1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
b'SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
1RD9D 1BCPB 1BCPD 1PTOB 1PTOD 1LO5D 3TSSA 1D5ZC 1SBBB 3GP7A 1I4PA 1L0YB 2NTSA 1KLGD 1CQVA 1L0XB 1FGBD 1EEID 3DWQA 1S5BD 5D3DA 1SXTA 2CHBD 4L6TB 1PZID 1V1PB 1UNSA 1LT6D 4OHJA 4RCOA 3KLSX 1YN3A 1S5CD 4RGOS 4RFBA 2J4XA 1B44D 1JQYD 1TS2A 2IJ0A 4UDUC 3URYA 3EFXD 1TS4A 4L63B 4RGMA 1F77A 1FD7D 2IPKD 5FK9C 1LTBD 3DWPA 1GOZA 1XXGA 1D6EC 1ESFA 1SE3A 3OWEB 4O1NA 1PRTC 4RH6A 3V05A 4TSSA 1XTCD 1T5XD 2Z8LA 1JCKB 3EA6A 1V1OA 1CHQD 3O13A 2QEJC 2XRSD 1EEFD 1LTRD 1I4XA 2O2LD 5FKAC 2XN9C 1S5FD 1EU3A 4RHRA 2WV6D 1PZJD 2RDGA 1I4QA 4K6LA 1JWMD 4NZLB 3BYTB 1UUPA 3BVMA 1FNUA 3CHBD 1AN8A 2SEBD 1RDPD 1PTOF 1PZKD 4Z9CB 2XNAC 1SEBD 1YN5A 1LTSD 1PRTB 1PRTD 3BYYB 4BWGB 1SJHD 5ELBA 2ICIA 1PYWD 1S5ED 1M4VA 1LTAD 1MD2D 1EWCA 5ELFA 1CHPD 3DWAA 5I4DA 4ZYSA 1YN4A 1HXYD 3BVZA 5ELCA 1JWSD 1TS3A 5D3IB 1B1ZA 1EFID 1DYQA 2XRQD 1KTKA 1SE4A 1LTTD 4DXFA 1AW7A 1HQRD 1LTID 1FNVA 1HA5A 1RCVD 1D5XC 1LTGD 1FNWA 3BZDB 2RDHA 1PTOH 1D5MC 1ENFA 4RHSA 2AQ2B 1LLRD 1BCPF 1I4GA 1DJRD 1TS5A 1BCPC 1EU4A 5TSSA 1S5DD 4DXGA 3MFGA 1PTOC 3BVGA 1I4RA 2AQ3B 3R2TA 1LT5D 1TY2A 1I4HA 2G9HD 3SEBA 2NTTA 1QILA 1LT3D 1TY0A 3R8BA 1KLUD 2R61A 1HTLD 4RGTA 1BXTA 3MC0B 2AQ1B 5ELEA 1RF2D 3R2IA 1ET9A 1CK1A 2QILA 3W2DA 1LT4D 5ELDA 4RGNA 1CT1D 1SE2A 1STEA 1JR0D 1V1PA 1ET6A 2TSSA 1G8ZD 1PRTF 4C56C 1JWUD 1SJED
chains in the Genus database with same CATH superfamily
1II3A 5C4XB 3FRPB 3UDGA 3S2HB 3IFDA 4A3JG 2V4DA 3PZDA 3VH3B 3TSSA 5E1FA 5H1SE 3PRPB 1OTCA 1CQVA 4B3TQ 2JE6I 3GTQH 2WDQB 3ER0A 3VFKA 2NVTB 5K36G 4BKGA 3NTHA 1F2ZA 2LVPA 3MXUA 3P4PB 4G0NB 3CCSA 4KGRA 4L6TB 1SE8A 5M5XB 1JJ2A 5JXVA 3DBLB 3VUXA 2K8BA 2KENA 2OTLA 3ZRFA 5BN4A 2KX3A 3P75A 1XMQL 3AEDB 2JUOA 2HCCA 3Q8FA 3CCMA 1F2RC 4L63B 2I38A 3JSVB 1IP9A 2KVRA 1MJCA 2J0KA 2R7ZG 2GOWA 3X0WA 2VL6A 5D94A 2XSCA 1W6KA 3OWEB 4I6PA 2ZEQA 2D0OA 2HDLA 5M3FG 3EN2A 4DUZL 4DR2L 3S16B 2VRRB 5C0XG 1X32A 5C3WA 4IM3A 1PQSA 1XCTL 3ZGZA 2Z8LA 5I6YA 3R3MA 2E6XA 4YCVA 1YX6B 4XC2A 2JEBI 4KMUC 4LNKA 2NMQA 3KQ4A 4LJPB 2KCNA 2Z0SA 1Q8KA 4DF7A 4AQYQ 4LFAL 5BMIA 1JWAD 2KACA 3L54A 3Q23A 4XQNA 3LB8C 3Q3MC 4MHEA 4R4OA 1YJWA 1RKNA 3FHWA 4KD4A 4KV2A 4US8A 2QDBA 5JAVA 2LRWA 3HOWB 4DDID 4A3BH 4NW2A 4DUZQ 4DR2Q 4OVUA 4E3CA 1YJNA 1O7YA 2FNJB 3FEWX 3CRKC 2WX1A 4DQOC 1RHPA 2QDFA 2ZXOA 2KWDA 2QSDA 4LCDE 1X56A 1JJGA 1TXYA 1R4MI 3H0GG 3PZ8A 4W9FA 2DN8A 2IX3A 5C23A 4TVAB 3AE3B 3BYYB 1GJZA 4JI2L 1GXDC 3PPAA 1TYGB 5L95C 1WSPA 3OIPA 1GG3A 2K0PA 4KD3A 4IM2A 4LK0M 3I7FA 5G5HA 5C3EB 3FP9A 3MHSD 2HJ8A 2O4XA 1M1KC 4GN4B 3OSOA 1EFID 1WTQA 2XRQD 2MWSB 3EBEA 3M85A 3Q8EA 4TKNA 2MNAA 1LTID 2KMCA 4K81A 1WGHA 4E6IA 1SB3C 4P16A 2EYOA 3KF6B 3NK9A 3JAME 4OZAA 3L16A 3AYHB 1EYDA 4B95A 1EOVA 2E2DC 3E0EA 4L2YA 1EU4A 4OWTB 1V49A 4R4CA 3SK4A 2JZ3B 5LMNL 1EIYB 4P1CC 4A3MB 1I6VC 3BDCA 5IP9H 2MBBB 1MHHE 1S1QB 5HG2A 4ZUIA 3RCZA 1KDCA 1FXAA 3KUDB 4C4VA 1SYBA 3W1BA 2G9HD 3W5OA 3F2DA 1K8OA 2LASA 3A7LA 1QILA 3L3OC 1V80A 1VQ5A 3JVZX 4OWWB 1E7VA 3T1HQ 3I4NG 1Q81C 2AEHA 1CFMA 4PNYA 4LFCL 5ELEA 5C4ZA 2N9XA 2XK5A 2GLSA 3J81L 3B2FA 3M4YA 3PUXA 2KT7A 3H8HA 1SE2A 3FDTA 2PPHA 2WDTB 2M0AA 3Q6BA 1KLVA 1IYVA 5FJ8G 2B63H 2K75A 2NVYH 3B6YA 4ALPA 2ZM6L 1AWDA 3ML9A 2Y3AA 3R3OA 1KJTA 1IUEA 2OOBB 3NXWA 3GDEA 2OTJA 3QC8B 4DAMA 3JYUA 1LO5D 1E6EB 1ZDVA 2QGQA 3CXCA 2ZNVC 3LYYA 1G51A 2B76B 1VQNA 5IAAC 4A90A 2CU1A 4DHZE 3IAM1 3SFDB 1VQDA 3J80L 1VZ8A 1BKBA 2QMTA 2L11A 5KNDA 1JB7A 1T0QC 1ZW7A 2MEKA 4R4IA 2ZM6Q 1A70A 3GB1A 4XDXA 4W9KA 4ZRKA 4AUQC 2CHBD 1WMHB 1NENB 2KDIA 2RCFA 4W9GA 1VMCA 2J0JA 5E6OA 1AE2A 2VXWA 4KHZA 1UWMA 5D2MB 4UDUC 1I3QH 1E22A 3KJOA 1JALA 1NI3A 1HFGA 2PE9A 3AU5A 3GTMH 2H1EA 2PPBC 5IP4D 4MGYE 3NEMA 1EL0A 1PRTC 1X3FA 2AKWB 4I7AA 3V05A 3X23A 5C4HA 2WXOA 4QMGA 4M0WB 2R92B 1TU2B 3S2DB 3L9AX 2PCFB 1A15A 1V1OA 1CQFA 2F0PA 4K3CA 5DEHA 2WB1G 5A2QE 3TEHB 2OEDA 4B6WA 4ZYNA 4RHRA 5BR8L 3U9OA 1QVGA 4KY5A 3A54A 1I4QA 3J7AF 2FAZA 4NZLB 1V1QA 4UY8C 2WLBA 2B2UC 3A8KE 2JU6X 4EEWA 3UIOB 3WAMA 3I72A 2J0MA 3A74A 2Z6KC 5GQOA 4LFBL 2KHSA 1PH2A 1X9NA 1I7HA 1YQ3B 3Q3NC 3PUWA 1KF6B 4C2MB 4LDTB 2WXFA 1PH6A 2MJ8A 2JEAI 3HOWG 1T0RC 4IKGA 4FDBA 1WIAA 2DAJA 3CQZB 4HJKA 5CC4A 1H9SB 1QJOA 4HCEA 3TEZA 5H8YE 2F0OA 4QIWB 3ND8A 3BG3A 2D0PA 5IYDG 4A3LG 4IWOA 4IOIE 5CHWA 3O65B 2KVMA 4HJ9A 1WYWB 3RULA 4HJ5A 1VS0A 1R4NI 2NCNA 1STYA 2J0TD 1KH0A 2LKVA 5IWAL 4C3JB 3WA0A 4R3DA 1VQHA 3OW2A 1BCPF 3CC7A 4A3GG 2V4LA 1CM9A 3QHTA 3MFGA 2XVSA 3MZ5A 5IKCM 3Q22A 5KNCA 4HPMB 2K1FA 3ICEA 4BY7H 4WURA 1T9HA 4NP5A 3HOVH 4A3PA 2Q2HA 4ODGA 4TQUS 3CCUA 4ULLA 2MO0A 1LT3D 3D32A 4R8IA 2KCMA 2QKIC 5BMHA 3GZNI 1O7IA 3HOXG 2HTHA 2JA9A 2AWTA 2F4IA 3VYSA 3I90A 3RYTA 2GN5A 1MKHA 5C0XI 4II2B 3RUZA 1ZEQX 1F9SA 3OOCA 2QCPX 1VQKA 2MW5A 1A5RA 3WIMA 5G3LD 5FLMH 4CKBA 1C4AA 5FO7B 1DGJA 2JPHA 3DVGX 3PUYA 1IKMA 1KRHA 1RD9D 2L32A 4JGHB 4HKZE 4OVVA 1WRIA 4CJ2C 1UE7A 5M5YH 1QZHA 3FPUB 2EOTA 4BVUC 5J3BA 1IXRA 5ELNA 4M01A 3BDOA 5C44B 4IUMB 1YHQA 2VY3A 4G7HC 