1K53A

Monomeric protein l b1 domain with a g15a mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
b'MHHHHHHAMEEVTIKANLIFANASTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k53A00
1C9FA 2J52A 2I38A 4HKZE 5BMHA 1IBXA 2PW9A 2ON8A 2LHDA 4GLSC 5BMGA 4MACA 2J53A 2EELA 1MHXA 5HHDG 2JU6X 1MPEA 1PGAA 5HI1A 1MI0A 5HFYA 4IOIE 1GB1A 1JMLA 2PTLA 2KDMA 2RMMA 1PGXA 2RPVA 2ZW1A 3UI3A 1MVKA 1D4BA 1K52A 1YNTE 1KH0A 1F2RI 2IGGA 1GB4A 1HEZE 1ZXHA 2KWDA 2LUMA 5HG2A 2N9KA 1UWXA 2JSVX 3MP9A 1F2RC 1MHHE 1P7FA 2KQ4X 4D2KA 1FCCC 4IKGA 1PGBA 1IGDA 3GB1A 2JZPA 2I2YA 5JXVA 1K51A 2KACA 2K0PA 1IGCA 2N7JA 2QSDA 1YMHE 1XCQL 4KGRA 2N9LA 1XCTL 1XF5L 1HZ6A 5BMIA 2ONQA 1Q10A 1EM7A 2KN4A 1IBXB 2PLPA 4OZAA 3V3XA 4WH4A 4OZCA 1K50A 2NMQA 4OZBA 2IGDA 4HJGE 2GI9A 1QKZA 1P7EA 4KGSA 2IGHA 1FCLA 4KGTA 2QMTA 2ZW0A 3FILB 1K53A 1FD6A 1HZ5A 2JXTA 2JWUA 2OEDA 2GB1A 2LHEA 3FILA 2LGIA
chains in the Genus database with same CATH superfamily
3NVWA 3AEBB 3Q8EA 5IN7A 2G9HD 2DWQA 4K81A 2L8JA 1E0ZA 3AE6B 3R8BA 4M0WA 2Y5CA 3SU8X 1EF5A 1D5XC 2FIFA 5D7GA 1TJEA 1XLOA 3TEXA 1JALA 4MJSA 3C8YA 1ZKHA 1XT9B 2K9XA 3VQIA 1ESFA 2LZ6A 3JW0X 4TKNA 5HKHA 3Q6BA 5DCNA 3QQ8B 3V05A 2KWDA 4P1CC 1SE3A 3K9PB 3UINB 3ZRFA 1FEHA 1D6EC 2VRRB 1R7SA 4JE3B 3KUDB 1F0ZA 2BTEA 4LLGM 4W9HA 3NZSA 3A33B 5IKCM 1XO3A 4EFOA 4HLEA 4US8A 1RFKA 2Z59B 1IUEA 4E3CA 2WXLA 1WMHB 1NI3A 5AZGA 4PYZA 1C1YB 4P1BC 1SSNA 3R2TA 1C4CA 4GU2A 1GAQB 1ENFA 1JQ4A 1SE4A 3CSFA 4ZRQA 1UD7A 2NCNA 3APCA 4ZHPA 4P16A 1J8CA 1B1ZA 2HDEA 2CHZA 3U52E 2ZNVB 4NPNA 2OEDA 2AQ1B 2XK5A 2V9HA 4EZJA 3W1YA 3PZ8A 4AS1A 2KVRA 3TBLD 4A90A 1FNUA 1UGMA 3QJZA 1SJED 4HKZE 3AN1A 2N9EB 4ARIA 3CSTA 2AYOB 2LJ5A 4KV2A 3EA6A 2KDFB 5D2MB 1ZP0B 2ZPYA 3AE9B 3TIXA 1WYGA 5EE3A 1GB1A 5AZHA 3CWIA 3PZDA 3ONSA 4HRSA 1Z2MA 1R4MB 2J0JA 1WWTA 2BVCA 3N9YC 1D3ZA 2L00B 3KYCD 1MG4A 3V6EB 3EFUA 2ZCBA 2V4IB 3WAMA 1SE2A 3Q14C 3VRAB 4D2KA 2L7RA 1TYGB 1BT0A 3ABVB 2K8BA 3R7RA 1NYQA 2MP2A 3N20C 1HA5A 3MC0B 1M94A 3PRZA 2HJ8A 5FK9C 2WLBA 2N9XA 1GUAB 2ONQA 4KSKC 1Q10A 2K6QA 2D3AA 1RLFA 3WAPA 2PE6B 4HKQA 3RCZA 3H7SA 1KLVA 1P9DU 3CF6E 4NZLB 1FXTB 1PYWD 2YVCA 4BBNF 2MQJA 4NJ7A 1TT5B 2JXTA 5G55A 3MTNB 2AQ2B 1WZ0A 4OW0A 5CTRC 2XN9C 3NVYA 5KHQA 2LGIA 2H88B 4BOZB 2RDGA 3Q3JA 3RZWC 1PUTA 4NQKE 2WXOA 4II3B 3LYYA 2CJOA 2PW9A 2IO0B 2LGXA 3WCQA 4E74A 1XLPA 3VHTC 1KTKA 4HROA 3ZIMA 1T6BX 3AU5A 3AMZA 1GC7A 3VTVA 1WGDA 4K1RB 2WQYB 2L32A 2VZKB 1WJUA 3DBHI 4EEWA 3GP7A 3KUCB 4HEA1 3Q8BA 3H8HA 1KH0A 2RDBC 2N7DA 3PPAA 2R61A 2K1FA 4RM9A 3HRDD 3BYTB 2FNJB 2RDHA 3DWMA 4WIPA 3L13A 4UDUC 1SEBD 1VZ6A 4RGTA 4B95A 3L08A 4Q2JA 2KAJA 1N60A 1JWAD 4URKA 3J9CA 4XDCA 3JSVB 4AJWA 2NVUI 2M8SA 4MELA 4W9FA 4KGRA 1FFUA 4GDLA 5C1ZA 5BYSA 2NPTB 4KSLC 4EZLA 1GPXA 4DDGD 1S3SG 1OTRB 1JRUA 2XEWA 3VUXA 3ZXRA 1IBXB 4OZAA 2INDC 3V3XA 5H92C 3ZKJC 1C4AA 4L2YA 4HPPA 2YEPF 1AARA 3APDA 1T5XD 1L7YA 3M3JA 2W9NA 5IAAC 3FILB 2BW2A 2WXMA 1FRDA 4EUTA 2JWUA 4FLHA 4ZRJA 2GB1A 4ZRIA 4ZRPA 3OWEB 4RMAA 2LD9A 2LXCA 4LNIA 1ZDVA 1YX5B 3NOBA 3WA0A 3W2DA 3QCAA 4KIKA 4IW0A 5BMHA 1ZE3D 4NY0A 1E8ZA 4C4VB 3JYUA 2W3SA 2BB6A 2DBYA 3H1UA 4GLSC 5EE1A 1TS5A 4MSMB 1C3TA 1MHXA 4G50A 2FCSA 4YSZB 4FA6A 1I4GA 3A4RA 2W55A 2G4SA 2EMSA 4IOIE 2DZMA 2PKOA 2W82A 4B0MA 1VZ8A 4OVVA 2KYWA 2QIEB 1I7HA 3SD5A 2DZKA 2KMMA 3EC8A 5AUKA 1L5PA 4E71A 2JSVX 1FNWA 5IO9A 2JPHA 1VLBA 2LGYA 1EF1A 2KT7A 4MM3B 3O65B 4ANXA 2BGFA 5TSSA 2QCZA 1X1MA 4IKGA 1STEA 4BAXA 2SEBD 3ZNHB 2AWTA 1FO4A 2B3AA 1I4QA 2QDFA 2GBJA 3VAWA 1NYRA 3U2SC 2KX3A 2REXA 3AECB 4MH8A 1V1OA 5AUIA 4BOSC 4X57B 4YWGG 3M63B 2BKFA 2KO3A 4YTNB 4LDTB 4S17A 4ZRKA 4WJQA 4AUQC 1CZPA 1DOXA 2WYQA 4WJPA 1VR9A 3RD2A 4DK5A 4BBNC 2QMTA 4EOYA 2V4LA 2ZW0A 3ZLZA 2FCMA 3C0RB 4PS7A 4JWUC 1L6UA 3E56A 2Q5WD 4G3XB 4KZCA 1NENB 1C9FA 1K8RB 3V61A 1C78A 3ML9A 3KYDD 3PTFC 4AP4C 2GBNA 2NTSA 2KJRA 1HTOA 4RCOA 2JY6A 2K25A 2IBIB 2LRUA 2IO1B 2KC2A 2BKRB 4YT0B 3DVGY 3SEBA 1AN8A 2GBMA 4IDIA 4XX5A 1HE8A 1WR1A 1OGWA 3AV8A 4DHJB 4ANVA 1YNTE 3PGEA 4BKGA 4XWTA 1QZEA 3A9JB 3IAM1 3MP9A 3NVZA 3K9OB 3TSSA 2A4ZA 3ZJUA 2IPKD 3ZYYX 2LFIA 3N1YC 2LUEA 2W54A 2N7JA 2VZKD 3FKYA 5G5HA 3B2FA 3BZDB 3TL5A 1MFWA 4MH0E 3P4PB 4GGQA 2DX5B 2GBKA 1J7CA 1K50A 4JIOU 3H7PB 3I57A 3NJTA 4A3PA 3A9KA 1NBFC 4I6PA 1J19A 1QKZA 3FC4A 3ZGZA 1OQQA 1JWMD 2M56B 1P1AA 4FBJB 4PK1A 3NS1A 1FXAA 1Y8RC 2B76B 3PHXB 1E90A 1HXYD 3VDZA 4CHKA 4AJYB 1L2NA 1VJKA 3I5JC 2D3BA 3V6CB 4EZKA 1F1HA 2OJRA 1FRRA 3VR8B 4W9EA 3LXFA 1N63A 3QA8A 4ZHOA 5HHDG 5HI1A 4OVZA 4EKUA 2HE7A 3MHZA 3RYTA 2RMMA 1N5XA 3ZVVA 1YQBA 2WXPA 3DBSA 2HD5B 2HJ1A 2TSSA 1K52A 1WX9A 2GMIC 3PLVA 1E7PB 4A3OA 4WAFA 1WRDB 2KDIA 3LJ3A 3PRMB 1YIWA 3QARA 2MEKA 3VH4B 4HWIB 2Z0DB 2BYVE 3ZJTA 4DXAB 3B08A 5EDSA 4K7UA 1UUPA 3DHHC 3KWVA 3EUB2 5C3JB 3R2IA 2KANA 2QEJC 1K51A 1GG3A 3NUHB 1JWSD 4DQOC 5DPWA 4KZ0A 4GIVA 1TY2A 2ZJDA 4FJZA 4XGAB 5BMIA 2WHIA 2J0MA 1EM7A 3MJWA 1P98A 1WMHA 1TZ1A 2KFKB 3NS8A 1WJNA 5BO4B 1TS4A 4IM3A 3ALBA 3NVVA 4P7IA 1WJ6A 2CR5A 1CMXB 5DPRA 2CS4A 4KGTA 3DVNU 2FUG1 4JL9A 1HZ5A 2WXGA 1L0XB 1C77A 3DBRI 3ENEA 2K22A 5G2NA 3U4EG 3P2BA 4MDKE 2IDYA 5DPTA 2KWUB 2ZCCA 1WF9A 2J0KA 1UNSA 4LDTD 1V81A 5JHBA 3ZXVA 2M1MA 2BPSA 2MH7A 3W9CB 3GOEA 4LNNA 1V49A 3AEEB 4MEMA 5CHWA 1ZGUB 4ASWC 3Q69A 