1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
1ET6A 2J4XA 1KTKA 1LO5D 5ELEA 2QILA 1RDPD 2XN9C 1PRTD 5D3IB 4UDUC 1PTOD 3DWAA 1GOZA 2IPKD 1T5XD 2R61A 1EWCA 2WV6D 2NTSA 1PRTB 1F77A 1PTOH 4BWGB 1PTOB 3BVGA 2XNAC 1FGBD 1PYWD 1JR0D 4RGMA 2ICIA 4RHSA 3R8BA 3W2DA 1S5CD 1LT5D 4DXFA 2O2LD 1PZKD 1BCPD 1L0XB 1EEFD 2Z8LA 3BYTB 4RGTA 1EU4A 1YN5A 3KLSX 4Z9CB 1RD9D 3SEBA 1BCPB 1B44D 1STEA 1HA5A 1LTGD 1DYQA 3R2TA 1HTLD 1QILA 1FNWA 1UUPA 4L63B 1AN8A 1LLRD 2TSSA 1TS2A 1JCKB 1MD2D 1PTOC 1D5ZC 1UNSA 1RCVD 4DXGA 1DJRD 1I4HA 2RDHA 3EA6A 3BZDB 1FD7D 1PTOF 1I4GA 1XTCD 5FKAC 1AW7A 1LTTD 1S5FD 4RGOS 2AQ1B 4RHRA 1FNUA 1CHQD 1D6EC 1S5BD 1SJHD 1I4XA 3GP7A 3O13A 1I4PA 1SEBD 2NTTA 1TS4A 1YN4A 1KLGD 2QEJC 2CHBD 1SJED 4RCOA 3URYA 1B1ZA 1LTRD 1JQYD 3MFGA 1V1OA 1ET9A 1EFID 1S5ED 5ELFA 1M4VA 1ESFA 1SE3A 4RH6A 2G9HD 4L6TB 1PRTC 1TY0A 1V1PA 3DWPA 1SE4A 4O1NA 4C56C 1LTAD 1LTBD 2AQ3B 1TS3A 1PRTF 1XXGA 1PZJD 4RGNA 1LT3D 1S5DD 1L0YB 3R2IA 1D5MC 2AQ2B 1LT4D 1PZID 1YN3A 3BVZA 1KLUD 1BCPC 1CT1D 3MC0B 5ELCA 2XRQD 1LT6D 5I4DA 1HQRD 1BCPF 4NZLB 1G8ZD 1LTID 1FNVA 1SXTA 1SE2A 1JWUD 1EEID 4TSSA 1JWSD 3EFXD 1EU3A 1TS5A 5FK9C 1HXYD 1CHPD 1RF2D 1I4RA 3OWEB 5TSSA 1D5XC 3TSSA 1V1PB 4OHJA 4K6LA 5ELDA 1CQVA 1LTSD 3DWQA 2RDGA 4ZYSA 4RFBA 3BVMA 3CHBD 5D3DA 3V05A 1ENFA 2SEBD 1TY2A 1BXTA 1CK1A 1JWMD 1SBBB 2XRSD 3BYYB 2IJ0A 5ELBA 1I4QA
chains in the Genus database with same CATH superfamily
1K8MA 3SFEB 4K5VA 3KYCD 2PW7A 3ZDTA 1K8AC 4DR4L 3NWTA 5AJ3Q 4GN4B 1HNXL 2AEHA 5E6PA 2VQFQ 1PRTD 1TT5B 4JWSC 1YMHE 1PTOD 3WOFA 4LF9L 1YHAA 2RHQB 1LM8B 4LNOA 4YWGG 1RL2A 1TWHH 4JC0A 3SDZA 1WY8A 3KWLA 3GTPB 4BWGB 4DR4Q 3M95A 3ZDMC 4A3BB 3D4DA 4XYQA 2IX3A 1UWMA 3I57A 2PQAA 3SVMA 4LF9Q 1S5CD 3TRZA 2NN6H 3UDFA 2OJWA 3PO2H 1MFWA 4MM3A 4ALPA 1ZKOA 4C3HH 4A3CH 4DK1A 1K3BC 4GLVB 4A3GB 4FXCA 2IL8A 2ATWA 5DPTA 1M94A 1RLFA 3I91A 2H4OA 2Q8TA 2QA4A 5C23A 3M4OB 1IKMA 1Y56A 1ZYRC 2D07B 1UUPA 4KD3A 2ON8A 2DNEA 2TSSA 2SDFA 4PK1A 5AUIA 2WDQB 4F8MA 2VXWA 3AB5A 4NY0A 3U4VA 5EQ0A 3ZYYX 4A3MH 3N30A 3ER0A 4A76A 1K9MC 2IO2B 2B63B 2OCEA 4X3SA 2GBKA 2ZPYA 4B3MQ 1XMQL 4PQXA 4TVAB 1CSPA 3RZDB 2JSOA 2WKDA 3AQQA 1NVID 2LRWA 4EUTA 3HOUH 4KGTA 4DV1L 2E3TA 1CHQD 2HQLA 1Z6HA 2KCMA 1ZEQX 1BF4A 1XPRA 4GDKA 3MHZA 2H89B 3PZ8A 1XMQQ 2JX5A 3PHXB 4KSLC 2K5NA 3UI2A 3PV1A 1EFID 5ELFA 4LFCL 3TEWA 2LXCA 1ZDXA 1M4VA 2FJ2A 5LL6S 2QCZA 1LM0A 1XNQL 4HCNB 4L5TA 3K58A 1K50A 3JAMi 2FCQA 2OWOA 2YLMA 3NY5A 3X0WA 1HZCA 2B29A 2RBMA 1G291 3RZOB 4LFCQ 1WIAA 2ZVNA 3PVLA 1YVCA 4CGYB 5M5WH 3N32A 4N8X1 3I4NG 1XNQQ 4EKUA 4S3SA 4HMIA 3UE1A 1Y1WB 1QOGA 2N0SB 2NPTA 5JJIA 1NAPA 1CQFA 2KD0A 2CWAA 2IO1B 5ELCA 3NJTA 3P4PB 1YITA 4HR7B 5IE8A 1HR0W 1WZ3A 4D2KA 5BYQA 3RYTA 1V43A 3S2DB 1DM0B 3H0GH 2PW5A 5C0XJ 1Q81C 1QWYA 2V4IB 4W9HA 4RCNA 1K83H 2LS01 3CMAA 3IG3A 5J2RA 4XT3B 1ZYRD 2BF8B 3D4WA 1EEID 3FMCA 3NK9A 2EJFC 3KK7A 1IBML 2DJFC 4WWNA 4TQ0A 4FDBA 2K52A 4ZRQA 3E6ZX 1N9WA 4ZUIA 5FO7B 4LWCA 1XPOA 2W82A 4WIPA 3SHQA 5KEEA 4DDID 3OWEB 1AARA 1U4RA 1AH9A 2G5DA 5CV5A 3G4SA 2HTHA 2WGSA 4X62L 2JA5B 4EZKA 3CCVA 5JVG3 3CRLC 2N88A 2Y0SE 1Q82C 3CXCA 4C4VA 4IWPA 2XRSD 4RM9A 4DV6L 4C3IH 5J17A 4KKUA 2MA9B 1GUSA 4XT1B 2D11A 3M7NA 1L4ZB 5I9PA 5IYCH 2KWCA 3OLMD 1Y1VB 1SFOB 5EPKA 1IP9A 3ZNZB 2C60A 2N7JA 4R8IA 2K1BA 3R3MA 3V60A 1L1OC 2F0NA 4YTNB 1T5XD 1MVKA 4RKLA 2JWZA 5BMHA 5AZFA 3I90A 2G4SA 2W54A 5L83A 2L7RA 2KQ4X 4LF4L 2XNAC 1VQCA 1EY4A 3ERQA 1E9MA 2PTLA 3APDA 4MT5A 3R8BA 4RHSA 2RDBC 5D2MB 1T0RC 2PE6B 4EQNA 1KF6B 5HURA 2F3IA 1CKOA 1MKHA 4AQYL 3PO2B 3ENEA 3A55A 2ZJPA 5JHBA 4PS8A 1D3ZA 1XCQL 4C3HB 4LFAQ 5GADC 1YJ9A 2FCSA 1L2FA 4P16A 1C3TA 5CGKA 4LF4Q 1FGUA 1B44D 1B70B 3Q8AA 1EUJA 2EIFA 5IWAL 1K8GA 4K81A 4AQYQ 1PDXA 4KIKB 2KMAA 4GB9A 3JAMc 1L6VA 4NMZA 1TS2A 4OVZA 2I2YA 5JEAH 5LXIB 4G3XB 3AI5A 3OG5A 4DXGA 3J80E 1DJRD 2E75C 1STHA 4A3MB 4YSYB 1V8QA 1ZE3D 5IWAQ 3K5NA 4APVA 4MJSB 1R4NI 3VH4B 5K5PA 2AQ1B 3MHBA 1LUZA 2F0PA 3C0RB 3RN9C 1VQDA 3KFUA 5I6WA 4IOCA 2IX1A 1DGJA 3L16A 4C7ZA 2RF4A 1ICWA 3RZFA 2ASQA 4OVVA 1EY0A 2QDFA 1BBXC 2R2QA 2ZW1A 4P73A 3WALA 3AE8B 3SGIA 3VR4A 1S1QB 1D1KA 3NTIA 1Q8IA 1E2VA 1MG8A 2V4LA 4M1UB 3KJOA 2UUAQ 4BBSH 2LWPA 2I46A 1DCZA 3IVFA 1LTBD 5C4XH 1JJGA 4W9CA 4GLXA 4IM2A 1V5TA 1ICFB 3OYYA 4MDKE 3W1YA 1TQOA 1WF9A 4ANVA 1TXYA 4C1NK 1CFMA 4WJQA 2Y0SG 3X3NA 2UXDL 2EVBA 4C1NI 4YCVA 3GTGH 1JMCA 3NUCA 2KANA 4K3CA 4R9WA 4C3JB 3E0EA 5M5YH 2UUBL 2JA6G 3BDCA 3KQ4A 5FLMH 4YTPB 1G8ZD 3H0GB 2UXDQ 1Q1OA 1K83B 4DXAB 3HOWH 1NUCA 1EF1A 1JWUD 2HD3A 1STAA 3H94A 2R7FA 3PUWA 5IGDA 2L11A 1EU3A 3LGJA 3PCOB 4KHZA 1YJJA 3R3OA 4IJLA 3L3OC 4AIMA 2LFIA 2EPBA 4LCDE 5IP4D 2PEAA 1E2ZA 5TSSA 3IXSA 3WCQA 1Y69U 4LLGM 2QGQA 1SIFA 1OFFA 2BOSA 4N9PA 4A55A 3D31A 1X6OA 1EM7A 2IBIB 1GNUA 3ERSX 1YZ6A 3W5OA 1MHHE 2F0TA 2WINB 2WQYB 4GDLB 4ARCA 1Z7TA 3EROA 2WXQA 1KDCA 4C3IB 4DHZB 2O6VA 3CCSA 1ZGUB 4GN1A 3HKZE 3MVVA 1D2BA 1FD6A 1KTKA 2BYEA 1N36L 2JQRB 1GHKA 2QILA 4CKBA 2JRHA 2EOTA 1H9SA 3NZ3A 5D94A 4HN7A 3HOVH 4UP7A 2K22A 2K8HA 3WA0A 5IY0A 2HDMA 1N36Q 1PTOH 3F1ZA 