1D5ZC

X-ray crystal structure of hla-dr4 complexed with peptidomimetic and seb
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
236
structure length
226
Chain Sequence
SQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system/peptide inhibitor
molecule keywords PROTEIN (HLA CLASS II HISTOCOMPATIBILITY ANTIGEN)
publication title Peptide and peptide mimetic inhibitors of antigen presentation by HLA-DR class II MHC molecules. Design, structure-activity relationships, and X-ray crystal structures.
pubmed doi rcsb
source organism Homo sapiens
total genus 64
structure length 226
sequence length 236
ec nomenclature
pdb deposition date 1999-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
C PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1d5zC01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1d5zC02
1FD7D 1YN3A 1PTOD 2ICIA 2O2LD 2SEBD 4ZYSA 1KLGD 1TY0A 5ELDA 1XTCD 4RH6A 1AN8A 1BCPB 1S5ED 5D3IB 3BVMA 1L0YB 2G9HD 2XN9C 1JCKB 1PTOC 1SE2A 1LTGD 4Z9CB 2IPKD 4BWGB 1F77A 1LTAD 2Z8LA 1RCVD 5ELEA 3R2IA 5TSSA 1CK1A 1L0XB 1STEA 3W2DA 3DWQA 1LTTD 1TS3A 3URYA 3BZDB 1UUPA 1JWUD 1FNVA 4RHSA 1MD2D 1TY2A 1S5BD 1ENFA 1JWSD 1G8ZD 1CT1D 1DYQA 1BCPF 1PZID 1S5FD 3SEBA 1HTLD 3BYTB 1TS4A 1V1OA 3KLSX 1TS2A 1CHPD 1UNSA 3GP7A 1JWMD 3BVZA 4TSSA 2RDGA 1QILA 1ET9A 2XRQD 1D6EC 1XXGA 3R8BA 1BXTA 1I4XA 1I4PA 1RD9D 5ELBA 3MFGA 1ET6A 4RHRA 5ELFA 3V05A 1D5ZC 1B44D 1EEID 1JQYD 1LT3D 1PRTF 4NZLB 1SJHD 1BCPD 1SXTA 1PYWD 3EA6A 2J4XA 5FKAC 1SE3A 1CQVA 1LT5D 1I4HA 1PRTB 1BCPC 3DWPA 1EEFD 2XNAC 4C56C 3OWEB 1T5XD 1AW7A 1YN5A 2AQ1B 1LO5D 1SE4A 1PZKD 3MC0B 1SBBB 1S5DD 1TS5A 1PRTD 2XRSD 1CHQD 2IJ0A 4L63B 2AQ2B 5ELCA 4L6TB 5D3DA 1LTSD 2CHBD 1YN4A 1KTKA 4DXGA 1D5XC 4RCOA 1LTBD 1PRTC 1RDPD 2QILA 3BYYB 4RFBA 3R2TA 1HQRD 4RGTA 2RDHA 1S5CD 1V1PA 1V1PB 4RGOS 5I4DA 3BVGA 1LT4D 1LTID 1SJED 2QEJC 1I4GA 2NTTA 1DJRD 1LTRD 2AQ3B 3TSSA 1EU4A 1LT6D 1PTOH 4OHJA 1EWCA 2R61A 1D5MC 4RGMA 1HA5A 1ESFA 1PTOF 4RGNA 1EFID 1PZJD 1HXYD 3EFXD 1M4VA 1FNUA 4DXFA 1RF2D 4K6LA 3CHBD 4UDUC 2NTSA 1PTOB 1B1ZA 2WV6D 1JR0D 1FNWA 3DWAA 1GOZA 3O13A 2TSSA 1SEBD 1LLRD 1FGBD 4O1NA 1I4QA 1EU3A 1I4RA 5FK9C 1KLUD
chains in the Genus database with same CATH superfamily
1FD7D 1WJ6A 3IFWB 2NVXB 2WXQA 2WX1A 3ZKJC 2KWCA 2WXOA 2INNE 1KD1C 3QR8A 3U8ZA 1J7BA 2DZIA 2NR2A 2EYFA 4BBRG 4MSQB 4BKSD 1B70B 3M7GA 1SE2A 4NQKE 3AYHB 5KIXA 2M2LA 2VQEQ 4CYEA 1BDOA 5EPLA 4B3RL 1ZXIA 4NAWA 3RNGC 1YZ6A 1L0XB 2K5NA 2L1BA 4JOIA 2ZNVB 4R1JA 3QOJA 3JSVA 3AMZA 4GN1A 1HPCA 2KBNA 1JWSD 4R9WA 3BWUD 5HG2A 1V80A 5BO4B 3PIOA 1BUVT 3TDQA 4RAUC 1VS0A 4YWMA 1VDVA 4GDKB 4IW0A 3AEFB 4JI1L 5CGKA 4L1BA 3BG3A 3CMAA 4AS1A 1MBYA 1SNDA 2CU3A 4ITKA 2OT2A 1FJGL 4J6IA 4M02A 1GXDC 3Q22A 5HGQA 3UINB 2DZJA 3P63A 1WF9A 2F0LA 5AFWA 2EIFA 4DDID 3A9JA 3A1QA 5JEAJ 3ZQ4A 2KYWA 4B3MQ 2A8VA 1D5ZC 3E0JA 4DK6C 3KUDB 2MQHA 1TT2A 1DOLA 2KTFA 4M8AA 1HE8A 5ISRA 3AEEB 4BY7G 1CQVA 4A3EH 4B3TQ 2KMMA 1NBFC 4N6EB 3ITPA 3HOVG 4FYDA 1C78A 1UE5A 2DYOA 1J9OA 5IO9A 3K7AB 4WQMA 1NNXA 3NY5A 2YTVA 2LGYA 4W9CA 5C3WA 3ZDTA 4YWKA 2WKDA 1YN5A 2VUMG 2WXNA 3LJ3A 2LWPA 2D3CA 2N4FA 4WJ4A 1CZPA 2NVTH 1UBIA 3D6WA 3MXNA 4A3CH 2K8CA 3KWVA 4C7ZA 1UE1A 2RF4A 2Z0DB 1WJ4A 5IYDH 4GU2A 2M56B 1Q8KA 4L5QA 5I4DA 2RMMA 4A90A 1G6ZA 3ZIMA 3FAHA 3PPAA 1WTOA 1MG8A 3NZUA 4PS7A 4JBJA 2SNSA 1XD3B 1CKNA 3OJ4B 5CHWA 4E74A 2EYMA 4AYBG 3A5UA 4CQNA 1C1YB 4YSYB 5IGFA 4YHHQ 2D2QA 2RPQA 1YJJA 1EWCA 3S16H 4PT5A 4OIJA 1ESFA 1E22A 5J3BA 3GV3A 3JAMi 1UWVA 1Q8IA 3MXPA 1JW9D 5C4ZA 2CHXA 1N9WA 1F2YA 4JWSC 3CC2A 4KHVA 1VQEA 4K6LA 1QOAA 4A3GB 3ZTCA 1PTOB 4DR3Q 2B63H 1CI3M 1JR0D 3CCRA 2OCEA 3NVWA 1D2BA 2JA5G 1LYLA 4JYAL 3IG3A 4NNJB 1FL0A 2WXHA 1Q1BA 4JI4Q 1PFSA 3RUZA 3A0JA 3SVMA 2WAQG 1KLUD 1J7AA 3OJ3A 5JEAG 4URKA 1NY4A 4JI0L 1MPEA 1A70A 2D3AA 1P7FA 3H7SA 3M4PA 4DNIA 2ICEC 3DBLI 1AN8A 3EBEA 4HMIA 1QKZA 1EIHA 4KX6B 1YJWA 4KZCA 4K0KQ 3CP0A 1FFVA 2NPTB 1M90C 1JJGA 2B3AA 2AKWB 2OJRA 4LDTD 3VUXA 1RJTA 3N3KB 2LZ6A 2V1CC 2GI9A 3TEWA 5GADC 1UWMA 1IYJB 1YNTE 2KJHB 2O4XA 4AIMA 2BDNA 5M5WH 3EQLC 1MD2D 1MHHE 3J7YW 1WXMA 1VF5C 3CCJA 2WYQA 3W1GA 4JG2A 4GKKL 2RPVA 3J80c 3VTWA 3QOLA 3RZDH 3J80i 1T0YA 4MH0E 3S1NB 2QGQA 3I4OA 1X32A 1N32L 3Q8EA 4JX1C 1CKMA 2F0GA 1A0IA 3BZCA 4A3LH 1KJTA 2IT1A 4OWWB 4CKCA 1L4DB 3IAM1 1FFUA 1OO9B 3MXGA 1QILA 5EE3A 4A93H 1A63A 4GLSC 2NUCA 3QAQA 1OQRA 2QHOA 2WGSA 4X65L 3PUWA 4GN5A 1GUNA 1U4LA 4ZRZA 4DR5L 2NBVB 4NZLB 3UIPB 4HRSA 1BCPD 3EIVA 3RNUA 1G51A 5NUCA 2K8BA 1Y1VG 4QB4A 4XXEA 3G4SA 4B3SQ 2VRRB 3WIMA 3GB1A 3K5LA 3I4MG 4IOAA 1C79A 1CQFA 5GAEC 1SNOA 2C7NB 1QCBD 1CZWA 5C0XH 1NI2A 1KRTA 1MJEA 1MI0A 3K9OB 3P4PB 1TBEA 2MHVA 2K14A 4GGQA 2W82A 2XTIA 1YD8U 3FKIB 1EM7A 3OAWA 2F4VL 3F2BA 1EOTA 3Q14C 2JA8H 1ENAA 1TT5B 2MBEA 5HY6A 3E56A 3OW7A 3P20A 4OIKA 3TRZA 2LVPA 1PFBA 5ELCA 5I9OA 2I46A 3Q23A 2GBNA 1YNND 4G4KA 1PH7A 4WWNA 4RCOA 3A74A 2JA6B 4KTAA 4ZOHC 1Y14B 5IYCH 1GNUA 2MCNB 4FXCA 2L11A 5IIFA 4DV0L 3ZUNA 3HOZH 2GBJA 1W3SA 2XWJB 2GN5A 4X3KA 2IHEA 4A3BG 4D2KA 1R4MI 4DHZB 1X6OA 4HJ8A 3R7QA 1Y8RC 1K3RA 3BDOA 3RN9C 2K7VA 1IBMQ 2PQAA 2INCC 1WTHA 3E6ZX 4OX9Q 2IY5B 