1SBBB

T-cell receptor beta chain complexed with superantigen seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords PROTEIN (14.3.D T CELL ANTIGEN RECEPTOR)
publication title Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.
pubmed doi rcsb
source organism Mus musculus
total genus 66
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sbbB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sbbB02
4TSSA 4NZLB 1PZJD 2IJ0A 2G9HD 4C56C 1HA5A 1PYWD 1JWSD 1RDPD 1JQYD 4L6TB 1SXTA 1FNUA 2QILA 1EEFD 5ELDA 3R8BA 1CK1A 1AW7A 2XN9C 1D6EC 4Z9CB 1TS3A 1AN8A 1PRTD 4RFBA 1L0XB 1LT3D 4RHSA 2NTSA 5FK9C 1LLRD 1YN3A 1HTLD 1G8ZD 1LTBD 1PRTC 1S5BD 1MD2D 3KLSX 5ELEA 1PTOH 1JR0D 1I4QA 1SE2A 1KLGD 1BCPD 1TY2A 2RDGA 3OWEB 4RCOA 3MC0B 1PRTF 1I4XA 3MFGA 1M4VA 3DWQA 4RGNA 4BWGB 1BCPC 1LTID 1UNSA 2CHBD 1I4HA 4DXGA 4ZYSA 1V1OA 1RD9D 3DWAA 1PRTB 1S5DD 1STEA 1SJHD 2NTTA 1BCPF 3O13A 2QEJC 1FNVA 3BYYB 3R2IA 4RGOS 3SEBA 3W2DA 5FKAC 1JWUD 1LTGD 2XNAC 1LO5D 4O1NA 1V1PA 1BCPB 1LTSD 2AQ2B 1D5XC 1SE4A 2J4XA 1CHPD 3EFXD 1YN5A 2O2LD 1SBBB 1D5ZC 2AQ1B 1LT4D 3TSSA 1LTTD 1BXTA 2TSSA 1HQRD 1RCVD 1TS5A 1SJED 5ELCA 1DJRD 1I4GA 2XRSD 1DYQA 3BVZA 1SEBD 5I4DA 4RHRA 4RGMA 1LTRD 1S5ED 2WV6D 1F77A 1KTKA 3BZDB 5ELFA 3BYTB 1HXYD 1PTOD 4L63B 4K6LA 1S5FD 1PZID 2XRQD 1QILA 1ET6A 2R61A 4DXFA 1FNWA 1EFID 1RF2D 1TS4A 1CHQD 1PZKD 3BVGA 1PTOC 1CT1D 5ELBA 1XXGA 3R2TA 1CQVA 1I4RA 2Z8LA 1PTOF 1D5MC 5TSSA 3CHBD 1B1ZA 1B44D 2RDHA 1SE3A 3URYA 1GOZA 2IPKD 3GP7A 5D3DA 3EA6A 4RGTA 1JCKB 4RH6A 2SEBD 1EU4A 1XTCD 1PTOB 1UUPA 3V05A 1EWCA 1TS2A 1L0YB 1KLUD 1FD7D 1TY0A 1YN4A 3DWPA 1LT5D 4UDUC 3BVMA 1T5XD 5D3IB 4OHJA 1EEID 1JWMD 1ENFA 1EU3A 1ESFA 2AQ3B 1LTAD 1I4PA 1FGBD 1V1PB 1LT6D 1S5CD 1ET9A 2ICIA
chains in the Genus database with same CATH superfamily
2NN6H 1IGDA 4JG2A 1T0RC 1A62A 3AMUA 2CJNA 4ZRJA 3H0GB 1L4DB 3SHQA 3HKZE 3R3OA 3W1GA 2J52A 2K52A 3HOXB 1C4CA 1O7LA 1PGBA 2N4FA 3DVNV 4N6EB 2L76A 4ARCA 1LACA 1WGRA 2KVZA 2IBIB 2KECA 3GE3C 1NCVA 3ZTDA 1VQGA 1YNND 2C7NB 4RM9A 4BY1B 4DDID 1CZPA 2CU3A 1QKZA 4HEA1 1S3OA 5IIFA 1XT9B 1GUTA 2HT1A 2M9VA 3N1ZC 5EKKA 1TT2A 2KHSA 4CKCA 5IYCG 1WGKA 2DHZA 1S5BD 1KNEA 2NVTH 1U4AA 2QIEB 1Q1EA 5G3LD 3K5LA 4M8MA 3E9HA 2JX5A 3AFPA 3I63C 1FMAD 5AZGA 3VR9B 2KLCA 1VQDA 2A8VA 1XPRA 5DCNA 1E0ZA 3UINB 2HE7A 3AE2B 2LUMA 4GLAC 3QOLA 3FEWX 1WX9A 2AL6A 3PREA 1S5DD 4C1NK 4JW0A 5K36H 1FJGQ 3VUWA 3KBXA 2MJ3A 2OEDA 2M0AA 4IDIA 4P16A 4DK0A 5EBCA 3BDLA 4DV6L 1WJUA 4BBSB 3V3XA 4WJQA 1U4PA 1OXTA 4GNXA 3HOWG 2IO3B 3ZO5B 2WP8J 3QR8A 3NK9A 3D32A 3DHQA 3NE5B 4PMBA 1JT8A 4OGQC 3PPAA 2VUMH 4PT5A 2MWSB 2V4LA 3ALBA 4YT0B 3I56A 3ZJVA 3DLLA 5CTRC 3L7ZC 1UH6A 3H3VI 4RA8A 3APCA 1AH9A 2WXNA 5E3FA 5KEEA 4ODGA 4X3UA 3KFUA 4RG1A 4GS3A 2GMIC 2YEPB 5IKCM 1EF1A 2BDOA 5HURA 4I7ZC 2L12A 3LJ3A 4D2KA 2DWQA 3CCLA 2JT4B 1VQAA 2QCPX 2Z6KA 3DEPA 5GAGC 4X65L 2FIFA 2NB0A 3BYTB 1FRRA 3I5JC 5G5HA 1ICFB 2NZ1D 4HJ9A 2LJIA 2RD0A 1AYFA 3ZXVA 2V0GA 2Q2TA 2F0QA 3NBHA 3FPPA 4DAVA 1E22A 1A15A 3WAMA 1VQBA 2SAKA 3R2TA 2KJ6A 2EJFC 3ZNZB 1J8CA 1BQQT 1VQCA 4PZ7A 5C3EG 1Q82C 2K0PA 4LAAA 2RSUA 2JYTA 1WMHA 3J7AV 3HFZB 3CXCA 4DV3Q 1HR0W 4WFN3 5M5YH 3B0AA 1UWXA 3KF8A 4L8JA 3VR6A 1Y1VH 3OTOQ 5IT9E 1F2RI 4BVUC 3GTMH 2KD0A 2IX0A 1K51A 3UIOB 3WDNA 1KABA 4YIJA 4F1SA 2FAZA 1X3EA 1N6ZA 1LT5D 4KGSA 3Q3NC 3KBGA 2E2JB 5IA7A 3M3YH 1ZEQX 1I94Q 4OHJA 1WTWA 3LGJA 2KDFB 3QIAA 3PSEB 3MEFA 2JA5G 2ACZB 1LT6D 1QQRA 1J9OA 1SYCA 1TWCH 2ICIA 4DR5Q 5M5WH 4JI7Q 3HOUH 3WALA 4NQKE 4MSMB 5BR8Q 4A3LG 1IGCA 4OW0A 1GHKA 4B0EA 2G5DA 1X56A 1WRDB 3TQYA 3HGBA 3T4AC 4P6VF 4BFRA 3HM3A 5C4XB 2M4NA 1KHIA 4GB9A 1AE2A 1TWHH 2K5DA 1HNZL 4P1BC 3GZNB 3IAYA 2JA7G 3PO2H 2LKVA 2KWVB 3P4PB 1LLRD 1DM0B 1JB7A 2KA7A 5E4WC 2DLBA 2MLBA 3B08A 2HDLA 5JVG3 3S1MB 5KNBA 3QJZA 4LJOB 2AWNA 4C3HB 2KWCA 4LJPB 5H1SE 3U7DA 3FP9A 3OWEB 2RA4A 5EAYA 2WLBA 1FL0A 4BA1I 1GJZA 1B53A 4YHHQ 5IODA 3PUVA 2V3PA 1V81A 5D2MB 4JI4L 3D6CA 1XMQL 1QOBA 1GG3A 3MTNB 4LF4L 4A93H 1E2ZA 2NTTA 1SE8A 1BCPF 2UUBQ 4B0MA 2QEJC 3OG5A 3PS6A 2R2QA 4A3IB 2JRHA 2BCOA 1IBML 2AHOB 5FKAC 4X62Q 2IX1A 1NVID 1NBFC 1NYRA 1ZYRC 2RMMA 3KWVA 4MEMA 2EXDA 1A2TA 1PH7A 2LWPA 3OMCA 3NZSA 2KWUB 5FR3A 4A3JB 2DUDA 3PRPB 1ZXTA 2JA6G 4FXKC 4K2LA 4PMCA 2R7DA 5IYCH 3GTJB 1TQOA 1BDOA 4A3BB 4MM3B 4HJ8A 3ZJTA 1CKNB 3DHHC 1LT4D 2M19A 1HNWQ 3TSSA 3TEWA 4QF4A 1Q3LA 2I5LX 5GROA 3BZKA 3HOZH 1NEKB 4USAA 4CDDC 1B9MA 3H91A 2MEKA 1L1OB 4FHJA 1GB4A 3LWEA 4K5WA 1AE3A 2PNHA 2WV6D 4XQQA 2PE9A 2WXJA 4GOCA 4A3DB 3T8MA 1MG8A 2WXIA 2OCEA 3BZDB 3AEBB 1WX7A 3EBEA 3JC66 5JXVA 1VS0A 3OOCA 4IO9A 4N59A 3CRKC 3Q8DA 2NBFA 3C46A 5FO9B 5LL6S 2A4ZA 2JZZA 2K5PA 3KLSA 4FNFA 4DXFA 5IOIA 1NJIC 2JA8G 4OO1G 1CHQD 1CSQA 2BYVE 1OGWA 1EY6A 2D5GA 1UWVA 1Q7YC 4FLHA 4DUZQ 1TT5B 4NJCA 3AEAB 4L5SA 1G6ZA 3HOWH 2B2VA 4IUVA 1YJ9A 3VDYA 1LGRA 2F0OA 4IURA 1YJWA 1VQKA 2H1EA 1L4ZB 3NS1A 5C5LA 3PO3G 3M7GA 1K83H 4HCSA 1XLQA 1XPUA 1NBWA 3N30A 3EHVA 5J22A 2K5HA 1VZ8A 4ZRKA 2E2IH 4EZLA 1IW7D 4DV7Q 1SSOA 3IG3A 4WH4A 2BB5A 4RH6A 3K9OB 1EU4A 1PTOB 3V05A 1II3A 4BBRG 3T1HQ 1GUWA 4MH0E 1TS2A 