3PPAA

Structure of the dusp-ubl domains of usp15
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
209
Chain Sequence
LDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGLLKQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEQEPIARKVVEQGMFVKHCKVEVYLTELKLCENGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQQVLVIEQKNEDGTWPRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase 15
publication title Structure of the Dusp-Ubl Domains of the Ubiquitin-Specific Protease 15
rcsb
source organism Homo sapiens
total genus 46
structure length 209
sequence length 215
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06337 DUSP DUSP domain
A PF14836 Ubiquitin_3 Ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3ppaA02
3.30.2230.10 Alpha Beta 2-Layer Sandwich DUSP-like DUSP-like 3ppaA01
1QZEA 1WR1A 2L0TA 3KUDB 4FA6A 4W9DA 3SHQA 1J8CA 2CHWA 2Z0DB 4NQKE 4HK2A 2LUEA 2LRWA 3LMNA 2ZVOA 3VQIA 2ZCBA 5JHBA 5E6PA 4LJOB 5LLIA 3SDLC 1TTNA 1WGGA 2WX1A 3DVNV 4CYEA 3NHEB 4EZJA 2LGDA 3KW5B 3GOEA 1WXVA 1AARA 5GMVA 3W1SC 3CF6E 3APDA 4GDLB 1OEYA 4EZLA 2MW5A 4ZYNA 3HIZA 2KMAA 3V6CB 1NBFC 1YX6B 5G2NA 1C3TA 2C7MB 2NS5A 3UF8A 4BKGA 1OGWA 2ZJDA 3NZSA 4EUTA 2KQSA 2JRIB 4ANUA 2XEWA 4TUUA 3L17A 2LGXA 3OAWA 3QQ8B 4ZRIA 2LVPA 3WAMA 3PT2B 3Q3JA 5L95C 1WGRA 4URKA 2HD5B 2KX0A 2MLBA 3UQAA 1Y8RC 3QAQA 2KWVB 5IAAC 5LXHA 4FHKA 4EEWA 2KN5A 3QC8B 2D10A 1R4NI 2EKEC 5CHWA 5LXIB 3BY4B 3RT3B 4DBGA 4HDQA 2FNJB 1ZKHA 3UGBB 3QA8A 3TL5A 1LXDA 2N1WA 4DK5A 2KFKB 5KHOA 3CMMB 2PE9A 3DVNU 1WY8A 5J18A 2W9NA 3IHPC 2GBMA 3VH4B 2KDBA 1D3ZA 1E8XA 2DX5B 2UYZB 3PSEB 4ANVA 3UIPB 3DBLI 4IWPA 2JF5A 2KANA 4HLEA 1RAXA 3QWZB 3ENEA 4MGYE 4PS3A 4M8NA 4ICVA 1E5WA 2LZ6A 4GMVA 4DDID 3A9KB 3ZW3A 1GUAB 2BKRB 4LDTD 3T9LA 4HDOA 5C1ZA 4W9GA 3MJWA 2AWTA 1JRUA 2KDIA 3IVFA 2L76A 3OLMD 1WM3A 4JL9A 4GDLA 4IW0A 3B0AA 1WXMA 5C23A 3P2BA 4PYZA 2WYQA 2NCNA 3TMPB 3O65B 1V80A 2M1MA 2KC2A 3JW0X 3ONSA 4G3XB 2BGFA 2GBJA 1UD7A 3A1QA 3HHMA 4IWOA 2MSED 5D6JB 2ZVNA 3WA0A 2Z59B 4JIOU 1WJ6A 1V5TA 1WIAA 2KDEB 2AYOB 1Q5WB 2JUOA 4MSQB 4KZ0A 2NPTA 2QHOA 2KTRB 2IY1B 2LXAA 2I1JA 3UIOB 2Z0EB 5DPRA 1V81A 1C1YB 2BYFA 1TZ1A 2KLCA 1E8ZA 4JQWC 1GNUA 3HM6X 2RSUA 4E3CA 3AU4A 1SE9A 4KIKB 3RZWC 2KX3A 2MP2B 3NY5A 4IM3A 2KFJA 5TR5A 4FLHA 1WM2A 3DBSA 3H7PA 2D11A 4B9KA 4DHZE 3A9JA 4K81A 1VD2A 2JRHA 3AXCA 3PHXB 4P7IA 4W9HA 5D94A 2LJ5A 5AZGA 1M94A 2WX0A 2C5LC 3QIJA 4G0NB 2PEAA 2VRRB 1WYWB 2N7EA 1BT0A 1PQSA 1V49A 2A4ZA 3WIMA 4ICUA 2R2OA 2AL3A 1EF1A 3QK0A 4FBJB 4LCDE 3VH3B 2JY6A 1V6EA 2M0XA 3JSVB 3JVZX 3DOWA 4BKSD 4HPMB 3OJ4B 4MGKE 2NR2A 2DZJA 4K1RB 4DHJD 2REXA 3A9KA 5BO4B 1WGYA 2KDFB 1IP9A 4AJYB 4IG7B 3QJZA 3PRMB 2KC1A 2MBBB 4NPNA 4B95A 4GU2A 1E90A 1ZGUB 2L7RA 3HM3A 4HXDA 4MM3A 3DDCB 2AEHA 5DCNA 3PLVA 1UBQA 2O2VA 3VUYA 4W9LA 4WJPA 3S2AA 2A5UA 1EUVB 3PREA 4RMAA 2N7DA 2O6VA 4BVUC 1L2NA 3L0WB 2GBRA 1YD8U 1WX9A 2KTRA 2C9WB 3L13A 2IY0B 4XZ4A 1WX7A 2G45B 4PYUA 2GBKA 1E8YA 1WJUA 4RM9A 2LD9A 3PHWB 4TV3A 4KIKA 3L08A 2CHXA 4KSKC 1MG8A 2MP2A 4W9EA 2G4SA 3B08A 3VXWA 4XC2A 2G3QB 2BPSA 1OQYA 2J0KA 4NNJB 1XD3B 1UELA 2OOBB 4TQ1A 1SGHA 1J19A 3N30A 1IPGA 4HVBA 2KKCA 1V2YA 2IZVB 4GXBA 4N9F4 2K39A 3LJ3A 5DPSA 1WZ0A 2KLGA 4BKTA 3APCA 3UINB 3DBHI 2UWQA 3JSVA 3TJPA 1UH6A 3DPDA 2FCQA 4HWIB 5L83A 4FHJA 4NJ6A 4MJSA 5J2RA 4WWPA 1WX8A 3X0WA 2FCSA 2KJHB 2KMCA 4EKUA 4F8CB 5JH5C 3ALBA 2KD0A 2PJHA 4KDIC 2MCNB 4ANXA 2I1KA 2RPQA 4MDKE 3R66C 2J0JA 1YX5B 2BWES 2M17A 3QX1A 2N4FA 2M8SA 4II2B 4KSLC 4MELA 3NS8A 2RD0A 4FADA 1WJNA 1E7VA 3VDZA 3ZRFA 2L0FA 1UGMA 4FJVB 2LI5A 3M63B 2JZ3B 3KYDD 2DYMA 3I3TB 4PS8A 2L00B 3VVWB 2N9XA 5D7GA 2MX2A 4YL8A 3EECA 2K25A 2CR5A 4PS7A 2KZRA 2LXCA 4JLCA 4M0WB 3ZVVA 4B6WA 3PS6A 1WH3A 3ZUNA 3HK0A 1OTRB 2HE7A 3X23A 4AP4C 3SD5A 4I6PA 1TBEA 1V9JA 2ZNVC 3R3MA 1LFDA 3H7SA 4FN2A 3R7QA 3Q3FA 1J0GA 3VUWA 2PPHA 2L05A 1EF5A 1T0YA 2L8JA 4GSWA 1GC6A 1WXSA 3KUCB 4NY0A 2NBVB 5AZHA 1E7UA 2BYEA 2CS4A 4WAAA 3ZNHB 3ZIMA 1GG3A 5AEKB 2KK8A 5CHVC 2PE6B 2ASQA 4MGZE 1F9JA 3IG3A 4W9CA 2K1FA 3B1LX 3KH0A 4WWOA 2BKFA 2KO3A 2KTFA 4AJWA 3DQVA 2JZZA 2NBWB 3QHTA 3WALA 4ANWA 1HE8A 2KFKA 3RD2A 1I42A 4K7UA 3T8MA 2HTHA 1EO6A 2GBNA 2C7HA 2RR9A 5FR6A 1WMHB 2MBQA 2MWSB 3AU5A 3V62A 1VCBA 2EMTA 4A3OA 4E74A 4EOYA 2WDTB 1WR6E 1YQBA 4WWNA 3ML9A 4W9IA 4IWQA 4II3B 5KHQA 2WWZA 1SIFA 2C7NB 2IO1B 2MQJA 2C60A 3M95A 4A3PA 3WANA 3N3KB 4GDKB 4IM2A 1Q0WB 3H6NA 2JXXA 4HPLB 1KLVA 5DPWA 2IBIB 2GMIC 2ZZPB 3UQBA 3V60A 3VTUA 2LASA 2KHWB 2O6VD 1RLFA 3H1UA 4BFRA 4J6IA 2KJRA 1WRDB 2CKHB 2J0MA 3ZRCA 3APFA 1ZW7A 4K7WA 1U4AA 4TQ0A 4NQLB 4ZRJA 2CHZA 3W1YA 1GJZA 3RULA 1Z2MA 2V3SA 4GOCA 2FAZA 4NAWB 4I6LB 4MSMB 3LDZE 4G11A 2LRUA 2LWPA 3BINA 1ISNA 5CTRC 1V86A 1WF9A 2D07B 3EFUA 4MH0E 1FXTB 2V4LA 4HCNB 2BWFA 1Q1OA 3L16A 3GZNI 4HJKA 4KVGB 1UZXB 2RGFA 3SU8X 1P3QU 4CHKA 1WJ4A 2DENB 2V1YA 2M4NA 2MBOA 3OJ3A 1A5RA 1WMHA 4LDTB 3M3JA 2LGYA 4W9FA 4KZCA 5DPTA 3ZNZB 4DWFA 2IO3B 4BBNF 2B3AA 2DZMA 2G4DB 2DHZA 3PZDA 2XK5B 3VFKA 4EFOA 3ZNGC 2R2QA 4RM8A 1R4MI 1LQBA 3ZDTA 4EZKA 4F7ZA 3A1QB 1XT9B 5JZEB 3DBRI 2N9PC 3V61A 1P0RA 3ZKJC 4HCPB 3MTNB 4OVVA 2ZPNA 2MRPA 3K9OB 4GDKA 4DXAB 5E6OA 2NPTB 3R7RA 3W1SA 3L10B 4FULA 3RZFA 4WJQA 2K6DB 2N1VA 4MEMA 3C0RB 4ASWC 4K7SA 3KUZA 1X1MA 4NJ7A 1WE7A 1H8CA 3EC8A 3JYUA 1NI2A 5CHFA 3KYCD 3ECIA 2JT4B 2YVCA 3D32A 1P1AA 2ZNVB 4I6NB 2FIFA 3VUXA 1YJ1A 4M8MA 4BOZB 2XBBC 3H7PB 2HJ8A 4G50A 5EDSA 3A9JB 2DZIA 4BOSC 2FUHB 2CU1A 3QARA 2BYVE 2OJRA 2ZPYA 4JGHB 2DZKA 3CSFA 4W9JA 4AWJA 5HKHA 3EHVA 4IUMB 2DYOA 3ZTDA 3KVFB 2JWZA 5J17A 5CX3A 2D3GA 4NAWA 3MHSD 3IBEA 2BF8B 3K9PB 4BBNC 2FCMA 2NBUA 4W9KA 3ZNID 4F1SA 3AI5A 2DAJA 2MBEA 3RUIB 4X57B 2J7QB 3TBLD 4CO7A 5E6NA 1WI0A 3ZLZA 1WZ3A 3RYTA 3H9DA 2NVUI 3U8ZA 4A20A 3CSTA 2KNBA 4GN1A 2AL6A 3M62B 4KDLB 3PTFC 3ZDMC 1YIWA 4DHJB 2N9EB 3DCGA 3WAPA 2LVQA 1RFAA 2K8BA 1RRBA 2ZEQA 4ZRKA 3RCZA 2XK5A 2JPHA 2O2VB 2KOXA 4DHZB 5AZFA 4FJZA 2K8HA 2KXJA 2ZCCA 1GC7A 4WJNA 1WGDA 4E71A 1P9DU 4LJPB 5IA7A 1WE6A 1G6JA 4FJYA 4AOFA 1LM8B 2O6VB 3TCAA 3L54A 1W6VA 5D2MB 1KM7A 1OEYJ 3A33B 4DDGD 2L3ZA 3TIXA 3VAWA 2IO2B 4AUQC 2MA9B 3PLUA 2IYDB 1TGZB 1V5OA 3U30A 3PRPB 3VTVA 2KWCA 2LVOA 1S3SG 3PV1A 2KWUB 3ZTCA 5G55A 1KJTA 1S1QB 5JHAA 3QCAA 1P98A 4MGIE 2YLMA 2GOWA 2IO0B 1WFYA 3PVLA 4KV2A 2DAFA 1Z5SB 2K6QA 4WQOB 3IFWB 3N32A 2JVCA 4GGQA 4ZDVA 3DVGY 3PPAA 2KVRA 1WGHA 3A4RA 1XQQA 1L7YA 1K8RB 1CMXB 3V6EB 2FIDA 1WXAA 3NOBA 3WAOA 2FCNA 2MBHA 4IC7B 1KOTA 4GIVA 2K8CA 1UBIA 4XX5A 3A4SC 1I35A 3U7DA 3AULA 2KJ6A 1H4RA 2DYBA 4MJSB 1E8WA 3DVGX 1NDDA 3PGEA 4IM0A 4TKNA 4BKSA 2D2QA 3NZUA 3VHTC 1IYFA 3VTWA 4OVUA 3ML8A 3ZO5B 2EMSA 3PRZA 2KQ7A 4GB9A 2Y5BB 4WJOA
chains in the Genus database with same CATH superfamily
