3PPAA

Structure of the dusp-ubl domains of usp15
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
209
Chain Sequence
b'LDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQQVLVIEQKNEDGTWPRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structure of the Dusp-Ubl Domains of the Ubiquitin-Specific Protease 15
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 46
structure length 209
sequence length 215
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ppaA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3ppaA01
2DZMA 3CSTA 2CHXA 1RAXA 3VQIA 4K7SA 2MP2B 3KUDB 3TJPA 1WFYA 3JW0X 5LLIA 3ML9A 2RGFA 4HPMB 4EOYA 1WE6A 2FCSA 2KVRA 4GMVA 2WX1A 4MJSA 2UYZB 2C7NB 2D3GA 4DDID 4LJPB 4LDTD 2HD5B 1TZ1A 3AULA 3NZUA 1GC6A 3M62B 3H7SA 4G50A 3WAMA 5KHQA 3KW5B 4GDLB 2C5LC 2LZ6A 5JZEB 2D07B 2KD0A 2LWPA 3C0RB 1C1YB 3RULA 4BVUC 4EZKA 3QWZB 4W9LA 3UINB 4EFOA 1EO6A 3A4SC 3JYUA 3QIJA 3CF6E 2MLBA 3UQBA 2IO3B 2FAZA 1HE8A 4F1SA 1YIWA 1I35A 3OJ4B 4ICVA 2K8BA 2KTRB 3QCAA 4ZRJA 3R3MA 4TUUA 5G2NA 4G3XB 4NPNA 1V9JA 1EF5A 5AZHA 2BWFA 4RM9A 5J2RA 1XT9B 3B0AA 3A9JB 3EHVA 2DAJA 3VH3B 3V6EB 4FULA 4M0WB 4W9FA 4B95A 4HXDA 2DAFA 4HJKA 1R4MI 1WGHA 4LCDE 2ZNVC 3VUYA 2PE9A 3U8ZA 2JRHA 3AU4A 2KX0A 4GXBA 3HIZA 2MRPA 2V1YA 2A4ZA 3R66C 3VTUA 5CHWA 3H1UA 1WGRA 2XBBC 2O6VD 4AOFA 1WZ0A 5TR5A 1WR6E 5AZGA 2MWSB 2PJHA 1WIAA 1GUAB 3TIXA 5LXHA 1IYFA 4LJOB 2LASA 4DBGA 2DYOA 4IW0A 1SIFA 4GB9A 2KFJA 4ANUA 3DVNU 2N9PC 2DENB 3U30A 4W9HA 2KHWB 4JQWC 1E8ZA 2J7QB 3QQ8B 5BO4B 3UQAA 2KANA 4KSLC 5D2MB 2J0JA 3CMMB 2L0TA 4KVGB 3PGEA 4E71A 4IM0A 5IAAC 5DCNA 4URKA 3ML8A 1WM2A 1SGHA 4EKUA 3HM3A 1V6EA 3ZVVA 2DYBA 4J6IA 3HHMA 4CHKA 2KMCA 4GDLA 2L0FA 3K9PB 5CX3A 1UH6A 1V80A 1X1MA 4W9IA 4NAWB 4FBJB 1L2NA 1Z5SB 2JY6A 1WMHB 2KLGA 4ZRKA 2YVCA 4FA6A 5CTRC 2XK5B 1W6VA 2LJ5A 2FIFA 3DOWA 4MGKE 2WWZA 5E6OA 1UD7A 3OJ3A 1WF9A 1GC7A 4DHJB 2O2VB 2KTRA 2K6QA 2NVUI 2PE6B 5D6JB 4E3CA 2KWCA 3IVFA 4B9KA 4EEWA 2BYFA 5DPRA 3VVWB 2UWQA 3L10B 2LI5A 1YD8U 2D11A 3A9JA 3NY5A 4IM2A 2J0KA 4XZ4A 4HPLB 3ZNHB 1LXDA 1E5WA 1LFDA 3NS8A 3B08A 1KOTA 2CR5A 3M63B 4HCNB 2BF8B 3JVZX 3KYDD 3PRMB 2IO0B 4WJPA 4II2B 4GSWA 3APDA 5E6NA 4ZRIA 5J17A 4W9KA 3VUXA 3O65B 1Q5WB 5C1ZA 1P98A 2MBOA 4XX5A 4GDKB 1WXMA 2MSED 3DBHI 3L0WB 5L83A 4OVUA 1WM3A 3KYCD 2WX0A 1ZW7A 3DPDA 2LXAA 5CHFA 1P3QU 2RPQA 4AJWA 3RUIB 3VTVA 2NS5A 1E7VA 2M4NA 4N9F4 4NJ6A 4EZLA 4ICUA 2L05A 1JRUA 2EKEC 2R2QA 1Q0WB 3H7PB 4AP4C 1UBQA 5DPWA 1UELA 3PV1A 2N7EA 3PPAA 4M8NA 2XEWA 2KO3A 2CHWA 4PS7A 3A1QB 3KUZA 4W9GA 3NOBA 3W1SC 3QJZA 5G55A 3JSVB 3ZNZB 1LM8B 4NAWA 1G6JA 3SU8X 1TGZB 1WMHA 2KQSA 2VRRB 2M17A 2XK5A 2DX5B 3T9LA 2IY1B 4WJOA 4ANWA 4KV2A 3RT3B 1OQYA 3ENEA 2GOWA 2O2VA 3V60A 4BKSD 3VHTC 3WALA 2FCQA 2KMAA 4HK2A 2J0MA 2KLCA 5L95C 5J18A 2N1VA 2K8CA 4BOZB 3Q3JA 1RFAA 3CSFA 4JGHB 1SE9A 3PTFC 3VAWA 1WGGA 3TMPB 2KZRA 3IHPC 1NDDA 3W1YA 3VXWA 3QHTA 3SHQA 2Z0EB 2KDFB 1XD3B 3DBLI 1J19A 4ZYNA 3ZDMC 4KDLB 4CYEA 1E8XA 2G4SA 2DHZA 2K6DB 4IWQA 3N32A 3UF8A 4JIOU 2RD0A 2CU1A 4GDKA 3KUCB 4HDOA 4W9JA 2BKFA 2FCNA 2L76A 3DVGX 4RMAA 4ASWC 1VD2A 2PPHA 5AEKB 3PLVA 3UIOB 4HDQA 3VFKA 5GMVA 2LUEA 2G4DB 3PT2B 1H4RA 2BPSA 3TL5A 2IYDB 1OEYJ 2WDTB 3B1LX 3ONSA 2MQJA 2KDEB 4GN1A 2L00B 3T8MA 3DVGY 3H7PA 2AL3A 2KDBA 2PEAA 4IG7B 3NHEB 3QC8B 4G11A 2KC2A 1AARA 4MGZE 1WH3A 3A1QA 2KWVB 1WE7A 3IBEA 4WWOA 2KDIA 1V86A 3JSVA 4K7UA 4IWOA 4WJNA 4DDGD 4NQLB 1Y8RC 3TCAA 4MGIE 3K9OB 3RD2A 1ZGUB 3WAOA 1C3TA 1T0YA 3RZFA 3MTNB 4DHJD 1P0RA 2LVOA 4GOCA 3QX1A 5AZFA 3WIMA 3DDCB 4W9CA 3WA0A 4IC7B 3MJWA 3W1SA 2KWUB 4MM3A 3DCGA 2KNBA 3QA8A 2WYQA 3AU5A 3HK0A 1WJ4A 2CS4A 1ISNA 4DWFA 3QK0A 1YQBA 2DZJA 1IPGA 2ZVOA 3D32A 1UGMA 1V81A 4JLCA 1OGWA 4IM3A 4KIKB 1GG3A 1A5RA 3RYTA 4AUQC 5C23A 1OEYA 1YX6B 4HWIB 2BKRB 3L16A 3ZIMA 2CHZA 1GNUA 3PLUA 1OTRB 2EMTA 5DPTA 5CHVC 4MSQB 3PRPB 3IFWB 2K8HA 2LRWA 1TTNA 2MBEA 3PHXB 3SD5A 3Q3FA 3VDZA 2I1KA 3RCZA 3M3JA 2K1FA 4I6PA 4DK5A 1WJNA 3S2AA 4NNJB 2ZZPB 3OLMD 1MG8A 2LVPA 4MH0E 1TBEA 4IWPA 3ZKJC 2JZ3B 4JL9A 5LXIB 3UGBB 3A4RA 4FADA 1V2YA 4DHZE 1E8YA 2IBIB 2NBVB 1WXSA 2R2OA 3N30A 4WJQA 2IO1B 3MHSD 1Q1OA 4EZJA 3V62A 3ALBA 4RM8A 4G0NB 1WY8A 2N9EB 3PRZA 4PYZA 5DPSA 2AL6A 2FCMA 2D2QA 3RZWC 2JRIB 4GU2A 2M8SA 4XC2A 1GJZA 4YL8A 4WWNA 1Z2MA 2FUHB 4IUMB 3ZLZA 2MBBB 4FJZA 4KSKC 2LD9A 1UBIA 3BINA 5JHAA 2ASQA 2JXXA 3EECA 2BYVE 1J8CA 4FLHA 2QHOA 4BKTA 1WR1A 1XQQA 4X57B 1YJ1A 2N9XA 2ZCCA 2HTHA 3EFUA 2KJHB 4BOSC 5EDSA 2ZCBA 3X0WA 3TBLD 2REXA 2EMSA 3UIPB 1J0GA 1I42A 2OJRA 2MW5A 3L08A 3OAWA 2ZVNA 4OVVA 4PYUA 5JH5C 2ZEQA 1KLVA 1WGDA 4FJYA 4FHJA 4KIKA 2FIDA 3IG3A 4BKGA 2O6VA 3N3KB 1EUVB 3ZDTA 3V61A 2L3ZA 2C7MB 1ZKHA 2C60A 2KX3A 4WWPA 2Y5BB 4WQOB 1H8CA 4P7IA 1V5OA 4BBNC 4E74A 1D3ZA 4TQ0A 3ZW3A 5IA7A 4PS3A 3WANA 2BYEA 3HM6X 2N1WA 3KH0A 2KK8A 4MELA 5D7GA 4BBNF 2A5UA 2IY0B 3AXCA 4CO7A 2JF5A 3PHWB 1WX7A 4TKNA 2LGXA 3APFA 3LDZE 2FNJB 2KJRA 3DVNV 4HVBA 1WXAA 3P2BA 2N7DA 4BFRA 1P9DU 5D94A 1WI0A 4MSMB 4K81A 2MBHA 3QARA 3LMNA 3APCA 2BWES 1KJTA 4LDTB 2C9WB 2RSUA 3LJ3A 1NBFC 2KFKB 2B3AA 2D10A 2KKCA 1E90A 2AWTA 1WJUA 3M95A 3L54A 3BY4B 4DXAB 4KDIC 1KM7A 4ZDVA 1V5TA 1WJ6A 2GBNA 2G3QB 4AWJA 2JPHA 2LGDA 2JUOA 2OOBB 2LRUA 2W9NA 4F7ZA 2KJ6A 3H9DA 2Z0DB 3AI5A 2I1JA 1EF1A 3ZTCA 2IZVB 2BGFA 3A33B 3DQVA 4GIVA 3V6CB 2ZPYA 3DBSA 2L7RA 3NZSA 1S1QB 2KQ7A 2KN5A 2K39A 4TV3A 4EUTA 4MDKE 2MP2A 3A9KB 1QZEA 2GBJA 3PS6A 2DYMA 1YX5B 2NPTB 1LQBA 2LGYA 2MA9B 4A3OA 4W9DA 1E8WA 2GBKA 4WAAA 4ANVA 5JHBA 2GBMA 1S3SG 4A20A 4MEMA 4I6NB 4KZ0A 2GBRA 2O6VB 3L13A 2JWZA 4FN2A 4PS8A 2AEHA 3VH4B 2NR2A 3SDLC 2MBQA 3L17A 2IO2B 3ZO5B 2AYOB 3X23A 4ANXA 2G45B 1WXVA 2CKHB 2MX2A 2M1MA 2V4LA 2KTFA 2Z59B 3H6NA 4K7WA 3WAPA 2YLMA 2HJ8A 2V3SA 5E6PA 4MJSB 2DZKA 2ZPNA 3VTWA 1RRBA 1VCBA 1U4AA 2JVCA 1M94A 2LVQA 4NY0A 2DZIA 1BT0A 1WX9A 2LXCA 2KOXA 3PZDA 3ZNGC 3ZNID 5HKHA 2K25A 2JZZA 3PVLA 4HCPB 2KFKA 2MCNB 3GOEA 3R7QA 1F9JA 1P1AA 3ZUNA 3ZRCA 4M8MA 4BKSA 1E7UA 1IP9A 2N4FA 1K8RB 3I3TB 1R4NI 4A3PA 1RLFA 4HLEA 3U7DA 1WZ3A 3ECIA 2ZNVB 2KC1A 2NBUA 4FHKA 5KHOA 1FXTB 3R7RA 3ZRFA 1NI2A 3EC8A 1WYWB 3KVFB 3ZTDA 4FJVB 2ZJDA 2M0XA 3DBRI 4II3B 3PREA 4I6LB 2JT4B 1WRDB 4DHZB 4NQKE 4AJYB 2NBWB 4K1RB 4KZCA 3VUWA 3GZNI 2L8JA 4F8CB 1CMXB 1WGYA 2NCNA 4NJ7A 2RR9A 3PSEB 3A9KA 5FR6A 4TQ1A 1V49A 2NPTA 3QAQA 1UZXB 4MGYE 2KXJA 2GMIC 4W9EA 1PQSA 4GGQA 1WX8A 2HE7A 1L7YA 4B6WA 2C7HA
chains in the Genus database with same CATH superfamily
