1SBBB

T-cell receptor beta chain complexed with superantigen seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords PROTEIN (14.3.D T CELL ANTIGEN RECEPTOR)
total genus 66
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sbbB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sbbB02
1LT6D 1UNSA 1I4PA 1STEA 4NZLB 2SEBD 1PRTD 3EA6A 4RH6A 5I4DA 1UUPA 1SBBB 5ELCA 4L6TB 1EWCA 1KTKA 1M4VA 4UDUC 2TSSA 4L63B 2QILA 3BYTB 3MFGA 3GP7A 2XRQD 1TS2A 1JQYD 4O1NA 4Z9CB 1KLUD 1EU4A 3BYYB 4BWGB 1JCKB 1CHPD 3O13A 1PRTC 1RF2D 3DWQA 1EU3A 5D3IB 1L0XB 2Z8LA 1XTCD 4RGNA 1PRTF 2O2LD 1D5ZC 1S5DD 1FNVA 5ELDA 5ELFA 1FD7D 4RHSA 1CHQD 1LLRD 1RD9D 5FKAC 1LTAD 1V1PA 1TS3A 1B44D 1HQRD 2G9HD 1ET6A 4RCOA 1S5ED 1HXYD 1LTGD 1SE4A 1I4QA 1ENFA 1BCPC 1TY2A 2RDGA 3BVZA 2NTSA 2AQ1B 1PYWD 1FNWA 1EEID 1LTBD 1LTRD 2ICIA 1S5CD 2J4XA 3CHBD 3MC0B 5D3DA 1LO5D 1CQVA 1SE3A 1TS5A 2AQ3B 1JR0D 1XXGA 2WV6D 4ZYSA 1I4XA 1RDPD 1I4HA 1T5XD 1I4RA 1FNUA 1SE2A 2NTTA 2XN9C 3DWPA 1G8ZD 3R2TA 1AW7A 4RGMA 2AQ2B 3BVMA 1S5BD 4OHJA 1KLGD 1QILA 1PRTB 3SEBA 1BXTA 1S5FD 1V1PB 1BCPF 5FK9C 2QEJC 1B1ZA 2CHBD 4K6LA 2RDHA 2IJ0A 5ELEA 1L0YB 1ESFA 1YN5A 1JWMD 1TS4A 1F77A 4C56C 1DYQA 1V1OA 1YN4A 3BVGA 4DXGA 1D6EC 3URYA 4TSSA 3OWEB 1TY0A 1I4GA 1FGBD 1PTOD 1LTID 1RCVD 1HA5A 1LT3D 1LTSD 1BCPD 1PTOC 1PTOH 1JWUD 1AN8A 4RGTA 1PTOB 1ET9A 5ELBA 1CK1A 1D5XC 1CT1D 1HTLD 1PTOF 1SEBD 3V05A 2R61A 1DJRD 1EEFD 1YN3A 1SXTA 2IPKD 2XRSD 1LT5D 1MD2D 3EFXD 3W2DA 2XNAC 1LT4D 3BZDB 4RHRA 4DXFA 1LTTD 5TSSA 1SJHD 4RGOS 1JWSD 3R2IA 1PZJD 3KLSX 1PZKD 1D5MC 1SJED 1GOZA 3DWAA 4RFBA 1BCPB 3TSSA 3R8BA 1PZID 1EFID
chains in the Genus database with same CATH superfamily
1P16A 4ZUJA 2GRIA 4W9KA 4NMZA 1SIJA 4LK0M 1DOIA 3KYCD 2D5DA 2WX1A 2A6EC 2BE5D 5I6YA 4WJ3M 3QIAA 4BBRH 1EUVB 2NCNA 3Q2AC 3EA6A 4GMVA 1GUTA 3JSVB 5CR3A 2ZNVB 2DX5B 3VDZA 4OVVA 1EWCA 2C9OA 1BBUA 3IKJA 2KX3A 1R4NB 3O65B 3GP7A 1F9JA 3ZNGC 2K9XA 3CCJA 4UY8C 4BWGB 3U4VA 4A3MB 2KMAA 1VS0A 3W5UB 2VB2X 1CUKA 2NB0A 3OTOQ 2INCC 3CIRB 1PRTC 3OMGA 3SVMA 3PUYA 3PRPB 3ZUNA 1DCZA 3RLOA 3SK6A 4BA2I 4A93G 2WP8J 4HPLB 1PH9A 1PRTF 2N1VA 4XGAB 1FNVA 1GC7A 2E2JH 2K7VA 3MWYW 3HKZB 4NNJB 1SN8A 2VQFQ 4DNRB 3PO2B 1PH8A 3VUWA 3H94A 4J8QA 5FOBB 1LTAD 3OHXC 1SE8A 4FXDA 1TS3A 3HRDD 1ET6A 1X3EA 2EDGA 2RDFA 3EBEA 4HEA1 3E0EA 1HXYD 2PJHA 4KN4C 4K3BA 3MEHA 4IUPA 1TY2A 3GTGH 4MTKA 3J7AV 1EIGA 3TZUA 3U2SC 5D2MB 4KKIA 2VUMG 5DNFA 2OT2A 1E0BA 1T6BX 2K1FA 1ZOYB 1LACA 1Y8OB 1FJGQ 4I6PA 5AZGA 2R3ZA 3U58A 2VQEL 4DR1L 2DAFA 3OSOA 2WAQB 1VQOA 3I4MH 3ENEA 1SRUA 1U4RA 2V4DA 2KQSA 5FLMG 4JI5L 3U4ZA 4P74A 4DV2Q 4OW0A 1FNUA 3PSEB 4IC7B 4KI0A 3B2FA 4M00A 4NPNA 1PH5A 5LHY1 2I5MX 4MM3B 4HDQA 2EOTA 4IWQA 2Z6BA 1C4CA 3OJ3A 4A3GB 2NN6I 4PK1A 3I3CA 3DM3A 3J7A5 1YN5A 4AJWA 1DYQA 2KEDA 4UP9A 1QUQB 3J80E 5JOBA 3ZVVA 1TY0A 5BN4A 3I4MB 1LM8B 2IY0B 2K0PA 3I4OA 4GLSC 4TMAB 5D94A 4GN3B 2K39A 3SFEB 3NUCA 2KHSA 3I4NG 2GB1A 2BTEA 1TU2B 3HOVG 2IGHA 2BA0A 2D62A 4FNFA 4YTNB 3J7ZC 3ZRFA 4KD4A 2K5NA 4HMIA 1VDZA 5KYIA 2IX0A 3ZGZA 1ENAA 1TZOA 4A3FH 2YV5A 4UHVA 3H3VI 2KQ4X 1C79A 3TZDA 2R93H 4AP4C 2IY1B 1SDFA 3LJ3A 4YY3Q 4ZKCB 2CQAA 3MHBA 3K81C 4DR2L 3DQVA 2F3WA 2UYZB 4II3B 2Y5CA 1CSPA 4JVZA 4YCUA 4C2MH 1STBA 2OTJA 1SJED 1B53A 3J81E 4NDXA 5LXIB 5A35A 3E9SA 5FJ8G 3ZDTA 3RN2A 4GGQA 3UIOB 4OWTB 4L5SA 1J8CA 2PI2A 2NVYB 1Q3LA 4L1BA 3TIXA 2K5DA 3LNNA 2WKDA 1II3A 1STEA 2B2WC 2KCCA 1SFOB 3ZDMC 2L9HA 2ZM6Q 2UUBQ 1JOKA 1E24A 4K7SA 4HAEA 2V4IB 1SBBB 2RHSB 5IWAQ 3V3XA 3K57A 1Y14B 1SSOA 2UU9L 2Q8TA 1WTHA 4JBWA 2HIXA 1VR9A 4A3DG 4FXGC 4A3BG 1Y1WH 3Q8AA 4A3MH 3MTNB 4FA6A 5M3FB 1IP9A 1IBMQ 5L83A 4UP7A 1F0ZA 2PO4A 4OZCA 3K5OA 1IBKL 2Q8RE 3TEZA 5M9OA 2PZTA 2EYHA 2L00B 3KWVA 3FKIG 1AH9A 1RD9D 2B8GA 3M63B 1KD1C 1VQ8A 4JV5L 2JWZA 2L83A 3PVLA 1B44D 1HQRD 4HN7A 4RCOA 3HG9A 4C3HG 1FCLA 3TBIB 3S2HB 2YYZA 4L23A 5MPOA 1E2VA 3L7ZC 1KDAA 2V1YA 1WJJA 2JN4A 3MTSA 4FF1A 4GB9A 1SNCA 4J1MA 4DV1L 5LMUQ 2KX0A 1MHHE 1LXDA 4CDEC 1IZ6A 5C23A 4L5TA 4IUUA 4DV6L 2JK8A 1Z5SB 1A3TA 1E7PB 1RLFA 4QQBX 2BDNA 4HSPA 3K5MA 3AM9A 4JOIC 2QMTA 3NENA 1XPUA 2YTVA 2EMSA 4BY7H 2LMCA 4U673 5CBEE 1LV9A 3HS0C 3DHGC 4DAYA 2L7RA 4E71A 2JUOA 3KQ4A 3EJIA 3AEGB 1EYDA 2WXIA 2CWAA 2IO0B 2B8FA 3J81c 4W9FA 3TCAA 4A3EH 4EE2A 2DZIA 1J9OA 4MNOA 4LDTD 3NQIA 4BY1H 4GDKB 5JVG3 1VQKA 2ONQA 2EE1A 3Q8BA 4IFDG 2KN4A 4JCVE 2BPSA 3T1HL 2M0AA 2FHTA 2B76B 1FO4A 3MP9A 2EVBA 3Q3FA 3F2CA 4BKTA 4LF6Q 1LTID 1GB4A 3KDFA 1WRIA 2PI2E 4OO1H 3A1QB 1AARA 3D0FA 1HZBA 5IAAC 4JGHB 1XEEA 1X3PA 5G2NA 1Q5WB 1SNPA 2Y3AA 1PFSA 2W54A 4KHPQ 1RM6C 4GOPA 2VXWA 2HQEA 4I7ZC 1T9HA 2BCOA 2DGYA 4QIWB 4LFAL 4C3JH 1MIUA 1LUZA 3IT4B 2K14A 3M4QA 4JBJA 1FJGL 3CF5A 2D2QA 3QWNA 3HKZG 3CMAA 2N4FA 1S3OA 4CGYB 3BS1A 2L32A 4CJ2C 3C19A 3V60A 4ZKBB 4A90A 2N0SB 4JE3B 5D14A 1JJ2A 1FVIA 1Q86C 4JC0A 5HGQA 5C3JB 3OYYA 4DK6C 3NZSA 2LUMA 4NW2A 3E9IA 3PUZA 4JK1C 3RULA 1NTGA 1KIXA 2IO3B 1EL0A 2BWFA 3KF6B 3ZJYC 2R7ZH 1OEYJ 2ATWA 2LJ5A 3ONSA 3CCRA 3PRZA 4K0KQ 3I9V1 1B3QA 4LMQD 2O4XA 1SNDA 3R3OA 5C3EH 1EFWA 1IUEA 2KWDA 2KC2A 3DCGA 4IWOA 