3OLMD 4HAEA 2LGSA 2R2OA 3Q8DA 2K3UA 4IOAA 1Q90A 4DU9A 1BR9A 1VQ6A 1J5EQ 4A93H 1V9JA 3L13A 3OTOL 3A7AB 3RNEC 4HRSA 2K6DB 2IJ0A 3RN2A 3GD7A 5M5WB 2AL3A 3AEFB 1FD7D 3S15B 1LTBD 2AMCB 1I50H 1S4ZA 2KOLA 2IYDB 3VTWA 3ZNID 3H7SA 2MX2A 4ZRPA 4A9AA 5EBCA 5IY0A 1DOIA 4IZ8A 1ZOYB 3O13A 2K50A 1FJGQ 4C1NI 2SAKA 4HIKA 2YU9H 1YMHE 2DGYA 1FCCC 2KDEB 4LTUA 4DN4M 1ZKOA 2EIFA 1O80A 1UEAB 4K8IA 2V4IB 3NY5A 2R92G 2PW5A 1UUPA 1QOGA 1MJEA 4FF1A 1OXUA 5ISRA 5KIXA 3PIO3 2IBIB 4GMVA 2OJRA 2F52A 3ZDTA 4LK1C 1SYGA 4YCUA 1SIFA 3ZNHB 4BBNC 4K5WA 1WCMG 1MBYA 1CA5A 3AE9B 1PZKD 4HDOA 3TUOA 1LTSD 1JORA 4W9LA 1RRBA 4IUTA 1CZWA 3K7AH 4OGQC 1U4AA 4NXNL 4B3RL 1JOQA 2ZT9C 3QIAA 1EWIA 1F9JA 3IKJA 3WOEA 3HKZB 1M4VA 4JYAQ 1ONLA 4C3IB 2L0FA 3H6MA 3QO2A 1N34L 5FO8B 3N20C 1LTTD 1J7AA 3C19A 2UXCL 3F2BA 1FNVA 3J81i 4AH6A 3TN2A 4ZQ3A 4NXNQ 4B3RQ 1OXSC 1FNWA 3RFZB 1F9PA 3HHMA 1TT2A 1H9MA 3BIID 1LLRD 3CKIB 3U58A 1WI0A 2F4VQ 3F2UA 1N34Q 1GC7A 2VS1A 3W1YA 5EPLA 1VF7A 2DNEA 4WJPA 2MUYA 4KK7A 3GTKH 1VQAA 1IBXA 2PIAA 2JYTA 4FJZA 3GTOH 3PTFC 1LV9A 2A8VA 3I73A 2O5IC 1PFDA 2KN5A 3AFPA 3NS8A 3DBLI 3I56A 4F88A 2CJNA 2BKRB 2CHXA 1MFWA 4XTCS 2E5LQ 2IO1B 2MP1A 4IW0A 3MA2B 4DXAB 2XBBC 2ZJPA 5C4XH 2ZVOA 4JCVE 4JLCA 3S2HH 3U4VA 1ET6A 2Q2UA 3RZFA 4CDDC 5IGDA 2BB6A 3CD6A 2F0KA 2E2IB 2FMCA 2HCIA 3K5OA 1PTOD 5C6AA 2PTLA 1QNUA 1L0VB 3ERQA 1C78A 1K8RB 1GUNA 2I1JA 5JHAA 1D8LA 1N9WA 5J2RA 5M5XH 2A4ZA 1PDXA 3OPOA 2UUAQ 3TMPB 1GNUA 1HR0Q 3A56A 4DV1L 1QCBD 2Q2TA 1V5TA 1V1PB 3QQ8B 4RCOA 3M95A 1JOOA 1WGDA 3TEXA 2PZWA 1Q3LA 5C0XJ 4Y7NB 1X3QA 1PGXA 1OQYA 1HTPA 5DLQE 2UXDL 1XLNA 2FCMA 2RSNA 2ZJDA 1K8GA 1K28A 3GO5A 3G6EA 1IW7D 3Q8BA 3ZDMC 3S16H 1EY4A 2F3WA 4OO1G 4KSLC 4WJOA 1EY7A 4CKCA 3N32A 4C7ZA 1IGCA 2N1WA 5AJ3L 1XPUA 3N6RA 1A0IA 4BY1B 1PH1A 3AXCA 2MCNB 3T8MA 3EA6A 4L8JA 1Y1VH 1LQBA 1C7YA 3ND9A 4UP7A 5IT9c 3PF5A 1N32L 1HEZE 1WGGA 3OIQA 3HOYH 2J53A 1U4RA 2JY6A 5GMVA 1N33L 1ROEA 2KA7A 1A62A 3L0OA 1GUGA 2RCNA 1GUSA 2LVOA 4OIJA 3AE6B 2O6VA 3EUB2 3CMMB 4CJ1B 2KLGA 4JL9A 4B9KA 5AJ3Q 4RG1A 5JH5C 5FLXE 5F2DA 5IYDH 1PLFA 1EIFA 5JVG3 2KLCA 4QIWE 4JG2A 3DBRB 4RAUC 1PA6A 1N32Q 1SEBD 3VR2A 4EFOA 3GTLB 2L5TA 2Z0EB 1AEXA 1KNEA 1OXTA 2L55A 4UP8A 5C3EH 4DUYQ 1WTRA 4JI6L 3QA8A 2NZ1D 3B9JA 4N9F4 3ZJUA 3W5VB 3PS6A 5IGGA 5IT9E 2MJ3A 2N7DA 1VQBA 4YWMA 1JWSD 3QR8A 4NJ6A 1IL8A 1YQ4B 2CW0C 4CHKA 1LACA 2BS4B 2G4DB 1WE6A 4II3B 2GBNA 1Y8PB 3HKZG 4K0KL 2AL6A 2VNUD 2MA9B 1ML0D 3C1FA 1XT9B 1ENFA 2CKZB 4A3CH 4A3MH 2MHJA 3VUWA 2AQ2B 1EQQA 2D07B 1BCPC 1HNWQ 2UUCL 3SGIA 4WORA 3HG9A 1XMOQ 1TWAB 4K14A 4ME3A 4RNAA 4A3EB 4JBMA 4R4QA 4A3BG 3RMKC 2LFIA 2RSUA 4K0KQ 3VVWB 4ZRQA 2OHFA 4J8QA 1R9TH 2Y5PA 2SNSA 4XQQA 4RGTA 4LF9Q 1SYFA 2BPSA 5HY6A 3A8JE 3EVQA 3K59A 1XLQA 2L83A 2JQOA 1QNKA 2YV5A 3J81c 3U30A 4N6EB 3S1RB 5LMUQ 2KQ7A 3PSEB 1X3PA 1CZGA 4PV1C 3VYUA 1N8RC 2K28A 4FF4A 1EO6A 1JRPA 2AHOB 1WR1A 2DZJA 5EE1A 1V97A 4P6VF 3E9IA 3DVNV 2CFMA 3RR5A 5GAGC 3K5NA 1SNPA 5C3JB 1RFKA 1JWUD 2KDBA 3WAOA 4FP5D 2NVQB 4EKUA 2A19A 3JSVA 1SNMA 4HKQA 4DFAA 1MG4A 5H92C 4RA8A 4KKIA 3TBIB 4MTKA 2JXTA 1NE3A 1CI3M 4DK3C 3WANA 4AOFA 1OGWA 1W6JA 2F0UA 4WJQA 3K8AA 3J81E 5EJWA 3SHLA 2C60A 1YN3A 2JWUA 4CO7A 1D2BA 2K01A 1WJ4A 3W3AA 4PMCA 2B2VA 5D65A 3A9KA 3B2GA 4DWFA 3A4RA 1UEBA 2WXPA 4RGMA 4OW0A 2PNRC 3T4AC 4S3SA 2IO0B 2PZTA 1WX9A 4HN7A 4LF6L 1ACCA 2R92H 1BMLC 2BS2B 5CX3A 2O5JC 3AE5B 4ZHOA 4BA1I 1SIJA 2BF8B 1XQQA 3MJWA 4WWPA 3U7DA 2BYVE 1MI2A 1PH9A 2DX5B 2GBKA 3CCJA 2LGXA 3H9DA 4JI4L 4Q0FA 1OFFA 2NVUI 1S5FD 4MIUA 2D3GA 2I5HA 1WJJA 4LMQD 1XWEA 2B63G 4ZUJA 1OTRB 1PZJD 4LF6Q 4LUOA 5HKHA 1FIQA 4RCNA 5CTRC 1NUCA 2H88B 4DHZB 2K04A 5C4JB 2IGDA 3MTSA 1C76A 3V6CB 3RLNA 4C2MH 3PF4A 1H4RA 3GTPB 3OHXC 5IGCA 1E24A 3HKZE 5HURA 1ZGUB 4DV0Q 3CQZH 2YVCA 2J7QB 2MBOA 4BKSA 2XWBB 2PE6B 1PRTD 3KF6A 4OXPA 4X62Q 1X3EA 4GKJQ 2QA4A 2C9WB 1I50B 2JVCA 5C5LA 3M4OB 1QZGA 1LTAD 3NENA 2EXZA 3B1LX 3K9PB 4NAMA 3TREA 2JXXA 4K7SA 1GM5A 3RN9C 1IZ6A 3VR3A 5AZGA 3K0YA 1DYQA 4IN3A 1WTXA 3SU8X 4W9HA 1YQBA 4C3JH 5HHDG 3WAPA 4NB3A 4JI3Q 3QJZA 2JA6B 4HSPA 2INDC 4H02A 4HLEA 3S2AA 1I4GA 2L1BA 2LXKA 4AYBB 3KUCB 2VUMB 3K7UC 4IPGA 1FMAD 3VHTC 1V86A 1YNJD 1MGSA 1K53A 2MQJA 1IBKQ 3AB9A 4WRDA 1SNQA 4IPCA 2MGSA 3SEBA 4DR6L 2WU2B 1C0AA 1EQTA 2HUGA 2KWCA 1TY0A 5I6WA 2CJOA 2K39A 4OO1I 5D6JB 2PVGC 4JI7L 2JA7B 2SNMA 1PV4A 1YJ1A 3FAHA 3I57A 2F0MA 2LVQA 3RMHA 3UI3A 5AEKB 3PO2H 4DV7L 3Q14C 1CT1D 2GA4B 3W1SC 4ITKA 3CF6E 2ASBA 1N63A 2AX5A 4X64L 3P42A 4PYZA 4ZYSA 3IHPC 4PT5A 5J18A 2WXKA 5TR5A 1I5FA 4NJCA 4HMIA 3SK5A 2ICEC 2MP2A 2JN4A 4JOIA 4BS9A 4ASWC 1PH3A 4DNRB 1TWCB 5C44H 1Z9FA 1D5ZC 2NBVB 4FXDA 4IJLA 4XX5A 1TT5B 2BBCA 5IP7H 5LNK1 2HE7A 1KLGD 3CRLC 2D2CC 1VQ9A 4CJ0B 4G50A 1FRRA 1VQCA 2GMIC 4M0WA 2QDLA 1J7BA 1L4DB 1PZID 2EYFA 3LJ3A 3CMAA 5M5WH 2NBUA 3S15H 4S0RA 1B44D 1JQYD 1TS2A 2K5WA 2VH2A 1RAXA 3HOVG 3OG5A 1A3TA 1XEEA 2V3NA 2V3SA 1D6EC 1SE3A 5EBDA 2M00A 4HIDA 3E9HA 1I6HB 1WYGA 2A5HA 2ON8A 2K33A 4ARCA 4A76A 1EZ8A 1Q1BA 3L7ZC 4F7XA 3AN1A 3OJ4B 4AJYB 1RWSA 1QVCA 2LI5A 1VQOA 1SGHA 4DV5L 3KF8B 