1FNUA 1O7ZA 1RRBA 1PXUA 2ZEQA 3CHBD 1C48A 4CDCC 2WXPA 4I6LB 4RM9A 2NZOA 2ID0A 3AE6B 2WV6D 4HCPB 2OOBB 4HK2A 3KLSA 3ZNZB 1O80A 3TS0A 4WJOA 1T5EA 2MHJA 4GLVB 4CDDC 4A3FB 3HG9A 1G6JA 2DAJA 1VQJA 5M5XH 4NXNL 2VZKD 3QARA 2JXTA 4POGA 3S2DB 2L7RA 3KJPA 5GAHC 5E4XA 4CO7A 3GTMB 2R92B 2PW9A 2LHDA 2YLMA 4KD3A 3MVVA 5COYA 2O2VA 3I4LA 1DD2A 4QL5A 2G9HD 5KHOA 2K28A 4DR1L 2EPBA 1LTGD 1SYBA 2OTLA 1ZYRD 4HPPA 4GN4B 4S3SA 5C3XA 2ZXRA 4G7HC 2V4IB 5CYUA 4XQJA 2IO3B 3B2GA 4A3IH 3H0GH 1D7QA 3X0WA 3HS0C 1IBXA 2B8GA 1F2LA 2QDLA 3I5JC 3ERQA 4KHZA 2KWUB 3HOUH 1FXIA 3M62B 5C6AA 1OXXK 3SHLA 4A3MH 2HT1A 2DZMA 3KYCD 4ZRQA 3PO3G 1EQTA 4K2LA 4JC0A 2A4ZA 4MH8A 3N1XC 1GVPA 4UP8A 3F8TA 2CHWA 4ARCA 1UNSA 3DHGC 1HJPA 1XO3A 4KN4C 3ABVB 3UDFA 3SXHA 1V1QA 1E7VA 3L3OC 1DONA 1UAPA 2WWZA 3WAPA 3NSWA 3Q3NC 2KECA 2D62A 5BR8Q 3WA0A 3K7UC 4B6WA 3MHBA 1KQSA 1TU2B 4HLEA 1P7EA 1ZOYB 1B44D 1EIGA 2B8FA 2CWAA 2WB1B 2Z4HA 2Q8IB 5IOCA 4ILWA 2WXRA 1SXTA 1AZQA 2ZVOA 1WJUA 3DBLB 5KEEA 3CC7A 4JQWC 1T0QC 2BW2A 1CKNB 4DDGD 4YWGG 5F2DA 1TIID 3PQIA 1BOSA 4IUUA 4KVGB 4R4QA 2PMZE 2JSVX 4YIJA 3H7PB 3P7JA 1WGHA 2MP2A 4DXAB 4P72A 4IQZA 2LI5A 1GUWA 3JW0X 2E2HB 3G48A 5CV5A 5C4JH 2WFWA 1YQ4B 4WAAA 4LK1C 4ZK9B 4A4IA 5EKKA 4LF4L 2UUCQ 3PO0A 2B3GA 1B3AA 2MJ8A 1TKGA 2YTYA 2RQXA 1S40A 4QUCA 1N61A 1ONLA 4C00A 1HEZE 3HP3A 3FC4A 1WJJA 4OONA 4DFAA 2EMSA 4G11A 3VYTA 3BVGA 2MW5A 3VH4B 3F2DA 4LCDE 2JVCA 1JB3A 3GTOH 1PGAA 1ASYA 4BOZB 4N8FA 3GTPB 2F0WA 1I42A 2RGFA 5EBDA 2JZ3B 4JK1C 4MTKA 2M1MA 3Q3JA 1Q10A 2R61A 1FPYA 3T4AC 4HPMB 1NEKB 3CQZB 5IA7A 4MN3A 2MJDA 2JA7G 1YQ3B 1Y8PB 5LMNQ 2KMCA 3HEJA 1M4VA 2BT6A 1RIPA 2F3IA 1WTWA 3GTLH 3RR5A 2BQQA 1Z47A 3CIRB 3DWAA 3HM3A 3RNAC 2DLBA 1WTRA 2FCMA 4LF9Q 3CKIB 3NBHA 3OMCA 1H95A 4A3JG 2G4DB 3MC8A 4FN2A 1O78A 3ZVVA 3KK7A 4BKSA 2OHFA 3Q3FA 3S24A 4HCSA 4ZRPA 4JV5L 4G7OC 4HIMA 2ICIA 4X3TA 3E9HA 1TY0A 3TS2A 5M5YB 1D4BA 4R4IA 1VQAA 1MG4A 2BA1A 3NWTA 4FJVB 4K1RB 4BBRH 3I3TB 2HCCA 4DA2A 1E7PB 4HWIB 1QLBB 2B2WC 1WSPA 4ZHOA 1KH0A 1C7YA 3DLLA 3BY4B 1JCKB 2XVSA 3LNNA 4ZRJA 4BWGB 5L37A 2JYTA 3PV0A 4REZA 4BKGA 4IWOA 4QF4A 2NVYB 2Z8LA 3K80C 1AWDA 4MTNA 5BN4A 2UUAL 3ULPA 1N8RC 1FEHA 5DPTA 4BY1B 1X3EA 2D07B 1R4MB 1EIYB 4POFA 4EX5A 2K6AA 1C8CA 2IX1A 3SR1A 5C0XJ 3GQBA 1ISNA 2V3PA 2CU1A 3LXFA 4JI2L 1FGUA 4CDFC 3CPFA 4ME3A 3IT6B 1HTLD 3K8AA 4PMBA 3S15H 2LXJA 4ZCKA 3F2UA 3TP8A 2KUMA 1EF1A 3NTIA 2J0KA 1IYUA 3CCMA 1WGGA 2BCOA 2JU6X 2K8HA 2WXIA 4DHJD 1HZAA 1GC6A 5C4XG 4QQBX 3Q6BA 4KGRA 3TZUA 4LFBL 3AEGB 3M95A 3RZWC 3KUZA 3X3NA 1WX7A 4B9WA 1F9PA 4N9TA 5J39A 2ASBA 3DHQA 1WTXA 4ICUA 1HFGA 3T8MA 2BYVE 1JE4A 5K5PA 1LT3D 5EAYA 3AEAB 4IUMB 1PDQA 1RHPA 2PQEA 2BH2A 1HZ6A 4ULLA 3AM9A 4NJ7A 1H4RA 2D11A 3NE5B 2UXBL 2QCZA 1V2YA 1QNUA 2WU2B 3HOVH 3Q8DA 1X9NA 5E6PA 4DWFA 1WYGA 3QCAA 5FLXc 1GJXA 3DVNV 1VQ5A 1VQGA 3ERSX 5GQOA 2I1KA 3SFDB 3J7A5 4IUTA 5EGTA 4DR4Q 4XX5A 4MJSB 3OWEB 2C5CA 4DKAC 2LASA 3KF6A 2VUMH 4GKJL 1VQDA 3EVQA 2JQOA 2KHSA 1VZ7A 4H44C 2LMCA 5C4HA 4O2DA 2CJOA 4EFOA 1TWFB 4N8X1 1WCMB 2IHFA 1KIXA 1Y56A 2LVQA 1PRTD 5CBAE 4C3JB 3IKJA 4A93G 5ELOA 1NSNS 3RZOH 3TREA 3FVQA 2HJ8A 1J7CA 3DCGA 4KSKC 1CMXB 2QDBA 4A6QA 4OO1H 1R4NB 3Q8FA 1ML0D 1PHJA 2MH7A 5CHVC 1TWAB 2C35B 5CHFA 3I4NH 4AUQC 2N55A 5HURA 1F2MA 4AOFA 1DOXA 2F3WA 2L9HA 3EROA 1HQMC 2LUEA 3DVNU 4A3DB 1CSPA 3ZRCA 2PZTA 3KBGA 4A3GG 4PS8A 2VH2A 5C3EB 4XDCA 1CJEA 4C7YA 3RPFC 2NVUI 1L2NA 4IWQA 4FO2A 3UF8A 3S17H 1AEXA 4OWTB 2JRHA 1YBYA 3H3VH 2Q8TA 3AE3B 3C8YA 4KDIC 1J8CA 3L10B 3RLNA 1BKBA 2JA5H 1GUTA 1QF6A 1GOZA 3S9WA 1VRAB 1L1OA 2E2IB 5E3FA 1SEBD 4LK0M 3T9LA 2B29A 3RNCC 3K57A 1FRRA 4TKOB 4F88A 1NR2A 3GDEA 2QA4A 4O1NA 3QWZB 4F7ZA 2E2JH 1EUJA 5LMUQ 1I4RA 2LJIA 2CHZA 4AP4C 4LFCQ 1RAXA 1YN3A 2EYPA 1WWTA 1ZDVA 4ZRIA 1SNCA 1TWCH 3BZKA 2AX5A 4XGAB 2D0PA 1K73C 3NTHA 1KHIA 3NP8A 4IPCA 2YV5A 3C46A 1CKOA 4X62Q 2QCPX 1S5ED 2OQ0A 1YHBA 1UH6A 3T56B 3SR6A 2VW9A 1X1MA 1HR0L 3P4RB 4FF3A 1RCVD 1XWEA 4HJGE 1RFAA 3VUYA 5GROA 4M0WA 3X3MA 5LHY1 4WIPA 1GHJA 4GN3B 4V190 1WX9A 5G2NA 3VDZA 4ZKCB 4A55A 4LF5L 2F0HA 3HRDD 2EYLA 1N33L 3GO5A 1IPGA 1CT1D 2PCFB 2I0QA 1U5KA 1DYQA 3V2TA 4KLKA 3NEMA 4MT5A 5C44G 3AU7A 2JYOA 3RNEC 4DUZQ 2N8NA 3KLSX 2UXDQ 1NCVA 2ZM6L 2MP2B 2NVQB 1A3TA 3MAQA 1R9TH 2LXAA 2GBMA 3K59A 4US9A 5IGGA 2FE8A 5AUIA 3ONSA 1FMAD 4XWTA 2I2YA 2PE6B 1V9PA 3MJWA 2UXCL 1UEBA 3BDCA 1GB4A 1NMFA 2E2DC 4DV6L 2G3QB 2JUOA 4K7UA 2K50A 4A8XC 2ZJPA 1RD9D 2RDFA 2J0MA 2ONQA 3DDCB 1HNXQ 3P75A 1LV9A 5JH5C 1EEID 1XX8A 2F52A 1MSHA 3H0GG 3AN1A 3FKYA 3RULA 3S1RH 4YSZB 2HCIA 3APCA 2K52A 5J18A 4AJWA 2O6VB 2MP1A 4NDXA 1MHWC 3I4MH 2ZW0A 3NHHA 3AE5B 3SK8A 1C9FA 4V0BA 4DR2Q 5J17A 1BCPC 4N59A 1E8WA 3I8ZA 5CBEE 3CU7A 4C56C 1WGRA 3QJYA 4XYOA 2HUGA 4GNXA 1QZGA 1N34Q 2M0XA 1C76A 2AQ1B 2CH4W 1KLVA 2GMIC 2N9XA 3OHXC 2KCTA 1A15A 1QJOA 2EVBA 3M4QA 1U4PA 3ZJVA 1CM9A 1J5EQ 2Q2UA 3NBHB 4K5WA 4LUZA 3K58A 4C3HB 4CJ0B 2V4LA 4RGTA 4C3IB 3CW2C 4WFN3 4L8JA 1P9DU 2VQEL 4HJAA 1LT4D 2QEJC 1YNNC 3A9KA 3OOCA 4WQOB 4A3BH 1OQQA 1WXVA 1BF4A 2NYZD 3DBSA 1IHZA 5BMHA 4EQPA 4X66Q 1M1KC 3M7NA 5JVG3 3TCAA 5FO9B 2WNMA 4IPGA 3HOWB 2ALYB 3ULJA 4NW2A 2KFKA 1SYEA 2FMCA 3EFXD 