4US9A 3IT4B 1L4ZB 1UF0A 1YN4A 1I4XA 2BW2A 2RGFA 2INDC 4HPMB 2WX1A 1WSPA 2D3GA 5AUIA 1T5XD 3FKYA 1P7FA 4GDLB 3HUIA 2LZ6A 3C0RB 4W9LA 1KTKA 4JE3B 2IO3B 4XDDA 5BMHA 2N0SB 1C77A 2K8BA 4ZRJA 3SFEB 5J2RA 1PYWD 3B0AA 3EHVA 2DAJA 3VH3B 4USAA 1FO4A 2DAFA 3BYYB 3DWMA 2PE9A 2JRHA 3AU4A 3VTUA 3P4RB 4HPPA 4AOFA 5TR5A 4WH4A 2ZW0A 1IBXB 4DXGA 4DBGA 3E56A 4IW0A 3NS1A 2J7QB 1QOFA 4OHJA 2J0JA 4M00A 2LGIA 2QDFA 5DCNA 3EA6A 3HM3A 3GB1A 1V6EA 2DYBA 4J6IA 2KMCA 1E7PB 1FNVA 1PGBA 4W9IA 1Z5SB 2KLGA 2WU2B 2YVCA 4FA6A 1W6VA 4ARCA 1JWAD 2VZKB 4MGKE 1WF9A 2Y5CA 2KTRA 2PE6B 2J53A 1E10A 2LI5A 2D11A 2SEBD 1CQVA 4M0WA 2LMCA 5C3JB 1E5WA 3NS8A 1PDXA 1DOYA 3AB5A 4WIPA 4DQOC 3APDA 4ZRIA 4W9KA 1MJDA 3AE8B 1P98A 2W3SA 4HKQA 1WXMA 3DBHI 1WM3A 1XLOA 4N6EB 2V9HA 4BAXA 1HA5A 1TZOA 3AEFB 1KF6B 4AS1A 1JRUA 2EKEC 1UBQA 1UELA 3PV1A 3PPAA 3P63A 4M8NA 2KO3A 4JWUC 3A1QB 4NZLB 3MC9A 1G6JA 2JXTA 2KQSA 1OQYA 4P1BC 1HTOA 3ENEA 2JU6X 2GOWA 5T8IA 4BKSD 3VHTC 3WALA 1QOGA 2KMAA 3MC0B 2KLCA 3ZYYX 3CSFA 3R8BA 2IDYA 1V1PB 1WGGA 3TMPB 1NDDA 3SHQA 2WHIA 1YNTE 4YSZB 3N32A 4OW0A 1N5XA 2CU1A 3KUCB 1MFWA 2BKFA 2FCNA 2L76A 4RMAA 5AEKB 1VD2A 3VFKA 2ACZB 3TL5A 4C56C 3B1LX 1K53A 4YTNB 2AL3A 1MG4A 2PEAA 4IG7B 3NHEB 2KACA 5JXVA 2WS3B 1AARA 1J7BA 4YSXB 2KWVB 1WE7A 4WWOA 3AMZA 4MGIE 3RD2A 1E0ZA 2INPE 4HROA 1C3TA 4DHJD 3TEYA 1P0RA 2J4XA 4GOCA 4LTUA 3WIMA 4RFBA 2QC8A 5LNK1 1SSNA 3HK0A 1WJ4A 1YQBA 4JLCA 1ZXIA 3NRZA 2LHEA 3RYTA 2FBWB 4NAMA 4A55A 2BKRB 3ZIMA 1OTRB 1BXTA 1HZ6A 1ZOYB 2L1AA 2MBEA 3VDZA 2SAKA 1YN5A 2K1FA 4N58A 3OLMD 3ZKJC 4MH0E 1XO3A 2JZ3B 2IJ0A 1LGRA 4PT5A 3V62A 4Q2JA 1PFDA 4RM8A 1F2RC 2D2QA 2PLPA 4XC2A 4A8XC 1GJZA 3ZLZA 1TYGB 4KSKC 2LD9A 4ARIA 1KLUD 2JXXA 3EECA 1FEHA 1XXGA 2N9XA 3Q8FA 4TSSA 2Q5WD 3X0WA 3TBLD 4PYUA 1XEEA 1WGDA 4BKGA 1L6UA 4C00A 3Q14C 4WQOB 4MT5A 3AEBB 4BBNC 4TQ0A 3WANA 2BYEA 3LB8C 3Q8AA 2QEJC 3KH0A 3Q6BA 2L83A 4CO7A 2WXJA 2FNJB 1P9DU 1WYGA 3APCA 2BWES 3N1YC 3V05A 5D3IB 2RSUA 1NBFC 3I5JC 2KFKB 2D10A 1I4GA 4OZAA 5FKAC 1TS4A 1J7AA 1WJUA 3P1MA 4S17A 1F0ZA 1V5TA 2GBNA 1B9RA 1ENFA 2LRUA 1TS5A 2KJ6A 2KN5A 4NJCA 1FCLA 4C7ZA 2OEDA 1QZEA 2GBJA 3PS6A 2W3RA 2NPTB 2LGYA 2MA9B 4ANVA 4MEMA 1KRHA 2GBRA 1XCTL 4FN2A 3VRBB 2JX5A 3Q69A 4ANXA 2G45B 2MHJA 3H6NA 2MX2A 2M1MA 3WAPA 2D3CA 2YLMA 2HJ8A 3V3XA 2AX5A 1RRBA 1VCBA 5TSSA 2JVCA 2WNMA 1TKEA 5HI1A 5HKHA 1GOZA 2KOXA 4RCOA 4XDCA 1ZDXA 2LJIA 3GOEA 1F9JA 2JYEA 3ZUNA 4BKSA 1SB3C 1RLFA 4HLEA 3DWGC 1FMAD 2H88B 3ECIA 2KC1A 4FHKA 3ZRFA 4B0MA 3ZTDA 2H89B 1K50A 4FJVB 1C76A 1QLBB 4AJYB 2JSVX 2RR9A 4TQ1A 3QAQA 1I4RA 2HE7A 1OQRA 3W1SA 2K5PA 2CHXA 1RAXA 4MACA 4YSYB 2WGSA 5EE1A 3TJPA 4OZCA 5GXGB 5HHDG 3RI7C 1F2RI 1UGJA 2PKOA 4LJPB 4LDTD 2HD5B 3AULA 3H7SA 3KW5B 3MJ5A 1C4CA 3I57A 1Y56A 2WXLA 2IGDA 2KD0A 4EZKA 3QWZB 3JYUA 1T3QA 3GS2A 3UQBA 2QCZA 2RDHA 4F1SA 4RGTA 3RMKC 1I35A 3AE4B 3QCAA 3R3MA 4TUUA 5G2NA 3AE1B 2BWFA 4RM9A 1XT9B 4C7YA 4ZHPA 1KFYB 3AV8A 4LCDE 3AH7A 3VUYA 3U8ZA 3RPFC 2V1YA 2A4ZA 3I9V1 3B2GA 3OG5A 4L1BA 3BVMA 3H1UA 1ZPSA 5BYQA 1EU4A 1WZ0A 1WR6E 5LXHA 1I4PA 2PJHA 1IYFA 1GUAB 4LJOB 2LASA 4GB9A 3DVNU 3U30A 4W9HA 3UQAA 3QQ8B 2AQ1B 3ABVB 3NZ3A 3AE2B 3KQ4A 4KSLC 1C9FA 1Q10A 5IAAC 1WM2A 2HDEA 3ZVVA 3HHMA 4GDLA 5BMIA 4UDUC 5CX3A 1X1MA 3LYYA 4FBJB 2JY6A 1WMHB 4ZRKA 5CTRC 2FIFA 3DOWA 2WWZA 1UD7A 2INNE 4DHJB 2O2VB 4CQNA 2UWQA 1YD8U 5IN7A 2N7JA 4XZ4A 4HPLB 1D5XC 1LXDA 1LFDA 4YTMB 1RFKA 3KYDD 2K3UA 3PRMB 4WJPA 4GSWA 5E6NA 2GI9A 1K51A 3O65B 1IBXA 1VRAB 5L83A 1HXYD 2W54A 2KDMA 1ZW7A 3ZQ4A 2LXAA 3URYA 4NJ6A 4ICUA 2L05A 4LNOA 2BVCA 4R3DA 3H7PB 1N60A 1TKGA 2RPVA 2XEWA 2CHWA 2BS4B 4PS7A 3O13A 3JSVB 1LM8B 2TSSA 3SU8X 3IAM1 4WJOA 3RT3B 4MM3B 3V60A 3MFGA 4HK2A 4GLSC 2K8CA 4JGHB 1AW7A 2LEKA 1TKYA 2KZRA 3IHPC 1N61A 3QHTA 3W9CB 2KDFB 1XD3B 1SE2A 3ZDMC 4REZA 1CK1A 2MEKA 1ZE3D 1T0SC 2DHZA 2K6DB 4IWQA 3BVGA 3P4SB 1IGDA 4HDOA 4W9JA 4ASWC 3J9CA 4HDQA 1H4RA 2WDTB 3ONSA 2MQJA 3C19A 1JW9D 3RNAC 2KC2A 2J42A 3A1QA 1V86A 4WJNA 3TCAA 3K9OB 1GB4A 3Q3MC 3WAOA 2LVOA 3QX1A 5AZFA 4W9CA 1TS2A 3DCGA 3QA8A 2V0GA 3SR6A 4KIKB 1F77A 1V1PA 1A5RA 3PO0A 1OEYA 1YX6B 4HWIB 2I2YA 1ET6A 1SE4A 5DPTA 2EMTA 1JQ4A 3IFWB 3PHXB 2LRWA 1TTNA 3TUOA 4I6PA 1WJNA 4NNJB 2LFIA 1MG8A 1TBEA 3W5UB 5LXIB 3UGBB 3A4RA 3U7ZA 3W5VB 2NBVB 1RWSA 3N30A 3N1ZC 1SF0A 3PRZA 5DPSA 3PZ8A 2JRIB 4GU2A 2M8SA 1Z2MA 2FUHB 2MBBB 1SIJA 2BB6A 5JHAA 3OWEB 3AE7B 4FLHA 2QHOA 4BKTA 1WR1A 1JWUD 5EDSA 2ZCBA 4YXDB 5IOIA 2REXA 2GB1A 1J0GA 2OJRA 2DNFA 2MW5A 3OAWA 3CIRB 1KLVA 4FJYA 3C8YA 4FHJA 2C7MB 4WWPA 2Y5BB 3DBHB 1H8CA 1V5OA 4E74A 1D3ZA 3ZW3A 5IA7A 1B1ZA 3HM6X 1V8CA 4MELA 5D7GA 2IGGA 2IY0B 3AXCA 2JF5A 1WX7A 4P1CC 3AE5B 3APFA 2KJRA 4HVBA 1WXAA 5H92C 1PGAA 1FRDA 3U4EG 4K81A 2L52A 2MBHA 1N62A 3LMNA 4LDTB 1MVKA 2B3AA 1E90A 5HFYA 1I4HA 1JMLA 2WXRA 5BMGA 2JUOA 1SE3A 2B76B 4F7ZA 2Z0DB 2WU5B 2I1JA 3AI5A 1C78A 2BGFA 3IT6B 4GIVA 1RYJA 2V3PA 2CJNA 1SJHD 4EUTA 2MP2A 3A9KB 1YX5B 1UNSA 4P16A 3NJTA 4A3OA 1E8WA 2WXOA 4KZ0A 4MH8A 2JWZA 3FAHA 3AEEB 2Y3AA 3VH4B 3SDLC 3L17A 3RNBC 3X23A 1L4DB 1WXVA 2KTFA 1MI0A 1VJKA 5E6PA 4MJSB 2DZKA 4B0EA 2JWUA 2PTLA 1L5PA 2LVQA 2DZIA 1WX9A 3PZDA 1SBBB 4HCPB 1JRPA 2KFKA 2WXMA 4RH6A 3R7QA 1P1AA 1A70A 3N1XC 1MHXA 2HTME 1K8RB 3AEGB 3I3TB 3ZXRA 1R4NI 1ZXHA 3EGRA 5EE0A 1M4VA 3U7DA 1WZ3A 2NMQA 1JALA 1NI2A 3EC8A 1D5MC 3DBRI 2M0XA 2RDGA 3DHHC 4K1RB 4DXFA 3VR8B 3GZNI 1WXQA 3ZJVA 1CMXB 4NJ7A 1UWMA 5FR6A 3AE6B 4XWTA 1DYQA 1V49A 2NPTA 1UZXB 1N5WA 2GMIC 1R7SA 3EFCA 4GGQA 4B6WA 4N59A 4XYCA 2HJ1A 3VQIA 4K7SA 2MP2B 3KUDB 1VR9A 1WFYA 1TJEA 3JW0X 4C80A 1XLQA 3ML9A 4RGNA 4O1NA 4WQMA 4EOYA 3HVZA 1HTQA 2UYZB 2C7NB 3NZUA 2V3NA 1GC6A 2D3BA 3M62B 1EU3A 3HVDA 1P7EA 2C5LC 2D07B 2LWPA 4BVUC 3RULA 1C1YB 3AN1A 3UINB 4EFOA 2WDQB 1FM0D 4D2KA 5EE9A 2BYTA 4G3XB 4NPNA 5AZHA 2RDBC 1C4AA 3A9JB 3V6EB 4HJKA 1KLGD 2D5GA 1WGHA 2ZNVC 4C4VB 4GXBA 2MRPA 3R66C 1CJEA 2WXIA 1WGRA 2XBBC 2O6VD 4LK0M 3I63C 5AZGA 3TIXA 2MWSB 2PVGC 1PGXA 2DYOA 2KFJA 4ANUA 2PW9A 2N9PC 2KHWB 1E8ZA 2KANA 2ICIA 3GP7A 3CMMB 3N20C 2BS2B 4KVGB 3PGEA 2MJEA 4URKA 2EELA 1FCCC 1ZUD2 4CHKA 2L0FA 2WXFA 5HG2A 1UH6A 3L4PA 4NAWB 3AE9B 2QIEB 2XK5B 2WXHA 2NVUI 4E3CA 1SEBD 2KWCA 4EEWA 2BYFA 4FXCA 1D4BA 2WLBA 3L10B 4LNFA 1GAQB 2YEPF 1TIFA 3B08A 1KOTA 4HCNB 2BF8B 4II2B 5J17A 3VUXA 1Q5WB 4GDKB 2RMMA 4P6VF 2W55A 4RNAA 2WX0A 3DPDA 1D6EC 1P3QU 2RPQA 4AJWA 5FR3A 2NS5A 2M4NA 4EZLA 1CZPA 1TS3A 4OZBA 5DPWA 2N7EA 1OFFA 4W9GA 3NOBA 1ACCA 3RNEC 5G55A 3ZNZB 1WMHA 4IDIA 4LNNA 4A90A 1KH0A 3U2SC 2VRRB 1EM7A 3T9LA 4ANWA 4KV2A 1HQRD 2O2VA 2FCQA 2G1EA 2N1VA 2M0AA 3DHGC 1SE9A 3PTFC 2MJ3A 1HZ5A 3VXWA 3ETRA 2VH1A 4PK1A 2Z0EB 3DBLI 4ZYNA 2QSDA 1E8XA 2G4SA 1FXIA 3UF8A 2RD0A 1UUPA 1V97A 1HEZE 2CU3A 2PPHA 4QAYA 3UIOB 3PT2B 1D5ZC 1NYRA 1OEYJ 2INCC 2KDEB 4GN1A 3H7PA 3P4PB 1WGKA 2OJWA 3QC8B 2BT6A 1WH3A 3TSSA 2NTSA 3JSVA 1FXAA 4IWOA 4K7UA 4DDGD 1N63A 4NQLB 1ZGUB 2BBCA 3RZFA 3MTNB 1WWTA 3DBLB 3DDCB 4IC7B 1L0VB 2KWUB 2LHDA 4MM3A 2KNBA 2WYQA 3H8HA 2CS4A 3QK0A 2DZJA 1AN8A 2QILA 1FFUA 3D32A 1UGMA 1V81A 1OGWA 4KGSA 2GRIA 5G5GA 4AUQC 5G5HA 1EWCA 1GNUA 3PLUA 4MSQB 2K8HA 4IOIE 3RCZA 3M3JA 4DK5A 3PZ7A 2ZZPB 1MHHE 2LVPA 4IWPA 3Q8BA 2CJOA 1V2YA 3FILB 4DHZE 1E8YA 2IBIB 1JROA 4WJQA 2IO1B 4ZOHC 3AE3B 1Q1OA 5H8YE 3WCQA 4G0NB 2N9EB 4PYZA 2AL6A 4RF0A 4YL8A 5I4DA 4WWNA 2V4IB 4IUMB 3NVZA 2BB5A 1UBIA 2E6XA 3U52E 2FE8A 4LNIA 3RNGC 2BYVE 1ROEA 1YJ1A 3R2IA 2ZCCA 4US8A 2HTHA 2W82A 1FD6A 2EMSA 3L08A 3Q8CA 2ZVNA 2X8XX 5JH5C 3Q3OC 1NVID 4KIKA 2FIDA 2O6VA 4J3OD 5IP4D 3N3KB 3ZDTA 2L3ZA 2KX3A 1YJJA 1SJED 4ZYSA 1I7HA 4PS3A 2E3TA 4BZAA 2KK8A 2M19A 2DLBA 4BBNF 3PHWB 3ZGZA 2LGXA 1AYFA 3DVNV 1T0RC 1E9MA 2N7DA 2ONQA 2WXPA 2NTTA 1WI0A 3QARA 3BK2A 2G9HD 2M56B 2C9WB 2Z8LA 4HJGE 3LJ3A 1I4QA 2IGHA 3MHZA 1L6VA 5IO9A 4DXAB 1KM7A 1YQ4B 2OOBB 4KGTA 2W9NA 3H9DA 1EF1A 1DGJA 3A33B 3DQVA 2ZPYA 1ZDVA 1QT9A 3DBSA 4HEA1 2KQ7A 2K39A 4KKIA 4TV3A 1STEA 2ZW1A 4MDKE 2N9LA 2DYMA 1VZ8A 2KT7A 2WP9B 4W9DA 2GBKA 5E6JA 5JHBA 1S3SG 4IKGA 4I6NB 2O6VB 3L13A 4PS8A 2AEHA 2MBQA 2IO2B 1YJIA 2AYOB 1T0QC 2V4LA 2Z59B 4WAFA 