1C4QA 1TY0A 4M0WB 3AEVA 3IXSA 2F0JA 2F3IA 3LWUA 2WXRA 1L7YA 5IO9A 3CCJA 3A9KA 1JWBD 4JI1Q 4DHZE 4GOPA 2HIXA 4FF3A 5CC4A 1J5EQ 3WAPA 1HNXL 3PLUA 1I4PA 2BW2A 4GLVB 1Q12A 3KDFB 4QIWE 4TSSA 3CCRA 4YCWA 2M1MA 5FO8B 1EWYC 3QJYA 4L6TB 1EQQA 3TMEA 5C3EH 3PSIA 2MQJA 1R4NI 3DVGX 1CK1A 3BDCA 1HJPA 1HTPA 3V2TA 4DPGA 2YU9H 2DYOA 2FCSA 3KQ4A 1LM8B 3TUOA 5HHDG 3P2BA 1ILQA 1RKNA 4R8IA 4P75A 4W9DA 5GAEC 4A3GH 2OTJA 4HDQA 1HHVA 4GDKA 3IRBA 4F88A 4F7XA 2RF4A 1EIHA 3Q69A 4JBMA 1QZHA 4Q5VA 3LB8C 5E7NA 4NJ6A 4IZ8A 4KGTA 1OO9B 5FR6A 3ITPA 4FF1A 1MJCA 3NS8A 1ZW7A 2EYOA 3A8IE 3JVZX 3JAMc 1ONLA 3HM6X 1LTID 3PZ8A 1SYDA 1SAPA 1Q8KA 2XTIA 4IPCA 1IBKL 5I6YA 3AE5B 5IN7A 4AS1A 3W5OA 4A3LH 2N55A 4MN3A 5E6JA 5BMHA 3O13A 4AQYL 5C23A 2QSDA 5IYBH 4U68A 2KANA 2PW5A 1TIID 4KLKA 3NHEB 2K7VA 2YTVA 4K3CA 4KKSA 4ANXA 2LRWA 2JA7H 5KHOA 2UUAL 4DHJD 3C3LA 3EECA 3JSVA 1SE4A 2F0VA 3I4MB 1V80A 4DR2L 1TIFA 3IAM1 2FINB 2O2LD 3NJTA 4BBNF 1XF5L 1ZXHA 3TDQA 4ANUA 2N78A 2DAFA 1R4QB 1HQRD 5M3MB 2UUCL 1SNDA 4A20A 2MBHA 3HZXA 1I4GA 3NQIA 4WJOA 4DUYL 3EFUA 4FXCA 1PMRA 4K14A 4J3OD 2WB1B 1XNRL 3GTKB 1HE8A 4B3RL 5IYDG 4A3FH 4EFOA 2WFWA 5GXGB 1E8WA 1RYJA 2AX5A 1J7AA 2LXCA 3M63B 2ZJQA 1SDFA 2F4VL 2K8CA 4OZBA 5GADC 2MP2A 2JPHA 1CSPA 3K81C 2G4DB 5CORA 1EFID 3S2DB 4A3CH 1OQYA 4HCPB 4WQMA 3E6ZX 3C8YA 4A3KG 4GMVA 4DV6Q 1IYJB 1D8LA 4U673 2JA6H 3CKIB 3P4RB 3T9LA 1YIWA 4WJWA 2LASA 1LV9A 2FMMA 1RLFA 1FGUA 1WTVA 3P4QB 1H9SA 3GP7A 1VQIA 3A0JA 1VMCA 1JCKB 1CI3M 4N8X1 4HN7A 2X6LA 4LUVA 2XWBB 1KLUD 1WTRA 4EQ5A 4NXML 2PLPA 3TIXA 2K4KA 2IY5B 1VF7A 2HTME 2AWOA 4GDLA 1PQSA 5J3BA 3I4NG 1C7YA 3Q6SA 2CU1A 2NPTA 3NVWA 2PTLA 4E3CA 2JA8H 2EYHA 4OO1H 5EE0A 1PZJD 3HG9A 4AYBG 4X65Q 2KTRB 1UE6A 1IL2A 3M4OB 4LF7Q 4DF7A 3AE8B 2PCFB 2B3GA 3PO3H 5A35A 2K1BA 2N9LA 3X23A 2KDIA 2KJXA 3TRZA 4GXBA 2XN9C 3TEHB 1X54A 3Q3OC 1X3FA 5GAHC 2PO4A 3K5OA 1RTOA 2R6GA 2NVQH 2WDQB 1GPXA 3FPUB 3MAQA 3VR4A 4PNYA 1JC7A 1AP0A 4A55A 3CC2A 2J0KA 3F2CA 4BKGA 5CR3A 5EJWA 3A4SC 3KLSX 2BWFA 2JYEA 5AZHA 1SMXA 1STHA 1EYGA 4YCVA 4DNRB 4ILWA 4IN3A 2IT1A 1XNQL 5CMDA 3MFGA 4HJKA 4HPPA 4KIKA 2OWOA 3SR1A 3K5MA 4Y52H 1E8XA 5D6JB 3X3NA 4IUUA 3I4OA 1U0LA 3DWAA 2N9KA 2NBVB 1I35A 4GKKL 2D10A 1D1KA 4DAYB 5JAVA 1SJHD 1UD7A 4G7ZC 5LXIB 2K03A 3W1BA 1I5FA 3MXNA 3DBHB 1IXRA 5T8IA 1G2SA 1SYFA 4S3SA 2EJGC 2N49A 2XNAC 5C3WA 3PIPA 2EPBA 2NVXH 4IFDI 1YNTE 3QWZB 5CHWA 5T1IA 1BKBA 4HIOA 2SDFA 1VQ5A 1VQPA 5C0XJ 4KX6B 4BOSC 3ZNGC 1MGSA 1N8RC 1F9QA 5K5PA 1HNZQ 4G57A 3VTWA 2ZW0A 4DV4L 2INPE 1LTTD 1C79A 3SK4A 4EQOA 2RR9A 2LI5A 3OW7A 1CFMA 3TBLD 3KF6A 1OTCA 3BVZA 1ENCA 4XZ4A 2BWES 4IPGA 4PZ8A 1OXVA 1X3QA 4XXEA 1STAA 1Y1WG 4A90A 1P0RA 2D3CA 1L0WA 1MI0A 2C35B 1KL9A 1FXTB 1AZQA 4MTKA 4KDLB 1SNQA 3NVZA 1F2LA 4F8CB 3PGZA 5BN5A 2PKOA 2ZTCA 4C1NI 1TZOA 3IL8A 4LLGM 4XT1B 1JICA 2HJ8A 1KDBA 2OQKA 1XMQQ 1HUNA 1ZDXA 1ZOYB 3PRMB 4LF4Q 2QHOA 3EFCA 4E74A 1OXUA 2VNUD 1NNXA 3ICEA 1G91A 5IGBA 2IGGA 2K39A 1DGJA 3H1UA 3IHPC 3L17A 3D4DA 2DNCA 3KUPA 4Q0FA 1H9JA 1SNPA 1IBMQ 1R4MI 2KHWB 2WHIA 1N5WA 1WR6E 4DNIA 3EIVA 3WOFA 4NJ7A 3BINA 2ENBA 4LJZC 2KFKB 4C7ZA 4EUTA 1IUEA 4JI5L 2K5VA 1ZUD2 3OAWA 2A6ED 3X0WA 1BUIC 1P9DU 2L7RA 2E3TA 4MJSB 3DBLB 5CHFA 3ONSA 4KK7A 4QL5A 1IBLL 4IWOA 5IYDH 5D3IB 3AEDB 3QQ8B 2VQFL 2WINB 3U58A 2A5UA 2N1WA 3QIJA 5J2RA 4CJ0B 4WAAA 1JWMD 1K8AC 4KN7C 5IP4D 1PYSB 1KXLA 1EWHA 2VL6A 1V1PB 2O6VB 3ONAB 3R93A 2KVRA 4B6WA 1ET9A 4KKJA 2DNEA 4K5VA 4G0NB 4TQ1A 4KD4A 1N33L 5BN4A 4LFCQ 2ZTEA 2QCZA 3C0RB 3I9V1 3MXUA 3L9AX 4A3KH 2MBEA 2B8FA 2KQSA 2KUMA 3H0GG 5A2QL 2KC2A 3P42A 1EEFD 2MO0A 1XX8A 3QOJA 1Q8IA 3VDZA 2BYTA 4W9KA 2D9UA 1JOOA 1PH4A 1YJ1A 2MA9B 4K7WA 4LK1C 4JK1C 1SN8A 5AJ3Q 1YNJD 2A69D 3AXCA 3AQQA 4BY1G 2QDLA 3IFTA 1G8ZD 3GOEA 3VYUA 5FOBB 2BF8B 2E75C 3PV0A 2IZVB 4KJNA 4PMWA 4NW2A 2MRPA 4E71A 4M8NA 3H15A 2K3UA 2AMCB 1TY2A 2KVMA 1FM0D 2WKDA 3NBIA 2EYLA 4BXXH 1FIQA 3HVZA 4PZ6A 3I4NH 2LS01 4QCLA 1WGYA 4BAXA 2KFJA 2PPBC 4WURA 2CHBD 4KKTA 5JJZA 3S15B 2O2VB 3MC8A 3NG0A 3GTGB 4I6NB 3IFWB 4AWJA 1STEA 4YXDB 2CHZA 3RLNA 1O78A 2NWGA 2WGSA 2NZHA 1XEEA 3U7ZA 4FDBA 4WWMA 5EKIA 1FCLA 4WIPA 3J81L 4ZUJA 2DAJA 3RPFC 1X3GA 3TL5A 1UEAB 3S2HH 2N9XA 4O1NA 3B2GA 2ON8A 1EOTA 4HKQA 4BBSG 1VQ7A 1XLPA 4ITKA 5C2TB 1LFDA 3T51B 2H4OA 3NVVA 5JJLA 1WJNA 1SFOH 1YHAA 3B1LX 4C4VB 1VMPA 4BA2I 4JWUC 1QF6A 2KX3A 2WNMA 1Y8OB 1X6OA 4GN5A 1PH6A 4I6LB 1SJED 2Y0SE 5IGGA 2OHFA 2WWZA 4K81A 1XJVA 2BH8A 3AM9A 3CP0A 2NYZD 1RJTA 4PYUA 2WP9B 4KD3A 1E10A 2LEKA 3H7PB 3Q8BA 4DV1L 4NAWB 1PZID 2G45B 3AE4B 4NAMA 1V1QA 2PMZE 3AB9A 3NSWA 1IBKQ 3M4QA 4KVGB 1X65A 2EDGA 4XIGS 1O7IA 3D4RA 1JOKA 4DR6L 2VH1A 1RFAA 2KCMA 1WM2A 4AQYQ 1IPGA 2JRIB 3KUCB 4KSLC 1I7HA 1PA6A 4K5XA 5DPSA 4JBWA 4ACFA 3RR5A 4LNKA 4Q2JA 5J1ZA 1D5MC 3UDIA 3CQZB 1Q1BA 1EIGA 4IUPA 1WE6A 2DENB 1EWIA 3P7JA 2BOSA 3NZ3A 4WJNA 1WY8A 1EZ8A 2UUAQ 2OQ0A 3S2AA 3L2PA 4DR2Q 4HXDA 4J6HA 4A76A 1QUQB 3ABVB 1JOQA 3MHBA 3GTOB 1CM9A 1YHQA 4HPMB 2PPHA 3ULJA 3EROA 1ISNA 1S1QB 1Y1WH 4UDUC 5IT9L 3VHTC 3A5UA 2HQEA 3E5SA 4MTNA 3Q8EA 2I1JA 4XYCA 1CZGA 2EELA 2DZMA 3VFKA 2EY2A 2VS1A 4DUYQ 1WJ6A 3PF5A 