5C23A

Parkin (s65dublr0rbr)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
405
structure length
384
Chain Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQDIVHIVQRPWRKGQEMNATNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGNGFAFCRECKEAYHEGECSAVFEYRVDERAAEQARWEATTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Disruption of the autoinhibited state primes the E3 ligase parkin for activation and catalysis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 85
structure length 384
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5c23A01
2MLBA 2FUHB 3TIXA 2M0XA 1BT0A 5KHQA 3DPDA 1WF9A 3VUXA 3MJWA 4HWIB 3PRMB 4KIKA 3IVFA 4GIVA 5JH5C 2RGFA 1WXAA 5GMVA 2HE7A 4GB9A 2MBBB 4I6PA 2DHZA 1WMHB 2W9NA 3UIPB 3VUYA 5DPSA 4JQWC 2LXCA 4I6LB 2KWCA 3N30A 3ZDTA 2KMCA 2MW5A 3ZNHB 1WM3A 3PGEA 2V1YA 1WJ4A 4EUTA 4IM2A 2R2OA 1Q1OA 1WM2A 4WJPA 1E7UA 4W9KA 1TZ1A 1IYFA 2GBNA 2J7QB 1WR6E 2V4LA 2ZEQA 3PLUA 2NR2A 2KNBA 2RR9A 2LWPA 3QAQA 1Z5SB 1WFYA 2C5LC 3WANA 2K39A 2L76A 4FJZA 2MP2A 1ZW7A 4OVUA 4KZ0A 4EZJA 2PE6B 2MSED 1J0GA 3B1LX 2MCNB 3IHPC 2LVOA 1P98A 3EECA 2KO3A 3RUIB 2IZVB 4K7UA 4II3B 2N1VA 2VRRB 3UINB 3NHEB 4ICUA 5C23A 4NQKE 3R7QA 3V6EB 3KUZA 3A9KA 4NJ6A 4MELA 1LM8B 2L7RA 1MG8A 3EHVA 1RLFA 2KHWB 1ZGUB 2AYOB 3L0WB 2KQSA 2MWSB 4GGQA 2BYEA 1H4RA 2NPTB 5G2NA 2KFKA 3PRPB 3L10B 1UGMA 1RFAA 4CHKA 4IWPA 4ANVA 2DZJA 4PS8A 4HPMB 1OTRB 2Y5BB 3M63B 1U4AA 4W9DA 3SDLC 3KH0A 2D2QA 2FCQA 4DXAB 1WRDB 3CMMB 3L08A 5CHFA 1WXMA 5L95C 1V49A 1NDDA 3QX1A 2C60A 5J2RA 4FLHA 2IO3B 2KWVB 4WWPA 2CS4A 2BYVE 3RT3B 1E90A 2MBEA 3O65B 3ML8A 1P1AA 2KZRA 1WMHA 3V6CB 4TKNA 2ZPYA 2Z59B 5LLIA 2RD0A 3DBLI 1E8XA 5CX3A 4KVGB 4W9LA 3EC8A 3OLMD 2IO2B 2UYZB 3DBRI 2IO1B 5D94A 3ZRFA 1EF5A 3VHTC 3LJ3A 1GNUA 4GMVA 4M8NA 1UELA 3NY5A 5JHAA 2D07B 1EUVB 3TL5A 3QCAA 1S3SG 1WGGA 5AZFA 3QA8A 2KDIA 2G4DB 1L2NA 4EEWA 2G4SA 1UZXB 4W9CA 2GBRA 2WX0A 1E8WA 2KX0A 2WX1A 3UF8A 2LZ6A 1WX8A 2KVRA 1OQYA 3ZDMC 2M1MA 3P2BA 4FADA 2AL6A 2RSUA 3ZO5B 3M62B 4LDTB 3A33B 2JT4B 4F8CB 4HPLB 3A9JB 1WZ0A 2KDBA 1VD2A 2LGDA 1J8CA 2NBVB 3HM6X 3MTNB 4G50A 3AULA 3NOBA 4FHKA 4NY0A 3U8ZA 3ZW3A 2CU1A 4KDLB 4BBNF 3PVLA 1WYWB 2JVCA 1VCBA 5DPWA 4HJKA 4B95A 4LDTD 4DHZE 1UD7A 3QHTA 2EKEC 2KLGA 2KTFA 2HJ8A 4N9F4 3T8MA 2K8HA 2JRIB 2BPSA 2M4NA 1P9DU 3L54A 2KTRB 5DPTA 3RCZA 3ZUNA 3I3TB 4ANWA 2D11A 4GDLB 2IBIB 2L00B 1WE7A 2PE9A 1EO6A 2DENB 4FN2A 2YVCA 4B6WA 3DCGA 1WGDA 4AJWA 2EMSA 4NPNA 4BFRA 1M94A 4IUMB 2Z0EB 1YX6B 1PQSA 4HDOA 1UH6A 1OEYA 1GC6A 2LXAA 3C0RB 2Z0DB 3OAWA 3M95A 2FNJB 2HTHA 4FBJB 2G3QB 4HK2A 4AUQC 4AWJA 1R4MI 4BBNC 2BWFA 2XK5A 5D7GA 3ZKJC 4K7WA 1C1YB 3ENEA 1V80A 4XC2A 2I1JA 3D32A 4RM8A 3B0AA 3N3KB 1LFDA 2KANA 2KC2A 1G6JA 3BY4B 2OOBB 4KDIC 4HDQA 4F1SA 3R66C 1KM7A 3HHMA 3WALA 2JRHA 4JL9A 4ZRKA 1SGHA 1K8RB 2D3GA 2UWQA 3L17A 1UBIA 1WGHA 2LGXA 4ZDVA 4TQ0A 4BKTA 1WI0A 4GU2A 1IP9A 2GMIC 2ZNVB 3R7RA 3VAWA 2LD9A 3AU5A 1V5TA 2CHZA 3A9JA 2I1KA 3QIJA 3ZLZA 3PRZA 2WYQA 3DDCB 1TBEA 1TTNA 2N7DA 2BKFA 4GDKB 1GC7A 3NS8A 3VH4B 3V60A 4FA6A 3K9PB 4ASWC 4IC7B 2KWUB 3WAMA 4WJNA 3AXCA 4DDGD 3L13A 4NNJB 4MJSB 5JHBA 1GG3A 2IY0B 5E6PA 2L3ZA 3WIMA 2FIDA 1NI2A 2ZCCA 2C7MB 3JSVB 4MM3A 2JF5A 3Q3JA 4W9IA 1X1MA 2K6DB 2KTRA 2LVPA 2KDEB 2MX2A 4GDLA 4JLCA 4GOCA 3UQBA 3WAOA 2KD0A 4DDID 4NAWB 4A3OA 2ZCBA 5JZEB 3PSEB 3H6NA 1YX5B 1WJNA 1C3TA 3IG3A 2ZPNA 3SU8X 4KSKC 5LXHA 3ZTCA 4KZCA 2FIFA 4A20A 2WDTB 5EDSA 1NBFC 2MRPA 4FJYA 1SE9A 3A1QB 4EFOA 4BKGA 3W1YA 2LASA 3PTFC 3APCA 3VUWA 1GJZA 2N7EA 2KXJA 3DVGX 2DZIA 2N9XA 3KUCB 3LDZE 5D2MB 1Q0WB 3CSFA 3NZUA 4I6NB 5DCNA 2KKCA 3QWZB 1YJ1A 4E74A 1ZKHA 3U30A 2JWZA 3PHXB 4II2B 3VTVA 3RD2A 1KOTA 4GXBA 1HE8A 1I35A 5TR5A 2CKHB 3U7DA 3APFA 3V62A 4AP4C 3PT2B 1T0YA 1KLVA 2MBOA 4MGYE 2NCNA 2DYMA 4MGKE 2BGFA 4CO7A 1V2YA 2ZNVC 3H1UA 2C7HA 1V81A 2K6QA 2DYBA 2L05A 3KW5B 1AARA 2BKRB 4W9HA 4YL8A 3H7PB 5IAAC 2PEAA 4NQLB 4KSLC 4PS7A 3ALBA 1V86A 1QZEA 5IA7A 3H9DA 3A4SC 2DAFA 3KYCD 4DK5A 2KJ6A 2FAZA 1TGZB 3VQIA 4DHJD 3HK0A 2KC1A 2HD5B 4ZRIA 3VVWB 2N4FA 1E7VA 1YQBA 2NPTA 4B9KA 2MQJA 3DBHI 3ZNZB 2K8BA 3ZNID 2CR5A 1WGRA 5L83A 2O2VB 3VTWA 3Q3FA 4FULA 4W9GA 4IM0A 3JW0X 2A4ZA 4IW0A 3MHSD 2JUOA 4IWQA 4WJQA 1P3QU 2MA9B 3RZFA 4M0WB 4P7IA 2ASQA 3PLVA 2PPHA 3JVZX 4E3CA 2V3SA 5CHVC 3K9OB 3A1QA 1WX7A 4MGZE 1WJ6A 2JZ3B 2JPHA 3W1SC 2L8JA 4AOFA 2AEHA 2LJ5A 4JIOU 4NJ7A 3W1SA 1LQBA 4W9FA 1OEYJ 1A5RA 4HCPB 2C9WB 3PHWB 2K1FA 1E8ZA 1Y8RC 3IBEA 5BO4B 2O6VB 4URKA 2XBBC 3NZSA 1Q5WB 4ANXA 4HLEA 2KOXA 3ONSA 4OVVA 4FJVB 2RPQA 5E6OA 4IWOA 3ML9A 5C1ZA 1OGWA 1V9JA 2R2QA 2KJHB 4J6IA 2WWZA 1WH3A 4G0NB 4GN1A 4IM3A 4MSQB 2O6VD 3DVGY 4FHJA 3AI5A 4ICVA 2IO0B 2IY1B 3HIZA 1XD3B 4MEMA 4K1RB 3SD5A 3WA0A 2XEWA 3H7PA 2M17A 2OJRA 3B08A 2KDFB 4EZKA 2K25A 2N9PC 2C7NB 2DAJA 1F9JA 5CTRC 4DHZB 5LXIB 3RULA 2NVUI 3QARA 4MH0E 2B3AA 2JZZA 3PREA 3VDZA 1H8CA 4TV3A 1I42A 3SHQA 2AL3A 1V5OA 3OJ3A 2ZZPB 1UBQA 2DZMA 3HM3A 1E5WA 1S1QB 4PYZA 4BVUC 3QK0A 3PS6A 4IG7B 2MBQA 2LRUA 2GBJA 1WR1A 2CHWA 2O2VA 1WXSA 3GOEA 4G11A 4EOYA 3CSTA 2ZJDA 1R4NI 4WAAA 1L7YA 3ZTDA 3WAPA 4W9JA 5D6JB 4XZ4A 1LXDA 3RYTA 4BOZB 5J18A 3ZRCA 4X57B 2G45B 3ZVVA 3TJPA 2A5UA 3S2AA 3DOWA 1RRBA 3V61A 2CHXA 3DQVA 4ANUA 3IFWB 3L16A 3RZWC 4TUUA 2DZKA 2KX3A 3CF6E 3TCAA 3VH3B 4RM9A 5J17A 4EKUA 4DBGA 5FR6A 2GOWA 2IYDB 2AWTA 4A3PA 1GUAB 1WZ3A 1XT9B 1RAXA 2MBHA 4HCNB 3H7SA 1WXVA 2KJRA 3VFKA 4DWFA 2O6VA 4BKSD 2GBMA 2M8SA 4TQ1A 2YLMA 4WJOA 2KLCA 2NBUA 2ZVOA 1YIWA 1IPGA 3DBSA 1YD8U 3R3MA 3ZIMA 4WWOA 1J19A 3ZNGC 1SIFA 3JYUA 2FCNA 5KHOA 2ZVNA 1WY8A 3ECIA 2FCSA 3N32A 2FCMA 4F7ZA 2LVQA 5HKHA 4EZLA 4HVBA 5DPRA 3QC8B 3UQAA 2K8CA 4JGHB 2KK8A 2NBWB 4MGIE 1JRUA 4LJPB 4W9EA 3TMPB 3T9LA 3VXWA 4KIKB 2LGYA 3PPAA 2DX5B 3X23A 3APDA 5E6NA 4PYUA 1EF1A 3EFUA 5AEKB 2LUEA 3A4RA 4BOSC 4DHJB 3AU4A 4HXDA 4GSWA 2XK5B 4GDKA 1XQQA 4XX5A 2EMTA 2N9EB 2L0TA 3OJ4B 2KN5A 1D3ZA 5AZGA 2KMAA 2N1WA 1WGYA 4MJSA 3KUDB 4ZYNA 3KVFB 3JSVA 3DVNV 4K81A 2J0JA 3PZDA 4PS3A 2KFJA 3KYDD 4LCDE 1ISNA 4WQOB 3GZNI 3PV1A 1WX9A 4NAWA 2JXXA 2MP2B 2NS5A 2BYFA 4BKSA 2L0FA 4MDKE 3UIOB 3X0WA 3QJZA 4G3XB 2LI5A 1FXTB 3VTUA 1WIAA 2GBKA 2REXA 4WWNA 5G55A 4E71A 4MSMB 1Z2MA 2J0MA 1CMXB 4AJYB 2BWES 3QQ8B 2LRWA 2KQ7A 1V6EA 1WJUA 3A9KB 4KV2A 5CHWA 1E8YA 2D10A 2QHOA 4M8MA 2DYOA 4K7SA 2PJHA 1P0RA 2BF8B 3M3JA 3BINA 4LJOB 5AZHA 3TBLD 3UGBB 4CYEA 2JY6A 4RMAA 3DVNU 2KFKB 1KJTA 2J0KA 4ZRJA 1WE6A
chains in the Genus database with same CATH superfamily
