5C23A

Parkin (s65dublr0rbr)
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
405
structure length
384
Chain Sequence
MIVFVRFNSSHGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELRNDWTVQNCDLDQQDIVHIVQRPWRKGQEMNATNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGNGFAFCRECKEAYHEGECSAVFEYRVDERAAEQARWEATTKPCPRCHVPVEKNGGCMHMKCPQPQCRLEWCWNCGCEWNRVCMGDHWFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
publication title Disruption of the autoinhibited state primes the E3 ligase parkin for activation and catalysis.
pubmed doi rcsb
source organism Homo sapiens
total genus 85
structure length 384
sequence length 405
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-06-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 5c23A01
3DBHI 2O2VB 2Z0DB 1XQQA 2BKRB 3AULA 3UF8A 2K39A 2O6VD 2JRHA 3VTWA 1ZGUB 3UGBB 2KWVB 5DPWA 1P98A 1LFDA 2FCNA 2KJ6A 2IO2B 2O2VA 1WH3A 2PPHA 4K81A 3ML8A 4HCPB 3R66C 2D07B 2LGYA 3NY5A 1WM3A 2RSUA 4W9DA 5J2RA 2AEHA 2JZ3B 2KKCA 2PEAA 3KYCD 4W9GA 1WGHA 1YJ1A 2GBKA 4FJZA 1AARA 4DXAB 2KQ7A 3Q3JA 3HHMA 2FAZA 2Y5BB 3EHVA 4MSQB 3OAWA 4AUQC 4KIKB 4NAWB 1XT9B 1FXTB 4DBGA 2RPQA 3EECA 5IAAC 5GMVA 2C60A 3PRMB 1L7YA 5DCNA 3T9LA 2LWPA 2JRIB 4KIKA 2IYDB 4NAWA 3VUWA 4DHJB 4IWOA 5CX3A 3HM3A 2DHZA 2N9PC 3X0WA 4KSKC 1PQSA 2KHWB 2LRUA 2AYOB 4ANUA 3ZNGC 4JQWC 2MLBA 4CYEA 1OQYA 4BKSA 4X57B 1WRDB 3HM6X 3QJZA 4E71A 4B6WA 2LJ5A 3ZNZB 3ZDMC 3BY4B 1WE7A 1OEYJ 2LI5A 2LUEA 4LCDE 3ZTDA 2VRRB 2DAJA 4M8NA 4NQLB 1ZW7A 1V9JA 2ZJDA 2MSED 2N1WA 3PZDA 4MDKE 4NY0A 2DAFA 4XC2A 2WWZA 3AU5A 1E7VA 2KNBA 3L16A 2V3SA 1V80A 1S1QB 2KFKA 2IO1B 2KLGA 3KVFB 4M8MA 2MP2B 4PS3A 2IBIB 4GDKB 4JIOU 3AXCA 1V5OA 3EC8A 4ZRIA 5JHBA 3A33B 2LXAA 2GMIC 4A3PA 5JHAA 4K7SA 2LASA 2M4NA 4LDTB 5AEKB 2XBBC 1G6JA 4JGHB 1U4AA 4GDKA 4WAAA 4GN1A 3ZRFA 2ZPYA 2R2OA 