1I4HA 1MI0A 2KTFA 2JWZA 2FAZA 2MJEA 3H6NA 2ZW1A 3ZTDA 3UI3A 3AEDB 1T0SC 1SIJA 1F2RI 5IP4D 4LNKA 2M17A 4ZDVA 4GXBA 2J4XA 1F2RC 2LVQA 3ZUNA 4K7WA 1WJ4A 2IO3B 3NG0A 3U30A 3VUWA 1OEYJ 1XLQA 1YQ3B 2CU1A 3FAHA 2V1YA 1DOYA 1QILA 2KACA 1WX7A 2XK5B 4W9CA 1NI2A 5LLIA 2J7QB 1S1QB 4ZYSA 3RNBC 4DHJD 2L76A 4HDQA 1I4RA 3HM6X 2WP9B 2MCNB 4WQOB 4K3CA 4RGOS 3TJPA 2LRWA 1SBBB 2ZPNA 4OZCA 1UH6A 4DDID 1UWMA 4HJGE 3QC8B 4C7YA 2A5UA 3BYYB 5IOIA 3GZNI 4KGSA 2N0SB 3BIID 2LWPA 5FKAC 3PVLA 1VZ7A 1Q0WB 2GBRA 3R66C 1T0QC 1QT9A 2LVPA 1E5WA 1WGRA 1WIAA 1TKGA 4JWSC 2SAKA 2J52A 3AM9A 4B0EA 1T3QA 2MW5A 3AXCA 4WWOA 4KKJA 2NR2A 1SB3C 3Q3MC 2G45B 2KMCA 1R4NB 1L6VA 3AE8B 2C7NB 2MP2B 4A55A 3MFGA 3QK0A 3N1ZC 4FADA 3AU4A 1ZOYB 2FBWB 3HM3A 3KQ4A 3BVMA 1PGXA 4A20A 3EECA 4FJVB 3TMPB 2LVOA 3AE3B 2O2VB 4FXCA 1GB4A 5BYRA 2PIAA 2LGDA 3H9DA 1EO6A 1IYFA 3U7DA 1V6EA 2MWSB 2PJHA 2BQQA 2M0XA 3IT6B 3ML8A 1I4XA 2JZPA 4YTPB 5C23A 4PT5A 4QAYA 2K0PA 1IGCA 1RRBA 2N1VA 3P4RB 4J6IA 2G1EA 3I63C 3QWZB 2N9LA 1YOVB 4WWNA 1XCTL 2NBWB 4KVGB 1XF5L 2KHWB 3IT4B 4M02A 4RF0A 1WXVA 5J17A 2WXHA 2OJWA 5J18A 2KC1A 3VTWA 1ROEA 1N5WA 4WH4A 3DBLB 1SXTA 1P0RA 2MBHA 5JZEB 3RNFC 2IY1B 2KMAA 2QHOA 4ACFA 3N32A 2MSED 2ASQA 3D32A 4F7ZA 3IBEA 3FILA 4I6LB 4NQLB 2C5LC 2GLSA 1YX6B 4DXFA 3W1SA 3RULA 1H8CA 4IG7B 2E3TA 2Y5PA 4A8XC 5GMVA 1MG8A 4FHKA 4YL8A 3RUIB 3ZO5B 3MHSD 1RM6C 4LJOB 4GDKB 2D5GA 2UWQA 1UZXB 1HQRD 4C4VA 2JU6X 1JWBD 1WGHA 2Y3AA 4TUUA 5I4DA 3DOWA 3M62B 3ZQ4A 3SFEB 2BS3B 3P42A 1XD3B 2UYZB 1EWCA 3DWGC 1LM8B 4MGKE 2K8HA 3VXWA 3PZ7A 3QHTA 4M8MA 5E6PA 5AZFA 4CYEA 4N6EB 2RR9A 3V60A 2INCC 2ZNVC 2WXFA 3PV1A 1C76A 1LGRA 2VH1A 1DYQA 3AE1B 1KF6B 2BS2B 2KLGA 2MRPA 4HPMB 2DYMA 2BWES 4DHZB 4MM3A 4EE2A 1XEEA 4C56C 2R2QA 3BK1A 1KM7A 4HCPB 2BYTA 3AH7A 1WYWB 2WXRA 4HJKA 3RNAC 4K7SA 2WDQB 4FJYA 3CMMB 4WJNA 3T3OA 1V1PB 2MA9B 1RFAA 2IYDB 2KJ6A 2KTRB 1ZUD2 2PE9A 1VD2A 4YXDB 3L10B 3NHEB 1R4MI 2VH2A 3HVDA 2PEAA 3Q2AC 4XYCA 3E9SA 2C7HA 2M19A 3P4SB 3DHIC 4DBGA 4HCNB 3BWUD 2W3RA 4C80A 2WU5B 2BWFA 3GS2A 5D3IB 4ARCA 2WXQA 4PS8A 3O13A 4FN2A 4J3OD 1TGZB 3T9LA 3NRZA 1IP9A 2JVCA 4C00A 3P63A 2DAFA 2L1AA 2I38A 3SHQA 4ICVA 4BVUC 1KOTA 1P3QU 3L54A 3VTUA 3DVNV 5MPOA 1Q1OA 2C60A 4RH6A 4N9F4 1WXQA 2HTME 4RNAA 2FCNA 4US9A 4L23A 2FCQA 2RPVA 2O6VB 4MGZE 2FIDA 4FULA 1QOAA 4W9KA 4BKTA 2WX1A 3TCAA 4G0NB 1HEZE 1I4PA 4HK2A 4C7ZA 4LTUA 2WS3B 2N9KA 2BYFA 2KDBA 4ICUA 1WM2A 4KKIA 2X38A 2KQ4X 3OLMD 3APFA 4TQ0A 3A9JA 2QILA 2WNMA 1T0RC 3BVZA 4TSSA 4L1BA 2KVZA 4S0RA 2UU7A 5E6JA 1JCKB 2HTHA 1TZOA 2AX5A 3IVFA 4NJ6A 1B9RA 3PHWB 4GOCA 1YN4A 2KWVB 2NTTA 2WXIA 4NAWB 3TEYA 1QF6A 4G11A 4TV3A 4W9IA 4XC2A 3AE5B 5CHVC 1L0YB 1FCLA 1K53A 1YJIA 3ZJVA 3KW5B 2C7MB 2DAJA 5D3DA 1M4VA 1MJDA 3RZFA 1TKEA 1AWDA 3MJ5A 1V5TA 3S2AA 3B2GA 1YN3A 1OEYA 2LASA 4IC7B 4IUMB 3ZTCA 2KDEB 3AEFB 2Y5BB 2ON8A 2D3CA 3RN9C 2D11A 3B1LX 2NBUA 3CIRB 1OQRA 1KFYB 3AI5A 3HUIA 5LXIB 2CU3A 3KVFB 1E7UA 1C4PA 1QOBA 4WQMA 1EU3A 2NBVB 1WFYA 4IM2A 2KX0A 3DCGA 3L0WB 1V86A 2DLBA 1AYFA 3DPDA 1WY8A 4ZYNA 2ZEQA 1D4BA 4LNOA 4DHZE 1RWSA 1I35A 5H8YE 3VVWB 3W1SC 1UGJA 2EKEC 5L83A 3OG5A 3A1QB 3VFKA 3Q8FA 2RSUA 3LB8C 2G4DB 2PMVA 3AULA 2GRIA 2K3UA 3RT3B 1F52A 5JHAA 1NVID 1Y56A 2INNE 1JRPA 3IAS1 2KQSA 2Z8LA 2BYEA 2EMTA 4KDLB 3UQBA 2MJDA 4HPLB 4BKSD 3UIOB 3VR9B 1RAXA 1TKYA 2MBEA 4I6NB 1IPGA 3ZNGC 1SF0A 1XQQA 2N9PC 3LDZE 3UGBB 4MSQB 1CK1A 2KFKA 3AE4B 2WDTB 3DBHB 4GB9A 1SGHA 3BINA 3EHVA 3B9JA 1V8CA 2V3SA 2ZVOA 4NJCA 4M0WB 3PT2B 3X23A 2M4NA 3PS6A 4JQWC 4M01A 1E8XA 2IO2B 4II2B 4LJPB 4OHJA 4LCDE 5FR6A 2EELA 4MJSB 3VH3B 4DWFA 2L52A 1H4RA 2QC8A 1MPEA 2G3QB 2N7EA 3ZNID 3R3MA 1V80A 1WGGA 4YSXB 2CJNA 3X0WA 4RGMA 1LO5D 4M00A 5T8IA 1FFVA 3RFZB 3IFWB 4P6VF 4W9LA 1I42A 1TY0A 1FMAD 2IGGA 2DYBA 4NNJB 1ZXHA 3KH0A 1UWXA 1MHHE 3N3KB 2BB5A 5EE0A 4K3BA 1FCCC 1PGBA 4GMVA 4REZA 4N59A 5JXVA 2WXJA 1TS2A 1WXAA 2CKHB 5CHFA 4WWMA 4XDDA 3Q3NC 1F77A 3L16A 2O6VD 4JX1C 1HZ6A 3BY4B 3Q8CA 3ECIA 3I9V1 3AE2B 4OZBA 1CQVA 4JGHB 2JUOA 2XBBC 1JWUD 3RI7C 1DOIA 2KD0A 2KN5A 1GC6A 3HVZA 2JYEA 2MBOA 2D07B 1C79A 1FNVA 3HK0A 2KLCA 4RM8A 1PQSA 2OHFA 5GXGB 1VCBA 5J2RA 2LJIA 3TUOA 2C9WB 2D2QA 2RGFA 1YD8U 4AOFA 5TR5A 2LEKA 4ITKA 1ISNA 2FE8A 2JQRB 2LHDA 3PREA 2K6DB 2BBCA 2KFJA 1VRAB 3AB5A 1Z5SB 1L4ZB 4M8NA 4W9GA 2KXJA 3HIZA 3ZRCA 4JPSA 5HFYA 2WGSA 4RFBA 2DYOA 1JMLA 2K39A 2L0FA 4F8CB 3A4SC 1MVKA 4B9KA 1V2YA 4DXGA 3P1MA 1WGKA 1J0GA 1HTQA 4USAA 1BXTA 4BZAA 2N4FA 5AEKB 1ZDXA 3MC8A 4CO7A 2I1JA 2O2VA 1P7FA 3T8MA 1WE6A 2ACZB 2L3ZA 2PPHA 3PO0A 2KQ7A 3IG3A 1UF0A 4MT5A 4YSYB 2BS4B 3U7ZA 3ZDTA 2KOXA 3NZUA 3PRPB 4LK0M 4H2AA 3V62A 1WXMA 1NDDA 1SIFA 2WDVB 2WDRB 4HXDA 2E6XA 2KNBA 2ZVNA 1U4AA 1NEKB 4PS3A 3RNCC 3RMKC 1WXSA 3Q3OC 2LMCA 4A6QA 4LNFA 2MHJA 3URYA 1P7EA 2WXNA 3I3TB 3SFDB 1ZXIA 3JSVA 1T0YA 1EWYC 1V97A 1ZW7A 4XE0A 5LNK1 2JT4B 3RPFC 1WI0A 1WSPA 2NPTA 5KHOA 1QQRA 1JW9D 1RYJA 4AQ7A 2DENB 2LI5A 1IBXA 5EE9A 3BK2A 2KJHB 2AL3A 4XWWA 3AEAB 4MACA 2I1KA 2QJLA 1XXGA 2CHWA 3TEWA 4GDKA 1KLUD 1OFFA 1FPYA 1G6JA 1WH3A 2JRHA 1GJZA 3BVGA 4O1NA 3OAWA 4GSWA 3GE8C 3W5UB 4ANUA 2YEPB 1ET9A 4A9AA 2XNAC 2INPE 3GE3C 1YN5A 4KX6B 1SJHD 3WAOA 1V9JA 3OJ4B 1WM3A 1WRIA 2AEHA 5LXHA 4WJOA 3W5VB 3WIMA 4R3DA 4BKSA 2PVOD 1YJJA 2JF5A 4IWPA 1AW7A 