5IGBA 3I7FA 4L23A 2C9WB 3D3RA 1ESRA 4GZYC 3FHWA 3HRZC 5EDSA 3RCZA 2YEPB 2K39A 1ROEA 1E24A 2R92G 2JT4B 5G3LF 2MBOA 2SDFA 2PPBC 2F0DA 3S1MH 2Y3AA 2BPSA 3B2FA 4B3ML 4IFDH 2SEBD 2ON8A 3QJZA 1B4OA 2K5HA 4RH6A 2N7JA 3I90A 4DAYB 2RDBC 5HFYA 5C5LA 4PZ6A 4B3TL 5FLXE 4GB9A 4MGYE 1K3BC 4WWOA 1LTLA 1RTOA 3NHEB 2KCCA 1FRDA 1D1KA 2WXMA 1HZCA 4IPDA 3W2DA 3T1YQ 1ZXHA 1L5PA 3MA2B 4MGIE 1LTTD 2AUJD 3OPOA 2PE9A 2BH8A 1PGBA 4LF7Q 3GTKB 3N32A 2RVLA 1Y1WG 1XCTL 3NK9A 3U9OA 2IO2B 5JVH3 4ME5A 3PO3H 5M3FB 5JHAA 3DUZA 1UGJA 1N62A 4JBWA 4AYBE 5FOBB 5IT9c 2MEKA 2RCFA 1TS2A 1S72A 4OGQC 1OGWA 2KQ4X 1JWMD 1YIWA 4H2AA 4AJYB 1GD7A 4DK0A 1H9SA 2KEEA 1I94L 4JI7Q 1I6HB 4M8MA 5E6JA 4NY0A 3AE1B 2JSOA 3KUPA 1ET9A 2M4NA 1FYCA 4KY7A 1WMHA 3U4ZA 3ZNHB 2AWOA 2WDRB 4YHHL 4HJ5A 2UU9Q 2J7QB 4OVUA 3V05A 4FDBA 1PMRA 3FPUB 2WDTB 3ZO5B 4KKUA 2UYZB 5IGEA 3PO2B 4JW0A 3V61A 1SE3A 1V97A 2EY1A 2WAQE 4HJ9A 1EQVA 3J7ZC 2R7ZB 1E6EB 4FA6A 2CWPA 4PZ8A 4HPLB 4DR3L 4KJOA 1V9JA 1F9SA 1STYA 4ANUA 2EYHA 1K8MA 3K0YA 2F0IA 1S4ZA 3TZDA 4DF7A 2BVCA 3EJIA 4DK1A 5JXVA 2W55A 1QUQB 2PNHA 1R4QB 2NN6I 4XE0A 3MTNB 4JOIC 3H6NA 1VQBA 1KDBA 1AFPA 1NI3A 3V96A 3N1YC 4DUYQ 2BOSA 2JQRB 4KN7C 3J81c 2MBHA 3S2HH 4C80A 3J81i 3U58A 1ZKOA 5AEKB 2KDFB 3NS8A 3HM6X 1WYDA 1V8QA 1SDFA 2A69C 2CH4A 1EIFA 3C2PA 3BYYB 2O5JC 1IYVA 4K0KL 2KLCA 2IZVB 2JYEA 3PSEB 3CMEA 1I7HA 2GVAA 1W6KA 4B95A 2A6HC 2B63B 3HKSA 3CSFA 5D94A 3EFUA 2Z0SA 5IP9H 2VQFL 1C77A 2N7EA 2ZJRA 2L0TA 1H9KA 2G5DA 1D5MC 1Q81C 4G7ZC 1PA6A 1N60A 2K3UA 5G5GA 2JA7H 1XLNA 2HTME 3M3YH 5CV4A 1L2FA 3AFQA 1Q82C 2PMZB 5T8IA 2E76C 3ZGZA 4DV1Q 3HGBA 2LVOA 4HSVA 4UDUC 1Y69U 3A33B 4P16A 1EUVB 4XDDA 2NVXH 4A3JH 4II2B 4YT0B 1GB1A 3RZFA 3MEFA 1LLRD 3AE8B 3VYRA 4OO1G 3NELA 2JZPA 3FDTA 4GIVA 4LW1A 2FNJB 4QY7A 2NB0A 2XSCA 1GG3A 3EHVA 1K83B 4CBVA 3MEHA 3I4NG 1E9MA 3NENA 4DK3C 5M5WB 1BNZA 1TYGB 2F0KA 4GOPA 1WVLA 3DM1A 1IBKQ 4KIKB 1BCPB 3IAYA 1PDXA 4BY1G 4NMZA 2KENA 3JAMc 2PI2A 4WH4A 3RZDB 4L2YA 2IPKD 2INPE 2DBYA 5ELNA 2LSSA 2XK5B 2K5VA 2IY1B 1T3QA 1LFDA 3DVGY 5A2QL 1SF0A 3KVFB 1RL2A 4HDQA 4KKJA 2PW5A 4DR7L 1BBWA 1QOBA 1Q86C 3NBIA 4X3UA 5C3JB 1J19A 2Y5CA 3IAS1 4JI3L 4GOPC 2L32A 5JPMC 1B9RA 1S5FD 4KD4A 4TVAB 1XPUA 4WJWA 4BZAA 3FILA 1UE6A 2D3BA 1ZXTA 1VQOA 1JMLA 2BB6A 5FJ8H 5C4XH 2HDEA 4MM3A 5H92C 2YVCA 1A62A 2XEWA 4FHJA 1SFOB 1YHAA 1E7ZA 2A73B 4ID6A 2PMVA 2AUKA 3T13A 4TQ1A 1Q12A 2AEHA 2XRQD 3ZXVA 5JJLA 1D6EC 2UUBL 3ZW3A 2D9UA 2N9LA 5IY0A 2QJLA 3LYYA 4JE3B 3CSTA 5T1IA 4FJYA 1IL8A 5J2RA 1YJNA 4I7ZC 1GC7A 3K7AH 1YNXA 4JIOU 1A3VA 4QGUA 1HH2P 4IZ8A 3QK0A 1X3FA 5D6JB 4GDLA 3HOYG 2OTJA 2JA8B 3VHTC 4OX9L 3A9KB 4HJKA 4DAMA 4ZDVA 1VQHA 3CPWA 1IGCA 1XLQA 2KD0A 2YYZA 5EJWA 5DPSA 2PVOD 2Q2HA 2EJFC 4IUNA 4RG1A 1Z5SB 4HN7A 1JWBD 1BT0A 2L83A 1PGXA 2QW7A 2KANA 2KFKB 3SDLC 4BOSC 4BAXA 3RMHA 3MC0B 2EJMA 4QUFA 5KNBA 1XLPA 4NP5A 4DV5Q 5K36G 2QC8A 4JVZA 3AU5A 2D2CC 4DPGA 5BN3A 1RWSA 1YN4A 3NUCA 4IFDJ 1N5WA 3PUYA 3CCQA 4LLGM 2EXDA 1PRTC 3IXSA 2K04A 1JRPA 1WD0A 3H91A 1Q46A 2IGGA 2IO0B 3TMEA 1YMHE 4MACA 1JICA 1XQQA 4K5XA 2KVRA 4IJLA 2A1AA 5I9PA 5EKLA 1L0WA 1JORA 1HTOA 4B0EA 1UZXB 3R66C 3MP9A 4IM2A 1EF5A 3D0FA 4A3GH 2NBWB 2ATWA 3GTJH 4HROA 1PTOH 5M5XB 5FO8B 2F0MA 1HA5A 3I2ZA 5LNK1 3UDIA 3A7AB 1FIQA 3BINA 3EFCA 4LNOA 5IT9E 1VQ7A 3HOXB 2JWUA 4WJPA 3Q2AC 2C9OA 1DOYA 2H4OA 1B1ZA 1OXUA 4BBSB 3U30A 2BS2B 4CDEC 2IGDA 3L0OA 2FCSA 1PFMA 1Y8OB 3PRZA 4A3IB 4MNOA 2LGSA 3STBC 2REXA 2L55A 1PTOD 3S14H 2O2LD 4MDKE 1X55A 4CJ1B 3HOUB 1ZW7A 4X6AH 4FP5D 4A3OA 4BS9A 3GTGB 4QMGA 4ABNA 4DBGA 3PREA 2ES2A 4Z9CB 2RCNA 2XN9C 1VQPA 3OYYA 2KK8A 1G2TA 5EE1A 1B3QA 1MSGA 1EQQA 2PTLA 3KOJA 3VR8B 4DV2Q 2AMCB 4DR6Q 1XEEA 4RKLA 2YU9B 1STEA 1L6VA 2K5DA 1SE9A 4IG7B 2DHZA 1SRUA 2ZW1A 3H3VC 3JSVB 1JC7A 1YEZA 2EYOA 3A8KE 1BBUA 3LGJA 3OSOA 3M4OH 4BBNC 2J52A 1F2RC 2KKCA 3J81E 1E8XA 1K8OA 1MJDA 2MO1A 4F8CB 2EXZA 1PZID 5C44H 4OVVA 5EPJA 2QKIC 5AZHA 3JYUA 4MHEA 4RWSC 2G45B 1TS4A 3SHQA 4IM0A 4IFDG 2F3VA 4OZCA 1EY8A 1VQLA 4BVUC 5LXIB 2W9NA 2A6ED 2KX0A 4BA1I 1HNWL 4ZKBB 1TTNA 3KLRA 3H8HA 4LUOA 2LY7A 4M1UB 1J8IA 4GKKQ 1MI2A 4LFAL 1HNZQ 3A9JB 1I4XA 4DV7Q 3A1QB 3L13A 1D8LA 1I6VC 5CC4A 1BQQT 3I73A 4RF0A 5LMNL 1XPOA 4UP9A 3D32A 4JCVE 3FKIH 2Y0SG 3HVZA 4JBKA 3NPPA 4C2MB 2ACZB 1SNMA 4ZUIA 3ML8A 3V6CB 4AWJA 3U4EG 3M9BA 4LF9L 2I5LX 3RD4A 4DR5Q 2KTRA 3VA5A 1R4NI 5M9OA 1YITA 4J1MA 4RKBA 3WDNA 1X3PA 1LO5D 1QB5D 5DEHA 3GTOB 2F03A 2F0UA 3O65B 3L4PA 4PQXA 1IBLQ 2HHHQ 1TS5A 1T9HA 2A68D 3K5MA 4KDLB 4P7IA 3MXNB 4A9AA 3A55A 1HHVA 4IM3A 4HSPA 3L7ZC 1WFQA 4EQOA 3JAME 2NZHA 2JY6A 4QAYA 1XJVA 2IBIB 4MELA 1ICWA 3I72A 2N1WA 1IW7D 4I65A 1V1PA 5DAUA 3WAOA 1SJED 4EZJA 3GTLB 1Q1OA 2F4VQ 1LTRD 3HOWG 1QWYA 2FJ2A 2MSED 1TVXA 3HKZG 1JROA 4S17A 4GOPB 4ASWC 4PV1C 2WX0A 1P0RA 2Z4IA 2N49A 2LD9A 3MHSD 2KCMA 3NOBA 1V43A 2DUDA 3RT3B 3S1QH 2Z6BA 4EVOA 4EE2A 2GOWA 2RR9A 3H15A 3AE7B 4X64Q 1N63A 2ZJQA 1IYFA 3S2DH 3BJUA 2AL6A 5JJIA 4BBRB 3HUIA 2F0EA 4RMFA 2R92H 2KMAA 3O13A 2BA0A 3MC9A 1WX8A 1ACCA 4P6VF 5HI1A 1STBA 3T1HQ 1TZ1A 2DNEA 3RD2A 1WRIA 4I6NB 4XC2A 1R7SA 1SSNA 2IY0B 4FXDA 3VXWA 2CR5A 2DNCA 1GHKA 1D1IA 1KLGD 4KHPQ 4MGZE 3U7DA 3D4DA 1SN8A 