2TSSA 1WR1A 2L0TA 3KUDB 1SB3C 4YSXB 4C4VA 2JWUA 3N1XC 1BXTA 2WP9B 2QILA 1F2RI 5LLIA 3SDLC 4USAA 1SEBD 3BVGA 1OEYA 2HDEA 2MW5A 4ZHOA 1EM7A 3V6CB 1C3TA 2C7MB 2LMCA 2XEWA 3AE5B 1TKYA 3L17A 2Y5PA 1HEZE 4MH8A 2DLBA 2KYWA 1TKGA 5L95C 1D4BA 4URKA 3UQAA 1Y8RC 2FBWB 2J4XA 5EE9A 5LXHA 4FHKA 2KN5A 2KDMA 5LXIB 3BY4B 3TL5A 3DVNU 1PGXA 1T5XD 3R2IA 1JALA 2WQYB 2WXRA 4M8NA 4DDID 3ZW3A 4HDOA 3WCQA 1QILA 1P7EA 1YJJA 5HI1A 1VRAB 1DOIA 4IW0A 3P2BA 4K3CA 1ET9A 3P4RB 2M1MA 2KC2A 3ONSA 5D6JB 1KRHA 1V5TA 1NYRA 2AYOB 4KZ0A 2NPTA 1I4PA 1UGJA 2I1JA 3UIOB 5DPRA 1E8ZA 1ZDVA 2RSUA 4E3CA 3AU4A 4KIKB 4IM3A 4FLHA 3H7PA 3A9JA 3URYA 4H2AA 3AXCA 3PHXB 5D94A 2WXHA 1I4HA 2WX0A 3AE1B 1WYWB 1VZ8A 1PQSA 1V49A 2R2OA 4B0MA 2LFIA 3QK0A 4FBJB 4LCDE 4A90A 1V6EA 2Y5CA 5E6JA 2NR2A 3A9KA 4NJCA 4OZAA 4YXDB 4NPNA 4DQOC 3AEFB 4HXDA 3Q8FA 3S2AA 2O6VA 2M0AA 3L0WB 3AEEB 2C9WB 4XE0A 3ZJVA 2D3CA 1XLOA 1WX7A 1E8YA 1WJUA 2VH2A 3AEBB 4M00A 2LD9A 3W5UB 2MP2A 3E9SA 1WWTA 1ZP0B 4ZYSA 2BPSA 2J53A 4NNJB 1XD3B 5EE0A 4TQ1A 3E56A 3KWVA 1V2YA 1N61A 4GXBA 3DBLB 1YNTE 3AE8B 1JW9D 4KGRA 4A6QA 3TJPA 2FCQA 2M56B 2IGGA 5J2RA 4MJSA 1WX8A 3X0WA 2KMCA 4L2YA 2D3BA 3ALBA 2KD0A 2PJHA 1SE3A 2J0JA 1YX5B 2BWES 3QX1A 4II2B 4KSLC 4MELA 5IOIA 1WRIA 4FJVB 1FD6A 3KYDD 2D5GA 1P7FA 3I3TB 4PS8A 1XCQL 1ROEA 2N9XA 3VVWB 2L83A 1UWMA 2K0PA 3AM9A 4JLCA 5AUIA 3PS6A 1WH3A 2OHFA 1OTRB 2HE7A 1HXYD 3SD5A 1TBEA 2BS2B 3R3MA 2KVZA 2K22A 4FN2A 1J0GA 2L05A 1EF5A 1T0YA 2NBVB 1E7UA 2BYEA 1TY2A 3ZNHB 2OJWA 1VJKA 5AEKB 2KK8A 5CHVC 2V0GA 2ASQA 4MGZE 4W9CA 1CJEA 4XGAB 4WWOA 2KTFA 1SE4A 1QKZA 2KFKA 3Q8CA 1I42A 1Y56A 2JQRB 3T8MA 2HTHA 5G5GA 2GBNA 2RR9A 3DHHC 2JSVX 3V62A 4A3OA 2I2YA 1IGCA 3MC9A 2BW2A 4IWQA 4RGOS 5KHQA 3N1YC 3CWIA 3P4QB 2C60A 4A3PA 3RN9C 2FE8A 3N3KB 4GDKB 3H6NA 2IBIB 5I4DA 3DHIC 2V3PA 3V60A 2IDYA 4YTMB 1SIJA 3VTUA 3NG0A 1WRDB 2J0MA 1J7AA 3U2SC 1ZW7A 1U4AA 4TSSA 3W1YA 1GJZA 2YEPB 3SFEB 3NUHB 3N20C 4NAWB 1E10A 1M4VA 4MSMB 2LWPA 1RYJA 2RDHA 3BINA 1V86A 1WF9A 1F1HA 4XWTA 2L1AA 1JCKB 2BWFA 2BTEA 1SXTA 4HJKA 4KVGB 1FMAD 5C3JB 1HQRD 4HJGE 2M4NA 3OJ3A 4LDTB 2LGYA 4P1BC 5DPTA 3GS2A 2BB6A 4O1NA 2DZMA 3AB5A 2G4DB 2DHZA 1F52A 3VFKA 1AN8A 3H8HA 5FK9C 1PGAA 1R4MI 1D6EC 4C00A 4EZKA 1NYQA 4KGTA 2FUG1 3AE9B 4HCPB 3K9OB 3R7RA 1VLBA 4FULA 4K7SA 1NVID 1VDVA 2GRIA 4NJ7A 5CHFA 2ZW0A 2JT4B 2YVCA 3P4PB 4FXCA 4M8MA 4TMAB 2BYVE 2OJRA 3CSFA 3RNFC 3ZXVA 1HZ5A 3EHVA 5J17A 5CX3A 2D3GA 4W9KA 3ZNID 4F1SA 2DAJA 2J7QB 3TBLD 2NMQA 4A20A 3U8ZA 2KNBA 4GN1A 1PGBA 2W3SA 4DHJB 3Q8BA 3DCGA 1JWAD 5D3DA 2WXOA 2JPHA 2O2VB 2KOXA 2UU7A 2K8HA 2ZCCA 3J9CA 1MFWA 3Q6BA 4FJYA 3TIXA 4A55A 3PLUA 1EU4A 4XDDA 1BMLC 1TYGB 3VTVA 2G9HD 3PV1A 1KJTA 3LXFA 4C7YA 1PUTA 3QCAA 2GOWA 1WFYA 4KV2A 1Z5SB 1Q10A 4ZDVA 2BB5A 1L7YA 2MJ3A 3V6EB 5T8IA 2FIDA 3WAOA 2FCNA 4GIVA 4XX5A 3A4SC 3P4SB 3IT6B 4GLSC 4TKNA 2WXKA 3NZUA 4OVUA 3ZO5B 1N63A 1QZEA 1IBXA 3AEAB 3U7ZA 2WU5B 2Z0DB 4HK2A 1SE2A 2LUEA 3VQIA 3Q3OC 5JHBA 4HPPA 3TUOA 1TTNA 2WX1A 2GB1A 3NHEB 2LGDA 3GOEA 1WXVA 1AARA 5GMVA 2WXIA 3CF6E 3APDA 4GDLB 4EZLA 1T3QA 1XEEA 2E3TA 2WXNA 4ZYNA 3HIZA 2KMAA 3AE6B 1YX6B 5G2NA 3UF8A 1L0VB 1I4RA 4ANUA 4TUUA 3W5VB 2LGXA 1TS2A 1QOAA 2LVPA 3SEBA 3PT2B 2ACZB 3UI3A 2PW9A 1N5WA 4DBGA 4HDQA 3QA8A 2CJNA 1WY8A 1J7CA 3IHPC 2UYZB 4ANVA 3PSEB 3UIPB 4IWPA 1JWMD 2JF5A 4HLEA 1HTOA 3QWZB 3ENEA 3MHZA 1GUAB 4XWWA 4HKZE 4LDTD 5C1ZA 4W9GA 3MJWA 1JRUA 2KDIA 3OLMD 1WM3A 3B0AA 5C23A 2WYQA 1BUIC 3O65B 2V3NA 1V80A 3JW0X 2E6XA 3HHMA 3A1QA 2QSDA 2Z59B 3WA0A 4JIOU 1WJ6A 1WIAA 2HJ1A 2JU6X 4OZBA 2QHOA 2KTRB 3BYTB 2LXAA 2Z0EB 1YN4A 2BYFA 1TZ1A 1FFVA 1K50A 4JQWC 2INCC 3EGRA 2KFJA 1WM2A 4P6VF 3NVZA 4DHZE 1C77A 1LO5D 4P7IA 1RM6C 3MFGA 1BT0A 4WQMA 1MG4A 2M0XA 3JSVB 1N6ZA 3OJ4B 1XO3A 3AECB 3EFCA 1N62A 4DHJD 2REXA 1WGYA 1RWSA 4KKJA 3QJZA 2MBBB 4US9A 1E90A 1CZPA 1FXIA 1PFDA 3BVMA 5HHDG 4MM3A 2AEHA 2JYEA 1UBQA 3VUYA 1DYQA 4W9LA 3ZYYX 1EUVB 3HUIA 4RMAA 4NZLB 1TS4A 1L2NA 4YTNB 2BBCA 3PZ8A 1YD8U 3L13A 2IY0B 4XZ4A 2WU2B 2GBKA 4RM9A 1AWDA 4RGTA 4KIKA 3L08A 4W9EA 2G4SA 1JROA 2KACA 2OOBB 5FR3A 2EKIA 1J19A 2K39A 5H92C 3UINB 2QJLA 3DPDA 4HWIB 5L83A 4FHJA 2AX5A 5JH5C 4KDIC 1L4DB 1HTQA 2M17A 2M8SA 1ZPSA 3I57A 3ETRA 3ZRFA 2L0FA 2LI5A 1EWYC 1FCLA 2MX2A 4RF1A 4YL8A 3EECA 3VRBB 1TKEA 1GB4A 4PS7A 1K52A 3ZVVA 1E9MA 3X23A 2PMVA 1STEA 3R7QA 1ZE3D 3Q3FA 2PPHA 3LYYA 4GSWA 1WXSA 5AZHA 2CS4A 3MJ5A 3ZIMA 2PE6B 3IG3A 4C4VB 2K1FA 3KH0A 3WALA 4ANWA 1HE8A 2KAJA 3RD2A 2H89B 1EO6A 2C7HA 1WMHB 3TEZA 2DWQA 3AU5A 1VCBA 2EMTA 2WDTB 1YQBA 1FNWA 1DGJA 2INDC 2IJ0A 3EA6A 4IM2A 1Q0WB 4LNIA 1VR9A 4RGMA 1KLVA 2IPKD 4RFBA 3UQBA 2LASA 4IKGA 3B2FA 2KJRA 3APFA 4K7WA 4C56C 3BIID 2AQ3B 4C80A 1Z2MA 1R7SA 1V1OA 4C7ZA 2WXGA 5CTRC 2KMMA 5EE3A 1JWUD 1Q1OA 1F77A 2VZKB 1P3QU 1I7HA 4W9FA 2QDFA 2QMTA 2MJEA 1WYGA 1D5XC 3PZDA 4LTUA 4WIPA 4LNKA 1TS3A 2N9PC 3V61A 4OVVA 1I35A 2ZPNA 4GDKA 4DXAB 2NPTB 3BZDB 2N1VA 2RDGA 2QEJC 2JYTA 3NVYA 1WE7A 3C8YA 3JYUA 2MEKA 1GAQB 2ZNVB 1FEHA 4I6NB 2FIFA 3VUXA 2LJIA 1TZOA 3H7PB 1A70A 2N7JA 4G50A 5EDSA 3A9JB 1MHHE 2DZIA 3QARA 2DZKA 2NTSA 2JWZA 3W2DA 3N1ZC 4NAWA 2BF8B 4BBNC 1JQ4A 1YQ4B 2NBUA 2MBEA 3RUIB 1FM0D 1UWXA 4CO7A 3RYTA 4KX6B 3CSTA 4HRSA 3T3OA 3M62B 4M01A 3PTFC 3ZDMC 1QOBA 1C76A 2IGDA 2LVQA 1ZOYB 2K8BA 3OWEB 3NVWA 4DHZB 3IAS1 2M19A 3TEWA 1WGDA 2KT7A 2BYTA 4RF0A 2O6VB 1OEYJ 3A33B 4DDGD 2L3ZA 3VAWA 2IO2B 2MA9B 2IYDB 1TGZB 3P42A 3I63C 1E0ZA 2W82A 1FNVA 4IDIA 2YLMA 3PVLA 1WSPA 2JVCA 2PTLA 3A4RA 1XQQA 4M0WA 2WLBA 1L5PA 4LNNA 1I4GA 3GB1A 4L23A 2KJ6A 3C19A 4MJSB 1E8WA 3V05A 1NDDA 3PGEA 4IM0A 3ZGZA 4YTPB 2D2QA 3VTWA 1FRDA 2EMSA 4GB9A 4WJOA 3SHQA 1R4MB 2LRWA 2WGSA 1E7PB 1FO4A 4LJOB 3O13A 1T0RC 1WGGA 4EZJA 3KW5B 1C4AA 1I4XA 2AQ2B 4HEA1 4N59A 3RNGC 3NRZA 1ZDXA 1R4NB 2NS5A 3AMZA 4JWUC 5FKAC 2OEDA 1OGWA 2PIAA 4MACA 4EUTA 2WXMA 5IP4D 3AE4B 3IT4B 3RPFC 3WAMA 1FFUA 3Q3JA 2HD5B 2MLBA 2KWVB 5IAAC 3Q3NC 3QC8B 2D10A 1R4NI 2EKEC 2WXPA 4HKQA 3UGBB 4DK5A 2N1WA 4ZOHC 2KFKB 5KHOA 1HZ6A 1MHXA 2LHDA 4N6EB 4P16A 1DOYA 1E8XA 4R3DA 4PS3A 2VZKD 4WAFA 4ICVA 2LZ6A 3T9LA 3TEXA 3RI7C 2AWTA 2L76A 5C2TB 4JL9A 1ENFA 1C4CA 4GDLA 1WXMA 5AUKA 4PYZA 3Q2AC 4G3XB 2BGFA 4IWOA 1UD7A 2WNMA 2MSED 2ZVNA 1ZXIA 1Q5WB 2W54A 2IY1B 1V81A 2GLSA 4WH4A 2KLCA 1GNUA 3HM6X 3Q69A 1SE9A 4JE3B 5TR5A 3DBSA 3VRAB 3ZQ4A 3SFDB 4K81A 1VD2A 2LJ5A 5MPOA 2LEKA 1YJIA 5AZGA 1M94A 2C5LC 2PEAA 2VH1A 2VRRB 2N7EA 3WIMA 2ONQA 1EF1A 3VH3B 1C4PA 2IGHA 3JVZX 1L4ZB 2WHIA 3DOWA 4BKSD 4HPMB 2DZJA 4K1RB 5BO4B 2KDFB 1IP9A 4AJYB 4B95A 4GU2A 1OFFA 5DCNA 4QAYA 1GPXA 2D3AA 3B9JA 3I9V1 2A5UA 2J52A 1V1PA 1AW7A 2N7DA 3AE7B 2KTRA 3VR8B 5IN7A 2INPE 2G45B 4PYUA 3PHWB 1KTKA 4TV3A 2CHXA 3B08A 4XC2A 4KKIA 1UELA 3N30A 1IPGA 3HVDA 1KH0A 4HVBA 3B2GA 2IZVB 4N9F4 5DPSA 1KF6B 2KLGA 3DWMA 4BKTA 4EE2A 1VZ6A 1ACCA 3JSVA 2N9LA 1YOVB 4NJ6A 2PVGC 2FCSA 2KJHB 4EKUA 4F8CB 4A9AA 4S0RA 2MCNB 2I1KA 2RPQA 3AE2B 2RD0A 1WGKA 4FADA 2PLPA 3VDZA 4ZHPA 3AEDB 3NZ3A 3M63B 2DYMA 2L00B 2CR5A 2WXQA 2LXCA 3RNAC 4B6WA 3ZUNA 3FC4A 3HK0A 4AP4C 1V9JA 1LFDA 1ZUD2 1E6EB 2L8JA 3MC0B 3Q8AA 1GC6A 4NY0A 3PO0A 1L0YB 1L6UA 4NAMA 1GG3A 2BQQA 1QOFA 1IBXB 1PDXA 1F9JA 4YSZB 1FRRA 1XLPA 4WWMA 1N60A 1FCCC 1SSNA 4AJWA 3DQVA 2NBWB 2MWSB 2Z8LA 1ESFA 2DNFA 1PYWD 4KGSA 2K5PA 3BVZA 1SIFA 2C7NB 3BK1A 2LGIA 3M95A 4K3BA 2SEBD 3WANA 4XDCA 4HPLB 5GXGB 1QT9A 2GMIC 2ZZPB 2LUMA 2WS3B 4ACFA 2KHWB 1RLFA 5JXVA 4J6IA 3GZNB 5G5HA 4NQLB 2CHZA 4PK1A 5BMIA 2V3SA 2PKOA 2FAZA 5HG2A 4I6LB 3LDZE 2LRUA 1ISNA 2D07B 3EFUA 2V4LA 4HCNB 3AE3B 3DBRB 3BYYB 2ON8A 3L16A 3GZNI 2RPVA 3AEGB 1UZXB 2RGFA 3SU8X 4CHKA 1UUPA 1WMHA 3ZNZB 2H88B 1OQRA 4BBNF 2B3AA 2XK5B 5BYQA 4RM8A 1NI3A 4PT5A 3A1QB 1XT9B 1L6VA 3DBRI 5JZEB 3ZKJC 3MTNB 3VR9B 2MRPA 1I4QA 5E6OA 4ASWC 1X1MA 1J7BA 5HFYA 3EC8A 3KYCD 3W9CB 3ECIA 2WXFA 1MJDA 1GOZA 1XCTL 1B1ZA 2FUHB 3PZ7A 4JGHB 1VZ7A 2ZPYA 