1SBBB

T-cell receptor beta chain complexed with superantigen seb
Total Genus 66
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
66
sequence length
239
structure length
239
Chain Sequence
ESQPDPKPDELHKSSKFTGLMENMKVLYDDNHVSAINVKSIDQFLYFDLIYSIKDTKLGNYDNVRVEFKNKDLADKYKDKYVDVFGANYYYQCYFSKKTNDINSHQTDKRKTCMYGGVTEHNGNQLDKYRSITVRVFEDGKNLLSFDVQTNKKKVTAQELDYLTRHYLVKNKKLYEFNNSPYETGYIKFIENENSFWYDMMPAPGDKFDQSKYLMMYNDNKMVDSKDVKIEVYLTTKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structure of the complex between a T cell receptor beta chain and the superantigen staphylococcal enterotoxin B.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords PROTEIN (14.3.D T CELL ANTIGEN RECEPTOR)
total genus 66
structure length 239
sequence length 239
chains with identical sequence D
ec nomenclature
pdb deposition date 1999-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
B PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1sbbB01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1sbbB02
5ELDA 4TSSA 4ZYSA 4Z9CB 1LTSD 1JCKB 1I4XA 3DWAA 1BCPC 1YN4A 4NZLB 1I4RA 3KLSX 1LTAD 1LT5D 1QILA 1TS3A 1SBBB 3EFXD 1SE4A 2AQ3B 1FNWA 1EFID 1LTID 5ELCA 4RGNA 1I4QA 3DWQA 1CHQD 3OWEB 2CHBD 4L63B 1FNVA 1YN3A 1HQRD 1PZKD 1S5DD 1S5FD 1V1PB 2Z8LA 1T5XD 5FK9C 1CHPD 1YN5A 1L0XB 1LO5D 1LTRD 1M4VA 5D3IB 5I4DA 1RCVD 1PZJD 4OHJA 1PZID 1LT3D 2AQ1B 1KLUD 1TS2A 2IJ0A 2SEBD 3R8BA 1BCPF 1SJED 4C56C 1EEFD 1I4HA 1JR0D 1DJRD 4RHSA 1DYQA 1RF2D 3URYA 3BVZA 1SJHD 2XN9C 1TY2A 4RFBA 3BZDB 5ELEA 3BVGA 1JWUD 1JWMD 1FD7D 1LLRD 4RGOS 1RDPD 3R2TA 5TSSA 1D5MC 2NTTA 3W2DA 2NTSA 1PRTD 5D3DA 1HA5A 2AQ2B 1TS4A 3R2IA 1KTKA 1F77A 1L0YB 1S5ED 4K6LA 2TSSA 1S5BD 5ELFA 1PTOF 1JWSD 1AW7A 1LT6D 1FNUA 1JQYD 2J4XA 1D6EC 4RHRA 4L6TB 1HXYD 4RGTA 4UDUC 1SXTA 1CK1A 2WV6D 1PTOB 1LTBD 1CQVA 1S5CD 1SE2A 1V1OA 2ICIA 3MFGA 1MD2D 1UNSA 5ELBA 1ET6A 3BYYB 4RGMA 2IPKD 2O2LD 4O1NA 1I4GA 3SEBA 1LTTD 1EU4A 1I4PA 1SEBD 1EEID 1B44D 1KLGD 2RDHA 5FKAC 1B1ZA 3MC0B 1UUPA 1PYWD 4RH6A 4DXFA 3BYTB 1SE3A 1XXGA 2G9HD 1PRTC 1RD9D 3DWPA 3TSSA 1LTGD 3O13A 1BCPB 1ENFA 2RDGA 4RCOA 1EWCA 1BCPD 1G8ZD 1PRTF 1EU3A 3CHBD 1ESFA 3EA6A 1TY0A 4BWGB 1BXTA 1FGBD 1PTOH 1TS5A 1PTOC 2XRQD 3BVMA 1XTCD 3GP7A 1GOZA 2XRSD 1AN8A 1PTOD 1PRTB 2QILA 1CT1D 1D5XC 1V1PA 1HTLD 3V05A 2R61A 1ET9A 2QEJC 4DXGA 1LT4D 2XNAC 1STEA 1D5ZC
chains in the Genus database with same CATH superfamily
2A6EC 3GTPH 3EHVA 2PVOD 3ZJYC 4NAWB 3GTJB 3CSFA 3OJ3A 4KN4C 3FPUB 5EBDA 4ICVA 5T1GA 5C3EG 4GSWA 1SYGA 2OTLA 4DK1A 3A9JA 3KWVA 2GMIC 1PDQA 3E9IA 3H3VC 4EUTA 4KY6A 2EKEC 4I6NB 1E2VA 2JJQA 1Q86C 5CTRC 1MG4A 3QB3A 2UUAL 5HI1A 4AQ7A 1EWYC 2J7QB 4JI4Q 3L10B 1TKYA 4OX9Q 3LJ3A 1PZKD 2WP9B 3DVGX 3CCRA 2DENB 1PH9A 2E76C 5AZFA 4DKAC 3SD5A 1M4VA 4NW2A 4OVVA 2VZAA 4IM0A 2WU5B 4USAA 3EQLC 2B63G 4HVBA 1Y8PB 1R9TB 1OEYA 1WJJA 4XIGS 2GBNA 5JVG3 4FHJA 2B2WA 2ZTEA 5CV4A 1L1OB 2VH1A 3CP0A 2R93B 3EGRA 3HKSA 2E2IB 3J80c 2XVSA 1T3QA 1QE6A 3A0JA 3MVVA 2AWNA 1U0LA 4LNOA 1J9OA 1XNQL 1NCVA 2WAQG 2KLCA 1ZYRC 1TY2A 3SR1A 3CCVA 1SB3C 2DAFA 2INNE 4MNOA 2XSCA 1SFOH 4E74A 3HOZG 3KLRA 2LRWA 2SDFA 2WX1A 2GLSA 1K8RB 3CC2A 5D14A 3SK6A 3DOWA 5HURA 2BT6A 4H13C 3ZNGC 2BYTA 2CHXA 1Z9FA 2AWOA 3GTQB 3GTOB 1YNND 1HNWQ 2IHEA 4YHHQ 2K28A 1PTOF 1JWSD 3CF5A 3VTWA 2EOTA 4DR6Q 1YJ1A 3CMAA 1M90C 2RVLA 1YIJA 4MTNA 5LL6S 4PS7A 1ZDVA 3GTLH 4IUTA 4K0KQ 4B0EA 1Y14B 4A3PA 4ANUA 1FPYA 3B2FA 4LLGM 3PHXB 3X0WA 3T3OA 3QCAA 1GC7A 3MXNA 1QZHA 1XPOA 1F2MA 3L7ZC 1DCZA 5A2QE 3QR8A 5JVH3 3HOUH 4MHEA 1XMOQ 3ZKJC 3K59A 1KF6B 3AE5B 1EU4A 4LF9Q 1JWAD 4H44C 1J6QA 3OOCA 2G45B 3E6ZX 2K14A 5FKAC 4N58A 3RNCC 3IRBA 3C1EA 2L9HA 4KMUC 5LMNW 4K8JA 3KYCD 3QQ8B 3U2SC 2KMAA 4FO2A 3DWGC 4HIMA 4LJPB 3ZVVA 4FXKC 2YU9B 4KZCA 1J8CA 1VS0A 3RI7C 3L0WB 1PH8A 4N9TA 4DGZA 4NPNA 1ONLA 1O7IA 3M4QA 1QT9A 4UHVA 2FIDA 2IX3A 3CCEA 1K50A 2JRIB 1EM7A 2DNCA 3QK0A 4PNYA 1GOZA 2BF8B 3Q3MC 2R2QA 2B3GA 3I4LA 4C3HG 3ZNHB 4A3JG 1FJGL 4IUNA 2A8VA 1V1QA 3D4RA 4K6DA 5GROA 3KOJA 4LF5Q 4MM3A 5C4JH 2CVRA 3PZ7A 2IT1A 2WKDA 2JY6A 5CMDA 5E4WC 4JI0Q 1ET9A 4U673 1IBMQ 3KYDD 5H92C 3MZ5A 3ER0A 3KLSA 3Q8CA 2KCCA 3PIPA 1CZGA 1TWGH 2L11A 3AMUA 1SAPA 3BU2A 3RZOH 2PW9A 2E3TA 3BINA 3TL5A 2EVBA 4AS1A 3NUCA 1OQQA 2ATWA 1NAPA 3WAMA 4J6IA 4DK3C 5CV8A 4BBSG 5EGTA 4TQ0A 1FNWA 1VJKA 3RLNA 4GOPB 1C9FA 2RF4A 5ELCA 2JQRB 1UZXB 4ARIA 2LJIA 1E3PA 3OWEB 5HY6A 3PF4A 1CKNA 3N32A 4P6VF 1DOYA 1UBIA 2NMQA 2K3UA 2O6VB 1E1OA 4DR5Q 4BBRH 4JVZA 3S14B 3CMMB 4W9FA 4N6EB 3E0JA 1EY5A 2PJHA 1T0QC 2IBIB 3PRZA 5C3WA 4NJ6A 1G6PA 2WXPA 2FCNA 1PZJD 4ZRKA 2NBUA 3FKIH 1A0IA 2HQEA 3ZLZA 3AE2B 3STBC 3EUB2 2IY1B 3BDCA 1I4HA 2FIFA 2ZXOA 4B3MQ 1Q82C 2F0QA 4Q2JA 3GTMB 2B2UC 4EE2A 5C3EH 2LXCA 3IAM1 2V0GA 2WS3B 4DK6C 2L12A 1STAA 4IALA 4HMIA 4XQQA 1DXMA 1PFMA 1C79A 4L5QA 3NUHB 2NVUI 3S17B 2GBMA 2MFIA 3H15A 4DNIA 2JA6G 2KFKA 1B70B 4A3KH 2ZNVB 4CYEA 1GD7A 2LSSA 2NYZD 3DM3A 4A3EB 3NVYA 3RN2A 1STGA 1F77A 4EZKA 5IODA 1L2FA 3NZ3A 1SIJA 2X8XX 2VH2A 5LXHA 1CKOA 2Y0SB 2NVXB 1PDXA 4HROA 3P4QB 4LNQA 1V9JA 1AZPA 2QGQA 4K14A 3OTOL 1P0RA 1F9SA 4GLSC 5AJ3Q 1LUZA 4ABNA 3S1QB 4KHZA 1OXTA 4RHRA 3KUZA 1YJIA 