5CX3A 1E8YA 5D6JB 1PDXA 1GNUA 4HDOA 2DZIA 2AQ3B 4GDLB 4AWJA 2K8CA 1KJTA 3B0AA 2GOWA 1WX8A 1J7AA 2V0GA 3QX1A 4F1SA 3PLUA 1LFDA 3IXSA 1TS3A 1YQ4B 1FIQA 2DHZA 1A5RA 3KUZA 2H89B 3SR6A 4MGYE 1V1PA 2NMQA 3AEGB 3SDLC 2KTRA 2D3GA 2JRIB 3ZW3A 2WXKA 4CQNA 5DPSA 1D5MC 2IGHA 3HHMA 2ICIA 2JX5A 1FD6A 1FM0D 4KIKB 2JZZA 1TIFA 3Q8AA 1N6ZA 2JYTA 1N62A 1Q5WB 1E6EB 4N58A 3DVGX 1KRHA 1TTNA 3WALA 4MGIE 1LXDA 5BMGA 3IHPC 2RPQA 2J53A 4B6WA 2L0TA 4WAAA 1PGAA 3UQAA 4WWPA 4FHJA 1OQYA 4OVUA 2BT6A 2FUHB 3Q3FA 3QIJA 5L95C 4IWOA 3DQVA 2JZ3B 2PTLA 2KDMA 3T3NA 1XLNA 1D5ZC 4BFRA 1DGJA 2LXAA 2Z0EB 3NZ3A 1WE7A 1E10A 2O6VA 2LUMA 2AL6A 2MBQA 3RNEC 2KWCA 1LQBA 3MC9A 3U8ZA 2MLBA 4RF1A 1BMLC 1PFDA 2OOBB 1EU4A 1WR6E 2K5PA 3GB1A 3ZDMC 2I2YA 3DBRB 1WGYA 2J42A 1ZPSA 2JXXA 2N1WA 2MBBB 1R4NI 2V3PA 4RGNA 5E6OA 2NS5A 4PYUA 1UBIA 5G5GA 3QAQA 1QOFA 1EUVB 3DHGC 2IJ0A 4XZ4A 1YJ1A 1L0VB 4NAMA 2DNFA 1UBQA 4TQ1A 2IGDA 2KK8A 1QOGA 2R2OA 2BF8B 1L4DB 4NAWA 3PSEB 5D94A 3ETRA 5BYQA 4ZOHC 2LHEA 2KKCA 5JH5C 1J7BA 1ET6A 4KDIC 2CHXA 3NY5A 5E6NA 4IWQA 1BUIC 3M95A 2IZVB 3TEZA 1FXIA 3H7PA 4IM0A 2L05A 2MJ3A 2RD0A 3VUYA 2IY0B 2M0AA 3DBLI 3P4QB 3RNGC 4HVBA 1TBEA 1GOZA 2EKIA 1ACCA 2WWZA 3WANA 3N1XC 5HG2A 2V3NA 3UIPB 3GZNB 3AE7B 3ZNZB 1VDVA 3VRBB 1E9MA 1WZ3A 4TMAB 3L17A 3DDCB 1IGDA 5IA7A 3A1QA 3KWLA 2LGSA 1N61A 2QSDA 4W9DA 1F9JA 5C2TB 1YMHE 1XCQL 4YTMB 5FR3A 4JLCA 2DZJA 1E7VA 2YLMA 1SE9A 1E8WA 2KZRA 2MX2A 2WX0A 1JROA 3N30A 3A9KB 2KN4A 2ZZPB 2PLPA 2D10A 4WURA 2X8XX 3EFCA 3L4PA 3EGRA 2GI9A 3JVZX 2WU2B 3KLSX 4ANWA 1V5OA 4W9JA 1KLGD 2L83A 3R7QA 1A70A 3UF8A 1UELA 1CJEA 3OJ3A 4GN1A 1QLBB 3C19A 2PVGC
chains in the Genus database with same CATH topology
5GXGB 2OHFA 3NVWA 4DXFA 3AEBB 1C9FA 3Q8EA 2LJIA 3W1SA 1C78A 2G9HD 3TUOA 2DWQA 2E3TA 2Y5PA 1E0ZA 4A8XC 2LEKA 2NTSA 4ITKA 3AE6B 1RM6C 2FE8A 4RCOA 3R8BA 4M0WA 2JQRB 2Y5CA 2LHDA 2D5GA 4GDKB 2BBCA 1D5XC 1VRAB 3AB5A 1HQRD 5D7GA 1L4ZB 2JU6X 1TJEA 1JWBD 2Y3AA 1XLOA 5I4DA 3TEXA 4YT0B 3ZQ4A 1JALA 3SFEB 3SEBA 3C8YA 2BS3B 3P42A 1AN8A 4IDIA 4JPSA 5HFYA 4RFBA 2DYOA 1JMLA 2K9XA 1EWCA 3AV8A 3DWGC 3VQIA 1ESFA 1MVKA 4DXGA 3P1MA 3PZ7A 1WGKA 1YNTE 4USAA 1BXTA 3V05A 2KWDA 1ZDXA 4XWTA 1SE3A 1FEHA 4N6EB 1D6EC 1R7SA 2WXFA 3IAM1 3MP9A 3NVZA 1C76A 3TSSA 1P7FA 1DYQA 4JE3B 3AE1B 1KF6B 2BS2B 3ZJUA 2ACZB 2IPKD 3PO0A 2DYMA 1F0ZA 2BTEA 4LLGM 4MT5A 4YSYB 2BS4B 3ZYYX 4EE2A 2LFIA 1XEEA 4C56C 3U7ZA 1XO3A 3BK1A 2W54A 2N7JA 4US8A 3AH7A 2BYTA 2WXRA 1RFKA 4LK0M 4H2AA 1IUEA 2WDQB 2VZKD 2WXLA 5G5HA 3B2FA 3T3OA 1NI3A 2WDVB 1V1PB 2WDRB 3BZDB 2E6XA 1NEKB 1SSNA 1ZUD2 3R2TA 1C4CA 3P4PB 2LMCA 1GAQB 4YXDB 1ENFA 1J7CA 1K50A 3HVDA 1JQ4A 3I57A 1SE4A 4ZRQA 3E9SA 1QKZA 3FC4A 4A6QA 3URYA 3ZGZA 1P7EA 4ZHPA 2M19A 1OQQA 3P4SB 4P16A 1JWMD 2M56B 2WXNA 1B1ZA 2HDEA 3BWUD 3SFDB 1ZXIA 3U52E 2W3RA 4C80A 2OEDA 3NS1A 1FXAA 2AQ1B 1EWYC 2B76B 1V97A 4XE0A 2WU5B 3PZ8A 3GS2A 5LNK1 5D3IB 4ARCA 4AS1A 2WXQA 3RPFC 1WSPA 1HXYD 3O13A 4J3OD 1QQRA 1JW9D 3NRZA 4A90A 1FNUA 1RYJA 1VJKA 3P63A 1SJED 2L1AA 4AQ7A 2I38A 4HKZE 1IBXA 5EE9A 3AN1A 4ARIA 3BK2A 1FRRA 3VR8B 4XWWA 3AEAB 4MACA 3LXFA 5MPOA 1N63A 2QJLA 4ZHOA 3EA6A 5HHDG 1XXGA 3TEWA 1KLUD 1OFFA 4RH6A 5HI1A 4OVZA 1WXQA 1ZP0B 2HTME 3AE9B 3BVGA 4O1NA 4RNAA 1WYGA 5EE3A 1GB1A 3MHZA 4US9A 2RMMA 3W5UB 3CWIA 4L23A 1N5XA 2YEPB 1ET9A 2RPVA 2WXPA 4A9AA 2XNAC 4HRSA 2INPE 2TSSA 1QOAA 1K52A 1YN5A 4KX6B 1E7PB 1SJHD 1HEZE 1WWTA 1I4PA 3N9YC 4C7ZA 1WRIA 4LTUA 2WS3B 4WAFA 2N9KA 3W5VB 4KKIA 2V4IB 2MEKA 4R3DA 1SE2A 2X38A 2KQ4X 2PVOD 4TQ0A 3ZJTA 1YJJA 3VRAB 4D2KA 2QILA 2WNMA 1TYGB 3ABVB 1AW7A 1UUPA 3BVZA 3KWVA 3EUB2 1PDXA 4TSSA 4L1BA 1NYQA 5C3JB 3R2IA 2AQ3B 4GDLB 2QEJC 1K51A 1HA5A 3MC0B 3NUHB 5E6JA 1JCKB 1JWSD 1TZOA 2AX5A 4DQOC 1J7AA 2V0GA 1B9RA 5FK9C 1TY2A 1YN4A 2WLBA 3IXSA 5BMIA 1TS3A 2ONQA 1Q10A 1YQ4B 1FIQA 1EM7A 2NTTA 2WXIA 2H89B 3SR6A 1V1PA 2NMQA 4NAWB 1TS4A 3AEGB 3TEYA 1QF6A 4HKQA 3NVVA 4NZLB 1PYWD 2WXKA 3AE5B 4CQNA 1D5MC 2IGHA 1L0YB 1FCLA 4KGTA 2FUG1 2ICIA 1K53A 2JX5A 1FD6A 1HZ5A 1YJIA 2JXTA 3ZJVA 2AQ2B 1L0XB 2WXGA 1FM0D 4OW0A 1C77A 2XN9C 5D3DA 1M4VA 3NVYA 1TKEA 1AWDA 2LGIA 2H88B 2K22A 2RDGA 3MJ5A 3B2GA 3Q8AA 3U4EG 1YN3A 2IDYA 1PUTA 2JYTA 1N62A 2WXOA 3LYYA 2CJOA 1UNSA 1E6EB 2PW9A 4N58A 3AEFB 2ON8A 1KRHA 3WCQA 5BMGA 1XLPA 2MH7A 2J53A 3CIRB 1OQRA 1KTKA 1KFYB 3W9CB 4HROA 3HUIA 1T6BX 3AMZA 1PGAA 2CU3A 3AEEB 1C4PA 1QOBA 2BT6A 4WQMA 1EU3A 2WQYB 3Q69A 1I4HA 1MI0A 2L32A 2VZKB 2PTLA 2KDMA 2MJEA 3T3NA 1XLNA 3GP7A 2DLBA 2ZW1A 1D5ZC 3UI3A 1AYFA 4HEA1 1DGJA 3Q8BA 1D4BA 3NZ3A 3AEDB 3H8HA 1KH0A 1SIJA 1F2RI 1E10A 1RWSA 2R61A 2LUMA 5H8YE 3HRDD 2J4XA 1UGJA 3BYTB 2RDHA 1F2RC 3DWMA 4WIPA 4RF1A 3Q8FA 1BMLC 1PFDA 3LB8C 4UDUC 1SEBD 2PMVA 1VZ6A 2GRIA 4RGTA 2K3UA 1EU4A 2K5PA 3GB1A 2I2YA 1XLQA 1NVID 1Y56A 1YQ3B 3FAHA 4Q2JA 1DOYA 2INNE 2KAJA 1N60A 1JRPA 2J42A 1JWAD 1ZPSA 3IAS1 2Z8LA 3J9CA 4XDCA 1QILA 2KACA 2V3PA 4RGNA 4ZYSA 4KGRA 1FFUA 5BYSA 1GPXA 2MJDA 1I4RA 5G5GA 2WP9B 4RGOS 1QOFA 3VR9B 1IBXB 1SBBB 1TKYA 4OZAA 3V3XA 2IJ0A 5H92C 1C4AA 4OZCA 1L0VB 4L2YA 1SF0A 4NAMA 2YEPF 4TQ1A 2IGDA 1UWMA 4HJGE 1QOGA 4C7YA 1CK1A 3AE4B 3BYYB 1T5XD 1L4DB 4KGSA 2N0SB 3BIID 5FKAC 3FILB 2BW2A 1VZ7A 2WXMA 3ETRA 1FRDA 5BYQA 2JWUA 3B9JA 4ZOHC 2GB1A 1V8CA 4ZRPA 2LHEA 1QT9A 3OWEB 