3N1XC 2BW2A 1BT0A 4WQMA 3MJWA 1F2RC 4HWIB 3PRMB 4KIKA 3SFDB 2HE7A 3UI3A 4CQNA 1XCTL 3ZDTA 2MW5A 2L1AA 1WM3A 4OW0A 4EUTA 1Y56A 2R2OA 4WJPA 3NVYA 1HA5A 2IGGA 1IYFA 1F2RI 3PLUA 2KNBA 2WDQB 1SF0A 2WXFA 4FJZA 1SBBB 4OVUA 3B1LX 2MCNB 2M19A 4K7UA 5C23A 4NQKE 4R3DA 1RWSA 3Q8AA 4NJ6A 3EHVA 1AWDA 1L4DB 1ZGUB 2Q5WD 2KQSA 3R2IA 3NRZA 1H4RA 2NPTB 4J3OD 5G2NA 2NTSA 4KGSA 1A70A 1UGMA 2DZJA 4HPMB 2Y5BB 1JWBD 1J7BA 1QOGA 3L08A 2J53A 2J42A 5J2RA 2IO3B 2KWVB 2CS4A 2WXJA 1E90A 3OG5A 4TKNA 2ZPYA 2Z59B 1E8XA 2D3BA 5D3IB 3ZRFA 3VHTC 2CJOA 2JWUA 1PGAA 4YTPB 4GMVA 1N60A 5JHAA 2Y5PA 3GB1A 3NVZA 2KDIA 5C2TB 4EEWA 1DOYA 2G4SA 2WX0A 4MT5A 3ZJVA 2WXIA 2LZ6A 1AN8A 2KVRA 3ZDMC 2AL6A 3P1MA 3AEFB 1V1OA 2E6XA 3A33B 3A9JB 1WZ0A 1VD2A 1RFKA 4OZBA 2N9KA 1J8CA 3MTNB 4G50A 1T0QC 3AE2B 4BBNF 1VCBA 3IAS1 4HJKA 4BZAA 1FNVA 2MEKA 2WU5B 5IN7A 1UD7A 2JRIB 3Q14C 1P9DU 1UGJA 2KTRB 2B76B 3I3TB 1ZOYB 4FN2A 2YVCA 1BMLC 2JSVX 1UH6A 2ON8A 2LXAA 4WWMA 3M95A 4FBJB 4AWJA 2QJLA 3DHGC 3ZKJC 2I1JA 3D32A 2K22A 2N7JA 2BS4B 1G6JA 5G5GA 5BYSA 3ZJUA 4HDQA 2JRHA 4JL9A 4ZRKA 1SGHA 1RYJA 2W82A 2E3TA 1FD6A 1WGHA 4ZDVA 4WH4A 4NZLB 2GMIC 2K0PA 2ZNVB 2N0SB 3VAWA 2LD9A 3AU5A 3QIJA 3ZLZA 3PRZA 2PW9A 4LNNA 4N6EB 2BKFA 2INDC 4ASWC 3AXCA 3R2TA 5E6PA 2L3ZA 1NEKB 1WWTA 2C7MB 4UDUC 1F0ZA 3Q3MC 1VZ6A 3WAOA 1EWCA 1QOBA 2WXRA 4KSKC 4KZCA 4RGTA 1TS5A 4FJYA 4EFOA 4BKGA 3W1YA 3VUWA 1T0RC 5FR3A 3LDZE 5D2MB 5DCNA 2KKCA 1YJ1A 3N1YC 2JWZA 2NTTA 3PHXB 1YJJA 1I35A 4LNIA 3U7DA 4AP4C 2WP9B 3AE9B 1KLVA 4M00A 4AS1A 2BGFA 2INNE 3Q6BA 4KKJA 5EE3A 1AARA 2BKRB 2J4XA 1JRPA 4WIPA 2PEAA 4O1NA 4C4VB 2TSSA 1QZEA 2BQQA 2GI9A 3RNAC 1CQVA 1GPXA 5LNK1 5C3JB 2FAZA 1TGZB 2KC1A 4HPPA 1YQBA 1VZ8A 4B9KA 3ZNZB 2K8BA 2INPE 2O2VB 3VTWA 3Q3FA 4FULA 4W9GA 3N9YC 2PVGC 1SSNA 2JUOA 1P3QU 1D6EC 3PLVA 3CIRB 5CHVC 3K9OB 4MGZE 3HVZA 1EWYC 2AEHA 1GB1A 3W1SA 1OEYJ 1YJIA 2I2YA 1E8ZA 3IBEA 4URKA 3V05A 1Q5WB 4OVVA 2RPQA 2W55A 4G0NB 1L0XB 3AI5A 5HFYA 1XD3B 2XEWA 2VZKB 3Q8CA 3RNFC 1I4QA 5EE9A 1TIFA 1ACCA 1F9JA 5CTRC 3EUB2 1CK1A 3RULA 3QARA 4MH0E 3VDZA 4TV3A 3SHQA 2MH7A 2VZKD 4AQ7A 2ZZPB 1UBQA 4YTMB 2WXOA 2AQ1B 3B2GA 3QK0A 2LRUA 3AV8A 1VDVA 3AEDB 1R4NI 1L7YA 3WAPA 4W9JA 4XZ4A 4YTNB 4LNFA 5J18A 2RDHA 2WLBA 3TJPA 4JE3B 3S2AA 3V61A 2CHXA 3DQVA 2DZKA 3CF6E 1KRHA 1HEZE 5FR6A 5EE0A 1XT9B 2MBHA 1RAXA 5E6JA 2KJRA 3VFKA 4C7ZA 2LHEA 4WJOA 3ETRA 4A6QA 2KLCA 2ZVOA 1IPGA 1YD8U 1J19A 3JYUA 2FCNA 3ECIA 3AN1A 5HKHA 1T6BX 2K8CA 4JGHB 3RNGC 4MGIE 3TMPB 4K3CA 4ACFA 3O13A 3AEEB 3PPAA 3X23A 1TY2A 1I4XA 4BOSC 4DHJB 4PT5A 1C79A 1XCQL 1KTKA 2N1WA 3C19A 4MJSA 3KUDB 3TEXA 3LYYA 2WU2B 1L6UA 3I57A 4HJGE 2KFJA 3P63A 3SFEB 4LCDE 4RF0A 1E7PB 4NAWA 4B0MA 2MP2B 2WDVB 1WYGA 3X0WA 3QJZA 2ZW1A 2GRIA 3Q8FA 4MACA 1TKGA 1I4HA 4MSMB 1CMXB 1LO5D 2D10A 2QHOA 4M8MA 2DYOA 4K7SA 2PJHA 2BF8B 4MM3B 4LJOB 1ET6A 3AE3B 5AZHA 3UGBB 4C00A 1WE6A 1SJHD 3RMKC 2FUHB 5MPOA 2W54A 3DPDA 4GIVA 5JH5C 3J9CA 3HVDA 5GMVA 4GB9A 2DHZA 1MG4A 1WMHB 2W9NA 3UIPB 1KF6B 1QF6A 2MJEA 2WQYB 3V3XA 1WSPA 3PGEA 1TY0A 1C77A 1K53A 2N9LA 1WM2A 1E7UA 4OHJA 1XO3A 2GBNA 1WR6E 2V4LA 2ZEQA 2NR2A 2RR9A 3QAQA 1WFYA 3TSSA 4A55A 1QOFA 3FILB 3RPFC 2BS3B 1KLUD 2MSED 4M0WA 3EECA 1K52A 3RUIB 4KGTA 4II3B 2N1VA 2VRRB 3NHEB 3R7QA 3V6EB 3KUZA 1LM8B 1FXIA 2KWDA 3IAM1 2KHWB 4YT0B 3NS1A 2FBWB 3L10B 2RDGA 1EU4A 2R61A 1DOXA 3M63B 4W9DA 3PZ7A 3KH0A 2FCQA 3CMMB 3MHZA 1V49A 3QX1A 4LLGM 2DLBA 3BYTB 5TSSA 2KZRA 3V6CB 5LLIA 4ZHPA 2RD0A 5CX3A 3EC8A 3OLMD 3R8BA 2UYZB 3EFCA 5D94A 4OZAA 2OEDA 4WAFA 4Q2JA 3NY5A 1MPEA 3VRAB 2D07B 1EUVB 1YN4A 3RFZB 3TUOA 3T3NA 3FC4A 4W9CA 1YNTE 2IGHA 3UF8A 1OQYA 2M1MA 3ZO5B 2QMTA 1R4NB 4F8CB 4HKZE 3HM6X 3NOBA 4FHKA 3U8ZA 3ZW3A 2CU1A 4ZRQA 3PVLA 2JVCA 1TT5B 4YXDB 2HJ8A 2K8HA 2AQ2B 2BPSA 2D3CA 2PKOA 5DPTA 3RCZA 4ANWA 2IBIB 1N63A 1WGDA 4IDIA 4NPNA 4BFRA 1M94A 4IUMB 2BBCA 1OEYA 1GC6A 2Z0DB 2QC8A 3OAWA 1ZPSA 3KLSX 2HTHA 1FMAD 1JWAD 4BBNC 2BWFA 4ZHOA 5D7GA 1V80A 4XC2A 4RM8A 1LFDA 2KANA 2JYTA 2KC2A 2VH2A 2OOBB 4A9AA 3R66C 3MJ5A 1K8RB 1UBIA 2RPVA 4TQ0A 4BKTA 1N61A 2KMMA 2EELA 1QOAA 1V5TA 2CHZA 3A9JA 3C8YA 5HHDG 3DDCB 1TBEA 1FIQA 2ONQA 1FXAA 3NS8A 3WAMA 4DDGD 1D5XC 1AYFA 3BZDB 3WIMA 1I4GA 1NI2A 2ZCCA 3W2DA 3JSVB 1LGRA 3Q3JA 4W9IA 2KTRA 1HTQA 1XLOA 3B2FA 2ZCBA 3H6NA 2G9HD 4NAMA 1WJNA 1C3TA 4A20A 3A1QB 2LASA 4OVZA 2N9XA 3IT4B 3KUCB 1TS4A 1Q0WB 1CZPA 1I4RA 1KOTA 4FXCA 1HE8A 4DXGA 3PT2B 4MGKE 4CO7A 4LNKA 1V2YA 3KW5B 1HZ5A 3SR6A 4YL8A 4NQLB 4KSLC 1FCCC 1V86A 3P42A 2KJ6A 3VQIA 3HK0A 2N4FA 5FK9C 1L4ZB 3DBHI 4L23A 3ZNID 1WGRA 5L83A 1IGDA 3AEBB 2Y5CA 4IW0A 4TSSA 1JW9D 3RZFA 2PPHA 3JVZX 3MC9A 3OWEB 4DQOC 3EA6A 1L0VB 1PGXA 1WX7A 1C4CA 5BMGA 3W1SC 4AOFA 4W9FA 2WXPA 2K1FA 1I4PA 1Y8RC 2V3NA 2XBBC 1MFWA 4ANXA 4HLEA 4RGMA 1TZOA 5E6OA 2D3AA 1C76A 1OGWA 1V9JA 4J6IA 1WGKA 4IM3A 3PO0A 3MP9A 4YSYB 2IY1B 3HIZA 4K1RB 4YSXB 1GAQB 3B08A 4EZKA 1ZXIA 2V3PA 2L32A 2C7NB 3AM9A 4C7YA 3Q8BA 5LXIB 1MHXA 2NVUI 1IBXA 2JZZA 1I42A 3AE4B 1RM6C 1V5OA 2HDEA 3VR9B 4PYZA 4RCOA 3DHIC 3PS6A 1JWMD 2MBQA 2GBJA 3Q2AC 1WR1A 2O2VA 4EOYA 2ZW0A 2WS3B 4WAAA 2KDMA 3RYTA 1XLNA 1RRBA 2WXLA 4ANUA 3IFWB 1L5PA 2LFIA 3L16A 1JALA 3TCAA 4RM9A 4EKUA 4A3PA 1GUAB 1WZ3A 3H7SA 3KWLA 2M8SA 4S0RA 1WRIA 2YLMA 2BT6A 3DBSA 3ZIMA 4WWOA 1WY8A 1QQRA 1N5WA 2FCMA 4F7ZA 4EZLA 4K3BA 3QC8B 3UQAA 2LGSA 1FEHA 2KQ4X 4LJPB 3NVWA 2LGYA 3HUIA 5E6NA 2LUEA 3N1ZC 4GDKA 4XX5A 2N9EB 3OJ4B 1ZP0B 2KT7A 4ZYNA 2X38A 3DVNV 4K81A 2MJDA 3PZDA 1J7CA 1ZDVA 2NMQA 3KYDD 5EE1A 4RNAA 1EM7A 1QILA 1TS2A 1HXYD 1VZ7A 1XLPA 2NS5A 3CWIA 3UIOB 3VTUA 2EKIA 1WIAA 1M4VA 4N58A 2CJNA 3QQ8B 2KQ7A 3U2SC 3A9KB 1E8YA 3AE1B 1D5MC 1PDXA 4QAYA 4YWGG 4CYEA 1OFFA 2KFKB 4ZRJA 2MLBA 3TIXA 1OQRA 3IVFA 4HKQA 2MBBB 2PVOD 3VUYA 5DPSA 2LXCA 4I6LB 3N30A 2KMCA 1WJ4A 4IM2A 4JPSA 4ZYSA 2LWPA 1Z5SB 2C5LC 3WANA 2K39A 2L76A 3BVMA 2MP2A 1ZW7A 3EGRA 4KZ0A 2FE8A 1FNWA 3IHPC 3W5VB 1P98A 1IUEA 4RFBA 2KO3A 2IZVB 4RGOS 2QIEB 3UINB 4ICUA 4XYCA 4JWSC 3NZ3A 4MELA 3TEZA 1MG8A 1E9MA 4US8A 3L0WB 2MWSB 5IKCM 4GGQA 2BYEA 3PRPB 3TEYA 3GS2A 4PS8A 1SB3C 2JXTA 4DXAB 1PFDA 1WRDB 2CU3A 1AW7A 4RF1A 1WXMA 1K51A 4WWPA 3RT3B 3O65B 1P1AA 1WMHA 1FM0D 3DBLI 4KVGB 4W9LA 3DBRI 5BYQA 5G5HA 2BB6A 3VRBB 1EF5A 1GNUA 4M8NA 1DOIA 3TL5A 3QCAA 1S3SG 5AZFA 3H8HA 4ARCA 2G4DB 4XWTA 2RDBC 4TMAB 2PLPA 1E8WA 3BIID 1MHHE 2KX0A 5H8YE 1DGJA 3GE8C 3P2BA 2JT4B 1ZXHA 4HPLB 2LGDA 2NBVB 3AULA 3FKYA 1FRDA 3HRDD 4KDLB 1WYWB 5DPWA 1UF0A 1YQ3B 2JZPA 4DHZE 2M0AA 2KLGA 4N9F4 3NUHB 2M4NA 2OJWA 2D11A 4GDLB 1WE7A 2DENB 4AJWA 2EMSA 1C4AA 1PQSA 3NJTA 3C0RB 2H89B 4KGRA 4P1BC 2X8XX 2G3QB 4HK2A 4AUQC 1R4MI 2XK5A 4DXFA 1ET9A 4K7WA 3ENEA 5BYRA 1P7EA 4KDIC 1L6VA 1KM7A 2YEPF 4D2KA 2LJIA 3L17A 4GU2A 1IP9A 1Q10A 3R7RA 1PGBA 2I1KA 2M56B 2LMCA 3V60A 3DHHC 4IC7B 5JHBA 3L13A 4NNJB 4MJSB 2JQRB 2FIDA 4GLSC 2L83A 2WXHA 1ENFA 2K3UA 1VJKA 2XN9C 2KDEB 4JLCA 4ITKA 4NAWB 1SJED 4A3OA 3PSEB 1YX5B 1NYRA 2ZPNA 2J52A 3SU8X 5LXHA 4REZA 1HTOA 1SE9A 1KH0A 3P4PB 4NJCA 3APCA 1GJZA 2N7EA 3RI7C 3DVGX 2DZIA 5HI1A 3CSFA 3NZUA 4I6NB 4S17A 4C56C 1ZE3D 4E74A 1F52A 3U30A 3BK1A 4II2B 3VTVA 4USAA 3APFA 4M01A 2MBOA 2PTLA 3PZ8A 2NCNA 2DYMA 2ZNVC 4B0EA 2C7HA 1SIJA 1V81A 2DYBA 1GOZA 4W9HA 3H7PB 5IAAC 1XLQA 5IA7A 3FAHA 3IT6B 1XF5L 2DAFA 1B1ZA 1HZ6A 3LB8C 1E7VA 1K50A 2NPTA 2OHFA 2MQJA 4IKGA 2CR5A 2GB1A 3JW0X 2A4ZA 4IWQA 4WJQA 4M0WB 4P7IA 2ASQA 1V1PB 4E3CA 2V3SA 3A1QA 3Q3NC 1WJ6A 2JZ3B 2LJ5A 4JIOU 4NJ7A 1SE3A 1A5RA 3VR8B 3PHWB 2SAKA 4JX1C 5BO4B 2O6VB 3DBLB 3U4EG 2KOXA 3ONSA 3ZQ4A 3ML9A 1I7HA 3ZYYX 2KJHB 2WWZA 1MJDA 1OQQA 2O6VD 3DVGY 4FHJA 2IO0B 4MEMA 4US9A 3DWGC 3SD5A 3MC8A 2M17A 3TEWA 2K25A 3L4PA 1FRRA 2I38A 2Z8LA 1E5WA 4PK1A 3WCQA 4A90A 5IOIA 2WXKA 4G11A 3GOEA 3CSTA 2BYTA 1LXDA 1EU3A 4ZOHC 1PUTA 3ZRCA 1ROEA 2A5UA 1IGCA 3DOWA 1P7FA 2H88B 3RZWC 3VH3B 5J17A 1D5ZC 4HEA1 5IP4D 2GOWA 2IYDB 2AWTA 1PYWD 1WXVA 3E56A 2WXGA 4BKSD 2WDRB 4C80A 1YIWA 1R4MB 1T5XD 1JWUD 1B9RA 3ZNGC 2ZVNA 4L2YA 2FCSA 3AE5B 3N32A 2INCC 4HVBA 5DPRA 2QEJC 4W9EA 1MVKA 4XDDA 1R7SA 4KIKB 4N59A 2LGIA 