1SBBB

T-cell receptor beta chain complexed with superantigen seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (14.3.D T CELL ANTIGEN RECEPTOR)
publication title Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 66
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sbbB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sbbB02
4RHSA 1LTGD 4K6LA 1XTCD 3R2IA 4DXFA 3V05A 1FD7D 1STEA 2SEBD 1D5XC 1BXTA 1LT6D 1S5ED 1SXTA 1PTOF 4RFBA 1BCPF 2XRSD 2NTTA 3BVGA 3SEBA 3W2DA 1TY2A 2AQ1B 1TY0A 1FNWA 1LT5D 1TS2A 1I4PA 1PZJD 3BZDB 1RCVD 4RGNA 1EEID 1S5CD 1JWSD 1ET9A 1CQVA 1LTSD 1PRTF 1JWMD 1RF2D 2TSSA 3OWEB 2ICIA 4L63B 5FK9C 1PZID 1LLRD 1YN4A 4Z9CB 1PRTC 4O1NA 1KTKA 1SE3A 2XRQD 5ELFA 1PTOD 1SJED 2QILA 1BCPD 1I4QA 2RDGA 1D5MC 4RGMA 1QILA 1LTBD 2O2LD 3R2TA 1FNUA 2G9HD 2IPKD 4L6TB 1EU3A 2IJ0A 3URYA 2WV6D 4UDUC 1PTOH 1B1ZA 1JR0D 4NZLB 1MD2D 2XNAC 1JQYD 1G8ZD 1HA5A 1GOZA 1LT3D 1HQRD 1UNSA 1EFID 4TSSA 1D6EC 3R8BA 4RHRA 1KLUD 4DXGA 1LT4D 1JCKB 1I4HA 2NTSA 3MFGA 1I4RA 1V1PB 3O13A 1V1PA 1D5ZC 5ELEA 4BWGB 4ZYSA 1FGBD 1AW7A 1DJRD 2QEJC 1CHQD 1PYWD 1XXGA 1YN5A 1EU4A 2CHBD 1EWCA 1F77A 2XN9C 1FNVA 1SE2A 3BVMA 3BYYB 3DWQA 1M4VA 2AQ3B 1SEBD 1SJHD 1L0XB 1PTOB 1BCPB 1S5FD 1UUPA 1AN8A 1YN3A 4C56C 1CK1A 1B44D 1PRTD 4RH6A 1LO5D 5D3IB 1CT1D 5TSSA 1HTLD 1KLGD 2Z8LA 1SE4A 1EEFD 1LTTD 3GP7A 4RCOA 1HXYD 1JWUD 1LTID 3EFXD 1S5DD 5ELDA 1LTAD 1TS4A 1S5BD 3EA6A 1PRTB 1PTOC 2RDHA 1BCPC 1RDPD 5FKAC 1T5XD 3BVZA 1LTRD 5ELBA 3BYTB 5ELCA 3DWPA 1SBBB 4RGTA 3TSSA 1I4XA 5D3DA 2AQ2B 1ENFA 1RD9D 3DWAA 5I4DA 1V1OA 3KLSX 2R61A 1PZKD 2J4XA 1TS5A 1TS3A 1ET6A 1L0YB 1I4GA 3CHBD 4RGOS 1ESFA 4OHJA 1CHPD 3MC0B 1DYQA
chains in the Genus database with same CATH superfamily
2HQLA 2HJ1A 3T4AC 2GBRA 5CMDA 2Q8RE 3AE5B 3UQBA 3FPUB 1FM0D 4XQNA 2E2JH 3M4YA 2WXPA 4NNJB 4K2LA 2JRHA 1HNWL 5G5HA 4OVZA 3TRZA 3MAQA 1PFDA 3ENEA 3Q3JA 3KF6B 1DOIA 1WMHB 3JW0X 3O65B 1MHWC 4MJSB 4OL7A 5CHFA 2EYPA 4ZDVA 4L5SA 3K7AH 1QVCA 2I5MX 3K5NA 1FRDA 1L1OA 2BCOA 4HDOA 3ERSX 3C46A 3B1LX 5E6JA 3M7NA 4DK6C 1MSGA 1U4AA 2F0FA 4JPBW 4RKLA 4DDID 4K2KA 3L2PA 5DNFA 1GB1A 4K14A 1RF2D 1PRTF 5KHQA 2K5DA 4C3IH 5C4HA 1LLRD 3SFEB 1IL2A 3NUCA 1C76A 2DZIA 1Y1WH 4F88A 3RNGC 1TWAB 3CCVA 4I6LB 4K7WA 4DNRB 2DHZA 4DR5L 4LUZA 2PCFB 1ONLA 4R4CA 4QY7A 5IWAQ 2O4XA 1MKHA 2YU9H 3G6JB 4IJHA 2IPKD 1MBYA 4L6TB 1V9PA 4DV2Q 2ICEC 1KAAA 1WVLA 3DEPA 2ZTEA 4O2DA 1KD1C 1UE1A 1FMAD 2IJ0A 4DK0A 1JMLA 1L4ZB 2N9LA 4K7SA 3VYSA 3ZNZB 1SSOA 4B9XA 2C7HA 4CO7A 1RL2A 3CIRB 3MXGA 3OWFA 3P1HA 1N33L 1XX8A 1GOZA 3E0JA 1W6KA 2HUGA 3HOWG 5GAHC 1E3PA 1VQDA 4GNXC 4EFOA 2YLMA 4KD3A 1CA5A 5EDSA 1WR6E 3CSTA 4ZYSA 4IFDJ 3HZXA 5LL6X 2NVXH 5EAYA 2PW7A 3GTJB 2EKIA 3N3KB 3Q3NC 2N88A 2MP1A 1K8AC 5I2XA 3AM9A 4ILWA 1DJRD 3EJIA 3KQ4A 3I4NH 3KW5B 1HTQA 3S2HH 1NTGA 2E3TA 2YEPB 5EPKA 4JYAL 1B70B 2CHBD 2ZT9C 1F77A 4OWTB 3CCEA 1JE5A 4XT3B 4DUZL 1K0RA 3J81j 2PPBC 3M4OH 2V1YA 3BVMA 1A8VA 5KGUA 2WXHA 4BA1I 3QK0A 3H0GG 1SMYD 5IODA 1VZ8A 2O6VA 2KNBA 2PVGC 2F0OA 4PYUA 4JBJA 1HUNA 1CA6A 4CQNA 4XZ4A 4C56C 3ULJA 2R7ZG 1H9MA 1YJ9A 1HNXQ 1SNOA 4LJZC 4PZ6A 4LDTB 1B7YB 2L55A 1I50H 2NBFA 4LFAQ 4UY8C 4M8MA 1CKOA 4YT0B 3R7QA 4BKSD 4IO9A 3SFDB 2ZTDA 4P75A 1ZOYB 4ZRJA 1SE4A 2R92G 1Z2MA 1FFUA 3MJ5A 2VNUD 1E24A 1S72A 4KMUC 2ZM6L 2K8BA 4LNNA 4OWWB 3A9JB 1ESRA 1E0ZA 3L4PA 2NPTA 1KAWA 2KT7A 2RDHA 5IE8A 2CJOA 4DV4Q 5JJLA 1T5XD 2INNE 4NW2A 4CDDC 1UE7A 2W3RA 2I5LX 4RCNA 2RHSB 4DV2L 3AE7B 1STHA 3KLWA 2JYEA 4GLVB 1K8GA 4DR7Q 4K1RB 2FXQA 4IOCA 3ER0A 2DAJA 1WFYA 3SK6A 2F0GA 3AE2B 3J9CA 1E90A 2CHZA 3Q22A 4WAAA 1WTQA 1TR5A 2R93B 2GI9A 2WU5B 5JJIA 4IKGA 1PFMA 1WGKA 2IGGA 3R2IA 3N1ZC 1ZDVA 4GN5A 5A2QL 1TWAH 2F3IA 5HFYA 1F2RI 1BF4A 4RFBA 1S5ED 1KF6B 3PUZA 4DUYL 1QOAA 2KFKA 5C23A 2JA8B 5E6PA 1FXAA 1ZE3D 4F8CB 2A69C 4S3SA 2UXBQ 3FDTA 3I73A 3EQLC 3B0AA 4R9WA 4DV6L 2KDFB 1ASYA 3CC4A 3A1QB 3ICEA 1YEZA 4JI8Q 1C3TA 2E2DC 2AMCB 3VTUA 3W9CB 3JAML 1JWSD 4P72A 1A6XA 2VRRB 4B3SQ 2WWZA 1YN4A 3IAS1 2V3SA 1F0ZA 4R3DA 3H91A 1XLQA 3TN2A 5JHAA 1SE3A 1YX5B 1BCPD 3GTJH 4OGQC 3AEVA 4GSWA 3PO3B 2CS4A 5CGKA 2J52A 2NZOA 2ZVOA 4FF4A 4KKUA 2F4IA 1FCCC 4HEA1 1LTBD 3AU4A 3AE3B 3ZTDA 2G1EA 4YCWA 2KA7A 2WXMA 4DV4L 1T3QA 2INCC 3MC9A 1GHJA 3QAQA 3RD2A 4YXDB 2NS5A 4TKOB 3UDIA 3NRZA 1C9OA 1NMGA 4GKKQ 2RVLA 3STBD 1A2TA 1SNQA 1V8CA 2PZUA 1FR3A 5HGTA 4UP9A 1GUOA 5HY6A 2KOLA 5I2YA 2B76B 4KN4C 1GUNA 3C0RB 3DCGA 4WH4A 3MFGA 3ZVVA 2JYTA 4XT1B 4YHHQ 2DJFC 2IY1B 2JVCA 2WXJA 3L0OA 2Q8IB 3L10B 5CHVC 2LMCB 4NAWB 2QCPX 2OTLA 3HVZA 5CBAE 4CGYB 4A20A 4IWQA 2N1VA 2JZ3B 2KEDA 5DEHA 2M17A 2AQ3B 4IJLA 1PTOB 2D11A 1EL0A 3M95A 5FLXL 3ECIA 2GA4B 2IX1A 1CTMA 4JI8L 2KAJA 2F4VL 1PH7A 3ZXRA 2ZXRA 1JRUA 3JSVA 4IM3A 1YJWA 4A3LH 2R93H 4V190 3ZO5B 2L7RA 3VR9B 1F2ZA 2W9NA 3EHVA 2KTRA 2NVYB 4L8JA 1E6EB 3AEEB 2X69A 3QCAA 1ZYRD 2J7ZA 3TZUA 4C1NK 5C0XI 1C1YB 1N60A 3DUZA 2W54A 2JA8H 2Z4HA 1GB4A 4IUMB 1CI3M 4BXXH 2YTXA 4XYOA 4DV5L 3NXWA 1FJGQ 4ASWC 1NI3A 4HSVA 1V2YA 3A8KE 2INDC 2L1BA 2VQFQ 2QKIC 5D65A 4JX1C 4AUQC 1XD3B 2JU6X 1TIID 1CZWA 1V1OA 4N8X1 1EO6A 2PNHA 4YIJA 