1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
1I4GA 2AQ1B 2RDHA 1STEA 1I4RA 1EFID 1D5XC 1BCPB 1D5MC 3R2IA 4RHRA 1S5FD 1XXGA 1TS4A 1JWMD 4ZYSA 1AN8A 1KTKA 1SJHD 4RGTA 5FK9C 1TS5A 2RDGA 1LTGD 2XRQD 1HTLD 1FNUA 1LLRD 1EWCA 4L6TB 4RGOS 5ELEA 4RGNA 1RCVD 1LTAD 4TSSA 3GP7A 3EA6A 1I4XA 1RF2D 1PRTD 1PRTC 2SEBD 2R61A 3DWPA 1CT1D 1AW7A 1F77A 4RHSA 1LT3D 1M4VA 1EEID 1PZKD 1KLUD 1TY2A 1UUPA 5TSSA 3R8BA 1D5ZC 1PTOF 1SE3A 3TSSA 1CHQD 1FNVA 1L0YB 5I4DA 1FGBD 1S5CD 5FKAC 1YN4A 1JR0D 3BVMA 2O2LD 2XN9C 1RD9D 1CQVA 1DYQA 1PTOH 1S5DD 1T5XD 1I4PA 3BYYB 3R2TA 1JWUD 5D3IB 1GOZA 1TS2A 1ESFA 4O1NA 5D3DA 1B44D 1JWSD 1ET6A 2IPKD 4NZLB 1LT4D 3O13A 1HXYD 1RDPD 1HA5A 1EU4A 4RGMA 1MD2D 2J4XA 1DJRD 1HQRD 1BCPD 1BCPC 2XNAC 2Z8LA 2NTSA 1PZJD 2ICIA 2NTTA 3CHBD 1KLGD 1LTRD 1TS3A 4UDUC 3DWAA 4C56C 3SEBA 1S5BD 1LTBD 4RFBA 1UNSA 2AQ2B 1LTID 2CHBD 1FD7D 1PTOB 1SBBB 1L0XB 1PRTB 1SE2A 1LTSD 1TY0A 2IJ0A 1D6EC 1I4QA 4OHJA 2TSSA 1PRTF 3MFGA 1BCPF 1YN5A 4DXGA 1EU3A 1PTOD 1PTOC 4Z9CB 1I4HA 1SE4A 3KLSX 5ELFA 1PZID 3EFXD 1V1PB 3DWQA 3BYTB 1G8ZD 2QEJC 4DXFA 3BVZA 3MC0B 1JQYD 3W2DA 1YN3A 1LTTD 1XTCD 1PYWD 3OWEB 2XRSD 1B1ZA 3BZDB 4K6LA 1BXTA 1S5ED 1JCKB 1ENFA 1LO5D 4L63B 4RCOA 1SEBD 2WV6D 2G9HD 1LT6D 4BWGB 1SJED 1FNWA 1ET9A 4RH6A 2QILA 1QILA 1V1OA 1CHPD 3URYA 3BVGA 2AQ3B 1SXTA 1LT5D 1V1PA 5ELCA 3V05A 5ELBA 1CK1A 5ELDA 1EEFD
chains in the Genus database with same CATH superfamily
3QQ8B 5LNK1 4II3B 2DY7A 2I1KA 1NENB 1QG7A 1EWYC 1GUNA 2LXJA 4H02A 2MH7A 4RHRA 1WGKA 4DUYL 3AEVA 3QB3A 3ERSX 1VQFA 3MXUA 3T1YL 3RZOH 2W82A 3OAWA 1B9MA 3ICEA 3PUYA 4HR7B 4RGOS 3V96A 4CDFC 4DR2Q 1MBYA 2N8NA 5KNDA 4XC2A 1KNEA 3OWFA 4EVOA 3PIO3 2N55A 2GRIA 4WQOB 2L11A 2DYMA 3KUDB 3AE5B 4OGQC 1JWAD 2RHQB 4A76A 4XX5A 4YSZB 1OEYA 3CP0A 4HVBA 1YJWA 4GN1A 3ULPA 3PHWB 3Q3OC 2HTME 2OQ0A 3AMZA 4OELB 5M5YH 1J5EL 2DX5B 3QCAA 1IGCA 3MAQA 1F9PA 2YTYA 3I90A 4A3EB 1XNQQ 2WXIA 5JHAA 1CQVA 4ULLA 4YWMA 3Q0AA 4ZRZA 2FAZA 4X66Q 2F0FA 4KZ0A 2LRWA 2DNFA 4DUZQ 2CWPA 5I9PA 2LVOA 4FO2A 4O1NA 4GKKL 4WRDA 3PTFC 2M0AA 4J6IA 2JRIB 4YIJA 1Y1WH 2KCTA 4R4TA 1SLJA 3NZSA 2C9WB 1BBXC 4K6DA 2Q2TA 5JAVA 1WGYA 1BCPD 1SSNA 1KC8C 2VRRB 2E76C 2G4DB 4BOZB 5EBDA 4K7WA 1FCLA 1Q10A 3MTSA 4ANWA 1EY4A 1VMPA 3ERQA 1G91A 2B2WC 3PRMB 3KDFB 1LXDA 2RPQA 4JI6Q 1SE9A 3P4SB 5CHVC 1HCZA 1JRPA 3OIQA 2N9PC 4L5RC 1A2UA 3EHVA 1PTOB 1SBBB 3M62B 2L15A 1WWTA 2IBIB 4PS3A 2EY5A 1LTSD 4BBSH 5BR8L 2CS4A 3E9HA 4LJPB 1Q8KA 3NSWA 2CHXA 3NZUA 1ZYRD 4BY7H 2R93B 2CJNA 4Z9CB 5IGGA 4X64L 1I4HA 5IYBH 3GZNB 4KJOA 1TYGB 2WXMA 3J80E 3A8IE 1L4ZB 4XZ4A 4X3TA 1AARA 2ONQA 2F4VL 5DPRA 5AEKB 3HKSA 1DOMA 3BYTB 1IGDA 3BVZA 3MC0B 1LTTD 4POFA 2NVUI 3DLLA 1IBMQ 2PW5A 2R93H 4BY7B 4I6LB 1F2LA 3LX0A 5LL6X 3BDLA 2P5ZX 2C7HA 3DCGA 2BS4B 3TMEA 2DY8A 5M5WH 3HHMA 4JI1Q 1GVPA 4KHVA 4A3IH 1SYBA 2BYVE 5LMNL 1UEBA 3R3OA 1ZUD2 3SVMA 4AP4C 3DXJC 2K75A 3UI3A 1V9JA 3F1ZA 2UXBQ 2ENBA 1SF0A 4RH6A 2BH2A 3AE8B 2VL6A 2ZXRA 3HOWB 4TKNA 2B2WA 2D5GA 3D0FA 4JI2L 3J7AV 2KT7A 3VUXA 2M8SA 3RNEC 1ESRA 4S3SA 1TZOA 3FRPB 1JJ2A 1SNCA 1Q1OA 4IUVA 4DR1Q 4DDGD 2K6AA 1K52A 5DPSA 3FILB 3CCJA 1I4RA 1EFID 1D5XC 3GV6A 1WM3A 2J0JA 3CCQA 1X3GA 2A68D 3NP8A 5H1SE 1A6XA 1GHKA 1LYLA 1SYFA 1WRDB 1Y69U 1BVSA 1JWMD 4URKA 2F3VA 2NBFA 4GB9A 3UQAA 1FL0A 2NMQA 2JK8A 2CCZA 3C2PA 2Z0EB 3KYCD 3VR9B 4JYAL 1AE3A 4HK2A 3ALBA 3GE3C 3PF4A 4TSSA 4B3ML 2DAFA 2O6VD 1H8CA 2BYEA 5CR3A 3HOUG 3L2PA 1GG3A 3UF8A 2KCCA 4I7AA 5IYBG 1CTMA 4W9HA 1PV4A 2RPVA 1T5EA 5IP4D 2E2IB 2NZOA 2BCOA 2K52A 1C4CA 1P3QU 2DWQA 4AS1A 3M7GA 4HPMB 3NWSA 4CKEA 3H7PB 2E74C 4LF6Q 2D62A 3PRPB 4ZKBB 2KDFB 1U4AA 4APVA 4DV4Q 4FJVB 1UWMA 5CYUA 1VQHA 2E8GA 2FHTA 5NUCA 4WAFA 5C44G 3H0GG 2XBBC 3QC8B 3I4MB 3X0WA 1YNND 2GVBA 4DV5L 3R2TA 4DV2L 1GOZA 3OHXC 3J7YW 4G7ZC 3BINA 2PMZE 4P7IA 4XWTA 4C3HB 1N33Q 2UYZB 5EE1A 1B9RA 2KK8A 3QJZA 4EZJA 5LL6S 1PYSB 1QVGA 2HQEA 1PQSA 2LI5A 1UH6A 2JXMB 4OXPA 4LK1C 2RR9A 3AE4B 4DUYQ 2HCCA 2JF5A 2FE8A 2L55A 3VTWA 2CVRA 3GTGH 4DAMA 1QVFA 2I5LX 1FMAD 2B2UC 4UDUC 5C0XH 1FEHA 1YQ4B 2LGIA 1SNMA 4MZ9A 2G4SA 1CSPA 3KLRA 1XJVA 2CHBD 4UP8A 2JA6H 2IX1A 2JWUA 5D2MB 4QQBX 1C9FA 2N9XA 4KD4A 3CCUA 2JXTA 1E8WA 1XTDA 2IDYA 4K2KA 3AFQA 4GOPB 3CCRA 1WJUA 1WX9A 4K0KL 5JHBA 2HD3A 1PXUA 1NMFA 4RMFA 3FVQA 2DZJA 5CORA 3PMFA 3CW2C 4YCWA 3SFEB 2WLBA 1QVCA 2D11A 4JK1C 2N1WA 5KHQA 1L0WA 5EPKA 2JA6G 4YCVA 4DR5L 2ZCCA 3MXPA 2MUYA 2D10A 4TQ0A 1GNUA 5J18A 4KDIC 3W5UB 3RZDH 3S16B 3UDFA 5K36H 2IO3B 2KTFA 2ZM6Q 5E4XA 1FCCC 2CJOA 3A54A 1X3EA 2WX1A 2XTIA 3RLFA 1S4ZA 1YBYA 1UF0A 2AL6A 2A8VA 3BVGA 4HIMA 2DZKA 2LRUA 3H0GB 1II3A 1WH3A 4DR5Q 3H1UA 2QC8A 3GQBA 5AZGA 3PO3H 3JYUA 1CK1A 1EO6A 3NVWA 5BO4B 5E6JA 3S1MB 1Z7TA 4JI0Q 5E1FA 2KC2A 3VA7A 2KXJA 3SDLC 2UUAL 3UE0A 1XPOA 2IY1B 5EE9A 1SRUA 3KK7A 2NVXB 3H0GH 3Q3JA 4AQYL 4E3CA 2A69C 3NTIA 3GTLB 4GLVB 3PGZA 1J8IA 1SJHD 2F3WA 3W5OA 3GS2A 2UUBL 1XNRQ 3HOYG 1EY8A 3IT4B 1EWIA 3L16A 4I6NB 1C4QA 1FNUA 3JW0X 1RTOA 1J9OA 1PFNA 4BA2I 3RULA 3V3XA 1HZ6A 3L7ZC 1VZ8A 1KAWA 1MSGA 2MO1A 5BN3A 1MVKA 2R2QA 4JL9A 1IYUA 