1ZDXA 1EF1A 3EFUA 1QT9A 4GSWA 1XQQA 2EMTA 2L0TA 2G1EA 1D3ZA 3KQ4A 2MHJA 2J0JA 1SE4A 4HRSA 5GXGB 3GZNI 1E6EB 3BVZA 2BYFA 2L0FA 4G3XB 2LI5A 4XGAB 1FXTB 3Q69A 1TYGB 2LUMA 2REXA 4WWNA 5G55A 1TS3A 2BWES 4KV2A 1V6EA 1WJUA 2LEKA 4LTUA 3BINA 2KACA 5FKAC 3DVNU 1F1HA 3RNEC 1NYQA 4RH6A 5IO9A 2M0XA 5KHQA 3U7ZA 1VLBA 1WF9A 3VUXA 2RGFA 1WXAA 3RNBC 2V4IB 4I6PA 4WURA 4YSZB 3ABVB 2IJ0A 4JQWC 1QLBB 2D5GA 3AECB 2KWCA 4C4VA 2QCZA 3ZNHB 2BVCA 2V1YA 1QKZA 1FO4A 4P1CC 1Q1OA 4W9KA 1TZ1A 2J7QB 3I63C 1HQRD 5JXVA 2W3RA 4EZJA 2PE6B 1J0GA 4RGNA 2LVOA 3NG0A 1SEBD 3W5UB 3AE6B 2SEBD 3E9SA 3A9KA 2L7RA 3U52E 1RLFA 5AUKA 2AYOB 2WXNA 4KKIA 2QILA 2KFKA 1N5XA 1RFAA 4CHKA 4IWPA 4ANVA 1OTRB 1U4AA 3SDLC 2D2QA 5CHFA 5L95C 2L52A 1NDDA 2C60A 4FLHA 2DWQA 2BYVE 2MBEA 3ML8A 4XE0A 1C9FA 4IOIE 2WXMA 2IO2B 4MH8A 2IO1B 1YMHE 4H2AA 3LJ3A 1UELA 4LK0M 2KYWA 1WGGA 3QA8A 1WXQA 1L2NA 1JCKB 1UZXB 1T0SC 2GBRA 2WX1A 5T8IA 1WX8A 4FADA 2RSUA 3M62B 3MC0B 4LDTB 2KDBA 2UU7A 1IBXB 2BB5A 4NY0A 3BVGA 3W9CB 1NENB 4B95A 4LDTD 1NI3A 5H92C 1JROA 3QHTA 2EKEC 2KTFA 3T8MA 1FCLA 5BMIA 3L54A 1T3QA 3ZUNA 2L00B 2PE9A 4B6WA 1EO6A 4P6VF 3DCGA 2Z0EB 1YX6B 4HDOA 2BS2B 2FNJB 3NVVA 3MFGA 1DYQA 1C1YB 4XWWA 1F77A 1CJEA 3B0AA 3N3KB 1YN5A 3BY4B 4F1SA 2XNAC 2DBYA 3HHMA 3WALA 1E0ZA 2D3GA 2UWQA 3GE3C 2LGXA 3AH7A 1WI0A 1TKYA 2DNFA 2QSDA 2MJ3A 3GZNB 3DBHB 2WYQA 2LHDA 1TTNA 2N7DA 4GDKB 1GC7A 2FUG1 3VH4B 4FA6A 3K9PB 1JMLA 2KWUB 1KLGD 4WJNA 4HROA 1GG3A 2IY0B 2W3SA 4MM3A 2JF5A 3RN9C 1X1MA 2K6DB 2LVPA 1UWMA 2K9XA 1V97A 2MX2A 4GDLA 4GOCA 3UQBA 2KD0A 4DDID 5JZEB 1KFYB 4BAXA 3IG3A 2ACZB 3ZJTA 3ZTCA 2FIFA 5EDSA 2WDTB 1NBFC 2MRPA 2WXQA 3B9JA 4ARIA 1ZUD2 3PTFC 1C78A 2KXJA 2WHIA 2Y3AA 3N20C 3QWZB 3AE8B 2QDFA 1ZKHA 3IXSA 3RD2A 1JWSD 3ZXRA 4GXBA 5TR5A 2CKHB 3V62A 1T0YA 3KWVA 4MGYE 1XXGA 4ZRPA 3FILA 3H1UA 1ESFA 2L05A 2K6QA 2V0GA 3AEGB 4A8XC 3Q3OC 4PS7A 3ALBA 1D4BA 3ZGZA 3H9DA 3A4SC 4LNOA 3KYCD 4DK5A 3P4RB 4DHJD 2HD5B 4ZRIA 3VVWB 3P4QB 2JU6X 2IDYA 2WNMA 1TJEA 2AQ3B 1UNSA 3LXFA 4IM0A 3MHSD 2MA9B 3AEAB 1J7AA 3BYYB 2IPKD 2JPHA 1UWXA 2HTME 2L8JA 2V9HA 3RNCC 1TKEA 3T3OA 1LQBA 1YQ4B 4HCPB 2C9WB 2GLSA 4L1BA 2IGDA 4M02A 4EE2A 4JWUC 2PIAA 3NZSA 1YN3A 3SEBA 1N6ZA 1GB4A 4FJVB 1VRAB 1L0YB 4IWOA 5C1ZA 2R2QA 1WH3A 4GN1A 4MSQB 4ICVA 1UUPA 3WA0A 5AUIA 5BMHA 1FPYA 1MI0A 3H7PA 2OJRA 2KDFB 2N9PC 2PMVA 2DAJA 3GP7A 4DHZB 2B3AA 3PREA 1H8CA 2AL3A 3OJ3A 5D3DA 2DZMA 3HM3A 1BUIC 1S1QB 4BVUC 2BTEA 4IG7B 1V8CA 2RMMA 2CHWA 1WXSA 1FNUA 2JX5A 2ZJDA 3ZTDA 5D6JB 1V1PA 4BOZB 4X57B 1FFUA 2G45B 3ZVVA 1YOVB 4TUUA 2KX3A 3ZXVA 4DBGA 4HCNB 4DWFA 2O6VA 5I4DA 1JQ4A 2GBMA 4TQ1A 3URYA 2VH1A 2NBUA 3BK2A 1N62A 3R3MA 1XEEA 1SIFA 5KHOA 2LVQA 2K5PA 5HG2A 1C4PA 2KK8A 2NBWB 1JRUA 3T9LA 3VXWA 1STEA 2DX5B 3APDA 4PYUA 5AEKB 2KN4A 3A4RA 2KAJA 3AU4A 4HXDA 2XK5B 4XDCA 1BXTA 3BWUD 2KN5A 4OZCA 2WGSA 5AZGA 2KMAA 1VR9A 1WGYA 2AX5A 1SXTA 3KVFB 3JSVA 2JYEA 4PS3A 1ISNA 4WQOB 3PV1A 1WX9A 2JXXA 4BKSA 4MDKE 1E10A 1NVID 3I9V1 3P4SB 2GBKA 1SE2A 4E71A 1Z2MA 2J0MA 2ICIA 2KVZA 3AMZA 4AJYB 2LRWA 5CHWA 3AB5A 3Q8EA 3I5JC 1P0RA 3M3JA 4KX6B 3TBLD 2JY6A 4RMAA 4P16A 2HJ1A 1KJTA 2J0KA 2YEPB 3DWMA 1FFVA 3DBRB 3AE7B
chains in the Genus database with same CATH topology
2MLBA 2FUHB 3TIXA 2M0XA 1BT0A 5KHQA 3DPDA 1WF9A 3VUXA 3MJWA 4HWIB 3PRMB 4KIKA 3IVFA 4GIVA 5JH5C 2RGFA 1WXAA 5GMVA 2HE7A 4GB9A 2MBBB 4I6PA 2DHZA 1WMHB 2W9NA 3UIPB 3VUYA 5DPSA 4JQWC 2LXCA 4I6LB 2KWCA 3N30A 3ZDTA 2KMCA 2MW5A 3ZNHB 1WM3A 3PGEA 2V1YA 1WJ4A 4EUTA 4IM2A 2R2OA 1Q1OA 1WM2A 4WJPA 1E7UA 4W9KA 1TZ1A 1IYFA 2GBNA 2J7QB 1WR6E 2V4LA 2ZEQA 3PLUA 2NR2A 2KNBA 2RR9A 2LWPA 3QAQA 1Z5SB 1WFYA 2C5LC 3WANA 2K39A 2L76A 4FJZA 2MP2A 1ZW7A 4OVUA 4KZ0A 4EZJA 2PE6B 2MSED 1J0GA 3B1LX 2MCNB 3IHPC 2LVOA 1P98A 3EECA 2KO3A 3RUIB 2IZVB 4K7UA 4II3B 2N1VA 2VRRB 3UINB 3NHEB 4ICUA 5C23A 4NQKE 3R7QA 3V6EB 3KUZA 3A9KA 4NJ6A 4MELA 1LM8B 2L7RA 1MG8A 3EHVA 1RLFA 2KHWB 1ZGUB 2AYOB 3L0WB 2KQSA 2MWSB 4GGQA 2BYEA 1H4RA 2NPTB 5G2NA 2KFKA 3PRPB 3L10B 1UGMA 1RFAA 4CHKA 4IWPA 4ANVA 2DZJA 4PS8A 4HPMB 1OTRB 2Y5BB 3M63B 1U4AA 4W9DA 3SDLC 3KH0A 2D2QA 2FCQA 4DXAB 1WRDB 3CMMB 3L08A 5CHFA 1WXMA 5L95C 1V49A 1NDDA 3QX1A 2C60A 5J2RA 4FLHA 2IO3B 2KWVB 4WWPA 2CS4A 2BYVE 3RT3B 1E90A 2MBEA 3O65B 3ML8A 1P1AA 2KZRA 1WMHA 3V6CB 4TKNA 2ZPYA 2Z59B 5LLIA 2RD0A 3DBLI 1E8XA 5CX3A 4KVGB 4W9LA 3EC8A 3OLMD 2IO2B 2UYZB 3DBRI 2IO1B 5D94A 3ZRFA 1EF5A 3VHTC 3LJ3A 1GNUA 4GMVA 4M8NA 1UELA 3NY5A 5JHAA 2D07B 1EUVB 3TL5A 3QCAA 1S3SG 1WGGA 5AZFA 3QA8A 2KDIA 2G4DB 1L2NA 4EEWA 2G4SA 1UZXB 4W9CA 2GBRA 2WX0A 1E8WA 2KX0A 2WX1A 3UF8A 2LZ6A 1WX8A 2KVRA 1OQYA 3ZDMC 2M1MA 3P2BA 4FADA 2AL6A 2RSUA 3ZO5B 3M62B 4LDTB 3A33B 2JT4B 4F8CB 4HPLB 3A9JB 1WZ0A 2KDBA 1VD2A 2LGDA 1J8CA 2NBVB 3HM6X 3MTNB 4G50A 3AULA 3NOBA 4FHKA 4NY0A 3U8ZA 3ZW3A 2CU1A 4KDLB 4BBNF 3PVLA 1WYWB 2JVCA 1VCBA 5DPWA 4HJKA 4B95A 4LDTD 4DHZE 1UD7A 3QHTA 2EKEC 2KLGA 2KTFA 2HJ8A 4N9F4 3T8MA 2K8HA 2JRIB 2BPSA 2M4NA 1P9DU 3L54A 2KTRB 5DPTA 3RCZA 3ZUNA 3I3TB 4ANWA 2D11A 4GDLB 2IBIB 2L00B 1WE7A 2PE9A 1EO6A 2DENB 4FN2A 2YVCA 4B6WA 3DCGA 1WGDA 4AJWA 2EMSA 4NPNA 4BFRA 1M94A 4IUMB 2Z0EB 1YX6B 1PQSA 4HDOA 1UH6A 1OEYA 1GC6A 2LXAA 3C0RB 2Z0DB 3OAWA 3M95A 2FNJB 2HTHA 4FBJB 2G3QB 4HK2A 4AUQC 4AWJA 1R4MI 4BBNC 2BWFA 2XK5A 5D7GA 3ZKJC 4K7WA 1C1YB 3ENEA 1V80A 4XC2A 2I1JA 3D32A 4RM8A 3B0AA 3N3KB 1LFDA 2KANA 2KC2A 1G6JA 3BY4B 2OOBB 4KDIC 4HDQA 4F1SA 3R66C 1KM7A 3HHMA 3WALA 2JRHA 4JL9A 4ZRKA 1SGHA 1K8RB 2D3GA 2UWQA 3L17A 1UBIA 1WGHA 2LGXA 4ZDVA 4TQ0A 4BKTA 1WI0A 4GU2A 1IP9A 2GMIC 2ZNVB 3R7RA 3VAWA 2LD9A 3AU5A 1V5TA 2CHZA 3A9JA 2I1KA 3QIJA 3ZLZA 3PRZA 2WYQA 3DDCB 1TBEA 1TTNA 2N7DA 2BKFA 4GDKB 1GC7A 3NS8A 3VH4B 3V60A 4FA6A 3K9PB 4ASWC 4IC7B 2KWUB 3WAMA 4WJNA 3AXCA 4DDGD 3L13A 4NNJB 4MJSB 5JHBA 1GG3A 2IY0B 5E6PA 2L3ZA 3WIMA 2FIDA 1NI2A 2ZCCA 2C7MB 3JSVB 4MM3A 2JF5A 3Q3JA 4W9IA 1X1MA 2K6DB 2KTRA 2LVPA 2KDEB 2MX2A 4GDLA 4JLCA 4GOCA 3UQBA 3WAOA 2KD0A 4DDID 4NAWB 4A3OA 2ZCBA 5JZEB 3PSEB 3H6NA 1YX5B 1WJNA 1C3TA 3IG3A 2ZPNA 3SU8X 4KSKC 5LXHA 3ZTCA 4KZCA 2FIFA 4A20A 2WDTB 5EDSA 1NBFC 2MRPA 4FJYA 1SE9A 3A1QB 4EFOA 4BKGA 3W1YA 2LASA 3PTFC 3APCA 3VUWA 1GJZA 2N7EA 2KXJA 3DVGX 2DZIA 2N9XA 3KUCB 3LDZE 5D2MB 1Q0WB 3CSFA 3NZUA 4I6NB 5DCNA 2KKCA 3QWZB 1YJ1A 4E74A 1ZKHA 3U30A 2JWZA 3PHXB 4II2B 3VTVA 3RD2A 1KOTA 4GXBA 1HE8A 1I35A 5TR5A 2CKHB 3U7DA 3APFA 3V62A 4AP4C 3PT2B 1T0YA 1KLVA 2MBOA 4MGYE 2NCNA 2DYMA 4MGKE 2BGFA 4CO7A 1V2YA 2ZNVC 3H1UA 2C7HA 1V81A 2K6QA 2DYBA 2L05A 3KW5B 1AARA 2BKRB 4W9HA 4YL8A 3H7PB 5IAAC 2PEAA 4NQLB 4KSLC 4PS7A 3ALBA 1V86A 1QZEA 5IA7A 3H9DA 3A4SC 2DAFA 3KYCD 4DK5A 2KJ6A 2FAZA 1TGZB 3VQIA 4DHJD 3HK0A 2KC1A 2HD5B 4ZRIA 3VVWB 2N4FA 1E7VA 1YQBA 2NPTA 4B9KA 2MQJA 3DBHI 3ZNZB 2K8BA 3ZNID 2CR5A 1WGRA 5L83A 2O2VB 3VTWA 3Q3FA 4FULA 4W9GA 4IM0A 3JW0X 2A4ZA 4IW0A 3MHSD 2JUOA 4IWQA 4WJQA 1P3QU 2MA9B 3RZFA 4M0WB 4P7IA 2ASQA 3PLVA 2PPHA 3JVZX 4E3CA 2V3SA 5CHVC 3K9OB 3A1QA 1WX7A 4MGZE 1WJ6A 2JZ3B 2JPHA 3W1SC 2L8JA 4AOFA 2AEHA 2LJ5A 4JIOU 4NJ7A 3W1SA 1LQBA 4W9FA 1OEYJ 1A5RA 4HCPB 2C9WB 3PHWB 2K1FA 1E8ZA 1Y8RC 3IBEA 5BO4B 2O6VB 4URKA 2XBBC 3NZSA 1Q5WB 4ANXA 4HLEA 2KOXA 3ONSA 4OVVA 4FJVB 2RPQA 5E6OA 4IWOA 3ML9A 5C1ZA 1OGWA 1V9JA 2R2QA 2KJHB 4J6IA 2WWZA 1WH3A 