3TEYA 1M4VA 1E7UA 2V9HA 1B8AA 2TSSA 4L63B 3MFGA 2VZAA 3HOYB 4OELB 3Q3JA 1EYAA 1F1HA 1WFQA 1A6XA 3MC8A 2BF8B 4FJYA 1RF2D 2ALYB 1FCCC 1FYCA 1HFGA 3DHQA 5M5YB 1QT9A 1VJKA 1RJTA 2X38A 1ZEQX 3MXNA 4KKUA 3DPDA 4R4QA 3GB1A 1LYLA 1PQSA 3NJTA 3Q8EA 4XWTA 2RSNA 2JA6G 4A3GH 3H8HA 2WDRB 4KY7A 2INDC 5E6NA 4P75A 3DXJC 1OXVA 5JJIA 1YX6B 2D3CA 1YIWA 2GBRA 1X55A 1N8RC 2DYBA 4WRDA 3I3TB 3EC8A 1O7YA 1B9RA 4MIUA 4A3IB 1IXRA 2LEKA 1SROA 4N58A 1SE2A 1XJVA 1XPOA 2NVTB 2AQ2B 4LCDE 4KZCA 1Z9FA 3BVMA 2AWNA 1CJEA 1WGRA 3IAYA 1STGA 5CHWA 2WIIB 4M01A 1QCBD 2WACA 4XIGS 1R7SA 2KT7A 3M4PA 1E90A 4EOYA 1K8MA 2L0CA 4A3EB 2R2OA 1DOLA 5IYBH 2RD0A 2ZXRA 1J7BA 4JQWC 2UUAQ 1S3SG 1F77A 1V1OA 3BVGA 2I5HA 1UH6A 4KVGB 2GVBA 3A74A 4HPPA 5E6OA 2A19A 3HOWH 1RCVD 1HA5A 1Y8NB 2A68C 3F1ZA 1CKNB 2AL6A 1YX5B 3G4SA 2M0XA 3GOEA 3NY5A 3RUIB 3BDOA 4XDCA 3C8YA 5DAUA 3AFQA 3PIP3 3CCVA 4B3MQ 1IGDA 1WXSA 4IPDA 4K8IA 3L0WB 3RPFC 1OO9B 5FLXL 3PO0A 1SXTA 4EUTA 2INNE 3PLVA 2K5WA 1N36Q 4JI0Q 1IYJB 2F3IA 2JY6A 2K8HA 3AEEB 3IAS1 2A5UA 2NBFA 1V86A 2K50A 3VR4A 5C6AA 3LDZE 4A76A 5GMVA 4MELA 2LASA 4F7XA 2F0NA 5IGGA 1KH0A 3M4OB 3HOUG 2ZJDA 4M8NA 3S16H 4YL8A 4NP5A 5K36G 2CKZB 1I3QB 2WXFA 2AWTA 2ZCCA 3K80C 1FXIA 2EYPA 3TS2A 1TKGA 4QCLA 2M56B 4OVUA 4MHEA 2CH4W 3BY4B 1LT6D 2JP1A 4XDXA 4IJLA 2PNRC 3OPOA 3CXCA 2FUG1 4FN2A 4NZLB 2PPBC 2VY3A 3KLWA 2K8BA 4MSMB 4I7AA 5CV7A 2F0EA 4LF5L 1TKWB 4UDUC 1BT0A 2RSUA 3OW7A 2UU7A 2WXKA 3IG3A 3VYRA 4CKEA 2OEOA 2FNJB 4BVUC 3JAMi 1D8LA 4GXBA 1QVGA 4TUUA 5C4JH 1J7CA 5IKCM 4HJ8A 1HUNA 3NZUA 1I42A 4NKLA 4WJPA 4NPSA 2N55A 1MJEA 4QB4A 4YSYB 4AYBG 4M0WB 3AB5A 1D5ZC 2KWCA 4ANWA 4C00A 1PFBA 5ELFA 2BQQA 1HNXQ 2L0FA 4RHSA 4BZAA 2Q2IA 4DDGD 5E7NA 5FKAC 3A8IE 4US8A 3T8MA 3NK9A 4DV7Q 3CW2C 4CJ1B 3D6WA 2LGXA 3AE4B 4BBNF 4YCWA 1LTGD 4R8NA 1D1IA 2MQJA 3I90A 1A62A 3T1YQ 3CAMA 2R93B 2UUCQ 4LFAQ 1BMLC 1EY4A 4HMJA 5IP9H 1PGBA 2Y5PA 4R1JA 4L2YA 1FNWA 1LTRD 3C0RB 2Z0DB 3CHBD 2J4XA 4UP8A 3TEHB 2FAZA 4A3CH 1B3AA 1DGSA 1HZCA 3VYTA 1YJJA 2NN6G 1PZID 4NXNQ 2F0MA 3HKSA 3HOZG 2PE6B 4LF8L 3D4WA 3PO3H 4JI6Q 1JWAD 3PPAA 1Z6HA 4N59A 5EE3A 5I9PA 2B63H 4JI6L 2RR9A 5IN7A 1KDBA 4YSZB 3QCAA 1VDVA 1GVPA 4DNIA 4HTHA 3RNCC 4TKOB 1WX8A 2KLGA 3VH3B 4HJ9A 2N7EA 2AMCB 3CCEA 4ZLTF 4W9IA 1PRTB 1EQTA 2NVQB 2GI9A 2QDFA 1VQ5A 3UGBB 2V0GA 4XT1B 2QEJC 3A1QA 3ER0A 2CHBD 4BBSB 3B08A 3MFYA 1WTWA 3P75A 3Q14C 3GTQB 4NJCA 4BKSD 1NSNS 4GZYC 1I50B 2QA4A 3AE9B 4WJNA 1WJNA 3D31A 3VYUA 1TWCH 4A3LH 4ZRIA 2KUMA 1G291 4QGUA 1GUNA 1NI2A 3VUXA 2KJRA 2DBYA 5AUKA 3QAQA 4FHKA 2ZZPB 4PV1C 4B3RL 3TREA 1I4GA 3K5NA 2KOLA 1PH3A 1K53A 3HK0A 1LT3D 2QF7A 2F0GA 1ZDXA 1EY9A 4EQPA 3GE8C 4KK7A 1CKMA 3UDGA 2D2CC 4MTNA 1BBXC 4MH0E 4FJZA 1D5XC 4APVA 1HNZL 1ILPA 4HCNB 2X6LA 2JA5G 1NR4A 3Q6BA 4KSKC 5KHQA 1HRJA 5KHOA 1LT5D 1V9JA 5AZFA 2WU2B 2QDBA 4XQQA 3RN9C 3QJYA 3PHWB 2MP1A 4DXFA 2V4LA 3CSTA 4JPSA 4JI2Q 1I50H 2FMCA 4V190 2PQAB 2KBNA 4KD3A 3N30A 3ZJTA 5EKKA 4US9A 2Z6KA 3NHHA 3RLFA 3TQYA 4E74A 4ODGA 1AWDA 5DPSA 2ZTCA 4ZRPA 4A3CG 2L5TA 2W3SA 2KENA 2E5LL 2ZPYA 4ZYNA 3IFDA 4LJZC 2E5LQ 4NY0A 1WR1A 1UNSA 2C7HA 4K5WA 2V1CC 5DPWA 2N9KA 3A55A 1DD2A 1ZW7A 3P7JA 4V0BA 1J8IA 1A3VA 3OLMD 5CGKA 4G7HC 1GJZA 1EWIA 4YHHL 2R2QA 1WMHA 1SR3A 1EY8A 1DONA 1V81A 3S2AA 1HPCA 1PYBA 4FDBA 5NUCA 4DV4Q 4A3JB 2UXDQ 1YITA 1WSPA 2XTIA 3A9JA 4WJWA 5C4JB 3NTKA 1EYGA 3AH7A 2L11A 3BK2A 1E8WA 1TWCB 4P72A 2K1BA 1QOAA 3QOJA 1E3PA 3CPWA 1D3ZA 2YVCA 4KGRA 1C78A 3H0GH 1PXUA 2LRUA 1IL8A 1PH6A 3UIPB 2RMMA 1SMYC 4ACFA 3N1YC 1F2ZA 4ICVA 5EE9A 1SSNA 4DKAC 2I5LX 2IWHA 5BN3A 1S5ED 3AMUA 5C1ZA 1I4QA 2C35B 1XO3A 2KO3A 2K03A 3JSVA 3NELA 4IG7B 1DOXA 3CC7A 2ZW0A 1XLNA 3V61A 2BVCA 2MBEA 3K7AH 4DV5Q 1LO5D 3MEFA 3L13A 1O7IA 3VTVA 4HK2A 5K36H 2R92B 1JE5A 3AULA 1BF4A 4CDFC 2E2IH 4DDID 1K50A 3GQBA 3PV0A 4KY6A 2B39A 2JA8H 5C3XA 1HEZE 4II2B 1C3TA 2CW0D 1KRSA 1YHAA 1R9TB 1YNJD 1HNWQ 3TP8A 1UWMA 4CHKA 5E1FA 3DBRI 4JWSC 4K6DA 2KN5A 4XXEA 2K5HA 4G0NB 1EUJA 3CCQA 2DUDA 5C44H 2D10A 2DZJA 2KXJA 2KK8A 1L0YB 2G4DB 2F0UA 1HH2P 2EYFA 1WJ4A 2PPHA 4LDTB 2FCNA 3VRAB 2EXZA 2Y0SE 3ND9A 2PW5A 1NAPA 2EXDA 1WGGA 2R92H 2LS01 4B3SL 2E76C 2E2HB 4K7UA 4XX5A 5J18A 4PYZA 4IQZA 2WINB 5D6JB 4EKUA 2NBWB 1XLOA 1QZHA 2VS1A 3TS0A 4A3MG 3RZWC 2GBMA 4IUQA 1UGMA 4IFDJ 3BZKA 4HJKA 4KKJA 5GXGB 1EOTA 4XYOA 3HFZB 1UE1A 4RKLA 1L0WA 2HHHL 2REXA 2OHFA 4BXXH 3N9YC 1YN3A 1HHVA 4BOSC 5AUIA 1CKOA 3M4YA 4DFAA 1S1QB 2KANA 2XVSA 1FRRA 3JAML 3S9WA 2LGYA 4MGYE 1QNUA 3UDIA 1OTCA 3I55A 3MHZA 1OGWA 2MH7A 1WTXA 1Z7TA 3H3VC 3AMZA 1NR2A 2KDMA 3GO5A 2O6VA 1HJPA 3S17B 1E1OA 3T16A 1CKNA 3AV8A 1M90C 2L05A 3A9KA 4KKTA 4ZRJA 2QGQA 4IM0A 1HZ5A 2JYEA 1S4ZA 2CVRA 1WXAA 3HOZB 1WZ3A 1I4PA 2BYTA 2WWZA 1TIID 2J0KA 2TMPA 1WM3A 2RPVA 1C77A 2JA6H 4A3GG 4DAPA 5DCNA 4XC2A 5IGCA 4TQ1A 5CV4A 3M7GA 2D0OA 1KHIA 1FL0A 1JRUA 4KGTA 2ZJPA 4A3KG 2X69A 2XBBC 3Q69A 1H9KA 1EY6A 3RZDH 2WDQB 2D9UA 3BYYB 3KDFB 4ASWC 1WYWB 3MXPA 2AL3A 2BWES 4P6VF 3T13A 2L3ZA 3Q8DA 2M4NA 4OL7A 4LFCQ 1JJGA 2K3UA 4A3IH 3DEPA 3EHVA 4JPBW 1E7VA 5L95C 1OQRA 1XTCD 2WB1E 4MN3A 1JMLA 1UBIA 4A55A 5EBCA 