1PGAA 4MH8A 3ZTDA 1YD8U 4ALPA 1SXTA 4G7OC 1ZP0B 1O7ZA 1F52A 1HFNA 1P3QU 3DBLB 3I4NB 2JZPA 1S4ZA 2H4OA 3EVQA 1SE2A 4EQOA 5JJIA 2EMSA 3A9JB 3VH3B 3HM6X 5I2YA 2DZMA 4XGAB 1SR3A 4O1NA 4Q5VA 1AE3A 3DEOA 1K8GA 4HEA1 4REZA 1A63A 2E2JB 1SEBD 5BYRA 2RDHA 3RYTA 1GKHA 1J7BA 2N4FA 5AFWA 4RH6A 2I38A 1LABA 4P2CB 2PMVA 1RD9D 4IFDH 1WXAA 3HOWH 2KX3A 1S40A 2NVXH 2F0IA 1WD1A 4C4VB 4DPGA 3TBLD 4IUQA 3IFDA 3VUXA 5JPNC 5L37A 1BCPD 2MBQA 2QDFA 2F0KA 3NBHA 3A8KE 3HKZE 3AH7A 2K1FA 5C3JB 2F0FA 1V80A 5IGCA 1VQFA 2HJ1A 3G6JB 4HN7A 4EFOA 2Q5WD 4A3IB 3DWMA 3W1SA 4L2YA 1JOQA 4WJQA 4OZCA 3RNUA 5I2XA 4DV3Q 4DV7L 1XYIA 1WXMA 4Y7NH 3A4SC 2NR2A 2DUDA 4QCLA 3H6NA 3A56A 4IUUA 1HFGA 3CXCA 3J7YW 1U9RA 1JCKB 4NMZA 4C3JH 1AZQA 4TQUS 2KHIA 3CCUA 4DV2L 2OTJA 1X9NA 2BYFA 2V4IB 4YSYB 4MGZE 3I5JC 5CV9A 1LT5D 1QILA 1WFQA 3MJ5A 1LM8B 1EF5A 2RPQA 2M8SA 1MBYA 2IGHA 1ZXIA 2IY0B 2V4DA 4L5SA 3NRZA 5J22A 1K51A 2O4XA 3OSOA 5CHFA 1JRUA 1C1YB 4YCUA 3B9JA 4GIVA 4KDIC 5KYIA 1BBUA 1VQKA 2KN4A 2UUCQ 4XYOA 3M85A 1D1IA 3PHWB 1S5DD 2RPVA 1CFMA 1N63A 3QWNA 1K9MC 2RCNA 2RA4A 2PQEA 4KKUA 2EYHA 1EOVA 3A8JE 3VR4A 1WTQA 5C4XH 4XT1B 2KDEB 1YN5A 4A3JH 4DNRB 2JA5B 3M9BA 3FVQA 2B2UA 2X6GA 3I4MB 1X56A 4O0AA 1ROEA 5AUKA 1KLUD 2IJ0A 1TQOA 2MBOA 3B08A 2HDMA 5C5LA 2NN6H 4IPGA 2PTLA 4LF8Q 1DJRD 2KT7A 3KQ4A 1NUCA 3KW5B 3VR6A 3GS2A 2PQAB 3AN1A 4RFBA 1WD0A 3APDA 2NVYB 3UI3A 1KAWA 3GOEA 5E7NA 1ZYRD 2K39A 3WIMA 1EF1A 4A3CH 5C5MA 4BBNC 1AWDA 1C9OA 5HGTA 3S24A 4F7XA 1XNRL 5IGBA 4AIMA 1WRDB 3ML9A 1S5ED 4HEDA 1SNPA 3UDIA 2KWCA 3NEMA 1OXVA 1V8CA 2LRUA 1LT6D 3K7AH 2PMZB 4LF7L 5E6OA 2D5GA 1VQLA 3Q24A 1N34Q 4XYCA 2IWHA 2IX1A 2D0PA 5IP9H 4UDUC 3RZWC 3A54A 3I4OA 1Q10A 3T51B 5DNFA 4A3FH 2E5LQ 1QVFA 5IYBG 3S1MB 3TP5A 2ZM6Q 1FRDA 1L7YA 1VCBA 2REXA 3VAWA 2KTFA 5FJ8G 4KY7A 1N33L 2FCQA 3BYYB 1I7HA 2LHDA 4M0WA 2R7FA 2JXXA 4Q0FA 1KNAA 5T8IA 1SMXA 1FL0A 1F1HA 4MM3B 1YJJA 2MA9B 4DR7L 3WAOA 1PYWD 2J7ZA 2JEBI 2M2LA 4HTHA 4DV5L 2W9NA 1T0SC 5HKHA 3HOUB 4KGRA 2N9PC 1EWHA 2VY3A 1LTGD 2ZW1A 1GUTA 1WTWA 4NJCA 3I72A 4OZAA 4JI7L 2GB1A 3SE0A 2CJOA 4MSMB 4A3BB 1X3FA 3D4DA 2PE9A 2EQSA 3G48A 3BIID 3NTHA 3VYUA 3S14H 4IKGA 4XYQA 1FGBD 4OVUA 1TKEA 2F4VL 2XRQD 2L55A 3H3VH 2WXLA 3FC4A 1BDOA 4HDOA 1HQMC 4HSVA 2VQFQ 3GTQH 4KZ0A 1CT1D 3D31A 1F9RA 4QIWB 1VQCA 1UE6A 3RZOB 2CS4A 1ESRA 2IW3A 3HOUG 3GTKB 4TUUA 2KD0A 2EY5A 1V81A 1ILQA 4TSSA 4A3BG 4BA2I 2F0HA 5C1ZA 1YN4A 3M7NA 1G2SA 1KNEA 5IOCA 2EJGC 2FMCA 3GE8C 3KH0A 5IGEA 1T6BX 3SHLA 2KQ7A 1UWMA 3LB8C 1HHVA 3DCGA 3V62A 1WGGA 2AUJD 3HRZC 3NOBA 1KC8C 2K01A 1TBEA 1II3A 2EYFA 3GV6A 3A55A 2EYMA 5J1ZA 2B39A 2EJMA 1I6HB 2L76A 5G5HA 5IO9A 3W5UB 1EQVA 4A75A 3KFUA 2K22A 2WWZA 3TEHB 4EKUA 5ELNA 1Q12A 3VR2A 4BOSC 1N5WA 4HJGE 2AKWB 2D9UA 3H7PB 2LKVA 1S5FD 4YT0B 5ISRA 2OQ0A 1IXRA 1MSGA 2K04A 5JOBA 1A3TA 1LO5D 1SNCA 3PIOA 2IYDB 2B2TC 3T1HL 1G51A 3CWIA 4FULA 4W9KA 2Z9HA 3AEDB 5EKIA 2K0PA 2HD3A 3PCOB 3M3YB 4NQKE 4ODGA 3L9AX 3K5NA 3L16A 3KDFA 4RHSA 1DYQA 4RF0A 1EQTA 1E5WA 4JPSA 2DJFC 4X62L 5KYLA 1P98A 2YV5A 1HTQA 1SGHA 3BVGA 5IOIA 1OQYA 1B7YB 1ZPSA 1AP0A 4XE0A 1KHIA 2KQ4X 2L05A 2D3CA 2FNJB 2NVQH 1RIPA 2ZXRA 4IOAA 2MCNB 4CQNA 3R2IA 2AWTA 4IURA 2LGDA 1L0YB 1FR3A 2EE1A 4KTAA 4UAIA 1K3BC 1C48A 3T8MA 3KF6A 1WE7A 5BR8L 2BE5C 2O2VB 3OWFA 1WX9A 1JOKA 4RGTA 3M3YH 3ULJA 3X23A 2RCFA 1EL0A 2E74C 3AE6B 3HOVG 2BYEA 2NPTB 2V1YA 1NR4A 3RLFA 3FKYA 3JSVA 5DCNA 2AHOB 1SYBA 4BKGA 1QUQB 1D3ZA 3VDYA 4FNFA 4M00A 2GOWA 1F9JA 3H3VI 1FMAD 1V8QA 4ASWC 5M3MH 3C8YA 4ZCKA 2CJNA 4OL7A 1B1ZA 1Q1OA 1A70A 3J80E 2M9VA 2J0TD 1SE3A 3APFA 2DX5B 3S2HH 1EY4A 3WOFA 4HJAA 2LI5A 4JI1L 3MTNB 2DHZA 4ITKA 4YSZB 2G3QB 3UE1A 3HOXB 4LNKA 1K28A 4JYAQ 3OHXC 4CJ1B 1L6UA 1HA6A 3LYYA 1NMGA 4US8A 3KVFB 4WFN3 2N55A 2JEAI 2ZJQA 4JL9A 4HIOA 1UBQA 4E71A 1PRTB 2A1AA 3L2PA 4A3MG 5BYQA 3MXGA 3WA0A 4BKSD 3J7A5 5IP4D 4MTKA 3KF8A 2YEPB 4CDDC 5AZGA 3KDFB 3PQIA 3JAMi 1AYFA 2C7NB 4ZYNA 5G3LF 1LT4D 4BY1H 2ZPYA 3KYHC 1D5ZC 4KJNA 4LMQD 1OTCA 4JX1C 3PSIA 4QB4A 4JI6Q 4IPHA 3AMZA 3Q2AC 4A3GG 1DGJA 2NVYH 2D07B 3S2DB 4Y7NB 4GKKL 3SDLC 1HNZQ 3K80C 3B1LX 2WHIA 2PNHA 4FVMA 1WIAA 4TKOB 3U4VA 2CU3A 4AYBB 1DOXA 1FD6A 1TWCH 1ILPA 1YNTE 3C46A 3TREA 1AEXA 3X3NA 4JV5Q 1BO0A 3W1YA 2UYZB 3NG0A 3QWZB 2AQ3B 4DHJD 1GJXA 2LWPA 2BBCA 2MHVA 2TMPA 2N9KA 4QF4A 4U68A 1E8ZA 4QAYA 1KRSA 4G0NB 1VQBA 2WB1G 5M3FH 5C4XB 2WYQA 3TMPB 3U50C 2JT4B 5LMNQ 3L4PA 3VA7A 2PI2A 2KDMA 2GRIA 4IO9A 2K75A 5FLMH 2FINB 1R4MB 5FO8B 4R9WA 4OO1I 4DAMA 1E7VA 2KJHB 2Z8LA 3VH4B 5IA7A 1N6ZA 4HDQA 3HKZB 3NTIA 3A1QB 3NPPA 3E3XA 2Z1CA 3TBIB 1HNXL 1YQBA 4OHJA 1D8LA 2Q8TA 4LFAQ 1GUNA 3FAHA 4KHPL 1TXYA 2INDC 4FP5D 4PZ7A 1WTHA 1TWCB 1K83H 2B3AA 4C3JG 2IX0A 4ACFA 2PE6B 2WQYB 3G4SA 3I63C 3RCZA 1SDFA 5CV5A 4FXGC 5EPLA 4DR1Q 3N1XC 5DM63 4DA2A 2KHSA 1TTNA 3ZGZA 1YNJC 2HJ8A 3A8IE 4C1NI 2ZCBA 3QJYA 1XMQL 2PEAA 1QB5D 4IOIE 2CH4W 2PZWA 4B6WA 3PLUA 5EKKA 1R4MI 1MG8A 1S3SG 2MBEA 4BKTA 4ARCA 2DWQA 5D2MB 3J81c 2WXRA 3A1QA 2DNEA 1C4QA 3BDLA 2PLPA 4A3LH 4FF4A 2I46A 1R4NB 2WLBA 4W9GA 2WDQB 4C2MB 2V3PA 4IDIA 1JICA 2J4XA 3PO3B 2RGFA 2ASQA 4IZ8A 5EE0A 3ZIMA 2NZHA 3RR5A 4JI3L 1VQ6A 4J3OD 3L54A 2A74C 3AB5A 5M5XH 3PLVA 3H09A 4JGHB 1VD2A 