1G51A 1TS3A 5GADC 1PH5A 1EIGA 2LGDA 3IL8A 4RHRA 3MC0B 2KDEB 4UP8A 4IOAA 4GN1A 5CTRC 4AWJA 2E5LL 4JVZA 1E1TA 5IKCM 4A3CH 3QWNA 3V05A 1HFNA 1N61A 4G50A 3PO3H 1J8IA 3I5JC 1UELA 2XRSD 1VQBA 4A3PA 2K25A 4HDQA 1VF7A 1GD7A 1N9WA 2KEEA 5JOBA 2ZCBA 5EPJA 3QJZA 4N6EB 2FFKB 4NDXA 1PLFA 3UIOB 2KCTA 4TQ0A 4AJWA 2F0EA 5D6JB 4PZ7A 2BKRB 4LF5Q 5FO7B 3SE0A 1ROEA 3U30A 4ZLTF 1RIPA 2F3WA 2YYZA 4JCVE 2K03A 4KHVA 2IX3A 1PVOA 1XNRL 1H9SA 4RKBA 1YQ4B 1F9SA 2BE5C 4R4OA 1PZID 5KNBA 5BO4B 3DOWA 2N9KA 4K3CA 4QIWB 2OJRA 3VUWA 4DBGA 2KVMA 4QMGA 4QUCA 4TV3A 3E9IA 2B2YC 2LKVA 4RGMA 4GNXB 4IWPA 4MH0E 4B9KA 4GMVA 3DVGY 1AWDA 2CFMA 5C3XA 5C44B 2BYFA 5M3FB 2O6VB 4JI6Q 1UWMA 3PZDA 5JH5C 1PTOH 1B1ZA 4NZLB 2E74C 2J0KA 3VYTA 4DGZA 4HJGE 5IP4D 3QOJA 3SD5A 4DHZE 2Z9HA 2HD5B 4KGRA 2RSOA 5C4XG 2RPQA 4MGKE 2CHWA 4HPPA 3CC2A 2NVYH 4Q5VA 1J5EQ 4LK0M 2DBYA 2WX1A 5J3BA 1SNMA 4WURA 5AZHA 1D2BA 3UI2A 3SK8A 3R3MA 1E2WA 5G5GA 1MHXA 1PH2A 4M8AA 2JA9A 3K57A 4OVVA 1PDQA 2KLGA 5LMUL 5EKIA 4EGVA 4W9LA 4K3BA 4E71A 1FYCA 3NOBA 3RN5A 2CU1A 2YV5A 4PMBA 2M0XA 2DYMA 4B08A 2DENB 1AN8A 1IYUA 2MBOA 4M0WA 4BXXG 3MEHA 3VYRA 3E6ZX 2KHJA 4IG7B 3A8JE 1SYBA 1IBKQ 4QJFA 4G0NB 4LK1C 4DV7Q 4X57B 5C0XH 2HT1A 1KLGD 3NSWA 4LFCL 2XK5A 1VQMA 1EIFA 1T6BX 2M56B 4DV3Q 1K3RA 4QB4A 3TEHB 3K58A 5DPWA 1S5BD 3SGIA 3RNBC 3U2SC 3F2BA 1ILPA 1GC7A 4OELB 1K51A 1F9RA 1A63A 2GVAA 2BS2B 4A3CG 3CCQA 1J7AA 2K39A 3GZNI 3A4RA 4TVAB 3PO3G 4AP4C 4EZLA 4N59A 4JI6L 2C7MB 3P1MA 4X3SA 4HCEA 3IVFA 4C80A 4GOPC 4DNTB 1DOYA 3H7SA 1S4ZA 4S0RA 1SF0A 2XVSA 2AWOA 4IQZA 4II3B 2NCNA 1E22A 4RM8A 1SR3A 1C77A 2WS3B 4OVUA 3I55A 5IYDH 4X64Q 3N52A 4ABNA 3ML9A 2D0PA 1J6QA 1IUEA 1Y8RC 3A8IE 3AU5A 1VJKA 1R4PB 1VQLA 2LXAA 2N9EB 4HVBA 4XQQA 2EYJA 4HIMA 3L08A 4NXML 4WJ3M 1SIJA 1KQSA 2AX5A 5C44H 2V9HA 2IGDA 3Q0AA 4HJKA 3I72A 4JI0L 3K0XA 5M3FH 4DPGA 4USAA 4AOFA 1XCTL 4C4VB 4DR2Q 1EUVB 5JHBA 2JRIB 2CWPA 4HR7B 3D6WA 1RCVD 2F0SA 2K5QA 1KH0A 1YHAA 4CJ2C 3UIPB 2K5HA 2OCEA 4GDKA 1X3EA 4A9AA 3J7AV 2ICIA 1TWCB 2KWVB 3H3VC 3M4QA 2DLBA 2L83A 4FADA 4CDFC 1VQ6A 4EQ5A 1YOVB 4A93B 2H89B 1TVXA 2LVQA 2B29A 2DZJA 2V3PA 4DV3L 1QILA 2C9OA 2I0QA 2ASBA 2MBEA 1C8CA 5LMNQ 4ZRQA 3HM3A 4E3CA 2DNEA 3PUYA 2B2WC 2LGIA 1NE3A 3MHSD 4W9DA 2M00A 5FJ8H 4LF6Q 1LM0A 4Q2JA 1ISNA 1WTXA 2B2VA 4ICVA 1STAA 5C5LA 4PG3A 1STGA 3AYHB 4A6QA 3HRDD 2EY2A 2FAZA 2DY8A 3L17A 2WDRB 2B2WA 4DR1L 2ZW1A 3JSVB 4JL9A 5M9OA 4K81A 1V43A 3RZDB 3APFA 3I7FA 3A56A 2OEDA 3Q6BA 1QKZA 4X64L 3OW2A 5E1FA 4A3MB 1NBWA 4LNFA 2JXMB 1WXAA 2KHIA 3LB8C 3VH3B 1RFAA 2CCZA 1N36Q 1PYWD 3BZCA 2R7DA 3OMGA 3PRPB 1C4QA 4LUVA 5K36H 1ICFB 2KYWA 4URKA 1EWCA 1O80A 3TZDA 1GKHA 4OX9L 4HEDA 4LWCA 5LLIA 1SAPA 4DR2L 3S1RB 1EFWA 1I6HB 3BDCA 4CDEC 4KIKA 1XCQL 4LLGM 4RMFA 4NAMA 5IGBA 1YNJC 1QZGA 5AZGA 3ZW3A 1JROA 3OG5A 1E7PB 5D3IB 4G7HC 2E6XA 4OEMB 2KMAA 4LFBL 4I6PA 4LJOB 1EY5A 4US8A 2DJGC 4W9CA 3E56A 3WA0A 4AYBG 1HXYD 4L23A 1EQTA 4CHTB 3EFXD 1WX9A 2I46A 3KOJA 1OTRB 3B08A 2HHHQ 4NXNL 2NBUA 4A3IB 1PRTB 2QA4A 4PK1A 3X23A 2WP9B 4BBRB 2JN4A 2NUCA 5CR3A 5IYDG 4A3FB 1XLOA 1KDAA 2OWOA 3V61A 2HCCA 1U4MA 2KHSA 5CV8A 1WE7A 2LZ6A 5F2DA 1UWXA 5C44G 2OF1A 2K33A 1WTOA 3R93A 2KDMA 4O42A 3PIP3 1W3SA 2KQ7A 3DVNU 5M3FG 1JC7A 1TWCH 2VY3A 1XPRA 3GTOH 2D62A 1P9DU 4F8MA 4K6LA 1RHPA 5IYCH 2B2TC 4A93H 3D4WA 4NPSA 3CPWA 2UUAQ 4WJ4A 3LXFA 2G9DA 3VR5A 4M8NA 1I94Q 1SNPA 1EY8A 1CM9A 2VL6A 1IBMQ 2WACA 3NTHA 3SVMA 3CMMB 2HQEA 3FVQA 1BVSA 1TY2A 2B2TA 2LGXA 2RSUA 3HP3A 3L9AX 4GKJL 3K5LA 4JIOU 4GN4B 1QJOA 1RJTA 3BZDB 3N1YC 5JPMC 2F0LA 2A19A 1CQFA 4DV0Q 4HROA 4MELA 1LGRA 2F0KA 2EYFA 4MTKA 2O2VB 2EELA 2TSSA 5I9OA 3RZDH 2MSED 1TZ1A 1L6VA 3J81L 3IT4B 1KHIA 3QARA 5EE9A 3PUVA 1ENAA 2Z6BA 4A3KB 3KF8A 2ZXOA 4A3MH 5FR6A 2XTIA 2WXNA 3DLLA 1YD8U 4A3BB 5AJ3L 3IKJA 3N1XC 4KV6A 3A7AB 3SHLA 4KHPQ 2WDVB 4K8JA 1EWHA 2MJEA 1FNUA 1IYVA 1WXQA 1EU3A 1DD2A 1UGMA 3DPDA 3Q3FA 4JWSC 3AEFB 1BUIC 2X6GA 1VMPA 3ND9A 1HZ5A 2F0VA 2PI2E 2MJ3A 4QGUA 3S1RH 1I6HH 1HR0W 4DAYB 3PTFC 4M0WB 1YNND 5L83A 2LHDA 5K36G 3FILB 4UP7A 2PEAA 1F2LA 4DHJB 3HG9A 3N20C 1JICA 3KBXA 1GUWA 3N32A 4EZJA 1JCKB 4F7ZA 4RG1A 3O13A 1SFOB 3ERQA 3S1NB 2KWUB 5EBCA 2GOWA 1YIWA 5KEEA 1JOOA 4J6HA 1UAPA 1XPOA 3RLOA 1C48A 2EYMA 2R2QA 2VH2A 2F3VA 4WJWA 4A3IH 2QEJC 4JW0A 1XXGA 4KKSA 1EU4A 4BBRH 3GD7A 1R4QB 4A3FH 5KNDA 1JWBD 1QLBB 1FNVA 1M4VA 1TJEA 3MXUA 5CV5A 1SJHD 4NKLA 2XGTA 1EOTA 2F0HA 2SDFA 2EPBA 3I3CA 1F2RC 1YMHE 4A90A 3J80i 1STYA 4DA2A 1Y8OB 3LWUA 2GBNA 3N6RA 3ONAB 4YY3L 1M8AA 2PTLA 1BDOA 1Q0WB 1YIJA 4HLEA 5DAUA 3FKYA 2Z8LA 4GOPB 4GGQA 4HWIB 3J80c 2KN4A 4JBWA 3WCQA 2KQ3A 1NYRA 4II2B 3M4PA 1HNWQ 2I38A 1OXXK 3K0YA 2UYZB 2F0WA 2AUKA 4BS9A 1JJGA 2EYOA 2Q2TA 1HA6A 3RR5A 1VQOA 2N7JA 4RGTA 2B8FA 3H3VI 2FHTA 4JI3Q 5IYCG 4U68A 1I4XA 4A93G 2AQ2B 2IY5B 2PKOA 3EGRA 1RD9D 5LXIB 2LUEA 1GHKA 3HK0A 3AE4B 3ZQ4A 1C7YA 4IPDA 2K32A 4M02A 2LRWA 2FNJB 2O5IC 4GDKB 2V4LA 3DWGC 1HTPA 3M63B 3RNFC 3P7JA 1Q7YC 2LS01 3AI5A 4ZRIA 3VA5A 3E9HA 4MM3B 2R6GA 3TS2A 4FXDA 5LNK1 4A3KH 1FL0A 2JK8A 3Q6SA 2KKCA 4YTNB 1UE5A 2DNCA 3J7YW 4A3BH 1STEA 1P8LA 3C19A 1PFBA 