3DHGC 2X8XX 2C7HA 5IOIA 2WXQA 5FLMG 4XT1B 1AYFA 1H9SA 3GTGH 1N60A 1JWMD 2UWQA 2KECA 3BYTB 3NHHA 4DNIA 1XTDA 4IJHA 3U9SA 1FD6A 4MDKE 4WJNA 2EPBA 2JSVX 4P73A 2WS3B 4J3OD 1CKNB 1HH2P 4DR4L 3RZOB 1P0RA 1OEYA 2BGFA 1Z7TA 4A3FB 4DHJB 5LMNW 1GVPA 4A93G 5T8IA 3VYTA 4C3IH 1SLJA 4K5XA 3ZJTA 3ULLA 1XMQQ 3A4SC 3M63B 4ZAIA 2DNFA 2BA0A 1D1IA 4OONA 5ELOA 3A9KB 4XGAB 3T13A 4GKKL 1Y1VB 1BBXC 4WAAA 1YIJA 4DR4Q 2WXMA 2OCEA 4XXEA 1K83H 3KLWA 2ID0A 4K2KA 3K6OA 1OEYJ 4XWWA 4EE2A 1NSNS 3HOYB 1O7ZA 2AUKA 4N8X1 4JI1L 1WXAA 3BZDB 4MM3A 4EZJA 1WRDB 3SDLC 4GOPA 2K9XA 5EKIA 3CCEA 4HJGE 1QE6A 3VAWA 1QVFA 3LNNA 2BYTA 4LFAQ 3ZJYC 1CSPA 3ULJA 2JRHA 2NS5A 1OQQA 1N6ZA 1IBLL 1FYCA 3EROA 1C9OA 1MHWC 4GKKQ 3MC9A 3GE3C 4B0EA 4AIMA 2EYJA 4HDQA 3STBC 3NWSA 3TEWA 3ABVB 2BE5C 1ILPA 4EQPA 1TQOA 3GE8C 3PLUA 4S17A 3DM1A 1NI2A 2JZPA 1RF2D 2LGIA 2KJRA 1K50A 5EKLA 4DR3L 2D3BA 2G45B 3GV3A 2FJ2A 2FCSA 4DR7L 3GTJB 5EPKA 1IBLQ 2A68C 4OEMB 4JOIC 4GNXB 1YJIA 2GRIA 1LYLA 4JI2Q 1VQMA 1UGJA 1YI2A 2E2IH 2R7DA 4WQOB 5AFWA 1MJDA 2BDOA 2IT1A 3HZXA 1Q5WB 4HMJA 4WJWA 1KIXA 1TGZB 2X38A 5LHY1 2BYFA 3VQIA 2W54A 1WJNA 2IO3B 3I3TB 4YSXB 1HHVA 3KYDD 2K52A 3AULA 3C46A 3AEVA 3KUPA 5D3DA 3VDYA 3P4QB 3M62B 3QARA 1SXTA 4JC0A 5E4XA 3PGZA 3M7GA 3V3XA 4Y7NH 1FR3A 1Q46A 3EFCA 2R6GA 3HOZB 2RD0A 1R9TB 2YEPB 3K5LA 3RI7C 2DBYA 4FHJA 2EYMA 5LMNQ 3ZQ4A 4R4TA 1UE1A 3L17A 3EFXD 3RT3B 3TP7A 1N36L 4K7WA 1YD8U 3DBRI 3EJIA 3PHXB 4KZCA 2Q2IA 3A8IE 3D3RA 1BF4A 2KNBA 3T3OA 4BY1H 3HUIA 4RH6A 4F87A 3C2PA 4A3OA 3AU7A 4LFCQ 4IQZA 5AZFA 1JCKB 4YIJA 5EGTA 3K58A 1NR4A 1LM8B 3PV1A 1CA6A 4HPLB 2LXJA 4KX6B 2L0TA 3HRZC 5C4XG 1GJXA 1FEHA 1AFPA 2WV6D 4PZ6A 2LWPA 1AH9A 4XE0A 5BN5A 1B8AA 2BT6A 3VRAB 1WI5A 3FILB 3BS1A 2BTEA 3NQTA 2O2VA 1TWHB 2VH1A 2MP2B 4REZA 1GPXA 4ARIA 3KK7A 1HTOA 2NBWB 2ZXRA 2EYLA 3NPPA 3GTLH 2L76A 3VTVA 3Q3JA 4FXGC 2JA5H 3VRBB 1XX8A 1WM2A 2JXMB 1QLBB 4BWGB 1IGDA 1JMCA 4C7YA 4HROA 2XWJB 1SYDA 2FIDA 3CW2C 4ACFA 1LXDA 1NR2A 1WTPA 4NPSA 4FF2A 3DWAA 1EUJA 1RFAA 2RQXA 1DOMA 2XTIA 2YTXA 2E76C 2QEXA 1FRDA 1LGRA 4AYBE 1XF5L 4KGTA 5COYA 3RNBC 4HVBA 2N8NA 2PMZB 4RKLA 3RNAC 1PFNA 2LRUA 4H13C 1AP0A 4JBKA 3QJYA 1IL2A 3I91A 2V1YA 1T5EA 2F0TA 1PYBA 1Y14B 2RDHA 4LW1A 4CDEC 3AE4B 3C0RB 3I5JC 1J0GA 1Y1VG 4NNJB 3QX1A 2GBJA 3MXGA 3P4SB 1V5OA 1TWAH 4A3EH 5CHFA 4RF1A 4DK5A 1YNJC 3UE0A 1I4RA 3R2TA 2AQ3B 2VZAA 5BR8Q 2EVBA 3RLOA 4C3HB 1B3QA 3HOYG 3DHQA 2D3AA 4EGVA 3CCLA 1WX7A 3DOWA 2F0QA 1ZPSA 4KTAA 3ZTCA 2VZKD 4Y52H 1C79A 1C77A 4NPNA 3MC0B 4XQJA 3S1RH 3N3KB 4PZ8A 4RMFA 4LFBQ 1JROA 4ABNA 2RPVA 3SFEB 2G9DA 4CBVA 4PS8A 3HRDD 2FCNA 2CW0D 3W2DA 2WXHA 4JI5L 1NAPA 5ELDA 4M8MA 1KAAA 4CGYB 4LLGM 1WOCA 1STEA 5C3EG 2UXBL 1ZKHA 1V1PA 1STAA 4BBRB 4B3SL 1EIGA 3C3LA 2NVQH 1DOXA 4EZKA 1KAWA 5C3XA 1MIUA 2EZVA 1B53A 4ANVA 1BCPD 1WH3A 3DEPA 3OW7A 1SBBB 2LUMA 3D4RA 3HP3A 4HJAA 1L0YB 4K8JA 2K6AA 3WCQA 2KEEA 2D62A 5JEAH 1FGBD 2N9PC 3H3VH 3APCA 3S14H 2UXBQ 4PS7A 2KUMA 2H89B 1E2ZA 5IWAQ 2M1MA 3CCVA 3LWEA 1EY9A 4A3CG 2A74C 4A3MG 2KJHB 1S3OA 1LT6D 2MHVA 4MM3B 4MSMB 5G55A 1WE7A 3QK0A 4QY7A 3J7ZC 3TJPA 2F0GA 4GOPB 1S72A 2VQFL 2Y5CA 2LUEA 4YHHL 1GUWA 1B7YB 1K51A 2H4OA 4JIOU 1ZYRC 4X3UA 1DOYA 3IVFA 3J7YW 2B2YA 2RSOA 1V43A 2EKEC 3PO2B 1GOZA 1XXGA 3H15A 2VB3X 1E5WA 1Q1OA 1STBA 3Q3OC 5BYQA 3UQBA 2JJQA 3ITPA 2A6ED 1V2YA 5DM73 1Z6HA 1Q7YC 1T5XD 1Y8RC 3CPWA 2NYZD 2R93B 1C4CA 1E9MA 2CQOA 1E8XA 5FKAC 3N1ZC 4FULA 4ICVA 5GROA 4F7ZA 1SRUA 4QF4A 1B9MA 4LWCA 5C4JH 2RDGA 4L23A 3WOFA 3CU7A 2B3GA 4YY3L 2FFKB 4IWQA 3GTPH 2BCOA 2NUCA 1VF5C 4JWSC 4QJFA 1FXTB 3K0XA 2KTRB 1ZXHA 3PRZA 2QF7A 1BUVT 1YNND 3MTNB 1X65A 2MQHA 1Y56A 4F1SA 3M4OH 5L37A 2K8HA 3U50C 5ELBA 2UUBL 2KHIA 4WH4A 3A5ZB 1A8VA 2K5HA 2FHTA 1NEKB 3OTOQ 3PGEA 1SDFA 2L3ZA 1EWCA 1C8CA 1QWYA 1HXYD 4KKSA 1VRAB 2O6VD 1EUVB 2QW7A 4HTHA 4YTMB 4M8AA 5CGKA 2JA6H 4US9A 4YT0B 3ZNZB 4FF3A 4KLKA 4JVZA 3R93A 3N52A 3AEEB 3IT6B 2N0SB 3GTGB 2M9VA 2RA4A 2DYBA 2C9OA 5DPSA 1QF6A 3HKSA 2VUMH 2NBFA 2BB5A 1D5MC 2Z0DB 5IA7A 1Q10A 2K14A 1HCZA 2ZW1A 1TS5A 2EQSA 1QZEA 1A3UA 1A2TA 4ILWA 1IYJB 3VR5A 3MAQA 1HR0W 1P7FA 4FBJB 2L7RA 4DV3L 1WTVA 3D4WA 1T0SC 4YWGG 1LT5D 4YWLA 2HT1A 2EYPA 2C5LC 1F9QA 4IO9A 2N78A 3FPPA 4R8NA 1T6BX 1B4OA 2V3PA 4ZKBB 5NUCA 2G1EA 4RWSC 2JA7H 1KOTA 4A4IA 2LD9A 2L0CA 2M56B 4GN3B 5KYLA 3AE7B 2O2VB 4XYCA 1K8AC 2K5PA 3FMCA 2K1BA 1C3TA 5KHOA 2QILA 4JBWA 2DUDA 3RZDB 4DV3Q 4DDGD 1RODA 1CUKA 3DBHI 1U4MA 2RDFA 4GN1A 1Y8NB 1UH6A 4JI0L 5J22A 1PGAA 1K83B 1A3VA 1H9JA 3RLFA 5EE9A 4DR1L 1EIHA 1TWCH 3LXFA 4AQ7A 1PH5A 1RM6C 1BBWA 5LL6X 4IFDH 4TV3A 2XEWA 5CV6A 2KOXA 4GU2A 4HEA1 1J8CA 2WFWA 4U68A 3C8YA 2WXRA 3PVLA 3QB3A 2F0HA 4C3JG 1E3PA 2UXCQ 4CHTB 1XNQL 4DGZA 4JE3B 4JI0Q 1XCQL 4KIKA 4WQMA 4KKTA 2DYOA 4O0AA 3J80i 4PMWA 1YHBA 4P75A 1WD1A 4PS3A 4KSKC 1S5CD 4MN3A 4L5QA 3DWGC 2KZRA 2JQRB 3URYA 2IDYA 5IGBA 5IGEA 4NQKE 3JAML 1I6HH 3N9YC 1G91A 1KD1C 2WDVB 2CU3A 2WXGA 3E56A 1STGA 3EECA 3CPFA 4O1NA 3J7AV 2A73B 1HZBA 2IWHA 3BZCA 2X6LA 4NXML 4BBSB 2OF1A 3NE5B 3G6JB 4QUFA 1K8MA 2I07B 2ENBA 4EZLA 3I4MB 2KQSA 2A6HC 