2GN5A 4PZ8A 4RHSA 2I2YA 2OQKA 1DCZA 1LT3D 4DR4L 1MHHE 3L54A 1PZKD 3R93A 2KACA 2WAQB 1FR3A 4YWLA 4DQOC 2CH4W 4K2LA 2K5DA 1EIYB 2WDQB 3HRDD 2KUMA 1OXVA 4MGKE 3VHTC 3H09A 1JW9D 1HTOA 5FKAC 3A74A 1JR0D 3PRZA 2RGFA 2CKZB 2N0SB 2IY0B 4A3BB 3AE6B 1PFBA 4P72A 1Y14B 2KVZA 3BK2A 1IL2A 3K5OA 1YIWA 4C4VA 2KHSA 4HPLB 1P1AA 3ZW3A 3O13A 3A8KE 2Y5CA 1VQAA 1HFNA 5IOCA 4XDXA 3VQIA 1TWCH 1MI2A 4BBRG 2LVQA 1Q82C 2GBNA 5EPLA 5C3JB 5FOBB 4ICUA 5ELOA 4ZRKA 2OTLA 4IC7B 4U68A 1YIJA 3EQLC 1WE6A 4PZ6A 1Z5SB 1WTOA 4JX1C 4G4KA 5A2QL 4RFBA 1A8VA 2AQ2B 2L0TA 4HCEA 2AL3A 2C60A 2KDIA 1WY8A 2MBQA 4A3MB 3U4EG 3VR6A 2L9HA 2JXXA 5GXGB 2AX5A 4DN4M 1KDAA 1SNPA 1UWXA 4F88A 3PIOA 4JWSC 5FR6A 5FO8B 4A3MH 2K6DB 3RYTA 4DR6Q 4DBGA 2WXPA 4H2AA 2E2IH 4CKBA 3U52E 2AUJD 2IZVB 1WYGA 2N3SA 1MHWC 4OL7A 1JE4A 1V9PA 3NVVA 4REZA 2MHVA 2K14A 3NWTA 5EJWA 3W2DA 4UP9A 4US8A 2HHHQ 1P7FA 1IYJB 1XMQQ 5ISRA 5IE8A 1CA5A 4LNKA 4NY0A 2Z4HA 1ONLA 1X6OA 1TKEA 2QHOA 3A33B 1V8QA 2BE5C 2D2QA 4W9CA 1NR4A 4A3GG 4N6EB 4GN4B 3OIPA 4WJOA 1PH8A 1SIJA 1Q90A 2HDMA 5GROA 4KIKB 5C2TB 3SHQA 1K83H 4OIKA 1JMLA 4B6WA 3PO2G 4IPCA 1ET9A 4EQOA 4HJ8A 1N5XA 3J7ZC 2FUHB 1CHPD 2VW9A 3NHEB 3BDCA 2A73B 1Q7YC 3VR2A 3U7DA 3ZLZA 4FXKC 2B2VC 4KV6A 4B9XA 3OW2A 1C48A 2EXZA 1GXDC 4NAWA 1JORA 5E4WC 2CH4A 2QKIC 2WFWA 2M19A 2KTRB 4DV4L 1UD7A 1FXAA 2SDFA 2PPBC 3C3LA 4HKQA 3M4YA 2C7NB 4RGTA 5C3XA 2KLCA 3DBHI 4LJZC 3AULA 3OJ3A 5ELEA 4BBNF 1R4NI 1OTCA 1HHVA 2FIFA 1BQQT 3Q24A 4TVAB 2KJ6A 3ZDMC 3WOEA 4ZRQA 1OXUA 4GS3A 2GBJA 4NPNA 3U8ZA 2NVYB 3KBXA 1AW7A 3KJOA 2KTRA 2BKRB 4JC0A 4KKTA 2KA7A 1R4MI 1UAPA 1TY2A 4LFAL 3OG5A 4AWJA 4DV1Q 2F0GA 1PTOF 3NENA 3E9SA 3R7RA 5DAUA 1VJKA 3GTJH 1S5CD 4ME3A 2B2VA 3S15B 1G2TA 1UBIA 4YWKA 1E8XA 3K80C 4R4OA 1WTRA 5C0XG 1TKGA 1V6EA 4YCUA 4BS9A 1RKNA 5FLXL 4GOPA 5M5WB 5EE0A 1E0ZA 3Q3NC 1WMHB 5I2XA 2F0VA 2WKCA 1L4DB 1YHQA 1RFKA 1GJZA 1KDCA 2BS2B 5G5GA 4NZLB 3PGEA 1N32L 4DV6Q 1HA5A 4NNJB 2LVPA 4RMAA 4GLXA 1WXMA 1RIPA 4CO7A 1HZAA 1NBFC 5M9OA 2B3AA 5CV7A 5DCNA 1LM8B 3PV0A 5EDSA 3UGBB 3I91A 2M0XA 4M01A 3J81L 3S1RH 1C77A 1MJEA 2VB3X 4IURA 2JZPA 1WTPA 3ZTDA 1FPYA 1OQRA 3IRBA 2J53A 1J19A 3PZ7A 4YTNB 4M1UB 1G291 4DK0A 2EXDA 4DR7L 1NCVA 1XT9B 5EKLA 2WXFA 4C56C 5C44H 4JQWC 1LTID 4LF9Q 1FXIA 4P1CC 1S3OA 5HGQA 3I4MH 1E1TA 2WB1B 4X64Q 2BVCA 1ICFB 3I8ZA 2OOBB 3FEWX 1JE5A 2M1MA 5IGCA 3STBD 2BWES 2ASQA 2WXNA 1PTOD 2L12A 5JEAH 1IW7D 3CMEA 1HNWQ 4BBSG 4JI0L 1QOGA 2R7ZH 2SNSA 2H88B 2K8BA 2PEAA 2QEJC 3L17A 3V61A 2MJ8A 1JQYD 1VRAB 1E8YA 4ANVA 4MM3B 2F0SA 2RF4A 2JA5B 5KNCA 4EEWA 1TR5A 2B39A 4HIOA 4HDQA 4USAA 2RCFA 4WURA 3K5MA 1YD8U 2RSUA 2JA6B 1WI5A 4BWGB 1ML0D 4OEMB 2WXLA 4DFAA 3G4SA 3DWMA 4WH4A 3T1HL 4EZLA 4IFDG 4LF5L 3DWGC 1VLBA 4A3PA 4DDID 3D6CA 1G2SA 1CJEA 1FIQA 1XLOA 3QG1A 1G51A 3VR4A 4C00A 4KKJA 2N78A 1GPXA 3VUYA 2H5XA 2FXQA 1LUZA 5I9OA 4QIWE 4EQNA 3I2ZA 1OQYA 4NDXA 1U4RA 1K8MA 4BFRA 3N20C 3MEHA 1WTWA 1S5FD 3AEAB 3M3YH 3DBLB 1K0SA 1BT0A 2RDGA 3EGRA 2F0KA 3RNGC 4GOPC 4LNOA 2VXWA 1DOKA 2AMCB 4WJPA 5HG2A 4HDOA 3LDZE 5C5MA 5FR3A 4P2CB 4IW0A 2V3NA 1A2TA 4KIKA 2D2CC 2YTVA 4CDCC 4MH8A 1EYAA 1FYCA 2HHHL 4DAYA 4LFCQ 2L32A 2V4LA 3S24A 1IL8A 2Q8TA 4HCNB 4AIMA 4BY7G 4IFDI 3WIMA 3CMAA 2EPBA 4NW2A 5EQ0A 1GB1A 1N33L 2GBRA 3X3MA 5M3MH 4G3XB 3KYHC 3N52A 2VUMB 2NBWB 3FKIH 3QWZB 1YN4A 1IYFA 3S2HH 1ZKHA 2OT2A 1PH1A 4P71A 3OTOL 1V1QA 5AUIA 2E6XA 1YJJA 2I46A 1Y1WB 4XT3B 3AE3B 1VQKA 3SE0A 1M8AA 4XQJA 1ZXTA 4IO9A 5JH5C 2X6LA 1ET6A 2CQAA 2KHIA 3JAML 4IJHA 3RLOA 2KFJA 4OZAA 4K1RB 4MACA 4LNQA 3L0WB 4DWFA 3VYRA 3AEGB 1R9TB 2EOTA 1HQRD 1Y1WG 1ZDVA 2YTXA 4CKCA 1PGBA 4XYOA 5AUKA 1WIAA 3FKIB 1UE6A 2NTSA 4NJ6A 2LS01 2CKHB 5GAGC 3C19A 4JBKA 2N1VA 4FDBA 3H3VC 4PNYA 2BWFA 4IPGA 1LTRD 4HROA 1L5PA 1WD1A 3SEBA 2MRPA 2V3PA 2VS1A 4DR1L 3KOJA 4ZK9B 4P73A 3BG3A 2R7DA 1FVIA 3TRZA 1D3ZA 1V80A 3PF5A 1FD7D 2N7EA 3GTMB 3K81C 3MA2B 3AECB 2V0GA 2GI9A 2EYMA 3MFGA 4XQQA 1TWGH 2O2VB 1ZYRC 1K8AC 2MO0A 3M63B 2WHIA 2DNCA 4MGIE 3I70A 1SE4A 2WU2B 3B08A 1VQ4A 5C4XG 5BYQA 2IWHA 5C23A 5HFYA 3O65B 1E10A 1V1PB 3IG3A 5J17A 2DN8A 3T51B 2BOSA 2D0PA 2PZWA 1C8CA 2KDMA 3P75A 1PYWD 1TIFA 1KM7A 2Y5BB 1I94L 5IP7G 4K5XA 5E6OA 1TWAH 5AFWA 3TZUA 2MGSA 2F0WA 1JB3A 1LT6D 3M9BA 4KJNA 2VZKB 4BA1I 4G0NB 1MKHA 3V60A 1PH4A 4BXXG 4AQYQ 3CRLC 4BY1H 3TEYA 4FULA 1NI2A 3CRKC 1KLVA 1AWDA 1V1PA 2F0NA 3UIOB 2TMPA 5ELBA 4DKAC 1Z6HA 4OWTB 1OTRB 1QJOA 2F4VQ 3NG0A 3DMUA 1AH9A 1YQ3B 3ZRCA 4LAAA 2A68C 4B0MA 4RG1A 1NEKB 1UELA 2LHDA 1SYDA 3ZJYC 2E5LQ 1WI0A 2BPSA 3S1QH 3SD5A 1EY9A 1XXGA 4IFDJ 2D0OA 3NE5B 1HA6A 1N62A 4C3IH 1TS5A 1JOKA 3K7AH 4I65A 5IYDH 4JBJA 2K01A 2ZM6L 4FJZA 3T8MA 4JBMA 1HTLD 1L7YA 1EWCA 4L6TB 3M95A 3EN2A 5IP9H 3E0JA 2DZMA 3UDXA 4A3EH 3S1QB 2KO3A 3PQIA 2DJFC 3JVZX 2NVTH 3WANA 2K8HA 4GKKQ 3MHSD 2K22A 3I7FA 3U30A 3RT3B 4C3HG 1V43A 1XMOL 3TREA 2BKFA 5LHY1 1CT1D 2EY6A 4KN7C 2VQFL 4XIGS 4YHHQ 1M4VA 4JOIA 1PH5A 2R2OA 1UUPA 2JX5A 3KDFA 4TQUS 1UWVA 3HOYH 3FPUB 1SE3A 2IO2B 2W3RA 1VQ5A 5I4DA 2UXCL 2NB0A 3HP3A 3NS1A 1J0GA 2SOBA 2N88A 4KD3A 4DF7A 1WCMG 3FMCA 