4NJCA 1ZDVA 1TKGA 1J7BA 1ET6A 4JWSC 2SAKA 3W2DA 2J52A 5BMHA 1ZE3D 3AM9A 1BUIC 4B0EA 3TEZA 1T3QA 1FXIA 4KKJA 4OHJA 2W3SA 2BB6A 2DBYA 4GLSC 1SB3C 5EE1A 1TS5A 2MJ3A 2EELA 1MHXA 2L52A 4YSZB 1L6VA 2M0AA 1MPEA 3AE8B 1I4GA 3P4QB 4A55A 3MFGA 2W55A 1ZOYB 4YSXB 2CJNA 2FBWB 3KQ4A 4RGMA 4IOIE 2PKOA 3BVMA 1LO5D 2W82A 4B0MA 1VZ8A 1PGXA 1GOZA 5T8IA 1FFVA 2EKIA 1ACCA 3RFZB 3AE3B 2QIEB 4P6VF 1TY0A 1FMAD 4FXCA 2IGGA 1GB4A 5BYRA 1I7HA 1ZXHA 2KMMA 5AUKA 5HG2A 2V3NA 1L5PA 1UWXA 2JSVX 1FNWA 2PIAA 3AE7B 1VLBA 1VDVA 3VRBB 1MHHE 1E9MA 4MM3B 5TSSA 2BB5A 4TMAB 5EE0A 1FCCC 4IKGA 1PGBA 1IGDA 4REZA 3IT6B 4N59A 1I4XA 2JZPA 5JXVA 4YTPB 1STEA 2WXJA 1TS2A 2SEBD 3KWLA 4PT5A 2K0PA 1IGCA 4WWMA 1N61A 2QSDA 5C2TB 1FO4A 4XDDA 1YMHE 1I4QA 1XCQL 3P4RB 4YTMB 1F77A 5FR3A 1NYRA 2G1EA 3U2SC 2N9LA 1XCTL 3AECB 1XF5L 1HZ6A 3IT4B 4JX1C 1V1OA 3Q8CA 4MH8A 4RF0A 5AUIA 2WXHA 1JROA 4YWGG 2KN4A 3I9V1 4YTNB 2PLPA 1ROEA 1N5WA 4WH4A 3AE2B 4OZBA 4WURA 1CQVA 1CZPA 3EGRA 1SXTA 3L4PA 1DOXA 2GI9A 1VR9A 2WU2B 3KLSX 1JWUD 1DOIA 2QMTA 1KLGD 2L83A 2ZW0A 3HVZA 2JYEA 1A70A 4JWUC 1L6UA 1CJEA 3E56A 1C79A 1FNVA 2Q5WD 3FILA 1QLBB 2PVGC 1NENB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1C9F A;  2J52 A;  2I38 A;  4HKZ E;  5BMH A;  1IBX A;  2PW9 A;  2ON8 A;  2LHD A;  4GLS C;  5BMG A;  4MAC A;  2J53 A;  2EEL A;  1MHX A;  5HHD G;  2JU6 X;  1MPE A;  1PGA A;  5HI1 A;  1MI0 A;  5HFY A;  4IOI E;  1GB1 A;  1JML A;  2PTL A;  2KDM A;  2RMM A;  1PGX A;  2RPV A;  2ZW1 A;  3UI3 A;  1MVK A;  1D4B A;  1K52 A;  1YNT E;  1KH0 A;  1F2R I;  2IGG A;  1GB4 A;  1HEZ E;  1ZXH A;  2KWD A;  2LUM A;  5HG2 A;  2N9K A;  1UWX A;  2JSV X;  3MP9 A;  1F2R C;  1MHH E;  1P7F A;  2KQ4 X;  4D2K A;  1FCC C;  4IKG A;  1PGB A;  1IGD A;  3GB1 A;  2JZP A;  2I2Y A;  5JXV A;  1K51 A;  2KAC A;  2K0P A;  1IGC A;  2N7J A;  2QSD A;  1YMH E;  1XCQ L;  4KGR A;  2N9L A;  1XCT L;  1XF5 L;  1HZ6 A;  5BMI A;  2ONQ A;  1Q10 A;  1EM7 A;  2KN4 A;  1IBX B;  2PLP A;  4OZA A;  3V3X A;  4WH4 A;  4OZC A;  1K50 A;  2NMQ A;  4OZB A;  2IGD A;  4HJG E;  2GI9 A;  1QKZ A;  1P7E A;  4KGS A;  2IGH A;  1FCL A;  4KGT A;  2QMT A;  2ZW0 A;  3FIL B;  1K53 A;  1FD6 A;  1HZ5 A;  2JXT A;  2JWU A;  2OED A;  2GB1 A;  2LHE A;  3FIL A;  2LGI A; 
#chains in the Genus database with same CATH topology
 3NVW A;  3AEB B;  3Q8E A;  5IN7 A;  2G9H D;  2DWQ A;  4K81 A;  2L8J A;  1E0Z A;  3AE6 B;  3R8B A;  4M0W A;  2Y5C A;  3SU8 X;  1EF5 A;  1D5X C;  2FIF A;  5D7G A;  1TJE A;  1XLO A;  3TEX A;  1JAL A;  4MJS A;  3C8Y A;  1ZKH A;  1XT9 B;  2K9X A;  3VQI A;  1ESF A;  2LZ6 A;  3JW0 X;  4TKN A;  5HKH A;  3Q6B A;  5DCN A;  3QQ8 B;  3V05 A;  2KWD A;  4P1C C;  1SE3 A;  3K9P B;  3UIN B;  3ZRF A;  1FEH A;  1D6E C;  2VRR B;  1R7S A;  4JE3 B;  3KUD B;  1F0Z A;  2BTE A;  4LLG M;  4W9H A;  3NZS A;  3A33 B;  5IKC M;  1XO3 A;  4EFO A;  4HLE A;  4US8 A;  1RFK A;  2Z59 B;  1IUE A;  4E3C A;  2WXL A;  1WMH B;  1NI3 A;  5AZG A;  4PYZ A;  1C1Y B;  4P1B C;  1SSN A;  3R2T A;  1C4C A;  4GU2 A;  1GAQ B;  1ENF A;  1JQ4 A;  1SE4 A;  3CSF A;  4ZRQ A;  1UD7 A;  2NCN A;  3APC A;  4ZHP A;  4P16 A;  1J8C A;  1B1Z A;  2HDE A;  2CHZ A;  3U52 E;  2ZNV B;  4NPN A;  2OED A;  2AQ1 B;  2XK5 A;  2V9H A;  4EZJ A;  3W1Y A;  3PZ8 A;  4AS1 A;  2KVR A;  3TBL D;  4A90 A;  1FNU A;  1UGM A;  3QJZ A;  1SJE D;  4HKZ E;  3AN1 A;  2N9E B;  4ARI A;  3CST A;  2AYO B;  2LJ5 A;  4KV2 A;  3EA6 A;  2KDF B;  5D2M B;  1ZP0 B;  2ZPY A;  3AE9 B;  3TIX A;  1WYG A;  5EE3 A;  1GB1 A;  5AZH A;  3CWI A;  3PZD A;  3ONS A;  4HRS A;  1Z2M A;  1R4M B;  2J0J A;  1WWT A;  2BVC A;  3N9Y C;  1D3Z A;  2L00 B;  3KYC D;  1MG4 A;  3V6E B;  3EFU A;  2ZCB A;  2V4I B;  3WAM A;  1SE2 A;  3Q14 C;  3VRA B;  4D2K A;  2L7R A;  1TYG B;  1BT0 A;  3ABV B;  2K8B A;  3R7R A;  1NYQ A;  2MP2 A;  3N20 C;  1HA5 A;  3MC0 B;  1M94 A;  3PRZ A;  2HJ8 A;  5FK9 C;  2WLB A;  2N9X A;  1GUA B;  2ONQ A;  4KSK C;  1Q10 A;  2K6Q A;  2D3A A;  1RLF A;  3WAP A;  2PE6 B;  4HKQ A;  3RCZ A;  3H7S A;  1KLV A;  1P9D U;  3CF6 E;  4NZL B;  1FXT B;  1PYW D;  2YVC A;  4BBN F;  2MQJ A;  4NJ7 A;  1TT5 B;  2JXT A;  5G55 A;  3MTN B;  2AQ2 B;  1WZ0 A;  4OW0 A;  5CTR C;  2XN9 C;  3NVY A;  5KHQ A;  2LGI A;  2H88 B;  4BOZ B;  2RDG A;  3Q3J A;  3RZW C;  1PUT A;  4NQK E;  2WXO A;  4II3 B;  3LYY A;  2CJO A;  2PW9 A;  2IO0 B;  2LGX A;  3WCQ A;  4E74 A;  1XLP A;  3VHT C;  1KTK A;  4HRO A;  3ZIM A;  1T6B X;  3AU5 A;  3AMZ A;  1GC7 A;  3VTV A;  1WGD A;  4K1R B;  2WQY B;  2L32 A;  2VZK B;  1WJU A;  3DBH I;  4EEW A;  3GP7 A;  3KUC B;  4HEA 1;  3Q8B A;  3H8H A;  1KH0 A;  2RDB C;  2N7D A;  3PPA A;  2R61 A;  2K1F A;  4RM9 A;  3HRD D;  3BYT B;  2FNJ B;  2RDH A;  3DWM A;  4WIP A;  3L13 A;  4UDU C;  1SEB D;  1VZ6 A;  4RGT A;  4B95 A;  3L08 A;  4Q2J A;  2KAJ A;  1N60 A;  1JWA D;  4URK A;  3J9C A;  4XDC A;  3JSV B;  4AJW A;  2NVU I;  2M8S A;  4MEL A;  4W9F A;  4KGR A;  1FFU A;  4GDL A;  5C1Z A;  5BYS A;  2NPT B;  4KSL C;  4EZL A;  1GPX A;  4DDG D;  1S3S G;  1OTR B;  1JRU A;  2XEW A;  3VUX A;  3ZXR A;  1IBX B;  4OZA A;  2IND C;  3V3X A;  5H92 C;  3ZKJ C;  1C4A A;  4L2Y A;  4HPP A;  2YEP F;  1AAR A;  3APD A;  1T5X D;  1L7Y A;  3M3J A;  2W9N A;  5IAA C;  