 2J7ZA 4DXGA 5LMNW 2PI2E 2VRRB 4ANUA 1HNWL 2SNSA 3VVWB 1D6EC 1B50A 1B3AA 2IW3A 1EY9A 2KDFB 2P5ZX 4EEWA 3EJIA 4KKUA 1LACA 1CT1D 3QIAA 1K73C 4JI5L 2W82A 3HOVH 1CA6A 4JWSC 1WM3A 4LF8Q 3PT2B 4C3JH 3N52A 1PZID 3DWMA 3WANA 3D32A 2WXKA 3A1QB 4NJCA 2F0WA 3EUB2 3QQ8B 3CCJA 1VCIA 3A74A 2ZJQA 1TT5B 4DXAB 4A3LH 2K01A 1KRHA 1E8YA 4P74A 2ICEC 3E9SA 4DV7L 3AB9A 4G7HC 3QJZA 3VAWA 2V3SA 5IP7G 1TWGH 2EY2A 2PE9A 4IPCA 3T1HL 5LL6S 3S15B 3FDTA 2Q5WD 3X23A 1UEAB 1HTLD 1WXAA 3NY5A 4ME3A 1H9KA 4B3TL 5LLIA 1BR9A 2VS1A 2LGSA 4FHKA 2XRSD 1F77A 5EQ0A 2B8GA 2ZXPA 4R4IA 3PUXA 4DV1L 4W9IA 1BO0A 3NBHB 3UE1A 3PO3G 3EFUA 4XGAB 1PXUA 2EY6A 3L7ZC 2IBIB 1A5RA 1HXYD 3DQVA 5MPOA 3UIPB 1GKHA 1FNWA 2HD3A 1V1OA 3P4QB 2ON8A 3SDLC 1UE6A 2N9XA 2PNHA 3LJ3A 4KIKB 2WXHA 1TS5A 4L6TB 2JEAI 4DR4Q 5DPTA 2A5HA 5AEKB 1K3RA 3AE1B 4K0KL 3TBIB 3VYUA 2F0DA 4P73A 2L15A 4V0BA 1TY0A 3KDFA 4HCNB 1N33Q 1BVSA 1XCTL 2JRIB 5IWAQ 4QIWB 1AFPA 5D6JB 3CXCA 3AE7B 3JW0X 1E90A 1SFOH 4WJQA 3A56A 4A93G 3S1MH 2F0UA 4LLGM 1WTHA 4O2DA 1UE7A 2XEWA 5E6OA 3BJUA 1YNJD 1V2YA 4YWMA 4DV6L 4KD4A 4FO2A 3TP8A 4IOAA 2ZPNA 1GG3A 1N62A 4L5QA 1HZCA 1GHJA 1WGGA 2LD9A 3TBLD 5KNCA 4POGA 4ZDVA 4HN7A 3QC8B 2F0TA 4D2KA 1QG7A 5G2NA 3DDCB 1SSOA 1WR6E 3S2AA 2WAQG 4YSXB 2J52A 1X3EA 2IX1A 4YTPB 1TWAB 3QAQA 4KJNA 3CCVA 1EY8A 1SYEA 1OXSC 1CTMA 3FVQA 3KFUA 1NVID 1BOSA 3TEZA 4B9XA 5F2DA 3K57A 3DBHB 2WU5B 4G11A 2O2LD 3HM6X 4N58A 1V1PA 1IW7D 1EF5A 1A2TA 1KRSA 2A4ZA 4OVUA 4ZK9B 5IP9G 4DHZB 4HLEA 2N78A 4DUZQ 3V2TA 1Q86C 4QCLA 1C0AA 4UDUC 2AX5A 1E7ZA 2LY7A 4UP7A 3Q23A 5JJLA 2EQSA 2WKCA 4LF6L 4N9F4 2F0OA 1EYDA 1TR5A 3AH7A 2LUMA 1NJIC 2EOTA 3K81C 4N59A 2KDEB 4DF7A 1O7YA 2B3AA 3WAPA 1PRTF 5JHBA 2AL3A 2B8FA 4HPMB 1RJTA 5AJ3Q 2JZ3B 2GI9A 2KFKA 1NBFC 4NPNA 4KY6A 4IURA 3FILA 3A33B 2INNE 2MP2B 2UU9Q 3WIMA 2K25A 1TKWB 4DV4L 4Q2JA 4IALA 3F2DA 2ZNVC 2A6HD 2LGXA 3O13A 4HPLB 2E76C 1WRDB 1X6OA 3EA6A 1ZYRC 4X62L 2M8SA 3N20C 3VUYA 5CV8A 5GADC 2WXLA 4ID6A 4US8A 4NZLB 1CSPA 1NMFA 1HUNA 5JEAH 2DY8A 1WTPA 5FLXE 2QEXA 2NVXB 3UGBB 1KAAA 3QG1A 3TUOA 3RNGC 4QUCA 2D2CC 4EVOA 4JV5L 3RUIB 3KJOA 5IIFA 1B70B 4AP4C 2ZM6Q 2XBBC 5T8IA 2F3VA 3TQYA 1XLOA 1YVCA 2LMCB 5DCNA 1KD1C 1C4PA 3VRBB 2HHHL 2M56B 1HTQA 1VQ5A 1N63A 2C9WB 1DOIA 4MIUA 1ZPSA 2KHSA 2B2YC 1FM0D 3K7UC 2LEKA 3I4MB 4DR1Q 4FVMA 1I42A 1MGSA 1XMQQ 4PG3A 1VZ6A 5LNK1 2HIXA 3V61A 2V9HA 1BDOA 4WWMA 1WCMH 2YVCA 2KLCA 5J18A 1STGA 2FJ2A 2E2JH 2BDOA 4NMZA 4JGHB 4A93B 4LK0M 2WV6D 1TWAH 3TP6A 3J80E 1NDDA 3NS8A 4NJ6A 1VQ8A 4A93H 3OWEB 3SHLA 1A3TA 4YCWA 2GVBA 3PO2G 4BXXG 3AE5B 4GDLB 4NKLA 3NTKA 3BK2A 3DBRB 1YQ3B 1LYLA 4JI1Q 3SE0A 2VZKD 5IN7A 4O1NA 4RFBA 3S24A 4GOPB 2OEDA 3K9OB 2NN6I 4ZKCB 2BH2A 2DYMA 3MXPA 1JOKA 1WXSA 1VQHA 2BTEA 4EX5A 1SB3C 1KLUD 1SNMA 1UUPA 2AQ1B 1F2RC 1WGHA 5C1ZA 2JN4A 2NTTA 1LO5D 1WZ3A 2F3WA 2DAFA 4OXPA 4A3EG 1L2FA 3P1HA 4BBRH 4IOIE 3B2GA 4GNXC 2DWQA 4G3XB 4K8JA 3J7YW 3MJ5A 1FXTB 3Q2AC 4A55A 1J7BA 1MG8A 1VF7A 2HDMA 3H3VC 1W2BA 1KL9A 3RUZA 3A1QA 2E2HH 2L8JA 5IGDA 2KHIA 2EKEC 3V62A 4JBMA 1JE5A 3PIO3 2KN5A 4WQMA 4YTNB 1GB1A 1FFVA 4C2MB 1WSPA 3IL8A 2F0JA 1K8GA 4PYZA 2JF5A 1SYFA 4BKSA 4A3FH 2D0OA 3HOWB 2JPHA 5K36G 3EFCA 1PZKD 2D5GA 2D3BA 1TZ1A 2O2VB 4C80A 1V8CA 2KTRB 2BS4B 3P42A 1EUVB 3RI7C 1WYDA 2F0HA 1YJ1A 4N9TA 