4IN3A 3VUWA 5M3MG 4A90A 3KVFB 4NAMA 4JI7L 2NVTB 3QOJA 1JW9D 2GVBA 4HCPB 2L32A 3OIQA 2OEOA 1FJGL 2NBUA 4RA8A 1EU4A 4B3TL 3AYHB 1CZWA 3PSIA 3HKSA 4P72A 4FLHA 4POGA 4KZCA 2WFWA 2CQOA 2UWQA 1DYQA 1FJGQ 1QILA 4RAUC 2R3ZA 2K6DB 5HG2A 4B3TQ 3I8ZA 3ZRFA 3S1NH 4DBGA 4HIDA 5IYDH 4OZAA 3N3KB 1U4AA 4P74A 2K5WA 4B9XA 4DV4L 1FD7D 4QQBX 2DZJA 2FCNA 3Q6SA 2K25A 3R66C 1ASZA 1L0VB 1G6JA 4FVMA 3C1EA 1VQAA 2G9DA 3P75A 2O4XA 1LV9A 2F0DA 4EE2A 1M8AA 2BS2B 3AULA 1I4XA 1WTHA 1B3AA 5IODA 2OOBB 5LLIA 1GJXA 2L00B 2L0TA 4G0NB 2KXJA 4DR2L 1I7HA 5C0XH 2FFKB 2JY6A 2LHEA 4FA6A 4EOYA 2LGSA 3RPFC 1ESFA 5GQOA 4B3SL 1GM5A 1JJCB 4FADA 1VF7A 4OZCA 1VQ8A 2LJIA 3NHEB 3DBLB 4DR2Q 1AP0A 4B6WA 1FMAD 3HP3A 1TY0A 3DDCB 1SE4A 2B2TA 4IPDA 1LYLA 4A3IH 2M1MA 2Z6BA 4DNRB 5C4XB 4B3SQ 3VFKA 4A3OA 1IW7C 1K0RA 3FP9A 1PZJD 2KECA 4XDDA 2WAQG 3OIPA 1KDAA 2K6AA 1V9PA 1RKNA 3DHHC 2AQ2B 1WYDA 1EQQA 2GOWA 2KVRA 1VQNA 4LFBL 2QCPX 3BWUD 3OW7A 3S17B 2MWSB 4DV2L 3HOXB 4HVBA 3TEZA 3HKZG 2QDLA 5M5YB 4A3KH 2I38A 1XF5L 3Q3OC 2GVAA 1O7YA 3IFDA 4BY1G 3PIO3 1NTGA 3B08A 3GDEA 2ES2A 3HFZB 1PFBA 3NBHA 3KJPA 2XWBB 3HOWB 1LGRA 1WE7A 1Z9FA 3B6YA 2L8JA 1Y8RC 5KIXA 3IHPC 3W1SA 1WMHB 5CYUA 4M8NA 4IQZA 3S15B 1X55A 3QWNA 3H7PB 4LF8L 1KRSA 1KHIA 2FXQA 2KBNA 1BO0A 2B2VA 3FPPA 2WDTB 4YT0B 5AEKB 4KKSA 4YCWA 1IUEA 4N8FA 4H44C 3QAQA 3F2CA 3I4MB 4MGZE 1EY6A 2M56B 3QC8B 4J15A 1UELA 2GBRA 1O78A 1EFWA 1E2WA 5HKHA 1TBEA 3GZNI 2FNJB 3F2DA 1VJKA 2K9XA 1F0ZA 2HT1A 4PZ7A 4HKZE 3DBHB 1WFYA 1A70A 4OL7A 3MXUA 1XLOA 3A9JA 4CQNA 2IHFA 5I9OA 4LTUA 2NVUI 3AMZA 4HKQA 2Z1CA 4ZLTF 4ZHOA 2K01A 2BTEA 1UE5A 2KHJA 2C9OA 1VR9A 1WE6A 4ILWA 1N60A 1QE6A 3D6WA 5BYSA 1NR2A 2FHTA 2N9KA 4MH0E 1A5RA 4BZAA 3UDIA 1RWSA 1A3UA 1IW7D 1PRTB 4JBKA 1QNUA 3PMFA 1FIQA 1PTOB 3RNUA 2Y5BB 1EQTA 4KJNA 5G5HA 2EYLA 2BT6A 2ZM6Q 1A0IA 4DNIA 4JK1C 3RULA 3ZXVA 2N55A 5FOBB 4KVGB 1XNRL 4XC2A 5CV8A 4G11A 2TMPA 1GKHA 4H2AA 2MUYA 3KLWA 1YI2A 5E6NA 2HCCA 4IUQA 3ZRCA 3WOEA 2A6ED 4IALA 4J6IA 4MSMB 1WGYA 1WI0A 3M62B 4WJPA 2GLSA 4K8IA 1ONLA 1SNOA 2J7ZA 1T0QC 3L10B 2FBWB 3I7FA 1I4HA 1V9JA 2NBVB 3ZTDA 1O80A 2M19A 3AEFB 1PDQA 3UINB 1CZGA 5L95C 3LB8C 3VTVA 2CHWA 4WRDA 1BT0A 4JVZA 2JE6I 3EBEA 2GRIA 1BR9A 3U58A 1I4PA 1YN4A 2MW5A 4NXML 1A15A 3E9HA 4BBRG 4IOIE 5JZEB 5DPSA 2PPBC 1ILPA 2A6HC 1LTRD 4LMQD 1V1OA 4PS3A 3EC8A 4AYBG 2K3UA 5LMUQ 3CD6A 2HHHL 3OJ4B 4WAFA 1B7YB 1SN8A 1E8YA 2EYPA 2KQ7A 3Q8FA 4B9WA 4N9F4 3QO2A 4NXMQ 2N49A 1R4MB 1MPEA 3NVYA 2LEKA 4O1NA 3H9DA 2OXPA 1Q10A 4M0WA 1R9TH 1E8ZA 2V3PA 4C7YA 4WH4A 3K7AB 3K0YA 2W55A 1VQMA 3LWEA 1WCMG 2EYOA 3S1MH 1GPXA 4W9JA 4RNAA 1UE7A 3TUOA 3V61A 2WDVB 5IGEA 2DENB 3S14B 3TS2A 1D1IA 2BKRB 3HOZB 3OW2A 1I6HB 2JYTA 3NBIA 2MJEA 4JPBW 2LASA 4G57A 1QCBD 2CQAA 2I07B 2E2JH 1H9MA 4YWMA 3M4QA 1HTOA 4OVUA 3MC8A 5JVH3 2OTJA 2LMCB 1UBQA 2FIFA 2IO3B 3ZVVA 4GS3A 1TU2B 2MO0A 1FFUA 2D3BA 3DPDA 1KABA 4K7UA 3ZJUA 1XLQA 1STYA 2K5PA 1QF6A 2I5MX 3UE0A 4NJCA 3DVGY 1C9FA 4RG1A 5K36G 3PO3H 3P20A 1ASYA 1EZ6A 1PVOA 2KFKB 4MSQB 4FBJB 1QUQA 2KAJA 3TIXA 1ROEA 4A3JB 2GBNA 3L08A 2JVCA 1WGRA 5HHDG 1CKNA 1J9OA 1XWEA 1KC8C 4OW0A 2GA4B 2DYBA 3BZKA 3RR5A 2B2YA 2R2OA 3B9JA 2MSED 4R4IA 4FULA 1V1QA 2CKHB 4DR5L 3FKIH 3QARA 3CPWA 2A6HD 2IJ0A 2JEAI 3V96A 4PS7A 3ND8A 1Q1EA 2FUHB 2O2VB 2WS3B 1VQFA 2N78A 2E74C 3MJ5A 1P16A 4ME3A 5FLXE 1Q3LA 1MG4A 1V2YA 3DVGX 4I65A 4I6NB 3SR1A 4AJWA 1X3QA 1LXDA 3AFQA 2R61A 2KQ3A 2UU7A 3MP9A 4LJOB 2EY5A 3J81E 3RNFC 4KHPQ 4EVOA 3TCAA 3I4OA 3QG1A 4TQUS 5JAVA 3CC2A 3Q2AC 5EE0A 3OWFA 1PYWD 4ZK9B 1K52A 3TMPB 4CO7A 2A68C 2O2LD 1PZKD 4BY7B 1HZ9A 4MNOA 1JB7A 3IRBA 3BYTB 3CC4A 3DM1A 4A3LH 1HCZA 3CMMB 2IGDA 5A35A 1XMOL 1HPCA 5BN3A 3TZUA 1XQQA 3L9AX 2F0IA 5IT9L 1XLNA 1JE5A 3R2TA 3MWYW 1FNWA 5IYBH 3H7SA 1HR0L 3TBIB 2G1EA 4XDCA 1JOOA 1XMOQ 4PT5A 4TMAB 1D5ZC 1JALA 1E1TA 1AE3A 4K14A 2BH8A 2Z6KA 5LMNL 1TZ1A 1I4GA 2NN6G 1XTCD 4XYOA 3GTPH 2BBCA 3CCRA 2FUG1 2D10A 1BOSA 1S5BD 3W1GA 1GUAB 2PZUA 1M90C 1WI5A 1J19A 5CV7A 3Q23A 1KFYB 2O5JC 5LMNQ 3VXWA 2SNMA 3ICEA 1WX7A 3WIMA 2Y5PA 3DMUA 5IOCA 2JXXA 2N1WA 5TR5A 4DHZE 1JB3A 1OTCA 3L0OA 3UQBA 5T1IA 3A1QA 1M1KC 5DCNA 4BKSA 3PIOA 3P4QB 3M4OH 2IWHA 2F0QA 2K4KA 1SE3A 1EQVA 3OMCA 4KDLB 3C2PA 2LRUA 1QOBA 4L6TB 1OGWA 3SR6A 3OOCA 2HIVA 4C56C 4IFDG 4GOPA 3MTSA 3S9WA 1WR1A 2RD0A 2B63H 2NS5A 5J18A 4M01A 1AEXA 1TGZB 5IT9c 3S1MB 1TWAB 1WJ4A 2RCNA 4A3FH 2F0JA 2A68D 4PYUA 2AMCB 1KM7A 1C4QA 5BMGA 5MPOA 1I42A 4X66Q 3AE7B 4L8JA 1CTMA 1HZAA 3T1HL 5DPRA 4BBNF 4X3UA 1VQLA 1K0SA 2UXCL 3DEOA 3KUDB 4LNNA 2MJ3A 1QZEA 3P4RB 2YYZA 3ZO5B 4II2B 3T1HQ 3E5SA 1C4CA 1CHPD 4BVUC 4TRDA 2UXCQ 1I4RA 3BY4B 1D5XC 3PO3B 2B2UA 5LHY1 2KHWB 1EY7A 1Y1WH 4DV7L 5C4HA 2PPHA 3K81C 5BYRA 5GXGB 5T1GA 2R7ZG 3TEXA 3VDZA 4KY7A 3D6CA 2VQEL 1JWMD 1MJCA 3FVQA 2L52A 2PJHA 3SDLC 4IZ8A 1IXRA 2PKOA 4K3BA 4WJ4A 2AX5A 4I7ZC 5IP9H 3DWMA 4XQJA 3AEEB 3BG3A 2XEWA 2VQEQ 1X3FA 2WB1E 5HGTA 2B2TC 3PV0A 5ELNA 1P7FA 2KTFA 3D32A 2A69C 1GOZA 3HOYG 2DWQA 3A8IE 4PNYA 1EWCA 2KNBA 4L1BA 3VR2A 1F77A 4YL8A 4GNXA 3W3AA 4ANWA 4OIJA 1SROA 4DV3Q 4BOZB 5CV9A 