1YQ3B 4K7WA 4L23A 2V3SA 2LUMA 2ZPNA 1U4AA 3BVZA 1UWXA 1C4PA 2Y5PA 2K25A 2KWDA 1FNWA 3NUHB 2MCNB 3ZRCA 4M8MA 1E7UA 2K22A 2KVZA 2N4FA 1IP9A 3GE8C 2NBUA 1FXTB 3R7RA 1WYWB 3KVFB 5EE3A 1VDVA 2FUG1 2ZJDA 4II3B 3PREA 4I6LB 1WRDB 4DHZB 4NQKE 2WXKA 2IPKD 4KZCA 3VUWA 1C79A 2L8JA 2WDVB 4F8CB 4ZHOA 2KN4A 2NCNA 4ZRPA 3A9KA 1DOIA 4MGYE 1IGCA 2KXJA 1PQSA 3MP9A 4KGRA 2DZMA 3CSTA 1XLNA 2PIAA 1YN3A 3BYTB 3NVVA 4JWSC 1WRIA 5LLIA 1NI3A 2PMVA 1FFVA 1NEKB 4XE0A 1WE6A 2FCSA 3RFZB 2KVRA 4GMVA 4MJSA 1ET9A 4DDID 1JWMD 1TZ1A 1TT5B 4G50A 2BQQA 3WAMA 5KHQA 2JQRB 4K3BA 5JZEB 3KLSX 1QF6A 1EO6A 3A4SC 3QIJA 3CF6E 2MLBA 1E6EB 2FAZA 1HE8A 1YIWA 3OJ4B 4ICVA 2KTRB 1JWSD 1V9JA 1EF5A 4K3CA 2QMTA 4FULA 4M0WB 4W9FA 1FPYA 4B95A 4HXDA 1MPEA 1R4MI 2QJLA 1QILA 2KX0A 3HIZA 5CHWA 3T3OA 4ITKA 1WIAA 2I38A 3EUB2 1JWBD 4KX6B 1SIFA 2DENB 4JQWC 5BO4B 2K9XA 5D2MB 2L0TA 2WDRB 4E71A 4IM0A 5C2TB 3ML8A 4RF1A 1SGHA 4EKUA 1NYQA 3K9PB 4H2AA 1V80A 3B2FA 1L2NA 1R4MB 3RNFC 2LJ5A 5FK9C 5E6OA 3OJ3A 1GC7A 2AQ2B 2WXGA 5D6JB 2K6QA 3IVFA 4B9KA 1IUEA 4RGMA 5DPRA 1YMHE 3VVWB 3RN9C 3A9JA 3NY5A 1EWYC 4OVZA 4JPSA 4IM2A 2J0KA 3ZNHB 2DBYA 1NENB 4C4VA 2CR5A 3M63B 3JVZX 2IO0B 3T3NA 1GB1A 3TEWA 5C1ZA 3ZXVA 2MBOA 2KQ4X 4XX5A 3W2DA 2MSED 1LO5D 3L0WB 2MJDA 4OVUA 3Q3NC 3KYCD 2L32A 4TMAB 5CHFA 3RUIB 4WURA 3VTVA 1E7VA 3BWUD 2EKIA 4N9F4 2R2QA 2K0PA 1Q0WB 4AP4C 1TY0A 4JX1C 3BZDB 3KUZA 1R4NB 3W1SC 1F52A 3QJZA 4NAWA 1TGZB 1QOBA 2MH7A 3LXFA 4M01A 2M17A 2XK5A 2DX5B 2IY1B 3DBRB 4ACFA 3B9JA 2YEPB 3GZNB 2J0MA 1K52A 1ESFA 5J18A 5L95C 4BOZB 3Q3JA 1RFAA 3VAWA 3W1YA 3VR9B 4EE2A 1J19A 4CYEA 4KDLB 3P4QB 2ON8A 1JCKB 4JIOU 4GDKA 3DVGX 1QKZA 3PLVA 5GMVA 2LUEA 2G4DB 2BPSA 1FNUA 2IYDB 1DOXA 5D3DA 3T8MA 2L00B 3DVGY 1AWDA 3FC4A 3ZJTA 2KDBA 3TEXA 4KKJA 4G11A 1SXTA 3DHIC 4MGZE 4M02A 1XCQL 3IBEA 2WXNA 2KDIA 3SEBA 1Y8RC 2BS3B 4LNKA 1BUIC 3NVYA 2VZKD 1T0YA 3WA0A 3MJWA 3AU5A 3UI3A 2KYWA 1ISNA 4DWFA 1QQRA 1IPGA 2ZVOA 4IM3A 5BYRA 3KWLA 1GG3A 1PUTA 3NG0A 5C23A 1L0YB 3L16A 2CHZA 5CHVC 3PRPB 3SD5A 3Q3FA 2I1KA 3Q2AC 4WWMA 3S2AA 3BIID 3KWVA 4JL9A 5IKCM 2JZPA 4FADA 1WXSA 2R2OA 3MHSD 4EZJA 3BK1A 3ALBA 1WY8A 3E9SA 3NVWA 3P42A 2FCMA 2AQ3B 3RZWC 2WQYB 1XLPA 3IAS1 3AM9A 4FJZA 3BINA 2ASQA 1GPXA 3CWIA 1J8CA 4RGOS 2OHFA 1XQQA 1OQQA 4X57B 4L2YA 3EFUA 2KJHB 4BOSC 1FIQA 3UIPB 1I42A 1TY2A 2PVOD 2D3AA 4OVVA 2ZEQA 3IG3A 1EUVB 3V61A 2XN9C 1ZKHA 2C60A 4XWWA 1V1OA 4HRSA 4P7IA 1YOVB 1FRRA 4AQ7A 2GLSA 2N1WA 1N6ZA 2N9KA 3Q8EA 2A5UA 3AEDB 3TEZA 3GE3C 4TKNA 3LDZE 3ZJUA 3P2BA 3FILA 4BFRA 5D94A 4MSMB 1KJTA 1VZ7A 4YT0B 1VZ6A 2JYTA 2KKCA 2AWTA 4ZRQA 3M95A 3SFDB 3L54A 3BY4B 2XNAC 4KDIC 4ZDVA 1WJ6A 4AWJA 2G3QB 2JPHA 2LGDA 1T6BX 2UU7A 2KMMA 2KAJA 2WXQA 3ZTCA 2IZVB 3V6CB 2L7RA 3NZSA 1S1QB 2R61A 3RNCC 2DWQA 1LQBA 4WAAA 4S0RA 2GBMA 4A20A 3N9YC 2BTEA 1QOAA 2NR2A 2J52A 3ZO5B 1XF5L 3HRDD 2CKHB 3AECB 5AUKA 1F1HA 4HKZE 1BMLC 3VTWA 1M94A 2X38A 1RM6C 4YWGG 4NY0A 2VH2A 3VRAB 4YTPB 1BT0A 2LXCA 3ZNGC 3ZNID 3PVLA 2JZZA 3AEAB 1L0XB 1ZP0B 4A3PA 5KHOA 2ZNVB 5MPOA 5BYSA 3R2TA 3MC8A 1VLBA 2JT4B 1J7CA 3IXSA 2NBWB 4XGAB 4A6QA 1WGYA 3PSEB 4A9AA 4LLGM 4W9EA 2LGSA 1WX8A 1L7YA 2C7HA
chains in the Genus database with same CATH topology
2DZMA 3CSTA 2CHXA 1RAXA 3VQIA 4K7SA 2MP2B 3KUDB 3TJPA 1WFYA 3JW0X 5LLIA 3ML9A 2RGFA 4HPMB 4EOYA 1WE6A 2FCSA 2KVRA 4GMVA 2WX1A 4MJSA 2UYZB 2C7NB 2D3GA 4DDID 4LJPB 4LDTD 2HD5B 1TZ1A 3AULA 3NZUA 1GC6A 3M62B 3H7SA 4G50A 3WAMA 5KHQA 3KW5B 4GDLB 2C5LC 2LZ6A 5JZEB 2D07B 2KD0A 2LWPA 3C0RB 1C1YB 3RULA 4BVUC 4EZKA 3QWZB 4W9LA 3UINB 4EFOA 1EO6A 3A4SC 3JYUA 3QIJA 3CF6E 2MLBA 3UQBA 2IO3B 2FAZA 1HE8A 4F1SA 1YIWA 1I35A 3OJ4B 4ICVA 2K8BA 2KTRB 3QCAA 4ZRJA 3R3MA 4TUUA 5G2NA 4G3XB 4NPNA 1V9JA 1EF5A 5AZHA 2BWFA 4RM9A 5J2RA 1XT9B 3B0AA 3A9JB 3EHVA 2DAJA 3VH3B 3V6EB 4FULA 4M0WB 4W9FA 4B95A 4HXDA 2DAFA 4HJKA 1R4MI 1WGHA 4LCDE 2ZNVC 3VUYA 2PE9A 3U8ZA 2JRHA 3AU4A 2KX0A 4GXBA 3HIZA 2MRPA 2V1YA 2A4ZA 3R66C 3VTUA 5CHWA 3H1UA 1WGRA 2XBBC 2O6VD 4AOFA 1WZ0A 5TR5A 1WR6E 5AZGA 2MWSB 2PJHA 1WIAA 1GUAB 3TIXA 5LXHA 1IYFA 4LJOB 2LASA 4DBGA 2DYOA 4IW0A 1SIFA 4GB9A 2KFJA 4ANUA 3DVNU 2N9PC 2DENB 3U30A 4W9HA 2KHWB 4JQWC 1E8ZA 2J7QB 3QQ8B 5BO4B 3UQAA 2KANA 4KSLC 5D2MB 2J0JA 3CMMB 2L0TA 4KVGB 3PGEA 4E71A 4IM0A 5IAAC 5DCNA 4URKA 3ML8A 1WM2A 1SGHA 4EKUA 3HM3A 1V6EA 3ZVVA 2DYBA 4J6IA 3HHMA 4CHKA 2KMCA 4GDLA 2L0FA 3K9PB 5CX3A 1UH6A 1V80A 1X1MA 4W9IA 4NAWB 4FBJB 1L2NA 1Z5SB 2JY6A 1WMHB 2KLGA 4ZRKA 2YVCA 4FA6A 5CTRC 2XK5B 1W6VA 2LJ5A 2FIFA 3DOWA 4MGKE 2WWZA 5E6OA 1UD7A 3OJ3A 1WF9A 1GC7A 4DHJB 2O2VB 2KTRA 2K6QA 2NVUI 2PE6B 5D6JB 4E3CA 2KWCA 3IVFA 4B9KA 4EEWA 2BYFA 5DPRA 3VVWB 2UWQA 3L10B 2LI5A 1YD8U 2D11A 3A9JA 3NY5A 4IM2A 2J0KA 4XZ4A 4HPLB 3ZNHB 1LXDA 1E5WA 1LFDA 3NS8A 3B08A 1KOTA 2CR5A 3M63B 4HCNB 2BF8B 3JVZX 3KYDD 3PRMB 2IO0B 4WJPA 4II2B 4GSWA 3APDA 5E6NA 4ZRIA 5J17A 4W9KA 3VUXA 3O65B 1Q5WB 5C1ZA 1P98A 2MBOA 4XX5A 4GDKB 1WXMA 2MSED 3DBHI 3L0WB 5L83A 4OVUA 1WM3A 3KYCD 2WX0A 1ZW7A 3DPDA 2LXAA 5CHFA 1P3QU 2RPQA 4AJWA 3RUIB 3VTVA 2NS5A 1E7VA 2M4NA 4N9F4 4NJ6A 4EZLA 4ICUA 2L05A 1JRUA 2EKEC 2R2QA 1Q0WB 3H7PB 4AP4C 1UBQA 5DPWA 1UELA 3PV1A 2N7EA 3PPAA 4M8NA 2XEWA 2KO3A 2CHWA 4PS7A 3A1QB 3KUZA 4W9GA 3NOBA 3W1SC 3QJZA 5G55A 3JSVB 3ZNZB 1LM8B 4NAWA 1G6JA 3SU8X 1TGZB 1WMHA 2KQSA 2VRRB 2M17A 2XK5A 2DX5B 3T9LA 2IY1B 4WJOA 4ANWA 4KV2A 3RT3B 1OQYA 3ENEA 2GOWA 2O2VA 3V60A 4BKSD 3VHTC 3WALA 2FCQA 2KMAA 4HK2A 2J0MA 2KLCA 5L95C 5J18A 2N1VA 2K8CA 4BOZB 3Q3JA 1RFAA 3CSFA 4JGHB 1SE9A 3PTFC 3VAWA 1WGGA 3TMPB 2KZRA 3IHPC 1NDDA 3W1YA 3VXWA 3QHTA 3SHQA 2Z0EB 2KDFB 1XD3B 3DBLI 1J19A 4ZYNA 3ZDMC 4KDLB 4CYEA 1E8XA 2G4SA 2DHZA 2K6DB 4IWQA 3N32A 3UF8A 4JIOU 2RD0A 2CU1A 4GDKA 3KUCB 4HDOA 4W9JA 2BKFA 2FCNA 2L76A 3DVGX 4RMAA 4ASWC 1VD2A 2PPHA 5AEKB 3PLVA 3UIOB 4HDQA 3VFKA 5GMVA 2LUEA 2G4DB 3PT2B 1H4RA 2BPSA 3TL5A 2IYDB 1OEYJ 2WDTB 3B1LX 3ONSA 2MQJA 2KDEB 4GN1A 2L00B 3T8MA 3DVGY 3H7PA 2AL3A 2KDBA 2PEAA 4IG7B 3NHEB 3QC8B 4G11A 2KC2A 1AARA 4MGZE 1WH3A 3A1QA 2KWVB 1WE7A 3IBEA 4WWOA 2KDIA 1V86A 3JSVA 4K7UA 4IWOA 4WJNA 4DDGD 4NQLB 1Y8RC 3TCAA 4MGIE 3K9OB 3RD2A 1ZGUB 3WAOA 1C3TA 1T0YA 3RZFA 3MTNB 4DHJD 1P0RA 2LVOA 4GOCA 3QX1A 5AZFA 3WIMA 3DDCB 4W9CA 3WA0A 4IC7B 3MJWA 3W1SA 2KWUB 4MM3A 3DCGA 2KNBA 3QA8A 2WYQA 3AU5A 3HK0A 1WJ4A 2CS4A 1ISNA 4DWFA 3QK0A 1YQBA 2DZJA 1IPGA 2ZVOA 3D32A 1UGMA 1V81A 4JLCA 1OGWA 4IM3A 4KIKB 1GG3A 1A5RA 3RYTA 4AUQC 5C23A 1OEYA 1YX6B 4HWIB 2BKRB 3L16A 3ZIMA 2CHZA 1GNUA 3PLUA 1OTRB 2EMTA 5DPTA 5CHVC 4MSQB 3PRPB 3IFWB 2K8HA 2LRWA 1TTNA 2MBEA 3PHXB 3SD5A 3Q3FA 3VDZA 2I1KA 3RCZA 3M3JA 2K1FA 4I6PA 4DK5A 1WJNA 3S2AA 4NNJB 2ZZPB 3OLMD 1MG8A 2LVPA 4MH0E 1TBEA 4IWPA 3ZKJC 2JZ3B 4JL9A 5LXIB 3UGBB 3A4RA 4FADA 1V2YA 4DHZE 1E8YA 2IBIB 2NBVB 1WXSA 2R2OA 3N30A 4WJQA 2IO1B 3MHSD 1Q1OA 4EZJA 3V62A 3ALBA 4RM8A 4G0NB 1WY8A 2N9EB 3PRZA 4PYZA 5DPSA 2AL6A 2FCMA 2D2QA 3RZWC 2JRIB 4GU2A 2M8SA 4XC2A 1GJZA 4YL8A 4WWNA 1Z2MA 2FUHB 4IUMB 3ZLZA 2MBBB 4FJZA 4KSKC 2LD9A 1UBIA 3BINA 5JHAA 2ASQA 2JXXA 3EECA 2BYVE 1J8CA 4FLHA 2QHOA 4BKTA 1WR1A 1XQQA 4X57B 1YJ1A 2N9XA 2ZCCA 2HTHA 3EFUA 2KJHB 4BOSC 5EDSA 2ZCBA 3X0WA 3TBLD 2REXA 2EMSA 3UIPB 1J0GA 1I42A 2OJRA 2MW5A 3L08A 3OAWA 2ZVNA 4OVVA 4PYUA 5JH5C 2ZEQA 1KLVA 1WGDA 4FJYA 4FHJA 4KIKA 