3SVMA 2RCFA 1XNRQ 1S5CD 4B3RQ 1RFKA 3RMKC 4ZDVA 2JWUA 1M94A 4DR7L 2V9HA 4UP7A 4KKUA 1T9HA 4JVZA 2LGSA 1DCZA 3C2PA 1C48A 2B2UC 1NDDA 2J42A 3U52E 1TKGA 1N36L 3PO2G 4CKBA 4RCNA 3E0JA 5CYUA 2GLSA 2KBNA 1GM5A 2GOWA 4ZHPA 1D6EC 1F2MA 3BK1A 1N32L 1F2RC 4TMAB 1HZCA 2K50A 4ZK9B 1LT3D 2ZJPA 5C4XG 1G2TA 1T0SC 3WWVA 2I38A 3Q8AA 4AJWA 1MSHA 1NAPA 4NPSA 2Q8IB 3RZDB 2C7MB 3RNEC 4KY6A 5ELEA 1GB1A 1VQ4A 1YJNA 1I4QA 1I50H 3GV6A 1VJKA 4DR1L 1J19A 1BCPD 1GHJA 3WCQA 4ZCKA 5DPRA 2PZTA 1PRTF 2QGQA 1ZP0B 2HDEA 2G3QB 2SOBA 2L3ZA 1V9JA 4RKLA 3QHTA 4JPBW 1J7BA 4B9XA 2RPVA 4A93G 4YSZB 1G51A 1M90C 2UXCQ 3FKIB 2MH7A 1RD9D 3S16B 4K3BA 5L95C 2O5IC 2KYWA 1WXSA 1YX6B 3BYYB 3M85A 4S17A 2RGFA 4WJ3M 1V2YA 2MSED 1QVFA 1JWUD 1F2ZA 3H0GH 2E2DC 2H88B 2VH2A 2O4XA 2WDRB 1YI2A 3HOXH 5IGCA 3PZDA 4OVUA 4FF2A 4P74A 4IOIE 3A9JB 3JYUA 4A3IG 4G7OC 3QAQA 1K73C 4M1UB 1WYGA 2M17A 3KWLA 3PIO3 2MHJA 4LMQD 2QJLA 2F0PA 3I91A 3MHSD 4BY1H 4X66Q 3CC4A 2EQSA 2F3WA 2HDMA 3M9BA 3C1FA 3HOZG 1I3QB 2VXWA 2L52A 1EQRA 2J0MA 3ERSX 1B70B 3TS0A 4IJHA 2K8BA 4OZCA 4O42A 3RNCC 4ASWC 3NTIA 2XIWA 2I2YA 1E1TA 1LTRD 4KKIA 4L5TA 4MACA 4L23A 1F77A 3CF6E 2F0HA 2NR2A 3G6JB 1PH2A 2LMCB 1WIAA 2RSOA 2VY3A 1HXYD 3NQTA 1GUNA 2NVUI 3W3AA 1S5FD 4A3DG 2CHXA 2O5JC 4MM3A 3A1QA 2QKIC 3CSFA 3HVDA 1EYDA 1YMHE 4MT5A 3CMEA 4JV5L 1CT1D 2DZKA 5I9PA 1X3PA 2WU5B 2B2YC 2MUYA 2KK8A 1I4RA 4BBSH 4EZKA 1I6HB 2ZZPB 3AE3B 1P1AA 3RD4A 1B1ZA 4QB4A 1SE3A 2FXQA 2LFNA 5C0XG 1LABA 4RGTA 4DGZA 3ZRCA 4GLXA 2WXPA 2WXMA 2F0TA 4IOAA 3ZDTA 2A6EC 3CPFA 5DM63 3QC8B 3WA0A 1J7CA 1WCMB 1E8YA 3KUDB 5LMUL 2IO1B 3DUZA 1ENFA 1X55A 4XT3B 3GTQB 5JHAA 4B3ML 2B63B 3ML8A 2FBWB 2ZEQA 3GB1A 1PFSA 3VH3B 3VA7A 1BMLC 2WAQB 1HA5A 1C1YB 2C5LC 3CSTA 1SF0A 4REZA 4TKNA 4AOFA 3P75A 2PMVA 2DYBA 2LHDA 4J6IA 1KFYB 2N1VA 3NRZA 1TWFB 2CWAA 1ESRA 1HH2P 1OEYJ 2INDC 3R8BA 2G4SA 2HTHA 4B3TL 3E9SA 3M4YA 4KN4C 1V97A 4JI3Q 4HIMA 4HWIB 4A3GG 4MGYE 2D0OA 5ELOA 1KD1C 1MI2A 1E90A 2NS5A 1AEXA 1GC7A 1I42A 2NVYB 3KDFA 3I90A 1QOHA 1MD2D 2JK8A 1WWTA 4HAEA 3T56B 1HQMC 1X32A 4OEMB 4C3IB 2A69C 3J7A5 2GBMA 4JI5Q 2KQ4X 1C3TA 4FJYA 2K05A 4JI8L 5AUIA 2IHEA 1OTRB 1SMYD 5JPNC 2EVBA 4LFAQ 1I4XA 5LHY1 4IFDJ 2UXBQ 2E2JH 3VVWB 4MNOA 3TBIB 1TWGB 2GBNA 2JQRB 4OVZA 1E7VA 3D31A 1IBLQ 4X6AH 4EKUA 4AJYB 1GVPA 3GDEA 4A3MB 2VQFQ 1VQNA 3LX0A 4CYEA 4NB3A 5IYBG 3JAMi 4CDEC 2WXGA 2KCTA 1PVOA 4US8A 2I1KA 1FEHA 4C3JB 3MHZA 1KIXA 1VQMA 3N6RA 4ABNA 3BU2A 2A68D 1RIPA 1CA6A 4DV2Q 1L6VA 5LMNL 1T6BX 2VQEQ 5C4XH 1KQSA 1RAXA 5C4HA 3J9CA 3MP9A 1B7YB 1U4MA 1OXXK 4HIDA 4PK1A 2YTXA 4YCUA 3CPWA 3L0OA 2M2LA 2KN4A 4GZYC 1M1KC 2LD9A 1Q46A 2PNRC 3S1MH 2UU9Q 2M56B 2ZVOA 2JSVX 4IM0A 1SROA 1Y8PB 5CV6A 4C3HH 1QB5D 1H9KA 4A3FG 1Z6HA 5I4DA 2IDYA 2KT7A 3NZUA 4LFBL 5M3MG 4YTPB 2N7DA 1RODA 2F0SA 1T0QC 3L4PA 4FVMA 1EZ6A 2L00B 4K0KL 4NQLB 1PFBA 1VZ6A 3AMZA 1WSPA 1DOKA 2WB1G 2X8XX 4LDTD 1BBUA 1TGZB 4A3CG 1ET6A 2CWPA 4FYDA 1EM7A 1N62A 5NUCA 4ZRQA 3WIMA 4A3IH 3RNUA 2V1CC 2X6GA 3DBSA 4DXAB 3AE6B 4HRSA 4BKSA 2GVAA 4XX5A 4A3JH 4EQPA 1B44D 1GC6A 1VQJA 1UELA 3A74A 2L32A 1JRPA 1T3QA 1OXSC 3GTJH 4A3BH 3T13A 2XK5B 4RMAA 3TN2A 3BVMA 5CGKA 3CRLC 3L54A 3H7SA 1F9RA 3ZXRA 2CW0D 3PLVA 1EEID 3CD6A 1KOTA 1EU3A 1PH3A 1LTAD 3Q3MC 5DEHA 1FGBD 4LF8L 4A3DH 2IY1B 5BN3A 4WQOB 1S3SG 1FVIA 2MCNB 4CO7A 1G6PA 1HPCA 2DN8A 4IUQA 1KAAA 1QVCA 2KZRA 4CHKA 1RDPD 3H3VH 1JQYD 2JXMB 2L1BA 2N7EA 1FNUA 3U50C 1E6EB 4HJ7A 5J17A 3DHGC 4X57B 4DR6Q 1AW7A 4APVA 4Z9CB 1KC8C 1WI0A 3EJIA 3GTLB 5C0XH 1L0XB 1WTQA 1F1HA 1MG4A 1SGHA 1R4PB 2NTSA 1EYAA 1UEBA 2EYFA 3A55A 1QVGA 1E3PA 5J18A 3ULLA 3BK2A 3V60A 1ROEA 1A2UA 2J0TD 2E8GA 1PTOH 3N3KB 2KTRA 1EUVB 3A4RA 3S14B 3K59A 1Z2MA 1GUAB 3KH0A 3L16A 4FULA 3QG1A 2WXOA 1OQRA 1BCPC 1WTXA 4CKEA 4DA2A 2Z0EB 4JPSA 3CC7A 1HZBA 3Q22A 3TP6A 4RM8A 4TRDA 2EYMA 1EIFA 3J80L 3FKYA 4JI2L 4KHPL 3HRDD 5EKLA 3W2DA 3RFZB 5HG2A 3ZQ4A 1YNXA 3U9SA 4IUTA 2JA9A 4GIVA 3VH4B 1YNNC 2NUCA 2KCNA 5HY6A 1WXQA 4R4TA 3TP8A 1N36Q 3VAWA 1RL2A 2ICEC 1PHJA 2IWHA 3VR3A 2AQ1B 1LUZA 2CHWA 4YWGG 4YSXB 2L15A 4URKA 4NXNL 3UDFA 3CCUA 1L6UA 4YTMB 1U4RA 1IYUA 4XQNA 1XLOA 3IAS1 2K14A 3OLMD 5DPWA 2B8GA 2F0DA 1V5OA 1QOFA 3IFDA 1WJJA 4NDXA 2BKRB 2KMCA 1WH3A 3JW0X 1E8ZA 3PUWA 2MBOA 2DZJA 2JA5B 5COYA 4LF5L 3I4LA 3JAME 1U5KA 2XRQD 3ZKJC 3VRAB 2QC8A 3FILB 1E2VA 1RF2D 4ZQ3A 1HCZA 4EGVA 1DOYA 2E5LL 2D3GA 2A5HA 3U30A 1Y56A 2DYMA 4JI6L 4BKTA 2KDEB 3AE9B 4MZ9A 2QMTA 1ZGUB 1WRIA 2D3AA 4FJZA 5JOBA 2FCMA 1NMFA 3OIPA 3I4MH 1QJOA 2KMMA 4C00A 4ZKBB 1PH8A 1K0SA 5KNCA 2K28A 1EY4A 5CBEE 2RDBC 3K6OA 4TUUA 3AECB 4DV0L 1F52A 2A73B 4R1JA 5M3MH 5D94A 1STGA 1SYEA 4O0AA 2WX1A 5H8YE 3H6NA 4DHZB 3S1RB 1TKWB 2GVBA 3DM1A 3GTKH 4JYAL 1PUTA 3CCSA 3VTVA 1WD1A 3HOVB 2KFKA 3RZOB 1WXAA 2UWQA 4JX1C 2L55A 2HD5B 1VZ7A 4OWWB 2BPSA 2D07B 4MJSA 2JEAI 3S2DH 4DR3L 2LJ5A 2QILA 1WJ4A 3S17B 1J0GA 1SIFA 1QCBD 1E9MA 1P98A 2AYOB 2K9XA 5LL6X 5FLXL 1DD2A 1MHXA 2JUOA 3NTHA 1AFPA 4CJ1B 3HOYB 2Z4HA 5EPLA 1D1IA 4B9WA 5TR5A 3EN2A 3RYTA 3S1QB 1VCBA 1ZE3D 3VA5A 5JZEB 5C4ZA 4I65A 4ARIA 3KJPA 2KHJA 4AIMA 4BXXG 2OT2A 4JOIC 5M5XB 2F0LA 1XTDA 4KZ0A 