3GTKB 5A2QE 1YHQA 2JA5H 2L83A 1STBA 4ICUA 4P75A 4OWXB 4DV0Q 4ZAIA 3JSVB 1FXTB 4DK6C 1GO3E 3KLSX 5CBAE 2Q8IB 3GOEA 2LGDA 2ZJRA 3KLRA 1EWIA 1Y1VH 5KYLA 1SFOH 1B9NA 3C1FA 1NMFA 3RLOA 5GAEC 4GKKL 1ZXHA 3W1SC 2YTYA 1EOVA 2K03A 2V4DA 2ZJQA 3QJYA 4LW1A 3CCJA 1V49A 3D8GA 2B2VC 3I72A 2MBEA 1XJVA 2KWDA 2WXOA 1WVLA 2WU5B 4GKKQ 4GIVA 3F8TA 2QW7A 1NR4A 4A75A 3M9BA 1HNXQ 4RGOS 2BA0A 2MEKA 5COYA 4EZJA 2KHIA 3RD4A 4ULLA 5ELOA 4AH6A 2XK5B 2INDC 3AU7A 1UD7A 3AE1B 2B39A 2G45B 1Z47A 3N9YC 1SNDA 2BE5C 2IY5B 3P42A 3RNAC 1HH2P 4US9A 5JEAG 4O2DA 5JH5C 1TKWB 1X65A 2GBMA 3ONAB 1KIXA 2LGYA 1RFAA 4CHKA 1ENAA 1G2SA 2YU9H 4WJOA 3KUCB 5M3FB 4A3DB 1QOFA 2A69D 2AWNA 4TKOB 3L13A 3WWVA 1E90A 1F2MA 1TWCH 3DHGC 3T3NA 4K6DA 1UEBA 5C5LA 3NP8A 3VVWB 1SF0A 5H8YE 1L0YB 1WYWB 2IDYA 3AXCA 3A9KB 2JSVX 2JWUA 1VQ4A 3Q8BA 4A3FB 1LFDA 2R92B 3NXWA 4EQ5A 1IPGA 1PYSB 4GLAC 3DM3A 1L4DB 3RT3B 4IPGA 3KF8B 4UPAA 1WTVA 4LDTD 5IA7A 1XTDA 2I5LX 3JAME 3U2SC 1NEKB 2W3SA 4JI2L 3M63B 3UQAA 1YOVB 1EY5A 2WB1G 2ACZB 4DV1Q 2MQJA 4BBSG 4CDDC 1KXLA 1NCVA 3KUZA 5LL6X 1NI2A 4HPLB 4OONA 3CQZB 3G6JB 3AEDB 4DR7L 3H3VH 3FILA 4JI2Q 1F9RA 3GV3A 3RNEC 1WJNA 2VUMG 2JRIB 4Y52H 1R4NB 3BJUA 3UF8A 3F2BA 4DR7Q 4DA2A 1C7YA 2BKFA 4K5WA 1S3OA 2RVLA 3V05A 2RQXA 1ENFA 4REZA 1TY2A 2A73B 4C3JH 2EY2A 4NAWB 1I3QB 2F0VA 1HZ5A 2BE5D 4KIKA 4NPSA 3BDOA 3BIID 4AS1A 2RKSA 1DD2A 3MXPA 4FYDA 1IYFA 2Y3AA 1OEYA 4YIJA 1YIJA 2Z59B 1QJOA 4JOIA 2CW0C 3W5VB 2PZWA 3TREA 4G7OC 1G6ZA 4E3CA 1GVPA 3N20C 1EYCA 4MJSA 3X23A 2IPKD 1DOLA 3OSOA 1E7UA 2YEPF 4UHVA 1ILQA 1EO6A 1VLBA 2NTSA 1J7CA 4IDIA 1GB1A 2ZJDA 2MH7A 2VB3X 2QC8A 1IBMQ 4DXFA 1L6UA 1ZPSA 4N59A 1R4PB 4BA1I 2OQKA 1HNZL 4UY8C 1UF0A 2PCFB 2ZTCA 2LUMA 1N32L 2FINB 2PQAB 2J52A 3LXFA 1MJEA 2ZVOA 4ZDVA 1PH2A 3CU7A 4BKTA 3QJZA 2INPE 1E6EB 4I6LB 1HJPA 1JWAD 1OQQA 2BCOA 4X62Q 1HNZQ 3MHSD 1HA5A 1N34L 4BAXA 4JI3L 1HTLD 2KWUB 1PGAA 3HOVG 1AN8A 3RZWC 3W9CB 1KL9A 1SMYC 2KYWA 5DEHA 1WM3A 1I94L 1RCVD 4DV6Q 2WXLA 4W9DA 3N6RA 3GTLH 4MGKE 4S17A 2CVRA 1VCIA 1N34Q 4IPHA 1AE2A 2K5QA 1SSNA 4A3EH 3IFWB 4US8A 1X3PA 3NS1A 5C1ZA 2IW3A 4HRSA 3IKJA 4M8AA 2Y5CA 4DK3C 5I2XA 1I94Q 2NVTH 3E9SA 4HJ8A 1EYGA 3UGBB 1C48A 1GUOA 3J7ZC 3IAYA 1YNTE 3LNNA 3K57A 1OQRA 1B1ZA 1BUIC 1S3SG 4GDKB 3Q3MC 1ET9A 3HM3A 1IBXA 4JWUC 2X6GA 3VRBB 5C3EH 5EPLA 5IYDG 3QWZB 4W9EA 2PVOD 1NBWA 5JOBA 2CW0D 1CA6A 3E56A 2YU9B 1IHZA 2C7NB 2VY3A 4R1JA 3P2BA 1BBWA 1LTAD 4JBJA 1PLFA 2MO1A 1SNCA 4CJ1B 1A8VA 4DNTB 1TWCB 4K0KL 2ZW0A 3B0AA 2MP2B 5CV4A 5T8IA 4YHHL 1FXIA 1D7QA 4GDLA 1NE3A 5CR3A 2K33A 1RJTA 3IL8A 2H1EA 4YSXB 3FEWX 4DUZL 1KLUD 2WX1A 4K0KQ 1Q7YC 2BYTA 3MC0B 2XRQD 5I4DA 2D0OA 2AUKA 1A3TA 2M4NA 3VAWA 2EYFA 4DAVA 4GMVA 1KNEA 1FNVA 4GLSC 2JA8G 2L1BA 4FF3A 4HEA1 4DUZQ 1G2TA 3NTKA 4MGYE 1DOKA 4A3IG 2OHFA 3L2PA 3Q3FA 2X38A 3SU8X 3UIOB 1CSQA 1SMYD 5FK9C 1NYRA 1Q8KA 4JE3B 4RMAA 4ANXA 2MBOA 3HZXA 5IGBA 1WOCA 5EKIA 2Z6KC 1RF2D 3L0WB 3MC9A 4OGQC 3S1RB 1E7ZA 1F9QA 2AWOA 4BFRA 5JXVA 4JBMA 5G55A 5LNK1 3CF6E 3J80i 5ELDA 3P1HA 1ZKHA 4IC7B 3SHLA 2DZKA 3AE4B 4RFBA 1B2TA 3CHBD 3SD5A 4A3KG 3RCZA 1TWGH 1SYGA 5CHWA 3S17H 4WQOB 3HOXH 5EAYA 2RSNA 4KI0A 3KBGA 1KH0A 2KEDA 1B9RA 2KLGA 1CJEA 5BN4A 3OHXC 1OO9B 3P1MA 3ZNGC 4B0EA 1CUKA 1SLJA 2RCFA 1IL2A 2R93B 5I2YA 1RDPD 1SYBA 3DCGA 4ZOHC 1J8IA 4LNIA 2UUBQ 2IZVB 3S15H 4GOPC 4HIKA 1DONA 4DWFA 2WV6D 1Y8PB 2WXKA 1OXUA 1QQRA 4ASWC 4JI1L 4JGHB 1FL0A 4E6IA 3I4MH 3E0JA 1BQQT 3KBXA 4GN5A 4ZKCB 5C44G 4NJ6A 3TN2A 5M5XB 4U68A 1OQYA 3VYRA 2KJ6A 2CKZB 3KW5B 4KMUC 4LF5L 4O0AA 4AQ7A 1YNJC 2LXJA 3VR5A 1PGBA 4JI1Q 5CHFA 4F1SA 1C1YB 4Z9CB 2F4IA 1YBYA 1A2TA 1B3QA 3NE5B 3SEBA 1VD2A 2KC1A 3EECA 3HM6X 2Q8RE 1H9KA 4KY6A 3J80L 1B50A 3AE3B 1LTGD 2I5HA 3CC7A 2RR9A 4XIGS 4IUMB 4KHVA 2MP1A 1LLRD 3KYDD 2K32A 5DLQE 2MRPA 4B95A 1XLPA 4EGVA 2LY7A 3BZDB 1PTOF 1IZ6A 3GTLB 1YQ4B 2C7HA 4MHEA 4DAPA 4A3EB 4EQPA 2KCNA 1V80A 1HE8A 3DVNV 2EE1A 3R93A 3U52E 1VQIA 2NN6I 2N8NA 3D0FA 1C4PA 4RMFA 3ALBA 1SYDA 3N1ZC 4FN2A 2QEJC 5CTRC 1RTOA 4X64L 1BVSA 1KDBA 5IOIA 4NW2A 2QF7A 4HCEA 4ZQ3A 4BKSD 3K5OA 2D2CC 1J5EL 4JI7Q 4IOAA 1JWBD 5C3EB 3A5UA 2MHJA 2JA7B 3F2UA 4WAAA 1W3SA 4X64Q 2ZXOA 1WTRA 2WDRB 1I50B 1G91A 1B4OA 1Y8OB 3PF4A 2B76B 3LDZE 4DAMA 4R4CA 3X3MA 2MJDA 4K8JA 1P8LA 1YEZA 2KK8A 1J5EQ 1TWFB 1EIFA 2VNUD 1QLBB 4KV2A 3RLNA 4GNXC 1L5PA 3PRMB 3MEHA 3L4PA 2HDLA 4QIWE 3J80c 3UDGA 3DHQA 3R2IA 4IFDI 2J0MA 1WXSA 3CSFA 4IG7B 2PQEA 2NVQH 4LUVA 1IBLL 2RPVA 4BBNC 4DV4Q 1YNJD 4NB3A 3CKIB 3TP7A 3VYUA 1F2RI 3T9LA 5J39A 4QUCA 2D5DA 2HTME 4A6QA 5FJ8H 4HJGE 2KDIA 1IBLQ 2CU1A 5BMIA 3ABVB 2QHOA 1YD8U 4G7HC 3NG0A 1JQ4A 4BXXG 4TSSA 1ZXIA 3H1UA 3PREA 4S0RA 4YXDB 4DF7A 2BH2A 3QOLA 3HRZC 2W9NA 4II3B 1EIYB 1DOMA 2KJXA 3PGEA 4K7SA 3AU5A 3K7AH 1V8CA 3TSSA 1V1PB 4AWJA 2WIIB 3MJWA 4PMBA 2ZPNA 4L5RC 1V86A 2KJRA 2DY7A 3KUPA 1NNXA 1EY8A 2PW9A 1SYEA 1F9PA 1TWGB 4FO2A 2SEBD 3S14H 3HOZH 1I6HH 1E0BA 1O7LA 1Q12A 4HCSA 2JZPA 2DUDA 3BYYB 2REXA 3WAMA 1X3EA 4K7WA 1HZBA 4LFBQ 1WM2A 1GD7A 4RWSC 1G6PA 1F9SA 4ACFA 4DV2Q 1PXUA 5CC4A 1HUNA 2L1AA 1SB3C 2EMTA 2D3CA 