1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system/peptide inhibitor
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
3CHBD 4RGNA 4L63B 1RF2D 1BCPC 1TS4A 2XRQD 4RGTA 1MD2D 3EA6A 3DWPA 1B1ZA 1SXTA 1JWSD 3R8BA 1SJHD 1KTKA 1ET6A 1G8ZD 1LTRD 2G9HD 2NTSA 1D5MC 1CK1A 1XXGA 1RCVD 2ICIA 1TS3A 1HTLD 4DXGA 1B44D 1FGBD 2NTTA 4O1NA 1D5XC 1AW7A 1S5ED 5FKAC 4RHSA 4RCOA 1L0XB 1PYWD 3TSSA 3R2IA 1YN3A 2AQ2B 1M4VA 1I4GA 4K6LA 2AQ3B 3BVGA 1BXTA 1SJED 1PRTD 3BVMA 2XNAC 1FNVA 5TSSA 2SEBD 1RD9D 1LTGD 1BCPB 3OWEB 2AQ1B 5FK9C 1PTOC 1EEFD 1DJRD 1JR0D 1SBBB 1PZID 4RFBA 4RH6A 1PRTC 1QILA 1UNSA 1YN4A 5ELEA 1LT5D 2IPKD 1PTOH 3BYTB 1EU3A 1RDPD 3O13A 1FNWA 4UDUC 4RHRA 1F77A 1TY2A 5D3IB 1SE4A 1DYQA 4Z9CB 2CHBD 1LT4D 1L0YB 1T5XD 1I4QA 2WV6D 3URYA 1AN8A 1BCPD 1ENFA 5D3DA 2Z8LA 1ESFA 1LT3D 1LT6D 3BYYB 1HA5A 1PZKD 3BZDB 1D5ZC 3MC0B 1CHQD 1ET9A 1YN5A 4BWGB 1EFID 1PRTF 2J4XA 1LTAD 1S5FD 3V05A 1LTTD 4DXFA 2O2LD 1EU4A 4C56C 1I4RA 1XTCD 2XN9C 1PRTB 1GOZA 3DWQA 1TS5A 1I4HA 3DWAA 1PTOB 1EEID 1STEA 1FD7D 1LO5D 3SEBA 2IJ0A 5ELFA 4NZLB 1FNUA 1SE3A 1SE2A 5ELBA 2QILA 1PZJD 5ELDA 1V1PB 1I4XA 1JQYD 3GP7A 3BVZA 1CHPD 3MFGA 3R2TA 1EWCA 1S5CD 1JWMD 1LTBD 1CT1D 4RGMA 4TSSA 1D6EC 2RDHA 1TY0A 5ELCA 5I4DA 1S5BD 1PTOD 4ZYSA 1KLUD 1KLGD 1S5DD 4RGOS 2R61A 1BCPF 4L6TB 1I4PA 1V1OA 1CQVA 1V1PA 2TSSA 1SEBD 3EFXD 1HXYD 1JWUD 1LTSD 1JCKB 2RDGA 2XRSD 1TS2A 1LTID 1UUPA 2QEJC 1LLRD 1HQRD 4OHJA 3KLSX 3W2DA 1PTOF
chains in the Genus database with same CATH superfamily
1EYCA 3VDYA 1JOOA 1XNQL 4PS8A 3EFUA 1MD2D 1B50A 3GTOH 1NI3A 3FHWA 1IXRA 3JSVB 2K5NA 3D4DA 4GOPB 3IXSA 1KRSA 1ZP0B 4U68A 3PO3G 4RMAA 1BBWA 2M0XA 3P4SB 2L32A 3VR9B 1MHHE 3H3VI 5C0XI 4II3B 2FJ2A 2C7HA 3F8TA 2QJLA 1K51A 2JUOA 4OIJA 4BZAA 1E5WA 2LMCA 3EIVA 1JQ4A 1ASYA 4POFA 4KKUA 2I2YA 5KNBA 3SU8X 4B6WA 2UU9Q 4Q2JA 1C4PA 4WAFA 1GHKA 4C1NI 2HJ8A 2E74C 3H6MA 4KGSA 1VZ8A 4QY7A 4WJ4A 4N6EB 4WQOB 4QQBX 2SEBD 3Q8FA 3T1HQ 1K8OA 4KVGB 1LTGD 1FEHA 4PS3A 4DR4L 4MEMA 2WACA 2LI5A 2G45B 1FIQA 4IG7B 1WI5A 4KJOA 3ML9A 5CC4A 1HNWL 4BXXG 2F0NA 2OWOA 1TKGA 1VD2A 5C3WA 2N0SB 3M4QA 4EGVA 2B3AA 3O13A 4JI4L 1E3PA 4GKKL 1UWVA 2EYOA 2D3GA 3TCAA 1XMQQ 3J81E 2H4OA 2JQOA 2UXCQ 3VR4A 4XWTA 3UIPB 4AYBB 5H1SE 1LT4D 3D4RA 3HVZA 5M5WB 3J7AF 3I3TB 2OTLA 1MKHA 1KH0A 4QIWB 3HOWG 2UXCL 2EY5A 1E0ZA 2OQKA 4ZRZA 5EKKA 1C79A 3PGEA 1Y1VG 1Z6HA 2BOSA 3AMUA 4S3SA 4BA2I 3PUYA 3SK4A 3MC0B 1XCTL 4J6HA 3A4SC 3WOEA 4C3HH 1O7YA 3Q6SA 1TWFH 2CJOA 1TIFA 4A76A 5HGTA 1P3QU 3PV1A 1K8MA 2K6QA 4POGA 3I90A 4ID6A 4IN3A 3FPUB 3B0AA 1KQSA 2BYEA 3AECB 4URKA 3DWAA 1KF6B 1WM3A 4W9CA 3PUZA 1ZYRC 3APCA 3A8KE 3U4ZA 4FBJB 1KOTA 3MHZA 3MVVA 2FIFA 2A5UA 4KK7A 3S1QB 1ZDVA 2NVQH 1NE3A 5LL6S 3AE4B 5GADC 3NE5B 5DCNA 5LMNQ 2ZPYA 1QOAA 1OXXK 2PI2A 4XX5A 1ENAA 3W5OA 3P4QB 2Z6KA 4ZKBB 1YBYA 4NXML 1D3ZA 5ELCA 3AULA 3JAMi 1KLGD 1HUNA 4IPCA 5T1GA 4G7OC 1JC7A 4JI1Q 2PI2E 3GTJH 1FCCC 2A73B 1WJUA 4IJHA 2KMAA 2KK8A 2MJ3A 4NY0A 4EFOA 3NK9A 1D1KA 4A3KG 2C5LC 3AE3B 4R3DA 2QF7A 5IGEA 1I7HA 4M8NA 4LUOA 3DCGA 5EJWA 2HHHQ 2F0KA 3L9AX 3UGBB 3E9HA 1EWIA 4DV7L 1X32A 3CHBD 3S16B 5EKLA 3AE7B 3RFZB 1BCPC 1RJTA 2K5DA 3E0JA 1PDQA 3NXWA 5JJIA 4BFRA 2N7DA 1EZ8A 1E7PB 1L7YA 2LVQA 2RCFA 3CPFA 1V1QA 1TVXA 3FC4A 2EY1A 4KTAA 3MC9A 4OZAA 1F0ZA 2XIWA 3BDCA 1QLBB 1QUQA 1HNXQ 1WOCA 4JI2Q 4JWUC 5IYDG 2IO0B 1I5FA 2J53A 3Q23A 5EBCA 2MSED 4MSQB 4NXNL 5JAVA 4IALA 1PYWD 2YEPB 1HR0L 2ZZPB 4LF8Q 2LFIA 4ZRPA 4K8JA 1C9FA 2E2JH 3TZUA 4H0LC 1OXTA 1FYCA 4A3CH 1EY0A 2YU9H 3HOYG 3EQLC 1WYDA 2W54A 1PYSB 5IKCM 1F9SA 2KX0A 1BCPB 3OWEB 4MACA 2GN5A 2I46A 3W1SC 2UUAL 1DJRD 1V8CA 1JJCB 1YHAA 3TZDA 3L0OA 1PH2A 2VY3A 1A3VA 1OTRB 1EZ6A 1UNSA 4GZYC 2ZVNA 1TQOA 2IY1B 1A3TA 4USAA 2D0PA 4ZQ3A 3CXCA 1TY2A 2UYZB 4A3IH 1DYQA 3MTNB 2WINB 3W5VB 2A6HD 4YTMB 4ZKCB 3NZ3A 3RNFC 1CKMA 1ILPA 1B2TA 1HA6A 3DXJC 3E3XA 4DPGA 4XQJA 3QK0A 3VAWA 2L8JA 1ENFA 4Q0FA 4MGYE 3CP0A 4JI5Q 4P6VF 3ENEA 2M19A 4UP8A 5IWAL 3Q3OC 4BWGB 4US8A 1VQAA 4P74A 1YQ4B 1KFYB 4HKQA 1PYBA 3E0EA 1QCBD 4B9WA 3PO3H 1SB3C 5JOBA 1XLPA 2KEEA 2WIIB 1VS0A 3RR5A 4LTUA 4P7IA 2EKEC 2TMPA 3U4EG 3EN2A 3A74A 1Z5SB 1BDOA 1A63A 4MELA 4F87A 1GAQB 4HJ8A 4GXBA 4X66Q 4L2YA 3A5ZB 4NZLB 4C3IG 1TWCB 3H09A 2D3AA 2JA6H 2XTIA 4YT0B 3P4PB 2KA7A 3V60A 4ILWA 3W1BA 4IZ8A 4J6IA 2PMZB 3NZUA 3HOYB 2X6LA 4A4IA 4GLSC 5IAAC 1JQYD 4OEMB 3NRZA 2KOLA 2V4DA 1J8IA 4JOIA 4ULLA 1SSOA 3LWUA 2CQOA 4K2KA 1WTQA 4LJZC 2L00B 2ZCBA 2ZW1A 1O80A 4TV3A 3RNBC 1GUNA 4DV1Q 3IAYA 3RULA 4MTNA 2IY5B 1BR9A 3J7ZC 1I4PA 1R9TB 1F2LA 5LL6X 3C1FA 2KT7A 1FXIA 2JA6G 5C3EH 1YQ3B 1LFDA 2EPBA 4ZDVA 3H94A 3K80C 5JHBA 1P16A 4C2MB 1UUPA 4DNRB 1WI0A 3AEDB 3MWYW 5LMNL 1WF9A 2LVOA 3CC7A 4KI0A 2CHXA 2YTVA 2L0CA 2NZHA 4I7ZC 3DLLA 1UD7A 4ASWC 2RCNA 1YNXA 4OX9L 4HIOA 3M4OB 2UUBL 1RKNA 4ZRJA 4YSXB 4A3GB 1B8AA 2EYHA 1WRIA 2OOBB 5IOIA 1GUGA 2B2VC 2L4NA 4HIMA 4HPMB 2Q2IA 4AUQC 1YEZA 4C1NK 4KGRA 4MM3B 2JE6I 4GNXA 2BPSA 4P1BC 3QARA 3W1YA 4HCSA 3OLMD 4DFAA 3NBIA 2IYDB 1HJPA 4GKJL 4BBNC 1ACCA 2K25A 1UBQA 3LB8C 1YN3A 2H1EA 1I6HH 1T0RC 5T8IA 