4IUMB 4Y7NB 2BKFA 1EYCA 1LYLA 3FHWA 3A7AB 1HFGA 4OL7A 5LNK1 2LGXA 3H94A 1V1OA 4K6DA 4KJOA 5LMUQ 2BYFA 3PQIA 1P8LA 3G7LA 5AEKB 1FPYA 2K6QA 3KLWA 1KDCA 3SEBA 3B2FA 2D0PA 3MZ5A 1NSNS 4AH6A 1X1MA 2LY7A 3M4OH 1ZDVA 3DHIC 3NVYA 3K80C 3RNGC 1WZ3A 2L05A 1LTSD 2HQLA 2PQAA 2K6AA 3K7AB 4BBNC 4PV1C 1T0YA 2A68C 4J15A 5GQOA 3F2BA 4B3TQ 4F7ZA 3EQLC 3U9OA 2O2VA 1YN5A 2YEPF 2RHQB 3ZTCA 2GN5A 1CMXB 1D5ZC 1K28A 4A3EB 1CQFA 1QWYA 3E3XA 3UIPB 2L8JA 1DXMA 1R4NB 4BBRB 4GN1A 4L5RC 3T53B 1PV4A 1HTOA 2L9HA 1SEBD 3FDTA 3PRZA 4KSKC 3W1SA 4DU9A 1P7FA 1S5ED 4HJ5A 4JI8Q 1EL0A 2GRIA 4TKOB 4FJVB 4QGUA 4IFDG 3I2ZA 1MFWA 1TJEA 4A3OA 2ZPNA 1EOVA 2R93B 2R61A 3MTSA 4C4VA 2R92B 4UY8C 2M0XA 3SFDB 1FJGL 4DKAC 2R7ZB 4BY7B 1SR3A 5HGTA 1CQVA 4GSWA 2PI2A 2QF7A 3MWYW 1ZKHA 5IGEA 2RSNA 2KENA 4DV5L 2BBCA 3L0WB 4YWLA 1DOXA 2KHIA 2R92H 1FXAA 3NPPA 2LXAA 1Q81C 4MGZE 2HHHL 2FCNA 3RUZA 5LMNQ 1X9NA 3X3MA 2PW7A 3H7PA 2JU6X 2E2HB 2ES2A 1WGGA 4NAWA 4JLCA 2RKSA 3KUZA 1ILPA 3EVQA 2Z59B 5M3FB 4A8XC 2WDVB 3BY4B 4BZAA 4AYBE 1WF9A 3TP7A 2L83A 3AU5A 2UXDL 2EXZA 5IE8A 4C80A 1QNKA 4WORA 5DNFA 4JI4Q 4P72A 1YX5B 4LFBQ 3GQBA 3UQAA 5E4XA 1T5EA 4JQWC 3P4SB 2A1AA 4NZLB 3AU7A 3UE0A 1YVCA 2N8NA 5KYIA 4K0KQ 2G9HD 3TEZA 1PYBA 2L0CA 2Y5PA 1YITA 1QUQA 1JWSD 4OXPA 1VQ6A 2UYZB 1TWAB 3GTPB 3G71A 4KV6A 4XWTA 3L08A 2F0EA 2OEOA 5BMIA 1PRTD 1YOVB 3CCEA 3UDGA 1IW7C 4PS3A 2CH4W 5D7GA 1R9TB 3ZJYC 4PG3A 1YN3A 3OMGA 3KW5B 1IL8A 1LTBD 4UP9A 4DV3L 2LGIA 1XWEA 5G5GA 1UZXB 3FC4A 3MXGA 3OTOL 1LXDA 1S40A 2K32A 5MPOA 5AZFA 3CAMA 5LLIA 1NR2A 4K1RB 1KRSA 2WU2B 3DWQA 2E74C 4W9FA 1E2WA 3RMHA 1I94L 1UE1A 5AUKA 1I4HA 3R7QA 1HRJA 3ZNID 3AEGB 4II2B 4A6QA 1GJXA 4POGA 2LGDA 3PUYA 2AWTA 4JGHB 2W55A 4DR5L 3FKIG 3HOXG 1F9JA 3R2IA 2R7FA 3Q6BA 5BR8L 2N9PC 3MJWA 1JQ4A 4A75A 2WS3B 1PXUA 1JJCB 2K5NA 3OWFA 2VZKD 4WWOA 3RNFC 1MKHA 3PMFA 1BCPB 1C76A 4OWTB 3P20A 1EIYB 3G48A 4W9IA 1O7ZA 2LZ6A 3PTFC 2CVRA 2NN6I 3APDA 4YY3L 3P1MA 4IALA 1STNA 3SGIA 1FXIA 1ASZA 5E1FA 4GDLB 1C78A 1JRUA 2D62A 1WFYA 2LHEA 1WVLA 3D3RA 2NPTB 3T3OA 2TSSA 1D7QA 3NWSA 1N5XA 3OHXC 5ELCA 5I9OA 1BOSA 2BE5D 2VB3X 2FUG1 2B39A 4MGIE 1HNXQ 3W9CB 4JBJA 5CV4A 2GI9A 1NY4A 3A9JA 3UI3A 3PGEA 3SU8X 2GBKA 4ME5A 3NY5A 3AB5A 2AUKA 4XTCS 2Z0DB 5IP9G 2IX3A 1TYGB 4K6LA 3S15H 3QK0A 2JWZA 2LSSA 3CU7A 3GTGH 4M00A 4WWPA 1YJJA 3DPDA 2UUBL 4RF1A 2RCNA 2DZIA 4XDDA 1MSGA 2MQHA 4JI2Q 4FA6A 2FE8A 4QAYA 2MNAA 1PTOF 3DXJC 4OIJA 4IJLA 5TSSA 1TBEA 4R3DA 4N8FA 5JJKA 2K6DB 2ZJRA 3F2UA 2LMCA 1Y69U 2CS4A 2EKEC 3J7ZC 4RWSC 5J39A 3PHWB 4K7SA 2SEBD 1PH5A 1PGXA 1UUPA 1HZ6A 2M8SA 3K58A 3DM3A 3P1HA 1JROA 3CIRB 1HNWL 5EE1A 3DWPA 2JE6I 4A3PA 1T5XD 1SB3C 2LXJA 2KXJA 4ZOHC 4A9AA 4H2AA 4B9KA 1ENAA 4NXNQ 2GB1A 4IFDH 3K0XA 2BB6A 4KTAA 2F0WA 2AQ3B 3D6WA 2BS2B 5ISRA 2C7HA 1WCMG 1L0VB 2XGTA 4YTNB 3DWMA 2V1YA 2IJ0A 4C56C 1KM7A 4P73A 3VR2A 2B63G 4LF5Q 3DMUA 4H7BA 4UPAA 2PW9A 2VZAA 2CJOA 3HS0C 2WAQG 3MFYA 5C4JB 3G6EA 3IT6B 3EC8A 4GNXC 2E5LQ 5EPKA 4QMGA 1AN8A 2ZT9C 5LMNW 4JI6Q 4LNIA 3CQZH 3DOWA 3RZWC 1D3ZA 5DM73 3VYSA 3S1NB 1VQ8A 4NNJB 1HFNA 4IG7B 2DX5B 4DV7L 2UUCQ 1R4MB 4ZRPA 2CR5A 2BA1A 3R66C 1A8VA 1K3BC 2JYOA 1B4OA 1C9OA 1CTMA 3T1HL 4P7IA 3NTKA 4FO2A 2W9NA 3GTOH 2MBBB 3MC0B 3LNNA 3NEMA 1OFFA 1Q1OA 3KK7A 2FJ2A 4DV0Q 2GA4B 4RGNA 1N63A 3ML9A 2F4VQ 1SYBA 1J5EL 2Z6KC 1RWSA 2QDFA 4DK3C 4IC7B 4W9HA 5HFYA 4EEWA 4ALPA 3SK6A 3AE7B 3RI7C 1EUJA 2RQXA 1UAPA 4A3MG 4JYAQ 3N32A 4O2DA 4C2MB 2NZOA 4DNTB 3K0YA 4DK1A 1MVKA 3QA8A 2ZNVC 2V3SA 2N7JA 2YLMA 3HRZC 2ZCBA 4TVAB 4QQBX 2OJRA 2LVQA 2CKHB 4IW0A 3TZDA 2FHTA 3NP8A 2INNE 2BH2A 2MJEA 4NXMQ 1GKHA 1K8MA 4C3HG 4AQ7A 1BXTA 4P1CC 2V3NA 1EY7A 5LXHA 4IUNA 5CV5A 3RZDH 3SDLC 1G6JA 2XRSD 1DYQA 1EY0A 3I70A 4RKBA 1E7PB 3QB3A 2JF5A 3SK8A 4S0RA 2Y0SB 2KLGA 1E24A 2MW5A 1DOMA 2B2TA 1UGJA 1A0IA 2Z6BA 2W54A 2MJ8A 2WYQA 3STBD 1UGMA 3AU4A 3VYTA 1JWAD 2OXPA 3FKIH 3S16H 2KOLA 3OIQA 3T16A 4PS7A 2M00A 2PMZB 5IP7H 1C77A 1XQQA 5L83A 2KDBA 2WKCA 2C5CA 5A2QE 4A3JG 3B9JA 1J8IA 2F0FA 4WJPA 1U4LA 3Q2AC 5BMGA 2B29A 5E6NA 2FCQA 3ZVVA 2JSOA 4A3BG 1VF5C 2V4IB 2EY6A 5IWAL 3F2DA 2D11A 1EFWA 2NVTB 5EE3A 4LDTB 3D4WA 3QCAA 1L0YB 2NMQA 4L5QA 3EGRA 3PZ7A 1I3QH 2EY1A 1XNQQ 2KTFA 1MJDA 2Y3AA 2HCIA 3H09A 1Q5WB 3UDXA 4ZAIA 2KN5A 4XE0A 1LTLA 3E0EA 1E0BA 5IP9H 4KZCA 5DPTA 5BYQA 3J81c 4R4OA 4X3KA 2E6XA 1CKNA 1P16A 4DK5A 4GKKQ 1Z7TA 2KO3A 4HMJA 2N9EB 4R8NA 3J7AF 2DJGC 4JL9A 1DONA 1P7EA 1L1OA 1WE7A 3PO0A 2KDMA 2J7ZA 3PIOA 4LF9L 2J7QB 2JXTA 4PYZA 2XK5A 1N61A 2WXFA 2BT6A 2YV5A 1SXTA 2HIVA 1VDZA 3GV3A 4R4CA 3J81E 3DEOA 1E7UA 1MJEA 1O80A 3CWIA 3AULA 1K9MC 1VQ9A 1NYQA 1I6HH 1QLBB 1TS3A 1A3VA 1TVXA 1FYCA 2VUMB 2KWDA 3N20C 2C9WB 5IGFA 1C4PA 4MDKE 2F0UA 3I57A 4YL8A 2K04A 4DV5Q 4YSYB 1IYFA 4DV4Q 3N52A 1B9NA 2BGFA 2LUEA 1PRTC 3KLRA 2IW3A 2HHHQ 1UBIA 3HEJA 1JB3A 4KY5A 1EO6A 1BVSA 2W3SA 4RCOA 5CX3A 1RRBA 2RHSB 1IKMA 3APFA 3A56A 4XDCA 1WZ0A 4LF6L 3I73A 1QG7A 2MHVA 1WCMH 4I7AA 2I5HA 3HKSA 4OX9L 2IO2B 1I6VC 5EBDA 4XGAB 2DY7A 1YQ4B 4M0WA 4KI0A 2UXDQ 3GTQH 1LQBA 2BVCA 3HKZB 3CCQA 2B63H 5C0XI 4B3SL 2K5QA 1QE6A 1GXDC 4RGOS 4UHVA 3FAHA 2INCC 4N58A 