3K8AA 4NNJB 4JL9A 2DNFA 4HK2A 4L23A 4FXKC 1KRTA 4QCLA 1BKBA 4HJKA 2I0QA 2IGHA 4DK5A 2WWZA 4CDEC 1BBUA 3GV6A 2BDOA 4CDFC 1TYGB 4A3JH 3I4NB 2NB0A 3EIVA 3FKIG 1EQRA 4A93G 2N9LA 4BKGA 3VTWA 2OQ0A 4LF8Q 1EEFD 2K04A 3B2FA 3EFCA 3MTNB 1YN5A 3MAQA 2WP9B 4YWKA 1E7PB 4DDGD 4LF6L 5AZGA 3IBEA 3RNGC 3DHIC 3AEBB 3DLLA 2AL3A 2QMTA 5IN7A 3Q8CA 1Q46A 1EOTA 3ZJYC 2BS3B 1KRHA 1UWVA 3MXNA 3S24A 2Q5WD 4LF6Q 3GTMB 1SR3A 2CS4A 2Z0EB 3PF5A 2K75A 3T53B 3EA6A 1X54A 3KF6A 1PFSA 2JQOA 1OXVA 3K0XA 5FKAC 1EUVB 1FO4A 4QGUA 2C5LC 2XBBC 4CBVA 2JA9A 3TP8A 1KLVA 4FF4A 4LNQA 1MHWC 4BY7H 4B0MA 2HUGA 4FHKA 1ZOYB 2IO0B 4F7ZA 4IO9A 1KLGD 2F0KA 3T13A 1PMRA 2K50A 5EPJA 2WX0A 1ZXTA 2BA1A 2LMCA 3GE3C 4CDCC 1VRAB 3G48A 1KNAA 5GROA 1GJZA 4JOIC 3BINA 2KMCA 3RI7C 2PNRC 1SNQA 2L55A 3NQIA 1XNRQ 5C6AA 3CF5A 4M00A 2CCZA 4F8CB 2A74C 3NS8A 2JU6X 3A4SC 3GTJH 4A3BG 1FVIA 4RF0A 1L2NA 2EYMA 1X3GA 1RRBA 3V3XA 1HFNA 1RODA 1C77A 1XEEA 1QVFA 1F2RC 5JPNC 4PMWA 4F87A 3MEFA 2N9XA 1TVXA 2EJMA 1MBYA 3NPPA 4A3GG 2NVQB 3BVZA 1OXXK 4K2LA 5IP7H 1KAWA 4P6VF 3RNBC 1LT6D 4KZ0A 1BCPF 4JG2A 4NZLB 2UUCL 3BK2A 3VA7A 3HRDD 3DEPA 3UDXA 2KVZA 3APCA 4LDTB 1Q86C 4WWOA 4MTKA 2ZCBA 2RPQA 1WJUA 2KCCA 1JWSD 2IT1A 3RMKC 2CWPA 2LFNA 2B63G 3CCMA 3NBHB 2V3SA 2KLCA 3AH7A 2L5TA 4MIUA 3A56A 2HHHQ 2BWES 3I9V1 1EZ8A 3TZDA 4AOFA 2IHEA 3H8HA 1VDVA 1KQSA 3L54A 1TWAH 4WORA 4ZYSA 3QQ8B 3BVMA 3Q22A 1VQ9A 5EE3A 4ME5A 5KRUA 2K7VA 1X9NA 3ML9A 1TJEA 1CK1A 2F0WA 3A8JE 4KDIC 1EYAA 3J81j 1WRIA 3H15A 2MBHA 2V0GA 2LI5A 1VF5C 3I56A 3A9JB 3PIP3 4HAEA 1ZDVA 5M9OA 3V62A 2A5UA 1V81A 1LO5D 2NUCA 2DAJA 2LJ5A 1ESRA 4L2YA 3BU2A 2XN9C 1Y1WG 2B3GA 2NWGA 4KLKA 3LJ3A 4BA2I 4USAA 1S40A 4JCVE 2A5HA 2UYZB 1K3RA 5EE9A 1JR0D 2ICIA 4POFA 3E9IA 2F0OA 4Y7NH 4KK7A 2JXTA 4A4IA 3DBHI 2C5CA 2WACA 2Y0SB 3I55A 4V190 5IP9G 1RD9D 3HG9A 4HDQA 3GQBA 3AE9B 3ZKJC 5CBEE 2QEXA 4NQKE 2JA6B 2V3NA 4JV5L 4XWWA 3LWUA 1TIID 1ZUD2 1NSNS 4WWMA 4DFAA 4A3PA 4DR5Q 1MGSA 4DR6L 2RA4A 1PFDA 3P63A 2DN8A 5E7NA 4E71A 4KY5A 2DBYA 1IKLA 3OTOL 2JA5G 2O5IC 4JV5Q 4IFDJ 1CI3M 4GXBA 4AJYB 3OMGA 4DAYA 1E8WA 1UGJA 2KOXA 5H92C 1E22A 3L17A 4QMGA 5CHVC 1ZP0B 1S4ZA 3GTKH 1FCCC 3CCLA 3A54A 3HS0C 3O13A 4HEDA 4OO1G 1HZ6A 2EKIA 3OTOQ 2K39A 3T1YL 2EDGA 1N63A 1Y1VG 4NDXA 2ZXPA 3NELA 3G71A 3VUXA 1A63A 4DQOC 1YHBA 3CW2C 3NWSA 4KN7C 3DBRI 2BB5A 2LGIA 3T1YQ 1J6QA 5CV6A 1P0RA 2EY1A 2Z4IA 4RH6A 1HUMA 4YTMB 1SE8A 4HPMB 3GTJB 2F0GA 2YV5A 2NBWB 4JPSA 1SGHA 2NZOA 4M0WB 4YCUA 3PS6A 1XYIA 2PZTA 3PO2G 4G4KA 1HR0Q 2LUEA 2WXNA 1PFNA 4GKJL 3J81i 4C3HG 4A3CG 4NJ7A 5M3MB 3SE0A 3BZCA 1NYQA 3EGRA 3RLFA 3GD7A 4DR1L 4IWQA 2JN4A 2Z0SA 2KHSA 5E1FA 2A19A 1VQ6A 2ZT9C 4GKJQ 4B08A 3U4EG 3VUYA 2DYMA 3SFDB 4ZHPA 3RFZB 2NVXH 4DR1Q 2LSSA 4A3MG 5J1ZA 1K53A 2CU3A 3HVDA 1TS5A 4KV6A 4PMCA 3QA8A 1GG3A 3GTQH 1HFGA 4H02A 4K2KA 5M3FH 4A3DH 1FPYA 2J42A 4P7IA 4C2MB 3DBSA 4IUPA 1RFKA 1BMLC 2JZZA 3A4RA 3W1BA 3HOUG 5IO9A 3JSVA 1L1OB 1PH3A 3T3OA 4UAIA 2Q2IA 3DWQA 1N5XA 1SYFA 5BO4B 1QUQB 1U4MA 3K5MA 2DAFA 1D4BA 1WD1A 2R92H 1PQSA 4JLCA 5FLXL 2KTRB 4JI8L 5BR8L 1PH6A 2NVYH 4IUNA 1TT2A 2KX0A 4BBRH 1NI3A 3B1LX 3PZ7A 2J53A 4Q0FA 1C4AA 3J81L 2KDMA 2RGFA 3AM9A 5ELEA 1NENB 1A2UA 2FMCA 2L05A 5LXHA 2FAZA 4JI8Q 3CQZH 1N33L 3IT4B 4ID6A 2IYDB 2RDFA 1JMLA 2HJ8A 1WH3A 2MFIA 2F0UA 4KKTA 3LYYA 3VR6A 1H4RA 4FXDA 1WZ0A 2XK5A 1FGBD 3I3CA 4C3JG 3I63C 3OAWA 2WAQB 4GU2A 1B8AA 2R6GA 4Y7NB 1L0XB 3H0GG 4ZRIA 1UGMA 3K9PB 2ENBA 1I3QH 2CJOA 2O6VD 1STEA 2Z4HA 4DV7Q 1VQHA 3HKZB 3KLSA 2E2HB 1WXVA 1F9JA 2AL6A 2N7EA 3RNCC 1R4QB 2JT4B 2MQHA 3PLUA 3I5JC 1SSOA 1Q1BA 4L63B 4BY1B 1FCLA 4M8MA 3CCUA 1C9OA 1PTOC 2PI2E 1T3QA 2B3AA 1A62A 5FLXc 2BVCA 3NVWA 2BGFA 2XSCA 4XQNA 1K73C 2FE8A 2X6LA 3AE2B 1QVGA 2F4VL 1S5FD 3R7QA 4JI0L 1OXSC 3J81c 3J7AF 5JJKA 3KF8A 1FNUA 1GUGA 1SJHD 4C3IG 1X32A 3ZGZA 2KZRA 2F3VA 2EXZA 5G3LF 1F2ZA 1YNXA 2ZTDA 5IYCG 2F4VQ 4KGRA 4JI0Q 3JVZX 5E3FA 3DWGC 2IGGA 3NHHA 4YWLA 1VZ7A 4AUQC 2K1FA 3IAM1 1CKMA 5EKLA 2OJRA 1E24A 3HEJA 4FP5D 1WXAA 3A1QB 3S16B 4ZRZA 2ASBA 2F3WA 1WGKA 2CHXA 2GB1A 2QIEB 3P4SB 1VQPA 1TS3A 3RMHA 3ZUNA 3IT6B 4RGNA 1LT3D 3PRZA 5KHQA 3UIPB 1C78A 4K5XA 2N3SA 3NRZA 3UI3A 1TZOA 1TTNA 4A20A 1WRDB 3I4LA 5EBCA 4A9AA 5AJ3L 2NBFA 1VS0A 4WWPA 3APFA 1EWHA 3NQTA 1PFMA 5ISRA 1RM6C 3TDQA 3CCEA 2JJQA 2EZVA 2M0AA 1SXTA 1ISNA 1FFVA 4O42A 1GUWA 2EYHA 3PIPA 2VB2X 3SXHA 2NVXB 2J7QB 1Q5WB 2YVCA 2KENA 3AE5B 2FIDA 3GTQB 3PRPB 1IYVA 1QB5D 3RUZA 4IW0A 1EY9A 3QK0A 1O7ZA 4OHJA 1XCTL 4ICVA 5CX3A 3J7YW 4FF1A 3NUHB 1V97A 3NEMA 2C7MB 4BS9A 4HMJA 3ZLZA 3TP6A 5IGGA 1BXTA 2UXBL 4WJ3M 1K51A 2NVYB 2VH2A 4OIKA 1IGDA 2DNCA 1E8XA 3C19A 4I6PA 5ELBA 4BBRB 2D3GA 3Q69A 2QDBA 4CJ2C 3Q24A 4B3ML 1VQKA 2J4XA 3Q3JA 4AYBB 2B8FA 4ZKBB 5C4XG 1U0LA 2UXBQ 4DGZA 4N58A 5A2QL 3DWAA 3KDFB 4IM3A 4MH8A 1R7SA 4IFDH 3CCQA 3PTFC 3S1RH 2WXPA 3ITPA 3QIAA 4EX5A 2J0JA 3V6EB 3T4AC 3U8ZA 3HOXG 4J3OD 4GNXB 1IL8A 1WCMB 4GGQA 3BDLA 3C46A 3VR8B 4MGIE 3Q8EA 4X3KA 1IYJB 4TQ1A 5FLMG 3DXJC 5FO9B 3ULPA 3ZJVA 2F0SA 5GAGC 2UU9L 2CR5A 2K0PA 1BUVT 2N9PC 3ZNID 3HOWG 4KD4A 4IKGA 1LACA 2KDFB 