2FIDA 3IG3A 4BKGA 2O6VA 3N3KB 1EUVB 3ZDTA 3V61A 2L3ZA 2C7MB 1ZKHA 2C60A 2KX3A 4WWPA 2Y5BB 4WQOB 1H8CA 4P7IA 1V5OA 4BBNC 4E74A 1D3ZA 4TQ0A 3ZW3A 5IA7A 4PS3A 3WANA 2BYEA 3HM6X 2N1WA 3KH0A 2KK8A 4MELA 5D7GA 4BBNF 2A5UA 2IY0B 3AXCA 4CO7A 2JF5A 3PHWB 1WX7A 4TKNA 2LGXA 3APFA 3LDZE 2FNJB 2KJRA 3DVNV 4HVBA 1WXAA 3P2BA 2N7DA 4BFRA 1P9DU 5D94A 1WI0A 4MSMB 4K81A 2MBHA 3QARA 3LMNA 3APCA 2BWES 1KJTA 4LDTB 2C9WB 2RSUA 3LJ3A 1NBFC 2KFKB 2B3AA 2D10A 2KKCA 1E90A 2AWTA 1WJUA 3M95A 3L54A 3BY4B 4DXAB 4KDIC 1KM7A 4ZDVA 1V5TA 1WJ6A 2GBNA 2G3QB 4AWJA 2JPHA 2LGDA 2JUOA 2OOBB 2LRUA 2W9NA 4F7ZA 2KJ6A 3H9DA 2Z0DB 3AI5A 2I1JA 1EF1A 3ZTCA 2IZVB 2BGFA 3A33B 3DQVA 4GIVA 3V6CB 2ZPYA 3DBSA 2L7RA 3NZSA 1S1QB 2KQ7A 2KN5A 2K39A 4TV3A 4EUTA 4MDKE 2MP2A 3A9KB 1QZEA 2GBJA 3PS6A 2DYMA 1YX5B 2NPTB 1LQBA 2LGYA 2MA9B 4A3OA 4W9DA 1E8WA 2GBKA 4WAAA 4ANVA 5JHBA 2GBMA 1S3SG 4A20A 4MEMA 4I6NB 4KZ0A 2GBRA 2O6VB 3L13A 2JWZA 4FN2A 4PS8A 2AEHA 3VH4B 2NR2A 3SDLC 2MBQA 3L17A 2IO2B 3ZO5B 2AYOB 3X23A 4ANXA 2G45B 1WXVA 2CKHB 2MX2A 2M1MA 2V4LA 2KTFA 2Z59B 3H6NA 4K7WA 3WAPA 2YLMA 2HJ8A 2V3SA 5E6PA 4MJSB 2DZKA 2ZPNA 3VTWA 1RRBA 1VCBA 1U4AA 2JVCA 1M94A 2LVQA 4NY0A 2DZIA 1BT0A 1WX9A 2LXCA 2KOXA 3PZDA 3ZNGC 3ZNID 5HKHA 2K25A 2JZZA 3PVLA 4HCPB 2KFKA 2MCNB 3GOEA 3R7QA 1F9JA 1P1AA 3ZUNA 3ZRCA 4M8MA 4BKSA 1E7UA 1IP9A 2N4FA 1K8RB 3I3TB 1R4NI 4A3PA 1RLFA 4HLEA 3U7DA 1WZ3A 3ECIA 2ZNVB 2KC1A 2NBUA 4FHKA 5KHOA 1FXTB 3R7RA 3ZRFA 1NI2A 3EC8A 1WYWB 3KVFB 3ZTDA 4FJVB 2ZJDA 2M0XA 3DBRI 4II3B 3PREA 4I6LB 2JT4B 1WRDB 4DHZB 4NQKE 4AJYB 2NBWB 4K1RB 4KZCA 3VUWA 3GZNI 2L8JA 4F8CB 1CMXB 1WGYA 2NCNA 4NJ7A 2RR9A 3PSEB 3A9KA 5FR6A 4TQ1A 1V49A 2NPTA 3QAQA 1UZXB 4MGYE 2KXJA 2GMIC 4W9EA 1PQSA 4GGQA 1WX8A 2HE7A 1L7YA 4B6WA 2C7HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZM A;  3CST A;  2CHX A;  1RAX A;  3VQI A;  4K7S A;  2MP2 B;  3KUD B;  3TJP A;  1WFY A;  3JW0 X;  5LLI A;  3ML9 A;  2RGF A;  4HPM B;  4EOY A;  1WE6 A;  2FCS A;  2KVR A;  4GMV A;  2WX1 A;  4MJS A;  2UYZ B;  2C7N B;  2D3G A;  4DDI D;  4LJP B;  4LDT D;  2HD5 B;  1TZ1 A;  3AUL A;  3NZU A;  1GC6 A;  3M62 B;  3H7S A;  4G50 A;  3WAM A;  5KHQ A;  3KW5 B;  4GDL B;  2C5L C;  2LZ6 A;  5JZE B;  2D07 B;  2KD0 A;  2LWP A;  3C0R B;  1C1Y B;  3RUL A;  4BVU C;  4EZK A;  3QWZ B;  4W9L A;  3UIN B;  4EFO A;  1EO6 A;  3A4S C;  3JYU A;  3QIJ A;  3CF6 E;  2MLB A;  3UQB A;  2IO3 B;  2FAZ A;  1HE8 A;  4F1S A;  1YIW A;  1I35 A;  3OJ4 B;  4ICV A;  2K8B A;  2KTR B;  3QCA A;  4ZRJ A;  3R3M A;  4TUU A;  5G2N A;  4G3X B;  4NPN A;  1V9J A;  1EF5 A;  5AZH A;  2BWF A;  4RM9 A;  5J2R A;  1XT9 B;  3B0A A;  3A9J B;  3EHV A;  2DAJ A;  3VH3 B;  3V6E B;  4FUL A;  4M0W B;  4W9F A;  4B95 A;  4HXD A;  2DAF A;  4HJK A;  1R4M I;  1WGH A;  4LCD E;  2ZNV C;  3VUY A;  2PE9 A;  3U8Z A;  2JRH A;  3AU4 A;  2KX0 A;  4GXB A;  3HIZ A;  2MRP A;  2V1Y A;  2A4Z A;  3R66 C;  3VTU A;  5CHW A;  3H1U A;  1WGR A;  2XBB C;  2O6V D;  4AOF A;  1WZ0 A;  5TR5 A;  1WR6 E;  5AZG A;  2MWS B;  2PJH A;  1WIA A;  1GUA B;  3TIX A;  5LXH A;  1IYF A;  4LJO B;  2LAS A;  4DBG A;  2DYO A;  4IW0 A;  1SIF A;  4GB9 A;  2KFJ A;  4ANU A;  3DVN U;  2N9P C;  2DEN B;  3U30 A;  4W9H A;  2KHW B;  4JQW C;  1E8Z A;  2J7Q B;  3QQ8 B;  5BO4 B;  3UQA A;  2KAN A;  4KSL C;  5D2M B;  2J0J A;  3CMM B;  2L0T A;  4KVG B;  3PGE A;  4E71 A;  4IM0 A;  5IAA C;  5DCN A;  4URK A;  3ML8 A;  1WM2 A;  1SGH A;  4EKU A;  3HM3 A;  1V6E A;  3ZVV A;  2DYB A;  4J6I A;  3HHM A;  4CHK A;  2KMC A;  4GDL A;  2L0F A;  3K9P B;  5CX3 A;  1UH6 A;  1V80 A;  1X1M A;  4W9I A;  4NAW B;  4FBJ B;  1L2N A;  1Z5S B;  2JY6 A;  1WMH B;  2KLG A;  4ZRK A;  2YVC A;  4FA6 A;  5CTR C;  2XK5 B;  1W6V A;  2LJ5 A;  2FIF A;  3DOW A;  4MGK E;  2WWZ A;  5E6O A;  1UD7 A;  3OJ3 A;  1WF9 A;  1GC7 A;  4DHJ B;  2O2V B;  2KTR A;  2K6Q A;  2NVU I;  2PE6 B;  5D6J B;  4E3C A;  2KWC A;  3IVF A;  4B9K A;  4EEW A;  2BYF A;  5DPR A;  3VVW B;  2UWQ A;  3L10 B;  2LI5 A;  1YD8 U;  2D11 A;  3A9J A;  3NY5 A;  4IM2 A;  2J0K A;  4XZ4 A;  4HPL B;  3ZNH B;  1LXD A;  1E5W A;  1LFD A;  3NS8 A;  3B08 A;  1KOT A;  2CR5 A;  3M63 B;  4HCN B;  2BF8 B;  3JVZ X;  3KYD D;  3PRM B;  2IO0 B;  4WJP A;  4II2 B;  4GSW A;  3APD A;  5E6N A;  4ZRI A;  5J17 A;  4W9K A;  3VUX A;  3O65 B;  1Q5W B;  5C1Z A;  1P98 A;  2MBO A;  4XX5 A;  4GDK B;  1WXM A;  2MSE D;  3DBH I;  3L0W B;  5L83 A;  4OVU A;  1WM3 A;  3KYC D;  2WX0 A;  1ZW7 A;  3DPD A;  2LXA A;  5CHF A;  1P3Q U;  2RPQ A;  4AJW A;  3RUI B;  3VTV A;  2NS5 A;  1E7V A;  2M4N A;  4N9F 4;  4NJ6 A;  4EZL A;  4ICU A;  2L05 A;  1JRU A;  2EKE C;  2R2Q A;  1Q0W B;  3H7P B;  4AP4 C;  1UBQ A;  5DPW A;  1UEL A;  3PV1 A;  2N7E A;  3PPA A;  4M8N A;  2XEW A;  2KO3 A;  2CHW A;  4PS7 A;  3A1Q B;  3KUZ A;  4W9G A;  3NOB A;  3W1S C;  3QJZ A;  5G55 A;  3JSV B;  3ZNZ B;  1LM8 B;  4NAW A;  1G6J A;  3SU8 X;  1TGZ B;  1WMH A;  2KQS A;  2VRR B;  2M17 A;  2XK5 A;  2DX5 B;  3T9L A;  2IY1 B;  4WJO A;  4ANW A;  4KV2 A;  3RT3 B;  1OQY A;  3ENE A;  2GOW A;  2O2V A;  3V60 A;  4BKS D;  3VHT C;  3WAL A;  2FCQ A;  2KMA A;  4HK2 A;  2J0M A;  2KLC A;  5L95 C;  5J18 A;  2N1V A;  2K8C A;  4BOZ B;  3Q3J A;  1RFA A;  3CSF A;  4JGH B;  1SE9 A;  3PTF C;  3VAW A;  1WGG A;  3TMP B;  2KZR A;  3IHP C;  1NDD A;  3W1Y A;  3VXW A;  3QHT A;  3SHQ A;  2Z0E B;  2KDF B;  1XD3 B;  3DBL I;  1J19 A;  4ZYN A;  3ZDM C;  4KDL B;  4CYE A;  1E8X A;  2G4S A;  2DHZ A;  2K6D B;  4IWQ A;  3N32 A;  3UF8 A;  4JIO U;  2RD0 A;  2CU1 A;  4GDK A;  3KUC B;  4HDO A;  4W9J A;  2BKF A;  2FCN A;  2L76 A;  3DVG X;  4RMA A;  4ASW C;  1VD2 A;  2PPH A;  5AEK B;  3PLV A;  3UIO B;  4HDQ A;  3VFK A;  5GMV A;  2LUE A;  2G4D B;  3PT2 B;  1H4R A;  2BPS A;  3TL5 A;  2IYD B;  1OEY J;  2WDT B;  3B1L X;  3ONS A;  2MQJ A;  2KDE B;  4GN1 A;  2L00 B;  3T8M A;  3DVG Y;  3H7P A;  2AL3 A;  2KDB A;  2PEA A;  4IG7 B;  3NHE B;  3QC8 B;  4G11 A;  2KC2 A;  1AAR A;  4MGZ E;  1WH3 A;  3A1Q A;  2KWV B;  1WE7 A;  3IBE A;  4WWO A;  2KDI A;  1V86 A;  3JSV A;  4K7U A;  4IWO A;  4WJN A;  4DDG D;  4NQL B;  1Y8R C;  3TCA A;  4MGI E;  3K9O B;  3RD2 A;  1ZGU B;  3WAO A;  1C3T A;  1T0Y A;  3RZF A;  3MTN B;  4DHJ D;  1P0R A;  2LVO A;  4GOC A;  3QX1 A;  5AZF A;  3WIM A;  3DDC B;  4W9C A;  3WA0 A;  4IC7 B;  3MJW A;  3W1S A;  2KWU B;  4MM3 A;  3DCG A;  2KNB A;  3QA8 A;  2WYQ A;  3AU5 A;  3HK0 A;  1WJ4 A;  2CS4 A;  1ISN A;  4DWF A;  3QK0 A;  1YQB A;  2DZJ A;  1IPG A;  2ZVO A;  3D32 A;  1UGM A;  1V81 A;  4JLC A;  1OGW A;  4IM3 A;  4KIK B;  1GG3 A;  1A5R A;  3RYT A;  4AUQ C;  5C23 A;  1OEY A;  1YX6 B;  4HWI B;  2BKR B;  3L16 A;  3ZIM A;  2CHZ A;  1GNU A;  3PLU A;  1OTR B;  2EMT A;  5DPT A;  5CHV C;  4MSQ B;  3PRP B;  3IFW B;  2K8H A;  2LRW A;  1TTN A;  2MBE A;  3PHX B;  3SD5 A;  3Q3F A;  3VDZ A;  2I1K A;  3RCZ A;  3M3J A;  2K1F A;  4I6P A;  4DK5 A;  1WJN A;  3S2A A;  4NNJ B;  2ZZP B;  3OLM D;  1MG8 A;  2LVP A;  4MH0 E;  1TBE A;  4IWP A;  3ZKJ C;  2JZ3 B;  4JL9 A;  5LXI B;  3UGB B;  3A4R A;  4FAD A;  1V2Y A;  4DHZ E;  1E8Y A;  2IBI B;  2NBV B;  1WXS A;  2R2O A;  3N30 A;  4WJQ A;  2IO1 B;  3MHS D;  1Q1O A;  4EZJ A;  3V62 A;  3ALB A;  4RM8 A;  4G0N B;  1WY8 A;  