3TQYA 2O2LD 3HKZE 4X6AH 1PTOH 2BH8A 5IYCH 3IKJA 4WJ3M 2MBHA 5JPMC 4V0BA 1YNNC 1AFPA 1VCBA 3V62A 4IUNA 4MSQB 4FNFA 1HRJA 1Q5WB 1BF4A 3NPPA 5GAEC 4JI4L 2WYQA 3IHPC 2PW7A 1K83B 2QGQA 1WXQA 3IAS1 4DU9A 3DVGX 2EJMA 1R7SA 1YX6B 2VH1A 2KKCA 5AZHA 3RNBC 1WXAA 1WX8A 4IWQA 1M1KC 3E56A 1GJXA 1E9MA 1P7EA 4RF1A 3RLNA 4JPBW 1IZ6A 2EJGC 4HLEA 4ZCKA 4RCNA 1VQ6A 2PE6B 1DXMA 3RNAC 2LWPA 4DR2L 3A4SC 1DGSA 5C3EH 4K8JA 1C78A 1UNSA 2IX0A 4DV5Q 2FCQA 5C5LA 3GTPB 3HRZC 3EROA 3T56B 4LFBQ 1NYQA 3SK4A 4DHJB 3P4PB 3HZXA 1RL2A 1PHJA 2BF8B 2JA9A 4WJ4A 2K5VA 2L1AA 1VQPA 1JJCB 3AYHB 4L1BA 3T13A 2FUG1 4OO1I 3GTPH 2EMSA 4LCDE 4A55A 2KCMA 4WORA 1SNDA 4IJLA 4IPHA 3E6ZX 3RZDB 4BVUC 2A6EC 2B76B 2XRSD 2VUMH 4LUZA 1ZPSA 3EJIA 3GO5A 3ML8A 3PPAA 5DEHA 3KYDD 2WB1G 1EQVA 1XPRA 1STHA 2KHWB 2X69A 1DGJA 3DHQA 2WXOA 2NR2A 3JAMc 1YI2A 3ZTCA 3RN2A 1V1OA 1V5OA 1V97A 3ZIMA 2PNRC 4DK3C 5AZFA 5JVH3 2FMMA 4UP7A 2UXDL 5ELCA 2LGSA 1CKMA 1VQBA 5IY0A 1Q12A 2KYWA 4WJNA 2EYFA 4B0EA 3ULJA 3CC2A 3JSVA 1K53A 1QKZA 1XO3A 2E2DC 3N6RA 1VQ8A 3VDYA 4L23A 3HFZB 2K5HA 2B8FA 4HCSA 1NTGA 1S72A 2DENB 4BBNC 3T3NA 4QJFA 4S0RA 1N9WA 3NVYA 5C4XB 2A69D 4IWPA 4KKIA 4G11A 5L95C 2EVBA 1EL0A 3M4QA 3AFPA 1CQFA 4X65Q 1XLPA 1M94A 5CV9A 1VF7A 4DK6C 5KRUA 4DR4Q 1D7QA 4PS8A 3K7UC 1Y8RC 5LMNQ 2GB1A 4CJ2C 3QHTA 1LLRD 4FF2A 4RGNA 4IM2A 2KZRA 3EC8A 2PCFB 2MQJA 3GP7A 2OF1A 4IG7B 2LFIA 2WU5B 1IBML 2NN6I 5CHWA 2JJQA 3CAMA 3ZVVA 5KIXA 3HVZA 1STNA 5LXHA 1XNRL 2W9NA 4OO1G 2R6GA 1A62A 5JJZA 1F9JA 2EKIA 3AM9A 4KSKC 1ZEQX 2MPMA 3RCZA 2INNE 3ZUNA 2B2TA 1FNVA 1L0YB 5LXIB 4F87A 2A1AA 2CWAA 2JEBI 3NRZA 1E7ZA 1X54A 1SYEA 2JSOA 1F52A 1E7UA 2IT1A 1TS2A 2QDFA 4DHZB 4LF4Q 1HTPA 2JA8H 3PUZA 4ODGA 1L2FA 2EIFA 3IL8A 3EIVA 3BU2A 4L5TA 3WA0A 4DV1L 1EUVB 3VRBB 1L1OB 3QK0A 3N1ZC 1AP0A 3M4PA 5JPNC 2MBBB 2B63H 4DHZE 2LJIA 2XNAC 1H95A 2K33A 3MZ5A 1YJ9A 2KAJA 1V81A 4ABNA 3Q8DA 3SHLA 2AUKA 3P4RB 3CHBD 2ZW1A 2X38A 1J7BA 4OVVA 3ZYYX 1ZDXA 3PIPA 1F2RC 1EOVA 2R93G 2YVCA 1I6VC 3ETRA 4U673 2NUCA 3GTKB 4FP5D 2R92H 1C79A 3OTOQ 2QSDA 4CJ1B 1WXSA 1U4MA 4AJWA 1OXTA 1XNQL 3HOUB 1A3VA 1A15A 1L0XB 1TQOA 1MI0A 2KWVB 3HIZA 4WQMA 2IJ0A 1E0BA 1I4QA 1TKWB 4HAEA 4YY3Q 4OHJA 4FBJB 2AWTA 2CW0C 3HOZH 2O4XA 3RN5A 1VR9A 3I4NH 2I5HA 3DEOA 2C5LC 2L05A 5HKHA 4RKBA 1PH6A 1TWHH 2YU9H 1HFGA 3EFXD 2A6HD 3D32A 1QZGA 1JOQA 5HHDG 1G8ZD 3BWUD 3GTLH 2WIIB 4ILWA 3U9SA 1JMCA 1EIFA 5M3FG 1AYFA 1WFYA 3Q8BA 1CA6A 2KECA 1PUTA 2BGFA 3BZDB 1KDBA 2WDRB 1GUGA 4R9WA 1JC7A 5C3WA 2JSVX 4DR3Q 2MBEA 3DUZA 4RCOA 2WV6D 4R8IA 1IYVA 1PGAA 4K7UA 5J3BA 1I6HH 1SYGA 4CBVA 1SJED 1SMXA 4LW1A 1NR2A 4JOIC 5DLQE 5E3FA 4DV6L 4X65L 1W2BA 2DBYA 2EYHA 2ZTEA 5CMDA 1QILA 2HTHA 3RMKC 1BNZA 4RM8A 2OTJA 3F2CA 4A3FB 3C1FA 1JJGA 4KMUC 1YJNA 5HURA 2F52A 1I3QH 3K59A 1MSHA 2F0MA 2UUCL 5GAHC 1WTVA 4KY6A 4AYBB 2MEKA 1GHJA 4BBSB 3E0EA 5TR5A 2JA7H 3QOLA 2I0QA 2F0DA 2Q2UA 4LF5Q 3SU8X 3ECIA 2BDOA 4DV3L 3HOVB 2WDTB 3Q14C 4XDCA 1FRDA 1P9DU 1T0QC 2IGHA 2E2HB 1F0ZA 3OOCA 2L4NA 2Z6BA 2Z6KA 3ZJUA 1TIID 3S9WA 4AUQC 2WP8J 4ASWC 3K0XA 3M7NA 3J80i 4KN4C 2NN6G 3Q8EA 2J7ZA 1EFWA 1Y1VH 4IUMB 3TBIB 3ABVB 3HOXG 3H94A 1RF2D 2LD9A 4TQ1A 3M85A 4A3JB 3DDCB 3LWEA 2LUEA 3MTNB 3P20A 4KGRA 3U7ZA 3F2UA 2E2JB 1HNWL 1RWSA 2QJLA 1WTQA 5H92C 3IAYA 2JYEA 3V6CB 5JVG3 2IL8A 4BY1B 1J6QA 3TSSA 4QMGA 1EQTA 5FJ8H 3J81j 1DOIA 1YMHE 2K5PA 3BY4B 4AOFA 4A3JG 2AWNA 5EAYA 1S5DD 1T5XD 2E2JH 3WALA 4MGZE 4HPPA 4OX9L 4JI5Q 4K5WA 1KIXA 4FYDA 1JWUD 1PLFA 1K50A 1S1QB 4ZOHC 1U4LA 2ES2A 1P0RA 3AEBB 2GBMA 4YXDB 2FIDA 2B63G 1F2RI 2UXBL 1O78A 2I38A 1G6ZA 4LK0M 1SAPA 4N9F4 4POGA 2X8XX 4N8X1 3P4QB 3U9OA 5E6PA 3AEFB 1IHZA 3H6MA 3NK9A 3LGJA 3K6OA 2OXPA 1WTXA 2Z8LA 3DBLI 3A0JA 5C44B 4C80A 3U4VA 3TP7A 3S17B 2Q8RE 2AKWB 1VZ7A 1XMQL 2FJ2A 2MJ3A 3MJ5A 1IBLQ 4LDTB 1A3TA 1SE8A 1ISNA 1SMYD 3PO2B 2FCNA 4W9EA 2D07B 1I42A 2RSOA 4CDDC 3M3JA 1R4QB 1QNUA 4X3SA 5D14A 4DXAB 3N9YC 2LKVA 4A3LH 1H9MA 2G45B 5IAAC 3KF6B 4X57B 4NKLA 1SE2A 1EYCA 3B6YA 3NEMA 5IKCM 1D6EC 1X32A 2D9UA 3S14B 1VQDA 4GLAC 2EKEC 3JSVB 3TEZA 4NAWB 1J7CA 4K3BA 4AJYB 2ZTDA 2LXCA 3T1HQ 1Y8OB 2K5WA 1IW7C 3KLSX 5JOBA 1LGRA 3A5ZB 1WZ0A 1XCQL 2V4IB 4MNOA 1WTHA 2WP9B 3BIID 3GZNI 4O0AA 3K7AB 2MJDA 1Q8IA 4DNTB 1QOAA 4W9FA 2XWBB 3OWEB 1J8CA 3WWVA 4EFOA 5LLIA 1BKBA 2LGYA 1S5ED 1JCKB 2NWGA 4B3TL 4KDLB 3HOYB 1FO4A 3IFTA 3TEWA 3VAWA 4GN5A 3DPDA 1ZKOA 4L63B 2KQ3A 3R3MA 3AQQA 2ZEQA 3AE1B 4R4IA 4M8MA 5M5XH 1Z9FA 1WJNA 2PVGC 1UE1A 1JRUA 4A93H 2O6VA 2D3GA 2BS3B 1EIHA 3TEHB 1O7IA 1XF5L 1X9NA 1HZ5A 3K58A 1UZXB 1BDOA 3L13A 2QCPX 1XLQA 1X56A 4KGTA 1SSOA 1MIUA 5CGKA 3GTJB 4DR7Q 1C4AA 1IBLL 1DD2A 3VH4B 4BAXA 2EMTA 2JZ3B 3SFDB 1TVXA 4K7SA 3LWUA 1WGHA 4RNAA 3I55A 2O5IC 1H9KA 1L0VB 1PDXA 2N49A 4HSPA 1WVLA 1NJIC 1F1HA 1FM0D 1Q1EA 1RAXA 4A3BG 2LUMA 1YHBA 1X3QA 1E3PA 4QIWB 1HNXQ 5HI1A 4HIKA 2FCMA 2H89B 4FA6A 4M8AA 1VQJA 3HG9A 2DAJA 3K57A 1WGGA 2PQEA 2XSCA 3HOWH 5F2DA 5J39A 1IKLA 2R61A 3FDTA 1EIGA 4NXNL 3I56A 1HZCA 1GUOA 3AN1A 2FBWB 4JLCA 3L0OA 5KYLA 1QOFA 1YJ1A 4US9A 4MH0E 2MFIA 5T1GA 2I1JA 2KANA 1QZHA 2UUAQ 