1P3QU 5G2NA 3AFQA 2MPMA 3H9DA 1MHWC 1ZKOA 4LF7L 2B2UA 2ONQA 1S4ZA 1XMOL 1B8AA 2B2VC 4MELA 1C9FA 5C44B 4W9GA 3H6MA 1TWFH 1JALA 3UF8A 1JW9D 2A6HD 1WYDA 2WDTB 3MC9A 3TCAA 4MSQB 5IT9c 2A74C 5D14A 2EJMA 5M5YB 1YNJC 3KVFB 4WJ4A 4XC2A 1CHPD 5G55A 1K8RB 1QNUA 1Y1VB 1H4RA 3NUHB 3GTMB 2KMAA 4LNOA 1LM0A 3W5VB 5C44H 4W9LA 1K8GA 3T3NA 5AFWA 2NVYH 1E5WA 1L2FA 3ZW3A 3KYCD 2HJ1A 1TS5A 2B2WA 4C3IH 3M3YB 1TZ1A 2Q8RE 4G11A 2GBRA 1D4BA 4GOPC 1KTKA 1SNCA 1K0RA 1KRTA 2Z0SA 4IWPA 2EZVA 4W9EA 2CH4A 1TWGH 2BE5C 1PH1A 1TWCB 1Q86C 1N34L 5M5WB 3HOUB 3TS2A 2N0SB 4GGQA 4HKZE 4A3MH 2JN4A 1N33Q 3Q24A 2ZW1A 2EY5A 2PZUA 1Q10A 2BS3B 3AE1B 4OWXB 1V9PA 3TP5A 2LVPA 3TEYA 1D2BA 1V8CA 3JAML 1VQOA 4C3JH 1BR9A 1VDVA 4EQNA 1TWHB 1NE3A 4H0LC 1BBWA 3PO2B 4LWCA 2MO1A 4EVOA 3I4MG 1JJGA 1KRHA 1IBXB 2YVCA 3PHXB 3ULPA 2KEEA 2IPKD 3L10B 1NI3A 1XCTL 1V5TA 2KC1A 5C5MA 2E76C 4HROA 4R9WA 4FP5D 4YY3Q 3FILA 5CV7A 3M7NA 1TR5A 4CGYB 2MX2A 5JJIA 2W82A 5JEAJ 4QUFA 2CCZA 4DHJB 3SD5A 1WOCA 2FNJB 3A33B 4CJ2C 3K57A 3I3CA 1FRDA 2N88A 1EF5A 1B9RA 3TEXA 4H44C 2PVGC 4K8IA 4IQZA 4A93B 1VQFA 3DBRI 5D3DA 4HK2A 5CHVC 1UWMA 1K52A 1W6JA 3BS1A 1YQBA 3O65B 2LRUA 3HOVG 2B2YA 1XYIA 1EY9A 1JMCA 1V49A 5H92C 3ZRFA 5ELDA 2KNBA 5KRUA 1GAQB 4IOCA 5C6AA 1TKEA 1Y14B 2PQEA 3HUIA 4RFBA 3U2SC 4IM3A 4FADA 3I7FA 4PQXA 2IY0B 1F2YA 3MJ5A 3HOYG 1F0ZA 3CCVA 3HOZB 1KNAA 2F0KA 2ALYB 2PZWA 1JR0D 1KDAA 1A5RA 4JCVE 5I2XA 2YYZA 3A1QB 3NOBA 3QX1A 4GNXB 1NI2A 3RZFA 1CA5A 3E9IA 1M4VA 1STYA 2I0QA 1HEZE 1WXMA 2MJDA 4BWGB 4DN4M 2ZM6L 3RT3B 3W1YA 3S9WA 1TKYA 2IL8A 4DV1Q 4HPLB 3HP3A 2KQ3A 4DXGA 5JHBA 3NENA 1GO3E 1HZAA 1HUMA 2Q8TA 1UF0A 5G3LF 1A3UA 3EUB2 4ZLTF 1FO4A 3IT4B 3SE0A 1NR4A 3RN9C 3HOWB 4LFCL 5IGDA 1UBQA 5F2DA 2K75A 4NP5A 1STBA 1F9PA 1JORA 1LTGD 1YD8U 1LO5D 2L11A 1K83B 3RLFA 1B2TA 4NY0A 2VW9A 4GN4B 4HMIA 3M4PA 3KJOA 2E2IB 2AQ2B 2ZVNA 4C7YA 2J4XA 2EYJA 3CW2C 4OO1I 5EDSA 2ZPYA 3GTLH 1N9WA 2YTYA 4MHEA 1AZPA 1SBBB 5AJ3L 1IYVA 4HEDA 3NBHB 2REXA 3BDOA 2ZNVB 2BYEA 4DWFA 4A3EG 4JI0L 2C9OA 2WB1E 4LNQA 3BG3A 4BS9A 2KX0A 4HJGE 3OYYA 3S14H 4HJAA 1MBYA 3A5ZB 3Q0AA 2Z1CA 2LFIA 1JE4A 2D3BA 1WMHB 3DQVA 4CHTB 4L2YA 3PUZA 1ACCA 3V61A 2F0GA 1W3SA 3KF8B 4L63B 5KIXA 4FXDA 1HZ9A 4HSPA 4DR7Q 3E56A 2R2OA 4RMFA 1PZKD 3STBC 4XQJA 3J80i 1G291 5ELBA 1B3AA 1VR9A 5C3EB 2R93G 4NKLA 1CZWA 5EGTA 2R92G 1DGSA 2FUHB 1VQHA 2XSCA 2YU9B 2R7ZG 4P2CB 2ASBA 4BY7G 4X3SA 3AEFB 1N32Q 2EOTA 3V62A 4DAYA 4A3GB 1HTQA 3A8KE 3UI2A 4HCEA 3Q23A 3SXHA 3A8JE 5JH5C 2W3RA 4XDXA 2I07B 1EWCA 4JC0A 1BO0A 3S24A 4DR1Q 1FD7D 1Y8RC 2X38A 4LUOA 1CKOA 2NBWB 5D65A 1QZEA 1SNOA 3DWGC 4J1MA 1IKLA 5M3FG 1ZXIA 3MVVA 3PCOB 3DBHI 4DDGD 5JVH3 5C1ZA 5IY0A 3T1YL 3W1SC 1QT9A 3I8ZA 2PJHA 1VRAB 4LNNA 4HIKA 3VXWA 3VYRA 2JA5H 3VQIA 5L37A 4WRDA 4EOYA 2PE6B 4YWKA 1NTGA 3GS2A 1QZGA 4FF4A 1K53A 4IWQA 3F8TA 2JA7B 4FN2A 2MBQA 4F87A 4CQNA 2I46A 4UP8A 1QOGA 1N60A 3RUIB 1HR0L 4RHSA 2RPQA 1JJ2A 1VQLA 1XO3A 5FK9C 3DBRB 1H8CA 4DK6C 1HTLD 2HCCA 3FVQA 2Q2HA 4X64L 3R7RA 4MH8A 1SYGA 4RAUC 3VUXA 3GD7A 1GD7A 2CQOA 5IWAQ 2EMTA 4KDIC 2F0IA 2RDGA 2Q2UA 4W9JA 1A63A 4A3FB 2KAJA 1B3QA 3F1ZA 5FO7B 2K01A 4QIWB 1MPEA 5ELNA 2BQQA 3RCZA 3S1RH 3ETRA 1PRTB 2ZCCA 3IKJA 2MFIA 4JV5Q 1UE7A 2EE1A 2IHFA 2XVSA 3CF5A 1W2BA 3HOVH 3RZOH 2GBJA 1AWDA 4GKJL 3VR8B 1YJIA 4K7UA 3MEHA 3BZCA 2JA6B 3PV1A 2JEBI 2H89B 1JE5A 1V1PA 2XWJB 4LF9Q 2O6VA 4ME3A 1A70A 3TMPB 3DBLI 1PFNA 3S17H 4G3XB 1D5XC 4YWMA 1WTHA 4DR4L 3EFXD 2VRRB 3HOYH 2A6HC 1RHPA 4NMZA 2IGHA 3S1QH 3FMCA 2IO0B 2KACA 2V4DA 3N9YC 3Q3JA 3SHLA 2UU7A 2EMSA 1FFVA 1SMYC 3U8ZA 4WAFA 2BS4B 5C3JB 1WGHA 4GN3B 4RGMA 5M5XH 5FJ8G 2WQYB 3KOJA 2VZKB 1GUSA 1PDQA 5T1GA 3RN2A 2P5ZX 2L0TA 4B3MQ 2DJFC 4XYOA 4Y7NH 4M8AA 1GUOA 4KHVA 3J81j 1SE9A 3UGBB 2JA8B 3G4SA 4LF6Q 1MHHE 4KV2A 4ZRIA 3ZIMA 1PTOD 2UXCL 2F1MA 2K33A 1QILA 5FLMG 2F4IA 4OX9Q 1TTNA 1NMGA 4V0BA 2G1EA 2KOXA 1FNWA 3NWTA 1L2NA 1M8AA 1C8CA 2B76B 1TS4A 3ZJUA 3TREA 1GUGA 3V96A 3PF4A 3PO3B 2I5MX 3A9KB 1H9MA 4B3SQ 1XXGA 4GOPB 2LXKA 2EKIA 1FR3A 4V190 3OW2A 2NVQB 4K8JA 1XD3B 1ICWA 2TMPA 1BF4A 2J53A 2WXQA 1XMOQ 2X69A 1H95A 4XWWA 4HR7B 1DOIA 2OOBB 2Z9HA 3K7AH 3LYYA 5KHQA 3PIP3 3URYA 4X66L 1KF6B 4JBKA 1OEYA 1XTCD 4CBVA 3V6EB 4A3EH 5I6WA 1HZ5A 4RNAA 2L0FA 3RNAC 3AV8A 4BBRH 4WWNA 1K8OA 3J80c 4AUQC 5CV8A 2F0MA 4HTHA 3Q3FA 3WANA 4P71A 4TQUS 3SFEB 4GDKB 1H9RA 3PT2B 2J0JA 3VRBB 3CMMB 1N34Q 3Q14C 3L13A 4J8QA 3J80E 2R93H 2NVXB 1EQVA 1SIJA 2R7ZH 3HIZA 3SK5A 4BY7H 1WX8A 1UE5A 3N1YC 3OJ3A 1VQEA 4M01A 2C60A 4GLSC 3QWNA 3A7LA 2JP1A 1E1OA 2B3AA 3HK0A 3ZUNA 4M02A 2AL3A 4US9A 4HDOA 2WX0A 2K5WA 2MGSA 3FRPB 2KCCA 2ASQA 1YQ3B 2DNFA 2NCNA 4NPNA 4FBJB 4JWSC 2E2HH 1W6KA 4L1BA 4R4IA 2DY8A 1PFDA 1Q0WB 2JXXA 1NENB 4FHKA 1RM6C 1V43A 1SLJA 5M3FH 2KKCA 3K9PB 4OZAA 1CUKA 2CW0C 5JEAG 4HVBA 1L5PA 1EY5A 1WTPA 3JSVB 3ERQA 1K50A 4CDCC 1IP9A 1UNSA 2AEHA 3H8HA 1PFMA 3MXPA 1FD6A 4QJFA 3VUYA 1WD0A 2RDFA 4K2KA 1FNVA 2Q5WD 5GMVA 1XCQL 4OVVA 4I6PA 4MGKE 3K7UC 4DFAA 2LVOA 4BKSD 2G9DA 2WXLA 2BDNA 1ASYA 3HHMA 1J6QA 3W5UB 3D0FA 3C19A 3ECIA 1TWAH 4LW1A 3GTPH 4G7HC 4DQOC 3BWUD 1CJEA 2XBBC 4JI3L 3KYHC 2FIDA 