3ZO5B 3CF6E 4DHZE 1TBEA 2MQJA 1WR6E 2JY6A 4FHJA 2XK5B 3TCAA 4A20A 2HTHA 2L7RA 3X23A 1I42A 4WQOB 1GUAB 4WJOA 2N9XA 3K9OB 5D6JB 3VTVA 4K7UA 3OJ4B 1JRUA 2KOXA 2NBUA 3L13A 4CHKA 3ZKJC 1A5RA 3U7DA 2XK5A 2CHXA 2YVCA 2KC1A 4OVUA 4GDLA 3PSEB 3PLUA 4EEWA 4ANXA 3A9JA 3V62A 2K8CA 2MX2A 4G0NB 4PS7A 3U8ZA 4EFOA 3SD5A 3KUZA 4RMAA 4G3XB 2ZVNA 4EOYA 2LZ6A 2C7MB 4FULA 2K6QA 4NNJB 4MM3A 4IG7B 2N4FA 3H1UA 3K9PB 3O65B 3RZFA 1J8CA 5AZFA 4WJNA 4F1SA 3ALBA 3PT2B 1WE6A 3A1QA 2IO3B 3PHWB 3DPDA 3JSVB 3QK0A 3BINA 3Q3FA 1YQBA 3HK0A 2DYBA 3DVNV 3QC8B 3W1YA 2EMTA 2D3GA 3AI5A 2KFJA 1Y8RC 1MG8A 3CSFA 5TR5A 1BT0A 2JZZA 1UBQA 1WJNA 2JF5A 4GB9A 3SDLC 1I35A 4EKUA 3KW5B 4IWPA 3R7QA 1WMHA 3VQIA 4ZDVA 2D10A 4IUMB 4ZYNA 2NPTA 1KJTA 1V81A 3IG3A 4DDID 3GZNI 2K25A 2LD9A 3MHSD 3QA8A 4I6NB 4IM0A 3A4RA 4MJSA 5E6PA 1VCBA 2KJRA 1E8XA 2N1VA 2L3ZA 4W9IA 4ICUA 4WJQA 1UGMA 3KUDB 1E8WA 2HD5B 2ASQA 3APCA 5G55A 2FIDA 1Z2MA 2ZCBA 3N32A 1KM7A 1IPGA 1UD7A 1WGYA 2CU1A 4BOZB 2NVUI 1C1YB 1TGZB 1RLFA 1TTNA 4FJYA 4K1RB 2BKFA 3KUCB 1YX6B 1WXVA 4II3B 4P7IA 2MCNB 1WFYA 3P2BA 3APFA 2KDFB 3VUXA 2JVCA 2L0TA 3M3JA 5J17A 3OLMD 3RT3B 3H9DA 4EZJA 2J0KA 3VFKA 4IM3A 5C23A 4URKA 2OOBB 5IA7A 1HE8A 2L76A 1P0RA 2DZMA 2KTRA 4HPMB 3PRZA 3RULA 1IP9A 3QARA 3R7RA 2UWQA 1WGDA 3L0WB 2JUOA 2WYQA 2DZKA 1TZ1A 3PPAA 3QCAA 3R3MA 2G4SA 4K7WA 2KDBA 4W9FA 4GXBA 3NOBA 4NPNA 3PTFC 3WANA 1P3QU 2BF8B 3ZTCA 2KLCA 4KSLC 2G4DB 2L0FA 3VXWA 2FNJB 1WR1A 2K8HA 1WJUA 2K1FA 3CMMB 1H4RA 2KMAA 4LJOB 4XX5A 4HJKA 2MRPA 4RM9A 2PE6B 3QX1A 3GOEA 4W9KA 4BKSD 2GBNA 2KTFA 5E6NA 4F7ZA 2KFKB 2GOWA 4KZ0A 1GJZA 1CMXB 2B3AA 2I1JA 3TMPB 3M95A 3VAWA 2CS4A 2KJHB 2LVQA 2PJHA 4A3OA 4MGZE 1EF5A 1L2NA 2C7HA 3M62B 3H7PA 4ASWC 4IM2A 4HCNB 4HDQA 4BBNF 2FIFA 3LDZE 4FBJB 2M0XA 1YIWA 4G50A 4AJWA 1WX9A 4YL8A 3ZDTA 1WY8A 3ZRCA 4AOFA 3PV1A 4LJPB 4M0WB 4WWNA 4NJ7A 