3GTOH 2B2VA 4HDOA 3T9LA 5M5YH 1CHQD 3K58A 4DHJD 2RHQB 3PUVA 3TN2A 4PMWA 4DAMA 3PV1A 3RCZA 3TBLD 2WXRA 1HTQA 4QUCA 4K2KA 2NVUI 2EY2A 2B3AA 1SYBA 5C3EG 2WDVB 2QCZA 2QHOA 5HI1A 2LHDA 2RDGA 5EBDA 1OXTA 4WWPA 4JI5Q 5EE0A 2Q2HA 3S1QB 3GTLH 1M94A 4B3TQ 4YTPB 4G11A 4A4IA 3QX1A 1SE3A 3L3OC 1GNUA 5JPMC 2KZRA 4HRSA 3HZXA 4OX9L 3L10B 3PUXA 4AWJA 1I4XA 1MPEA 5I6WA 1WGYA 2WX0A 1AW7A 5AJ3Q 3M3YH 2OQ0A 4H44C 2CHWA 2F0IA 1U4LA 1D1KA 1TWFH 1QG7A 2GBNA 2JEAI 2KQ3A 2M00A 1FXAA 2VH1A 1WX7A 3DDCB 4IN3A 2F0TA 1NEKB 4EZJA 1A0IA 1T0SC 3PO3G 2QSDA 4DHJB 3ERSX 2X6GA 2ID0A 3SK4A 5C44B 2ZNVC 2ZVNA 4A3IG 4GKKQ 3VTWA 4XWWA 2MBOA 5FO9B 3VQIA 2ZJRA 1F2YA 3M9BA 1MKHA 4DV4L 3URYA 4UAIA 2A69C 4HCSA 1BQQT 5C0XI 1MJDA 5HURA 4O42A 2XSCA 2ACZB 2WQYB 3EN2A 1E1TA 2BS4B 3EVQA 5AFWA 4G3XB 5CC4A 3IVFA 1TKYA 4BY1G 4WFN3 4JL9A 1WOCA 5BYSA 3CMMB 2GVAA 2PCFB 5CV9A 3UI2A 1IGCA 4EQNA 5BO4B 4N8FA 2EPBA 4KHZA 1V49A 2BS3B 1VQBA 2DAJA 1B4OA 3UQAA 3P1MA 2NZHA 1K51A 1XMOL 1LTTD 5E4WC 3TMEA 3UINB 4R4CA 5KRUA 1E2ZA 1LM0A 1O7LA 3ERQA 2B2TA 3C1EA 2IX1A 5EAYA 4AYBE 4AJYB 1VF5C 2HQLA 1D5MC 1W3SA 5BR8L 5JVH3 1HE8A 3IAM1 2B29A 1Q81C 2K6DB 2YTXA 2K8CA 5M3MH 5C4XG 3RD2A 4HKQA 3SFDB 4EZKA 4DR2Q 1Y1WG 1XTDA 1QOGA 2JRIB 2Z1CA 2KYWA 3OIQA 3WANA 1TBEA 1EIYB 2JZPA 3C46A 1QLBB 3ZNZB 5LL6X 2CU3A 4L6TB 5DM63 1YNNC 1N32Q 1N33L 3F8TA 1T5EA 1VRAB 3APFA 2N78A 3QWZB 1JQYD 2MWSB 3AEBB 4M8MA 1H9RA 1GG3A 1JCKB 1EOVA 2ENBA 5G3LD 5J1ZA 4Q0FA 3J7YW 2XK5A 1P8LA 3BWUD 2N8NA 2I38A 1VF7A 2XIWA 4FYDA 1NUCA 2JU6X 1SB3C 1D4BA 1GB1A 5DPRA 2ASBA 5EQ0A 4K1RB 2F03A 1WXVA 2FE8A 1EY7A 1K8AC 3CCLA 4GKJL 1YEZA 1EO6A 1YJ1A 5IP4D 1IW7C 3RMKC 3Q3OC 2Y0SB 3L4PA 2G9HD 1K0SA 4IALA 2PMZE 2N9XA 2JA7B 4RM9A 1ZYRD 3P2BA 2CH4A 3NOBA 2CS4A 3T1YL 4POGA 4WAAA 5C0XJ 2JPHA 3LYYA 2A4ZA 5JEAG 5AEKB 3S14H 4QF4A 4F87A 1PYWD 3PIPA 4A3JG 1ZUD2 3EFCA 3T3NA 2F0FA 1WGHA 1B70B 2DLBA 3KBGA 4IUNA 2Z0EB 2PVOD 5A2QE 3A56A 1HUMA 3OAWA 2ZCBA 1A70A 2UXBL 4DNTB 1YOVB 2WKCA 3H0GB 4LAAA 4E6IA 2HJ8A 3B9JA 1L6UA 2JF5A 4JW0A 1T5XD 2F4VQ 3H1UA 1JORA 1EIFA 1G8ZD 1Y1VB 4J6IA 1N34Q 2BBCA 2VUMB 3L54A 4GNXB 1E8ZA 2K22A 1AZPA 3NS1A 2NS5A 1VQDA 3SEBA 1K3BC 4QIWE 1BCPF 1AYFA 5E4XA 3PLUA 1RTOA 2RDHA 2WYQA 2IGGA 1WYDA 3SR1A 4CHTB 1TR5A 4HJAA 4BBSH 1ZDVA 3A8JE 1JWMD 1TS4A 1S72A 3L0OA 3JAME 2GN5A 2VQFL 1TWGH 3HKZE 2K6AA 3J81j 1MHXA 1HTOA 3A33B 3DWMA 2KHIA 1Q10A 4PZ6A 4Y52H 1HR0Q 1K0RA 2LKVA 3UDXA 2KMCA 3WCQA 1GPXA 4RKBA 1SYEA 1DOMA 4FXCA 1C1YB 2D3BA 3ICEA 1RRBA 1X32A 4ZDVA 2WNMA 1AN8A 2B2YC 1ET9A 4WORA 2JEBI 1B50A 4E3CA 3U4EG 3V05A 3T1HQ 1CT1D 1B7YB 1L6VA 3VR6A 4IOIE 2IHEA 2ZXOA 1G6PA 1EF1A 4DA2A 4NB3A 4DR1Q 2XRSD 4EQOA 3PHXB 1IYUA 3P4RB 4NQKE 3GTGB 3BZDB 1YJNA 4JI3L 4AS1A 2WHIA 4OONA 4WH4A 2H5XA 3FVQA 4PMCA 4RGOS 4OZBA 4LFBL 3RZFA 4LNFA 4KDLB 5CTRC 5EGTA 4J3OD 3K0YA 2C7NB 4A93B 5FLXE 1ZGUB 5CX3A 2X8XX 2Q2TA 4ZAIA 2PW7A 3I4NB 4H7BA 3S24A 1WM2A 3L9AX 3S1NB 4K14A 3KJPA 5BMHA 2RCFA 1EWHA 1IW7D 3PZDA 2IHFA 4DUYQ 4JYAL 3RNGC 1PLFA 5J39A 1YNTE 1UUPA 2OTLA 4G7ZC 1WJ6A 2Y5BB 4WJOA 5HG2A 1CZPA 3NS8A 1B9MA 5ELBA 4X3UA 2IT1A 2PTLA 3LX0A 2ZT9C 4LNQA 3Q6SA 4NXMQ 1UEBA 1CHPD 1VMCA 4JI8Q 1ASZA 4X3KA 4A93H 3DVNU 3F2DA 4DWFA 2NUCA 2LJIA 3WA0A 3H15A 3Q24A 2CQOA 2KFKB 4IDIA 1KXLA 3D6CA 1N5XA 1S5DD 2EMTA 2LUEA 4IPCA 1E22A 2IBIB 3DVNV 4DK5A 3QR8A 5HGTA 3J80L 5J22A 1FRDA 1N61A 1J6QA 1HR0W 3B1LX 3MHSD 3PQIA 1X3FA 1EY0A 1P0RA 4BBSG 3K8AA 2A1AA 2A5HA 1ENFA 3APCA 4BBRG 2MA9B 1XMOQ 3CMEA 1UE7A 3K7UC 3VVWB 2LGIA 3WAMA 5TR5A 4ZRKA 4WWNA 3FKIH 3I2ZA 2L8JA 4RF0A 3KW5B 3FMCA 2MLBA 5CV8A 3ONAB 5I9OA 1RFAA 1WH3A 2E2IB 3S1MB 1JR0D 3P20A 1H8CA 3D3RA 2MPMA 4DV2L 3HOUB 4C7ZA 2WLBA 3NRZA 1HCZA 1V8QA 4J6HA 1AE3A 1VQHA 1V5TA 4A3KH 1SFOH 1VD2A 5T8IA 3KFUA 3AE3B 2LWPA 4W9EA 4R3DA 1JJCB 2AYOB 1EQVA 2ES2A 1HZ6A 1UGJA 2MBHA 2F0PA 5C5LA 3HUIA 1KJTA 4C2MB 2EYJA 2A69D 1Q0WB 1ZP0B 2D11A 2W9NA 1PA6A 3U8ZA 3RNFC 5FJ8H 1NDDA 2KD0A 4DAYB 4RNAA 5M5XB 3S1RB 5EJWA 3IT6B 1PDQA 2BS2B 2B2WA 1ZE3D 1BCPD 1JWUD 4CDCC 2SNSA 4REZA 2OJWA 4MJSB 1V6EA 4JI7L 4LNIA 2RCNA 3JW0X 4GS3A 1W6KA 5FO7B 1TQOA 1RFKA 1WGKA 1WWTA 3GV3A 3H7PA 4KDIC 5FR3A 2LY7A 3HOWG 1VQAA 3E3XA 5LMNQ 1WD0A 4AQYQ 4BXXG 2HDMA 5M5WB 3ZNID 3TEWA 4W9JA 2PKOA 1JROA 4KV2A 5H8YE 2F0JA 1PZJD 3X3NA 2O6VB 1I94Q 2JQOA 2M9VA 3A8KE 1U4AA 4W9GA 4LF9L 2EJMA 2GOWA 2IZVB 1X56A 2PMVA 3TSSA 2JYTA 4W9DA 1YNXA 1TXYA 1EFID 2E3TA 1P1AA 4A8XC 2B2YA 3BZCA 2HJ1A 2CU1A 1GUSA 3FEWX 3CCMA 4XE0A 1GC6A 3E9HA 3GZNI 2IO2B 4K8JA 4MEMA 4WAFA 1RTNA 1C8CA 1O78A 5ELCA 3AEVA 1Y69U 3M62B 2PMZB 1FFVA 2GBKA 2QCPX 3KF6A 4Z9CB 1XMQL 1KLUD 1WFYA 2SNMA 2F1MA 5CMDA 5FO8B 3JAMc 4LF7Q 1NYRA 2MW5A 2B3GA 2OEDA 4ZRQA 3CC2A 1U4MA 3KLSA 3HOXG 2XEWA 3AXCA 4G50A 3PS6A 2NWGA 4IZ8A 5KNCA 2Z8LA 1I35A 3A4SC 3SHLA 3LWUA 5IGDA 1L5PA 2BKFA 4ICUA 4OO1I 2FCQA 2LVPA 1E2WA 3DVGX 4ARIA 4MSQB 1VCBA 1C76A 3PCOB 3OG5A 3P1HA 2L0TA 5D7GA 1C0AA 1ZKHA 4GN1A 2VQEQ 1KAAA 3J80c 2DENB 2YEPB 4C3IG 1QZGA 3LWEA 2Z59B 5G5HA 4YY3L 3ZLZA 2VH2A 5EDSA 3SE0A 1E10A 4DU9A 2FJ2A 1BNZA 4A3PA 2J0TD 1E5WA 2OF1A 2KOXA 2F0HA 4DV1Q 2MNAA 1GAQB 