1K53A

Monomeric protein l b1 domain with a g15a mutation
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
72
structure length
72
Chain Sequence
MHHHHHHAMEEVTIKANLIFANASTQTAEFKGTFEKATSEAYAYADTLKKDNGEWTVDVADKGYTLNIKFAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Protein L
publication title Single-site mutations induce 3D domain swapping in the B1 domain of protein L from Peptostreptococcus magnus.
pubmed doi rcsb
source organism Finegoldia magna
total genus 20
structure length 72
sequence length 72
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-10-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1k53A00
1HEZE 2KWDA 1D4BA 4HJGE 1EM7A 5BMIA 1YMHE 1K50A 2PW9A 2IGHA 1MVKA 2GB1A 4WH4A 4OZCA 4IKGA 1P7EA 3FILA 1XCQL 2K0PA 2KACA 2KN4A 2I38A 2RMMA 2PLPA 1XF5L 2J52A 2LUMA 3FILB 2ZW0A 4IOIE 4KGTA 1FCCC 1F2RC 1K52A 2KDMA 1K51A 2N9LA 1MHXA 4KGRA 1JMLA 2EELA 2KQ4X 1C9FA 2N9KA 5BMHA 3MP9A 1PGXA 2ONQA 1FD6A 3V3XA 1IBXA 2QMTA 2JSVX 1K53A 4HKZE 1IGDA 1YNTE 1IBXB 5BMGA 2JU6X 1GB4A 1MI0A 5HG2A 3UI3A 4GLSC 2LHEA 4MACA 1FCLA 2ON8A 1IGCA 2OEDA 2GI9A 1HZ5A 4KGSA 2JWUA 1ZXHA 1MPEA 1PGBA 1KH0A 2I2YA 1Q10A 1UWXA 4OZBA 5HHDG 1P7FA 2IGGA 4D2KA 3GB1A 1MHHE 2QSDA 2RPVA 2PTLA 2LGIA 5HFYA 1HZ6A 2J53A 4OZAA 1PGAA 2N7JA 2NMQA 5JXVA 1QKZA 2JXTA 2IGDA 5HI1A 2JZPA 2LHDA 2ZW1A 1GB1A 1F2RI 1XCTL
chains in the Genus database with same CATH superfamily
1S1QB 4GDKA 1HEZE 1XEEA 3N9YC 4BOZB 2KOXA 5LNK1 2KDIA 2WXMA 2K22A 3DBSA 5JHBA 4MM3A 1P7EA 1TYGB 2BBCA 5IKCM 1VRAB 5DPWA 4W9KA 4ANWA 2XNAC 2KK8A 3R3MA 1V5OA 2AQ1B 2KTRA 1VR9A 1KOTA 3M95A 5FR3A 1UWMA 2KDMA 3Q3NC 4USAA 4HWIB 1P1AA 4CO7A 2L8JA 4RCOA 4M0WB 1JRUA 4XZ4A 3WA0A 1EO6A 3V3XA 1I4RA 1TTNA 3WIMA 1D5XC 2BS4B 4EZJA 5EE3A 4A3PA 2M0XA 1KF6B 1NENB 4N58A 1MI0A 1UZXB 3H8HA 2WXKA 1P3QU 4GLSC 2LHEA 3TBLD 1B1ZA 3AE4B 1ACCA 4IUMB 2KMAA 3V05A 1C77A 3B0AA 3BVZA 5MPOA 1JROA 4XYCA 1WX8A 2AX5A 4W9EA 2D3BA 2KANA 4LCDE 2IO2B 3NRZA 3OLMD 3AM9A 2WXFA 1FXIA 4LDTB 2WDQB 4XDDA 4P7IA 2LRWA 2WHIA 3VR8B 2D07B 4TQ1A 1D4BA 5BYQA 4JGHB 4HEA1 2GB1A 4IKGA 2IO0B 2AL6A 1WZ3A 2LJ5A 4DQOC 3P2BA 1WSPA 2FNJB 2CHWA 1YN5A 3JVZX 1KRHA 4HPPA 4FHKA 3MFGA 4S0RA 1YIWA 1FO4A 4MJSA 3HM3A 3HVDA 3UF8A 3TCAA 2IO3B 1Q5WB 1SF0A 4DXAB 1WJ4A 3SHQA 2N9KA 4JWUC 4KZCA 3DBRB 4EEWA 3FC4A 2MBQA 1EF5A 1FD6A 5JH5C 3NJTA 4BVUC 1TGZB 2KFJA 3DBLI 3VUYA 4BBNF 4LLGM 2JZZA 4L23A 3GZNI 1GC7A 1WE7A 3R8BA 2KDBA 3VUWA 4K7SA 2IY1B 1ZW7A 2NR2A 4L1BA 2M1MA 3ECIA 2MWSB 5HHDG 2UU7A 2IGGA 3PZDA 3N20C 5D3DA 4LTUA 4W9FA 4A8XC 1NDDA 4JX1C 2A4ZA 3LYYA 3W9CB 3BVGA 2DBYA 2JXTA 3H7PB 4YSZB 1YX5B 4C4VB 1XLQA 2E6XA 3L13A 3PVLA 1E8WA 1KM7A 2OHFA 2WU5B 1S3SG 3ZDMC 1V86A 5D6JB 1D6EC 4PT5A 3I5JC 4P1CC 3AE5B 1V81A 3RYTA 2GLSA 5AZHA 1XT9B 4NAMA 1HA5A 2WYQA 2O2VB 4IOIE 5TR5A 1N6ZA 4AP4C 2INDC 2DZIA 1UNSA 3AXCA 3KWLA 1D3ZA 3AEDB 5E6OA 3SDLC 3VTUA 1VZ7A 1JMLA 2V9HA 3CMMB 1PGXA 2KVRA 4BOSC 4E3CA 2ZNVB 1AARA 4XE0A 4EFOA 1RFKA 4OW0A 2JY6A 1UUPA 2LJIA 1I4PA 2KQSA 2JRHA 2KX0A 2KMCA 3RN9C 4DXGA 2K8CA 1FEHA 4RGOS 1WWTA 1DOXA 3A9KB 1AN8A 5IN7A 4E74A 1NYQA 3HIZA 2KLGA 4RH6A 4NQLB 4HKQA 3UINB 4MT5A 2V0GA 3PRMB 1FFVA 2YEPB 2VH1A 3VQIA 2CJNA 3RZWC 2L83A 4J6IA 2C7MB 1ZGUB 4LJPB 4XGAB 3TEZA 4NQKE 2H89B 4XDCA 1VZ8A 3PGEA 2M4NA 3LB8C 3C19A 2WDVB 2Y5PA 2AQ3B 3ZNHB 3SEBA 1CZPA 2G3QB 2WS3B 4K3BA 2G1EA 2NVUI 1EM7A 2L1AA 2N0SB 4DHZB 2HJ8A 3BVMA 1RAXA 5C2TB 4LK0M 2AL3A 4BAXA 3MJWA 3ZTCA 2KN4A 2PMVA 2O6VD 2BKRB 3PHXB 2IJ0A 3PPAA 3EUB2 2MRPA 1Y8RC 4J3OD 4A9AA 3AE3B 3AU5A 4JIOU 3TJPA 3NY5A 1K52A 3VTWA 3LJ3A 1J7CA 2KWVB 1TS4A 1H8CA 1XLNA 2WXHA 4KGRA 3ZNID 2KJHB 1LQBA 3B1LX 2WXQA 1EWYC 4NJ6A 1C79A 1NEKB 2J0JA 1OQRA 3GOEA 2LGXA 4KIKB 1JWMD 3IXSA 1C78A 4RM9A 5J18A 1SBBB 3R2TA 2RR9A 3V6EB 5J17A 1V6EA 4PS3A 2IPKD 4KV2A 3TSSA 1SE3A 1E8YA 3VH3B 1YQBA 4ZYSA 3ALBA 1UD7A 2KFKB 4C00A 2V1YA 1V2YA 1WIAA 3URYA 1YD8U 3DHHC 1VLBA 2X38A 2WNMA 1SE2A 2OJWA 2N1WA 1WXSA 3RPFC 2PVOD 3V6CB 2NPTB 5IP4D 1UGMA 1QOGA 1TKGA 2PJHA 2DWQA 2HJ1A 2QEJC 2LGIA 3GS2A 2A5UA 4DK5A 1K8RB 2M19A 4ANUA 1T3QA 1AYFA 3W1SA 3AEGB 3IT4B 1XQQA 4HJGE 5AUIA 3RFZB 2LGDA 3PRZA 3KH0A 4C7ZA 4M0WA 1CJEA 1YJJA 1CMXB 1V1PB 3UQBA 2ASQA 1P9DU 1G6JA 3JSVB 3KUCB 3Q3MC 1KLGD 2M8SA 2KDEB 3KLSX 2JT4B 2MBOA 1UGJA 3ZVVA 2ZW0A 1E90A 2BQQA 3A4RA 2WDRB 1T0SC 2YLMA 1FNVA 4ZRQA 5I4DA 5L95C 1R4NI 5LXIB 1E5WA 1WJNA 3R66C 2N9LA 3RMKC 3PLVA 3MHZA 4JWSC 4MSQB 3MC0B 4NPNA 4FXCA 3L08A 4K7UA 1RRBA 4EOYA 1PYWD 2K6QA 2K9XA 3PZ8A 4XC2A 1HQRD 4BFRA 2K6DB 4ZRIA 2FCSA 3I9V1 1A5RA 2WWZA 5IO9A 4I6NB 2AWTA 3NOBA 1T0QC 2J0KA 4S17A 2MLBA 2GBJA 3BWUD 3IG3A 3N1XC 3Q2AC 1KH0A 2L0TA 4GDLA 4TKNA 1ROEA 1PQSA 5EE9A 2KAJA 2PTLA 1JWBD 2PE9A 2DYOA 4ZYNA 2LFIA 1ET9A 2N7JA 1WGDA 4AQ7A 2W3SA 3QA8A 2TSSA 2INNE 3KYDD 5CHFA 2GOWA 2I1KA 3DBHB 2X8XX 1QQRA 4UDUC 1F1HA 1VCBA 3IBEA 1SJED 4TSSA 1N62A 4HLEA 2QILA 1DOIA 1MG8A 3WCQA 3H1UA 2JUOA 3VUXA 4A90A 3GE3C 3O65B 1U4AA 1QOFA 2KJRA 1TY0A 4US9A 3OJ3A 4MH8A 2PIAA 1B9RA 2W55A 1J8CA 1E7PB 1YJIA 1BXTA 4W9CA 1L0XB 5C3JB 3ABVB 4NY0A 1WMHA 3DOWA 1K51A 1WM2A 4C7YA 1T0RC 4ZRKA 1FXTB 2EELA 3PV1A 2WXOA 4LNOA 1F0ZA 1E7UA 4KKJA 2WXJA 1AWDA 2KHWB 5T8IA 1QLBB 2O6VB 5IOIA 3BY4B 4OVVA 1IPGA 2Y5CA 1IYFA 3UI3A 3QJZA 4DDGD 2ON8A 4C4VA 3HHMA 2D3GA 5BYSA 2GBMA 2Z0EB 4ZRJA 