5IP9G 2IL8A 2OJWA 4IPHA 3OG5A 3J80E 1N36Q 1UEAB 5C23A 2K03A 3ONAB 1EY4A 2CVRA 1SIJA 1EYAA 1HTPA 2YEPF 3ND8A 3M63B 1JB7A 1GUOA 4DR4L 2J7ZA 5M3FG 1TQOA 2EY6A 1ZPSA 3URYA 2CKHB 1XMOQ 2KO3A 1V6EA 1KAWA 1I5FA 3V60A 1JWUD 1Y1WH 3L17A 4GDLB 2MRPA 3TUOA 2MA9B 2PZWA 1KXLA 2BF8B 4Y7NB 1EYCA 4DR1Q 2GVBA 3BDLA 4EZKA 3UQAA 1TWGB 2Z1CA 1SYFA 2KEDA 3LDZE 1KABA 4WRDA 3T51B 1BMLC 2D5DA 3WOEA 3X23A 5EPKA 2GRIA 4BY7B 2BS4B 1B50A 3OIPA 1E8YA 2SAKA 1TWHH 3HOVB 2BDOA 1LM0A 2C7MB 1VQCA 3W1BA 3PT2B 3N30A 3CAMA 4NXMQ 1QOGA 4NAWB 1U4AA 3VAWA 3PO2G 4XZ4A 4ANWA 1LQBA 1XXGA 2IW3A 5KNDA 4C4VA 2E74C 1ET6A 4HCNB 3KYHC 1F2ZA 2XIWA 4PMCA 1JQYD 3PGEA 4PYUA 1CUKA 2DY7A 4OEMB 4WJNA 3I70A 4IOCA 2MUYA 1P8LA 1KC8C 5E6OA 2KWVB 3RZOB 1E0BA 1PFNA 2KQ7A 3OLMD 2J0TD 1GAQB 3DBHI 3PZ8A 4KSLC 4NJ6A 3T53B 2V9HA 2WINB 3DMUA 1WI5A 3OTOQ 3AECB 3I91A 1I3QB 1E1TA 3I3CA 4PNYA 1ZUD2 2J0JA 2QDFA 3AXCA 2EDGA 5FJ8G 1MJCA 2I38A 4AYBB 3TMPB 4A20A 1S5DD 2R7DA 4GMVA 3KF8A 3Q0AA 3G71A 1Z7TA 4KZ0A 1HUMA 2UWQA 4MGKE 5IP7G 4CKEA 3B9JA 3L54A 2E75C 2EE1A 4DV3Q 1KTKA 2V3SA 1V5TA 4A76A 2NMQA 3S17B 4YL8A 1F0ZA 1WTPA 2FCQA 3RMKC 1GKHA 1I50B 3CQZH 3VR6A 3PF5A 5E6NA 3VUWA 3QWNA 1WRDB 4USAA 4CKBA 2JA5B 1P16A 3MXUA 4IUQA 3SE0A 3DEOA 2LFNA 5IGDA 3IT4B 4ODGA 4JI8Q 4LF4Q 2KAJA 3AB5A 3BS1A 3OWFA 4LNIA 2WAQB 2CJNA 1AZPA 1YX5B 1A8VA 1IGDA 1YJ9A 1X56A 3PSIA 3EGRA 3RYTA 2PQAB 3I55A 1WXQA 2Q8RE 1EWHA 2X6GA 4DUZL 1DZ1A 1OQYA 2UXDL 2PW7A 3DHIC 4NAMA 4OZAA 1QQRA 2M17A 3GS2A 5TR5A 3PTFC 2R93B 1HR0W 3MJ5A 4FLHA 3A8IE 1S1QB 2MBQA 3Q3OC 3EECA 1QVFA 4OW0A 4TQUS 2VY3A 2DENB 4HR7B 2MX2A 4K7WA 4U673 2V1YA 5C2TB 1QZHA 5T1GA 4I7AA 2EY5A 2KQ3A 3G7LA 1P98A 3AEBB 3H9DA 3P1MA 1A2TA 2NVYH 4IC7B 3VR5A 1WM2A 3W5VB 1CZGA 5E7NA 1KFYB 5AJ3Q 4DNRB 4BY1H 1X3GA 1QOHA 2O2VB 5DLQE 2HD3A 1QOFA 3Q3MC 2L52A 1QT9A 1WH3A 4DR2L 3MZ5A 2K4KA 4IO9A 4US8A 2K05A 3TEYA 4G50A 5DNFA 4ICVA 4JV5Q 1WZ0A 2Z9HA 4HKQA 1B2TA 1IBXB 4H13C 1N34L 1FM0D 5BYQA 1E7UA 3NZSA 1EZ6A 3LX0A 1S3OA 1KDCA 1YX6B 1G8ZD 2N78A 3J80L 4MZ9A 2NCNA 3PLVA 1BCPF 4XWWA 2PEAA 1ENCA 3BYTB 3P2BA 4GDKA 1Y1VB 3S1RB 2L00B 1VQFA 1CHPD 2VNUD 4OZBA 4QJFA 3QO2A 4RNAA 2FAZA 4WJ3M 1LXDA 3I4MB 4WJQA 3LWEA 2ZNVC 2F0SA 1SLJA 2L1AA 1ZKHA 1E8ZA 5KYIA 1L1OC 1V8CA 3R8BA 2K01A 4G57A 4EKUA 4RHRA 3AV8A 2KDBA 2E3TA 2KN5A 3VTVA 5CORA 3HOYH 3NVZA 3NJTA 3CC4A 1MFWA 4M8NA 3N20C 5A35A 2HTHA 4XIGS 1II3A 2KFJA 3LB8C 5M3MB 1TWFH 4FXGC 4U68A 1C0AA 3NWSA 4C3JH 3VRBB 3SDZA 5I2XA 1Q7YC 5JJKA 3SK5A 2PKOA 2ZVNA 1EWIA 3E3XA 1SYDA 3F1ZA 4IWPA 1J6QA 4XYCA 5JZEB 2UXBQ 5K36H 4YTPB 2EKEC 4IALA 1WR1A 4KV2A 4NQLB 1L7YA 5LL6X 3R3OA 4RA8A 4L6TB 2D10A 3PCOB 2CHBD 3SK4A 4LNQA 1EYDA 4DQOC 2E5LQ 2L12A 4A3DH 3APFA 1LTBD 2FCNA 3R2TA 1HQRD 5C3EH 2RDHA 1XNRL 1LTID 2FINB 3OIQA 1EY7A 1STAA 2CCZA 1OEYA 3GTQB 1DJRD 1WE6A 2AQ3B 1X54A 2PI2E 3FKIG 4GXBA 1DCZA 4JI6Q 4LUVA 1FO4A 2RSOA 1ILQA 2IO1B 1I35A 2BE5D 1WJNA 3VDYA 2KN4A 4O42A 2E2IH 4KY6A 2WHIA 3NG0A 4LF8Q 4A3KB 2B2VA 2NN6G 4C1NK 2JA6G 1SNQA 4KK7A 4JWUC 3DBHB 4GSWA 2K0PA 1AH9A 1GUSA 3VRAB 2KACA 2D5GA 3V3XA 1SIFA 3TBLD 4K2KA 2WP8J 3SK6A 3C0RB 2FIFA 2VXWA 4AQ7A 1EU3A 3VA7A 2EZVA 5AZFA 3AE4B 2UU9L 1ZP0B 3W5UB 3KQ4A 2HIXA 4GNXC 1AP0A 3K9PB 1OXVA 1KF6B 1YVCA 1JE5A 1Q1EA 4KI0A 2B2VC 5ELDA 4GLXA 2JX5A 3IFDA 2MJEA 3P4QB 3DEPA 3CRLC 3PO3B 2BGFA 1N5XA 4IDIA 3E0EA 5D3IB 1JQ4A 4DNTB 3OMGA 1PTOC 2KC2A 2NPTA 3A5ZB 2K1FA 2FUG1 1VQ8A 4YWLA 4W9HA 4A3FG 1IL2A 1O7LA 2GB1A 5JAVA 2L05A 2KLGA 1JMCA 3PF4A 3QQ8B 3CD6A 1YI2A 4FJZA 1G291 3TBIB 2G1EA 2D3GA 2K22A 2ZCBA 5KHQA 1NR4A 1S5BD 2I5HA 4LF6Q 4HEA1 3JC66 4KJNA 2WXLA 4DUYL 1E5WA 2X69A 2BKFA 4KGSA 2NBFA 5E4WC 5C0XI 1SB3C 3TEXA 2JEBI 2Z0EB 3GP7A 2O5IC 3HVDA 1C9OA 2PIAA 2KX3A 3DHHC 3NRZA 4LF5Q 1EZ8A 2CQOA 3H09A 2RDGA 2N9PC 4IKGA 1G2SA 4EQNA 2LRWA 3KF8B 2K5QA 2MNAA 1ASZA 3TEZA 3A4RA 2A6EC 2NWGA 3AMUA 2JXXA 3DWMA 1TZOA 2A19A 3PLUA 1OFFA 4FF2A 2ZM6Q 3UDXA 1IUEA 1NMGA 1ZYRC 1Q0WB 3C1EA 5IWAQ 2KOXA 4FULA 4C1NI 1TR5A 3ZYYX 1WZ3A 1PVOA 1E2VA 4XT1B 4DV1L 3S2HB 4W9KA 1QNKA 4IURA 4DV6Q 3NS1A 2SOBA 4LAAA 1YQBA 3PMFA 2R3ZA 1T5XD 2BYTA 3KF6B 3GE8C 1WOCA 2B76B 1VDZA 1L6UA 2K6QA 2O6VD 4A3EB 2YTXA 2LMCB 4C3IH 1RFKA 2WB1G 2QMTA 2WP9B 3DOWA 4RF1A 4G3XB 4B9KA 1XNQQ 4GOCA 2LRUA 1F1HA 1EY9A 2IJ0A 1YNJD 2K1BA 5LLIA 1IBKL 2LUMA 1U0LA 1OTRB 3Q69A 4YY3Q 2JA7B 1HCZA 3M3YB 1GUGA 4P75A 4JI5Q 3ZNID 3SEBA 3KBXA 4A3PA 3PVLA 1DOMA 2NVTB 5IODA 1WYWB 4WURA 4YTMB 4IN3A 2GA4B 3HOWH 2L8JA 3QG1A 2UU7A 5D2MB 1CTMA 1XMQQ 4DN4M 3KUCB 1EU4A 4FADA 4A3JB 2EELA 3F2CA 1IW7C 1PH4A 3GD7A 1QE6A 4UAIA 2DYMA 2DZKA 4OHJA 1YJ1A 4TKNA 5EE0A 5EQ0A 3PIP3 5IE8A 2OF1A 2EJGC 2KVMA 4JI4L 4H02A 4BXXG 4HDOA 1PZJD 3IRBA 4ACFA 4WORA 3TP7A 3W5OA 3AB9A 1VQ4A 5IN7A 4ZLTF 2HJ1A 5CTRC 3TEHB 2NTSA 2OEOA 2MQJA 2VH1A 2MJ3A 3S16B 4EEWA 3C3LA 1L1OB 2VB3X 4ZAIA 4LNKA 5L83A 3TL5A 2EOTA 1ZGUB 3WWVA 4YXDB 1X3QA 4NB3A 5D14A 2C60A 2H1EA 1EY6A 3E5SA 4LDTB 2ZCCA 4R4OA 1A5RA 2KDMA 3LWUA 4OWXB 4APVA 2DWQA 4FNFA 3Q8CA 3GTKH 2IGHA 4DV4Q 2HQLA 3SGIA 3H1UA 3ZLZA 3DPDA 3K81C 5M3FH 5CMDA 4BFRA 1EY5A 1FVIA 5C4XB 2H89B 2BS3B 4AQYQ 3J9CA 4M0WB 2IDYA 1M8AA 4F8MA 1VLBA 2RBMA 2HIVA 4TQ0A 2A5HA 3K5NA 