4DDID 1YOVB 1OEYJ 4PZ6A 3BVGA 1CSQA 3KDFB 4K14A 1PMRA 1PRTD 4RWSC 2KQ7A 3CF6E 3QAQA 1SROA 4A3LG 2LRUA 1B3QA 3TEXA 1HCZA 2WXGA 5C23A 3UQAA 1EF5A 2M1MA 3J81L 2B3GA 5IYBH 4OZBA 2BH2A 3SR1A 5M5XH 2KLCA 2KTFA 3DHQA 3WWVA 3QO2A 3ZDMC 1T5EA 1PH6A 2CH4W 3I63C 4JQWC 4WH4A 3QJZA 4GLXA 4DK0A 2KVRA 2F4IA 3KUZA 4DAVA 2F0QA 5LLIA 2IW3A 1F77A 4RAUC 3OSOA 5TR5A 1C0AA 2HIVA 3DHGC 3PO2B 3VHTC 5GMVA 4A3JG 1VQ5A 1E6EB 1DD2A 3D31A 2I5LX 4FJZA 4XT1B 3DBLB 5EPLA 4NNJB 4XYQA 2K1FA 3F2CA 1VF7A 1Y1WH 3BJUA 3PQIA 2W82A 4PZ8A 1HA5A 3CKIB 3N6RA 1Q7YC 1LM8B 1OXSC 2K5VA 1H9SB 2KECA 5C4JB 3Q3NC 3RCZA 1SDFA 5IT9c 4X6AH 4BY1G 1EUVB 3NVYA 2P5ZX 1LTAD 2SNMA 3HZXA 4LF6Q 4UAIA 4NXMQ 3VDZA 4TQ0A 1PFBA 4LF9L 3VYTA 3Q8AA 1FXAA 5DPWA 1EEID 2IJ0A 3EGRA 3ZJUA 3RNAC 1S3OA 4TVAB 3C19A 1G291 3PUWA 2BDNA 4B0MA 4PG3A 3E9IA 2WXOA 2WU5B 3GV6A 4ME3A 4IUUA 1JWMD 4X62Q 1VQ9A 1TTNA 4ANWA 2G9DA 1E90A 4RM8A 2SDFA 3AE6B 4P1CC 1MI2A 3GTMH 1S5BD 4Y7NB 1PXUA 2MO0A 2PQEA 5C5LA 1K8RB 1RODA 1C76A 1KNAA 5C0XG 1IBKL 3H0GB 2N9LA 3QWNA 4LNKA 3OAWA 3NZSA 1NI2A 4A3EB 1JCKB 2LMCB 4J15A 4KD3A 4GN4B 2GBMA 1WJJA 5BO4B 3K8AA 1F9JA 3HOXB 1H9SA 3ZDTA 5M5WH 1OFFA 4CKCA 2ZW0A 3M3YB 2GRIA 2NBFA 1J7AA 1R4NB 2BF8B 3KYDD 1SNCA 3I7FA 4N9TA 2RPQA 3BIID 2BVCA 2EYPA 2KC2A 3TIXA 4A3DH 2WX0A 3CC4A 1WE6A 4J8QA 1G8ZD 2KCNA 2NYZD 3LYYA 4FP5D 1VQFA 4C3IB 2EY6A 1A70A 4DUYL 2ICIA 2DNEA 3BS1A 2CQAA 4NW2A 3UE1A 1FGBD 3I70A 3GV3A 1MPEA 4A90A 3U50C 2MP2A 3WAPA 1UE1A 4YWKA 3ABVB 4PMBA 4BBSH 2Z6BA 5K36H 2Y0SG 4ARIA 3FMCA 2LASA 2YVCA 1WVLA 2A69C 1HZ5A 4FXGC 2JA7B 3B2FA 4A93G 5CYUA 1J9OA 4ZAIA 3S14H 4XQNA 1B3AA 4K7UA 3V6EB 4OELB 5I6WA 2CHZA 4ZCKA 1CSPA 4L1BA 1MBYA 4NXNQ 2I1JA 4IJLA 2KVZA 2EYJA 1EWHA 1TBEA 1QNUA 3BYTB 1JE5A 3GTLB 1QE6A 1Y1VH 1JMCA 2L52A 2MW5A 3TUOA 1U4MA 2Q5WD 3I55A 1J5EL 5BMIA 1E22A 2J0JA 2LXAA 3OTOL 2MQJA 4ZRQA 2A69D 2Z4HA 3T3NA 1TT2A 3CQZB 1QB5D 3QG1A 5IGGA 5FR3A 1RFAA 3A33B 3M4PA 3AH7A 3Q0AA 1Q1BA 4I6NB 1AYFA 5KHOA 5LMUQ 3P4RB 2KACA 1ET9A 5D65A 3RMHA 4WJNA 1BO0A 1CJEA 1SYEA 4DGZA 3HKZE 3NVVA 4JI3Q 3FKIG 4C7ZA 2IX1A 2KCCA 1ZKHA 2IO3B 2HCCA 3HOZH 2NVUI 1F9QA 2PMVA 4WJPA 1V5TA 2FUHB 4XXEA 1HTPA 1XTCD 1K83B 1ZXHA 2ZNVC 1JRUA 3N3KB 2F4VQ 3BY4B 3PZ8A 3TBLD 2JA5G 5BYRA 3J80c 1EOVA 3VA5A 2R93G 2ZJDA 1LO5D 4G57A 4DV3Q 3ML8A 4KX6B 2Y0SB 1R4MB 3CCSA 1B9NA 2Z6KC 2M56B 1Y8OB 3BG3A 4P73A 4FF3A 5JPNC 3J80E 3A7LA 2KWCA 4JK1C 2IO1B 3BDOA 4JI1L 2NN6I 2W3RA 3IHPC 3VR6A 1K83H 2QA4A 1X1MA 2J52A 4H13C 2VUMH 2VUMG 4LF6L 4PMCA 5C0XJ 2OTJA 3SFEB 1P7EA 1PH4A 4JGHB 2Z4IA 4QL5A 3G48A 4JI5L 4LK1C 1YIWA 4WIPA 3ZXVA 5M3FB 2F0TA 1FVIA 4DAYA 5I2YA 2NBWB 2IDYA 5IT9E 4J3OD 4UHVA 4DAYB 3CCQA 4GNXC 2Q2TA 4I6LB 2RDFA 3PIP3 4I65A 2B76B 4HDQA 2F0SA 2VXWA 3WA0A 4B3RL 4KIKA 4A3EG 1CFMA 1N33L 4FF1A 1KXLA 3DWGC 4H2AA 3OJ3A 2LGXA 4B0EA 3IAM1 4DF7A 1MJDA 2NBVB 1QWYA 4O2DA 4B3SL 4FHJA 2RDBC 4IFDH 2UXBQ 1T3QA 2MRPA 2CKZB 3IT4B 4KZCA 1B7YB 4DV4Q 2MJEA 1QOGA 2BKRB 4FN2A 5J39A 4QMGA 1YNNC 2JEAI 3ULLA 5KNCA 1I50B 2EYFA 3PSEB 3AU5A 2K03A 1HNZQ 4F1SA 1XWEA 2XBBC 4LJPB 2R3ZA 3Q6BA 1WGGA 2QGQA 2AHOB 1HQMC 2JJQA 4ZHPA 2ZCCA 4H02A 2KZRA 2L5TA 5IYCH 1KJTA 1X3GA 2K7VA 4M00A 2E2HB 2WB1G 1QOHA 1M4VA 2ES2A 2NVQB 2BWFA 2HTHA 3W1SA 3KDFA 4A3OA 3RUIB 1G6ZA 2J0KA 2PVGC 1W2BA 2X8XX 2KNBA 4WFN3 5IP4D 2JPHA 2GB1A 2HQLA 5FK9C 1Q82C 3EUB2 3HVDA 4NQLB 3ZXRA 1DOXA 3MXUA 1XF5L 2F1MA 1A8VA 1PRTC 1TWFB 3H9DA 3SVMA 3DEPA 5ELEA 2K0PA 4JI7Q 2N88A 1X6OA 3RZFA 2IWHA 4WQMA 1BKBA 5DM73 2CCZA 3Q69A 4O0AA 4ZUIA 4FYDA 4LNQA 1DM0B 3Q14C 2KFJA 3DEOA 1TWHB 1YNND 3S14B 2BT6A 3M4OH 1H9KA 4DHJB 2J0MA 2D2CC 4W9IA 4X3UA 1AN8A 5EGTA 2JA7H 4MNOA 5D2MB 3DHIC 5DEHA 2DN8A 3WIMA 4EQOA 3BYYB 4DV5Q 1U4PA 4A3DG 3AV8A 3NBHB 2MWSB 4CQNA 2RSUA 2VH1A 3P1MA 4M0WB 4CO7A 3A9JA 4DV6Q 1UAPA 4GDLB 4HCPB 1I4RA 1NENB 4W9FA 5IYDH 4A3MB 2JX5A 1SFOH 3GTKB 2DNFA 2PEAA 4M02A 1STEA 5L95C 3FRPB 2F0IA 5C5MA 2HDLA 1CMXB 1Y8NB 2AKWB 2NVTB 2GBNA 4BY7H 2B2YC 5ELDA 3GS2A 1ZGUB 2Y5CA 5F2DA 1WD0A 1I4XA 1S40A 4A3CG 2MUYA 2EMSA 2A74C 4IFDG 3IVFA 5AZHA 1LTBD 3VYSA 4GLAC 2G4DB 3TMEA 2N1VA 3X0WA 2B2YA 4JBKA 2NCNA 4ZYSA 3CSTA 2K28A 4HMIA 2K01A 4RGOS 4AYBG 2GVAA 1UH6A 1VJKA 4PT5A 1UE5A 4LNIA 3PRMB 2TSSA 4HAEA 3VUXA 4NP5A 2WYQA 2WXKA 1QKZA 3P20A 1Q86C 3DVGX 1TS2A 3CCEA 4A3BH 1Q8KA 1QZGA 4NAMA 1Y8PB 4DUZL 4GOCA 5I9OA 1XLQA 1L2NA 2RF4A 1AFPA 1H8CA 1XMQL 1EY9A 2R92G 4G0NB 4HDOA 3D6CA 3OIPA 4JG2A 4GGQA 3FKIB 1EYAA 3LWEA 3T13A 1TU2B 3DWPA 4BY1H 2BE5C 3T51B 1O7IA 2IGGA 1VQNA 1WMHB 3SFDB 1YJ1A 4LF7L 1X9NA 1SMYC 1J8CA 1SIFA 1SSNA 2B2WA 1H95A 1K3BC 3NPPA 3AEBB 2PO4A 4PMWA 2AUJD 2EYLA 1N62A 4IUMB 4HEDA 5BN3A 3UINB 4P2CB 2I07B 1RCVD 2K14A 1G6PA 1EO6A 1ZEQX 3T1YL 2V3SA 5IGFA 5JH5C 1STNA 1AZQA 3CAMA 2K4KA 3I2ZA 4RCOA 1N63A 3FP9A 3R2IA 3S1NB 2K5PA 3B2GA 2N8NA 2KWVB 4RCNA 2JRIB 2F4VL 2WXPA 3J9CA 5D94A 3J80i 2HT1A 2PLPA 1HTQA 2ZT9C 4DHZE 3NWTA 4OIKA 3RNUA 1HRJA 3MJ5A 2JA8H 2BE5D 4FO2A 4LCDE 4R4QA 1YJNA 4BA1I 3VRBB 1SNOA 3CMMB 3A7AB 4JWSC 4R1JA 4A3KB 3DBLI 1GUSA 4P72A 1QILA 1GB4A 4B3TL 1P1AA 4CJ1B 3VVWB 2L55A 1ICFB 