4DR5Q 5ISRA 1YJJA 4M1UB 1BR9A 3J81E 2MA9B 1HZBA 1KL9A 2VS1A 3I70A 4A3MG 4W9EA 4K7UA 1PYBA 3DMUA 4K0KL 3TQYA 1NVID 2K52A 3NQTA 2D3CA 3CD6A 5J2RA 1I4PA 4A3OA 1UEBA 4W9IA 3D32A 2EY1A 4E6IA 2RHQB 1N33Q 3BZKA 2CVRA 3RLNA 4JI4L 2A6HD 2GBJA 3A74A 4LW1A 4A3EB 3PF5A 2KDBA 4IURA 4LAAA 5E4XA 1SFOH 3S1NH 1A62A 1LUZA 1PTOD 1WIAA 2GMIC 1L1OC 3NZ3A 1OEYJ 2K4KA 3Q2AC 1NR2A 1GO3E 3BINA 3PZ8A 4P2CB 3P4RB 3RNAC 3PO2B 4JYAQ 4X3TA 2C5LC 1YQBA 5AZFA 4DUZQ 2OXPA 4QUFA 5FO9B 4ZOHC 2KCMA 3V3XA 4JI3L 2JE6I 3S16B 4DAPA 3NVYA 4A3IG 2YTVA 2QCZA 3ZJUA 4EQOA 4BBRG 4A3FG 1EFID 1X32A 3D3RA 1B2TA 1DCZA 1RM6C 2QHOA 4N9TA 1KLUD 2F03A 2K5VA 4IPCA 1DM0B 5K5PA 3D0FA 3NK9A 5C3JB 5JEAH 2JZZA 4EKUA 1VQHA 3IFDA 3RCZA 3DDCB 2ZM6Q 1X3FA 3H6MA 1P16A 2FIFA 1SYGA 3PREA 1V49A 1C9FA 2NVUI 5EBDA 5C0XJ 2DWQA 2WXRA 2BS3B 3A55A 4D2KA 3PPAA 4M01A 5IT9L 2JA6B 2MBHA 4DQOC 3PIPA 4XXEA 3T9LA 2VZKD 3ML8A 2EJGC 3GV3A 2UU7A 2LSSA 4FVMA 2Z4IA 3CCSA 1KC8C 1Q1BA 1Y14B 2FE8A 1K0SA 1WJNA 2KN5A 1MHHE 2K04A 1T0QC 3UDFA 4RA8A 1WGYA 2K9XA 2Z6KA 3NTIA 1CKNA 3RD4A 1K9MC 1WYWB 3DBLI 3T3NA 1QQRA 4P73A 2PZTA 5IGEA 2C60A 3TP7A 1IXRA 3AE1B 1EEFD 3GP7A 2Z0SA 1L0VB 3DBHI 5EJWA 4Y52H 1C4CA 2L15A 5EKKA 5C3WA 3F2DA 2MRPA 5FLMG 1V8QA 3CW2C 1E8ZA 1V9JA 4BKTA 2M0AA 3MHBA 4DUYQ 3UQAA 3H3VH 1TKWB 1KDCA 3VR6A 2Q2HA 4A3KG 1F52A 1MG4A 3DWPA 1AH9A 1IKMA 2EZVA 2Z0EB 3TSSA 1MJCA 2ON8A 2KJHB 2MQJA 4DV6Q 4XIGS 2Y0SG 1IL8A 2PZWA 1WFQA 2LD9A 1PZKD 2J4XA 2MHVA 1SMYC 2L12A 4H44C 1VQ4A 2MEKA 1LACA 3OW7A 4A3EH 2ALYB 5CV4A 3DBHB 2J53A 4ZRPA 3IXSA 3NVVA 3MP9A 4DV1Q 1J7CA 3SDZA 2MJ8A 5JVG3 3MA2B 4B9WA 2NN6I 1ZP0B 2CH4A 3T56B 3W1GA 1D5XC 4FF3A 4HCNB 4WIPA 1BOSA 1NMFA 3VR8B 5EGTA 3H94A 5KRUA 3S14B 3PO2H 2Z1CA 2ZZPB 3B2GA 4WJNA 1RRBA 4BKSA 4FF1A 3RN9C 1L6UA 2WKCA 4CKEA 2J42A 3AB9A 3GTQB 3R66C 1E10A 3S16H 4LNKA 2BWFA 4WJQA 2WB1E 2DZKA 3RUIB 3T1YL 4XX5A 4JBKA 1OO9B 3A0JA 4MDKE 1P7FA 3K9OB 5EE1A 1GUGA 1Q46A 4GB9A 1UEAB 4Z9CB 1HZ9A 1FGUA 5IP7H 4PS8A 4ODGA 3E0EA 1D5MC 1E7ZA 3TP6A 3T53B 1F2YA 3B9JA 2O2LD 3I57A 1TU2B 2LUMA 3VXWA 1CZPA 4C3IG 3TIXA 4HIKA 1KRTA 4YTMB 2JA6H 4J8QA 2QDLA 3URYA 1Y1WG 2I1KA 3TP5A 3HOYB 2MX2A 3M62B 3P63A 2INPE 3TMPB 2L00B 4ITKA 2C7NB 3R8BA 1PGBA 3SXHA 2V1CC 4ICUA 4R4TA 2F4VQ 5CHWA 3Q24A 3NJTA 5BMGA 1QVFA 1NR4A 5DPSA 5IT9E 2V0GA 4BY7B 2JF5A 1ZW7A 2EJMA 1GUAB 4DV1L 2LEKA 4P1CC 5T8IA 1D5ZC 4NMZA 2A69D 2KK8A 4DHZB 4HJ5A 1HQMC 2EE1A 1R4NI 3NVWA 3DBRI 1N62A 2B2UA 1CMXB 4PS7A 4KX6B 3QHTA 4JK1C 4DV5Q 4P6VF 1KFYB 4YSZB 3IFTA 2TMPA 3IG3A 1PMRA 1TWFB 2ENBA 3TMEA 1VR9A 3JYUA 5JZEB 4IPHA 2UUBL 3J7AF 1VZ7A 3S15B 1GVPA 3I4NG 1P3QU 2IO1B 4ZUIA 2KMCA 1FFVA 2VQEQ 1KJTA 3ABVB 1LO5D 3TDQA 2JQOA 4TKNA 4BA2I 2E5LQ 5TSSA 3KLRA 3NS8A 2PI2A 1T9HA 2LXKA 3TBLD 3ZKJC 3TEWA 1QF6A 4RCOA 1R4NB 2BB5A 3NZUA 1HNZQ 4A3EG 3DHIC 2IDYA 4HPMB 3S14H 3NENA 3VAWA 2BH8A 3KUPA 4FXGC 1PH8A 3HOVB 1NENB 2L5TA 1FXIA 4KDIC 2GN5A 4OONA 3TP8A 1DGSA 1KRHA 1NYQA 3GTQH 4RWSC 1WJ6A 3NG0A 2W82A 4FP5D 2JEBI 3CC7A 2LASA 1Q3LA 1BO0A 1TS5A 3BJUA 3ZJYC 2K6AA 3HOZB 3PO2G 1EIYB 4AQYQ 1NEKB 1T0SC 4TUUA 2PYKA 1CHPD 4HIOA 1F1HA 4KK7A 1PQSA 1XNRQ 3IRBA 4G11A 1HZAA 2MH7A 1GG3A 4EE2A 1EY0A 2PMVA 4WWOA 2VZAA 1N8RC 2H88B 1EY6A 2JEAI 1EWYC 3B6YA 1PYSB 4FDBA 2SEBD 3A5UA 2LVPA 4NP5A 3E9SA 2IBIB 1ZYRC 1Q81C 1MGSA 2L76A 2FCNA 2O5JC 2WX0A 2OQ0A 3BVGA 4POFA 1WXMA 3OHXC 2CKZB 4KD4A 1L1OB 1FNWA 3FKIB 5IP7G 1EZ6A 3HOYH 3RULA 1H9RA 5A2QE 3U4ZA 4XWWA 1VMCA 3PT2B 5HG2A 3JAMi 3P42A 1ZXHA 2B63B 2G4DB 2EDGA 3AFQA 1BKBA 4C3HB 2VQEL 2JA6G 2K28A 4L63B 4BY7H 2BWES 3TL5A 4XC2A 3RZWC 5CV6A 1PRTC 4DU9A 3T16A 3PGZA 3ZYYX 2L52A 2PLPA 3GTGB 4YWKA 1I4QA 1RTOA 2HDEA 5AUIA 3L13A 3DXJC 1YHBA 4C1NI 1WGHA 1TWHB 1HNZL 2X6LA 1GJZA 3R2TA 4JWUC 1RODA 3FHWA 3SK4A 3JAME 1E9MA 3DHGC 3ZNGC 4GOCA 1RWSA 2WFWA 4KTAA 2RSNA 5LMUQ 3H9DA 1X9NA 1V6EA 1TWFH 3CCLA 4B3RQ 3T1HL 1Q1OA 2KVZA 3S15H 1XEEA 3CRKC 2CQAA 1LT3D 1CKNB 3ULLA 3CXCA 4IFDI 1LFDA 4AQYL 3DM1A 3I3TB 3K5MA 1FEHA 5D7GA 4NJ7A 2ATWA 2MGSA 2J0MA 1DOKA 4LFCQ 5JAVA 2MP2A 1OQYA 2EYLA 3T51B 1MJEA 1A0IA 1AW7A 2BGFA 1Q8IA 3PV1A 2KENA 5HURA 1MG8A 2VW9A 3HOVH 3OYYA 4C2MB 4EQNA 3GE8C 3DQVA 2JYOA 2XN9C 1EF5A 5JJZA 1Y56A 4WJOA 1SIFA 3VHTC 3UF8A 2D9UA 1SEBD 4A3JB 4DK5A 3HS0C 1I42A 1K8MA 4H0LC 1ICWA 3HOZH 2N49A 3F8TA 3I4LA 2K1FA 3OIPA 3ZDTA 3F2CA 1HH2P 1IYJB 3D4DA 3CCJA 1WSPA 4JGHB 2ZEQA 2E76C 3D31A 3SK5A 1VCIA 5IGDA 1D3ZA 1JWUD 2ZJDA 3ZDMC 2PVOD 3Q3MC 2Z59B 2EY5A 3N9YC 1T0YA 1PH1A 5FLXE 3FEWX 3MFYA 5CV7A 3KYDD 2NPTB 4NXMQ 5IGCA 2EXZA 3KH0A 5AUKA 3ZJVA 3AEBB 4A3LG 2R93G 2REXA 2HDMA 5J1ZA 3K6OA 2BYTA 4JI0Q 1K3BC 4DNIA 1VQ9A 3FKIH 1F9QA 2NZ1D 1A2UA 2GVBA 3I90A 2XEWA 4HK2A 2EIFA 2Y5PA 5E6NA 3OOCA 3EROA 4B3RL 5M5XB 3L0WB 3Q8DA 1F2MA 4WWPA 2B63H 1L0YB 1D1KA 3I8ZA 2JA8G 1IHZA 1NUCA 4C3HH 2J7QB 2VB3X 4KKIA 4IUVA 4W9GA 1VZ6A 3HOYG 4IALA 4H2AA 2UUCL 2ZJRA 1XTCD 2K7VA 3ITPA 3GTGH 1OGWA 4IM2A 1XNQL 4BBNF 1LT6D 3WOFA 2DZMA 1TWHH 2KFKB 1MVKA 1FRRA 4BZAA 4DHJD 1XWEA 4BY7G 2KXJA 1JW9D 3X0WA 2JZPA 2FMCA 2A68D 4ZKBB 1FVIA 1NAPA 4L2YA 1ACCA 3I2ZA 1WCMB 4TQUS 1V81A 1VLBA 1PUTA 