1I6HH 2VZKB 4IUQA 2N9EB 2JA7G 1PH1A 2DNCA 1GB4A 1FCLA 4DV7Q 1EIFA 2L0TA 4I6NB 2EYFA 5LL6X 4A3KG 2FMMA 3DWPA 1SE2A 3WCQA 5LHY1 4DV4Q 5DM63 2ES2A 3S2DH 5EE3A 4N9PA 2NMQA 2RGFA 2PQEA 4DAPA 5C4HA 1A70A 2OQKA 1G6PA 3CRKC 4BBNF 3BZCA 1TS3A 4IUTA 4A6QA 4H2AA 1OTCA 2PE6B 1F2YA 1L0XB 4KLKA 2HCIA 2UUAL 3P1MA 1MHHE 3HGBA 3IAM1 3IKJA 4R4CA 1EU4A 1X1MA 2IGHA 2I38A 1Q5WB 5AUIA 4R8IA 4P2CB 3A55A 3ERSX 3ZXVA 3S2HH 3P4SB 4B0MA 4ZHPA 4I6LB 4Z9CB 4OZAA 1U4RA 5GQOA 2F4IA 4A4IA 1KH0A 1R4MB 2K5PA 2Z59B 3QO2A 2JA6B 4W9HA 3RNUA 1PRTB 2FCQA 2H4OA 1VQGA 3APFA 3NUCA 4X65Q 5DPRA 2DHZA 4A20A 1QF6A 4GDLA 4CDDC 1JB3A 4X57B 1CMXB 4KK7A 1G291 3T16A 4LDTD 4J6HA 1Q46A 2A19A 4A3PA 5C44H 3OIPA 4CDEC 3AEAB 1QILA 3C0RB 3CCEA 4EUTA 2D5DA 1F2LA 1BBWA 4P16A 2CHBD 3NOBA 4LJPB 4AUQC 3DVGY 2ZW0A 4N8FA 3Q3OC 1WGKA 2L3ZA 4KHZA 3PIOA 3HOUH 3JYUA 3VA5A 4E6IA 1XPRA 1I7HA 4JI4L 1G2TA 3S1RH 1AE3A 4IPHA 2MH7A 2F0NA 3ER0A 2E3TA 2V1CC 2JA6H 2V3NA 1N33L 1STBA 4JWUC 1FD6A 4MNOA 1CM9A 4DBGA 3PF5A 1SGHA 3RLFA 1IP9A 4OELB 1XNQQ 2W3SA 1MHWC 1EOVA 4CDCC 1KM7A 5FR6A 3V6CB 4XQJA 2Y5CA 3ETRA 1HZBA 5LMNQ 1Q82C 2E6XA 4B3SQ 2BWFA 3NK9A 3JSVB 1IKMA 3K5LA 2BCOA 2KCCA 3K0YA 3C8YA 1ML0D 5BMIA 2EDGA 1PDXA 4AJYB 1M94A 1QUQA 3FPUB 3T1YQ 1LABA 1EYAA 5I4DA 1E7PB 1ICFB 1NAPA 2GBJA 3W1YA 4RGMA 4FF3A 1UBIA 4O0AA 4W9KA 3W5OA 2A73B 1ASZA 2KJHB 4XDDA 3GS2A 1EQVA 4U68A 2YTXA 3BIID 1XMOQ 3ULPA 2PPHA 1WXQA 4LMQD 3QA8A 3CAMA 4LJOB 3NBIA 3VUXA 4OIJA 3EROA 4C3HG 3MXUA 1S5CD 4GOPC 3S17H 3TP5A 3AQQA 4A3FB 5FKAC 2A6EC 4IN3A 2JSVX 3S14B 1PTOF 1QOBA 1D5MC 1PFNA 2KCNA 2B63B 3S14H 1GC6A 2UYZB 4MZ9A 2K0PA 3UDGA 4LF8L 1WH3A 1ZGUB 4K6DA 4MSMB 1VLBA 1VMCA 4RM8A 1K28A 4XXEA 3GTLH 1KFYB 5IYDH 3MZ5A 1O7ZA 2HQLA 5JVG3 3J81L 2VH2A 1E22A 1R9TB 3AE8B 4MGIE 5G55A 5COYA 1N6ZA 1WE6A 2SNMA 1ZKOA 1Q7YC 3KF6A 2PVOD 3E0JA 4WAFA 2B2TA 1NYQA 4LF5L 4WIPA 1QNKA 2EYJA 2MUYA 1SE9A 4HSVA 3I8ZA 1DOYA 2KNBA 2XK5B 1FXIA 5IT9c 1HFNA 2MO0A 1NE3A 1J8IA 1A3VA 4B6WA 4B3SL 4JBKA 3AM9A 4AJWA 3KK7A 4IQZA 1S5ED 2KWCA 4KY7A 2W54A 4ZRIA 4Y7NB 1L1OC 4TMAB 1HA6A 1FIQA 4RHSA 2PPBC 4BY1B 1AP0A 3BWUD 2E2JB 1YJIA 3Q3MC 2D07B 4OZCA 4HXDA 1I50H 1T3QA 3VDZA 1PH7A 1MKHA 3JAMc 3CCLA 3CHBD 3PGZA 4WORA 5KNBA 3UIOB 1EY6A 1GUGA 4J15A 3B1LX 4OO1G 2ZNVB 4NQLB 2MBEA 1R7SA 2R2OA 3GTGH 1TZOA 4YHHQ 2F03A 4JI4Q 5C0XG 2L4NA 2CCZA 4WJNA 1YD8U 4JK1C 2VZAA 3SR1A 2K5VA 3RYTA 4WJ4A 1QLBB 1OO9B 5CORA 1YIJA 4E3CA 3DVNU 1QZGA 2JX5A 1O80A 3J81i 2K39A 4KD3A 1PH2A 2GN5A 2LJ5A 2F0MA 3BVGA 2E2IH 3PS6A 3AXCA 2Q2IA 5KIXA 1C4CA 4K5VA 4A3IB 4DWFA 2ZPYA 4CHTB 3KLRA 2VB2X 1EEID 3CCMA 4HDQA 3I4MG 3TEYA 2KWDA 3BYYB 1NR4A 1F2RI 5CV7A 2HJ8A 4ZRJA 3KF6B 4EGVA 5C23A 1KRTA 4JI1L 2L32A 3VTVA 4H44C 2UWQA 2J0KA 1XTCD 4DGZA 1KAWA 1O78A 4PMWA 2KCMA 4BY1G 2NBWB 4HJ7A 4KGTA 2EYPA 2Z6KA 5DNFA 2H88B 3DHGC 5AFWA 1V9JA 3EIVA 1PLFA 3AE9B 3S1NH 2K8BA 2EPBA 1GVPA 1H8CA 3QWZB 4IW0A 3ND8A 1WTOA 1MJCA 1DONA 2AKWB 3GTQH 4OX9L 4RF0A 1GPXA 4E74A 4C7ZA 2MP2A 1I4GA 3FHWA 2K75A 2E8GA 3J80L 4JG2A 1VDZA 2K03A 1S72A 2L1AA 1PYWD 2K6AA 2WINB 4WH4A 1ONLA 1JJCB 1Q8KA 2HDLA 5D3DA 3VDYA 2WQYB 4IKGA 1VQKA 1U4LA 1XF5L 2GBNA 2IHFA 3LB8C 3TMPB 4BKTA 1XPUA 4M00A 5M9OA 2JA5B 1QCBD 2KQSA 3T3OA 3T51B 4GKJQ 2KHJA 5E6JA 3STBD 5JPMC 4AWJA 2KFJA 3T3NA 4JOIC 3S1NB 