1RDPD 2JA6B 4P71A 1CA5A 4JYAL 1HE8A 4EZLA 5JZEB 3SR6A 1E8ZA 4BBRG 4MJSB 1YX5B 4PQXA 4CHTB 2F3VA 4YL8A 1BUVT 4R8IA 3NHHA 4YXDB 1B4OA 4JPBW 2AWOA 3RMKC 1NYRA 1EIFA 3RZWC 1E7ZA 2EMTA 4L23A 2B63H 4DNTB 1I50H 3PT2B 2M17A 2PZUA 4DR1Q 2F3IA 2VZKD 2QCZA 3QWZB 2MGSA 1SLJA 4FJYA 4IM0A 4N9F4 4JI6Q 4PZ7A 3S24A 4ZLTF 1D7QA 1FRDA 3MXNB 1S1QB 2QKIC 4F7XA 1FPYA 3VRAB 3OJ4B 1CUKA 1N36Q 3K0XA 1LYLA 2KDFB 3Q3FA 3ZLZA 2GMIC 4LMQD 3RD4A 4JI0L 3M85A 1YQBA 4YWMA 4A55A 4EZJA 4A3GH 4BBSB 4XZ4A 1U5KA 1PZJD 4OVZA 5CV5A 4TQUS 4MZ9A 4YCVA 1F1HA 1EL0A 4IQZA 2JXXA 4NKLA 1L0VB 1UWMA 1WGYA 1HTOA 5AZGA 1FXTB 1PVOA 1SYDA 2LZ6A 4IPGA 5J22A 1G2TA 2Y3AA 2A8VA 1L2FA 1S5DD 3BZKA 2R61A 5IIFA 1JW9D 1BCPF 3A54A 4AH6A 3GTLH 4QJFA 4GNXB 3TEYA 1RLFA 4W9EA 1K8GA 3U58A 2MQHA 3I4MH 1EYGA 1ROEA 1LTSD 2X69A 3S1MH 1FJGL 2VQFL 4JBMA 4LFCQ 2D07B 2MP1A 3DMUA 3T56B 1BT0A 3B6YA 4K7WA 2REXA 4MGKE 4HRSA 3BU2A 4PV1C 5FR6A 3F2BA 2GBKA 2Y5BB 3DDCB 1P7FA 2XRQD 1TWGH 4KHPL 2KLGA 5FLXc 1ZYRD 4ANVA 4DQOC 2JP1A 4L5RC 1D2BA 1ENCA 2IL8A 3ERQA 2BYFA 1KTKA 3ZJTA 2M9VA 2W55A 1EY8A 2N9KA 2INCC 4OZCA 2WP9B 1J6QA 2HJ1A 1Q1EA 1RTOA 1IGCA 1GG3A 3G71A 2JA5H 3Q3JA 1SNPA 4DV2Q 1BBXC 4DAPA 1QVGA 2MHJA 1DOYA 2NZ1D 4GMVA 4KSKC 3KLWA 1R9TH 1CA6A 3PZ7A 3ZIMA 2JA7G 2B63B 4W9DA 3ZQ4A 1FL0A 3ONSA 1QJOA 2UUCQ 2O6VB 5EE3A 4JCVE 3RN2A 1WGRA 4NDXA 2M0AA 1V81A 1YHQA 4DR6L 2B8GA 5AJ3L 1OTCA 3FVQA 4OL7A 3OIQA 2EKIA 2OCEA 3KYHC 2JZPA 2LJIA 1VQIA 4QF4A 2FHTA 4KKTA 2NZOA 3NTKA 1F9RA 3J81i 4NMZA 3FEWX 1EY7A 4RHRA 4AQYL 3KF6A 3FILA 3K7UC 4L8JA 4Y7NH 3MC8A 3HOWB 5AZFA 2FAZA 1XMOL 5G55A 2LGIA 3TP8A 4DR7L 4IM2A 4RG1A 3SK6A 1L0YB 4DV0Q 3DVNU 3OW7A 1IBML 1N32Q 4JI4Q 5BN5A 2ZPNA 4M0WA 4CYEA 5BYSA 2RHQB 1FCLA 3GO5A 2UUAQ 4R4IA 2NN6G 3CRKC 3L4PA 1LABA 3QOJA 4A3DB 2AUKA 4A6QA 1U4AA 1K53A 3AB5A 2BDOA 3V2TA 2C7MB 2LUEA 3QB3A 5FJ8G 1TKEA 2K5HA 3K9OB 4MSMB 1GO3E 4E6IA 2AYOB 1STHA 3M3JA 1FJGQ 3HIZA 3KOJA 5M5XB 1I35A 3HS0C 5DAUA 4LUZA 1VDVA 2D11A 3HOXH 4A3MG 3WAOA 2ACZB 1GOZA 1U4RA 3K5MA 2KKCA 3NELA 3A9JB 3KH0A 3SEBA 3PLVA 1TR5A 1X3PA 3HHMA 3QCAA 2O5JC 3WAMA 3GTQH 4W9HA 3JC66 3CQZH 1SE2A 4NQKE 2WXRA 1NCVA 2KJXA 2ZTCA 2J0TD 1BUIC 2JWZA 3U7DA 3VR3A 1CHPD 1MGSA 2WKCA 3C3LA 2WAQG 1DGSA 1HZCA 4JI6L 1D8LA 4GS3A 4RF1A 5M3FG 1M1KC 4W9LA 3UDXA 5JEAG 1WXVA 2BYTA 2QEXA 3I73A 2QMTA 3PCOB 5IP7H 2W3SA 2E8GA 1Q81C 3N1ZC 3PO2G 2XK5A 4FLHA 1JALA 1MSHA 1DZ1A 3MXPA 4KY7A 1RM6C 3LGJA 4WJQA 2V4IB 3CF5A 4EUTA 2FE8A 2YTXA 3I57A 3GQBA 4ALPA 3Q8BA 5EE0A 1GC7A 1BNZA 1RFKA 2G5DA 1H4RA 3KLSX 1WCMB 1E7VA 1K73C 4XDDA 1XTDA 4G50A 3HUIA 2N9EB 2MBBB 1YD8U 1ESRA 2K8HA 4K81A 2BB6A 2RR9A 2C7NB 4BY7B 4BKGA 1JORA 2A6ED 2NBUA 4IOAA 4AJYB 3S1RH 2B2VA 1GUOA 2KHWB 3DQVA 1SFOB 1XNQQ 3GTKH 3KYCD 3PV0A 1NMFA 3K5OA 1YNTE 1GHJA 5CBAE 1P98A 2CU1A 3M95A 3MP9A 3HOWH 3NUHB 1X54A 4FDBA 5G3LD 2DGYA 4R4CA 4RF0A 3I3CA 3KK7A 2KENA 3L17A 2FCSA 1K0SA 4H7BA 5NUCA 1ICWA 2JU6X 2BWES 4C3JH 3CIRB 3IFDA 2N49A 5FOBB 3AEGB 3T53B 5K5PA 3PPAA 3DBHB 1SMXA 3CW2C 4JI7L 3I4NH 5TSSA 4QCLA 3BINA 2VUMB 3NVZA 2HCIA 2A5HA 4A20A 1YNJD 1WWTA 3NP8A 1MHXA 1PTOC 4KN4C 4JV5L 2NVTH 4GN3B 5KGUA 1Q10A 1PZID 3S1MB 4D2KA 1OO9B 3I8ZA 2LXCA 5C1ZA 4HXDA 1E10A 3H7SA 4IURA 2L7RA 1XYIA 2IPKD 2VB3X 2JEBI 1VR9A 2H88B 1JOKA 2RVLA 1JWAD 1YHBA 4DNIA 4KHVA 4HSPA 1K9MC 2FBWB 5M5YH 2QW7A 1HPCA 1WCMG 1WTXA 2F0EA 1IW7D 3HG9A 4QUCA 3RNGC 3AB9A 4NB3A 2B39A 3K5NA 3T1YQ 1C3TA 4HEA1 1SNMA 3K57A 5IGDA 1QUQB 2JY6A 3M9BA 4N8FA 2F52A 5D3DA 1B70B 4KSLC 1GXDC 4LAAA 1CKNA 1PZKD 5AUKA 5HURA 2Z9HA 1RL2A 2K50A 2WDQB 3LX0A 2MBQA 2Z1CA 5HGQA 1WGKA 5EAYA 4DXFA 2DJFC 2UUBQ 3KJOA 2XK5B 3TJPA 1X3QA 2Q2UA 2NR2A 2KDEB 2EY2A 1LXDA 1TKYA 4XGAB 4MHEA 1Q3LA 1AZPA 4BBSG 5CX3A 3H8HA 4JL9A 3QIAA 3CU7A 4JI8L 2QHOA 4N9PA 2V1CC 3S1RB 2AX5A 3R2TA 3U52E 1E1TA 4BOZB 5AFWA 3P42A 5AUIA 2ZM6L 2WS3B 3IAS1 4BS9A 1XPUA 2WXLA 1VLBA 3BZCA 2K6DB 3RZDH 3VR2A 5IOCA 1VQ8A 2OJWA 5JEAH 4BKSA 3H7PB 3RN9C 4HJ7A 1MI0A 4EEWA 3EFXD 3HGBA 2FINB 4R9WA 2LGSA 1X3EA 2PNRC 1TWHH 4GOPA 1T0SC 2ZXOA 2KJRA 2W9NA 1E2ZA 2WDRB 1E2VA 2V9HA 3PVLA 1KD1C 3HOVH 1KIXA 3TP6A 2F3WA 3JAME 4A3GG 1N5WA 2QDFA 2RKSA 2KJ6A 2PQAA 2A68C 4YWLA 1GUTA 1JJ2A 4OONA 1A0IA 1B1ZA 1SXTA 1R4NI 4BY7G 1JWSD 2PJHA 1RRBA 2QC8A 1TWAB 1VQCA 2E76C 5CMDA 1YJIA 4YSYB 5H8YE 4UP7A 4OWTB 1LTRD 2DENB 4GU2A 3UF8A 2G9HD 1CK1A 4A3FB 3S17B 4HK2A 1Q8IA 1VQKA 2DZIA 1SR3A 1I6VC 4KKJA 5A35A 1B44D 2NTTA 3NEMA 4BXXH 4C7YA 2B63G 2N1WA 1XJVA 5JJKA 1S4ZA 4DKAC 2BS3B 2KMMA 3RT3B 2ZVOA 1NSNS 2AQ2B 1QOFA 4AP4C 4KY5A 2J7ZA 2WKDA 4K6LA 2GI9A 4B3ML 3HP3A 2JRHA 2NS5A 4IKGA 4K3CA 2VNUD 5C44B 3TQYA 4ZRIA 2HD3A 1WZ0A 2B2TC 2WLBA 2XNAC 3VTVA 1RTNA 2RGFA 1FNVA 4CDEC 1WZ3A 3CSFA 4ME5A 3P75A 2I38A 3MTSA 3J7YW 4NPSA 2WP8J 4W9JA 4DV2L 1VCIA 2VB2X 1EY4A 3K7AB 1CTMA 5KYIA 4GDKB 4RFBA 3D8GA 1VQMA 4AOFA 3QOLA 4B3RQ 2C60A 3GDEA 4MH8A 1E9MA 1EWYC 1GPXA 1AH9A 1PDXA 3HKZB 4A3JB 3DWMA 5IYBG 5LXIB 1EU3A 4DR5L 4B95A 1PV4A 2BYVE 3HRDD 3KF6B 3FILB 3JW0X 5D3IB 3SDZA 2DZMA 3NY5A 1XO3A 5BR8Q 5KRUA 4G11A 4G3XB 1PGBA 3U2SC 2R92B 3GZNI 2K6AA 2AWNA 