2K8HA 5IOCA 2MP2B 1S72A 4H02A 3SR6A 3NUCA 2NBUA 2PEAA 3PVLA 2RBMA 2A19A 2PI2E 1R9TH 5HKHA 3Q8FA 1O7YA 2XEWA 3B6YA 4II3B 1EQTA 4JOIA 1YEZA 1RCVD 4DAMA 1WGDA 2AUJD 2ZJDA 4GU2A 4LFAL 1B50A 4LF8Q 1V86A 4JI7L 2UXBL 3P63A 2OF1A 5ELFA 4LK0M 4EZJA 1H9SB 1JMLA 2Y0SG 3CMAA 3RN5A 4POFA 2ZM6Q 5FLXc 2L4NA 1WI5A 3I3TB 1DOLA 3BJUA 3RLOA 5IP7G 4A3KB 3IVFA 1SRUA 2NN6G 2Q2IA 3BVGA 3M62B 4KGRA 5E6OA 3DCGA 5CV9A 1PLFA 1Q90A 4LUZA 1VD2A 1PH9A 3DVNU 2Z8LA 1R7SA 1BBXC 3ZDMC 4DV2L 5FLXE 3CHBD 5HGQA 3AH7A 3GE8C 4TQ0A 2VQEL 4G50A 3UE1A 4OELB 4OONA 2ZTDA 4R4QA 1FFUA 1WTOA 1YN4A 4HLEA 1Z5SB 3TZUA 5FJ8H 4LCDE 4ANWA 2Z4IA 1V8QA 3I4NB 1YHBA 2IYDB 4QUCA 1NUCA 2UU9L 4YHHL 2R3ZA 3AN1A 1WR1A 1IHZA 4JI0Q 5M9OA 4ZHOA 4AYBB 2D2CC 4ANVA 3L3OC 5FLMH 4ZRZA 2PQAB 1VLBA 2QA4A 2KJHB 3NELA 1Z47A 4E6IA 1IZ6A 4X62L 1VCIA 4KHZA 3J81i 4KHPQ 1C4AA 3D8GA 2HD3A 3OSOA 1BUVT 1XLNA 2B2TC 5CBAE 5K36G 1PDXA 1RTNA 1PYWD 2DBYA 2JZPA 3S2HB 3M3JA 3WAOA 4ZKCB 4TV3A 1XPOA 2Y5CA 4LTUA 4ZYNA 4ZUIA 4KIKB 2LGYA 4EX5A 4B95A 4ULLA 1SFOB 4JIOU 4KMUC 4CDFC 2ZXPA 1OQQA 4IPDA 2JY6A 5JPMC 1KH0A 5BO4B 2HUGA 2BTEA 3ND8A 4QY7A 2VUMG 3MXNB 2F52A 5KYLA 1SE2A 2K1FA 2JQOA 2IGDA 1KLGD 1ML0D 1MIUA 1U9RA 4KY7A 4BOZB 4XYQA 3OJ4B 2PIAA 1WFQA 3Q8CA 1SSNA 3U4VA 2JVCA 3M95A 4IM2A 3NHHA 4N9TA 4ZYSA 3NXWA 3C1EA 3PUXA 3ND9A 3K8AA 2N3SA 2L1AA 3AEEB 5DAUA 1SNMA 1ZYRD 4DUZL 3AYHB 2F3VA 2FFKB 4JE3B 2WACA 5DLQE 4IPHA 3T1YQ 3U4ZA 2SNMA 2Y5BB 1FCCC 1DZ1A 1K3RA 2AKWB 3ZYYX 3KF6B 2WXKA 3HKZG 2QDBA 4W9CA 2CKZB 1WM3A 4DAPA 2CFMA 5EQ0A 1L1OC 5C4JH 2BA0A 2JJQA 4LNFA 1GNUA 5C44G 1KJTA 3LDZE 3ZGZA 2EYPA 1HA6A 4N9PA 3QO2A 3ZNHB 4HSVA 2ATWA 2QW7A 2QEXA 3S1NH 4C3IG 1HR0Q 2JZ3B 1YBYA 4JI1L 2D2QA 3DVGY 1Z9FA 3SDZA 1Y1VG 1Y1WB 4UAIA 3J7YW 4FXGC 3H3VC 1F9SA 1A6XA 5EE9A 3A54A 1DJRD 4X64Q 5JEAH 2PYKA 1YZ6A 3ZLZA 4RHRA 1PGAA 3MA2B 4G4KA 3IBEA 1WYWB 4DBGA 1YIJA 2PVOD 4RF0A 3TJPA 3DDCB 3QARA 4EE2A 1QOAA 5IAAC 1KAWA 3V6CB 1V6EA 3I72A 1ZPSA 3WOEA 4A4IA 1AARA 2K22A 3VR5A 4C3JG 4ID6A 3HOUG 5C3XA 2CQAA 2L5TA 4MIUA 2OTLA 5BYRA 3RD2A 2WXHA 3RNBC 1PTOC 4DR3Q 3CCMA 3U4EG 5EPJA 5BYSA 3ENEA 4C2MH 2FMCA 4X3TA 2ID0A 2ZXOA 2KQ7A 2VB2X 4ICVA 3BIID 4GKJQ 5HI1A 5KNDA 3RULA 2DGYA 3AI5A 4ICUA 3N1XC 3GO5A 2H5XA 2KJRA 2O6VD 3LXFA 4N9F4 1Y8NB 2WIIB 1TU2B 4HCNB 2RDHA 2F0NA 4F8MA 1GOZA 4AP4C 1BT0A 3EA6A 2F03A 2SNSA 2RVLA 2ZXRA 4H13C 1BNZA 5E6PA 1E7ZA 1I50B 3OPOA 4OIKA 4DR4Q 2EIFA 4B08A 1CKMA 2KEDA 1EY8A 2MP1A 3UQBA 1A3TA 1WXVA 5I2YA 3KYDD 3I55A 3K5NA 3R3MA 3VTUA 5KGUA 1KLVA 1C0AA 2OJWA 3ER0A 3GZNI 4IKGA 1ESFA 4PS8A 1IBXA 2D5DA 2B2WC 1TXYA 2WAQE 2K25A
chains in the Genus database with same CATH topology
2NN6H 1IGDA 3AMUA 2CJNA 3H0GB 1L4DB 3R3OA 2J52A 3HOXB 1C4CA 1PGBA 1O7LA 4N6EB 4ARCA 1LACA 2KECA 1NCVA 1YNND 4BY1B 1CZPA 2CU3A 1QKZA 4HEA1 5IIFA 1GUTA 2M9VA 5EKKA 1TT2A 2KHSA 4CKCA 1WGKA 1S5BD 1KNEA 2QIEB 1Q1EA 5G3LD 3K5LA 2JX5A 1FMAD 3VR9B 1E0ZA 3AE2B 2LUMA 3QOLA 3FEWX 1S5DD 4C1NK 5K36H 3KBXA 2MJ3A 2OEDA 2M0AA 4IDIA 4P16A 4DK0A 5EBCA 3BDLA 4BBSB 3V3XA 1U4PA 1OXTA 2WP8J 3NK9A 3DHQA 3NE5B 4PMBA 4OGQC 4PT5A 4YT0B 3ZJVA 3L7ZC 4RA8A 2WXNA 5E3FA 5KEEA 4ODGA 4X3UA 2YEPB 2BDOA 5HURA 4I7ZC 2L12A 4D2KA 2DWQA 2QCPX 3DEPA 2NB0A 3BYTB 1FRRA 5G5HA 2NZ1D 2LJIA 1AYFA 2V0GA 2F0QA 3NBHA 3FPPA 4DAVA 1A15A 2SAKA 3R2TA 2EJFC 1BQQT 2K0PA 4LAAA 2JYTA 3J7AV 4WFN3 1UWXA 3KF8A 4L8JA 3VR6A 5IT9E 1F2RI 2IX0A 1K51A 3WDNA 1KABA 4YIJA 4KGSA 1LT5D 3KBGA 2E2JB 1ZEQX 4OHJA 1WTWA 3QIAA 2ACZB 1LT6D 1QQRA 1SYCA 1J9OA 2ICIA 1IGCA 4OW0A 1GHKA 4B0EA 3HGBA 3T4AC 4P6VF 5C4XB 2K5DA 3IAYA 2LKVA 3P4PB 1LLRD 1DM0B 2KA7A 5E4WC 2DLBA 2HDLA 5JVG3 3S1MB 5KNBA 2AWNA 4C3HB 3OWEB 2RA4A 2WLBA 4BA1I 1B53A 5IODA 3PUVA 2V3PA 3D6CA 1QOBA 4B0MA 1E2ZA 2NTTA 1BCPF 2QEJC 4A3IB 2BCOA 2IX1A 5FKAC 1NVID 1NYRA 1ZYRC 2RMMA 3KWVA 1A2TA 3OMCA 5FR3A 4A3JB 1ZXTA 4FXKC 4K2LA 4PMCA 3GTJB 1TQOA 1BDOA 4A3BB 4MM3B 3ZJTA 1LT4D 2M19A 3TEWA 3TSSA 4QF4A 1Q3LA 4USAA 1NEKB 1B9MA 3H91A 2MEKA 1GB4A 3LWEA 4K5WA 4XQQA 2WV6D 2WXJA 4A3DB 2WXIA 5JXVA 3BZDB 3AEBB 3OOCA 4N59A 3CRKC 2NBFA 3C46A 5FO9B 5LL6S 2K5PA 3KLSA 4FNFA 4DXFA 4OO1G 1CHQD 2D5GA 4NJCA 1EY6A 3AEAB 1G6ZA 2B2VA 4IUVA 2F0OA 4IURA 2H1EA 1L4ZB 3NS1A 5C5LA 3M7GA 4HCSA 1XLQA 5J22A 1VZ8A 1IW7D 1SSOA 4WH4A 2BB5A 4RH6A 1EU4A 1PTOB 3V05A 1II3A 1GUWA 1TS2A 1C4QA 1TY0A 3IXSA 2F0JA 3LWUA 2WXRA 1JWBD 4FF3A 5CC4A 1I4PA 2BW2A 1Q12A 4TSSA 5FO8B 1EWYC 3QJYA 4L6TB 3TMEA 1CK1A 3BDCA 1HTPA 3KQ4A 3V2TA 2DYOA 3TUOA 5HHDG 1ILQA 1RKNA 4R8IA 1HHVA 4F88A 4F7XA 1EIHA 3Q69A 4Q5VA 3LB8C 4IZ8A 4KGTA 1OO9B 3ITPA 4FF1A 2EYOA 3A8IE 1ONLA 1LTID 3PZ8A 1SYDA 1SAPA 3AE5B 5I6YA 4AS1A 2N55A 4MN3A 5E6JA 5BMHA 3O13A 2QSDA 4U68A 2PW5A 1TIID 2K7VA 4KKSA 3C3LA 1SE4A 2F0VA 3I4MB 3IAM1 2FINB 2O2LD 1XF5L 1ZXHA 3TDQA 1R4QB 1HQRD 5M3MB 1SNDA 3HZXA 1I4GA 3NQIA 4FXCA 1PMRA 4K14A 4J3OD 2WB1B 3GTKB 5GXGB 2AX5A 1RYJA 1J7AA 1SDFA 4OZBA 5CORA 1EFID 3S2DB 4WQMA 3E6ZX 3C8YA 4U673 3P4RB 3CKIB 4WJWA 1LV9A 2FMMA 3P4QB 1WTVA 1H9SA 3GP7A 1VMCA 1JCKB 1CI3M 4HN7A 2X6LA 2XWBB 1KLUD 1WTRA 2PLPA 1VF7A 2HTME 2AWOA 3Q6SA 3NVWA 2PTLA 2EYHA 4OO1H 