1G6ZA 1VQEA 4OWTB 1MHXA 2KNBA 4MDKE 2YTXA 4C1NK 4NAMA 1VLBA 3FRPB 2PNRC 1C7YA 1DOKA 5LL6X 1P1AA 4LDTD 1C77A 2O5IC 1WOCA 1JMCA 3JW0X 1GG3A 1Q5WB 1UUPA 3OIPA 1GNUA 2I5MX 2VUMB 4JI8Q 4JOIC 1PRTC 3WWVA 3DWPA 2MP2A 1QNUA 1RL2A 2UUAQ 4DR4Q 3HM3A 1TT5B 3FDTA 3NQIA 1SYCA 4DAPA 2MO1A 3RMHA 3RNBC 3SFDB 1OXSC 4OX9L 3ZDTA 4A90A 4L5RC 2IY5B 3J7AV 1T0RC 3TEYA 1WTXA 1VQGA 4LF4Q 4M8NA 2AEHA 1PTOC 4RKBA 4DHZE 1Z2MA 4KVGB 1U4MA 1PVOA 1BBXC 5IGGA 3I8ZA 4P72A 5IP7G 3SR6A 4A3EG 1C4CA 1UEBA 1XD3B 3W9CB 2O6VD 4B9KA 2F0NA 3CKIB 2I1KA 2L0FA 2WAQB 5IYDH 2IL8A 1PH2A 1UWXA 4FN2A 3HRDD 4B9WA 5GAGC 2FUHB 3DHHC 3QO2A 3Q3JA 1XTDA 2E8GA 3I90A 2R7ZH 1E2ZA 3S1RB 2D0OA 1XNQQ 4K7WA 1LTSD 4ZLTF 2YU9H 4PYZA 5C44H 1FM0D 2CKHB 4A20A 3NHHA 1IBKL 2KO3A 4E3CA 1Q3LA 1GB1A 3EFXD 4LUOA 4R4TA 3ZYYX 2NVQB 4K81A 2F0DA 2LVPA 1TZ1A 3SHQA 2JSOA 2MGSA 3CQZB 4OIJA 3J81E 1OTRB 2KWUB 3TCAA 4P73A 4DU9A 4YHHL 4OONA 1TZOA 3Q6BA 3A7AB 4DR6L 4DAVA 4WORA 4K7SA 3M4OB 3DVNU 4FDBA 2J0JA 3AU4A 3MJWA 1Y1WG 1AARA 1EFWA 1GUWA 1HCZA 1Y56A 2BVCA 2PKOA 4N9F4 1T5XD 3S1RH 5GQOA 2DAJA 4A55A 3P20A 1FO4A 5FLMG 2WNMA 5HG2A 1XWEA 5D3IB 3VR5A 1RYJA 1RCVD 3EBEA 2VW9A 2JE6I 4BBSB 2DYMA 2WXOA 4LF9L 3MWYW 1WM2A 2ZCCA 3IXSA 5G3LD 4JBWA 2KX0A 1PHJA 1YIWA 3I3CA 4DBGA 5M9OA 3A5ZB 2B2VA 1E8XA 2HE7A 1EIGA 1P7EA 1VQIA 1RKNA 1LLRD 2FXQA 1HJPA 3NBHB 5I6YA 4X65Q 3PS6A 1A8VA 2E2HB 2MJEA 1HR0Q 4UP9A 1E90A 5KNCA 1WTVA 3MHSD 1BR9A 3U4ZA 1HA5A 3CCQA 5FLXL 1JMLA 4UPAA 3AI5A 3Q8DA 3GQBA 3CRLC 1FJGQ 2TSSA 1NEKB 2QSDA 2NWGA 4CGYB 3J81i 4HIDA 2JZZA 4ZRQA 2MW5A 1ML0D 2K05A 2NUCA 2Z4HA 5GAHC 4HCPB 5M3MB 5IKCM 1IBML 2WXJA 4GOCA 1LACA 5KNDA 3J81j 3AEBB 1J19A 3W1BA 1YJ9A 3W1GA 3PO2G 1DONA 4DF7A 3V61A 3M95A 2K32A 3B6YA 1WM3A 1EEID 1P8LA 1XT9B 1Z5SB 2QCZA 5CC4A 2KDFB 2FHTA 5L95C 3N9YC 2A69C 2VQEL 5H8YE 1JB3A 2G5DA 2BH2A 2M0XA 3TSSA 5IE8A 1FRRA 1N60A 1A3VA 3F2UA 2ONQA 1D1KA 5LNK1 1WF9A 4IFDI 5CBEE 2MJ8A 3AYHB 2V3NA 1EWCA 2XIWA 4C3IG 3S1QH 2M17A 4II3B 3G6EA 3NJTA 1JC7A 2NBFA 4K5XA 4RMFA 5G2NA 2B2WC 2CFMA 4LTUA 1VQNA 1CZPA 4YCWA 3R93A 3RD4A 3T1YQ 3PZDA 4X3TA 4LF6Q 4PG3A 4X66L 1Q46A 1WH3A 2FAZA 4DQOC 1XLQA 4GN4B 5EE3A 1WZ0A 2DLBA 2JX5A 3EN2A 1VQ9A 2L00B 4ILWA 3AFPA 3IAYA 2SNSA 3CAMA 1LTLA 3Q8EA 2KENA 4OW0A 2WDTB 4PV1C 3I7FA 3KUCB 4Z9CB 1QOHA 2OWOA 2LGXA 4F8CB 4XWWA 1I4RA 4P1BC 3IBEA 2EYLA 3CCJA 3K8AA 1GM5A 2G4DB 1QCBD 2L15A 1SBBB 3M4PA 3N3KB 1PUTA 1LM0A 3JAML 3JVZX 4MEMA 4WWMA 1QJOA 2ZJRA 2JZ3B 3J81L 3U30A 2FCMA 2D11A 2BS2B 4WQMA 4ANWA 1XLOA 3OTOQ 5KGUA 4YTPB 2CH4A 1HUMA 2AYOB 2MP2B 1FNVA 1SROA 1MJCA 3MHBA 2KKCA 5M3FG 1HZAA 2DYOA 1M94A 2ZEQA 1QG7A 3H94A 3I56A 2AUKA 3ICEA 3VTVA 1YMHE 5TR5A 4HPLB 4K8IA 1AE2A 1YITA 2EYJA 1X32A 2QC8A 1ZEQX 3DHQA 3QOJA 3HP3A 3R8BA 4A3KB 4APVA 3IT4B 1ENCA 1NSNS 2VUMH 2IO1B 3TS0A 5E6NA 4BBRB 1EYAA 1F2ZA 1NY4A 1U4PA 5M3FB 4XC2A 1SJHD 1IW7C 5ELEA 2H88B 2RHSB 1I35A 4PYUA 4K2LA 4A93H 4HSPA 1YI2A 2OXPA 2EZVA 1RDPD 1IL8A 3V6CB 4PMWA 1EIFA 1TIFA 2E6XA 4DV0L 1VMCA 2L0TA 2I5LX 3FEWX 5IWAL 3R3OA 3ML8A 2YEPF 3DHGC 4HCSA 3X3MA 2L4NA 2C7MB 4G7HC 4EVOA 4RA8A 1XQQA 1S5BD 2F4IA 4DV7Q 2B8GA 1NJIC 3PMFA 3ETRA 2E2JH 1G291 4DWFA 3TZUA 1OGWA 4W9EA 2E2IH 2XGTA 1N9WA 1STYA 4FHKA 3PIO3 3T13A 1J5EQ 3BG3A 2K03A 4YWLA 3SU8X 1OEYJ 4GB9A 5C0XG 1HTPA 1MD2D 1UNSA 2OHFA 1I5FA 4WIPA 4ZDVA 3RMKC 4G57A 5C4ZA 1JE5A 1NYRA 1WCMG 3VYTA 2UXBL 4CHKA 1OFFA 3HOYH 4W9DA 1VQHA 1JQ4A 2OEOA 2LFNA 1FXAA 2Y5CA 3AU7A 4RG1A 2KMMA 3QA8A 2B2TA 1ZUD2 4IPDA 2HUGA 1F2RC 3CCLA 3AEAB 4TRDA 1D7QA 4II2B 1ICWA 1SIFA 4EZLA 2J0MA 2UUCL 1D4BA 4DV4Q 2VNUD 1ESFA 1VF7A 1B9RA 3RLOA 3EA6A 2JA5G 4X64Q 4DAYB 3I9V1 3T16A 2UU9L 1OXUA 4C3IH 3GP7A 1T5EA 3ZW3A 1PTOD 3UDGA 2D62A 1KAAA 1KDAA 1CJEA 2WXFA 2ZVNA 5GXGB 3H1UA 5BN3A 4P1CC 5DPSA 4B3TQ 3MTSA 4AH6A 4BBRG 3U9OA 2KJRA 2P5ZX 2XBBC 4WWNA 5C23A 2R61A 1PFBA 3J80L 4BAXA 2HHHL 1ASZA 2C9OA 4LK1C 4BY1B 1ISNA 3EROA 3M7GA 4NXMQ 3PVLA 4AQYQ 3NZSA 3GTJH 3GTOH 2GBRA 4KGTA 4B95A 2PW5A 1SYDA 5LLIA 2PQAA 1TS3A 5KHQA 4DHJB 4A3OA 5EAYA 4M0WB 2N78A 1J7CA 2CHZA 3DUZA 1SE4A 2EXZA 4NNJB 4RNAA 3F2BA 2WU2B 5DM73 4M01A 4PMBA 3I4MH 5JAVA 4LF7Q 2JA8B 1PFDA 4MSQB 2G1EA 1K53A 4G7ZC 1N34L 1QVCA 3M3JA 5IP7H 1QLBB 2HCIA 4ZRPA 3UDXA 4A6QA 2E5LL 3DM1A 2LJ5A 3AEFB 2ZM6L 1WCMB 2ZXPA 3LX0A 4NXNQ 4N9PA 2IGDA 1CHPD 4NAWA 3K5LA 1QZGA 1JJ2A 4H2AA 1EQRA 3HG9A 1PZID 3IT6B 5J3BA 3UDFA 1A5RA 3UI2A 4YWKA 2C60A 4L8JA 3E5SA 1Q8IA 4C56C 4DV5Q 1WGDA 4DR3Q 2OJRA 2Z6KA 1WE6A 3QAQA 3D8GA 3UF8A 4P75A 1IP9A 2F0LA 1Z7TA 1I6HH 3MP9A 2JA6H 3I55A 4OIKA 4JWUC 1U4LA 2JA8H 4DXAB 4K2KA 2BKRB 2DY8A 3W2DA 4DUYL 4ZQ3A 1QZEA 4KDLB 2K7VA 2FE8A 2KDIA 3LNNA 4WJOA 5EJWA 3M62B 1KL9A 5IYDG 2XK5B 3VXWA 3F1ZA 4GN5A 3CMEA 5EE9A 1YJNA 1RFAA 4GMVA 3VR8B 3QHTA 2KFJA 3GTMH 3AULA 4DDID 3EECA 1C8CA 1BUVT 2W55A 5E3FA 4A9AA 1TWAH 1IGDA 4GOPA 1WGKA 3B0AA 3C2PA 4MJSB 3CQZH 1E1TA 5ELOA 4IWOA 1UE1A 2L8JA 1GUOA 1LTTD 1KXLA 5IGDA 3PO2H 4DV6L 5E1FA 4IFDG 3DMUA 3APCA 2B63B 4WH4A 4POGA 5DPRA 4JK1C 3TP8A 1XXGA 2INPE 3ZXRA 1WGYA 1TT2A 2RKSA 4LW1A 1N8RC 1BCPB 4QGUA 1V5TA 1GO3E 1IUEA 3AEEB 4QJFA 1TWHB 4X6AH 1ICFB 2N9XA 1ZOYB 4BWGB 4CJ0B 3N6RA 2JSVX 3BVMA 2MP1A 5JEAJ 1HPCA 4GLXA 1X3GA 