4RH6A 4W9JA 1XF5L 4AWJA 4IUMB 3ZTDA 3KVFB 3MHSD 4M02A 2Q5WD 3IBEA 3K9PB 4A8XC 2KN4A 1ZXHA 3AI5A 1IUEA 2RDBC 5E6NA 3FILB 2EELA 1C9FA 2NVUI 3FKYA 5TSSA 2AQ1B 4KDLB 2N9EB 3WAPA 4MM3B 1KLGD 4JX1C 1NEKB 3RCZA 4OHJA 3P1MA 1FXAA 2V9HA 4E71A 4UDUC 5IA7A 5H8YE 1GB1A 1WE6A 1G6JA 2KQ4X 4AOFA 3TCAA 3L54A 1W6VA 1NENB 5D2MB 1DOXA 1KM7A 5EE1A 1T0QC 2DBYA 4ZRQA 2LGSA 2LVOA 1S3SG 4J3OD 3IXSA 4WQOB 2K6QA 3N32A 4GGQA 3PPAA 1WGHA 1CK1A 4JWSC 1K8RB 1WXAA 2QCZA 4REZA 2MBHA 1KOTA 2K8CA 2NTTA 3ABVB 2CJOA 1H4RA 2DYBA 4BKSA 4D2KA 3ML8A 2Y5BB 5BYSA 1EWCA 4FA6A 4W9DA 1J8CA 2CHWA 1TS5A 4NQKE 3GE3C 3RNCC 1IGDA 3LMNA 2ZVOA 3IAM1 2ZCBA 5E6PA 1F2RC 3DVNV 4CYEA 3W1SC 3RNEC 2BT6A 3NVVA 4YT0B 1XXGA 1NBFC 3U52E 4BKGA 4DXFA 2ZJDA 3NZSA 2KQSA 2JRIB 2Y3AA 3OAWA 3QQ8B 4ZRIA 2L52A 1WGRA 2KX0A 3QAQA 2JZPA 4EEWA 5CHWA 1QOGA 3RT3B 2FNJB 1ZKHA 1LXDA 3CMMB 3NJTA 2PE9A 5J18A 2W3RA 3ZJTA 2W9NA 2GBMA 3VH4B 1UF0A 2KDBA 1D3ZA 2DX5B 1KFYB 3BWUD 3DBLI 2KANA 1RAXA 2RMMA 4ARIA 4MGYE 1E5WA 4GMVA 2N0SB 3R2TA 3A9KB 2BKRB 3IVFA 4CQNA 1XLQA 2NCNA 3TMPB 2GBJA 3HRDD 2KDEB 4N58A 2JUOA 4ARCA 4MSQB 4RNAA 4YSYB 1C1YB 4MT5A 3T3NA 3V3XA 2G1EA 3RMKC 3RZWC 2KX3A 2MP2B 3NY5A 4LLGM 1JRPA 2D11A 2XN9C 4B9KA 2JRHA 4W9HA 3QIJA 4G0NB 2ICIA 3DHGC 2L32A 2A4ZA 2CU3A 4BAXA 4ICUA 2AL3A 2JY6A 3I5JC 4MGKE 2ZW1A 5IKCM 2X8XX 2WXJA 5IO9A 4IG7B 1FNUA 3PRMB 2KC1A 2YEPF 1ZGUB 3AV8A 1TY0A 2L7RA 1QQRA 3HM3A 3DDCB 1UNSA 3PLVA 2O2VA 1JWBD 4WJPA 3TSSA 3PREA 4BVUC 2R61A 3HVZA 4ZRPA 2GBRA 1WX9A 3KLSX 1D5ZC 3FAHA 2WXLA 3DBHB 2K9XA 1QF6A 3MP9A 4KSKC 1MG8A 3VXWA 3Q14C 2G3QB 1YQ3B 1OQYA 2J0KA 1T0SC 1SGHA 1K53A 3MC8A 1D5MC 2KKCA 3LJ3A 1WZ0A 3APCA 1JWSD 2UWQA 3DBHI 2J42A 1C79A 1UH6A 4DXGA 1OQQA 4WWPA 4L1BA 5BMGA 4ANXA 3L4PA 4MDKE 4JPSA 3R66C 1SF0A 4OW0A 2N4FA 1SBBB 3NS1A 3NS8A 3OG5A 3ZJUA 1WJNA 1E7VA 1UGMA 2JZ3B 3CIRB 5D7GA 2WDVB 2K25A 2JXTA 2KZRA 4M0WB 4I6PA 2ZNVC 3H7SA 1MPEA 3VUWA 3KUCB 2K3UA 4RGNA 2V4IB 4WAAA 2MH7A 3AH7A 3TEYA 1MVKA 4B0EA 3BK2A 1AYFA 3B1LX 3AN1A 2BKFA 2KO3A 3GE8C 3P63A 4US8A 2JZZA 3QHTA 1L0XB 3DWGC 1LGRA 4K7UA 5FR6A 2BS4B 2MBQA 1RFKA 1YN3A 1V8CA 2BS3B 4E74A 4EOYA 1WR6E 3ML9A 3Q8EA 4W9IA 4II3B 2HTME 2WDQB 2WWZA 1TIFA 2IO1B 1TJEA 2MQJA 2N9KA 1JMLA 2KWDA 1B9RA 2JXXA 1YN5A 5DPWA 2O6VD 2W55A 3H1UA 4BFRA 5D3IB 3Q3MC 2CKHB 1T6BX 3ZRCA 3ZXRA 4TQ0A 2GI9A 1TT5B 4ZRJA 4XYCA 4P1CC 3KQ4A 3RULA 4GOCA 3RFZB 4Q2JA 4G11A 2WDRB 4MH0E 4ITKA 3RNBC 1FXTB 5BMHA 4BZAA 4AS1A 2QIEB 3KWLA 4S17A 1WJ4A 2DENB 2V1YA 4RCOA 2MBOA 1A5RA 4DWFA 3M3JA 4KZCA 2IO3B 5LNK1 4EFOA 3ZNGC 3SR6A 2R2QA 1LQBA 3ZDTA 4F7ZA 1P0RA 2B76B 3W1SA 3L10B 3RZFA 4WJQA 2K6DB 4MEMA 3C0RB 3KUZA 1SJHD 1H8CA 4IOIE 1NI2A 1EU3A 1K51A 3D32A 1P1AA 1MI0A 1YJ1A 1XLNA 4BOZB 2XBBC 2HJ8A 4BOSC 2CU1A 1HA5A 4LNFA 5HKHA 2DYOA 3N9YC 2X38A 2FCMA 1QLBB 4X57B 1V97A 2MJDA 2PVOD 1WI0A 3ZLZA 1SJED 1WZ3A 3H9DA 3LB8C 2AL6A 2BVCA 1YIWA 4OZCA 3EUB2 1RFAA 3R8BA 1RRBA 2ZEQA 4ZRKA 2XK5A 5AZFA 4FJZA 2I38A 2KXJA 1GC7A 4WJNA 1P9DU 4LJPB 2QC8A 1ET6A 1V1PB 1LM8B 1YMHE 1C78A 4AUQC 2JX5A 1KLUD 4AQ7A 4WURA 1V5OA 3U30A 3PRPB 2SAKA 1FIQA 2KWCA 2KWUB 3U4EG 3ZTCA 5G55A 2MHJA 1S1QB 4HROA 5JHAA 1P98A 4MGIE 2IO0B 2DAFA 3IFWB 5BYRA 3DVGY 2KVRA 4OVZA 4YWGG 1CMXB 1WXQA 1N5XA 3NOBA 4IC7B 1CQVA 2LHEA 1UBIA 3GP7A 3U7DA 3AULA 4LK0M 3FILA 2XNAC 3DVGX 1IYFA 4LNOA 3VHTC 1FPYA 1F0ZA 3PRZA 2KQ7A 4WWNA 2INNE
chains in the Genus database with same CATH topology
1QZEA 1WR1A 2L0TA 3KUDB 4FA6A 4W9DA 3SHQA 1J8CA 2CHWA 2Z0DB 4NQKE 4HK2A 2LUEA 2LRWA 3LMNA 2ZVOA 3VQIA 2ZCBA 5JHBA 5E6PA 4LJOB 5LLIA 3SDLC 1TTNA 1WGGA 2WX1A 3DVNV 4CYEA 3NHEB 4EZJA 2LGDA 3KW5B 3GOEA 1WXVA 1AARA 5GMVA 3W1SC 3CF6E 3APDA 4GDLB 1OEYA 4EZLA 2MW5A 4ZYNA 3HIZA 2KMAA 3V6CB 1NBFC 1YX6B 5G2NA 1C3TA 2C7MB 2NS5A 3UF8A 4BKGA 1OGWA 2ZJDA 3NZSA 4EUTA 2KQSA 2JRIB 4ANUA 2XEWA 4TUUA 3L17A 2LGXA 3OAWA 3QQ8B 4ZRIA 2LVPA 3WAMA 3PT2B 3Q3JA 5L95C 1WGRA 4URKA 2HD5B 2KX0A 2MLBA 3UQAA 1Y8RC 3QAQA 2KWVB 5IAAC 5LXHA 4FHKA 4EEWA 2KN5A 3QC8B 2D10A 1R4NI 2EKEC 5CHWA 5LXIB 3BY4B 3RT3B 4DBGA 4HDQA 2FNJB 1ZKHA 3UGBB 3QA8A 3TL5A 1LXDA 2N1WA 4DK5A 2KFKB 5KHOA 3CMMB 2PE9A 3DVNU 1WY8A 5J18A 2W9NA 3IHPC 2GBMA 3VH4B 2KDBA 1D3ZA 1E8XA 2DX5B 2UYZB 3PSEB 4ANVA 3UIPB 3DBLI 4IWPA 2JF5A 2KANA 4HLEA 1RAXA 3QWZB 3ENEA 4MGYE 4PS3A 4M8NA 4ICVA 1E5WA 2LZ6A 4GMVA 4DDID 3A9KB 3ZW3A 1GUAB 2BKRB 4LDTD 3T9LA 4HDOA 5C1ZA 4W9GA 3MJWA 2AWTA 1JRUA 2KDIA 3IVFA 2L76A 3OLMD 1WM3A 4JL9A 4GDLA 4IW0A 3B0AA 1WXMA 5C23A 3P2BA 4PYZA 2WYQA 2NCNA 3TMPB 3O65B 1V80A 2M1MA 2KC2A 3JW0X 3ONSA 4G3XB 2BGFA 2GBJA 1UD7A 3A1QA 3HHMA 4IWOA 2MSED 5D6JB 2ZVNA 3WA0A 2Z59B 4JIOU 1WJ6A 1V5TA 1WIAA 2KDEB 2AYOB 1Q5WB 2JUOA 4MSQB 4KZ0A 2NPTA 2QHOA 2KTRB 2IY1B 2LXAA 2I1JA 3UIOB 2Z0EB 5DPRA 1V81A 1C1YB 2BYFA 1TZ1A 2KLCA 1E8ZA 4JQWC 1GNUA 3HM6X 2RSUA 4E3CA 3AU4A 1SE9A 4KIKB 3RZWC 2KX3A 2MP2B 3NY5A 4IM3A 2KFJA 5TR5A 4FLHA 1WM2A 3DBSA 3H7PA 2D11A 4B9KA 4DHZE 3A9JA 4K81A 1VD2A 2JRHA 3AXCA 3PHXB 4P7IA 4W9HA 5D94A 2LJ5A 5AZGA 1M94A 2WX0A 2C5LC 3QIJA 4G0NB 2PEAA 2VRRB 1WYWB 2N7EA 1BT0A 1PQSA 1V49A 2A4ZA 3WIMA 4ICUA 2R2OA 2AL3A 1EF1A 3QK0A 4FBJB 4LCDE 3VH3B 2JY6A 1V6EA 2M0XA 3JSVB 3JVZX 3DOWA 4BKSD 4HPMB 3OJ4B 4MGKE 2NR2A 2DZJA 4K1RB 4DHJD 2REXA 3A9KA 5BO4B 1WGYA 2KDFB 1IP9A 4AJYB 4IG7B 3QJZA 3PRMB 2KC1A 2MBBB 4NPNA 4B95A 4GU2A 1E90A 1ZGUB 2L7RA 3HM3A 4HXDA 4MM3A 3DDCB 2AEHA 5DCNA 3PLVA 1UBQA 2O2VA 3VUYA 4W9LA 4WJPA 3S2AA 2A5UA 1EUVB 3PREA 4RMAA 2N7DA 2O6VA 4BVUC 1L2NA 3L0WB 2GBRA 1YD8U 1WX9A 2KTRA 2C9WB 3L13A 2IY0B 4XZ4A 1WX7A 2G45B 4PYUA 2GBKA 1E8YA 1WJUA 4RM9A 2LD9A 3PHWB 4TV3A 4KIKA 3L08A 2CHXA 4KSKC 1MG8A 2MP2A 4W9EA 2G4SA 3B08A 3VXWA 4XC2A 2G3QB 2BPSA 1OQYA 2J0KA 4NNJB 1XD3B 1UELA 2OOBB 4TQ1A 1SGHA 1J19A 3N30A 1IPGA 4HVBA 2KKCA 1V2YA 2IZVB 4GXBA 4N9F4 2K39A 3LJ3A 5DPSA 1WZ0A 2KLGA 4BKTA 3APCA 3UINB 3DBHI 2UWQA 3JSVA 3TJPA 1UH6A 3DPDA 2FCQA 4HWIB 5L83A 4FHJA 4NJ6A 4MJSA 5J2RA 4WWPA 1WX8A 3X0WA 2FCSA 2KJHB 2KMCA 4EKUA 4F8CB 5JH5C 3ALBA 2KD0A 2PJHA 4KDIC 2MCNB 4ANXA 2I1KA 2RPQA 4MDKE 3R66C 2J0JA 1YX5B 2BWES 2M17A 3QX1A 2N4FA 2M8SA 4II2B 4KSLC 4MELA 3NS8A 2RD0A 4FADA 1WJNA 1E7VA 3VDZA 3ZRFA 2L0FA 1UGMA 4FJVB 2LI5A 3M63B 2JZ3B 3KYDD 2DYMA 3I3TB 4PS8A 2L00B 3VVWB 2N9XA 5D7GA 2MX2A 4YL8A 3EECA 2K25A 2CR5A 4PS7A 2KZRA 2LXCA 4JLCA 4M0WB 3ZVVA 4B6WA 3PS6A 1WH3A 3ZUNA 3HK0A 1OTRB 2HE7A 3X23A 4AP4C 3SD5A 4I6PA 1TBEA 1V9JA 2ZNVC 3R3MA 1LFDA 3H7SA 4FN2A 3R7QA 3Q3FA 1J0GA 3VUWA 2PPHA 2L05A 1EF5A 1T0YA 2L8JA 4GSWA 1GC6A 1WXSA 3KUCB 4NY0A 2NBVB 5AZHA 1E7UA 2BYEA 2CS4A 4WAAA 3ZNHB 3ZIMA 1GG3A 5AEKB 2KK8A 5CHVC 2PE6B 2ASQA 4MGZE 1F9JA 3IG3A 4W9CA 2K1FA 3B1LX 3KH0A 4WWOA 2BKFA 2KO3A 2KTFA 4AJWA 3DQVA 2JZZA 2NBWB 3QHTA 3WALA 4ANWA 1HE8A 2KFKA 3RD2A 1I42A 4K7UA 3T8MA 2HTHA 1EO6A 2GBNA 2C7HA 2RR9A 5FR6A 1WMHB 2MBQA 2MWSB 3AU5A 3V62A 1VCBA 2EMTA 4A3OA 4E74A 4EOYA 2WDTB 1WR6E 1YQBA 4WWNA 3ML9A 4W9IA 4IWQA 4II3B 5KHQA 2WWZA 1SIFA 2C7NB 2IO1B 2MQJA 2C60A 3M95A 4A3PA 3WANA 3N3KB 4GDKB 4IM2A 1Q0WB 3H6NA 2JXXA 4HPLB 1KLVA 5DPWA 2IBIB 2GMIC 2ZZPB 3UQBA 3V60A 3VTUA 2LASA 2KHWB 2O6VD 1RLFA 3H1UA 4BFRA 4J6IA 2KJRA 1WRDB 2CKHB 2J0MA 3ZRCA 3APFA 1ZW7A 4K7WA 1U4AA 4TQ0A 4NQLB 4ZRJA 2CHZA 3W1YA 1GJZA 3RULA 1Z2MA 2V3SA 4GOCA 2FAZA 4NAWB 4I6LB 4MSMB 3LDZE 4G11A 2LRUA 2LWPA 3BINA 1ISNA 