5EE0A 1PZJD 3HG9A 3M4OB 4DF7A 3AE8B 2PCFB 5A35A 2K1BA 2N9LA 2KJXA 2XN9C 2PO4A 3K5OA 1RTOA 2R6GA 2WDQB 1GPXA 3FPUB 3MAQA 3VR4A 4PNYA 1JC7A 1AP0A 4A55A 5CR3A 5EJWA 3KLSX 2JYEA 1STHA 4DNRB 4ILWA 4IN3A 2IT1A 5CMDA 3MFGA 3SR1A 3K5MA 3X3NA 4IUUA 2N9KA 3DWAA 5JAVA 1D1KA 1SJHD 4G7ZC 2K03A 3MXNA 5T8IA 1G2SA 1SYFA 4S3SA 2EJGC 2XNAC 5C3WA 4IFDI 1YNTE 2EPBA 5T1IA 2SDFA 5C0XJ 4KX6B 1MGSA 1F9QA 5K5PA 4G57A 2ZW0A 2INPE 1LTTD 1C79A 3SK4A 4EQOA 3OW7A 1CFMA 3BVZA 1ENCA 1OXVA 1X3QA 4XXEA 1STAA 4A90A 1MI0A 1AZQA 1SNQA 3NVZA 1F2LA 5BN5A 2PKOA 4C1NI 4LLGM 1TZOA 3IL8A 4XT1B 1JICA 1KDBA 1HUNA 1ZDXA 1ZOYB 1OXUA 2VNUD 1G91A 5IGBA 2IGGA 1DGJA 3D4DA 2DNCA 3KUPA 4Q0FA 1H9JA 1SNPA 1N5WA 3WOFA 2ENBA 4LJZC 4C7ZA 1IUEA 1ZUD2 2A6ED 1BUIC 2E3TA 4KK7A 5D3IB 3AEDB 2WINB 4CJ0B 1JWMD 4KN7C 1EWHA 1V1PB 3R93A 3ONAB 1ET9A 4KKJA 2DNEA 4K5VA 4TQ1A 4KD4A 5BN4A 3I9V1 3MXUA 3L9AX 2B8FA 2KUMA 5A2QL 3P42A 1EEFD 1XX8A 3QOJA 1Q8IA 2BYTA 2D9UA 1JOOA 4LK1C 4JK1C 1YNJD 2A69D 3IFTA 1G8ZD 3VYUA 5FOBB 2E75C 3PV0A 4KJNA 4PMWA 4NW2A 2K3UA 1TY2A 2KVMA 1FM0D 2WKDA 3NBIA 2EYLA 1FIQA 3HVZA 4QCLA 2LS01 2PPBC 4WURA 2CHBD 4KKTA 5JJZA 3S15B 3GTGB 1STEA 4YXDB 1O78A 2NWGA 3U7ZA 1XEEA 4WWMA 5EKIA 1FCLA 4WIPA 3J81L 4ZUJA 3RPFC 1UEAB 4O1NA 3B2GA 2ON8A 1EOTA 4HKQA 1XLPA 4ITKA 5C2TB 3T51B 2H4OA 3NVVA 1VMPA 4BA2I 4JWUC 1QF6A 2WNMA 1Y8OB 1SJED 5IGGA 2OHFA 3AM9A 2NYZD 1RJTA 2WP9B 4KD3A 1E10A 2LEKA 3Q8BA 4NAWB 1PZID 3AE4B 4NAMA 3AB9A 3NSWA 2EDGA 4XIGS 3D4RA 1JOKA 1I7HA 4K5XA 4JBWA 4Q2JA 5J1ZA 1D5MC 3CQZB 1Q1BA 1EIGA 4IUPA 3P7JA 3NZ3A 2BOSA 1EZ8A 4J6HA 3ABVB 1JOQA 3MHBA 3GTOB 1CM9A 3EROA 4UDUC 5IT9L 2HQEA 3E5SA 3Q8EA 1CZGA 2EELA 2EY2A 3SVMA 1S5CD 1RFKA 2JWUA 4KKUA 1DCZA 3C2PA 1C48A 2B2UC 2J42A 3U52E 1TKGA 4CKBA 4RCNA 3E0JA 5CYUA 4ZHPA 1D6EC 1F2MA 1F2RC 4TMAB 4ZK9B 1LT3D 1G2TA 2I38A 3Q8AA 1MSHA 1NAPA 2Q8IB 3RZDB 4KY6A 5ELEA 1GB1A 1I4QA 3GV6A 1VJKA 3WCQA 1BCPD 1GHJA 2PZTA 1PRTF 1ZP0B 2HDEA 2SOBA 4RKLA 1J7BA 4B9XA 2RPVA 4YSZB 3FKIB 2MH7A 1RD9D 3S16B 2O5IC 3BYYB 3M85A 1JWUD 1F2ZA 2H88B 2E2DC 2WDRB 2O4XA 5IGCA 4FF2A 4IOIE 4G7OC 1WYGA 4M1UB 3KWLA 3PIO3 2QJLA 4LMQD 2F0PA 3I91A 3C1FA 2F3WA 2HDMA 1I3QB 2VXWA 2L52A 4OZCA 2I2YA 4O42A 3NTIA 2XIWA 1LTRD 4KKIA 4MACA 4L23A 1F77A 2F0HA 3G6JB 2LMCB 2RSOA 3NQTA 1HXYD 1GUNA 3W3AA 1S5FD 2O5JC 2QKIC 3HVDA 4MT5A 1EYDA 1YMHE 1CT1D 5I9PA 1X3PA 2WU5B 2B2YC 2MUYA 1I4RA 1I6HB 3AE3B 3RD4A 1B1ZA 4QB4A 1SE3A 2LFNA 5C0XG 1LABA 4RGTA 4DGZA 2WXPA 2WXMA 2F0TA 2A6EC 5DM63 1J7CA 1WCMB 3DUZA 1ENFA 4XT3B 3GTQB 2B63B 2FBWB 3GB1A 3VA7A 1BMLC 2WAQB 1HA5A 1SF0A 4REZA 3P75A 2PMVA 2LHDA 1KFYB 3NRZA 1TWFB 1ESRA 3R8BA 3E9SA 3M4YA 4KN4C 1V97A 1MI2A 1AEXA 2NVYB 3I90A 1QOHA 1MD2D 1WWTA 4HAEA 3T56B 1HQMC 1X32A 2KQ4X 4C3IB 2A69C 2K05A 5AUIA 1SMYD 5JPNC 2EVBA 5LHY1 1I4XA 4IFDJ 3TBIB 4OVZA 1TWGB 2JQRB 3D31A 4A3MB 3LX0A 2WXGA 4US8A 1FEHA 4C3JB 3MHZA 3N6RA 4ABNA 2A68D 1CA6A 1L6VA 1T6BX 3J9CA 5C4HA 3MP9A 1U4MA 1OXXK 2M2LA 2KN4A 4GZYC 2M56B 2PNRC 2JSVX 1Y8PB 5CV6A 1QB5D 1H9KA 1Z6HA 5I4DA 2IDYA 4YTPB 1RODA 2F0SA 3L4PA 4FVMA 1EZ6A 1PFBA 1VZ6A 3AMZA 1WSPA 1DOKA 1ET6A 4FYDA 1EM7A 1N62A 5NUCA 4ZRQA 2X6GA 3AE6B 4HRSA 4EQPA 1B44D 2L32A 1JRPA 1T3QA 1OXSC 3T13A 3TN2A 3BVMA 5CGKA 3CRLC 1F9RA 2CW0D 1EEID 1EU3A 1LTAD 5DEHA 1FGBD 5BN3A 1HPCA 2DN8A 4IUQA 1KAAA 1RDPD 1JQYD 2JXMB 2L1BA 1FNUA 1E6EB 1AW7A 4Z9CB 3EJIA 3GTLB 5C0XH 1L0XB 1WTQA 1R4PB 2NTSA 1EYAA 2EYFA 3A55A 3BK2A 1ROEA 1A2UA 2J0TD 1PTOH 3S14B 3K59A 3QG1A 2WXOA 1OQRA 1BCPC 1WTXA 4CKEA 4DA2A 4JPSA 3Q22A 3TP6A 4TRDA 2EYMA 3J80L 3HRDD 5EKLA 3W2DA 3RFZB 5HG2A 3ZQ4A 3U9SA 4IUTA 1YNNC 2NUCA 2KCNA 1WXQA 3TP8A 2ICEC 2IWHA 3VR3A 2AQ1B 4YWGG 4YSXB 1L6UA 4YTMB 1U4RA 1IYUA 4XQNA 1XLOA 3IAS1 2B8GA 2F0DA 1QOFA 3IFDA 4NDXA 3PUWA 2JA5B 5COYA 3I4LA 3JAME 2XRQD 3VRAB 3FILB 1E2VA 1RF2D 4ZQ3A 1HCZA 4EGVA 1DOYA 2A5HA 1Y56A 2DYMA 3AE9B 2QMTA 1WRIA 5JOBA 3OIPA 1QJOA 2KMMA 4ZKBB 5KNCA 2K28A 1EY4A 5CBEE 3K6OA 3AECB 2A73B 1STGA 1SYEA 5H8YE 3S1RB 1TKWB 3DM1A 1PUTA 1WD1A 3HOVB 3RZOB 4JX1C 2L55A 1VZ7A 2JEAI 2QILA 3S17B 1QCBD 1E9MA 2K9XA 5LL6X 5FLXL 1DD2A 1MHXA 3NTHA 1AFPA 4CJ1B 3HOYB 2Z4HA 5EPLA 1D1IA 4B9WA 3S1QB 1ZE3D 3VA5A 5C4ZA 4I65A 4ARIA 2OT2A 5M5XB 2F0LA 4Y7NB 1EYCA 3A7AB 1HFGA 4OL7A 5LNK1 3H94A 1V1OA 4K6DA 4KJOA 3G7LA 1KDCA 3SEBA 3B2FA 3MZ5A 1NSNS 2LY7A 1ZDVA 3NVYA 1LTSD 2K6AA 3K7AB 4PV1C 2A68C 3EQLC 3U9OA 1YN5A 2YEPF 1D5ZC 4A3EB 1CQFA 1QWYA 1DXMA 4BBRB 3T53B 3W1SA 2L9HA 1SEBD 3FDTA 4DU9A 1P7FA 1S5ED 1EL0A 2GRIA 4TKOB 4IFDG 1TJEA 2R93B 2R61A 3MTSA 2R92B 3SFDB 2R7ZB 4BY7B 5HGTA 1CQVA 2QF7A 3MWYW 5IGEA 2RSNA 2BBCA 1DOXA 1FXAA 3NPPA 3RUZA 3X3MA 2PW7A 2JU6X 2E2HB 2RKSA 1ILPA 3EVQA 5M3FB 4A8XC 2WDVB 3TP7A 2L83A 2EXZA 4C80A 1QNKA 4WORA 5DNFA 3GQBA 5E4XA 1T5EA 3P4SB 4NZLB 3AU7A 5KYIA 2G9HD 3TEZA 2L0CA 2Y5PA 1JWSD 1TWAB 3GTPB 4KV6A 4XWTA 2F0EA 2OEOA 5BMIA 1PRTD 1IW7C 5D7GA 1R9TB 1YN3A 3OMGA 1IL8A 1LTBD 5G5GA 2LGIA 1XWEA 3FC4A 3MXGA 2K32A 5MPOA 1NR2A 2WU2B 3DWQA 2E74C 1E2WA 3RMHA 5AUKA 1I4HA 1HRJA 3AEGB 4A6QA 1GJXA 3PUYA 2W55A 3R2IA 1JQ4A 2WS3B 1PXUA 3OWFA 2VZKD 3PMFA 1BCPB 1C76A 