2LFIA 4K14A 2Y5BB 2DNFA 1JWAD 4LJOB 2A74C 2NZ1D 4DV5L 1I6HH 5J1ZA 3I9V1 3U4VA 2FFKB 4EZLA 3EN2A 1XT9B 1V1OA 3AE9B 3UGBB 3PGZA 4B3SL 1MVKA 3R93A 2ASQA 2JF5A 1VMCA 1WXSA 1WR6E 1K50A 3PO2H 1B8AA 4L5TA 1A2UA 2N7DA 2B2UA 2R7ZH 1KM7A 4G0NB 2OXPA 1AYFA 3NUHB 5D7GA 5BN5A 3D4WA 2R6GA 3N1ZC 2N88A 3QC8B 5IKCM 4UY8C 1PRTF 3NXWA 1Y8NB 2KDEB 3TP6A 2L76A 4HMJA 1I94Q 3FPPA 1PH8A 4A93B 2ZJDA 3PIPA 2V0GA 1I4HA 5FLXL 4UHVA 5EBCA 2LS01 2JJQA 2XNAC 1BR9A 4B3RQ 1HFNA 2ZZPB 1SYCA 4B9XA 2MFIA 3WOFA 4B0MA 4GNXB 3H7PA 2B2UC 1AW7A 2F0JA 5IYBH 1WGKA 4PS3A 2CW0D 1W6JA 1SNPA 2L0CA 2KHIA 5G5HA 3WAMA 5IP7H 3GTJB 5GXGB 2AQ2B 4K7SA 4MEMA 1VF7A 4L5SA 2X8XX 1NBWA 5H1SE 3B1LX 4DXGA 3ENEA 2MWSB 4JI1Q 1K53A 3CCEA 1NE3A 2WXJA 1XLOA 3BK2A 2LGIA 1U4RA 4K8JA 1IBML 1FJGQ 4DV2L 4DR6L 1SSOA 2KCNA 3EUB2 3ULLA 3OW2A 1HZ9A 5DPRA 1H9MA 3J7AF 1WCMG 3IFTA 5JJZA 2QSDA 4NPNA 4C3JG 2LHEA 5LXHA 1QVGA 1XF5L 1WY8A 4RGMA 1JJCB 5CV8A 5BYSA 1JOOA 2R93G 1DXMA 1K0RA 3HOZB 1PH5A 3RLOA 2VZKB 3S14B 1TXYA 4QIWE 1Q5WB 2EQSA 1VQ6A 4FF4A 3ICEA 1B53A 1L4ZB 4H0LC 2DAFA 1K83H 2DJFC 1NDDA 2L3ZA 1FXAA 2VQFQ 2Z6KA 1WIAA 4N58A 3WCQA 3P42A 3IVFA 4BBNF 4R4TA 5GMVA 3K5OA 1QG7A 2IX0A 2RHSB 4A3DG 1SAPA 4MSMB 4Q2JA 2GBRA 5C3EG 4FVMA 1HNZL 2W3SA 2Y0SE 4DV7L 3VQIA 4E6IA 1PH2A 1CA5A 3KFUA 3HZXA 4I6PA 3ZXRA 1E10A 2HDMA 2X6LA 5CX3A 2PLPA 1Q3LA 3M4OB 2LJ5A 2F0VA 3K0XA 1SGHA 5C44B 1YIJA 2A5UA 2Z6KC 4FF1A 2VB2X 2PYKA 2JZZA 5I6WA 1UUPA 2I5MX 1KOTA 4K5VA 1ILPA 1V49A 1IBLL 2HHHL 3QX1A 1DOIA 2NS5A 1SFOH 2KOLA 5FO7B 1XTDA 1WTVA 4O0AA 1D3ZA 1FXTB 5KGUA 1F9QA 5BR8L 3AH7A 3H0GB 3HKZE 1NYRA 2BTEA 2K32A 5LMNW 3ER0A 3ZTDA 1O7IA 4DK5A 2LXKA 1TKEA 3JVZX 1IP9A 1JJ2A 5BMIA 1H9SB 1UWXA 4P74A 2H88B 3TIXA 4A3MB 2W54A 4DR7Q 4JYAQ 1P3QU 1H9RA 2Z59B 1M94A 1WMHB 3PZDA 3MTSA 4JI3Q 2IYDB 5FLMG 3VH3B 1XPRA 2RHQB 1BXTA 3AEDB 1C3TA 3RLFA 3MFGA 4OO1I 2WIIB 5M3MG 1RTNA 3S1NH 1VQKA 4JI0Q 4ANVA 3A56A 2MLBA 1SJHD 1XYIA 1RODA 5DM73 1VMPA 3W1SA 3M4YA 2H5XA 4E71A 1G91A 3AE2B 4X64L 2WKCA 1K9MC 5KRUA 2R7FA 4LMQD 5DPWA 1Z6HA 4XYQA 4DU9A 3DWPA 2UUCL 2UUBQ 3VR2A 4J8QA 3B6YA 2GBKA 3UE0A 4MJSA 1ZE3D 3T1HL 4PG3A 2PJHA 2M00A 1Z9FA 1K52A 1PZKD 1UELA 4HAEA 3H3VI 1K51A 2OEDA 1MHXA 4LJPB 1K28A 1CHQD 4KHPL 1C4PA 3W1SC 4L63B 2ZPYA 5D3DA 1F2RI 3G6JB 3AI5A 3S1QB 1N32Q 1N36L 1VD2A 1ZDXA 3VR3A 4RFBA 2KJ6A 4FHKA 1B7YB 3ZJTA 1GPXA 1K8RB 1S5CD 2CFMA 4YCWA 5C4JB 1A3UA 1AARA 1I4GA 2F0NA 5J22A 4S0RA 1TKWB 2ZTDA 4TMAB 3HOXH 4A3KG 1XMOL 3PUVA 1BVSA 3ETRA 4X65Q 4ANXA 4BBSH 1HZBA 1HRJA 2CS4A 4XQQA 2MGSA 1EFID 2KA7A 5EE9A 2NN6H 1E3PA 1C4QA 4C3HG 2JA6H 1PYSB 3GZNI 2WDVB 2BE5C 4C3IG 1RF2D 4X57B 5FR3A 4LNNA 1V5OA 1SMYD 2PNRC 1EO6A 1NVID 3RUIB 4JBMA 2TSSA 3L0WB 1SMXA 4NXML 4J3OD 3GTGH 1FGBD 1AE2A 4NKLA 2RA4A 2MO0A 2ZTCA 5FK9C 3ZDMC 2AYOB 3S2AA 1EWYC 3CCUA 1FCCC 4LJZC 1KRHA 1XCQL 1OTCA 1C4AA 1Y1WB 1WGYA 2YU9H 4M00A 1Q90A 2JWZA 5HKHA 1A6XA 2BKRB 4W9GA 4EUTA 4A3FH 1H9JA 2J42A 1LTAD 3A54A 5TSSA 4K3BA 1STNA 4DV0Q 3OTOL 4QCLA 2TMPA 2N3SA 5G3LD 3DWQA 4DAPA 1TWHB 4HCEA 4N9PA 3VR4A 3I56A 3GTMH 2LXCA 4BKTA 4XDXA 1DOKA 4DHJB 1FNVA 1KNEA 4RHSA 2Q5WD 1TY2A 4K6DA 4LNFA 1AE3A 5E1FA 3SU8X 1WFYA 4HVBA 3PV1A 2C7HA 2VZAA 3IL8A 4PMWA 5IT9L 3CCSA 1NTGA 4KMUC 4DV3L 3FILB 3PRMB 4BA2I 3RFZB 2VL6A 4TRDA 4KY5A 4MM3B 4YCUA 2JPHA 3BVZA 4P1BC 2OQKA 1PH3A 2A69D 2N1VA 2FBWB 1OXTA 4WWMA 3DQVA 1DGSA 3CF5A 4NXNQ 4JI8L 1CFMA 3S15B 5BYRA 4K8IA 4C2MH 3RNBC 5ELFA 2A6HD 1Z2MA 4P2CB 1WTQA 3D8GA 1E2WA 4GLAC 3VR9B 4PK1A 1PYWD 2DY8A 3L16A 1HNWQ 2O6VA 2J53A 5FKAC 1VZ8A 3DWGC 5IAAC 1LT5D 3U52E 3GE3C 2CKZB 4A3EG 4L5RC 1PRTB 3VYSA 1DGJA 4LFAQ 1X65A 2AWNA 2F0QA 3FRPB 3TQYA 2K9XA 1OEYJ 1EY0A 3MFYA 2Y5PA 1KDAA 2MPMA 1VQNA 1VQIA 4Q5VA 2M19A 2IWHA 1T6BX 4E3CA 1SE4A 1F52A 2I1JA 4KGTA 2R2OA 1H8CA 3V6EB 1UF0A 1SBBB 2RD0A 3AULA 3DM3A 2B2WA 4HTHA 3J81L 2FIDA 1LACA 4A3CG 5JOBA 2DGYA 3HFZB 5AJ3L 2KXJA 1KAAA 2R7ZG 2LKVA 2SNMA 5IYDG 5C5MA 2VUMB 2KHWB 3RI7C 5BMGA 1YNJC 3U50C 3VVWB 1QZEA 1VR9A 3I57A 3ND9A 4HIDA 3UI3A 4Y52H 4YCVA 2EYJA 3TSSA 4IFDI 3U9SA 1PYBA 4K3CA 1LABA 3IHPC 1WI0A 2E2HH 3HHMA 4XQNA 4W9FA 1UD7A 2PO4A 3WANA 1STGA 2WACA 1VZ6A 4BXXH 4RGNA 1IZ6A 3I4NB 5LMUL 1KRSA 3W3AA 1WXAA 3U7ZA 3UQBA 1NENB 4P1CC 3KDFA 5IYBG 1PH1A 4LFCL 3KYDD 1GUAB 4DXFA 1RKNA 3RN5A 2BWFA 4RM8A 4IJHA 5GAGC 4R8IA 3GTPH 2B63G 4OXPA 4X62L 1CSQA 3H94A 2PVGC 3PUZA 1EYGA 1QVCA 3PS6A 1UE7A 1DM0B 1YJIA 1PH9A 3BK1A 3CWIA 2WQYB 4EOYA 2VS1A 5CV6A 1IXRA 4ZYSA 3QIJA 1EFWA 1VQMA 2B2TA 4W9IA 3JAML 5I2YA 4DAYA 2JP1A 3VYUA 3C1FA 3BVMA 1L0YB 5KNCA 2E2JB 2BBCA 1IKLA 1WGDA 4Y7NH 2E8GA 5IP4D 4EQ5A 2WU5B 1CK1A 1TWCB 3U2SC 1MIUA 1TWGH 1NUCA 2RKSA 3E9SA 5AZGA 3TJPA 5G55A 3FMCA 1CA6A 2ZXOA 3CF6E 1SYGA 2G9DA 3BZDB 1GO3E 5JPNC 1SROA 5M5YH 2JRIB 4BY7H 2E6XA 2RSUA 2ENBA 2QEXA 2AL3A 3NVVA 2WXGA 4HEDA 2B2TC 4ARIA 3GZNB 4KV6A 3BU2A 1BBXC 3R7RA 2KC1A 2OWOA 1HNXL 1BO0A 2JE6I 1FD6A 5CR3A 2E5LL 3HOYB 1JALA 4F1SA 4WWPA 2K6DB 3CMMB 3D4RA 2F1MA 2K33A 3H6MA 1EQRA 1VQ9A 1E90A 4TSSA 1FCLA 4A3LG 2LEKA 2ZT9C 4II3B 3ML9A 1MGSA 3KWLA 5CV9A 1GM5A 2EY2A 4UPAA 4JI6L 2I07B 3PHXB 5I6YA 2M8SA 2F0OA 5D65A 1U9RA 1G6PA 4W9DA 4CHTB 1P1AA 4ZRKA 1R9TB 3I63C 