3Q22A 4RGMA 5AJ3L 3LJ3A 3P1HA 3VA5A 1NYRA 1SDFA 2K32A 4FF1A 3APFA 3F2BA 1ICWA 1W6KA 4JI5L 4IQZA 1QQRA 3ITPA 4XYCA 3IBEA 2MWSB 2QIEB 5DNFA 1B44D 4GDKB 1DOLA 3BJUA 4TUUA 1LT4D 1ASYA 1K51A 3E5SA 2XEWA 3M4OB 2C9OA 5C1ZA 1ENCA 4A93G 2HJ8A 3Q6SA 3TP8A 3H3VH 1IBXA 4HEDA 4GKJL 2V1YA 4M02A 2F0PA 4Q0FA 4DV3Q 2DNEA 3T3OA 3DM1A 1C0AA 2KQ7A 3S2AA 1VDVA 4IZ8A 1XPUA 3OLMD 2JA7B 2QA4A 1H9SB 1IUEA 1K3BC 2LY7A 2WACA 3RUZA 3PT2B 4C3JG 3GTMH 1K0RA 3N30A 4ME5A 5IT9c 2UUCQ 4JV5L 3OJ4B 1VQIA 3K9PB 4NQKE 3LB8C 2LEKA 1K9MC 1UGMA 3X3NA 3AE2B 4A3KB 4C4VB 3OW7A 4YT0B 4GLSC 4IM0A 3I3TB 4K0KQ 4H0LC 4H13C 5EPJA 1PH7A 1QUQB 2MNAA 3ZNID 1QLBB 1KRSA 3I4OA 1JROA 2RSNA 3HM6X 4A3KH 2RDBC 3ONSA 2CR5A 1PZID 4TKOB 3DWQA 1FRRA 3QA8A 4A3LG 3H7SA 2Z6KC 2YEPF 4ICVA 1B7YB 3H91A 4LWCA 4HCPB 1S3SG 1VQMA 2F1MA 3TBLD 4FXCA 4DV0L 2G3QB 3BDOA 3P2BA 4IUPA 4XTCS 2HIXA 1EY7A 2J7QB 3FAHA 1LO5D 2Z1CA 2M2LA 1LM0A 1WSPA 3EUB2 3MXNB 2G9HD 2X6GA 1U0LA 3G48A 5IGBA 2K9XA 3PLVA 1MFWA 3W1GA 4ZLTF 5KYIA 1HZBA 2XGTA 1X65A 4O2DA 5L37A 2MJEA 1FNWA 1RJTA 1CZPA 5JEAJ 1Z2MA 5C4JB 1BMLC 2QCZA 4JI4Q 1R4NB 2Y3AA 5CX3A 2AQ3B 1KAAA 1SXTA 1WR6E 2PVOD 3TIXA 3W5VB 2EYPA 3A4RA 3CF6E 2IHEA 2J52A 3NUCA 2VNUD 2E75C 4J8QA 5IT9E 3J7A5 2R92B 2AQ1B 4DK1A 3H7PA 3ML9A 1STEA 2EE1A 1ZGUB 2GLSA 5M5YB 1YNXA 4GOCA 4IWOA 1DM0B 3D6WA 1WCMB 2XWJB 4XQNA 2L0CA 1WGDA 2Y0SG 1W3SA 2K05A 3QO2A 4YHHL 1E7VA 3A1QB 3LXFA 4R3DA 5EKIA 3S16H 2MBOA 1F9SA 2JRHA 3CQZB 4R4QA 3PZDA 5CBEE 1WFQA 2F0QA 3T16A 2REXA 3TMPB 2LGDA 4W9DA 2JU6X 4II2B 4YTMB 3CSFA 1I4XA 4FF4A 4JYAQ 2OHFA 1IXRA 2LZ6A 4XWWA 2HUGA 3MXGA 3PO3B 2VH2A 4IOIE 3ND8A 1QWYA 1ZP0B 1PH9A 4AYBG 1KLUD 4E6IA 3CD6A 3NBHA 2M4NA 2E5LL 2UWQA 3IT6B 4WIPA 2KQSA 3PHXB 5M3MB 2F0TA 5CBAE 2H1EA 4HMIA 1UGJA 3A1QA 1FGBD 4ZYNA 3T9LA 5BYRA 3WAMA 5EE3A 4MTNA 2VB2X 4NPSA 3BVMA 5M3FB 1WXVA 1DYQA 2V4DA 1I4PA 4A3CH 3B0AA 1Q46A 1TJEA 5CHFA 2WAQE 5CV5A 3KF8B 4GNXA 1WR1A 3A9JA 1FFVA 1STBA 1SNOA 3CC7A 5G55A 1B53A 3H6NA 3MFYA 4MGYE 2LGXA 1T6BX 4EOYA 1N60A 1O7YA 2EYOA 4H7BA 2ZJPA 2ZJRA 1E2WA 1X3FA 1FJGQ 2RMMA 4BKSD 4A3FG 4R1JA 1I50H 1STYA 1VQLA 2HJ1A 2PZUA 4JI8L 4I7ZC 3VFKA 4A3DH 1HH2P 4KX6B 4W9LA 3D4RA 2F4IA 1C4PA 3TN2A 2VZAA 2ZVOA 4HWIB 4XE0A 4P75A 4DV7Q 3S1NB 4J15A 4FXGC 3C46A 2NVYH 3KF8A 4L8JA 1LQBA 3UQBA 5CC4A 1D2BA 1TWCB 4J3OD 4ZUIA 3HOVG 2KOLA 4TV3A 4ID6A 1PRTB 1GUSA 2JPHA 1TY0A 2J42A 2ATWA 2TSSA 1GUWA 3JC66 1AEXA 1NUCA 3HOZG 1QZEA 3DM3A 2EDGA 2J0MA 1XEEA 1X55A 2OCEA 3VYSA 1RYJA 3CXCA 2M56B 3HOVH 1ZXHA 2C35B 2BT6A 1NDDA 4CHTB 1KOTA 4B3TQ 1K73C 4GSWA 2A6ED 2HDEA 1IBXB 2HE7A 1K8GA 3TP5A 1K28A 3I5JC 1FXTB 3NJTA 3I9V1 1ENFA 1MGSA 1X3PA 3V6EB 3ZJTA 2ZCBA 4ARCA 3G6EA 1DONA 1VS0A 5HY6A 4WWPA 3F2DA 4A3DG 3GD7A 5C4ZA 2L0FA 3HVDA 3D4WA 2A5UA 1EYDA 2D5DA 2JUOA 2EY2A 4C3IB 3MJWA 4XGAB 3DEPA 1XCTL 4P74A 3BK1A 4KHPQ 3E3XA 4FHJA 4PT5A 5IN7A 2NS5A 4WWNA 3U2SC 1K8OA 2UU7A 1L2NA 1YHAA 2JA5G 2Z4IA 5IGFA 1KQSA 2Z0DB 3FKYA 2WXGA 5CV4A 3HS0C 2BDNA 4NP5A 1OXXK 3NQTA 2UU9Q 3RZOB 2H4OA 4A3CG 2L5TA 3GTOB 4JI2Q 2N9EB 4EQPA 2KJXA 1BCPB 3PVLA 4MTKA 1FD6A 4GIVA 4JIOU 1C9OA 4HJKA 4MT5A 2D3AA 4F8MA 1KTKA 2PO4A 4IUUA 4LFBL 1C76A 2W3SA 5FLMH 1WF9A 4DGZA 4GDKA 2INDC 4OVZA 4KK7A 4K5VA 1O7ZA 2EZVA 3ONAB 2JE6I 1TT2A 3KUPA 2EQSA 1BUIC 4QAYA 1LTAD 2JQRB 2EY1A 2K6QA 4TMAB 4NB3A 2FCSA 3EA6A 4C7ZA 2HQLA 2IX3A 2BA1A 2NPTB 1EY0A 1PRTC 4DA2A 4OX9Q 3A9KB 4ANXA 5COYA 1FJGL 1ZXIA 2IW3A 3U58A 1MPEA 2RBMA 4EUTA 1ZE3D 3DQVA 2F3IA 1HR0Q 3C0RB 1CHQD 4KSLC 4DAVA 2R92G 3ZRFA 3G71A 4QB4A 2KMCA 4FLHA 1U4PA 2WDVB 1B70B 3SR1A 4LF8L 3QR8A 4HJAA 2KLGA 2CFMA 1HPCA 1QUQA 3GB1A 2N9LA 3K9OB 1I35A 2ZXPA 1ESFA 4XXEA 1PYBA 1G6PA 2KC1A 3I73A 4KHPL 3AE9B 4HRSA 1EY6A 3TEXA 4BKGA 1EYGA 1EF5A 4NJ7A 5D7GA 1D1IA 5ELNA 2KMAA 1EU4A 2AHOB 4KY5A 4TRDA 4RM9A 3ZXVA 2K50A 2J4XA 3N1XC 3FC4A 3I4LA 2LFNA 3ENEA 3VYUA 4K8IA 4UAIA 2ZJQA 4Q5VA 3MP9A 3RFZB 1PZJD 1HZ9A 1KABA 3EBEA 3D31A 3VR8B 2ZVNA 1OEYJ 1WRIA 2MA9B 3RNFC 4X62L 1GC7A 2KN4A 4HJ5A 4QCLA 3X23A 1QOBA 5DM63 2L8JA 4J6HA 1SNQA 4CHKA 3I4NB 3KW5B 2DUDA 1A0IA 4JW0A 1HR0W 4ZRPA 1B50A 2BB5A 1VQEA 4JGHB 1J5EQ 5JZEB 1PRTF 2CW0D 4ZUJA 4L2YA 4S17A 3NELA 1CZWA 1MJDA 1CI3M 4JWUC 5ELFA 2A6HC 1B3QA 1RM6C 1AZPA 3RR5A 2M9VA 4EKUA 2PI2A 4DNIA 4JI7Q 2KN5A 3S15H 3PLUA 2K5NA 3VTVA 1EWHA 5DPWA 4JPSA 1I94Q 3TUOA 3A7LA 5C3EG 2B29A 2M00A 1GO3E 1VCIA 2QF7A 4JI8Q 1VQ7A 2B2UA 3KLWA 3Q23A 3WCQA 3KVFB 2L1BA 4L5SA 2K25A 3GOEA 3VDZA 5CTRC 4A3FH 1TWFH 4JI3L 1ROEA 1YNJD 1WOCA 1AZQA 2GBKA 3OSOA 2BW2A 3NTHA 3L4PA 5BR8Q 3J9CA 4GGQA 4K81A 4UPAA 2MCNB 4MELA 4JI7L 2NBUA 4JE3B 1JB7A 2L83A 1I7HA 1EEFD 3NBHB 3Q3MC 1D8LA 1A63A 4X62Q 1N8RC 3RUIB 3PCOB 3J80c 3IXSA 1UE5A 3UIPB 4OVUA 2EYJA 2JP1A 1QCBD 4MEMA 4X3KA 4XT1B 4KKUA 2AWOA 3S2DH 2LJ5A 2KMMA 2XK5A 3AMUA 3GDEA 3RNUA 3AU5A 2WNMA 3CCMA 2NVQB 2KDBA 5C0XJ 1CZGA 3PZ8A 4RAUC 1ASZA 4ZKCB 4RF0A 3NXWA 4R4CA 5D65A 2ZNVC 3ER0A 3HOWG 3H9DA 1X1MA 4GMVA 2SEBD 2Q8IB 3CF5A 4IKGA 4Y7NH 1WJ4A 3IAM1 4I6PA 4X66L 4H44C 3I4NG 4CYEA 1HQMC 2KVMA 4ZQ3A 5IP9G 4OZBA 5BMGA 4LTUA 2Z0SA 3UINB 3GE8C 