2KQ3A 3VUWA 3H0GB 1TKYA 4TV3A 3I91A 3R7QA 3HFZB 5JXVA 1G6JA 2EY5A 4G50A 4JBWA 4XYQA 3MXNB 4R1JA 2VNUD 4RCOA 4DK6C 2XGTA 1CI3M 4ZYSA 2KFKB 2REXA 2WXNA 2CU3A 3BDOA 1EO6A 1SFOB 3PLVA 2DGYA 1EYGA 4DHJD 2WAQB 5EGTA 2RR9A 5D94A 2WXJA 5IGGA 1EWYC 3U4EG 3U8ZA 1QVFA 4MHEA 2WXOA 5G5GA 3V3XA 4X3KA 4XIGS 2SAKA 3T4AC 4MH0E 2IL8A 1QZHA 4BFRA 2B2UC 4WWNA 4ZLTF 1V86A 3FMCA 5CYUA 3HKZB 5EKKA 2L55A 1ASYA 4A3MG 1CZWA 2RKSA 2K6DB 2KLGA 2NPTB 2X8XX 3AE2B 1VQIA 4YT0B 2IGGA 1AW7A 3N6RA 1H9RA 2NN6H 2D11A 2X6GA 4KV2A 4R4QA 2R3ZA 4X3TA 3W1BA 1UEBA 4G57A 3GTMB 3U30A 1T0SC 3DHHC 3DBLI 1Q3LA 2NUCA 3HOXB 3TMEA 3H9DA 3I3CA 2HD5B 2Y0SE 2WAQE 3RZOH 2AYOB 3S15H 1LFDA 5M5XB 4MSQB 1JRPA 2HUGA 3Q6SA 4HPPA 1EIGA 3ZYYX 5JVH3 2KWUB 1WMHB 4K14A 4W9JA 4EKUA 1XTDA 3OW7A 4K3BA 5GXGB 2YEPB 4IUVA 1VDVA 1PGAA 1HZAA 4B9WA 2WDRB 4HRSA 3DM1A 4K2KA 3DWQA 2KX0A 5HGQA 5IKCM 2OTJA 3A9JB 1JICA 1SIFA 2PEAA 2DJFC 4V190 2L76A 2WXFA 4JI7L 4I6PA 1QNUA 1LGRA 1DM0B 4TSSA 2ZZPB 2MBOA 1MHXA 1EWIA 2KOXA 1UNSA 3V05A 1TVXA 3B2FA 2WDTB 2O5IC 1JWMD 2K50A 3NVVA 3MWYW 4P1CC 1VQMA 3J81j 1BBXC 1A15A 3AB5A 3N1XC 2V4IB 2PMZE 4IWPA 1K83B 5FLXc 3DHIC 1NUCA 3SR6A 1WR1A 1R9TH 2EELA 2B2WA 2MLBA 4C3JG 1IYJB 2D3AA 1SR3A 5CV6A 5C4JH 3RNFC 4KVGB 2I5MX 2I1JA 4UAIA 3ICEA 1RCVD 1NI2A 2ID0A 3H7PA 1VCBA 4XTCS 3VRAB 2YYZA 2KMCA 3A8IE 1FRDA 1SE3A 5GAHC 2RSOA 4IUPA 2E2IB 1K52A 1NTGA 2RQXA 3HOZH 3N30A 2KC2A 3I4NB 1WZ0A 5E4XA 5DM73 3OLMD 2E74C 3QCAA 1GNUA 2WB1G 5EDSA 1J5EQ 2CVRA 2FINB 4LFAL 4JPBW 1XEEA 1XQQA 2N9PC 3IT6B 2PTLA 4GLAC 5EJWA 1VRAB 1C4QA 1GM5A 4UP8A 3QR8A 3GV3A 2JA7B 1VQ9A 2J0MA 4FF1A 1FL0A 5IYBG 1H4RA 4MN3A 1FVIA 3Q3NC 4JX1C 4F7ZA 2JYEA 2WB1B 1WJ4A 1EFWA 5HHDG 4UY8C 3ZNZB 5DLQE 3HM3A 4LUOA 3IXSA 2F0QA 1VQJA 3I4NG 2BWES 3PRPB 2H89B 2A1AA 1STHA 4LAAA 1YNNC 2Z0EB 1Q81C 2VQFQ 4DUZL 2A5UA 1IBXA 1T0YA 1K8AC 4HKZE 1HA5A 2ZT9C 3FEWX 5FOBB 1WFQA 2FUHB 4GLVB 4C3JB 5C44G 4Y7NH 4DAMA 2MNAA 4DPGA 1JWBD 5I6YA 1YZ6A 3A4SC 3GTPH 2PW7A 3NRZA 3P63A 1HEZE 4GN5A 3BVMA 1WCMG 4PQXA 1SNDA 2H1EA 5IGBA 5H1SE 3GTQB 3RD2A 5IA7A 4FNFA 5LMNL 4CQNA 1YNXA 2MGSA 1LT6D 1P98A 2WU2B 4A76A 4KV6A 1WXMA 4WJOA 2BYEA 1DOLA 1F2ZA 2NVYH 1NNXA 2K4KA 2Z1CA 3WOEA 2ZCCA 1AN8A 4M01A 4PZ6A 4DQOC 1GHKA 4KKJA 1ET9A 4M02A 1WIAA 1XNRL 5IT9E 2WYQA 4L63B 3QOLA 2K3UA 1C79A 4RM9A 5FO7B 1V80A 3DHQA 4TKNA 1EY5A 4ZRPA 1KOTA 4A3OA 1RM6C 1DZ1A 2LMCA 4XYCA 2SEBD 1A62A 4J3OD 1BMLC 1X32A 1SDFA 2LGIA 1D7QA 4JI7Q 4IM3A 4DUYL 4ULLA 2RSNA 1VQLA 5CGKA 1E6EB 1CKNA 1HPCA 5ELOA 2K5WA 1E1OA 4C3IB 2R93G 1YN5A 5E4WC 2Q2UA 4HJ9A 2I1KA 4P1BC 2LRUA 4APVA 3S1QH 1MI2A 2LXKA 3T53B 3CMEA 4IM2A 1PH8A 2NWGA 2CH4A 4RMFA 3SEBA 1RTNA 3IVFA 5FLMG 3L54A 1UE5A 1PFBA 4JI8Q 3JVZX 2EJFC 1IBML 3M3YH 1KXLA 2SOBA 1C48A 4A3DH 3NUHB 3NE5B 2MWSB 5AZHA 2CKZB 2CHXA 4HROA 5BYSA 2CQAA 1LXDA 2DJGC 2N3SA 2KC1A 3HOZG 4FDBA 1WTXA 3HKZG 1IGCA 4CJ2C 4KHVA 5C3EB 1GJXA 4CDFC 2JP1A 1YI2A 1GJZA 3MFGA 2LXCA 4RMAA 3OPOA 2ZXOA 4GKJL 1JOQA 2D9UA 2CQOA 2OJRA 1V1QA 2MCNB 1I6VC 5TR5A 1TTNA 2VQFL 2GMIC 2I46A 3A7AB 4B3RQ 5E3FA 2Q2TA 4FP5D 4HIKA 4ALPA 4F1SA 3PIP3 3ONAB 2AMCB 3TL5A 4DR2Q 2F0PA 3VR8B 2RCNA 3S1RB 1CA5A 5BMHA 1LLRD 2OT2A 4RA8A 1E2ZA 3P7JA 1P8LA 1Z9FA 3CPFA 2L0CA 3LGJA 1B53A 3NBHA 3QX1A 2PMZB 4JI2Q 1D5ZC 3MEHA 3O65B 2VY3A 3VA7A 