4BAXA 4QCLA 3PO2G 1L6UA 2KDFB 2D5GA 3QIJA 4DPGA 3TRZA 1IBML 2CS4A 2WX0A 1IKLA 3HVZA 1QG7A 4X66L 2F1MA 3CC2A 3MP9A 1Z5SB 3RZOH 2F0EA 5C44G 5M9OA 4GB9A 4HXDA 5IP7G 3S1MB 1VLBA 4A3FH 1RDPD 2FINB 2E8GA 1PTOF 2DWQA 3ZTDA 1LTLA 1QOHA 5CR3A 2XNAC 2ZTEA 3A33B 2IL8A 1YN5A 1Y8OB 2RHQB 3KYCD 4HR7B 2K6QA 1K0SA 1SJHD 4DV1Q 2ICIA 3ML8A 4XDCA 1F1HA 2R2QA 1AARA 1Q1EA 1TWGB 5KHQA 3AH7A 2PMZE 2CCZA 3TEYA 3N1YC 2HIVA 1MSGA 3L10B 1PFMA 2L12A 1ICFB 4LF4L 2UXDQ 2WYQA 1WD0A 3BK1A 2G5DA 3E5SA 2E74C 2D9UA 4PQXA 4KKJA 1EM7A 4FO2A 2BW2A 4EOYA 4PYUA 1AW7A 4APVA 3FC4A 1DM0B 1HQRD 3T1YL 3T9LA 1TKEA 1D5XC 3TQYA 3S17B 1PTOH 5CV4A 1VZ6A 2KBNA 4RHSA 1YOVB 3AE2B 3DM3A 2K22A 4W9DA 4X65L 1QQRA 2HIXA 4LF8L 4BXXH 1UGMA 4BA2I 4NY0A 4WWOA 1L1OA 1I94L 1XLOA 2JA5B 1N33Q 2JX5A 1H9KA 4OZCA 4KN4C 3U7ZA 5A2QL 2KHJA 4WJ3M 2EELA 4NAWA 5E6NA 4JI8L 2R61A 1X6OA 4H44C 3Q8AA 3G71A 3NUCA 4IURA 3GTJH 2K25A 2MLBA 2N9KA 4HK2A 2RVLA 2YEPF 4FXKC 1QOFA 1L4ZB 1CK1A 4X65Q 1NDDA 4N58A 2DZMA 4MGZE 1LT4D 1NNXA 3PV0A 1NCVA 3J81j 2WKDA 3W1GA 4IG7B 1EWHA 5GAHC 3IL8A 1I94Q 4JI6Q 4MJSA 1G6PA 1LABA 2MFIA 1PH7A 1JR0D 4C3IG 4ZKCB 3UDXA 4TUUA 4C56C 2AUJD 3S9WA 4JI8Q 2I0QA 1HA6A 3OMCA 3BK2A 1ENAA 1BDOA 4K3BA 2EYHA 1VR9A 4IFDJ 3CC4A 4ID6A 3DQVA 2ZJQA 2JSOA 1L0XB 3ZLZA 1UE5A 2RBMA 2REXA 3STBD 3UIPB 3HOZH 1JE4A 4KGSA 2BE5D 4B3ML 1HRJA 1TKGA 2UU9L 1G6ZA 3EQLC 4HIMA 3KLSX 5FOBB 5LXHA 5IE8A 2BA1A 2F3IA 4RFBA 1RL2A 1ASZA 3KF8A 1WX8A 2UUCQ 4FNFA 3AMZA 2LMCB 2A68D 1YHAA 5EAYA 3H94A 3K80C 1S3SG 4JV5L 3HS0C 2LHEA 1E7PB 3QCAA 4WWNA 2KVZA 3ZJVA 5CYUA 1VQ4A 5I9OA 3H6NA 2A6EC 4P71A 4E74A 3LWUA 2NVXB 4TSSA 2UU9Q 5IYCH 1FGUA 1SAPA 1XTCD 2Z4IA 4DAPA 1WTOA 2KQ4X 2NPTA 2YLMA 4AP4C 4HIOA 1NMFA 4A3KB 1SMXA 2Z4HA 3AFQA 1CKNA 3NZ3A 3V96A 2BH2A 1T0YA 2OJWA 3AEGB 3QOJA 4A3DB 1I4XA 2C35B 1E2VA 3RD4A 4YWKA 3J80c 3DHHC 5EE3A 4JV5Q 2NN6H 3HGBA 3APFA 2RGFA 1TWHH 1RYJA 1SSOA 5HGQA 5E6JA 3I4MG 3BVMA 3S14B 3R7RA 5IGFA 5FO9B 3BINA 5JVH3 2EJFC 2UYZB 4J15A 3CHBD 3BJUA 3FVQA 3S1NB 2EY1A 3D8GA 3R66C 2CR5A 1VQEA 1GHKA 1YNNC 4RM8A 2CKHB 3ZRCA 4LDTD 2JF5A 3T3NA 3NSWA 4I6NB 2PMVA 2HHHL 2RDBC 1K3RA 5FR6A 4DR5L 2F0JA 4QUCA 4KIKB 1KFYB 3ZIMA 3NVYA 3M9BA 1MD2D 3PUZA 1PVOA 1JOKA 1NY4A 1Y1WB 3J80E 2KXJA 2VW9A 4M8NA 4TMAB 2IHFA 1TS3A 1DONA 1B1ZA 2PNHA 3NVZA 5A35A 2KC1A 1WXMA 3PQIA 4BY1G 3HFZB 1BT0A 2JRIB 1KDAA 2JA8B 1R4NB 3VA5A 4ME5A 1LTGD 2W3RA 3SD5A 5DPTA 2V9HA 4MACA 2ZXPA 1GUAB 3KUZA 3PUVA 4EQOA 2N4FA 1BOSA 2KN4A 4JI4Q 4C3HH 1WGYA 3BY4B 1X3GA 4NKLA 4GNXA 1EYGA 3BVGA 4HJ7A 3PO3H 1FL0A 4OWXB 1NBWA 2GB1A 4FADA 1Q12A 2F0FA 5DPRA 2LJ5A 2PW9A 2N3SA 2XIWA 4EX5A 1B3AA 2ATWA 1DZ1A 1IPGA 1XNRL 4JWUC 2F0IA 2KWUB 1IYFA 2YTVA 2BS3B 4MGKE 4NJ7A 2R7ZB 3GZNB 3SXHA 3FKIB 4N9TA 4G11A 3NELA 3V61A 2L4NA 1T3QA 2Q8RE 3C1EA 4TQ0A 1E7ZA 1PMRA 5CV8A 5M3FB 2JA5G 1WGRA 2EXDA 4IM0A 4BBRH 4UP9A 1WY8A 4RGNA 4UPAA 3NVWA 1H9RA 4NMZA 4PK1A 1KQSA 4A55A 4HEDA 3CCQA 3KYHC 3MHZA 2X6GA 2TSSA 4GDKA 1PRTF 3SHQA 2F0LA 1SJED 4ICUA 5MPOA 4V190 2DY8A 2CHWA 5IODA 1MHXA 1P98A 1QUQB 2HD5B 4J6IA 3KDFB 5IYBG 1CJEA 1PGBA 1AZQA 2K8CA 1PDQA 3ZW3A 1LM0A 2DLBA 1S5BD 2CQAA 4PG3A 1HZ9A 3HEJA 5EPJA 3CMEA 3K57A 2ONQA 4A3IH 3H0GB 3PIPA 2RMMA 2A1AA 4GN5A 4A3EG 1QT9A 1JJCB 4I65A 3Q69A 1TKWB 3UQAA 2AWNA 2DZIA 5FK9C 4I7ZC 4DR6Q 3DWPA 1CZPA 1L1OB 3FILA 2PQEA 1YIWA 1FXIA 2R93H 2KX0A 4AJWA 4RKBA 1N5WA 4KDIC 4GLSC 4BKTA 4JI7Q 2IY1B 2D5DA 2QEJC 1EWYC 4GDLB 4DV7Q 2K03A 1NMGA 1H95A 1VJKA 2XN9C 2B2VC 1BO0A 4MJSB 4X64Q 2D11A 1G291 2PVOD 1SROA 4K6LA 4A3KG 1SN8A 3L2PA 3RUIB 1C9FA 5JHBA 3QAQA 1GHJA 1HNZL 2QJLA 2D2QA 1UWXA 1AN8A 2PQAA 1GAQB 3AB5A 5G2NA 1ZYRD 1YX5B 1KNAA 4NQLB 5JEAG 5GADC 3I4NB 1BUIC 1G2SA 5HGTA 5DNFA 1WJUA 2D3CA 2G3QB 2L00B 2KTFA 3V6EB 4B0MA 3E0JA 1EYAA 2QCZA 1WWTA 4DV6L 1E7UA 2MJEA 4FLHA 3E9SA 2W3SA 4OX9L 3ZNGC 3ZVVA 4BOSC 1X1MA 5JZEB 1M90C 5ELCA 2E3TA 1U4PA 4JPBW 4MTNA 1HZ5A 2PLPA 3TS0A 4MH0E 2EE1A 1KTKA 1YBYA 4QGUA 5DAUA 1XO3A 4B3TL 2W55A 4GNXC 4IUNA 1RCVD 3WALA 1EQRA 1HJPA 2INCC 1N62A 3VXWA 1GD7A 2PI2E 3MHBA 2EDGA 2NPTB 2DJGC 2NZHA 3NJTA 1OO9B 1UWVA 3P7JA 4DAYA 4GGQA 4FA6A 4DKAC 1I35A 1E2WA 1P8LA 4DAVA 4DV5Q 1WF9A 2JA8G 1P16A 2P5ZX 1XJVA 5E3FA 3ZO5B 1E10A 1VQIA 3Q0AA 4IDIA 2KJXA 4OIKA 3A0JA 4LJOB 4KHVA 4GXBA 1E8WA 4IC7B 1E0ZA 3Q3FA 3EIVA 3NP8A 4PZ7A 2VB2X 4P7IA 3SK8A 2JYOA 1HTLD 3FKYA 5T1GA 1VCIA 4JX1C 3RZDH 3R2IA 4YCWA 2IGHA 1ZP0B 1C4PA 1V8CA 2B2WA 3I55A 1EY0A 5FLXL 1STHA 4AQYL 3ALBA 4ANUA 3DLLA 3IT4B 5DPWA 3NRZA 3RZWC 4A75A 2IW3A 2WB1B 3FKIG 3ULPA 2BKFA 1JB3A 4H0LC 2WGSA 1KXLA 2CHZA 1VQ7A 1PTOB 4XDDA 1F9RA 3GP7A 2JA6G 1TKYA 3OWFA 1FFUA 4CYEA 2JP1A 1NBFC 5IT9L 1D7QA 3G4SA 3MJ5A 3M3JA 4AYBG 1WZ0A 4JI1Q 3U4EG 2VUMG 1SF0A 3WDNA 5EQ0A 1MI0A 3I63C 4RMAA 3RNUA 4LF5L 5CV7A 3SR1A 1YVCA 2SDFA 1F0ZA 4LNOA 3LGJA 3CP0A 1B9RA 2FUHB 2BQQA 1DD2A 3V60A 3JAMc 1F77A 3AEBB 3DPDA 4XYQA 4BBSH 3H09A 3NOBA 1FFVA 3JC66 2JA7G 1KC8C 1JE5A 2FBWB 4BZAA 2B2UA 3I4MH 3H7PB 3I9V1 2IGGA 4LF5Q 2Z6KA 1SMYC 1DOKA 1C48A 1V6EA 4DR3Q 2B8FA 2HDMA 4DR7Q 1EEFD 2RKSA 2O2LD 4HJ8A 4C1NK 1WGKA 1MPEA 