5I6YA 4PV1C 3AEDB 1X56A 3D6CA 3WWVA 3AH7A 2I2YA 2RPVA 4DR1Q 4L1BA 3CPFA 2K5WA 1GXDC 1QOFA 1P7EA 4I7AA 2SAKA 4B3TL 2KACA 3T8MA 1WWTA 2B3GA 2PQAA 2BA1A 2H5XA 4WRDA 3BDOA 2BKFA 2KOXA 4OW0A 5C2TB 4DKAC 2N7EA 2PW9A 4B3ML 2JJQA 3AFPA 4BY1B 4N9F4 4MTNA 1O7YA 3U9SA 4PS3A 3U7DA 2A5UA 4C2MH 3GZNB 5GXGB 4IUTA 2DAFA 1H9KA 1EF1A 1A15A 1X55A 2BDOA 5JEAJ 1FIQA 4A3JH 4OX9Q 2DGYA 5J18A 4KSLC 1UWVA 4OZCA 3Q8CA 3U58A 3TS0A 1YVCA 3HOVG 1VQ5A 2FJ2A 1EQQA 1WZ3A 2KMMA 1JE4A 5KNCA 1AZPA 1D7QA 2LHEA 3N30A 3QA8A 4MGZE 3P4SB 1EYGA 4LFBQ 1WGGA 2MLBA 1WXVA 1V1PA 3GTOB 4DR6L 2RDBC 1WX7A 5ELEA 4FJYA 5GAGC 2MFIA 4FNFA 2H4OA 4DF7A 3CF5A 4JI5L 3CMEA 3HOZG 3RZOB 1OQQA 1N63A 2B2VC 4J3OD 4EZKA 4XYQA 3OSOA 2KECA 4NXNQ 4IPGA 2CW0D 1J7BA 3IT6B 5I9PA 1WM3A 3I91A 2UXDL 4KGTA 3A7LA 5D2MB 1JJCB 4MIUA 1VQNA 1HJPA 3VH4B 1BBWA 2IHFA 3GB1A 5DCNA 1E7UA 4QCLA 5M5XH 1PFNA 2LI5A 3WDNA 4US9A 1X1MA 2WP8J 5COYA 4ZUJA 4R4IA 2QF7A 2A6EC 3ZJTA 2CQOA 3FKIG 3KYCD 3GTMB 4HRSA 3AQQA 1STBA 4IUNA 4OO1I 4P16A 1XMQQ 4ZYNA 2KTRB 3HKZE 1HZ6A 4A75A 4TQ1A 2B63G 1HTOA 4I7ZC 1IPGA 2BB6A 2WXIA 4DDGD 1PH4A 5M5YB 3GO5A 2L11A 3EVQA 4C3HG 1K28A 4J15A 2KWCA 1LYLA 4X66Q 4AYBE 3CU7A 3BVZA 1QZHA 1BT0A 5A35A 5ELBA 5C0XG 4KJNA 2D10A 4PNYA 5GROA 2ZXPA 1WCMH 2QDFA 2ZPNA 4J6IA 1EY9A 2A74C 2PIAA 4ZAIA 2MBBB 3RI7C 4GKJQ 1WR1A 2F0IA 3KLSX 1WXSA 5KYLA 1TGZB 3AE8B 2C35B 5M3MB 3DVGX 2J0TD 2GLSA 4W9HA 3KLSA 2RR9A 2HTHA 4A55A 2L05A 3A4SC 3KJPA 3ZIMA 2IO0B 1VQGA 4OXPA 3M85A 3UDGA 1FD7D 3PF4A 2HIVA 4BY1H 4WQMA 5AJ3Q 5TR5A 1SN8A 3TJPA 4GXBA 3E5SA 4CHKA 2IT1A 2MO0A 1E5WA 1A5RA 1K83B 2ZW0A 2N8NA 2AQ1B 1HPCA 4L5QA 4GLSC 4YL8A 3AV8A 4V0BA 2OTJA 3AE6B 3B2FA 4FN2A 4HKZE 4WWNA 2L0TA 1XF5L 4A4IA 5LMNW 3BU2A 3S2DB 1CUKA 1XLNA 2Q8TA 1IYFA 1H9SB 2D3BA 1P1AA 1WM2A 1XT9B 2KC1A 4A3JG 3X3NA 3CF6E 5IAAC 1OQRA 4APVA 4EX5A 2XRQD 1XMQL 1VS0A 1DOMA 2A1AA 2EVBA 3KBGA 4L5TA 3RZOH 2RDGA 4BVUC 1AYFA 1T0RC 3P2BA 2LRUA 2D3GA 2FUG1 5HHDG 3NS1A 3NBIA 4X66L 3CSFA 4L5RC 4IDIA 1UH6A 4W9KA 1QE6A 3V6EB 4IC7B 3VR2A 4UDUC 3RMKC 5BYSA 3UE1A 4W9JA 2GBKA 1JQYD 5H92C 4GDLA 3H09A 4JOIA 4DFAA 1PHJA 3WAPA 2PPHA 4TSSA 2HJ8A 3APDA 3CCMA 5H8YE 3PLUA 2E2IB 4RM9A 4DXGA 2H1EA 4YY3Q 3K8AA 3GTMH 4X6AH 1I4HA 1Q90A 5FJ8G 3MXPA 4FULA 1KRSA 1IBLL 3P4PB 3MWYW 2ID0A 3U50C 4ZKCB 1I3QB 2ZTCA 3F2UA 2N4FA 1U4RA 2IYDB 1FGBD 1PGAA 5M5YH 4F87A 5BR8L 5CC4A 1JRPA 1HHVA 1TQOA 3HFZB 2DYBA 3KVFB 3U8ZA 4ANXA 4LDTD 3QJYA 1MI2A 3M7GA 5DPRA 1SNDA 3NEMA 4DK3C 2JA5B 3U4EG 1O78A 3PUXA 5G3LD 2BYEA 3SR1A 1L0XB 3RYTA 5M3MH 2NVQB 1NNXA 1L0WA 4JV5Q 1B9MA 2BBCA 1HZCA 4C7ZA 3L54A 4OWXB 1DOLA 4RH6A 1SMXA 3KWLA 4IWOA 2IWHA 1WCMG 1FD6A 1SLJA 4CBVA 2D2QA 2IO2B 1EY4A 2XK5B 1KDBA 4BBSB 1X3GA 5E3FA 4YSXB 4R1JA 3CP0A 3H0GB 2UXCL 4WWMA 1HR0L 2BA0A 1YNTE 5ELOA 1IKLA 2K50A 1AFPA 2JWZA 1PFSA 4MACA 3A9JA 5C4JB 2V4DA 5HI1A 1RDPD 5FKAC 4X62Q 4GZYC 1QZEA 1CJEA 2FUHB 1K83H 4LTUA 1Y69U 4KJOA 1YHQA 2WLBA 4K0KQ 4ME5A 2MJDA 4BY1G 3GTLB 3Q8EA 3P4QB 1U4LA 2EOTA 5EQ0A 2WNMA 5BN3A 5EE0A 1QNKA 5EKLA 5H1SE 1WYDA 1P0RA 4JI4Q 1EWIA 2W55A 3MHZA 4OHJA 3S2DH 4KHZA 4HN7A 4QL5A 2VH1A 2DN8A 4GU2A 2UU9Q 3PUWA 1QOBA 2QC8A 2Z0DB 3OTOL 3GOEA 3TEYA 3EBEA 3Q8AA 4KY5A 4LMQD 2LXJA 1R9TB 1GNUA 3KUDB 4UHVA 3OIQA 1K50A 1VF5C 4F7XA 4EOYA 2KDIA 1BXTA 3KDFA 1FPYA 1BCPF 3MC8A 1IW7C 3K7UC 5E7NA 3VQIA 1I35A 4XDDA 3C1EA 2MPMA 3S24A 1G91A 1TBEA 2ONQA 4J1MA 4ZRZA 4FLHA 5DPTA 1KABA 3AXCA 3KK7A 3K80C 1FXTB 3I9V1 2F0TA 1UD7A 2N7DA 3FC4A 2P5ZX 2AWNA 4H13C 3WAOA 4LCDE 3A1QA 3CAMA 1M90C 1LM8B 2WDTB 1K8RB 3FAHA 4RMAA 4JV5L 2A5HA 3J81i 2E2IH 4GN3B 1ET9A 4RHSA 5L95C 4O0AA 1JWMD 4K5VA 1EYDA 4JI2L 1RYJA 2MW5A 1ZPSA 4YCVA 4BAXA 1R4MI 2V4IB 4O1NA 1I3QH 3QIJA 2WB1B 2QILA 3J81c 3WALA 2WAQE 4FJZA 2CR5A 5LL6S 2PMZE 4REZA 1J8CA 2HDLA 1EQRA 2QJLA 4X62L 3FRPB 2G9HD 3RUZA 2JA5H 5KIXA 3VDYA 1AE3A 2JXXA 2WV6D 3QIAA 1RLFA 4LF9L 1OXSC 1Q82C 1L4DB 3EFUA 1MD2D 5DM63 2NVQH 4HXDA 3LDZE 4XYCA 4GS3A 1TXYA 1D6EC 3OPOA 1R4MB 3H7PA 1LT4D 3CKIB 2NTSA 3NHHA 1AZQA 2UU9L 5IN7A 4OZBA 1XYIA 4BBSH 5ELNA 2MO1A 1UBIA 3AU7A 3H0GH 3WOEA 2HTME 3RPFC 3TUOA 4C7YA 5C4JH 3HOXB 1S3SG 5EPLA 1EOVA 3OLMD 4JE3B 5FR3A 2UWQA 2CHXA 1X3QA 1Q10A 1WRDB 4ZQ3A 1EUJA 4CKCA 3Q14C 2AKWB 5AFWA 1YJ1A 2ZJPA 2EJFC 3GTLH 1MSHA 3PSEB 4HJ9A 4KIKB 5DM73 1S5FD 1UUPA 3WAMA 3RN2A 3X3MA 1RTNA 4I65A 2JSVX 2ACZB 3VTVA 5DLQE 4EUTA 1C4PA 1GPXA 4KZ0A 4ACFA 3HUIA 4NY0A 1N34L 3ZUNA 2D5DA 1HTLD 1Z7TA 1R9TH 1JJ2A 1PDXA 4TRDA 1AEXA 5CORA 1GJXA 1LTAD 2DYOA 2ASQA 2L32A 2SOBA 3PV0A 3QOLA 2AWTA 4CJ0B 2WXQA 3A33B 2FCQA 1ML0D 3BYTB 4JI1Q 1F9PA 4G3XB 3BG3A 2Z6KC 2GRIA 4HMJA 2YTYA 5D3DA 1BNZA 4RNAA 4A3DB 4ZHOA 1W6JA 1ZGUB 4X3KA 3S17B 1IGCA 3K9PB 3LGJA 1MFWA 1YBYA 2RMMA 4PT5A 3CHBD 1ESFA 5J22A 3T1YQ 1N6ZA 2KTFA 2Y0SE 3NBHA 3BK1A 1QNUA 1ENCA 4XDXA 2VXWA 3RNEC 3PGEA 3IAYA 1LTGD 3VR3A 4DXFA 3KJOA 1N32Q 4AQ7A 2XWBB 1OXTA 3PIO3 3CCUA 3OMCA 3VUYA 1IBXA 4AJYB 2D2CC 1D8LA 3UDXA 1XMOL 2NBWB 1WJ4A 2L9HA 5NUCA 4KVGB 3G7LA 1SB3C 2MUYA 3G6EA 3SEBA 3MZ5A 1BUVT 1OTCA 2BF8B 4A3BG 1WX8A 4GDLB 2Y5BB 4HPLB 2JPHA 1KM7A 1CZGA 2BS4B 1YITA 3OJ4B 4HAEA 