4CHKA 3VFKA 2XGTA 4PZ7A 4RCNA 1B9NA 3CCLA 1I3QH 4LF8L 2EMTA 3Q8BA 2FMMA 4XTCS 1KNAA 4DHZE 1GJZA 2HE7A 3AQQA 2DN8A 2WXFA 1J5EL 1S3SG 2D0OA 1EEFD 2XWBB 1TJEA 4J6HA 1RYJA 2FUHB 5C0XG 2UUAQ 5DM63 4FXKC 2DX5B 2KTRB 2EKIA 3DBRI 4W9JA 1HA6A 3NTKA 3PUXA 3KW5B 1QUQA 1JOKA 1RLFA 1E1OA 1TGZB 1I50H 3P1HA 1NAPA 3D31A 4JI2Q 4W9EA 4A75A 4WAFA 2JA8G 1LGRA 4GS3A 3Q8AA 2XBBC 1LTSD 1EOVA 2CW0C 2V4DA 4X66L 4W9LA 3STBD 4Q0FA 3L08A 2KT7A 3UIOB 1V86A 1D5XC 1VJKA 5JHBA 3N6RA 3APDA 1PUTA 3SFEB 3WALA 1V1PB 3TP5A 4HXDA 3VTUA 3M85A 3Q6SA 5IYCG 4LFBQ 5JEAH 3K6OA 2K25A 1LUZA 2QIEB 3CXCA 5C1ZA 3ZJYC 3HOZG 5FR6A 1JOQA 1WCMH 4P71A 2R2QA 4HJ7A 1PLFA 4CGYB 4YTNB 1UGMA 3NQIA 2KNBA 4LF6L 4JPSA 4M01A 1PTOF 3CRKC 2R93H 1YHQA 2BYFA 3IBEA 2L15A 3PHWB 1KL9A 3DXJC 3ZRFA 4DAVA 1TWAH 3MWYW 5LL6S 4ALPA 2LGDA 2ZTEA 2JN4A 4X3SA 4A3BB 1N6ZA 3W9CB 1VCBA 1PH6A 1FNWA 2JK8A 3G6EA 2HDLA 4DGZA 2Q2IA 4KKSA 1L0VB 1WD1A 3P4SB 4R8NA 4F7XA 4GKJQ 2DJGC 3T3OA 3RN2A 2M9VA 3QB3A 3T1YL 1LM8B 3A8JE 4FBJB 2L4NA 3ZJUA 1T0RC 1F9JA 3RNFC 2MBBB 3HOXG 5IWAL 3GOEA 1R4PB 1XTCD 4LF7L 1K8GA 3UE1A 3ALBA 3FP9A 4UP7A 3EC8A 3M3JA 4NPSA 3AEVA 4KIKA 4N9F4 2WS3B 1ICFB 3FEWX 4BBSG 3S1MB 4B08A 3V62A 2WB1E 3E9IA 3AFPA 1F77A 3UI2A 3N52A 1T0SC 3R3MA 2XK5A 3QA8A 5ELEA 3R2IA 3UDGA 1EL0A 1HTQA 3KLWA 2HD5B 1TS3A 4J15A 4A3IG 1Y1VH 2BWES 4JI7L 3J81j 4QIWB 1OXSC 2X38A 1ENFA 5EKIA 3HOUG 1XNQL 4H7BA 4A3MG 4PYZA 3A7LA 3A4SC 2BB5A 4YSXB 2W3RA 4XT3B 4YY3L 2RSNA 1W2BA 1HZ5A 4JI5L 4HIOA 3QIAA 3T3NA 3B0AA 3AU4A 4OVZA 2Y0SB 5DCNA 4F87A 2KQSA 4JLCA 4IUVA 1XMQL 1TIFA 4P73A 3N9YC 5FLMH 1NYQA 2WDQB 4KKTA 3NQTA 2G4SA 4IOIE 4C4VB 1I4PA 5ELBA 5M3MH 4HIKA 2INDC 3PRPB 3TN2A 2V3NA 2B2YA 4NJCA 1U4MA 2B39A 2N9EB 2JEAI 4EGVA 2KDIA 1B9MA 2F0PA 3HK0A 1ZEQX 2P5ZX 2WXKA 1PQSA 1JRUA 2F0TA 3EA6A 2NVQH 2KJRA 2J4XA 2DYBA 4R3DA 2M0AA 3KJOA 4JPBW 5IOIA 1C4CA 1HR0Q 3ECIA 3C19A 4RMAA 3QHTA 3L2PA 2Q2TA 1JT8A 4JL9A 4TUUA 4ZHPA 1UBQA 1PFDA 3KH0A 2F4IA 5KYLA 2AHOB 2F0FA 3PIO3 2GLSA 2B2YC 3HKZB 3KDFB 1K8AC 1FR3A 1N33Q 2AWTA 3NZ3A 4CJ2C 2ZPNA 4R4CA 1VCIA 2XRSD 3GTQH 1V81A 2N9KA 1WE7A 1E2ZA 2HQEA 4OELB 1E0ZA 4LTUA 2K75A 3D6CA 1SE8A 4TV3A 2ZXPA 2QILA 1RDPD 4DV4L 2QF7A 4MIUA 5HGTA 2C5LC 4RGOS 2KZRA 4KKIA 2LGXA 3L9AX 1SR3A 2NTTA 1BUIC 2FXQA 2K5PA 2FHTA 4A3KH 4AQYL 2PZUA 5A2QE 4ZYNA 2UXCQ 1LT6D 2L0FA 4ZUJA 1TKYA 2JA9A 2BYEA 4AH6A 2WLBA 4ZQ3A 4IUPA 3Q24A 2KWDA 4HKZE 5AUKA 2IX3A 5MPOA 3J7AV 2L5TA 5CV7A 1RM6C 2CQAA 3SD5A 4C3HH 2KVZA 3DVGX 1STHA 1HXYD 2PPHA 3B08A 1XNRQ 4JGHB 1J0GA 1PV4A 4OL7A 1NJIC 3BIID 3GV6A 5L95C 2KHJA 3NVYA 2NBUA 1MKHA 3MHZA 1F9RA 1HUNA 3T16A 1IKMA 1K0SA 5HHDG 1YOVB 1O7YA 4LWCA 3DBRB 5H8YE 2A68C 3W1YA 5IGCA 2K5WA 3CCVA 3HIZA 3PZ7A 4K81A 1I4QA 1SMYC 2JXMB 1WM3A 2N0SB 2KJXA 3ZNGC
chains in the Genus database with same CATH topology
1FD7D 2NVXB 2WXQA 2WXOA 2INNE 1J7BA 2EYFA 3M7GA 1SE2A 5KIXA 2M2LA 1BDOA 5EPLA 1ZXIA 1L0XB 2L1BA 3QOJA 3AMZA 1HPCA 1JWSD 4R9WA 3BWUD 5HG2A 1BUVT 3TDQA 4RAUC 1VDVA 4GDKB 3AEFB 5CGKA 4L1BA 3BG3A 4AS1A 1MBYA 1SNDA 2CU3A 4ITKA 2OT2A 1GXDC 3Q22A 3P63A 2F0LA 5AFWA 3ZQ4A 5JEAJ 1D5ZC 3E0JA 1TT2A 1DOLA 4M8AA 5ISRA 3AEEB 1CQVA 2KMMA 4N6EB 3ITPA 4FYDA 1C78A 2DYOA 1J9OA 3K7AB 4WQMA 5C3WA 1YN5A 2WKDA 2WXNA 1CZPA 3D6WA 3MXNA 3KWVA 4C7ZA 2M56B 2RMMA 5I4DA 4A90A 1G6ZA 3FAHA 1WTOA 2SNSA 2EYMA 4CQNA 4YSYB 5IGFA 1YJJA 1EWCA 4PT5A 4OIJA 1ESFA 3GV3A 1Q8IA 3MXPA 1JW9D 5C4ZA 1F2YA 4JWSC 4KHVA 4K6LA 1QOAA 4A3GB 1PTOB 1CI3M 1JR0D 3NVWA 1D2BA 2WXHA 1Q1BA 3RUZA 3SVMA 1KLUD 1J7AA 5JEAG 1MPEA 1A70A 1P7FA 2ICEC 1AN8A 4HMIA 1QKZA 1EIHA 4KX6B 1FFVA 1RJTA 2GI9A 3TEWA 1UWMA 1YNTE 2O4XA 2BDNA 3EQLC 1MD2D 1MHHE 3J7YW 1VF5C 2RPVA 3QOLA 3S1NB 1X32A 4JX1C 2F0GA 2IT1A 3IAM1 4CKCA 1L4DB 1FFUA 1OO9B 3MXGA 1QILA 5EE3A 4GLSC 2NUCA 1OQRA 3PUWA 1GUNA 1U4LA 4ZRZA 4NZLB 4HRSA 1BCPD 5NUCA 4QB4A 4XXEA 3GB1A 3K5LA 1C79A 1CQFA 1SNOA 1QCBD 1CZWA 5C0XH 1MI0A 3P4PB 2MHVA 2W82A 3FKIB 1EM7A 1EOTA 1ENAA 3E56A 3OW7A 3P20A 4OIKA 1PFBA 5ELCA 5I9OA 2I46A 3Q23A 1YNND 4G4KA 4RCOA 2JA6B 4KTAA 4ZOHC 4FXCA 2L11A 5IIFA 2XWJB 4X3KA 4D2KA 3BDOA 2K7VA 3E6ZX 1FNUA 1O7ZA 1PXUA 3CHBD 1C48A 2WXPA 3AE6B 2ID0A 2WV6D 3KLSA 1O80A 1T5EA 4A3FB 3HG9A 2VZKD 2JXTA 3S2DB 5E4XA 3GTMB 2R92B 2PW9A 2LHDA 4KD3A 3MVVA 5COYA 3I4LA 1DD2A 2G9HD 2K28A 2EPBA 1LTGD 1SYBA 1ZYRD 4S3SA 5C3XA 2ZXRA 4G7HC 2V4IB 5CYUA 4XQJA 3B2GA 3HS0C 1IBXA 2B8GA 1F2LA 3ERQA 4KHZA 1FXIA 5C6AA 1OXXK 3SHLA 4ZRQA 1EQTA 4K2LA 4MH8A 4ARCA 1UNSA 1XO3A 4KN4C 3ABVB 3SXHA 3L3OC 1DONA 1UAPA 3NSWA 2KECA 2D62A 3MHBA 1TU2B 1P7EA 1ZOYB 1B44D 1EIGA 2B8FA 2Q8IB 2WB1B 2Z4HA 5IOCA 2WXRA 4ILWA 1SXTA 1AZQA 5KEEA 2BW2A 4YWGG 5F2DA 1TIID 1BOSA 4IUUA 2JSVX 4YIJA 3P7JA 4IQZA 1GUWA 2E2HB 5CV5A 1YQ4B 4LK1C 4ZK9B 5EKKA 3PO0A 1B3AA 2MJ8A 1TKGA 2RQXA 4QUCA 1N61A 1ONLA 1HEZE 3HP3A 3FC4A 4DFAA 3VYTA 3BVGA 1JB3A 1PGAA 3GTPB 2F0WA 5EBDA 4JK1C 1Q10A 2R61A 3T4AC 1NEKB 3CQZB 4MN3A 2MJDA 1YQ3B 1Y8PB 3HEJA 1M4VA 2BT6A 1WTWA 1Z47A 3CIRB 3DWAA 2DLBA 1WTRA 3CKIB 3NBHA 3OMCA 1O78A 3KK7A 2OHFA 4ZRPA 4HCSA 4G7OC 2ICIA 4X3TA 1TY0A 5M5YB 1D4BA 2BA1A 3NWTA 2HCCA 4DA2A 1E7PB 1QLBB 2B2WC 1WSPA 4ZHOA 1KH0A 1JCKB 2XVSA 3LNNA 4BWGB 