1K53A

Monomeric protein l b1 domain with a g15a mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANASTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
molecule tags Protein binding
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k53A00
2N9LA 2ONQA 2KQ4X 5HFYA 2LUMA 2OEDA 2IGDA 1K50A 2ON8A 2KN4A 2EELA 4KGRA 2PLPA 1UWXA 1Q10A 2LGIA 1IGDA 2KDMA 4IOIE 2I2YA 1MI0A 1F2RI 2RPVA 2J53A 1QKZA 2JXTA 1IGCA 2GB1A 2QMTA 2N9KA 2K0PA 4OZBA 1MHXA 1PGAA 1HZ6A 2IGGA 2JU6X 2JZPA 1D4BA 2JWUA 2ZW1A 3UI3A 1GB1A 4D2KA 2J52A 2QSDA 1K51A 5HI1A 5JXVA 1C9FA 1MHHE 1PGBA 1HZ5A 1XCQL 4KGSA 4OZCA 4GLSC 1YNTE 3V3XA 1XF5L 2ZW0A 1K53A 4KGTA 3MP9A 5BMHA 1JMLA 2RMMA 5BMGA 1K52A 1IBXA 5HG2A 1IBXB 4HKZE 1F2RC 3GB1A 2LHEA 5BMIA 2KACA 1P7FA 1PGXA 3FILB 4HJGE 1GB4A 2GI9A 1YMHE 1ZXHA 4IKGA 2IGHA 1EM7A 1FD6A 1MPEA 1FCLA 2KWDA 2JSVX 2NMQA 4WH4A 1MVKA 1XCTL 5HHDG 2LHDA 4MACA 2PW9A 1HEZE 1P7EA 1FCCC 2PTLA 3FILA 1KH0A 4OZAA 2N7JA 2I38A
chains in the Genus database with same CATH superfamily
2M0XA 2K8BA 2EKIA 3ZXRA 4ICUA 3TMPB 4QAYA 2EELA 3UGBB 2H89B 2JUOA 1WGYA 4M00A 4W9IA 3RYTA 4FULA 4WWMA 3O13A 1TY2A 1ZGUB 2IO3B 2I2YA 2N9XA 4ICVA 2NS5A 3LB8C 4IW0A 2HJ8A 2N4FA 1WXMA 1SJHD 2K6DB 4GXBA 2AYOB 1I35A 2DZMA 2WLBA 4HKQA 2BYVE 2RPQA 3P42A 2BYEA 1FEHA 3ML8A 4JWSC 4GDKA 3UI3A 1AYFA 2V3SA 2KK8A 4LJOB 2QSDA 4UDUC 3B0AA 2ZPNA 4HPMB 4AJWA 4ZOHC 4LNKA 4JIOU 4J6IA 1V8CA 1VR9A 2ICIA 1OQQA 3Q14C 4BOSC 1OGWA 1JMLA 2RMMA 4EOYA 4KZCA 2I1KA 1DOIA 3DBHB 3MHSD 1JALA 4G0NB 3V6CB 5I4DA 4L1BA 4A90A 1BXTA 4ZYNA 3N20C 2V0GA 4HRSA 1XCTL 4A20A 2J0MA 4I6LB 1P7EA 2KJHB 2L05A 4US9A 4MEMA 1SSNA 2LD9A 1KFYB 2ONQA 2WDRB 2YVCA 4PYUA 3OAWA 1WXVA 2Y5BB 2WXJA 1KM7A 1S1QB 3IHPC 4LK0M 5BO4B 3N9YC 1NVID 5C3JB 1H8CA 3N3KB 1ZDVA 1NENB 3GE3C 2UU7A 4BKSD 3WAMA 2WXNA 3QC8B 1XQQA 5CHWA 4EZJA 5DPSA 1WRIA 4RGMA 1GPXA 1ISNA 1T3QA 4N6EB 1Q0WB 2GB1A 2BS3B 3IT6B 1UUPA 3HIZA 4KX6B 1PGAA 2Y5PA 3I63C 2W3SA 1E10A 1WX8A 4DK5A 3VTWA 1JWMD 2AEHA 2INPE 2B3AA 4OVVA 3C19A 3NZSA 3N1YC 2ZPYA 1K51A 1AN8A 2WXQA 3VH3B 4DXFA 2WU5B 4YTMB 4KV2A 4KGSA 1E8WA 4YWGG 3WALA 2FBWB 2KYWA 5D94A 1JWAD 3TEWA 4BKSA 1KTKA 3QA8A 4S0RA 1EUVB 2KFKA 3D32A 2JRHA 3U4EG 4FA6A 2QC8A 1XLQA 2V3NA 3HVZA 2DBYA 2YLMA 2CU1A 1CMXB 4LNIA 1TJEA 1FMAD 1J8CA 3KYDD 3ZO5B 3DBLB 3W1YA 1WJ6A 3WAOA 5CHVC 3GS2A 4A9AA 3U7DA 1EM7A 2K25A 2PVGC 2KTRB 5FR6A 3LXFA 4W9CA 1AWDA 2M19A 4MJSB 2MWSB 1OTRB 2WNMA 3E56A 3QQ8B 1J7AA 4JQWC 4WAFA 3R2TA 4II3B 3AXCA 2KQ4X 1WYWB 3SHQA 3W5VB 3Q8CA 3AECB 5DCNA 1P0RA 2KN4A 2LZ6A 4LTUA 2HTME 3PRZA 2BB6A 5LLIA 1F77A 3UIPB 1EU3A 5AUKA 3AE6B 3PRPB 3RMKC 4KVGB 2WXIA 4EE2A 2D3AA 1NI2A 4OVZA 4XX5A 4HLEA 3Q8FA 4ACFA 1SIJA 5E6JA 3QIJA 3W1SC 3IAM1 3AE3B 1D5XC 1HA5A 1VLBA 1I4GA 4II2B 4MH0E 2W55A 1UNSA 3IAS1 3AE5B 3UINB 4E71A 2KMCA 3UQBA 4ZRIA 1I4QA 2KFJA 5JHAA 1D3ZA 2PJHA 1WY8A 4WJOA 5AZFA 2Z8LA 2IO2B 2NCNA 2KACA 1VDVA 2FE8A 5EE3A 4KKIA 2ACZB 4MH8A 1PGXA 1SGHA 1GB4A 4WJNA 1D5ZC 2W54A 2KLCA 3A4RA 2LGXA 2FNJB 1BMLC 3P4QB 5D2MB 2KLGA 4CQNA 2BVCA 2KWDA 3EA6A 3P4PB 4K3CA 1OQRA 1HTOA 3VUYA 3HVDA 3RNFC 3AE4B 2N1VA 2CS4A 2RR9A 2BS4B 4ARIA 2WXGA 5IAAC 4HVBA 1FFUA 2L00B 3U52E 1CJEA 2SAKA 4FXCA 3DHHC 4YXDB 4BOZB 1Q10A 2LVQA 2KJ6A 1V6EA 4REZA 2BYFA 1QF6A 3M3JA 3B9JA 3H7SA 3KH0A 2JX5A 2DZIA 3DBSA 1D4BA 4WWNA 4PS7A 3R3MA 4GDKB 1M4VA 1AARA 1E5WA 1KRHA 1PGBA 2K6QA 1JWSD 2NBWB 5E6PA 2BW2A 4A55A 1VZ8A 2TSSA 5L83A 4MELA 4M8MA 2C7HA 3AI5A 4ZRJA 1T6BX 2KDIA 3ZRFA 1WZ3A 1DOYA 3NVZA 1UWMA 3E9SA 3VTVA 1YN3A 2KWUB 3HK0A 5J2RA 3PS6A 4ASWC 2MHJA 1LFDA 3ZW3A 2LJ5A 1YOVB 5AUIA 2KHWB 3PHXB 3ZDTA 2JYTA 4OW0A 2BBCA 3NY5A 3P1MA 1YJ1A 3RI7C 2LEKA 5AZHA 1FO4A 2D11A 1JRUA 2KAJA 2NMQA 2Z0EB 3U8ZA 1CQVA 2INDC 1GG3A 2N9PC 5AEKB 1RRBA 4AWJA 2IPKD 1V1OA 1ZOYB 2MBHA 2CKHB 3SD5A 3TBLD 4F7ZA 4AQ7A 4OZAA 4YTPB 3TJPA 2L32A 3S2AA 2N9LA 2MJ3A 4K7UA 1K50A 2KTRA 3RD2A 4FHJA 3NJTA 1SE2A 4M01A 5KHOA 5BYQA 3VRBB 2LI5A 4YSZB 1X1MA 2OOBB 5IP4D 2NBVB 5DPRA 1E9MA 1QOGA 5AZGA 3DCGA 1J7CA 3MC0B 3L4PA 5C2TB 2W9NA 4JGHB 1MI0A 2G3QB 1E7PB 2M4NA 4MDKE 2MRPA 2E6XA 3IXSA 3Q3FA 3NRZA 1GUAB 2RDBC 4IWOA 3R7RA 3UQAA 1XEEA 1EWYC 4OZBA 2IGGA 2DYBA 3NVYA 5T8IA 3HM3A 1HTQA 1Z2MA 5DPTA 3DDCB 1STEA 4IM2A 2MP2A 3MTNB 1C79A 3TSSA 3Q8EA 1JWBD 1JW9D 1KLGD 3NVWA 4LNNA 3RNBC 1R7SA 4S17A 1E7VA 3PZDA 1LM8B 4FJYA 3ONSA 1C4AA 4AJYB 3MC8A 4W9JA 2WDVB 2WXMA 4AP4C 4FJZA 2WHIA 2HD5B 1E0ZA 4DQOC 3AEDB 1DYQA 2V9HA 4P1BC 2KFKB 3EFUA 4NPNA 2DZKA 3GB1A 5E6OA 2MEKA 1FM0D 2LGDA 5MPOA 4JLCA 5D3DA 1ZXHA 2CR5A 2LVPA 2KC1A 4G50A 3PHWB 2AX5A 4TMAB 5IOIA 3M62B 3TEZA 1MPEA 2KDEB 3QCAA 2K1FA 3T3NA 1G6JA 1UELA 4NJ6A 4GU2A 4EZLA 4MGKE 5GXGB 2GMIC 3BYTB 2PTLA 1D6EC 4NQKE 1R4MI 5HFYA 3BVZA 3L08A 5JHBA 4WURA 3RT3B 3MC9A 4DHZB 2BF8B 1F1HA 4C7YA 4KGRA 3Q3JA 4LJPB 3A9KA 1L6VA 2INNE 3VR8B 2HDEA 1L0XB 2L8JA 2V4IB 3ZKJC 2WXOA 3V62A 5FK9C 3UF8A 1XXGA 1QOBA 3IT4B 1GNUA 1RWSA 2K0PA 1QLBB 2LGSA 1XO3A 2JU6X 1E8YA 1MFWA 3SEBA 4A8XC 4P16A 3AE9B 2ZW1A 1NI3A 3H7PB 4K3BA 4WJPA 2X38A 2OHFA 2D2QA 1E90A 5D7GA 1C77A 2AL3A 2IZVB 4W9DA 3HRDD 2WS3B 1L0VB 3RNEC 3VH4B 2GBNA 1NBFC 1IBXA 1PUTA 4HKZE 4ANWA 3Q3NC 5BMIA 1YQBA 5J18A 3EHVA 2REXA 3U7ZA 1YMHE 4BKTA 4MM3A 4RF0A 2PE9A 1FD6A 2FCNA 4DHJB 1V1PA 4B0MA 1SE4A 3N1ZC 