3A9JB 2HD5B 3P42A 2LXCA 2EKEC 3U2SC 2VRRB 1ZXHA 2QJLA 1TZ1A 1LGRA 3U8ZA 2MHJA 4B95A 4NZLB 3RNFC 1OFFA 2WXLA 1XO3A 3IHPC 4NNJB 1BUIC 1SIJA 5BO4B 2FUG1 4ACFA 1OQQA 1HZ6A 1OEYA 2NMQA 2IGDA 1OTRB 4MSMB 1F2RI 3M3JA 3Q6BA 4WJPA 2LD9A 4LNKA 4CQNA 2G45B 2D2QA 4WIPA 4EUTA 2CU3A 2G4DB 2FCMA 4WH4A 2N7DA 1HTOA 2BGFA 4KSLC 1TT5B 1SIFA 3PO0A 1PDXA 4CHKA 3M62B 2YVCA 3APDA 4MDKE 1GNUA 2KJ6A 1GAQB 2GRIA 2ZJDA 4C56C 4US8A 4FJZA 2G9HD 5D2MB 1UH6A 5KHOA 4WWMA 4FA6A 3CSTA 3QIJA 5AEKB 4GIVA 4YT0B 1LXDA 3NZUA 3HK0A 2CKHB 3W5VB 3AEAB 3MTNB 2JVCA 2PEAA 1WM3A 4MELA 2QHOA 1RFAA 4W9JA 1IBXB 1WFYA 2KWCA 1C4PA 2LI5A 2GBNA 1YX6B 1VZ6A 2MBBB 4AOFA 2DYBA 3ZTDA 2OOBB 3NZ3A 3DCGA 2PPHA 3A1QA 3RUIB 2MP2A 1EU4A 1FM0D 3E56A 1XD3B 2I2YA 4WWOA 3OG5A 4EZKA 2LXAA 3EECA 2RD0A 3NS8A 1F9JA 4WURA 3AEEB 2XK5B 1V1OA 4HPMB 1CQVA 2SEBD 3QWZB 4KDLB 3Q8AA 4RF0A 3TIXA 5GXGB 4N59A 1QOAA 5JXVA 3DVGX 3NVWA 4PS7A 2KDFB 4TUUA 3AB5A 4M8MA 3DPDA 3ML9A 2GMIC 3VVWB 3UQAA 5BMIA 3SR6A 1I4HA 4GDKB 4II3B 4W9DA 2MJDA 1WXMA 1I4XA 3FILA 3L16A 3V61A 4ICVA 4YXDB 5D94A 2WXGA 3EC8A 4MM3B 1XF5L 1WJ6A 3QAQA 4WQMA 2I1JA 1WYWB 2J7QB 1IP9A 1DYQA 1TBEA 4H2AA 2ACZB 2D5GA 3A4SC 2C5LC 2KX3A 2AQ2B 3DWMA 2MW5A 3ZNZB 1YOVB 2KTRB 3P63A 3R2IA 3DWGC 2KQ4X 1I42A 3DVNV 4YWGG 1HE8A 1X1MA 3JYUA 2NS5A 3WAPA 3DBRI 2MCNB 3DVGY 2C9WB 4GSWA 2M17A 1E9MA 3TMPB 1RLFA 4W9HA 1GPXA 4DHZE 5DCNA 2QMTA 4WQOB 1E6EB 4OVZA 3KVFB 4IWPA 2JU6X 1V49A 1FFUA 5AUKA 4F8CB 3V60A 2MH7A 1FPYA 2XBBC 3QHTA 4EKUA 1F77A 4YSXB 2NBVB 2GI9A 1RWSA 5LLIA 3VHTC 1N63A 4NAWA 4YTMB 4HROA 5DPRA 2CJOA 2KD0A 2L7RA 1WX7A 4P1BC 1WGGA 2LVOA 3LDZE 2BVCA 4LNFA 1N61A 3APCA 1PGAA 2W54A 2QDFA 5C23A 5HI1A 4Q2JA 3H9DA 4GB9A 2LGYA 3Q8EA 3AE6B 3ZYYX 2CS4A 1TS5A 4FN2A 2WDTB 3CWIA 2NTTA 2IDYA 4OHJA 4FBJB 3HRDD 1VJKA 4F7ZA 2D11A 3X0WA 5D3IB 2MX2A 4G50A 4YL8A 1F2RC 2JPHA 4LJOB 3AECB 4RGTA 1LO5D 1FRDA 5FK9C 2V4LA 4LNIA 3U7ZA 2KQ7A 3SFEB 3EA6A 3PREA 2B76B 2MBHA 3SD5A 3AE1B 3OJ4B 3I63C 4MJSB 2JF5A 3E9SA 4JE3B 1NVID 1TS3A 2IO1B 2MBEA 3PHWB 1NI3A 2AEHA 4HPLB 3ZO5B 1SJHD 1YNTE 1GJZA 2DZMA 4GXBA 1V97A 3TL5A 3TEYA 2RDHA 1T0YA 2JXXA 3P4QB 2CHZA 4REZA 5G5HA 4ITKA 1MJDA 5G5GA 1AW7A 5HKHA 2JYTA 1ZOYB 1C4CA 1C3TA 3NVYA 1M94A 1XLPA 2WP9B 3CIRB 3I3TB 4FHJA 3Q14C 1WYGA 3VDZA 1WZ0A 3UIOB 2J0MA 1ZP0B 2ZPYA 1D5ZC 2VZKD 4NJCA 1KLVA 5CHVC 3B08A 2JZPA 1YN3A 2LHDA 4MGZE 1OEYJ 5BYRA 3VTVA 2R2OA 4F1SA 1PUTA 4YTPB 1N5XA 1SE4A 1L6VA 3L17A 4HCPB 2E3TA 1OGWA 1BT0A 1XCQL 3ZW3A 1KFYB 3KQ4A 1I4GA 2JWZA 3DQVA 1VDVA 1J0GA 2EMSA 3IT6B 1N60A 4ASWC 1JCKB 1UBQA 2K8BA 4IM3A 4XWWA 3T3OA 1WGHA 3B2FA 1ZDVA 2ZCCA 3H6NA 3U52E 1MHXA 4ICUA 4G3XB 4MGKE 1WX9A 4YTNB 5G55A 3PLUA 3FAHA 1ZE3D 1ISNA 4B6WA 1WH3A 2EKIA 4K81A 1K53A 3H7SA 1V9JA 2GBKA 4GOCA 1GB4A 4BZAA 5HG2A 5DPTA 3VAWA 2QC8A 2XN9C 3VXWA 2OEDA 3QQ8B 1HZ5A 3RNAC 4WWNA 2WLBA 4L2YA 1L5PA 1V80A 1MPEA 1E10A 3VRAB 4OVUA 2KNBA 2Z59B 3PTFC 2PVGC 2RPVA 3EFUA 1EWCA 5AZFA 3PSEB 5FKAC 1DGJA 2NCNA 3W5UB 3AEFB 4AJWA 3L4PA 1J7BA 3P4SB 2KWDA 4KX6B 3NG0A 3VFKA 5IA7A 4ZRPA 4W9GA 3KWVA 2BWES 1MVKA 2KT7A 2Q5WD 2RDGA 3KW5B 1JALA 4OZCA 2HDEA 4DBGA 2KACA 2I38A 5J2RA 2W3RA 2JRIB 2FIFA 2DAFA 5EE0A 1YN4A 1Y56A 1TIFA 3PT2B 4RNAA 1WJUA 2JQRB 3MC8A 3EFCA 2UWQA 2LMCA 4LNNA 2FCQA 3U30A 1M4VA 3MP9A 5LXHA 1Q0WB 2DAJA 2MSED 3ETRA 1WXAA 4RF1A 2DENB 2WQYB 3BIID 2XK5A 1SGHA 2RPQA 3V62A 1IGDA 4HCNB 2DHZA 3MJ5A 2KC2A 2N9PC 4TQ0A 4R3DA 4M00A 4AUQC 4WWPA 4K7WA 3ZGZA 4KGSA 1JWSD 2Y5BB 3NZSA 3TEWA 1C1YB 2ZNVC 1Q10A 1UWXA 3AV8A 1ET6A 1P7FA 3ZRFA 1WF9A 3GB1A 1Q1OA 2QSDA 1T6BX 2ZEQA 4HDQA 1UF0A 3VH4B 3IAS1 3NUHB 2BF8B 3NS1A 3H7PA 3ZXVA 4XX5A 4TMAB 4HRSA 3U7DA 3IFWB 2QCZA 1I7HA 2RGFA 2QIEB 3DBHI 3PZ7A 2M56B 3OWEB 1NYRA 1ZXIA 3W2DA 3AI5A 3O13A 4WJNA 4KKIA 2K5PA 4EZLA 3ZLZA 2N9XA 1WGKA 2IGHA 1D5MC 4JLCA 4DWFA 1ZUD2 1V8CA 3AH7A 3PS6A 2O2VA 1T5XD 1YQ3B 2INPE 4BKSA 2V3SA 1RM6C 2V3PA 3A33B 1LFDA 2V3NA 2G4SA 4AJYB 2VZKB 1PFDA 4KVGB 2XEWA 5H8YE 4HK2A 1QILA 2AYOB 2HTHA 2MJ3A 2L05A 1TS2A 1L0YB 3HUIA 2WX1A 1WRDB 4GMVA 3WANA 2IBIB 5FR6A 3VRBB 3CF6E 2LGSA 3QX1A 3TEXA 1TKYA 3DBLB 4P16A 2KTFA 1STEA 3N30A 3A9KA 2BT6A 3GZNB 1WR6E 2L3ZA 3ZJUA 4ANVA 1QT9A 4K3CA 3VR9B 3I57A 1WGRA 2K25A 2WU2B 2BPSA 1CK1A 1SE9A 2KZRA 2J42A 4FLHA 1DOYA 3QARA 4PK1A 2Y3AA 2GBRA 4GDLB 4M02A 2INCC 4K1RB 3NHEB 2WX0A 4MEMA 4FJVB 3N1ZC 2N7EA 3RNCC 1VD2A 2KO3A 4OZAA 3HM6X 2NTSA 4I6LB 5E6JA 1QKZA 2ZVOA 3Q8FA 4MH0E 2CR5A 4WAAA 2D3AA 3T9LA 3ZNGC 1WRIA 4P6VF 4ARCA 2V4IB 5EDSA 3MHSD 3KYCD 5CX3A 4C80A 1TJEA 4ZHOA 1TZOA 2KXJA 1JWUD 3FKYA 1EUVB 1NBFC 2MEKA 3UGBB 4A3OA 2L52A 2LUMA 2KC1A 4KZ0A 3GP7A 4ZHPA 2MQJA 1WY8A 1KTKA 4IDIA 4AS1A 4HVBA 1C9FA 4KIKA 5AZGA 5BMHA 4BKGA 1WMHB 3M63B 3W1YA 2N1VA 2Z8LA 3Q8BA 3BK2A 3OAWA 1EU3A 2BS2B 4FADA 2EMTA 4RMAA 4HKZE 5IAAC 4B0MA 2KN5A 2RSUA 2KLCA 2KFKA 3CSFA 2DYMA 4W9IA 5G2NA 4MACA 3HVZA 4G0NB 2PKOA 1IGCA 2NPTA 3AMZA 1L4DB 1SEBD 1EF1A 1UELA 3JW0X 1V5TA 2C7HA 1PGBA 5E6PA 3DDCB 3NVVA 4M01A 2Z0DB 4YSYB 3Q3FA 3RT3B 5E6NA 3P1MA 4IM2A 1WE6A 3GE8C 4M8NA 4X57B 1L7YA 2J53A 2DNFA 3KUDB 2HE7A 4A20A 4EE2A 1E0ZA 1XCTL 5DPSA 4ZDVA 1V1PA 4KSKC 2KYWA 2DX5B 4CYEA 5L83A 2ICIA 3JSVA 1YMHE 1Z5SB 3K9OB 1NI2A 4GN1A 1WXQA 2IZVB 2M0AA 2FCNA 3J9CA 2SAKA 2BB5A 2DZKA 5JZEB 3IAM1 2IY0B 4RGNA 3LXFA 4PYUA 2WXPA 1GUAB 2LEKA 2NBWB 2W82A 3MC9A 2ZCBA 