2MBBB 1A3VA 1J7BA 4X65L 4MELA 1I35A 4WQMA 1YQ3B 1WGDA 1C0AA 1K8RB 2UU9Q 4PZ8A 2R93H 1JCKB 1N5WA 1EIGA 4QL5A 2EXDA 2PMVA 2MP2A 3I4MG 2RHSB 2RDHA 4X65Q 1VQ5A 4JI6L 1WTOA 4XYCA 3LX0A 3HIZA 3S1QH 1E5WA 2EQSA 1AW7A 1YQBA 3NZUA 4QB4A 5M5XH 3NTHA 1QOHA 4DKAC 1K28A 2F1MA 4JI6Q 2L76A 1U9RA 4JW0A 5FR3A 4RCOA 2R7ZH 1JORA 3MFGA 2PMZB 2E6XA 1DOIA 4MM3B 2LHDA 1WXQA 1EL0A 3N52A 1WX9A 3VH3B 1HTQA 5LMNW 2INCC 3BK1A 5FR6A 4RF1A 3VHTC 1FRRA 3G6EA 1N32Q 3NZSA 2H5XA 1J0GA 4HIMA 2G9HD 4R4QA 1P1AA 2GI9A 3HUIA 1GXDC 5E4WC 4FJVB 1QZHA 5DPWA 2M17A 4CHTB 1XXGA 1P7EA 2KN4A 3HOYH 4DU9A 2K8BA 4JI3Q 2NR2A 2PIAA 5HI1A 3A33B 2WNMA 5JJLA 1D5MC 3JAML 4TKNA 1CA5A 3SK8A 2VH1A 5AFWA 1YN3A 3MA2B 1YJNA 2DLBA 1BCPC 2B2YC 2LXKA 5GAHC 5C4JH 1F52A 4JX1C 3TQYA 1LTLA 3M7GA 2LVQA 1DXMA 5C5MA 1TKYA 1HQRD 4L5QA 2DZMA 5G5GA 3NENA 1UBIA 5F2DA 3Q14C 3GTOH 4OELB 1JE4A 4HJ5A 2JA7H 1NY4A 3CMEA 2OEDA 2X8XX 3K5LA 1GC7A 3AB9A 3DUZA 1I50H 3QX1A 3TEHB 1VMCA 1JT8A 4HTHA 2A1AA 1TWHB 3IAS1 4IWOA 4P1CC 1TWFH 3A74A 3FILB 4LFAL 3K7UC 5JHAA 2VRRB 4GOCA 4J6HA 5G2NA 4EZLA 5HGQA 3J7A5 1TR5A 1VQGA 2D3AA 4MEMA 4E74A 1VQ7A 2A4ZA 1P9DU 5FJ8G 5C0XG 2NPTB 1UE1A 3BS1A 4PG3A 4YHHQ 3S2AA 1F2LA 4DHJD 1N6ZA 4B3RL 2WXIA 3HVZA 3U50C 3AE6B 2F0MA 2EJGC 2KEEA 1VZ6A 4FJYA 3I73A 2K8CA 2HJ1A 1YJ1A 2ZCCA 1IGCA 1UEAB 5CORA 2B2WA 4B3RQ 2FCMA 3ZJTA 1MI0A 2KCTA 3PUYA 1EYDA 2AHOB 1G51A 5EE1A 2L0CA 3HOUB 4KN4C 3HOZG 3PUZA 1T5EA 3H6MA 1XX8A 2OT2A 1BCPD 1I6VC 4F7XA 1PH4A 1RYJA 4RGTA 4R4TA 4ZRJA 2WHIA 4XE0A 5I6YA 1J8CA 2UUAL 2VZAA 2PE9A 1T6BX 4LNFA 2R7DA 1B53A 4HJAA 2DY8A 3TJPA 2ID0A 4C4VB 2VL6A 1KJTA 4G50A 3EQLC 2Q2UA 4M02A 4AP4C 3ZW3A 1AZQA 3GB1A 1MD2D 1B9MA 5EGTA 2L4NA 2DHZA 4W9GA 1DOYA 1WX8A 2DX5B 3M4YA 5M5WB 3RUIB 1L0WA 1MI2A 3FKYA 2HIXA 1II3A 4MTNA 1V5OA 4A3JG 2F52A 3PHWB 1E3PA 5H1SE 1PHJA 4W9FA 5E6JA 1N61A 3S1QB 2VUMH 2IX0A 3D3RA 2M0XA 5KNDA 2J0TD 3I4NH 4HXDA 2ZNVC 2NTTA 4KJOA 5EJWA 2IY0B 1FXAA 4EEWA 1PH7A 3URYA 3T51B 4JQWC 2R7ZB 2B8GA 1UH6A 2LD9A 4OO1I 1U5KA 5DM63 1S5ED 1F1HA 2IY1B 1IBXB 2PI2A 4LF5Q 2BYFA 1F2YA 4ABNA 1V1PA 3PUVA 1YJIA 3C8YA 4IPCA 1T9HA 1O7IA 3GTMH 3QR8A 2VS1A 2M9VA 1PRTF 1W2BA 2YEPB 3NOBA 2WXGA 4F88A 1HQMC 2D9UA 1S5DD 3HOYB 2B2UC 1WJJA 4BY7G 5IKCM 1AZPA 1WSPA 4HSVA 1VQJA 2WAQE 3O65B 1PZID 3PPAA 4GSWA 3GZNB 1WXMA 2HDEA 5IIFA 3M3JA 2EY6A 5C4JB 1PGXA 5AUKA 2BDNA 2ONQA 3C3LA 5C3JB 2F0HA 5D6JB 3AU4A 3TEYA 4RM8A 2PNHA 1EWYC 2NYZD 1MIUA 3MFYA 4DUYL 2M00A 2JEBI 1SE2A 2DZIA 3TL5A 1IBKL 1WMHA 5D65A 1PA6A 3GTOB 5C3WA 2D2QA 3CSTA 3H7PA 4QAYA 2VZKB 1HNWL 4DK0A 4LF7L 2JPHA 3SK6A 4DUYQ 4XZ4A 1X1MA 1QVCA 1IBKQ 2EELA 1GUTA 2QKIC 2M8SA 2WP8J 3K59A 5C2TB 4K6LA 2MJ8A 1CQVA 5IP7G 4XDXA 4CJ0B 1HNWQ 4KKJA 1A6XA 4LF7Q 4YSZB 4W9LA 1YJWA 3VA5A 2D0PA 2HQEA 4UP9A 3Q3NC 1ET6A 2HE7A 3I3TB 2L9HA 1L7YA 4XWTA 4OWWB 2Q2HA 2XGTA 4U673 4A8XC 1FYCA 4IM0A 3H3VI 1BDOA 2SNSA 5JPMC 3G7LA 5DM73 2WXFA 1UWXA 1X56A 2BYVE 5D14A 2KVMA 3W2DA 1SE9A 3AEAB 3Q6BA 1JOKA 1LT5D 1SYCA 1SNMA 3ULLA 2PLPA 1SRUA 2Z0DB 4PV1C 5C4ZA 1H9JA 1QG7A 2KJHB 1OXTA 2SAKA 5KNBA 3OJ3A 3NVVA 1NBFC 5IAAC 2JA8H 4XQQA 2O6VB 3AEGB 4I7AA 2WB1B 2LGXA 2JF5A 3K6OA 4BBSB 5BN5A 1FRDA 5HY6A 3PO3G 4HDOA 4TUUA 1AFPA 5IGFA 4LK1C 1HTPA 2G3QB 1H9SB 3P7JA 5E4XA 2ZXRA 1SDFA 2BQQA 5AZHA 2VUMB 4NP5A 4RHRA 2WU2B 4HLEA 4NKLA 5GMVA 1YX5B 5KHOA 4LJZC 3GTGB 4ARIA 3PT2B 5E6OA 4CKEA 2MGSA 1TS4A 3EHVA 2N1VA 2CHBD 1T0SC 1E1OA 1SJED 2EKEC 2KN5A 4W9IA 4OXPA 3ECIA 4EFOA 1WTPA 1H8CA 4DN4M 2A6EC 4AYBE 2ZTEA 2P5ZX 2K5VA 4JI5L 2JA6H 1QKZA 2JXMB 1U4LA 3Q0AA 3RN5A 1QZGA 2BB6A 1H95A 2KO3A 4DR3L 3ZTCA 1WD0A 1J7AA 1GB4A 3DWPA 2KC2A 2F03A 1CMXB 3U4ZA 3VYSA 4JI5Q 1C79A 2L0FA 1WGHA 1DGSA 4DR3Q 2EYJA 1LT4D 3D4RA 4XTCS 1UE6A 2CH4A 4A3LG 3FRPB 1JRPA 3QHTA 5C44H 2QSDA 2WYQA 4WURA 4WJWA 4JBWA 3A5ZB 4HROA 3PSEB 1ML0D 1FR3A 3EUB2 3QIJA 2JZ3B 1WR6E 1LTID 5IYBG 1P98A 3EVQA 4UP8A 3A0JA 2JYEA 3AN1A 2MBQA 2NZ1D 2CH4W 4XXEA 2ZM6L 1MSGA 1HXYD 5KYIA 3HOVB 2KFKA 3K80C 2LVOA 3Q8DA 1E7VA 1XPUA 1P3QU 1C8CA 3EJIA 4IJHA 1Z5SB 2WXJA 4OZBA 4ANUA 5G3LD 4HJ7A 1WTQA 1XD3B 5M3MH 4EQOA 2V1CC 1JC7A 1VQEA 2LVPA 1VDZA 3A7AB 1HRJA 2NMQA 1SBBB 2PMZE 2O2VA 1QNKA 2N9EB 2KT7A 4QJFA 4FNFA 3JYUA 3NVZA 3DBRB 3H3VC 5M3FG 4A3DG 2DGYA 2BWFA 2WXMA 4ZYNA 1JRUA 3CWIA 1EF5A 3S1NB 1ACCA 4QF4A 3U30A 3DBLI 3T16A 4LAAA 2YTXA 3TP5A 3U9SA 4C2MH 1H9RA 5L37A 2UUCQ 2ALYB 4H13C 2K6QA 4Q2JA 2JYOA 4A3FG 2R92G 1N62A 2F0FA 2AUJD 1WFQA 5LMUL 2KX3A 4RGMA 1PH5A 1WYGA 4OEMB 3VTUA 3ND9A 2CHZA 3CAMA 2ZZPB 4GN3B 5C3XA 4JYAL 1CZPA 2Z8LA 1WWTA 2BW2A 2GN5A 1GC6A 3J7AV 3ZQ4A 3CPFA 3KWVA 4P2CB 1MSHA 2LXAA 2XIWA 5EDSA 3WAPA 2MNAA 4C80A 4JYAQ 1S72A 1HA6A 2PVGC 3AMUA 3ML8A 2JP1A 3PZDA 1SNPA 1NJIC 2JA8B 1RHPA 1PH9A 2Z9HA 3N1YC 3N1XC 3PLVA 3CRKC 1NMGA 1HHVA 1UNSA 3A7LA 2OF1A 5J3BA 4Q5VA 4A3IB 3KOJA 2M2LA 5IT9E 4BXXH 4FHJA 3PGZA 3MXNB 1W6KA 5FO8B 1VQOA 1WTWA 2V9HA 2E2IH 3KF6B 3TS0A 1E10A 3OPOA 2KA7A 2WLBA 4X6AH 1SEBD 4ZUJA 4LUOA 2PO4A 4A3KB 3CIRB 1Q90A 1W6JA 1JQYD 1AWDA 1WGGA 2DJGC 4IUUA 4LUZA 3FC4A 1VZ8A 5DNFA 2E2HH 1HEZE 2INNE 2SOBA 