2AL6A 3DBLB 1G6JA 4P7IA 1GUSA 4DR4L 5FOBB 4RGNA 2B3AA 1S5CD 3Q8BA 3A54A 2JA5G 1CQVA 1Z47A 2F0MA 4KY6A 5IY0A 4XE0A 1Q8KA 1RAXA 3KF8B 2O6VD 1SJED 2AYOB 1PV4A 3U52E 1V1QA 2M19A 1G2SA 1O7LA 5CYUA 2EQSA 3HOXH 4GNXA 3TBIB 1TT2A 1A70A 5IOCA 5CV9A 1W2BA 1WJUA 4NB3A 2K8HA 3ND8A 4BBSG 2NYZD 2KLCA 2N1WA 3CWIA 4JI1L 2OQKA 3I56A 3BWUD 4OZAA 2D07B 2YVCA 4LF4Q 1YNXA 4HJAA 3ULPA 3JC66 1JR0D 3BDLA 4K8IA 2UUBQ 4A3GB 2K01A 3NHEB 1QVGA 5GAEC 1EYAA 1PGXA 3GV6A 3C8YA 1QUQA 1Y8NB 3L3OC 3VR4A 4WQOB 2K22A 1SGHA 3NP8A 3GS2A 3TEZA 4LNIA 1DXMA 1N32L 3PLVA 1FO4A 2WDQB 2W3SA 2AEHA 5BYRA 5BN5A 2CU3A 4MSQB 1YQ3B 2VUMB 5IWAL 1YJIA 4HCPB 2PE6B 1HFGA 4MHEA 1PH9A 3AULA 3NPPA 5C4XB 3PRZA 3H6NA 1Z9FA 1SYDA 1SYCA 2I07B 3QO2A 4AH6A 5JEAG 2NVTB 4A3DH 1OXVA 1E1OA 1I7HA 2F52A 5IT9c 1VQ8A 3DHQA 3S17H 2EYHA 1D4BA 3R7RA 3IAM1 1CT1D 4P71A 3RNCC 2BTEA 4FHJA 5IO9A 2B2UC 4P74A 5HKHA 3DEOA 2AL3A 3KDFB 1UBQA 2KO3A 2IO3B 2L0FA 4DXAB 3EA6A 3RNUA 1BCPC 2HCIA 1AE2A 5L37A 5IYBH 2JQRB 2WB1G 2MHJA 2F0DA 1JB7A 4FBJB 1ZKHA 4LNOA 3AEGB 1G2TA 3HM6X 4LF4L 4QAYA 2WIIB 5GQOA 5JXVA 1QWYA 1ET6A 1J19A 2PJHA 1I4GA 1HNXL 3C3LA 2OOBB 1HUMA 3STBC 4FXKC 4LFAL 2QIEB 4BKGA 2K75A 4OIKA 4X3UA 3W1BA 5I6WA 1NY4A 4B0MA 1UF0A 4IN3A 5J39A 4CKBA 3DBRB 5IOIA 1UE6A 2FIDA 1SYFA 4MGYE 1U0LA 2WKDA 2KCCA 4G4KA 3IFWB 1K8OA 1S1QB 3HEJA 4A8XC 5D14A 5C3EB 2MCNB 4C4VA 3HOXG 3EECA 4FXCA 4ULLA 4DR7L 1Q5WB 2RQXA 3T1HQ 4A3GH 2LWPA 1ASZA 1EQVA 1L7YA 3H7PB 3AN1A 1V5TA 1EEID 3MJWA 4Q0FA 1WD1A 3OWEB 3VUXA 3HRZC 5JJKA 1MJDA 1TT5B 2NN6H 1VQ7A 2NMQA 2RCFA 5ELFA 3W5OA 1Y1VB 1ZXIA 4YWMA 1WF9A 1YJNA 2BDNA 1TZOA 2IGHA 1C79A 2VUMH 4RF1A 2Q2UA 1B3QA 3ONSA 1I6VC 4YSYB 1B50A 2B39A 2UXBL 2X8XX 4GLAC 2IHEA 5C4XH 2K6QA 2PQEA 3AE9B 5C4ZA 1QB5D 1H95A 2QMTA 3ZTCA 2NVTH 3GQBA 1LV9A 4IZ8A 1XJVA 1OXUA 3C2PA 1VQKA 2JXTA 5BMHA 1WY8A 3KUZA 1E8YA 1ZXTA 4KDLB 4HTHA 2KJRA 3U4VA 2BOSA 4B3SL 1HRJA 2NB0A 2ZPYA 1I4RA 2K8CA 4A3DG 2Y5CA 3JAMc 4GIVA 4ZCKA 1J0GA 3SU8X 2MBQA 4HJ7A 4BOSC 4K5WA 2K6DB 1L2NA 3S9WA 3RT3B 2D3AA 5C1ZA 4G57A 3WIMA 1SYEA 3PCOB 3BYYB 1VCBA 4KKTA 3PSIA 3OJ3A 1K52A 3MXNA 4GKKL 2DY7A 2K1BA 2XSCA 3LNNA 1SE9A 2XWJB 3P20A 1PRTD 3NBHB 5IYBG 3PIOA 3W1YA 2E2HB 2Q2IA 1JMCA 2WHIA 1D1IA 3DM3A 4JPSA 4YHHL 2UUCQ 2KWDA 3SDLC 4ARIA 3W3AA 1VQEA 2VZKB 1KLVA 1B4OA 4FHKA 1IBXB 1S5DD 3NWTA 1GM5A 1XNQQ 1LQBA 3ZNHB 1J9OA 2E8GA 1E8WA 3AECB 4XQJA 3BIID 2K05A 1HEZE 3UE0A 1PXUA 5C6AA 2ZVNA 3HKZB 4P1BC 3I4MB 1X54A 3V96A 3G4SA 3PVLA 2OJWA 1YZ6A 1H9JA 1NJIC 2LGYA 5C3EH 2MWSB 3V60A 3VYUA 4AYBB 3NELA 1E2VA 1UZXB 3ETRA 4XGAB 3EN2A 4KN7C 2BE5D 3AMZA 4DWFA 4RGOS 2L1AA 1Q1EA 2A73B 1HCZA 5BMIA 5M5WB 1EZ8A 5FLXc 2YEPF 4B3TQ 1A3UA 4NJ6A 3HOUB 2OHFA 1KXLA 1Y1VH 3K5OA 1SROA 2L4NA 3SHQA 4A3GG 1WE6A 1T5EA 1WH3A 5KHOA 4B3MQ 4QQBX 3HIZA 1KNAA 3L16A 3P75A 1B9RA 1SXTA 3LWEA 1C78A 2LJ5A 1LABA 2RD0A 1NBFC 2WXLA 1K73C 2N78A 1VQPA 1JALA 2NN6G 1L5PA 2GB1A 1FJGL 2LFIA 1Y8PB 2JWUA 3WANA 1X6OA 3W2DA 2VQFL 1QT9A 3CMAA 3H8HA 2B2YA 2RDFA 3ZRFA 5G3LF 3M9BA 4PMCA 2VUMG 3AB5A 1G6PA 4S17A 3PQIA 3PRMB 3KUCB 1QUQB 1GUTA 3J7ZC 3I63C 3RFZB 2KFJA 2O2VA 1G6ZA 4MNOA 4JQWC 4LUOA 5FK9C 2A4ZA 1QOHA 2R3ZA 3DVNV 2F0QA 1S40A 2KVRA 4NQLB 4DR6Q 4ZRKA 5G55A 4YWLA 1NDDA 4PQXA 4JI5Q 2WXFA 1X3PA 1BQQT 2K5NA 4QF4A 2RBMA 3ZLZA 2K3UA 2BW2A 2CJNA 2JX5A 4WAFA 3NQIA 3LX0A 2ZNVC 3A9KA 3RLFA 1VQCA 2UXDQ 2D0OA 2ES2A 4RF0A 2A68C 3DBSA 3RZFA 3EUB2 2M8SA 4DAYA 4LF5L 1B3AA 4MZ9A 1G8ZD 1UNSA 3UI3A 3G48A 1HQRD 3QQ8B 3FILA 4JLCA 2CH4W 3V6CB 1XLPA 2E2HH 3S1QB 2KZRA 4U673 3PHWB 2M2LA 3ZXVA 2HE7A 1PA6A 4ANUA 2N0SB 3G71A 4JBMA 1IZ6A 3HVDA 4BWGB 1NCVA 2KX3A 1XTDA 3BY4B 1TKGA 2Q5WD 3JVZX 1CSQA 4WFN3 3Q23A 2M1MA 3VVWB 2LGSA 3VRAB 3HHMA 1VQFA 3DWMA 4YWGG 2M4NA 1WYGA 3I4MH 2IX0A 3EIVA 2QDBA 5HGQA 4MN3A 3U7ZA 5FO8B 1EY7A 1SE2A 2N9XA 5BYQA 2F1MA 2DNFA 1B8AA 2PO4A 2JA7B 4RAUC 3C1FA 1B9NA 2JP1A 1BCPB 4BFRA 4IFDH 4FF2A 4N9PA 3NE5B 1G291 1YN3A 2K5PA 1CKMA 1CFMA 4I6NB 4EQPA 5E6OA 3QB3A 2MQHA 3TEXA 2OT2A 3T13A 4DAMA 5M5WH 2K14A 3QR8A 2WINB 1P98A 4MSMB 3CCRA 3T3OA 2F0PA 2NBVB 3HOUH 5C3EG 2BVCA 1WTPA 4IW0A 1TKYA 4GOPA 1LTTD 1J5EL 3BS1A 1V97A 1LTID 3UINB 1V5OA 4MH8A 1DZ1A 5ELDA 1DGJA 2QW7A 2IZVB 1E7VA 3H1UA 1Y1VG 5ELCA 2R7FA 1VD2A 2CW0C 1IGDA 2RF4A 2IY0B 1UGJA 4N58A 2G45B 1S3OA 2SNMA 4DN4M 1MI0A 2CWAA 1L2FA 3M3JA 4ZHPA 3Q69A 4Y7NB 1ZDXA 1Q12A 3KWVA 4G7ZC 2LFNA 3VTWA 1IBKL 2KX0A 4DV7L 3GTKB 4LJPB 4MM3A 3LYYA 2KANA 1IP9A 4IUPA 4C3JB 3LJ3A 2EMTA 1Z6HA 2L8JA 3IHPC 1PTOF 4YTPB 2WU2B 4FJVB 4HSPA 2EKEC 3BK2A 2FMMA 3NVZA 3PO0A 3M3YB 4F1SA 2NTTA 3ZGZA 4LNQA 1XO3A 1TYGB 3KFUA 5GMVA 1TY0A 3SR6A 1TWGB 1TS2A 1XPUA 4NPNA 1BBUA 2KBNA 1N5WA 2JY6A 2A6ED 2K0PA 2WXGA 5J17A 2KUMA 2M9VA 1KOTA 1B53A 2XIWA 4QIWE 3S2AA 2LVOA 1QG7A 2SNSA 1WGDA 4OIJA 3S1QH 4B0EA 4KKJA 4NJCA 1STNA 2LJIA 1E2ZA 1C0AA 2NWGA 4PZ8A 1IBLQ 3ZNID 1SDFA 1KTKA 5MPOA 3EFCA 1ZEQX 4EVOA 2JUOA 3I4OA 4R8NA 4XTCS 3W1SC 4C00A 4CYEA 4CDCC 5KYIA 3VA7A 4ARCA 4MGIE 4HIDA 5BR8Q 1E8XA 3W5VB 1M94A 3V2TA 1GC6A 1YX6B 3V62A 2XBBC 4FO2A 2EMSA 3KF6A 1WMHA 3H15A 4MJSA 2WAQB 1K53A 3W1SA 2I5HA 3MXNB 4IUUA 