4G0NB 4GN1A 4IM3A 4MSQB 2O6VD 3DVGY 4FHJA 3AI5A 4ICVA 2IO0B 2IY1B 3HIZA 1XD3B 4MEMA 4K1RB 3SD5A 3WA0A 2XEWA 3H7PA 2M17A 2OJRA 3B08A 2KDFB 4EZKA 2K25A 2N9PC 2C7NB 2DAJA 1F9JA 5CTRC 4DHZB 5LXIB 3RULA 2NVUI 3QARA 4MH0E 2B3AA 2JZZA 3PREA 3VDZA 1H8CA 4TV3A 1I42A 3SHQA 2AL3A 1V5OA 3OJ3A 2ZZPB 1UBQA 2DZMA 3HM3A 1E5WA 1S1QB 4PYZA 4BVUC 3QK0A 3PS6A 4IG7B 2MBQA 2LRUA 2GBJA 1WR1A 2CHWA 2O2VA 1WXSA 3GOEA 4G11A 4EOYA 3CSTA 2ZJDA 1R4NI 4WAAA 1L7YA 3ZTDA 3WAPA 4W9JA 5D6JB 4XZ4A 1LXDA 3RYTA 4BOZB 5J18A 3ZRCA 4X57B 2G45B 3ZVVA 3TJPA 2A5UA 3S2AA 3DOWA 1RRBA 3V61A 2CHXA 3DQVA 4ANUA 3IFWB 3L16A 3RZWC 4TUUA 2DZKA 2KX3A 3CF6E 3TCAA 3VH3B 4RM9A 5J17A 4EKUA 4DBGA 5FR6A 2GOWA 2IYDB 2AWTA 4A3PA 1GUAB 1WZ3A 1XT9B 1RAXA 2MBHA 4HCNB 3H7SA 1WXVA 2KJRA 3VFKA 4DWFA 2O6VA 4BKSD 2GBMA 2M8SA 4TQ1A 2YLMA 4WJOA 2KLCA 2NBUA 2ZVOA 1YIWA 1IPGA 3DBSA 1YD8U 3R3MA 3ZIMA 4WWOA 1J19A 3ZNGC 1SIFA 3JYUA 2FCNA 5KHOA 2ZVNA 1WY8A 3ECIA 2FCSA 3N32A 2FCMA 4F7ZA 2LVQA 5HKHA 4EZLA 4HVBA 5DPRA 3QC8B 3UQAA 2K8CA 4JGHB 2KK8A 2NBWB 4MGIE 1JRUA 4LJPB 4W9EA 3TMPB 3T9LA 3VXWA 4KIKB 2LGYA 3PPAA 2DX5B 3X23A 3APDA 5E6NA 4PYUA 1EF1A 3EFUA 5AEKB 2LUEA 3A4RA 4BOSC 4DHJB 3AU4A 4HXDA 4GSWA 2XK5B 4GDKA 1XQQA 4XX5A 2EMTA 2N9EB 2L0TA 3OJ4B 2KN5A 1D3ZA 5AZGA 2KMAA 2N1WA 1WGYA 4MJSA 3KUDB 4ZYNA 3KVFB 3JSVA 3DVNV 4K81A 2J0JA 3PZDA 4PS3A 2KFJA 3KYDD 4LCDE 1ISNA 4WQOB 3GZNI 3PV1A 1WX9A 4NAWA 2JXXA 2MP2B 2NS5A 2BYFA 4BKSA 2L0FA 4MDKE 3UIOB 3X0WA 3QJZA 4G3XB 2LI5A 1FXTB 3VTUA 1WIAA 2GBKA 2REXA 4WWNA 5G55A 4E71A 4MSMB 1Z2MA 2J0MA 1CMXB 4AJYB 2BWES 3QQ8B 2LRWA 2KQ7A 1V6EA 1WJUA 3A9KB 4KV2A 5CHWA 1E8YA 2D10A 2QHOA 4M8MA 2DYOA 4K7SA 2PJHA 1P0RA 2BF8B 3M3JA 3BINA 4LJOB 5AZHA 3TBLD 3UGBB 4CYEA 2JY6A 4RMAA 3DVNU 2KFKB 1KJTA 2J0KA 4ZRJA 1WE6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MLB A;  2FUH B;  3TIX A;  2M0X A;  1BT0 A;  5KHQ A;  3DPD A;  1WF9 A;  3VUX A;  3MJW A;  4HWI B;  3PRM B;  4KIK A;  3IVF A;  4GIV A;  5JH5 C;  2RGF A;  1WXA A;  5GMV A;  2HE7 A;  4GB9 A;  2MBB B;  4I6P A;  2DHZ A;  1WMH B;  2W9N A;  3UIP B;  3VUY A;  5DPS A;  4JQW C;  2LXC A;  4I6L B;  2KWC A;  3N30 A;  3ZDT A;  2KMC A;  2MW5 A;  3ZNH B;  1WM3 A;  3PGE A;  2V1Y A;  1WJ4 A;  4EUT A;  4IM2 A;  2R2O A;  1Q1O A;  1WM2 A;  4WJP A;  1E7U A;  4W9K A;  1TZ1 A;  1IYF A;  2GBN A;  2J7Q B;  1WR6 E;  2V4L A;  2ZEQ A;  3PLU A;  2NR2 A;  2KNB A;  2RR9 A;  2LWP A;  3QAQ A;  1Z5S B;  1WFY A;  2C5L C;  3WAN A;  2K39 A;  2L76 A;  4FJZ A;  2MP2 A;  1ZW7 A;  4OVU A;  4KZ0 A;  4EZJ A;  2PE6 B;  2MSE D;  1J0G A;  3B1L X;  2MCN B;  3IHP C;  2LVO A;  1P98 A;  3EEC A;  2KO3 A;  3RUI B;  2IZV B;  4K7U A;  4II3 B;  2N1V A;  2VRR B;  3UIN B;  3NHE B;  4ICU A;  5C23 A;  4NQK E;  3R7Q A;  3V6E B;  3KUZ A;  3A9K A;  4NJ6 A;  4MEL A;  1LM8 B;  2L7R A;  1MG8 A;  3EHV A;  1RLF A;  2KHW B;  1ZGU B;  2AYO B;  3L0W B;  2KQS A;  2MWS B;  4GGQ A;  2BYE A;  1H4R A;  2NPT B;  5G2N A;  2KFK A;  3PRP B;  3L10 B;  1UGM A;  1RFA A;  4CHK A;  4IWP A;  4ANV A;  2DZJ A;  4PS8 A;  4HPM B;  1OTR B;  2Y5B B;  3M63 B;  1U4A A;  4W9D A;  3SDL C;  3KH0 A;  2D2Q A;  2FCQ A;  4DXA B;  1WRD B;  3CMM B;  3L08 A;  5CHF A;  1WXM A;  5L95 C;  1V49 A;  1NDD A;  3QX1 A;  2C60 A;  5J2R A;  4FLH A;  2IO3 B;  2KWV B;  4WWP A;  2CS4 A;  2BYV E;  3RT3 B;  1E90 A;  2MBE A;  3O65 B;  3ML8 A;  1P1A A;  2KZR A;  1WMH A;  3V6C B;  4TKN A;  2ZPY A;  2Z59 B;  5LLI A;  2RD0 A;  3DBL I;  1E8X A;  5CX3 A;  4KVG B;  4W9L A;  3EC8 A;  3OLM D;  2IO2 B;  2UYZ B;  3DBR I;  2IO1 B;  5D94 A;  3ZRF A;  1EF5 A;  3VHT C;  3LJ3 A;  1GNU A;  4GMV A;  4M8N A;  1UEL A;  3NY5 A;  5JHA A;  2D07 B;  1EUV B;  3TL5 A;  3QCA A;  1S3S G;  1WGG A;  5AZF A;  3QA8 A;  2KDI A;  2G4D B;  1L2N A;  4EEW A;  2G4S A;  1UZX B;  4W9C A;  2GBR A;  2WX0 A;  1E8W A;  2KX0 A;  2WX1 A;  3UF8 A;  2LZ6 A;  1WX8 A;  2KVR A;  1OQY A;  3ZDM C;  2M1M A;  3P2B A;  4FAD A;  2AL6 A;  2RSU A;  3ZO5 B;  3M62 B;  4LDT B;  3A33 B;  2JT4 B;  4F8C B;  4HPL B;  3A9J B;  1WZ0 A;  2KDB A;  1VD2 A;  2LGD A;  1J8C A;  2NBV B;  3HM6 X;  3MTN B;  4G50 A;  3AUL A;  3NOB A;  4FHK A;  4NY0 A;  3U8Z A;  3ZW3 A;  2CU1 A;  4KDL B;  4BBN F;  3PVL A;  1WYW B;  2JVC A;  1VCB A;  5DPW A;  4HJK A;  4B95 A;  4LDT D;  4DHZ E;  1UD7 A;  3QHT A;  2EKE C;  2KLG A;  2KTF A;  2HJ8 A;  4N9F 4;  3T8M A;  2K8H A;  2JRI B;  2BPS A;  2M4N A;  1P9D U;  3L54 A;  2KTR B;  5DPT A;  3RCZ A;  3ZUN A;  3I3T B;  4ANW A;  2D11 A;  4GDL B;  2IBI B;  2L00 B;  1WE7 A;  2PE9 A;  1EO6 A;  2DEN B;  4FN2 A;  2YVC A;  4B6W A;  3DCG A;  1WGD A;  4AJW A;  2EMS A;  4NPN A;  4BFR A;  1M94 A;  4IUM B;  2Z0E B;  1YX6 B;  1PQS A;  4HDO A;  1UH6 A;  1OEY A;  1GC6 A;  2LXA A;  3C0R B;  2Z0D B;  3OAW A;  3M95 A;  2FNJ B;  2HTH A;  4FBJ B;  2G3Q B;  4HK2 A;  4AUQ C;  4AWJ A;  1R4M I;  4BBN C;  2BWF A;  2XK5 A;  5D7G A;  3ZKJ C;  4K7W A;  1C1Y B;  3ENE A;  1V80 A;  4XC2 A;  2I1J A;  3D32 A;  4RM8 A;  3B0A A;  3N3K B;  1LFD A;  2KAN A;  2KC2 A;  1G6J A;  3BY4 B;  2OOB B;  4KDI C;  4HDQ A;  4F1S A;  3R66 C;  1KM7 A;  3HHM A;  3WAL A;  2JRH A;  4JL9 A;  4ZRK A;  1SGH A;  1K8R B;  2D3G A;  2UWQ A;  3L17 A;  1UBI A;  1WGH A;  2LGX A;  4ZDV A;  4TQ0 A;  4BKT A;  1WI0 A;  4GU2 A;  1IP9 A;  2GMI C;  2ZNV B;  3R7R A;  3VAW A;  2LD9 A;  3AU5 A;  1V5T A;  2CHZ A;  3A9J A;  2I1K A;  3QIJ A;  3ZLZ A;  3PRZ A;  2WYQ A;  3DDC B;  1TBE A;  1TTN A;  2N7D A;  2BKF A;  4GDK B;  1GC7 A;  3NS8 A;  3VH4 B;  3V60 A;  4FA6 A;  3K9P B;  4ASW C;  4IC7 B;  2KWU B;  3WAM A;  4WJN A;  3AXC A;  4DDG D;  3L13 A;  4NNJ B;  4MJS B;  5JHB A;  1GG3 A;  2IY0 B;  5E6P A;  2L3Z A;  3WIM A;  2FID A;  1NI2 A;  2ZCC A;  2C7M B;  3JSV B;  4MM3 A;  2JF5 A;  3Q3J A;  4W9I A;  1X1M A;  2K6D B;  2KTR A;  2LVP A;  2KDE B;  2MX2 A;  4GDL A;  4JLC A;  4GOC A;  3UQB A;  3WAO A;  2KD0 A;  4DDI D;  4NAW B;  4A3O A;  2ZCB A;  5JZE B;  3PSE B;  3H6N A;  1YX5 B;  1WJN A;  1C3T A;  3IG3 A;  2ZPN A;  3SU8 X;  4KSK C;  5LXH A;  3ZTC A;  4KZC A;  2FIF A;  4A20 A;  2WDT B;  5EDS A;  1NBF C;  2MRP A;  4FJY A;  1SE9 A;  3A1Q B;  4EFO A;  4BKG A;  3W1Y A;  2LAS A;  3PTF C;  3APC A;  3VUW A;  1GJZ A;  2N7E A;  2KXJ A;  3DVG X;  2DZI A;  2N9X A;  3KUC B;  3LDZ E;  5D2M B;  1Q0W B;  3CSF A;  3NZU A;  4I6N B;  5DCN A;  2KKC A;  3QWZ B;  1YJ1 A;  4E74 A;  1ZKH A;  3U30 A;  2JWZ A;  3PHX B;  4II2 B;  3VTV A;  3RD2 A;  1KOT A;  4GXB A;  1HE8 A;  1I35 A;  5TR5 A;  2CKH B;  3U7D A;  3APF A;  3V62 A;  4AP4 C;  3PT2 B;  1T0Y A;  1KLV A;  2MBO A;  4MGY E;  2NCN A;  2DYM A;  4MGK E;  2BGF A;  4CO7 A;  1V2Y A;  2ZNV C;  3H1U A;  2C7H A;  1V81 A;  2K6Q A;  2DYB A;  2L05 A;  3KW5 B;  1AAR A;  2BKR B;  4W9H A;  4YL8 A;  3H7P B;  5IAA C;  2PEA A;  4NQL B;  4KSL C;  4PS7 A;  3ALB A;  1V86 A;  1QZE A;  5IA7 A;  3H9D A;  3A4S C;  2DAF A;  3KYC D;  4DK5 A;  2KJ6 A;  2FAZ A;  1TGZ B;  3VQI A;  4DHJ D;  3HK0 A;  2KC1 A;  2HD5 B;  4ZRI A;  3VVW B;  2N4F A;  1E7V A;  1YQB A;  2NPT A;  4B9K A;  2MQJ A;  3DBH I;  3ZNZ B;  2K8B A;  3ZNI D;  2CR5 A;  1WGR A;  5L83 A;  2O2V B;  3VTW A;  3Q3F A;  4FUL A;  4W9G A;  4IM0 A;  3JW0 X;  2A4Z A;  4IW0 A;  3MHS D;  2JUO