1P9DU 1RM6C 1XPRA 1L2NA 3CW2C 1EY9A 2YYZA 2EJFC 4MJSA 3T1HQ 4JI5Q 1HZCA 1V1PA 1CMXB 1WGHA 4ANXA 4GN1A 2EYPA 4K3BA 1ZW7A 2FJ2A 4FJZA 1XJVA 2QEJC 1I4PA 1STEA 1G2TA 4JLCA 2XK5A 1BQQT 3TRZA 1DOIA 1E8YA 5CYUA 4RMAA 1TWGB 1MGSA 3WANA 4RCNA 2KWVB 1SNMA 4EOYA 3STBD 2KECA 2KA7A 3KLWA 3HKZG 2ASBA 3ZDMC 2F0TA 3TEZA 4R8NA 2QA4A 3H6MA 1AH9A 4YL8A 3ND8A 4B08A 1EFID 3OJ4B 1Q90A 2WXIA 5FLXE 3NVVA 3HUIA 2F0OA 3OYYA 3P1HA 1VDZA 2HIVA 3PUZA 4WWPA 4HJ5A 1LFDA 3DBRB 4GKJQ 1VQJA 3U52E 4B3RQ 5CR3A 1MHWC 5M5WB 1IKLA 1WWTA 5KIXA 3P1MA 4V190 3N1YC 3HGBA 4XQJA 4IWPA 1G6JA 4A4IA 3CF6E 4H0LC 4I7ZC 4MN3A 4A93B 1K73C 3P4PB 4FYDA 1JRPA 2MQJA 1EEFD 1KQSA 1CQFA 2N7JA 1NI2A 4X3SA 1WJUA 3U8ZA 1UAPA 3TQYA 3CIRB 1Q1BA 4F7ZA 2WIIB 3DQVA 4B0MA 1UEAB 2CWAA 3HOXG 2LFIA 1M1KC 1I6VC 3BDOA 3HOWG 1R4QB 4GU2A 1K8MA 1IW7D 2E2HH 5TSSA 3TP6A 1BMLC 1IYJB 2NN6I 1SLJA 2H1EA 2X6LA 1RHPA 4A3GH 1C78A 4JBJA 2BS3B 1L4DB 2K8BA 2MRPA 3KUDB 2WP8J 4K3CA 1TS4A 2PZTA 4WAAA 1F2LA 2I07B 3TEWA 5FR6A 1TWFH 2X69A 4GN3B 3RULA 4C3JB 2QEXA 1N32L 4ME3A 2LY7A 5J39A 1K0SA 3IAS1 1GJZA 2R2OA 2B2YA 1E10A 4LJOB 2OCEA 2JYOA 3HOWB 3MXPA 5IYCG 4JI6L 3I4NH 1PTOB 1UE7A 1V1OA 1SMYC 2ICIA 2A6HC 5ELBA 1L0WA 4AYBG 1H9JA 1VDVA 3NBIA 4GKKQ 3E56A 3NK9A 2FCSA 1E0BA 4JC0A 1WYWB 1KDBA 2F0EA 1B9NA 2QW7A 4WQOB 1I94Q 4WJPA 3BJUA 3ALBA 4GNXC 1L6VA 2MLBA 1YHAA 2EXDA 3RN5A 3AE8B 1MFWA 5I9PA 3L13A 3DLLA 1PH1A 1VRAB 4ZKCB 4IC7B 3J7AF 5LMNL 1G8ZD 2F0GA 3SXHA 1DZ1A 2EDGA 3TIXA 1J7AA 2R6GA 2KEEA 1VMPA 1A3UA 4DHZB 1PLFA 1AN8A 2IZVB 5IAAC 1S72A 2WXMA 1YQ3B 1Y1VB 2KHJA 2QDBA 2QDLA 4IUPA 1VQDA 3VYRA 4EEWA 1NE3A 2Y0SG 4A3LG 3VHTC 1QOFA 3O65B 1XLPA 5IIFA 3VUYA 4GGQA 4FF3A 2XNAC 3AXCA 2J52A 1A15A 3VR3A 1HR0W 4S17A 2EY1A 3GV3A 3N20C 2LUEA 1X3QA 4LUZA 4NZLB 2IGGA 3KF6B 1LTAD 4CDCC 2RDFA 1B53A 2CQAA 1PH6A 2K5PA 4PK1A 4BXXH 5E6PA 4R4OA 4GDLA 3Q0AA 1DD2A 1WTPA 3CCSA 2YLMA 1L1OA 3PUVA 3CC4A 2LGYA 5JJKA 5FLXc 4XXEA 3QC8B 1V43A 2QCPX 4DDGD 5KEEA 3RZFA 1Y69U 1FCLA 3ULPA 2RDBC 1RWSA 1Z47A 2AX5A 4PZ8A 4ZAIA 3S16H 2E2DC 2N88A 3NSWA 2WXNA 2BWFA 2A19A 1NBWA 4C3IB 2DBYA 2Q2UA 4G4KA 2AL3A 1CI3M 1L0XB 3T56B 2A6ED 4OXPA 4B3SQ 2MWSB 4AJWA 3CD6A 2N0SB 1R9TH 5EPKA 3D0FA 2MEKA 3ND9A 4YTNB 1BCPF 1MI2A 2L52A 2RSOA 1KIXA 1X6OA 3OW7A 2DJGC 4JI8L 4DAYA 2QKIC 4GNXA 1IYUA 4DR4L 2XN9C 3QX1A 1VQOA 1B4OA 5IGFA 2F52A 3W3AA 4GDKA 1WJ4A 3PO3H 4LFBL 1SF0A 3IL8A 2ZZPB 3HVDA 4KI0A 2IO2B 3P63A 4YTMB 1GHJA 4LF4L 4LFCQ 2B2YC 2KUMA 4UY8C 1A2UA 3GTPB 5A2QL 4TVAB 3RUZA 1J8IA 2Y0SE 4IUMB 1H9MA 4CHTB 4DN4M 2MBBB 3AB9A 3RFZB 2V4LA 1G91A 2EPBA 1NVID 1GVPA 3EFUA 1B50A 4L6TB 3HOVH 3P4SB 1T9HA 1U4RA 5D94A 3WCQA 3PSEB 1MIUA 4IFDJ 2D3GA 4TMAB 3V60A 2KVZA 3TEXA 2L0CA 2KBNA 5JPMC 4KY5A 4HR7B 5HFYA 2B63H 4HIKA 1IL2A 2JA6B 2BCOA 4MGIE 1PH4A 4AYBE 4A3BH 1IBKQ 3SEBA 2SNMA 2M0AA 1YNXA 4WRDA 2KAJA 5IT9c 5CHVC 3ZNZB 1U4AA 5CX3A 1Y8RC 4RF1A 2I5HA 1JROA 2MSED 3I4MG 2DZJA 1CKNB 2KEDA 1TVXA 4O42A 1C4AA 1F9PA 2WB1E 1Z6HA 4A3FG 1HZBA 5BMIA 2OJWA 1E6EB 5BMHA 1PRTF 3W1SC 3VTUA 5FJ8H 3P7JA 3T4AC 2LXAA 5JEAH 1YJWA 1BXTA 1YOVB 1LGRA 4QL5A 1FYCA 2Q2HA 1SSNA 3TZDA 5BO4B 2XTIA 3NENA 2F0VA 2QILA 4F8MA 5LMUL 2WXGA 1FXTB 3N52A 2B76B 3D6CA 2AMCB 1N36Q 2BH8A 4IM3A 4DK0A 1BOSA 1WI5A 2KANA 3HK0A 1PYBA 4UP8A 2EIFA 2BA0A 3P75A 4GOPC 3S2HB 2KC1A 1W6KA 5EKLA 1MJDA 1RAXA 4KSKC 2MO0A 5EPJA 2WDVB 4WAFA 1BCPC 1KDCA 1V49A 3LDZE 4X65L 1HR0L 4IG7B 1WYGA 2H89B 3S15H 4R4IA 2ZT9C 1F2YA 4M8AA 4FF1A 1XCQL 2J53A 4C4VA 3R66C 3F8TA 4B9XA 1V6EA 4HKZE 1EYGA 3VRAB 3PT2B 2HT1A 4H7BA 1NR2A 4XTCS 3OG5A 1RJTA 1VQ5A 2WAQE 1BT0A 1WMHB 4PQXA 3A9KA 4KKIA 4PS8A 4W9CA 2M56B 3TS2A 1STBA 4A3DG 1K52A 3ERSX 3PO2B 1E7PB 3UQBA 3I91A 1WCMH 1KRHA 5IY0A 5FK9C 4QUFA 1MVKA 3HS0C 4R3DA 2LUMA 5NUCA 1RODA 2B8FA 1GC6A 3CC7A 2QHOA 2B2VC 3TP7A 3L17A 3VUWA 2RHQB 4OO1H 5JZEB 2HTHA 1H8CA 1FGUA 2Q2TA 1NENB 1O7YA 1SJED 2OQKA 2I0QA 1B3AA 2VQEQ 2HDEA 2M1MA 1JR0D 5D65A 4V0BA 5I9OA 1EO6A 2K5DA 5FOBB 4JI2L 3UIOB 2LZ6A 4US9A 4C7YA 4XWTA 1PMRA 4A3DB 4OVZA 1Y8OB 3V96A 2KJ6A 4IQZA 4IN3A 2L1AA 1CSPA 2WGSA 4KKSA 4ME5A 4F88A 2BB5A 3HOZH 4YIJA 3T1YL 3UGBB 1I3QB 4LF6L 2OEDA 2UUBL 1SYFA 4X66Q 4DV1Q 4A3KG 4K6LA 2F03A 1JJGA 2M19A 2F0MA 2KVMA 3JAME 3B2GA 1AW7A 4KKJA 3TMEA 4YWMA 5C0XI 4GDLB 4JQWC 1K83B 1TJEA 1RLFA 2EKIA 2FUG1 3ZXVA 3QARA 1SE8A 2EELA 3LXFA 1FFVA 1K8AC 4X3UA 5E4XA 1K0RA 1LTBD 3BZKA 3S1NB 1KH0A 4IWQA 5COYA 1ZXTA 3F2DA 3Q69A 4IM2A 1WMHA 3A9KB 3RN9C 4BOZB 5DPWA 1SMYD 3I70A 2MPMA 3QJZA 3KJOA 3R3MA 3RZDB 1C0AA 2DGYA 2KVRA 3JAMc 2QMTA 4TV3A 5J2RA 1YZ6A 2MHJA 3WAPA 4CDFC 2PCFB 3DBHI 2LXKA 4WJ4A 1IBLL 4UP7A 1H95A 2BTEA 1HE8A 1N62A 3DHIC 4YY3Q 1LXDA 1F2RI 2PIAA 3K0YA 4RCOA 2L7RA 1B3QA 2N1VA 3SK8A 1DGSA 2QF7A 1J0GA 3NWSA 4A76A 1HEZE 3FHWA 1EY8A 2VXWA 3TDQA 3T3NA 1X3EA 1H4RA 1VQ8A 3K5OA 1JWBD 3U7ZA 2EMTA 2JK8A 2K50A 2PW7A 2A5UA 2K6DB 2L1BA 1EY6A 1TWFB 2Z0DB 3U4EG 3N1ZC 2D3BA 2PMZE 1ENAA 2A73B 2N1WA 4POFA 4LNIA 5M5YH 3J9CA 1JE4A 4C3HH 4DR2L 4EZJA 3DPDA 4HRSA 5E6JA 2JWUA 2EYOA 4X3KA 2JA8G 3LWUA 3CPWA 1PXUA 2R92H 3E9SA 4WJNA 1SNDA 1WGRA 5BN5A 1B8AA 1IPGA 4FJYA 2GA4B 1R4PB 2BOSA 4C2MH 4DV0Q 4PS3A 5IWAQ 2YTVA 4O2DA 3N30A 4BZAA 5FR3A 3JC66 2JQOA 2JA7B 