3I57A 2VRRB 4LNOA 3BY4B 3TIXA 2RSUA 3B2FA 4BFRA 2LHDA 4MACA 4LNFA 2KWCA 2PKOA 2XBBC 3X0WA 1ZKHA 2KVRA 1SE3A 1FNVA 1XLNA 4IUMB 2I38A 1IP9A 1BUIC 1FIQA 4KDIC 4WAAA 1UGMA 3RNGC 2GBMA 3IFWB 1WJNA 1VD2A 1KOTA 3WCQA 2KDMA 3JW0X 4JWUC 2CHWA 5CHFA 4IOIE 1ROEA 2NTTA 1JRPA 4A3PA 1WGDA 4FN2A 4FJVB 4RH6A 2C5LC 1EF5A 3GE8C 4MGYE 4KIKA 2K9XA 2M17A 3CIRB 5G2NA 3H1UA 3PVLA 3W1SA 1C1YB 4GDLA 3RNCC 4C80A 1MG4A 2O6VA 3ZXVA 3APDA 2PVOD 3AU5A 4EFOA 4L23A 3Q6BA 1WI0A 1NDDA 3A33B 3PO0A 1E8XA 2D3GA 4BBNC 3BK2A 3RUIB 4BAXA 2RDGA 3H9DA 2ZEQA 4B95A 2BPSA 5JH5C 4P6VF 3ZUNA 1UGJA 2GI9A 4KSLC 2BWFA 4C56C 2XK5A 1C78A 1CK1A 3A4SC 2KC2A 1WGRA 1YX6B 2KDFB 1TS3A 1K8RB 4US8A 3KWLA 1FNUA 2KOXA 2D5GA 4AUQC 2PEAA 4DBGA 1QT9A 1U4AA 4NAMA 4TQ0A 2XEWA 2MA9B 2MJDA 4RCOA 2BB5A 3J9CA 3ZLZA 5D6JB 4GN1A 4Q2JA 4XWTA 4LLGM 4IWPA 2D10A 2LUEA 2IJ0A 2LUMA 2QDFA 2IO1B 2WXHA 2IDYA 2HTHA 2ASQA 4N58A 3EGRA 1V80A 3KWVA 2L52A 5L95C 3DQVA 2A5UA 4PK1A 5GMVA 1T0SC 1TTNA 3L13A 1SEBD 2ZNVC 1YN5A 2G1EA 1M94A 3N1XC 2JZ3B 2C7MB 3K9PB 4KKJA 3L10B 2INCC 3CSTA 3SFEB 2KTFA 3V61A 2I1JA 2MP2B 2FUG1 2J52A 5HI1A 1N62A 5JXVA 3R66C 3T9LA 1YJJA 1I4RA 1E8ZA 2W3RA 2RDHA 4IC7B 1YIWA 2H88B 3ZNID 3V3XA 2J0JA 2JVCA 1S3SG 3IVFA 1XD3B 1V5OA 3H7PA 1Q5WB 4DHJD 3CSFA 2MBBB 1ET9A 1SE9A 1B1ZA 4MGIE 3FILB 3AE7B 4HJGE 4XDDA 3L54A 1WH3A 5D3IB 3HHMA 3LJ3A 5H8YE 1UBIA 3T8MA 4XE0A 3NS8A 4HDOA 2L3ZA 4GB9A 2Q5WD 4HK2A 4K81A 4HDQA 1FCCC 3NOBA 1ZDXA 3RNAC 2JF5A 5TSSA 3R2IA 2N7DA 1TIFA 1Y8RC 2LXCA 1E7UA 4ZRQA 4YSXB 4LCDE 4AOFA 2FIFA 2KQSA 1L4DB 5H92C 3FC4A 3HM6X 2RD0A 5DPWA 2R2OA 3A9KB 2WDTB 2GBKA 2DX5B 2K3UA 4USAA 1N61A 3RZFA 3B1LX 3QWZB 4PS8A 4WQOB 3AEBB 2BWES 3BINA 5CX3A 3DBRI 2NPTA 1MHXA 1WR1A 1VZ6A 2IO0B 3DWGC 3Q8BA 4PYZA 2JWUA 2KZRA 3VTUA 2N1WA 1EWCA 1LGRA 1WX9A 3RPFC 1C9FA 2JZZA 4W9HA 2K39A 3JVZX 2KD0A 4F8CB 1TZOA 3PT2B 2RGFA 4OZCA 1F52A 4W9FA 1K53A 3T3OA 1IBXB 1I4XA 4ARCA 2LVOA 2WGSA 5EDSA 1EF1A 1WX7A 1T0YA 3W2DA 4JX1C 2JPHA 1WYGA 2Z59B 2N0SB 2EMTA 3URYA 3TEXA 4MM3B 2K8CA 4ZRKA 2QCZA 1V1PB 3A1QA 2M1MA 2EMSA 2KDBA 1D5MC 3VVWB 3OG5A 1N6ZA 3SFDB 4JE3B 1KH0A 2BKRB 2WXKA 2G4DB 2MW5A 1AW7A 3PRMB 2KO3A 2R2QA 2YEPB 1R4NI 4HEA1 2QEJC 1UWXA 1TKEA 2K5PA 2KJRA 4FLHA 2WDQB 2DENB 1RAXA 3P4SB 5KHQA 3MFGA 4OHJA 3A9JA 2YEPF 3KYCD 1WZ0A 2QMTA 2N9KA 2R61A 3GZNI 4PS3A 4KIKB 2E3TA 1L7YA 3ZIMA 3AEFB 3BIID 4RM8A 3NZUA 1RYJA 2W82A 1JQ4A 3AEAB 1SF0A 1V86A 4GDLB 4OVUA 4M02A 4RFBA 1MHHE 1E6EB 1GAQB 1FXIA 1HZ5A 1WXQA 2MBOA 1P1AA 2LFIA 2O6VB 3EC8A 3RFZB 1XCQL 4ZRPA 3U2SC 5C23A 2KX3A 4PT5A 2WX0A 3QAQA 1VJKA 5BMGA 1FXAA 3UIOB 1WR6E 4NNJB 2HE7A 1N60A 2BQQA 3KQ4A 3N30A 1GOZA 1PYWD 2L0FA 2KN5A 1WIAA 2XK5B 4IG7B 1ZXIA 2J7QB 3ML9A 3PV1A 5HHDG 3AV8A 3PPAA 3ZRCA 3CMMB 1VRAB 1FXTB 4IWQA 3AH7A 3FILA 3TUOA 3GOEA 2ZJDA 1TS5A 3ZJTA 1PFDA 2BS2B 2D3BA 1VCBA 4C4VA 3PZ8A 4WIPA 3VHTC 2M0AA 2LGIA 3Q69A 2IYDB 1WM3A 3I5JC 1SBBB 1XLOA 2XNAC 4W9GA 5IA7A 1WSPA 1A70A 1C4PA 4NAWA 4A3OA 1WGHA 1Q1OA 4A6QA 3Q2AC 4TV3A 3AB5A 4G11A 1QKZA 2J53A 3PSEB 4NY0A 4RMAA 3AE8B 1ZW7A 3I9V1 4ITKA 3PTFC 3DBHI 1HZ6A 3VFKA 4TUUA 3NZ3A 2B76B 5FR3A 3ECIA 2GBJA 2WXLA 3HUIA 3JSVA 4B9KA 2FCSA 1V97A 4N9F4 3H6NA 2LRUA 5LNK1 1RFKA 3R8BA 4W9EA 3AEGB 4CYEA 2C7NB 3BZDB 3B08A 3N32A 4BZAA 4KGTA 5BMHA 4X57B 1C4CA 3V05A 2EKEC 4RM9A 2M8SA 3PGEA 2LJIA 3M95A 3RN9C 2WXFA 1JCKB 1I4HA 2BT6A 1V5TA 3SR6A 3U30A 3AEEB 3V6EB 2IGHA 1J19A 3M63B 2V3PA 4P1CC 1I42A 2Y3AA 2KMMA 2FIDA 2JSVX 4K7SA 3ZVVA 1MVKA 2BTEA 1FFVA 3QK0A 3KVFB 2V4LA 1WXSA 4HJKA 3ZTDA 5C1ZA 1EO6A 1UBQA 5EE1A 1MJDA 1GC7A 1TT5B 2MX2A 3Q3MC 2CJNA 1TY0A 2PIAA 4ZHOA 3KUCB 5EE0A 1YX5B 1WFYA 4AS1A 2OEDA 1YN4A 2IGDA 2KT7A 3AMZA 3QJZA 1P98A 4RGNA 1YJIA 1Z5SB 2JXXA 3BVMA 2AQ1B 1TKYA 2LASA 2HJ1A 2NR2A 1J7BA 3EECA 4NJ7A 4MSQB 1LQBA 3ETRA 3Q8AA 4WWPA 2NTSA 3DBLI 2NPTB 2O6VD 2PE6B 4K1RB 2D07B 3DOWA 3I3TB 2GBRA 2MQJA 1QOFA 3ZTCA 2G4SA 2L83A 3QHTA 3CWIA 3WAPA 1R4MB 1SJED 3FAHA 4DXGA 3ZNHB 3P2BA 4XZ4A 1HE8A 4NJCA 2O2VA 4GGQA 1IPGA 3ZQ4A 1WMHA 4DDID 3DVGX 2LMCA 1V2YA 1PDXA 1IUEA 4ANXA 1ZPSA 3ENEA 1F0ZA 3BWUD 1OEYA 4N59A 2VZKB 1XLPA 2LHEA 2PMVA 2XN9C 4XC2A 2ZCCA 1GJZA 2BYTA 2KVZA 1UF0A 2JY6A 4CO7A 3VUXA 4XYCA 4XGAB 4J3OD 3C0RB 4MT5A 1FCLA 2FAZA 4ZYSA 1QQRA 3A1QB 2GLSA 2LXAA 3QX1A 2PW9A 1FPYA 2L76A 2MJEA 5IKCM 1YQ4B 4ZDVA 1L6UA 2DAFA 4NQLB 3VR9B 1SXTA 4DXAB 2VH1A 4KZ0A 4EZKA 4E3CA 2K22A 1L0YB 4E74A 3H8HA 3TL5A 3DVNV 4DHZE 1ZE3D 1YD8U 2ZCBA 4M0WA 2UYZB 1IGDA 1WF9A 3K9OB 3WA0A 2WWZA 4W9LA 1I4PA 2WXRA 1P9DU 1N5WA 4WQMA 1XT9B 2ZVNA 1IGCA 5BYSA 1RLFA 3A9JB 1OQYA 2KX0A 3LDZE 3AM9A 2Z0DB 4MGZE 3W9CB 1WGKA 3RULA 1QILA 3OLMD 4D2KA 1IYFA 4IM3A 3W5UB 2FCMA 2PPHA 4LDTD 5BYRA 5G5HA 1J0GA 5LXHA 4I6PA 3X23A 3ZDMC 2MSED 3ZJUA 1XF5L 3DPDA 1DGJA 2GRIA 3KUZA 4M8NA 4MSMB 4RGOS 1KJTA 5HG2A 2K8HA 3BVGA 1NEKB 2KQ7A 1UD7A 4B0EA 2Y5CA 4IDIA 4TSSA 3L16A 1T0QC 5J17A 1WM2A 2MH7A 2WP9B 1Y56A 3FKYA 4TKNA 3L17A 4KDLB 1OEYJ 1UZXB 4HCNB 4GIVA 2LGYA 3GP7A 2N7EA 2N9EB 2L7RA 3V60A 4I6NB 2ZZPB 3MHZA 3NUHB 1A5RA 1WJ4A 3EUB2 2ON8A 4C4VB 3OWEB 4G3XB 2D3CA 2PLPA 1L5PA 2ZVOA 4DDGD 4ZHPA 1L2NA 1ENFA 4NAWB 2JT4B 2JXTA 3Q3OC 3BK1A 4HROA 2SEBD 1V9JA 3DWMA 1QZEA 3PREA 3ZGZA 3PLUA 3JSVB 1WGGA 1MG8A 2WX1A 3TEYA 1TGZB 4EKUA 1F9JA 1TKGA 3ABVB 1B9RA 2BKFA 