1UELA 2MO0A 2PVGC 1GUAB 4N8X1 3AEDB 1AE2A 3RT3B 3VR9B 2CJNA 2WU5B 2ZTEA 2Z6KC 3BIID 5J17A 4G57A 2VZKD 2J52A 5JH5C 3IL8A 1IHZA 2KLCA 1RDPD 2K25A 1E8YA 1VQ6A 5ELDA 3HRZC 2NTTA 3EROA 5HHDG 4IURA 4DBGA 1A2UA 1WD1A 1PH7A 1K83H 2Y0SG 2LXCA 1NBWA 4MACA 2KJ6A 5T1GA 2RF4A 3HGBA 3AB9A 3ND8A 3PMFA 4H13C 5EE1A 1BXTA 3G71A 4N6EB 1H9MA 4MM3A 4JYAQ 1B1ZA 1WTVA 1SE9A 1XCQL 2KWUB 1IYFA 3CCUA 1GUOA 2WS3B 4YHHQ 2KCNA 2VW9A 3GTQH 1PGAA 3PF4A 1ESFA 2EY6A 4C1NK 3GTJH 1KRTA 3HVDA 3M95A 5E6PA 2K05A 1XCTL 2GMIC 1QB5D 4GN5A 1HNZQ 1FGUA 4AIMA 4JG2A 4MGKE 2KHWB 4BFRA 2LHEA 4X65Q 4TVAB 2JA8B 1AFPA 1UZXB 1XF5L 3A4RA 3GTKB 4X64Q 3DWGC 4LF6L 4S17A 4C7YA 4GLAC 4LJOB 3AU7A 5DPTA 2ICEC 1MFWA 4POFA 3BJUA 2BA1A 5GAEC 3Q8FA 1QJOA 3AEFB 1D2BA 2CW0C 4JBMA 5M5WH 1XNRL 3RNAC 1MD2D 2Z4IA 1T0YA 4OX9Q 2LFNA 2XNAC 2WXJA 1I5FA 1LT4D 3FAHA 4FP5D 4FXKC 4N9F4 4FADA 4K5XA 1SNQA 1L1OA 4RM8A 4DQOC 4A20A 3A7AB 4DAVA 5IE8A 5KGUA 2HE7A 4NJ7A 1A15A 3AE8B 4PZ8A 4X57B 5BYRA 4Y7NH 4YT0B 2WGSA 2ZEQA 2JYOA 5JPNC 1G6ZA 3BG3A 3B0AA 3W1SA 2IDYA 1IL2A 3ZRCA 4I65A 3TP6A 2UUAL 4B9XA 3PUWA 3KH0A 1Q1EA 3UDFA 4MT5A 4BY7G 4P1CC 4OO1G 4ITKA 1GHKA 5IT9L 1WCMB 1DZ1A 1XX8A 2KCMA 3AU5A 1Q12A 1QE6A 4P2CB 2A6HD 4FO2A 1Q82C 4KTAA 1PH2A 1Q1OA 1TS2A 1ASYA 4WWMA 3QB3A 4HIMA 5LNK1 2F4IA 1A3UA 4B3SQ 1GUWA 2MX2A 3OTOL 1NJIC 3AEAB 4LJPB 3RI7C 4NJ6A 2DYMA 3I8ZA 1KQSA 4FVMA 2N9EB 1SYGA 3V2TA 3S1MH 1STAA 3KJOA 4CDDC 3ML8A 4GKJQ 2WXOA 2PZWA 4NQLB 5C0XG 4TV3A 1SAPA 1WF9A 1HZ9A 1FD7D 4XZ4A 1UE5A 1TJEA 5G55A 1V80A 3NBHB 4JI7Q 1QVFA 1NNXA 1U9RA 3GTMB 4DV0L 1I6HH 4IJHA 1TZ1A 2UWQA 2R7DA 1J7AA 1V97A 2V3PA 2J0JA 1G51A 2OXPA 1A2TA 4OIKA 3S15H 1O80A 1TT5B 2P5ZX 4K7WA 2F0VA 2LI5A 4A3BB 2DNEA 3KUPA 2JA7G 2ICIA 1N63A 3W1SC 5D3DA 1I94L 1STNA 1TGZB 1KL9A 1QWYA 1GXDC 4DR5Q 2JA8G 4P71A 4EFOA 3KYHC 3NQTA 2H89B 1NMGA 1NY4A 1CQFA 3QHTA 5K5PA 3N20C 2NPTA 1V9PA 1L7YA 2IGDA 3NVVA 4HJGE 2D5GA 3ZNHB 3HM6X 4N9PA 2NBVB 4EVOA 4TRDA 3VA7A 2KJHB 5ELOA 3QARA 1MSGA 4ARCA 3KK7A 3NTHA 1V1PB 1B9NA 4DGZA 2NVXH 3U30A 2BKRB 2EY1A 5ELEA 1N6ZA 2GLSA 5G3LF 3W1BA 4B9WA 3T3OA 1HZAA 1R4NI 4IWPA 2D0PA 2EZVA 3Q3NC 4A3BH 4A3DH 1BKBA 2M19A 5T1IA 2L1AA 4GU2A 3FHWA 2PQAA 1DGJA 4GDKA 1YVCA 1ONLA 3OWEB 4HSVA 4X66L 1NE3A 1NCVA 2PYKA 1CZGA 4QMGA 4IFDI 2DHZA 3QIJA 2D3GA 5KNDA 3UE1A 1LTSD 4HIDA 1TTNA 2BGFA 1PTOH 2FCSA 1OXXK 3FILB 2JZZA 5I2YA 3ML9A 1MHWC 5EPKA 2A73B 2BH8A 3KUZA 1QF6A 3A54A 1FM0D 2M17A 1EEFD 3SR6A 5C0XH 1QQRA 4A3OA 4F88A 3U7ZA 3W2DA 3DMUA 3C2PA 5C3EB 3LB8C 4X3TA 4YWMA 2L15A 1Q90A 4FF2A 1Z2MA 1JWSD 3ZJVA 1ZKOA 5C2TB 1EZ6A 3G6EA 3FP9A 4JBKA 4OXPA 3RMHA 5IO9A 2AHOB 4RFBA 2MEKA 3AFPA 3P63A 4W9LA 1L1OB 1JOOA 1MSHA 2E74C 3R8BA 2WAQE 4HIOA 1TWHB 2A74C 5AJ3L 4LF4Q 4PS7A 4LF4L 2O2VB 4IUTA 3FPPA 3DM1A 2K33A 3FRPB 1RODA 1WI5A 4DK3C 1VQ7A 1ACCA 4X3SA 3GTPB 3Q22A 4C3JB 5ISRA 4B9KA 3I57A 2I46A 2HCCA 2WB1G 3H09A 4P16A 1LABA 2QILA 3VYSA 1X3QA 5KEEA 2JA9A 2MBBB 3NPPA 2HTME 4NAWB 5JHAA 1XQQA 3CPFA 4WURA 1C9FA 2WXLA 5CORA 1PHJA 3O13A 1J5EQ 1H4RA 3HHMA 3JC66 3R93A 1C4PA 3STBD 3MAQA 4P7IA 2L12A 1V1QA 2OOBB 3IBEA 1WX9A 4AH6A 4RAUC 4LF7L 1A63A 1SF0A 3ZYYX 2DNFA 2C5CA 2OWOA 3SK5A 4YCVA 1JWBD 4YIJA 1PH4A 1WE7A 4KSLC 3UQBA 3S15B 5FLMH 1SYFA 1L4ZB 3BVZA 3GTLB 2LGDA 3AQQA 4H2AA 5D65A 2JA5H 1T3QA 4DHZB 1MJCA 1F2MA 1EYCA 2AQ1B 1L4DB 5GADC 4KN7C 4Q5VA 1SIFA 4C3HB 2M2LA 1WZ0A 1ZXTA 4HCEA 5COYA 1YJWA 4AUQC 1E6EB 1CM9A 1GO3E 3NTIA 4L5QA 4DR3L 1TS5A 2E2HH 2K6QA 4HLEA 2XGTA 1SNMA 1X65A 3W9CB 1L0VB 4JI3Q 2JX5A 4ANUA 1VZ8A 3AE1B 1U4PA 3RR5A 4CQNA 3DWPA 2M8SA 4KJNA 5J3BA 1GUGA 4IUMB 4A3LG 1HNWL 3M3YB 2L4NA 3TEXA 2D07B 1QILA 1OFFA 4DHZE 2HD3A 2CHXA 4C4VB 4P1BC 1P7EA 3PZ8A 2MSED 3MXNB 1EQRA 2OCEA 3P4SB 2ZXPA 2CWPA 5DEHA 3RD4A 1ISNA 1YIJA 2DY7A 2F0OA 4IOCA 3S1QH 4PS3A 1LQBA 1CI3M 1WIAA 5L37A 2N9PC 3S1RH 3ULLA 4RMAA 2NBUA 1K73C 1YHQA 1YNJC 4L5RC 1JW9D 2GBJA 2EYLA 2NN6H 3W5OA 4BOZB 3I63C 1PTOB 2L52A 4KIKA 2EIFA 4JI1L 2JZ3B 3C3LA 4KHPL 2KWVB 4BAXA 4C3JG 4MZ9A 1FIQA 4HROA 3HVZA 4DV6Q 3WWVA 3I56A 1CA6A 2BYFA 5J2RA 5C44G 1LGRA 1UEAB 2IYDB 5CYUA 3KBXA 3HOXH 1IBXA 1SJHD 2EQSA 4M1UB 2EKIA 3GZNB 1R4MI 1WRDB 3PO2G 1V5OA 3X23A 5IP7H 5C4HA 3E56A 1MVKA 1X3GA 2O5IC 4LF9Q 4XYQA 1YZ6A 4PG3A 1PVOA 1RKNA 4BKGA 1N36L 4JI0L 3CD6A 1BCPB 4GOPB 3HOWB 2HD5B 1PYSB 1TWAH 4G4KA 2KDFB 3ETRA 2DY8A 1VQLA 1X9NA 4JI4L 2JVCA 1K3RA 2QIEB 2ZPNA 3N3KB 1JRPA 1MG4A 2EY5A 3T56B 1RL2A 4LW1A 5JJLA 1QOBA 4FJVB 1LTLA 1WTPA 4BBRB 4RG1A 2KAJA 2WXMA 1MG8A 4ID6A 5HFYA 2UU9Q 2VNUD 4YWLA 2KNBA 5LLIA 2KJXA 3HOXB 2VZKB 4WQMA 1NBFC 2YTYA 4HJ5A 1I3QH 3FC4A 4X66Q 3AE5B 3PF5A 4B3RQ 3FKIB 1CSQA 1NENB 4ZQ3A 4YWKA 2O2LD 3I7FA 5F2DA 1IBKQ 3HOUH 4M0WA 1T0RC 5LL6S 2Q2UA 1FPYA 4B08A 1Y1VG 4ZUIA 1K52A 4ME5A 4IW0A 4MGIE 3Q23A 2W3RA 5LXHA 5IYBG 4GLVB 2HUGA 3S2DH 3D32A 1SE4A 1JT8A 3F2UA 2UXCL 3OWFA 5JJKA 1Q7YC 4EGVA 2RBMA 5IOCA 4PS8A 2JA5B 2V3SA 2FINB 5KYLA 2LFIA 1ICFB 5DM73 3HOYH 1S5CD 3E6ZX 2PW9A 1QZEA 1F9RA 4DV0Q 2PLPA 2VB3X 4C3IH 4PNYA 3VH4B 2AQ3B 3TUOA 3EQLC 1RWSA 1K8GA 1XXGA 2YEPF 1S40A 5IOIA 4LLGM 3SU8X 1I4RA 1K83B 1YBYA 4KHVA 