2KXJA 2FFKB 3P4RB 2KMCA 1CZWA 1STNA 4GLAC 4PZ6A 2DZIA 1SSOA 1TKGA 4CBVA 2UU7A 4ZRJA 3ZRCA 4KGSA 3I3TB 2CHBD 4BY1G 3Q23A 4L63B 4IJHA 5T1IA 1PGXA 2F3IA 1QOAA 3HEJA 4KKTA 2ZTDA 1J5EL 4HJ9A 3MXNB 1PYSB 4DUZQ 3L08A 2JYEA 2BWES 3P2BA 2JVCA 1XX8A 3SGIA 1LTRD 1F9QA 1I42A 3BZCA 4ZUIA 2JA5H 1YBYA 4JCVE 4CKCA 4DNTB 2UXBQ 3AE4B 3ERQA 1YEZA 3DBLI 3EC8A 1TS2A 5G55A 3A74A 2LGIA 2UXCL 2BE5D 3Q14C 2ZTCA 2UXDQ 3FKIG 2PI2E 4LNFA 2K5QA 1GUSA 2JWZA 4DK5A 1HTOA 3PGEA 3C1FA 1VCIA 3AQQA 4J6HA 3ULLA 1NNXA 2B29A 2RMMA 3BZDB 3JSVB 1JWUD 3K7AB 2GBKA 3I73A 4PMCA 1SNOA 3CPFA 4K5WA 4DV4L 2F3WA 1Y1VH 1VZ6A 1VZ8A 4PT5A 3K81C 4X64L 5JHBA 2UU9Q 2F0WA 1PRTD 4JW0A 2PPHA 3MXUA 3IKJA 3V2TA 5K36H 4KIKB 4C00A 3RPFC 4ULLA 1EYCA 2MNAA 4ZRIA 5KRUA 4B3TL 1D6EC 2LS01 4JI4L 3BWUD 3RNEC 1RFKA 1X1MA 4E6IA 3S16B 2L5TA 2HHHQ 1RRBA 1WXQA 2QJLA 1HRJA 1YHQA 1CK1A 3BK2A 1VF5C 4NB3A 2WV6D 1H9SB 3LGJA 3MFGA 4NXML 1IGCA 5JJZA 4AQYL 4YCVA 4W9HA 2IPKD 5BMGA 1I4GA 1VQPA 3NP8A 2N7DA 5C44G 4LAAA 5BYSA 2ZNVC 4I6LB 3K9OB 2JUOA 4HCEA 3HVZA 2PO4A 4DXFA 5GMVA 2C35B 2C7HA 3K9PB 4G3XB 4GDKB 4NQLB 1FIQA 1RTNA 1L0VB 2WFWA 4TQ1A 2Z59B 2K33A 4IUVA 1GUGA 4HJ8A 4H02A 3DVNV 4ICUA 4RWSC 3JYUA 3Q3NC 1OXXK 2NB0A 3LWEA 2NBWB 1QKZA 1TS5A 1BKBA 2OT2A 3HOYB 2VZKD 4NXNL 1CA6A 1EIYB 1UD7A 2O6VA 1QUQA 2K8CA 2DY7A 1UGMA 1MKHA 1HNWL 1WJNA 3AM9A 4BY7B 1XPUA 4YWGG 2KFKB 4I6PA 1W3SA 3VA5A 2LASA 4DR3L 4KD3A 2R7ZB 3PO3G 1E8WA 4K0KL 1C3TA 3GB1A 3H0GB 4ZYSA 3KK7A 2JXMB 1I4XA 2L83A 2L3ZA 1DOLA 2BYVE 2K8HA 1HZ5A 1JALA 1PQSA 1XMOL 3DBHB 3KJPA 4W9JA 4DUYQ 2ZJDA 1LYLA 4NKLA 2MUYA 4LJZC 2H5XA 4JPBW 2K9XA 4YXDB 2ID0A 2CWPA 1I3QH 2N9EB 3VR9B 2LXJA 2DN8A 2YTYA 1LTID 3PUYA 1W6JA 2K5VA 1I4QA 2R93G 4WURA 3DWQA 2KZRA 4CO7A 3GD7A 4RM8A 4NPSA 2R7ZG 3SK5A 1C4PA 1YQ4B 3H0GG 1WXVA 2JA9A 1WXSA 1V1PB 2SAKA 4MELA 4JE3B 1QQRA 3E0EA 3AE9B 3MC8A 3W5VB 3AE3B 5AUIA 1E0ZA 4ZKBB 4ANVA 1EUVB 1QOBA 5D6JB 2AQ1B 2Y5PA 4LF5L 4LWCA 3H7SA 4DV6Q 2IO0B 1SRUA 2KCNA 3G7LA 3VQIA 4MH0E 4OO1G 4BKSA 3UIPB 4JI0L 2LGSA 2NN6G 2DNFA 4AOFA 2CQOA 4KJOA 1FD7D 1X54A 3EIVA 3HOYG 3L0OA 4RGOS 2A4ZA 2DYBA 2F0JA 3IFTA 1NMFA 4A3MB 1CKMA 2NTSA 4CDEC 1WTOA 4A3CG 1KTKA 1K8OA 1S1QB 3Q3OC 4W9IA 2ENBA 1XF5L 5DLQE 4EGVA 4JI5L 4MGYE 2BS4B 3L3OC 2Q2IA 3NELA 2WXQA 1FNUA 4QMGA 1QNKA 1LV9A 4JIOU 1L1OC 4C80A 4IPCA 3KF8B 4DR5L 3IVFA 4ZOHC 3S9WA 3AFQA 1S5CD 4I7AA 5LHY1 5IP9G 2Z6KC 2LVQA 3OW2A 3CSTA 2SOBA 4IW0A 3ZJVA 4X57B 3UE0A 2VS1A 5F2DA 1DM0B 1CUKA 4KK7A 2JA7H 3RUIB 3ITPA 4D2KA 2IO3B 3BK1A 4K7UA 5AEKB 2BGFA 4B3ML 2VZKB 2HCCA 3H9DA 1FVIA 3I57A 3NE5B 4FXDA 3RZDH 3K58A 2KLGA 2KOLA 1FCCC 2N8NA 4GKJL 1XEEA 3HZXA 1WZ3A 4B3RL 1EZ8A 1BNZA 1TY0A 4ZHOA 1WJ6A 1X65A 3S1NH 3FP9A 4XZ4A 1SNQA 2Z6BA 2XRSD 4EQPA 1Q81C 2JYTA 3RD2A 4WJ3M 3EFCA 5AJ3L 1KFYB 3KUPA 4GNXB 1YX6B 1TWHH 3SVMA 1AFPA 1TYGB 2KN5A 4DXGA 3HOZB 4FF2A 3OPOA 3VYSA 4EQ5A 3S2DH 1PGBA 4BFRA 2BA1A 5M3MG 4P16A 4KHVA 5CGKA 4HXDA 2ACZB 3DVGY 3I4NG 3ONSA 2LMCB 2KTRA 4LK0M 5MPOA 1GXDC 4OGQC 4A3JB 3J80i 2ZW0A 4WWOA 5CV7A 2CKZB 5DEHA 3MA2B 1MJEA 3H8HA 5JH5C 3ZNID 2GBJA 4RGNA 1N32Q 4BVUC 2O5JC 2PVGC 1EY7A 1M8AA 4CKEA 1CM9A 4IJLA 3NS1A 4M8MA 3V3XA 4JWSC 1T0YA 1TIID 2JP1A 2V1CC 2ON8A 2NZOA 1V5OA 2L32A 2HTME 2WKCA 4HPMB 2MJ3A 4AP4C 2VB2X 1JJCB 4ZRZA 4GZYC 4J15A 1VQ4A 2UWQA 1F0ZA 2D3AA 2K1BA 2K5WA 1UF0A 1EY0A 4P74A 3HIZA 3PRPB 3Q8BA 1D2BA 4FXCA 5I6WA 1I94L 4DV3L 2VUMG 4TKNA 1BVSA 3OMGA 2K6AA 2SEBD 3NS8A 2C9WB 3AEGB 4NJ7A 3GTGH 5FO9B 1YX5B 5LXIB 2G9DA 2KWDA 4OWWB 2AL6A 5CORA 3Q8FA 2N3SA 4QQBX 1ACCA 1IKMA 3URYA 4IOCA 2XWBB 1ZDXA 1CTMA 2J42A 4URKA 1CSQA 1Y1WB 4DV2Q 2ALYB 1UWVA 1IHZA 1OO9B 2HD5B 3ECIA 2ZVOA 1D5MC 1SYEA 3CU7A 5HGQA 2MJDA 4R1JA 3AE1B 2NTTA 3QIJA 2WDRB 3OAWA 4OEMB 4C3HB 1Y1VG 4HCNB 1UE5A 3NTKA 3K0XA 1IBXB 4KLKA 3GE3C 5AZHA 1E9MA 1STHA 5EQ0A 1JQYD 3ENEA 4L5TA 1WSPA 2W54A 1KM7A 5HHDG 2BPSA 3C0RB 4YSXB 2Q8RE 4NDXA 1ZXHA 5J17A 2RBMA 3E9HA 1CQVA 3GDEA 1WTRA 3ZTCA 2RSUA 5JHAA 1H9RA 1ZGUB 2KC2A 1ET6A 1E24A 2O2LD 2XWJB 4NY0A 1SE9A 3A5UA 2K5NA 3OIQA 1B44D 1YNJD 5K5PA 1ZKHA 1U5KA 4HAEA 2KCMA 3PV0A 1TU2B 3UQAA 1JOOA 3BYTB 1NTGA 4LF8L 3SK4A 2Z0SA 4HWIB 2R3ZA 5C2TB 3NHEB 2EY2A 2I2YA 2A68C 3O13A 2LVOA 3TN2A 1VQAA 1ENFA 2RDGA 3PUXA 3GTKH 4FA6A 2ZPNA 2K4KA 4MZ9A 2F0SA 2OF1A 1I50B 2F0UA 4R4QA 4BS9A 5G5GA 2N49A 3CHBD 4C7ZA 5D7GA 1E22A 3Q3FA 4LDTB 2F0PA 1QVGA 4R8IA 2BQQA 2R7DA 2RR9A 1XTCD 1XNRQ 4GS3A 1NYQA 3VRBB 1P16A 3EJIA 3CCMA 1H9KA 1Q8KA 1HH2P 4B3SL 1Q0WB 3IG3A 4MT5A 3WALA 2Y5BB 1HTLD 3V05A 5M5YB 2C5LC 4G11A 3ZUNA 2JRHA 1WX8A 4OELB 1N61A 1MPEA 4F87A 3QIAA 3IHPC 2WINB 3C3LA 2NVTB 4HLEA 5EBCA 3PO0A 1DOMA 5ELDA 4KN7C 5IT9E 5C0XJ 2CR5A 4BY7H 5L83A 4ZHPA 1XCTL 5GAEC 3DWAA 3J7ZC 2JN4A 2I1JA 2N7EA 3K57A 1N33Q 3NY5A 4LFBQ 1MHHE 3KLSX 5IYCH 3T53B 4CKBA 2OOBB 2XEWA 5C3XA 3M4OH 5CHWA 1BF4A 4LFCL 5IT9L 3DDCB 2GVBA 1EWIA 2MH7A 4DR7Q 2D2CC 3U58A 1UELA 5C4HA 1H9SA 3S2AA 4XDXA 4OWXB 1RTOA 2O2VA 4AUQC 5EDSA 4Y52H 1TWAB 3NVWA 5JJLA 3T9LA 3ZJUA 3Q8AA 1XO3A 2BW2A 1L4ZB 1SFOB 4JI7Q 2JU6X 1IYVA 1YHBA 1HQRD 1PFSA 3G71A 3TUOA 5H1SE 2RSNA 1E7ZA 2PZUA 1MI0A 3H0GH 3PRMB 4LNNA 3U7DA 2F4VQ 2VL6A 2KOXA 2CW0D 4JOIA 5I4DA 2D5DA 3GO5A 2VQFL 2K5HA 3FILB 