4B9KA 4WJOA 2J4XA 1FNWA 1JRPA 1KJTA 2OJRA 4PYZA 4XWTA 3ZXRA 2PE6B 1ENFA 3AE2B 4DHJD 1WI0A 2KMMA 1HTQA 2FUHB 1SSNA 2ONQA 3SU8X 2R61A 3L54A 2FIDA 5CTRC 3EHVA 3K9PB 3AE9B 1J19A 4N6EB 3RNGC 4G11A 1E7VA 1C76A 4IM0A 4E71A 2LZ6A 3X23A 4ANXA 2DLBA 2ZVNA 3T3NA 2WXIA 1E8XA 1HXYD 2L76A 3D32A 1F52A 1P0RA 4RGMA 1WXVA 3ZRCA 5C1ZA 1JQ4A 3IVFA 1ZPSA 3L0WB 1C4AA 1WR1A 1MG4A 4URKA 2LVQA 3ZQ4A 4GGQA 3C0RB 2BW2A 4HXDA 1GG3A 2JWUA 1OQYA 3A1QB 2MP2B 2LWPA 3R7QA 4MGIE 3KUZA 3WALA 4B0EA 1MHHE 3RNBC 1JW9D 4QAYA 4ZOHC 1FNUA 3ZUNA 4IWQA 1QF6A 2L0FA 3WAMA 5H92C 3TUOA 2FBWB 1XLOA 2BB6A 2JX5A 1QZEA 3DHGC 2LVPA 3S2AA 1XXGA 1K50A 2PW9A 4JQWC 3B9JA 1LM8B 3RCZA 3QC8B 4HDOA 4A55A 2YEPF 4HJKA 3W1SC 2N4FA 3UIPB 1ESFA 2KWUB 2RDBC 3FILB 1ZDXA 3QCAA 4KGTA 1RYJA 3N32A 3AU4A 1FCCC 2JZ3B 1L4ZB 3L10B 4JL9A 4DXFA 1R4NB 3AEBB 1N5WA 5D7GA 4BKTA 3P4RB 1IUEA 1A70A 2JYEA 2LUEA 2K3UA 3BK1A 1WGYA 1JWAD 4IG7B 2BS3B 2REXA 2WGSA 2BKFA 1I35A 4TV3A 2O6VA 5JHAA 2D10A 3ZJVA 1YQ4B 3ZIMA 3AE8B 3BYTB 2JSVX 3N1YC 1R4MB 4BBNC 1TY2A 3AN1A 5BMGA 1L0VB 4IWOA 1J7AA 4W9LA 4LDTD 4DDID 5KHQA 3ZKJC 3A9JA 1FIQA 1TKEA 4NJ7A 1KLUD 1L6UA 4GU2A 2H88B 3R7RA 3BINA 2FAZA 2MA9B 4WJQA 1P98A 4OZBA 2IYDB 4I6PA 3T8MA 4NAWB 3U4EG 1Z2MA 3DHIC 2DZJA 2N9EB 5CHWA 3BYYB 2BYTA 1I4QA 1H4RA 4FULA 2D3CA 1BMLC 4IC7B 2WXNA 2W9NA 1GB1A 2K39A 3Q8CA 3QK0A 3EGRA 2BYEA 3Q69A 4ARIA 1MFWA 4AWJA 3RD2A 1ZKHA 3C8YA 2K0PA 2RMMA 1SB3C 1L2NA 3B2GA 3WAOA 2PLPA 3DVNU 2L00B 2VH2A 2J52A 2BWFA 1FMAD 3NVZA 3BZDB 1R4MI 4IW0A 3SFDB 3RZFA 4RFBA 4FJYA 2MJEA 2CU1A 4RM8A 3ZDTA 2FE8A 4O1NA 1QOBA 1GOZA 3RNEC 3RULA 2C7NB 1GC6A 1IBXA 3PRPB 4JPSA 2CHXA 3Q3OC 3AULA 5GMVA 2K1FA 1E8ZA 2ZPNA 2C60A 2BTEA 4MGYE 2LASA 2L32A 2BYVE 3AE7B 2B3AA 4II2B 4PS8A 1FCLA 2ZZPB 3APFA 3N3KB 2NBUA 2KVZA 2HTME 1YJ1A 4WAFA 2WXRA 2K8HA 3RI7C 3ZJTA 1SXTA 1FRRA 1UBIA 4A6QA 4DHJB 2UYZB 2LRUA 4D2KA 4KDIC 3ENEA 3P4PB 5EE1A 2R2QA 4BKSD 5HFYA 1FXAA 2KKCA 3Q3JA 2BYFA 3ML8A 4N9F4 1R7SA 2ZW1A 3ONSA 5TSSA
chains in the Genus database with same CATH topology
1AYFA 1HEZE 1XEEA 3N9YC 3W1SA 3AEGB 3IT4B 4HJGE 5AUIA 4C80A 3RFZB 5LNK1 3Q8EA 4C7ZA 3AE6B 4M0WA 1CJEA 1TJEA 2WXMA 1YJJA 3ZYYX 2K22A 4ZHOA 1TS5A 1V1PB 1TZOA 1P7EA 1JWUD 3CWIA 1TYGB 2NTTA 2IDYA 4OHJA 1KLGD 2BBCA 2MEKA 3HRDD 1VJKA 2L52A 1VRAB 3KLSX 2LUMA 5D3IB 1UGJA 2XNAC 2ZW0A 2AQ1B 2WDRB 1VR9A 1F2RC 1FNVA 4ZRQA 5I4DA 3GP7A 3AECB 4RGTA 4ZHPA 5FR3A 1LO5D 1FRDA 5FK9C 1UWMA 2KDMA 3U7ZA 2N9LA 3SFEB 1KTKA 3EA6A 4IDIA 4USAA 4AS1A 2B76B 3MHZA 1C9FA 4JWSC 5BMHA 3AE1B 3MC0B 4RCOA 4FXCA 3E9SA 4JE3B 2Z8LA 3Q8BA 3BK2A 1NVID 1EU3A 1TS3A 3V3XA 1I4RA 2BS2B 1PYWD 1NI3A 1D5XC 2K9XA 2BS4B 3PZ8A 1HQRD 1SJHD 4HKZE 5EE3A 4B0MA 1YNTE 1KF6B 1NENB 4N58A 1MI0A 1V97A 3H8HA 3I9V1 3TEYA 2WXKA 2DYMA 4GLSC 2RDHA 2LHEA 4MACA 3P4QB 3HVZA 1B1ZA 4REZA 5G5HA 4ITKA 2PKOA 5G5GA 1IGCA 1AW7A 3AMZA 1L4DB 3AE4B 1ACCA 1SEBD 2JYTA 1ZOYB 1C4CA 3NVYA 3BWUD 1KH0A 1PGBA 3V05A 1XLPA 1C77A 3NVVA 2WP9B 4YSYB 3BVZA 3CIRB 1ROEA 5MPOA 5EE9A 2KAJA 1JROA 2PTLA 1WYGA 3P1MA 1JWBD 1ZP0B 2AX5A 1D5ZC 2VZKD 4NJCA 2DYOA 2LFIA 2J53A 1ET9A 2N7JA 3NRZA 4AQ7A 2W3SA 2TSSA 3AM9A 2WXFA 2JZPA 1FXIA 1YN3A 2INNE 2WDQB 2LHDA 4XDDA 4EE2A 1E0ZA 5BYRA 1XCTL 1QQRA 4UDUC 3VR8B 1V1PA 4TQ1A 1D4BA 1SJED 4TSSA 5BYQA 1N62A 4HEA1 2ICIA 1PUTA 4YTPB 1YMHE 1N5XA 2QILA 1SE4A 1L6VA 1DOIA 3WCQA 2GB1A 2E3TA 1WXQA 2M0AA 4IKGA 4A90A 1XCQL 3J9CA 1KFYB 2SAKA 2BB5A 3KQ4A 1I4GA 1QOFA 1VDVA 1TY0A 4US9A 4MH8A 2PIAA 1B9RA 3IT6B 2W55A 4DQOC 3IAM1 1E7PB 1WSPA 1YJIA 3LXFA 1N60A 4RGNA 1JCKB 1BXTA 2WXPA 1L0XB 1YN5A 4XWWA 2LEKA 1KRHA 2W82A 3T3OA 5C3JB 3ABVB 3MFGA 3B2FA 1FO4A 1ZDVA 2J4XA 1FNWA 1JRPA 3U52E 1K51A 1MHXA 3HVDA 4XWTA 4C7YA 2EELA 1SF0A 2WXOA 4YTNB 2N9KA 1ENFA 3AE2B 4JWUC 3FAHA 1ZE3D 1F0ZA 2KMMA 4KKJA 3FC4A 2WXJA 1SSNA 2ONQA 1FD6A 2R61A 1AWDA 2EKIA 4N6EB 3AE9B 5T8IA 1QLBB 1K53A 1C76A 4LLGM 2DLBA 4L23A 3T3NA 1GB4A 2WXIA 1HXYD 5HG2A 2Y5CA 3UI3A 4RGMA 3R8BA 1JQ4A 2XN9C 1ZPSA 2ON8A 1C4AA 2OEDA 4L1BA 3ZQ4A 5BYSA 2BW2A 1HZ5A 3P42A 2WLBA 4L2YA 1L5PA 3U2SC 1ZXHA 2JWUA 1MPEA 1E10A 2QJLA 3VRAB 5HHDG 2IGGA 4B0EA 2PVGC 5D3DA 4LTUA 1MHHE 2RPVA 1EWCA 4A8XC 4NZLB 1JW9D 1OFFA 4ZOHC 2WXLA 1FNUA 1XO3A 1BUIC 1SIJA 4JX1C 3LYYA 5FKAC 3W9CB 1QF6A 2FUG1 1OQQA 1DGJA 1HZ6A 5H92C 3BVGA 2NMQA 3TUOA 2DBYA 2JXTA 2FBWB 1XLOA 2IGDA 3W5UB 1F2RI 3AEFB 4YSZB 2BB6A 3L4PA 1J7BA 4CQNA 1XLQA 3P4SB 2JX5A 2KWDA 4KX6B 2E6XA 4ZRPA 4WIPA 3KWVA 1XXGA 2OHFA 1K50A 2PW9A 2WU5B 2CU3A 1MVKA 3B9JA 4WH4A 2Q5WD 2RDGA 1JALA 4OZCA 4A55A 1D6EC 2HDEA 4PT5A 2YEPF 3AE5B 3PO0A 2KACA 1PDXA 2I38A 2W3RA 1ESFA 4NAMA 1HA5A 3FILB 1ZDXA 4IOIE 5EE0A 1YN4A 4KGTA 1GAQB 1RYJA 2GRIA 1UNSA 1FCCC 1Y56A 3KWLA 1L4ZB 4RNAA 3AEDB 2JQRB 4DXFA 3AEBB 1N5WA 4C56C 5D7GA 4US8A 2G9HD 2LMCA 3P4RB 1IUEA 1A70A 1VZ7A 2JYEA 4WWMA 1M4VA 1JMLA 2K3UA 3BK1A 3MP9A 1JWAD 1PGXA 4YT0B 2BS3B 3ETRA 4RF1A 3W5VB 3AEAB 3ZJVA 2WQYB 3BIID 1YQ4B 4XE0A 3AE8B 1RFKA 2JSVX 3BYTB 4OW0A 1TY2A 1IGDA 1UUPA 3AN1A 1IBXB 5BMGA 1L0VB 2LJIA 1I4PA 1C4PA 1J7AA 3MJ5A 1VZ6A 4DXGA 1FIQA 1TKEA 1FEHA 4RGOS 1WWTA 4TQ0A 4R3DA 1DOXA 3NZ3A 1KLUD 1L6UA 2H88B 1AN8A 1EU4A 1FM0D 1NYQA 4RH6A 3ZGZA 3E56A 4KGSA 4HKQA 1JWSD 3TEWA 2I2YA 4MT5A 1Q10A 1UWXA 4OZBA 3AV8A 2V0GA 1ET6A 1P7FA 1FFVA 4WURA 3GB1A 2YEPB 3AEEB 3VQIA 2CJNA 2QSDA 1T6BX 2L83A 