2N9E B;  3PRZ A;  4PYZ A;  5DPS A;  2AL6 A;  2FCM A;  2D2Q A;  3RZW C;  2JRI B;  4GU2 A;  2M8S A;  4XC2 A;  1GJZ A;  4YL8 A;  4WWN A;  1Z2M A;  2FUH B;  4IUM B;  3ZLZ A;  2MBB B;  4FJZ A;  4KSK C;  2LD9 A;  1UBI A;  3BIN A;  5JHA A;  2ASQ A;  2JXX A;  3EEC A;  2BYV E;  1J8C A;  4FLH A;  2QHO A;  4BKT A;  1WR1 A;  1XQQ A;  4X57 B;  1YJ1 A;  2N9X A;  2ZCC A;  2HTH A;  3EFU A;  2KJH B;  4BOS C;  5EDS A;  2ZCB A;  3X0W A;  3TBL D;  2REX A;  2EMS A;  3UIP B;  1J0G A;  1I42 A;  2OJR A;  2MW5 A;  3L08 A;  3OAW A;  2ZVN A;  4OVV A;  4PYU A;  5JH5 C;  2ZEQ A;  1KLV A;  1WGD A;  4FJY A;  4FHJ A;  4KIK A;  2FID A;  3IG3 A;  4BKG A;  2O6V A;  3N3K B;  1EUV B;  3ZDT A;  3V61 A;  2L3Z A;  2C7M B;  1ZKH A;  2C60 A;  2KX3 A;  4WWP A;  2Y5B B;  4WQO B;  1H8C A;  4P7I A;  1V5O A;  4BBN C;  4E74 A;  1D3Z A;  4TQ0 A;  3ZW3 A;  5IA7 A;  4PS3 A;  3WAN A;  2BYE A;  3HM6 X;  2N1W A;  3KH0 A;  2KK8 A;  4MEL A;  5D7G A;  4BBN F;  2A5U A;  2IY0 B;  3AXC A;  4CO7 A;  2JF5 A;  3PHW B;  1WX7 A;  4TKN A;  2LGX A;  3APF A;  3LDZ E;  2FNJ B;  2KJR A;  3DVN V;  4HVB A;  1WXA A;  3P2B A;  2N7D A;  4BFR A;  1P9D U;  5D94 A;  1WI0 A;  4MSM B;  4K81 A;  2MBH A;  3QAR A;  3LMN A;  3APC A;  2BWE S;  1KJT A;  4LDT B;  2C9W B;  2RSU A;  3LJ3 A;  1NBF C;  2KFK B;  2B3A A;  2D10 A;  2KKC A;  1E90 A;  2AWT A;  1WJU A;  3M95 A;  3L54 A;  3BY4 B;  4DXA B;  4KDI C;  1KM7 A;  4ZDV A;  1V5T A;  1WJ6 A;  2GBN A;  2G3Q B;  4AWJ A;  2JPH A;  2LGD A;  2JUO A;  2OOB B;  2LRU A;  2W9N A;  4F7Z A;  2KJ6 A;  3H9D A;  2Z0D B;  3AI5 A;  2I1J A;  1EF1 A;  3ZTC A;  2IZV B;  2BGF A;  3A33 B;  3DQV A;  4GIV A;  3V6C B;  2ZPY A;  3DBS A;  2L7R A;  3NZS A;  1S1Q B;  2KQ7 A;  2KN5 A;  2K39 A;  4TV3 A;  4EUT A;  4MDK E;  2MP2 A;  3A9K B;  1QZE A;  2GBJ A;  3PS6 A;  2DYM A;  1YX5 B;  2NPT B;  1LQB A;  2LGY A;  2MA9 B;  4A3O A;  4W9D A;  1E8W A;  2GBK A;  4WAA A;  4ANV A;  5JHB A;  2GBM A;  1S3S G;  4A20 A;  4MEM A;  4I6N B;  4KZ0 A;  2GBR A;  2O6V B;  3L13 A;  2JWZ A;  4FN2 A;  4PS8 A;  2AEH A;  3VH4 B;  2NR2 A;  3SDL C;  2MBQ A;  3L17 A;  2IO2 B;  3ZO5 B;  2AYO B;  3X23 A;  4ANX A;  2G45 B;  1WXV A;  2CKH B;  2MX2 A;  2M1M A;  2V4L A;  2KTF A;  2Z59 B;  3H6N A;  4K7W A;  3WAP A;  2YLM A;  2HJ8 A;  2V3S A;  5E6P A;  4MJS B;  2DZK A;  2ZPN A;  3VTW A;  1RRB A;  1VCB A;  1U4A A;  2JVC A;  1M94 A;  2LVQ A;  4NY0 A;  2DZI A;  1BT0 A;  1WX9 A;  2LXC A;  2KOX A;  3PZD A;  3ZNG C;  3ZNI D;  5HKH A;  2K25 A;  2JZZ A;  3PVL A;  4HCP B;  2KFK A;  2MCN B;  3GOE A;  3R7Q A;  1F9J A;  1P1A A;  3ZUN A;  3ZRC A;  4M8M A;  4BKS A;  1E7U A;  1IP9 A;  2N4F A;  1K8R B;  3I3T B;  1R4N I;  4A3P A;  1RLF A;  4HLE A;  3U7D A;  1WZ3 A;  3ECI A;  2ZNV B;  2KC1 A;  2NBU A;  4FHK A;  5KHO A;  1FXT B;  3R7R A;  3ZRF A;  1NI2 A;  3EC8 A;  1WYW B;  3KVF B;  3ZTD A;  4FJV B;  2ZJD A;  2M0X A;  3DBR I;  4II3 B;  3PRE A;  4I6L B;  2JT4 B;  1WRD B;  4DHZ B;  4NQK E;  4AJY B;  2NBW B;  4K1R B;  4KZC A;  3VUW A;  3GZN I;  2L8J A;  4F8C B;  1CMX B;  1WGY A;  2NCN A;  4NJ7 A;  2RR9 A;  3PSE B;  3A9K A;  5FR6 A;  4TQ1 A;  1V49 A;  2NPT A;  3QAQ A;  1UZX B;  4MGY E;  2KXJ A;  2GMI C;  4W9E A;  1PQS A;  4GGQ A;  1WX8 A;  2HE7 A;  1L7Y A;  4B6W A;  2C7H A; 
#chains in the Genus database with same CATH topology
 4US9 A;  3IT4 B;  1L4Z B;  1UF0 A;  1YN4 A;  1I4X A;  2BW2 A;  2RGF A;  2IND C;  4HPM B;  2WX1 A;  1WSP A;  2D3G A;  5AUI A;  1T5X D;  3FKY A;  1P7F A;  4GDL B;  3HUI A;  2LZ6 A;  3C0R B;  4W9L A;  1KTK A;  4JE3 B;  2IO3 B;  4XDD A;  5BMH A;  2N0S B;  1C77 A;  2K8B A;  4ZRJ A;  3SFE B;  5J2R A;  1PYW D;  3B0A A;  3EHV A;  2DAJ A;  3VH3 B;  4USA A;  1FO4 A;  2DAF A;  3BYY B;  3DWM A;  2PE9 A;  2JRH A;  3AU4 A;  3VTU A;  3P4R B;  4HPP A;  4AOF A;  5TR5 A;  4WH4 A;  2ZW0 A;  1IBX B;  4DXG A;  4DBG A;  3E56 A;  4IW0 A;  3NS1 A;  2J7Q B;  1QOF A;  4OHJ A;  2J0J A;  4M00 A;  2LGI A;  2QDF A;  5DCN A;  3EA6 A;  3HM3 A;  3GB1 A;  1V6E A;  2DYB A;  4J6I A;  2KMC A;  1E7P B;  1FNV A;  1PGB A;  4W9I A;  1Z5S B;  2KLG A;  2WU2 B;  2YVC A;  4FA6 A;  1W6V A;  4ARC A;  1JWA D;  2VZK B;  4MGK E;  1WF9 A;  2Y5C A;  2KTR A;  2PE6 B;  2J53 A;  1E10 A;  2LI5 A;  2D11 A;  2SEB D;  1CQV A;  4M0W A;  2LMC A;  5C3J B;  1E5W A;  3NS8 A;  1PDX A;  1DOY A;  3AB5 A;  4WIP A;  4DQO C;  3APD A;  4ZRI A;  4W9K A;  1MJD A;  3AE8 B;  1P98 A;  2W3S A;  4HKQ A;  1WXM A;  3DBH I;  1WM3 A;  1XLO A;  4N6E B;  2V9H A;  4BAX A;  1HA5 A;  1TZO A;  3AEF B;  1KF6 B;  4AS1 A;  1JRU A;  2EKE C;  1UBQ A;  1UEL A;  3PV1 A;  3PPA A;  3P63 A;  4M8N A;  2KO3 A;  4JWU C;  3A1Q B;  4NZL B;  3MC9 A;  1G6J A;  2JXT A;  2KQS A;  1OQY A;  4P1B C;  1HTO A;  3ENE A;  2JU6 X;  2GOW A;  5T8I A;  4BKS D;  3VHT C;  3WAL A;  1QOG A;  2KMA A;  3MC0 B;  2KLC A;  3ZYY X;  3CSF A;  3R8B A;  2IDY A;  1V1P B;  1WGG A;  3TMP B;  1NDD A;  3SHQ A;  2WHI A;  1YNT E;  4YSZ B;  3N32 A;  4OW0 A;  1N5X A;  2CU1 A;  3KUC B;  1MFW A;  2BKF A;  2FCN A;  2L76 A;  4RMA A;  5AEK B;  1VD2 A;  3VFK A;  2ACZ B;  3TL5 A;  4C56 C;  3B1L X;  1K53 A;  4YTN B;  2AL3 A;  1MG4 A;  2PEA A;  4IG7 B;  3NHE B;  2KAC A;  5JXV A;  2WS3 B;  1AAR A;  1J7B A;  4YSX B;  2KWV B;  1WE7 A;  4WWO A;  3AMZ A;  4MGI E;  3RD2 A;  1E0Z A;  2INP E;  4HRO A;  1C3T A;  4DHJ D;  3TEY A;  1P0R A;  2J4X A;  4GOC A;  4LTU A;  3WIM A;  4RFB A;  2QC8 A;  5LNK 1;  1SSN A;  3HK0 A;  1WJ4 A;  1YQB A;  4JLC A;  1ZXI A;  3NRZ A;  2LHE A;  3RYT A;  2FBW B;  4NAM A;  4A55 A;  2BKR B;  3ZIM A;  1OTR B;  1BXT A;  1HZ6 A;  1ZOY B;  2L1A A;  2MBE A;  3VDZ A;  2SAK A;  1YN5 A;  2K1F A;  4N58 A;  3OLM D;  3ZKJ C;  4MH0 E;  1XO3 A;  2JZ3 B;  2IJ0 A;  1LGR A;  4PT5 A;  3V62 A;  4Q2J A;  1PFD A;  4RM8 A;  1F2R C;  2D2Q A;  2PLP A;  4XC2 A;  4A8X C;  1GJZ A;  3ZLZ A;  1TYG B;  4KSK C;  2LD9 A;  4ARI A;  1KLU D;  2JXX A;  3EEC A;  1FEH A;  1XXG A;  2N9X A;  3Q8F A;  4TSS A;  2Q5W D;  3X0W A;  3TBL D;  4PYU A;  1XEE A;  1WGD A;  4BKG A;  1L6U A;  4C00 A;  3Q14 C;  4WQO B;  4MT5 A;  3AEB B;  4BBN C;  4TQ0 A;  3WAN A;  2BYE A;  3LB8 C;  3Q8A A;  2QEJ C;  3KH0 A;  3Q6B A;  2L83 A;  4CO7 A;  2WXJ A;  2FNJ B;  1P9D U;  1WYG A;  3APC A;  2BWE S;  3N1Y C;  3V05 A;  5D3I B;  2RSU A;  1NBF C;  3I5J C;  2KFK B;  2D10 A;  1I4G A;  4OZA A;  5FKA C;  1TS4 A;  1J7A A;  1WJU A;  3P1M A;  4S17 A;  1F0Z A;  1V5T A;  2GBN A;  1B9R A;  1ENF A;  2LRU A;  1TS5 A;  2KJ6 A;  2KN5 A;  4NJC A;  1FCL A;  4C7Z A;  2OED A;  1QZE A;  2GBJ A;  3PS6 A;  2W3R A;  2NPT B;  2LGY A;  2MA9 B;  4ANV A;  4MEM A;  1KRH A;  2GBR A;  1XCT L;  4FN2 A;  3VRB B;  2JX5 A;  3Q69 A;  4ANX A;  2G45 B;  2MHJ A;  3H6N A;  2MX2 A;  2M1M A;  3WAP A;  2D3C A;  2YLM A;  2HJ8 A;  3V3X A;  2AX5 A;  1RRB A;  1VCB A;  5TSS A;  2JVC A;  2WNM A;  1TKE A;  5HI1 A;  5HKH A;  1GOZ A;  2KOX A;  4RCO A;  4XDC A;  1ZDX A;  2LJI A;  3GOE A;  1F9J A;  2JYE A;  3ZUN A;  4BKS A;  1SB3 C;  1RLF A;  4HLE A;  3DWG C;  1FMA D;  2H88 B;  3ECI A;  2KC1 A;  4FHK A;  3ZRF A;  4B0M A;  3ZTD A;  2H89 B;  1K50 A;  4FJV B;  1C76 A;  1QLB B;  4AJY B;  2JSV X;  2RR9 A;  4TQ1 A;  3QAQ A;  1I4R A;  2HE7 A;  1OQR