A;  4IWQ A;  4WJQ A;  1P3Q U;  2MA9 B;  3RZF A;  4M0W B;  4P7I A;  2ASQ A;  3PLV A;  2PPH A;  3JVZ X;  4E3C A;  2V3S A;  5CHV C;  3K9O B;  3A1Q A;  1WX7 A;  4MGZ E;  1WJ6 A;  2JZ3 B;  2JPH A;  3W1S C;  2L8J A;  4AOF A;  2AEH A;  2LJ5 A;  4JIO U;  4NJ7 A;  3W1S A;  1LQB A;  4W9F A;  1OEY J;  1A5R A;  4HCP B;  2C9W B;  3PHW B;  2K1F A;  1E8Z A;  1Y8R C;  3IBE A;  5BO4 B;  2O6V B;  4URK A;  2XBB C;  3NZS A;  1Q5W B;  4ANX A;  4HLE A;  2KOX A;  3ONS A;  4OVV A;  4FJV B;  2RPQ A;  5E6O A;  4IWO A;  3ML9 A;  5C1Z A;  1OGW A;  1V9J A;  2R2Q A;  2KJH B;  4J6I A;  2WWZ A;  1WH3 A;  4G0N B;  4GN1 A;  4IM3 A;  4MSQ B;  2O6V D;  3DVG Y;  4FHJ A;  3AI5 A;  4ICV A;  2IO0 B;  2IY1 B;  3HIZ A;  1XD3 B;  4MEM A;  4K1R B;  3SD5 A;  3WA0 A;  2XEW A;  3H7P A;  2M17 A;  2OJR A;  3B08 A;  2KDF B;  4EZK A;  2K25 A;  2N9P C;  2C7N B;  2DAJ A;  1F9J A;  5CTR C;  4DHZ B;  5LXI B;  3RUL A;  2NVU I;  3QAR A;  4MH0 E;  2B3A A;  2JZZ A;  3PRE A;  3VDZ A;  1H8C A;  4TV3 A;  1I42 A;  3SHQ A;  2AL3 A;  1V5O A;  3OJ3 A;  2ZZP B;  1UBQ A;  2DZM A;  3HM3 A;  1E5W A;  1S1Q B;  4PYZ A;  4BVU C;  3QK0 A;  3PS6 A;  4IG7 B;  2MBQ A;  2LRU A;  2GBJ A;  1WR1 A;  2CHW A;  2O2V A;  1WXS A;  3GOE A;  4G11 A;  4EOY A;  3CST A;  2ZJD A;  1R4N I;  4WAA A;  1L7Y A;  3ZTD A;  3WAP A;  4W9J A;  5D6J B;  4XZ4 A;  1LXD A;  3RYT A;  4BOZ B;  5J18 A;  3ZRC A;  4X57 B;  2G45 B;  3ZVV A;  3TJP A;  2A5U A;  3S2A A;  3DOW A;  1RRB A;  3V61 A;  2CHX A;  3DQV A;  4ANU A;  3IFW B;  3L16 A;  3RZW C;  4TUU A;  2DZK A;  2KX3 A;  3CF6 E;  3TCA A;  3VH3 B;  4RM9 A;  5J17 A;  4EKU A;  4DBG A;  5FR6 A;  2GOW A;  2IYD B;  2AWT A;  4A3P A;  1GUA B;  1WZ3 A;  1XT9 B;  1RAX A;  2MBH A;  4HCN B;  3H7S A;  1WXV A;  2KJR A;  3VFK A;  4DWF A;  2O6V A;  4BKS D;  2GBM A;  2M8S A;  4TQ1 A;  2YLM A;  4WJO A;  2KLC A;  2NBU A;  2ZVO A;  1YIW A;  1IPG A;  3DBS A;  1YD8 U;  3R3M A;  3ZIM A;  4WWO A;  1J19 A;  3ZNG C;  1SIF A;  3JYU A;  2FCN A;  5KHO A;  2ZVN A;  1WY8 A;  3ECI A;  2FCS A;  3N32 A;  2FCM A;  4F7Z A;  2LVQ A;  5HKH A;  4EZL A;  4HVB A;  5DPR A;  3QC8 B;  3UQA A;  2K8C A;  4JGH B;  2KK8 A;  2NBW B;  4MGI E;  1JRU A;  4LJP B;  4W9E A;  3TMP B;  3T9L A;  3VXW A;  4KIK B;  2LGY A;  3PPA A;  2DX5 B;  3X23 A;  3APD A;  5E6N A;  4PYU A;  1EF1 A;  3EFU A;  5AEK B;  2LUE A;  3A4R A;  4BOS C;  4DHJ B;  3AU4 A;  4HXD A;  4GSW A;  2XK5 B;  4GDK A;  1XQQ A;  4XX5 A;  2EMT A;  2N9E B;  2L0T A;  3OJ4 B;  2KN5 A;  1D3Z A;  5AZG A;  2KMA A;  2N1W A;  1WGY A;  4MJS A;  3KUD B;  4ZYN A;  3KVF B;  3JSV A;  3DVN V;  4K81 A;  2J0J A;  3PZD A;  4PS3 A;  2KFJ A;  3KYD D;  4LCD E;  1ISN A;  4WQO B;  3GZN I;  3PV1 A;  1WX9 A;  4NAW A;  2JXX A;  2MP2 B;  2NS5 A;  2BYF A;  4BKS A;  2L0F A;  4MDK E;  3UIO B;  3X0W A;  3QJZ A;  4G3X B;  2LI5 A;  1FXT B;  3VTU A;  1WIA A;  2GBK A;  2REX A;  4WWN A;  5G55 A;  4E71 A;  4MSM B;  1Z2M A;  2J0M A;  1CMX B;  4AJY B;  2BWE S;  3QQ8 B;  2LRW A;  2KQ7 A;  1V6E A;  1WJU A;  3A9K B;  4KV2 A;  5CHW A;  1E8Y A;  2D10 A;  2QHO A;  4M8M A;  2DYO A;  4K7S A;  2PJH A;  1P0R A;  2BF8 B;  3M3J A;  3BIN A;  4LJO B;  5AZH A;  3TBL D;  3UGB B;  4CYE A;  2JY6 A;  4RMA A;  3DVN U;  2KFK B;  1KJT A;  2J0K A;  4ZRJ A;  1WE6 A; 
#chains in the Genus database with same CATH topology
 3N1X C;  2BW2 A;  1BT0 A;  4WQM A;  3MJW A;  1F2R C;  4HWI B;  3PRM B;  4KIK A;  3SFD B;  2HE7 A;  3UI3 A;  4CQN A;  1XCT L;  3ZDT A;  2MW5 A;  2L1A A;  1WM3 A;  4OW0 A;  4EUT A;  1Y56 A;  2R2O A;  4WJP A;  3NVY A;  1HA5 A;  2IGG A;  1IYF A;  1F2R I;  3PLU A;  2KNB A;  2WDQ B;  1SF0 A;  2WXF A;  4FJZ A;  1SBB B;  4OVU A;  3B1L X;  2MCN B;  2M19 A;  4K7U A;  5C23 A;  4NQK E;  4R3D A;  1RWS A;  3Q8A A;  4NJ6 A;  3EHV A;  1AWD A;  1L4D B;  1ZGU B;  2Q5W D;  2KQS A;  3R2I A;  3NRZ A;  1H4R A;  2NPT B;  4J3O D;  5G2N A;  2NTS A;  4KGS A;  1A70 A;  1UGM A;  2DZJ A;  4HPM B;  2Y5B B;  1JWB D;  1J7B A;  1QOG A;  3L08 A;  2J53 A;  2J42 A;  5J2R A;  2IO3 B;  2KWV B;  2CS4 A;  2WXJ A;  1E90 A;  3OG5 A;  4TKN A;  2ZPY A;  2Z59 B;  1E8X A;  2D3B A;  5D3I B;  3ZRF A;  3VHT C;  2CJO A;  2JWU A;  1PGA A;  4YTP B;  4GMV A;  1N60 A;  5JHA A;  2Y5P A;  3GB1 A;  3NVZ A;  2KDI A;  5C2T B;  4EEW A;  1DOY A;  2G4S A;  2WX0 A;  4MT5 A;  3ZJV A;  2WXI A;  2LZ6 A;  1AN8 A;  2KVR A;  3ZDM C;  2AL6 A;  3P1M A;  3AEF B;  1V1O A;  2E6X A;  3A33 B;  3A9J B;  1WZ0 A;  1VD2 A;  1RFK A;  4OZB A;  2N9K A;  1J8C A;  3MTN B;  4G50 A;  1T0Q C;  3AE2 B;  4BBN F;  1VCB A;  3IAS 1;  4HJK A;  4BZA A;  1FNV A;  2MEK A;  2WU5 B;  5IN7 A;  1UD7 A;  2JRI B;  3Q14 C;  1P9D U;  1UGJ A;  2KTR B;  2B76 B;  3I3T B;  1ZOY B;  4FN2 A;  2YVC A;  1BML C;  2JSV X;  1UH6 A;  2ON8 A;  2LXA A;  4WWM A;  3M95 A;  4FBJ B;  4AWJ A;  2QJL A;  3DHG C;  3ZKJ C;  2I1J A;  3D32 A;  2K22 A;  2N7J A;  2BS4 B;  1G6J A;  5G5G A;  5BYS A;  3ZJU A;  4HDQ A;  2JRH A;  4JL9 A;  4ZRK A;  1SGH A;  1RYJ A;  2W82 A;  2E3T A;  1FD6 A;  1WGH A;  4ZDV A;  4WH4 A;  4NZL B;  2GMI C;  2K0P A;  2ZNV B;  2N0S B;  3VAW A;  2LD9 A;  3AU5 A;  3QIJ A;  3ZLZ A;  3PRZ A;  2PW9 A;  4LNN A;  4N6E B;  2BKF A;  2IND C;  4ASW C;  3AXC A;  3R2T A;  5E6P A;  2L3Z A;  1NEK B;  1WWT A;  2C7M B;  4UDU C;  1F0Z A;  3Q3M C;  1VZ6 A;  3WAO A;  1EWC A;  1QOB A;  2WXR A;  4KSK C;  4KZC A;  4RGT A;  1TS5 A;  4FJY A;  4EFO A;  4BKG A;  3W1Y A;  3VUW A;  1T0R C;  5FR3 A;  3LDZ E;  5D2M B;  5DCN A;  2KKC A;  1YJ1 A;  3N1Y C;  2JWZ A;  2NTT A;  3PHX B;  1YJJ A;  1I35 A;  4LNI A;  3U7D A;  4AP4 C;  2WP9 B;  3AE9 B;  1KLV A;  4M00 A;  4AS1 A;  2BGF A;  2INN E;  3Q6B A;  4KKJ A;  5EE3 A;  1AAR A;  2BKR B;  2J4X A;  1JRP A;  4WIP A;  2PEA A;  4O1N A;  4C4V B;  2TSS A;  1QZE A;  2BQQ A;  2GI9 A;  3RNA C;  1CQV A;  1GPX A;  5LNK 1;  5C3J B;  2FAZ A;  1TGZ B;  2KC1 A;  4HPP A;  1YQB A;  1VZ8 A;  4B9K A;  3ZNZ B;  2K8B A;  2INP E;  2O2V B;  3VTW A;  3Q3F A;  4FUL A;  4W9G A;  3N9Y C;  2PVG C;  1SSN A;  2JUO A;  1P3Q U;  1D6E C;  3PLV A;  3CIR B;  5CHV C;  3K9O B;  4MGZ E;  3HVZ A;  1EWY C;  2AEH A;  1GB1 A;  3W1S A;  1OEY J;  1YJI A;  2I2Y A;  1E8Z A;  3IBE A;  4URK A;  3V05 A;  1Q5W B;  4OVV A;  2RPQ A;  2W55 A;  4G0N B;  1L0X B;  3AI5 A;  5HFY A;  1XD3 B;  2XEW A;  2VZK B;  3Q8C A;  3RNF C;  1I4Q A;  5EE9 A;  1TIF A;  1ACC A;  1F9J A;  5CTR C;  3EUB 2;  1CK1 A;  3RUL A;  3QAR A;  4MH0 E;  3VDZ A;  4TV3 A;  3SHQ A;  2MH7 A;  2VZK D;  4AQ7 A;  2ZZP B;  1UBQ A;  4YTM B;  2WXO A;  2AQ1 B;  3B2G A;  3QK0 A;  2LRU A;  3AV8 A;  1VDV A;  3AED B;  1R4N I;  1L7Y A;  3WAP A;  4W9J A;  4XZ4 A;  4YTN B;  4LNF A;  5J18 A;  2RDH A;  2WLB A;  3TJP A;  4JE3 B;  3S2A A;  3V61 A;  2CHX A;  3DQV A;  2DZK A;  3CF6 E;  1KRH A;  1HEZ E;  5FR6 A;  5EE0 A;  1XT9 B;  2MBH A;  1RAX A;  5E6J A;  2KJR A;  3VFK A;  4C7Z A;  2LHE A;  4WJO A;  3ETR A;  4A6Q A;  2KLC A;  2ZVO A;  1IPG A;  1YD8 U;  1J19 A;  3JYU A;  2FCN A;  3ECI A;  3AN1 A;  5HKH A;  1T6B X;  2K8C A;  4JGH B;  3RNG C;  4MGI E;  3TMP B;  4K3C A;  4ACF A;  3O13 A;  3AEE B;  3PPA A;  3X23 A;  1TY2 A;  1I4X A;  4BOS C;  4DHJ B;  4PT5 A;  1C79 A;  1XCQ L;  1KTK A;  