1DXMA 4ZCKA 4U673 1MSGA 3MAQA 2UXDL 1XT9B 1NSNS 1L7YA 5J3BA 2O6VA 3KQ4A 3TEXA 5C2TB 2O6VD 5IODA 5M3MH 1F9PA 1VQDA 1HR0W 2N9LA 2NS5A 2FCMA 5FR3A 1LTID 1K83H 3IAS1 4YCVA 1P7EA 4OEMB 4DR5Q 3KBGA 2K32A 3NS1A 2LXJA 3RNAC 2A6HC 1E7VA 1YJWA 1PRTC 2MP1A 1R4MI 4BAXA 3G7LA 2E75C 3C3LA 2O5JC 2XSCA 1YX6B 1YIWA 3AEFB 5C4XG 3UE0A 1HUMA 4TQUS 4LF7Q 1MIUA 4HAEA 4JI8L 1LTBD 4KY5A 1J6QA 2EXDA 1AWDA 1XLQA 2JZPA 3EECA 2UXCL 1IYFA 3G6JB 1PYSB 2IYDB 1ZEQX 4GN3B 4LFBQ 1SSNA 2INDC 2Y5PA 4KMUC 5EKIA 4GN4B 3IG3A 2WP8J 2QDFA 2D2QA 3KF8A 2WXQA 3Q8DA 1VMPA 3HOYH 3HRDD 1A0IA 3UF8A 3OG5A 4NY0A 4ITKA 2OCEA 1XJVA 3E9IA 4OVZA 5CX3A 4MGYE 2N0SB 1SROA 3HP3A 3PV0A 3W3AA 3SGIA 4A3EB 3WOFA 4JI6L 3D4DA 3MXNA 5C3XA 4A3BG 1PHJA 5IGEA 2M19A 2KQ4X 3CWIA 3D8GA 2NN6G 4NJ7A 2NVTB 4NP5A 4XYOA 4BBSB 1N32Q 2QGQA 3GE3C 4ZRZA 2CWAA 4IFDG 1JT8A 1HZ5A 4KI0A 1IUEA 2KT7A 4RKLA 2FUG1 2KOLA 2KX3A 2NVXH 3HEJA 1PTOH 2R7ZB 2VUMH 1MI0A 2MJ3A 1IXRA 2KEDA 1V81A 4NAWB 1RL2A 1OGWA 1Y8PB 2Z6BA 2UU7A 3LDZE 5BYQA 4C1NI 4GKKQ 4LUZA 1HFGA 3OJ3A 3VR3A 4NDXA 4NAMA 3CU7A 4FN2A 5HY6A 4DXFA 4KKSA 4C1NK 1WI5A 3FC4A 2ATWA 1WVLA 2JSOA 1VQPA 2MJEA 2WS3B 2NVYB 4KSKC 1CZGA 2M17A 2MJDA 3PUYA 1UGMA 2LGDA 3EC8A 1V8QA 2ZEQA 4ZHOA 5FO9B 1N5WA 2CJOA 5D2MB 4YHHL 4CJ1B 4GXBA 2K7VA 2Q8IB 4MT5A 1TYGB 2CJNA 1SXTA 4X6AH 3OJ4B 1B9MA 1QJOA 3J7ZC 1CHPD 4GOPA 1WGRA 3SK4A 2ZJRA 2Z0DB 3KWLA 4GIVA 4ZRQA 1FXAA 3ZUNA 1D1KA 1EY4A 2F52A 3NTIA 3KF8B 4PNYA 2HCCA 4FULA 3H0GH 5M3FG 1OQQA 4GNXB 1BNZA 2F0GA 1WM2A 2QC8A 3ZXRA 2K6QA 3CC4A 2WNMA 3M4YA 1S40A 1TWHH 2BB6A 3K0XA 5NUCA 4LF9L 1P16A 4DHJB 4BKSD 2ICIA 3LX0A 1JORA 4O42A 5JEAG 3IFWB 2EJGC 1YJNA 4REZA 3VYRA 2NZ1D 3ZRFA 1HQMC 2PW9A 2R61A 3KUDB 3RNCC 5L37A 4DV0L 2G45B 3C46A 1XD3B 1KF6B 4R3DA 3A5UA 2DBYA 2DYOA 2ALYB 2NZHA 5CV4A 2X38A 4FBJB 2GA4B 3GTMH 1H9MA 5CBEE 1L6UA 4B95A 1KNEA 1EQTA 1Y69U 1L1OB 3URYA 3WWVA 1C9OA 3TDQA 2GBMA 1AH9A 1B1ZA 1LT5D 3S9WA 4K7UA 2L52A 1OXXK 2LVQA 1CQFA 4RG1A 3ZJYC 2R7DA 2IT1A 1XO3A 1HNXQ 2BYTA 4GDKB 4KX6B 5IYBH 4K1RB 1EY7A 1I3QH 3CCRA 4YWKA 5IP9H 4DUYQ 1VQBA 3KDFB 2B2VC 4XDXA 1WYWB 1R4PB 2KDBA 1KIXA 2BOSA 4W9LA 1PGXA 1H9SB 4OO1H 1N32L 2IO0B 3E0EA 4KTAA 1N8RC 2K1FA 4FXKC 1UGJA 3HZXA 1W6JA 3RFZB 4DK1A 2O6VB 3TP7A 4B3MQ 4WAAA 3K7AB 2RDGA 1WGDA 4JL9A 4C4VA 2MJ8A 4K3CA 1EFID 1MPEA 3SU8X 3GO5A 3ZJTA 2XNAC 3VR5A 1WTWA 4QUFA 3ZTCA 2FIDA 4QJFA 2JRHA 1EM7A 2KO3A 2ASQA 3I72A 2N7EA 4HCSA 2EMSA 1L4ZB 2QCPX 3P75A 5BR8L 2EYHA 1I50B 3HOYB 1TS2A 1TWHB 4LDTB 3A4RA 1FO4A 3TREA 4JV5Q 5FJ8G 2JXMB 2VQEL 3SDZA 2L83A 3AMZA 1HNZQ 2MHVA 1WCMB 2CW0D 1VF5C 3QJYA 1DOMA 3D6CA 3DWAA 3M4PA 1SMXA 5E6NA 4FXCA 2MFIA 2V4DA 1X3QA 3PSEB 3VXWA 3DPDA 3K6OA 1VD2A 3CC2A 2JXTA 4QAYA 5IYDG 1X3GA 2WDVB 4PMBA 3MFYA 1PQSA 2JA8G 1HNXL 2NR2A 1OEYA 5ELBA 4LCDE 5G3LF 2BE5C 1C4AA 3SFDB 3L17A 4I65A 4RAUC 4LFCL 1WD0A 1BUVT 3MC0B 1K0RA 3HG9A 1PH9A 2ONQA 3KUZA 1PGBA 3TCAA 5IP7H 2XVSA 5TSSA 4L2YA 4JOIA 4K2LA 3NQTA 4DK0A 5I9OA 2AQ2B 4RGTA 1E8WA 2ZTEA 1QOHA 2MHJA 5IOIA 4PV1C 1RRBA 2UXDQ 1VS0A 1B4OA 1JWUD 4EQ5A 4DR5L 4OIKA 1ENCA 5ELDA 1F1HA 3OAWA 3U52E 4XWTA 2A69D 2QDLA 1LV9A 3KLSA 3F8TA 2NVTH 3MTNB 5L83A 2AEHA 3SHQA 3E9HA 5BO4B 4HMIA 2CW0C 3U9SA 5GAEC 2LJIA 3CIRB 2F4VL 3APCA 1VQAA 3IHPC 3L0WB 4A3GH 4A8XC 1PTOB 2XWJB 1I4PA 4DR2L 2FIFA 5E6PA 4X66Q 1L5PA 1EZ6A 1J7CA 2AUKA 1OQYA 3M4OH 5D3IB 5EE1A 4S3SA 4IJLA 4KDLB 2PZTA 1BCPB 4K7SA 3U50C 4AQYL 1KNAA 1D5XC 3A5ZB 3NELA 4FXGC 3Q3JA 1D4BA 1MVKA 1SYGA 3GTOH 1VJKA 2M1MA 1T0QC 5DPWA 2EY1A 2VUMG 4B3RL 3HOWG 2JE6I 2FHTA 4KN7C 1I35A 4NNJB 4ASWC 1KQSA 1CSQA 3BK1A 4TUUA 4L5TA 4EQNA 1LM8B 3UINB 4ODGA 4KHPQ 3ZJUA 5DAUA 4UHVA 3U4ZA 4GN1A 3X0WA 3DVNV 5EAYA 2N49A 1J8CA 4WWOA 2GBRA 5LXHA 3HOUG