3LX0A 5IIFA 4A3GB 4XWTA 4LUVA 3UDIA 4LUZA 1ZE3D 4GLVB 4GDKB 1Q8IA 2HQLA 4IFDG 3S1MH 1M8AA 2F0VA 1TBEA 2LGYA 3T1HL 2EY5A 1HZCA 5BO4B 2FXQA 2LEKA 2KO3A 5JOBA 2NR2A 5AUKA 4TKOB 3HK0A 3HIZA 3AU4A 5IO9A 3HOXB 4Z9CB 1JW9D 2B29A 1R7SA 5BYSA 1YZ6A 1TWGH 3I4LA 1B70B 4MT5A 4W9EA 2CVRA 2FIFA 4JQWC 2ZJRA 4CKEA 2HD3A 3IFTA 2A6HD 1FCLA 1YN4A 2B8GA 1N36Q 3PMFA 1BBUA 1W3SA 3M4QA 2KFKB 4N9PA 1SE4A 4H7BA 3KLSA 3S17H 3MEHA 1MG8A 1ILQA 4UHVA 4Q2JA 1GB4A 3EHVA 5D7GA 3QWZB 3GV6A 1KHIA 1GC6A 5TSSA 4P74A 4OELB 3E6ZX 2KC2A 2I1KA 5KGUA 1U4LA 2LHDA 4ZLTF 3VYRA 4HCSA 5D14A 3VH4B 1HZAA 3HOUH 2YYZA 4FXCA 2B2WC 2PKOA 5CBAE 1J19A 2KYWA 2W9NA 2K5QA 4POGA 3U4ZA 3RNCC 4KN7C 1A2UA 3A1QB 2PQAB 5KEEA 4A3FG 1B9NA 4GOPC 5IYBH 1Z2MA 2WACA 3DMUA 2C7NB 2WDRB 2KMMA 3GQBA 1JT8A 2LGDA 3NS1A 4HWIB 3AEAB 4EUTA 1E90A 1L0WA 4G57A 3NZSA 2OXPA 2OQKA 2GI9A 2CWPA 1XD3B 4KV6A 1HPCA 3PO3B 1RJTA 3UINB 1EEID 3DWQA 4XT3B 2WKCA 4ZCKA 2B2TA 4IOCA 1VCBA 1WXVA 2BDNA 3K9OB 1WCMB 4OHJA 3PCOB 4G4KA 3H3VI 3NQIA 4ANXA 1K0RA 2PO4A 1GO3E 5E4WC 2QIEB 4LNFA 1TWFB 3M3YB 4BXXG 2Z9HA 4DAYB 2BH8A 1EF1A 5CHVC 2F0NA 3D4DA 1MSHA 3F8TA 4ANWA 1SR3A 1D3ZA 2IPKD 4G3XB 1SFOB 2NVXH 2EKIA 1CSQA 3J9CA 4K6DA 4LAAA 4MNOA 3NVVA 4A3KH 4QAYA 1UELA 4BFRA 4JW0A 4FYDA 4ZRJA 3F1ZA 3P20A 5JJZA 1Z47A 2KCTA 1YJ9A 4A3DH 2PYKA 2KD0A 4ZRIA 2IHEA 1HUNA 2UU7A 2ZNVB 4YSZB 2Y0SB 3A55A 1UBQA 2PZUA 3IFWB 3CCRA 2RR9A 2XRSD 2Q5WD 4V0BA 1R4PB 4OL7A 2M2LA 5K5PA 4JI5Q 2MSED 1YITA 3DCGA 3MWYW 1VQJA 1TJEA 3NUHB 4G7OC 4B3SQ 2R3ZA 2Y5BB 3IAYA 4KI0A 4KKUA 3S1QB 1YNXA 2JZZA 3TIXA 1BNZA 3S1NH 3AECB 4A3IB 3OMGA 4K5VA 3B0AA 1OQRA 4ZHPA 4YXDB 1UAPA 2Z1CA 2ES2A 2WAQB 1WVLA 2A69D 2L8JA 2WXJA 1EQVA 2DY7A 3CSTA 3L4PA 2LXAA 4WAFA 2DAFA 4BOZB 3HOZG 4F8MA 1PRTB 1VD2A 3L08A 1QKZA 4L5SA 2DYMA 3BWUD 5CV5A 4XYOA 1Y1WH 1SSNA 3X3MA 2KTRA 4TQ1A 1EFWA 1S5ED 3KBXA 3MXNA 1U0LA 4ZRZA 2VQFQ 3ZXVA 4YHHQ 3UF8A 2EY6A 5ELFA 2A5UA 2INNE 4O2DA 3BVZA 4A3JH 3VR8B 2PI2A 4EQ5A 2JA8H 1L6VA 4IUVA 1E0BA 4M00A 3I2ZA 3LDZE 3PT2B 4XIGS 3S24A 5BYRA 2C5CA 5G3LF 5IYCG 5K36H 4R1JA 4E71A 4B9WA 5CV9A 1E1TA 1SNCA 1WZ3A 1PFBA 1J5EL 1D4BA 4LNQA 3RN5A 2L52A 1YJJA 4C00A 1LUZA 2J42A 1SNDA 1X54A 2NN6G 5E7NA 3KJPA 3B08A 2AYOB 2LZ6A 3R7QA 1I4HA 2V1CC 1S40A 2R7ZH 2IX1A 1F2MA 1GKHA 4YY3Q 3FKIH 2LY7A 3DBSA 3DUZA 1BXTA 5M3FH 4K7UA 3MC8A 1J6QA 2AWOA 5C0XH 2WB1E 1ICWA 3SDZA 1C1YB 2WXIA 1TVXA 3OYYA 4NDXA 2WXNA 3J7A5 5EE0A 1FJGL 1B2TA 3F2CA 3KH0A 2PJHA 1EY8A 4TRDA 2KCCA 2UUBQ 4B08A 2Z6BA 5M3MB 1VQPA 1UD7A 4C4VB 4KY6A 3UE1A 2N1VA 2RPQA 4KY7A 2ZTDA 2EJMA 2B2TC 2LMCA 3ONSA 2GBMA 4A20A 3PRMB 2N9LA 2E2JB 2SOBA 4WFN3 4IFDI 2FE8A 2ALYB 2K4KA 2NTSA 2XK5B 5BMGA 2OWOA 3ZKJC 5JJIA 3H0GH 2MBQA 1EZ6A 2IX0A 2BVCA 1HZ6A 1WXQA 2LS01 3GTQB 1AZPA 2N55A 1WR6E 2JT4B 3U2SC 4C3HG 1XLPA 1HTQA 1WYDA 1XPOA 1ESRA 4RGOS 3PO3G 2J4XA 4YTNB 4JYAL 5IOCA 3TL5A 3SVMA 3A5UA 3VDZA 1TS4A 4KHPL 4CDCC 1KL9A 1Q86C 2KDMA 1ESFA 2N7EA 1NYQA 1NTGA 1SE9A 3V2TA 1O7LA 2I5MX 2WNMA 2N9EB 3TP5A 3AE1B 2V0GA 1J8IA 2J52A 1ISNA 3H1UA 4WIPA 4BBRG 2F4VL 4KHPQ 3TBLD 1WTWA 3V62A 4PMBA 4D2KA 4KVGB 5JEAJ 2B2YC 1WM3A 1ZDXA 4FVMA 1EY6A 4DR1Q 5L83A 2Y0SG 2OEOA 3D6WA 1JRUA 4QB4A 5C1ZA 1FNUA 1ZXTA 2L05A 3PIP3 2KJ6A 3KVFB 4LNIA 1CMXB 2GBRA 3I4NH 1CKOA 1IYUA 4A3BB 2MPMA 4L1BA 2Z59B 3SR6A 1Q82C 1EF5A 2HDEA 1PFSA 4HCNB 2RF4A 1XNQQ 4CQNA 2R7FA 2E5LL 2I2YA 4R9WA 4A3IG 1A6XA 1NJIC 3UGBB 2CWAA 1L7YA 2I46A 2F0WA 5FJ8H 4DHJD 2E2HH 1PYWD 1YNTE 4W9JA 2ZVNA 4W9IA 1WFQA 2WAQG 1U5KA 1KRTA 3KWVA 4GOCA 3MFYA 2M4NA 1OXXK 1V8QA 4DXFA 4Q5VA 3DXJC 3DVNU 1KDBA 2R93G 4A8XC 3H91A 4NXMQ 1PXUA 3G48A 3QWNA 1STNA 2UUAL 1HR0L 2B39A 1WFYA 4L5TA 2K7VA 4L5RC 5LXIB 3X3NA 1LFDA 2QHOA 1DJRD 1S5DD 3NHEB 4IUPA 2J7ZA 2FCQA 3VTUA 1IBMQ 2PEAA 3KOJA 1R4MB 1UF0A 3EC8A 4GSWA 2K5VA 1TY2A 5LL6S 2NVTH 1P3QU 1D1KA 3VR4A 4X66Q 2N88A 2NTTA 2NZOA 1UZXB 1JICA 2XGTA 1V9PA 3AQQA 1M94A 1MVKA 5J17A 3DWMA 2WINB 2KQ3A 3OJ3A 4K2LA 1QUQA 4MGIE 1CKMA 3KDFA 4U673 3CWIA 3VR6A 4C80A 3N30A 5DCNA 3GOEA 3U52E 4DK0A 2EMSA 3DEOA 3ENEA 3CIRB 3PHWB 1F2LA 5FLXc 3G7LA 3IRBA 3AMUA 4J6HA 1JMLA 3EFUA 3TCAA 4BKSD 3AE8B 1L2NA 1G8ZD 2X69A 3Q6SA 5JPNC 4BBNF 3ZXRA 4IPDA 2K5DA 4B9XA 2NVYB 1FVIA 1HUMA 3MXNB 4LF4Q 4N8FA 2B63B 4X3KA 1K52A 3PZ7A 4OVZA 3NBHA 4DV4L 1K73C 3P2BA 1VQ8A 3I4OA 5M3MG 2CH4W 3T1YQ 1FM0D 4GIVA 4I6LB 3PREA 3HOWH 3EGRA 4RF0A 5E6PA 3HOUB 4X57B 4FN2A 4IUUA 4DUYL 3TZUA 3H3VC 4GDLA 2BYEA 3L0WB 3E3XA 1VDZA 2M0XA 4USAA 1Q0WB 3PSIA 3MEFA 4DV4Q 4LF8Q 4A3LH 1G2TA 4JBJA 1F2RI 5KRUA 3A9JA 4O42A 2Y0SE 2GVBA 5EDSA 1ASYA 3IBEA 2KAJA 1I3QB 2EY2A 4FHKA 5KYIA 5I2XA 3GTMB 1J7CA 3ZUNA 4MZ9A 1UE6A 3TP6A 3KW5B 1GB1A 4FJVB 1SYCA 5JJLA 1HE8A 5CMDA 3TP8A 2WIIB 2KHWB 1CHQD 2ZPYA 4OZBA 3I8ZA 4A3GH 1LTRD 2DENB 2KWVB 2L9HA 1HNWL 1DXMA 1WXSA 1EU3A 3NWTA 1XMOL 4UAIA 4X3TA 5I2YA 2WAQE 1BVSA 1PH8A 2WHIA 2NN6I 4EVOA 2K05A 3ONAB 3SK6A 4LF7L 2KKCA 1P7EA 3DVGY 1ZXIA 1Y69U 4LF9L 3HOXH 4W9CA 2CH4A 2F03A 2A69C 2KK8A 3AM9A 4RM9A 2KEDA 5LMUL 2FMMA 2WQYB 3NG0A 2Q8TA 3QOLA 4B3MQ 5J1ZA 4ZK9B 2TMPA 4GLAC 3SE0A 3DHIC 5J39A 