1V1OA 1CQVA 4NAWB 3U4EG 2SEBD 3TEZA 3IAS1 3BYYB 3NUHB 2BYTA 4RF0A 2H89B 3Q8AA 4XDCA 1VZ8A 5GXGB 4N59A 1I4QA 3NS1A 3LB8C 1QOAA 4TMAB 5JXVA 2WDVB 2Y5PA 4HRSA 2AQ3B 1I7HA 1BMLC 2WXNA 3SEBA 1GB1A 1CZPA 2QIEB 3NVWA 3PZ7A 3AB5A 2M56B 3Q8CA 3OWEB 2WS3B 1NYRA 1ZXIA 3W2DA 3O13A 2G1EA 4KKIA 2K5PA 1EM7A 2L1AA 2N0SB 3EGRA 5BMIA 3SR6A 1I4HA 1WGKA 2IGHA 3Q69A 4GDKB 1D5MC 3BVMA 5C2TB 4ARIA 2MJDA 4LK0M 1ZUD2 1I4XA 1V8CA 3AH7A 3FILA 3C8YA 2K0PA 2KN4A 4YXDB 2PMVA 1T5XD 1YQ3B 2INPE 2WXGA 2RMMA 1SB3C 4MM3B 3B2GA 2PLPA 1RM6C 1XF5L 2IJ0A 2V3PA 2J52A 3EUB2 2V3NA 4WQMA 1FMAD 3NVZA 2VZKB 3BZDB 4J3OD 4A9AA 3AE3B 1DYQA 4H2AA 3SFDB 2ACZB 2D5GA 4RFBA 1PFDA 2MJEA 2AQ2B 2FE8A 1K52A 3DWMA 5H8YE 4O1NA 1J7CA 1TS4A 3P63A 1XLNA 1QILA 1QOBA 2V4IB 2WXHA 3DWGC 3R2IA 2KQ4X 4KGRA 2MJ3A 4YWGG 1GOZA 1L0YB 1TS2A 3HUIA 2WXQA 1EWYC 1E9MA 1C79A 1NEKB 1IBXA 1OQRA 1GPXA 3VRBB 1JWMD 4JPSA 2QMTA 3TEXA 1TKYA 4P16A 3IXSA 1STEA 1C78A 1SBBB 1E6EB 4OVZA 3R2TA 2BTEA 2JU6X 2BT6A 1FFUA 2L32A 5AUKA 3AE7B 2MH7A 3ZJUA 2IPKD 4ZYSA 3TSSA 1SE3A 1FCLA 1F77A 4YSXB 1QT9A 3VR9B 3I57A 3URYA 1VLBA 2X38A 2WNMA 1SE2A 2GI9A 2HTME 2WU2B 1RWSA 4WAFA 2WXRA 3RPFC 3ZJTA 1CK1A 1SXTA 2PVOD 1FRRA 2J42A 1DOYA 1N63A 4A6QA 1QOGA 4YTMB 4D2KA 4HROA 2Y3AA 2CJOA 1TKGA 3P4PB 2DWQA 4GDLB 2QEJC 2LGIA 3GS2A 5EE1A 5HFYA 1N61A 4OZAA 1FXAA 1PGAA 2W54A 2NTSA 5E6JA 1QKZA 3Q8FA 5HI1A 1R7SA 2M19A 1WRIA 2ZW1A 4P6VF 5TSSA 4ARCA 4Q2JA 1T3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HEZ E;  2KWD A;  1D4B A;  4HJG E;  1EM7 A;  5BMI A;  1YMH E;  1K50 A;  2PW9 A;  2IGH A;  1MVK A;  2GB1 A;  4WH4 A;  4OZC A;  4IKG A;  1P7E A;  3FIL A;  1XCQ L;  2K0P A;  2KAC A;  2KN4 A;  2I38 A;  2RMM A;  2PLP A;  1XF5 L;  2J52 A;  2LUM A;  3FIL B;  2ZW0 A;  4IOI E;  4KGT A;  1FCC C;  1F2R C;  1K52 A;  2KDM A;  1K51 A;  2N9L A;  1MHX A;  4KGR A;  1JML A;  2EEL A;  2KQ4 X;  1C9F A;  2N9K A;  5BMH A;  3MP9 A;  1PGX A;  2ONQ A;  1FD6 A;  3V3X A;  1IBX A;  2QMT A;  2JSV X;  1K53 A;  4HKZ E;  1IGD A;  1YNT E;  1IBX B;  5BMG A;  2JU6 X;  1GB4 A;  1MI0 A;  5HG2 A;  3UI3 A;  4GLS C;  2LHE A;  4MAC A;  1FCL A;  2ON8 A;  1IGC A;  2OED A;  2GI9 A;  1HZ5 A;  4KGS A;  2JWU A;  1ZXH A;  1MPE A;  1PGB A;  1KH0 A;  2I2Y A;  1Q10 A;  1UWX A;  4OZB A;  5HHD G;  1P7F A;  2IGG A;  4D2K A;  3GB1 A;  1MHH E;  2QSD A;  2RPV A;  2PTL A;  2LGI A;  5HFY A;  1HZ6 A;  2J53 A;  4OZA A;  1PGA A;  2N7J A;  2NMQ A;  5JXV A;  1QKZ A;  2JXT A;  2IGD A;  5HI1 A;  2JZP A;  2LHD A;  2ZW1 A;  1GB1 A;  1F2R I;  1XCT L; 
#chains in the Genus database with same CATH topology
 1S1Q B;  4GDK A;  1HEZ E;  1XEE A;  3N9Y C;  4BOZ B;  2KOX A;  5LNK 1;  2KDI A;  2WXM A;  2K22 A;  3DBS A;  5JHB A;  4MM3 A;  1P7E A;  1TYG B;  2BBC A;  5IKC M;  1VRA B;  5DPW A;  4W9K A;  4ANW A;  2XNA C;  2KK8 A;  3R3M A;  1V5O A;  2AQ1 B;  2KTR A;  1VR9 A;  1KOT A;  3M95 A;  5FR3 A;  1UWM A;  2KDM A;  3Q3N C;  4USA A;  4HWI B;  1P1A A;  4CO7 A;  2L8J A;  4RCO A;  4M0W B;  1JRU A;  4XZ4 A;  3WA0 A;  1EO6 A;  3V3X A;  1I4R A;  1TTN A;  3WIM A;  1D5X C;  2BS4 B;  4EZJ A;  5EE3 A;  4A3P A;  2M0X A;  1KF6 B;  1NEN B;  4N58 A;  1MI0 A;  1UZX B;  3H8H A;  2WXK A;  1P3Q U;  4GLS C;  2LHE A;  3TBL D;  1B1Z A;  3AE4 B;  1ACC A;  4IUM B;  2KMA A;  3V05 A;  1C77 A;  3B0A A;  3BVZ A;  5MPO A;  1JRO A;  4XYC A;  1WX8 A;  2AX5 A;  4W9E A;  2D3B A;  2KAN A;  4LCD E;  2IO2 B;  3NRZ A;  3OLM D;  3AM9 A;  2WXF A;  1FXI A;  4LDT B;  2WDQ B;  4XDD A;  4P7I A;  2LRW A;  2WHI A;  3VR8 B;  2D07 B;  4TQ1 A;  1D4B A;  5BYQ A;  4JGH B;  4HEA 1;  2GB1 A;  4IKG A;  2IO0 B;  2AL6 A;  1WZ3 A;  2LJ5 A;  4DQO C;  3P2B A;  1WSP A;  2FNJ B;  2CHW A;  1YN5 A;  3JVZ X;  1KRH A;  4HPP A;  4FHK A;  3MFG A;  4S0R A;  1YIW A;  1FO4 A;  4MJS A;  3HM3 A;  3HVD A;  3UF8 A;  3TCA A;  2IO3 B;  1Q5W B;  1SF0 A;  4DXA B;  1WJ4 A;  3SHQ A;  2N9K A;  4JWU C;  4KZC A;  3DBR B;  4EEW A;  3FC4 A;  2MBQ A;  1EF5 A;  1FD6 A;  5JH5 C;  3NJT A;  4BVU C;  1TGZ B;  2KFJ A;  3DBL I;  3VUY A;  4BBN F;  4LLG M;  2JZZ A;  4L23 A;  3GZN I;  1GC7 A;  1WE7 A;  3R8B A;  2KDB A;  3VUW A;  4K7S A;  2IY1 B;  1ZW7 A;  2NR2 A;  4L1B A;  2M1M A;  3ECI A;  2MWS B;  5HHD G;  2UU7 A;  2IGG A;  3PZD A;  3N20 C;  5D3D A;  4LTU A;  4W9F A;  4A8X C;  1NDD A;  4JX1 C;  2A4Z A;  3LYY A;  3W9C B;  3BVG A;  2DBY A;  2JXT A;  3H7P B;  4YSZ B;  1YX5 B;  4C4V B;  1XLQ A;  2E6X A;  3L13 A;  3PVL A;  1E8W A;  1KM7 A;  2OHF A;  2WU5 B;  1S3S G;  3ZDM C;  1V86 A;  5D6J B;  1D6E C;  4PT5 A;  3I5J C;  4P1C C;  3AE5 B;  1V81 A;  3RYT A;  2GLS A;  5AZH A;  1XT9 B;  4NAM A;  1HA5 A;  2WYQ A;  2O2V B;  4IOI E;  5TR5 A;  1N6Z A;  4AP4 C;  2IND C;  2DZI A;  1UNS A;  3AXC A;  3KWL A;  1D3Z A;  3AED B;  5E6O A;  3SDL C;  3VTU A;  1VZ7 A;  1JML A;  2V9H A;  3CMM B;  1PGX A;  2KVR A;  4BOS C;  4E3C A;  2ZNV B;  1AAR A;  4XE0 A;  4EFO A;  1RFK A;  4OW0 A;  2JY6 A;  1UUP A;  2LJI A;  1I4P A;  2KQS A;  2JRH A;  2KX0 A;  2KMC A;  3RN9 C;  4DXG A;  2K8C A;  1FEH A;  4RGO S;  1WWT A;  1DOX A;  3A9K B;  1AN8 A;  5IN7 A;  4E74 A;  1NYQ A;  3HIZ A;  2KLG A;  4RH6 A;  4NQL B;  4HKQ A;  3UIN B;  4MT5 A;  2V0G A;  3PRM B;  1FFV A;  2YEP B;  2VH1 A;  3VQI A;  2CJN A;  3RZW C;  2L83 A;  4J6I A;  2C7M