chains in the Genus database with same CATH topology
2RA4A 3RZDB 1A6XA 1S5BD 3MTSA 1WTQA 1JALA 5JOBA 1PDQA 3L9AX 5IGFA 1EOTA 1T5XD 3W9CB 1JROA 4L23A 2J0TD 1ZXHA 3AEEB 4HCEA 1F9SA 1JWAD 3RD4A 3VR4A 4F88A 1T5EA 1KTKA 5IGCA 4A3MB 2A68D 4TRDA 3GB1A 2HTME 4XE0A 1JE4A 3GTGB 2Z4IA 5BMGA 1I4QA 3EVQA 5ELFA 5EBDA 1B2TA 4RNAA 5ISRA 3I57A 4M0WA 1EU3A 4RGOS 5I6WA 4BY7B 4YSZB 1SNPA 4F87A 1NR2A 1WRIA 1TKEA 2PMVA 4ZUIA 4ARIA 4A3DB 1J9OA 4K6LA 4QMGA 4F8MA 3MA2B 4H13C 5EBCA 1Y8OB 3KUPA 4ZOHC 3NQIA 2R6GA 3GTLB 4K5XA 2I2YA 1YNJC 1OXVA 1UWXA 3AU7A 2QEJC 1N60A 2G1EA 2W3RA 3A7LA 5D65A 1N5XA 1D1IA 4H0LC 1WD1A 3K59A 2QILA 5HG2A 2EVBA 1C76A 5IT9L 3H94A 3N9YC 5H92C 1HRJA 5JAVA 2B2VA 3GTPB 3AEDB 4A90A 2PLPA 1IYUA 3R93A 4YSYB 1SJHD 3ITPA 3NPPA 1V1PB 5EPKA 4C3IG 2OXPA 2R93B 1GOZA 5CV9A 5KYIA 3IFTA 2RVLA 3PUVA 3IAYA 2IX3A 4A3GB 1PFMA 4KGSA 1BUIC 2A68C 5EKLA 1VR9A 3AN1A 2L12A 3FAHA 3W1SA 2WP9B 2X69A 1AZPA 3DUZA 1ZE3D 4IDIA 1C78A 3TZDA 2TSSA 3H91A 2J42A 4K8IA 5J22A 3S1QB 5HI1A 3HOUB 2JU6X 1U9RA 3KBXA 2OHFA 3K5NA 3AECB 1MD2D 3OWFA 5T1IA 1ZYRD 2NTSA 5C44B 4RHRA 3U9OA 4DAVA 4EE2A 4IFDJ 4WJWA 5C3JB 3A54A 2FE8A 3TN2A 1EL0A 1YN4A 3JAML 1E2WA 4RF1A 1NEKB 1E0ZA 3DEOA 1L0YB 3UI3A 4G7ZC 4GLSC 1FGBD 2QDBA 4N6EB 2EZVA 1YMHE 4ABNA 1Q12A 2ACZB 2RDFA 1E0BA 4XDCA 4CKCA 3Q8EA 3GD7A 2PYKA 5BN3A 4XT1B 1BCPF 1YQ4B 3LWUA 3EGRA 1SNQA 1J7AA 3I9V1 3VYTA 1Q8IA 3M4OB 1EIHA 1ZDVA 2KVMA 3P20A 2B2YA 1EYCA 3RZOB 2G9DA 4DU9A 1CFMA 1YNTE 2WKDA 3NZ3A 1DJRD 1C9FA 2IDYA 4FXDA 1LT4D 4HMJA 5G3LD 2HDEA 4EQOA 3MXGA 2BBCA 3K5MA 5T1GA 1S5FD 2KMMA 3H09A 1ENAA 4RGNA 3HVDA 4DNTB 1C77A 1XLPA 1GUTA 3I70A 1EWHA 1F9QA 1FNVA 5BN4A 2E2HB 2K33A 2Z4HA 4CGYB 2WACA 2IJ0A 1VZ8A 2EE1A 3C2PA 2WLBA 3NSWA 4BWGB 2OEOA 3AE3B 1NCVA 5KYLA 1RD9D 3DEPA 5K5PA 4US9A 1FEHA 2C5CA 3AMUA 1H9JA 4ZKBB 3IFDA 4BA2I 3D6WA 4ZQ3A 4B08A 1Y1VB 5FO8B 4XT3B 2QKIC 3A8JE 3ZGZA 4CKEA 2PO4A 4X3SA 4FYDA 3ABVB 3OOCA 2NYZD 3E5SA 3QOJA 3J81E 4MACA 1CZPA 5G5HA 1SNOA 1MSHA 1L0VB 1F2MA 2PCFB 1B9RA 3OHXC 1ILPA 1GUOA 1CK1A 2FBWB 3ZQ4A 4ILWA 3HOVB 3EQLC 3SXHA 4AYBB 4AQ7A 1LTSD 3OIQA 1SAPA 3SVMA 1IGDA 4BA1I 1FFUA 2XRQD 3H6MA 1RFKA 1RF2D 2BT6A 2QSDA 4A3KB 1SBBB 1I3QB 5KRUA 1Y56A 1BCPC 1ZP0B 3SK6A 3S17B 2K05A 4QF4A 3J7AF 2K28A 3MHZA 4CJ0B 3U7ZA 2XN9C 3Q8CA 2K5DA 5C5LA 2B2WC 4R9WA 1STAA 1LT3D 1PUTA 2I07B 2NBFA 3X3MA 2DN8A 1ZXIA 1JWSD 2K5QA 2KN4A 2F0EA 1LTRD 2L11A 3J9CA 4QB4A 1WTRA 1KDCA 4AS1A 3MHBA 1RKNA 3PZ8A 2BA1A 3I90A 1QE6A 3D3RA 3MVVA 2RMMA 4DN4M 3NWSA 5M5YB 1GAQB 1GUWA 3NVWA 2Y0SB 2BS3B 3FILB 4M8AA 2K22A 2J4XA 1SIJA 2F0IA 3WDNA 1N61A 3AEGB 4IUNA 2K1BA 4GZYC 3R2IA 2EYMA 2VB3X 2D62A 2KEEA 1LTGD 1JC7A 1HZ6A 4OW0A 3GP7A 3B9JA 2L9HA 4XQQA 4A3BB 1DD2A 3SK8A 5JPNC 4DA2A 4OO1I 5EPJA 1HTPA 1JOOA 2V0GA 5J1ZA 1LTAD 4WURA 3DWGC 2W55A 1MBYA 2QMTA 4CKBA 2BW2A 3CRLC 1CHQD 1DGJA 