2N1W A;  3C19 A;  4MJS A;  3KUD B;  3TEX A;  3LYY A;  2WU2 B;  1L6U A;  3I57 A;  4HJG E;  2KFJ A;  3P63 A;  3SFE B;  4LCD E;  4RF0 A;  1E7P B;  4NAW A;  4B0M A;  2MP2 B;  2WDV B;  1WYG A;  3X0W A;  3QJZ A;  2ZW1 A;  2GRI A;  3Q8F A;  4MAC A;  1TKG A;  1I4H A;  4MSM B;  1CMX B;  1LO5 D;  2D10 A;  2QHO A;  4M8M A;  2DYO A;  4K7S A;  2PJH A;  2BF8 B;  4MM3 B;  4LJO B;  1ET6 A;  3AE3 B;  5AZH A;  3UGB B;  4C00 A;  1WE6 A;  1SJH D;  3RMK C;  2FUH B;  5MPO A;  2W54 A;  3DPD A;  4GIV A;  5JH5 C;  3J9C A;  3HVD A;  5GMV A;  4GB9 A;  2DHZ A;  1MG4 A;  1WMH B;  2W9N A;  3UIP B;  1KF6 B;  1QF6 A;  2MJE A;  2WQY B;  3V3X A;  1WSP A;  3PGE A;  1TY0 A;  1C77 A;  1K53 A;  2N9L A;  1WM2 A;  1E7U A;  4OHJ A;  1XO3 A;  2GBN A;  1WR6 E;  2V4L A;  2ZEQ A;  2NR2 A;  2RR9 A;  3QAQ A;  1WFY A;  3TSS A;  4A55 A;  1QOF A;  3FIL B;  3RPF C;  2BS3 B;  1KLU D;  2MSE D;  4M0W A;  3EEC A;  1K52 A;  3RUI B;  4KGT A;  4II3 B;  2N1V A;  2VRR B;  3NHE B;  3R7Q A;  3V6E B;  3KUZ A;  1LM8 B;  1FXI A;  2KWD A;  3IAM 1;  2KHW B;  4YT0 B;  3NS1 A;  2FBW B;  3L10 B;  2RDG A;  1EU4 A;  2R61 A;  1DOX A;  3M63 B;  4W9D A;  3PZ7 A;  3KH0 A;  2FCQ A;  3CMM B;  3MHZ A;  1V49 A;  3QX1 A;  4LLG M;  2DLB A;  3BYT B;  5TSS A;  2KZR A;  3V6C B;  5LLI A;  4ZHP A;  2RD0 A;  5CX3 A;  3EC8 A;  3OLM D;  3R8B A;  2UYZ B;  3EFC A;  5D94 A;  4OZA A;  2OED A;  4WAF A;  4Q2J A;  3NY5 A;  1MPE A;  3VRA B;  2D07 B;  1EUV B;  1YN4 A;  3RFZ B;  3TUO A;  3T3N A;  3FC4 A;  4W9C A;  1YNT E;  2IGH A;  3UF8 A;  1OQY A;  2M1M A;  3ZO5 B;  2QMT A;  1R4N B;  4F8C B;  4HKZ E;  3HM6 X;  3NOB A;  4FHK A;  3U8Z A;  3ZW3 A;  2CU1 A;  4ZRQ A;  3PVL A;  2JVC A;  1TT5 B;  4YXD B;  2HJ8 A;  2K8H A;  2AQ2 B;  2BPS A;  2D3C A;  2PKO A;  5DPT A;  3RCZ A;  4ANW A;  2IBI B;  1N63 A;  1WGD A;  4IDI A;  4NPN A;  4BFR A;  1M94 A;  4IUM B;  2BBC A;  1OEY A;  1GC6 A;  2Z0D B;  2QC8 A;  3OAW A;  1ZPS A;  3KLS X;  2HTH A;  1FMA D;  1JWA D;  4BBN C;  2BWF A;  4ZHO A;  5D7G A;  1V80 A;  4XC2 A;  4RM8 A;  1LFD A;  2KAN A;  2JYT A;  2KC2 A;  2VH2 A;  2OOB B;  4A9A A;  3R66 C;  3MJ5 A;  1K8R B;  1UBI A;  2RPV A;  4TQ0 A;  4BKT A;  1N61 A;  2KMM A;  2EEL A;  1QOA A;  1V5T A;  2CHZ A;  3A9J A;  3C8Y A;  5HHD G;  3DDC B;  1TBE A;  1FIQ A;  2ONQ A;  1FXA A;  3NS8 A;  3WAM A;  4DDG D;  1D5X C;  1AYF A;  3BZD B;  3WIM A;  1I4G A;  1NI2 A;  2ZCC A;  3W2D A;  3JSV B;  1LGR A;  3Q3J A;  4W9I A;  2KTR A;  1HTQ A;  1XLO A;  3B2F A;  2ZCB A;  3H6N A;  2G9H D;  4NAM A;  1WJN A;  1C3T A;  4A20 A;  3A1Q B;  2LAS A;  4OVZ A;  2N9X A;  3IT4 B;  3KUC B;  1TS4 A;  1Q0W B;  1CZP A;  1I4R A;  1KOT A;  4FXC A;  1HE8 A;  4DXG A;  3PT2 B;  4MGK E;  4CO7 A;  4LNK A;  1V2Y A;  3KW5 B;  1HZ5 A;  3SR6 A;  4YL8 A;  4NQL B;  4KSL C;  1FCC C;  1V86 A;  3P42 A;  2KJ6 A;  3VQI A;  3HK0 A;  2N4F A;  5FK9 C;  1L4Z B;  3DBH I;  4L23 A;  3ZNI D;  1WGR A;  5L83 A;  1IGD A;  3AEB B;  2Y5C A;  4IW0 A;  4TSS A;  1JW9 D;  3RZF A;  2PPH A;  3JVZ X;  3MC9 A;  3OWE B;  4DQO C;  3EA6 A;  1L0V B;  1PGX A;  1WX7 A;  1C4C A;  5BMG A;  3W1S C;  4AOF A;  4W9F A;  2WXP A;  2K1F A;  1I4P A;  1Y8R C;  2V3N A;  2XBB C;  1MFW A;  4ANX A;  4HLE A;  4RGM A;  1TZO A;  5E6O A;  2D3A A;  1C76 A;  1OGW A;  1V9J A;  4J6I A;  1WGK A;  4IM3 A;  3PO0 A;  3MP9 A;  4YSY B;  2IY1 B;  3HIZ A;  4K1R B;  4YSX B;  1GAQ B;  3B08 A;  4EZK A;  1ZXI A;  2V3P A;  2L32 A;  2C7N B;  3AM9 A;  4C7Y A;  3Q8B A;  5LXI B;  1MHX A;  2NVU I;  1IBX A;  2JZZ A;  1I42 A;  3AE4 B;  1RM6 C;  1V5O A;  2HDE A;  3VR9 B;  4PYZ A;  4RCO A;  3DHI C;  3PS6 A;  1JWM D;  2MBQ A;  2GBJ A;  3Q2A C;  1WR1 A;  2O2V A;  4EOY A;  2ZW0 A;  2WS3 B;  4WAA A;  2KDM A;  3RYT A;  1XLN A;  1RRB A;  2WXL A;  4ANU A;  3IFW B;  1L5P A;  2LFI A;  3L16 A;  1JAL A;  3TCA A;  4RM9 A;  4EKU A;  4A3P A;  1GUA B;  1WZ3 A;  3H7S A;  3KWL A;  2M8S A;  4S0R A;  1WRI A;  2YLM A;  2BT6 A;  3DBS A;  3ZIM A;  4WWO A;  1WY8 A;  1QQR A;  1N5W A;  2FCM A;  4F7Z A;  4EZL A;  4K3B A;  3QC8 B;  3UQA A;  2LGS A;  1FEH A;  2KQ4 X;  4LJP B;  3NVW A;  2LGY A;  3HUI A;  5E6N A;  2LUE A;  3N1Z C;  4GDK A;  4XX5 A;  2N9E B;  3OJ4 B;  1ZP0 B;  2KT7 A;  4ZYN A;  2X38 A;  3DVN V;  4K81 A;  2MJD A;  3PZD A;  1J7C A;  1ZDV A;  2NMQ A;  3KYD D;  5EE1 A;  4RNA A;  1EM7 A;  1QIL A;  1TS2 A;  1HXY D;  1VZ7 A;  1XLP A;  2NS5 A;  3CWI A;  3UIO B;  3VTU A;  2EKI A;  1WIA A;  1M4V A;  4N58 A;  2CJN A;  3QQ8 B;  2KQ7 A;  3U2S C;  3A9K B;  1E8Y A;  3AE1 B;  1D5M C;  1PDX A;  4QAY A;  4YWG G;  4CYE A;  1OFF A;  2KFK B;  4ZRJ A;  2MLB A;  3TIX A;  1OQR A;  3IVF A;  4HKQ A;  2MBB B;  2PVO D;  3VUY A;  5DPS A;  2LXC A;  4I6L B;  3N30 A;  2KMC A;  1WJ4 A;  4IM2 A;  4JPS A;  4ZYS A;  2LWP A;  1Z5S B;  2C5L C;  3WAN A;  2K39 A;  2L76 A;  3BVM A;  2MP2 A;  1ZW7 A;  3EGR A;  4KZ0 A;  2FE8 A;  1FNW A;  3IHP C;  3W5V B;  1P98 A;  1IUE A;  4RFB A;  2KO3 A;  2IZV B;  4RGO S;  2QIE B;  3UIN B;  4ICU A;  4XYC A;  4JWS C;  3NZ3 A;  4MEL A;  3TEZ A;  1MG8 A;  1E9M A;  4US8 A;  3L0W B;  2MWS B;  5IKC M;  4GGQ A;  2BYE A;  3PRP B;  3TEY A;  3GS2 A;  4PS8 A;  1SB3 C;  2JXT A;  4DXA B;  1PFD A;  1WRD B;  2CU3 A;  1AW7 A;  4RF1 A;  1WXM A;  1K51 A;  4WWP A;  3RT3 B;  3O65 B;  1P1A A;  1WMH A;  1FM0 D;  3DBL I;  4KVG B;  4W9L A;  3DBR I;  5BYQ A;  5G5H A;  2BB6 A;  3VRB B;  1EF5 A;  1GNU A;  4M8N A;  1DOI A;  3TL5 A;  3QCA A;  1S3S G;  5AZF A;  3H8H A;  4ARC A;  2G4D B;  4XWT A;  2RDB C;  4TMA B;  2PLP A;  1E8W A;  3BII D;  1MHH E;  2KX0 A;  5H8Y E;  1DGJ A;  3GE8 C;  3P2B A;  2JT4 B;  1ZXH A;  4HPL B;  2LGD A;  2NBV B;  3AUL A;  3FKY A;  1FRD A;  3HRD D;  4KDL B;  1WYW B;  5DPW A;  1UF0 A;  1YQ3 B;  2JZP A;  4DHZ E;  2M0A A;  2KLG A;  4N9F 4;  3NUH B;  2M4N A;  2OJW A;  2D11 A;  4GDL B;  1WE7 A;  2DEN B;  4AJW A;  2EMS A;  1C4A A;  1PQS A;  3NJT A;  3C0R B;  2H89 B;  4KGR A;  4P1B C;  2X8X X;  2G3Q B;  4HK2 A;  4AUQ C;  1R4M I;  2XK5 A;  4DXF A;  1ET9 A;  4K7W A;  3ENE A;  5BYR A;  1P7E A;  4KDI C;  1L6V A;  1KM7 A;  2YEP F;  4D2K A;  2LJI A;  3L17 A;  4GU2 A;  1IP9 A;  1Q10 A;  3R7R A;  1PGB A;  2I1K A;  2M56 B;  2LMC A;  3V60 A;  3DHH C;  4IC7 B;  5JHB A;  3L13 A;  4NNJ B;  4MJS B;  2JQR B;  2FID A;  4GLS C;  2L83 A;  2WXH A;  1ENF A;  2K3U A;  1VJK A;  2XN9 C;  2KDE B;  4JLC A;  4ITK A;  4NAW B;  1SJE D;  4A3O A;  3PSE B;  1YX5 B;  1NYR A;  2ZPN A;  2J52 A;  3SU8 X;  5LXH A;  4REZ A;  1HTO A;  1SE9 A;  1KH0 A;  3P4P B;  4NJC A;  3APC A;  1GJZ A;  2N7E A;  3RI7 C;  3DVG X;  2DZI A;  5HI1 A;  3CSF A;  3NZU A;  4I6N B;  4S17 A;  4C56 C;  1ZE3 D;  4E74 A;  1F52 A;  3U30 A;  3BK1 A;  4II2 B;  3VTV A;  4USA A;  3APF A;  4M01 A;  2MBO A;  2PTL A;  3PZ8 A;  2NCN A;  2DYM A;  2ZNV C;  4B0E A;  2C7H A;  1SIJ A;  1V81 A;  2DYB A;  1GOZ A;  4W9H A;  3H7P B;  5IAA C;  1XLQ A;  5IA7 A;  3FAH A;  3IT6 B;  1XF5 L;  2DAF A;  1B1Z A;  1HZ6 A;  3LB8 C;  1E7V A;  1K50 A;  2NPT A;  2OHF A;  2MQJ A;  4IKG A;  2CR5 A;  2GB1 A;  3JW0 X;  2A4Z A;  4IWQ A;  4WJQ A;  4M0W B;  4P7I A;  2ASQ A;  1V1P B;  4E3C A;  2V3S A;  3A1Q A;  3Q3N C;  1WJ6 A;  2JZ3 B;  2LJ5 A;  4JIO U;  4NJ7 A;  