4XDCA 2CHXA 2VZKD 2OJWA 2UWQA 4P7IA 3MP9A 1NYQA 4WWOA 2JQRB 2CU3A 1P7FA 2G9HD 4K7WA 5EE9A 2V1YA 3LYYA 4WJQA 3PLVA 1LO5D 2WQYB 1WE7A 4BBNF 1PQSA 1WWTA 2VH2A 3WIMA 1V81A 4BKGA 4W9KA 2KKCA 3DVGY 2KMAA 4WH4A 3VQIA 1NYRA 2CJOA 4R3DA 5LXIB 5IO9A 4HXDA 1FNWA 2AL6A 5G5GA 2DNFA 2QILA 4XWWA 3O65B 1T0RC 2DYOA 1WJUA 1L4ZB 1ZP0B 4YL8A 5JZEB 4BVUC 2LRWA 3ZNZB 2WYQA 2NVUI 1JROA 2IY1B 4EEWA 2MBQA 1ACCA 1T5XD 1I7HA 1KF6B 2ZNVB 3AE1B 2BGFA 3IBEA 2G45B 4RF1A 4YT0B 3NVVA 1HXYD 4B6WA 3DVNU 3BYYB 3B2GA 1V49A 2JZPA 2WXPA 4JL9A 1BT0A 2C60A 1KLUD 1EU4A 3KW5B 1GB1A 1ESFA 2DWQA 4NZLB 1N5XA 3SU8X 1RM6C 1C3TA 4RGTA 4O1NA 4EUTA 2LWPA 2JRIB 4GLSC 2CHZA 1TS4A 3R7QA 2MLBA 2O2VB 2DZJA 3VDZA 1RFAA 1WMHB 5IN7A 2ZW0A 3EFCA 3QARA 4TQ1A 1ET6A 1K52A 4CHKA 1VZ7A 1F2RC 2MBEA 4C7ZA 2DYMA 3DBRB 1N63A 1LXDA 1TYGB 4IKGA 4ANVA 4HPPA 4RNAA 3VAWA 1C76A 2DLBA 2JWZA 3APCA 2FUHB 1P3QU 2KANA 4MJSA 2J4XA 3ALBA 3KUDB 4C00A 3AU4A 2NBUA 2QIEB 3PZ7A 2J42A 3RCZA 2L1AA 4ANUA 4IM0A 2DAJA 2N7JA 5HKHA 3KLSX 3OJ3A 2J0KA 3P63A 3TCAA 1ZUD2 3AE2B 3IG3A 1FRDA 1UH6A 4URKA 3AULA 1FRRA 3JYUA 2A4ZA 1WE6A 3NG0A 2QHOA 4HCPB 1JWUD 1SIFA 2DHZA 4L2YA 4M0WB 4HPLB 1TBEA 2FCQA 3MJWA 4F1SA 3P4RB 1DOXA 1F2RI 2KXJA 2RPVA 2C9WB 3MJ5A 4YTNB 1TZ1A 2OJRA 5FKAC 1GC6A 3ZJVA 1KLVA 3VRAB 2AQ2B 2GOWA 1SB3C 4FBJB 1H4RA 1WXAA 2M56B 2AWTA 1R4NB 2L0TA 1YNTE 3ZNGC 1WRDB 2WU2B 3NHEB 3DHIC 3DHGC 5E6NA 3L0WB 3ZYYX 3SDLC 3APFA 5CTRC 3AN1A 1OFFA 2IY0B 4H2AA 2QJLA 4GSWA 2KWVB 2JYEA 3GZNB 4GMVA 2KNBA 3CF6E 4DWFA 2X8XX 4KSKC 2IBIB 3C8YA 1HQRD 1YQ3B 4GOCA 4YSYB 2AQ3B 5G55A 4FHKA 3VUWA 3OJ4B 3RZWC 4HWIB 3VXWA 4LDTB 3WANA 4JPSA 4FADA 3NS1A 1HEZE 1TS2A 2MCNB 5TR5A 1CZPA 1QOAA
chains in the Genus database with same CATH topology
2K22A 2N9LA 1L0YB 2MJ3A 2EKIA 4ZRQA 1K50A 4YSXB 3H8HA 5BYQA 3VRBB 1SE2A 2EELA 4YSZB 2H89B 1ZE3D 1L4DB 5H92C 3FC4A 1E9MA 4M0WA 1IGDA 1QOGA 1J7CA 3MC0B 4WWMA 3O13A 3L4PA 1TY2A 5C2TB 1I4PA 2WXRA 2K3UA 2I2YA 4USAA 1N5WA 4WQMA 1N61A 1MI0A 1E7PB 3AEBB 3LB8C 1IGCA 5BYSA 2E6XA 3IXSA 3NRZA 1SJHD 1XEEA 1EWYC 3AM9A 1MHXA 4OZBA 2IGGA 1VZ6A 3DWGC 3NVYA 2WLBA 3Q8BA 5T8IA 4HKQA 3P42A 1WGKA 3W9CB 1FEHA 1STEA 1QILA 2JWUA 4JWSC 3TSSA 1C79A 3UI3A 1AYFA 3Q8EA 4D2KA 1EWCA 1JWBD 1JW9D 1KLGD 2QSDA 3NVWA 4UDUC 3RPFC 3W5UB 1C9FA 1R7SA 5BYRA 1C4AA 1TZOA 5G5HA 4OZCA 2WDVB 2WXMA 4ZOHC 3ZJUA 1E0ZA 4DQOC 3AEDB 1DYQA 1XF5L 1K53A 1V8CA 1VR9A 2ICIA 1OQQA 3T3OA 1DGJA 2GRIA 1JMLA 2RMMA 4RGOS 5HG2A 3BVGA 1IBXB 1I4XA 4ARCA 1NEKB 3GB1A 2MEKA 4B0EA 2Y5CA 1FM0D 4IDIA 1DOIA 4TSSA 5MPOA 1JALA 4JX1C 1ZXHA 5D3DA 1WYGA 3W2DA 2N0SB 3URYA 2MH7A 3TEXA 4MM3B 2WP9B 1Y56A 5I4DA 2AX5A 4TMAB 4L1BA 4A90A 3TEZA 1MPEA 1BXTA 3T3NA 1V1PB 2V0GA 4HRSA 1XCTL 1D5MC 5GXGB 3GP7A 1P7EA 3BYTB 2PTLA 4US9A 1D6EC 3SFDB 4JE3B 1KH0A 1SSNA 2WXKA 1KFYB 3MHZA 3NUHB 2ONQA 2WDRB 5HFYA 1AW7A 3BVZA 2WXJA 3EUB2 2ON8A 4LK0M 4WURA 2YEPB 3N9YC 1NVID 3OWEB 5C3JB 4C7YA 4HEA1 4KGRA 1ZDVA 2QEJC 2PLPA 1L5PA 1NENB 1UWXA 1TKEA 2WXNA 1L6VA 2K5PA 2INNE 2WDQB 1WRIA 4ZHPA 1ENFA 3VR8B 4NAWB 2HDEA 4RGMA 1L0XB 1GPXA 3P4SB 2JXTA 2V4IB 3MFGA 4OHJA 1T3QA 2WXOA 2GB1A 2YEPF 4N6EB 3BK1A 2BS3B 2QMTA 2N9KA 5FK9C 1XXGA 1QOBA 2R61A 3IT4B 1RWSA 1UUPA 2K0PA 1QLBB 3IT6B 4HROA 2E3TA 4KX6B 1PGAA 2Y5PA 2SEBD 2W3SA 3AEFB 3BIID 3DWMA 1XO3A 2JU6X 1E10A 3SEBA 1RYJA 2W82A 4A8XC 4P16A 1JQ4A 3AE9B 1JWMD 3AEAB 2ZW1A 2INPE 3ZGZA 1SF0A 1NI3A 4GDLB 4RFBA 1K51A 1AN8A 3TEYA 2WXQA 2X38A 1MHHE 1E6EB 2OHFA 4DXFA 1GAQB 1HZ5A 1FXIA 1WXQA 2WU5B 2LFIA 5D7GA 4YTMB 1TKGA 3ABVB 3RFZB 1B9RA 1XCQL 4KGSA 4ZRPA 3U2SC 4YWGG 2FBWB 1C77A 4XDCA 1JWAD 2VZKD 3HRDD 3TEWA 1KTKA 2WS3B 1L0VB 3U4EG 1XLQA 4PT5A 2V3NA 3HVZA 2DBYA 3MP9A 1VJKA 1NYQA 5BMGA 1IBXA 1FXAA 1TJEA 2JQRB 1FMAD 1PUTA 4HKZE 5BMIA 2CU3A 1P7FA 2G9HD 1N60A 5EE9A 3LYYA 3KQ4A 3U7ZA 1YMHE 3GS2A 1LO5D 1GOZA 1PYWD 2WQYB 4A9AA 4RF0A 1WWTA 1EM7A 1FD6A 2PVGC 1V1PA 3LXFA 4B0MA 1SE4A 1ZXIA 3I57A 4WH4A 1AWDA 3VQIA 1NYRA 2CJOA 2M19A 4R3DA 3B2FA 3AV8A 5HHDG 2LHDA 4MACA 1FNWA 5G5GA 2PKOA 1VRAB 2WNMA 3E56A 1SE3A 1J7AA 3AH7A 1FNVA 3FILA 1XLNA 2QILA 4WAFA 4XWWA 3R2TA 3TUOA 2DYOA 2I38A 1TS5A 2KQ4X 1L4ZB 1BUIC 1ZP0B 3ZJTA 1FIQA 1PFDA 2BS2B 3W5VB 3Q8CA 3AECB 2KN4A 3PZ8A 4WIPA 4LTUA 1JROA 2M0AA 2HTME 2LGIA 3WCQA 3Q69A 2KDMA 4JWUC 2BB6A 1SBBB 1ACCA 1T5XD 1XLOA 1I7HA 2XNAC 4IOIE 1KF6B 1ROEA 2NTTA 1JRPA 1F77A 1WSPA 1A70A 1C4PA 3AE1B 1EU3A 5AUKA 4A6QA 4RH6A 3AB5A 2J53A 1QKZA 3AE6B 3AE8B 4RF1A 3I9V1 4YT0B 3NVVA 2K9XA 1HXYD 3CIRB 4ITKA 3BYYB 2WXIA 4EE2A 1HZ6A 3B2GA 3NZ3A 4OVZA 2B76B 2JZPA 2WXPA 5FR3A 3W1SA 3Q8FA 1SIJA 1KLUD 2WXLA 5E6JA 3HUIA 1EU4A 1GB1A 1ESFA 2DWQA 3IAM1 1V97A 4NZLB 3AE3B 1D5XC 1HA5A 1N5XA 4C80A 1VLBA 1I4GA 5LNK1 1RM6C 1RFKA 2W55A 3R8BA 4RGTA 1UNSA 2PVOD 3IAS1 4O1NA 4L23A 3AE5B 3AEGB 4GLSC 1I4QA 1TS4A 3PO0A 3BZDB 2ZW0A 3BK2A 4KGTA 4TQ1A 5BMHA 2RDGA 1C4CA 1ET6A 1K52A 3V05A 1VZ7A 2Z8LA 1F2RC 4C7ZA 2DYMA 1VDVA 2FE8A 2KACA 5EE3A 2LJIA 2ACZB 4KKIA 1N63A 1PGXA 2WXFA 4MH8A 1JCKB 1I4HA 2BT6A 4P6VF 1UGJA 1TYGB 3SR6A 1GB4A 2GI9A 3AEEB 4IKGA 1D5ZC 2W54A 2IGHA 4C56C 4RNAA 1BMLC 2V3PA 1C78A 1C76A 3P4QB 2DLBA 1CK1A 2Y3AA 1TS3A 2KMMA 4CQNA 4US8A 2KWDA 1FNUA 2JSVX 3KWLA 2D5GA 3EA6A 1MVKA 2BTEA 1QT9A 1FFVA 2J4XA 4NAMA 4TQ0A 3P4PB 2QIEB 2J42A 2MJDA 3PZ7A 