A;  3W1S A;  2K5P A;  2CHX A;  1RAX A;  4MAC A;  4YSY B;  2WGS A;  5EE1 A;  3TJP A;  4OZC A;  5GXG B;  5HHD G;  3RI7 C;  1F2R I;  1UGJ A;  2PKO A;  4LJP B;  4LDT D;  2HD5 B;  3AUL A;  3H7S A;  3KW5 B;  3MJ5 A;  1C4C A;  3I57 A;  1Y56 A;  2WXL A;  2IGD A;  2KD0 A;  4EZK A;  3QWZ B;  3JYU A;  1T3Q A;  3GS2 A;  3UQB A;  2QCZ A;  2RDH A;  4F1S A;  4RGT A;  3RMK C;  1I35 A;  3AE4 B;  3QCA A;  3R3M A;  4TUU A;  5G2N A;  3AE1 B;  2BWF A;  4RM9 A;  1XT9 B;  4C7Y A;  4ZHP A;  1KFY B;  3AV8 A;  4LCD E;  3AH7 A;  3VUY A;  3U8Z A;  3RPF C;  2V1Y A;  2A4Z A;  3I9V 1;  3B2G A;  3OG5 A;  4L1B A;  3BVM A;  3H1U A;  1ZPS A;  5BYQ A;  1EU4 A;  1WZ0 A;  1WR6 E;  5LXH A;  1I4P A;  2PJH A;  1IYF A;  1GUA B;  4LJO B;  2LAS A;  4GB9 A;  3DVN U;  3U30 A;  4W9H A;  3UQA A;  3QQ8 B;  2AQ1 B;  3ABV B;  3NZ3 A;  3AE2 B;  3KQ4 A;  4KSL C;  1C9F A;  1Q10 A;  5IAA C;  1WM2 A;  2HDE A;  3ZVV A;  3HHM A;  4GDL A;  5BMI A;  4UDU C;  5CX3 A;  1X1M A;  3LYY A;  4FBJ B;  2JY6 A;  1WMH B;  4ZRK A;  5CTR C;  2FIF A;  3DOW A;  2WWZ A;  1UD7 A;  2INN E;  4DHJ B;  2O2V B;  4CQN A;  2UWQ A;  1YD8 U;  5IN7 A;  2N7J A;  4XZ4 A;  4HPL B;  1D5X C;  1LXD A;  1LFD A;  4YTM B;  1RFK A;  3KYD D;  2K3U A;  3PRM B;  4WJP A;  4GSW A;  5E6N A;  2GI9 A;  1K51 A;  3O65 B;  1IBX A;  1VRA B;  5L83 A;  1HXY D;  2W54 A;  2KDM A;  1ZW7 A;  3ZQ4 A;  2LXA A;  3URY A;  4NJ6 A;  4ICU A;  2L05 A;  4LNO A;  2BVC A;  4R3D A;  3H7P B;  1N60 A;  1TKG A;  2RPV A;  2XEW A;  2CHW A;  2BS4 B;  4PS7 A;  3O13 A;  3JSV B;  1LM8 B;  2TSS A;  3SU8 X;  3IAM 1;  4WJO A;  3RT3 B;  4MM3 B;  3V60 A;  3MFG A;  4HK2 A;  4GLS C;  2K8C A;  4JGH B;  1AW7 A;  2LEK A;  1TKY A;  2KZR A;  3IHP C;  1N61 A;  3QHT A;  3W9C B;  2KDF B;  1XD3 B;  1SE2 A;  3ZDM C;  4REZ A;  1CK1 A;  2MEK A;  1ZE3 D;  1T0S C;  2DHZ A;  2K6D B;  4IWQ A;  3BVG A;  3P4S B;  1IGD A;  4HDO A;  4W9J A;  4ASW C;  3J9C A;  4HDQ A;  1H4R A;  2WDT B;  3ONS A;  2MQJ A;  3C19 A;  1JW9 D;  3RNA C;  2KC2 A;  2J42 A;  3A1Q A;  1V86 A;  4WJN A;  3TCA A;  3K9O B;  1GB4 A;  3Q3M C;  3WAO A;  2LVO A;  3QX1 A;  5AZF A;  4W9C A;  1TS2 A;  3DCG A;  3QA8 A;  2V0G A;  3SR6 A;  4KIK B;  1F77 A;  1V1P A;  1A5R A;  3PO0 A;  1OEY A;  1YX6 B;  4HWI B;  2I2Y A;  1ET6 A;  1SE4 A;  5DPT A;  2EMT A;  1JQ4 A;  3IFW B;  3PHX B;  2LRW A;  1TTN A;  3TUO A;  4I6P A;  1WJN A;  4NNJ B;  2LFI A;  1MG8 A;  1TBE A;  3W5U B;  5LXI B;  3UGB B;  3A4R A;  3U7Z A;  3W5V B;  2NBV B;  1RWS A;  3N30 A;  3N1Z C;  1SF0 A;  3PRZ A;  5DPS A;  3PZ8 A;  2JRI B;  4GU2 A;  2M8S A;  1Z2M A;  2FUH B;  2MBB B;  1SIJ A;  2BB6 A;  5JHA A;  3OWE B;  3AE7 B;  4FLH A;  2QHO A;  4BKT A;  1WR1 A;  1JWU D;  5EDS A;  2ZCB A;  4YXD B;  5IOI A;  2REX A;  2GB1 A;  1J0G A;  2OJR A;  2DNF A;  2MW5 A;  3OAW A;  3CIR B;  1KLV A;  4FJY A;  3C8Y A;  4FHJ A;  2C7M B;  4WWP A;  2Y5B B;  3DBH B;  1H8C A;  1V5O A;  4E74 A;  1D3Z A;  3ZW3 A;  5IA7 A;  1B1Z A;  3HM6 X;  1V8C A;  4MEL A;  5D7G A;  2IGG A;  2IY0 B;  3AXC A;  2JF5 A;  1WX7 A;  4P1C C;  3AE5 B;  3APF A;  2KJR A;  4HVB A;  1WXA A;  5H92 C;  1PGA A;  1FRD A;  3U4E G;  4K81 A;  2L52 A;  2MBH A;  1N62 A;  3LMN A;  4LDT B;  1MVK A;  2B3A A;  1E90 A;  5HFY A;  1I4H A;  1JML A;  2WXR A;  5BMG A;  2JUO A;  1SE3 A;  2B76 B;  4F7Z A;  2Z0D B;  2WU5 B;  2I1J A;  3AI5 A;  1C78 A;  2BGF A;  3IT6 B;  4GIV A;  1RYJ A;  2V3P A;  2CJN A;  1SJH D;  4EUT A;  2MP2 A;  3A9K B;  1YX5 B;  1UNS A;  4P16 A;  3NJT A;  4A3O A;  1E8W A;  2WXO A;  4KZ0 A;  4MH8 A;  2JWZ A;  3FAH A;  3AEE B;  2Y3A A;  3VH4 B;  3SDL C;  3L17 A;  3RNB C;  3X23 A;  1L4D B;  1WXV A;  2KTF A;  1MI0 A;  1VJK A;  5E6P A;  4MJS B;  2DZK A;  4B0E A;  2JWU A;  2PTL A;  1L5P A;  2LVQ A;  2DZI A;  1WX9 A;  3PZD A;  1SBB B;  4HCP B;  1JRP A;  2KFK A;  2WXM A;  4RH6 A;  3R7Q A;  1P1A A;  1A70 A;  3N1X C;  1MHX A;  2HTM E;  1K8R B;  3AEG B;  3I3T B;  3ZXR A;  1R4N I;  1ZXH A;  3EGR A;  5EE0 A;  1M4V A;  3U7D A;  1WZ3 A;  2NMQ A;  1JAL A;  1NI2 A;  3EC8 A;  1D5M C;  3DBR I;  2M0X A;  2RDG A;  3DHH C;  4K1R B;  4DXF A;  3VR8 B;  3GZN I;  1WXQ A;  3ZJV A;  1CMX B;  4NJ7 A;  1UWM A;  5FR6 A;  3AE6 B;  4XWT A;  1DYQ A;  1V49 A;  2NPT A;  1UZX B;  1N5W A;  2GMI C;  1R7S A;  3EFC A;  4GGQ A;  4B6W A;  4N59 A;  4XYC A;  2HJ1 A;  3VQI A;  4K7S A;  2MP2 B;  3KUD B;  1VR9 A;  1WFY A;  1TJE A;  3JW0 X;  4C80 A;  1XLQ A;  3ML9 A;  4RGN A;  4O1N A;  4WQM A;  4EOY A;  3HVZ A;  1HTQ A;  2UYZ B;  2C7N B;  3NZU A;  2V3N A;  1GC6 A;  2D3B A;  3M62 B;  1EU3 A;  3HVD A;  1P7E A;  2C5L C;  2D07 B;  2LWP A;  4BVU C;  3RUL A;  1C1Y B;  3AN1 A;  3UIN B;  4EFO A;  2WDQ B;  1FM0 D;  4D2K A;  5EE9 A;  2BYT A;  4G3X B;  4NPN A;  5AZH A;  2RDB C;  1C4A A;  3A9J B;  3V6E B;  4HJK A;  1KLG D;  2D5G A;  1WGH A;  2ZNV C;  4C4V B;  4GXB A;  2MRP A;  3R66 C;  1CJE A;  2WXI A;  1WGR A;  2XBB C;  2O6V D;  4LK0 M;  3I63 C;  5AZG A;  3TIX A;  2MWS B;  2PVG C;  1PGX A;  2DYO A;  2KFJ A;  4ANU A;  2PW9 A;  2N9P C;  2KHW B;  1E8Z A;  2KAN A;  2ICI A;  3GP7 A;  3CMM B;  3N20 C;  2BS2 B;  4KVG B;  3PGE A;  2MJE A;  4URK A;  2EEL A;  1FCC C;  1ZUD 2;  4CHK A;  2L0F A;  2WXF A;  5HG2 A;  1UH6 A;  3L4P A;  4NAW B;  3AE9 B;  2QIE B;  2XK5 B;  2WXH A;  2NVU I;  4E3C A;  1SEB D;  2KWC A;  4EEW A;  2BYF A;  4FXC A;  1D4B A;  2WLB A;  3L10 B;  4LNF A;  1GAQ B;  2YEP F;  1TIF A;  3B08 A;  1KOT A;  4HCN B;  2BF8 B;  4II2 B;  5J17 A;  3VUX A;  1Q5W B;  4GDK B;  2RMM A;  4P6V F;  2W55 A;  4RNA A;  2WX0 A;  3DPD A;  1D6E C;  1P3Q U;  2RPQ A;  4AJW A;  5FR3 A;  2NS5 A;  2M4N A;  4EZL A;  1CZP A;  1TS3 A;  4OZB A;  5DPW A;  2N7E A;  1OFF A;  4W9G A;  3NOB A;  1ACC A;  3RNE C;  5G55 A;  3ZNZ B;  1WMH A;  4IDI A;  4LNN A;  4A90 A;  1KH0 A;  3U2S C;  2VRR B;  1EM7 A;  3T9L A;  4ANW A;  4KV2 A;  1HQR D;  2O2V A;  2FCQ A;  2G1E A;  2N1V A;  2M0A A;  3DHG C;  1SE9 A;  3PTF C;  2MJ3 A;  1HZ5 A;  3VXW A;  3ETR A;  2VH1 A;  4PK1 A;  2Z0E B;  3DBL I;  4ZYN A;  2QSD A;  1E8X A;  2G4S A;  1FXI A;  3UF8 A;  2RD0 A;  1UUP A;  1V97 A;  1HEZ E;  2CU3 A;  2PPH A;  4QAY A;  3UIO B;  3PT2 B;  1D5Z C;  1NYR A;  1OEY J;  2INC C;  2KDE B;  4GN1 A;  3H7P A;  3P4P B;  1WGK A;  2OJW A;  3QC8 B;  2BT6 A;  1WH3 A;  3TSS A;  2NTS A;  3JSV A;  1FXA A;  4IWO A;  4K7U A;  4DDG D;  1N63 A;  4NQL B;  1ZGU B;  2BBC A;  3RZF A;  3MTN B;  1WWT A;  3DBL B;  3DDC B;  4IC7 B;  1L0V B;  2KWU B;  2LHD A;  4MM3 A;  2KNB A;  2WYQ A;  3H8H A;  2CS4 A;  3QK0 A;  2DZJ A;  1AN8 A;  2QIL A;  1FFU A;  3D32 A;  1UGM A;  1V81 A;  1OGW A;  4KGS A;  2GRI A;  5G5G A;  4AUQ C;  5G5H A;  1EWC A;  1GNU A;  3PLU A;  4MSQ B;  2K8H A;  4IOI E;  3RCZ A;  3M3J A;  4DK5 A;  3PZ7 A;  2ZZP B;  1MHH E;  2LVP A;  4IWP A;  3Q8B A;  2CJO A;  1V2Y A;  3FIL B;  4DHZ E;  1E8Y A;  2IBI B;  1JRO A;  4WJQ A;  2IO1 B;  4ZOH C;  3AE3 B;  1Q1O A;  5H8Y E;  3WCQ A;  4G0N B;  2N9E B;  4PYZ A;  2AL6 A;  4RF0 A;  4YL8 A;  5I4D A;  4WWN A;  2V4I B;  4IUM B;  3NVZ A;  2BB5 A;  1UBI A;  2E6X A;  3U52 E;  2FE8 A;  4LNI A;  3RNG C;  2BYV E;  1ROE A;  1YJ1 A;  3R2I A;  2ZCC A;  4US8 A;  2HTH A;  2W82 A;  1FD6 A;  2EMS A;  3L08 A;  3Q8C