2G4SA 2GVBA 3I56A 4ZK9B 4ICVA 3KUPA 3V62A 1YVCA 4BY1B 3B08A 2VQFQ 1PH8A 1LT3D 1L6VA 1W6KA 2Z0SA 3W3AA 4R8NA 1PFMA 2XWJB 2ZXPA 5BYQA 2FMCA 1D5ZC 2NB0A 1CHQD 2KX3A 3BWUD 3BK1A 1STGA 1EFID 2FCNA 4DR6Q 2J4XA 5KHQA 2JK8A 5C4XB 1WX8A 1PH7A 1NNXA 4EOYA 2IZVB 5HHDG 4LF8L 2JSVX 4NJCA 4PNYA 2XN9C 5HI1A 1PFNA 4FNFA 3PO2H 3N32A 5G5HA 5C6AA 1J0GA 1X3FA 3ZO5B 3S2DH 4CJ2C 3I4OA 4MN3A 1IYJB 1HNXL 2IY0B 3ZNGC 3GTJB 4XE0A 5C44H 2VL6A 3PSIA 4J1MA 1T9HA 3G6JB 4KV6A 3N9YC 2WX1A 2NN6H 1TZ1A 3CD6A 2DHZA 3NTHA 1G6JA 5GAEC 4II2B 1Q90A 3H0GG 2E75C 2AL6A 2K8BA 1D6EC 1STBA 1BVSA 2PPHA 1R4PB 1HEZE 1V86A 4EQ5A 5HY6A 2XGTA 2PCFB 2JYEA 2FMMA 4R4OA 4S17A 4K1RB 1UBIA 1V1PA 2RSNA 4N59A 3TREA 3HOXG 4A3MH 3Q2AC 1JWUD 3UI3A 3K0YA 1GJZA 3U9SA 4CDCC 4ANUA 1C77A 5CV4A 1V6EA 4OO1I 1CM9A 4GDKA 2OQ0A 4BBRH 4CDFC 3DM3A 4HVBA 3R3OA 2ZM6Q 3K9PB 3MJWA 4LNOA 1OQRA 3L10B 4IWOA 4RGNA 4L63B 1QVFA 1TS4A 1OEYA 3EA6A 3CCMA 1E2WA 4W9KA 3I4NB 1NY4A 3R8BA 2FIDA 1SJHD 2CW0D 1KHIA 5C4XG 2KANA 5IA7A 4K5WA 4TQ1A 1T6BX 1UGMA 3L08A 5CV8A 2JA8G 4FXKC 4P75A 2DAFA 1YJWA 2KFKB 3RNEC 2I5MX 4A3FG 2WXNA 4JPSA 2N3SA 2PPBC 2KEDA 1I42A 1JICA 1OXUA 1VMPA 1FFVA 2MBOA 1HZBA 1HZ6A 3U30A 2D10A 4PK1A 2KDBA 1KNEA 1JB3A 4NJ6A 4L5TA 1WRDB 1DCZA 5AEKB 3LDZE 1JROA 2L0TA 3RLOA 3S2HH 2AQ3B 4WWMA 4HJ9A 5L83A 5C2TB 2IX0A 1WR6E 4HROA 4A3BB 5CORA 3M63B 2MCNB 2R7ZB 5E7NA 5GXGB 1NR4A 1C7YA 1QZEA 1VRAB 2A19A 5HFYA 4JLCA 1HZAA 4EKUA 5I6YA 4K6DA 3PHWB 2VQEL 1HZ9A 1YN4A 2I1KA 2M4NA 2RBMA 2UU7A 1PTOH 1IBMQ 2CR5A 3HOUB 1FNWA 4S0RA 2D0OA 3MZ5A 4XC2A 3VYRA 4B3MQ 1K52A 1PUTA 4OVVA 1RWSA 4DHJD 2D9UA 2R7FA 2HIXA 1WFQA 1IZ6A 4QUFA 1O7LA 1VQLA 4FXCA 1JJGA 2B2UC 4YIJA 5IYCG 1VQJA 1GUWA 4NAWA 1ESFA 2MPMA 1LT6D 4IUVA 2AEHA 1KLVA 2LWPA 1FRRA 3H1UA 3U7ZA 3H3VC 2KC1A 2KHSA 3W5UB 5IP9G 2NWGA 3HK0A 1KDBA 2JA5B 2CH4A 2R93B 4PYZA 2D3CA 2O2LD 3RLNA 3S1NH 3GZNB 4IUPA 2O2VA 3MXGA 1KDCA 3D3RA 1MG8A 5IE8A 1PRTB 4DR1L 3C0RB 1E24A 1GC6A 2MJ8A 2MLBA 3ETRA 1I4HA 1RHPA 3PGZA 5CV7A 1IW7C 2MO1A 3ICEA 2E5LQ 2K52A 4HWIB 1Q46A 1CI3M 1E8XA 3NS1A 2D2QA 4KN7C 1WJ4A 2QILA 1XPRA 1BQQT 4LF9Q 1L4DB 1G51A 4PYUA 4DV3L 1SGHA 2DYBA 4DBGA 2MH7A 4C4VB 3FKIH 2YV5A 1N60A 4JYAQ 1K8AC 4F8CB 3AFQA 1CZWA 4TSSA 4NJ7A 1XD3B 3SGIA 3SD5A 4BOSC 5I4DA 2YU9B 1PTOD 1Y1WB 3CCLA 1Q0WB 3HOUG 5KNDA 3PIO3 2J42A 2K33A 3UDIA 2NPTA 2R2OA 3M4YA 4WJWA 1PH5A 3SK8A 3P7JA 2XWBB 1VZ6A 4IO9A 5I9PA 1P9DU 5EDSA 4LFAL 4E74A 2KHJA 3M62B 4K7SA 4JOIC 2DJGC 3C2PA 1QOBA 1WJNA 3IG3A 2IBIB 1WTHA 2K32A 1J19A 2KMCA 1C9OA 4HJKA 4HCEA 1LV9A 3L3OC 2G3QB 2VZAA 1I94Q 3HOUH 1L1OB 3A56A 3PUVA 3CCVA 2WDVB 3C8YA 2BH8A 4AJWA 3K5LA 2UXDQ 2EE1A 1VZ7A 4KV2A 2L0FA 3ECIA 2O4XA 3L2PA 4BKTA 4K8IA 3P63A 1WE7A 4CKBA 4B9KA 3OMCA 4X57B 3HRZC 1NR2A 3TN2A 1S72A 1PH1A 3ALBA 5J1ZA 2GOWA 2AWTA 1D4BA 5CV6A 1SJED 1IBXB 1STAA 5E6JA 2WAQB 3A8IE 2GA4B 1N33Q 3ZVVA 1WYGA 1E7UA 3M7GA 2Q2HA 3S15B 1SE9A 2MBHA 4MGIE 3EFCA 4US9A 2C5CA 3ZUNA 2EDGA 3I4LA 3EVQA 3G4SA 4JI8Q 3D32A 4G7HC 3NHEB 1E8YA 2DBYA 3R3MA 3N1YC 1N34L 1VMCA 1DOIA 5CHWA 2L1BA 4UDUC 4N8X1 4DK1A 1TXYA 3KUCB 2NVYB 4A93H 4Y52H 1Y69U 3I4MB 1PGXA 2KN5A 2EOTA 3R7RA 1GB1A 3GTMB 2K1BA 2PIAA 3KQ4A 2WXQA 1A62A 3A8JE 2CWPA 1E8WA 2CHWA 2E2JB 4HMJA 1I4QA 1WX9A 4MDKE 5DPTA 3URYA 3STBD 3KBXA 1H9JA 4JI3L 2YYZA 3L0WB 1P0RA 3TS0A 1PQSA 4XYOA 1ZW7A 2MA9B 4AWJA 1E1OA 4KIKB 1EQQA 3E5SA 4B3TQ 1XQQA 2LGYA 3NBHA 3GTPB 1VF5C 1V9JA 2K05A 1C4QA 3G7LA 3V61A 3ER0A 3SHLA 1PRTF 5CHVC 4FADA 2KUMA 1P8LA 1IUEA 1EU4A 3ZJYC 3G6EA 1NYQA 5EPJA 1FGUA 4DV5L 1MJCA 2X6GA 3C1EA 4FVMA 3F2UA 4K5VA 5EQ0A 2E6XA 2ENBA 1FD7D 2F0MA 3AQQA 3DVNV 1F2RC 2LEKA 2BQQA 2IHEA 2HDMA 2YTYA 1MFWA 5E6PA 3NG0A 3Q22A 2RQXA 2F0LA 1G2SA 3PZDA 2INPE 3BVZA 4XIGS 5DLQE 2H5XA 2ZJPA 1R4QB 3UI2A 3SHQA 5ELNA 1CT1D 3K59A 3CCJA 5CTRC 2LHEA 2L05A 4JX1C 1ZXTA 2WXMA 4V190 1PHJA 1IHZA 3NUCA 1KAAA 1EUJA 1EQVA 2RSOA 4HN7A 5GROA 4CGYB 3Q8EA 3ZRFA 4DXAB 4EVOA 5E1FA 3GTGH 1SEBD 2B2UA 2L15A 2Z0DB 4TUUA 5E6NA 2RDGA 1L4ZB 2FXQA 4RKLA 5L37A 3EROA 3P2BA 1M8AA 2RA4A 4YCUA 1TWGB 3NQTA 1VQ7A 3J7AV 2WXJA 4KDIC 3D4WA 3I72A 2CVRA 2JT4B 4ZHOA 3KFUA 4NPNA 4HR7B 1J5EQ 3I4NG 1ILQA 5C3XA 1PH3A 5M5YB 2KD0A 3UIOB 4C00A 3APDA 2WWZA 1ASZA 1Z9FA 1CZPA 1VQ4A 2L83A 2CW0C 3AU7A 2BGFA 5FO7B 1XXGA 2JYOA 3FDTA 2KWDA 2N7EA 2WB1E 1QVCA 2KQ3A 2X38A 4A3LH 2SNSA 1HHVA 4M01A 1HTLD 1HFNA 2KYWA 1IKLA 1AW7A 5C44G 2EQSA 3TSSA 2KDMA 5D6JB 5BMHA 3QC8B 1Q5WB 3ITPA 2ZJRA 1I94L 4XQQA 1IL2A 1N36L 2V3NA 3BVMA 1WTWA 5JVH3 1Q1OA 3DHHC 4GKJQ 1NVID 3JAMc 2IX3A 2WGSA 1O7ZA 2A6EC 1RD9D 3HKZG 3A9KA 2CS4A 5C4ZA 4DHZB 5CR3A 5IO9A 2YLMA 2PE9A 2BCOA 3N1XC 3WCQA 2L9HA 4X66L 3CCUA 1XEEA 4ODGA 4BBRB 2LUMA 3EBEA 2B8FA 2EYMA 2QCPX 3A0JA 3NS8A 2ZJQA 2VW9A 1KC8C 3GOEA 2V0GA 3MFYA 1AARA 4DV7Q 4OWWB 1IBLL 1I3QB 3TS2A 2UUCL 4LFBL 1RAXA 1VQ6A 3APFA 3KF8B 1WX7A 3RZOH 1VQHA 2LFNA 2XEWA 4APVA 4GIVA 1VQDA 3AFPA 2C35B 2MFIA 4RA8A 5CHFA 5E6OA 2ICEC 4CKEA 2WV6D 2XVSA 4DU9A 2K3UA 1YI2A 2E2HH 1HFGA 1RYJA 3IL8A 2ID0A 3A9KB 1K3RA 3JAML 1AP0A 4FHKA 2F0VA 2PVOD 1M94A 2BA1A 2KOXA 1SYFA 5KEEA 4ANXA 