4JLCA 3ZIMA 1UBIA 1GNUA 3NZSA 3PLVA 5E6OA 3V61A 1Q1OA 5G2NA 4TUUA 3V6EB 2CKHB 4IW0A 2MBOA 4FA6A 4PYZA 3V60A 5DPSA 2MWSB 2FUHB 3WIMA 4TQ1A 3IVFA 2PE9A 4DK5A 4E3CA 2IY0B 1V6EA 4EZKA 4FN2A 2GBMA 1WM2A 3QIJA 4GDLB 2ZZPB 2MA9B 1YX5B 3A9JB 2V1YA 1KOTA 3L54A 1GC6A 3AU4A 3MJWA 4MGIE 1E90A 1J0GA 3H6NA 1Z5SB 4W9LA 4KDLB 4E74A 1UH6A 4II2B 2MBEA 2J0MA 2FCSA 1V86A 4ICVA 2KX3A 3B0AA 1GG3A 1R4MI 3MTNB 1RRBA 1WJ4A 2C9WB 3RUIB 3WAPA 3ZNHB 3A1QB 3VDZA 5D7GA 5LXHA 2DX5B 2DYOA 2NBVB 3JW0X 3PVLA 5BO4B 4FHKA 2C5LC 3QAQA 1WXSA 1T0YA 4BOSC 4CO7A 4W9JA 2Z0EB 1OGWA 3UQAA 3QQ8B 4JL9A 2KWUB 5D2MB 4G11A 1SIFA 5J18A 4ANVA 2GBJA 1WMHB 4MH0E 3DVNU 2KX0A 5C1ZA 3ML9A 4GGQA 2A4ZA 2NPTB 3ZW3A 5KHOA 4BVUC 3UIPB 2KQSA 3WALA 4MJSB 5JH5C 2ZPNA 2WDTB 1P9DU 4ZRKA 2XEWA 1VD2A 4WWOA 1V5TA 3VTUA 2EKEC 1E5WA 2WX1A 2LGXA 2M8SA 4RM8A 3PS6A 1IYFA 3NZUA 2GBRA 5HKHA 4NJ6A 2KWCA 1KLVA 4N9F4 3S2AA 2MBBB 3A9KB 3PGEA 4HLEA 2RR9A 2RD0A 4HDOA 2KANA 2EMSA 4XZ4A 4WWPA 2NR2A 3ENEA 2BYVE 4B9KA 2J0JA 3TL5A 2W9NA 3ZUNA 4FADA 3SHQA 1QZEA 4KZCA 1SE9A 5EDSA 2UYZB 3A9KA 3DCGA 3L10B 2CHWA 1F9JA 1WZ0A 1P1AA 1LM8B 3IBEA 3RCZA 1NI2A 5AZHA 4B95A 2KTRB 3JYUA 2O6VA 2BPSA 2YLMA 2ZCCA 2I1KA 2NBWB 4GU2A 4IWQA 3VUYA 1RFAA 4HXDA 4GSWA 1S3SG 1E7UA 2KN5A 3TIXA 2C7NB 4GOCA 3WAMA 2ZNVC 2JXXA 3DBLI 3LJ3A 4FJVB 3HIZA 4MSMB 3RYTA 1EUVB 2N9EB 2DZIA 4PYUA 2KK8A 2HJ8A 3ECIA 4NQKE 4DWFA 5JZEB 2ZVOA 2KXJA 1EO6A 3I3TB 4KDIC 5DPRA 4DHZB 4HPLB 2M1MA 3ZNID 3L08A 3KH0A 4DDGD 5CHWA 1C3TA 3DVGY 1WF9A 3DVGX 2IO0B 4OVVA 3VH4B 3UIOB 3H7PB 3KYDD 1RAXA 4AJYB 2IY1B 2ZNVB 3PRPB 1NBFC 1WGGA 4EZLA 1XD3B 3DDCB 1WIAA 4KV2A 3TJPA 3W1SC 2G3QB 3H7SA 3JVZX 2BWFA 4W9HA 2RGFA 3M63B 1WX7A 1UELA 4GMVA 4IC7B 1EF1A 2BYFA 2D2QA 3TBLD 2KD0A 1V2YA 2M17A 3ZLZA 3N30A 3RZWC 3OJ3A 2JWZA 1R4NI 2DZJA 1E8ZA 2L05A 2REXA 3QWZB 3B1LX 1WXMA 4WJPA 3DQVA 4DHJD 1X1MA 