4KV2A 2DLBA 2A19A 1D5ZC 3JAME 4A8XC 4C3IG 1XWEA 1HUMA 4KGSA 4MJSA 1G6JA 3RNCC 4G7OC 3TP6A 4HTHA 4F7ZA 1H9SA 3DBHB 2KX0A 2KFKA 2O5JC 3ND9A 4B3SQ 4JCVE 1WJ6A 3CC4A 5BYSA 2J0TD 1XLNA 4MIUA 1HNZQ 5FO7B 1NSNS 2IPKD 1N5WA 1HXYD 1SYCA 4BBRH 3W1SA 4KLKA 1IPGA 2MW5A 1YOVB 1CSQA 2QW7A 5J1ZA 4DAPA 3HGBA 2PW9A 3UDGA 3HOXB 1V86A 2QMTA 1R4MB 5I6YA 1OGWA 1MG4A 2KEEA 2NPTA 3P42A 3FP9A 5MPOA 3ZGZA 2NTTA 4ZAIA 4BBRB 4DV0Q 1VQ9A 1NI3A 4HJ7A 2GMIC 3CIRB 3WAPA 3VR3A 1KLGD 1HNZL 2KFKB 4K3CA 4LNIA 3PS6A 1SMYC 2K1BA 5IP7H 1WE7A 1S5BD 2K8CA 4KTAA 4IALA 5IT9L 1PVOA 2Y0SB 2KJHB 4B3RQ 4OZCA 2KX3A 4LNFA 3ZNZB 2PZTA 4A3KG 2UXCQ 4BKTA 2F0IA 1KL9A 2NCNA 5G5HA 1F9RA 3CQZH 5DM73 1GM5A 1WGRA 1YN5A 3NVZA 2JYTA 4G57A 4KY7A 1O80A 2N7DA 4AYBE 1T0YA 3CCLA 1CKNA 1R9TH 5KNBA 5T1IA 5LMNW 4DXFA 2I5MX 2CU1A 3S2HB 4A3EG 1KXLA 2CHWA 1YITA 3DVGY 4CJ0B 1FGUA 4OONA 4C3JH 1KH0A 2PMZB 1N6ZA 3AEEB 4PS7A 3TS0A 3HK0A 4YL8A 1PFMA 1KNAA 2ICEC 3DVNU 3N1YC 2ID0A 1IP9A 3DBRI 2WKDA 4QY7A 3SK5A 3Q6BA 2PLPA 2AYOB 3A9KA 3U4ZA 1LT5D 2B2TC 3WDNA 1H9RA 2G5DA 2HD5B 4GU2A 1R4PB 2K3UA 1JQ4A 1E1OA 3ZNHB 2KENA 3KWLA 1CUKA 1I3QB 2DYOA 1TWAB 2FINB 4IDIA 4MHEA 1XX8A 4BXXH 4C3JB 1D1KA 5IWAL 1GKHA 3GV3A 4L5QA 2V3SA 1GC6A 2K04A 5K36G 4O42A 1ILPA 4A3DB 4QF4A 3S1RB 1N34Q 1SIFA 1LTGD 3SXHA 3AE7B 2NZHA 4FJYA 1P8LA 3KUZA 4LF9L 5IODA 3NHHA 2RD0A 2VUMG 3ULLA 2MSED 1EUJA 3VH3B 1LFDA 4DK5A 2NYZD 3HEJA 3KUCB 4WJQA 1HNXL 5JJLA 1Y1VG 3QJYA 4G50A 2DGYA 2KQ4X 3DWPA 3P7JA 2HCIA 4JVZA 4QUFA 4A20A 2ZW0A 3DVNV 5FLXE 3LYYA 1LV9A 1EEID 4A3BH 1N34L 2QDBA 2ZXOA 4NAMA 2NBVB 2LMCB 3P63A 5HGTA 2J0KA 4A9AA 4LFAQ 2JA7G 2NVTB 4KVGB 4B95A 2RCNA 4QL5A 3KF6A 2VQFQ 4FN2A 4YSYB 3VTUA 5I6WA 1KF6B 4GZYC 4PG3A 2L7RA 3M4OH 2O2VA 1WYWB 3CCSA 4JI6L 3AEDB 2Y5PA 1Z47A 3L3OC 2N4FA 3MHZA 4FF3A 1E8ZA 3J7AF 1BOSA 4ZRJA 3RZFA 3LNNA 2IGGA 4M8NA 1NE3A 4F8CB 1MD2D 2LSSA 2ZPYA 1BCPC 1V5TA 4IUQA 4IFDH 4LDTD 3IFWB 3BZKA 4DAYB 3NY5A 3D3RA 2RA4A 1E2VA 1UE7A 1L1OC 1Y8PB 1STGA 3GTGB 4LUVA 1DOXA 1TS3A 3VXWA 2KEDA 4C2MB 4FHKA 1LTBD 5M5XB 2ASBA 1LABA 2IGDA 4HKZE 3APCA 3A9JB 4LF8Q 4W9KA 5M3MG 3I3CA 4BOSC 2INCC 2A4ZA 2SAKA 2WQYB 3S14H 4N9TA 5JEAG 2G1EA 1WX7A 4XDDA 4UY8C 2KWDA 5IA7A 4B3RL 2Q2HA 2L76A 3UI2A 4OW0A 3GTKH 3R7QA 4DHJD 3QIJA 2DHZA 1VD2A 4N58A 2RQXA 2YYZA 3PUVA 1VQNA 2IY5B 1V49A 1TT5B 4BZAA 2JWZA 3W1YA 1N61A 1GB4A 1XTCD 2QDLA 2BYFA 4B9WA 1B1ZA 1YVCA 4KI0A 1O7LA 4B08A 3GTQB 3Q2AC 1E2ZA 1T9HA 3AB9A 1GD7A 1SEBD 4IOCA 5A35A 2OJWA 2B8GA 1HE8A 4PMWA 3EVQA 5BN4A 2JEAI 2KDEB 4CQNA 1VQCA 4F1SA 1RODA 4F7XA 5IIFA 3R66C 4B3SL 2Z59B 3V05A 1I6HB 1SROA 3K0YA 2JA8G 3HM3A 5ELDA 3MC9A 4ZRIA 2KBNA 4JV5Q 2NZ1D 3MWYW 3KWVA 5GQOA 1KFYB 4BY1G 2K39A 1PDQA 1E22A 2F0JA 4A4IA 2V1CC 4P16A 5C3EB 5KEEA 2KJRA 4PYZA 1VQGA 1D5MC 1EOTA 4LF6L 3BS1A 3MVVA 4EGVA 1D4BA 5FK9C 5FJ8G 3W1SC 4WAAA 4ACFA 2YU9B 3HUIA 2WXJA 1H4RA 4FXDA 4N8FA 4A75A 3QOJA 3NS8A 3VYTA 5G2NA 3J81E 3I57A 1CM9A 3KLSA 2R7ZG 3VR5A 4C1NK 4D2KA 4HN7A 2DYBA 4JG2A 1BBUA 2NN6H 3J81i 4GDLB 1Y56A 1TBEA 4RA8A 3Q8CA 2B2YC 2Q5WD 5FLMG 1F2ZA 1Q81C 1MG8A 1PA6A 4P6VF 1A3UA 3CU7A 2RVLA 3I72A 1GUAB 3DHGC 1RD9D 3MEFA 2K28A 3FPPA 1YEZA 2R7ZB 4NXNQ 3BYYB 2MQHA 5D3IB 4NXMQ 1VZ6A 2ALYB 3V2TA 4CDEC 2WXRA 4DV7L 2JA5H 5IGEA 2B3GA 2PIAA 4GDLA 4DPGA 2G9DA 2IHFA 1OQQA 1T3QA 2PKOA 2JQOA 2Q2IA 4X3UA 1N36Q 2K5QA 3IFDA 1EY5A 4QGUA 5EBCA 1WD0A 5JXVA 2WXKA 2LXAA 5KGUA 1JOOA 2RHSB 1P16A 1TWGB 3A8JE 3KBGA 3K5NA 2ACZB 4OIJA 1N32Q 2PYKA 3B2GA 5KHOA 4PK1A 1DOYA 2PPHA 2PJHA 3MXNA 3A7AB 4W9JA 2JA8B 2LMCA 3J81c 3CSTA 3DWAA 1F2MA 5JJKA 1B8AA 3CKIB 3NQIA 3UE1A 1A70A 2BBCA 4A3JH 2F0LA 1E5WA 2ZNVB 2BQQA 4ZHOA 4M00A 1WYDA 2N7JA 1QF6A 3APDA 4EQ5A 3N32A 1NBWA 4YY3L 4A3MG 1FFUA 3VVWB 1Q3LA 1QE6A 2ZJDA 3IVFA 1QOHA 1KRHA 1F2YA 1XQQA 4YTPB 1VQOA 2WGSA 5GMVA 3HOXH 3WOFA 3DHHC 1WM2A 4NJCA 3S2DB 4DNRB 2SNMA 4Y7NB 3ZNGC 1IBKL 4PQXA 2BB6A 4J1MA 2AEHA 4K6LA 1PGXA 4ZHPA 5J22A 3NUHB 3ZKJC 3RPFC 2OEDA 3QAQA 1J7AA 1U9RA 3H8HA 2ZTCA 3MC8A 1JWBD 2PMVA 1YQBA 4A3GB 2E3TA 4Q2JA 4CGYB 2KD0A 1Q1BA 1RLFA 1YJIA 3SDZA 4LF4L 1OO9B 3QARA 2MP2B 2INPE 3GTOH 3P1MA 4LF7Q 3RD4A 1Q86C 2CQOA 2L52A 3KQ4A 1TWHB 1M90C 1I4GA 2RDHA 5BMIA 5D6JB 2B2YA 3PIP3 3CMMB 1C7YA 3T4AC 2DZIA 2W54A 1KHIA 4C1NI 3PSEB 1YNTE 1PMRA 2WAQG 5D94A 2BTEA 2KWCA 2L00B 1BR9A 1WCMH 5BMHA 3R2IA 1TS4A 3PUXA 4MN3A 2K03A 4WJWA 4ZYSA 1WZ3A 2BA0A 3QWNA 1GUTA 1NNXA 2D3BA 4A3GH 4FVMA 2HIVA 1PH3A 2QEXA 4GNXB 2PTLA 1E7PB 3NBIA 3JAMi 2R3ZA 1OFFA 1U5KA 5M3FH 1SGHA 4IOAA 1B9NA 1RCVD 2MP2A 2WXHA 1L1OA 1C1YB 4LMQD 5BN5A 4OWWB 3FHWA 1SN8A 3SR6A 3OPOA 4DV2Q 1PRTD 3CCVA 1EQQA 3RD2A 2JZZA 3ZDTA 3F8TA 4ARIA 4PMBA 2WINB 1PFDA 4KZCA 1T0RC 1SFOH 1TGZB 2IO0B 1VMCA 3T53B 2MX2A 4GN3B 1DZ1A 4HJ9A 3DBSA 2WWZA 3R8BA 5EGTA 4HIDA 2V9HA 5IOIA 2KWUB 4YSXB 2C7MB 1H9JA 3I4MG 4N9PA 4PMCA 1UEAB 2GA4B 5C0XI 1N63A 2XN9C 1E90A 2EELA 3ZQ4A 4WWOA 2OEOA 2E2HH 1UBQA 3RN9C 2EYLA 3W3AA 5C4HA 3KFUA 2UXDQ 1IKMA 3S1NH 3TZDA 1PH2A 2F03A 2YEPB 1BO0A 1LTLA 4KKSA 5D3DA 3SGIA 3K5LA 4HMJA 3KH0A 2PQAA 1RDPD 1T0SC 2L3ZA 1XYIA 5K5PA 