3FIL B;  2BW2 A;  2WXM A;  1FRD A;  4EUT A;  2JWU A;  4FLH A;  4ZRJ A;  2GB1 A;  4ZRI A;  4ZRP A;  3OWE B;  4RMA A;  2LD9 A;  2LXC A;  4LNI A;  1ZDV A;  1YX5 B;  3NOB A;  3WA0 A;  3W2D A;  3QCA A;  4KIK A;  4IW0 A;  5BMH A;  1ZE3 D;  4NY0 A;  1E8Z A;  4C4V B;  3JYU A;  2W3S A;  2BB6 A;  2DBY A;  3H1U A;  4GLS C;  5EE1 A;  1TS5 A;  4MSM B;  1C3T A;  1MHX A;  4G50 A;  2FCS A;  4YSZ B;  4FA6 A;  1I4G A;  3A4R A;  2W55 A;  2G4S A;  2EMS A;  4IOI E;  2DZM A;  2PKO A;  2W82 A;  4B0M A;  1VZ8 A;  4OVV A;  2KYW A;  2QIE B;  1I7H A;  3SD5 A;  2DZK A;  2KMM A;  3EC8 A;  5AUK A;  1L5P A;  4E71 A;  2JSV X;  1FNW A;  5IO9 A;  2JPH A;  1VLB A;  2LGY A;  1EF1 A;  2KT7 A;  4MM3 B;  3O65 B;  4ANX A;  2BGF A;  5TSS A;  2QCZ A;  1X1M A;  4IKG A;  1STE A;  4BAX A;  2SEB D;  3ZNH B;  2AWT A;  1FO4 A;  2B3A A;  1I4Q A;  2QDF A;  2GBJ A;  3VAW A;  1NYR A;  3U2S C;  2KX3 A;  2REX A;  3AEC B;  4MH8 A;  1V1O A;  5AUI A;  4BOS C;  4X57 B;  4YWG G;  3M63 B;  2BKF A;  2KO3 A;  4YTN B;  4LDT B;  4S17 A;  4ZRK A;  4WJQ A;  4AUQ C;  1CZP A;  1DOX A;  2WYQ A;  4WJP A;  1VR9 A;  3RD2 A;  4DK5 A;  4BBN C;  2QMT A;  4EOY A;  2V4L A;  2ZW0 A;  3ZLZ A;  2FCM A;  3C0R B;  4PS7 A;  4JWU C;  1L6U A;  3E56 A;  2Q5W D;  4G3X B;  4KZC A;  1NEN B;  1C9F A;  1K8R B;  3V61 A;  1C78 A;  3ML9 A;  3KYD D;  3PTF C;  4AP4 C;  2GBN A;  2NTS A;  2KJR A;  1HTO A;  4RCO A;  2JY6 A;  2K25 A;  2IBI B;  2LRU A;  2IO1 B;  2KC2 A;  2BKR B;  4YT0 B;  3DVG Y;  3SEB A;  1AN8 A;  2GBM A;  4IDI A;  4XX5 A;  1HE8 A;  1WR1 A;  1OGW A;  3AV8 A;  4DHJ B;  4ANV A;  1YNT E;  3PGE A;  4BKG A;  4XWT A;  1QZE A;  3A9J B;  3IAM 1;  3MP9 A;  3NVZ A;  3K9O B;  3TSS A;  2A4Z A;  3ZJU A;  2IPK D;  3ZYY X;  2LFI A;  3N1Y C;  2LUE A;  2W54 A;  2N7J A;  2VZK D;  3FKY A;  5G5H A;  3B2F A;  3BZD B;  3TL5 A;  1MFW A;  4MH0 E;  3P4P B;  4GGQ A;  2DX5 B;  2GBK A;  1J7C A;  1K50 A;  4JIO U;  3H7P B;  3I57 A;  3NJT A;  4A3P A;  3A9K A;  1NBF C;  4I6P A;  1J19 A;  1QKZ A;  3FC4 A;  3ZGZ A;  1OQQ A;  1JWM D;  2M56 B;  1P1A A;  4FBJ B;  4PK1 A;  3NS1 A;  1FXA A;  1Y8R C;  2B76 B;  3PHX B;  1E90 A;  1HXY D;  3VDZ A;  4CHK A;  4AJY B;  1L2N A;  1VJK A;  3I5J C;  2D3B A;  3V6C B;  4EZK A;  1F1H A;  2OJR A;  1FRR A;  3VR8 B;  4W9E A;  3LXF A;  1N63 A;  3QA8 A;  4ZHO A;  5HHD G;  5HI1 A;  4OVZ A;  4EKU A;  2HE7 A;  3MHZ A;  3RYT A;  2RMM A;  1N5X A;  3ZVV A;  1YQB A;  2WXP A;  3DBS A;  2HD5 B;  2HJ1 A;  2TSS A;  1K52 A;  1WX9 A;  2GMI C;  3PLV A;  1E7P B;  4A3O A;  4WAF A;  1WRD B;  2KDI A;  3LJ3 A;  3PRM B;  1YIW A;  3QAR A;  2MEK A;  3VH4 B;  4HWI B;  2Z0D B;  2BYV E;  3ZJT A;  4DXA B;  3B08 A;  5EDS A;  4K7U A;  1UUP A;  3DHH C;  3KWV A;  3EUB 2;  5C3J B;  3R2I A;  2KAN A;  2QEJ C;  1K51 A;  1GG3 A;  3NUH B;  1JWS D;  4DQO C;  5DPW A;  4KZ0 A;  4GIV A;  1TY2 A;  2ZJD A;  4FJZ A;  4XGA B;  5BMI A;  2WHI A;  2J0M A;  1EM7 A;  3MJW A;  1P98 A;  1WMH A;  1TZ1 A;  2KFK B;  3NS8 A;  1WJN A;  5BO4 B;  1TS4 A;  4IM3 A;  3ALB A;  3NVV A;  4P7I A;  1WJ6 A;  2CR5 A;  1CMX B;  5DPR A;  2CS4 A;  4KGT A;  3DVN U;  2FUG 1;  4JL9 A;  1HZ5 A;  2WXG A;  1L0X B;  1C77 A;  3DBR I;  3ENE A;  2K22 A;  5G2N A;  3U4E G;  3P2B A;  4MDK E;  2IDY A;  5DPT A;  2KWU B;  2ZCC A;  1WF9 A;  2J0K A;  1UNS A;  4LDT D;  1V81 A;  5JHB A;  3ZXV A;  2M1M A;  2BPS A;  2MH7 A;  3W9C B;  3GOE A;  4LNN A;  1V49 A;  3AEE B;  4MEM A;  5CHW A;  1ZGU B;  4ASW C;  3Q69 A;  1I4H A;  1MI0 A;  2KTF A;  2JWZ A;  2FAZ A;  2MJE A;  3H6N A;  2ZW1 A;  3ZTD A;  3UI3 A;  3AED B;  1T0S C;  1SIJ A;  1F2R I;  5IP4 D;  4LNK A;  2M17 A;  4ZDV A;  4GXB A;  2J4X A;  1F2R C;  2LVQ A;  3ZUN A;  4K7W A;  1WJ4 A;  2IO3 B;  3NG0 A;  3U30 A;  3VUW A;  1OEY J;  1XLQ A;  1YQ3 B;  2CU1 A;  3FAH A;  2V1Y A;  1DOY A;  1QIL A;  2KAC A;  1WX7 A;  2XK5 B;  4W9C A;  1NI2 A;  5LLI A;  2J7Q B;  1S1Q B;  4ZYS A;  3RNB C;  4DHJ D;  2L76 A;  4HDQ A;  1I4R A;  3HM6 X;  2WP9 B;  2MCN B;  4WQO B;  4K3C A;  4RGO S;  3TJP A;  2LRW A;  1SBB B;  2ZPN A;  4OZC A;  1UH6 A;  4DDI D;  1UWM A;  4HJG E;  3QC8 B;  4C7Y A;  2A5U A;  3BYY B;  5IOI A;  3GZN I;  4KGS A;  2N0S B;  3BII D;  2LWP A;  5FKA C;  3PVL A;  1VZ7 A;  1Q0W B;  2GBR A;  3R66 C;  1T0Q C;  1QT9 A;  2LVP A;  1E5W A;  1WGR A;  1WIA A;  1TKG A;  4JWS C;  2SAK A;  2J52 A;  3AM9 A;  4B0E A;  1T3Q A;  2MW5 A;  3AXC A;  4WWO A;  4KKJ A;  2NR2 A;  1SB3 C;  3Q3M C;  2G45 B;  2KMC A;  1R4N B;  1L6V A;  3AE8 B;  2C7N B;  2MP2 B;  4A55 A;  3MFG A;  3QK0 A;  3N1Z C;  4FAD A;  3AU4 A;  1ZOY B;  2FBW B;  3HM3 A;  3KQ4 A;  3BVM A;  1PGX A;  4A20 A;  3EEC A;  4FJV B;  3TMP B;  2LVO A;  3AE3 B;  2O2V B;  4FXC A;  1GB4 A;  5BYR A;  2PIA A;  2LGD A;  3H9D A;  1EO6 A;  1IYF A;  3U7D A;  1V6E A;  2MWS B;  2PJH A;  2BQQ A;  2M0X A;  3IT6 B;  3ML8 A;  1I4X A;  2JZP A;  4YTP B;  5C23 A;  4PT5 A;  4QAY A;  2K0P A;  1IGC A;  1RRB A;  2N1V A;  3P4R B;  4J6I A;  2G1E A;  3I63 C;  3QWZ B;  2N9L A;  1YOV B;  4WWN A;  1XCT L;  2NBW B;  4KVG B;  1XF5 L;  2KHW B;  3IT4 B;  4M02 A;  4RF0 A;  1WXV A;  5J17 A;  2WXH A;  2OJW A;  5J18 A;  2KC1 A;  3VTW A;  1ROE A;  1N5W A;  4WH4 A;  3DBL B;  1SXT A;  1P0R A;  2MBH