2DYMA 3CSTA 4MELA 2KC2A 2BGFA 3ZVVA 2L8JA 4I6LB 3A4SC 4TV3A 2KDIA 2LVOA 4MEMA 3L17A 2LVPA 5DPTA 2LRWA 4AWJA 3W1SA 2IZVB 1WX8A 3V6CB 3NHEB 2HE7A 1K8RB 3WAOA 1UZXB 1V49A 4AP4C 2KZRA 2QHOA 1LXDA 1OTRB 5CHVC 1WYWB 4FLHA 4HK2A 3UINB 2MBQA 2A5UA 4J6IA 2KMCA 3DBSA 2CR5A 2ZEQA 2MP2A 4I6PA 2N7DA 1Q0WB 2D11A 3ONSA 1M94A 3NS8A 3QHTA 1WI0A 3SU8X 2JPHA 3IHPC 4HVBA 1Q5WB 2MW5A 3U30A 4BKTA 1WJ6A 2G45B 2R2QA 4LDTD 5KHQA 1E8YA 2JT4B 2CHZA 1YD8U 2L00B 2NS5A 4ANWA 2LXCA 3UQBA 2MBHA 2WX0A 3VHTC 2AL3A 4W9EA 4HWIB 2AL6A 4MGKE 4PS8A 3D32A 4W9CA 4ZRJA 5CTRC 2FCQA 1WZ3A 1LQBA 4EUTA 1WXAA 2K8BA 2N7EA 4F8CB 2K6DB 2FCMA 3APDA 3N3KB 1OEYA 3PREA 1ISNA 1NDDA 4BKGA 2KO3A 2V4LA 5CHFA 3VH3B 5D94A 5L95C 2KVRA 2LGDA 3B08A 2KDEB 3C0RB 5L83A 2OJRA 3EFUA 2DENB 4BFRA 1H8CA 2O6VB 2J7QB 2Z59B 4MGYE 5AZGA 3WA0A 1ZKHA 2BYEA 2BWES 2NCNA 4KVGB 4BBNC 3JSVA 3VVWB 5LLIA 2AWTA 5FR6A 4GIVA 1D3ZA 3DOWA 3RD2A 1WGRA 5LXIB 1J19A 4TQ0A 1SGHA 3T8MA 4TKNA 1GC7A 3IFWB 3PHXB 3DBRI
chains in the Genus database with same CATH superfamily
3DBHI 2BKRB 3FILA 3VTWA 1V1OA 2KWVB 3DBHB 5DPWA 1Y56A 4XDDA 2FCNA 3AE2B 2O2VA 2PPHA 3SR6A 1EWYC 2LGYA 3NY5A 1WM3A 3AE8B 2JZ3B 2PEAA 5J2RA 2GBKA 2MHJA 4BAXA 1XF5L 2RPVA 3OAWA 4NAWB 4P6VF 1D5MC 3B2FA 4DBGA 3EECA 3R8BA 1C77A 1L7YA 5DCNA 4KIKA 2IYDB 4DHJB 3HM3A 2DHZA 4MT5A 3X0WA 4KSKC 2LRUA 2MLBA 2BS4B 2Q5WD 1RWSA 2WXOA 2XNAC 4WURA 4BKSA 4E71A 2LJ5A 4WAFA 3ZDMC 1OEYJ 4XDCA 2LI5A 1J7BA 2L52A 3I63C 3EA6A 2BTEA 2MJEA 3DWGC 2N1WA 3PZDA 2DAFA 4XC2A 3L16A 1OQRA 1YN5A 3KVFB 1ZOYB 2IBIB 4IOIE 4LDTB 4S0RA 4HROA 4PK1A 3CF6E 1RYJA 1TBEA 4N59A 1WR6E 2JY6A 4A20A 1I42A 1QOGA 2ZW1A 2NTTA 1GUAB 5GXGB 2KOXA 2KYWA 2NBUA 3U4EG 2XK5A 1FMAD 2CHXA 2KC1A 3ZGZA 4EEWA 4K3BA 2GRIA 4ANXA 2K8CA 2WU5B 3SD5A 2C7MB 1QLBB 2K6QA 4MM3A 5EE0A 1TJEA 2QIEB 2HTME 3IT6B 4HRSA 1N60A 2LMCA 3J9CA 