2LY7A 1HR0W 3VFKA 1DOKA 1KAWA 4C2MH 2B29A 4REZA 2MHVA 4X65L 3OTOQ 2KWUB 1KL9A 3AEEB 1DGJA 1YNJC 3JSVA 2Z59B 4FXDA 3Q8DA 1C4AA 3A1QA 5T1IA 4C3IH 2R7ZH 3CC2A 1CZGA 1C48A 5FJ8H 3VUWA 2OXPA 3I9V1 4YY3Q 1IP9A 4BAXA 2KBNA 1FO4A 1O78A 1SF0A 2LRWA 3RLFA 4YSZB 4DK6C 2JN4A 4C3JG 1OQYA 3AEFB 3WDNA 4JBWA 3X3MA 4C3HB 5FO8B 4UP9A 1L6UA 3GE8C 3VQIA 1W3SA 2MNAA 4A3IB 2RDHA 2UXBL 3F1ZA 2RPVA 5LHY1 3HM3A 1J7BA 1WCMH 4MJSA 4ZRKA 5E4XA 3GD7A 4K2LA 4L6TB 5IODA 2FNJB 4YHHL 4XTCS 4YWGG 3ONAB 3H6NA 2MBEA 1HNZL 1KM7A 1VCBA 1IYUA 4R4TA 1A15A 3U9OA 4L5SA 2JYTA 2JZZA 3ZNHB 4A3JH 4DR3L 3ZJVA 4YHHQ 5FLMG 2DY7A 1PTOF 3J7A5 1WTRA 1I6HB 3K7AH 2D62A 2IGHA 2INDC 4GDLA 3VTWA 1NAPA 5BN4A 2JSOA 2I0QA 4CHKA 1I3QH 2F0HA 4X3TA 4IUTA 4DV0L 1EIHA 1UEAB 3QJYA 1FM0D 1Y56A 1STYA 2CJNA 2IGDA 2DZKA 4GLVB 2LS01 2KXJA 3AI5A 5GAHC 1SMYD 2LJ5A 3A1QB 3QX1A 4ABNA 2HE7A 2NTSA 3GTQB 1SYCA 3TEZA 2NVXH 4DA2A 3HOYH 1ZDXA 4JV5Q 2IHFA 4LUVA 4IDIA 1SIJA 4KD4A 2EELA 3L13A 1XLOA 2DZJA 4DK5A 1KDAA 1D5XC 1EQTA 3NWSA 3AE5B 5IN7A 5E4WC 1L0XB 1W6JA 3DM1A 5MPOA 4V0BA 4KHZA 4DR4Q 1F52A 1A6XA 4WWNA 1GUAB 2J7QB 3L54A 4KKIA 4UY8C 5C4JH 1BXTA 3VA7A 4MIUA 3B1LX 1YMHE 4AYBE 2JXTA 3KWLA 2AL3A 5C3EB 2ZTDA 4KLKA 1SRUA 4BVUC 2F0GA 4IFDJ 2AMCB 1EEFD 2PZTA 4JIOU 3S2AA 2F0PA 1UWXA 1Y8RC 3W9CB 1DOLA 1WSPA 1WY8A 1K28A 1V80A 3ZNID 2KDIA 1R4MI 1WTVA 2BKFA 3I4MG 1G91A 1NEKB 1F9PA 3KLRA 1ZXIA 4B9XA 1SE4A 4CDDC 4Z9CB 2ONQA 3OG5A 1PFDA 1XPOA 3WANA 1A3UA 3VH3B 1X56A 1ZOYB 1WM2A 1T5XD 2JVCA 2RHSB 3GE3C 4QB4A 2OEDA 1B9RA 2SAKA 3S1QH 2RD0A 2I5HA 1VQEA 3UDGA 3PLUA 1BOSA 1LQBA 1GM5A 3MA2B 1YN5A 2JWUA 2PZWA 3N52A 3P1HA 5G5GA 1WTPA 2MJDA 2MP2B 1H9MA 2JA8B 4LDTB 1N61A 3LJ3A 3IBEA 4LFBQ 1LTTD 2JA9A 1IPGA 4DWFA 5ISRA 1QQRA 1TZOA 2N78A 4C56C 4M8MA 1V8QA 2PW5A 1SE8A 2PQAB 1EY5A 1YITA 3AEAB 4O42A 1LM0A 2CKHB 2KTRA 1F2ZA 4HCNB 1JT8A 3PRPB 5J17A 4HSVA 1XLNA 3T16A 3Q24A 2ALYB 4GOPC 4KHPQ 1FFUA 1WIAA 2NMQA 2LXKA 1TIID 5FLXE 2INNE 3NENA 4IWQA 4A3BG 3QHTA 2K22A 4K5XA 1UE7A 2UXDL 4LNNA 4JC0A 5C3EG 1Y1WG 1EWCA 2K5QA 4JI0Q 4FJVB 4OVUA 1AE2A 3RD2A 4EE2A 3HKSA 4GB9A 2ATWA 2NVXB 5M9OA 1VQBA 4C3HG 2LKVA 3U4VA 1TY0A 2HDEA 2KQSA 2BB5A 4OW0A 5BR8L 2HQEA 1KLUD 1XT9B 2O6VA 4WJOA 4UPAA 5FO9B 2EVBA 3NTIA 3DBSA 3ZRCA 3MAQA 3SK5A 4A3FH 1EF1A 2F0FA 1Y14B 4F8MA 2DYMA 1FD6A 4IUQA 1IBXA 1GNUA 4IUNA 2WXIA 3AM9A 1ZKOA 2BTEA 2B2WC 5A2QL 3NSWA 2KTRB 2V4LA 2D5DA 2F0WA 2PKOA 2BS2B 3J80L 2K8CA 3AE1B 2HTME 4L5QA 2N55A 5IGCA 1HQRD 1IBKQ 1LGRA 5M3MH 1SYGA 2LGDA 4E71A 4YCWA 1V49A 1SAPA 2Y0SE 4IFDI 1HR0Q 3PO0A 1XX8A 4RGTA 1T0QC 1WXMA 4C4VA 2B2TA 3FKYA 4BBNF 3AE8B 4HJ5A 1L1OA 3OMGA 4QGUA 1D5MC 5M3FH 3R7QA 4KMUC 3KJPA 1QZHA 3AXCA 3AMZA 5HG2A 3OHXC 3H3VH 2V3PA 1R7SA 3GB1A 2PNHA 4ZYNA 2R6GA 4DXGA 4W9GA 5FLXL 5JJZA 5FKAC 4RHSA 1QG7A 4GN5A 1F2MA 3ZYYX 3ZTDA 5KIXA 2N7JA 4LF5L 4FA6A 4DV6L 1NDDA 4LW1A 1I4GA 3RUZA 2K04A 3PUXA 1ZUD2 1CQFA 1PLFA 4XDXA 4A3IG 4LFAQ 2FUG1 2HHHL 2F0DA 2L11A 1AE3A 2E3TA 2V1YA 1EOTA 2N4FA 4MGZE 2ASQA 4WJ3M 3I91A 1V43A 2AQ1B 3VTUA 3B9JA 5IP9H 3BDLA 1LACA 4FF4A 2OHFA 3M3YH 1C4CA 2MX2A 2E5LL 4DDGD 1U0LA 2L76A 3DVGY 3KWVA 4HKZE 4MH0E 3JYUA 2WXFA 4EQPA 3NVWA 5DPSA 1EQRA 4X3KA 1QF6A 2L12A 4N58A 5CV9A 4ZUJA 4C80A 5LMUL 1ZPSA 1N34Q 1A5RA 5EE9A 4M8AA 4A3KH 3H0GH 4Q5VA 3W1GA 3TL5A 4JVZA 2N9PC 1YIJA 3GTOB 2K9XA 4LFCL 5ELOA 1UGJA 3EJIA 5GAGC 2A4ZA 4I7AA 1NBWA 4FF2A 3L16A 1WGHA 4X3SA 2M2LA 2VS1A 5J2RA 2VZKB 3AEVA 1Z7TA 3AN1A 4GN1A 3KW5B 1S5FD 1EM7A 4ICUA 4KDLB 3VR5A 5CBEE 1C8CA 1V5OA 1JMLA 3MEHA 1IKMA 1WXQA 2Q8TA 2NVYH 4IW0A 3OW2A 4QIWE 3MHBA 2EZVA 2GBRA 3FAHA 1XNRQ 4LNFA 3I5JC 3TMPB 4TKNA 1N8RC 2RMMA 1IL8A 1KRTA 2PW9A 3AYHB 3D0FA 4KZ0A 4TMAB 3QQ8B 3T8MA 2F0OA 3S15H 1WTOA 3IT6B 1N6ZA 1XNRL 1CKNB 1E0BA 2WHIA 2NUCA 2FCMA 1SNQA 3HM6X 5JXVA 3JVZX 2D3BA 4OX9Q 3KF8A 1MIUA 2E2IB 3SDLC 3ZTCA 3R93A 3ULPA 2QDBA 3WALA 4TKOB 1IYFA 4IC7B 4DUZQ 4MM3A 1CQVA 1U9RA 5KYLA 2KN4A 3KVFB 5JVG3 2NPTB 3TEWA 1UF0A 3VXWA 1HXYD 3TDQA 4DR2Q 2E2DC 1TGZB 2XRSD 1L5PA 2QEJC 4OO1H 2H89B 2JF5A 2KQ4X 5D14A 4F7ZA 2PYKA 3DBHI 2BA0A 5EKIA 3T4AC 4F88A 1WJ6A 2DNCA 2JZ3B 4LLGM 5DM63 3AE9B 3O65B 4CBVA 3LNNA 4AIMA 4LF5Q 3RN5A 4KGTA 1ONLA 2EXDA 4HLEA 1N32L 4A3EH 4GKKQ 3T3OA 1V9PA 1ET6A 2KCTA 4IPHA 5HKHA 4K0KQ 3KLSA 3PO3B 2ASBA 4XWWA 5M3MB 4HIKA 1B53A 3V6CB 1BF4A 1MVKA 1IBLQ 5EPKA 2YEPF 3D6WA 3RZOB 1NBFC 1SNDA 1JWBD 2BS4B 4A9AA 1NUCA 2ON8A 3QIJA 3OPOA 4K0KL 3S2HB 2LHDA 5IY0A 3EHVA 4LF4Q 1B9MA 1VQOA 2QSDA 5G3LF 4A8XC 3R66C 3CMEA 1OGWA 2DWQA 1WXAA 4DAMA 2O6VD 1DONA 2WB1B 5DNFA 5IGBA 4M1UB 3PF4A 2C9WB 1PA6A 1YX6B 4WURA 3UQBA 3V96A 4WWOA 4LF4L 3U8ZA 4MTKA 3CMAA 1GD7A 3J81c 1NTGA 1PH9A 1EFWA 1SBBB 2WXHA 4RH6A 4EZKA 2GLSA 3IKJA 2LVPA 3PF5A 3CWIA 3ULJA 5I2XA 3PHXB 2HUGA 3HOZG 1WH3A 4LK0M 1AEXA 4LF7Q 3S2DB 3MXNA 2OT2A 4HTHA 2EJFC 4EX5A 1IYVA 1TYGB 3DPDA 1WR1A 3N30A 4LDTD 3PMFA 2CHBD 4IWPA 3TP7A 1PFSA 1DXMA 5IWAQ 4DR5Q 1JOQA 1UELA 3V3XA 1L1OC 5GQOA 1N9WA 1UE6A 4H44C 1JB7A 4G4KA 4DN4M 5JPMC 2PE6B 2VH2A 2E2IH 2N9XA 4E3CA 1WFYA 3BZDB 3F2DA 2CFMA 4A3PA 2ZXRA 5E3FA 2LSSA 5LNK1 