4BS9A 2LFNA 3T13A 2AWNA 1STYA 2Q8RE 5JJZA 5A2QL 5AUKA 4F7XA 2YU9B 1Z6HA 5C0XI 3T56B 2XWBB 1O7LA 5CC4A 3AE6B 1AZQA 4ARCA 4PMCA 5C3WA 3D4WA 2PVGC 1TIID 1KDBA 3J7AV 5ELCA 2HQEA 1I6HB 3L4PA 1Q1BA 2FMCA 1ACCA 4G4KA 2F0KA 1G91A 1LTTD 3PO0A 1IL8A 2ENBA 1ZXTA 1H9SA 3Q8FA 5M3MB 3V96A 5EE9A 1SJED 1L6VA 2JEBI 1XX8A 1I4RA 3W5UB 1SEBD 3C1FA 1PZJD 2QJLA 3FKIB 1G8ZD 3BYTB 1F9RA 2EKIA 1Y8NB 3HVZA 4USAA 2EXZA 3NTHA 1WYGA 4MM3B 1HQRD 1K50A 1QWYA 1GUSA 4Q0FA 1EZ8A 2JQRB 2LHDA 4K5WA 1IW7C 4HR7B 2C9OA 5CMDA 3KWVA 2L5TA 1KDAA 3NVYA 1Z7TA 2KA7A 1A2UA 1OFFA 2O4XA 1VZ7A 1FRRA 4HKQA 3DMUA 5C4ZA 1QT9A 1JQ4A 1JW9D 2N9KA 2G9HD 4HEDA 1G6ZA 2R92B 2N7JA 4OHJA 1ESFA 4JPSA 2A74C 3M85A 1TWCB 2AWOA 1W6KA 3NVZA 3D4RA 3GTJB 2B76B 2A6ED 2A69C 3D31A 2WXHA 4TKOB 3FPPA 3QB3A 3TEWA 1SYBA 1QOAA 4Q5VA 4KN4C 3CKIB 1UWMA 2LS01 4BBRB 1BQQT 2KAJA 3RMHA 1FD7D 4PT5A 1KLGD 4G7OC 2BE5D 4M1UB 3Q24A 3LNNA 1ICWA 1PFDA 4KKTA 1GXDC 1RODA 4KJOA 4IFDH 1YNND 2Z8LA 4C7YA 3BS1A 2IPKD 1RWSA 4MH8A 1EY0A 5BYRA 3GTOB 5CBAE 2WXPA 3Q8AA 1FR3A 1CJEA 4RWSC 2INPE 2PIAA 2N55A 1Q1EA 4YWGG 1RHPA 2M2LA 5IOCA 2KDMA 2E2DC 3SFEB 4KGRA 2F0VA 1NENB 5ELEA 5CV5A 4YTMB 4RCNA 3S16B 5FLXL 4FF4A 5C5MA 2Q8TA 2IX0A 4A9AA 3LYYA 3IT4B 1EWCA 2BS2B 2FFKB 1M8AA 3BZDB 5E1FA 3AEBB 5EPLA 3DXJC 3SK5A 3LXFA 1M4VA 3HS0C 1K8MA 4ZAIA 5C4JB 1WTVA 1TQOA 4KKIA 2K04A 3PO2B 3GTKB 3VYSA 2GRIA 2BA0A 3PUWA 3JAME 2EYOA 3H8HA 4WRDA 3U2SC 2EYLA 4OZBA 2PZWA 1TS4A 1QB5D 1U4MA 5JEAJ 3Q0AA 2WDQB 3VQIA 4NW2A 3R3OA 4YIJA 2YEPF 5FK9C 4HJGE 2BDNA 4FF2A 5A35A 1PTOC 2DNEA 1DOKA 1ET6A 3A8KE 3NHHA 2WXRA 3LWEA 1L4DB 2KECA 2Y3AA 3ZJVA 1E10A 1TWFB 3BDCA 4L8JA 3VR2A 5EE0A 5I2YA 5J39A 3NWTA 4P6VF 1CQVA 2PKOA 1SF0A 3P4RB 3E6ZX 1QOFA 3OMCA 2SDFA 5M3FB 3Q8BA 3L3OC 1ESRA 1YN3A 1SMYC 2NB0A 1SMYD 4EQPA 3GQBA 2TMPA 1I4HA 2F0FA 4IUUA 4J1MA 2M9VA 1B44D 2B2TC 3W2DA 5DEHA 2F1MA 1UAPA 3BG3A 1YJJA 1R4QB 1HCZA 1ROEA 2M00A 4TQ0A 3QWNA 2BB5A 3OMGA 1G2SA 2F0SA 1TWGB 3F2UA 3BDLA 4LK1C 1D2BA 1F0ZA 3HRZC 3PZ7A 4WFN3 1BXTA 5D14A 3X3NA 1IBXB 4IZ8A 4I7ZC 5D7GA 1B9NA 1U4PA 1IHZA 4A3JB 1I4XA 1SNCA 3C1EA 3HUIA 3S1MB 2L1BA 1DOXA 3ND9A 2JWUA 5K36H 2V3PA 3AE4B 3MP9A 1TU2B 1OQRA 1JR0D 1II3A 4HEA1 1S4ZA 3AV8A 4LTUA 5C0XJ 2RDHA 1RDPD 1PRTD 2WXGA 2PW5A 1OXTA 3P4PB 1DCZA 1SE4A 1GUNA 1XYIA 2DY7A 5C0XH 2GB1A 3FRPB 4C56C 5KNDA 3ERQA 1SYCA 1TJEA 1JCKB 2VUMB 5C4XB 3PMFA 1C8CA 1ENFA 1NYRA 1OXUA 3M7NA 1WWTA 5HFYA 3OSOA 3VR9B 1RYJA 5I2XA 4OL7A 4ME5A 1XLNA 1Q10A 1DYQA 1FYCA 1PMRA 4HSPA 1TY2A 2JYTA 3KLSX 3Q22A 1BF4A 5I9PA 2LFIA 1NI3A 2QF7A 3K5OA 3Q69A 3TZUA 4L1BA 1XCQL 1RTOA 2WXIA 5KGUA 2K9XA 1FMAD 4JE3B 5BN5A 5M5WB 1EEFD 1Z47A 1SYDA 2RPVA 4XWWA 1JMLA 5HGTA 3I73A 2M0AA 2MEKA 3M7GA 3BVZA 5KEEA 2WIIB 2KJXA 3NXWA 2JA8B 3I4LA 1K51A 4C3HB 2J53A 1E2VA 2QIEB 3HOZB 2KUMA 1A3UA 1FNUA 1Q90A 1P7FA 1TT2A 2XIWA 1T6BX 1QKZA 4H7BA 1ZOYB 2LHEA 1AYFA 1XXGA 5H8YE 1XWEA 1HHVA 5HURA 4X3UA 3R2TA 1ILQA 2PZUA 3GV6A 4LJZC 2MPMA 2PNRC 1KABA 2B2UA 1FCCC 3RPFC 2JYOA 4R8NA 2DLBA 4TQ1A 1E9MA 2VXWA 5CR3A 4RKBA 1IYVA 1Y1WB 4IFDI 3PUZA 2WXMA 3S2HB 5A2QE 1S5DD 3S2DB 1AEXA 1PTOD 1QQRA 1QOGA 4YXDB 3EFXD 3R8BA 1X3PA 4RH6A 3PO3B 1ZUD2 2IGDA 1IKLA 1STEA 2X6LA 2LKVA 3M3YB 4XQNA 4DAYA 2ZXRA 3K58A 2AUJD 2NVQB 3UI2A 1ZDXA 4OGQC 3NP8A 4DNRB 1BCPD 4DFAA 