1WE6A 2CU3A 3Q3NC 3A1QA 2IO3B 1IGCA 3DPDA 3HK0A 3QC8B 3AI5A 1BT0A 2V3NA 4GB9A 2RDGA 1ZP0B 3R7QA 4ZDVA 2D10A 2DBYA 4IUMB 2IPKD 5BYQA 3GZNI 2K25A 2LD9A 5E6PA 4MJSA 4RGOS 1YMHE 3GZNB 2W55A 1E8WA 2ASQA 3APCA 1EM7A 1L6VA 2ZCBA 4NZLB 1QOFA 1KM7A 2NVUI 4II3B 3P42A 1WFYA 3OLMD 1MPEA 5E6JA 1HE8A 2L76A 1P0RA 2QCZA 3RULA 2KDMA 3Q14C 3GP7A 1J7CA 3BK2A 2ICIA 1L5PA 2J53A 2K8HA 4WWMA 1H4RA 4XX5A 3GOEA 1KFYB 2KTFA 1GJZA 2XN9C 1VLBA 2B3AA 2I1JA 3TMPB 2WXFA 3M95A 4MGZE 1EF5A 1L2NA 3M62B 4HCNB 2FIFA 4FBJB 4QAYA 4YL8A 3ZDTA 4AOFA 1FO4A 3U2SC 3AE5B 3ZIMA 2KACA 4M01A 1Q1OA 1L4ZB 4FA6A 3NZ3A 4M0WA 4M00A 1EWCA 3WIMA 4TQ1A 3IVFA 2J4XA 3AN1A 1QF6A 1QKZA 3AE4B 4NAMA 4GDLB 3NUHB 3QIJA 2WDVB 3PZ7A 3A9JB 3MFGA 3MJWA 4MGIE 4ARIA 4JWSC 1UH6A 1ENFA 1R4MI 3MTNB 4NJCA 3RUIB 3CWIA 3VDZA 2DX5B 2DYOA 1R4MB 4FHKA 4W9JA 2WXMA 4DXFA 3U52E 1OGWA 3UQAA 4JL9A 2KWUB 1SIFA 4ANVA 2GBJA 2K5PA 2NPTB 3ZW3A 3UIPB 1JRPA 5JH5C 4AS1A 2XEWA 2BVCA 3VTUA 2M8SA 3PS6A 3NZUA 2GBRA 2UU7A 4N9F4 3S2AA 3A9KB 1QQRA 2EMSA 3ENEA 2BYVE 1L0VB 2SAKA 2BS3B 1QZEA 3ZJTA 1SE9A 2K9XA 3DCGA 2CHWA 3KLSX 1TY2A 1LM8B 1Q10A 1NI2A 3T3NA 5IN7A 4XE0A 1RFAA 2J42A 1S3SG 2KN5A 3WAMA 5H8YE 3RYTA 4MSMB 1HXYD 1TS3A 4PYUA 2KK8A 2HJ8A 4NQKE 2D3CA 4C00A 1UNSA 1EO6A 4DHZB 1I4XA 2D5GA 4DDGD 1WF9A 3DVGX 2IO0B 2X8XX 2Y5PA 3VH4B 3UIOB 3H7PB 4AJYB 4KKJA 4R3DA 1JCKB 4US9A 4IDIA 2JQRB 1JWUD 3AEDB 3TJPA 3W1SC 3JVZX 4W9HA 1XLQA 2RGFA 1T0RC 2AX5A 1C9FA 4C4VB 5BYSA 2JWZA 1R4NI 1JWAD 1C78A 4JX1C 1GPXA 4WJPA 1R4NB 2DYMA 2KC2A 1HZ6A 2RDBC 2LRWA 3MC9A 2IZVB 1WX8A 3V6CB 1FEHA 3NHEB 1SXTA 2HE7A 1HZ5A 2KZRA 1UUPA 3L4PA 5CHVC 1WYWB 4HK2A 2YEPB 1D4BA 2KMCA 2MP2A 2N7DA 1Q0WB 4A90A 3ONSA 4LNOA 3SU8X 1ZPSA 2V4IB 2JPHA 1TKGA 1N6ZA 3U30A 1SE4A 1HQRD 1V1PA 2G45B 2R2QA 4RF1A 3OWEB 2CHZA 2L00B 4ANWA 2LXCA 2WX0A 4HWIB 3KWLA 2JZPA 4UDUC 1V8CA 4N58A 