1XMQQ 3J7AF 2D3AA 2WXNA 3ABVB 3P4PB 3KF8A 4GDLB 1TYGB 5CHVC 2HT1A 1BUVT 4GNXA 3R7QA 2K52A 4F7ZA 1S5FD 2WXHA 1HR0L 1EF5A 1UWXA 1RAXA 4GKKL 2J0MA 4TKNA 2F0QA 3HIZA 5BMGA 2KEEA 2AKWB 2XWJB 4IO9A 3DVGY 1YMHE 4URKA 4DXGA 3PO3B 1MGSA 5EKIA 3GTJB 2WB1B 5DLQE 3K6OA 4GLXA 3R7RA 2CCZA 2E6XA 1YJ9A 3RLNA 4R4OA 2KHJA 1PTOD 1F9QA 2RKSA 3DOWA 4KLKA 4OZAA 1Z47A 2WFWA 1DXMA 2N88A 3GTOB 2LD9A 3IHPC 2JQRB 1CK1A 3PT2B 3A5ZB 3MJWA 3ZIMA 2R7ZB 3R66C 2R7FA 3GV6A 2HHHQ 1Q8IA 2LSSA 2BH2A 2CKHB 5FLXc 5BN5A 4BBNC 2KVZA 1G2SA 1SYCA 3NVZA 3RYTA 1R4QB 1SYDA 5KNBA 1XPRA 2KTRA 3H6NA 3P4QB 3CRLC 3Q0AA 4M02A 4CKCA 5GAHC 3R2IA 2O5JC 4KKSA 3DBSA 3DUZA 1ESRA 5E3FA 4K3CA 4ZOHC 3PIO3 2I1KA 3WALA 1OQYA 3FILA 3SDZA 3CCSA 1IBXB 3QQ8B 5IWAL 1A8VA 3ULPA 4RHRA 2E75C 1BOSA 5CBAE 3HOZH 5CV6A 4H02A 2G1EA 4LFBQ 3AI5A 4HVBA 5C4XB 4B95A 1EWYC 5IY0A 4JIOU 4QY7A 2CR5A 2SEBD 2DJFC 1FXTB 4RH6A 3FPUB 2JA6B 1VCIA 2LXAA 2NZ1D 1KC8C 4HKZE 4U68A 3M3JA 1ZYRC 2K01A 4DV3L 2RGFA 1WE6A 2LXJA 2MQHA 4DV3Q 2KACA 1KLVA 3CU7A 2MBQA 1KM7A 3VAWA 2NMQA 5A2QL 2DZKA 3NXWA 1F9PA 4LUOA 4BY7B 1GD7A 2WDTB 2HDEA 4GIVA 2A6HC 1TWHH 4KGSA 4LNKA 1WTOA 1HNXL 4JWUC 1KF6B 4FLHA 4JI1Q 3NUHB 2C7MB 1IKLA 2MCNB 5C4XH 5M3MG 2JXTA 2N1WA 4FF4A 3GTMH 5GAGC 2N49A 1QOFA 2MJ3A 4DV5L 3PGZA 2KKCA 5BR8Q 4H0LC 1VQMA 1CZWA 3K9OB 1VLBA 2HIVA 5IGEA 1R4MB 4USAA 3MC0B 1LTBD 3NSWA 3N52A 4B3TL 3DHIC 1CQVA 2DWQA 3NBIA 2FIFA 3X3MA 3CQZB 4ULLA 1JB7A 2WXQA 1F52A 1P9DU 2EKEC 4ZYSA 5JZEB 4DR6Q 3DBHI 3PO2H 1CTMA 2NVYH 4AYBB 2FIDA 4W9HA 3U52E 2IY5B 4JI4Q 2WP9B 3R2TA 3UI3A 1N34L 3M7NA 2BYEA 1BVSA 1IBLL 1FR3A 4S3SA 1S5BD 2A68D 1IBLQ 3P42A 2EJFC 1KLGD 1XWEA 2KQ7A 3QO2A 4BA1I 3TMPB 3L16A 2BW2A 1BBWA 2Q5WD 3RNEC 5JJZA 4K6LA 1Q46A 4HEDA 5KIXA 1VZ7A 3VHTC 4KZ0A 2C60A 3V62A 3T51B 5I2XA 4XQNA 4K5VA 4C3HH 2N9LA 4WIPA 4C56C 1I6VC 1XYIA 2YLMA 3EECA 4LFCL 3PZ7A 4D2KA 3WOEA 1D6EC 2N7JA 4BY1B 4HR7B 2EYOA 3BDCA 4A3JH 3BU2A 3W1GA 1YJIA 2PZUA 1F2RC 2K04A 3N32A 4DPGA 4HWIB 4AQYL 2KDBA 2B2UC 5CHFA 2UUCL 3BINA 3EGRA 3PRMB 4DK0A 4CJ0B 1V43A 3V6CB 1J0GA 1R9TH 1HTLD 1SEBD 3VR3A 3S2HH 3VFKA 2RQXA 2R61A 4JV5Q 3S2DB 3NBHA 3KUDB 4NXNL 1AP0A 1ILQA 4PYUA 2NZOA 3D4RA 4IOAA 4LF8Q 1PH1A 3CKIB 2MP2B 3QK0A 4LNOA 4XDDA 4WWOA 1E0ZA 3UF8A 1WCMH 4JI2L 1KOTA 1TKEA 2JSVX 2Q8IB 2B2VC 3TP7A 1UD7A 2Z4HA 3I73A 2G5DA 5LMUL 2NPTB 3QC8B 4HXDA 2CHZA 1Q1BA 2MUYA 1PFDA 1G2TA 3QOLA 1UF0A 3PTFC 1V8CA 2AWOA 1GOZA 4WJ4A 5M3FH 3H9DA 3PGEA 3H7SA 2KTRB 3HM3A 1BR9A 1W2BA 3MJ5A 4IPHA 2CJOA 4KIKB 1YQ3B 4F1SA 3KF8B 4GDLA 1KNAA 2RA4A 1KFYB 4I6NB 2J7ZA 2L55A 2FCMA 1H9JA 1WVLA 3VR8B 2UXBQ 3GS2A 3NEMA 2XK5B 1TIFA 2R93G 2K4KA 2QDLA 3BYTB 4O1NA 3OJ4B 2E8GA 3H91A 4A3FG 2LVOA 1BUIC 2W82A 5ELNA 4LNNA 3E0JA 5BMIA 1JQ4A 2NYZD 3S17H 2MHJA 3GD7A 3AN1A 2MP2A 3ZKJC 2KVMA 3R3MA 3J9CA 4B0EA 3SK8A 4F8MA 3DWQA 3ULJA 3NWTA 3M85A 1XD3B 3I4NH 4RGNA 2NVTH 4X62Q 4DR4Q 2E2DC 1VQ4A 4XYCA 3PSIA 2KECA 4DN4M 1H9SA 2E2JB 3RNUA 1NMFA 3Q3MC 4BKSA 3EIVA 2FMMA 4ME3A 1V1PA 4PQXA 3VDYA 1QOHA 2NR2A 1HQMC 3W3AA 2HTHA 4ZHOA 1BDOA 4RMFA 4ZK9B 2KMMA 3ZJUA 1ICWA 2K32A 3J81L 2YU9B 2RPQA 2WAQG 5IYDG 1E7ZA 4C80A 3D4DA 4MDKE 1YD8U 3AU4A 2C9WB 2PIAA 2IL8A 5JEAH 3IFWB 3NVWA 3K0XA 4DR3Q 2O6VD 3ITPA 3HOVH 4OIJA 4CYEA 1JC7A 1K8RB 2KDEB 3APDA 5JAVA 1TT2A 1RYJA 4HPMB 5C5MA 1YHBA 1R4PB 5IA7A 1GKHA 1X54A 2XN9C 4IKGA 2F4VL 4FF3A 2V3NA 3V6EB 4Q2JA 1KNEA 3SD5A 1YNND 3OW2A 2HCIA 5IIFA 2DZMA 5IGBA 2RSOA 2JXMB 2UXDL 4ZCKA 1D7QA 1PUTA 4JX1C 3QJZA 1PMRA 4JI8L 3TP5A 4C4VA 3VA5A 2VRRB 4N9TA 3VTUA 1Y8PB 3UE0A 1HFNA 1WI0A 2H4OA 3LXFA 1FD6A 4X65L 3E5SA 3G7LA 2ASQA 2N7DA 4GNXC 4IM3A 1P3QU 3IFTA 2I1JA 3A9JB 3TRZA 1VQFA 1HA6A 5HKHA 5H1SE 1FMAD 2JWUA 3WDNA 1TWGB 1V2YA 1VMPA 1VQGA 3AE6B 1H9SB 3VXWA 4DUYL 2I07B 4C3IB 1L2NA 4ILWA 3U50C 2IW3A 3HOVB 1YQ4B 3CWIA 4L8JA 4EQ5A 1PDXA 1DOYA 3D8GA 4YTMB 5IYCG 5EPLA 3VR5A 3I4MG 4M8AA 3B6YA 2I0QA 4PMBA 2WXPA 3FKYA 3MXUA 3H3VH 1JOQA 4WJQA 3STBC 4EEWA 2J7QB 4IFDH 1UBQA 3F2BA 3FDTA 1XNQQ 1YI2A 4MGZE 2LMCB 5E6JA 1N9WA 3GDEA 3TDQA 2KTFA 3DBRB 1STHA 4DK1A 3N1XC 3EFXD 2ZW1A 4A3EG 3A5UA 2AX5A 2AUJD 1X1MA 1I7HA 2C5LC 2K5PA 1Y8RC 5JEAJ 3IXSA 1QUQA 1OEYA 3MVVA 4RWSC 4S0RA 1N60A 3U7DA 2MO1A 3M4OH 3NHEB 2F0LA 4IM2A 4CBVA 1NYQA 3KLSX 1PZKD 2K28A 5C3WA 2QJLA 2RDBC 5EKLA 1WR6E 2J42A 1WMHB 1PFMA 1DM0B 2HDLA 3RUZA 1C7YA 4LF5Q 4LWCA 3NE5B 4AOFA 5IODA 4HIKA 2EJGC 1ZPSA 3NZ3A 2BE5C 2A6ED 4YWGG 4DUZL 1P7FA 2DYOA 5IT9c 4DUZQ 5I4DA 1E8XA 3I5JC 1WGDA 2QC8A 3KWLA 3VRBB 1KTKA 3NP8A 1EZ8A 2AUKA 3I70A 4FULA 1C4QA 2F0WA 4HJ7A 1UWVA 2PQEA 1H95A 4O2DA 2DNCA 3U9SA 3AYHB 2FBWB 2SDFA 3V96A 3K7AB 5GQOA 2B63B 4A3DB 3W1YA 3DBLB 5D3IB 1TVXA 1SMXA 1L0XB 5LMNW 3QA8A 2KC1A 3WOFA 5M5XH 4UPAA 4LTUA 1YQBA 4PZ7A 2LVQA 5LMNL 3GE3C 4XTCS 1F2RI 4ANVA 2LGSA 4GN4B 1G91A 3KYDD 4LUVA 4B3ML 5IT9E 1B2TA 2L76A 1STYA 1LFDA 4J15A 2SAKA 2K75A 1SGHA 3MC9A 1VQJA 2IX3A 5GROA 3RZOB 3WAPA 1I6HB 3MZ5A 2QEXA 4PT5A 1BCPC 1GJXA 1IPGA 2WXGA 1K9MC 1EY5A 3N1ZC 4EX5A 1XLPA 2MHVA 1U0LA 4A9AA 3VUYA 2OJRA 1O7ZA 3I91A 3K5LA 3DHHC 2JT4B 1JMCA 4DV7L 1WTRA 1DOKA 2G9DA 2PE9A 4A6QA 2K5VA 