5CTRC 1V86A 1WF9A 2D07B 3EFUA 4MH0E 1FXTB 2V4LA 4HCNB 2BWFA 1Q1OA 3L16A 3GZNI 4HJKA 4KVGB 1UZXB 2RGFA 3SU8X 1P3QU 4CHKA 1WJ4A 2DENB 2V1YA 2M4NA 2MBOA 3OJ3A 1A5RA 1WMHA 4LDTB 3M3JA 2LGYA 4W9FA 4KZCA 5DPTA 3ZNZB 4DWFA 2IO3B 4BBNF 2B3AA 2DZMA 2G4DB 2DHZA 3PZDA 2XK5B 3VFKA 4EFOA 3ZNGC 2R2QA 4RM8A 1R4MI 1LQBA 3ZDTA 4EZKA 4F7ZA 3A1QB 1XT9B 5JZEB 3DBRI 2N9PC 3V61A 1P0RA 3ZKJC 4HCPB 3MTNB 4OVVA 2ZPNA 2MRPA 3K9OB 4GDKA 4DXAB 5E6OA 2NPTB 3R7RA 3W1SA 3L10B 4FULA 3RZFA 4WJQA 2K6DB 2N1VA 4MEMA 3C0RB 4ASWC 4K7SA 3KUZA 1X1MA 4NJ7A 1WE7A 1H8CA 3EC8A 3JYUA 1NI2A 5CHFA 3KYCD 3ECIA 2JT4B 2YVCA 3D32A 1P1AA 2ZNVB 4I6NB 2FIFA 3VUXA 1YJ1A 4M8MA 4BOZB 2XBBC 3H7PB 2HJ8A 4G50A 5EDSA 3A9JB 2DZIA 4BOSC 2FUHB 2CU1A 3QARA 2BYVE 2OJRA 2ZPYA 4JGHB 2DZKA 3CSFA 4W9JA 4AWJA 5HKHA 3EHVA 4IUMB 2DYOA 3ZTDA 3KVFB 2JWZA 5J17A 5CX3A 2D3GA 4NAWA 3MHSD 3IBEA 2BF8B 3K9PB 4BBNC 2FCMA 2NBUA 4W9KA 3ZNID 4F1SA 3AI5A 2DAJA 2MBEA 3RUIB 4X57B 2J7QB 3TBLD 4CO7A 5E6NA 1WI0A 3ZLZA 1WZ3A 3RYTA 3H9DA 2NVUI 3U8ZA 4A20A 3CSTA 2KNBA 4GN1A 2AL6A 3M62B 4KDLB 3PTFC 3ZDMC 1YIWA 4DHJB 2N9EB 3DCGA 3WAPA 2LVQA 1RFAA 2K8BA 1RRBA 2ZEQA 4ZRKA 3RCZA 2XK5A 2JPHA 2O2VB 2KOXA 4DHZB 5AZFA 4FJZA 2K8HA 2KXJA 2ZCCA 1GC7A 4WJNA 1WGDA 4E71A 1P9DU 4LJPB 5IA7A 1WE6A 1G6JA 4FJYA 4AOFA 1LM8B 2O6VB 3TCAA 3L54A 1W6VA 5D2MB 1KM7A 1OEYJ 3A33B 4DDGD 2L3ZA 3TIXA 3VAWA 2IO2B 4AUQC 2MA9B 3PLUA 2IYDB 1TGZB 1V5OA 3U30A 3PRPB 3VTVA 2KWCA 2LVOA 1S3SG 3PV1A 2KWUB 3ZTCA 5G55A 1KJTA 1S1QB 5JHAA 3QCAA 1P98A 4MGIE 2YLMA 2GOWA 2IO0B 1WFYA 3PVLA 4KV2A 2DAFA 1Z5SB 2K6QA 4WQOB 3IFWB 3N32A 2JVCA 4GGQA 4ZDVA 3DVGY 3PPAA 2KVRA 1WGHA 3A4RA 1XQQA 1L7YA 1K8RB 1CMXB 3V6EB 2FIDA 1WXAA 3NOBA 3WAOA 2FCNA 2MBHA 4IC7B 1KOTA 4GIVA 2K8CA 1UBIA 4XX5A 3A4SC 1I35A 3U7DA 3AULA 2KJ6A 1H4RA 2DYBA 4MJSB 1E8WA 3DVGX 1NDDA 3PGEA 4IM0A 4TKNA 4BKSA 2D2QA 3NZUA 3VHTC 1IYFA 3VTWA 4OVUA 3ML8A 3ZO5B 2EMSA 3PRZA 2KQ7A 4GB9A 2Y5BB 4WJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1QZE A;  1WR1 A;  2L0T A;  3KUD B;  4FA6 A;  4W9D A;  3SHQ A;  1J8C A;  2CHW A;  2Z0D B;  4NQK E;  4HK2 A;  2LUE A;  2LRW A;  3LMN A;  2ZVO A;  3VQI A;  2ZCB A;  5JHB A;  5E6P A;  4LJO B;  5LLI A;  3SDL C;  1TTN A;  1WGG A;  2WX1 A;  3DVN V;  4CYE A;  3NHE B;  4EZJ A;  2LGD A;  3KW5 B;  3GOE A;  1WXV A;  1AAR A;  5GMV A;  3W1S C;  3CF6 E;  3APD A;  4GDL B;  1OEY A;  4EZL A;  2MW5 A;  4ZYN A;  3HIZ A;  2KMA A;  3V6C B;  1NBF C;  1YX6 B;  5G2N A;  1C3T A;  2C7M B;  2NS5 A;  3UF8 A;  4BKG A;  1OGW A;  2ZJD A;  3NZS A;  4EUT A;  2KQS A;  2JRI B;  4ANU A;  2XEW A;  4TUU A;  3L17 A;  2LGX A;  3OAW A;  3QQ8 B;  4ZRI A;  2LVP A;  3WAM A;  3PT2 B;  3Q3J A;  5L95 C;  1WGR A;  4URK A;  2HD5 B;  2KX0 A;  2MLB A;  3UQA A;  1Y8R C;  3QAQ A;  2KWV B;  5IAA C;  5LXH A;  4FHK A;  4EEW A;  2KN5 A;  3QC8 B;  2D10 A;  1R4N I;  2EKE C;  5CHW A;  5LXI B;  3BY4 B;  3RT3 B;  4DBG A;  4HDQ A;  2FNJ B;  1ZKH A;  3UGB B;  3QA8 A;  3TL5 A;  1LXD A;  2N1W A;  4DK5 A;  2KFK B;  5KHO A;  3CMM B;  2PE9 A;  3DVN U;  1WY8 A;  5J18 A;  2W9N A;  3IHP C;  2GBM A;  3VH4 B;  2KDB A;  1D3Z A;  1E8X A;  2DX5 B;  2UYZ B;  3PSE B;  4ANV A;  3UIP B;  3DBL I;  4IWP A;  2JF5 A;  2KAN A;  4HLE A;  1RAX A;  3QWZ B;  3ENE A;  4MGY E;  4PS3 A;  4M8N A;  4ICV A;  1E5W A;  2LZ6 A;  4GMV A;  4DDI D;  3A9K B;  3ZW3 A;  1GUA B;  2BKR B;  4LDT D;  3T9L A;  4HDO A;  5C1Z A;  4W9G A;  3MJW A;  2AWT A;  1JRU A;  2KDI A;  3IVF A;  2L76 A;  3OLM D;  1WM3 A;  4JL9 A;  4GDL A;  4IW0 A;  3B0A A;  1WXM A;  5C23 A;  3P2B A;  4PYZ A;  2WYQ A;  2NCN A;  3TMP B;  3O65 B;  1V80 A;  2M1M A;  2KC2 A;  3JW0 X;  3ONS A;  4G3X B;  2BGF A;  2GBJ A;  1UD7 A;  3A1Q A;  3HHM A;  4IWO A;  2MSE D;  5D6J B;  2ZVN A;  3WA0 A;  2Z59 B;  4JIO U;  1WJ6 A;  1V5T A;  1WIA A;  2KDE B;  2AYO B;  1Q5W B;  2JUO A;  4MSQ B;  4KZ0 A;  2NPT A;  2QHO A;  2KTR B;  2IY1 B;  2LXA A;  2I1J A;  3UIO B;  2Z0E B;  5DPR A;  1V81 A;  1C1Y B;  2BYF A;  1TZ1 A;  2KLC A;  1E8Z A;  4JQW C;  1GNU A;  3HM6 X;  2RSU A;  4E3C A;  3AU4 A;  1SE9 A;  4KIK B;  3RZW C;  2KX3 A;  2MP2 B;  3NY5 A;  4IM3 A;  2KFJ A;  5TR5 A;  4FLH A;  1WM2 A;  3DBS A;  3H7P A;  2D11 A;  4B9K A;  4DHZ E;  3A9J A;  4K81 A;  1VD2 A;  2JRH A;  3AXC A;  3PHX B;  4P7I A;  4W9H A;  5D94 A;  2LJ5 A;  5AZG A;  1M94 A;  2WX0 A;  2C5L C;  3QIJ A;  4G0N B;  2PEA A;  2VRR B;  1WYW B;  2N7E A;  1BT0 A;  1PQS A;  1V49 A;  2A4Z A;  3WIM A;  4ICU A;  2R2O A;  2AL3 A;  1EF1 A;  3QK0 A;  4FBJ B;  4LCD E;  3VH3 B;  2JY6 A;  1V6E A;  2M0X A;  3JSV B;  3JVZ X;  3DOW A;  4BKS D;  4HPM B;  3OJ4 B;  4MGK E;  2NR2 A;  2DZJ A;  4K1R B;  4DHJ D;  2REX A;  3A9K A;  5BO4 B;  1WGY A;  2KDF B;  1IP9 A;  4AJY B;  4IG7 B;  3QJZ A;  3PRM B;  2KC1 A;  2MBB B;  4NPN A;  4B95 A;  4GU2 A;  1E90 A;  1ZGU B;  2L7R A;  3HM3 A;  4HXD A;  4MM3 A;  3DDC B;  2AEH A;  5DCN A;  3PLV A;  1UBQ A;  2O2V A;  3VUY A;  4W9L A;  4WJP A;  3S2A A;  2A5U A;  1EUV B;  3PRE A;  4RMA A;  2N7D A;  2O6V A;  4BVU C;  1L2N A;  3L0W B;  2GBR A;  1YD8 U;  1WX9 A;  2KTR A;  2C9W B;  3L13 A;  2IY0 B;  4XZ4 A;  1WX7 A;  2G45 B;  4PYU A;  2GBK A;  1E8Y A;  1WJU A;  4RM9 A;  2LD9 A;  3PHW B;  4TV3 A;  4KIK A;  3L08 A;  2CHX A;  4KSK C;  1MG8 A;  2MP2 A;  4W9E A;  2G4S A;  3B08 A;  3VXW A;  4XC2 A;  2G3Q B;  2BPS A;  1OQY A;  2J0K A;  4NNJ B;  1XD3 B;  1UEL A;  2OOB B;  4TQ1 A;  1SGH A;  1J19 A;  3N30 A;  1IPG A;  4HVB A;  2KKC A;  1V2Y A;  2IZV B;  4GXB A;  4N9F 4;  2K39 A;  3LJ3 A;  5DPS A;  1WZ0 A;  2KLG A;  4BKT A;  3APC A;  3UIN B;  3DBH I;  2UWQ A;  3JSV A;  3TJP A;  1UH6 A;  3DPD A;  2FCQ A;  4HWI B;  5L83 A;  4FHJ A;  4NJ6 A;  4MJS A;  5J2R A;  4WWP A;  1WX8 A;  3X0W A;  2FCS A;  2KJH B;  2KMC A;  4EKU A;  4F8C B;  5JH5 C;  3ALB A;  2KD0 A;  2PJH A;  4KDI C;  2MCN B;  4ANX A;  2I1K A;  2RPQ A;  4MDK E;  3R66 C;  2J0J A;  1YX5 B;  2BWE S;  2M17 A;  3QX1 A;  2N4F A;  2M8S A;  4II2 B;  4KSL C;  4MEL A;  3NS8 A;  2RD0 A;  4FAD A;  1WJN A;  1E7V A;  3VDZ A;  3ZRF A;  2L0F A;  1UGM A;  4FJV B;  2LI5 A;  3M63 B;  2JZ3 B;  3KYD D;  2DYM A;  3I3T B;  4PS8 A;  2L00 B;  3VVW B;  2N9X A;  5D7G A;  2MX2 A;  4YL8 A;  3EEC A;  2K25 A;  2CR5 A;  4PS7 A;  2KZR A;  2LXC A;  4JLC A;  4M0W B;  3ZVV A;  4B6W A;  3PS6 A;  1WH3 A;  3ZUN A;  3HK0 A;  1OTR B;  2HE7 A;  3X23 A;  4AP4 C;  3SD5 A;  4I6P A;  1TBE A;  1V9J A;  2ZNV C;  3R3M A;  1LFD A;  3H7S A;  4FN2 A;  3R7Q A;  3Q3F A;  1J0G A;  3VUW A;  2PPH A;  2L05 A;  1EF5 A;  1T0Y A;  2L8J A;  4GSW A;  1GC6 A;  1WXS A;  3KUC B;  4NY0 A;  2NBV B;  5AZH A;  1E7U A;  2BYE A;  2CS4 A;  4WAA A;  3ZNH B;  3ZIM A;  1GG3 A;  5AEK B;  2KK8 A;  5CHV C;  2PE6 B;  2ASQ A;  4MGZ E;  1F9J A;  3IG3 A;  4W9C A;  2K1F A;  3B1L X;  3KH0 A;  4WWO A;  2BKF A;  2KO3 A;  2KTF A;  4AJW A;  3DQV A;  2JZZ A;  2NBW B;  3QHT A;  3WAL A;  4ANW A;  1HE8 A;  2KFK A;  3RD2 A;  1I42 A;  4K7U A;  3T8M A;  2HTH A;  1EO6 A;  2GBN A;  2C7H A;  2RR9 A;  5FR6 A;  1WMH B;  2MBQ A;  2MWS B;  3AU5 A;  3V62 A;  1VCB A;  2EMT A;  4A3O A;  4E74 A;  4EOY A;  2WDT B;  1WR6 E;  1YQB A;  4WWN A;  3ML9 A;  4W9I A;  4IWQ A;  4II3 B;  5KHQ A;  2WWZ A;  1SIF A;  2C7N B;  2IO1 B;  2MQJ A;  2C60 A;  