2BB5A 3J9CA 4RCOA 5EE1A 1OQRA 2CJNA 1TY0A 2L1AA 2PIAA 4ZHOA 3HVDA 3AE4B 4Q2JA 4XWTA 2N7JA 5EE0A 2BS4B 4ARIA 3KLSX 2WXGA 4LLGM 4AS1A 3P63A 1FFUA 1YN4A 2IJ0A 2IGDA 1ZUD2 2LUMA 2OEDA 1FRDA 3AE2B 1CJEA 3AMZA 3U52E 2WXHA 2SAKA 2IDYA 4FXCA 1FRRA 4RGNA 1YJIA 4YXDB 4N58A 3EGRA 1Q10A 4L2YA 1JWUD 3KWVA 2L52A 3BVMA 2AQ1B 1TKYA 4REZA 1J7BA 1SEBD 1QF6A 3P4RB 1DOXA 1F2RI 3ETRA 2RPVA 3Q8AA 1YN5A 3MJ5A 4YTNB 2G1EA 3B9JA 2NTSA 4KKJA 5FKAC 3ZJVA 3SFEB 2JX5A 3VRAB 1D4BA 2AQ2B 1QOFA 2L83A 4GDKB 3CWIA 2FUG1 1M4VA 2J52A 5HI1A 1N62A 1SB3C 5JXVA 1KRHA 1SJED 1PGBA 3FAHA 4DXGA 1JWSD 1YJJA 2M56B 2BW2A 1I4RA 4A55A 1VZ8A 2TSSA 2RDHA 2W3RA 4NJCA 1YNTE 2H88B 2WU2B 3V3XA 3ZQ4A 3ZYYX 2LMCA 1T6BX 1PDXA 1DOYA 1IUEA 3AN1A 1OFFA 3NVZA 1UWMA 1ZPSA 2QJLA 1YN3A 3E9SA 4H2AA 1F0ZA 3BWUD 2JYEA 4N59A 2VZKB 1XLPA 2LHEA 1ET9A 2PMVA 2XN9C 1B1ZA 2BYTA 3FILB 3AE7B 4HJGE 4XDDA 5AUIA 5D3IB 3C8YA 1HQRD 1YQ3B 2JYTA 4OW0A 4YSYB 5H8YE 2AQ3B 2BBCA 3P1MA 4XE0A 4J3OD 4MT5A 1FCLA 2LEKA 1FO4A 4ZYSA 1QQRA 2KAJA 2NMQA 1CQVA 4JPSA 2Q5WD 2PW9A 3NS1A 2IPKD 2MJEA 1HEZE 1YQ4B 1L6UA 1FCCC 3VR9B 1V1OA 1ZOYB 1SXTA 1TS2A 1ZDXA 5TSSA 3R2IA 4OZAA 4YTPB 4AQ7A 1CZPA 2L32A 1QOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N9L A;  2ONQ A;  2KQ4 X;  5HFY A;  2LUM A;  2OED A;  2IGD A;  1K50 A;  2ON8 A;  2KN4 A;  2EEL A;  4KGR A;  2PLP A;  1UWX A;  1Q10 A;  2LGI A;  1IGD A;  2KDM A;  4IOI E;  2I2Y A;  1MI0 A;  1F2R I;  2RPV A;  2J53 A;  1QKZ A;  2JXT A;  1IGC A;  2GB1 A;  2QMT A;  2N9K A;  2K0P A;  4OZB A;  1MHX A;  1PGA A;  1HZ6 A;  2IGG A;  2JU6 X;  2JZP A;  1D4B A;  2JWU A;  2ZW1 A;  3UI3 A;  1GB1 A;  4D2K A;  2J52 A;  2QSD A;  1K51 A;  5HI1 A;  5JXV A;  1C9F A;  1MHH E;  1PGB A;  1HZ5 A;  1XCQ L;  4KGS A;  4OZC A;  4GLS C;  1YNT E;  3V3X A;  1XF5 L;  2ZW0 A;  1K53 A;  4KGT A;  3MP9 A;  5BMH A;  1JML A;  2RMM A;  5BMG A;  1K52 A;  1IBX A;  5HG2 A;  1IBX B;  4HKZ E;  1F2R C;  3GB1 A;  2LHE A;  5BMI A;  2KAC A;  1P7F A;  1PGX A;  3FIL B;  4HJG E;  1GB4 A;  2GI9 A;  1YMH E;  1ZXH A;  4IKG A;  2IGH A;  1EM7 A;  1FD6 A;  1MPE A;  1FCL A;  2KWD A;  2JSV X;  2NMQ A;  4WH4 A;  1MVK A;  1XCT L;  5HHD G;  2LHD A;  4MAC A;  2PW9 A;  1HEZ E;  1P7E A;  1FCC C;  2PTL A;  3FIL A;  1KH0 A;  4OZA A;  2N7J A;  2I38 A; 
#chains in the Genus database with same CATH topology
 2M0X A;  2K8B A;  2EKI A;  3ZXR A;  4ICU A;  3TMP B;  4QAY A;  2EEL A;  3UGB B;  2H89 B;  2JUO A;  1WGY A;  4M00 A;  4W9I A;  3RYT A;  4FUL A;  4WWM A;  3O13 A;  1TY2 A;  1ZGU B;  2IO3 B;  2I2Y A;  2N9X A;  4ICV A;  2NS5 A;  3LB8 C;  4IW0 A;  2HJ8 A;  2N4F A;  1WXM A;  1SJH D;  2K6D B;  4GXB A;  2AYO B;  1I35 A;  2DZM A;  2WLB A;  4HKQ A;  2BYV E;  2RPQ A;  3P42 A;  2BYE A;  1FEH A;  3ML8 A;  4JWS C;  4GDK A;  3UI3 A;  1AYF A;  2V3S A;  2KK8 A;  4LJO B;  2QSD A;  4UDU C;  3B0A A;  2ZPN A;  4HPM B;  4AJW A;  4ZOH C;  4LNK A;  4JIO U;  4J6I A;  1V8C A;  1VR9 A;  2ICI A;  1OQQ A;  3Q14 C;  4BOS C;  1OGW A;  1JML A;  2RMM A;  4EOY A;  4KZC A;  2I1K A;  1DOI A;  3DBH B;  3MHS D;  1JAL A;  4G0N B;  3V6C B;  5I4D A;  4L1B A;  4A90 A;  1BXT A;  4ZYN A;  3N20 C;  2V0G A;  4HRS A;  1XCT L;  4A20 A;  2J0M A;  4I6L B;  1P7E A;  2KJH B;  2L05 A;  4US9 A;  4MEM A;  1SSN A;  2LD9 A;  1KFY B;  2ONQ A;  2WDR B;  2YVC A;  4PYU A;  3OAW A;  1WXV A;  2Y5B B;  2WXJ A;  1KM7 A;  1S1Q B;  3IHP C;  4LK0 M;  5BO4 B;  3N9Y C;  1NVI D;  5C3J B;  1H8C A;  3N3K B;  1ZDV A;  1NEN B;  3GE3 C;  2UU7 A;  4BKS D;  3WAM A;  2WXN A;  3QC8 B;  1XQQ A;  5CHW A;  4EZJ A;  5DPS A;  1WRI A;  4RGM A;  1GPX A;  1ISN A;  1T3Q A;  4N6E B;  1Q0W B;  2GB1 A;  2BS3 B;  3IT6 B;  1UUP A;  3HIZ A;  4KX6 B;  1PGA A;  2Y5P A;  3I63 C;  2W3S A;  1E10 A;  1WX8 A;  4DK5 A;  3VTW A;  1JWM D;  2AEH A;  2INP E;  2B3A A;  4OVV A;  3C19 A;  3NZS A;  3N1Y C;  2ZPY A;  1K51 A;  1AN8 A;  2WXQ A;  3VH3 B;  4DXF A;  2WU5 B;  4YTM B;  4KV2 A;  4KGS A;  1E8W A;  4YWG G;  3WAL A;  2FBW B;  2KYW A;  5D94 A;  1JWA D;  3TEW A;  4BKS A;  1KTK A;  3QA8 A;  4S0R A;  1EUV B;  2KFK A;  3D32 A;  2JRH A;  3U4E G;  4FA6 A;  2QC8 A;  1XLQ A;  2V3N A;  3HVZ A;  2DBY A;  2YLM A;  2CU1 A;  1CMX B;  4LNI A;  1TJE A;  1FMA D;  1J8C A;  3KYD D;  3ZO5 B;  3DBL B;  3W1Y A;  1WJ6 A;  3WAO A;  5CHV C;  3GS2 A;  4A9A A;  3U7D A;  1EM7 A;  2K25 A;  2PVG C;  2KTR B;  5FR6 A;  3LXF A;  4W9C A;  1AWD A;  2M19 A;  4MJS B;  2MWS B;  1OTR B;  2WNM A;  3E56 A;  3QQ8 B;  1J7A A;  4JQW C;  4WAF A;  3R2T A;  4II3 B;  3AXC A;  2KQ4 X;  1WYW B;  3SHQ A;  3W5V B;  3Q8C A;  3AEC B;  5DCN A;  1P0R A;  2KN4 A;  2LZ6 A;  4LTU A;  2HTM E;  3PRZ A;  2BB6 A;  5LLI A;  1F77 A;  3UIP B;  1EU3 A;  5AUK A;  3AE6 B;  3PRP B;  3RMK C;  4KVG B;  2WXI A;  4EE2 A;  2D3A A;  1NI2 A;  4OVZ A;  4XX5 A;  4HLE A;  3Q8F A;  4ACF A;  1SIJ A;  5E6J A;  3QIJ A;  3W1S C;  3IAM 1;  3AE3 B;  1D5X C;  1HA5 A;  1VLB A;  1I4G A;  4II2 B;  4MH0 E;  2W55 A;  1UNS A;  3IAS 1;  3AE5 B;  3UIN B;  4E71 A;  2KMC A;  3UQB A;  4ZRI A;  1I4Q A;  2KFJ A;  5JHA A;  1D3Z A;  2PJH A;  1WY8 A;  4WJO A;  5AZF A;  2Z8L A;  2IO2 B;  2NCN A;  2KAC A;  1VDV A;  2FE8 A;  5EE3 A;  4KKI A;  2ACZ B;  4MH8 A;  1PGX A;  1SGH A;  1GB4 A;  