1WYWB 2O5IC 3OWFA 3A4RA 4DK3C 1RIPA 3CCRA 1LUZA 1FR3A 3V05A 2DAJA 3K58A 3TP5A 1DOMA 1XMOQ 2R92H 3LXFA 3ZKJC 2DUDA 2UU9L 3IRBA 3RI7C 1LTLA 1SYBA 5FLMH 3DWQA 2VRRB 1TS5A 4K3BA 1WMHA 3QR8A 1PTOB 1EY6A 2A68D 4LJOB 3Q3MC 5ELFA 4ITKA 1SE3A 3S16H 3DOWA 1C78A 3L7ZC 1A2TA 4HPPA 5ELBA 3DBRB 5JHAA 2EXZA 3GP7A 2DYOA 1K0RA 3M7NA 3MFGA 1WD1A 5CGKA 3C46A 1S5CD 4WORA 4FULA 3IFTA 4KY6A 3ND8A 3UDFA 4RGMA 4HIDA 1MSGA 1MHWC 4B3SQ 4YTNB 2G1EA 1EYDA 5J18A 1YJJA 2L1AA 4IOIE 4IM3A 1A2UA 3HOZB 2K39A 4DR3Q 3DUZA 3OOCA 3VUYA 2PW7A 1H9RA 4HJAA 2WNMA 4P16A 4JW0A 1K50A 4LWCA 2Z0EB 3K81C 1TKWB 3NQIA 4TRDA 4DV1L 4RM9A 3EECA 1ML0D 1HH2P 4X65Q 2DLBA 4ZOHC 3HEJA 3VH4B 2R7DA 4OHJA 3S17H 3W2DA 1LTID 3GTPH 1QNKA 2C9OA 1EIYB 2IT1A 5C4HA 1MG4A 2O2VB 2L3ZA 1RF2D 2KJHB 1TJEA 4IOCA 4B08A 4DR7Q 3N20C 3KBGA 1F2YA 4U673 1FMAD 4AS1A 4AQ7A 1ZE3D 4G7ZC 3PS6A 2F03A 2JXMB 1GJXA 4JE3B 1Y1VB 2WFWA 1J7CA 2QIEB 3AU4A 1HUMA 4DR2L 1UZXB 1NMGA 3X23A 4ACFA 2K75A 5COYA 5C0XH 2QDLA 3ZGZA 2JQRB 3E6ZX 2WU2B 1TS3A 3SE0A 2BBCA 3ZNZB 4O1NA 1BMLC 1S5ED 1SN8A 3CRLC 4JBJA 5AJ3Q 3RNCC 2WAQE 2IO2B 3E9SA 3Q8CA 2KCMA 1YZ6A 3A55A 4GSWA 4XYCA 2R7ZG 2KVMA 4KKSA 2CU3A 4YTPB 1KABA 5EE1A 4RMFA 3TBIB 3KUDB 3RZDB 1S3SG 3H7PA 4C3JB 3CPWA 3AE2B 4PS7A 5D7GA 3OYYA 1TWCH 4BKSD 3PIOA 1WGDA 2EJGC 3GTGB 3IFWB 1JR0D 1M90C 5LMNW 1VDZA 3NJTA 1OXVA 2KO3A 2ZNVB 2WDTB 3NOBA 1LT5D 1TWAH 2DY8A 2M8SA 3A5UA 1C1YB 3E56A 1V97A 3TEHB 1Q12A 1VQPA 2PTLA 2FFKB 4DV4L 1PGAA 5BMGA 4DUYQ 5C4XH 1Z2MA 2WQYB 2LXJA 2Q8IB 3HOVB 1II3A 1QT9A 3PIPA 1CKOA 1WXSA 2MEKA 3H91A 2KFKA 3TRZA 1BCPD 2OEOA 2ZTEA 3WOFA 2Z8LA 1TT5B 2HD5B 3QA8A 3K6OA 2CWAA 5IT9L 4JI2L 5M3MG 3EC8A 4RNAA 5JEAJ 4KJNA 1ISNA 4WRDA 5G2NA 2DX5B 4ARCA 2K5WA 4RKBA 4EQNA 4MT5A 5LXHA 3PREA 3PRZA 4WWPA 3MHSD 4HPLB 1N5XA 2EJMA 2PMZE 4XT3B 3H15A 2VQEQ 1HNWQ 1JRPA 3RYTA 2KAJA 4OGQC 1XCQL 4X62L 2R2QA 1IGDA 1FNUA 2UWQA 5DPRA 1D1IA 1GVPA 1UEBA 3FPPA 2A6HC 4AQYQ 4XDCA 5EBDA 2OJRA 2GBJA 1V1PB 4OO1G 1F2RI 1OQQA 3J81j 3T9LA 3RPFC 4NAWB 3VR8B 2FCQA 3ND9A 1U4LA 3S9WA 3ZW3A 1L0WA 5IP7G 2ZEQA 5K36G 2F0JA 4QAYA 4A93B 4WAAA 2A1AA 5C3JB 5A2QE 1V2YA 3UE0A 4IPDA 5J3BA 1BBUA 1VQGA 1X55A 2F0UA 2KHIA 1EIGA 2XSCA 4OWXB 3STBC 1AWDA 4CJ0B 2BW2A 2EIFA 1MJEA 1X65A 5H92C 3X3NA 3ERSX 4OXPA 4A75A 1YJ9A 3DBRI 2D5GA 1JE4A 1V1OA 4X64L 1Z47A 2SOBA 3SXHA 2Y5PA 3PTFC 4HJGE 1GKHA 4YY3L 1T0YA 4I6PA 1NJIC 2Q8RE 2OF1A 1KRHA 2R93H 5JJLA 3VYUA 3HOVG 1LLRD 2M00A 3MEFA 4X64Q 3HFZB 3T1HL 2LD9A 3BK2A
chains in the Genus database with same CATH topology
1EYCA 1JOOA 1MD2D 1B50A 1NI3A 3D4DA 3IXSA 1ZP0B 4U68A 3P4SB 2L32A 3VR9B 1MHHE 5C0XI 2FJ2A 2QJLA 1K51A 4OIJA 2LMCA 1JQ4A 4KKUA 2I2YA 5KNBA 4Q2JA 1C4PA 4WAFA 1GHKA 4C1NI 2E74C 3H6MA 4KGSA 1VZ8A 4N6EB 2SEBD 3Q8FA 1K8OA 1LTGD 1FEHA 2WACA 1FIQA 4KJOA 5CC4A 2F0NA 1TKGA 5C3WA 2N0SB 4EGVA 3O13A 2EYOA 3J81E 2H4OA 3VR4A 4XWTA 4AYBB 1LT4D 3D4RA 3HVZA 5M5WB 3J7AF 1KH0A 4QIWB 2EY5A 1E0ZA 4ZRZA 5EKKA 1C79A 1Z6HA 2BOSA 3AMUA 4S3SA 4BA2I 3SK4A 3PUYA 3MC0B 1XCTL 4J6HA 3WOEA 1O7YA 3Q6SA 2CJOA 5HGTA 1K8MA 3I90A 4ID6A 4IN3A 3FPUB 3AECB 3DWAA 1KF6B 3PUZA 1ZYRC 3A8KE 3MHZA 3MVVA 4KK7A 3S1QB 1ZDVA 5LL6S 3AE4B 3NE5B 1QOAA 1OXXK 1ENAA 3P4QB 4ZKBB 5ELCA 1KLGD 1HUNA 1FCCC 5T1GA 4G7OC 1JC7A 2A73B 2MJ3A 3NK9A 1D1KA 3AE3B 4R3DA 2QF7A 5IGEA 1I7HA 5EJWA 2F0KA 3L9AX 1X32A 3CHBD 3S16B 5EKLA 3AE7B 3RFZB 1BCPC 1RJTA 2K5DA 3E0JA 1PDQA 3NXWA 1EZ8A 1E7PB 1F0ZA 4OZAA 1TVXA 3FC4A 2EY1A 4KTAA 2XIWA 3BDCA 1QLBB 4JWUC 2J53A 3Q23A 5EBCA 5JAVA 4IALA 1PYWD 2YEPB 2LFIA 4ZRPA 4K8JA 1C9FA 3TZUA 4H0LC 1OXTA 1FYCA 1EY0A 3EQLC 2W54A 1F9SA 4MACA 1BCPB 3OWEB 2I46A 1DJRD 1V8CA 3TZDA 3AE2B 1A3VA 1EZ6A 1UNSA 4GZYC 1TQOA 1A3TA 4USAA 4ZQ3A 1TY2A 1DYQA 2WINB 3W5VB 2A6HD 4YTMB 4ZKCB 3NZ3A 1ILPA 1B2TA 1HA6A 3DXJC 4XQJA 1ENFA 4Q0FA 4P6VF 2M19A 4BWGB 4US8A 1YQ4B 4HKQA 1KFYB 4B9WA 1QCBD 1SB3C 5JOBA 1XLPA 2KEEA 2WIIB 4LTUA 2TMPA 3U4EG 1BDOA 4F87A 1GAQB 4L2YA 4NZLB 4C3IG 1TWCB 3H09A 4YT0B 3P4PB 2KA7A 4ILWA 4IZ8A 2PMZB 3HOYB 2X6LA 4GLSC 1JQYD 3NRZA 2KOLA 2V4DA 1J8IA 4ULLA 1SSOA 3LWUA 4K2KA 1WTQA 4LJZC 2ZW1A 1O80A 1GUNA 3IAYA 1BR9A 1I4PA 1R9TB 1F2LA 5LL6X 3C1FA 1FXIA 1YQ3B 2EPBA 3H94A 4C2MB 1UUPA 4DNRB 3AEDB 3MWYW 4KI0A 2L0CA 4I7ZC 3M4OB 1RKNA 4YSXB 4A3GB 2EYHA 1WRIA 1GUGA 2B2VC 2L4NA 4C1NK 4KGRA 4MM3B 2JE6I 4HCSA 4DFAA 3NBIA 1ACCA 3LB8C 1YN3A 2H1EA 5T8IA 3BVGA 4K14A 5H92C 4RWSC 1PMRA 1PRTD 3TEXA 1HCZA 2WXGA 3J81L 4OZBA 3SR1A 3DHQA 3QO2A 1T5EA 4WH4A 4DK0A 2F4IA 4DAVA 2F0QA 2IW3A 1F77A 4RAUC 3OSOA 3PO2B 1E6EB 1DD2A 3D31A 4XT1B 5EPLA 4XYQA 1VF7A 2W82A 1HA5A 3CKIB 3N6RA 1OXSC 1H9SB 2KECA 5C4JB 1SDFA 3NVYA 1LTAD 2SNMA 3HZXA 4UAIA 4TQ0A 1PFBA 3VYTA 3Q8AA 1FXAA 1EEID 2IJ0A 3EGRA 3ZJUA 1G291 3PUWA 2BDNA 4B0MA 2WXOA 2WU5B 3GV6A 4IUUA 1JWMD 2G9DA 2SDFA 3AE6B 1MI2A 1S5BD 4Y7NB 1PXUA 2PQEA 5C5LA 1RODA 1C76A 1KNAA 5C0XG 3H0GB 2N9LA 3QWNA 4A3EB 1JCKB 2LMCB 4KD3A 3HOXB 1H9SA 1OFFA 4CKCA 2ZW0A 3M3YB 2GRIA 2NBFA 1J7AA 1SNCA 4N9TA 3BIID 2EYPA 4J8QA 1G8ZD 2KCNA 2NYZD 3LYYA 4FP5D 4C3IB 2EY6A 1A70A 2ICIA 2DNEA 3BS1A 2CQAA 