4WJ4A 4LF7Q 1SMYD 4X3SA 4POFA 4GLXA 1F2YA 1KRSA 1RIPA 2LSSA 1HNXL 2KFJA 4IUQA 5T1IA 2ACZB 1VDVA 2MBHA 1CHPD 2K32A 3BZKA 3HVDA 1C4QA 3HM6X 2INPE 4YTPB 4G7ZC 5HI1A 5FR3A 2DZKA 4XZ4A 4AS1A 4BBSG 2M17A 1J9OA 1KM7A 2OQ0A 3T56B 1EY5A 3NTIA 4J1MA 1E8YA 1PUTA 3P1MA 1HA5A 3CF5A 3TMEA 1FPYA 4DNTB 4LNNA 3K81C 2MRPA 4QL5A 4DV2L 2LJIA 1HNXQ 1NVID 2WP8J 3TZDA 1L5PA 3RD2A 3T53B 1E1OA 4DXGA 5HFYA 5C5MA 3W1SA 3GS2A 3M4PA 4P1BC 3KWLA 3WWVA 1L2FA 4FJYA 2ZTCA 2LFNA 3P1HA 2YTYA 3T51B 2VZKB 4MEMA 2WXLA 4WWMA 1H8CA 4KZ0A 1O78A 2JK8A 3HOVB 4BY7B 1TZOA 1KLUD 3ERSX 1VQLA 1P9DU 2M19A 2DNCA 4DV2Q 2K5NA 2GVAA 1F52A 2AQ1B 5G5GA 2MO1A 4IPHA 1AE3A 1KABA 1K9MC 2N49A 4P72A 4A3JB 5IP9G 2JYEA 4YL8A 2HHHQ 1VQGA 4ZDVA 3D0FA 4DR5Q 1QOBA 3CAMA 1P1AA 3RPFC 2HTME 1I42A 3MVVA 1L1OC 5DM63 2ASQA 2KANA 1PYSB 2DHZA 2HJ1A 1VMPA 3RNFC 1IBXB 3S2DH 3HM3A 4MELA 1BCPB 1B50A 1I4PA 2IY0B 1EYCA 3AI5A 3D31A 3ECIA 1GUOA 3ZYYX 5AUIA 5CBEE 1WCMH 5M5YB 2ZCCA 4DV0L 3CSFA 3H7PA 3RNGC 1W2BA 1DOLA 5CORA 2D10A 4A6QA 4X62L 5IN7A 4GKJL 3VUYA 1TWFH 3QG1A 2BOSA 3M3YH 1NYRA 1UNSA 2F3VA 3TDQA 1ENCA 3PIOA 4GS3A 3VA7A 1V81A 1SFOH 2LXCA 1U9RA 4KDLB 4DK6C 4M1UB 4A93B 4JK1C 3P4RB 2MBEA 2RHSB 2E75C 4HCPB 3HOUG 3AV8A 2EJGC 2IZVB 2F0DA 3IAS1 2JWZA 1XNRQ 3JAMi 1CTMA 1DGSA 4JI3L 3U8ZA 1GUTA 2B3AA 4AWJA 4CDFC 2I5LX 5GAEC 4H2AA 1RTOA 2IO2B 3ETRA 2Q8IB 2VQEL 2C7MB 3IXSA 1ZUD2 3PO0A 1OXVA 1TIFA 3D6CA 1XPRA 3S1QH 5GXGB 2ZCBA 1N5XA 2M8SA 1IBKL 2YU9B 3Q2AC 4N59A 2BWES 5C2TB 3KLRA 2NWGA 2WU5B 4X6AH 2L15A 2N7JA 1G6JA 2OT2A 1QB5D 2SEBD 2WP9B 2ZPNA 1TIID 1SNOA 2KFKA 1XYIA 2L1AA 3NBHB 1VZ7A 1E8ZA 5JJKA 3PLVA 2VQEQ 4MH8A 1K3BC 3UI2A 2W82A 4KJNA 3NZUA 5I9PA 4IWPA 1FO4A 2ZZPB 1R4QB 4GZYC 3NTKA 3APDA 3P63A 1BQQT 1JC7A 1YEZA 3K7AB 2FUG1 4EQNA 2MJDA 5I4DA 1RTNA 2O6VB 3BU2A 1UBIA 3JW0X 3KBGA 2MH7A 2BWFA 3A9JB 5D3IB 3Q24A 2WWZA 2HQEA 3M7NA 4K1RB 4DBGA 1TTNA 1PH4A 3N1XC 1TR5A 4A3DG 2G4SA 3I70A 1WMHA 3I3CA 3A1QA 4F8CB 2H5XA 4NAWB 4LJZC 4DA2A 2F0SA 3VR9B 1VQFA 3TS2A 2IY5B 5BN3A 5JPMC 2ZW0A 1PTOC 1HFNA 3DDCB 2PW7A 3NBIA 3W9CB 5EKKA 1JQ4A 3Q8CA 4KJOA 1DCZA 2EMTA 5KNBA 1WJ6A 4MSQB 3BDLA 2NB0A 4OO1H 1HNZQ 3OAWA 3R8BA 4JPSA 1N61A 4P2CB 3GTKB 1IHZA 1JWBD 4HSVA 1WTHA 1HQMC 4IALA 2E2HB 4DK1A 4ZOHC 5AZHA 3KFUA 3GTOB 4HPPA 1QOAA 1ET9A 3MXPA 4YSYB 4URKA 3T16A 4M02A 5M3MH 3IG3A 4QQBX 1EOTA 3K5MA 1SYEA 4BY7G 1A63A 4DV6Q 3DBHB 1IW7C 1PHJA 1Y1WG 1TZ1A 2KMAA 2DJFC 1RLFA 2QC8A 5LLIA 3W5UB 3UDFA 1X55A 2E2JH 4OX9Q
chains in the Genus database with same CATH topology
1II3A 5C4XB 3FRPB 3S2HB 3IFDA 2V4DA 3TSSA 5E1FA 1CQVA 2JE6I 2WDQB 2NVTB 5K36G 3NTHA 1F2ZA 3MXUA 3P4PB 4KGRA 4L6TB 5M5XB 5JXVA 5BN4A 3P75A 3AEDB 2HCCA 3Q8FA 1F2RC 4L63B 2I38A 2XSCA 1W6KA 3OWEB 2HDLA 2Y5PA 3S16B 3ZGZA 5C0XG 1X32A 5C3WA 1XCTL 2Z8LA 5I6YA 2E6XA 2JEBI 4KMUC 2NMQA 3KQ4A 2KCNA 4DF7A 5BMIA 1JWAD 2KACA 3Q23A 4XQNA 3LB8C 4MHEA 1RKNA 4KD4A 4US8A 2QDBA 5JAVA 3HOWB 4NW2A 1O7YA 4DQOC 3FEWX 3CRKC 1RHPA 2ZXOA 2KWDA 2QSDA 3PZ8A 2DN8A 2IX3A 3AE3B 3BYYB 1GXDC 1TYGB 1WSPA 3OIPA 2K0PA 4KD3A 4LK0M 5G5HA 5C3EB 2O4XA 3OSOA 1EFID 1WTQA 2XRQD 3M85A 3Q8EA 1LTID 4E6IA 1SB3C 4P16A 2EYOA 3NK9A 3JAME 4OZAA 1EYDA 2E2DC 4L2YA 1EU4A 3SK4A 4A3MB 1I6VC 3BDCA 1MHHE 5HG2A 4ZUIA 1KDCA 1FXAA 1SYBA 1K8OA 2G9HD 3A7LA 1QILA 3L3OC 1CFMA 4PNYA 5ELEA 5C4ZA 3J81L 3B2FA 3M4YA 3PUXA 3H8HA 1SE2A 3FDTA 2M0AA 1IYVA 1AWDA 2Y3AA 3R3OA 1IUEA 3NXWA 1LO5D 1E6EB 1ZDVA 3LYYA 2B76B 4A90A 3IAM1 3SFDB 3J80L 1VZ8A 2QMTA 2L11A 5KNDA 3GB1A 2MEKA 1A70A 4XDXA 2CHBD 1NENB 1VMCA 4KHZA 2VXWA 1UWMA 4UDUC 1JALA 1NI3A 1HFGA 2H1EA 2PPBC 1EL0A 1PRTC 3V05A 5C4HA 2WXOA 4QMGA 2R92B 1TU2B 3S2DB 3L9AX 2PCFB 1A15A 1V1OA 1CQFA 2F0PA 5DEHA 5A2QE 2OEDA 4RHRA 3U9OA 4KY5A 3A54A 1I4QA 3J7AF 4NZLB 2WLBA 2B2UC 3A8KE 2JU6X 3I72A 2KHSA 1YQ3B 1I7HA 3PUWA 1KF6B 4C2MB 2WXFA 2MJ8A 2JEAI 4IKGA 3CQZB 5CC4A 1H9SB 1QJOA 4HCEA 3TEZA 5H8YE 2F0OA 4QIWB 3ND8A 3BG3A 4IOIE 2KVMA 1STYA 2J0TD 1KH0A 2LKVA 4C3JB 4R3DA 1BCPF 1CM9A 3MFGA 2XVSA 3MZ5A 3Q22A 5KNCA 4WURA 4NP5A 4TQUS 4ODGA 4ULLA 1LT3D 4R8IA 2QKIC 5BMHA 2F4IA 3VYSA 3I90A 5C0XI 3RUZA 1ZEQX 1F9SA 3OOCA 2QCPX 5G3LD 4CKBA 1C4AA 5FO7B 1DGJA 3PUYA 1IKMA 1KRHA 1RD9D 2L32A 4HKZE 1WRIA 4CJ2C 3FPUB 2EOTA 3BDOA 5C44B 4G7HC 4HAEA 2K3UA 1Q90A 4DU9A 1BR9A 3A7AB 4HRSA 2IJ0A 3GD7A 5M5WB 3AEFB 1FD7D 3S15B 1LTBD 1S4ZA 2KOLA 4A9AA 4ZRPA 5EBCA 1DOIA 4IZ8A 1ZOYB 3O13A 4C1NI 2SAKA 1YMHE 1FCCC 4LTUA 4DN4M 1ZKOA 1O80A 1UEAB 4K8IA 2V4IB 2PW5A 1UUPA 1QOGA 4FF1A 1OXUA 5ISRA 5KIXA 3PIO3 4LK1C 1SYGA 4K5WA 1CA5A 1MBYA 3AE9B 3TUOA 1PZKD 1LTSD 1JORA 4IUTA 1CZWA 4OGQC 1JOQA 2ZT9C 3QIAA 3IKJA 3WOEA 3HKZB 1M4VA 1ONLA 4C3IB 3H6MA 3QO2A 5FO8B 1LTTD 1J7AA 1FNVA 3TN2A 4ZQ3A 1OXSC 1FNWA 3RFZB 1F9PA 1TT2A 1H9MA 3BIID 1LLRD 3CKIB 3F2UA 5EPLA 1VF7A 2DNEA 2MUYA 4KK7A 1IBXA 2PIAA 2JYTA 1LV9A 2O5IC 3I73A 1PFDA 4F88A 2CJNA 4XTCS 2MP1A 3MA2B 1ET6A 5IGDA 2BB6A 2F0KA 2E2IB 2FMCA 2HCIA 3K5OA 1PTOD 5C6AA 2PTLA 1QNUA 1L0VB 3ERQA 1C78A 1GUNA 1PDXA 3OPOA 3A56A 1QCBD 1V1PB 4RCOA 1JOOA 3TEXA 2PZWA 1Q3LA 5C0XJ 4Y7NB 1X3QA 1PGXA 