4WJN A;  1D5Z C;  2W54 A;  2KLC A;  3A4R A;  2LGX A;  2FNJ B;  1BML C;  3P4Q B;  5D2M B;  2KLG A;  4CQN A;  2BVC A;  2KWD A;  3EA6 A;  3P4P B;  4K3C A;  1OQR A;  1HTO A;  3VUY A;  3HVD A;  3RNF C;  3AE4 B;  2N1V A;  2CS4 A;  2RR9 A;  2BS4 B;  4ARI A;  2WXG A;  5IAA C;  4HVB A;  1FFU A;  2L00 B;  3U52 E;  1CJE A;  2SAK A;  4FXC A;  3DHH C;  4YXD B;  4BOZ B;  1Q10 A;  2LVQ A;  2KJ6 A;  1V6E A;  4REZ A;  2BYF A;  1QF6 A;  3M3J A;  3B9J A;  3H7S A;  3KH0 A;  2JX5 A;  2DZI A;  3DBS A;  1D4B A;  4WWN A;  4PS7 A;  3R3M A;  4GDK B;  1M4V A;  1AAR A;  1E5W A;  1KRH A;  1PGB A;  2K6Q A;  1JWS D;  2NBW B;  5E6P A;  2BW2 A;  4A55 A;  1VZ8 A;  2TSS A;  5L83 A;  4MEL A;  4M8M A;  2C7H A;  3AI5 A;  4ZRJ A;  1T6B X;  2KDI A;  3ZRF A;  1WZ3 A;  1DOY A;  3NVZ A;  1UWM A;  3E9S A;  3VTV A;  1YN3 A;  2KWU B;  3HK0 A;  5J2R A;  3PS6 A;  4ASW C;  2MHJ A;  1LFD A;  3ZW3 A;  2LJ5 A;  1YOV B;  5AUI A;  2KHW B;  3PHX B;  3ZDT A;  2JYT A;  4OW0 A;  2BBC A;  3NY5 A;  3P1M A;  1YJ1 A;  3RI7 C;  2LEK A;  5AZH A;  1FO4 A;  2D11 A;  1JRU A;  2KAJ A;  2NMQ A;  2Z0E B;  3U8Z A;  1CQV A;  2IND C;  1GG3 A;  2N9P C;  5AEK B;  1RRB A;  4AWJ A;  2IPK D;  1V1O A;  1ZOY B;  2MBH A;  2CKH B;  3SD5 A;  3TBL D;  4F7Z A;  4AQ7 A;  4OZA A;  4YTP B;  3TJP A;  2L32 A;  3S2A A;  2N9L A;  2MJ3 A;  4K7U A;  1K50 A;  2KTR A;  3RD2 A;  4FHJ A;  3NJT A;  1SE2 A;  4M01 A;  5KHO A;  5BYQ A;  3VRB B;  2LI5 A;  4YSZ B;  1X1M A;  2OOB B;  5IP4 D;  2NBV B;  5DPR A;  1E9M A;  1QOG A;  5AZG A;  3DCG A;  1J7C A;  3MC0 B;  3L4P A;  5C2T B;  2W9N A;  4JGH B;  1MI0 A;  2G3Q B;  1E7P B;  2M4N A;  4MDK E;  2MRP A;  2E6X A;  3IXS A;  3Q3F A;  3NRZ A;  1GUA B;  2RDB C;  4IWO A;  3R7R A;  3UQA A;  1XEE A;  1EWY C;  4OZB A;  2IGG A;  2DYB A;  3NVY A;  5T8I A;  3HM3 A;  1HTQ A;  1Z2M A;  5DPT A;  3DDC B;  1STE A;  4IM2 A;  2MP2 A;  3MTN B;  1C79 A;  3TSS A;  3Q8E A;  1JWB D;  1JW9 D;  1KLG D;  3NVW A;  4LNN A;  3RNB C;  1R7S A;  4S17 A;  1E7V A;  3PZD A;  1LM8 B;  4FJY A;  3ONS A;  1C4A A;  4AJY B;  3MC8 A;  4W9J A;  2WDV B;  2WXM A;  4AP4 C;  4FJZ A;  2WHI A;  2HD5 B;  1E0Z A;  4DQO C;  3AED B;  1DYQ A;  2V9H A;  4P1B C;  2KFK B;  3EFU A;  4NPN A;  2DZK A;  3GB1 A;  5E6O A;  2MEK A;  1FM0 D;  2LGD A;  5MPO A;  4JLC A;  5D3D A;  1ZXH A;  2CR5 A;  2LVP A;  2KC1 A;  4G50 A;  3PHW B;  2AX5 A;  4TMA B;  5IOI A;  3M62 B;  3TEZ A;  1MPE A;  2KDE B;  3QCA A;  2K1F A;  3T3N A;  1G6J A;  1UEL A;  4NJ6 A;  4GU2 A;  4EZL A;  4MGK E;  5GXG B;  2GMI C;  3BYT B;  2PTL A;  1D6E C;  4NQK E;  1R4M I;  5HFY A;  3BVZ A;  3L08 A;  5JHB A;  4WUR A;  3RT3 B;  3MC9 A;  4DHZ B;  2BF8 B;  1F1H A;  4C7Y A;  4KGR A;  3Q3J A;  4LJP B;  3A9K A;  1L6V A;  2INN E;  3VR8 B;  2HDE A;  1L0X B;  2L8J A;  2V4I B;  3ZKJ C;  2WXO A;  3V62 A;  5FK9 C;  3UF8 A;  1XXG A;  1QOB A;  3IT4 B;  1GNU A;  1RWS A;  2K0P A;  1QLB B;  2LGS A;  1XO3 A;  2JU6 X;  1E8Y A;  1MFW A;  3SEB A;  4A8X C;  4P16 A;  3AE9 B;  2ZW1 A;  1NI3 A;  3H7P B;  4K3B A;  4WJP A;  2X38 A;  2OHF A;  2D2Q A;  1E90 A;  5D7G A;  1C77 A;  2AL3 A;  2IZV B;  4W9D A;  3HRD D;  2WS3 B;  1L0V B;  3RNE C;  3VH4 B;  2GBN A;  1NBF C;  1IBX A;  1PUT A;  4HKZ E;  4ANW A;  3Q3N C;  5BMI A;  1YQB A;  5J18 A;  3EHV A;  2REX A;  3U7Z A;  1YMH E;  4BKT A;  4MM3 A;  4RF0 A;  2PE9 A;  1FD6 A;  2FCN A;  4DHJ B;  1V1P A;  4B0M A;  1SE4 A;  3N1Z C;  3I57 A;  2VRR B;  4LNO A;  3BY4 B;  3TIX A;  2RSU A;  3B2F A;  4BFR A;  2LHD A;  4MAC A;  4LNF A;  2KWC A;  2PKO A;  2XBB C;  3X0W A;  1ZKH A;  2KVR A;  1SE3 A;  1FNV A;  1XLN A;  4IUM B;  2I38 A;  1IP9 A;  1BUI C;  1FIQ A;  4KDI C;  4WAA A;  1UGM A;  3RNG C;  2GBM A;  3IFW B;  1WJN A;  1VD2 A;  1KOT A;  3WCQ A;  2KDM A;  3JW0 X;  4JWU C;  2CHW A;  5CHF A;  4IOI E;  1ROE A;  2NTT A;  1JRP A;  4A3P A;  1WGD A;  4FN2 A;  4FJV B;  4RH6 A;  2C5L C;  1EF5 A;  3GE8 C;  4MGY E;  4KIK A;  2K9X A;  2M17 A;  3CIR B;  5G2N A;  3H1U A;  3PVL A;  3W1S A;  1C1Y B;  4GDL A;  3RNC C;  4C80 A;  1MG4 A;  2O6V A;  3ZXV A;  3APD A;  2PVO D;  3AU5 A;  4EFO A;  4L23 A;  3Q6B A;  1WI0 A;  1NDD A;  3A33 B;  3PO0 A;  1E8X A;  2D3G A;  4BBN C;  3BK2 A;  3RUI B;  4BAX A;  2RDG A;  3H9D A;  2ZEQ A;  4B95 A;  2BPS A;  5JH5 C;  4P6V F;  3ZUN A;  1UGJ A;  2GI9 A;  4KSL C;  2BWF A;  4C56 C;  2XK5 A;  1C78 A;  1CK1 A;  3A4S C;  2KC2 A;  1WGR A;  1YX6 B;  2KDF B;  1TS3 A;  1K8R B;  4US8 A;  3KWL A;  1FNU A;  2KOX A;  2D5G A;  4AUQ C;  2PEA A;  4DBG A;  1QT9 A;  1U4A A;  4NAM A;  4TQ0 A;  2XEW A;  2MA9 B;  2MJD A;  4RCO A;  2BB5 A;  3J9C A;  3ZLZ A;  5D6J B;  4GN1 A;  4Q2J A;  4XWT A;  4LLG M;  4IWP A;  2D10 A;  2LUE A;  2IJ0 A;  2LUM A;  2QDF A;  2IO1 B;  2WXH A;  2IDY A;  2HTH A;  2ASQ A;  4N58 A;  3EGR A;  1V80 A;  3KWV A;  2L52 A;  5L95 C;  3DQV A;  2A5U A;  4PK1 A;  5GMV A;  1T0S C;  1TTN A;  3L13 A;  1SEB D;  2ZNV C;  1YN5 A;  2G1E A;  1M94 A;  3N1X C;  2JZ3 B;  2C7M B;  3K9P B;  4KKJ A;  3L10 B;  2INC C;  3CST A;  3SFE B;  2KTF A;  3V61 A;  2I1J A;  2MP2 B;  2FUG 1;  2J52 A;  5HI1 A;  1N62 A;  5JXV A;  3R66 C;  3T9L A;  1YJJ A;  1I4R A;  1E8Z A;  2W3R A;  2RDH A;  4IC7 B;  1YIW A;  2H88 B;  3ZNI D;  3V3X A;  