A;  5JZE B;  3RNF C;  2IY1 B;  2KMA A;  2QHO A;  4ACF A;  3N32 A;  2MSE D;  2ASQ A;  3D32 A;  4F7Z A;  3IBE A;  3FIL A;  4I6L B;  4NQL B;  2C5L C;  2GLS A;  1YX6 B;  4DXF A;  3W1S A;  3RUL A;  1H8C A;  4IG7 B;  2E3T A;  2Y5P A;  4A8X C;  5GMV A;  1MG8 A;  4FHK A;  4YL8 A;  3RUI B;  3ZO5 B;  3MHS D;  1RM6 C;  4LJO B;  4GDK B;  2D5G A;  2UWQ A;  1UZX B;  1HQR D;  4C4V A;  2JU6 X;  1JWB D;  1WGH A;  2Y3A A;  4TUU A;  5I4D A;  3DOW A;  3M62 B;  3ZQ4 A;  3SFE B;  2BS3 B;  3P42 A;  1XD3 B;  2UYZ B;  1EWC A;  3DWG C;  1LM8 B;  4MGK E;  2K8H A;  3VXW A;  3PZ7 A;  3QHT A;  4M8M A;  5E6P A;  5AZF A;  4CYE A;  4N6E B;  2RR9 A;  3V60 A;  2INC C;  2ZNV C;  2WXF A;  3PV1 A;  1C76 A;  1LGR A;  2VH1 A;  1DYQ A;  3AE1 B;  1KF6 B;  2BS2 B;  2KLG A;  2MRP A;  4HPM B;  2DYM A;  2BWE S;  4DHZ B;  4MM3 A;  4EE2 A;  1XEE A;  4C56 C;  2R2Q A;  3BK1 A;  1KM7 A;  4HCP B;  2BYT A;  3AH7 A;  1WYW B;  2WXR A;  4HJK A;  3RNA C;  4K7S A;  2WDQ B;  4FJY A;  3CMM B;  4WJN A;  3T3O A;  1V1P B;  2MA9 B;  1RFA A;  2IYD B;  2KJ6 A;  2KTR B;  1ZUD 2;  2PE9 A;  1VD2 A;  4YXD B;  3L10 B;  3NHE B;  1R4M I;  2VH2 A;  3HVD A;  2PEA A;  3Q2A C;  4XYC A;  3E9S A;  2C7H A;  2M19 A;  3P4S B;  3DHI C;  4DBG A;  4HCN B;  3BWU D;  2W3R A;  4C80 A;  2WU5 B;  2BWF A;  3GS2 A;  5D3I B;  4ARC A;  2WXQ A;  4PS8 A;  3O13 A;  4FN2 A;  4J3O D;  1TGZ B;  3T9L A;  3NRZ A;  1IP9 A;  2JVC A;  4C00 A;  3P63 A;  2DAF A;  2L1A A;  2I38 A;  3SHQ A;  4ICV A;  4BVU C;  1KOT A;  1P3Q U;  3L54 A;  3VTU A;  3DVN V;  5MPO A;  1Q1O A;  2C60 A;  4RH6 A;  4N9F 4;  1WXQ A;  2HTM E;  4RNA A;  2FCN A;  4US9 A;  4L23 A;  2FCQ A;  2RPV A;  2O6V B;  4MGZ E;  2FID A;  4FUL A;  1QOA A;  4W9K A;  4BKT A;  2WX1 A;  3TCA A;  4G0N B;  1HEZ E;  1I4P A;  4HK2 A;  4C7Z A;  4LTU A;  2WS3 B;  2N9K A;  2BYF A;  2KDB A;  4ICU A;  1WM2 A;  4KKI A;  2X38 A;  2KQ4 X;  3OLM D;  3APF A;  4TQ0 A;  3A9J A;  2QIL A;  2WNM A;  1T0R C;  3BVZ A;  4TSS A;  4L1B A;  2KVZ A;  4S0R A;  2UU7 A;  5E6J A;  1JCK B;  2HTH A;  1TZO A;  2AX5 A;  3IVF A;  4NJ6 A;  1B9R A;  3PHW B;  4GOC A;  1YN4 A;  2KWV B;  2NTT A;  2WXI A;  4NAW B;  3TEY A;  1QF6 A;  4G11 A;  4TV3 A;  4W9I A;  4XC2 A;  3AE5 B;  5CHV C;  1L0Y B;  1FCL A;  1K53 A;  1YJI A;  3ZJV A;  3KW5 B;  2C7M B;  2DAJ A;  5D3D A;  1M4V A;  1MJD A;  3RZF A;  1TKE A;  1AWD A;  3MJ5 A;  1V5T A;  3S2A A;  3B2G A;  1YN3 A;  1OEY A;  2LAS A;  4IC7 B;  4IUM B;  3ZTC A;  2KDE B;  3AEF B;  2Y5B B;  2ON8 A;  2D3C A;  3RN9 C;  2D11 A;  3B1L X;  2NBU A;  3CIR B;  1OQR A;  1KFY B;  3AI5 A;  3HUI A;  5LXI B;  2CU3 A;  3KVF B;  1E7U A;  1C4P A;  1QOB A;  4WQM A;  1EU3 A;  2NBV B;  1WFY A;  4IM2 A;  2KX0 A;  3DCG A;  3L0W B;  1V86 A;  2DLB A;  1AYF A;  3DPD A;  1WY8 A;  4ZYN A;  2ZEQ A;  1D4B A;  4LNO A;  4DHZ E;  1RWS A;  1I35 A;  5H8Y E;  3VVW B;  3W1S C;  1UGJ A;  2EKE C;  5L83 A;  3OG5 A;  3A1Q B;  3VFK A;  3Q8F A;  2RSU A;  3LB8 C;  2G4D B;  2PMV A;  3AUL A;  2GRI A;  2K3U A;  3RT3 B;  1F52 A;  5JHA A;  1NVI D;  1Y56 A;  2INN E;  1JRP A;  3IAS 1;  2KQS A;  2Z8L A;  2BYE A;  2EMT A;  4KDL B;  3UQB A;  2MJD A;  4HPL B;  4BKS D;  3UIO B;  3VR9 B;  1RAX A;  1TKY A;  2MBE A;  4I6N B;  1IPG A;  3ZNG C;  1SF0 A;  1XQQ A;  2N9P C;  3LDZ E;  3UGB B;  4MSQ B;  1CK1 A;  2KFK A;  3AE4 B;  2WDT B;  3DBH B;  4GB9 A;  1SGH A;  3BIN A;  3EHV A;  3B9J A;  1V8C A;  2V3S A;  2ZVO A;  4NJC A;  4M0W B;  3PT2 B;  3X23 A;  2M4N A;  3PS6 A;  4JQW C;  4M01 A;  1E8X A;  2IO2 B;  4II2 B;  4LJP B;  4OHJ A;  4LCD E;  5FR6 A;  2EEL A;  4MJS B;  3VH3 B;  4DWF A;  2L52 A;  1H4R A;  2QC8 A;  1MPE A;  2G3Q B;  2N7E A;  3ZNI D;  3R3M A;  1V80 A;  1WGG A;  4YSX B;  2CJN A;  3X0W A;  4RGM A;  1LO5 D;  4M00 A;  5T8I A;  1FFV A;  3RFZ B;  3IFW B;  4P6V F;  4W9L A;  1I42 A;  1TY0 A;  1FMA D;  2IGG A;  2DYB A;  4NNJ B;  1ZXH A;  3KH0 A;  1UWX A;  1MHH E;  3N3K B;  2BB5 A;  5EE0 A;  4K3B A;  1FCC C;  1PGB A;  4GMV A;  4REZ A;  4N59 A;  5JXV A;  2WXJ A;  1TS2 A;  1WXA A;  2CKH B;  5CHF A;  4WWM A;  4XDD A;  3Q3N C;  1F77 A;  3L16 A;  2O6V D;  4JX1 C;  1HZ6 A;  3BY4 B;  3Q8C A;  3ECI A;  3I9V 1;  3AE2 B;  4OZB A;  1CQV A;  4JGH B;  2JUO A;  2XBB C;  1JWU D;  3RI7 C;  1DOI A;  2KD0 A;  2KN5 A;  1GC6 A;  3HVZ A;  2JYE A;  2MBO A;  2D07 B;  1C79 A;  1FNV A;  3HK0 A;  2KLC A;  4RM8 A;  1PQS A;  2OHF A;  5GXG B;  1VCB A;  5J2R A;  2LJI A;  3TUO A;  2C9W B;  2D2Q A;  2RGF A;  1YD8 U;  4AOF A;  5TR5 A;  2LEK A;  4ITK A;  1ISN A;  2FE8 A;  2JQR B;  2LHD A;  3PRE A;  2K6D B;  2BBC A;  2KFJ A;  1VRA B;  3AB5 A;  1Z5S B;  1L4Z B;  4M8N A;  4W9G A;  2KXJ A;  3HIZ A;  3ZRC A;  4JPS A;  5HFY A;  2WGS A;  4RFB A;  2DYO A;  1JML A;  2K39 A;  2L0F A;  4F8C B;  3A4S C;  1MVK A;  4B9K A;  1V2Y A;  4DXG A;  3P1M A;  1WGK A;  1J0G A;  1HTQ A;  4USA A;  1BXT A;  4BZA A;  2N4F A;  5AEK B;  1ZDX A;  3MC8 A;  4CO7 A;  2I1J A;  2O2V A;  1P7F A;  3T8M A;  1WE6 A;  2ACZ B;  2L3Z A;  2PPH A;  3PO0 A;  2KQ7 A;  3IG3 A;  1UF0 A;  4MT5 A;  4YSY B;  2BS4 B;  3U7Z A;  3ZDT A;  2KOX A;  3NZU A;  3PRP B;  4LK0 M;  4H2A A;  3V62 A;  1WXM A;  1NDD A;  1SIF A;  2WDV B;  2WDR B;  4HXD A;  2E6X A;  2KNB A;  