3M95 A;  4A3P A;  3WAN A;  3N3K B;  4GDK B;  4IM2 A;  1Q0W B;  3H6N A;  2JXX A;  4HPL B;  1KLV A;  5DPW A;  2IBI B;  2GMI C;  2ZZP B;  3UQB A;  3V60 A;  3VTU A;  2LAS A;  2KHW B;  2O6V D;  1RLF A;  3H1U A;  4BFR A;  4J6I A;  2KJR A;  1WRD B;  2CKH B;  2J0M A;  3ZRC A;  3APF A;  1ZW7 A;  4K7W A;  1U4A A;  4TQ0 A;  4NQL B;  4ZRJ A;  2CHZ A;  3W1Y A;  1GJZ A;  3RUL A;  1Z2M A;  2V3S A;  4GOC A;  2FAZ A;  4NAW B;  4I6L B;  4MSM B;  3LDZ E;  4G11 A;  2LRU A;  2LWP A;  3BIN A;  1ISN A;  5CTR C;  1V86 A;  1WF9 A;  2D07 B;  3EFU A;  4MH0 E;  1FXT B;  2V4L A;  4HCN B;  2BWF A;  1Q1O A;  3L16 A;  3GZN I;  4HJK A;  4KVG B;  1UZX B;  2RGF A;  3SU8 X;  1P3Q U;  4CHK A;  1WJ4 A;  2DEN B;  2V1Y A;  2M4N A;  2MBO A;  3OJ3 A;  1A5R A;  1WMH A;  4LDT B;  3M3J A;  2LGY A;  4W9F A;  4KZC A;  5DPT A;  3ZNZ B;  4DWF A;  2IO3 B;  4BBN F;  2B3A A;  2DZM A;  2G4D B;  2DHZ A;  3PZD A;  2XK5 B;  3VFK A;  4EFO A;  3ZNG C;  2R2Q A;  4RM8 A;  1R4M I;  1LQB A;  3ZDT A;  4EZK A;  4F7Z A;  3A1Q B;  1XT9 B;  5JZE B;  3DBR I;  2N9P C;  3V61 A;  1P0R A;  3ZKJ C;  4HCP B;  3MTN B;  4OVV A;  2ZPN A;  2MRP A;  3K9O B;  4GDK A;  4DXA B;  5E6O A;  2NPT B;  3R7R A;  3W1S A;  3L10 B;  4FUL A;  3RZF A;  4WJQ A;  2K6D B;  2N1V A;  4MEM A;  3C0R B;  4ASW C;  4K7S A;  3KUZ A;  1X1M A;  4NJ7 A;  1WE7 A;  1H8C A;  3EC8 A;  3JYU A;  1NI2 A;  5CHF A;  3KYC D;  3ECI A;  2JT4 B;  2YVC A;  3D32 A;  1P1A A;  2ZNV B;  4I6N B;  2FIF A;  3VUX A;  1YJ1 A;  4M8M A;  4BOZ B;  2XBB C;  3H7P B;  2HJ8 A;  4G50 A;  5EDS A;  3A9J B;  2DZI A;  4BOS C;  2FUH B;  2CU1 A;  3QAR A;  2BYV E;  2OJR A;  2ZPY A;  4JGH B;  2DZK A;  3CSF A;  4W9J A;  4AWJ A;  5HKH A;  3EHV A;  4IUM B;  2DYO A;  3ZTD A;  3KVF B;  2JWZ A;  5J17 A;  5CX3 A;  2D3G A;  4NAW A;  3MHS D;  3IBE A;  2BF8 B;  3K9P B;  4BBN C;  2FCM A;  2NBU A;  4W9K A;  3ZNI D;  4F1S A;  3AI5 A;  2DAJ A;  2MBE A;  3RUI B;  4X57 B;  2J7Q B;  3TBL D;  4CO7 A;  5E6N A;  1WI0 A;  3ZLZ A;  1WZ3 A;  3RYT A;  3H9D A;  2NVU I;  3U8Z A;  4A20 A;  3CST A;  2KNB A;  4GN1 A;  2AL6 A;  3M62 B;  4KDL B;  3PTF C;  3ZDM C;  1YIW A;  4DHJ B;  2N9E B;  3DCG A;  3WAP A;  2LVQ A;  1RFA A;  2K8B A;  1RRB A;  2ZEQ A;  4ZRK A;  3RCZ A;  2XK5 A;  2JPH A;  2O2V B;  2KOX A;  4DHZ B;  5AZF A;  4FJZ A;  2K8H A;  2KXJ A;  2ZCC A;  1GC7 A;  4WJN A;  1WGD A;  4E71 A;  1P9D U;  4LJP B;  5IA7 A;  1WE6 A;  1G6J A;  4FJY A;  4AOF A;  1LM8 B;  2O6V B;  3TCA A;  3L54 A;  1W6V A;  5D2M B;  1KM7 A;  1OEY J;  3A33 B;  4DDG D;  2L3Z A;  3TIX A;  3VAW A;  2IO2 B;  4AUQ C;  2MA9 B;  3PLU A;  2IYD B;  1TGZ B;  1V5O A;  3U30 A;  3PRP B;  3VTV A;  2KWC A;  2LVO A;  1S3S G;  3PV1 A;  2KWU B;  3ZTC A;  5G55 A;  1KJT A;  1S1Q B;  5JHA A;  3QCA A;  1P98 A;  4MGI E;  2YLM A;  2GOW A;  2IO0 B;  1WFY A;  3PVL A;  4KV2 A;  2DAF A;  1Z5S B;  2K6Q A;  4WQO B;  3IFW B;  3N32 A;  2JVC A;  4GGQ A;  4ZDV A;  3DVG Y;  3PPA A;  2KVR A;  1WGH A;  3A4R A;  1XQQ A;  1L7Y A;  1K8R B;  1CMX B;  3V6E B;  2FID A;  1WXA A;  3NOB A;  3WAO A;  2FCN A;  2MBH A;  4IC7 B;  1KOT A;  4GIV A;  2K8C A;  1UBI A;  4XX5 A;  3A4S C;  1I35 A;  3U7D A;  3AUL A;  2KJ6 A;  1H4R A;  2DYB A;  4MJS B;  1E8W A;  3DVG X;  1NDD A;  3PGE A;  4IM0 A;  4TKN A;  4BKS A;  2D2Q A;  3NZU A;  3VHT C;  1IYF A;  3VTW A;  4OVU A;  3ML8 A;  3ZO5 B;  2EMS A;  3PRZ A;  2KQ7 A;  4GB9 A;  2Y5B B;  4WJO A; 
#chains in the Genus database with same CATH topology
 2TSS A;  1WR1 A;  2L0T A;  3KUD B;  1SB3 C;  4YSX B;  4C4V A;  2JWU A;  3N1X C;  1BXT A;  2WP9 B;  2QIL A;  1F2R I;  5LLI A;  3SDL C;  4USA A;  1SEB D;  3BVG A;  1OEY A;  2HDE A;  2MW5 A;  4ZHO A;  1EM7 A;  3V6C B;  1C3T A;  2C7M B;  2LMC A;  2XEW A;  3AE5 B;  1TKY A;  3L17 A;  2Y5P A;  1HEZ E;  4MH8 A;  2DLB A;  2KYW A;  1TKG A;  5L95 C;  1D4B A;  4URK A;  3UQA A;  1Y8R C;  2FBW B;  2J4X A;  5EE9 A;  5LXH A;  4FHK A;  2KN5 A;  2KDM A;  5LXI B;  3BY4 B;  3TL5 A;  3DVN U;  1PGX A;  1T5X D;  3R2I A;  1JAL A;  2WQY B;  2WXR A;  4M8N A;  4DDI D;  3ZW3 A;  4HDO A;  3WCQ A;  1QIL A;  1P7E A;  1YJJ A;  5HI1 A;  1VRA B;  1DOI A;  4IW0 A;  3P2B A;  4K3C A;  1ET9 A;  3P4R B;  2M1M A;  2KC2 A;  3ONS A;  5D6J B;  1KRH A;  1V5T A;  1NYR A;  2AYO B;  4KZ0 A;  2NPT A;  1I4P A;  1UGJ A;  2I1J A;  3UIO B;  5DPR A;  1E8Z A;  1ZDV A;  2RSU A;  4E3C A;  3AU4 A;  4KIK B;  4IM3 A;  4FLH A;  3H7P A;  3A9J A;  3URY A;  4H2A A;  3AXC A;  3PHX B;  5D94 A;  2WXH A;  1I4H A;  2WX0 A;  3AE1 B;  1WYW B;  1VZ8 A;  1PQS A;  1V49 A;  2R2O A;  4B0M A;  2LFI A;  3QK0 A;  4FBJ B;  4LCD E;  4A90 A;  1V6E A;  2Y5C A;  5E6J A;  2NR2 A;  3A9K A;  4NJC A;  4OZA A;  4YXD B;  4NPN A;  4DQO C;  3AEF B;  4HXD A;  3Q8F A;  3S2A A;  2O6V A;  2M0A A;  3L0W B;  3AEE B;  2C9W B;  4XE0 A;  3ZJV A;  2D3C A;  1XLO A;  1WX7 A;  1E8Y A;  1WJU A;  2VH2 A;  3AEB B;  4M00 A;  2LD9 A;  3W5U B;  2MP2 A;  3E9S A;  1WWT A;  1ZP0 B;  4ZYS A;  2BPS A;  2J53 A;  4NNJ B;  1XD3 B;  5EE0 A;  4TQ1 A;  3E56 A;  3KWV A;  1V2Y A;  1N61 A;  4GXB A;  3DBL B;  1YNT E;  3AE8 B;  1JW9 D;  4KGR A;  4A6Q A;  3TJP A;  2FCQ A;  2M56 B;  2IGG A;  5J2R A;  4MJS A;  1WX8 A;  3X0W A;  2KMC A;  4L2Y A;  2D3B A;  3ALB A;  2KD0 A;  2PJH A;  1SE3 A;  2J0J A;  1YX5 B;  2BWE S;  3QX1 A;  4II2 B;  4KSL C;  4MEL A;  5IOI A;  1WRI A;  4FJV B;  1FD6 A;  3KYD D;  2D5G A;  1P7F A;  3I3T B;  4PS8 A;  1XCQ L;  1ROE A;  2N9X A;  3VVW B;  2L83 A;  1UWM A;  2K0P A;  3AM9 A;  4JLC A;  5AUI A;  3PS6 A;  1WH3 A;  2OHF A;  1OTR B;  2HE7 A;  1HXY D;  3SD5 A;  1TBE A;  2BS2 B;  3R3M A;  2KVZ A;  2K22 A;  4FN2 A;  1J0G A;  2L05 A;  1EF5 A;  1T0Y A;  2NBV B;  1E7U A;  2BYE A;  1TY2 A;  3ZNH B;  2OJW A;  1VJK A;  5AEK B;  2KK8 A;  5CHV C;  2V0G A;  2ASQ A;  4MGZ E;  4W9C A;  1CJE A;  4XGA B;  4WWO A;  2KTF A;  1SE4 A;  1QKZ A;  2KFK A;  3Q8C A;  1I42 A;  1Y56 A;  2JQR B;  3T8M A;  2HTH A;  5G5G A;  2GBN A;  2RR9 A;  3DHH C;  2JSV X;  3V62 A;  4A3O A;  2I2Y A;  1IGC A;  3MC9 A;  2BW2 A;  4IWQ A;  4RGO S;  5KHQ A;  3N1Y C;  3CWI A;  3P4Q B;  2C60 A;  4A3P A;  3RN9 C;  2FE8 A;  3N3K B;  4GDK B;  3H6N A;  2IBI B;  5I4D A;  3DHI C;  2V3P A;  3V60 A;  2IDY A;  4YTM B;  1SIJ A;  3VTU A;  3NG0 A;  1WRD B;  2J0M A;  1J7A A;  3U2S C;  1ZW7 A;  1U4A A;  4TSS A;  3W1Y A;  1GJZ A;  2YEP B;  3SFE B;  3NUH B;  3N20 C;  4NAW B;  1E10 A;  1M4V A;  4MSM B;  2LWP A;  1RYJ A;  2RDH A;  3BIN A;  1V86 A;  1WF9 A;  1F1H A;  4XWT A;  2L1A A;  1JCK B;  2BWF A;  2BTE A;  1SXT A;  4HJK A;  4KVG B;  1FMA D;  5C3J B;  1HQR D;  4HJG E;  2M4N A;  3OJ3 A;  4LDT B;  2LGY A;  4P1B C;  5DPT A;  3GS2 A;  2BB6 A;  4O1N A;  2DZM A;  3AB5 A;  2G4D B;  2DHZ A;  1F52 A;  3VFK A;  1AN8 A;  3H8H A;  5FK9 C;  1PGA A;  1R4M I;  1D6E C;  4C00 A;  4EZK A;  1NYQ A;  4KGT A;  2FUG 1;  3AE9 B;  4HCP B;  3K9O B;  3R7R A;  1VLB A;  4FUL A;  4K7S A;  1NVI D;  1VDV A;  2GRI A;  4NJ7 A;  5CHF A;  2ZW0 A;  2JT4 B;  2YVC A;  3P4P B;  4FXC A;  4M8M A;  4TMA B;  2BYV E;  2OJR A;  3CSF A;  3RNF C;  3ZXV A;  1HZ5 A;  3EHV A;  5J17 A;  5CX3 A;  2D3G A;  4W9K A;  3ZNI D;  4F1S A;  2DAJ A;  2J7Q B;  3TBL D;  2NMQ A;  4A20 A;  3U8Z A;  2KNB A;  4GN1 A;  1PGB A;  