2RVLA 1VQPA 1Y1WB 1RIPA 3EFUA 4YSXB 3G6JB 2KDIA 3AE2B 5BYQA 2F3VA 2WV6D 3ZTDA 3GTKH 2F0KA 3I4LA 2BT6A 1EQQA 5M3MB 2MGSA 4OHJA 3U9OA 1PGXA 2H1EA 2NVXB 2BYVE 2F0SA 4DR5L 2NVQH 2MJDA 1JICA 5FK9C 3IRBA 3KUCB 1OXUA 4IPGA 5IYCH 4A3FB 4DR6L 2IJ0A 3J81i 4K2LA 1WTQA 4FBJB 1N32L 2B2TC 4P73A 3QG1A 5JXVA 1YN4A 1F2LA 1AZQA 2PEAA 3RNBC 2PNHA 1WYGA 4K0KL 1J5EL 3CQZH 4NAMA 4WQOB 2BB6A 3RFZB 2VL6A 1FGBD 3S16B 4OVZA 4QAYA 2LZ6A 2QW7A 3T4AC 1PTOC 2KA7A 2FXQA 3OOCA 4OWWB 3HEJA 4X62L 3S1NH 4DR4L 2UXCQ 1P98A 1XT9B 1ZXHA 2W55A 1RHPA 2XWBB 2H88B 1PTOF 1W6JA 3VR2A 1DJRD 3MXGA 1XNRQ 4HCPB 1JE4A 3B2GA 1SNOA 3SHQA 2AEHA 3X0WA 1J19A 2ZTDA 2JSOA 4ZRZA 2LXKA 4XQJA 3ECIA 1M8AA 4LK1C 1NI3A 2KFKA 3SDLC 3KLRA 2L1BA 3RZDB 2JXXA 4ZHPA 1L1OC 4LUZA 1VZ6A 1Q8KA 1OQQA 3ZXVA 4BS9A 1C48A 3RN5A 3TJPA 3JVZX 4GOCA 4CKBA 4ABNA 4GOPC 3ZQ4A 2K5QA 2MRPA 3OIPA 4F8CB 2BDOA 4G7OC 4KMUC 4X6AH 3Q8CA 3BK1A 4YXDB 4KJOA 1G6JA 1GHJA 2MJ8A 4R4TA 1KAWA 1VQCA 1NVID 3A0JA 4MJSA 4QUFA 2F0DA 1WXQA 4ANXA 3GTPH 1PRTD 2VUMH 1L2FA 1IBML 2R6GA 3DEOA 1KRHA 1WJUA 2IO1B 3CF6E 4RF1A 1MI2A 3DLLA 3JYUA 2R92G 1A5RA 3KOJA 3HP3A 3W5VB 2XRQD 4RA8A 3DBHB 2FFKB 1EU4A 1PV4A 5HY6A 3HOYG 3NWSA 4DR7L 5FR6A 5G5GA 4DR7Q 2ZVOA 1KABA 4NAWA 1WY8A 4OWXB 1EU3A 1U5KA 2I2YA 4RCNA 1X6OA 2O2VA 4XT3B 3CP0A 2J53A 4I6LB 4JLCA 4NXML 1LLRD 1T0QC 2KFJA 2JA7H 3ZW3A 2F52A 3KVFB 3EUB2 4TQ0A 1ML0D 1OXSC 1C9OA 5IYDH 3I72A 2G45B 3NVYA 1JB3A 1CA5A 4FHJA 2KVRA 1K8OA 1Y56A 3ALBA 2NTSA 1E9MA 3C1FA 1SMYD 2DN8A 4TQUS 1EEID 4A75A 1IKMA 3H7PB 2DJGC 4IUVA 2G3QB 4GSWA 2Z0SA 3LGJA 3N6RA 2MFIA 3WIMA 1VQIA 2SOBA 1ROEA 1XLQA 4KX6B 4O0AA 2JRHA 3K9PB 3SGIA 4JOIA 1VQ9A 2LRWA 3H6MA 4KY5A 3ZO5B 1HTPA 1I4HA 1VQEA 1FFUA 3CC4A 3G48A 2INPE 4RGMA 4ALPA 3ZXRA 1TWAB 1K28A 1Y1VH 2OQKA 1FEHA 2R7ZG 1M1KC 1JALA 3H0GG 5IGFA 2ZM6L 2UUBL 1MI0A 1WXMA 3L08A 3WAOA 4AQ7A 2JE6I 1N5WA 4R8IA 3SXHA 2BOSA 3MA2B 1SLJA 1AEXA 2B63G 4CO7A 2G4SA 1ENCA 5IP7G 1OTRB 3TL5A 3BDLA 5JHBA 1QNKA 2CFMA 2B2UA 2Z9HA 4Y7NB 3S14B 1CFMA 2EELA 1ZXIA 1CMXB 5H92C 4R9WA 4QL5A 4TSSA 5IP9G 5CV5A 4EZLA 4KV6A 5C4ZA 5M3FG 1N33Q 1C4AA 1EM7A 3PREA 2EYMA 3L2PA 2M1MA 4X64L 3PIOA 1EIHA 4RGTA 1QKZA 4DF7A 4A3KB 3ZTCA 4C1NI 1KDCA 1TWFB 2ON8A 3CSFA 1UAPA 3T53B 1QVCA 3J80i 4B6WA 3CRKC 1WCMG 1VQNA 3RZOH 4OEMB 2MJEA 4DXAB 2IPKD 2N3SA 4QJFA 2ZJQA 4W9CA 4B0MA 2JJQA 2BB5A 4MH8A 3DBLI 2YU9H 3L17A 3OMCA 3NG0A 3AE7B 5TSSA 4OGQC 3A7LA 5AZHA 2KCTA 3K59A 1XNQL 1IYVA 2A8VA 3AECB 1N62A 4K81A 1GM5A 1F9SA 3A9KB 4R4IA 3DWAA 1UE6A 1PFNA 2GA4B 5EPJA 1BO0A 1MBYA 2QKIC 2FUHB
chains in the Genus database with same CATH topology
4ZUJA 2GRIA 4NMZA 1SIJA 4LK0M 1DOIA 2D5DA 2A6EC 2BE5D 5I6YA 3QIAA 3EA6A 1GUTA 5CR3A 1EWCA 2C9OA 3IKJA 3GP7A 2K9XA 4BWGB 4A3MB 3W5UB 2VB2X 2NB0A 3CIRB 1PRTC 3OMGA 3SVMA 3PUYA 1DCZA 4BA2I 3SK6A 2WP8J 1PRTF 1FNVA 2K7VA 3MWYW 3HKZB 3PO2B 4DNRB 3H94A 4J8QA 5FOBB 1LTAD 3OHXC 4FXDA 1TS3A 3HRDD 1ET6A 2EDGA 2RDFA 4HEA1 1HXYD 4KN4C 3MEHA 4IUPA 1TY2A 3J7AV 1EIGA 3TZUA 3U2SC 4KKIA 5DNFA 2OT2A 1E0BA 1T6BX 1ZOYB 1LACA 1Y8OB 2R3ZA 3OSOA 2WAQB 1U4RA 2V4DA 4OW0A 1FNUA 4KI0A 3B2FA 5LHY1 2EOTA 1C4CA 4A3GB 2NN6I 3I3CA 1YN5A 1DYQA 2KEDA 3J80E 5JOBA 1TY0A 5BN4A 3I4MB 4TMAB 2K0PA 4GLSC 3SFEB 2BTEA 3NUCA 2KHSA 2GB1A 1TU2B 2IGHA 2BA0A 2D62A 4FNFA 4YTNB 4KD4A 4HMIA 5KYIA 1VDZA 2IX0A 3ZGZA 1ENAA 1TZOA 2KQ4X 1C79A 3TZDA 1SDFA 4ZKCB 2CQAA 3MHBA 2F3WA 2Y5CA 1STBA 1SJED 1B53A 3J81E 4NDXA 5A35A 3E9SA 4L1BA 2NVYB 1Q3LA 2K5DA 3LNNA 2WKDA 1II3A 1STEA 2B2WC 2KCCA 1SFOB 2L9HA 1JOKA 4HAEA 2V4IB 1SBBB 3V3XA 3K57A 1SSOA 2Q8TA 4JBWA 1VR9A 4FXGC 3Q8AA 5M3FB 1F0ZA 2PO4A 4OZCA 3K5OA 2Q8RE 3TEZA 5M9OA 2PZTA 2EYHA 3KWVA 1RD9D 2B8GA 2L83A 1B44D 1HQRD 4HN7A 4RCOA 3HG9A 4C3HG 1FCLA 3TBIB 3S2HB 2YYZA 4L23A 5MPOA 1E2VA 3L7ZC 1KDAA 3MTSA 4FF1A 1SNCA 4J1MA 1MHHE 4IUUA 1A3TA 1E7PB 2BDNA 4HSPA 3K5MA 3AM9A 2QMTA 2LMCA 4U673 5CBEE 1LV9A 3HS0C 4DAYA 3KQ4A 3EJIA 3AEGB 1EYDA 2WXIA 2B8FA 4EE2A 1J9OA 3NQIA 4GDKB 5JVG3 2ONQA 2EE1A 3Q8BA 4IFDG 2KN4A 2M0AA 1FO4A 2FHTA 2B76B 3MP9A 2EVBA 1LTID 1GB4A 1WRIA 4OO1H 1XEEA 1X3PA 1SNPA 2Y3AA 2W54A 1RM6C 2VXWA 2HQEA 4I7ZC 2BCOA 4QIWB 3IT4B 3QWNA 4CGYB 3BS1A 2L32A 4CJ2C 4ZKBB 4A90A 2N0SB 4JE3B 5D14A 5C3JB 2LUMA 4NW2A 3PUZA 4JK1C 1EL0A 3I9V1 3T3NA 4LMQD 2O4XA 1SNDA 3R3OA 1IUEA 2KWDA 3TEYA 1M4VA 2TSSA 4L63B 3MFGA 3HOYB 1EYAA 1A6XA 1RF2D 1FCCC 1FYCA 1HFGA 3DHQA 5M5YB 1QT9A 1VJKA 1RJTA 2X38A 1ZEQX 3MXNA 4KKUA 3GB1A 3Q8EA 4XWTA 2RSNA 3H8HA 2WDRB 4KY7A 3DXJC 1OXVA 4WRDA 1O7YA 1B9RA 4MIUA 4A3IB 2LEKA 4N58A 1SE2A 2NVTB 2AQ2B 3BVMA 2AWNA 1CJEA 3IAYA 1STGA 2WIIB 1QCBD 2WACA 4XIGS 1R7SA 1K8MA 2L0CA 4A3EB 1DOLA 2ZXRA 1J7BA 1F77A 1V1OA 3BVGA 1RCVD 1HA5A 1Y8NB 2A68C 3BDOA 4XDCA 3C8YA 5DAUA 3PIP3 1IGDA 4K8IA 3RPFC 1OO9B 5FLXL 3PO0A 1SXTA 2INNE 2K5WA 3AEEB 3IAS1 2NBFA 3VR4A 5C6AA 4F7XA 2F0NA 5IGGA 1KH0A 3M4OB 4NP5A 5K36G 1I3QB 2WXFA 1FXIA 2EYPA 1TKGA 4QCLA 2M56B 4MHEA 1LT6D 2JP1A 4XDXA 2PNRC 3OPOA 2FUG1 4NZLB 2PPBC 5CV7A 2F0EA 1TKWB 4UDUC 2WXKA 3OW7A 3VYRA 4CKEA 2OEOA 1J7CA 1HUNA 4NKLA 2N55A 4QB4A 3AB5A 1D5ZC 1PFBA 5ELFA 