A;  2ZVN A;  2X8X X;  5JH5 C;  3Q3O C;  1NVI D;  4KIK A;  2FID A;  2O6V A;  4J3O D;  5IP4 D;  3N3K B;  3ZDT A;  2L3Z A;  2KX3 A;  1YJJ A;  1SJE D;  4ZYS A;  1I7H A;  4PS3 A;  2E3T A;  4BZA A;  2KK8 A;  2M19 A;  2DLB A;  4BBN F;  3PHW B;  3ZGZ A;  2LGX A;  1AYF A;  3DVN V;  1T0R C;  1E9M A;  2N7D A;  2ONQ A;  2WXP A;  2NTT A;  1WI0 A;  3QAR A;  3BK2 A;  2G9H D;  2M56 B;  2C9W B;  2Z8L A;  4HJG E;  3LJ3 A;  1I4Q A;  2IGH A;  3MHZ A;  1L6V A;  5IO9 A;  4DXA B;  1KM7 A;  1YQ4 B;  2OOB B;  4KGT A;  2W9N A;  3H9D A;  1EF1 A;  1DGJ A;  3A33 B;  3DQV A;  2ZPY A;  1ZDV A;  1QT9 A;  3DBS A;  4HEA 1;  2KQ7 A;  2K39 A;  4KKI A;  4TV3 A;  1STE A;  2ZW1 A;  4MDK E;  2N9L A;  2DYM A;  1VZ8 A;  2KT7 A;  2WP9 B;  4W9D A;  2GBK A;  5E6J A;  5JHB A;  1S3S G;  4IKG A;  4I6N B;  2O6V B;  3L13 A;  4PS8 A;  2AEH A;  2MBQ A;  2IO2 B;  1YJI A;  2AYO B;  1T0Q C;  2V4L A;  2Z59 B;  4WAF A;  1YQ3 B;  4K7W A;  4L23 A;  2V3S A;  2LUM A;  2ZPN A;  1U4A A;  3BVZ A;  1UWX A;  1C4P A;  2Y5P A;  2K25 A;  2KWD A;  1FNW A;  3NUH B;  2MCN B;  3ZRC A;  4M8M A;  1E7U A;  2K22 A;  2KVZ A;  2N4F A;  1IP9 A;  3GE8 C;  2NBU A;  1FXT B;  3R7R A;  1WYW B;  3KVF B;  5EE3 A;  1VDV A;  2FUG 1;  2ZJD A;  4II3 B;  3PRE A;  4I6L B;  1WRD B;  4DHZ B;  4NQK E;  2WXK A;  2IPK D;  4KZC A;  3VUW A;  1C79 A;  2L8J A;  2WDV B;  4F8C B;  4ZHO A;  2KN4 A;  2NCN A;  4ZRP A;  3A9K A;  1DOI A;  4MGY E;  1IGC A;  2KXJ A;  1PQS A;  3MP9 A;  4KGR A;  2DZM A;  3CST A;  1XLN A;  2PIA A;  1YN3 A;  3BYT B;  3NVV A;  4JWS C;  1WRI A;  5LLI A;  1NI3 A;  2PMV A;  1FFV A;  1NEK B;  4XE0 A;  1WE6 A;  2FCS A;  3RFZ B;  2KVR A;  4GMV A;  4MJS A;  1ET9 A;  4DDI D;  1JWM D;  1TZ1 A;  1TT5 B;  4G50 A;  2BQQ A;  3WAM A;  5KHQ A;  2JQR B;  4K3B A;  5JZE B;  3KLS X;  1QF6 A;  1EO6 A;  3A4S C;  3QIJ A;  3CF6 E;  2MLB A;  1E6E B;  2FAZ A;  1HE8 A;  1YIW A;  3OJ4 B;  4ICV A;  2KTR B;  1JWS D;  1V9J A;  1EF5 A;  4K3C A;  2QMT A;  4FUL A;  4M0W B;  4W9F A;  1FPY A;  4B95 A;  4HXD A;  1MPE A;  1R4M I;  2QJL A;  1QIL A;  2KX0 A;  3HIZ A;  5CHW A;  3T3O A;  4ITK A;  1WIA A;  2I38 A;  3EUB 2;  1JWB D;  4KX6 B;  1SIF A;  2DEN B;  4JQW C;  5BO4 B;  2K9X A;  5D2M B;  2L0T A;  2WDR B;  4E71 A;  4IM0 A;  5C2T B;  3ML8 A;  4RF1 A;  1SGH A;  4EKU A;  1NYQ A;  3K9P B;  4H2A A;  1V80 A;  3B2F A;  1L2N A;  1R4M B;  3RNF C;  2LJ5 A;  5FK9 C;  5E6O A;  3OJ3 A;  1GC7 A;  2AQ2 B;  2WXG A;  5D6J B;  2K6Q A;  3IVF A;  4B9K A;  1IUE A;  4RGM A;  5DPR A;  1YMH E;  3VVW B;  3RN9 C;  3A9J A;  3NY5 A;  1EWY C;  4OVZ A;  4JPS A;  4IM2 A;  2J0K A;  3ZNH B;  2DBY A;  1NEN B;  4C4V A;  2CR5 A;  3M63 B;  3JVZ X;  2IO0 B;  3T3N A;  1GB1 A;  3TEW A;  5C1Z A;  3ZXV A;  2MBO A;  2KQ4 X;  4XX5 A;  3W2D A;  2MSE D;  1LO5 D;  3L0W B;  2MJD A;  4OVU A;  3Q3N C;  3KYC D;  2L32 A;  4TMA B;  5CHF A;  3RUI B;  4WUR A;  3VTV A;  1E7V A;  3BWU D;  2EKI A;  4N9F 4;  2R2Q A;  2K0P A;  1Q0W B;  4AP4 C;  1TY0 A;  4JX1 C;  3BZD B;  3KUZ A;  1R4N B;  3W1S C;  1F52 A;  3QJZ A;  4NAW A;  1TGZ B;  1QOB A;  2MH7 A;  3LXF A;  4M01 A;  2M17 A;  2XK5 A;  2DX5 B;  2IY1 B;  3DBR B;  4ACF A;  3B9J A;  2YEP B;  3GZN B;  2J0M A;  1K52 A;  1ESF A;  5J18 A;  5L95 C;  4BOZ B;  3Q3J A;  1RFA A;  3VAW A;  3W1Y A;  3VR9 B;  4EE2 A;  1J19 A;  4CYE A;  4KDL B;  3P4Q B;  2ON8 A;  1JCK B;  4JIO U;  4GDK A;  3DVG X;  1QKZ A;  3PLV A;  5GMV A;  2LUE A;  2G4D B;  2BPS A;  1FNU A;  2IYD B;  1DOX A;  5D3D A;  3T8M A;  2L00 B;  3DVG Y;  1AWD A;  3FC4 A;  3ZJT A;  2KDB A;  3TEX A;  4KKJ A;  4G11 A;  1SXT A;  3DHI C;  4MGZ E;  4M02 A;  1XCQ L;  3IBE A;  2WXN A;  2KDI A;  3SEB A;  1Y8R C;  2BS3 B;  4LNK A;  1BUI C;  3NVY A;  2VZK D;  1T0Y A;  3WA0 A;  3MJW A;  3AU5 A;  3UI3 A;  2KYW A;  1ISN A;  4DWF A;  1QQR A;  1IPG A;  2ZVO A;  4IM3 A;  5BYR A;  3KWL A;  1GG3 A;  1PUT A;  3NG0 A;  5C23 A;  1L0Y B;  3L16 A;  2CHZ A;  5CHV C;  3PRP B;  3SD5 A;  3Q3F A;  2I1K A;  3Q2A C;  4WWM A;  3S2A A;  3BII D;  3KWV A;  4JL9 A;  5IKC M;  2JZP A;  4FAD A;  1WXS A;  2R2O A;  3MHS D;  4EZJ A;  3BK1 A;  3ALB A;  1WY8 A;  3E9S A;  3NVW A;  3P42 A;  2FCM A;  2AQ3 B;  3RZW C;  2WQY B;  1XLP A;  3IAS 1;  3AM9 A;  4FJZ A;  3BIN A;  2ASQ A;  1GPX A;  3CWI A;  1J8C A;  4RGO S;  2OHF A;  1XQQ A;  1OQQ A;  4X57 B;  4L2Y A;  3EFU A;  2KJH B;  4BOS C;  1FIQ A;  3UIP B;  1I42 A;  1TY2 A;  2PVO D;  2D3A A;  4OVV A;  2ZEQ A;  3IG3 A;  1EUV B;  3V61 A;  2XN9 C;  1ZKH A;  2C60 A;  4XWW A;  1V1O A;  4HRS A;  4P7I A;  1YOV B;  1FRR A;  4AQ7 A;  2GLS A;  2N1W A;  1N6Z A;  2N9K A;  3Q8E A;  2A5U A;  3AED B;  3TEZ A;  3GE3 C;  4TKN A;  3LDZ E;  3ZJU A;  3P2B A;  3FIL A;  4BFR A;  5D94 A;  4MSM B;  1KJT A;  1VZ7 A;  4YT0 B;  1VZ6 A;  2JYT A;  2KKC A;  2AWT A;  4ZRQ A;  3M95 A;  3SFD B;  3L54 A;  3BY4 B;  2XNA C;  4KDI C;  4ZDV A;  1WJ6 A;  4AWJ A;  2G3Q B;  2JPH A;  2LGD A;  1T6B X;  2UU7 A;  2KMM A;  2KAJ A;  2WXQ A;  3ZTC A;  2IZV B;  3V6C B;  2L7R A;  3NZS A;  1S1Q B;  2R61 A;  3RNC C;  2DWQ A;  1LQB A;  4WAA A;  4S0R A;  2GBM A;  4A20 A;  3N9Y C;  2BTE A;  1QOA A;  2NR2 A;  2J52 A;  3ZO5 B;  1XF5 L;  3HRD D;  2CKH B;  3AEC B;  5AUK A;  1F1H A;  4HKZ E;  1BML C;  3VTW A;  1M94 A;  2X38 A;  1RM6 C;  4YWG G;  4NY0 A;  2VH2 A;  3VRA B;  4YTP B;  1BT0 A;  2LXC A;  3ZNG C;  3ZNI D;  3PVL A;  2JZZ A;  3AEA B;  1L0X B;  1ZP0 B;  4A3P A;  5KHO A;  2ZNV B;  5MPO A;  5BYS A;  3R2T A;  3MC8 A;  1VLB A;  2JT4 B;  1J7C A;  3IXS A;  2NBW B;  4XGA B;  4A6Q A;  1WGY A;  3PSE B;  4A9A A;  4LLG M;  4W9E A;  2LGS A;  1WX8 A;  1L7Y A;  2C7H A; 
#chains in the Genus database with same CATH homology
 2DZM A;  3CST A;  2CHX A;  1RAX A;  3VQI A;  4K7S A;  2MP2 B;  3KUD B;  3TJP A;  1WFY A;  3JW0 X;  5LLI A;  3ML9 A;  2RGF A;  4HPM B;  4EOY A;  1WE6 A;  2FCS A;  2KVR A;  4GMV A;  2WX1 A;  4MJS A;  2UYZ B;  2C7N B;  2D3G A;  4DDI D;  4LJP B;  4LDT D;  2HD5 B;  1TZ1 A;  3AUL A;  3NZU A;  1GC6 A;  3M62 B;  3H7S A;  4G50 A;  3WAM A;  5KHQ A;  3KW5 B;  4GDL B;  2C5L C;  2LZ6 A;  5JZE B;  2D07 B;  2KD0 A;  2LWP A;  3C0R B;  1C1Y B;  3RUL A;  4BVU C;  4EZK A;  3QWZ B;  4W9L A;  3UIN B;  4EFO A;  1EO6 A;  3A4S C;  3JYU A;  3QIJ A;  3CF6 E;  2MLB A;  3UQB A;  2IO3 B;  2FAZ A;  1HE8 A;  4F1S A;  1YIW A;  1I35 A;  3OJ4 B;  4ICV A;  2K8B A;  2KTR B;  3QCA A;  4ZRJ A;  3R3M A;  4TUU A;  5G2N A;  4G3X B;  4NPN A;  1V9J A;  1EF5 A;  5AZH A;  2BWF A;  4RM9 A;  5J2R A;  1XT9 B;  3B0A A;  3A9J B;  3EHV A;  2DAJ A;  3VH3 B;  3V6E B;  4FUL A;  4M0W B;  4W9F A;  4B95 A;  4HXD A;  2DAF A;  4HJK A;  1R4M I;  1WGH A;  4LCD E;  2ZNV C;  3VUY A;  2PE9 A;  3U8Z A;  2JRH A;  3AU4 A;  2KX0 A;  4GXB A;  3HIZ A;  2MRP A;  2V1Y A;  2A4Z A;  3R66 C;  3VTU A;  5CHW A;  3H1U A;  1WGR A;  2XBB C;  2O6V D;  4AOF A;  1WZ0 A;  5TR5 A;  1WR6 E;  5AZG A;  2MWS B;  2PJH A;  1WIA A;  1GUA B;  3TIX A;  5LXH A;  1IYF A;  4LJO B;  2LAS A;  4DBG A;  2DYO A;  4IW0 A;  1SIF A;  4GB9 A;  2KFJ A;  4ANU A;  3DVN U;  2N9P C;  2DEN B;  3U30 A;  4W9H A;  2KHW B;  4JQW C;  1E8Z A;  2J7Q B;  3QQ8 B;  5BO4 B;  3UQA A;  2KAN A;  4KSL C;  5D2M B;  2J0J A;  3CMM B;  2L0T A;  