B;  1ZGU B;  4LJP B;  4XGA B;  3TEZ A;  4NQK E;  2H89 B;  4XDC A;  1VZ8 A;  3PGE A;  2M4N A;  3LB8 C;  3C19 A;  2WDV B;  2Y5P A;  2AQ3 B;  3ZNH B;  3SEB A;  1CZP A;  2G3Q B;  2WS3 B;  4K3B A;  2G1E A;  2NVU I;  1EM7 A;  2L1A A;  2N0S B;  4DHZ B;  2HJ8 A;  3BVM A;  1RAX A;  5C2T B;  4LK0 M;  2AL3 A;  4BAX A;  3MJW A;  3ZTC A;  2KN4 A;  2PMV A;  2O6V D;  2BKR B;  3PHX B;  2IJ0 A;  3PPA A;  3EUB 2;  2MRP A;  1Y8R C;  4J3O D;  4A9A A;  3AE3 B;  3AU5 A;  4JIO U;  3TJP A;  3NY5 A;  1K52 A;  3VTW A;  3LJ3 A;  1J7C A;  2KWV B;  1TS4 A;  1H8C A;  1XLN A;  2WXH A;  4KGR A;  3ZNI D;  2KJH B;  1LQB A;  3B1L X;  2WXQ A;  1EWY C;  4NJ6 A;  1C79 A;  1NEK B;  2J0J A;  1OQR A;  3GOE A;  2LGX A;  4KIK B;  1JWM D;  3IXS A;  1C78 A;  4RM9 A;  5J18 A;  1SBB B;  3R2T A;  2RR9 A;  3V6E B;  5J17 A;  1V6E A;  4PS3 A;  2IPK D;  4KV2 A;  3TSS A;  1SE3 A;  1E8Y A;  3VH3 B;  1YQB A;  4ZYS A;  3ALB A;  1UD7 A;  2KFK B;  4C00 A;  2V1Y A;  1V2Y A;  1WIA A;  3URY A;  1YD8 U;  3DHH C;  1VLB A;  2X38 A;  2WNM A;  1SE2 A;  2OJW A;  2N1W A;  1WXS A;  3RPF C;  2PVO D;  3V6C B;  2NPT B;  5IP4 D;  1UGM A;  1QOG A;  1TKG A;  2PJH A;  2DWQ A;  2HJ1 A;  2QEJ C;  2LGI A;  3GS2 A;  2A5U A;  4DK5 A;  1K8R B;  2M19 A;  4ANU A;  1T3Q A;  1AYF A;  3W1S A;  3AEG B;  3IT4 B;  1XQQ A;  4HJG E;  5AUI A;  3RFZ B;  2LGD A;  3PRZ A;  3KH0 A;  4C7Z A;  4M0W A;  1CJE A;  1YJJ A;  1CMX B;  1V1P B;  3UQB A;  2ASQ A;  1P9D U;  1G6J A;  3JSV B;  3KUC B;  3Q3M C;  1KLG D;  2M8S A;  2KDE B;  3KLS X;  2JT4 B;  2MBO A;  1UGJ A;  3ZVV A;  2ZW0 A;  1E90 A;  2BQQ A;  3A4R A;  2WDR B;  1T0S C;  2YLM A;  1FNV A;  4ZRQ A;  5I4D A;  5L95 C;  1R4N I;  5LXI B;  1E5W A;  1WJN A;  3R66 C;  2N9L A;  3RMK C;  3PLV A;  3MHZ A;  4JWS C;  4MSQ B;  3MC0 B;  4NPN A;  4FXC A;  3L08 A;  4K7U A;  1RRB A;  4EOY A;  1PYW D;  2K6Q A;  2K9X A;  3PZ8 A;  4XC2 A;  1HQR D;  4BFR A;  2K6D B;  4ZRI A;  2FCS A;  3I9V 1;  1A5R A;  2WWZ A;  5IO9 A;  4I6N B;  2AWT A;  3NOB A;  1T0Q C;  2J0K A;  4S17 A;  2MLB A;  2GBJ A;  3BWU D;  3IG3 A;  3N1X C;  3Q2A C;  1KH0 A;  2L0T A;  4GDL A;  4TKN A;  1ROE A;  1PQS A;  5EE9 A;  2KAJ A;  2PTL A;  1JWB D;  2PE9 A;  2DYO A;  4ZYN A;  2LFI A;  1ET9 A;  2N7J A;  1WGD A;  4AQ7 A;  2W3S A;  3QA8 A;  2TSS A;  2INN E;  3KYD D;  5CHF A;  2GOW A;  2I1K A;  3DBH B;  2X8X X;  1QQR A;  4UDU C;  1F1H A;  1VCB A;  3IBE A;  1SJE D;  4TSS A;  1N62 A;  4HLE A;  2QIL A;  1DOI A;  1MG8 A;  3WCQ A;  3H1U A;  2JUO A;  3VUX A;  4A90 A;  3GE3 C;  3O65 B;  1U4A A;  1QOF A;  2KJR A;  1TY0 A;  4US9 A;  3OJ3 A;  4MH8 A;  2PIA A;  1B9R A;  2W55 A;  1J8C A;  1E7P B;  1YJI A;  1BXT A;  4W9C A;  1L0X B;  5C3J B;  3ABV B;  4NY0 A;  1WMH A;  3DOW A;  1K51 A;  1WM2 A;  4C7Y A;  1T0R C;  4ZRK A;  1FXT B;  2EEL A;  3PV1 A;  2WXO A;  4LNO A;  1F0Z A;  1E7U A;  4KKJ A;  2WXJ A;  1AWD A;  2KHW B;  5T8I A;  1QLB B;  2O6V B;  5IOI A;  3BY4 B;  4OVV A;  1IPG A;  2Y5C A;  1IYF A;  3UI3 A;  3QJZ A;  4DDG D;  2ON8 A;  4C4V A;  3HHM A;  2D3G A;  5BYS A;  2GBM A;  2Z0E B;  4ZRJ A;  3A9J B;  2HD5 B;  3P42 A;  2LXC A;  2EKE C;  3U2S C;  2VRR B;  1ZXH A;  2QJL A;  1TZ1 A;  1LGR A;  3U8Z A;  2MHJ A;  4B95 A;  4NZL B;  3RNF C;  1OFF A;  2WXL A;  1XO3 A;  3IHP C;  4NNJ B;  1BUI C;  1SIJ A;  5BO4 B;  2FUG 1;  4ACF A;  1OQQ A;  1HZ6 A;  1OEY A;  2NMQ A;  2IGD A;  1OTR B;  4MSM B;  1F2R I;  3M3J A;  3Q6B A;  4WJP A;  2LD9 A;  4LNK A;  4CQN A;  2G45 B;  2D2Q A;  4WIP A;  4EUT A;  2CU3 A;  2G4D B;  2FCM A;  4WH4 A;  2N7D A;  1HTO A;  2BGF A;  4KSL C;  1TT5 B;  1SIF A;  3PO0 A;  1PDX A;  4CHK A;  3M62 B;  2YVC A;  3APD A;  4MDK E;  1GNU A;  2KJ6 A;  1GAQ B;  2GRI A;  2ZJD A;  4C56 C;  4US8 A;  4FJZ A;  2G9H D;  5D2M B;  1UH6 A;  5KHO A;  4WWM A;  4FA6 A;  3CST A;  3QIJ A;  5AEK B;  4GIV A;  4YT0 B;  1LXD A;  3NZU A;  3HK0 A;  2CKH B;  3W5V B;  3AEA B;  3MTN B;  2JVC A;  2PEA A;  1WM3 A;  4MEL A;  2QHO A;  1RFA A;  4W9J A;  1IBX B;  1WFY A;  2KWC A;  1C4P A;  2LI5 A;  2GBN A;  1YX6 B;  1VZ6 A;  2MBB B;  4AOF A;  2DYB A;  3ZTD A;  2OOB B;  3NZ3 A;  3DCG A;  2PPH A;  3A1Q A;  3RUI B;  2MP2 A;  1EU4 A;  1FM0 D;  3E56 A;  1XD3 B;  2I2Y A;  4WWO A;  3OG5 A;  4EZK A;  2LXA A;  3EEC A;  2RD0 A;  3NS8 A;  1F9J A;  4WUR A;  3AEE B;  2XK5 B;  1V1O A;  4HPM B;  1CQV A;  2SEB D;  3QWZ B;  4KDL B;  3Q8A A;  4RF0 A;  3TIX A;  5GXG B;  4N59 A;  1QOA A;  5JXV A;  3DVG X;  3NVW A;  4PS7 A;  2KDF B;  4TUU A;  3AB5 A;  4M8M A;  3DPD A;  3ML9 A;  2GMI C;  3VVW B;  3UQA A;  5BMI A;  3SR6 A;  1I4H A;  4GDK B;  4II3 B;  4W9D A;  2MJD A;  1WXM A;  1I4X A;  3FIL A;  3L16 A;  3V61 A;  4ICV A;  4YXD B;  5D94 A;  2WXG A;  3EC8 A;  4MM3 B;  1XF5 L;  1WJ6 A;  3QAQ A;  4WQM A;  2I1J A;  1WYW B;  2J7Q B;  1IP9 A;  1DYQ A;  1TBE A;  4H2A A;  2ACZ B;  2D5G A;  3A4S C;  2C5L C;  2KX3 A;  2AQ2 B;  3DWM A;  2MW5 A;  3ZNZ B;  1YOV B;  2KTR B;  3P63 A;  3R2I A;  3DWG C;  2KQ4 X;  1I42 A;  3DVN V;  4YWG G;  1HE8 A;  1X1M A;  3JYU A;  2NS5 A;  3WAP A;  3DBR I;  2MCN B;  3DVG Y;  2C9W B;  4GSW A;  2M17 A;  1E9M A;  3TMP B;  1RLF A;  4W9H A;  1GPX A;  4DHZ E;  5DCN A;  2QMT A;  4WQO B;  1E6E B;  4OVZ A;  3KVF B;  4IWP A;  2JU6 X;  1V49 A;  1FFU A;  5AUK A;  4F8C B;  