2PE9A 2PMZB 4KI0A 4N8FA 3NUHB 2JA7H 5D94A 1U5KA 5IP9H 3PZ7A 2BYVE 1YNJD 5AEKB 1JB3A 4KV2A 3HKZG 1HA5A 2F0NA 2RA4A 3K81C 4ID6A 3K59A 3I4MG 1TKEA 2RGFA 2EXDA 3ZRCA 5IA7A 2G3QB 3ALBA 5C5MA 3CQZB 1NI2A 1R7SA 4KLKA 1DOXA 1WJJA 1JORA 2MP2B 4IFDG 4UAIA 1VDVA 1SSNA 1RFKA 2UXCQ 4KSKC 1HR0Q 5IGGA 4KY7A 1WTHA 1WTVA 5CBEE 5LMNL 5BN4A 1MPEA 2C9WB 1WOCA 4JOIC 3HOUG 1E0BA 2N3SA 3W5UB 4LF6L 1BMLC 4POGA 3S1MB 3DWQA 2KC2A 2AHOB 2WGSA 1VQJA 4PMWA 3TCAA 1C4AA 4Y7NH 1HE8A 1CK1A 2I1JA 3D4RA 2C5CA 3CRLC 5JPNC 2QGQA 5E4WC 2R2OA 3GTKH 3J80L 3OTOQ 3KYHC 1AARA 2FCSA 4ZK9B 2AUJD 4AS1A 3R3OA 4H7BA 4R8IA 1YI2A 2DX5B 4C3JH 1VQAA 2G4SA 4XDCA 2G5DA 4WORA 1JWAD 5IIFA 4LF7Q 2FBWB 1FCLA 1TS4A 1SE8A 4ALPA 2IL8A 3QX1A 1N36L 2WXKA 3HGBA 3M3YH 3L7ZC 5G2NA 2KHWB 1NSNS 1LTRD 4HMIA 4GLXA 3HOWB 1N5XA 1Z5SB 1SNCA 1SBBB 3NWSA 3FP9A 1EIHA 4B95A 1TWGH 5EE3A 3F1ZA 3DWAA 2L0CA 1ZKOA 1V80A 1JOKA 2R61A 2KQ4X 1QCBD 2BPSA 4IOIE 2KJ6A 3NTKA 4TMAB 3PS6A 4B6WA 4OO1H 4MT5A 1EM7A 3QG1A 4JI2Q 1DYQA 1WZ0A 1YNNC 1U4PA 3GTPB 3UGBB 3NY5A 2X38A 4XWTA 2BQQA 2WYQA 1F9JA 2D5GA 2Y0SB 3FPPA 3A5ZB 2HHHL 4G7OC 4FYDA 2V3NA 4BBNC 3A9KB 4X65Q 2R7ZB 3PMFA 3PHXB 1O7IA 5IGFA 2KD0A 4WJPA 4DAVA 1LT5D 1CSPA 2JT4B 2L3ZA 2VB2X 4LF9Q 4ANVA 3E3XA 4FA6A 2R92B 1WGRA 1PZJD 2NR2A 1TIFA 2ZNVB 2B8GA 3VRBB 2Y3AA 1WRIA 4E74A 4JI7Q 3CQZH 4M00A 1LTSD 3RMHA 5T1IA 3MEFA 2JA7G 2N9PC 2PQAB 5IP9G 1PH3A 1JT8A 4R4QA 1WI5A 1WD0A 2E2JB 1I5FA 2OEOA 1EYCA 2UUAL 4LF7L 2RCNA 2QSDA 4ANWA 4DR3Q 4LF8Q 4IM0A 1I94L 1U9RA 3D8GA 1M1KC 1IBML 2BH2A 5LHY1 3K7AB 2F0UA 4ME3A 3S1MH 4KZCA 4EEWA 1WTRA 3NZSA 4K6DA 3U9OA 2WXOA 1O7ZA 2KJXA 2XNAC 1VDZA 2IW3A 4NQKE 2N55A 1ILQA 2F0JA 1DONA 4H02A 4CJ1B 4DV0L 1GAQB 1V86A 3QWZB 2A8VA 4K5XA 1OFFA 3OAWA 1SRUA 5LXHA 1JQ4A 3VFKA 1A3VA 2PNRC 3MVVA 1V1PB 4C3IB 1N34Q 3FMCA 1LXDA 2CKHB 1IW7D 1RKNA 1VRAB 1BBXC 1KIXA 2HD3A 1Y1WB 4JC0A 2RKSA 1CHQD 2LY7A 4HKQA 1YN5A 3J80E 4KHPL 3J7A5 2YU9B 4X65L 3HOWH 3HKSA 3AMUA 2BT6A 2LXCA 4C3JG 1WTWA 4AIMA 4W9FA 3MTNB 4BOZB 2DUDA 2ZCCA 5T1GA 3GDEA 1ZUD2 3IBEA 2FINB 2NZHA 1A3TA 5FLMH 1XQQA 4KGSA 1B44D 1AP0A 1QOGA 1PH6A 2JSOA 3DHHC 2J0JA 4JI7L 4A76A 2EY6A 3GTPH 2WQYB 2PW5A 3AEAB 4MEMA 1MIUA 4UPAA 2A6HC 1H4RA 3VDZA 5M3MG 2NVXB 2GBMA 3TREA 2ZJQA 1VQIA 2LMCA 4OO1G 4NAWA 1XMOQ 4DR3L 1PTOC 1Q86C 4JG2A 1KNEA 4LF8L 2R7ZH 3I4NB 3S2HB 2KQSA 2FCMA 1X65A 1WI0A 2QEXA 2HIXA 1JOQA 3GE3C 3M4OB 1TTNA 3Q8FA 3MTSA 4PYZA 2KCNA 3EC8A 4DK1A 1ENFA 5CX3A 1II3A 5I4DA 2R92H 4HCSA 4IUQA 4YCUA 3Q3OC 4DR4Q 4HJ8A 2MNAA 2E75C 1LTLA 3QC8B 2WAQG 1H8CA 3APCA 1I50B 5JVH3 1OEYA
chains in the Genus database with same CATH topology
3AE5B 3T4AC 5CMDA 2Q8RE 3FPUB 1FM0D 4XQNA 3M4YA 2WXPA 4K2LA 5G5HA 4OVZA 3MAQA 1PFDA 1DOIA 4OL7A 2EYPA 3K5NA 1FRDA 2BCOA 3C46A 5E6JA 3M7NA 1MSGA 2F0FA 4RKLA 4K2KA 5DNFA 1GB1A 4K14A 1RF2D 1PRTF 2K5DA 5C4HA 1LLRD 3SFEB 3NUCA 1C76A 4F88A 1TWAB 4DNRB 2PCFB 1ONLA 2O4XA 3G6JB 4L6TB 2IPKD 1MBYA 1WVLA 1JOQA 2ICEC 1KAAA 3DEPA 1FMAD 1JMLA 1L4ZB 2IJ0A 4DK0A 2N9LA 3VYSA 1SSOA 4B9XA 3CIRB 3MXGA 3OWFA 3P1HA 1XX8A 1GOZA 3E0JA 1W6KA 2HUGA 4KD3A 1CA5A 4ZYSA 4IFDJ 3HZXA 5LL6X 3GTJB 2PW7A 2EKIA 2N88A 2MP1A 3AM9A 5I2XA 4ILWA 1DJRD 3EJIA 3KQ4A 2E3TA 2YEPB 5EPKA 2CHBD 2ZT9C 1F77A 2PPBC 4XT3B 2WXHA 3BVMA 5KGUA 4BA1I 1SMYD 5IODA 1VZ8A 2PVGC 2F0OA 1HUNA 1CA6A 4CQNA 4C56C 1H9MA 1SNOA 4LJZC 2L55A 2NBFA 4YT0B 3SFDB 1ZOYB 1SE4A 1FFUA 3MJ5A 2VNUD 4KMUC 1ESRA 1E0ZA 3L4PA 2RDHA 2CJOA 1T5XD 2INNE 4NW2A 2W3RA 4RCNA 3AE7B 1STHA 2JYEA 3SK6A 2F0GA 3AE2B 3J9CA 3Q22A 1WTQA 1TR5A 2R93B 2GI9A 2WU5B 4IKGA 1PFMA 1WGKA 2IGGA 3R2IA 1ZDVA 5A2QL 5HFYA 1F2RI 1BF4A 4RFBA 1S5ED 1KF6B 3PUZA 1QOAA 2JA8B 1FXAA 1ZE3D 2A69C 4S3SA 3FDTA 3I73A 3EQLC 4R9WA 2E2DC 3W9CB 3JAML 1JWSD 1A6XA 1YN4A 3IAS1 1F0ZA 4R3DA 3H91A 1XLQA 3TN2A 1SE3A 1BCPD 4OGQC 3PO3B 5CGKA 2J52A 4FF4A 4KKUA 2F4IA 1FCCC 4HEA1 1LTBD 3AE3B 2G1EA 2KA7A 2WXMA 1T3QA 1GHJA 4YXDB 4TKOB 3NRZA 2RVLA 1A2TA 1SNQA 1V8CA 2PZUA 1FR3A 5HGTA 1GUOA 2KOLA 5I2YA 2B76B 4KN4C 1GUNA 4WH4A 3MFGA 2JYTA 4XT1B 2WXJA 2Q8IB 2LMCB 4NAWB 2QCPX 3HVZA 5CBAE 4CGYB 2KEDA 5DEHA 2AQ3B 1PTOB 1EL0A 5FLXL 2GA4B 2IX1A 1CTMA 2KAJA 2ZXRA 4V190 3VR9B 1F2ZA 2NVYB 4L8JA 1E6EB 3AEEB 2X69A 1ZYRD 2J7ZA 3TZUA 4C1NK 5C0XI 1N60A 3DUZA 2W54A 2Z4HA 1GB4A 1CI3M 4XYOA 3NXWA 1NI3A 4HSVA 3A8KE 2L1BA 2QKIC 5D65A 4JX1C 2JU6X 1TIID 1CZWA 1V1OA 4YIJA 1TS3A 1EIGA 3IL8A 4RHRA 3MC0B 3QWNA 3V05A 1HFNA 1N61A 1J8IA 2XRSD 1VF7A 2KEEA 5JOBA 5EPJA 4N6EB 4TQ0A 2FFKB 4NDXA 1PLFA 2F0EA 5FO7B 3SE0A 1ROEA 4ZLTF 2F3WA 2YYZA 2K03A 4KHVA 2IX3A 1YQ4B 3U52E 1H9SA 4RKBA 3WCQA 1F9SA 2BE5C 5KNBA 1PZID 2N9KA 4QIWB 2KVMA 4QMGA 4QUCA 2B2YC 2LKVA 4RGMA 1AWDA 5C3XA 5C44B 5M3FB 1UWMA 1PTOH 1B1ZA 4NZLB 2E74C 3VYTA 4DGZA 4HJGE 3QOJA 4KGRA 2RSOA 4Q5VA 4LK0M 2DBYA 1SNMA 4WURA 1D2BA 3UI2A 3SK8A 5G5GA 1E2WA 1MHXA 4M8AA 3K57A 1PDQA 5EKIA 4EGVA 1FYCA 4PMBA 2DYMA 4B08A 1AN8A 1IYUA 4M0WA 3MEHA 3VYRA 3E6ZX 3A8JE 1SYBA 4LK1C 5C0XH 1KLGD 3NSWA 1T6BX 2M56B 4QB4A 3K58A 1S5BD 3U2SC 1ILPA 1K51A 1F9RA 2BS2B 1J7AA 4N59A 3P1MA 4X3SA 4HCEA 4C80A 4DNTB 1DOYA 1S4ZA 1SF0A 