3P20A 1O7ZA 2CVRA 2NN6I 3P1MA 4IALA 1STNA 1FXIA 5E1FA 4GDLB 1C78A 2D62A 2LHEA 1WVLA 3D3RA 3T3OA 2TSSA 3NWSA 1N5XA 3OHXC 5ELCA 5I9OA 1BOSA 2BE5D 2VB3X 2FUG1 2B39A 3W9CB 5CV4A 2GI9A 3UI3A 4ME5A 3AB5A 2AUKA 4XTCS 2IX3A 1TYGB 4K6LA 3CU7A 1YJJA 4RF1A 4XDDA 1MSGA 2FE8A 1PTOF 3DXJC 4OIJA 5TSSA 4R3DA 3F2UA 2LMCA 1Y69U 4RWSC 5J39A 2SEBD 1PGXA 1UUPA 1HZ6A 3K58A 3CIRB 3P1HA 1JROA 5EE1A 3DWPA 2JE6I 1T5XD 1SB3C 4ZOHC 4A9AA 4H2AA 1ENAA 2GB1A 4IFDH 2BB6A 4KTAA 2F0WA 2AQ3B 3D6WA 2BS2B 5ISRA 1L0VB 4YTNB 3DWMA 2IJ0A 4C56C 3VR2A 3DMUA 4H7BA 2PW9A 2CJOA 3HS0C 3IT6B 3MFYA 5C4JB 5EPKA 4QMGA 1AN8A 2ZT9C 5DM73 3VYSA 3S1NB 1HFNA 4ZRPA 2BA1A 2JYOA 1B4OA 1CTMA 3NTKA 4FO2A 3MC0B 3LNNA 1OFFA 3KK7A 2FJ2A 2GA4B 4RGNA 1N63A 1SYBA 5HFYA 1RWSA 3SK6A 3AE7B 2RQXA 1UAPA 4C2MB 4DNTB 3K0YA 4DK1A 1MVKA 2N7JA 3HRZC 3TZDA 2FHTA 3NP8A 2INNE 2MJEA 1K8MA 4C3HG 4AQ7A 1BXTA 2V3NA 1EY7A 4IUNA 5CV5A 2XRSD 1DYQA 4RKBA 1EY0A 3I70A 1E7PB 3QB3A 3SK8A 2Y0SB 1DOMA 2B2TA 1UGJA 2W54A 2MJ8A 3VYTA 1JWAD 2OXPA 2KOLA 3OIQA 3T16A 2M00A 2PMZB 1C77A 2WKCA 2C5CA 5A2QE 3B9JA 1J8IA 2F0FA 1U4LA 5BMGA 2JSOA 1VF5C 2V4IB 2EY6A 5EE3A 2NVTB 3D4WA 1L0YB 2NMQA 3EGRA 3PZ7A 2EY1A 2Y3AA 2HCIA 3H09A 4ZAIA 4XE0A 5BYQA 1E0BA 4X3KA 2E6XA 1Z7TA 4HMJA 4R8NA 3J7AF 1DONA 1P7EA 3PO0A 2KDMA 2J7ZA 2JXTA 1N61A 2WXFA 2BT6A 1SXTA 1VDZA 3GV3A 3J81E 3CWIA 3DEOA 1O80A 1NYQA 1QLBB 1TS3A 1A3VA 1TVXA 1FYCA 2VUMB 2KWDA 5IGFA 1C4PA 4YSYB 2F0UA 3I57A 2K04A 3N52A 1B9NA 1PRTC 3KLRA 2IW3A 3HEJA 1JB3A 4KY5A 2W3SA 4RCOA 1IKMA 4XDCA 3A56A 3I73A 1QG7A 2MHVA 1I6VC 5EBDA 2DY7A 1YQ4B 4M0WA 4KI0A 3HKZB 5C0XI 2K5QA 1QE6A 1GXDC 4RGOS 4N58A 3FAHA 2MPMA 1ZKOA 2ONQA 2B2UA 1S4ZA 1C9FA 2B2VC 5C44B 3H6MA 1JALA 1JW9D 2A6HD 2A74C 5D14A 2EJMA 5M5YB 1YNJC 1CHPD 1QNUA 1Y1VB 3NUHB 3GTMB 3W5VB 3T3NA 5AFWA 1TS5A 2B2WA 3M3YB 2Q8RE 1D4BA 1KTKA 1SNCA 2EZVA 2BE5C 3HOUB 1TWCB 2N0SB 5M5WB 4HKZE 2ZW1A 3Q24A 2EY5A 2PZUA 1Q10A 2BS3B 3AE1B 3TP5A 3TEYA 1D2BA 1V8CA 3JAML 1BR9A 1VDVA 4EQNA 1TWHB 4H0LC 3PO2B 4EVOA 1KRHA 1IBXB 2KEEA 2IPKD 1NI3A 1XCTL 5C5MA 2E76C 4HROA 4R9WA 4FP5D 3FILA 5CV7A 3M7NA 1TR5A 4CGYB 2W82A 5JEAJ 4QUFA 4CJ2C 3K57A 3I3CA 1FRDA 2N88A 1B9RA 3TEXA 4H44C 2PVGC 4K8IA 4IQZA 4A93B 5D3DA 1UWMA 1K52A 1W6JA 3BS1A 2B2YA 1XYIA 1EY9A 5H92C 5ELDA 5KRUA 1GAQB 5C6AA 1TKEA 2PQEA 3HUIA 4RFBA 3U2SC 4PQXA 1F2YA 3MJ5A 1F0ZA 3HOZB 1KNAA 2F0KA 2PZWA 1JR0D 1KDAA 5I2XA 2YYZA 1CA5A 1HEZE 1M4VA 1STYA 2MJDA 4BWGB 4DN4M 3S9WA 1TKYA 2IL8A 3HP3A 2KQ3A 4DXGA 2Q8TA 3EUB2 1HUMA 5G3LF 1A3UA 1FO4A 4ZLTF 3IT4B 3SE0A 1NR4A 3HOWB 5IGDA 5F2DA 4NP5A 1STBA 1F9PA 1JORA 1LTGD 1LO5D 2L11A 1K83B 3RLFA 1B2TA 4HMIA 2E2IB 2AQ2B 4C7YA 2J4XA 2EYJA 4OO1I 4MHEA 1AZPA 1SBBB 1IYVA 4HEDA 3BDOA 2C9OA 3BG3A 4BS9A 4HJGE 1MBYA 3Q0AA 2LFIA 2Z1CA 1JE4A 4CHTB 4L2YA 3PUZA 1ACCA 2F0GA 4L63B 5KIXA 4FXDA 3E56A 4HSPA 1PZKD 4XQJA 1G291 5ELBA 1B3AA 1VR9A 5C3EB 4NKLA 1CZWA 5EGTA 2XSCA 2YU9B 4P2CB 3AEFB 4X3SA 2EOTA 4DAYA 4A3GB 3A8KE 3UI2A 4HCEA 3Q23A 3SXHA 3A8JE 2W3RA 4XDXA 2I07B 1EWCA 1BO0A 1FD7D 2X38A 5D65A 1SNOA 3DWGC 4J1MA 1IKLA 1ZXIA 3MVVA 5JVH3 1QT9A 3I8ZA 1VRAB 3VYRA 3VQIA 4WRDA 3GS2A 4FF4A 1K53A 2JA7B 4F87A 4CQNA 2I46A 1QOGA 1N60A 4RHSA 1XO3A 5FK9C 1HTLD 2HCCA 3FVQA 4MH8A 1SYGA 4RAUC 3GD7A 2F0IA 2RDGA 4A3FB 2KAJA 5FO7B 2K01A 4QIWB 1MPEA 3ETRA 1PRTB 3IKJA 3BK1A 2EE1A 2XVSA 1AWDA 3VR8B 1YJIA 3MEHA 2JA6B 2JEBI 2H89B 1V1PA 2XWJB 1A70A 1PFNA 1D5XC 3EFXD 2A6HC 1RHPA 4NMZA 2IGHA 2KACA 3FMCA 3N9YC 2V4DA 3SHLA 1FFVA 1SMYC 4WAFA 2BS4B 5C3JB 2WQYB 4RGMA 2VZKB 1GUSA 1PDQA 5T1GA 4XYOA 4M8AA 1GUOA 4KHVA 2JA8B 1MHHE 1PTOD 2F1MA 2K33A 1QILA 2G1EA 2F4IA 4V0BA 1FNWA 3NWTA 1M8AA 1C8CA 2B76B 1TS4A 3ZJUA 1GUGA 3V96A 3PO3B 1H9MA 1XXGA 2EKIA 1FR3A 4V190 2NVQB 4K8JA 1ICWA 2TMPA 1BF4A 2J53A 2WXQA 2X69A 4XWWA 4HR7B 1DOIA 3LYYA 3PIP3 3URYA 1KF6B 1XTCD 4CBVA 5I6WA 1HZ5A 4RNAA 3AV8A 1K8OA 5CV8A 2F0MA 4HTHA 4TQUS 3SFEB 4GDKB 1H9RA 3VRBB 4J8QA 3J80E 2NVXB 1EQVA 1SIJA 3SK5A 4GLSC 3QWNA 3A7LA 2JP1A 4US9A 2K5WA 2MGSA 3FRPB 2KCCA 1YQ3B 4JWSC 4L1BA 1W6KA 2DY8A 1PFDA 1NENB 1RM6C 1V43A 4OZAA 2CW0C 5JEAG 1L5PA 1EY5A 1WTPA 3ERQA 1K50A 1UNSA 3H8HA 1PFMA 3MXPA 1FD6A 1WD0A 2RDFA 4K2KA 1FNVA 2Q5WD 1XCQL 4DFAA 2G9DA 2WXLA 2BDNA 3W5UB 4G7HC 4DQOC 3BWUD 1CJEA 5IOCA 3SR6A 3NUCA 2RBMA 3Q8FA 1O7YA 1EQTA 1RCVD 2AUJD 1B50A 3P63A 2OF1A 5ELFA 4LK0M 1H9SB 1JMLA 2L4NA 1DOLA 4A3KB 2NN6G 3BVGA 4KGRA 5CV9A 1PLFA 1Q90A 2Z8LA 1R7SA 1BBXC 5FLXE 3CHBD 3AH7A 4TQ0A 1FFUA 1WTOA 1YN4A 3TZUA 2Z4IA 1V8QA 3I4NB 4QUCA 1NUCA 2R3ZA 3AN1A 1IHZA 5M9OA 4ZHOA 4AYBB 2D2CC 3L3OC 4ZRZA 1VLBA 4E6IA 1Z47A 1C4AA 1VCIA 4KHZA 3D8GA 3OSOA 1BUVT 1XLNA 2B2TC 5CBAE 5K36G 1PDXA 1RTNA 1PYWD 2DBYA 2JZPA 3S2HB 4ZKCB 2Y5CA 4LTUA 4ZUIA 4ULLA 1SFOB 4KMUC 1OQQA 2ZXPA 5JPMC 1KH0A 2HUGA 2BTEA 3ND8A 5KYLA 1SE2A 2IGDA 1KLGD 1ML0D 1U9RA 4KY7A 4XYQA 2PIAA 3Q8CA 1SSNA 3NHHA 4N9TA 4ZYSA 3NXWA 3C1EA 3PUXA 3ND9A 2L1AA 3AEEB 5DAUA 1SNMA 1ZYRD 2F3VA 2FFKB 4JE3B 2WACA 2SNMA 1FCCC 1DZ1A 3ZYYX 2WXKA 2QDBA 4DAPA 5EQ0A 2BA0A 3ZGZA 2EYPA 1HA6A 4N9PA 3QO2A 4HSVA 4C3IG 3SDZA 1Y1WB 4UAIA 3J7YW 4FXGC 3H3VC 1F9SA