2W3S A;  4DHJ B;  3Q8B A;  3DCG A;  1JWA D;  5D3D A;  2WXO A;  2JPH A;  2O2V B;  2KOX A;  2UU7 A;  2K8H A;  2ZCC A;  3J9C A;  1MFW A;  3Q6B A;  4FJY A;  3TIX A;  4A55 A;  3PLU A;  1EU4 A;  4XDD A;  1BML C;  1TYG B;  3VTV A;  2G9H D;  3PV1 A;  1KJT A;  3LXF A;  4C7Y A;  1PUT A;  3QCA A;  2GOW A;  1WFY A;  4KV2 A;  1Z5S B;  1Q10 A;  4ZDV A;  2BB5 A;  1L7Y A;  2MJ3 A;  3V6E B;  5T8I A;  2FID A;  3WAO A;  2FCN A;  4GIV A;  4XX5 A;  3A4S C;  3P4S B;  3IT6 B;  4GLS C;  4TKN A;  2WXK A;  3NZU A;  4OVU A;  3ZO5 B;  1N63 A;  1QZE A;  1IBX A;  3AEA B;  3U7Z A;  2WU5 B;  2Z0D B;  4HK2 A;  1SE2 A;  2LUE A;  3VQI A;  3Q3O C;  5JHB A;  4HPP A;  3TUO A;  1TTN A;  2WX1 A;  2GB1 A;  3NHE B;  2LGD A;  3GOE A;  1WXV A;  1AAR A;  5GMV A;  2WXI A;  3CF6 E;  3APD A;  4GDL B;  4EZL A;  1T3Q A;  1XEE A;  2E3T A;  2WXN A;  4ZYN A;  3HIZ A;  2KMA A;  3AE6 B;  1YX6 B;  5G2N A;  3UF8 A;  1L0V B;  1I4R A;  4ANU A;  4TUU A;  3W5V B;  2LGX A;  1TS2 A;  1QOA A;  2LVP A;  3SEB A;  3PT2 B;  2ACZ B;  3UI3 A;  2PW9 A;  1N5W A;  4DBG A;  4HDQ A;  3QA8 A;  2CJN A;  1WY8 A;  1J7C A;  3IHP C;  2UYZ B;  4ANV A;  3PSE B;  3UIP B;  4IWP A;  1JWM D;  2JF5 A;  4HLE A;  1HTO A;  3QWZ B;  3ENE A;  3MHZ A;  1GUA B;  4XWW A;  4HKZ E;  4LDT D;  5C1Z A;  4W9G A;  3MJW A;  1JRU A;  2KDI A;  3OLM D;  1WM3 A;  3B0A A;  5C23 A;  2WYQ A;  1BUI C;  3O65 B;  2V3N A;  1V80 A;  3JW0 X;  2E6X A;  3HHM A;  3A1Q A;  2QSD A;  2Z59 B;  3WA0 A;  4JIO U;  1WJ6 A;  1WIA A;  2HJ1 A;  2JU6 X;  4OZB A;  2QHO A;  2KTR B;  3BYT B;  2LXA A;  2Z0E B;  1YN4 A;  2BYF A;  1TZ1 A;  1FFV A;  1K50 A;  4JQW C;  2INC C;  3EGR A;  2KFJ A;  1WM2 A;  4P6V F;  3NVZ A;  4DHZ E;  1C77 A;  1LO5 D;  4P7I A;  1RM6 C;  3MFG A;  1BT0 A;  4WQM A;  1MG4 A;  2M0X A;  3JSV B;  1N6Z A;  3OJ4 B;  1XO3 A;  3AEC B;  3EFC A;  1N62 A;  4DHJ D;  2REX A;  1WGY A;  1RWS A;  4KKJ A;  3QJZ A;  2MBB B;  4US9 A;  1E90 A;  1CZP A;  1FXI A;  1PFD A;  3BVM A;  5HHD G;  4MM3 A;  2AEH A;  2JYE A;  1UBQ A;  3VUY A;  1DYQ A;  4W9L A;  3ZYY X;  1EUV B;  3HUI A;  4RMA A;  4NZL B;  1TS4 A;  1L2N A;  4YTN B;  2BBC A;  3PZ8 A;  1YD8 U;  3L13 A;  2IY0 B;  4XZ4 A;  2WU2 B;  2GBK A;  4RM9 A;  1AWD A;  4RGT A;  4KIK A;  3L08 A;  4W9E A;  2G4S A;  1JRO A;  2KAC A;  2OOB B;  5FR3 A;  2EKI A;  1J19 A;  2K39 A;  5H92 C;  3UIN B;  2QJL A;  3DPD A;  4HWI B;  5L83 A;  4FHJ A;  2AX5 A;  5JH5 C;  4KDI C;  1L4D B;  1HTQ A;  2M17 A;  2M8S A;  1ZPS A;  3I57 A;  3ETR A;  3ZRF A;  2L0F A;  2LI5 A;  1EWY C;  1FCL A;  2MX2 A;  4RF1 A;  4YL8 A;  3EEC A;  3VRB B;  1TKE A;  1GB4 A;  4PS7 A;  1K52 A;  3ZVV A;  1E9M A;  3X23 A;  2PMV A;  1STE A;  3R7Q A;  1ZE3 D;  3Q3F A;  2PPH A;  3LYY A;  4GSW A;  1WXS A;  5AZH A;  2CS4 A;  3MJ5 A;  3ZIM A;  2PE6 B;  3IG3 A;  4C4V B;  2K1F A;  3KH0 A;  3WAL A;  4ANW A;  1HE8 A;  2KAJ A;  3RD2 A;  2H89 B;  1EO6 A;  2C7H A;  1WMH B;  3TEZ A;  2DWQ A;  3AU5 A;  1VCB A;  2EMT A;  2WDT B;  1YQB A;  1FNW A;  1DGJ A;  2IND C;  2IJ0 A;  3EA6 A;  4IM2 A;  1Q0W B;  4LNI A;  1VR9 A;  4RGM A;  1KLV A;  2IPK D;  4RFB A;  3UQB A;  2LAS A;  4IKG A;  3B2F A;  2KJR A;  3APF A;  4K7W A;  4C56 C;  3BII D;  2AQ3 B;  4C80 A;  1Z2M A;  1R7S A;  1V1O A;  4C7Z A;  2WXG A;  5CTR C;  2KMM A;  5EE3 A;  1JWU D;  1Q1O A;  1F77 A;  2VZK B;  1P3Q U;  1I7H A;  4W9F A;  2QDF A;  2QMT A;  2MJE A;  1WYG A;  1D5X C;  3PZD A;  4LTU A;  4WIP A;  4LNK A;  1TS3 A;  2N9P C;  3V61 A;  4OVV A;  1I35 A;  2ZPN A;  4GDK A;  4DXA B;  2NPT B;  3BZD B;  2N1V A;  2RDG A;  2QEJ C;  2JYT A;  3NVY A;  1WE7 A;  3C8Y A;  3JYU A;  2MEK A;  1GAQ B;  2ZNV B;  1FEH A;  4I6N B;  2FIF A;  3VUX A;  2LJI A;  1TZO A;  3H7P B;  1A70 A;  2N7J A;  4G50 A;  5EDS A;  3A9J B;  1MHH E;  2DZI A;  3QAR A;  2DZK A;  2NTS A;  2JWZ A;  3W2D A;  3N1Z C;  4NAW A;  2BF8 B;  4BBN C;  1JQ4 A;  1YQ4 B;  2NBU A;  2MBE A;  3RUI B;  1FM0 D;  1UWX A;  4CO7 A;  3RYT A;  4KX6 B;  3CST A;  4HRS A;  3T3O A;  3M62 B;  4M01 A;  3PTF C;  3ZDM C;  1QOB A;  1C76 A;  2IGD A;  2LVQ A;  1ZOY B;  2K8B A;  3OWE B;  3NVW A;  4DHZ B;  3IAS 1;  2M19 A;  3TEW A;  1WGD A;  2KT7 A;  2BYT A;  4RF0 A;  2O6V B;  1OEY J;  3A33 B;  4DDG D;  2L3Z A;  3VAW A;  2IO2 B;  2MA9 B;  2IYD B;  1TGZ B;  3P42 A;  3I63 C;  1E0Z A;  2W82 A;  1FNV A;  4IDI A;  2YLM A;  3PVL A;  1WSP A;  2JVC A;  2PTL A;  3A4R A;  1XQQ A;  4M0W A;  2WLB A;  1L5P A;  4LNN A;  1I4G A;  3GB1 A;  4L23 A;  2KJ6 A;  3C19 A;  4MJS B;  1E8W A;  3V05 A;  1NDD A;  3PGE A;  4IM0 A;  3ZGZ A;  4YTP B;  2D2Q A;  3VTW A;  1FRD A;  2EMS A;  4GB9 A;  4WJO A;  3SHQ A;  1R4M B;  2LRW A;  2WGS A;  1E7P B;  1FO4 A;  4LJO B;  3O13 A;  1T0R C;  1WGG A;  4EZJ A;  3KW5 B;  1C4A A;  1I4X A;  2AQ2 B;  4HEA 1;  4N59 A;  3RNG C;  3NRZ A;  1ZDX A;  1R4N B;  2NS5 A;  3AMZ A;  4JWU C;  5FKA C;  2OED A;  1OGW A;  2PIA A;  4MAC A;  4EUT A;  2WXM A;  5IP4 D;  3AE4 B;  3IT4 B;  3RPF C;  3WAM A;  1FFU A;  3Q3J A;  2HD5 B;  2MLB A;  2KWV B;  5IAA C;  3Q3N C;  3QC8 B;  2D10 A;  1R4N I;  2EKE C;  2WXP A;  4HKQ A;  3UGB B;  4DK5 A;  2N1W A;  4ZOH C;  2KFK B;  5KHO A;  1HZ6 A;  1MHX A;  2LHD A;  4N6E B;  4P16 A;  1DOY A;  1E8X A;  4R3D A;  4PS3 A;  2VZK D;  4WAF A;  4ICV A;  2LZ6 A;  3T9L A;  3TEX A;  3RI7 C;  2AWT A;  2L76 A;  5C2T B;  4JL9 A;  1ENF A;  1C4C A;  4GDL A;  1WXM A;  5AUK A;  4PYZ A;  3Q2A C;  4G3X B;  2BGF A;  4IWO A;  1UD7 A;  2WNM A;  2MSE D;  2ZVN A;  1ZXI A;  1Q5W B;  2W54 A;  2IY1 B;  1V81 A;  2GLS A;  4WH4 A;  2KLC A;  1GNU A;  3HM6 X;  3Q69 A;  1SE9 A;  4JE3 B;  5TR5 A;  3DBS A;  3VRA B;  3ZQ4 A;  3SFD B;  4K81 A;  1VD2 A;  2LJ5 A;  5MPO A;  2LEK A;  1YJI A;  5AZG A;  1M94 A;  2C5L C;  2PEA A;  2VH1 A;  2VRR B;  2N7E A;  3WIM A;  2ONQ A;  1EF1 A;  3VH3 B;  1C4P A;  2IGH A;  3JVZ X;  1L4Z B;  2WHI A;  3DOW A;  4BKS D;  4HPM B;  2DZJ A;  4K1R B;  5BO4 B;  2KDF B;  1IP9 A;  4AJY B;  4B95 A;  4GU2 A;  1OFF A;  5DCN A;  4QAY A;  1GPX A;  2D3A A;  3B9J A;  3I9V 1;  2A5U A;  2J52 A;  1V1P A;  1AW7 A;  2N7D A;  3AE7 B;  2KTR A;  3VR8 B;  5IN7 A;  2INP E;  2G45 B;  4PYU A;  3PHW B;  1KTK A;  4TV3 A;  2CHX A;  3B08 A;  4XC2 A;  4KKI A;  1UEL A;  3N30 A;  1IPG A;  3HVD A;  1KH0 A;  4HVB A;  3B2G A;  2IZV B;  4N9F 4;  5DPS A;  1KF6 B;  2KLG A;  3DWM A;  4BKT A;  4EE2 A;  1VZ6 A;  1ACC A;  3JSV A;  2N9L A;  1YOV B;  4NJ6 A;  2PVG C;  2FCS A;  2KJH B;  4EKU A;  4F8C B;  4A9A A;  4S0R A;  2MCN B;  2I1K A;  2RPQ A;  3AE2 B;  2RD0 A;  1WGK A;  4FAD A;  2PLP A;  3VDZ A;  4ZHP A;  3AED B;  3NZ3 A;  3M63 B;  2DYM A;  2L00 B;  2CR5 A;  2WXQ A;  2LXC A;  3RNA C;  4B6W A;  3ZUN A;  3FC4 A;  3HK0 A;  4AP4 C;  1V9J A;  1LFD A;  1ZUD 2;  1E6E B;  2L8J A;  3MC0 B;  3Q8A A;  1GC6 A;  4NY0 A;  3PO0 A;  1L0Y B;  1L6U A;  4NAM A;  1GG3 A;  2BQQ A;  1QOF A;  1IBX B;  1PDX A;  1F9J A;  4YSZ B;  1FRR A;  1XLP A;  4WWM A;  1N60 A;  1FCC C;  1SSN A;  4AJW A;  3DQV A;  2NBW B;  2MWS B;  2Z8L A;  1ESF A;  2DNF A;  1PYW D;  4KGS A;  2K5P A;  3BVZ A;  1SIF A;  2C7N B;  3BK1 A;  2LGI A;  3M95 A;  4K3B A;  2SEB D;  3WAN A;  4XDC A;  4HPL B;  5GXG B;  1QT9 A;  2GMI C;  2ZZP B;  2LUM A;  2WS3 B;  4ACF A;  2KHW B;  1RLF A;  5JXV A;  4J6I