4RHSA 5FKAC 3A8IE 4US8A 3NK9A 4CJ1B 3D6WA 3AE4B 1LTGD 4R8NA 1D1IA 3I90A 2R93B 1BMLC 1EY4A 4HMJA 1PGBA 2Y5PA 4L2YA 1FNWA 1LTRD 3CHBD 2J4XA 1YJJA 1B3AA 3VYTA 2NN6G 1PZID 2F0MA 5EE3A 3D4WA 1JWAD 1Z6HA 4N59A 5I9PA 1KDBA 4YSZB 1VDVA 4HTHA 4TKOB 4ZLTF 1PRTB 1EQTA 2NVQB 2GI9A 2V0GA 4XT1B 2QEJC 2CHBD 4BBSB 3MFYA 1WTWA 3P75A 4NJCA 3GTQB 1NSNS 4GZYC 1I50B 3AE9B 3D31A 3VYUA 2KUMA 1G291 1GUNA 2DBYA 5AUKA 4PV1C 3K5NA 1I4GA 2KOLA 1K53A 1LT3D 2QF7A 2F0GA 1ZDXA 1EY9A 4EQPA 4KK7A 2D2CC 1BBXC 1D5XC 1ILPA 2X6LA 1NR4A 1HRJA 1LT5D 2WU2B 2QDBA 4XQQA 3QJYA 2MP1A 4DXFA 4JPSA 2FMCA 4V190 4KD3A 3ZJTA 5EKKA 4US9A 3NHHA 3RLFA 4ODGA 1AWDA 4ZRPA 2L5TA 2W3SA 3IFDA 4LJZC 1UNSA 4K5WA 2N9KA 3A55A 1DD2A 3P7JA 4V0BA 1J8IA 1A3VA 5CGKA 4G7HC 1EY8A 1DONA 1HPCA 5NUCA 1WSPA 4A3JB 3AH7A 4WJWA 5C4JB 3NTKA 3BK2A 2L11A 1TWCB 1QOAA 2K1BA 3QOJA 4KGRA 1C78A 1PXUA 1IL8A 2RMMA 1SMYC 1F2ZA 5EE9A 1SSNA 2IWHA 5BN3A 1S5ED 3AMUA 1I4QA 1XO3A 2K03A 1DOXA 2ZW0A 1XLNA 1LO5D 5K36H 2R92B 1BF4A 1K50A 3GQBA 3PV0A 4KY6A 2B39A 5C3XA 1HEZE 2CW0D 1R9TB 1YNJD 3TP8A 1UWMA 5E1FA 4JWSC 4K6DA 4XXEA 1L0YB 2F0UA 2EYFA 3VRAB 2EXZA 3ND9A 2PW5A 1NAPA 2LS01 2E76C 2E2HB 4IQZA 2WINB 1XLOA 4IUQA 4IFDJ 4KKJA 5GXGB 1EOTA 4XYOA 4RKLA 2OHFA 3N9YC 1YN3A 1HHVA 5AUIA 4DFAA 3M4YA 2XVSA 1FRRA 3JAML 3S9WA 1QNUA 3MHZA 2MH7A 1WTXA 1Z7TA 3H3VC 3AMZA 1NR2A 2KDMA 3GO5A 3S17B 3T16A 3AV8A 4KKTA 1HZ5A 2JYEA 1S4ZA 2CVRA 3HOZB 1I4PA 2BYTA 1TIID 2RPVA 2TMPA 1C77A 4DAPA 5IGCA 4TQ1A 5CV4A 3M7GA 4KGTA 2X69A 3Q69A 1H9KA 1EY6A 2WDQB 2D9UA 3BYYB 3MXPA 4P6VF 3T13A 4OL7A 2K3UA 3DEPA 1OQRA 1XTCD 4MN3A 1JMLA 4A55A 5EBCA 2B2VA 1CHQD 3K58A 3TN2A 3PUVA 4PMWA 2WXRA 4QUCA 4K2KA 2EY2A 1SYBA 2WDVB 5HI1A 2LHDA 2RDGA 5EBDA 1OXTA 5EE0A 3S1QB 4YTPB 1SE3A 3L3OC 5JPMC 4HRSA 3HZXA 3PUXA 1I4XA 1MPEA 5I6WA 1AW7A 4H44C 2F0IA 1U4LA 1D1KA 1QG7A 2JEAI 2KQ3A 2M00A 1FXAA 4IN3A 2F0TA 1NEKB 2QSDA 2X6GA 2ID0A 3SK4A 5C44B 4XWWA 5FO9B 3VQIA 1F2YA 3URYA 4UAIA 2A69C 4HCSA 1BQQT 5C0XI 5HURA 4O42A 2XSCA 2ACZB 2WQYB 2BS4B 3EVQA 5AFWA 5CC4A 1TKYA 4WFN3 5BYSA 5CV9A 2PCFB 3UI2A 1IGCA 4EQNA 2EPBA 4KHZA 2BS3B 1B4OA 3P1MA 1K51A 1LTTD 5E4WC 3TMEA 5KRUA 1E2ZA 1O7LA 3ERQA 2B2TA 3C1EA 2IX1A 1VF5C 1D5MC 5JVH3 3IAM1 4HKQA 3SFDB 1QOGA 2Z1CA 3OIQA 2JZPA 3C46A 1QLBB 5LL6X 2CU3A 4L6TB 5DM63 1YNNC 1VRAB 1T5EA 1JQYD 3AEBB 1H9RA 1JCKB 2ENBA 5G3LD 5J1ZA 3J7YW 4Q0FA 3BWUD 2I38A 1VF7A 2XIWA 4FYDA 1NUCA 2JU6X 1SB3C 1D4BA 1GB1A 5EQ0A 2F03A 2FE8A 1EY7A 1IW7C 2Y0SB 3L4PA 2G9HD 4IALA 2JA7B 1ZYRD 5C0XJ 3LYYA 5JEAG 4QF4A 4F87A 1PYWD 1ZUD2 2F0FA 2DLBA 3KBGA 4IUNA 2PVOD 5A2QE 3A56A 1HUMA 1A70A 4DNTB 2WKCA 3H0GB 4LAAA 4E6IA 3B9JA 1L6UA 1T5XD 1JORA 1G8ZD 1Y1VB 2BBCA 2VUMB 2K22A 1AZPA 3NS1A 3SEBA 1BCPF 1AYFA 5E4XA 1RTOA 2RDHA 2IGGA 3SR1A 4CHTB 1TR5A 1ZDVA 3A8JE 1JWMD 1TS4A 3JAME 4MM3B 2K6AA 1MHXA 3DWMA 1Q10A 2LKVA 3WCQA 1GPXA 4RKBA 1SYEA 1DOMA 4FXCA 1X32A 2WNMA 1AN8A 2B2YC 1ET9A 4WORA 2JEBI 1B50A 3U4EG 3V05A 1CT1D 1L6VA 4IOIE 3VR6A 2ZXOA 4DA2A 2XRSD 4EQOA 1IYUA 3P4RB 3GTGB 3BZDB 4AS1A 4WH4A 3FVQA 4PMCA 4RGOS 4OZBA 5EGTA 4J3OD 3K0YA 4A93B 5FLXE 4ZAIA 2PW7A 3I4NB 4H7BA 3L9AX 3S1NB 4K14A 5BMHA 1EWHA 1IW7D 1PLFA 5J39A 1YNTE 1UUPA 4G7ZC 5HG2A 1CZPA 1B9MA 5ELBA 4X3UA 2IT1A 2PTLA 3LX0A 2ZT9C 3Q6SA 1CHPD 1VMCA 4X3KA 2NUCA 2LJIA 3Q24A 4IDIA 3D6CA 1N5XA 1S5DD 5HGTA 3J80L 5J22A 1FRDA 1N61A 1EY0A 2A5HA 1ENFA 2LGIA 4RF0A 3FMCA 5CV8A 3ONAB 5I9OA 2E2IB 3S1MB 1JR0D 3P20A 3D3RA 2MPMA 3HOUB 4C7ZA 2WLBA 3NRZA 1HCZA 1V8QA 4J6HA 5T8IA 3AE3B 4R3DA 1EQVA 1HZ6A 1UGJA 2F0PA 5C5LA 3HUIA 4C2MB 2EYJA 2A69D 1ZP0B 4RNAA 5M5XB 3S1RB 5EJWA 3IT6B 1PDQA 2BS2B 2B2WA 1ZE3D 1BCPD 1JWUD 4REZA 2SNSA 5FO7B 1W6KA 1TQOA 1RFKA 1WGKA 1WWTA 3GV3A 5FR3A 2LY7A 1WD0A 2HDMA 5M5WB 3TEWA 2PKOA 1JROA 5H8YE 2F0JA 1PZJD 3X3NA 3A8KE 2M9VA 2EJMA 2PMVA 3TSSA 2JYTA 1EFID 2E3TA 4A8XC 2B2YA 1GUSA 3FEWX 4XE0A 4K8JA 4WAFA 1RTNA 1C8CA 1O78A 5ELCA 1Y69U 2PMZB 1FFVA 2QCPX 4Z9CB 1KLUD 2SNMA 2F1MA 5CMDA 5FO8B 1NYRA 2OEDA 4ZRQA 1U4MA 3KLSA 2NWGA 4IZ8A 5KNCA 2Z8LA 3SHLA 3LWUA 5IGDA 1L5PA 4OO1I 1E2WA 4ARIA 1C76A 3P1HA 5D7GA 1KAAA 2YEPB 4C3IG 3LWEA 5G5HA 3SE0A 1E10A 4DU9A 2FJ2A 1BNZA 2J0TD 2OF1A 2F0HA 1GAQB 2PVGC 3AEDB 3VR9B 2CJNA 2WU5B 3BIID 4G57A 2VZKD 2J52A 3IL8A 1IHZA 1RDPD 5HHDG 5ELDA 3HRZC 2NTTA 3EROA 4IURA 1A2UA 1WD1A 4MACA 5T1GA 3HGBA 3ND8A 3AB9A 3PMFA 4H13C 5EE1A 1BXTA 4N6EB 1H9MA 1B1ZA 1WTVA 1XCQL 1GUOA 2WS3B 2KCNA 1PGAA 1ESFA 2EY6A 4C1NK 3HVDA 2K05A 1XCTL 1QB5D 2LHEA 2JA8B 1XF5L 1AFPA 3DWGC 3GTKB 4C7YA 3AU7A 2ICEC 2BA1A 3Q8FA 1QJOA 3AEFB 1D2BA 2CW0C 1MD2D 2Z4IA 2LFNA 2XNAC 2WXJA 1LT4D 3FAHA 4FP5D 4FXKC 4K5XA 1SNQA 4DQOC 3A7AB 4DAVA 5KGUA 1A15A 3AE8B 5BYRA 4YT0B 2JYOA 5JPNC 1G6ZA 3BG3A 3W1SA 2IDYA 4I65A 3TP6A 4B9XA 3PUWA 1Q1EA 4MT5A 4OO1G 4ITKA 1GHKA 5IT9L 1WCMB 1DZ1A 1XX8A 1Q12A 1QE6A 4P2CB 2A6HD 4FO2A 4KTAA 1TS2A 4WWMA 3QB3A 5LNK1 2F4IA 1A3UA 1GUWA 3AEAB 2DYMA 3I8ZA 4FVMA 1SYGA 3V2TA 1STAA 2WXOA 2PZWA 5C0XG 1SAPA 1FD7D 1TJEA 1U9RA 3GTMB 1J7AA 1V97A 2V3PA 2OXPA 1A2TA 4OIKA 1O80A 2F0VA 4A3BB 2DNEA 3KUPA 2ICIA 1N63A 5D3DA 1STNA 1QWYA 