3V60 A;  2MH7 A;  1FPY A;  2XBB C;  3QHT A;  4EKU A;  1F77 A;  4YSX B;  2NBV B;  2GI9 A;  1RWS A;  5LLI A;  3VHT C;  1N63 A;  4NAW A;  4YTM B;  4HRO A;  5DPR A;  2CJO A;  2KD0 A;  2L7R A;  1WX7 A;  4P1B C;  1WGG A;  2LVO A;  3LDZ E;  2BVC A;  4LNF A;  1N61 A;  3APC A;  1PGA A;  2W54 A;  2QDF A;  5C23 A;  5HI1 A;  4Q2J A;  3H9D A;  4GB9 A;  2LGY A;  3Q8E A;  3AE6 B;  3ZYY X;  2CS4 A;  1TS5 A;  4FN2 A;  2WDT B;  3CWI A;  2NTT A;  2IDY A;  4OHJ A;  4FBJ B;  3HRD D;  1VJK A;  4F7Z A;  2D11 A;  3X0W A;  5D3I B;  2MX2 A;  4G50 A;  4YL8 A;  1F2R C;  2JPH A;  4LJO B;  3AEC B;  4RGT A;  1LO5 D;  1FRD A;  5FK9 C;  2V4L A;  4LNI A;  3U7Z A;  2KQ7 A;  3SFE B;  3EA6 A;  3PRE A;  2B76 B;  2MBH A;  3SD5 A;  3AE1 B;  3OJ4 B;  3I63 C;  4MJS B;  2JF5 A;  3E9S A;  4JE3 B;  1NVI D;  1TS3 A;  2IO1 B;  2MBE A;  3PHW B;  1NI3 A;  2AEH A;  4HPL B;  3ZO5 B;  1SJH D;  1YNT E;  1GJZ A;  2DZM A;  4GXB A;  1V97 A;  3TL5 A;  3TEY A;  2RDH A;  1T0Y A;  2JXX A;  3P4Q B;  2CHZ A;  4REZ A;  5G5H A;  4ITK A;  1MJD A;  5G5G A;  1AW7 A;  5HKH A;  2JYT A;  1ZOY B;  1C4C A;  1C3T A;  3NVY A;  1M94 A;  1XLP A;  2WP9 B;  3CIR B;  3I3T B;  4FHJ A;  3Q14 C;  1WYG A;  3VDZ A;  1WZ0 A;  3UIO B;  2J0M A;  1ZP0 B;  2ZPY A;  1D5Z C;  2VZK D;  4NJC A;  1KLV A;  5CHV C;  3B08 A;  2JZP A;  1YN3 A;  2LHD A;  4MGZ E;  1OEY J;  5BYR A;  3VTV A;  2R2O A;  4F1S A;  1PUT A;  4YTP B;  1N5X A;  1SE4 A;  1L6V A;  3L17 A;  4HCP B;  2E3T A;  1OGW A;  1BT0 A;  1XCQ L;  3ZW3 A;  1KFY B;  3KQ4 A;  1I4G A;  2JWZ A;  3DQV A;  1VDV A;  1J0G A;  2EMS A;  3IT6 B;  1N60 A;  4ASW C;  1JCK B;  1UBQ A;  2K8B A;  4IM3 A;  4XWW A;  3T3O A;  1WGH A;  3B2F A;  1ZDV A;  2ZCC A;  3H6N A;  3U52 E;  1MHX A;  4ICU A;  4G3X B;  4MGK E;  1WX9 A;  4YTN B;  5G55 A;  3PLU A;  3FAH A;  1ZE3 D;  1ISN A;  4B6W A;  1WH3 A;  2EKI A;  4K81 A;  1K53 A;  3H7S A;  1V9J A;  2GBK A;  4GOC A;  1GB4 A;  4BZA A;  5HG2 A;  5DPT A;  3VAW A;  2QC8 A;  2XN9 C;  3VXW A;  2OED A;  3QQ8 B;  1HZ5 A;  3RNA C;  4WWN A;  2WLB A;  4L2Y A;  1L5P A;  1V80 A;  1MPE A;  1E10 A;  3VRA B;  4OVU A;  2KNB A;  2Z59 B;  3PTF C;  2PVG C;  2RPV A;  3EFU A;  1EWC A;  5AZF A;  3PSE B;  5FKA C;  1DGJ A;  2NCN A;  3W5U B;  3AEF B;  4AJW A;  3L4P A;  1J7B A;  3P4S B;  2KWD A;  4KX6 B;  3NG0 A;  3VFK A;  5IA7 A;  4ZRP A;  4W9G A;  3KWV A;  2BWE S;  1MVK A;  2KT7 A;  2Q5W D;  2RDG A;  3KW5 B;  1JAL A;  4OZC A;  2HDE A;  4DBG A;  2KAC A;  2I38 A;  5J2R A;  2W3R A;  2JRI B;  2FIF A;  2DAF A;  5EE0 A;  1YN4 A;  1Y56 A;  1TIF A;  3PT2 B;  4RNA A;  1WJU A;  2JQR B;  3MC8 A;  3EFC A;  2UWQ A;  2LMC A;  4LNN A;  2FCQ A;  3U30 A;  1M4V A;  3MP9 A;  5LXH A;  1Q0W B;  2DAJ A;  2MSE D;  3ETR A;  1WXA A;  4RF1 A;  2DEN B;  2WQY B;  3BII D;  2XK5 A;  1SGH A;  2RPQ A;  3V62 A;  1IGD A;  4HCN B;  2DHZ A;  3MJ5 A;  2KC2 A;  2N9P C;  4TQ0 A;  4R3D A;  4M00 A;  4AUQ C;  4WWP A;  4K7W A;  3ZGZ A;  4KGS A;  1JWS D;  2Y5B B;  3NZS A;  3TEW A;  1C1Y B;  2ZNV C;  1Q10 A;  1UWX A;  3AV8 A;  1ET6 A;  1P7F A;  3ZRF A;  1WF9 A;  3GB1 A;  1Q1O A;  2QSD A;  1T6B X;  2ZEQ A;  4HDQ A;  1UF0 A;  3VH4 B;  3IAS 1;  3NUH B;  2BF8 B;  3NS1 A;  3H7P A;  3ZXV A;  4XX5 A;  4TMA B;  4HRS A;  3U7D A;  3IFW B;  2QCZ A;  1I7H A;  2RGF A;  2QIE B;  3DBH I;  3PZ7 A;  2M56 B;  3OWE B;  1NYR A;  1ZXI A;  3W2D A;  3AI5 A;  3O13 A;  4WJN A;  4KKI A;  2K5P A;  4EZL A;  3ZLZ A;  2N9X A;  1WGK A;  2IGH A;  1D5M C;  4JLC A;  4DWF A;  1ZUD 2;  1V8C A;  3AH7 A;  3PS6 A;  2O2V A;  1T5X D;  1YQ3 B;  2INP E;  4BKS A;  2V3S A;  1RM6 C;  2V3P A;  3A33 B;  1LFD A;  2V3N A;  2G4S A;  4AJY B;  2VZK B;  1PFD A;  4KVG B;  2XEW A;  5H8Y E;  4HK2 A;  1QIL A;  2AYO B;  2HTH A;  2MJ3 A;  2L05 A;  1TS2 A;  1L0Y B;  3HUI A;  2WX1 A;  1WRD B;  4GMV A;  3WAN A;  2IBI B;  5FR6 A;  3VRB B;  3CF6 E;  2LGS A;  3QX1 A;  3TEX A;  1TKY A;  3DBL B;  4P16 A;  2KTF A;  1STE A;  3N30 A;  3A9K A;  2BT6 A;  3GZN B;  1WR6 E;  2L3Z A;  3ZJU A;  4ANV A;  1QT9 A;  4K3C A;  3VR9 B;  3I57 A;  1WGR A;  2K25 A;  2WU2 B;  2BPS A;  1CK1 A;  1SE9 A;  2KZR A;  2J42 A;  4FLH A;  1DOY A;  3QAR A;  4PK1 A;  2Y3A A;  2GBR A;  4GDL B;  4M02 A;  2INC C;  4K1R B;  3NHE B;  2WX0 A;  4MEM A;  4FJV B;  3N1Z C;  2N7E A;  3RNC C;  1VD2 A;  2KO3 A;  4OZA A;  3HM6 X;  2NTS A;  4I6L B;  5E6J A;  1QKZ A;  2ZVO A;  3Q8F A;  4MH0 E;  2CR5 A;  4WAA A;  2D3A A;  3T9L A;  3ZNG C;  1WRI A;  4P6V F;  4ARC A;  2V4I B;  5EDS A;  3MHS D;  3KYC D;  5CX3 A;  4C80 A;  1TJE A;  4ZHO A;  1TZO A;  2KXJ A;  1JWU D;  3FKY A;  1EUV B;  1NBF C;  2MEK A;  3UGB B;  4A3O A;  2L52 A;  2LUM A;  2KC1 A;  4KZ0 A;  3GP7 A;  4ZHP A;  2MQJ A;  1WY8 A;  1KTK A;  4IDI A;  4AS1 A;  4HVB A;  1C9F A;  4KIK A;  5AZG A;  5BMH A;  4BKG A;  1WMH B;  3M63 B;  3W1Y A;  2N1V A;  2Z8L A;  3Q8B A;  3BK2 A;  3OAW A;  1EU3 A;  2BS2 B;  4FAD A;  2EMT A;  4RMA A;  4HKZ E;  5IAA C;  4B0M A;  2KN5 A;  2RSU A;  2KLC A;  2KFK A;  3CSF A;  2DYM A;  4W9I A;  5G2N A;  4MAC A;  3HVZ A;  4G0N B;  2PKO A;  1IGC A;  2NPT A;  3AMZ A;  1L4D B;  1SEB D;  1EF1 A;  1UEL A;  3JW0 X;  1V5T A;  2C7H A;  1PGB A;  5E6P A;  3DDC B;  3NVV A;  4M01 A;  2Z0D B;  4YSY B;  3Q3F A;  3RT3 B;  5E6N A;  3P1M A;  4IM2 A;  1WE6 