1SE3 A;  1A5R A;  3VR8 B;  3PHW B;  2SAK A;  4JX1 C;  5BO4 B;  2O6V B;  3DBL B;  3U4E G;  2KOX A;  3ONS A;  3ZQ4 A;  3ML9 A;  1I7H A;  3ZYY X;  2KJH B;  2WWZ A;  1MJD A;  1OQQ A;  2O6V D;  3DVG Y;  4FHJ A;  2IO0 B;  4MEM A;  4US9 A;  3DWG C;  3SD5 A;  3MC8 A;  2M17 A;  3TEW A;  2K25 A;  3L4P A;  1FRR A;  2I38 A;  2Z8L A;  1E5W A;  4PK1 A;  3WCQ A;  4A90 A;  5IOI A;  2WXK A;  4G11 A;  3GOE A;  3CST A;  2BYT A;  1LXD A;  1EU3 A;  4ZOH C;  1PUT A;  3ZRC A;  1ROE A;  2A5U A;  1IGC A;  3DOW A;  1P7F A;  2H88 B;  3RZW C;  3VH3 B;  5J17 A;  1D5Z C;  4HEA 1;  5IP4 D;  2GOW A;  2IYD B;  2AWT A;  1PYW D;  1WXV A;  3E56 A;  2WXG A;  4BKS D;  2WDR B;  4C80 A;  1YIW A;  1R4M B;  1T5X D;  1JWU D;  1B9R A;  3ZNG C;  2ZVN A;  4L2Y A;  2FCS A;  3AE5 B;  3N32 A;  2INC C;  4HVB A;  5DPR A;  2QEJ C;  4W9E A;  1MVK A;  4XDD A;  1R7S A;  4KIK B;  4N59 A;  2LGI A;  1ZDX A;  1EF1 A;  3EFU A;  1QT9 A;  4GSW A;  1XQQ A;  2EMT A;  2L0T A;  2G1E A;  1D3Z A;  3KQ4 A;  2MHJ A;  2J0J A;  1SE4 A;  4HRS A;  5GXG B;  3GZN I;  1E6E B;  3BVZ A;  2BYF A;  2L0F A;  4G3X B;  2LI5 A;  4XGA B;  1FXT B;  3Q69 A;  1TYG B;  2LUM A;  2REX A;  4WWN A;  5G55 A;  1TS3 A;  2BWE S;  4KV2 A;  1V6E A;  1WJU A;  2LEK A;  4LTU A;  3BIN A;  2KAC A;  5FKA C;  3DVN U;  1F1H A;  3RNE C;  1NYQ A;  4RH6 A;  5IO9 A;  2M0X A;  5KHQ A;  3U7Z A;  1VLB A;  1WF9 A;  3VUX A;  2RGF A;  1WXA A;  3RNB C;  2V4I B;  4I6P A;  4WUR A;  4YSZ B;  3ABV B;  2IJ0 A;  4JQW C;  1QLB B;  2D5G A;  3AEC B;  2KWC A;  4C4V A;  2QCZ A;  3ZNH B;  2BVC A;  2V1Y A;  1QKZ A;  1FO4 A;  4P1C C;  1Q1O A;  4W9K A;  1TZ1 A;  2J7Q B;  3I63 C;  1HQR D;  5JXV A;  2W3R A;  4EZJ A;  2PE6 B;  1J0G A;  4RGN A;  2LVO A;  3NG0 A;  1SEB D;  3W5U B;  3AE6 B;  2SEB D;  3E9S A;  3A9K A;  2L7R A;  3U52 E;  1RLF A;  5AUK A;  2AYO B;  2WXN A;  4KKI A;  2QIL A;  2KFK A;  1N5X A;  1RFA A;  4CHK A;  4IWP A;  4ANV A;  1OTR B;  1U4A A;  3SDL C;  2D2Q A;  5CHF A;  5L95 C;  2L52 A;  1NDD A;  2C60 A;  4FLH A;  2DWQ A;  2BYV E;  2MBE A;  3ML8 A;  4XE0 A;  1C9F A;  4IOI E;  2WXM A;  2IO2 B;  4MH8 A;  2IO1 B;  1YMH E;  4H2A A;  3LJ3 A;  1UEL A;  4LK0 M;  2KYW A;  1WGG A;  3QA8 A;  1WXQ A;  1L2N A;  1JCK B;  1UZX B;  1T0S C;  2GBR A;  2WX1 A;  5T8I A;  1WX8 A;  4FAD A;  2RSU A;  3M62 B;  3MC0 B;  4LDT B;  2KDB A;  2UU7 A;  1IBX B;  2BB5 A;  4NY0 A;  3BVG A;  3W9C B;  1NEN B;  4B95 A;  4LDT D;  1NI3 A;  5H92 C;  1JRO A;  3QHT A;  2EKE C;  2KTF A;  3T8M A;  1FCL A;  5BMI A;  3L54 A;  1T3Q A;  3ZUN A;  2L00 B;  2PE9 A;  4B6W A;  1EO6 A;  4P6V F;  3DCG A;  2Z0E B;  1YX6 B;  4HDO A;  2BS2 B;  2FNJ B;  3NVV A;  3MFG A;  1DYQ A;  1C1Y B;  4XWW A;  1F77 A;  1CJE A;  3B0A A;  3N3K B;  1YN5 A;  3BY4 B;  4F1S A;  2XNA C;  2DBY A;  3HHM A;  3WAL A;  1E0Z A;  2D3G A;  2UWQ A;  3GE3 C;  2LGX A;  3AH7 A;  1WI0 A;  1TKY A;  2DNF A;  2QSD A;  2MJ3 A;  3GZN B;  3DBH B;  2WYQ A;  2LHD A;  1TTN A;  2N7D A;  4GDK B;  1GC7 A;  2FUG 1;  3VH4 B;  4FA6 A;  3K9P B;  1JML A;  2KWU B;  1KLG D;  4WJN A;  4HRO A;  1GG3 A;  2IY0 B;  2W3S A;  4MM3 A;  2JF5 A;  3RN9 C;  1X1M A;  2K6D B;  2LVP A;  1UWM A;  2K9X A;  1V97 A;  2MX2 A;  4GDL A;  4GOC A;  3UQB A;  2KD0 A;  4DDI D;  5JZE B;  1KFY B;  4BAX A;  3IG3 A;  2ACZ B;  3ZJT A;  3ZTC A;  2FIF A;  5EDS A;  2WDT B;  1NBF C;  2MRP A;  2WXQ A;  3B9J A;  4ARI A;  1ZUD 2;  3PTF C;  1C78 A;  2KXJ A;  2WHI A;  2Y3A A;  3N20 C;  3QWZ B;  3AE8 B;  2QDF A;  1ZKH A;  3IXS A;  3RD2 A;  1JWS D;  3ZXR A;  4GXB A;  5TR5 A;  2CKH B;  3V62 A;  1T0Y A;  3KWV A;  4MGY E;  1XXG A;  4ZRP A;  3FIL A;  3H1U A;  1ESF A;  2L05 A;  2K6Q A;  2V0G A;  3AEG B;  4A8X C;  3Q3O C;  4PS7 A;  3ALB A;  1D4B A;  3ZGZ A;  3H9D A;  3A4S C;  4LNO A;  3KYC D;  4DK5 A;  3P4R B;  4DHJ D;  2HD5 B;  4ZRI A;  3VVW B;  3P4Q B;  2JU6 X;  2IDY A;  2WNM A;  1TJE A;  2AQ3 B;  1UNS A;  3LXF A;  4IM0 A;  3MHS D;  2MA9 B;  3AEA B;  1J7A A;  3BYY B;  2IPK D;  2JPH A;  1UWX A;  2HTM E;  2L8J A;  2V9H A;  3RNC C;  1TKE A;  3T3O A;  1LQB A;  1YQ4 B;  4HCP B;  2C9W B;  2GLS A;  4L1B A;  2IGD A;  4M02 A;  4EE2 A;  4JWU C;  2PIA A;  3NZS A;  1YN3 A;  3SEB A;  1N6Z A;  1GB4 A;  4FJV B;  1VRA B;  1L0Y B;  4IWO A;  5C1Z A;  2R2Q A;  1WH3 A;  4GN1 A;  4MSQ B;  4ICV A;  1UUP A;  3WA0 A;  5AUI A;  5BMH A;  1FPY A;  1MI0 A;  3H7P A;  2OJR A;  2KDF B;  2N9P C;  2PMV A;  2DAJ A;  3GP7 A;  4DHZ B;  2B3A A;  3PRE A;  1H8C A;  2AL3 A;  3OJ3 A;  5D3D A;  2DZM A;  3HM3 A;  1BUI C;  1S1Q B;  4BVU C;  2BTE A;  4IG7 B;  1V8C A;  2RMM A;  2CHW A;  1WXS A;  1FNU A;  2JX5 A;  2ZJD A;  3ZTD A;  5D6J B;  1V1P A;  4BOZ B;  4X57 B;  1FFU A;  2G45 B;  3ZVV A;  1YOV B;  4TUU A;  2KX3 A;  3ZXV A;  4DBG A;  4HCN B;  4DWF A;  2O6V A;  5I4D A;  1JQ4 A;  2GBM A;  4TQ1 A;  3URY A;  2VH1 A;  2NBU A;  3BK2 A;  1N62 A;  3R3M A;  1XEE A;  1SIF A;  5KHO A;  2LVQ A;  2K5P A;  5HG2 A;  1C4P A;  2KK8 A;  2NBW B;  1JRU A;  3T9L A;  3VXW A;  1STE A;  2DX5 B;  3APD A;  4PYU A;  5AEK B;  2KN4 A;  3A4R A;  2KAJ A;  3AU4 A;  4HXD A;  2XK5 B;  4XDC A;  1BXT A;  3BWU D;  2KN5 A;  4OZC A;  2WGS A;  5AZG A;  2KMA A;  1VR9 A;  1WGY A;  2AX5 A;  1SXT A;  3KVF B;  3JSV A;  2JYE A;  4PS3 A;  1ISN A;  4WQO B;  3PV1 A;  1WX9 A;  2JXX A;  4BKS A;  4MDK E;  1E10 A;  1NVI D;  3I9V 1;  3P4S B;  2GBK A;  1SE2 A;  4E71 A;  1Z2M A;  2J0M A;  2ICI A;  2KVZ A;  3AMZ A;  4AJY B;  2LRW A;  5CHW A;  3AB5 A;  3Q8E A;  3I5J C;  1P0R A;  3M3J A;  4KX6 B;  3TBL D;  2JY6 A;  4RMA A;  4P16 A;  2HJ1 A;  1KJT A;  2J0K A;  2YEP B;  3DWM A;  1FFV A;  3DBR B;  3AE7 B; 
#chains in the Genus database with same CATH homology
 2MLB A;  2FUH B;  3TIX A;  2M0X A;  1BT0 A;  5KHQ A;  3DPD A;  1WF9 A;  3VUX A;  3MJW A;  4HWI B;  3PRM B;  4KIK A;  3IVF A;  4GIV A;  5JH5 C;  2RGF A;  1WXA A;  5GMV A;  2HE7 A;  4GB9 A;  2MBB B;  4I6P A;  2DHZ A;  1WMH B;  2W9N A;  3UIP B;  3VUY A;  5DPS A;  4JQW C;  2LXC A;  4I6L B;  2KWC A;  3N30 A;  3ZDT A;  2KMC A;  2MW5 A;  3ZNH B;  1WM3 A;  3PGE A;  2V1Y A;  1WJ4 A;  4EUT A;  4IM2 A;  2R2O A;  1Q1O A;  1WM2 A;  4WJP A;  1E7U A;  4W9K A;  1TZ1 A;  1IYF A;  2GBN A;  2J7Q B;  1WR6 E;  2V4L A;  2ZEQ A;  3PLU A;  2NR2 A;  2KNB A;  2RR9 A;  2LWP A;  3QAQ A;  1Z5S B;  1WFY A;  2C5L C;  3WAN A;  2K39 A;  2L76 A;  4FJZ A;  2MP2 A;  1ZW7 A;  4OVU A;  4KZ0 A;  4EZJ A;  2PE6 B;  2MSE D;  1J0G A;  3B1L X;  2MCN B;  3IHP C;  2LVO A;  1P98 A;  3EEC A;  2KO3 A;  3RUI B;  2IZV B;  4K7U A;  4II3 B;  2N1V A;  2VRR B;  3UIN B;  3NHE B;  4ICU A;  5C23 A;  4NQK E;  3R7Q A;  3V6E B;  3KUZ A;  3A9K A;  4NJ6 A;  4MEL A;  1LM8 B;  2L7R A;  1MG8 A;  3EHV A;  1RLF A;  2KHW B;  1ZGU B;  2AYO B;  3L0W B;  2KQS A;  2MWS B;  4GGQ A;  2BYE A;  1H4R A;  2NPT B;  5G2N A;  2KFK A;  3PRP B;  3L10 B;  1UGM A;  1RFA A;  4CHK A;  4IWP A;  4ANV A;  2DZJ A;  4PS8 A;  4HPM B;  1OTR B;  2Y5B B;  3M63 B;  1U4A A;  4W9D A;  3SDL C;  3KH0 A;  2D2Q A;  2FCQ A;  4DXA B;  1WRD B;  3CMM B;  3L08 A;  5CHF A;  1WXM A;  5L95 C;  1V49 A;  1NDD A;  3QX1 A;  2C60 A;  5J2R A;  4FLH A;  2IO3 B;  2KWV B;  4WWP A;  2CS4 A;  2BYV E;  3RT3 B;  1E90 A;  2MBE