4JBKA 1LT3D 3F2CA 2LEKA 3NWTA 3PTFC 5KHOA 1WYDA 3BY4B 1BBWA 3AEVA 3S15B 4KSLC 4RM9A 2JPHA 3PV1A 1O80A 1GUAB 2ZJPA 2ICEC 4A3FB 3S1MH 3DBRI 5CBAE 3ZO5B 3ZRFA 3BVZA 1JORA 1V9PA 1EZ6A 4K1RB 5C0XH 1ASYA 1KJTA 4XDDA 1NDDA 5C4JB 1GHKA 5EE1A 2BB6A 3SFEB 3M4YA 4LUVA 1WY8A 4KX6B 3K5MA 4A3IG 3OLMD 1NBFC 4HJ7A 2KJXA 4I65A 1TGZB 2NCNA 2NZ1D 1GPXA 1PV4A 1WX7A 3GZNI 1KD1C 3GZNB 2Z0EB 3KBXA 5LMUQ 3DBSA 1PFNA 1Q7YC 2GN5A 3HHMA 4LCDE 3V6EB 3PF5A 1N36L 1XLNA 1WR6E 4FBJB 1HXYD 5BN4A 1KRTA 1JT8A 2VRRB 1N5XA 2IHFA 1PH5A 3MEHA 2NS5A 1QWYA 3C19A 1E7UA 2RD0A 1O78A 4QY7A 4RAUC 1GAQB 2MQHA 2Z4IA 1E2WA 3Q6SA 4A3DH 1OQRA 2KDBA 4RGMA 3VFKA 1SN8A 1CA5A 1HZ9A 1KLGD 3DXJC 5DAUA 3WOEA 2V9HA 2N9LA 4N59A 4P7IA 1R7SA 2R93H 4M02A 1PA6A 3MHZA 1FEHA 3WDNA 2WXKA 2KHWB 3P42A 4FJVB 2M4NA 4X62Q 3NVZA 2F1MA 2HQLA 3FKIB 4BXXG 3ONAB 2CW0C 2GVAA 3R7QA 2KYWA 4XDCA 1EIHA 1EU3A 2JXTA 3PIP3 2KTRB 2LHEA 2LMCA 3PZ8A 3SDZA 1PTOH 3IFWB 1A6XA 2VB3X 4KV6A 1S3OA 3A7LA 4ZK9B 1WVLA 2KQSA 3NXWA 2JF5A 3Q22A 2LD9A 3A4RA 3VDZA 2CHWA 5IN7A 1BUIC 2WACA 4KIKA 2INCC 2QIEB 1ZKOA 3A33B 5BR8Q 1FFUA 4HPPA 4QIWE 3ZQ4A 2KQ3A 3R7RA 4JI2Q 3GTLB 2CCZA 1IZ6A 2BDOA 3HFZB 2W3SA 1VQ7A 3D32A 1WRIA 4MGKE 3BS1A 2A69D 1K3RA 2RQXA 1JB7A 2KCTA 3I2ZA 2NPTA 1UH6A 4KV2A 2FMMA 5IYBH 2NBVB 1V86A 4BBSH 4QUCA 1IBXA 2PYKA 1O7LA 3TJPA 2K25A 2UUBQ 1L5PA 4DV1L 4L23A 4EQNA 4RKLA 2MBHA 5CV6A 3PREA 1JW9D 2KACA 5DPTA 3RNAC 2G4SA 1CHQD 3QG1A 1HZ6A 1C76A 4JI1Q 3UINB 4R4CA 4ZUJA 1YN3A 3RT3B 2E75C 3MFYA 3D4WA 5JXVA 4JYAL 3OMCA 1P7FA 2FBWB 2R92B 5C6AA 3AV8A 2EY6A 4A3EH 1VQMA 1EQQA 3VVWB 2M00A 1WR1A 5JEAG 2JA7G 3NQTA 1R4NI 4K5VA 3QOLA 3K7UC 2ES2A 1QOGA 1UGJA 3M63B 3ABVB 1W2BA 1Y8NB 2MX2A 4DFAA 2J0KA 2WX0A 1FXIA 2A6HD 4BY7G 4W9LA 1IBLQ 4G50A 1RF2D 4WJWA 5M5WH 3PPAA 3FPPA 4HKQA 4CJ2C 4YY3L 3RNGC 4GXBA 1Q1EA 5A35A 1LQBA 1JWMD 1KOTA 1I50H 1HNZL 3R2TA 2R92G 1VZ7A 2D2QA 1KABA 2Y3AA 4A3GB 2PPBC 4A3MH 3H7PA 3AE7B 1QF6A 5D3DA 5C3EB 4JV5L 1MSHA 2AQ2B 2W3RA 2X38A 3AECB 4HJKA 4MIUA 1Y1WH 2Q8IB 4A3IH 4BBNF 2C5CA 1WFYA 1WI0A 3S17H 1A62A 5ELFA 3PUWA 4XQNA 2K6QA 3GTGB 4DR2Q 2CU1A 4XX5A 3HOXH 4JG2A 3MEFA 3ZJTA 1IYFA 3U9SA 4F1SA 4AJYB 1TKWB 1A2TA 3AU5A 4N8X1 4BA1I 3KWLA 4J8QA 2K52A 3D6WA 1NI3A 4L1BA 3DEPA 4XT3B 5KNBA 1PH7A 2GI9A 1GB4A 1PH3A 1HNXQ 4OZBA 5FO7B 4GLVB 5GADC 4LFAL 2W82A 4KHPQ 2BDNA 4HK2A 2KK8A 3MC0B 3H91A 1V97A 3D3RA 3NZUA 1EYDA 2BKFA 2G9HD 5M5XB 4A93G 2HDLA 1KLVA 3FMCA 4DR1L 1EUJA 3FILA 4S0RA 1YVCA 3HOVB 2V3SA 2A68D 4N8FA 2YVCA 4HMJA 2F3VA 5J18A 3PGZA 1XMQQ 3CRKC 3MAQA 4DUZL 4MACA 4FADA 4ID6A 2DZKA 3W5OA 3KBGA 1TR5A 5C44B 4FLHA 2D10A 1X55A 2NVTH 4A8XC 4M1UB 4EX5A 4J1MA 3RNFC 1ZE3D 1D5XC 4KD4A 5K36G 4AWJA 1B9MA 1B2TA 2HIXA 4NP5A 2UXCQ 2A5HA 4S3SA 1V2YA 2WXHA 1HUNA 3MC9A 2UXDL 1EOTA 2WB1B 4JI3Q 1X3PA 3K6OA 4P71A 5C4XG 1VR9A 2IDYA 4JBMA 1YNNC
chains in the Genus database with same CATH topology
2A6EC 2PVOD 4NAWB 3GTJB 4KN4C 3FPUB 5EBDA 5T1GA 1SYGA 4DK1A 3KWVA 1PDQA 3H3VC 4KY6A 1E2VA 3QB3A 5HI1A 4AQ7A 1EWYC 1TKYA 1PZKD 2WP9B 2E76C 1M4VA 4NW2A 2WU5B 4USAA 3EQLC 1Y8PB 1R9TB 4XIGS 5JVG3 2B2WA 5CV4A 2R93B 3EGRA 2E2IB 2XVSA 1T3QA 1QE6A 3MVVA 2AWNA 1J9OA 1NCVA 1ZYRC 1TY2A 3SR1A 1SB3C 2INNE 2XSCA 3KLRA 2SDFA 5D14A 3SK6A 2BYTA 5HURA 2BT6A 4H13C 2AWOA 3GTQB 3GTOB 1YNND 2K28A 1PTOF 1JWSD 2EOTA 2RVLA 5LL6S 1ZDVA 4IUTA 4B0EA 3B2FA 4LLGM 3T3OA 3MXNA 1F2MA 3L7ZC 1DCZA 5JVH3 5A2QE 4MHEA 3K59A 1KF6B 3AE5B 1EU4A 1JWAD 4H44C 3OOCA 3E6ZX 4N58A 5FKAC 3C1EA 2L9HA 4KMUC 4K8JA 3U2SC 4FO2A 3DWGC 4FXKC 2YU9B 4N9TA 4DGZA 1ONLA 1QT9A 2IX3A 1K50A 1EM7A 2DNCA 4PNYA 1GOZA 3I4LA 4C3HG 4IUNA 3D4RA 4K6DA 2CVRA 3PZ7A 2IT1A 2WKDA 5CMDA 5E4WC 5H92C 1ET9A 4U673 3MZ5A 3KLSA 3Q8CA 2KCCA 1CZGA 2L11A 3AMUA 1SAPA 2PW9A 2E3TA 2EVBA 4AS1A 3NUCA 1OQQA 1NAPA 5CV8A 5EGTA 4TQ0A 1FNWA 1VJKA 1C9FA 5ELCA 2JQRB 4ARIA 2LJIA 3OWEB 4P6VF 1DOYA 2NMQA 2K3UA 3S14B 4N6EB 3E0JA 1EY5A 5C3WA 2WXPA 1PZJD 2HQEA 3AE2B 3EUB2 3BDCA 1I4HA 2ZXOA 2F0QA 4Q2JA 3GTMB 2B2UC 4EE2A 3IAM1 2V0GA 2WS3B 2L12A 4XQQA 1STAA 4HMIA 4IALA 1DXMA 1PFMA 1C79A 3NUHB 3S17B 2NYZD 3NVYA 4A3EB 1STGA 1F77A 5IODA 3NZ3A 1SIJA 2Y0SB 2NVXB 1PDXA 4HROA 3P4QB 1AZPA 4K14A 4GLSC 1F9SA 4ABNA 3S1QB 4KHZA 1OXTA 4RHRA 1YJIA 1PGAA 4MH8A 1SXTA 4G7OC 1ZP0B 1O7ZA 1HFNA 3I4NB 2JZPA 1S4ZA 2H4OA 3EVQA 1SE2A 4EQOA 5I2YA 4O1NA 4Q5VA 4HEA1 3DEOA 4REZA 2E2JB 1SEBD 5BYRA 2RDHA 1J7BA 5AFWA 4RH6A 2I38A 1LABA 4P2CB 2PMVA 1RD9D 4IFDH 1WD1A 2F0IA 4IUQA 3IFDA 5JPNC 1BCPD 2F0KA 3NBHA 3A8KE 3AH7A 5C3JB 2F0FA 5IGCA 3G6JB 4HN7A 2Q5WD 4A3IB 3DWMA 3W1SA 4L2YA 1JOQA 4OZCA 5I2XA 1XYIA 4QCLA 3A56A 4IUUA 1HFGA 3J7YW 1U9RA 1AZQA 1JCKB 4NMZA 4TQUS 2V4IB 4YSYB 5CV9A 1LT5D 1QILA 3MJ5A 1MBYA 2IGHA 1ZXIA 2V4DA 3NRZA 5J22A 1K51A 2O4XA 3OSOA 3B9JA 5KYIA 2KN4A 4XYOA 3M85A 1D1IA 1S5DD 2RPVA 1CFMA 1N63A 3QWNA 2RA4A 2PQEA 4KKUA 2EYHA 3A8JE 3VR4A 1WTQA 4XT1B 1YN5A 4DNRB 2JA5B 3FVQA 2B2UA 2X6GA 3I4MB 1ROEA 5AUKA 1KLUD 2IJ0A 1TQOA 2HDMA 5C5LA 2NN6H 2PTLA 1DJRD 3KQ4A 1NUCA 3VR6A 3GS2A 3AN1A 4RFBA 1WD0A 3UI3A 2NVYB 1ZYRD 5C5MA 1AWDA 5HGTA 4F7XA 5IGBA 1S5ED 4HEDA 1SNPA 1OXVA 1V8CA 1LT6D 2PMZB 2D5GA 3Q24A 2IWHA 2IX1A 4UDUC 3A54A 1Q10A 3T51B 5DNFA 3S1MB 