A;  3GE8 C;  4M8N A;  4X57 B;  1L7Y A;  2J53 A;  2DNF A;  3KUD B;  2HE7 A;  4A20 A;  4EE2 A;  1E0Z A;  1XCT L;  5DPS A;  4ZDV A;  1V1P A;  4KSK C;  2KYW A;  2DX5 B;  4CYE A;  5L83 A;  2ICI A;  3JSV A;  1YMH E;  1Z5S B;  3K9O B;  1NI2 A;  4GN1 A;  1WXQ A;  2IZV B;  2M0A A;  2FCN A;  3J9C A;  2SAK A;  2BB5 A;  2DZK A;  5JZE B;  3IAM 1;  2IY0 B;  4RGN A;  3LXF A;  4PYU A;  2WXP A;  1GUA B;  2LEK A;  2NBW B;  2W82 A;  3MC9 A;  2ZCB A;  4B9K A;  4WJO A;  2J4X A;  1FNW A;  1JRP A;  1KJT A;  2OJR A;  4PYZ A;  4XWT A;  3ZXR A;  2PE6 B;  1ENF A;  3AE2 B;  4DHJ D;  1WI0 A;  2KMM A;  1HTQ A;  2FUH B;  1SSN A;  2ONQ A;  3SU8 X;  2R61 A;  3L54 A;  2FID A;  5CTR C;  3EHV A;  3K9P B;  3AE9 B;  1J19 A;  4N6E B;  3RNG C;  4G11 A;  1E7V A;  1C76 A;  4IM0 A;  4E71 A;  2LZ6 A;  3X23 A;  4ANX A;  2DLB A;  2ZVN A;  3T3N A;  2WXI A;  1E8X A;  1HXY D;  2L76 A;  3D32 A;  1F52 A;  1P0R A;  4RGM A;  1WXV A;  3ZRC A;  5C1Z A;  1JQ4 A;  3IVF A;  1ZPS A;  3L0W B;  1C4A A;  1WR1 A;  1MG4 A;  4URK A;  2LVQ A;  3ZQ4 A;  4GGQ A;  3C0R B;  2BW2 A;  4HXD A;  1GG3 A;  2JWU A;  1OQY A;  3A1Q B;  2MP2 B;  2LWP A;  3R7Q A;  4MGI E;  3KUZ A;  3WAL A;  4B0E A;  1MHH E;  3RNB C;  1JW9 D;  4QAY A;  4ZOH C;  1FNU A;  3ZUN A;  4IWQ A;  1QF6 A;  2L0F A;  3WAM A;  5H92 C;  3TUO A;  2FBW B;  1XLO A;  2BB6 A;  2JX5 A;  1QZE A;  3DHG C;  2LVP A;  3S2A A;  1XXG A;  1K50 A;  2PW9 A;  4JQW C;  3B9J A;  1LM8 B;  3RCZ A;  3QC8 B;  4HDO A;  4A55 A;  2YEP F;  4HJK A;  3W1S C;  2N4F A;  3UIP B;  1ESF A;  2KWU B;  2RDB C;  3FIL B;  1ZDX A;  3QCA A;  4KGT A;  1RYJ A;  3N32 A;  3AU4 A;  1FCC C;  2JZ3 B;  1L4Z B;  3L10 B;  4JL9 A;  4DXF A;  1R4N B;  3AEB B;  1N5W A;  5D7G A;  4BKT A;  3P4R B;  1IUE A;  1A70 A;  2JYE A;  2LUE A;  2K3U A;  3BK1 A;  1WGY A;  1JWA D;  4IG7 B;  2BS3 B;  2REX A;  2WGS A;  2BKF A;  1I35 A;  4TV3 A;  2O6V A;  5JHA A;  2D10 A;  3ZJV A;  1YQ4 B;  3ZIM A;  3AE8 B;  3BYT B;  2JSV X;  3N1Y C;  1R4M B;  4BBN C;  1TY2 A;  3AN1 A;  5BMG A;  1L0V B;  4IWO A;  1J7A A;  4W9L A;  4LDT D;  4DDI D;  5KHQ A;  3ZKJ C;  3A9J A;  1FIQ A;  1TKE A;  4NJ7 A;  1KLU D;  1L6U A;  4GU2 A;  2H88 B;  3R7R A;  3BIN A;  2FAZ A;  2MA9 B;  4WJQ A;  1P98 A;  4OZB A;  2IYD B;  4I6P A;  3T8M A;  4NAW B;  3U4E G;  1Z2M A;  3DHI C;  2DZJ A;  2N9E B;  5CHW A;  3BYY B;  2BYT A;  1I4Q A;  1H4R A;  4FUL A;  2D3C A;  1BML C;  4IC7 B;  2WXN A;  2W9N A;  1GB1 A;  2K39 A;  3Q8C A;  3QK0 A;  3EGR A;  2BYE A;  3Q69 A;  4ARI A;  1MFW A;  4AWJ A;  3RD2 A;  1ZKH A;  3C8Y A;  2K0P A;  2RMM A;  1SB3 C;  1L2N A;  3B2G A;  3WAO A;  2PLP A;  3DVN U;  2L00 B;  2VH2 A;  2J52 A;  2BWF A;  1FMA D;  3NVZ A;  3BZD B;  1R4M I;  4IW0 A;  3SFD B;  3RZF A;  4RFB A;  4FJY A;  2MJE A;  2CU1 A;  4RM8 A;  3ZDT A;  2FE8 A;  4O1N A;  1QOB A;  1GOZ A;  3RNE C;  3RUL A;  2C7N B;  1GC6 A;  1IBX A;  3PRP B;  4JPS A;  2CHX A;  3Q3O C;  3AUL A;  5GMV A;  2K1F A;  1E8Z A;  2ZPN A;  2C60 A;  2BTE A;  4MGY E;  2LAS A;  2L32 A;  2BYV E;  3AE7 B;  2B3A A;  4II2 B;  4PS8 A;  1FCL A;  2ZZP B;  3APF A;  3N3K B;  2NBU A;  2KVZ A;  2HTM E;  1YJ1 A;  4WAF A;  2WXR A;  2K8H A;  3RI7 C;  3ZJT A;  1SXT A;  1FRR A;  1UBI A;  4A6Q A;  4DHJ B;  2UYZ B;  2LRU A;  4D2K A;  4KDI C;  3ENE A;  3P4P B;  5EE1 A;  2R2Q A;  4BKS D;  5HFY A;  1FXA A;  2KKC A;  3Q3J A;  2BYF A;  3ML8 A;  4N9F 4;  1R7S A;  2ZW1 A;  3ONS A;  5TSS A; 
#chains in the Genus database with same CATH homology
 1AYF A;  1HEZ E;  1XEE A;  3N9Y C;  3W1S A;  3AEG B;  3IT4 B;  4HJG E;  5AUI A;  4C80 A;  3RFZ B;  5LNK 1;  3Q8E A;  4C7Z A;  3AE6 B;  4M0W A;  1CJE A;  1TJE A;  2WXM A;  1YJJ A;  3ZYY X;  2K22 A;  4ZHO A;  1TS5 A;  1V1P B;  1TZO A;  1P7E A;  1JWU D;  3CWI A;  1TYG B;  2NTT A;  2IDY A;  4OHJ A;  1KLG D;  2BBC A;  2MEK A;  3HRD D;  1VJK A;  2L52 A;  1VRA B;  3KLS X;  2LUM A;  5D3I B;  1UGJ A;  2XNA C;  2ZW0 A;  2AQ1 B;  2WDR B;  1VR9 A;  1F2R C;  1FNV A;  4ZRQ A;  5I4D A;  3GP7 A;  3AEC B;  4RGT A;  4ZHP A;  5FR3 A;  1LO5 D;  1FRD A;  5FK9 C;  1UWM A;  2KDM A;  3U7Z A;  2N9L A;  3SFE B;  1KTK A;  3EA6 A;  4IDI A;  4USA A;  4AS1 A;  2B76 B;  3MHZ A;  1C9F A;  4JWS C;  5BMH A;  3AE1 B;  3MC0 B;  4RCO A;  4FXC A;  3E9S A;  4JE3 B;  2Z8L A;  3Q8B A;  3BK2 A;  1NVI D;  1EU3 A;  1TS3 A;  3V3X A;  1I4R A;  2BS2 B;  1PYW D;  1NI3 A;  1D5X C;  2K9X A;  2BS4 B;  3PZ8 A;  1HQR D;  1SJH D;  4HKZ E;  5EE3 A;  4B0M A;  1YNT E;  1KF6 B;  1NEN B;  4N58 A;  1MI0 A;  1V97 A;  3H8H A;  3I9V 1;  3TEY A;  2WXK A;  2DYM A;  4GLS C;  2RDH A;  2LHE A;  4MAC A;  3P4Q B;  3HVZ A;  1B1Z A;  4REZ A;  5G5H A;  4ITK A;  2PKO A;  5G5G A;  1IGC A;  1AW7 A;  3AMZ A;  1L4D B;  3AE4 B;  1ACC A;  1SEB D;  2JYT A;  1ZOY B;  1C4C A;  3NVY A;  3BWU D;  1KH0 A;  1PGB A;  3V05 A;  1XLP A;  1C77 A;  3NVV A;  2WP9 B;  4YSY B;  3BVZ A;  3CIR B;  1ROE A;  5MPO A;  5EE9 A;  2KAJ A;  1JRO A;  2PTL A;  1WYG A;  3P1M A;  1JWB D;  1ZP0 B;  2AX5 A;  1D5Z C;  2VZK D;  4NJC A;  2DYO A;  2LFI A;  2J53 A;  1ET9 A;  2N7J A;  3NRZ A;  4AQ7 A;  2W3S A;  2TSS A;  3AM9 A;  2WXF A;  2JZP A;  1FXI A;  1YN3 A;  2INN E;  2WDQ B;  2LHD A;  4XDD A;  4EE2 A;  1E0Z A;  5BYR A;  1XCT L;  1QQR A;  4UDU C;  3VR8 B;  1V1P A;  4TQ1 A;  