2J0J A;  2JVC A;  1S3S G;  3IVF A;  1XD3 B;  1V5O A;  3H7P A;  1Q5W B;  4DHJ D;  3CSF A;  2MBB B;  1ET9 A;  1SE9 A;  1B1Z A;  4MGI E;  3FIL B;  3AE7 B;  4HJG E;  4XDD A;  3L54 A;  1WH3 A;  5D3I B;  3HHM A;  3LJ3 A;  5H8Y E;  1UBI A;  3T8M A;  4XE0 A;  3NS8 A;  4HDO A;  2L3Z A;  4GB9 A;  2Q5W D;  4HK2 A;  4K81 A;  4HDQ A;  1FCC C;  3NOB A;  1ZDX A;  3RNA C;  2JF5 A;  5TSS A;  3R2I A;  2N7D A;  1TIF A;  1Y8R C;  2LXC A;  1E7U A;  4ZRQ A;  4YSX B;  4LCD E;  4AOF A;  2FIF A;  2KQS A;  1L4D B;  5H92 C;  3FC4 A;  3HM6 X;  2RD0 A;  5DPW A;  2R2O A;  3A9K B;  2WDT B;  2GBK A;  2DX5 B;  2K3U A;  4USA A;  1N61 A;  3RZF A;  3B1L X;  3QWZ B;  4PS8 A;  4WQO B;  3AEB B;  2BWE S;  3BIN A;  5CX3 A;  3DBR I;  2NPT A;  1MHX A;  1WR1 A;  1VZ6 A;  2IO0 B;  3DWG C;  3Q8B A;  4PYZ A;  2JWU A;  2KZR A;  3VTU A;  2N1W A;  1EWC A;  1LGR A;  1WX9 A;  3RPF C;  1C9F A;  2JZZ A;  4W9H A;  2K39 A;  3JVZ X;  2KD0 A;  4F8C B;  1TZO A;  3PT2 B;  2RGF A;  4OZC A;  1F52 A;  4W9F A;  1K53 A;  3T3O A;  1IBX B;  1I4X A;  4ARC A;  2LVO A;  2WGS A;  5EDS A;  1EF1 A;  1WX7 A;  1T0Y A;  3W2D A;  4JX1 C;  2JPH A;  1WYG A;  2Z59 B;  2N0S B;  2EMT A;  3URY A;  3TEX A;  4MM3 B;  2K8C A;  4ZRK A;  2QCZ A;  1V1P B;  3A1Q A;  2M1M A;  2EMS A;  2KDB A;  1D5M C;  3VVW B;  3OG5 A;  1N6Z A;  3SFD B;  4JE3 B;  1KH0 A;  2BKR B;  2WXK A;  2G4D B;  2MW5 A;  1AW7 A;  3PRM B;  2KO3 A;  2R2Q A;  2YEP B;  1R4N I;  4HEA 1;  2QEJ C;  1UWX A;  1TKE A;  2K5P A;  2KJR A;  4FLH A;  2WDQ B;  2DEN B;  1RAX A;  3P4S B;  5KHQ A;  3MFG A;  4OHJ A;  3A9J A;  2YEP F;  3KYC D;  1WZ0 A;  2QMT A;  2N9K A;  2R61 A;  3GZN I;  4PS3 A;  4KIK B;  2E3T A;  1L7Y A;  3ZIM A;  3AEF B;  3BII D;  4RM8 A;  3NZU A;  1RYJ A;  2W82 A;  1JQ4 A;  3AEA B;  1SF0 A;  1V86 A;  4GDL B;  4OVU A;  4M02 A;  4RFB A;  1MHH E;  1E6E B;  1GAQ B;  1FXI A;  1HZ5 A;  1WXQ A;  2MBO A;  1P1A A;  2LFI A;  2O6V B;  3EC8 A;  3RFZ B;  1XCQ L;  4ZRP A;  3U2S C;  5C23 A;  2KX3 A;  4PT5 A;  2WX0 A;  3QAQ A;  1VJK A;  5BMG A;  1FXA A;  3UIO B;  1WR6 E;  4NNJ B;  2HE7 A;  1N60 A;  2BQQ A;  3KQ4 A;  3N30 A;  1GOZ A;  1PYW D;  2L0F A;  2KN5 A;  1WIA A;  2XK5 B;  4IG7 B;  1ZXI A;  2J7Q B;  3ML9 A;  3PV1 A;  5HHD G;  3AV8 A;  3PPA A;  3ZRC A;  3CMM B;  1VRA B;  1FXT B;  4IWQ A;  3AH7 A;  3FIL A;  3TUO A;  3GOE A;  2ZJD A;  1TS5 A;  3ZJT A;  1PFD A;  2BS2 B;  2D3B A;  1VCB A;  4C4V A;  3PZ8 A;  4WIP A;  3VHT C;  2M0A A;  2LGI A;  3Q69 A;  2IYD B;  1WM3 A;  3I5J C;  1SBB B;  1XLO A;  2XNA C;  4W9G A;  5IA7 A;  1WSP A;  1A70 A;  1C4P A;  4NAW A;  4A3O A;  1WGH A;  1Q1O A;  4A6Q A;  3Q2A C;  4TV3 A;  3AB5 A;  4G11 A;  1QKZ A;  2J53 A;  3PSE B;  4NY0 A;  4RMA A;  3AE8 B;  1ZW7 A;  3I9V 1;  4ITK A;  3PTF C;  3DBH I;  1HZ6 A;  3VFK A;  4TUU A;  3NZ3 A;  2B76 B;  5FR3 A;  3ECI A;  2GBJ A;  2WXL A;  3HUI A;  3JSV A;  4B9K A;  2FCS A;  1V97 A;  4N9F 4;  3H6N A;  2LRU A;  5LNK 1;  1RFK A;  3R8B A;  4W9E A;  3AEG B;  4CYE A;  2C7N B;  3BZD B;  3B08 A;  3N32 A;  4BZA A;  4KGT A;  5BMH A;  4X57 B;  1C4C A;  3V05 A;  2EKE C;  4RM9 A;  2M8S A;  3PGE A;  2LJI A;  3M95 A;  3RN9 C;  2WXF A;  1JCK B;  1I4H A;  2BT6 A;  1V5T A;  3SR6 A;  3U30 A;  3AEE B;  3V6E B;  2IGH A;  1J19 A;  3M63 B;  2V3P A;  4P1C C;  1I42 A;  2Y3A A;  2KMM A;  2FID A;  2JSV X;  4K7S A;  3ZVV A;  1MVK A;  2BTE A;  1FFV A;  3QK0 A;  3KVF B;  2V4L A;  1WXS A;  4HJK A;  3ZTD A;  5C1Z A;  1EO6 A;  1UBQ A;  5EE1 A;  1MJD A;  1GC7 A;  1TT5 B;  2MX2 A;  3Q3M C;  2CJN A;  1TY0 A;  2PIA A;  4ZHO A;  3KUC B;  5EE0 A;  1YX5 B;  1WFY A;  4AS1 A;  2OED A;  1YN4 A;  2IGD A;  2KT7 A;  3AMZ A;  3QJZ A;  1P98 A;  4RGN A;  1YJI A;  1Z5S B;  2JXX A;  3BVM A;  2AQ1 B;  1TKY A;  2LAS A;  2HJ1 A;  2NR2 A;  1J7B A;  3EEC A;  4NJ7 A;  4MSQ B;  1LQB A;  3ETR A;  3Q8A A;  4WWP A;  2NTS A;  3DBL I;  2NPT B;  2O6V D;  2PE6 B;  4K1R B;  2D07 B;  3DOW A;  3I3T B;  2GBR A;  2MQJ A;  1QOF A;  3ZTC A;  2G4S A;  2L83 A;  3QHT A;  3CWI A;  3WAP A;  1R4M B;  1SJE D;  3FAH A;  4DXG A;  3ZNH B;  3P2B A;  4XZ4 A;  1HE8 A;  4NJC A;  2O2V A;  4GGQ A;  1IPG A;  3ZQ4 A;  1WMH A;  4DDI D;  3DVG X;  2LMC A;  1V2Y A;  1PDX A;  1IUE A;  4ANX A;  1ZPS A;  3ENE A;  1F0Z A;  3BWU D;  1OEY A;  4N59 A;  2VZK B;  1XLP A;  2LHE A;  2PMV A;  2XN9 C;  4XC2 A;  2ZCC A;  1GJZ A;  2BYT A;  2KVZ A;  1UF0 A;  2JY6 A;  4CO7 A;  3VUX A;  4XYC A;  4XGA B;  4J3O D;  3C0R B;  4MT5 A;  1FCL A;  2FAZ A;  4ZYS A;  1QQR A;  3A1Q B;  2GLS A;  2LXA A;  3QX1 A;  2PW9 A;  1FPY A;  2L76 A;  2MJE A;  5IKC M;  1YQ4 B;  4ZDV A;  1L6U A;  2DAF A;  4NQL B;  3VR9 B;  1SXT A;  4DXA B;  2VH1 A;  4KZ0 A;  4EZK A;  4E3C A;  2K22 A;  1L0Y B;  4E74 A;  3H8H A;  3TL5 A;  3DVN V;  4DHZ E;  1ZE3 D;  1YD8 U;  2ZCB A;  4M0W A;  2UYZ B;  1IGD A;  1WF9 A;  3K9O B;  3WA0 A;  2WWZ A;  4W9L A;  1I4P A;  2WXR A;  1P9D U;  1N5W A;  4WQM A;  1XT9 B;  2ZVN A;  1IGC A;  5BYS A;  1RLF A;  3A9J B;  1OQY A;  2KX0 A;  3LDZ E;  3AM9 A;  2Z0D B;  4MGZ E;  3W9C B;  1WGK A;  3RUL A;  1QIL A;  3OLM D;  4D2K A;  1IYF A;  4IM3 A;  3W5U B;  2FCM A;  2PPH A;  4LDT D;  5BYR A;  5G5H A;  1J0G A;  5LXH A;  4I6P A;  3X23 A;  3ZDM C;  2MSE D;  