2XIWA 3AU7A 5JJIA 3PV1A 1TXYA 1DJRD 3G6JB 4A3IB 2F0EA 4GKJQ 3ZJVA 4ALPA 1E6EB 2N9KA 4LNNA 3TDQA 1MHXA 4MJSB 1XMOQ 1OXSC 3W9CB 1PFSA 1CKNB 1F9QA 4IUTA 2OWOA 1SB3C 1B3AA 1EF1A 3PO0A 3Q8AA 5G3LD 4B9KA 4W9IA 3MHBA 4NQLB 3CCEA 3KJPA 1V2YA 4R8NA 3E9IA 3EFCA 1YX5B 1JALA 1V8CA 2PQAB 1P98A 3ZO5B 5AJ3Q 1ZOYB 4ANUA 3DBRB 3C1EA 3UDIA 4GNXC 5E6NA 4OO1H 1WMHA 4DXGA 1EM7A 3CPFA 4WFN3 1L6UA 1ZW7A 4Y52H 4IM3A 2ON8A 2CU3A 3DOWA 4DR3L 2VQEL 1YN3A 4V190 4YWGG 3A5UA 2MP1A 3ZXRA 4QUCA 3AH7A 3S17H 3VUWA 1HJPA 2FFKB 1AE2A 2GVAA 1BXTA 2RDFA 2PI2E 4RWSC 5C6AA 1HUNA 2BE5D 3AV8A 3L10B 4HEA1 3CPWA 2I07B 2EJFC 4HJGE 2LXKA 1I5FA 3H15A 4HSVA 1TTNA 3K8AA 4DR6L 2UUBQ 1QNKA 4JI1L 3QX1A 3L9AX 3PREA 2F0OA 2JY6A 1YNJC 2QILA 4A90A 4LLGM 1XD3B 1BUVT 1Y8NB 4FADA 3D4DA 3TJPA 2Z9HA 1ACCA 3PO3G 1B4OA 4KHZA 3PUWA 2D3CA 4N59A 4A3OA 4ZDVA 2KNBA 1ILQA 5FO9B 2FNJB 3CWIA 4LJOB 4LF7L 2WXQA 5J2RA 4E74A 1ENAA 1CMXB 2RKSA 1K3RA 2HT1A 2K7VA 3PO2H 3Q69A 3HKZB 1BBWA 1KJTA 3A55A 1L6VA 3FKIG 4A93B 2M17A 3AB5A 1AN8A 2K0PA 4MM3A 2XRQD 1NMGA 1JT8A 3AI5A 3EECA 2ZT9C 3NOBA 5L83A 2W55A 2WB1E 4C2MH 2JVCA 4BKSA 4ITKA 4E71A 1NAPA 1K8RB 2BYTA 4IPDA 3OMGA 3PSIA 3GTQH 4IN3A 4P1BC 4C3HH 4MDKE 3D8GA 2JT4B 3NTKA 1QB5D 1IBKQ 3HOUH 1RFAA 1E24A 3DHIC 2A5HA 4PV1C 1S40A 4K14A 2OJRA 3U50C 1RRBA 2MHJA 3Q8FA 5IO9A 1F77A 1CKOA 2YV5A 5T8IA 5GADC 4RKLA 4G7HC 4PZ7A 3M3YB 5E7NA 2PNHA 3L08A 1MJCA 2K4KA 5TSSA 2KVRA 1LACA 3RZWC 4JBWA 3NZ3A 4WWMA 5C4JH 1NVID 1TZ1A 4NMZA 2MLBA 3RI7C 2PE9A 2B63B 3S1MH 5G3LF 4AQ7A 1W6JA 2HDLA 4DUZL 5H8YE 1C3TA 1QT9A 4EZKA 3TS2A 4EX5A 4AH6A 2DJGC 1JWSD 3HOZB 1GAQB 1HR0L 4OWXB 2ZZPB 3AU4A 1VF5C 2XVSA 4JI3Q 3QIAA 4A6QA 4XYQA 4HXDA 2LHEA 3Q3FA 1N36L 3B2FA 3I63C 4LFCL 1WJJA 4M0WB 2ICIA 3RMHA 4EE2A 4A3IG 1Q0WB 2KHJA 2JN4A 5IWAQ 3G7LA 1RHPA 5A2QE 1A5RA 2VQEQ 5DPTA 1EZ8A 5IYCG 1TWFB 2JYOA 2KOXA 4NXML 1I50B 2FMCA 1EZ6A 2O6VB 2CHZA 1NY4A 2K1FA 3TCAA 3OMCA 3T1YQ 3EFUA 3HKZG 5EKKA 1YZ6A 4C7YA 1STAA 3SK8A 1CFMA 5C4XH 2R7FA 2NVXH 4PYUA 5LMUL 2A74C 3STBC 1BCPF 2ZPNA 2F0HA 1EU3A 1PTOC 1VDZA 3FILA 1JICA 3WAOA 2UU9L 4M0WA 1SFOB 1HEZE 1KD1C 2YLMA 4MSMB 5CV8A 2IO1B 2XK5B 4W9GA 3SK6A 3N3KB 2WS3B 2IYDB 4B3MQ 3BZCA 3VRAB 1TU2B 4LUOA 5IYDG 5I2YA 3W1BA 4UHVA 1B2TA 3TL5A 2VY3A 3C8YA 2Y0SE 5IGDA 1KRTA 5FLXc 1RTNA 5LMUQ 2KCNA 5CV6A 1Y1VB 3AXCA 1HTQA 3URYA 2LASA 2WX0A 2VZKD 3B9JA 2GOWA 1EQRA 2NVQH 1SR3A 3A56A 3OYYA 1TKYA 3J80L 3B1LX 4GXBA 2F0UA 3H3VI 2C5CA
chains in the Genus database with same CATH topology
5LNK1 2DY7A 1NENB 1QG7A 1EWYC 1GUNA 2MH7A 4RHRA 1WGKA 3QB3A 3MXUA 2W82A 1B9MA 3PUYA 4HR7B 4RGOS 3V96A 1MBYA 5KNDA 1KNEA 3OWFA 4EVOA 3PIO3 2N55A 2GRIA 2L11A 2DYMA 3AE5B 4OGQC 1JWAD 4YSZB 2HTME 3AMZA 1IGCA 3MAQA 1F9PA 3I90A 4A3EB 2WXIA 1CQVA 4ULLA 3Q0AA 4ZRZA 2F0FA 5I9PA 4FO2A 4O1NA 4WRDA 2M0AA 4YIJA 1BBXC 4K6DA 5JAVA 1BCPD 1SSNA 2E76C 5EBDA 1FCLA 1Q10A 3MTSA 1EY4A 1VMPA 3ERQA 1G91A 2B2WC 3P4SB 1HCZA 1JRPA 3OIQA 1A2UA 1PTOB 1SBBB 1WWTA 2EY5A 1LTSD 3NSWA 1ZYRD 2R93B 2CJNA 4Z9CB 5IGGA 1I4HA 4KJOA 1TYGB 2WXMA 3J80E 3A8IE 1L4ZB 4X3TA 2ONQA 1DOMA 3BYTB 1IGDA 3BVZA 3MC0B 1LTTD 2PW5A 4BY7B 1F2LA 3LX0A 5LL6X 3BDLA 2BS4B 3TMEA 2DY8A 4KHVA 1SYBA 3R3OA 1ZUD2 3SVMA 3DXJC 3UI3A 2ENBA 1SF0A 4RH6A 3AE8B 2ZXRA 3HOWB 2B2WA 2D5GA 3J7AV 1ESRA 4S3SA 1TZOA 3FRPB 1SNCA 4IUVA 2K6AA 1K52A 3FILB 1I4RA 1EFID 1D5XC 3GV6A 3NP8A 2A68D 1A6XA 1GHKA 1SYFA 1Y69U 1JWMD 2F3VA 2NBFA 2NMQA 3C2PA 3VR9B 4TSSA 5CR3A 2KCCA 1CTMA 2RPVA 1T5EA 2E2IB 2BCOA 1C4CA 2DWQA 4AS1A 3M7GA 3NWSA 4CKEA 2E74C 2D62A 4ZKBB 1UWMA 5CYUA 2FHTA 5NUCA 4WAFA 3I4MB 1YNND 3R2TA 1GOZA 3OHXC 3J7YW 4G7ZC 4XWTA 4C3HB 5EE1A 1B9RA 5LL6S 2HQEA 2JXMB 4LK1C 3AE4B 2HCCA 2FE8A 2L55A 2CVRA 1YQ4B 1FMAD 2B2UC 4UDUC 5C0XH 1FEHA 2LGIA 1SNMA 3KLRA 2CHBD 1C9FA 2IX1A 2JWUA 4KD4A 2JXTA 2IDYA 4K2KA 1PXUA 3FVQA 5CORA 3PMFA 3SFEB 2WLBA 4JK1C 5EPKA 3MXPA 2MUYA 4TQ0A 3W5UB 3S16B 5K36H 5E4XA 1FCCC 2CJOA 3A54A 3RLFA 1S4ZA 3BVGA 3H0GB 1II3A 3GQBA 1CK1A 3NVWA 5E6JA 3S1MB 1Z7TA 5E1FA 3VA7A 5EE9A 3KK7A 2NVXB 2A69C 3NTIA 3GTLB 1J8IA 1SJHD 2F3WA 3GS2A 3IT4B 1EY8A 1C4QA 1FNUA 1RTOA 1J9OA 1PFNA 4BA2I 3V3XA 1HZ6A 3L7ZC 1VZ8A 1MSGA 5BN3A 1MVKA 1IYUA 4RHSA 2I2YA 1DCZA 1LT3D 1MHHE 4DQOC 1PZKD 3R93A 2KACA 2WAQB 1FR3A 4K2LA 2K5DA 2WDQB 3HRDD 2KUMA 1OXVA 3H09A 1JW9D 5FKAC 1JR0D 2N0SB 4A3BB 3AE6B 1PFBA 3BK2A 3K5OA 2KHSA 3O13A 3A8KE 2Y5CA 1HFNA 5IOCA 4XDXA 3VQIA 1MI2A 5C3JB 5EPLA 5FOBB 4U68A 3EQLC 1WTOA 4JX1C 4G4KA 5A2QL 4RFBA 2AQ2B 4HCEA 3U4EG 4A3MB 3VR6A 2L9HA 5GXGB 2AX5A 4DN4M 1KDAA 1SNPA 1UWXA 4F88A 4JWSC 5FO8B 2WXPA 4H2AA 3U52E 4CKBA 2AUJD 1WYGA 3NVVA 4OL7A 1JE4A 4REZA 2MHVA 3NWTA 5EJWA 3W2DA 4US8A 1P7FA 1CA5A 5ISRA 2Z4HA 1ONLA 1TKEA 1V8QA 2BE5C 1NR4A 4N6EB 3OIPA 1SIJA 1Q90A 2HDMA 5C2TB 4OIKA 1JMLA 1ET9A 4EQOA 1N5XA 1CHPD 3BDCA 2A73B 3VR2A 4FXKC 2B2VC 4KV6A 4B9XA 1C48A 2EXZA 1GXDC 1JORA 5E4WC 2QKIC 2M19A 2SDFA 2PPBC 3C3LA 4HKQA 3M4YA 4RGTA 5C3XA 4LJZC 5ELEA 1HHVA 1BQQT 3Q24A 3WOEA 4ZRQA 1OXUA 2NVYB 3KBXA 1AW7A 4KKTA 2KA7A 1UAPA 1TY2A 2F0GA 1PTOF 3E9SA 5DAUA 