4NW2A 1FGBD 3I70A 3GV3A 1MPEA 4A90A 3ABVB 4PMBA 5K36H 4ARIA 3FMCA 1WVLA 2A69C 1HZ5A 4FXGC 2JA7B 3B2FA 5CYUA 1J9OA 4ZAIA 4XQNA 1B3AA 5I6WA 4L1BA 1MBYA 2EYJA 1EWHA 1QNUA 3BYTB 3GTLB 2L52A 1QE6A 3TUOA 1U4MA 2Q5WD 5BMIA 4ZRQA 2A69D 2Z4HA 3T3NA 1TT2A 3CQZB 1QB5D 3QG1A 5IGGA 5FR3A 3AH7A 3Q0AA 1Q1BA 1AYFA 3P4RB 2KACA 1ET9A 5D65A 3RMHA 1BO0A 1CJEA 1SYEA 4DGZA 3NVVA 4C7ZA 2IX1A 2KCCA 2PMVA 2HCCA 1F9QA 4XXEA 1HTPA 1XTCD 1K83B 1ZXHA 3PZ8A 5BYRA 3VA5A 1LO5D 4G57A 4KX6B 2Y0SB 1B9NA 2M56B 1Y8OB 3BG3A 4FF3A 5JPNC 3J80E 3A7LA 4JK1C 3BDOA 2NN6I 2W3RA 3VR6A 2J52A 4H13C 3SFEB 4PMCA 5C0XJ 1P7EA 2Z4IA 4LK1C 4WIPA 5M3FB 2F0TA 4DAYA 5I2YA 2IDYA 5IT9E 4J3OD 2RDFA 3PIP3 4I65A 2B76B 2F0SA 2VXWA 1CFMA 4FF1A 3DWGC 4H2AA 4B0EA 3IAM1 4DF7A 1QWYA 3IT4B 4IFDH 1T3QA 2MJEA 1QOGA 5J39A 4QMGA 1YNNC 2JEAI 5KNCA 1I50B 2EYFA 2K03A 1XWEA 2R3ZA 1HQMC 4ZHPA 2L5TA 2K7VA 2E2HB 1QOHA 1M4VA 2NVQB 3W1SA 1G6ZA 2PVGC 4WFN3 2GB1A 5FK9C 3EUB2 3HVDA 1DOXA 3MXUA 1XF5L 2F1MA 1PRTC 1TWFB 3SVMA 3DEPA 5ELEA 2K0PA 2N88A 2IWHA 4WQMA 5DM73 3Q69A 4ZUIA 4FYDA 1DM0B 3DEOA 1TWHB 1YNND 3S14B 2BT6A 1H9KA 2D2CC 4X3UA 1AN8A 5EGTA 5DEHA 2DN8A 4EQOA 3BYYB 1U4PA 3AV8A 4CQNA 3P1MA 4GDLB 1UAPA 1I4RA 1NENB 4A3MB 2JX5A 3GTKB 1STEA 3FRPB 2F0IA 5C5MA 2HDLA 1Y8NB 2NVTB 2B2YC 5ELDA 3GS2A 2Y5CA 5F2DA 1WD0A 1I4XA 2MUYA 2A74C 4IFDG 1LTBD 3VYSA 3TMEA 2B2YA 4ZYSA 2K28A 4HMIA 2K01A 4RGOS 1VJKA 4PT5A 2TSSA 4HAEA 4NP5A 2WXKA 1QKZA 3P20A 1TS2A 4NAMA 1Y8PB 5I9OA 1XLQA 1AFPA 1EY9A 3D6CA 3OIPA 3FKIB 1EYAA 3LWEA 3T13A 1TU2B 3DWPA 2IGGA 2BE5C 3T51B 3SFDB 1SMYC 1SSNA 2B2WA 3NPPA 3AEBB 2PO4A 4PMWA 2AUJD 2EYLA 1N62A 4HEDA 5BN3A 4P2CB 2I07B 1RCVD 1ZEQX 5IGFA 1STNA 1AZQA 4RCOA 1N63A 3S1NB 3R2IA 2K5PA 3B2GA 4RCNA 2WXPA 3J9CA 2PLPA 2ZT9C 3NWTA 4OIKA 1HRJA 3MJ5A 2BE5D 4FO2A 4BA1I 3VRBB 1SNOA 3A7AB 4JWSC 4A3KB 1GUSA 1GB4A 1QILA 4CJ1B 2L55A 1RDPD 2JA6B 1CA5A 3SR6A 4PQXA 4CHTB 2F3VA 4YXDB 1BUVT 4R8IA 3NHHA 1B4OA 2AWOA 1NYRA 4L23A 4DNTB 2PZUA 2VZKD 2MGSA 4ZLTF 1FRDA 2QKIC 4F7XA 3VRAB 4LMQD 3RD4A 3M85A 4A55A 4BBSB 1PZJD 4OVZA 5CV5A 4TQUS 1EL0A 4IQZA 4NKLA 1L0VB 1UWMA 1SYDA 1G2TA 5J22A 2Y3AA 1S5DD 2R61A 5IIFA 1JW9D 1BCPF 3A54A 3TEYA 1ROEA 1LTSD 2X69A 2MP1A 3DMUA 3T56B 4HRSA 4PV1C 1P7FA 2XRQD 1ZYRD 4DQOC 2JP1A 1D2BA 1ENCA 2IL8A 3ERQA 1KTKA 3ZJTA 2M9VA 2W55A 1EY8A 2N9KA 4OZCA 2WP9B 1Q1EA 1RTOA 1IGCA 1SNPA 1BBXC 4DAPA 1DOYA 2NZ1D 1CA6A 3PZ7A 2B63B 3ZQ4A 1QJOA 5EE3A 4NDXA 2M0AA 2B8GA 3FVQA 4OL7A 3OIQA 2EKIA 2JZPA 2LJIA 4QF4A 2FHTA 4KKTA 3NTKA 1F9RA 4NMZA 3FEWX 1EY7A 4RHRA 3FILA 4L8JA 3HOWB 2LGIA 3TP8A 3SK6A 1L0YB 3OW7A 4M0WA 5BN5A 5BYSA 1FCLA 3GO5A 2NN6G 3CRKC 3L4PA 1LABA 3QOJA 4A3DB 2AUKA 4A6QA 3AB5A 1K53A 3V2TA 2BDOA 3QB3A 1TKEA 4E6IA 1STHA 5M5XB 3HS0C 5DAUA 1VDVA 2ACZB 1GOZA 1U4RA 3K5MA 3SEBA 1TR5A 1X3PA 2O5JC 1SE2A 2WXRA 1NCVA 2KJXA 1BUIC 2J0TD 3VR3A 1CHPD 1MGSA 2WKCA 3C3LA 4RF1A 5JEAG 2BYTA 3I73A 2QMTA 2W3SA 1JALA 1MSHA 1DZ1A 3MXPA 4KY7A 1RM6C 2V4IB 2FE8A 3I57A 3GQBA 5EE0A 3Q8BA 1RFKA 1BNZA 3KLSX 1WCMB 4XDDA 3HUIA 1ESRA 2BB6A 4BY7B 1JORA 2A6ED 2B2VA 1GUOA 1SFOB 3PV0A 3K5OA 1YNTE 1GHJA 5CBAE 3MP9A 3NUHB 5G3LD 4RF0A 3I3CA 3KK7A 4H7BA 5NUCA 1ICWA 2JU6X 3CIRB 3IFDA 5FOBB 3AEGB 3T53B 5K5PA 5TSSA 4QCLA 2VUMB 3NVZA 2HCIA 2A5HA 1YNJD 1WWTA 3NP8A 1MHXA 1PTOC 4KN4C 1Q10A 5KGUA 4D2KA 1PZID 3S1MB 1OO9B 3I8ZA 1E10A 4IURA 1XYIA 2IPKD 2VB3X 2JEBI 1VR9A 2H88B 1JOKA 2RVLA 1JWAD 4KHVA 4HSPA 2FBWB 1HPCA 1WTXA 2F0EA 1IW7D 3HG9A 4QUCA 3AB9A 2B39A 3K5NA 4HEA1 1SNMA 3K57A 5IGDA 5D3DA 1GXDC 4LAAA 1PZKD 5AUKA 5HURA 2WDQB 3LX0A 2Z1CA 1WGKA 4DXFA 1X3QA 2EY2A 1TKYA 4MHEA 1Q3LA 1AZPA 3H8HA 3QIAA 3CU7A 4N9PA 3S1RB 2AX5A 3R2TA 3U52E 5AFWA 3P42A 5AUIA 2WS3B 3IAS1 4BS9A 2WXLA 1VLBA 3VR2A 5IOCA 5JEAH 1MI0A 3EFXD 3HGBA 2FINB 4R9WA 2PNRC 2ZXOA 1E2ZA 2WDRB 1E2VA 3TP6A 2F3WA 3JAME 1N5WA 2RKSA 2A68C 1GUTA 1B1ZA 1SXTA 1JWSD 1TWAB 2E76C 5CMDA 1YJIA 4YSYB 5H8YE 1LTRD 2G9HD 1CK1A 4A3FB 3S17B 1Q8IA 1I6VC 4KKJA 5A35A 1B44D 2NTTA 4C7YA 1S4ZA 2BS3B 2KMMA 1NSNS 2AQ2B 1QOFA 4KY5A 2J7ZA 2WKDA 4K6LA 2GI9A 4IKGA 3HP3A 2VNUD 5C44B 2B2TC 2WLBA 2XNAC 1RTNA 1FNVA 4ME5A 3P75A 2I38A 3MTSA 3J7YW 2WP8J 1VCIA 2VB2X 1EY4A 3K7AB 1CTMA 5KYIA 4GDKB 4RFBA 3D8GA 3QOLA 4MH8A 1GPXA 1E9MA 1EWYC 1PDXA 3HKZB 4A3JB 3DWMA 1EU3A 3HRDD 3FILB 5D3IB 3SDZA 1XO3A 5KRUA 1PGBA 3U2SC 2R92B 2K6AA 2AWNA 4ZK9B 3KUPA 4BY1B 1LT3D 1L6VA 1W6KA 4R8NA 3W3AA 1PFMA 2XWJB 2ZXPA 5BYQA 2FMCA 1D5ZC 2NB0A 1CHQD 3BWUD 3BK1A 1STGA 1EFID 2J4XA 5C4XB 5HHDG 2JSVX 4NJCA 4PNYA 2XN9C 5HI1A 1PFNA 4FNFA 5G5HA 5C6AA 4CJ2C 4MN3A 3GTJB 4XE0A 4J1MA 3G6JB 4KV6A 3N9YC 2NN6H 3NTHA 1Q90A 2E75C 1D6EC 1STBA 1R4PB 1HEZE 2PCFB 2JYEA 2FMMA 1V1PA 2RSNA 4N59A 1JWUD 3UI3A 3K0YA 3U9SA 1C77A 5CV4A 4OO1I 1CM9A 3R3OA 1OQRA 4RGNA 4L63B 1TS4A 3EA6A 1E2WA 3I4NB 3R8BA 1SJHD 2CW0D 4K5WA 4TQ1A 1T6BX 5CV8A 4FXKC 2WXNA 4JPSA 2PPBC 2KEDA 1JICA 1OXUA 1VMPA 1FFVA 1HZ6A 1KNEA 1JB3A 1DCZA 1JROA 2AQ3B 4WWMA 5C2TB 2IX0A 4HROA 4A3BB 5CORA 2R7ZB 5GXGB 1NR4A 1VRAB 5HFYA 5I6YA 4K6DA 1YN4A 2RBMA 1PTOH 3HOUB 1FNWA 3MZ5A 3VYRA 1K52A 