2XVSA 2AWOA 4IQZA 1C77A 2WS3B 3N52A 4ABNA 1IUEA 3A8IE 1VJKA 1R4PB 4XQQA 2EYJA 1SIJA 2AX5A 2IGDA 3Q0AA 3I72A 4USAA 1XCTL 4HR7B 3D6WA 1RCVD 2F0SA 2K5QA 1KH0A 4CJ2C 4A9AA 3J7AV 2ICIA 1TWCB 3H3VC 2L83A 2DLBA 4A93B 2H89B 1TVXA 2V3PA 1QILA 2C9OA 1C8CA 4ZRQA 2DNEA 3PUYA 2B2WC 2LGIA 2M00A 4Q2JA 1WTXA 2B2VA 1STAA 5C5LA 1STGA 4A6QA 3HRDD 2EY2A 2DY8A 2WDRB 2B2WA 2ZW1A 5M9OA 1V43A 3RZDB 3A56A 2OEDA 1QKZA 4A3MB 5E1FA 2JXMB 3LB8C 1PYWD 3OMGA 1C4QA 5K36H 1EWCA 1O80A 3TZDA 4HEDA 1SAPA 3S1RB 1I6HB 3BDCA 1XCQL 4LLGM 4NAMA 5IGBA 1YNJC 1JROA 1E7PB 5D3IB 4G7HC 2E6XA 1EY5A 4US8A 3E56A 1HXYD 4L23A 1EQTA 4CHTB 3EFXD 2I46A 4A3IB 1PRTB 2WP9B 4BBRB 2NUCA 5CR3A 4A3FB 1XLOA 1KDAA 2HCCA 1U4MA 2KHSA 5CV8A 5F2DA 1UWXA 2OF1A 2K33A 1WTOA 3R93A 2KDMA 4O42A 3PIP3 1JC7A 2D62A 4F8MA 4K6LA 1RHPA 2B2TC 3D4WA 3LXFA 2G9DA 3VR5A 1SNPA 1EY8A 1CM9A 2WACA 3NTHA 3SVMA 2HQEA 3FVQA 1TY2A 2B2TA 3HP3A 3L9AX 3K5LA 1QJOA 1RJTA 3BZDB 5JPMC 2F0LA 4HROA 1CQFA 2F0KA 2EYFA 2EELA 2TSSA 5I9OA 1L6VA 3J81L 3IT4B 5EE9A 3PUVA 1ENAA 4A3KB 3KF8A 2ZXOA 2WXNA 4A3BB 3IKJA 4KV6A 3A7AB 3SHLA 2WDVB 4K8JA 1EWHA 2MJEA 1FNUA 1IYVA 1WXQA 1EU3A 1DD2A 4JWSC 3AEFB 1BUIC 2X6GA 1VMPA 3ND9A 1HZ5A 2F0VA 2MJ3A 1YNND 2LHDA 5K36G 3FILB 1F2LA 3HG9A 1JICA 3KBXA 1GUWA 1JCKB 3O13A 1SFOB 3ERQA 3S1NB 5EBCA 5KEEA 1JOOA 4J6HA 1UAPA 1C48A 2EYMA 2F3VA 4WJWA 2QEJC 1XXGA 4KKSA 1EU4A 3GD7A 1R4QB 1JWBD 5KNDA 1QLBB 1FNVA 1M4VA 1TJEA 3MXUA 5CV5A 1SJHD 4NKLA 1EOTA 2F0HA 2SDFA 2EPBA 3I3CA 1F2RC 1YMHE 4A90A 1STYA 4DA2A 1Y8OB 3LWUA 3N6RA 3ONAB 1M8AA 2PTLA 1BDOA 5DAUA 2Z8LA 2KN4A 4JBWA 2KQ3A 1NYRA 2I38A 1OXXK 3K0YA 2F0WA 2AUKA 4BS9A 2EYOA 1HA6A 2N7JA 4RGTA 2B8FA 2FHTA 4U68A 1I4XA 2PKOA 2AQ2B 3EGRA 1RD9D 1GHKA 3AE4B 3ZQ4A 2K32A 4GDKB 2O5IC 3DWGC 1HTPA 3P7JA 2LS01 3VA5A 4MM3B 2R6GA 4FXDA 5LNK1 3Q6SA 4YTNB 2DNCA 3J7YW 1STEA 1PFBA 5ISRA 1YJJA 4M1UB 1BR9A 3J81E 3I70A 3DMUA 1NVID 3NQTA 1I4PA 2EY1A 4E6IA 2CVRA 2A6HD 4A3EB 4IURA 4LAAA 5E4XA 1PTOD 3NZ3A 1NR2A 3PZ8A 4P2CB 3P4RB 3PO2B 4X3TA 2OXPA 4QUFA 5FO9B 4ZOHC 3V3XA 2JE6I 3S16B 4DAPA 3NVYA 3ZJUA 4EQOA 1EFID 1X32A 3D3RA 1B2TA 1DCZA 1RM6C 4N9TA 1KLUD 2F03A 1DM0B 5K5PA 3NK9A 5C3JB 5JEAH 3IFDA 3H6MA 1SYGA 1C9FA 5EBDA 5C0XJ 2DWQA 2WXRA 2BS3B 3A55A 4D2KA 5IT9L 2JA6B 4DQOC 4XXEA 2VZKD 2EJGC 3GV3A 4FVMA 2Z4IA 1Q1BA 2FE8A 1MHHE 2K04A 4RA8A 2K9XA 3NTIA 3RD4A 3T3NA 1QQRA 2PZTA 5IGEA 3TP7A 3AE1B 1EEFD 3GP7A 1L0VB 5EJWA 1C4CA 5EKKA 5C3WA 1V8QA 2M0AA 3MHBA 1TKWB 1KDCA 3VR6A 3DWPA 1IKMA 2EZVA 3TSSA 2ON8A 4XIGS 1IL8A 2PZWA 1PZKD 2J4XA 2MHVA 1SMYC 2L12A 4H44C 2MEKA 1LACA 3OW7A 5CV4A 2J53A 4ZRPA 3IXSA 3NVVA 3MP9A 1J7CA 3SDZA 2MJ8A 5JVG3 3MA2B 4B9WA 2NN6I 1ZP0B 3T56B 1D5XC 4FF3A 4WIPA 3VR8B 1BOSA 5EGTA 3H94A 5KRUA 3S14B 2Z1CA 3B2GA 4FF1A 1L6UA 2WKCA 4CKEA 2J42A 3AB9A 3GTQB 1E10A 1OO9B 1P7FA 5EE1A 1GUGA 1UEAB 4Z9CB 4ODGA 1D5MC 3TP6A 3T53B 1F2YA 3B9JA 2O2LD 3I57A 1TU2B 2LUMA 1CZPA 4C3IG 4YTMB 4J8QA 3URYA 3TP5A 3HOYB 3P63A 2INPE 4ITKA 3R8BA 1PGBA 3SXHA 3Q24A 5BMGA 1NR4A 2V0GA 5IT9E 4BY7B 2EJMA 2LEKA 5T8IA 1D5ZC 4NMZA 2A69D 1HQMC 2EE1A 3NVWA 1N62A 2B2UA 4KX6B 4JK1C 4P6VF 1KFYB 4YSZB 3IFTA 2TMPA 1PMRA 1TWFB 2ENBA 3TMEA 1VR9A 3J7AF 1VZ7A 3S15B 4ZUIA 1FFVA 3ABVB 1LO5D 3TDQA 4BA2I 5TSSA 3KLRA 3TEWA 1QF6A 4RCOA 2BB5A 2IDYA 3KUPA 4FXGC 3HOVB 1NENB 2L5TA 1FXIA 3TP8A 1KRHA 1NYQA 4RWSC 2W82A 4FP5D 2JEBI 1Q3LA 1BO0A 1TS5A 3HOZB 2K6AA 1NEKB 2PYKA 1CHPD 4KK7A 2MH7A 4EE2A 1EY0A 2PMVA 2H88B 1EY6A 2JEAI 1EWYC 2SEBD 4NP5A 3E9SA 1ZYRC 1MGSA 2O5JC 3BVGA 3OHXC 4KD4A 1FNWA 3FKIB 1EZ6A 1H9RA 5A2QE 4XWWA 1VMCA 5HG2A 3P42A 1ZXHA 2B63B 2EDGA 4C3HB 2K28A 4L63B 5CV6A 1PRTC 4DU9A 3T16A 3ZYYX 2PLPA 2L52A 3GTGB 1I4QA 1RTOA 2HDEA 5AUIA 3DXJC 4C1NI 1TWHB 2X6LA 3R2TA 4JWUC 1RODA 3JAME 3SK4A 1E9MA 1RWSA 4KTAA 2RSNA 1XEEA 3CRKC 2CQAA 1LT3D 4IFDI 3DM1A 3K5MA 1FEHA 5D7GA 2MGSA 1DOKA 5JAVA 2EYLA 3T51B 1AW7A 1Q8IA 5HURA 4C2MB 4EQNA 2JYOA 2XN9C 1Y56A 5JJZA 2D9UA 1SEBD 4A3JB 3HS0C 1K8MA 4H0LC 1ICWA 3I4LA 3OIPA 3D4DA 1WSPA 2E76C 3D31A 3SK5A 1VCIA 5IGDA 1JWUD 2PVOD 3N9YC 2EY5A 5FLXE 3FEWX 3MFYA 5CV7A 3ZJVA 5IGCA 2EXZA 5AUKA 3AEBB 2HDMA 5J1ZA 3K6OA 2BYTA 1F9QA 2NZ1D 1A2UA 3I90A 2Y5PA 3OOCA 3EROA 5M5XB 1F2MA 1L0YB 1D1KA 3I8ZA 1IHZA 1NUCA 2VB3X 4KKIA 4IUVA 1VZ6A 4IALA 4H2AA 1XTCD 2K7VA 3ITPA 1LT6D 3WOFA 1MVKA 1FRRA 1XWEA 1JW9D 2JZPA 2FMCA 2A68D 4ZKBB 1NAPA 4L2YA 1ACCA 1WCMB 4TQUS 1VLBA 1PUTA 5I6YA 4PV1C 3AEDB 2I2YA 3D6CA 3AH7A 2RPVA 4L1BA 2K5WA 1GXDC 1QOFA 1P7EA 2SAKA 2KACA 1WWTA 2BA1A 4WRDA 3BDOA 4OW0A 5C2TB 2PW9A 4BY1B 1O7YA 3U9SA 5GXGB 4IUTA 1H9KA 1A15A 2BDOA 1FIQA 5JEAJ 4OZCA 3Q8CA 2FJ2A 2KMMA 2LHEA 1JE4A 5KNCA 1AZPA 3P4SB 1V1PA 3GTOB 5ELEA 4FNFA 2H4OA 4DF7A 3RZOB 1OQQA 1N63A 2B2VC 4J3OD 4XYQA 3OSOA 2KECA 2CW0D 1J7BA 3IT6B 5I9PA 3I91A 4KGTA 3A7LA 4MIUA 3GB1A 4QCLA 1PFNA 3WDNA 4US9A 2WP8J 5COYA 4ZUJA 2QF7A 2A6EC 3ZJTA 3GTMB 4HRSA 1STBA 4IUNA 4OO1I 4P16A 1HZ6A 4TQ1A 4I7ZC 2BB6A 2WXIA 5M5YB 3GO5A 2L11A 3EVQA 4C3HG 3CU7A 3BVZA 5A35A 5ELBA 5C0XG 4KJNA 4PNYA 2ZXPA 1EY9A 2A74C 2PIAA 4ZAIA 2F0IA 3KLSX 5KYLA 3AE8B 5M3MB 2J0TD 3KLSA 4A55A 