1D4B A;  1SJE D;  4TSS A;  5BYQ A;  1N62 A;  4HEA 1;  2ICI A;  1PUT A;  4YTP B;  1YMH E;  1N5X A;  2QIL A;  1SE4 A;  1L6V A;  1DOI A;  3WCQ A;  2GB1 A;  2E3T A;  1WXQ A;  2M0A A;  4IKG A;  4A90 A;  1XCQ L;  3J9C A;  1KFY B;  2SAK A;  2BB5 A;  3KQ4 A;  1I4G A;  1QOF A;  1VDV A;  1TY0 A;  4US9 A;  4MH8 A;  2PIA A;  1B9R A;  3IT6 B;  2W55 A;  4DQO C;  3IAM 1;  1E7P B;  1WSP A;  1YJI A;  3LXF A;  1N60 A;  4RGN A;  1JCK B;  1BXT A;  2WXP A;  1L0X B;  1YN5 A;  4XWW A;  2LEK A;  1KRH A;  2W82 A;  3T3O A;  5C3J B;  3ABV B;  3MFG A;  3B2F A;  1FO4 A;  1ZDV A;  2J4X A;  1FNW A;  1JRP A;  3U52 E;  1K51 A;  1MHX A;  3HVD A;  4XWT A;  4C7Y A;  2EEL A;  1SF0 A;  2WXO A;  4YTN B;  2N9K A;  1ENF A;  3AE2 B;  4JWU C;  3FAH A;  1ZE3 D;  1F0Z A;  2KMM A;  4KKJ A;  3FC4 A;  2WXJ A;  1SSN A;  2ONQ A;  1FD6 A;  2R61 A;  1AWD A;  2EKI A;  4N6E B;  3AE9 B;  5T8I A;  1QLB B;  1K53 A;  1C76 A;  4LLG M;  2DLB A;  4L23 A;  3T3N A;  1GB4 A;  2WXI A;  1HXY D;  5HG2 A;  2Y5C A;  3UI3 A;  4RGM A;  3R8B A;  1JQ4 A;  2XN9 C;  1ZPS A;  2ON8 A;  1C4A A;  2OED A;  4L1B A;  3ZQ4 A;  5BYS A;  2BW2 A;  1HZ5 A;  3P42 A;  2WLB A;  4L2Y A;  1L5P A;  3U2S C;  1ZXH A;  2JWU A;  1MPE A;  1E10 A;  2QJL A;  3VRA B;  5HHD G;  2IGG A;  4B0E A;  2PVG C;  5D3D A;  4LTU A;  1MHH E;  2RPV A;  1EWC A;  4A8X C;  4NZL B;  1JW9 D;  1OFF A;  4ZOH C;  2WXL A;  1FNU A;  1XO3 A;  1BUI C;  1SIJ A;  4JX1 C;  3LYY A;  5FKA C;  3W9C B;  1QF6 A;  2FUG 1;  1OQQ A;  1DGJ A;  1HZ6 A;  5H92 C;  3BVG A;  2NMQ A;  3TUO A;  2DBY A;  2JXT A;  2FBW B;  1XLO A;  2IGD A;  3W5U B;  1F2R I;  3AEF B;  4YSZ B;  2BB6 A;  3L4P A;  1J7B A;  4CQN A;  1XLQ A;  3P4S B;  2JX5 A;  2KWD A;  4KX6 B;  2E6X A;  4ZRP A;  4WIP A;  3KWV A;  1XXG A;  2OHF A;  1K50 A;  2PW9 A;  2WU5 B;  2CU3 A;  1MVK A;  3B9J A;  4WH4 A;  2Q5W D;  2RDG A;  1JAL A;  4OZC A;  4A55 A;  1D6E C;  2HDE A;  4PT5 A;  2YEP F;  3AE5 B;  3PO0 A;  2KAC A;  1PDX A;  2I38 A;  2W3R A;  1ESF A;  4NAM A;  1HA5 A;  3FIL B;  1ZDX A;  4IOI E;  5EE0 A;  1YN4 A;  4KGT A;  1GAQ B;  1RYJ A;  2GRI A;  1UNS A;  1FCC C;  1Y56 A;  3KWL A;  1L4Z B;  4RNA A;  3AED B;  2JQR B;  4DXF A;  3AEB B;  1N5W A;  4C56 C;  5D7G A;  4US8 A;  2G9H D;  2LMC A;  3P4R B;  1IUE A;  1A70 A;  1VZ7 A;  2JYE A;  4WWM A;  1M4V A;  1JML A;  2K3U A;  3BK1 A;  3MP9 A;  1JWA D;  1PGX A;  4YT0 B;  2BS3 B;  3ETR A;  4RF1 A;  3W5V B;  3AEA B;  3ZJV A;  2WQY B;  3BII D;  1YQ4 B;  4XE0 A;  3AE8 B;  1RFK A;  2JSV X;  3BYT B;  4OW0 A;  1TY2 A;  1IGD A;  1UUP A;  3AN1 A;  1IBX B;  5BMG A;  1L0V B;  2LJI A;  1I4P A;  1C4P A;  1J7A A;  3MJ5 A;  1VZ6 A;  4DXG A;  1FIQ A;  1TKE A;  1FEH A;  4RGO S;  1WWT A;  4TQ0 A;  4R3D A;  1DOX A;  3NZ3 A;  1KLU D;  1L6U A;  2H88 B;  1AN8 A;  1EU4 A;  1FM0 D;  1NYQ A;  4RH6 A;  3ZGZ A;  3E56 A;  4KGS A;  4HKQ A;  1JWS D;  3TEW A;  2I2Y A;  4MT5 A;  1Q10 A;  1UWX A;  4OZB A;  3AV8 A;  2V0G A;  1ET6 A;  1P7F A;  1FFV A;  4WUR A;  3GB1 A;  2YEP B;  3AEE B;  3VQI A;  2CJN A;  2QSD A;  1T6B X;  2L83 A;  1V1O A;  1CQV A;  4NAW B;  3U4E G;  2SEB D;  3TEZ A;  3IAS 1;  3BYY B;  3NUH B;  2BYT A;  4RF0 A;  2H89 B;  3Q8A A;  4XDC A;  1VZ8 A;  5GXG B;  4N59 A;  1I4Q A;  3NS1 A;  3LB8 C;  1QOA A;  4TMA B;  5JXV A;  2WDV B;  2Y5P A;  4HRS A;  2AQ3 B;  1I7H A;  1BML C;  2WXN A;  3SEB A;  1GB1 A;  1CZP A;  2QIE B;  3NVW A;  3PZ7 A;  3AB5 A;  2M56 B;  3Q8C A;  3OWE B;  2WS3 B;  1NYR A;  1ZXI A;  3W2D A;  3O13 A;  2G1E A;  4KKI A;  2K5P A;  1EM7 A;  2L1A A;  2N0S B;  3EGR A;  5BMI A;  3SR6 A;  1I4H A;  1WGK A;  2IGH A;  3Q69 A;  4GDK B;  1D5M C;  3BVM A;  5C2T B;  4ARI A;  2MJD A;  4LK0 M;  1ZUD 2;  1I4X A;  1V8C A;  3AH7 A;  3FIL A;  3C8Y A;  2K0P A;  2KN4 A;  4YXD B;  2PMV A;  1T5X D;  1YQ3 B;  2INP E;  2WXG A;  2RMM A;  1SB3 C;  4MM3 B;  3B2G A;  2PLP A;  1RM6 C;  1XF5 L;  2IJ0 A;  2V3P A;  2J52 A;  3EUB 2;  2V3N A;  4WQM A;  1FMA D;  3NVZ A;  2VZK B;  3BZD B;  4J3O D;  4A9A A;  3AE3 B;  1DYQ A;  4H2A A;  3SFD B;  2ACZ B;  2D5G A;  4RFB A;  1PFD A;  2MJE A;  2AQ2 B;  2FE8 A;  1K52 A;  3DWM A;  5H8Y E;  4O1N A;  1J7C A;  1TS4 A;  3P63 A;  1XLN A;  1QIL A;  1QOB A;  2V4I B;  2WXH A;  3DWG C;  3R2I A;  2KQ4 X;  4KGR A;  2MJ3 A;  4YWG G;  1GOZ A;  1L0Y B;  1TS2 A;  3HUI A;  2WXQ A;  1EWY C;  1E9M A;  1C79 A;  1NEK B;  1IBX A;  1OQR A;  1GPX A;  3VRB B;  1JWM D;  4JPS A;  2QMT A;  3TEX A;  1TKY A;  4P16 A;  3IXS A;  1STE A;  1C78 A;  1SBB B;  1E6E B;  4OVZ A;  3R2T A;  2BTE A;  2JU6 X;  2BT6 A;  1FFU A;  2L32 A;  5AUK A;  3AE7 B;  2MH7 A;  3ZJU A;  2IPK D;  4ZYS A;  3TSS A;  1SE3 A;  1FCL A;  1F77 A;  4YSX B;  1QT9 A;  3VR9 B;  3I57 A;  3URY A;  1VLB A;  2X38 A;  2WNM A;  1SE2 A;  2GI9 A;  2HTM E;  2WU2 B;  1RWS A;  4WAF A;  2WXR A;  3RPF C;  3ZJT A;  1CK1 A;  1SXT A;  2PVO D;  1FRR A;  2J42 A;  1DOY A;  1N63 A;  4A6Q A;  1QOG A;  4YTM B;  4D2K A;  4HRO A;  2Y3A A;  2CJO A;  1TKG A;  3P4P B;  2DWQ A;  4GDL B;  2QEJ C;  2LGI A;  3GS2 A;  5EE1 A;  5HFY A;  1N61 A;  4OZA A;  1FXA A;  1PGA A;  2W54 A;  2NTS A;  5E6J A;  1QKZ A;  3Q8F A;  5HI1 A;  1R7S A;  2M19 A;  1WRI A;  2ZW1 A;  4P6V F;  5TSS A;  4ARC A;  4Q2J A;  1T3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...