A;  3O65 B;  3ML8 A;  1P1A A;  2KZR A;  1WMH A;  3V6C B;  4TKN A;  2ZPY A;  2Z59 B;  5LLI A;  2RD0 A;  3DBL I;  1E8X A;  5CX3 A;  4KVG B;  4W9L A;  3EC8 A;  3OLM D;  2IO2 B;  2UYZ B;  3DBR I;  2IO1 B;  5D94 A;  3ZRF A;  1EF5 A;  3VHT C;  3LJ3 A;  1GNU A;  4GMV A;  4M8N A;  1UEL A;  3NY5 A;  5JHA A;  2D07 B;  1EUV B;  3TL5 A;  3QCA A;  1S3S G;  1WGG A;  5AZF A;  3QA8 A;  2KDI A;  2G4D B;  1L2N A;  4EEW A;  2G4S A;  1UZX B;  4W9C A;  2GBR A;  2WX0 A;  1E8W A;  2KX0 A;  2WX1 A;  3UF8 A;  2LZ6 A;  1WX8 A;  2KVR A;  1OQY A;  3ZDM C;  2M1M A;  3P2B A;  4FAD A;  2AL6 A;  2RSU A;  3ZO5 B;  3M62 B;  4LDT B;  3A33 B;  2JT4 B;  4F8C B;  4HPL B;  3A9J B;  1WZ0 A;  2KDB A;  1VD2 A;  2LGD A;  1J8C A;  2NBV B;  3HM6 X;  3MTN B;  4G50 A;  3AUL A;  3NOB A;  4FHK A;  4NY0 A;  3U8Z A;  3ZW3 A;  2CU1 A;  4KDL B;  4BBN F;  3PVL A;  1WYW B;  2JVC A;  1VCB A;  5DPW A;  4HJK A;  4B95 A;  4LDT D;  4DHZ E;  1UD7 A;  3QHT A;  2EKE C;  2KLG A;  2KTF A;  2HJ8 A;  4N9F 4;  3T8M A;  2K8H A;  2JRI B;  2BPS A;  2M4N A;  1P9D U;  3L54 A;  2KTR B;  5DPT A;  3RCZ A;  3ZUN A;  3I3T B;  4ANW A;  2D11 A;  4GDL B;  2IBI B;  2L00 B;  1WE7 A;  2PE9 A;  1EO6 A;  2DEN B;  4FN2 A;  2YVC A;  4B6W A;  3DCG A;  1WGD A;  4AJW A;  2EMS A;  4NPN A;  4BFR A;  1M94 A;  4IUM B;  2Z0E B;  1YX6 B;  1PQS A;  4HDO A;  1UH6 A;  1OEY A;  1GC6 A;  2LXA A;  3C0R B;  2Z0D B;  3OAW A;  3M95 A;  2FNJ B;  2HTH A;  4FBJ B;  2G3Q B;  4HK2 A;  4AUQ C;  4AWJ A;  1R4M I;  4BBN C;  2BWF A;  2XK5 A;  5D7G A;  3ZKJ C;  4K7W A;  1C1Y B;  3ENE A;  1V80 A;  4XC2 A;  2I1J A;  3D32 A;  4RM8 A;  3B0A A;  3N3K B;  1LFD A;  2KAN A;  2KC2 A;  1G6J A;  3BY4 B;  2OOB B;  4KDI C;  4HDQ A;  4F1S A;  3R66 C;  1KM7 A;  3HHM A;  3WAL A;  2JRH A;  4JL9 A;  4ZRK A;  1SGH A;  1K8R B;  2D3G A;  2UWQ A;  3L17 A;  1UBI A;  1WGH A;  2LGX A;  4ZDV A;  4TQ0 A;  4BKT A;  1WI0 A;  4GU2 A;  1IP9 A;  2GMI C;  2ZNV B;  3R7R A;  3VAW A;  2LD9 A;  3AU5 A;  1V5T A;  2CHZ A;  3A9J A;  2I1K A;  3QIJ A;  3ZLZ A;  3PRZ A;  2WYQ A;  3DDC B;  1TBE A;  1TTN A;  2N7D A;  2BKF A;  4GDK B;  1GC7 A;  3NS8 A;  3VH4 B;  3V60 A;  4FA6 A;  3K9P B;  4ASW C;  4IC7 B;  2KWU B;  3WAM A;  4WJN A;  3AXC A;  4DDG D;  3L13 A;  4NNJ B;  4MJS B;  5JHB A;  1GG3 A;  2IY0 B;  5E6P A;  2L3Z A;  3WIM A;  2FID A;  1NI2 A;  2ZCC A;  2C7M B;  3JSV B;  4MM3 A;  2JF5 A;  3Q3J A;  4W9I A;  1X1M A;  2K6D B;  2KTR A;  2LVP A;  2KDE B;  2MX2 A;  4GDL A;  4JLC A;  4GOC A;  3UQB A;  3WAO A;  2KD0 A;  4DDI D;  4NAW B;  4A3O A;  2ZCB A;  5JZE B;  3PSE B;  3H6N A;  1YX5 B;  1WJN A;  1C3T A;  3IG3 A;  2ZPN A;  3SU8 X;  4KSK C;  5LXH A;  3ZTC A;  4KZC A;  2FIF A;  4A20 A;  2WDT B;  5EDS A;  1NBF C;  2MRP A;  4FJY A;  1SE9 A;  3A1Q B;  4EFO A;  4BKG A;  3W1Y A;  2LAS A;  3PTF C;  3APC A;  3VUW A;  1GJZ A;  2N7E A;  2KXJ A;  3DVG X;  2DZI A;  2N9X A;  3KUC B;  3LDZ E;  5D2M B;  1Q0W B;  3CSF A;  3NZU A;  4I6N B;  5DCN A;  2KKC A;  3QWZ B;  1YJ1 A;  4E74 A;  1ZKH A;  3U30 A;  2JWZ A;  3PHX B;  4II2 B;  3VTV A;  3RD2 A;  1KOT A;  4GXB A;  1HE8 A;  1I35 A;  5TR5 A;  2CKH B;  3U7D A;  3APF A;  3V62 A;  4AP4 C;  3PT2 B;  1T0Y A;  1KLV A;  2MBO A;  4MGY E;  2NCN A;  2DYM A;  4MGK E;  2BGF A;  4CO7 A;  1V2Y A;  2ZNV C;  3H1U A;  2C7H A;  1V81 A;  2K6Q A;  2DYB A;  2L05 A;  3KW5 B;  1AAR A;  2BKR B;  4W9H A;  4YL8 A;  3H7P B;  5IAA C;  2PEA A;  4NQL B;  4KSL C;  4PS7 A;  3ALB A;  1V86 A;  1QZE A;  5IA7 A;  3H9D A;  3A4S C;  2DAF A;  3KYC D;  4DK5 A;  2KJ6 A;  2FAZ A;  1TGZ B;  3VQI A;  4DHJ D;  3HK0 A;  2KC1 A;  2HD5 B;  4ZRI A;  3VVW B;  2N4F A;  1E7V A;  1YQB A;  2NPT A;  4B9K A;  2MQJ A;  3DBH I;  3ZNZ B;  2K8B A;  3ZNI D;  2CR5 A;  1WGR A;  5L83 A;  2O2V B;  3VTW A;  3Q3F A;  4FUL A;  4W9G A;  4IM0 A;  3JW0 X;  2A4Z A;  4IW0 A;  3MHS D;  2JUO A;  4IWQ A;  4WJQ A;  1P3Q U;  2MA9 B;  3RZF A;  4M0W B;  4P7I A;  2ASQ A;  3PLV A;  2PPH A;  3JVZ X;  4E3C A;  2V3S A;  5CHV C;  3K9O B;  3A1Q A;  1WX7 A;  4MGZ E;  1WJ6 A;  2JZ3 B;  2JPH A;  3W1S C;  2L8J A;  4AOF A;  2AEH A;  2LJ5 A;  4JIO U;  4NJ7 A;  3W1S A;  1LQB A;  4W9F A;  1OEY J;  1A5R A;  4HCP B;  2C9W B;  3PHW B;  2K1F A;  1E8Z A;  1Y8R C;  3IBE A;  5BO4 B;  2O6V B;  4URK A;  2XBB C;  3NZS A;  1Q5W B;  4ANX A;  4HLE A;  2KOX A;  3ONS A;  4OVV A;  4FJV B;  2RPQ A;  5E6O A;  4IWO A;  3ML9 A;  5C1Z A;  1OGW A;  1V9J A;  2R2Q A;  2KJH B;  4J6I A;  2WWZ A;  1WH3 A;  4G0N B;  4GN1 A;  4IM3 A;  4MSQ B;  2O6V D;  3DVG Y;  4FHJ A;  3AI5 A;  4ICV A;  2IO0 B;  2IY1 B;  3HIZ A;  1XD3 B;  4MEM A;  4K1R B;  3SD5 A;  3WA0 A;  2XEW A;  3H7P A;  2M17 A;  2OJR A;  3B08 A;  2KDF B;  4EZK A;  2K25 A;  2N9P C;  2C7N B;  2DAJ A;  1F9J A;  5CTR C;  4DHZ B;  5LXI B;  3RUL A;  2NVU I;  3QAR A;  4MH0 E;  2B3A A;  2JZZ A;  3PRE A;  3VDZ A;  1H8C A;  4TV3 A;  1I42 A;  3SHQ A;  2AL3 A;  1V5O A;  3OJ3 A;  2ZZP B;  1UBQ A;  2DZM A;  3HM3 A;  1E5W A;  1S1Q B;  4PYZ A;  4BVU C;  3QK0 A;  3PS6 A;  4IG7 B;  2MBQ A;  2LRU A;  2GBJ A;  1WR1 A;  2CHW A;  2O2V A;  1WXS A;  3GOE A;  4G11 A;  4EOY A;  3CST A;  2ZJD A;  1R4N I;  4WAA A;  1L7Y A;  3ZTD A;  3WAP A;  4W9J A;  5D6J B;  4XZ4 A;  1LXD A;  3RYT A;  4BOZ B;  5J18 A;  3ZRC A;  4X57 B;  2G45 B;  3ZVV A;  3TJP A;  2A5U A;  3S2A A;  3DOW A;  1RRB A;  3V61 A;  2CHX A;  3DQV A;  4ANU A;  3IFW B;  3L16 A;  3RZW C;  4TUU A;  2DZK A;  2KX3 A;  3CF6 E;  3TCA A;  3VH3 B;  4RM9 A;  5J17 A;  4EKU A;  4DBG A;  5FR6 A;  2GOW A;  2IYD B;  2AWT A;  4A3P A;  1GUA B;  1WZ3 A;  1XT9 B;  1RAX A;  2MBH A;  4HCN B;  3H7S A;  1WXV A;  2KJR A;  3VFK A;  4DWF A;  2O6V A;  4BKS D;  2GBM A;  2M8S A;  4TQ1 A;  2YLM A;  4WJO A;  2KLC A;  2NBU A;  2ZVO A;  1YIW A;  1IPG A;  3DBS A;  1YD8 U;  3R3M A;  3ZIM A;  4WWO A;  1J19 A;  3ZNG C;  1SIF A;  3JYU A;  2FCN A;  5KHO A;  2ZVN A;  1WY8 A;  3ECI A;  2FCS A;  3N32 A;  2FCM A;  4F7Z A;  2LVQ A;  5HKH A;  4EZL A;  4HVB A;  5DPR A;  3QC8 B;  3UQA A;  2K8C A;  4JGH B;  2KK8 A;  2NBW B;  4MGI E;  1JRU A;  4LJP B;  4W9E A;  3TMP B;  3T9L A;  3VXW A;  4KIK B;  2LGY A;  3PPA A;  2DX5 B;  3X23 A;  3APD A;  5E6N A;  4PYU A;  1EF1 A;  3EFU A;  5AEK B;  2LUE A;  3A4R A;  4BOS C;  4DHJ B;  3AU4 A;  4HXD A;  4GSW A;  2XK5 B;  4GDK A;  1XQQ A;  4XX5 A;  2EMT A;  2N9E B;  2L0T A;  3OJ4 B;  2KN5 A;  1D3Z A;  5AZG A;  2KMA A;  2N1W A;  1WGY A;  4MJS A;  3KUD B;  4ZYN A;  3KVF B;  3JSV A;  3DVN V;  4K81 A;  2J0J A;  3PZD A;  4PS3 A;  2KFJ A;  3KYD D;  4LCD E;  1ISN A;  4WQO B;  3GZN I;  3PV1 A;  1WX9 A;  4NAW A;  2JXX A;  2MP2 B;  2NS5 A;  2BYF A;  4BKS A;  2L0F A;  4MDK E;  3UIO B;  3X0W A;  3QJZ A;  4G3X B;  2LI5 A;  1FXT B;  3VTU A;  1WIA A;  2GBK A;  2REX A;  4WWN A;  5G55 A;  4E71 A;  4MSM B;  1Z2M A;  2J0M A;  1CMX B;  4AJY B;  2BWE S;  3QQ8 B;  2LRW A;  2KQ7 A;  1V6E A;  1WJU A;  3A9K B;  4KV2 A;  5CHW A;  1E8Y A;  2D10 A;  2QHO A;  4M8M A;  2DYO A;  4K7S A;  2PJH A;  1P0R A;  2BF8 B;  3M3J A;  3BIN A;  4LJO B;  5AZH A;  3TBL D;  3UGB B;  4CYE A;  2JY6 A;  4RMA A;  3DVN U;  2KFK B;  1KJT A;  2J0K A;  4ZRJ A;  1WE6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...