2JYTA 4REZA 3PV0A 4QF4A 2NVYB 2Z8LA 1AWDA 5BN4A 1FEHA 4BY1B 1C8CA 2IX1A 2K6AA 3SR1A 5C0XJ 3GQBA 2V3PA 3LXFA 3IT6B 1HTLD 4PMBA 3F2UA 3TP8A 2KUMA 2WXIA 3NTIA 2JU6X 1IYUA 2BCOA 4KGRA 3TZUA 3AEGB 3X3NA 4B9WA 4N9TA 1F9PA 5J39A 3DHQA 1WTXA 1HFGA 1JE4A 5K5PA 1LT3D 3AEAB 1PDQA 1RHPA 2PQEA 1HZ6A 4ULLA 3AM9A 3NE5B 1QNUA 2WU2B 1WYGA 1GJXA 3SFDB 4IUTA 5EGTA 3OWEB 2C5CA 3EVQA 2KHSA 1VZ7A 4H44C 2LMCA 5C4HA 2CJOA 1TWFB 1WCMB 1Y56A 1PRTD 5CBAE 4C3JB 3IKJA 1NSNS 3FVQA 1J7CA 2QDBA 4A6QA 4OO1H 3Q8FA 1ML0D 2MH7A 1TWAB 2N55A 5HURA 1F2MA 1DOXA 2F3WA 2L9HA 3EROA 1HQMC 4A3DB 2PZTA 3KBGA 5C3EB 4XDCA 1CJEA 4C7YA 3RPFC 4FO2A 1AEXA 2Q8TA 3AE3B 3C8YA 1GUTA 1QF6A 1GOZA 3S9WA 1VRAB 2E2IB 5E3FA 1SEBD 4LK0M 3K57A 1FRRA 4TKOB 4F88A 1NR2A 4O1NA 1I4RA 2LJIA 1YN3A 2EYPA 1WWTA 1ZDVA 1SNCA 2AX5A 3NTHA 3NP8A 3C46A 2QCPX 1S5ED 3T56B 3SR6A 3P4RB 4FF3A 1RCVD 1XWEA 4HJGE 4M0WA 3X3MA 5LHY1 4WIPA 1GHJA 4V190 4ZKCB 4A55A 2F0HA 3HRDD 2EYLA 3GO5A 1CT1D 2PCFB 1DYQA 3V2TA 4MT5A 3AU7A 2JYOA 3KLSX 1NCVA 2NVQB 1A3TA 3MAQA 3K59A 4US9A 5IGGA 2FE8A 5AUIA 1FMAD 4XWTA 2I2YA 1GB4A 3BDCA 2E2DC 4A8XC 1RD9D 2RDFA 2ONQA 3P75A 1LV9A 1EEID 1XX8A 1MSHA 3AN1A 4YSZB 2HCIA 2MP1A 4NDXA 2ZW0A 3NHHA 3AE5B 3SK8A 1C9FA 4V0BA 1BCPC 4N59A 3I8ZA 5CBEE 3CU7A 4C56C 3QJYA 4XYOA 2HUGA 1C76A 2AQ1B 3OHXC 1A15A 1QJOA 2EVBA 1U4PA 3ZJVA 1CM9A 4K5WA 3K58A 4C3HB 4CJ0B 4RGTA 4C3IB 4WFN3 4L8JA 1LT4D 2QEJC 1YNNC 3OOCA 1OQQA 1BF4A 2NYZD 1IHZA 5BMHA 4EQPA 3M7NA 5JVG3 5FO9B 2WNMA 3HOWB 4NW2A 1SYEA 2FMCA 3EFXD 5IGBA 4L23A 3D3RA 1ESRA 4GZYC 3HRZC 2YEPB 1ROEA 5G3LF 2SDFA 2PPBC 2F0DA 2Y3AA 3B2FA 4IFDH 2SEBD 2ON8A 1B4OA 4RH6A 2N7JA 3I90A 5HFYA 5C5LA 5FLXE 1RTOA 2KCCA 1FRDA 1D1KA 2WXMA 1ZXHA 3W2DA 1L5PA 3MA2B 1LTTD 2AUJD 3OPOA 1PGBA 3GTKB 2RVLA 1XCTL 3NK9A 3U9OA 5JVH3 4ME5A 5M3FB 3DUZA 1UGJA 1N62A 4JBWA 5FOBB 2MEKA 1TS2A 4OGQC 2KQ4X 1JWMD 4H2AA 4DK0A 1H9SA 2KEEA 1I6HB 5E6JA 3AE1B 2JSOA 3KUPA 1ET9A 1FYCA 4KY7A 2AWOA 2WDRB 3V05A 1PMRA 3FPUB 4KKUA 5IGEA 3PO2B 1SE3A 1V97A 2EY1A 2R7ZB 1EQVA 1E6EB 4KJOA 1F9SA 1STYA 2EYHA 1K8MA 3K0YA 2F0IA 1S4ZA 3TZDA 4DF7A 3EJIA 4DK1A 5JXVA 2W55A 1R4QB 2NN6I 4XE0A 1AFPA 1KDBA 1NI3A 3V96A 2BOSA 2JQRB 4KN7C 4C80A 1ZKOA 1V8QA 1SDFA 2A69C 2O5JC 3C2PA 3BYYB 1IYVA 2JYEA 1I7HA 1W6KA 2A6HC 2B63B 1C77A 1H9KA 1D5MC 4G7ZC 1N60A 2K3UA 5G5GA 1XLNA 2HTME 5CV4A 2PMZB 5T8IA 2E76C 3ZGZA 3HGBA 4HSVA 4UDUC 1Y69U 4P16A 4XDDA 4YT0B 1GB1A 1LLRD 3AE8B 3VYRA 4OO1G 2JZPA 3FDTA 2NB0A 2XSCA 1K83B 4CBVA 3MEHA 1E9MA 5M5WB 1BNZA 1TYGB 2F0KA 1WVLA 3DM1A 1BCPB 3IAYA 1PDXA 4NMZA 4WH4A 3RZDB 4L2YA 2IPKD 2INPE 2DBYA 1T3QA 5A2QL 1SF0A 4KKJA 2PW5A 1QOBA 3NBIA 4X3UA 5C3JB 2Y5CA 3IAS1 2L32A 5JPMC 1B9RA 1S5FD 4KD4A 4WJWA 3FILA 1ZXTA 2BB6A 1JMLA 2HDEA 5H92C 1SFOB 2A73B 4ID6A 2PMVA 3T13A 2AUKA 4TQ1A 1Q12A 2XRQD 1D6EC 2D9UA 2N9LA 2QJLA 3LYYA 4JE3B 5T1IA 1IL8A 4I7ZC 1A3VA 4IZ8A 2JA8B 1IGCA 1XLQA 2YYZA 5EJWA 2PVOD 2EJFC 4IUNA 4HN7A 1JWBD 2L83A 1PGXA 3RMHA 3MC0B 2EJMA 4QUFA 5KNBA 1XLPA 4NP5A 5K36G 2D2CC 5BN3A 1RWSA 1YN4A 3NUCA 4IFDJ 1N5WA 3PUYA 4LLGM 1PRTC 3IXSA 2K04A 1JRPA 1WD0A 3H91A 2IGGA 3TMEA 1YMHE 4MACA 1JICA 4K5XA 5I9PA 5EKLA 1JORA 4B0EA 3MP9A 4HROA 1PTOH 5M5XB 5FO8B 2F0MA 1HA5A 5LNK1 3A7AB 1FIQA 5IT9E 3HOXB 2JWUA 2C9OA 1DOYA 2H4OA 1B1ZA 1OXUA 4BBSB 2BS2B 2IGDA 1PFMA 1Y8OB 4A3IB 2L55A 1PTOD 2O2LD 4CJ1B 3HOUB 4FP5D 4BS9A 3GTGB 4QMGA 4ABNA 4Z9CB 2XN9C 1G2TA 5EE1A 1MSGA 2PTLA 3VR8B 1XEEA 4NAWB 4RKLA 2YU9B 1STEA 1L6VA 2K5DA 2ZW1A 3H3VC 1JC7A 3A8KE 2EYOA 3OSOA 2J52A 1F2RC 3J81E 1K8OA 2EXZA 1PZID 5EPJA 2QKIC 4MHEA 4RWSC 1TS4A 4IFDG 2F3VA 4OZCA 1EY8A 2A6ED 4BA1I 4ZKBB 3KLRA 3H8HA 2LY7A 4M1UB 1J8IA 1MI2A 1I4XA 1I6VC 5CC4A 1BQQT 3I73A 4RF0A 3HVZA 2ACZB 3NPPA 4C2MB 1SNMA 4ZUIA 3U4EG 3RD4A 3VA5A 5M9OA 4J1MA 4RKBA 3WDNA 1X3PA 1LO5D 1QB5D 5DEHA 3GTOB 2F03A 2F0UA 3L4PA 4PQXA 3SFEB 1TS5A 3K5MA 2A68D 4A9AA 3A55A 1HHVA 4HSPA 3L7ZC 4EQOA 3JAME 1ICWA 3I72A 1IW7D 4I65A 1V1PA 5DAUA 1SJED 3GTLB 1LTRD 1QWYA 2FJ2A 1TVXA 1JROA 4PV1C 2Z4IA 1V43A 4EVOA 4EE2A 3AE7B 1N63A 4BBRB 3HUIA 2F0EA 3O13A 2BA0A 1ACCA 4P6VF 5HI1A 1STBA 2DNEA 1WRIA 1R7SA 1SSNA 4FXDA 2DNCA 1GHKA 1D1IA 1KLGD 3D4DA 2IL8A 3J80E 1UEAB 2K03A 3ONAB 1EY4A 2CVRA 1SIJA 1EYAA 1HTPA 2YEPF 3ND8A 1GUOA 2J7ZA 1TQOA 2EY6A 1ZPSA 3URYA 1JWUD 4GDLB 3TUOA 2PZWA 4Y7NB 1EYCA 3BDLA 1TWGB 2Z1CA 1SYFA 2KEDA 1KABA 4WRDA 3T51B 1BMLC 2D5DA 3WOEA 5EPKA 2GRIA 4BY7B 2BS4B 1B50A 3OIPA 2SAKA 3Q8EA 3HOVB 2BDOA 1QOGA 1XXGA 2IW3A 5KNDA 2E74C 1ET6A 1F2ZA 2XIWA 4PMCA 1JQYD 2DY7A 3I70A 2MUYA 3RZOB 1E0BA 1PFNA 3PZ8A 2J0TD 1GAQB 3T53B 2WINB 3DMUA 3AECB 3I91A 1I3QB 3I3CA 4PNYA 1ZUD2 2EDGA 2I38A 4AYBB 1S5DD 3KF8A 3Q0AA 1Z7TA 1HUMA 4CKEA 3B9JA 2E75C 2EE1A 1KTKA 2NMQA 3S17B 1F0ZA 1WTPA 1I50B 3VR6A 3QWNA 4USAA 4CKBA 2JA5B 3MXUA 4IUQA 3SE0A 3DEOA 2LFNA 5IGDA 3IT4B 4ODGA 3AB5A 2KAJA 3BS1A 3OWFA 2WAQB 2CJNA 1AZPA 1IGDA 3EGRA 1WXQA 2Q8RE 1EWHA 2X6GA 1DZ1A 2PW7A 4NAMA 4OZAA 1QQRA 3GS2A 2R93B 3MJ5A 3A8IE 4OW0A 4TQUS 4HR7B 5C2TB 4U673 5T1GA 3AEBB 2EY5A 2KQ3A 3G7LA 3P1MA 1A2TA 3VR5A 3W5VB 1CZGA 1KFYB 4DNRB 1QOHA 1QOFA 2L52A 1QT9A 3MZ5A 4US8A 2K05A 3TEYA 5DNFA 4HKQA 1B2TA 1IBXB 4H13C 