A;  3GZN B;  5G5H A;  4NQL B;  2CHZ A;  4PK1 A;  5BMI A;  2V3S A;  2PKO A;  2FAZ A;  5HG2 A;  4I6L B;  3LDZ E;  2LRU A;  1ISN A;  2D07 B;  3EFU A;  2V4L A;  4HCN B;  3AE3 B;  3DBR B;  3BYY B;  2ON8 A;  3L16 A;  3GZN I;  2RPV A;  3AEG B;  1UZX B;  2RGF A;  3SU8 X;  4CHK A;  1UUP A;  1WMH A;  3ZNZ B;  2H88 B;  1OQR A;  4BBN F;  2B3A A;  2XK5 B;  5BYQ A;  4RM8 A;  1NI3 A;  4PT5 A;  3A1Q B;  1XT9 B;  1L6V A;  3DBR I;  5JZE B;  3ZKJ C;  3MTN B;  3VR9 B;  2MRP A;  1I4Q A;  5E6O A;  4ASW C;  1X1M A;  1J7B A;  5HFY A;  3EC8 A;  3KYC D;  3W9C B;  3ECI A;  2WXF A;  1MJD A;  1GOZ A;  1XCT L;  1B1Z A;  2FUH B;  3PZ7 A;  4JGH B;  1VZ7 A;  2ZPY A;  4RH6 A;  4W9J A;  1XF5 L;  4AWJ A;  4IUM B;  3ZTD A;  3KVF B;  3MHS D;  4M02 A;  2Q5W D;  3IBE A;  3K9P B;  4A8X C;  2KN4 A;  1ZXH A;  3AI5 A;  1IUE A;  2RDB C;  5E6N A;  3FIL B;  2EEL A;  1C9F A;  2NVU I;  3FKY A;  5TSS A;  2AQ1 B;  4KDL B;  2N9E B;  3WAP A;  4MM3 B;  1KLG D;  4JX1 C;  1NEK B;  3RCZ A;  4OHJ A;  3P1M A;  1FXA A;  2V9H A;  4E71 A;  4UDU C;  5IA7 A;  5H8Y E;  1GB1 A;  1WE6 A;  1G6J A;  2KQ4 X;  4AOF A;  3TCA A;  3L54 A;  1W6V A;  1NEN B;  5D2M B;  1DOX A;  1KM7 A;  5EE1 A;  1T0Q C;  2DBY A;  4ZRQ A;  2LGS A;  2LVO A;  1S3S G;  4J3O D;  3IXS A;  4WQO B;  2K6Q A;  3N32 A;  4GGQ A;  3PPA A;  1WGH A;  1CK1 A;  4JWS C;  1K8R B;  1WXA A;  2QCZ A;  4REZ A;  2MBH A;  1KOT A;  2K8C A;  2NTT A;  3ABV B;  2CJO A;  1H4R A;  2DYB A;  4BKS A;  4D2K A;  3ML8 A;  2Y5B B;  5BYS A;  1EWC A;  4FA6 A;  4W9D A;  1J8C A;  2CHW A;  1TS5 A;  4NQK E;  3GE3 C;  3RNC C;  1IGD A;  3LMN A;  2ZVO A;  3IAM 1;  2ZCB A;  5E6P A;  1F2R C;  3DVN V;  4CYE A;  3W1S C;  3RNE C;  2BT6 A;  3NVV A;  4YT0 B;  1XXG A;  1NBF C;  3U52 E;  4BKG A;  4DXF A;  2ZJD A;  3NZS A;  2KQS A;  2JRI B;  2Y3A A;  3OAW A;  3QQ8 B;  4ZRI A;  2L52 A;  1WGR A;  2KX0 A;  3QAQ A;  2JZP A;  4EEW A;  5CHW A;  1QOG A;  3RT3 B;  2FNJ B;  1ZKH A;  1LXD A;  3CMM B;  3NJT A;  2PE9 A;  5J18 A;  2W3R A;  3ZJT A;  2W9N A;  2GBM A;  3VH4 B;  1UF0 A;  2KDB A;  1D3Z A;  2DX5 B;  1KFY B;  3BWU D;  3DBL I;  2KAN A;  1RAX A;  2RMM A;  4ARI A;  4MGY E;  1E5W A;  4GMV A;  2N0S B;  3R2T A;  3A9K B;  2BKR B;  3IVF A;  4CQN A;  1XLQ A;  2NCN A;  3TMP B;  2GBJ A;  3HRD D;  2KDE B;  4N58 A;  2JUO A;  4ARC A;  4MSQ B;  4RNA A;  4YSY B;  1C1Y B;  4MT5 A;  3T3N A;  3V3X A;  2G1E A;  3RMK C;  3RZW C;  2KX3 A;  2MP2 B;  3NY5 A;  4LLG M;  1JRP A;  2D11 A;  2XN9 C;  4B9K A;  2JRH A;  4W9H A;  3QIJ A;  4G0N B;  2ICI A;  3DHG C;  2L32 A;  2A4Z A;  2CU3 A;  4BAX A;  4ICU A;  2AL3 A;  2JY6 A;  3I5J C;  4MGK E;  2ZW1 A;  5IKC M;  2X8X X;  2WXJ A;  5IO9 A;  4IG7 B;  1FNU A;  3PRM B;  2KC1 A;  2YEP F;  1ZGU B;  3AV8 A;  1TY0 A;  2L7R A;  1QQR A;  3HM3 A;  3DDC B;  1UNS A;  3PLV A;  2O2V A;  1JWB D;  4WJP A;  3TSS A;  3PRE A;  4BVU C;  2R61 A;  3HVZ A;  4ZRP A;  2GBR A;  1WX9 A;  3KLS X;  1D5Z C;  3FAH A;  2WXL A;  3DBH B;  2K9X A;  1QF6 A;  3MP9 A;  4KSK C;  1MG8 A;  3VXW A;  3Q14 C;  2G3Q B;  1YQ3 B;  1OQY A;  2J0K A;  1T0S C;  1SGH A;  1K53 A;  3MC8 A;  1D5M C;  2KKC A;  3LJ3 A;  1WZ0 A;  3APC A;  1JWS D;  2UWQ A;  3DBH I;  2J42 A;  1C79 A;  1UH6 A;  4DXG A;  1OQQ A;  4WWP A;  4L1B A;  5BMG A;  4ANX A;  3L4P A;  4MDK E;  4JPS A;  3R66 C;  1SF0 A;  4OW0 A;  2N4F A;  1SBB B;  3NS1 A;  3NS8 A;  3OG5 A;  3ZJU A;  1WJN A;  1E7V A;  1UGM A;  2JZ3 B;  3CIR B;  5D7G A;  2WDV B;  2K25 A;  2JXT A;  2KZR A;  4M0W B;  4I6P A;  2ZNV C;  3H7S A;  1MPE A;  3VUW A;  3KUC B;  2K3U A;  4RGN A;  2V4I B;  4WAA A;  2MH7 A;  3AH7 A;  3TEY A;  1MVK A;  4B0E A;  3BK2 A;  1AYF A;  3B1L X;  3AN1 A;  2BKF A;  2KO3 A;  3GE8 C;  3P63 A;  4US8 A;  2JZZ A;  3QHT A;  1L0X B;  3DWG C;  1LGR A;  4K7U A;  5FR6 A;  2BS4 B;  2MBQ A;  1RFK A;  1YN3 A;  1V8C A;  2BS3 B;  4E74 A;  4EOY A;  1WR6 E;  3ML9 A;  3Q8E A;  4W9I A;  4II3 B;  2HTM E;  2WDQ B;  2WWZ A;  1TIF A;  2IO1 B;  1TJE A;  2MQJ A;  2N9K A;  1JML A;  2KWD A;  1B9R A;  2JXX A;  1YN5 A;  5DPW A;  2O6V D;  2W55 A;  3H1U A;  4BFR A;  5D3I B;  3Q3M C;  2CKH B;  1T6B X;  3ZRC A;  3ZXR A;  4TQ0 A;  2GI9 A;  1TT5 B;  4ZRJ A;  4XYC A;  4P1C C;  3KQ4 A;  3RUL A;  4GOC A;  3RFZ B;  4Q2J A;  4G11 A;  2WDR B;  4MH0 E;  4ITK A;  3RNB C;  1FXT B;  5BMH A;  4BZA A;  4AS1 A;  2QIE B;  3KWL A;  4S17 A;  1WJ4 A;  2DEN B;  2V1Y A;  4RCO A;  2MBO A;  1A5R A;  4DWF A;  3M3J A;  4KZC A;  2IO3 B;  5LNK 1;  4EFO A;  3ZNG C;  3SR6 A;  2R2Q A;  1LQB A;  3ZDT A;  4F7Z A;  1P0R A;  2B76 B;  3W1S A;  3L10 B;  3RZF A;  4WJQ A;  2K6D B;  4MEM A;  3C0R B;  3KUZ A;  1SJH D;  1H8C A;  4IOI E;  1NI2 A;  1EU3 A;  1K51 A;  3D32 A;  1P1A A;  1MI0 A;  1YJ1 A;  1XLN A;  4BOZ B;  2XBB C;  2HJ8 A;  4BOS C;  2CU1 A;  1HA5 A;  4LNF A;  5HKH A;  2DYO A;  3N9Y C;  2X38 A;  2FCM A;  1QLB B;  4X57 B;  1V97 A;  2MJD A;  2PVO D;  1WI0 A;  3ZLZ A;  1SJE D;  1WZ3 A;  3H9D A;  3LB8 C;  2AL6 A;  2BVC A;  1YIW A;  4OZC A;  3EUB 2;  1RFA A;  3R8B A;  1RRB A;  2ZEQ A;  4ZRK A;  2XK5 A;  5AZF A;  4FJZ A;  2I38 A;  2KXJ A;  1GC7 A;  4WJN A;  1P9D U;  4LJP B;  2QC8 A;  1ET6 A;  1V1P B;  1LM8 B;  1YMH E;  1C78 A;  4AUQ C;  2JX5 A;  1KLU D;  4AQ7 A;  4WUR A;  1V5O A;  3U30 A;  3PRP B;  2SAK A;  1FIQ A;  2KWC A;  2KWU B;  3U4E G;  3ZTC A;  5G55 A;  2MHJ A;  1S1Q B;  4HRO A;  5JHA A;  1P98 A;  4MGI E;  2IO0 B;  2DAF A;  3IFW B;  5BYR A;  3DVG Y;  2KVR A;  4OVZ A;  4YWG G;  1CMX B;  1WXQ A;  1N5X A;  3NOB A;  4IC7 B;  1CQV A;  2LHE A;  1UBI A;  3GP7 A;  3U7D A;  3AUL A;  4LK0 M;  3FIL A;  2XNA C;  3DVG X;  1IYF A;  4LNO A;  3VHT C;  1FPY A;  1F0Z A;  3PRZ A;  2KQ7 A;  4WWN A;  2INN E; 
#chains in the Genus database with same CATH homology
 1QZE A;  1WR1 A;  2L0T A;  3KUD B;  4FA6 A;  4W9D A;  3SHQ A;  1J8C A;  2CHW A;  2Z0D B;  4NQK E;  4HK2 A;  2LUE A;  2LRW A;  3LMN A;  2ZVO A;  3VQI A;  2ZCB A;  5JHB A;  5E6P A;  4LJO B;  5LLI A;  3SDL C;  1TTN A;  1WGG A;  2WX1 A;  3DVN V;  4CYE A;  3NHE B;  4EZJ A;  2LGD A;  3KW5 B;  3GOE A;  1WXV A;  1AAR A;  5GMV A;  3W1S C;  3CF6 E;  3APD A;  4GDL B;  1OEY A;  4EZL A;  2MW5 A;  4ZYN A;  3HIZ A;  2KMA A;  3V6C B;  1NBF C;  1YX6 B;  5G2N A;  1C3T A;  2C7M B;  2NS5 A;  3UF8 A;  4BKG A;  1OGW A;  2ZJD A;  3NZS A;  4EUT A;  2KQS A;  2JRI B;  4ANU A;  2XEW A;  4TUU A;  3L17 A;  2LGX A;  3OAW A;  3QQ8 B;  4ZRI A;  2LVP A;  3WAM A;  3PT2 B;  3Q3J A;  5L95 C;  1WGR A;  4URK A;  2HD5 B;  2KX0 A;  2MLB A;  3UQA A;  1Y8R C;  3QAQ A;  2KWV B;  5IAA C;  5LXH A;  4FHK A;  4EEW A;  2KN5 A;  3QC8 B;  2D10 A;  1R4N I;  2EKE C;  5CHW A;  5LXI B;  3BY4 B;  3RT3 B;  4DBG A;  4HDQ A;  2FNJ B;  1ZKH A;  3UGB B;  3QA8 A;  3TL5 A;  1LXD A;  2N1W A;  4DK5 A;  2KFK B;  5KHO A;  3CMM B;  2PE9 A;  3DVN U;  1WY8 A;  5J18 A;  2W9N A;  3IHP C;  2GBM A;  3VH4 B;  2KDB A;  1D3Z A;  1E8X A;  2DX5 B;  2UYZ B;  3PSE B;  4ANV A;  3UIP B;  3DBL I;  4IWP A;  2JF5 A;  2KAN A;  4HLE A;  1RAX A;  3QWZ B;  3ENE A;  4MGY E;  4PS3 A;  4M8N A;  4ICV A;  1E5W A;  2LZ6 A;  4GMV A;  4DDI D;  3A9K B;  3ZW3 A;  1GUA B;  2BKR B;  4LDT D;  3T9L A;  4HDO A;  5C1Z A;  4W9G A;  3MJW A;  2AWT A;  1JRU A;  2KDI A;  3IVF A;  2L76 A;  