3FDTA 4QUFA 4BY1H 1DZ1A 5IGCA 1OEYJ 1VQBA 2B2WC 2F0EA 2HD5B 2CJNA 3VR9B 1L1OA 2H88B 2J0KA 3HHMA 1QT9A 3ONSA 3ETRA 1C76A 2D5GA 4HPPA 2YTVA 2RSOA 4PZ6A 2NCNA 4JIOU 3GE8C 4C00A 4HJ9A 4G7ZC 4R4OA 2KTRA 4DR6Q 5C44B 1CT1D 3SK5A 4IUVA 4A93H 4X3TA 1SIJA 1FEHA 1JICA 4KX6B 4XGAB 3V6CB 3K9OB 2KMMA 3RN2A 4KHPL 1YX6B 2X69A 5HFYA 3JC66 5DAUA 1OTRB 1XO3A 3EFXD 1K8OA 2I1JA 3TBLD 3ZXRA 3ZIMA 4DV5L 4OX9L 1E0ZA 1YIWA 3S16H 2G4DB 4P71A 2MLBA 1JROA 4XX5A 1MJDA 3EN2A 3M3YH 4W9KA 3VR3A 3WANA 2PYKA 4K1RB 1RIPA 2XTIA 2VW9A 1Y14B 3W5UB 1D8LA 3V2TA 2GBJA 4DV5Q 4OX9Q 1LTSD 4YY3L 2RDGA 1LQBA 3VDYA 1WJ6A 4V0BA 3WAOA 5D3DA 3S2HH 4FJZA 3KYHC 3MXGA 4OWTB 4FF2A 4LJPB 2W3RA 4HSPA 2LKVA 1UZXB 4ITKA 3VYTA 2V1YA 2K14A 4YY3Q 3U7ZA 2K5DA 2AWTA 5C0XI 4ZCKA 2Q2TA 2WKCA 2BS4B 2VZKD 3H91A 5J22A 2MX2A 3AV8A 2E5LL 4J8QA 4DHJB 1SMXA 3U7DA 1R4MI 1T0YA 1VMPA 3I70A 5D3IB 4UDUC 3EFUA 2AKWB 2KFJA 3TMEA 4NQLB 2WXHA 1AYFA 4A3BH 2E5LQ 3DVNU 3BVGA 1STNA 1ZW7A 3ULJA 2RSUA 2MCNB 3IFTA 4MZ9A 3HGBA 2E2DC 4KGSA 1NDDA 1TKEA 4FXGC 2KQSA 2L3ZA 3VRAB 2KDBA 3HK0A 4A3GH 2K5HA 1CKNB 3PO0A 4HWIB 4B9KA 3M4PA 3B2GA 1PYBA 1BCPB 1PV4A 5EKKA 1VCBA 3I2ZA 3AECB 2EMSA 4N6EB 3PQIA 5EBDA 2HCIA 2K05A 4LNKA 1MHXA 3DOWA 3L7ZC 5BR8Q 1DOXA 1R9TB 2N4FA 1U4PA 4X66L 1XT9B 4H0LC 2DYOA 1JOQA 2C35B 4P1BC 1TKGA 3E3XA 3QB3A 3RZDH 1LTTD 2E2IB 4NPNA 2XWJB 3U9OA 4MACA 2F0LA 1D6EC 1WCMH 4DAYB 1N33Q 2A8VA 2ZEQA 3GP7A 1KAAA 1FM0D 4ODGA 1YNNC 1JJ2A 2RMMA 1UAPA 4R8NA 1PH8A 4KTAA 4IUTA 3STBC 2E2JB 5KGUA 2I1KA 2L12A 4QY7A 2C9WB 3JW0X 4CYEA 3H6NA 2R93G 1TIFA 3GS2A 3QCAA 3PUXA 3RD2A 4KKIA 1IYUA 3KH0A 1KOTA 1ENCA 3MZ5A 4R3DA 3CP0A 1PRTC 3RZOH 3FPUB 5JEAJ 2JUOA 2FMMA 4N9TA 2OTLA 2AQ3B 2XVSA 4J1MA 2GMIC 3ZNHB 4L5SA 2KACA 2KDEB 3A9KA 2QJLA 4TV3A 1STGA 4URKA 3WDNA 5K36H 2K28A 3AFPA 3SK4A 1WTXA 1GUNA 1PUTA 3GO5A 2N7DA 2KOLA 4WJNA 3R7RA 3FKIB 4RKBA 4A93B 1RAXA 2KKCA 4GZYC 3S2DH 1KD1C 3T56B 1GAQB 5JJZA 2LZ6A 5KNCA 4HIOA 4DPGA 3H09A 4MN3A 4WFN3 1N8RC 2KWVB 2KUMA 3KDFA 4ZRKA 3VQIA 4DV3L 2NZHA 2WXRA 3M85A 2L15A 5CMDA 5NUCA 1PH1A 1Q0WB 4IURA 1QOAA 4LK0M 1Z2MA 4X57B 2MHVA 1SAPA 3NSWA 2AYOB 4A3EG 4DV0L 3DQVA 4CKCA 2CFMA 3A8KE 3M3YB 4JI4L 3J9CA 4ZRPA 3T8MA 3FHWA 1I5FA 1LABA 2E76C 4NXNL 4QIWB 2ICEC 3FAHA 2JK8A 4GOPB 2MPMA 4BOSC 2E8GA 2BPSA 1Y8NB 3AEVA 4H7BA 4JI4Q 4NAWA 4PYZA 1YNND 3S2HB 1V6EA 4KSKC 1BNZA 4NXNQ 2VQFL 4OO1H 2ZNVB 1GHJA 1CM9A 3STBD 1RTNA 5C3EG 2D62A 1EIHA 5D7GA 2JA7G 1I4QA
chains in the Genus database with same CATH topology
1K8MA 3SFEB 4K5VA 2PW7A 3NWTA 1PRTD 4JWSC 1YMHE 1PTOD 3WOFA 4YWGG 3SDZA 3KWLA 3GTPB 4BWGB 4A3BB 3D4DA 4XYQA 2IX3A 1UWMA 3I57A 3SVMA 1S5CD 2NN6H 1ZKOA 4DK1A 4A3GB 4FXCA 2IL8A 3I91A 2H4OA 2Q8TA 3M4OB 1IKMA 1Y56A 1ZYRC 1UUPA 4KD3A 2ON8A 2DNEA 2TSSA 2SDFA 5AUIA 2WDQB 4F8MA 2VXWA 3AB5A 5EQ0A 3ZYYX 2B63B 4X3SA 4PQXA 3RZDB 2JSOA 2WKDA 1NVID 4KGTA 2E3TA 1CHQD 1Z6HA 1ZEQX 1BF4A 3MHZA 2H89B 3PZ8A 2JX5A 3UI2A 1EFID 5ELFA 3TEWA 1ZDXA 1M4VA 2FJ2A 5LL6S 3K58A 1K50A 2RBMA 1G291 3RZOB 4CGYB 4S3SA 4HMIA 1Y1WB 1QOGA 2N0SB 1NAPA 1CQFA 5ELCA 3P4PB 4HR7B 4D2KA 5BYQA 1V43A 3S2DB 1DM0B 2PW5A 5C0XJ 1QWYA 2V4IB 4RCNA 2LS01 4XT3B 1ZYRD 3D4WA 1EEID 3FMCA 3NK9A 2EJFC 3KK7A 4TQ0A 4ZRQA 3E6ZX 5FO7B 4ZUIA 2W82A 4WIPA 5KEEA 3OWEB 1U4RA 5CV5A 2JA5B 5JVG3 3CRLC 2N88A 2XRSD 4KKUA 1GUSA 4XT1B 3M7NA 1L4ZB 5I9PA 1Y1VB 1SFOB 5EPKA 2N7JA 4R8IA 2K1BA 4YTNB 2F0NA 1T5XD 1MVKA 4RKLA 5BMHA 3I90A 2W54A 2KQ4X 2XNAC 3ERQA 1EY4A 1E9MA 2PTLA 4MT5A 3R8BA 4RHSA 4EQNA 1KF6B 5HURA 3PO2B 3A55A 1XCQL 4C3HB 4P16A 5CGKA 1B44D 3Q8AA 1PDXA 1L6VA 4NMZA 1TS2A 4OVZA 2I2YA 5JEAH 4DXGA 3J80E 1DJRD 2E75C 1STHA 4A3MB 4YSYB 1V8QA 1ZE3D 3K5NA 5K5PA 2AQ1B 3MHBA 2F0PA 5I6WA 2IX1A 1DGJA 4C7ZA 1ICWA 1EY0A 1BBXC 2ZW1A 3AE8B 3VR4A 1D1KA 3NTIA 1Q8IA 1E2VA 4M1UB 2I46A 1DCZA 1LTBD 1TQOA 4C1NK 1CFMA 3X3NA 2EVBA 4C1NI 3NUCA 4R9WA 4C3JB 3BDCA 3KQ4A 4YTPB 1G8ZD 3H0GB 1K83B 1NUCA 1JWUD 3PUWA 1STAA 3H94A 5IGDA 2L11A 1EU3A 4KHZA 1YJJA 3R3OA 3L3OC 2LFIA 2EPBA 1E2ZA 5TSSA 3IXSA 3WCQA 1Y69U 4LLGM 1OFFA 2BOSA 4N9PA 4A55A 3D31A 1EM7A 1MHHE 2F0TA 2WINB 2WQYB 4GDLB 4ARCA 1Z7TA 3EROA 2WXQA 1KDCA 4C3IB 3MVVA 1D2BA 1FD6A 1KTKA 2JQRB 1GHKA 2QILA 4CKBA 2EOTA 1H9SA 3NZ3A 4HN7A 2K22A 2HDMA 1PTOH 4IN3A 4A90A 4NAMA 2NVTB 3QOJA 1JW9D 2L32A 3OIQA 2OEOA 4RA8A 1EU4A 1CZWA 1DYQA 1QILA 4RAUC 2R3ZA 5HG2A 3I8ZA 4OZAA 4B9XA 2K5WA 1FD7D 3Q6SA 1L0VB 4FVMA 3C1EA 2G9DA 3P75A 2O4XA 1LV9A 2F0DA 4EE2A 1M8AA 2BS2B 1I4XA 1B3AA 5IODA 1GJXA 1I7HA 5C0XH 2FFKB 2LHEA 3RPFC 1ESFA 1VF7A 4OZCA 2LJIA 1AP0A 1FMAD 3HP3A 1TY0A 1SE4A 2B2TA 4DNRB 5C4XB 1IW7C 1PZJD 2KECA 4XDDA 3OIPA 1KDAA 2K6AA 1RKNA 2AQ2B 2QCPX 3BWUD 3OW7A 3S17B 3HOXB 3TEZA 5M5YB 2I38A 1XF5L 1O7YA 3IFDA 3PIO3 1PFBA 3NBHA 3HOWB 2XWBB 3W1SA 5KIXA 5CYUA 4IQZA 3S15B 3QWNA 3FPPA 4YT0B 1BO0A 2B2VA 4KKSA 1IUEA 4H44C 3I4MB 1EY6A 2M56B 1O78A 1E2WA 1F0ZA 1VJKA 2K9XA 4HKZE 1A70A 4OL7A 3MXUA 1XLOA 4CQNA 5I9OA 4LTUA 3AMZA 4HKQA 2Z1CA 4ZLTF 4ZHOA 2K01A 2BTEA 2C9OA 1VR9A 4ILWA 1N60A 1QE6A 3D6WA 5BYSA 1NR2A 2FHTA 2N9KA 1RWSA 1A3UA 