5C6AA 3W5VB 4ZUJA 1V43A 1K8OA 4J8QA 2ZW1A 2KACA 3CQZB 1STNA 2F0LA 2AQ3B 2OF1A 2IWHA 2B39A 2N88A 4CBVA 3E56A 4HTHA 2RBMA 1K53A 3TSSA 1TKGA 1JQYD 1V97A 3VR6A 2EJMA 2J7ZA 4DXGA 2SNSA 1D6EC 1B50A 1B3AA 2IW3A 1EY9A 3EJIA 4KKUA 1LACA 1CT1D 3QIAA 2W82A 1CA6A 4JWSC 3N52A 1PZID 3DWMA 2WXKA 4NJCA 2F0WA 3EUB2 1VCIA 1KRHA 2K01A 2ICEC 3E9SA 3AB9A 4G7HC 2EY2A 3S15B 5LL6S 2Q5WD 3FDTA 1UEAB 1HTLD 1H9KA 1BR9A 2XRSD 5EQ0A 1F77A 2B8GA 2ZXPA 3PUXA 1BO0A 1PXUA 2EY6A 3L7ZC 1HXYD 5MPOA 1FNWA 3P4QB 1V1OA 2ON8A 1TS5A 4L6TB 2JEAI 2A5HA 3AE1B 3TBIB 3VYUA 2F0DA 4V0BA 1TY0A 1XCTL 4QIWB 1AFPA 3AE7B 3A56A 4LLGM 2F0UA 1YNJD 4KD4A 4FO2A 3TP8A 1N62A 1GHJA 5KNCA 4HN7A 2F0TA 4D2KA 1QG7A 1SSOA 4YSXB 2J52A 2IX1A 4YTPB 1TWAB 4KJNA 1EY8A 1SYEA 1OXSC 1CTMA 3FVQA 1NVID 3TEZA 1BOSA 4B9XA 5F2DA 3K57A 4N58A 2WU5B 2O2LD 1V1PA 1IW7D 1A2TA 4ZK9B 3V2TA 4QCLA 2AX5A 4UDUC 2LY7A 3Q23A 2WKCA 2F0OA 1EYDA 1TR5A 3AH7A 2LUMA 2EOTA 4N59A 4DF7A 1O7YA 1PRTF 2B8FA 1RJTA 2GI9A 4KY6A 4IURA 3FILA 2INNE 1TKWB 4Q2JA 4IALA 2A6HD 3O13A 2E76C 3EA6A 1ZYRC 5CV8A 2WXLA 4ID6A 4US8A 4NZLB 1HUNA 5JEAH 2DY8A 1WTPA 5FLXE 2NVXB 1KAAA 3QG1A 3TUOA 4QUCA 2D2CC 4EVOA 5IIFA 5T8IA 2F3VA 1XLOA 2LMCB 1C4PA 3VRBB 2M56B 1N63A 1DOIA 4MIUA 1ZPSA 2KHSA 2B2YC 1FM0D 2LEKA 3I4MB 4FVMA 1MGSA 1VZ6A 5LNK1 1BDOA 4WWMA 1STGA 2FJ2A 4B0EA 2BDOA 4NMZA 4A93B 4LK0M 2WV6D 3J80E 3TP6A 3OWEB 3SHLA 1A3TA 3AE5B 4GDLB 4NKLA 3NTKA 3BK2A 1YQ3B 3SE0A 2VZKD 4O1NA 4RFBA 2OEDA 2NN6I 4ZKCB 2DYMA 3MXPA 1JOKA 2BTEA 1SB3C 1KLUD 1SNMA 1UUPA 2AQ1B 1F2RC 2NTTA 1LO5D 2F3WA 3P1HA 4IOIE 3B2GA 2DWQA 4K8JA 3J7YW 3MJ5A 4A55A 1J7BA 1VF7A 2HDMA 3H3VC 3RUZA 5IGDA 3PIO3 4WQMA 4YTNB 1GB1A 1FFVA 4C2MB 1WSPA 3IL8A 2F0JA 1SYFA 3HOWB 5K36G 1PZKD 2D5GA 4C80A 1V8CA 2BS4B 3P42A 2F0HA 4N9TA 2VZKB 4IUQA 2DNCA 1GB4A 1FCLA 2EYFA 5LL6X 2FMMA 3DWPA 1SE2A 3WCQA 5LHY1 5DM63 5EE3A 4N9PA 2NMQA 2PQEA 4DAPA 5C4HA 1A70A 3CRKC 1TS3A 4IUTA 4A6QA 4H2AA 1F2YA 1L0XB 2HCIA 3P1MA 1MHHE 3HGBA 3IAM1 3IKJA 1EU4A 2IGHA 2I38A 5AUIA 4R8IA 4P2CB 3A55A 3P4SB 4B0MA 4ZHPA 4Z9CB 4OZAA 1U4RA 2F4IA 1KH0A 2K5PA 3QO2A 2JA6B 1PRTB 2H4OA 3NUCA 1QF6A 1JB3A 4KK7A 1G291 3T16A 4J6HA 3OIPA 3AEAB 1QILA 2D5DA 1F2LA 4P16A 2CHBD 2ZW0A 1WGKA 4KHZA 3VA5A 4E6IA 1I7HA 1G2TA 2MH7A 2F0NA 2E3TA 2V3NA 1STBA 4JWUC 1FD6A 1CM9A 3RLFA 2W3SA 4XQJA 2Y5CA 3ETRA 2E6XA 3NK9A 1IKMA 3K5LA 2BCOA 2KCCA 3K0YA 3C8YA 1ML0D 5BMIA 2EDGA 1PDXA 3FPUB 1LABA 1EYAA 5I4DA 1E7PB 1NAPA 4RGMA 4FF3A 4XDDA 2A73B 3GS2A 1EQVA 4U68A 3BIID 1WXQA 4LMQD 3NBIA 4OIJA 3EROA 4C3HG 3MXUA 1S5CD 3TP5A 4A3FB 5FKAC 2A6EC 4IN3A 2JSVX 3S14B 1PTOF 1QOBA 1D5MC 1PFNA 2KCNA 2B63B 2K0PA 4K6DA 1VLBA 1VMCA 4XXEA 1KFYB 3MZ5A 1O7ZA 5JVG3 3J81L 1R9TB 3AE8B 5COYA 2SNMA 1ZKOA 2PVOD 3E0JA 4WAFA 2B2TA 1NYQA 4WIPA 1QNKA 2EYJA 2MUYA 4HSVA 3I8ZA 1DOYA 1FXIA 1HFNA 1J8IA 1A3VA 3AM9A 3KK7A 4IQZA 1S5ED 4KY7A 2W54A 4Y7NB 4TMAB 1HA6A 1FIQA 4RHSA 2PPBC 4BY1B 1AP0A 3BWUD 2E2JB 1YJIA 4OZCA 1T3QA 3CHBD 4WORA 5KNBA 1EY6A 1GUGA 4OO1G 1R7SA 1TZOA 2F03A 5C0XG 2L4NA 4JK1C 3SR1A 1QLBB 1OO9B 5CORA 2JX5A 1O80A 4KD3A 2F0MA 3BVGA 5KIXA 1C4CA 4K5VA 4A3IB 4CHTB 3KLRA 2VB2X 1EEID 3TEYA 2KWDA 3BYYB 1NR4A 1F2RI 5CV7A 4EGVA 2L32A 4H44C 4DGZA 1XTCD 1O78A 4PMWA 4KGTA 2EYPA 5DNFA 2H88B 5AFWA 1PLFA 3AE9B 2EPBA 3ND8A 