2ZVN A;  1U4A A;  1NEK B;  4PS3 A;  3RNC C;  3RMK C;  1WXS A;  3Q3O C;  2LMC A;  4A6Q A;  4LNF A;  2MHJ A;  3URY A;  1P7E A;  2WXN A;  3I3T B;  3SFD B;  1ZXI A;  3JSV A;  1T0Y A;  1EWY C;  1V97 A;  1ZW7 A;  4XE0 A;  5LNK 1;  2JT4 B;  3RPF C;  1WI0 A;  1WSP A;  2NPT A;  5KHO A;  1QQR A;  1JW9 D;  1RYJ A;  4AQ7 A;  2DEN B;  2LI5 A;  1IBX A;  5EE9 A;  3BK2 A;  2KJH B;  2AL3 A;  4XWW A;  3AEA B;  4MAC A;  2I1K A;  2QJL A;  1XXG A;  2CHW A;  3TEW A;  4GDK A;  1KLU D;  1OFF A;  1FPY A;  1G6J A;  1WH3 A;  2JRH A;  1GJZ A;  3BVG A;  4O1N A;  3OAW A;  4GSW A;  3GE8 C;  3W5U B;  4ANU A;  2YEP B;  1ET9 A;  4A9A A;  2XNA C;  2INP E;  3GE3 C;  1YN5 A;  4KX6 B;  1SJH D;  3WAO A;  1V9J A;  3OJ4 B;  1WM3 A;  1WRI A;  2AEH A;  5LXH A;  4WJO A;  3W5V B;  3WIM A;  4R3D A;  4BKS A;  2PVO D;  1YJJ A;  2JF5 A;  4IWP A;  1AW7 A;  5CX3 A;  1E8Y A;  5D6J B;  1PDX A;  1GNU A;  4HDO A;  2DZI A;  2AQ3 B;  4GDL B;  4AWJ A;  2K8C A;  1KJT A;  3B0A A;  2GOW A;  1WX8 A;  1J7A A;  2V0G A;  3QX1 A;  4F1S A;  3PLU A;  1LFD A;  3IXS A;  1TS3 A;  1YQ4 B;  1FIQ A;  2DHZ A;  1A5R A;  3KUZ A;  2H89 B;  3SR6 A;  4MGY E;  1V1P A;  2NMQ A;  3AEG B;  3SDL C;  2KTR A;  2D3G A;  2JRI B;  3ZW3 A;  2WXK A;  4CQN A;  5DPS A;  1D5M C;  2IGH A;  3HHM A;  2ICI A;  2JX5 A;  1FD6 A;  1FM0 D;  4KIK B;  2JZZ A;  1TIF A;  3Q8A A;  1N6Z A;  2JYT A;  1N62 A;  1Q5W B;  1E6E B;  4N58 A;  3DVG X;  1KRH A;  1TTN A;  3WAL A;  4MGI E;  1LXD A;  5BMG A;  3IHP C;  2RPQ A;  2J53 A;  4B6W A;  2L0T A;  4WAA A;  1PGA A;  3UQA A;  4WWP A;  4FHJ A;  1OQY A;  4OVU A;  2BT6 A;  2FUH B;  3Q3F A;  3QIJ A;  5L95 C;  4IWO A;  3DQV A;  2JZ3 B;  2PTL A;  2KDM A;  3T3N A;  1XLN A;  1D5Z C;  4BFR A;  1DGJ A;  2LXA A;  2Z0E B;  3NZ3 A;  1WE7 A;  1E10 A;  2O6V A;  2LUM A;  2AL6 A;  2MBQ A;  3RNE C;  2KWC A;  1LQB A;  3MC9 A;  3U8Z A;  2MLB A;  4RF1 A;  1BML C;  1PFD A;  2OOB B;  1EU4 A;  1WR6 E;  2K5P A;  3GB1 A;  3ZDM C;  2I2Y A;  3DBR B;  1WGY A;  2J42 A;  1ZPS A;  2JXX A;  2N1W A;  2MBB B;  1R4N I;  2V3P A;  4RGN A;  5E6O A;  2NS5 A;  4PYU A;  1UBI A;  5G5G A;  3QAQ A;  1QOF A;  1EUV B;  3DHG C;  2IJ0 A;  4XZ4 A;  1YJ1 A;  1L0V B;  4NAM A;  2DNF A;  1UBQ A;  4TQ1 A;  2IGD A;  2KK8 A;  1QOG A;  2R2O A;  2BF8 B;  1L4D B;  4NAW A;  3PSE B;  5D94 A;  3ETR A;  5BYQ A;  4ZOH C;  2LHE A;  2KKC A;  5JH5 C;  1J7B A;  1ET6 A;  4KDI C;  2CHX A;  3NY5 A;  5E6N A;  4IWQ A;  1BUI C;  3M95 A;  2IZV B;  3TEZ A;  1FXI A;  3H7P A;  4IM0 A;  2L05 A;  2MJ3 A;  2RD0 A;  3VUY A;  2IY0 B;  2M0A A;  3DBL I;  3P4Q B;  3RNG C;  4HVB A;  1TBE A;  1GOZ A;  2EKI A;  1ACC A;  2WWZ A;  3WAN A;  3N1X C;  5HG2 A;  2V3N A;  3UIP B;  3GZN B;  3AE7 B;  3ZNZ B;  1VDV A;  3VRB B;  1E9M A;  1WZ3 A;  4TMA B;  3L17 A;  3DDC B;  1IGD A;  5IA7 A;  3A1Q A;  3KWL A;  2LGS A;  1N61 A;  2QSD A;  4W9D A;  1F9J A;  5C2T B;  1YMH E;  1XCQ L;  4YTM B;  5FR3 A;  4JLC A;  2DZJ A;  1E7V A;  2YLM A;  1SE9 A;  1E8W A;  2KZR A;  2MX2 A;  2WX0 A;  1JRO A;  3N30 A;  3A9K B;  2KN4 A;  2ZZP B;  2PLP A;  2D10 A;  4WUR A;  2X8X X;  3EFC A;  3L4P A;  3EGR A;  2GI9 A;  3JVZ X;  2WU2 B;  3KLS X;  4ANW A;  1V5O A;  4W9J A;  1KLG D;  2L83 A;  3R7Q A;  1A70 A;  3UF8 A;  1UEL A;  1CJE A;  3OJ3 A;  4GN1 A;  1QLB B;  3C19 A;  2PVG C; 
#chains in the Genus database with same CATH homology
 5GXG B;  2OHF A;  3NVW A;  4DXF A;  3AEB B;  1C9F A;  3Q8E A;  2LJI A;  3W1S A;  1C78 A;  2G9H D;  3TUO A;  2DWQ A;  2E3T A;  2Y5P A;  1E0Z A;  4A8X C;  2LEK A;  2NTS A;  4ITK A;  3AE6 B;  1RM6 C;  2FE8 A;  4RCO A;  3R8B A;  4M0W A;  2JQR B;  2Y5C A;  2LHD A;  2D5G A;  4GDK B;  2BBC A;  1D5X C;  1VRA B;  3AB5 A;  1HQR D;  5D7G A;  1L4Z B;  2JU6 X;  1TJE A;  1JWB D;  2Y3A A;  1XLO A;  5I4D A;  3TEX A;  4YT0 B;  3ZQ4 A;  1JAL A;  3SFE B;  3SEB A;  3C8Y A;  2BS3 B;  3P42 A;  1AN8 A;  4IDI A;  4JPS A;  5HFY A;  4RFB A;  2DYO A;  1JML A;  2K9X A;  1EWC A;  3AV8 A;  3DWG C;  3VQI A;  1ESF A;  1MVK A;  4DXG A;  3P1M A;  3PZ7 A;  1WGK A;  1YNT E;  4USA A;  1BXT A;  3V05 A;  2KWD A;  1ZDX A;  4XWT A;  1SE3 A;  1FEH A;  4N6E B;  1D6E C;  1R7S A;  2WXF A;  3IAM 1;  3MP9 A;  3NVZ A;  1C76 A;  3TSS A;  1P7F A;  1DYQ A;  4JE3 B;  3AE1 B;  1KF6 B;  2BS2 B;  3ZJU A;  2ACZ B;  2IPK D;  3PO0 A;  2DYM A;  1F0Z A;  2BTE A;  4LLG M;  4MT5 A;  4YSY B;  2BS4 B;  3ZYY X;  4EE2 A;  2LFI A;  1XEE A;  4C56 C;  3U7Z A;  1XO3 A;  3BK1 A;  2W54 A;  2N7J A;  4US8 A;  3AH7 A;  2BYT A;  2WXR A;  1RFK A;  4LK0 M;  4H2A A;  1IUE A;  2WDQ B;  2VZK D;  2WXL A;  5G5H A;  3B2F A;  3T3O A;  1NI3 A;  2WDV B;  1V1P B;  2WDR B;  3BZD B;  2E6X A;  1NEK B;  1SSN A;  1ZUD 2;  3R2T A;  1C4C A;  3P4P B;  2LMC A;  1GAQ B;  4YXD B;  1ENF A;  1J7C A;  1K50 A;  3HVD A;  1JQ4 A;  3I57 A;  1SE4 A;  4ZRQ A;  3E9S A;  1QKZ A;  3FC4 A;  4A6Q A;  3URY A;  3ZGZ A;  1P7E A;  4ZHP A;  2M19 A;  1OQQ A;  3P4S B;  4P16 A;  1JWM D;  2M56 B;  2WXN A;  1B1Z A;  2HDE A;  3BWU D;  3SFD B;  1ZXI A;  3U52 E;  2W3R A;  4C80 A;  2OED A;  3NS1 A;  1FXA A;  2AQ1 B;  1EWY C;  2B76 B;  1V97 A;  4XE0 A;  2WU5 B;  3PZ8 A;  3GS2 A;  5LNK 1;  5D3I B;  4ARC A;  4AS1 A;  2WXQ A;  3RPF C;  1WSP A;  