1IW7D 1PRTB 1QNUA 3PMFA 1FIQA 1PTOB 1EQTA 4KJNA 5G5HA 2EYLA 2BT6A 4JK1C 2N55A 5FOBB 5CV8A 2TMPA 4H2AA 2MUYA 2HCCA 4IUQA 3WOEA 2A6ED 4IALA 4K8IA 1ONLA 1SNOA 2J7ZA 2FBWB 1I4HA 1O80A 2M19A 3AEFB 1PDQA 1CZGA 3LB8C 4WRDA 2JE6I 2GRIA 1BR9A 1I4PA 1YN4A 4IOIE 1A15A 2PPBC 1ILPA 2A6HC 1LTRD 4LMQD 1V1OA 2K3UA 4WAFA 2EYPA 3Q8FA 4B9WA 3QO2A 1MPEA 3NVYA 2LEKA 4O1NA 2OXPA 1Q10A 4M0WA 2V3PA 4C7YA 4WH4A 3K7AB 3K0YA 2W55A 3LWEA 2EYOA 1GPXA 4RNAA 3TUOA 2WDVB 5IGEA 3S14B 1D1IA 3HOZB 1I6HB 2JYTA 3NBIA 2MJEA 4G57A 1QCBD 2CQAA 2I07B 1H9MA 5JVH3 2LMCB 1TU2B 1FFUA 1KABA 3ZJUA 1XLQA 1STYA 2K5PA 1QF6A 4NJCA 1C9FA 5K36G 3P20A 1EZ6A 2KAJA 1ROEA 4A3JB 5HHDG 1J9OA 1XWEA 4OW0A 2GA4B 2B2YA 3B9JA 2A6HD 2IJ0A 2JEAI 3V96A 3ND8A 1Q1EA 2WS3B 2E74C 3MJ5A 5FLXE 1Q3LA 4I65A 3SR1A 1X3QA 2R61A 2KQ3A 3MP9A 2EY5A 3J81E 4EVOA 3QG1A 4TQUS 5JAVA 5EE0A 3OWFA 1PYWD 4ZK9B 1K52A 2A68C 2O2LD 1PZKD 4BY7B 3BYTB 3DM1A 1HCZA 2IGDA 5A35A 1HPCA 5BN3A 3TZUA 3L9AX 2F0IA 5IT9L 1XLNA 3R2TA 3MWYW 1FNWA 3TBIB 2G1EA 4XDCA 1JOOA 4PT5A 4TMAB 1D5ZC 1JALA 4K14A 1I4GA 2NN6G 1XTCD 4XYOA 2BBCA 2FUG1 1BOSA 1S5BD 2PZUA 1KFYB 5CV7A 3Q23A 2O5JC 2SNMA 2Y5PA 3DMUA 5IOCA 1JB3A 5T1IA 3P4QB 2IWHA 2F0QA 1SE3A 1EQVA 3OMCA 3SR6A 3C2PA 1QOBA 4L6TB 3OOCA 4C56C 4IFDG 3MTSA 3S9WA 1AEXA 3S1MB 1TWAB 2F0JA 2A68D 1C4QA 5BMGA 5MPOA 3AE7B 4L8JA 1CTMA 4X3UA 3DEOA 2MJ3A 3P4RB 2YYZA 3E5SA 1C4CA 1CHPD 4TRDA 1I4RA 1D5XC 3PO3B 2B2UA 5LHY1 1EY7A 5C4HA 5BYRA 5GXGB 5T1GA 3TEXA 4KY7A 3D6CA 1JWMD 3FVQA 2L52A 4IZ8A 2PKOA 2AX5A 4I7ZC 3DWMA 4XQJA 3AEEB 3BG3A 5HGTA 2B2TC 3PV0A 1P7FA 2A69C 1GOZA 2DWQA 3A8IE 4PNYA 1EWCA 4L1BA 3VR2A 1F77A 3W3AA 4OIJA 5CV9A 3GTKB 5A2QE 2L83A 1STBA 4ZAIA 3KLSX 5CBAE 2Q8IB 3KLRA 5KYLA 1B9NA 3C1FA 1ZXHA 2V4DA 2K03A 3QJYA 3D8GA 2B2VC 3I72A 2KWDA 2WXOA 1WVLA 2WU5B 1NR4A 4RGOS 2BA0A 2MEKA 5COYA 3RD4A 4ULLA 3AE1B 3AU7A 2B39A 1Z47A 3N9YC 1SNDA 2BE5C 3P42A 4US9A 5JEAG 1TKWB 3ONAB 1ENAA 1G2SA 5M3FB 4A3DB 1QOFA 2A69D 2AWNA 4TKOB 1F2MA 3T3NA 4K6DA 5C5LA 3NP8A 1SF0A 5H8YE 1L0YB 2IDYA 2JSVX 2JWUA 3Q8BA 4A3FB 2R92B 3NXWA 1L4DB 1WTVA 3JAME 3U2SC 1NEKB 2W3SA 1EY5A 2ACZB 1NCVA 5LL6X 3CQZB 3G6JB 3AEDB 3FILA 1F9RA 3GV3A 4DA2A 4K5WA 2RVLA 3V05A 2RQXA 1ENFA 4REZA 1TY2A 2A73B 2EY2A 4NAWB 1I3QB 2F0VA 1HZ5A 2BE5D 4AS1A 3BDOA 3BIID 2RKSA 1DD2A 3MXPA 4FYDA 2Y3AA 4YIJA 1QJOA 2CW0C 3W5VB 2PZWA 1G6ZA 4G7OC 1EYCA 2IPKD 1DOLA 3OSOA 2YEPF 1VLBA 1ILQA 2NTSA 1J7CA 4IDIA 1GB1A 2MH7A 2VB3X 4DXFA 1L6UA 1ZPSA 4N59A 1R4PB 4BA1I 2LUMA 2PCFB 3LXFA 2FINB 2J52A 3CU7A 2INPE 1E6EB 1JWAD 1OQQA 2BCOA 1HA5A 1HTLD 1PGAA 1AN8A 3W9CB 1SMYC 5DEHA 1RCVD 2WXLA 3N6RA 2CVRA 1VCIA 2K5QA 1SSNA 4US8A 1X3PA 3NS1A 2IW3A 4HRSA 3IKJA 4M8AA 2Y5CA 5I2XA 3E9SA 1C48A 1GUOA 3IAYA 1YNTE 3LNNA 3K57A 1OQRA 1B1ZA 1BUIC 4GDKB 1ET9A 1IBXA 4JWUC 2X6GA 3VRBB 5EPLA 2PVOD 5JOBA 2CW0D 1CA6A 3E56A 2YU9B 1IHZA 1LTAD 1PLFA 1SNCA 4CJ1B 4DNTB 1TWCB 2ZW0A 5CV4A 5T8IA 1FXIA 5CR3A 2K33A 1RJTA 3IL8A 2H1EA 4YSXB 3FEWX 1KLUD 2BYTA 3MC0B 2XRQD 5I4DA 2AUKA 1A3TA 2EYFA 4DAVA 1KNEA 1FNVA 4GLSC 2L1BA 4FF3A 4HEA1 1G2TA 3NTKA 1DOKA 2OHFA 2X38A 1SMYD 5FK9C 1NYRA 4JE3B 3HZXA 5IGBA 5EKIA 1RF2D 4OGQC 3S1RB 1F9QA 2AWOA 5JXVA 5LNK1 5ELDA 3P1HA 3SHLA 3AE4B 4RFBA 1B2TA 3CHBD 1SYGA 2RSNA 4KI0A 3KBGA 1KH0A 2KEDA 1B9RA 1CJEA 5BN4A 3OHXC 1OO9B 3P1MA 4B0EA 2R93B 5I2YA 1RDPD 1SYBA 4ZOHC 1J8IA 1DONA 2WV6D 1Y8PB 2WXKA 1OXUA 1QQRA 4E6IA 3E0JA 1BQQT 3KBXA 4ZKCB 3TN2A 5M5XB 4U68A 3VYRA 4KMUC 4AQ7A 1YNJC 3VR5A 1PGBA 4Z9CB 2F4IA 1A2TA 3NE5B 3SEBA 2Q8RE 1H9KA 4KY6A 3J80L 1B50A 3AE3B 1LTGD 4XIGS 4KHVA 2MP1A 1LLRD 2K32A 1XLPA 4EGVA 2LY7A 3BZDB 1PTOF 3GTLB 1YQ4B 4MHEA 4DAPA 4A3EB 4EQPA 2KCNA 2EE1A 3R93A 3U52E 2NN6I 1C4PA 1SYDA 2QEJC 1RTOA 1KDBA 4NW2A 2QF7A 4HCEA 4ZQ3A 3K5OA 2D2CC 1JWBD 5C3EB 2JA7B 3F2UA 2ZXOA 1WTRA 2WDRB 1I50B 1G91A 1B4OA 1Y8OB 2B76B 3X3MA 2MJDA 4K8JA 2VNUD 1TWFB 1QLBB 1L5PA 3MEHA 3L4PA 2HDLA 4IFDI 3DHQA 3R2IA 2PQEA 2RPVA 1YNJD 3VYUA 3CKIB 3TP7A 1F2RI 5J39A 4QUCA 2D5DA 2HTME 4A6QA 4HJGE 5BMIA 3ABVB 1JQ4A 4G7HC 4TSSA 1ZXIA 4YXDB 4DF7A 3QOLA 3HRZC 1DOMA 2KJXA 1V8CA 3TSSA 1V1PB 2WIIB 4PMBA 2DY7A 3KUPA 1EY8A 2PW9A 1SYEA 1F9PA 1TWGB 4FO2A 2SEBD 1E0BA 1O7LA 1Q12A 4HCSA 2JZPA 3BYYB 4RWSC 1F9SA 1PXUA 5CC4A 1HUNA 2L1AA 1SB3C 4L23A 4FXKC 4QCLA 2IGHA 3GV6A 2BDOA 1TYGB 3I4NB 2NB0A 2N9LA 1EEFD 2K04A 3B2FA 1YN5A 3MAQA 2WP9B 1E7PB 3AEBB 2QMTA 3Q8CA 1EOTA 2BS3B 1KRHA 3MXNA 2Q5WD 3GTMB 3T53B 3EA6A 1FO4A 1OXVA 5FKAC 4CBVA 3TP8A 4FF4A 4B0MA 2HUGA 1ZOYB 1KLGD 2F0KA 3T13A 1PMRA 5EPJA 1ZXTA 2BA1A 2LMCA 1VRAB 1KNAA 2PNRC 1SNQA 2L55A 3NQIA 5C6AA 2A74C 2JU6X 4RF0A 2EYMA 3V3XA 1HFNA 1RODA 1C77A 1XEEA 1F2RC 5JPNC 4PMWA 4F87A 1TVXA 2EJMA 1MBYA 3NPPA 2NVQB 3BVZA 1OXXK 4K2LA 4P6VF 1LT6D 1BCPF 4NZLB 3BK2A 3VA7A 3HRDD 3DEPA 2KCCA 1JWSD 2IT1A 2LFNA 3AH7A 2L5TA 4MIUA 3A56A 3I9V1 1EZ8A 3TZDA 3H8HA 1VDVA 4WORA 4ZYSA 3BVMA 3Q22A 5EE3A 4ME5A 5KRUA 2K7VA 1TJEA 1CK1A 2F0WA 3A8JE 1EYAA 1WRIA 2V0GA 1VF5C 3PIP3 4HAEA 1ZDVA 5M9OA 1LO5D 2NUCA 1ESRA 4L2YA 2XN9C 2NWGA 4BA2I 4USAA 2A5HA 5EE9A 1JR0D 2ICIA 