1XLNA 1HTPA 2RSNA 3GO5A 3Q8BA 1IW7D 1EY4A 2F3WA 4OO1G 1EY7A 4CKCA 4C7ZA 1IGCA 3N6RA 4BY1B 3EA6A 4L8JA 3ND9A 1HEZE 3OIQA 2J53A 1U4RA 1ROEA 2KA7A 1GUGA 3EUB2 1GUSA 4OIJA 3AE6B 4CJ1B 5FLXE 5F2DA 1PLFA 5JVG3 4RAUC 1SEBD 3VR2A 3GTLB 2L5TA 1AEXA 1KNEA 1OXTA 2L55A 1WTRA 2NZ1D 3B9JA 3ZJUA 3W5VB 5IGGA 5IT9E 2MJ3A 1JWSD 1IL8A 1YQ4B 2CW0C 1LACA 2BS4B 1Y8PB 2VNUD 1ML0D 3C1FA 1ENFA 2AQ2B 1BCPC 4WORA 3HG9A 1TWAB 4K14A 4RNAA 4A3EB 2LFIA 4ZRQA 2OHFA 4J8QA 2SNSA 4XQQA 4RGTA 1SYFA 3A8JE 3EVQA 3K59A 1XLQA 2L83A 1QNKA 4N6EB 3S1RB 1X3PA 1CZGA 4PV1C 3VYUA 4FF4A 2K28A 1JRPA 5EE1A 1V97A 4P6VF 3K5NA 1SNPA 5C3JB 1RFKA 1JWUD 4FP5D 2NVQB 1SNMA 4HKQA 4DFAA 5H92C 4RA8A 4KKIA 3TBIB 2JXTA 1CI3M 1W6JA 2F0UA 3J81E 5EJWA 3SHLA 2JWUA 1YN3A 1D2BA 2K01A 3W3AA 4PMCA 2B2VA 5D65A 3B2GA 2WXPA 4RGMA 4OW0A 2PNRC 3T4AC 4S3SA 2PZTA 4HN7A 1ACCA 1BMLC 2BS2B 2O5JC 3AE5B 4ZHOA 4BA1I 1SIJA 1MI2A 4Q0FA 1OFFA 1S5FD 4MIUA 4LMQD 1XWEA 4ZUJA 1PZJD 1FIQA 4RCNA 1NUCA 2H88B 2K04A 5C4JB 2IGDA 3MTSA 1C76A 3GTPB 3OHXC 5IGCA 5HURA 2XWBB 1PRTD 1I50B 5C5LA 3M4OB 1LTAD 2EXZA 4NAMA 3VR3A 3K0YA 1DYQA 4IN3A 1WTXA 5HHDG 2JA6B 4HSPA 1I4GA 2L1BA 4AYBB 2VUMB 1FMAD 1YNJD 1MGSA 1K53A 3AB9A 4WRDA 1SNQA 2MGSA 3SEBA 2WU2B 1EQTA 2HUGA 1TY0A 5I6WA 2CJOA 4OO1I 2PVGC 2JA7B 2SNMA 3FAHA 3I57A 2F0MA 3RMHA 3UI3A 1CT1D 2GA4B 4ITKA 1N63A 2AX5A 3P42A 4ZYSA 4PT5A 2WXKA 4NJCA 4HMIA 3SK5A 2ICEC 4BS9A 4DNRB 1TWCB 1D5ZC 4FXDA 2BBCA 5LNK1 1KLGD 3CRLC 2D2CC 4CJ0B 1FRRA 4M0WA 1J7BA 1L4DB 1PZID 2EYFA 1B44D 1JQYD 1TS2A 2K5WA 1A3TA 1XEEA 2V3NA 1D6EC 1SE3A 5EBDA 2M00A 1I6HB 1WYGA 2A5HA 2ON8A 2K33A 4ARCA 1EZ8A 1Q1BA 3L7ZC 4F7XA 3AN1A 1RWSA 2WXQA 4XT1B 1AYFA 1H9SA 1N60A 1JWMD 2KECA 3BYTB 3NHHA 3U9SA 1FD6A 2EPBA 2JSVX 2WS3B 4J3OD 3RZOB 1Z7TA 4A3FB 5T8IA 3VYTA 4K5XA 3ZJTA 4ZAIA 2BA0A 1D1IA 3T13A 1Y1VB 1BBXC 2WXMA 4XXEA 2ID0A 4K2KA 3K6OA 4XWWA 4EE2A 1NSNS 3HOYB 1O7ZA 2AUKA 3BZDB 2K9XA 5EKIA 4HJGE 1QE6A 3LNNA 2BYTA 1OQQA 1FYCA 3EROA 4B0EA 2EYJA 3TEWA 3NWSA 3ABVB 2BE5C 1ILPA 4EQPA 1TQOA 3DM1A 2JZPA 2LGIA 1RF2D 1K50A 5EKLA 3GV3A 2FJ2A 3GTJB 5EPKA 2A68C 1YJIA 2GRIA 1UGJA 5AFWA 2BDOA 2IT1A 3HZXA 2X38A 4HMJA 4WJWA 5LHY1 3VQIA 2W54A 4YSXB 1HHVA 3C46A 3KUPA 5D3DA 3P4QB 1SXTA 5E4XA 3M7GA 3V3XA 1FR3A 2R6GA 3HOZB 2YEPB 1R9TB 3K5LA 2DBYA 3ZQ4A 2EYMA 3EFXD 3TP7A 3EJIA 3A8IE 3D3RA 1BF4A 3T3OA 3HUIA 4RH6A 4F87A 3C2PA 3AU7A 4IQZA 1JCKB 4YIJA 5EGTA 3K58A 1NR4A 1CA6A 4KX6B 3HRZC 1GJXA 1FEHA 1AFPA 2WV6D 4XE0A 5BN5A 2BT6A 3VRAB 3FILB 3BS1A 2BTEA 3NQTA 1TWHB 4REZA 1GPXA 4ARIA 2ZXRA 2EYLA 3NPPA 4FXGC 3VRBB 1XX8A 2JXMB 1QLBB 4BWGB 1IGDA 4C7YA 4HROA 2XWJB 1SYDA 1NR2A 1WTPA 4FF2A 3DWAA 2RQXA 1DOMA 2E76C 1FRDA 1XF5L 4KGTA 5COYA 2PMZB 4RKLA 1PFNA 4H13C 1AP0A 3QJYA 3I91A 1T5EA 2F0TA 2RDHA 3AE4B 3MXGA 3P4SB 4RF1A 1YNJC 1I4RA 2AQ3B 3R2TA 4C3HB 2EVBA 3DHQA 4EGVA 2F0QA 1ZPSA 4KTAA 2VZKD 1C79A 1C77A 3MC0B 4XQJA 1JROA 4ABNA 2RPVA 3SFEB 2G9DA 4CBVA 3HRDD 2CW0D 3W2DA 2WXHA 1NAPA 5ELDA 1KAAA 4CGYB 4LLGM 1STEA 1V1PA 1STAA 4BBRB 3C3LA 1EIGA 1DOXA 5C3XA 2EZVA 1B53A 1BCPD 3DEPA 3OW7A 1SBBB 2LUMA 3D4RA 3HP3A 1L0YB 4K8JA 2K6AA 3WCQA 2KEEA 2D62A 5JEAH 1FGBD 2KUMA 2H89B 1E2ZA 3LWEA 1EY9A 2A74C 2MHVA 1LT6D 4MM3B 2F0GA 2Y5CA 1GUWA 1K51A 2H4OA 1ZYRC 4X3UA 1DOYA 3J7YW 2B2YA 2RSOA 1V43A 3PO2B 1GOZA 1XXGA 5BYQA 2VB3X 1STBA 3ITPA 2A6ED 5DM73 1Z6HA 1T5XD 2NYZD 2R93B 1C4CA 1E9MA 5FKAC 4QF4A 1B9MA 2RDGA 4L23A 3WOFA 3CU7A 2FFKB 2BCOA 2NUCA 1VF5C 4JWSC 1ZXHA 2QF7A 1BUVT 1YNND 1Y56A 5ELBA 4WH4A 2FHTA 1NEKB 1SDFA 1EWCA 1C8CA 1QWYA 1HXYD 4KKSA 1VRAB 4HTHA 4YTMB 4M8AA 5CGKA 4US9A 4YT0B 4FF3A 3IT6B 3R93A 3N52A 3AEEB 2N0SB 3GTGB 2M9VA 2RA4A 1QF6A 2C9OA 2NBFA 2BB5A 1D5MC 1Q10A 1HCZA 2ZW1A 1TS5A 1A3UA 1A2TA 4ILWA 3VR5A 3MAQA 1P7FA 1WTVA 3D4WA 4YWGG 1LT5D 2EYPA 1F9QA 3FPPA 4R8NA 1T6BX 1B4OA 2V3PA 4ZKBB 5NUCA 2G1EA 4RWSC 2L0CA 2M56B 5KYLA 3AE7B 2K5PA 3FMCA 2K1BA 2QILA 4JBWA 3RZDB 1RODA 1U4MA 2RDFA 1Y8NB 1PGAA 5J22A 1K83B 1A3VA 1H9JA 3RLFA 5EE9A 1EIHA 3LXFA 4AQ7A 1RM6C 5LL6X 4IFDH 5CV6A 4HEA1 4U68A 3C8YA 2WXRA 3QB3A 2F0HA 4C3JG 4CHTB 4DGZA 4JE3B 1XCQL 4WQMA 4KKTA 2DYOA 4PMWA 1WD1A 1S5CD 4MN3A 3DWGC 2JQRB 3URYA 2IDYA 5IGBA 5IGEA 3JAML 3N9YC 1G91A 2WDVB 2CU3A 2WXGA 3E56A 1STGA 4O1NA 3J7AV 2A73B 2IWHA 4BBSB 2X6LA 2OF1A 3NE5B 3G6JB 4QUFA 1K8MA 2I07B 2ENBA 3I4MB 2A6HC 4QCLA 1L6UA 2D5GA 1IKLA 3HVZA 1QG7A 2F1MA 3MP9A 2F0EA 5M9OA 3S1MB 1VLBA 1RDPD 2FINB 2DWQA 1PTOF 1QOHA 5CR3A 2XNAC 2IL8A 1YN5A 1Y8OB 4HR7B 1SJHD 4XDCA 2ICIA 1Q1EA 1TWGB 3TEYA 3AH7A 1MSGA 1PFMA 2L12A 1WD0A 3BK1A 3E5SA 2E74C 2D9UA 4PQXA 4KKJA 1EM7A 4FO2A 2BW2A 1AW7A 3FC4A 1DM0B 1HQRD 1TKEA 1D5XC 3S17B 1PTOH 5CV4A 1VZ6A 4RHSA 3AE2B 2K22A 1QQRA 4BA2I 1XLOA 2JA5B 2JX5A 1H9KA 4OZCA 4KN4C 3U7ZA 5A2QL 2EELA 2R61A 3Q8AA 4H44C 3NUCA 4IURA 2N9KA 2RVLA 2YEPF 4FXKC 1QOFA 1L4ZB 1CK1A 4N58A 1LT4D 3PV0A 1NCVA 2WKDA 1EWHA 3IL8A 1LABA 1JR0D 4C3IG 4ZKCB 4C56C 2AUJD 3S9WA 1HA6A 3OMCA 3BK2A 1ENAA 1BDOA 2EYHA 1VR9A 4IFDJ 4ID6A 2JSOA 1L0XB 2RBMA 1JE4A 4KGSA 2BE5D 1TKGA 1HRJA 1G6ZA 3EQLC 3KLSX 5FOBB 2BA1A 4RFBA 