3TP5A 1FRDA 4KY7A 3BYYB 1I7HA 2LHDA 4M0WA 4Q0FA 1KNAA 5T8IA 4MM3B 1YJJA 1PYWD 2J7ZA 2JEBI 2M2LA 4HTHA 3HOUB 4KGRA 1EWHA 1LTGD 2ZW1A 1GUTA 1WTWA 4NJCA 3I72A 4OZAA 2GB1A 3SE0A 2CJOA 4A3BB 3D4DA 3BIID 4IKGA 3NTHA 3VYUA 4XYQA 1FGBD 1TKEA 2XRQD 2L55A 2WXLA 3FC4A 1BDOA 1HQMC 4HSVA 1CT1D 3D31A 1F9RA 4QIWB 3RZOB 1ESRA 2IW3A 3GTKB 2EY5A 1ILQA 4TSSA 4BA2I 2F0HA 1YN4A 3M7NA 1G2SA 1KNEA 5IOCA 2EJGC 2FMCA 5IGEA 1T6BX 3SHLA 1UWMA 3LB8C 1HHVA 2AUJD 3HRZC 2K01A 1II3A 2EYFA 3GV6A 3A55A 2EYMA 5J1ZA 2B39A 2EJMA 1I6HB 3W5UB 5G5HA 1EQVA 2K22A 1Q12A 3VR2A 1N5WA 4HJGE 2D9UA 2LKVA 1S5FD 4YT0B 5ISRA 1MSGA 5JOBA 2K04A 1A3TA 1LO5D 1SNCA 2B2TC 3CWIA 3AEDB 5EKIA 2K0PA 3M3YB 4ODGA 3L9AX 3K5NA 4RHSA 1DYQA 4RF0A 1EQTA 4JPSA 5KYLA 3BVGA 1ZPSA 1AP0A 4XE0A 2KQ4X 4CQNA 2ZXRA 3R2IA 4IURA 1L0YB 1FR3A 2EE1A 4KTAA 4UAIA 1C48A 2BE5C 3OWFA 1JOKA 4RGTA 1EL0A 2E74C 3AE6B 1NR4A 3RLFA 1SYBA 4FNFA 1FMAD 1V8QA 3C8YA 2CJNA 4OL7A 1B1ZA 1A70A 3J80E 2M9VA 2J0TD 1SE3A 1EY4A 3WOFA 4ITKA 4YSZB 3HOXB 3OHXC 4CJ1B 1L6UA 1HA6A 3LYYA 4WFN3 2N55A 2JEAI 1PRTB 5BYQA 3MXGA 3KF8A 2YEPB 1AYFA 5G3LF 1LT4D 4JX1C 1D5ZC 4KJNA 4LMQD 4QB4A 3AMZA 1DGJA 3S2DB 4Y7NB 4FVMA 4TKOB 2CU3A 4AYBB 1DOXA 1FD6A 1ILPA 1YNTE 3C46A 3X3NA 1AEXA 1BO0A 2AQ3B 1GJXA 2BBCA 2MHVA 2TMPA 2N9KA 4QF4A 4U68A 5C4XB 3L4PA 3VA7A 2KDMA 2GRIA 2FINB 5FO8B 4R9WA 4OO1I 2Z8LA 3HKZB 3NTIA 3NPPA 3TBIB 2Z1CA 4OHJA 2Q8TA 3FAHA 1GUNA 4FP5D 1TWCB 4C3JG 2IX0A 2WQYB 1SDFA 5CV5A 4FXGC 5EPLA 5DM63 4DA2A 2KHSA 3ZGZA 1YNJC 3A8IE 4C1NI 3QJYA 1QB5D 4IOIE 2PZWA 5EKKA 4ARCA 2DWQA 2WXRA 2DNEA 1C4QA 3BDLA 2PLPA 4FF4A 2I46A 2WLBA 2WDQB 4C2MB 2V3PA 4IDIA 1JICA 2J4XA 3PO3B 4IZ8A 5EE0A 4J3OD 2A74C 3AB5A 3H09A 1G6ZA 1MHXA 4C1NK 4NAMA 1VLBA 3FRPB 2PNRC 1DOKA 5LL6X 1C77A 2O5IC 1UUPA 3OIPA 2VUMB 1PRTC 3DWPA 1QNUA 3SFDB 3FDTA 3NQIA 1SYCA 4DAPA 3RMHA 4A90A 1OXSC 3J7AV 3TEYA 1WTXA 1PTOC 4RKBA 1U4MA 1BBXC 5IGGA 3I8ZA 3SR6A 3W9CB 1C4CA 2F0NA 3CKIB 2WAQB 2IL8A 1UWXA 3HRDD 4B9WA 3QO2A 3I90A 1E2ZA 3S1RB 1LTSD 4ZLTF 1FM0D 3NHHA 1Q3LA 1GB1A 3EFXD 3ZYYX 2NVQB 2F0DA 2JSOA 2MGSA 3CQZB 4OIJA 3J81E 4DU9A 1TZOA 3A7AB 4DAVA 4WORA 3M4OB 1GUWA 1Y56A 1HCZA 2PKOA 1T5XD 4A55A 3P20A 1FO4A 5HG2A 2WNMA 1XWEA 5D3IB 3VR5A 1RYJA 1RCVD 2JE6I 4BBSB 2DYMA 2WXOA 3MWYW 3IXSA 5G3LD 4JBWA 3I3CA 5M9OA 2B2VA 1EIGA 1P7EA 1RKNA 1LLRD 5I6YA 2E2HB 2MJEA 5KNCA 1WTVA 1BR9A 1HA5A 5FLXL 1JMLA 3GQBA 3CRLC 2TSSA 1NEKB 2QSDA 2NWGA 4CGYB 4ZRQA 1ML0D 2K05A 2NUCA 2Z4HA 5M3MB 2WXJA 1LACA 5KNDA 3AEBB 1DONA 4DF7A 2K32A 1EEID 5CC4A 2FHTA 3N9YC 2A69C 5H8YE 1JB3A 3TSSA 1FRRA 1N60A 1A3VA 3F2UA 2ONQA 1D1KA 5LNK1 4IFDI 5CBEE 2MJ8A 2V3NA 1EWCA 2XIWA 4C3IG 1JC7A 2NBFA 4K5XA 2B2WC 4LTUA 1CZPA 3R93A 3RD4A 4X3TA 4DQOC 1XLQA 5EE3A 2DLBA 2JX5A 4ILWA 3IAYA 2SNSA 3Q8EA 4OW0A 4PV1C 4Z9CB 1QOHA 4XWWA 1I4RA 2EYLA 1QCBD 1SBBB 4WWMA 1PUTA 3JAML 1QJOA 3J81L 2BS2B 4WQMA 1XLOA 4YTPB 5KGUA 1HUMA 1FNVA 3MHBA 2DYOA 1QG7A 3H94A 2AUKA 1YMHE 4K8IA 2EYJA 1X32A 1ZEQX 3DHQA 3QOJA 3HP3A 3R8BA 4A3KB 3IT4B 1ENCA 1NSNS 4BBRB 1EYAA 1F2ZA 1U4PA 5M3FB 1SJHD 1IW7C 5ELEA 2H88B 4K2LA 4HSPA 2OXPA 2EZVA 1RDPD 1IL8A 4PMWA 2E6XA 1VMCA 3FEWX 3R3OA 2YEPF 4HCSA 3X3MA 2L4NA 4G7HC 4EVOA 4RA8A 1S5BD 2F4IA 3ETRA 2B8GA 3PMFA 1G291 3TZUA 1STYA 3PIO3 3T13A 3BG3A 2K03A 5C0XG 1HTPA 1MD2D 1UNSA 2OHFA 4WIPA 4G57A 5C4ZA 1NYRA 3VYTA 1OFFA 1JQ4A 2OEOA 2LFNA 1FXAA 2Y5CA 3AU7A 2KMMA 2B2TA 1ZUD2 2HUGA 1F2RC 3AEAB 4TRDA 1ICWA 1D4BA 2VNUD 1ESFA 1VF7A 1B9RA 3EA6A 3I9V1 3T16A 1OXUA 3GP7A 1T5EA 1PTOD 2D62A 1KAAA 1KDAA 1CJEA 2WXFA 5GXGB 5BN3A 3MTSA 3U9OA 2R61A 1PFBA 3J80L 2C9OA 4LK1C 4BY1B 3EROA 3M7GA 4KGTA 2PW5A 1SYDA 1TS3A 1J7CA 3DUZA 1SE4A 2EXZA 4RNAA 2WU2B 5DM73 4PMBA 5JAVA 2JA8B 1PFDA 2G1EA 1K53A 4G7ZC 1QLBB 2HCIA 4ZRPA 4A6QA 3DM1A 3AEFB 1WCMB 2ZXPA 3LX0A 4N9PA 2IGDA 1CHPD 3K5LA 4H2AA 3HG9A 1PZID 3IT6B 3UI2A 4L8JA 3E5SA 1Q8IA 4C56C 3D8GA 2F0LA 1Z7TA 3MP9A 4OIKA 4JWUC 1U4LA 4K2KA 2DY8A 3W2DA 4ZQ3A 2K7VA 2FE8A 3LNNA 5EJWA 5EE9A 3VR8B 1C8CA 1BUVT 2W55A 5E3FA 4A9AA 1IGDA 1WGKA 3C2PA 1GUOA 1LTTD 5IGDA 5E1FA 4IFDG 3DMUA 2B63B 4WH4A 4JK1C 3TP8A 1XXGA 2INPE 1TT2A 2RKSA 1BCPB 1IUEA 3AEEB 1TWHB 1ZOYB 4BWGB 4CJ0B 3N6RA 2JSVX 3BVMA 2MP1A 5JEAJ 1HPCA 1RM6C 1EY9A 2YYZA 2EJFC 1V1PA 2EYPA 2FJ2A 2QEJC 1I4PA 1STEA 1G2TA 1BQQT 1DOIA 5CYUA 1TWGB 1MGSA 4RCNA 1SNMA 2KECA 2KA7A 2F0TA 3TEZA 4R8NA 3H6MA 3ND8A 4B08A 1EFID 1Q90A 2WXIA 5FLXE 3NVVA 3HUIA 2F0OA 3P1HA 1VDZA 3PUZA 3U52E 5CR3A 5M5WB 1IKLA 1WWTA 5KIXA 3P1MA 4V190 3HGBA 4XQJA 4H0LC 4I7ZC 4MN3A 4A93B 3P4PB 4FYDA 1JRPA 1EEFD 2N7JA 1CQFA 4X3SA 1UAPA 3CIRB 1Q1BA 2WIIB 4B0MA 1UEAB 2LFIA 1I6VC 3BDOA 1R4QB 1K8MA 1IW7D 5TSSA 3TP6A 1BMLC 2NN6I 2H1EA 2X6LA 1RHPA 1C78A 2BS3B 1L4DB 2WP8J 1TS4A 2PZTA 1F2LA 2I07B 3TEWA 2X69A 4C3JB 5J39A 2LY7A 3IAS1 2B2YA 1E10A 2JYOA 3HOWB 3MXPA 4US8A 1PTOB 1V1OA 1SMYC 2ICIA 2A6HC 5ELBA 1VDVA 1H9JA 3NBIA 3E56A 3NK9A 1E0BA 1KDBA 2F0EA 1B9NA 1L6VA 3AE8B 5I9PA 1VRAB 4ZKCB 3J7AF 1G8ZD 2F0GA 3SXHA 1DZ1A 2EDGA 1J7AA 2R6GA 2KEEA 1VMPA 1A3UA 1PLFA 1AN8A 2WXMA 1YQ3B 1Y1VB 3VYRA 2QDBA 4IUPA 1QOFA 1XLPA 5IIFA 4FF3A 2XNAC 2J52A 1A15A 3VR3A 2EY1A 3GV3A 1X3QA 4NZLB 2IGGA 1LTAD 2RDFA 1B53A 2CQAA 