2F0OA 4KK7A 2JXTA 2C5CA 2WACA 2Y0SB 4V190 1RD9D 3HG9A 3GQBA 3AE9B 5CBEE 2JA6B 2V3NA 4XWWA 3LWUA 1TIID 1ZUD2 1NSNS 4WWMA 4DFAA 1MGSA 2RA4A 1PFDA 3P63A 2DN8A 4KY5A 2DBYA 1IKLA 2O5IC 4IFDJ 1CI3M 3OMGA 4DAYA 5H92C 1UGJA 4QMGA 1ZP0B 1S4ZA 1FCCC 4OO1G 3A54A 3HS0C 3O13A 4HEDA 1HZ6A 2EKIA 2EDGA 1N63A 4NDXA 2ZXPA 4DQOC 3NWSA 4KN7C 2BB5A 2LGIA 5CV6A 2EY1A 2Z4IA 4RH6A 1HUMA 4YTMB 3GTJB 2F0GA 4JPSA 1XYIA 2PZTA 4G4KA 2WXNA 1PFNA 4C3HG 5M3MB 3SE0A 1NYQA 3EGRA 3RLFA 3GD7A 2KHSA 5E1FA 2ZT9C 4B08A 3U4EG 2DYMA 3SFDB 4ZHPA 3RFZB 2CU3A 3HVDA 5J1ZA 1K53A 1TS5A 4KV6A 4PMCA 1HFGA 4K2KA 2J42A 4C2MB 4IUPA 1RFKA 1BMLC 3T3OA 4UAIA 3DWQA 1N5XA 1SYFA 1D4BA 1U4MA 3K5MA 1WD1A 5FLXL 4IUNA 1TT2A 1NI3A 3PZ7A 2J53A 4Q0FA 1C4AA 3J81L 2KDMA 3AM9A 5ELEA 1NENB 1A2UA 2FMCA 3IT4B 4ID6A 2RDFA 1JMLA 2F0UA 4KKTA 3LYYA 3VR6A 4FXDA 1FGBD 3I3CA 4C3JG 2WAQB 2R6GA 4Y7NB 1L0XB 2ENBA 2CJOA 1STEA 2Z4HA 2E2HB 3HKZB 3KLSA 1R4QB 1SSOA 1Q1BA 4L63B 4BY1B 1FCLA 1PTOC 1T3QA 3NVWA 2XSCA 4XQNA 2FE8A 2X6LA 3AE2B 1S5FD 1OXSC 3J7AF 3KF8A 1FNUA 1GUGA 1SJHD 4C3IG 1X32A 3ZGZA 2F3VA 2EXZA 5G3LF 1F2ZA 4KGRA 5E3FA 3DWGC 2IGGA 3NHHA 1VZ7A 3IAM1 5EKLA 3HEJA 4FP5D 3S16B 4ZRZA 2F3WA 1WGKA 2GB1A 2QIEB 3P4SB 1TS3A 3RMHA 3IT6B 4RGNA 1LT3D 1C78A 4K5XA 3NRZA 3UI3A 1TZOA 4A9AA 3I4LA 5EBCA 2NBFA 1EWHA 3NQTA 1PFMA 5ISRA 1RM6C 3TDQA 2EZVA 2M0AA 1SXTA 1FFVA 4O42A 1GUWA 2EYHA 2VB2X 3SXHA 2NVXB 3AE5B 3GTQB 1IYVA 1QB5D 3RUZA 1EY9A 1O7ZA 4OHJA 1XCTL 3J7YW 4FF1A 3NUHB 1V97A 4BS9A 4HMJA 3TP6A 5IGGA 1BXTA 1K51A 2NVYB 4OIKA 1IGDA 2DNCA 5ELBA 4BBRB 3Q69A 2QDBA 4CJ2C 3Q24A 2J4XA 4AYBB 2B8FA 4ZKBB 4DGZA 4N58A 5A2QL 3DWAA 4MH8A 1R7SA 4IFDH 2WXPA 3ITPA 3QIAA 3T4AC 4J3OD 1IL8A 1WCMB 3BDLA 3C46A 3VR8B 3Q8EA 4X3KA 4TQ1A 3DXJC 5FO9B 3ZJVA 2F0SA 2K0PA 1BUVT 4KD4A 4IKGA 1LACA 1A3VA 1J7BA 4WQMA 1YQ3B 1N5WA 2PMVA 1JCKB 1EIGA 2RDHA 1WTOA 3LX0A 1AW7A 4QB4A 3NTHA 1QOHA 2F1MA 1U9RA 5FR3A 4RCOA 1JORA 3MFGA 2PMZB 2E6XA 1DOIA 4MM3B 2LHDA 1WXQA 1EL0A 3N52A 3BK1A 4RF1A 1FRRA 2G9HD 2GI9A 3HUIA 1GXDC 5E4WC 4CHTB 1XXGA 1P7EA 2KN4A 4DU9A 2PIAA 5HI1A 2WNMA 1D5MC 3JAML 1CA5A 3SK8A 5AFWA 1YN3A 3MA2B 2DLBA 1BCPC 2B2YC 4JX1C 3M7GA 1DXMA 5C5MA 1TKYA 1HQRD 5G5GA 5F2DA 1JE4A 2OEDA 3K5LA 3AB9A 3DUZA 1VMCA 4HTHA 1TWHB 3IAS1 3FILB 4J6HA 1TR5A 5C0XG 3BS1A 1F2LA 2WXIA 3HVZA 3AE6B 2F0MA 2EJGC 2KEEA 1VZ6A 3I73A 1IGCA 1UEAB 5CORA 2B2WA 3ZJTA 1MI0A 3PUYA 1EYDA 5EE1A 2L0CA 3HOUB 4KN4C 3PUZA 1T5EA 3H6MA 1XX8A 2OT2A 1BCPD 1I6VC 4F7XA 1RYJA 4RGTA 4XE0A 5I6YA 1T6BX 1B53A 2DY8A 2ID0A 3EQLC 1AZQA 3GB1A 1MD2D 1B9MA 5EGTA 2L4NA 1DOYA 3M4YA 5M5WB 1MI2A 1II3A 5E6JA 1N61A 3S1QB 2IX0A 3D3RA 5KNDA 2J0TD 2NTTA 4KJOA 5EJWA 1FXAA 3URYA 3T51B 2R7ZB 2B8GA 4OO1I 5DM63 1S5ED 1IBXB 1F2YA 4ABNA 1V1PA 3PUVA 1YJIA 3C8YA 2M9VA 1PRTF 2YEPB 2WXGA 4F88A 1HQMC 2D9UA 1S5DD 3HOYB 2B2UC 1AZPA 1WSPA 4HSVA 1PZID 2HDEA 5IIFA 2EY6A 5C4JB 1PGXA 5AUKA 2BDNA 2ONQA 3C3LA 5C3JB 2F0HA 3TEYA 1EWYC 2NYZD 3MFYA 2M00A 2JEBI 1SE2A 5D65A 3GTOB 5C3WA 2VZKB 4DK0A 3SK6A 2EELA 1GUTA 2QKIC 2WP8J 3K59A 5C2TB 4K6LA 2MJ8A 1CQVA 4XDXA 4CJ0B 4KKJA 1A6XA 4YSZB 3VA5A 2HQEA 1ET6A 2L9HA 4XWTA 4U673 1FYCA 1BDOA 2SNSA 5JPMC 3G7LA 5DM73 2WXFA 1UWXA 5D14A 2KVMA 3W2DA 3AEAB 1JOKA 1LT5D 1SYCA 1SNMA 2PLPA 4PV1C 5C4ZA 1H9JA 1QG7A 1OXTA 2SAKA 5KNBA 3NVVA 4XQQA 3AEGB 2WB1B 3K6OA 4BBSB 5BN5A 1FRDA 1AFPA 5IGFA 4LK1C 1HTPA 1H9SB 3P7JA 5E4XA 2ZXRA 1SDFA 2VUMB 4NP5A 4RHRA 2WU2B 4NKLA 4LJZC 3GTGB 4ARIA 4CKEA 2MGSA 1TS4A 2CHBD 1SJED 1WTPA 4DN4M 2A6EC 1QKZA 2JXMB 1U4LA 3Q0AA 2BB6A 1WD0A 1J7AA 1GB4A 3DWPA 2F03A 3VYSA 1C79A 2EYJA 1LT4D 3D4RA 4XTCS 3FRPB 1JRPA 4WURA 2QSDA 4WJWA 4JBWA 4HROA 1ML0D 1FR3A 3EUB2 1LTID 3EVQA 2JYEA 3AN1A 2NZ1D 4XXEA 1MSGA 1HXYD 5KYIA 3HOVB 1C8CA 3EJIA 2WXJA 4OZBA 5G3LD 1WTQA 4EQOA 1JC7A 1VDZA 3A7AB 1HRJA 2NMQA 1SBBB 1QNKA 4FNFA 3NVZA 3H3VC 2WXMA 3CWIA 3S1NB 1ACCA 4QF4A 3T16A 4LAAA 3TP5A 3U9SA 1H9RA 4Q2JA 4H13C 2JYOA 1N62A 2F0FA 2AUJD 4RGMA 1WYGA 3ND9A 5C3XA 1CZPA 2Z8LA 1WWTA 2BW2A 3J7AV 3ZQ4A 3KWVA 4P2CB 1MSHA 2XIWA 4C80A 1HA6A 2PVGC 3AMUA 2JP1A 1SNPA 2JA8B 1RHPA 3CRKC 1HHVA 1UNSA 3A7LA 2OF1A 4Q5VA 4A3IB 5IT9E 4A8XC 2M2LA 1W6KA 5FO8B 1WTWA 1E10A 3OPOA 2KA7A 2WLBA 1SEBD 4ZUJA 2PO4A 4A3KB 3CIRB 1Q90A 1W6JA 1JQYD 1AWDA 4IUUA 3FC4A 1VZ8A 5DNFA 1HEZE 2INNE 2SOBA 3FDTA 4QUFA 1DZ1A 5IGCA 2B2WC 2F0EA 2CJNA 3VR9B 2H88B 1QT9A 3ETRA 1C76A 2D5GA 2RSOA 4G7ZC 5C44B 1CT1D 3SK5A 4IUVA 4X3TA 1SIJA 1FEHA 1JICA 4KX6B 2KMMA 2X69A 5HFYA 5DAUA 1XO3A 3EFXD 1K8OA 1E0ZA 1JROA 3VR3A 2PYKA 3W5UB 3V2TA 1LTSD 2RDGA 4V0BA 5D3DA 3MXGA 4FF2A 2W3RA 4HSPA 2LKVA 4ITKA 3VYTA 3U7ZA 2K5DA 5C0XI 2WKCA 2BS4B 2VZKD 3H91A 5J22A 3AV8A 4J8QA 1VMPA 3I70A 5D3IB 4UDUC 3TMEA 2WXHA 1AYFA 3BVGA 1STNA 3IFTA 3HGBA 2E2DC 4KGSA 1TKEA 4FXGC 3VRAB 3PO0A 3B2GA 1BCPB 5EKKA 3AECB 4N6EB 5EBDA 2HCIA 2K05A 1MHXA 3L7ZC 1DOXA 1R9TB 1U4PA 4H0LC 2DYOA 1JOQA 1TKGA 3QB3A 1LTTD 2E2IB 2XWJB 3U9OA 4MACA 2F0LA 1D6EC 3GP7A 1KAAA 1FM0D 4ODGA 1YNNC 2RMMA 1UAPA 4R8NA 4KTAA 4IUTA 2E2JB 5KGUA 2L12A 3GS2A 3PUXA 4KKIA 1IYUA 1ENCA 3MZ5A