1VJKA 1S5CD 2B2VA 3S15B 1G2TA 1TKGA 1WTRA 5C0XG 4BS9A 5EE0A 1RKNA 5FLXL 5M5WB 1E0ZA 5I2XA 2F0VA 2WKCA 1L4DB 1RFKA 1KDCA 2BS2B 5G5GA 4NZLB 1HA5A 5M9OA 5CV7A 3PV0A 3I91A 3J81L 1C77A 2JZPA 2VB3X 4IURA 1WTPA 2J53A 1OQRA 3PZ7A 4M1UB 1G291 4DK0A 2WXFA 1NCVA 5EKLA 4C56C 1LTID 1FXIA 2WB1B 3I8ZA 3FEWX 5IGCA 2WXNA 1PTOD 2L12A 5JEAH 1IW7D 1QOGA 2SNSA 2H88B 2QEJC 2MJ8A 1JQYD 1VRAB 4MM3B 2F0SA 2JA5B 5KNCA 1TR5A 2B39A 4USAA 4WURA 3K5MA 2JA6B 4BWGB 2WXLA 1ML0D 4WH4A 4DFAA 3DWMA 4IFDG 3DWGC 1VLBA 3D6CA 1G2SA 1CJEA 1FIQA 1XLOA 3QG1A 3VR4A 4KKJA 1GPXA 5I9OA 4EQNA 4NDXA 1U4RA 1K8MA 3MEHA 1WTWA 1S5FD 3AEAB 2RDGA 3EGRA 2F0KA 2VXWA 1DOKA 5HG2A 5C5MA 5FR3A 4P2CB 2V3NA 1A2TA 2D2CC 4MH8A 1EYAA 1FYCA 4DAYA 2L32A 1IL8A 2Q8TA 4IFDI 2EPBA 4NW2A 5EQ0A 1GB1A 3X3MA 3N52A 2VUMB 1YN4A 2OT2A 5AUIA 2E6XA 1YJJA 2I46A 1Y1WB 4XT3B 3AE3B 3SE0A 1M8AA 4XQJA 1ZXTA 2X6LA 1ET6A 2CQAA 3JAML 4OZAA 4MACA 3VYRA 3AEGB 1R9TB 2EOTA 1HQRD 1ZDVA 4CKCA 1PGBA 4XYOA 5AUKA 3FKIB 2NTSA 2LS01 3H3VC 4PNYA 1LTRD 4HROA 1L5PA 1WD1A 3SEBA 2V3PA 4ZK9B 3BG3A 1FD7D 3GTMB 3MA2B 3AECB 2V0GA 2GI9A 2EYMA 3MFGA 4XQQA 1ZYRC 2DNCA 3I70A 1SE4A 2WU2B 5HFYA 5BYQA 2IWHA 1E10A 1V1PB 2DN8A 3T51B 2BOSA 2PZWA 1C8CA 2KDMA 3P75A 1PYWD 4K5XA 5AFWA 3TZUA 2MGSA 2F0WA 1JB3A 1LT6D 4KJNA 2VZKB 4BA1I 3TEYA 3CRLC 3CRKC 1AWDA 1V1PA 2F0NA 2TMPA 5ELBA 1Z6HA 1QJOA 3DMUA 1YQ3B 4LAAA 2A68C 4B0MA 1NEKB 2LHDA 1SYDA 1EY9A 1XXGA 4IFDJ 1HA6A 3NE5B 1N62A 1TS5A 1JOKA 4I65A 2K01A 1HTLD 1EWCA 4L6TB 3E0JA 3S1QB 2K22A 4C3HG 1V43A 5LHY1 1CT1D 2EY6A 4KN7C 4XIGS 1M4VA 1UUPA 2JX5A 4TQUS 3FPUB 1SE3A 5I4DA 2NB0A 3HP3A 3NS1A 2SOBA 2N88A 4KD3A 4DF7A 3FMCA 2O2LD 1PTOH 3IKJA 5JPMC 4V0BA 1YNNC 1AFPA 4IUNA 4FNFA 1HRJA 1BF4A 3NPPA 2PW7A 1K83B 1WXQA 3IAS1 4DU9A 2EJMA 1R7SA 3E56A 1GJXA 1E9MA 1P7EA 4RF1A 2EJGC 4RCNA 1DXMA 4K8JA 1C78A 1UNSA 2IX0A 5C5LA 3GTPB 3HRZC 3EROA 3T56B 1NYQA 3SK4A 3P4PB 3HZXA 2L1AA 4L1BA 3T13A 2FUG1 4OO1I 4A55A 4WORA 1SNDA 3E6ZX 3RZDB 2A6EC 2B76B 2XRSD 1ZPSA 3EJIA 3GO5A 5DEHA 1EQVA 1STHA 2X69A 1DGJA 3DHQA 2WXOA 1V1OA 1V97A 2PNRC 5JVH3 2FMMA 5ELCA 4B0EA 1Q12A 2EYFA 1K53A 1QKZA 1XO3A 2E2DC 3N6RA 4L23A 3T3NA 4HCSA 2B8FA 3NVYA 5C4XB 2A69D 4KKIA 2EVBA 1EL0A 1XLPA 1CQFA 5CV9A 1VF7A 5KRUA 2GB1A 4CJ2C 1LLRD 4FF2A 4RGNA 2PCFB 3GP7A 2OF1A 2LFIA 2WU5B 2NN6I 5KIXA 3HVZA 1STNA 4OO1G 2R6GA 5JJZA 2EKIA 3AM9A 1ZEQX 2MPMA 2INNE 2B2TA 1FNVA 1L0YB 4F87A 2JEBI 3NRZA 1SYEA 2JSOA 2IT1A 1TS2A 1HTPA 3PUZA 3IL8A 4ODGA 3VRBB 1AP0A 5JPNC 2LJIA 2XNAC 2K33A 3MZ5A 2KAJA 4ABNA 3SHLA 2AUKA 3P4RB 3CHBD 2ZW1A 2X38A 1J7BA 3ZYYX 1ZDXA 1F2RC 1I6VC 3ETRA 4U673 2NUCA 3GTKB 4FP5D 2QSDA 1C79A 4CJ1B 1U4MA 1OXTA 3HOUB 4WQMA 1A3VA 1A15A 1L0XB 1TQOA 1MI0A 2IJ0A 1E0BA 1I4QA 1TKWB 4HAEA 4OHJA 2CW0C 2O4XA 1VR9A 3DEOA 4RKBA 1HFGA 3EFXD 2A6HD 1JOQA 5HHDG 1G8ZD 3BWUD 2WIIB 4ILWA 3U9SA 1AYFA 3Q8BA 1CA6A 2KECA 1PUTA 2WDRB 1KDBA 3BZDB 1GUGA 4R9WA 1JC7A 5C3WA 2JSVX 3DUZA 4RCOA 2WV6D 4R8IA 1IYVA 1PGAA 1SYGA 4CBVA 1SJED 1NR2A 5E3FA 2DBYA 2EYHA 5CMDA 1QILA 1BNZA 4A3FB 3C1FA 4KMUC 5HURA 3K59A 1MSHA 2F0MA 1WTVA 4KY6A 4AYBB 2MEKA 1GHJA 4BBSB 3QOLA 2F0DA 2BDOA 3HOVB 4XDCA 1FRDA 2IGHA 2E2HB 1F0ZA 3OOCA 2L4NA 3ZJUA 1TIID 3S9WA 2WP8J 3M7NA 4KN4C 2NN6G 3Q8EA 2J7ZA 3TBIB 3ABVB 3H94A 1RF2D 4TQ1A 3M85A 4A3JB 3LWEA 3P20A 4KGRA 3U7ZA 3F2UA 2E2JB 1RWSA 2QJLA 1WTQA 5H92C 3IAYA 2JYEA 5JVG3 2IL8A 4BY1B 3TSSA 4QMGA 1EQTA 2K5PA 1DOIA 1YMHE 2AWNA 1S5DD 1T5XD 4K5WA 4FYDA 1JWUD 1PLFA 1K50A 4ZOHC 1U4LA 3AEBB 4YXDB 1F2RI 1O78A 2I38A 1G6ZA 4LK0M 1SAPA 3P4QB 3U9OA 3AEFB 1IHZA 3H6MA 3NK9A 3K6OA 2OXPA 1WTXA 2Z8LA 4C80A 5C44B 3TP7A 3S17B 2Q8RE 1VZ7A 3MJ5A 2FJ2A 2MJ3A 1A3TA 1SMYD 3PO2B 2RSOA 1R4QB 1QNUA 4X3SA 5D14A 3N9YC 2LKVA 1H9MA 4NKLA 1SE2A 1EYCA 1D6EC 1X32A 2D9UA 3S14B 3TEZA 4NAWB 1J7CA 1Y8OB 2K5WA 1IW7C 3KLSX 5JOBA 1XCQL 2V4IB 3BIID 2WP9B 2MJDA 3K7AB 1Q8IA 4DNTB 1QOAA 2XWBB 3OWEB 1S5ED 1JCKB 2NWGA 1FO4A 3HOYB 3TEWA 3IFTA 1ZKOA 4L63B 2KQ3A 3AE1B 2PVGC 2BS3B 1EIHA 1XF5L 1HZ5A 3K58A 1BDOA 2QCPX 1XLQA 4KGTA 1SSOA 5CGKA 3GTJB 1C4AA 1DD2A 3SFDB 1TVXA 3LWUA 4RNAA 2O5IC 1H9KA 1L0VB 1PDXA 1WVLA 4HSPA 1FM0D 1Q1EA 2LUMA 1X3QA 4QIWB 5HI1A 2H89B 4M8AA 3HG9A 3K57A 2PQEA 2XSCA 5F2DA 5J39A 1IKLA 2R61A 3FDTA 1EIGA 1GUOA 3AN1A 2FBWB 5KYLA 1QOFA 4US9A 5T1GA 3Q22A 4RGMA 3P1HA 3VA5A 1NYRA 1SDFA 2K32A 4FF1A 1ICWA 1W6KA 4IQZA 1QQRA 3ITPA 2QIEB 5DNFA 1B44D 4GDKB 1DOLA 1LT4D 1K51A 3E5SA 3M4OB 2C9OA 1ENCA 3Q6SA 3TP8A 1IBXA 4HEDA 2F0PA 4Q0FA 2DNEA 3T3OA 3DM1A 1VDVA 4IZ8A 2JA7B 1H9SB 1IUEA 2LY7A 2WACA 3RUZA 4C3JG 4ME5A 3LB8C 2LEKA 3X3NA 3AE2B 4A3KB 3OW7A 4YT0B 4GLSC 4H0LC 4H13C 5EPJA 1QLBB 1JROA 2RSNA 1PZID 4TKOB 3DWQA 1FRRA 2YEPF 3H91A 2F1MA 4FXCA 3BDOA 4IUPA 4XTCS 3FAHA 1EY7A 1LO5D 2Z1CA 2M2LA 1WSPA 3EUB2 2G9HD 2X6GA 5IGBA 2K9XA 4ZLTF 5KYIA 2MJEA 2W3RA 1FNWA 1RJTA 1CZPA 5JEAJ 5C4JB 1BMLC 2Y3AA 2AQ3B 1KAAA 1SXTA 2PVOD 3W5VB 2EYPA 2J52A 3NUCA 2VNUD 2E75C 4J8QA 5IT9E 2R92B 2AQ1B 4DK1A 1STEA 2EE1A 5M5YB 1DM0B 2XWJB 1WCMB 3D6WA 4XQNA 2L0CA 2K05A 3QO2A 3LXFA 4R3DA 5EKIA 1F9SA 3CQZB 5CBEE 