1WTOA 1DONA 4RF0A 1GPXA 4C7ZA 1I4GA 3J80L 1VDZA 2K03A 2L1AA 1PYWD 2K6AA 2WINB 4WH4A 1ONLA 2HDLA 5D3DA 2WQYB 4IKGA 1U4LA 1XF5L 3LB8C 5M9OA 2JA5B 1QCBD 3T3OA 3T51B 5E6JA 5JPMC 3T3NA 3S1NB 2KQ3A 3H0GB 1TKYA 3I91A 5JXVA 2EY5A 4JBWA 4XYQA 2VNUD 4RCOA 1CI3M 4ZYSA 2WXNA 2CU3A 3BDOA 1SFOB 2WAQB 5EGTA 2WXJA 5IGGA 1EWYC 3U4EG 4MHEA 2WXOA 5G5GA 3V3XA 4X3KA 4XIGS 2SAKA 3T4AC 2IL8A 2B2UC 4ZLTF 3FMCA 5CYUA 3HKZB 5EKKA 2L55A 1CZWA 2RKSA 3AE2B 4YT0B 2IGGA 1AW7A 3N6RA 1H9RA 2NN6H 2X6GA 2R3ZA 4X3TA 4G57A 3GTMB 1Q3LA 2NUCA 3HOXB 3TMEA 3I3CA 5M5XB 1JRPA 2HUGA 3Q6SA 1EIGA 3ZYYX 5JVH3 4K14A 5GXGB 3OW7A 2YEPB 4IUVA 1VDVA 1PGAA 4B9WA 2WDRB 4HRSA 3DM1A 4K2KA 3DWQA 1JICA 4V190 2WXFA 1QNUA 1DM0B 4TSSA 1MHXA 1UNSA 3V05A 1TVXA 3B2FA 2O5IC 1JWMD 3NVVA 3MWYW 1BBXC 1A15A 3AB5A 2V4IB 1K83B 1NUCA 3SR6A 2EELA 2B2WA 4C3JG 5CV6A 4UAIA 1RCVD 3VRAB 2ID0A 4XTCS 2YYZA 3A8IE 1FRDA 1SE3A 2RSOA 4IUPA 2E2IB 1K52A 2RQXA 3I4NB 5E4XA 5DM73 2E74C 2CVRA 2FINB 1XEEA 3IT6B 2PTLA 5EJWA 1VRAB 1C4QA 3GV3A 2JA7B 4FF1A 4MN3A 4JX1C 2JYEA 2WB1B 5HHDG 3IXSA 2F0QA 2H89B 1STHA 4LAAA 1YNNC 1IBXA 4HKZE 1HA5A 2ZT9C 3FEWX 5FOBB 4C3JB 1JWBD 5I6YA 2PW7A 3NRZA 3P63A 1HEZE 3BVMA 4PQXA 1SNDA 2H1EA 5IGBA 3GTQB 4FNFA 4CQNA 2MGSA 1LT6D 2WU2B 4KV6A 1DOLA 1F2ZA 2Z1CA 3WOEA 1AN8A 4DQOC 1GHKA 4KKJA 1ET9A 5IT9E 4L63B 3QOLA 2K3UA 1C79A 5FO7B 3DHQA 1EY5A 4ZRPA 1RM6C 1DZ1A 2LMCA 2SEBD 4J3OD 1BMLC 1X32A 1SDFA 2LGIA 4ULLA 2RSNA 5CGKA 1E6EB 1HPCA 2K5WA 4C3IB 1YN5A 5E4WC 1MI2A 3T53B 2NWGA 3SEBA 1RTNA 1PFBA 2EJFC 2SOBA 1C48A 3NUHB 3NE5B 4HROA 5BYSA 2CQAA 1WTXA 1IGCA 4CJ2C 4KHVA 5C3EB 1GJXA 2JP1A 3MFGA 3OPOA 2ZXOA 1JOQA 2D9UA 1I6VC 2I46A 3A7AB 5E3FA 4FP5D 3PIP3 3ONAB 3VR8B 2F0PA 3S1RB 1CA5A 5BMHA 1LLRD 2OT2A 4RA8A 1E2ZA 3P7JA 2L0CA 1B53A 3NBHA 2PMZB 1D5ZC 3MEHA 3VA7A 1DXMA 4U673 1MSGA 3MAQA 1NSNS 3KQ4A 3TEXA 5C2TB 5IODA 1F9PA 2N9LA 5FR3A 1LTID 3IAS1 1P7EA 3KBGA 2K32A 3NS1A 2A6HC 1PRTC 2MP1A 3G7LA 2E75C 3C3LA 2O5JC 2XSCA 3AEFB 1HUMA 4TQUS 4HAEA 1LTBD 4KY5A 1AWDA 1XLQA 2JZPA 3G6JB 1ZEQX 1SSNA 2Y5PA 4KMUC 5EKIA 2WP8J 3KF8A 2WXQA 1VMPA 3HRDD 4ITKA 4OVZA 2N0SB 3W3AA 3HP3A 3PV0A 4A3EB 3WOFA 3D4DA 3MXNA 5C3XA 5IGEA 2M19A 2KQ4X 3CWIA 3D8GA 2NN6G 2NVTB 4NP5A 4XYOA 4BBSB 4ZRZA 4IFDG 1HZ5A 4KI0A 1IUEA 4RKLA 2FUG1 2KOLA 3HEJA 1PTOH 2R7ZB 1MI0A 2MJ3A 2KEDA 4NAWB 1Y8PB 5BYQA 4C1NI 1HFGA 3VR3A 4NDXA 4NAMA 3CU7A 4DXFA 4KKSA 4C1NK 3FC4A 1WVLA 2JSOA 2MJEA 2WS3B 2NVYB 1CZGA 2MJDA 3PUYA 1V8QA 4ZHOA 5FO9B 1N5WA 2CJOA 4CJ1B 2K7VA 2Q8IB 4MT5A 1TYGB 2CJNA 1SXTA 1B9MA 1QJOA 1CHPD 3SK4A 3KWLA 4ZRQA 1FXAA 1D1KA 1EY4A 3NTIA 4PNYA 2HCCA 1OQQA 1BNZA 2F0GA 2WNMA 3M4YA 2BB6A 5NUCA 2ICIA 3LX0A 1JORA 4O42A 5JEAG 2EJGC 4REZA 3VYRA 2NZ1D 1HQMC 2PW9A 2R61A 3C46A 1KF6B 4R3DA 2DYOA 2DBYA 5CV4A 2X38A 2GA4B 5CBEE 1H9MA 1L6UA 1KNEA 1EQTA 1Y69U 3URYA 3TDQA 1B1ZA 1LT5D 3S9WA 2L52A 1OXXK 1CQFA 2IT1A 1XO3A 2BYTA 4GDKB 4KX6B 1EY7A 4XDXA 2B2VC 1R4PB 2BOSA 1PGXA 1H9SB 4OO1H 4KTAA 4FXKC 1UGJA 3HZXA 1W6JA 3RFZB 4DK1A 3TP7A 3K7AB 2RDGA 2MJ8A 1EFID 1MPEA 3GO5A 3ZJTA 2XNAC 3VR5A 1WTWA 4QUFA 1EM7A 3I72A 4HCSA 1L4ZB 2QCPX 3P75A 2EYHA 1I50B 3HOYB 1TS2A 1TWHB 1FO4A 2JXMB 3SDZA 2L83A 3AMZA 2MHVA 1WCMB 2CW0D 1VF5C 3QJYA 1DOMA 3D6CA 3DWAA 4FXCA 2V4DA 1X3QA 3K6OA 2JXTA 2WDVB 4PMBA 3MFYA