3ZJU A;  1XF5 L;  3DPD A;  1DGJ A;  2GRI A;  3KUZ A;  4M8N A;  4MSM B;  4RGO S;  1KJT A;  5HG2 A;  2K8H A;  3BVG A;  1NEK B;  2KQ7 A;  1UD7 A;  4B0E A;  2Y5C A;  4IDI A;  4TSS A;  3L16 A;  1T0Q C;  5J17 A;  1WM2 A;  2MH7 A;  2WP9 B;  1Y56 A;  3FKY A;  4TKN A;  3L17 A;  4KDL B;  1OEY J;  1UZX B;  4HCN B;  4GIV A;  2LGY A;  3GP7 A;  2N7E A;  2N9E B;  2L7R A;  3V60 A;  4I6N B;  2ZZP B;  3MHZ A;  3NUH B;  1A5R A;  1WJ4 A;  3EUB 2;  2ON8 A;  4C4V B;  3OWE B;  4G3X B;  2D3C A;  2PLP A;  1L5P A;  2ZVO A;  4DDG D;  4ZHP A;  1L2N A;  1ENF A;  4NAW B;  2JT4 B;  2JXT A;  3Q3O C;  3BK1 A;  4HRO A;  2SEB D;  1V9J A;  3DWM A;  1QZE A;  3PRE A;  3ZGZ A;  3PLU A;  3JSV B;  1WGG A;  1MG8 A;  2WX1 A;  3TEY A;  1TGZ B;  4EKU A;  1F9J A;  1TKG A;  3ABV B;  1B9R A;  2BKF A;  4XDC A;  2CHX A;  2VZK D;  2OJW A;  2UWQ A;  4P7I A;  3MP9 A;  1NYQ A;  4WWO A;  2JQR B;  2CU3 A;  1P7F A;  2G9H D;  4K7W A;  5EE9 A;  2V1Y A;  3LYY A;  4WJQ A;  3PLV A;  1LO5 D;  2WQY B;  1WE7 A;  4BBN F;  1PQS A;  1WWT A;  2VH2 A;  3WIM A;  1V81 A;  4BKG A;  4W9K A;  2KKC A;  3DVG Y;  2KMA A;  4WH4 A;  3VQI A;  1NYR A;  2CJO A;  4R3D A;  5LXI B;  5IO9 A;  4HXD A;  1FNW A;  2AL6 A;  5G5G A;  2DNF A;  2QIL A;  4XWW A;  3O65 B;  1T0R C;  2DYO A;  1WJU A;  1L4Z B;  1ZP0 B;  4YL8 A;  5JZE B;  4BVU C;  2LRW A;  3ZNZ B;  2WYQ A;  2NVU I;  1JRO A;  2IY1 B;  4EEW A;  2MBQ A;  1ACC A;  1T5X D;  1I7H A;  1KF6 B;  2ZNV B;  3AE1 B;  2BGF A;  3IBE A;  2G45 B;  4RF1 A;  4YT0 B;  3NVV A;  1HXY D;  4B6W A;  3DVN U;  3BYY B;  3B2G A;  1V49 A;  2JZP A;  2WXP A;  4JL9 A;  1BT0 A;  2C60 A;  1KLU D;  1EU4 A;  3KW5 B;  1GB1 A;  1ESF A;  2DWQ A;  4NZL B;  1N5X A;  3SU8 X;  1RM6 C;  1C3T A;  4RGT A;  4O1N A;  4EUT A;  2LWP A;  2JRI B;  4GLS C;  2CHZ A;  1TS4 A;  3R7Q A;  2MLB A;  2O2V B;  2DZJ A;  3VDZ A;  1RFA A;  1WMH B;  5IN7 A;  2ZW0 A;  3EFC A;  3QAR A;  4TQ1 A;  1ET6 A;  1K52 A;  4CHK A;  1VZ7 A;  1F2R C;  2MBE A;  4C7Z A;  2DYM A;  3DBR B;  1N63 A;  1LXD A;  1TYG B;  4IKG A;  4ANV A;  4HPP A;  4RNA A;  3VAW A;  1C76 A;  2DLB A;  2JWZ A;  3APC A;  2FUH B;  1P3Q U;  2KAN A;  4MJS A;  2J4X A;  3ALB A;  3KUD B;  4C00 A;  3AU4 A;  2NBU A;  2QIE B;  3PZ7 A;  2J42 A;  3RCZ A;  2L1A A;  4ANU A;  4IM0 A;  2DAJ A;  2N7J A;  5HKH A;  3KLS X;  3OJ3 A;  2J0K A;  3P63 A;  3TCA A;  1ZUD 2;  3AE2 B;  3IG3 A;  1FRD A;  1UH6 A;  4URK A;  3AUL A;  1FRR A;  3JYU A;  2A4Z A;  1WE6 A;  3NG0 A;  2QHO A;  4HCP B;  1JWU D;  1SIF A;  2DHZ A;  4L2Y A;  4M0W B;  4HPL B;  1TBE A;  2FCQ A;  3MJW A;  4F1S A;  3P4R B;  1DOX A;  1F2R I;  2KXJ A;  2RPV A;  2C9W B;  3MJ5 A;  4YTN B;  1TZ1 A;  2OJR A;  5FKA C;  1GC6 A;  3ZJV A;  1KLV A;  3VRA B;  2AQ2 B;  2GOW A;  1SB3 C;  4FBJ B;  1H4R A;  1WXA A;  2M56 B;  2AWT A;  1R4N B;  2L0T A;  1YNT E;  3ZNG C;  1WRD B;  2WU2 B;  3NHE B;  3DHI C;  3DHG C;  5E6N A;  3L0W B;  3ZYY X;  3SDL C;  3APF A;  5CTR C;  3AN1 A;  1OFF A;  2IY0 B;  4H2A A;  2QJL A;  4GSW A;  2KWV B;  2JYE A;  3GZN B;  4GMV A;  2KNB A;  3CF6 E;  4DWF A;  2X8X X;  4KSK C;  2IBI B;  3C8Y A;  1HQR D;  1YQ3 B;  4GOC A;  4YSY B;  2AQ3 B;  5G55 A;  4FHK A;  3VUW A;  3OJ4 B;  3RZW C;  4HWI B;  3VXW A;  4LDT B;  3WAN A;  4JPS A;  4FAD A;  3NS1 A;  1HEZ E;  1TS2 A;  2MCN B;  5TR5 A;  1CZP A;  1QOA A; 
#chains in the Genus database with same CATH homology
 2K22 A;  2N9L A;  1L0Y B;  2MJ3 A;  2EKI A;  4ZRQ A;  1K50 A;  4YSX B;  3H8H A;  5BYQ A;  3VRB B;  1SE2 A;  2EEL A;  4YSZ B;  2H89 B;  1ZE3 D;  1L4D B;  5H92 C;  3FC4 A;  1E9M A;  4M0W A;  1IGD A;  1QOG A;  1J7C A;  3MC0 B;  4WWM A;  3O13 A;  3L4P A;  1TY2 A;  5C2T B;  1I4P A;  2WXR A;  2K3U A;  2I2Y A;  4USA A;  1N5W A;  4WQM A;  1N61 A;  1MI0 A;  1E7P B;  3AEB B;  3LB8 C;  1IGC A;  5BYS A;  2E6X A;  3IXS A;  3NRZ A;  1SJH D;  1XEE A;  1EWY C;  3AM9 A;  1MHX A;  4OZB A;  2IGG A;  1VZ6 A;  3DWG C;  3NVY A;  2WLB A;  3Q8B A;  5T8I A;  4HKQ A;  3P42 A;  1WGK A;  3W9C B;  1FEH A;  1STE A;  1QIL A;  2JWU A;  4JWS C;  3TSS A;  1C79 A;  3UI3 A;  1AYF A;  3Q8E A;  4D2K A;  1EWC A;  1JWB D;  1JW9 D;  1KLG D;  2QSD A;  3NVW A;  4UDU C;  3RPF C;  3W5U B;  1C9F A;  1R7S A;  5BYR A;  1C4A A;  1TZO A;  5G5H A;  4OZC A;  2WDV B;  2WXM A;  4ZOH C;  3ZJU A;  1E0Z A;  4DQO C;  3AED B;  1DYQ A;  1XF5 L;  1K53 A;  1V8C A;  1VR9 A;  2ICI A;  1OQQ A;  3T3O A;  1DGJ A;  2GRI A;  1JML A;  2RMM A;  4RGO S;  5HG2 A;  3BVG A;  1IBX B;  1I4X A;  4ARC A;  1NEK B;  3GB1 A;  2MEK A;  4B0E A;  2Y5C A;  1FM0 D;  4IDI A;  1DOI A;  4TSS A;  5MPO A;  1JAL A;  4JX1 C;  1ZXH A;  5D3D A;  1WYG A;  3W2D A;  2N0S B;  3URY A;  2MH7 A;  3TEX A;  4MM3 B;  2WP9 B;  1Y56 A;  5I4D A;  2AX5 A;  4TMA B;  4L1B A;  4A90 A;  3TEZ A;  1MPE A;  1BXT A;  3T3N A;  1V1P B;  2V0G A;  4HRS A;  1XCT L;  1D5M C;  5GXG B;  3GP7 A;  1P7E A;  3BYT B;  2PTL A;  4US9 A;  1D6E C;  3SFD B;  4JE3 B;  1KH0 A;  1SSN A;  2WXK A;  1KFY B;  3MHZ A;  3NUH B;  2ONQ A;  2WDR B;  5HFY A;  1AW7 A;  3BVZ A;  2WXJ A;  3EUB 2;  2ON8 A;  4LK0 M;  4WUR A;  2YEP B;  3N9Y C;  1NVI D;  3OWE B;  5C3J B;  4C7Y A;  4HEA 1;  4KGR A;  1ZDV A;  2QEJ C;  2PLP A;  1L5P A;  1NEN B;  1UWX A;  1TKE A;  2WXN