2F0QA 3T16A 4YTMB 2JU6X 1I4XA 4FF4A 2OHFA 4XWWA 2HUGA 3MXGA 3PO3B 4IOIE 3ND8A 1QWYA 1ZP0B 1KLUD 4E6IA 3NBHA 3IT6B 4WIPA 5M3MB 2F0TA 5CBAE 2H1EA 4HMIA 1UGJA 1FGBD 5BYRA 5EE3A 2VB2X 5M3FB 3BVMA 1DYQA 2V4DA 1I4PA 1TJEA 5CV5A 1FFVA 1STBA 1SNOA 1B53A 3MFYA 1T6BX 1N60A 1O7YA 2EYOA 4H7BA 1E2WA 2RMMA 1STYA 2PZUA 4I7ZC 4KX6B 3D4RA 2F4IA 1C4PA 3TN2A 4XE0A 3S1NB 4FXGC 3C46A 3KF8A 4L8JA 5CC4A 1D2BA 1TWCB 4J3OD 4ZUIA 2KOLA 4ID6A 1PRTB 1GUSA 1TY0A 2J42A 2TSSA 1GUWA 1AEXA 1NUCA 2EDGA 1XEEA 3VYSA 1RYJA 2M56B 1ZXHA 2BT6A 4CHTB 2A6ED 2HDEA 1IBXB 3TP5A 3I9V1 1ENFA 1MGSA 1X3PA 3ZJTA 4ARCA 1DONA 3GD7A 5C4ZA 3HVDA 3D4WA 1EYDA 2D5DA 2EY2A 4C3IB 3DEPA 1XCTL 3BK1A 4PT5A 3U2SC 1K8OA 2Z4IA 5IGFA 2WXGA 5CV4A 3HS0C 2BDNA 4NP5A 1OXXK 3NQTA 3RZOB 2H4OA 2L5TA 3GTOB 1FD6A 4EQPA 2KJXA 1BCPB 4MT5A 4F8MA 1KTKA 2PO4A 4IUUA 2W3SA 1C76A 4DGZA 4OVZA 4KK7A 4K5VA 1O7ZA 2EZVA 3ONAB 2JE6I 1TT2A 3KUPA 1BUIC 1LTAD 2JQRB 2EY1A 4TMAB 4C7ZA 3EA6A 2IX3A 2BA1A 1EY0A 1PRTC 4DA2A 5COYA 1ZXIA 2IW3A 1MPEA 2RBMA 1ZE3D 1CHQD 4DAVA 4QB4A 1U4PA 2WDVB 3SR1A 1HPCA 3GB1A 2N9LA 2ZXPA 1ESFA 4XXEA 3I73A 3AE9B 4HRSA 1EY6A 3TEXA 5D7GA 1D1IA 1EU4A 4TRDA 4KY5A 2J4XA 3FC4A 3I4LA 2LFNA 3VYUA 4K8IA 4UAIA 4Q5VA 3MP9A 3RFZB 1PZJD 1KABA 3D31A 3VR8B 1WRIA 2KN4A 4QCLA 1QOBA 5DM63 4J6HA 1SNQA 3I4NB 4ZRPA 1B50A 2BB5A 1PRTF 2CW0D 4ZUJA 4L2YA 1CZWA 1CI3M 4JWUC 5ELFA 2A6HC 1RM6C 1AZPA 2M9VA 1EWHA 4JPSA 3TUOA 3A7LA 2M00A 1VCIA 2QF7A 2B2UA 3Q23A 3WCQA 2L1BA 1ROEA 1YNJD 1AZQA 3OSOA 2BW2A 3NTHA 3L4PA 3J9CA 4JE3B 2L83A 1I7HA 1EEFD 3IXSA 2EYJA 2JP1A 1QCBD 4X3KA 4XT1B 4KKUA 2AWOA 2KMMA 3AMUA 2WNMA 2NVQB 5C0XJ 1CZGA 3PZ8A 4RAUC 4RF0A 4ZKCB 3NXWA 5D65A 2SEBD 2Q8IB 4IKGA 3IAM1 4H44C 1HQMC 2KVMA 4ZQ3A 4OZBA 5BMGA 4LTUA 2DLBA 1D5ZC 3JAME 4A8XC 4C3IG 1XWEA 1HUMA 4KGSA 4G7OC 3TP6A 4HTHA 1H9SA 2O5JC 3ND9A 5BYSA 2J0TD 1XLNA 4MIUA 5FO7B 1NSNS 2IPKD 1N5WA 1HXYD 1SYCA 3W1SA 5J1ZA 4DAPA 3HGBA 2PW9A 3HOXB 2QMTA 5I6YA 2KEEA 3P42A 5MPOA 3ZGZA 2NTTA 4ZAIA 4BBRB 1NI3A 3CIRB 3VR3A 1KLGD 1SMYC 2K1BA 1S5BD 4KTAA 4IALA 5IT9L 4OZCA 2Y0SB 2PZTA 2F0IA 5G5HA 1F9RA 1YN5A 5DM73 3NVZA 2JYTA 4G57A 4KY7A 1O80A 5KNBA 5T1IA 4DXFA 3S2HB 4CJ0B 1KH0A 2PMZB 3AEEB 1PFMA 1KNAA 2ICEC 2ID0A 2WKDA 3SK5A 2PLPA 1LT5D 2B2TC 3WDNA 1H9RA 1JQ4A 1R4PB 2K3UA 3KWLA 2DYOA 1I3QB 1TWAB 2FINB 4IDIA 4MHEA 1XX8A 4C3JB 1D1KA 3GV3A 2K04A 5K36G 4O42A 1ILPA 4A3DB 4QF4A 3S1RB 1LTGD 3SXHA 3AE7B 5IODA 3NHHA 2NYZD 3HEJA 3QJYA 2KQ4X 3DWPA 3P7JA 2HCIA 4QUFA 2ZW0A 5FLXE 3LYYA 1LV9A 1EEID 2QDBA 2ZXOA 4NAMA 2LMCB 3P63A 5HGTA 4A9AA 2NVTB 4YSYB 5I6WA 1KF6B 4GZYC 3AEDB 2Y5PA 1Z47A 3L3OC 3MHZA 4FF3A 3J7AF 1BOSA 3LNNA 2IGGA 1MD2D 1BCPC 4IUQA 4IFDH 3D3RA 2RA4A 1E2VA 1Y8PB 1STGA 3GTGB 1DOXA 1TS3A 2KEDA 4C2MB 1LTBD 5M5XB 1LABA 2IGDA 4HKZE 3I3CA 2SAKA 2WQYB 4N9TA 5JEAG 2G1EA 4XDDA 2KWDA 3UI2A 4OW0A 4N58A 2RQXA 2YYZA 3PUVA 1N61A 1GB4A 1XTCD 4B9WA 1B1ZA 1O7LA 4KI0A 4B08A 3GTQB 1E2ZA 3AB9A 1SEBD 5A35A 2B8GA 4PMWA 3EVQA 5BN4A 2JEAI 4CQNA 1RODA 4F7XA 5IIFA 3V05A 1I6HB 3K0YA 5ELDA 3KWVA 2NZ1D 3MWYW 1KFYB 1PDQA 2F0JA 4P16A 5C3EB 5KEEA 1D5MC 1EOTA 3BS1A 3MVVA 4EGVA 1D4BA 5FK9C 2YU9B 3HUIA 2WXJA 4FXDA 3QOJA 3VYTA 3J81E 3I57A 1CM9A 3KLSA 4D2KA 3VR5A 4C1NK 4HN7A 2NN6H 4GDLB 1Y56A 4RA8A 3Q8CA 2B2YC 2Q5WD 1F2ZA 4P6VF 1A3UA 3CU7A 2RVLA 3I72A 1RD9D 2K28A 3FPPA 2R7ZB 3BYYB 5D3IB 1VZ6A 3V2TA 2WXRA 5IGEA 2PIAA 2G9DA 1OQQA 1T3QA 2PKOA 4X3UA 2K5QA 3IFDA 1EY5A 5JXVA 5EBCA 1WD0A 2WXKA 5KGUA 1JOOA 3A8JE 1TWGB 3KBGA 3K5NA 2ACZB 3B2GA 1DOYA 4OIJA 2PYKA 3MXNA 3A7AB 2JA8B 2LMCA 3DWAA 1F2MA 3NQIA 3CKIB 1A70A 2BBCA 2F0LA 4ZHOA 2N7JA 1QF6A 1FFUA 1Q3LA 1QE6A 1QOHA 1KRHA 1F2YA 4YTPB 3WOFA 4NJCA 3S2DB 4DNRB 2SNMA 4Y7NB 4PQXA 2BB6A 4J1MA 4K6LA 1PGXA 4ZHPA 5J22A 3NUHB 3RPFC 2OEDA 1J7AA 1U9RA 3H8HA 1JWBD 2PMVA 4A3GB 2E3TA 4Q2JA 4CGYB 1Q1BA 1YJIA 3SDZA 1OO9B 2INPE 3P1MA 3RD4A 2L52A 3KQ4A 1TWHB 5BMIA 1I4GA 2RDHA 2B2YA 3PIP3 3T4AC 2W54A 4C1NI 1YNTE 1PMRA 2BTEA 1BR9A 5BMHA 3R2IA 1TS4A 3PUXA 4ZYSA 2K03A 4MN3A 4WJWA 2BA0A 3QWNA 1GUTA 4FVMA 2PTLA 1E7PB 3NBIA 2R3ZA 1OFFA 1B9NA 1RCVD 2WXHA 4LMQD 5BN5A 3SR6A 3OPOA 1PRTD 4ARIA 4PMBA 2WINB 1PFDA 1VMCA 3T53B 1DZ1A 3R8BA 5EGTA 4YSXB 1H9JA 4N9PA 4PMCA 1UEAB 2GA4B 5C0XI 1N63A 2XN9C 2EELA 3ZQ4A 2OEOA 2EYLA 3W3AA 5C4HA 1IKMA 3TZDA 2F03A 2YEPB 1BO0A 5D3DA 4KKSA 3K5LA 4HMJA 1RDPD 1XYIA 5K5PA 2XIWA 3AU7A 1DJRD 3G6JB 4A3IB 2F0EA 3ZJVA 1E6EB 2N9KA 3TDQA 1MHXA 1OXSC 3W9CB 1F9QA 4IUTA 1SB3C 3Q8AA 3PO0A 1B3AA 5G3LD 3MHBA 4R8NA 1JALA 1V8CA 1ZOYB 3C1EA 4OO1H 4DXGA 1EM7A 4WFN3 1L6UA 2ON8A 2CU3A 1YN3A 4V190 4YWGG 2MP1A 4QUCA 3AH7A 2FFKB 1FXAA 4YTNB 1BXTA 2RDFA 4RWSC 5C6AA 1HUNA 4HEA1 2BE5D 3AV8A 2I07B 2EJFC 4HJGE 4HSVA 1QNKA 3L9AX 2F0OA 1YNJC 2QILA 4A90A 4LLGM 1BUVT 1Y8NB 3D4DA 1ACCA 1B4OA 4KHZA 3PUWA 4N59A 1ILQA 5FO9B 3CWIA 2WXQA 1ENAA 2RKSA 3Q69A 2K7VA 3HKZB 3A55A 1L6VA 3AB5A 4A93B 1AN8A 2K0PA 2XRQD 2ZT9C 2W55A 4ITKA 1NAPA 2BYTA 3OMGA 4IN3A 3D8GA 3NTKA 1QB5D 2A5HA 4PV1C 4K14A 3Q8FA 1F77A 5T8IA 4RKLA 4G7HC 3M3YB 5TSSA 1LACA 4JBWA 3NZ3A 4WWMA 1NVID