1FM0D 5BYQA 1EZ6A 3LX0A 1KDCA 1G8ZD 3J80L 4XWWA 1BCPF 1ENCA 3BYTB 1Y1VB 3S1RB 2VNUD 1CHPD 4OZBA 3QO2A 4RNAA 3I4MB 3LWEA 2F0SA 2L1AA 5KYIA 1V8CA 3R8BA 2K01A 4G57A 4RHRA 3AV8A 2E3TA 5CORA 3NVZA 5A35A 3LB8C 4XIGS 1II3A 5M3MB 4FXGC 4U68A 3NWSA 3VRBB 3SDZA 5I2XA 3SK5A 2PKOA 1SYDA 5K36H 4YTPB 4IALA 5LL6X 3R3OA 4RA8A 4L6TB 2CHBD 3SK4A 1EYDA 4DQOC 2L12A 1LTBD 3R2TA 1HQRD 2RDHA 1LTID 2FINB 3OIQA 1EY7A 1STAA 3GTQB 1DJRD 2AQ3B 1DCZA 1FO4A 2RSOA 1ILQA 2BE5D 2KN4A 4O42A 4KY6A 4A3KB 2B2VA 2NN6G 4C1NK 1SNQA 4KK7A 4JWUC 2K0PA 1GUSA 3VRAB 2KACA 2D5GA 3V3XA 4K2KA 2WP8J 3SK6A 2VXWA 4AQ7A 1EU3A 3VA7A 2EZVA 3AE4B 1ZP0B 3W5UB 3KQ4A 1AP0A 1OXVA 1KF6B 5ELDA 1Q1EA 4KI0A 2B2VC 2MJEA 2JX5A 3IFDA 3P4QB 3DEPA 3CRLC 3PO3B 1N5XA 4IDIA 5D3IB 1JQ4A 4DNTB 3OMGA 1PTOC 2FUG1 1O7LA 2GB1A 5JAVA 1G291 3TBIB 2G1EA 2K22A 1NR4A 1S5BD 4HEA1 4KJNA 2WXLA 2X69A 4KGSA 2NBFA 5E4WC 5C0XI 1SB3C 3TEXA 2JEBI 3GP7A 2O5IC 3HVDA 2PIAA 3NRZA 1EZ8A 3H09A 2RDGA 4IKGA 1G2SA 4EQNA 2K5QA 3TEZA 2A6EC 2NWGA 3AMUA 3DWMA 1TZOA 1OFFA 4FF2A 1IUEA 1ZYRC 3C1EA 4C1NI 1TR5A 3ZYYX 1E2VA 4XT1B 3S2HB 1QNKA 4IURA 3NS1A 2SOBA 4LAAA 3PMFA 2R3ZA 1T5XD 2BYTA 2B76B 1VDZA 1L6UA 4A3EB 2LMCB 1RFKA 2QMTA 2WP9B 4RF1A 1EY9A 2IJ0A 1YNJD 2K1BA 2LUMA 3Q69A 2JA7B 1HCZA 3M3YB 1GUGA 3SEBA 3KBXA 1DOMA 2NVTB 5IODA 4YTMB 4WURA 4IN3A 2GA4B 3QG1A 1CTMA 4DN4M 1EU4A 4A3JB 2EELA 1IW7C 3GD7A 1QE6A 4UAIA 2DYMA 4OHJA 5EE0A 5EQ0A 3PIP3 2OF1A 2EJGC 2KVMA 1PZJD 4WORA 3TP7A 3AB9A 4ZLTF 2NTSA 2OEOA 2MJ3A 3S16B 3C3LA 2VB3X 4ZAIA 2EOTA 4YXDB 1X3QA 5D14A 2H1EA 1EY6A 3E5SA 2KDMA 3LWUA 2DWQA 4FNFA 3Q8CA 2IGHA 5CMDA 1EY5A 2H89B 5C4XB 2BS3B 3J9CA 2IDYA 1M8AA 4F8MA 1VLBA 2RBMA 4TQ0A 2A5HA 3K5NA 2LFIA 4K14A 1JWAD 2A74C 2NZ1D 5J1ZA 3I9V1 2FFKB 1V1OA 3AE9B 1MVKA 3R93A 1VMCA 1K50A 1A2UA 2B2UA 2OXPA 1AYFA 3NUHB 5D7GA 5BN5A 3D4WA 2R6GA 2N88A 1PRTF 1Y8NB 3NXWA 3TP6A 4HMJA 3FPPA 4A93B 2V0GA 1I4HA 5FLXL 5EBCA 2LS01 2XNAC 1BR9A 1HFNA 1SYCA 4B9XA 3WOFA 4B0MA 2B2UC 1AW7A 2F0JA 1WGKA 2CW0D 1W6JA 1SNPA 2L0CA 5G5HA 3GTJB 5GXGB 2AQ2B 1VF7A 4DXGA 1K53A 2WXJA 1XLOA 3BK2A 2LGIA 1U4RA 4K8JA 1SSOA 2KCNA 3EUB2 1H9MA 3J7AF 3IFTA 5JJZA 2QSDA 4C3JG 2LHEA 1XF5L 4RGMA 5CV8A 5BYSA 1JOOA 1DXMA 3HOZB 2VZKB 3S14B 4FF4A 1B53A 1L4ZB 4H0LC 1FXAA 3WCQA 4N58A 3P42A 3K5OA 1QG7A 2IX0A 1SAPA 4Q2JA 2W3SA 4FVMA 3VQIA 4E6IA 1CA5A 3HZXA 1E10A 2HDMA 2X6LA 2PLPA 1Q3LA 3M4OB 2F0VA 5C44B 4FF1A 2VB2X 2PYKA 5I6WA 1UUPA 4K5VA 1ILPA 1DOIA 2KOLA 5FO7B 1WTVA 5KGUA 1F9QA 3AH7A 3H0GB 1NYRA 2BTEA 2K32A 1TKEA 5BMIA 1H9SB 1UWXA 2H88B 4A3MB 2W54A 1H9RA 3MTSA 1BXTA 3AEDB 3RLFA 3MFGA 4OO1I 2WIIB 1RTNA 3A56A 1SJHD 1XYIA 1RODA 5DM73 1VMPA 3W1SA 3M4YA 1G91A 3AE2B 2WKCA 5KRUA 4LMQD 1Z6HA 4XYQA 4DU9A 3DWPA 3VR2A 4J8QA 1ZE3D 2M00A 1K52A 1PZKD 4HAEA 1K51A 2OEDA 1MHXA 1CHQD 1C4PA 4L63B 5D3DA 1F2RI 3G6JB 3S1QB 1ZDXA 3VR3A 4RFBA 3ZJTA 1GPXA 1S5CD 5C4JB 1A3UA 1I4GA 2F0NA 5J22A 1TKWB 4TMAB 3PUVA 3ETRA 1HRJA 4XQQA 2MGSA 1EFID 2KA7A 5EE9A 2NN6H 1C4QA 4C3HG 2WDVB 2BE5C 4C3IG 1RF2D 5FR3A 1SMYD 2PNRC 1NVID 2TSSA 4J3OD 1FGBD 4NKLA 2RA4A 5FK9C 1EWYC 1FCCC 1KRHA 4LJZC 1XCQL 1C4AA 1Y1WB 1Q90A 1A6XA 1H9JA 2J42A 1LTAD 3A54A 5TSSA 1STNA 4QCLA 2TMPA 5G3LD 4DAPA 3DWQA 1TWHB 4HCEA 4N9PA 3VR4A 4XDXA 1DOKA 1FNVA 1KNEA 4RHSA 2Q5WD 1TY2A 4K6DA 5E1FA 3IL8A 4PMWA 5IT9L 4KMUC 3FILB 3RFZB 4BA2I 4TRDA 4KY5A 4MM3B 3BVZA 2A69D 2FBWB 1OXTA 4WWMA 5BYRA 1CFMA 3S15B 4K8IA 5ELFA 2A6HD 4P2CB 1WTQA 3D8GA 1E2WA 3VR9B 1PYWD 2DY8A 3DWGC 2J53A 5FKAC 1VZ8A 3U52E 1LT5D 1PRTB 3VYSA 1DGJA 2AWNA 2F0QA 3FRPB 2K9XA 1EY0A 3MFYA 2Y5PA 1KDAA 2MPMA 4Q5VA 2M19A 2IWHA 1T6BX 1SE4A 4KGTA 1SBBB 4HTHA 2B2WA 3J81L 1LACA 5JOBA 1KAAA 2LKVA 2SNMA 2VUMB 5C5MA 5BMGA 1YNJC 1VR9A 3I57A 3ND9A 3UI3A 4IFDI 2EYJA 3TSSA 3U9SA 1LABA 4XQNA 2PO4A 1STGA 2WACA 1VZ6A 4RGNA 3I4NB 3W3AA 3U7ZA 1NENB 4DXFA 1RKNA 4R8IA 3H94A 2PVGC 3PUZA 1DM0B 1YJIA 3BK1A 3CWIA 2WQYB 5CV6A 4ZYSA 2B2TA 3JAML 5I2YA 4DAYA 2JP1A 3VYUA 3C1FA 5KNCA 3BVMA 1L0YB 2E2JB 2BBCA 1IKLA 2WU5B 1CK1A 1TWCB 3U2SC 2RKSA 3E9SA 1NUCA 3FMCA 1CA6A 2ZXOA 1SYGA 2G9DA 3BZDB 5JPNC 2E6XA 2ENBA 3NVVA 2WXGA 4HEDA 2B2TC 4ARIA 4KV6A 1BBXC 1BO0A 2JE6I 1FD6A 5CR3A 1JALA 3HOYB 3D4RA 2F1MA 2K33A 3H6MA 4TSSA 1FCLA 2LEKA 2ZT9C 1MGSA 3KWLA 5CV9A 2EY2A 2I07B 5I6YA 2F0OA 5D65A 1U9RA 4CHTB 1R9TB 4RCNA 1B9NA 3Q8BA 2FMMA 4XTCS 1KNAA 2DN8A 2WXFA 1EEFD 2XWBB 1TJEA 4J6HA 1RYJA 5C0XG 5DM63 4FXKC 2EKIA 1HA6A 3NTKA 3PUXA 1JOKA 3P1HA 1NAPA 3D31A 4WAFA 3Q8AA 1LTSD 2CW0C 2V4DA 4Q0FA 1D5XC 1VJKA 3N6RA 1PUTA 1V1PB 3TP5A 3M85A 3Q6SA 5JEAH 3K6OA 2QIEB 1JOQA 1PLFA 4CGYB 4YTNB 3NQIA 4JPSA 1PTOF 3CRKC 3DXJC 4DAVA 3MWYW 5LL6S 4A3BB 4X3SA 3W9CB 1FNWA 2HDLA 4DGZA 4KKSA 1L0VB 1WD1A 3P4SB 4R8NA 4F7XA 3T3OA 2M9VA 3QB3A 3A8JE 2L4NA 3ZJUA 1R4PB 1XTCD 2WS3B 3FEWX 3S1MB 4B08A 1F77A 3UI2A 3N52A 5ELEA 3R2IA 1EL0A 1TS3A 4QIWB 1OXSC 2X38A 1ENFA 5EKIA 4H7BA 3A7LA 2BB5A 4YSXB 2W3RA 4XT3B 2RSNA 1HZ5A 3T3NA 3QIAA 4OVZA 2Y0SB 4F87A 4IUVA 3N9YC 1NYQA 2WDQB 4KKTA 3NQTA 4IOIE 1I4PA 5ELBA 4NJCA 3TN2A 2V3NA 2B2YA 1U4MA 2B39A 2JEAI 4EGVA 1B9MA 2F0PA 1ZEQX 2WXKA 2F0TA 3EA6A 2J4XA 4R3DA 2M0AA 1C4CA 4ZHPA 1PFDA 2F4IA 5KYLA 2F0FA 3PIO3