1PUTA 1RWSA 2D9UA 4QUFA 1O7LA 4FXCA 2B2UC 4YIJA 1GUWA 1ESFA 2MPMA 1LT6D 4IUVA 1FRRA 3U7ZA 3H3VC 2KHSA 3W5UB 2NWGA 1KDBA 2JA5B 2R93B 2O2LD 4IUPA 3MXGA 1KDCA 3D3RA 1PRTB 2MJ8A 3ETRA 1I4HA 1RHPA 5CV7A 1IW7C 1CI3M 3NS1A 4KN7C 2QILA 1BQQT 1L4DB 2MH7A 1N60A 1CZWA 4TSSA 5I4DA 2YU9B 1PTOD 1Y1WB 5KNDA 3PIO3 2J42A 2K33A 3M4YA 4WJWA 3SK8A 3P7JA 2XWBB 1VZ6A 5I9PA 3C2PA 1QOBA 2K32A 4HCEA 1LV9A 3L3OC 3A56A 3PUVA 2WDVB 3C8YA 3K5LA 2EE1A 1VZ7A 2O4XA 4K8IA 3P63A 4CKBA 3OMCA 3HRZC 1NR2A 3TN2A 5J1ZA 1D4BA 5CV6A 1SJED 1IBXB 1STAA 5E6JA 2WAQB 3A8IE 2GA4B 1WYGA 3M7GA 3S15B 4US9A 2C5CA 2EDGA 3I4LA 3EVQA 4G7HC 2DBYA 1VMCA 1DOIA 4UDUC 2L1BA 4DK1A 2NVYB 1Y69U 3I4MB 1PGXA 2EOTA 1GB1A 3GTMB 2K1BA 2PIAA 3KQ4A 2WXQA 3A8JE 2E2JB 4HMJA 1I4QA 3URYA 3KBXA 1H9JA 2YYZA 4XYOA 3E5SA 3NBHA 3GTPB 1VF5C 2K05A 1C4QA 3G7LA 3SHLA 1PRTF 2KUMA 1IUEA 1EU4A 1NYQA 5EPJA 3C1EA 2X6GA 4FVMA 3F2UA 4K5VA 5EQ0A 2E6XA 2ENBA 1FD7D 2F0MA 1F2RC 2LEKA 2HDMA 3Q22A 2RQXA 2F0LA 1G2SA 2INPE 3BVZA 4XIGS 1R4QB 3UI2A 1CT1D 3K59A 2LHEA 4JX1C 1ZXTA 2WXMA 4V190 1IHZA 3NUCA 1KAAA 2RSOA 1EQVA 3Q8EA 4CGYB 4HN7A 4EVOA 5E1FA 1SEBD 2B2UA 2RDGA 1L4ZB 4RKLA 3EROA 1M8AA 2RA4A 1TWGB 3NQTA 3J7AV 2WXJA 3D4WA 3I72A 2CVRA 4ZHOA 4HR7B 1ILQA 5C3XA 5M5YB 1CZPA 2L83A 2CW0C 3AU7A 5FO7B 1XXGA 2JYOA 3FDTA 2KQ3A 2X38A 2SNSA 1HHVA 1HTLD 1HFNA 1IKLA 1AW7A 3TSSA 2KDMA 5BMHA 3ITPA 4XQQA 2V3NA 3BVMA 1WTWA 5JVH3 1NVID 2IX3A 1O7ZA 2A6EC 1RD9D 5C4ZA 5CR3A 2BCOA 3WCQA 2L9HA 1XEEA 4ODGA 4BBRB 2LUMA 2B8FA 2EYMA 2QCPX 2V0GA 3MFYA 1I3QB 2LFNA 4RA8A 2ICEC 4CKEA 2WV6D 2XVSA 4DU9A 2K3UA 1HFGA 1RYJA 3IL8A 2ID0A 1AP0A 3JAML 2F0VA 2PVOD 2BA1A 1SYFA 5KEEA 2LY7A 1DOKA 4REZA 2MHVA 3AEEB 1DGJA 1YNJC 4FXDA 1C4AA 5T1IA 1CZGA 1C48A 2OXPA 3I9V1 1FO4A 1O78A 1SF0A 3RLFA 4YSZB 4C3JG 3AEFB 3WDNA 4JBWA 3X3MA 4C3HB 5FO8B 1L6UA 3VQIA 4A3IB 2RDHA 2RPVA 5LHY1 1J7BA 5E4XA 3GD7A 4K2LA 4L6TB 5IODA 4XTCS 4YWGG 3ONAB 1IYUA 1A15A 3U9OA 2JYTA 3ZJVA 2DY7A 1PTOF 1I6HB 1WTRA 2D62A 2IGHA 1NAPA 5BN4A 2JSOA 2F0HA 4X3TA 4IUTA 1EIHA 1UEAB 3QJYA 1FM0D 1Y56A 1STYA 2CJNA 2IGDA 2LS01 1SMYD 4ABNA 2NTSA 3GTQB 1SYCA 3TEZA 4DA2A 1ZDXA 4IDIA 1SIJA 4KD4A 2EELA 1XLOA 1KDAA 1D5XC 1EQTA 3NWSA 3AE5B 5E4WC 1L0XB 1W6JA 3DM1A 5MPOA 4V0BA 4KHZA 1A6XA 4KKIA 1BXTA 3VA7A 4MIUA 1YMHE 2JXTA 3KWLA 5C3EB 2F0GA 4IFDJ 2PZTA 1EEFD 2F0PA 1UWXA 3W9CB 1DOLA 1WSPA 1WTVA 1G91A 1NEKB 1F9PA 3KLRA 1ZXIA 4B9XA 1SE4A 4Z9CB 2ONQA 1PFDA 1A3UA 1ZOYB 1T5XD 4QB4A 2OEDA 1B9RA 2SAKA 1BOSA 5G5GA 3MA2B 1YN5A 2JWUA 2PZWA 3N52A 3P1HA 1WTPA 2MJDA 1H9MA 2JA8B 1N61A 1LTTD 5ISRA 1QQRA 1TZOA 4C56C 1V8QA 2PW5A 1EY5A 3AEAB 4O42A 1F2ZA 4HSVA 1XLNA 3T16A 3Q24A 1FFUA 1TIID 5FLXE 2INNE 2K22A 4K5XA 1EWCA 2K5QA 4EE2A 2NVXB 5M9OA 2HDEA 4C3HG 2LKVA 1TY0A 4OW0A 2BB5A 2HQEA 1KLUD 5FO9B 2EVBA 3NTIA 3MAQA 3SK5A 2DYMA 1FD6A 2F0FA 4F8MA 1IBXA 4IUQA 4IUNA 2WXIA 3AM9A 1ZKOA 2BTEA 2B2WC 5A2QL 3NSWA 2D5DA 2F0WA 2PKOA 2BS2B 3J80L 3AE1B 2HTME 2N55A 5IGCA 1HQRD 1SYGA 1SAPA 4IFDI 3PO0A 1XX8A 4RGTA 2B2TA 3AE8B 3OMGA 1D5MC 4KMUC 3AMZA 5HG2A 3OHXC 2V3PA 1R7SA 3GB1A 2R6GA 4DXGA 5FLXL 5JJZA 5FKAC 4RHSA 1QG7A 1F2MA 3ZYYX 5KIXA 1I4GA 3RUZA 2K04A 3PUXA 1ZUD2 1CQFA 1PLFA 4XDXA 2FUG1 2F0DA 2L11A 2E3TA 1EOTA 3I91A 1V43A 2AQ1B 3B9JA 3BDLA 1LACA 4FF4A 2OHFA 1C4CA 4HKZE 3KWVA 2WXFA 4EQPA 3NVWA 1QF6A 4X3KA 2L12A 4N58A 5CV9A 4ZUJA 4C80A 1ZPSA 5EE9A 4M8AA 4Q5VA 3GTOB 2K9XA 1UGJA 3EJIA 4FF2A 4X3SA 2M2LA 2VZKB 1Z7TA 3AN1A 1S5FD 1EM7A 3VR5A 5CBEE 1C8CA 1JMLA 3MEHA 1IKMA 1WXQA 2Q8TA 3MHBA 2EZVA 3FAHA 2RMMA 1IL8A 2PW9A 4TMAB 2F0OA 3IT6B 1WTOA 1E0BA 2NUCA 1SNQA 5JXVA 3KF8A 2E2IB 3R93A 2QDBA 4TKOB 1CQVA 1U9RA 5KYLA 2KN4A 5JVG3 3TEWA 1HXYD 3TDQA 2H89B 2E2DC 2XRSD 1L5PA 2QEJC 4OO1H 2KQ4X 5D14A 2PYKA 2BA0A 5EKIA 3T4AC 4F88A 2DNCA 4LLGM 5DM63 3AE9B 4CBVA 3LNNA 4KGTA 1ONLA 3T3OA 1ET6A 3KLSA 3PO3B 4XWWA 5M3MB 1B53A 1BF4A 1MVKA 2YEPF 5EPKA 3D6WA 3RZOB 1SNDA 1JWBD 2BS4B 4A9AA 1NUCA 2ON8A 3OPOA 3S2HB 2LHDA 4A8XC 1B9MA 2QSDA 5G3LF 2DWQA 1DONA 2WB1B 5DNFA 5IGBA 4M1UB 4WURA 3V96A 1SBBB 2WXHA 4RH6A 3IKJA 3CWIA 5I2XA 2HUGA 4LK0M 1AEXA 3S2DB 3MXNA 2OT2A 4HTHA 2EJFC 1IYVA 1TYGB 3PMFA 2CHBD 3TP7A 1DXMA 3V3XA 1JOQA 4H44C 4G4KA 4DN4M 5JPMC 3BZDB 2ZXRA 5E3FA 5LNK1 2O5IC 3OWFA 1FR3A 3V05A 3K58A 3TP5A 1DOMA 3LXFA 1SYBA 3DWQA 1TS5A 1PTOB 1EY6A 2A68D 5ELFA 4ITKA 1SE3A 1C78A 3L7ZC 1A2TA 5ELBA 2EXZA 3GP7A 2DYOA 3M7NA 3MFGA 1WD1A 5CGKA 3C46A 1S5CD 4WORA 3IFTA 4KY6A 3ND8A 4RGMA 4YTNB 1MSGA 2G1EA 1EYDA 1YJJA 2L1AA 4IOIE 1A2UA 3HOZB 3DUZA 3OOCA 2PW7A 1H9RA 2WNMA 4P16A 1K50A 1TKWB 3NQIA 4TRDA 1ML0D 2DLBA 4ZOHC 3HEJA 4OHJA 3W2DA 1LTID 1QNKA 2C9OA 2IT1A 5C4HA 1RF2D 1TJEA 4B08A 3KBGA 1F2YA 4U673 1FMAD 4AS1A 4AQ7A 1ZE3D 4G7ZC 2F03A 2JXMB 1GJXA 4JE3B 1Y1VB 1J7CA 2QIEB 1HUMA 5COYA 5C0XH 3ZGZA 2JQRB 3E6ZX 2WU2B 1TS3A 3SE0A 2BBCA 4O1NA 1BMLC 1S5ED 3CRLC 3E9SA 3Q8CA 3A55A 2KVMA 4KKSA 2CU3A 4YTPB 1KABA 5EE1A 3TBIB 3RZDB 4C3JB 5D7GA 2EJGC 3GTGB 1JR0D 1VDZA 1OXVA 1LT5D 2DY8A 3E56A 1V97A 1Q12A 2PTLA 2FFKB 1PGAA 5BMGA 2WQYB 3HOVB 2Q8IB 1QT9A 1II3A 2MEKA 3H91A 1BCPD