3M85A 1FD7D 4WQMA 3E5SA 2IT1A 1K83B 2ZW0A 2AQ1B 1HPCA 4GLSC 3AV8A 4V0BA 3AE6B 3B2FA 4HKZE 1XF5L 3S2DB 1XLNA 2Q8TA 1H9SB 3X3NA 1OQRA 2XRQD 2EVBA 1DOMA 3KBGA 2RDGA 1AYFA 2FUG1 5HHDG 3NS1A 3NBIA 4IDIA 1QE6A 5BYSA 3VR2A 4UDUC 5H92C 1JQYD 3H09A 4DFAA 4TSSA 5H8YE 2E2IB 4DXGA 2H1EA 1I4HA 1Q90A 3MXPA 3P4PB 3MWYW 2ID0A 4ZKCB 1I3QB 3F2UA 1U4RA 1FGBD 1PGAA 1JRPA 4F87A 3SR6A 5CC4A 1HHVA 1TQOA 3QJYA 1MI2A 3M7GA 1SNDA 2JA5B 3U4EG 1O78A 3PUXA 5G3LD 3SR1A 1L0XB 2NVQB 1B9MA 2BBCA 4C7ZA 1DOLA 4RH6A 3KWLA 2IWHA 1FD6A 4CBVA 1EY4A 1KDBA 4BBSB 5E3FA 4YSXB 3H0GB 4WWMA 2BA0A 1YNTE 4MACA 1IKLA 1AFPA 5HI1A 5C4JB 2V4DA 1RDPD 5FKAC 4GZYC 4LTUA 1CJEA 1Y69U 4KJOA 2WLBA 4ME5A 2MJDA 3GTLB 3Q8EA 3P4QB 1U4LA 2EOTA 5EQ0A 2WNMA 5BN3A 5EE0A 1QNKA 5EKLA 2W55A 3MHZA 4OHJA 4KHZA 4HN7A 2DN8A 3PUWA 1QOBA 3TEYA 3Q8AA 4KY5A 4LMQD 1R9TB 3OIQA 1K50A 1VF5C 4F7XA 1BXTA 1BCPF 1IW7C 3VQIA 4XDDA 3C1EA 2MPMA 1G91A 2ONQA 4J1MA 4ZRZA 1KABA 3KK7A 3I9V1 2F0TA 3FC4A 2AWNA 4H13C 3FAHA 2A5HA 1ET9A 4RHSA 1JWMD 4K5VA 1EYDA 1RYJA 1ZPSA 2V4IB 4O1NA 2WB1B 2QILA 5LL6S 4REZA 2HDLA 2QJLA 3FRPB 2G9HD 3RUZA 5KIXA 2WV6D 3QIAA 1OXSC 1L4DB 1MD2D 5DM63 1D6EC 3OPOA 1LT4D 3CKIB 2NTSA 3NHHA 1AZQA 4OZBA 1XYIA 3AU7A 3WOEA 2HTME 3RPFC 3TUOA 4C7YA 3HOXB 5EPLA 4JE3B 5FR3A 1X3QA 1Q10A 4ZQ3A 4CKCA 5AFWA 2EJFC 1MSHA 5DM73 1S5FD 1UUPA 3X3MA 1RTNA 4I65A 2JSVX 2ACZB 1C4PA 1GPXA 3HUIA 2D5DA 1HTLD 1Z7TA 1PDXA 4TRDA 1AEXA 5CORA 1GJXA 1LTAD 2DYOA 2L32A 2SOBA 3PV0A 3QOLA 2WXQA 4CJ0B 1ML0D 3BYTB 1F9PA 3BG3A 2GRIA 4HMJA 5D3DA 1BNZA 4RNAA 4A3DB 4ZHOA 1W6JA 4X3KA 3S17B 1IGCA 2RMMA 4PT5A 3CHBD 1ESFA 5J22A 3NBHA 3BK1A 1QNUA 1ENCA 4XDXA 2VXWA 3IAYA 1LTGD 3VR3A 4DXFA 4AQ7A 2XWBB 1OXTA 3PIO3 3OMCA 1IBXA 2D2CC 2L9HA 5NUCA 3G7LA 1SB3C 2MUYA 3SEBA 3MZ5A 1BUVT 4GDLB 1CZGA 2BS4B 4HAEA 1GUSA 5FOBB 4RGNA 3Q8BA 1S5CD 3A54A 1CQVA 1Z47A 2F0MA 4KY6A 4XE0A 1SJED 2M19A 1G2SA 1O7LA 5CYUA 3TBIB 1TT2A 1A70A 5IOCA 5CV9A 3ND8A 2NYZD 3CWIA 3BWUD 4OZAA 1JR0D 3BDLA 4K8IA 4A3GB 2K01A 1EYAA 1PGXA 3GV6A 3C8YA 1Y8NB 3VR4A 3L3OC 2K22A 3NP8A 3GS2A 3TEZA 1DXMA 1FO4A 2WDQB 2W3SA 5BYRA 5BN5A 2CU3A 1YQ3B 2VUMB 1YJIA 1HFGA 4MHEA 3NPPA 5C4XB 2I07B 1SYDA 1SYCA 5JEAG 3QO2A 2NVTB 1I7HA 1OXVA 3DHQA 2EYHA 1D4BA 3IAM1 1CT1D 2BTEA 2B2UC 3DEOA 3EA6A 1BCPC 2HCIA 2JQRB 2F0DA 3AEGB 1G2TA 2WIIB 5JXVA 1QWYA 1ET6A 1I4GA 3C3LA 1HUMA 4FXKC 2QIEB 4OIKA 4X3UA 5I6WA 4B0MA 4IN3A 5J39A 4CKBA 1SYFA 2WKDA 2KCCA 4G4KA 1K8OA 3HEJA 4A8XC 5D14A 5C3EB 4FXCA 4ULLA 2RQXA 1EQVA 3AN1A 1EEID 4Q0FA 1WD1A 3OWEB 3HRZC 2NN6H 2NMQA 5ELFA 1Y1VB 1ZXIA 2BDNA 1TZOA 2IGHA 1C79A 4RF1A 4YSYB 1I6VC 1B50A 2B39A 2PQEA 3AE9B 5C4ZA 1QB5D 2QMTA 3GQBA 1LV9A 4IZ8A 1OXUA 3C2PA 2JXTA 5BMHA 1ZXTA 4HTHA 1HRJA 2BOSA 2NB0A 1I4RA 2Y5CA 4K5WA 3S9WA 4G57A 1SYEA 3BYYB 4KKTA 1K52A 3MXNA 2DY7A 2K1BA 2XSCA 3LNNA 2XWJB 3P20A 1PRTD 2E2HB 1D1IA 4JPSA 2KWDA 4ARIA 3W3AA 2VZKB 1B4OA 1IBXB 1S5DD 3NWTA 1J9OA 3BIID 3AECB 4XQJA 2K05A 1HEZE 5C6AA 1PXUA 3HKZB 3I4MB 3V96A 1H9JA 3VYUA 4AYBB 3ETRA 1E2VA 4KN7C 2BE5D 3AMZA 4RGOS 2L1AA 1Q1EA 2A73B 1HCZA 5BMIA 5M5WB 1EZ8A 2YEPF 1A3UA 3HOUB 2OHFA 3K5OA 2L4NA 1T5EA 1KNAA 1B9RA 3P75A 1SXTA 3LWEA 1C78A 1LABA 2WXLA 1JALA 2NN6G 1L5PA 2GB1A 2LFIA 1Y8PB 2JWUA 3W2DA 1QT9A 3H8HA 2B2YA 2RDFA 5G3LF 4PMCA 3AB5A 1GUTA 3RFZB 1G6ZA 5FK9C 1QOHA 2R3ZA 2F0QA 4PQXA 2WXFA 1X3PA 1BQQT 4QF4A 2RBMA 2K3UA 2BW2A 2CJNA 2JX5A 4WAFA 3NQIA 3LX0A 3RLFA 4RF0A 2A68C 3EUB2 4DAYA 1B3AA 1G8ZD 1UNSA 3UI3A 1HQRD 3FILA 1XLPA 3S1QB 4U673 2M2LA 2N0SB 3HVDA 4BWGB 1NCVA 1TKGA 2Q5WD 4WFN3 3Q23A 3VRAB 4YWGG 3DWMA 1WYGA 2IX0A 2QDBA 4MN3A 3U7ZA 5FO8B 1EY7A 1SE2A 5BYQA 2F1MA 2JA7B 2PO4A 4RAUC 3C1FA 1B9NA 2JP1A 1BCPB 4IFDH 4FF2A 4N9PA 3NE5B 1G291 1YN3A 2K5PA 1CFMA 4EQPA 3QB3A 3TEXA 2OT2A 3T13A 2WINB 3T3OA 2F0PA 1WTPA 1TKYA 1LTTD 3BS1A 1V97A 1LTID 4MH8A 1DZ1A 5ELDA 1DGJA 5ELCA 2CW0C 1IGDA 1UGJA 4N58A 2SNMA 4DN4M 1MI0A 4ZHPA 3Q69A 4Y7NB 1ZDXA 1Q12A 3KWVA 4G7ZC 2LFNA 3GTKB 3LYYA 4IUPA 4C3JB 1Z6HA 1PTOF 4YTPB 2WU2B 4HSPA 3BK2A 3NVZA 2FMMA 3ZGZA 3PO0A 3M3YB 2NTTA 1XO3A 1TYGB 1TY0A 1TWGB 1TS2A 1N5WA 2A6ED 2K0PA 2WXGA 2KUMA 2M9VA 1B53A 2XIWA 1QG7A 2SNSA 4OIJA 4B0EA 4KKJA 4NJCA 1STNA 2LJIA 1E2ZA 5MPOA 2NWGA 1SDFA 1KTKA 1ZEQX 4EVOA 4R8NA 4XTCS 3VA7A 5KYIA 4ARCA 3W5VB 3V2TA 4FO2A 2WAQB 1K53A 3W1SA 4IUUA 2PMZB 4KI0A 3NUHB 3PZ7A 1YNJD 1JB3A 1HA5A 2F0NA 2RA4A 4ID6A 3K59A 1TKEA 5C5MA 3CQZB 1R7SA 1DOXA 1JORA 4IFDG 4UAIA 1VDVA 1SSNA 1RFKA 5IGGA 4KY7A 1WTVA 5CBEE 5BN4A 1MPEA 1E0BA 3W5UB 1BMLC 3S1MB 3DWQA 4PMWA 1C4AA 1CK1A 3D4RA 2C5CA 3CRLC 5JPNC 5E4WC 3J80L 4ZK9B 2AUJD 4AS1A 3R3OA 4H7BA 4R8IA 4XDCA 4WORA 1JWAD 5IIFA 2FBWB 1FCLA 1TS4A 2IL8A 2WXKA 3HGBA 3L7ZC 1NSNS 1LTRD 4HMIA 3HOWB 1N5XA 1SNCA 1SBBB 3NWSA 1EIHA 5EE3A 3DWAA 2L0CA 1ZKOA 1JOKA 2R61A 2KQ4X 1QCBD 4IOIE 3NTKA 4TMAB 4OO1H 4MT5A 1EM7A 3QG1A 1DYQA 1YNNC 1U4PA 3GTPB 2X38A 4XWTA 2D5GA 2Y0SB 3FPPA 4G7OC 4FYDA 2V3NA 2R7ZB 3PMFA 5IGFA 4DAVA 1LT5D 2VB2X 2R92B 1PZJD 2B8GA 3VRBB 2Y3AA 1WRIA 1LTSD 3RMHA 5T1IA 1WD0A 2E2JB 2OEOA 1EYCA 2QSDA 1U9RA 3D8GA 5LHY1 3K7AB 2F0UA 1WTRA 4K6DA 3U9OA