2K5PA 3Q0AA 1DD2A 1WTPA 3PUVA 4XXEA 1V43A 2QCPX 5KEEA 1Y69U 1FCLA 1RWSA 1Z47A 2AX5A 4ZAIA 2E2DC 2N88A 3NSWA 2WXNA 4C3IB 2DBYA 4G4KA 1CI3M 1L0XB 3T56B 2A6ED 2N0SB 5EPKA 2MEKA 3ND9A 4YTNB 1BCPF 1MI2A 2L52A 2RSOA 3OW7A 4DAYA 2QKIC 1IYUA 2XN9C 1B4OA 5IGFA 3W3AA 1SF0A 3IL8A 3HVDA 4KI0A 3P63A 4YTMB 1GHJA 2B2YC 2KUMA 3GTPB 1A2UA 5A2QL 3RUZA 1J8IA 1H9MA 4CHTB 4DN4M 3AB9A 3RFZB 1G91A 2EPBA 1NVID 1B50A 4L6TB 3P4SB 1U4RA 3WCQA 4TMAB 4IFDJ 3TEXA 2L0CA 5JPMC 4KY5A 4HR7B 5HFYA 2JA6B 2BCOA 3SEBA 2SNMA 2M0AA 4WRDA 2KAJA 4RF1A 1JROA 2KEDA 1TVXA 4O42A 1C4AA 1F9PA 1Z6HA 5BMIA 1E6EB 5BMHA 1PRTF 3P7JA 3T4AC 5JEAH 1BXTA 1FYCA 1SSNA 3TZDA 2F0VA 2QILA 4F8MA 2WXGA 3N52A 2B76B 3D6CA 4DK0A 1BOSA 2BA0A 3P75A 3S2HB 1W6KA 5EKLA 5EPJA 2WDVB 4WAFA 1BCPC 1KDCA 1WYGA 2H89B 2ZT9C 1F2YA 4M8AA 4FF1A 1XCQL 2J53A 4B9XA 4HKZE 3VRAB 4H7BA 1NR2A 4XTCS 1RJTA 4PQXA 4KKIA 2M56B 1STBA 1K52A 3PO2B 1E7PB 3I91A 1KRHA 5FK9C 4QUFA 1MVKA 3HS0C 4R3DA 2LUMA 5NUCA 1RODA 2B8FA 2B2VC 3TP7A 4OO1H 1NENB 1O7YA 1SJED 2HDEA 1B3AA 1JR0D 5D65A 4V0BA 5I9OA 2K5DA 5FOBB 4US9A 4C7YA 4XWTA 1PMRA 4A3DB 4OVZA 1Y8OB 3V96A 4IQZA 4IN3A 2L1AA 4KKSA 4ME5A 4F88A 2BB5A 4YIJA 1I3QB 2OEDA 1SYFA 4K6LA 2F03A 2M19A 2F0MA 2KVMA 3JAME 3B2GA 1AW7A 4KKJA 3TMEA 4GDLB 5C0XI 1K83B 1TJEA 2FUG1 2EKIA 2EELA 3LXFA 1FFVA 4X3UA 5E4XA 3S1NB 1LTBD 1KH0A 5COYA 1ZXTA 3Q69A 1SMYD 3I70A 2MPMA 3RZDB 2QMTA 2PCFB 2BTEA 1N62A 1F2RI 2PIAA 3K0YA 4RCOA 3SK8A 2QF7A 3NWSA 1HEZE 1EY8A 2VXWA 3TDQA 3T3NA 3K5OA 1JWBD 3U7ZA 2PW7A 2L1BA 1EY6A 1TWFB 3U4EG 1ENAA 2A73B 3J9CA 1JE4A 4HRSA 5E6JA 2JWUA 2EYOA 4X3KA 3LWUA 3E9SA 1PXUA 1SNDA 5BN5A 2GA4B 1R4PB 2BOSA 5FR3A 2JA7B 2FFKB 3P4RB 1CZWA 1STNA 1SSOA 1TKGA 4CBVA 4KGSA 2CHBD 3Q23A 4L63B 5T1IA 1PGXA 1QOAA 3HEJA 4KKTA 2JYEA 1XX8A 1LTRD 1F9QA 4ZUIA 4CKCA 4DNTB 3AE4B 3ERQA 1TS2A 2LGIA 2BE5D 2K5QA 1GUSA 3C1FA 1VCIA 4J6HA 2RMMA 3BZDB 1JWUD 3K7AB 3I73A 4PMCA 1SNOA 4K5WA 2F3WA 1VZ6A 1VZ8A 4PT5A 2F0WA 1PRTD 3MXUA 3IKJA 3V2TA 5K36H 3RPFC 4ULLA 1EYCA 5KRUA 1D6EC 2LS01 3BWUD 1RFKA 4E6IA 3S16B 2L5TA 1WXQA 2QJLA 1HRJA 3BK2A 1CK1A 1VF5C 2WV6D 1H9SB 3MFGA 1IGCA 5JJZA 2IPKD 5BMGA 1I4GA 3NP8A 4LAAA 5BYSA 4HCEA 3HVZA 2PO4A 4DXFA 4GDKB 1FIQA 1RTNA 1L0VB 4TQ1A 2K33A 4IUVA 1GUGA 4RWSC 1OXXK 2NB0A 3LWEA 1QKZA 1TS5A 2OT2A 3HOYB 2VZKD 1CA6A 2DY7A 3AM9A 4BY7B 4YWGG 3VA5A 4KD3A 2R7ZB 3GB1A 3H0GB 4ZYSA 3KK7A 2JXMB 1I4XA 2L83A 1DOLA 1HZ5A 1JALA 4NKLA 2MUYA 4LJZC 2K9XA 4YXDB 2ID0A 3VR9B 2DN8A 3PUYA 1LTID 1W6JA 1I4QA 4WURA 3DWQA 3GD7A 3SK5A 1C4PA 1YQ4B 1V1PB 2SAKA 4JE3B 1QQRA 3AE9B 3W5VB 3AE3B 5AUIA 1E0ZA 4ZKBB 1QOBA 2AQ1B 2Y5PA 2KCNA 3G7LA 3VQIA 4OO1G 2NN6G 4KJOA 1FD7D 4RGOS 2F0JA 3IFTA 4A3MB 2NTSA 1WTOA 1KTKA 1K8OA 2ENBA 1XF5L 4EGVA 2BS4B 3L3OC 2WXQA 1FNUA 4QMGA 1QNKA 1LV9A 4C80A 4ZOHC 3S9WA 1S5CD 5LHY1 2SOBA 3ZJVA 5F2DA 1DM0B 4KK7A 3ITPA 4D2KA 3BK1A 2VZKB 2HCCA 3I57A 3NE5B 4FXDA 3K58A 2KOLA 1FCCC 1XEEA 3HZXA 1EZ8A 1BNZA 1TY0A 4ZHOA 1SNQA 2XRSD 4EQPA 2JYTA 1KFYB 3KUPA 3SVMA 1AFPA 1TYGB 4DXGA 3HOZB 4FF2A 3OPOA 3VYSA 1PGBA 2BA1A 4P16A 4KHVA 5CGKA 2ACZB 2LMCB 4LK0M 5MPOA 1GXDC 4OGQC 4A3JB 2ZW0A 5CV7A 5DEHA 3H8HA 3MA2B 4RGNA 2O5JC 2PVGC 1EY7A 1M8AA 4CKEA 1CM9A 3NS1A 3V3XA 4JWSC 1TIID 2JP1A 2ON8A 2L32A 2HTME 2WKCA 2MJ3A 2VB2X 4ZRZA 4GZYC 1F0ZA 2K1BA 2K5WA 1EY0A 3Q8BA 1D2BA 4FXCA 5I6WA 3OMGA 2K6AA 2SEBD 3AEGB 5FO9B 2G9DA 2KWDA 5CORA 3Q8FA 1ACCA 1IKMA 3URYA 2XWBB 1ZDXA 1CTMA 2J42A 1Y1WB 1IHZA 1OO9B 3AE1B 1D5MC 1SYEA 3CU7A 2MJDA 2NTTA 2WDRB 4C3HB 3NTKA 1IBXB 1E9MA 1STHA 5EQ0A 1JQYD 1WSPA 2W54A 5HHDG 4YSXB 2Q8RE 4NDXA 1ZXHA 2RBMA 1WTRA 1CQVA 1H9RA 1ET6A 2XWJB 2O2LD 3OIQA 1B44D 1YNJD 5K5PA 4HAEA 3PV0A 1TU2B 1JOOA 3BYTB 3SK4A 2R3ZA 5C2TB 2EY2A 2I2YA 2A68C 3O13A 3TN2A 1ENFA 2RDGA 3PUXA 2OF1A 2F0SA 1I50B 2F0UA 4BS9A 5G5GA 3CHBD 5D7GA 2F0PA 4R8IA 1XTCD 1NYQA 3VRBB 3EJIA 1H9KA 4MT5A 1HTLD 3V05A 5M5YB 1N61A 1MPEA 4F87A 3QIAA 2WINB 3C3LA 2NVTB 5EBCA 3PO0A 1DOMA 5ELDA 4KN7C 5IT9E 5C0XJ 4ZHPA 1XCTL 3DWAA 3K57A 1MHHE 3KLSX 3T53B 4CKBA 5C3XA 1BF4A 5IT9L 2MH7A 2D2CC 5C4HA 1H9SA 4XDXA 1RTOA 1TWAB 3NVWA 3ZJUA 3Q8AA 1XO3A 2BW2A 1L4ZB 1SFOB 2JU6X 1IYVA 1HQRD 3TUOA 2RSNA 2PZUA 1MI0A 2CW0D 5I4DA 2D5DA 3GO5A 3FILB 1LT3D 2LEKA 3NWTA 3S15B 1O80A 2ICEC 4A3FB 5CBAE 3BVZA 1JORA 1EZ6A 4XDDA 5C4JB 1GHKA 5EE1A 2BB6A 3SFEB 3M4YA 4KX6B 3K5MA 2KJXA 4I65A 1GPXA 2NZ1D 3KBXA 1PFNA 1XLNA 1HXYD 5BN4A 1N5XA 3MEHA 1QWYA 1O78A 4RAUC 1GAQB 2Z4IA 3Q6SA 1E2WA 1OQRA 4RGMA 1CA5A 1KLGD 3DXJC 5DAUA 3WOEA 2N9LA 4N59A 1R7SA 3MHZA 1FEHA 3WDNA 2WXKA 3P42A 3NVZA 2F1MA 3FKIB 3ONAB 2CW0C 4XDCA 1EIHA 1EU3A 2JXTA 3PIP3 2LMCA 2LHEA 3PZ8A 3SDZA 1PTOH 1A6XA 2VB3X 3A7LA 4KV6A 4ZK9B 4C7ZA 1WVLA 3NXWA 3Q22A 1BUIC 2WACA 2QIEB 1ZKOA 1FFUA 3ZQ4A 2KQ3A 3GTLB 2BDOA 2W3SA 1WRIA 3BS1A 2A69D 2RQXA 2FMMA 4QUCA 1IBXA 2PYKA 1O7LA 1L5PA 4L23A 4EQNA 4RKLA 5CV6A 1JW9D 2KACA 1CHQD 3QG1A 1HZ6A 1C76A 1YN3A 4ZUJA 2E75C 3MFYA 3D4WA 5JXVA 3OMCA 1P7FA 2FBWB 2R92B 5C6AA 3AV8A 2EY6A 2M00A 5JEAG 3NQTA 4K5VA 3QOLA 1QOGA 1UGJA 3ABVB 1Y8NB 4DFAA 1FXIA 2A6HD 1RF2D 4WJWA 3FPPA 4HKQA 4CJ2C 1Q1EA 5A35A 1JWMD 3R2TA 1VZ7A 1KABA 2Y3AA 4A3GB 2PPBC 1QF6A 3AE7B 5D3DA 5C3EB 2W3RA 1MSHA 2AQ2B