3OLM D;  1WM3 A;  4JL9 A;  4GDL A;  4IW0 A;  3B0A A;  1WXM A;  5C23 A;  3P2B A;  4PYZ A;  2WYQ A;  2NCN A;  3TMP B;  3O65 B;  1V80 A;  2M1M A;  2KC2 A;  3JW0 X;  3ONS A;  4G3X B;  2BGF A;  2GBJ A;  1UD7 A;  3A1Q A;  3HHM A;  4IWO A;  2MSE D;  5D6J B;  2ZVN A;  3WA0 A;  2Z59 B;  4JIO U;  1WJ6 A;  1V5T A;  1WIA A;  2KDE B;  2AYO B;  1Q5W B;  2JUO A;  4MSQ B;  4KZ0 A;  2NPT A;  2QHO A;  2KTR B;  2IY1 B;  2LXA A;  2I1J A;  3UIO B;  2Z0E B;  5DPR A;  1V81 A;  1C1Y B;  2BYF A;  1TZ1 A;  2KLC A;  1E8Z A;  4JQW C;  1GNU A;  3HM6 X;  2RSU A;  4E3C A;  3AU4 A;  1SE9 A;  4KIK B;  3RZW C;  2KX3 A;  2MP2 B;  3NY5 A;  4IM3 A;  2KFJ A;  5TR5 A;  4FLH A;  1WM2 A;  3DBS A;  3H7P A;  2D11 A;  4B9K A;  4DHZ E;  3A9J A;  4K81 A;  1VD2 A;  2JRH A;  3AXC A;  3PHX B;  4P7I A;  4W9H A;  5D94 A;  2LJ5 A;  5AZG A;  1M94 A;  2WX0 A;  2C5L C;  3QIJ A;  4G0N B;  2PEA A;  2VRR B;  1WYW B;  2N7E A;  1BT0 A;  1PQS A;  1V49 A;  2A4Z A;  3WIM A;  4ICU A;  2R2O A;  2AL3 A;  1EF1 A;  3QK0 A;  4FBJ B;  4LCD E;  3VH3 B;  2JY6 A;  1V6E A;  2M0X A;  3JSV B;  3JVZ X;  3DOW A;  4BKS D;  4HPM B;  3OJ4 B;  4MGK E;  2NR2 A;  2DZJ A;  4K1R B;  4DHJ D;  2REX A;  3A9K A;  5BO4 B;  1WGY A;  2KDF B;  1IP9 A;  4AJY B;  4IG7 B;  3QJZ A;  3PRM B;  2KC1 A;  2MBB B;  4NPN A;  4B95 A;  4GU2 A;  1E90 A;  1ZGU B;  2L7R A;  3HM3 A;  4HXD A;  4MM3 A;  3DDC B;  2AEH A;  5DCN A;  3PLV A;  1UBQ A;  2O2V A;  3VUY A;  4W9L A;  4WJP A;  3S2A A;  2A5U A;  1EUV B;  3PRE A;  4RMA A;  2N7D A;  2O6V A;  4BVU C;  1L2N A;  3L0W B;  2GBR A;  1YD8 U;  1WX9 A;  2KTR A;  2C9W B;  3L13 A;  2IY0 B;  4XZ4 A;  1WX7 A;  2G45 B;  4PYU A;  2GBK A;  1E8Y A;  1WJU A;  4RM9 A;  2LD9 A;  3PHW B;  4TV3 A;  4KIK A;  3L08 A;  2CHX A;  4KSK C;  1MG8 A;  2MP2 A;  4W9E A;  2G4S A;  3B08 A;  3VXW A;  4XC2 A;  2G3Q B;  2BPS A;  1OQY A;  2J0K A;  4NNJ B;  1XD3 B;  1UEL A;  2OOB B;  4TQ1 A;  1SGH A;  1J19 A;  3N30 A;  1IPG A;  4HVB A;  2KKC A;  1V2Y A;  2IZV B;  4GXB A;  4N9F 4;  2K39 A;  3LJ3 A;  5DPS A;  1WZ0 A;  2KLG A;  4BKT A;  3APC A;  3UIN B;  3DBH I;  2UWQ A;  3JSV A;  3TJP A;  1UH6 A;  3DPD A;  2FCQ A;  4HWI B;  5L83 A;  4FHJ A;  4NJ6 A;  4MJS A;  5J2R A;  4WWP A;  1WX8 A;  3X0W A;  2FCS A;  2KJH B;  2KMC A;  4EKU A;  4F8C B;  5JH5 C;  3ALB A;  2KD0 A;  2PJH A;  4KDI C;  2MCN B;  4ANX A;  2I1K A;  2RPQ A;  4MDK E;  3R66 C;  2J0J A;  1YX5 B;  2BWE S;  2M17 A;  3QX1 A;  2N4F A;  2M8S A;  4II2 B;  4KSL C;  4MEL A;  3NS8 A;  2RD0 A;  4FAD A;  1WJN A;  1E7V A;  3VDZ A;  3ZRF A;  2L0F A;  1UGM A;  4FJV B;  2LI5 A;  3M63 B;  2JZ3 B;  3KYD D;  2DYM A;  3I3T B;  4PS8 A;  2L00 B;  3VVW B;  2N9X A;  5D7G A;  2MX2 A;  4YL8 A;  3EEC A;  2K25 A;  2CR5 A;  4PS7 A;  2KZR A;  2LXC A;  4JLC A;  4M0W B;  3ZVV A;  4B6W A;  3PS6 A;  1WH3 A;  3ZUN A;  3HK0 A;  1OTR B;  2HE7 A;  3X23 A;  4AP4 C;  3SD5 A;  4I6P A;  1TBE A;  1V9J A;  2ZNV C;  3R3M A;  1LFD A;  3H7S A;  4FN2 A;  3R7Q A;  3Q3F A;  1J0G A;  3VUW A;  2PPH A;  2L05 A;  1EF5 A;  1T0Y A;  2L8J A;  4GSW A;  1GC6 A;  1WXS A;  3KUC B;  4NY0 A;  2NBV B;  5AZH A;  1E7U A;  2BYE A;  2CS4 A;  4WAA A;  3ZNH B;  3ZIM A;  1GG3 A;  5AEK B;  2KK8 A;  5CHV C;  2PE6 B;  2ASQ A;  4MGZ E;  1F9J A;  3IG3 A;  4W9C A;  2K1F A;  3B1L X;  3KH0 A;  4WWO A;  2BKF A;  2KO3 A;  2KTF A;  4AJW A;  3DQV A;  2JZZ A;  2NBW B;  3QHT A;  3WAL A;  4ANW A;  1HE8 A;  2KFK A;  3RD2 A;  1I42 A;  4K7U A;  3T8M A;  2HTH A;  1EO6 A;  2GBN A;  2C7H A;  2RR9 A;  5FR6 A;  1WMH B;  2MBQ A;  2MWS B;  3AU5 A;  3V62 A;  1VCB A;  2EMT A;  4A3O A;  4E74 A;  4EOY A;  2WDT B;  1WR6 E;  1YQB A;  4WWN A;  3ML9 A;  4W9I A;  4IWQ A;  4II3 B;  5KHQ A;  2WWZ A;  1SIF A;  2C7N B;  2IO1 B;  2MQJ A;  2C60 A;  3M95 A;  4A3P A;  3WAN A;  3N3K B;  4GDK B;  4IM2 A;  1Q0W B;  3H6N A;  2JXX A;  4HPL B;  1KLV A;  5DPW A;  2IBI B;  2GMI C;  2ZZP B;  3UQB A;  3V60 A;  3VTU A;  2LAS A;  2KHW B;  2O6V D;  1RLF A;  3H1U A;  4BFR A;  4J6I A;  2KJR A;  1WRD B;  2CKH B;  2J0M A;  3ZRC A;  3APF A;  1ZW7 A;  4K7W A;  1U4A A;  4TQ0 A;  4NQL B;  4ZRJ A;  2CHZ A;  3W1Y A;  1GJZ A;  3RUL A;  1Z2M A;  2V3S A;  4GOC A;  2FAZ A;  4NAW B;  4I6L B;  4MSM B;  3LDZ E;  4G11 A;  2LRU A;  2LWP A;  3BIN A;  1ISN A;  5CTR C;  1V86 A;  1WF9 A;  2D07 B;  3EFU A;  4MH0 E;  1FXT B;  2V4L A;  4HCN B;  2BWF A;  1Q1O A;  3L16 A;  3GZN I;  4HJK A;  4KVG B;  1UZX B;  2RGF A;  3SU8 X;  1P3Q U;  4CHK A;  1WJ4 A;  2DEN B;  2V1Y A;  2M4N A;  2MBO A;  3OJ3 A;  1A5R A;  1WMH A;  4LDT B;  3M3J A;  2LGY A;  4W9F A;  4KZC A;  5DPT A;  3ZNZ B;  4DWF A;  2IO3 B;  4BBN F;  2B3A A;  2DZM A;  2G4D B;  2DHZ A;  3PZD A;  2XK5 B;  3VFK A;  4EFO A;  3ZNG C;  2R2Q A;  4RM8 A;  1R4M I;  1LQB A;  3ZDT A;  4EZK A;  4F7Z A;  3A1Q B;  1XT9 B;  5JZE B;  3DBR I;  2N9P C;  3V61 A;  1P0R A;  3ZKJ C;  4HCP B;  3MTN B;  4OVV A;  2ZPN A;  2MRP A;  3K9O B;  4GDK A;  4DXA B;  5E6O A;  2NPT B;  3R7R A;  3W1S A;  3L10 B;  4FUL A;  3RZF A;  4WJQ A;  2K6D B;  2N1V A;  4MEM A;  3C0R B;  4ASW C;  4K7S A;  3KUZ A;  1X1M A;  4NJ7 A;  1WE7 A;  1H8C A;  3EC8 A;  3JYU A;  1NI2 A;  5CHF A;  3KYC D;  3ECI A;  2JT4 B;  2YVC A;  3D32 A;  1P1A A;  2ZNV B;  4I6N B;  2FIF A;  3VUX A;  1YJ1 A;  4M8M A;  4BOZ B;  2XBB C;  3H7P B;  2HJ8 A;  4G50 A;  5EDS A;  3A9J B;  2DZI A;  4BOS C;  2FUH B;  2CU1 A;  3QAR A;  2BYV E;  2OJR A;  2ZPY A;  4JGH B;  2DZK A;  3CSF A;  4W9J A;  4AWJ A;  5HKH A;  3EHV A;  4IUM B;  2DYO A;  3ZTD A;  3KVF B;  2JWZ A;  5J17 A;  5CX3 A;  2D3G A;  4NAW A;  3MHS D;  3IBE A;  2BF8 B;  3K9P B;  4BBN C;  2FCM A;  2NBU A;  4W9K A;  3ZNI D;  4F1S A;  3AI5 A;  2DAJ A;  2MBE A;  3RUI B;  4X57 B;  2J7Q B;  3TBL D;  4CO7 A;  5E6N A;  1WI0 A;  3ZLZ A;  1WZ3 A;  3RYT A;  3H9D A;  2NVU I;  3U8Z A;  4A20 A;  3CST A;  2KNB A;  4GN1 A;  2AL6 A;  3M62 B;  4KDL B;  3PTF C;  3ZDM C;  1YIW A;  4DHJ B;  2N9E B;  3DCG A;  3WAP A;  2LVQ A;  1RFA A;  2K8B A;  1RRB A;  2ZEQ A;  4ZRK A;  3RCZ A;  2XK5 A;  2JPH A;  2O2V B;  2KOX A;  4DHZ B;  5AZF A;  4FJZ A;  2K8H A;  2KXJ A;  2ZCC A;  1GC7 A;  4WJN A;  1WGD A;  4E71 A;  1P9D U;  4LJP B;  5IA7 A;  1WE6 A;  1G6J A;  4FJY A;  4AOF A;  1LM8 B;  2O6V B;  3TCA A;  3L54 A;  1W6V A;  5D2M B;  1KM7 A;  1OEY J;  3A33 B;  4DDG D;  2L3Z A;  3TIX A;  3VAW A;  2IO2 B;  4AUQ C;  2MA9 B;  3PLU A;  2IYD B;  1TGZ B;  1V5O A;  3U30 A;  3PRP B;  3VTV A;  2KWC A;  2LVO A;  1S3S G;  3PV1 A;  2KWU B;  3ZTC A;  5G55 A;  1KJT A;  1S1Q B;  5JHA A;  3QCA A;  1P98 A;  4MGI E;  2YLM A;  2GOW A;  2IO0 B;  1WFY A;  3PVL A;  4KV2 A;  2DAF A;  1Z5S B;  2K6Q A;  4WQO B;  3IFW B;  3N32 A;  2JVC A;  4GGQ A;  4ZDV A;  3DVG Y;  3PPA A;  2KVR A;  1WGH A;  3A4R A;  1XQQ A;  1L7Y A;  1K8R B;  1CMX B;  3V6E B;  2FID A;  1WXA A;  3NOB A;  3WAO A;  2FCN A;  2MBH A;  4IC7 B;  1KOT A;  4GIV A;  2K8C A;  1UBI A;  4XX5 A;  3A4S C;  1I35 A;  3U7D A;  3AUL A;  2KJ6 A;  1H4R A;  2DYB A;  4MJS B;  1E8W A;  3DVG X;  1NDD A;  3PGE A;  4IM0 A;  4TKN A;  4BKS A;  2D2Q A;  3NZU A;  3VHT C;  1IYF A;  3VTW A;  4OVU A;  3ML8 A;  3ZO5 B;  2EMS A;  3PRZ A;  2KQ7 A;  4GB9 A;  2Y5B B;  4WJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...