4KVG B;  3PGE A;  4E71 A;  4IM0 A;  5IAA C;  5DCN A;  4URK A;  3ML8 A;  1WM2 A;  1SGH A;  4EKU A;  3HM3 A;  1V6E A;  3ZVV A;  2DYB A;  4J6I A;  3HHM A;  4CHK A;  2KMC A;  4GDL A;  2L0F A;  3K9P B;  5CX3 A;  1UH6 A;  1V80 A;  1X1M A;  4W9I A;  4NAW B;  4FBJ B;  1L2N A;  1Z5S B;  2JY6 A;  1WMH B;  2KLG A;  4ZRK A;  2YVC A;  4FA6 A;  5CTR C;  2XK5 B;  1W6V A;  2LJ5 A;  2FIF A;  3DOW A;  4MGK E;  2WWZ A;  5E6O A;  1UD7 A;  3OJ3 A;  1WF9 A;  1GC7 A;  4DHJ B;  2O2V B;  2KTR A;  2K6Q A;  2NVU I;  2PE6 B;  5D6J B;  4E3C A;  2KWC A;  3IVF A;  4B9K A;  4EEW A;  2BYF A;  5DPR A;  3VVW B;  2UWQ A;  3L10 B;  2LI5 A;  1YD8 U;  2D11 A;  3A9J A;  3NY5 A;  4IM2 A;  2J0K A;  4XZ4 A;  4HPL B;  3ZNH B;  1LXD A;  1E5W A;  1LFD A;  3NS8 A;  3B08 A;  1KOT A;  2CR5 A;  3M63 B;  4HCN B;  2BF8 B;  3JVZ X;  3KYD D;  3PRM B;  2IO0 B;  4WJP A;  4II2 B;  4GSW A;  3APD A;  5E6N A;  4ZRI A;  5J17 A;  4W9K A;  3VUX A;  3O65 B;  1Q5W B;  5C1Z A;  1P98 A;  2MBO A;  4XX5 A;  4GDK B;  1WXM A;  2MSE D;  3DBH I;  3L0W B;  5L83 A;  4OVU A;  1WM3 A;  3KYC D;  2WX0 A;  1ZW7 A;  3DPD A;  2LXA A;  5CHF A;  1P3Q U;  2RPQ A;  4AJW A;  3RUI B;  3VTV A;  2NS5 A;  1E7V A;  2M4N A;  4N9F 4;  4NJ6 A;  4EZL A;  4ICU A;  2L05 A;  1JRU A;  2EKE C;  2R2Q A;  1Q0W B;  3H7P B;  4AP4 C;  1UBQ A;  5DPW A;  1UEL A;  3PV1 A;  2N7E A;  3PPA A;  4M8N A;  2XEW A;  2KO3 A;  2CHW A;  4PS7 A;  3A1Q B;  3KUZ A;  4W9G A;  3NOB A;  3W1S C;  3QJZ A;  5G55 A;  3JSV B;  3ZNZ B;  1LM8 B;  4NAW A;  1G6J A;  3SU8 X;  1TGZ B;  1WMH A;  2KQS A;  2VRR B;  2M17 A;  2XK5 A;  2DX5 B;  3T9L A;  2IY1 B;  4WJO A;  4ANW A;  4KV2 A;  3RT3 B;  1OQY A;  3ENE A;  2GOW A;  2O2V A;  3V60 A;  4BKS D;  3VHT C;  3WAL A;  2FCQ A;  2KMA A;  4HK2 A;  2J0M A;  2KLC A;  5L95 C;  5J18 A;  2N1V A;  2K8C A;  4BOZ B;  3Q3J A;  1RFA A;  3CSF A;  4JGH B;  1SE9 A;  3PTF C;  3VAW A;  1WGG A;  3TMP B;  2KZR A;  3IHP C;  1NDD A;  3W1Y A;  3VXW A;  3QHT A;  3SHQ A;  2Z0E B;  2KDF B;  1XD3 B;  3DBL I;  1J19 A;  4ZYN A;  3ZDM C;  4KDL B;  4CYE A;  1E8X A;  2G4S A;  2DHZ A;  2K6D B;  4IWQ A;  3N32 A;  3UF8 A;  4JIO U;  2RD0 A;  2CU1 A;  4GDK A;  3KUC B;  4HDO A;  4W9J A;  2BKF A;  2FCN A;  2L76 A;  3DVG X;  4RMA A;  4ASW C;  1VD2 A;  2PPH A;  5AEK B;  3PLV A;  3UIO B;  4HDQ A;  3VFK A;  5GMV A;  2LUE A;  2G4D B;  3PT2 B;  1H4R A;  2BPS A;  3TL5 A;  2IYD B;  1OEY J;  2WDT B;  3B1L X;  3ONS A;  2MQJ A;  2KDE B;  4GN1 A;  2L00 B;  3T8M A;  3DVG Y;  3H7P A;  2AL3 A;  2KDB A;  2PEA A;  4IG7 B;  3NHE B;  3QC8 B;  4G11 A;  2KC2 A;  1AAR A;  4MGZ E;  1WH3 A;  3A1Q A;  2KWV B;  1WE7 A;  3IBE A;  4WWO A;  2KDI A;  1V86 A;  3JSV A;  4K7U A;  4IWO A;  4WJN A;  4DDG D;  4NQL B;  1Y8R C;  3TCA A;  4MGI E;  3K9O B;  3RD2 A;  1ZGU B;  3WAO A;  1C3T A;  1T0Y A;  3RZF A;  3MTN B;  4DHJ D;  1P0R A;  2LVO A;  4GOC A;  3QX1 A;  5AZF A;  3WIM A;  3DDC B;  4W9C A;  3WA0 A;  4IC7 B;  3MJW A;  3W1S A;  2KWU B;  4MM3 A;  3DCG A;  2KNB A;  3QA8 A;  2WYQ A;  3AU5 A;  3HK0 A;  1WJ4 A;  2CS4 A;  1ISN A;  4DWF A;  3QK0 A;  1YQB A;  2DZJ A;  1IPG A;  2ZVO A;  3D32 A;  1UGM A;  1V81 A;  4JLC A;  1OGW A;  4IM3 A;  4KIK B;  1GG3 A;  1A5R A;  3RYT A;  4AUQ C;  5C23 A;  1OEY A;  1YX6 B;  4HWI B;  2BKR B;  3L16 A;  3ZIM A;  2CHZ A;  1GNU A;  3PLU A;  1OTR B;  2EMT A;  5DPT A;  5CHV C;  4MSQ B;  3PRP B;  3IFW B;  2K8H A;  2LRW A;  1TTN A;  2MBE A;  3PHX B;  3SD5 A;  3Q3F A;  3VDZ A;  2I1K A;  3RCZ A;  3M3J A;  2K1F A;  4I6P A;  4DK5 A;  1WJN A;  3S2A A;  4NNJ B;  2ZZP B;  3OLM D;  1MG8 A;  2LVP A;  4MH0 E;  1TBE A;  4IWP A;  3ZKJ C;  2JZ3 B;  4JL9 A;  5LXI B;  3UGB B;  3A4R A;  4FAD A;  1V2Y A;  4DHZ E;  1E8Y A;  2IBI B;  2NBV B;  1WXS A;  2R2O A;  3N30 A;  4WJQ A;  2IO1 B;  3MHS D;  1Q1O A;  4EZJ A;  3V62 A;  3ALB A;  4RM8 A;  4G0N B;  1WY8 A;  2N9E B;  3PRZ A;  4PYZ A;  5DPS A;  2AL6 A;  2FCM A;  2D2Q A;  3RZW C;  2JRI B;  4GU2 A;  2M8S A;  4XC2 A;  1GJZ A;  4YL8 A;  4WWN A;  1Z2M A;  2FUH B;  4IUM B;  3ZLZ A;  2MBB B;  4FJZ A;  4KSK C;  2LD9 A;  1UBI A;  3BIN A;  5JHA A;  2ASQ A;  2JXX A;  3EEC A;  2BYV E;  1J8C A;  4FLH A;  2QHO A;  4BKT A;  1WR1 A;  1XQQ A;  4X57 B;  1YJ1 A;  2N9X A;  2ZCC A;  2HTH A;  3EFU A;  2KJH B;  4BOS C;  5EDS A;  2ZCB A;  3X0W A;  3TBL D;  2REX A;  2EMS A;  3UIP B;  1J0G A;  1I42 A;  2OJR A;  2MW5 A;  3L08 A;  3OAW A;  2ZVN A;  4OVV A;  4PYU A;  5JH5 C;  2ZEQ A;  1KLV A;  1WGD A;  4FJY A;  4FHJ A;  4KIK A;  2FID A;  3IG3 A;  4BKG A;  2O6V A;  3N3K B;  1EUV B;  3ZDT A;  3V61 A;  2L3Z A;  2C7M B;  1ZKH A;  2C60 A;  2KX3 A;  4WWP A;  2Y5B B;  4WQO B;  1H8C A;  4P7I A;  1V5O A;  4BBN C;  4E74 A;  1D3Z A;  4TQ0 A;  3ZW3 A;  5IA7 A;  4PS3 A;  3WAN A;  2BYE A;  3HM6 X;  2N1W A;  3KH0 A;  2KK8 A;  4MEL A;  5D7G A;  4BBN F;  2A5U A;  2IY0 B;  3AXC A;  4CO7 A;  2JF5 A;  3PHW B;  1WX7 A;  4TKN A;  2LGX A;  3APF A;  3LDZ E;  2FNJ B;  2KJR A;  3DVN V;  4HVB A;  1WXA A;  3P2B A;  2N7D A;  4BFR A;  1P9D U;  5D94 A;  1WI0 A;  4MSM B;  4K81 A;  2MBH A;  3QAR A;  3LMN A;  3APC A;  2BWE S;  1KJT A;  4LDT B;  2C9W B;  2RSU A;  3LJ3 A;  1NBF C;  2KFK B;  2B3A A;  2D10 A;  2KKC A;  1E90 A;  2AWT A;  1WJU A;  3M95 A;  3L54 A;  3BY4 B;  4DXA B;  4KDI C;  1KM7 A;  4ZDV A;  1V5T A;  1WJ6 A;  2GBN A;  2G3Q B;  4AWJ A;  2JPH A;  2LGD A;  2JUO A;  2OOB B;  2LRU A;  2W9N A;  4F7Z A;  2KJ6 A;  3H9D A;  2Z0D B;  3AI5 A;  2I1J A;  1EF1 A;  3ZTC A;  2IZV B;  2BGF A;  3A33 B;  3DQV A;  4GIV A;  3V6C B;  2ZPY A;  3DBS A;  2L7R A;  3NZS A;  1S1Q B;  2KQ7 A;  2KN5 A;  2K39 A;  4TV3 A;  4EUT A;  4MDK E;  2MP2 A;  3A9K B;  1QZE A;  2GBJ A;  3PS6 A;  2DYM A;  1YX5 B;  2NPT B;  1LQB A;  2LGY A;  2MA9 B;  4A3O A;  4W9D A;  1E8W A;  2GBK A;  4WAA A;  4ANV A;  5JHB A;  2GBM A;  1S3S G;  4A20 A;  4MEM A;  4I6N B;  4KZ0 A;  2GBR A;  2O6V B;  3L13 A;  2JWZ A;  4FN2 A;  4PS8 A;  2AEH A;  3VH4 B;  2NR2 A;  3SDL C;  2MBQ A;  3L17 A;  2IO2 B;  3ZO5 B;  2AYO B;  3X23 A;  4ANX A;  2G45 B;  1WXV A;  2CKH B;  2MX2 A;  2M1M A;  2V4L A;  2KTF A;  2Z59 B;  3H6N A;  4K7W A;  3WAP A;  2YLM A;  2HJ8 A;  2V3S A;  5E6P A;  4MJS B;  2DZK A;  2ZPN A;  3VTW A;  1RRB A;  1VCB A;  1U4A A;  2JVC A;  1M94 A;  2LVQ A;  4NY0 A;  2DZI A;  1BT0 A;  1WX9 A;  2LXC A;  2KOX A;  3PZD A;  3ZNG C;  3ZNI D;  5HKH A;  2K25 A;  2JZZ A;  3PVL A;  4HCP B;  2KFK A;  2MCN B;  3GOE A;  3R7Q A;  1F9J A;  1P1A A;  3ZUN A;  3ZRC A;  4M8M A;  4BKS A;  1E7U A;  1IP9 A;  2N4F A;  1K8R B;  3I3T B;  1R4N I;  4A3P A;  1RLF A;  4HLE A;  3U7D A;  1WZ3 A;  3ECI A;  2ZNV B;  2KC1 A;  2NBU A;  4FHK A;  5KHO A;  1FXT B;  3R7R A;  3ZRF A;  1NI2 A;  3EC8 A;  1WYW B;  3KVF B;  3ZTD A;  4FJV B;  2ZJD A;  2M0X A;  3DBR I;  4II3 B;  3PRE A;  4I6L B;  2JT4 B;  1WRD B;  4DHZ B;  4NQK E;  4AJY B;  2NBW B;  4K1R B;  4KZC A;  3VUW A;  3GZN I;  2L8J A;  4F8C B;  1CMX B;  1WGY A;  2NCN A;  4NJ7 A;  2RR9 A;  3PSE B;  3A9K A;  5FR6 A;  4TQ1 A;  1V49 A;  2NPT A;  3QAQ A;  1UZX B;  4MGY E;  2KXJ A;  2GMI C;  4W9E A;  1PQS A;  4GGQ A;  1WX8 A;  2HE7 A;  1L7Y A;  4B6W A;  2C7H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...