A;  1L6V A;  2K5P A;  2INN E;  2WDQ B;  1WRI A;  4ZHP A;  1ENF A;  3VR8 B;  4NAW B;  2HDE A;  4RGM A;  1L0X B;  1GPX A;  3P4S B;  2JXT A;  2V4I B;  3MFG A;  4OHJ A;  1T3Q A;  2WXO A;  2GB1 A;  2YEP F;  4N6E B;  3BK1 A;  2BS3 B;  2QMT A;  2N9K A;  5FK9 C;  1XXG A;  1QOB A;  2R61 A;  3IT4 B;  1RWS A;  1UUP A;  2K0P A;  1QLB B;  3IT6 B;  4HRO A;  2E3T A;  4KX6 B;  1PGA A;  2Y5P A;  2SEB D;  2W3S A;  3AEF B;  3BII D;  3DWM A;  1XO3 A;  2JU6 X;  1E10 A;  3SEB A;  1RYJ A;  2W82 A;  4A8X C;  4P16 A;  1JQ4 A;  3AE9 B;  1JWM D;  3AEA B;  2ZW1 A;  2INP E;  3ZGZ A;  1SF0 A;  1NI3 A;  4GDL B;  4RFB A;  1K51 A;  1AN8 A;  3TEY A;  2WXQ A;  2X38 A;  1MHH E;  1E6E B;  2OHF A;  4DXF A;  1GAQ B;  1HZ5 A;  1FXI A;  1WXQ A;  2WU5 B;  2LFI A;  5D7G A;  4YTM B;  1TKG A;  3ABV B;  3RFZ B;  1B9R A;  1XCQ L;  4KGS A;  4ZRP A;  3U2S C;  4YWG G;  2FBW B;  1C77 A;  4XDC A;  1JWA D;  2VZK D;  3HRD D;  3TEW A;  1KTK A;  2WS3 B;  1L0V B;  3U4E G;  1XLQ A;  4PT5 A;  2V3N A;  3HVZ A;  2DBY A;  3MP9 A;  1VJK A;  1NYQ A;  5BMG A;  1IBX A;  1FXA A;  1TJE A;  2JQR B;  1FMA D;  1PUT A;  4HKZ E;  5BMI A;  2CU3 A;  1P7F A;  2G9H D;  1N60 A;  5EE9 A;  3LYY A;  3KQ4 A;  3U7Z A;  1YMH E;  3GS2 A;  1LO5 D;  1GOZ A;  1PYW D;  2WQY B;  4A9A A;  4RF0 A;  1WWT A;  1EM7 A;  1FD6 A;  2PVG C;  1V1P A;  3LXF A;  4B0M A;  1SE4 A;  1ZXI A;  3I57 A;  4WH4 A;  1AWD A;  3VQI A;  1NYR A;  2CJO A;  2M19 A;  4R3D A;  3B2F A;  3AV8 A;  5HHD G;  2LHD A;  4MAC A;  1FNW A;  5G5G A;  2PKO A;  1VRA B;  2WNM A;  3E56 A;  1SE3 A;  1J7A A;  3AH7 A;  1FNV A;  3FIL A;  1XLN A;  2QIL A;  4WAF A;  4XWW A;  3R2T A;  3TUO A;  2DYO A;  2I38 A;  1TS5 A;  2KQ4 X;  1L4Z B;  1BUI C;  1ZP0 B;  3ZJT A;  1FIQ A;  1PFD A;  2BS2 B;  3W5V B;  3Q8C A;  3AEC B;  2KN4 A;  3PZ8 A;  4WIP A;  4LTU A;  1JRO A;  2M0A A;  2HTM E;  2LGI A;  3WCQ A;  3Q69 A;  2KDM A;  4JWU C;  2BB6 A;  1SBB B;  1ACC A;  1T5X D;  1XLO A;  1I7H A;  2XNA C;  4IOI E;  1KF6 B;  1ROE A;  2NTT A;  1JRP A;  1F77 A;  1WSP A;  1A70 A;  1C4P A;  3AE1 B;  1EU3 A;  5AUK A;  4A6Q A;  4RH6 A;  3AB5 A;  2J53 A;  1QKZ A;  3AE6 B;  3AE8 B;  4RF1 A;  3I9V 1;  4YT0 B;  3NVV A;  2K9X A;  1HXY D;  3CIR B;  4ITK A;  3BYY B;  2WXI A;  4EE2 A;  1HZ6 A;  3B2G A;  3NZ3 A;  4OVZ A;  2B76 B;  2JZP A;  2WXP A;  5FR3 A;  3W1S A;  3Q8F A;  1SIJ A;  1KLU D;  2WXL A;  5E6J A;  3HUI A;  1EU4 A;  1GB1 A;  1ESF A;  2DWQ A;  3IAM 1;  1V97 A;  4NZL B;  3AE3 B;  1D5X C;  1HA5 A;  1N5X A;  4C80 A;  1VLB A;  1I4G A;  5LNK 1;  1RM6 C;  1RFK A;  2W55 A;  3R8B A;  4RGT A;  1UNS A;  2PVO D;  3IAS 1;  4O1N A;  4L23 A;  3AE5 B;  3AEG B;  4GLS C;  1I4Q A;  1TS4 A;  3PO0 A;  3BZD B;  2ZW0 A;  3BK2 A;  4KGT A;  4TQ1 A;  5BMH A;  2RDG A;  1C4C A;  1ET6 A;  1K52 A;  3V05 A;  1VZ7 A;  2Z8L A;  1F2R C;  4C7Z A;  2DYM A;  1VDV A;  2FE8 A;  2KAC A;  5EE3 A;  2LJI A;  2ACZ B;  4KKI A;  1N63 A;  1PGX A;  2WXF A;  4MH8 A;  1JCK B;  1I4H A;  2BT6 A;  4P6V F;  1UGJ A;  1TYG B;  3SR6 A;  1GB4 A;  2GI9 A;  3AEE B;  4IKG A;  1D5Z C;  2W54 A;  2IGH A;  4C56 C;  4RNA A;  1BML C;  2V3P A;  1C78 A;  1C76 A;  3P4Q B;  2DLB A;  1CK1 A;  2Y3A A;  1TS3 A;  2KMM A;  4CQN A;  4US8 A;  2KWD A;  1FNU A;  2JSV X;  3KWL A;  2D5G A;  3EA6 A;  1MVK A;  2BTE A;  1QT9 A;  1FFV A;  2J4X A;  4NAM A;  4TQ0 A;  3P4P B;  2QIE B;  2J42 A;  2MJD A;  3PZ7 A;  2BB5 A;  3J9C A;  4RCO A;  5EE1 A;  1OQR A;  2CJN A;  1TY0 A;  2L1A A;  2PIA A;  4ZHO A;  3HVD A;  3AE4 B;  4Q2J A;  4XWT A;  2N7J A;  5EE0 A;  2BS4 B;  4ARI A;  3KLS X;  2WXG A;  4LLG M;  4AS1 A;  3P63 A;  1FFU A;  1YN4 A;  2IJ0 A;  2IGD A;  1ZUD 2;  2LUM A;  2OED A;  1FRD A;  3AE2 B;  1CJE A;  3AMZ A;  3U52 E;  2WXH A;  2SAK A;  2IDY A;  4FXC A;  1FRR A;  4RGN A;  1YJI A;  4YXD B;  4N58 A;  3EGR A;  1Q10 A;  4L2Y A;  1JWU D;  3KWV A;  2L52 A;  3BVM A;  2AQ1 B;  1TKY A;  4REZ A;  1J7B A;  1SEB D;  1QF6 A;  3P4R B;  1DOX A;  1F2R I;  3ETR A;  2RPV A;  3Q8A A;  1YN5 A;  3MJ5 A;  4YTN B;  2G1E A;  3B9J A;  2NTS A;  4KKJ A;  5FKA C;  3ZJV A;  3SFE B;  2JX5 A;  3VRA B;  1D4B A;  2AQ2 B;  1QOF A;  2L83 A;  4GDK B;  3CWI A;  2FUG 1;  1M4V A;  2J52 A;  5HI1 A;  1N62 A;  1SB3 C;  5JXV A;  1KRH A;  1SJE D;  1PGB A;  3FAH A;  4DXG A;  1JWS D;  1YJJ A;  2M56 B;  2BW2 A;  1I4R A;  4A55 A;  1VZ8 A;  2TSS A;  2RDH A;  2W3R A;  4NJC A;  1YNT E;  2H88 B;  2WU2 B;  3V3X A;  3ZQ4 A;  3ZYY X;  2LMC A;  1T6B X;  1PDX A;  1DOY A;  1IUE A;  3AN1 A;  1OFF A;  3NVZ A;  1UWM A;  1ZPS A;  2QJL A;  1YN3 A;  3E9S A;  4H2A A;  1F0Z A;  3BWU D;  2JYE A;  4N59 A;  2VZK B;  1XLP A;  2LHE A;  1ET9 A;  2PMV A;  2XN9 C;  1B1Z A;  2BYT A;  3FIL B;  3AE7 B;  4HJG E;  4XDD A;  5AUI A;  5D3I B;  3C8Y A;  1HQR D;  1YQ3 B;  2JYT A;  4OW0 A;  4YSY B;  5H8Y E;  2AQ3 B;  2BBC A;  3P1M A;  4XE0 A;  4J3O D;  4MT5 A;  1FCL A;  2LEK A;  1FO4 A;  4ZYS A;  1QQR A;  2KAJ A;  2NMQ A;  1CQV A;  4JPS A;  2Q5W D;  2PW9 A;  3NS1 A;  2IPK D;  2MJE A;  1HEZ E;  1YQ4 B;  1L6U A;  1FCC C;  3VR9 B;  1V1O A;  1ZOY B;  1SXT A;  1TS2 A;  1ZDX A;  5TSS A;  3R2I A;  4OZA A;  4YTP B;  4AQ7 A;  1CZP A;  2L32 A;  1QOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...