1GXDC 3NQTA 2H89B 1CQFA 5K5PA 4HJGE 2IGDA 3NVVA 2D5GA 4N9PA 4EVOA 4TRDA 3VA7A 1MSGA 4ARCA 3KK7A 3NTHA 1V1PB 1B9NA 4DGZA 2EY1A 5ELEA 5G3LF 4B9WA 3T3OA 2EZVA 2M19A 5T1IA 2L1AA 1DGJA 1ONLA 3OWEB 4HSVA 1NCVA 2PYKA 1CZGA 4QMGA 4IFDI 5KNDA 3FILB 1LTSD 1PTOH 1OXXK 5I2YA 5EPKA 2A73B 1QF6A 3A54A 1FM0D 1EEFD 3SR6A 5C0XH 1QQRA 4F88A 3U7ZA 3W2DA 3DMUA 3C2PA 5C3EB 3LB8C 4X3TA 1Q90A 4FF2A 3ZJVA 1JWSD 1ZKOA 5C2TB 1EZ6A 3RMHA 4RFBA 2MEKA 3P63A 1MSHA 1JOOA 2E74C 3R8BA 1TWHB 2A74C 4IUTA 3FPPA 3DM1A 2K33A 3FRPB 1RODA 1ACCA 4X3SA 3GTPB 3Q22A 4C3JB 5ISRA 3I57A 2I46A 2HCCA 3H09A 4P16A 1LABA 2QILA 3VYSA 1X3QA 5KEEA 3NPPA 2HTME 4NAWB 4WURA 1C9FA 2WXLA 5CORA 3O13A 3R93A 1C4PA 3MAQA 2L12A 1SF0A 4RAUC 3ZYYX 2C5CA 3SK5A 1JWBD 4YIJA 3S15B 1SYFA 1L4ZB 3BVZA 3GTLB 4H2AA 5D65A 1T3QA 1F2MA 1EYCA 2AQ1B 1L4DB 4KN7C 4Q5VA 4C3HB 2M2LA 1ZXTA 4HCEA 5COYA 1E6EB 1CM9A 3NTIA 1TS5A 1SNMA 3W9CB 1L0VB 2JX5A 1VZ8A 3AE1B 1U4PA 4CQNA 3DWPA 4KJNA 1GUGA 3M3YB 2L4NA 3TEXA 1QILA 1OFFA 1P7EA 3PZ8A 3P4SB 2ZXPA 3RD4A 5DEHA 2DY7A 2F0OA 1CI3M 1YNJC 1JW9D 2EYLA 2NN6H 1PTOB 2L52A 3C3LA 4C3JG 1FIQA 4HROA 3HVZA 1CA6A 1UEAB 5CYUA 3KBXA 1IBXA 1SJHD 4M1UB 2EKIA 3E56A 5C4HA 1MVKA 2O5IC 4XYQA 1RKNA 1BCPB 3HOWB 4G4KA 3ETRA 2DY8A 2QIEB 1JRPA 2EY5A 3T56B 1QOBA 1WTPA 4BBRB 2KAJA 2WXMA 4ID6A 5HFYA 2VNUD 2KJXA 3HOXB 2VZKB 4WQMA 3FC4A 3AE5B 3FKIB 1NENB 4ZQ3A 2O2LD 5F2DA 4M0WA 5LL6S 4B08A 4ZUIA 1K52A 4ME5A 3Q23A 2W3RA 2HUGA 1SE4A 3F2UA 3OWFA 4EGVA 2RBMA 5IOCA 2JA5B 2FINB 5KYLA 2LFIA 5DM73 1S5CD 3E6ZX 2PW9A 1F9RA 2PLPA 2VB3X 4PNYA 2AQ3B 3EQLC 1RWSA 1XXGA 2YEPF 4LLGM 1I4RA 1K83B 4KHVA 3J7AF 3ABVB 2WXNA 3P4PB 3KF8A 4GDLB 1TYGB 1BUVT 1S5FD 2WXHA 1UWXA 2F0QA 5BMGA 2KEEA 2XWJB 1YMHE 4DXGA 3PO3B 1MGSA 5EKIA 3GTJB 2WB1B 3K6OA 2E6XA 1PTOD 1F9QA 2RKSA 4OZAA 1Z47A 3GTOB 1DXMA 2N88A 2JQRB 1CK1A 2R7ZB 3GV6A 1Q8IA 5BN5A 1G2SA 1SYCA 3NVZA 1R4QB 1SYDA 5KNBA 3P4QB 3CRLC 3Q0AA 4CKCA 3R2IA 2O5JC 4KKSA 3DUZA 1ESRA 5E3FA 4ZOHC 3PIO3 3FILA 3SDZA 1IBXB 4RHRA 2E75C 1BOSA 5CBAE 5CV6A 2G1EA 5C4XB 1EWYC 2SEBD 4RH6A 3FPUB 2JA6B 1VCIA 2NZ1D 4HKZE 4U68A 1ZYRC 2K01A 2KACA 3CU7A 2NMQA 5A2QL 3NXWA 1F9PA 4BY7B 2HDEA 2A6HC 4KGSA 1WTOA 4JWUC 1KF6B 3NUHB 1IKLA 2JXTA 4FF4A 1QOFA 2MJ3A 4H0LC 1CZWA 1VLBA 5IGEA 4USAA 3MC0B 1LTBD 3NSWA 3N52A 1CQVA 2DWQA 3NBIA 3X3MA 3CQZB 4ULLA 2WXQA 4ZYSA 1CTMA 3U52E 4AYBB 2WP9B 3R2TA 3UI3A 3M7NA 1FR3A 4S3SA 1S5BD 2A68D 3P42A 2EJFC 1KLGD 1XWEA 3QO2A 4BA1I 2BW2A 2Q5WD 5JJZA 4K6LA 5KIXA 4HEDA 1VZ7A 3T51B 5I2XA 4XQNA 4K5VA 2N9LA 4WIPA 4C56C 1I6VC 1XYIA 3PZ7A 4D2KA 3WOEA 1D6EC 2N7JA 4BY1B 4HR7B 2EYOA 3BDCA 1YJIA 2PZUA 1F2RC 2K04A 2B2UC 3EGRA 4DK0A 4CJ0B 1V43A 1HTLD 1SEBD 3VR3A 2RQXA 2R61A 3S2DB 3NBHA 1AP0A 1ILQA 3D4RA 1E0ZA 3CKIB 4XDDA 1TKEA 2JSVX 2Q8IB 2B2VC 3TP7A 3TUOA 2Z4HA 3I73A 1Q1BA 2MUYA 1PFDA 1G2TA 3QOLA 1V8CA 2AWOA 1GOZA 1BR9A 3MJ5A 2CJOA 1YQ3B 1KNAA 2RA4A 1KFYB 3VR8B 2J7ZA 2L55A 1H9JA 1WVLA 3GS2A 3BYTB 4O1NA 3H91A 1BUIC 2W82A 3E0JA 5BMIA 2NYZD 3AN1A 3GD7A 2KVMA 4B0EA 3J9CA 3SK8A 4F8MA 3DWQA 3NWTA 3M85A 4RGNA 2E2DC 2KECA 4DN4M 1H9SA 2E2JB 2FMMA 1V1PA 4PQXA 1QOHA 1HQMC 3W3AA 4ZHOA 1BDOA 4ZK9B 2KMMA 3ZJUA 1ICWA 2K32A 3J81L 2YU9B 4C80A 3D4DA 2PIAA 2IL8A 5JEAH 3NVWA 3ITPA 4OIJA 1JC7A 5JAVA 1TT2A 1RYJA 5C5MA 1R4PB 2XN9C 4IKGA 4FF3A 2V3NA 4Q2JA 1KNEA 1YNND 2HCIA 5IIFA 5IGBA 2RSOA 2JXMB 1PUTA 4JX1C 1PMRA 3TP5A 3VA5A 4N9TA 1Y8PB 1HFNA 3LXFA 2H4OA 1FD6A 3E5SA 3G7LA 3IFTA 1HA6A 1FMAD 2JWUA 3WDNA 1TWGB 1VMPA 3AE6B 1H9SB 2I07B 4C3IB 4ILWA 3HOVB 2IW3A 1YQ4B 3CWIA 4L8JA 1PDXA 1DOYA 3D8GA 4YTMB 5EPLA 3VR5A 4M8AA 4PMBA 2WXPA 3MXUA 1JOQA 4IFDH 3FDTA 2LMCB 5E6JA 3TDQA 1STHA 4DK1A 3EFXD 2ZW1A 2AX5A 2AUJD 1I7HA 2K5PA 3IXSA 5JEAJ 3MVVA 4RWSC 1N60A 2F0LA 4CBVA 1NYQA 3KLSX 1PZKD 2K28A 5C3WA 2QJLA 5EKLA 2J42A 1PFMA 1DM0B 2HDLA 3RUZA 3NE5B 5IODA 2EJGC 1ZPSA 3NZ3A 2BE5C 2A6ED 4YWGG 2DYOA 1P7FA 5I4DA 3VRBB 3KWLA 1KTKA 3NP8A 1EZ8A 2AUKA 3I70A 1C4QA 2F0WA 2PQEA 2DNCA 3U9SA 2FBWB 2SDFA 3V96A 3K7AB 2B63B 4A3DB 5D3IB 1TVXA 1L0XB 3WOFA 4LTUA 4XTCS 1F2RI 1G91A 5IT9E 1B2TA 1STYA 2SAKA 2IX3A 3RZOB 1I6HB 3MZ5A 4PT5A 1BCPC 1GJXA 2WXGA 1EY5A 1XLPA 2MHVA 4A9AA 1O7ZA 3I91A 3K5LA 1WTRA 1DOKA 2G9DA 4A6QA 2RVLA 1Y1WB 4YSXB 3G6JB 3AE2B 5BYQA 2F3VA 2WV6D 2F0KA 3I4LA 2BT6A 5M3MB 2MGSA 4OHJA 3U9OA 1PGXA 2H1EA 2NVXB 2MJDA 2F0SA 1JICA 5FK9C 1OXUA 4A3FB 2IJ0A 4K2LA 1WTQA 2B2TC 3QG1A 5JXVA 1YN4A 1F2LA 1AZQA 1WYGA 4NAMA 2BB6A 3RFZB 1FGBD 3S16B 4OVZA 1JQ4A 3T4AC 1PTOC 2KA7A 3OOCA 4YSYB 3HEJA 1ZXHA 2W55A 1RHPA 2XWBB 2H88B 1PTOF 1W6JA 3VR2A 1DJRD 3MXGA 1JE4A 3B2GA 1SNOA 2JSOA 4ZRZA 4XQJA 1M8AA 4LK1C 1NI3A 3KLRA 2L1BA 3RZDB 4ZHPA 1VZ6A 1OQQA 4BS9A 1C48A 4CKBA 4ABNA 3ZQ4A 2K5QA 3OIPA 2BDOA 4G7OC 4KMUC 3Q8CA 4YXDB 3BK1A 4KJOA 1GHJA 2MJ8A 1NVID 4QUFA 2F0DA 1WXQA 1PRTD 2R6GA 3DEOA 1KRHA 4RF1A 1MI2A 3HP3A 3W5VB 2XRQD 4RA8A 2FFKB 1EU4A 3NWSA 5G5GA 1KABA 1EU3A 2I2YA 4RCNA 4XT3B 2J53A 1LLRD 3EUB2 4TQ0A 1ML0D 1OXSC 3I72A 3NVYA 1JB3A 1CA5A 1K8OA 1Y56A 2NTSA 1E9MA 3C1FA 1SMYD 2DN8A 4TQUS 1EEID 1IKMA 4IUVA 3N6RA 2SOBA 1ROEA 1XLQA 4KX6B 3H6MA