1HXY D;  3O13 A;  4J3O D;  1QQR A;  1JW9 D;  3NRZ A;  4A90 A;  1FNU A;  1RYJ A;  1VJK A;  3P63 A;  1SJE D;  2L1A A;  4AQ7 A;  2I38 A;  4HKZ E;  1IBX A;  5EE9 A;  3AN1 A;  4ARI A;  3BK2 A;  1FRR A;  3VR8 B;  4XWW A;  3AEA B;  4MAC A;  3LXF A;  5MPO A;  1N63 A;  2QJL A;  4ZHO A;  3EA6 A;  5HHD G;  1XXG A;  3TEW A;  1KLU D;  1OFF A;  4RH6 A;  5HI1 A;  4OVZ A;  1WXQ A;  1ZP0 B;  2HTM E;  3AE9 B;  3BVG A;  4O1N A;  4RNA A;  1WYG A;  5EE3 A;  1GB1 A;  3MHZ A;  4US9 A;  2RMM A;  3W5U B;  3CWI A;  4L23 A;  1N5X A;  2YEP B;  1ET9 A;  2RPV A;  2WXP A;  4A9A A;  2XNA C;  4HRS A;  2INP E;  2TSS A;  1QOA A;  1K52 A;  1YN5 A;  4KX6 B;  1E7P B;  1SJH D;  1HEZ E;  1WWT A;  1I4P A;  3N9Y C;  4C7Z A;  1WRI A;  4LTU A;  2WS3 B;  4WAF A;  2N9K A;  3W5V B;  4KKI A;  2V4I B;  2MEK A;  4R3D A;  1SE2 A;  2X38 A;  2KQ4 X;  2PVO D;  4TQ0 A;  3ZJT A;  1YJJ A;  3VRA B;  4D2K A;  2QIL A;  2WNM A;  1TYG B;  3ABV B;  1AW7 A;  1UUP A;  3BVZ A;  3KWV A;  3EUB 2;  1PDX A;  4TSS A;  4L1B A;  1NYQ A;  5C3J B;  3R2I A;  2AQ3 B;  4GDL B;  2QEJ C;  1K51 A;  1HA5 A;  3MC0 B;  3NUH B;  5E6J A;  1JCK B;  1JWS D;  1TZO A;  2AX5 A;  4DQO C;  1J7A A;  2V0G A;  1B9R A;  5FK9 C;  1TY2 A;  1YN4 A;  2WLB A;  3IXS A;  5BMI A;  1TS3 A;  2ONQ A;  1Q10 A;  1YQ4 B;  1FIQ A;  1EM7 A;  2NTT A;  2WXI A;  2H89 B;  3SR6 A;  1V1P A;  2NMQ A;  4NAW B;  1TS4 A;  3AEG B;  3TEY A;  1QF6 A;  4HKQ A;  3NVV A;  4NZL B;  1PYW D;  2WXK A;  3AE5 B;  4CQN A;  1D5M C;  2IGH A;  1L0Y B;  1FCL A;  4KGT A;  2FUG 1;  2ICI A;  1K53 A;  2JX5 A;  1FD6 A;  1HZ5 A;  1YJI A;  2JXT A;  3ZJV A;  2AQ2 B;  1L0X B;  2WXG A;  1FM0 D;  4OW0 A;  1C77 A;  2XN9 C;  5D3D A;  1M4V A;  3NVY A;  1TKE A;  1AWD A;  2LGI A;  2H88 B;  2K22 A;  2RDG A;  3MJ5 A;  3B2G A;  3Q8A A;  3U4E G;  1YN3 A;  2IDY A;  1PUT A;  2JYT A;  1N62 A;  2WXO A;  3LYY A;  2CJO A;  1UNS A;  1E6E B;  2PW9 A;  4N58 A;  3AEF B;  2ON8 A;  1KRH A;  3WCQ A;  5BMG A;  1XLP A;  2MH7 A;  2J53 A;  3CIR B;  1OQR A;  1KTK A;  1KFY B;  3W9C B;  4HRO A;  3HUI A;  1T6B X;  3AMZ A;  1PGA A;  2CU3 A;  3AEE B;  1C4P A;  1QOB A;  2BT6 A;  4WQM A;  1EU3 A;  2WQY B;  3Q69 A;  1I4H A;  1MI0 A;  2L32 A;  2VZK B;  2PTL A;  2KDM A;  2MJE A;  3T3N A;  1XLN A;  3GP7 A;  2DLB A;  2ZW1 A;  1D5Z C;  3UI3 A;  1AYF A;  4HEA 1;  1DGJ A;  3Q8B A;  1D4B A;  3NZ3 A;  3AED B;  3H8H A;  1KH0 A;  1SIJ A;  1F2R I;  1E10 A;  1RWS A;  2R61 A;  2LUM A;  5H8Y E;  3HRD D;  2J4X A;  1UGJ A;  3BYT B;  2RDH A;  1F2R C;  3DWM A;  4WIP A;  4RF1 A;  3Q8F A;  1BML C;  1PFD A;  3LB8 C;  4UDU C;  1SEB D;  2PMV A;  1VZ6 A;  2GRI A;  4RGT A;  2K3U A;  1EU4 A;  2K5P A;  3GB1 A;  2I2Y A;  1XLQ A;  1NVI D;  1Y56 A;  1YQ3 B;  3FAH A;  4Q2J A;  1DOY A;  2INN E;  2KAJ A;  1N60 A;  1JRP A;  2J42 A;  1JWA D;  1ZPS A;  3IAS 1;  2Z8L A;  3J9C A;  4XDC A;  1QIL A;  2KAC A;  2V3P A;  4RGN A;  4ZYS A;  4KGR A;  1FFU A;  5BYS A;  1GPX A;  2MJD A;  1I4R A;  5G5G A;  2WP9 B;  4RGO S;  1QOF A;  3VR9 B;  1IBX B;  1SBB B;  1TKY A;  4OZA A;  3V3X A;  2IJ0 A;  5H92 C;  1C4A A;  4OZC A;  1L0V B;  4L2Y A;  1SF0 A;  4NAM A;  2YEP F;  4TQ1 A;  2IGD A;  1UWM A;  4HJG E;  1QOG A;  4C7Y A;  1CK1 A;  3AE4 B;  3BYY B;  1T5X D;  1L4D B;  4KGS A;  2N0S B;  3BII D;  5FKA C;  3FIL B;  2BW2 A;  1VZ7 A;  2WXM A;  3ETR A;  1FRD A;  5BYQ A;  2JWU A;  3B9J A;  4ZOH C;  2GB1 A;  1V8C A;  4ZRP A;  2LHE A;  1QT9 A;  3OWE B;  4NJC A;  1ZDV A;  1TKG A;  1J7B A;  1ET6 A;  4JWS C;  2SAK A;  3W2D A;  2J52 A;  5BMH A;  1ZE3 D;  3AM9 A;  1BUI C;  4B0E A;  3TEZ A;  1T3Q A;  1FXI A;  4KKJ A;  4OHJ A;  2W3S A;  2BB6 A;  2DBY A;  4GLS C;  1SB3 C;  5EE1 A;  1TS5 A;  2MJ3 A;  2EEL A;  1MHX A;  2L52 A;  4YSZ B;  1L6V A;  2M0A A;  1MPE A;  3AE8 B;  1I4G A;  3P4Q B;  4A55 A;  3MFG A;  2W55 A;  1ZOY B;  4YSX B;  2CJN A;  2FBW B;  3KQ4 A;  4RGM A;  4IOI E;  2PKO A;  3BVM A;  1LO5 D;  2W82 A;  4B0M A;  1VZ8 A;  1PGX A;  1GOZ A;  5T8I A;  1FFV A;  2EKI A;  1ACC A;  3RFZ B;  3AE3 B;  2QIE B;  4P6V F;  1TY0 A;  1FMA D;  4FXC A;  2IGG A;  1GB4 A;  5BYR A;  1I7H A;  1ZXH A;  2KMM A;  5AUK A;  5HG2 A;  2V3N A;  1L5P A;  1UWX A;  2JSV X;  1FNW A;  2PIA A;  3AE7 B;  1VLB A;  1VDV A;  3VRB B;  1MHH E;  1E9M A;  4MM3 B;  5TSS A;  2BB5 A;  4TMA B;  5EE0 A;  1FCC C;  4IKG A;  1PGB A;  1IGD A;  4REZ A;  3IT6 B;  4N59 A;  1I4X A;  2JZP A;  5JXV A;  4YTP B;  1STE A;  2WXJ A;  1TS2 A;  2SEB D;  3KWL A;  4PT5 A;  2K0P A;  1IGC A;  4WWM A;  1N61 A;  2QSD A;  5C2T B;  1FO4 A;  4XDD A;  1YMH E;  1I4Q A;  1XCQ L;  3P4R B;  4YTM B;  1F77 A;  5FR3 A;  1NYR A;  2G1E A;  3U2S C;  2N9L A;  1XCT L;  3AEC B;  1XF5 L;  1HZ6 A;  3IT4 B;  4JX1 C;  1V1O A;  3Q8C A;  4MH8 A;  4RF0 A;  5AUI A;  2WXH A;  1JRO A;  4YWG G;  2KN4 A;  3I9V 1;  4YTN B;  2PLP A;  1ROE A;  1N5W A;  4WH4 A;  3AE2 B;  4OZB A;  4WUR A;  1CQV A;  1CZP A;  3EGR A;  1SXT A;  3L4P A;  1DOX A;  2GI9 A;  1VR9 A;  2WU2 B;  3KLS X;  1JWU D;  1DOI A;  2QMT A;  1KLG D;  2L83 A;  2ZW0 A;  3HVZ A;  2JYE A;  1A70 A;  4JWU C;  1L6U A;  1CJE A;  3E56 A;  1C79 A;  1FNV A;  2Q5W D;  3FIL A;  1QLB B;  2PVG C;  1NEN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...