3KF8A 3AMZA 4FNFA 2LMCB 2A68D 3H94A 2LHEA 3HS0C 1E7PB 3ZJVA 5CYUA 5I9OA 2A6EC 3LWUA 2NVXB 4TSSA 1XTCD 1SAPA 1WTOA 2Z4IA 4DAPA 2KQ4X 4A3KB 2Z4HA 3NZ3A 3V96A 3AEGB 3QOJA 4A3DB 1I4XA 1E2VA 3RD4A 5EE3A 2NN6H 3HGBA 1RYJA 1SSOA 5E6JA 3BVMA 3S14B 5IGFA 5FO9B 5JVH3 2EJFC 3CHBD 3FVQA 3S1NB 2EY1A 3D8GA 1GHKA 1YNNC 3T3NA 3NSWA 2PMVA 2F0JA 4QUCA 1KFYB 3NVYA 3PUZA 1MD2D 1JOKA 1Y1WB 3J80E 4TMAB 1TS3A 1DONA 1B1ZA 3NVZA 5A35A 1KDAA 2JA8B 3VA5A 4ME5A 1LTGD 2W3RA 4MACA 2ZXPA 3PUVA 4EQOA 1BOSA 2KN4A 4NKLA 3BVGA 2GB1A 1Q12A 2F0FA 2PW9A 1DZ1A 2XIWA 1B3AA 4JWUC 2F0IA 2BS3B 2R7ZB 3SXHA 3FKIB 4N9TA 2L4NA 1T3QA 2Q8RE 3C1EA 4TQ0A 5CV8A 1PMRA 5M3FB 4RGNA 3NVWA 1H9RA 4NMZA 4A55A 4HEDA 3MHZA 2X6GA 2TSSA 1PRTF 2F0LA 1SJED 5MPOA 4V190 2DY8A 5IODA 1MHXA 1CJEA 1PGBA 1AZQA 1PDQA 2DLBA 1S5BD 2CQAA 2ONQA 3HEJA 5EPJA 3K57A 3H0GB 2RMMA 1QT9A 4I65A 3Q69A 1TKWB 2AWNA 5FK9C 4I7ZC 1CZPA 3DWPA 3FILA 2PQEA 1FXIA 4RKBA 1N5WA 4GLSC 2D5DA 2QEJC 1EWYC 4GDLB 2K03A 1VJKA 2XN9C 2B2VC 1BO0A 1G291 2PVOD 4K6LA 1C9FA 1GHJA 2QJLA 1UWXA 1AN8A 1GAQB 3AB5A 1ZYRD 1KNAA 5JEAG 3I4NB 1BUIC 1G2SA 5HGTA 5DNFA 4B0MA 3E0JA 1EYAA 1WWTA 2MJEA 3E9SA 2W3SA 5ELCA 2E3TA 1U4PA 2PLPA 1HZ5A 2EE1A 1KTKA 5DAUA 1XO3A 2W55A 4IUNA 1RCVD 1N62A 3MHBA 2EDGA 1OO9B 4DAYA 3P7JA 1E2WA 4DAVA 5E3FA 1E10A 3Q0AA 4IDIA 2KJXA 4OIKA 4KHVA 1E0ZA 3NP8A 2VB2X 3SK8A 2JYOA 1HTLD 5T1GA 1VCIA 4JX1C 3R2IA 2IGHA 1ZP0B 1C4PA 1V8CA 2B2WA 1EY0A 5FLXL 1STHA 3IT4B 3NRZA 2IW3A 2WB1B 1JB3A 4H0LC 1PTOB 4XDDA 1F9RA 3GP7A 1TKYA 3OWFA 1FFUA 2JP1A 5IT9L 3MJ5A 3U4EG 1SF0A 3WDNA 5EQ0A 1MI0A 5CV7A 3SR1A 2SDFA 1F0ZA 1B9RA 1DD2A 1F77A 3AEBB 4XYQA 3H09A 1FFVA 2FBWB 2B2UA 3I9V1 2IGGA 1SMYC 1DOKA 1C48A 2B8FA 2HDMA 1EEFD 2RKSA 2O2LD 4C1NK 1WGKA 1MPEA 3LX0A 5IIFA 4A3GB 4XWTA 1ZE3D 4GDKB 1Q8IA 4IFDG 1M8AA 2F0VA 2EY5A 2LEKA 5JOBA 5AUKA 4TKOB 5BYSA 3HOXB 4Z9CB 1JW9D 1R7SA 3I4LA 4MT5A 2CVRA 4CKEA 3IFTA 2A6HD 1FCLA 1YN4A 2B8GA 3PMFA 4N9PA 1SE4A 4H7BA 3KLSA 3MEHA 1ILQA 4Q2JA 1GB4A 5D7GA 3GV6A 5TSSA 3E6ZX 5KGUA 1U4LA 2LHDA 4ZLTF 3VYRA 4HCSA 5D14A 2YYZA 4FXCA 2B2WC 2PKOA 5CBAE 2K5QA 4KN7C 1A2UA 5KEEA 1B9NA 2WACA 3DMUA 2WDRB 2KMMA 3GQBA 3NS1A 3AEAB 4G57A 2OXPA 2GI9A 4KV6A 1HPCA 3PO3B 1RJTA 1EEID 3DWQA 4XT3B 2WKCA 2B2TA 2BDNA 1WCMB 4OHJA 4G4KA 3NQIA 2PO4A 2QIEB 5E4WC 1TWFB 3M3YB 2F0NA 3D4DA 1MSHA 2IPKD 1SFOB 2EKIA 3J9CA 4K6DA 4LAAA 3NVVA 4FYDA 3P20A 5JJZA 1Z47A 2PYKA 1HUNA 4YSZB 2Y0SB 3A55A 2PZUA 2XRSD 2Q5WD 4V0BA 1R4PB 4OL7A 2M2LA 5K5PA 3MWYW 1TJEA 3NUHB 4G7OC 2R3ZA 3IAYA 4KI0A 4KKUA 3S1QB 1BNZA 3AECB 4A3IB 3OMGA 4K5VA 1OQRA 4ZHPA 4YXDB 1UAPA 2Z1CA 2WAQB 1WVLA 2A69D 2WXJA 1EQVA 2DY7A 4WAFA 3L4PA 4F8MA 1PRTB 1QKZA 2DYMA 3BWUD 5CV5A 4XYOA 1SSNA 3X3MA 4TQ1A 1S5ED 3KBXA 3MXNA 4ZRZA 2EY6A 5ELFA 2INNE 3BVZA 3VR8B 1L6VA 4IUVA 1E0BA 4XIGS 5BYRA 2C5CA 5G3LF 5K36H 4B9WA 5CV9A 1SNCA 1PFBA 1D4BA 2L52A 1YJJA 2J42A 1SNDA 2NN6G 1I4HA 2IX1A 1F2MA 2LY7A 3DUZA 1BXTA 2AWOA 5C0XH 3SDZA 1ICWA 2WXIA 1TVXA 4NDXA 2WXNA 5EE0A 1B2TA 1EY8A 4TRDA 2KCCA 4B08A 5M3MB 4KY6A 4KY7A 2EJMA 2B2TC 2LMCA 2N9LA 2E2JB 2SOBA 4WFN3 4IFDI 2FE8A 2NTSA 5BMGA 1EZ6A 2IX0A 1HZ6A 1WXQA 2LS01 3GTQB 1AZPA 2N55A 3U2SC 4C3HG 1XLPA 4YTNB 1ESRA 4RGOS 2J4XA 5IOCA 3SVMA 1TS4A 2KDMA 1ESFA 1NYQA 3V2TA 1O7LA 2WNMA 3TP5A 3AE1B 2V0GA 1J8IA 2J52A 4WIPA 1WTWA 4PMBA 4D2KA 5JEAJ 2B2YC 1ZDXA 4FVMA 1EY6A 2OEOA 3D6WA 4QB4A 1FNUA 1ZXTA 3PIP3 1IYUA 4A3BB 2MPMA 4L1BA 3SR6A 2HDEA 4CQNA 2I2YA 4R9WA 1A6XA 2I46A 2F0WA 1PYWD 1YNTE 3KWVA 3MFYA 1OXXK 1V8QA 4DXFA 4Q5VA 3DXJC 1KDBA 4A8XC 3H91A 1PXUA 3QWNA 1STNA 2B39A 2K7VA 3X3NA 1DJRD 1S5DD 4IUPA 2J7ZA 1TY2A 5LL6S 1D1KA 3VR4A 2N88A 2NTTA 1JICA 1MVKA 3DWMA 2WINB 2KQ3A 4K2LA 4U673 3CWIA 3VR6A 4C80A 3U52E 4DK0A 3DEOA 3CIRB 1F2LA 1JMLA 3G7LA 3AMUA 4J6HA 3AE8B 1G8ZD 2X69A 3Q6SA 5JPNC 2B63B 2K5DA 4B9XA 2NVYB 1HUMA 4OVZA 4X3KA 1K52A 3PZ7A 3NBHA 1FM0D 3EGRA 4RF0A 3HOUB 4IUUA 3TZUA 3H3VC 1VDZA 4USAA 1G2TA 1F2RI 5KRUA 4O42A 2KAJA 1I3QB 2EY2A 5KYIA 5I2XA 3GTMB 1J7CA 3TP6A 1GB1A 1SYCA 5CMDA 3TP8A 2WIIB 1CHQD 4OZBA 3I8ZA 1LTRD 2L9HA 1DXMA 1EU3A 3NWTA 4UAIA 4X3TA 5I2YA 2NN6I 4EVOA 2K05A 3ONAB 3SK6A 1P7EA 1ZXIA 1Y69U 2F03A 2A69C 3AM9A 2KEDA 2FMMA 2WQYB 2Q8TA 3QOLA 5J1ZA 4ZK9B 2TMPA 3SE0A 5J39A 1SMYD 4X3SA 1F2YA 4IUQA 5T1IA 2ACZB 1VDVA 1CHPD 2K32A 3HVDA 5HI1A 1C4QA 2INPE 4YTPB 4G7ZC 5FR3A 4AS1A 1J9OA 3T56B 1EY5A 3NTIA 4J1MA 1PUTA 3P1MA 1HA5A 3TMEA 4DNTB 2LJIA 1NVID 2WP8J 3TZDA 1L5PA 3T53B 4DXGA 5HFYA 5C5MA 3W1SA 3GS2A 3KWLA 2LFNA 3P1HA 3T51B 2VZKB 2WXLA 4WWMA 1O78A 4BY7B 3HOVB 1TZOA 1KLUD 2M19A 2DNCA 2AQ1B 5G5GA 1KABA 2JYEA 4A3JB 1QOBA 3RPFC 2HTME 3MVVA 5DM63 1IBXB 1VMPA 1BCPB 1B50A 1I4PA 1EYCA 3D31A 1GUOA 3ZYYX 5AUIA 5CBEE 5M5YB 1DOLA 5CORA 4A6QA 2BOSA 3QG1A 1NYRA 1UNSA 2F3VA 3TDQA 1ENCA 3VA7A 1U9RA 4M1UB 4A93B 4JK1C 3P4RB 2E75C 3AV8A 2EJGC 2F0DA 3IAS1 1CTMA 1GUTA 4H2AA 1RTOA 3ETRA 3IXSA 2Q8IB 3PO0A 1ZUD2 1OXVA 3D6CA 5GXGB 1N5XA 2YU9B 4N59A 5C2TB 3KLRA 2NWGA 2WU5B 2N7JA 2OT2A 1QB5D 2SEBD 2WP9B 1TIID 1SNOA 2L1AA 1XYIA 1VZ7A 4MH8A 3UI2A 2W82A 4KJNA 5I9PA 1FO4A