2RDHA 5HG2A 1UF0A 3N3KB 1ISNA 1C79A 3P4QB 5CHFA 1YOVB 2INPE 3C0RB 1WYGA 5L83A 4BFRA 1CQVA 1F77A 2YEPF 5EE3A 1AN8A 5FR6A 1WXQA 5LXIB 2MJ3A 4TQ0A 3W9CB 1SGHA 4TKNA 1QOBA 2MJDA 1GC7A 3IFWB 3PHXB 3P4SB 4DQOC 2O2VB 1C76A 2Z0DB 1XQQA 3AULA 2JRHA 1ZGUB 1LFDA 3AECB 1IBXA 4WQMA 2IO2B 1WH3A 5IP4D 1XLPA 3R66C 4RFBA 2RSUA 1TIFA 1YJ1A 3MJ5A 4FJZA 2KQ7A 1ZUD2 3RNCC 2KVZA 4KIKB 4RCOA 3P1MA 1FM0D 1P7EA 3LYYA 5GMVA 1J7AA 2WXLA 1TY0A 2JX5A 3T9LA 2LWPA 5CX3A 2N9PC 1NENB 3ZNGC 1WRDB 3GE8C 3QJZA 3LB8C 2W82A 4B6WA 3ZNZB 3BY4B 2LUEA 2CJOA 3ZTDA 2VRRB 4NQLB 3MP9A 3AEEB 2MSED 4MDKE 2LEKA 1I4RA 2KFKA 2IO1B 2KLGA 4KGTA 4HJGE 3A33B 4ITKA 2GMIC 2M4NA 5AEKB 2XBBC 1G6JA 3Q3OC 4B0MA 4GN1A 1DYQA 5FKAC 1JROA 3ZO5B 4USAA 4DHZE 4LLGM 2XK5B 1L6UA 3TCAA 2L7RA 2WXHA 1BXTA 3VTVA 2N9XA 4K7UA 3ZJUA 1CJEA 4MM3B 3ZKJC 1A5RA 3U7DA 2YVCA 2FUG1 2KQ4X 2NMQA 3ETRA 4G0NB 4PS7A 4YWGG 2ZVNA 2BYTA 3BIID 2LHEA 2N4FA 3K9PB 3O65B 3RZFA 1N5WA 1J8CA 1E9MA 3HVDA 5JXVA 3QK0A 3AE9B 3SFDB 2JWUA 3W1YA 2QDFA 3CSFA 5TR5A 1I4HA 1UBQA 1MVKA 3KW5B 1WMHA 4ZYNA 3UI3A 2INNE 3QA8A 3Q8FA 1GB1A 1E8XA 2N1VA 4W9IA 2KWDA 4WJQA 4LNNA 1UWXA 2PVGC 2FIDA 1Z2MA 3Q3MC 1WGYA 1UD7A 4OVZA 4HKZE 3B2GA 1RLFA 1TTNA 3KUCB 1YX6B 1WXVA 2PTLA 2MCNB 1FNUA 2BBCA 2JVCA 2V9HA 3M3JA 5J17A 3RT3B 4XWWA 3VFKA 4URKA 4IM3A 5C23A 2OOBB 2DNFA 2AQ2B 2KTRA 4US8A 3Q69A 5C3JB 3QARA 3R7RA 1ZDVA 3C8YA 1KLUD 2UWQA 1ET9A 4RMAA 4EZJA 4K7WA 4GXBA 3PTFC 1P3QU 1SBBB 4XWTA 2KLCA 4KSLC 3C19A 3VXWA 2FNJB 2LUMA 1WJUA 2Z8LA 2KMAA 4LJOB 3N9YC 4HJKA 4J3OD 3SFEB 3QX1A 4BKSD 2BQQA 2GBNA 2GOWA 1CMXB 2G1EA 4B0EA 2C7HA 4ASWC 4OZAA 4HDQA 3LDZE 1GAQB 1WX9A 4M0WB 4WWNA 4JLCA 1JWBD 1UBIA 3NZSA 4ZYSA 5BMHA 4JWUC 2BB6A 4IW0A 2MBOA 2DLBA 3E9SA 5I4DA 4PYZA 3V60A 3AM9A 1YNTE 4XYCA 2FUHB 1ZDXA 4DK5A 2IY0B 1GB4A 4C80A 4OW0A 4FN2A 1WM2A 1WSPA 2PMVA 2RMMA 2V1YA 1F2RI 1FCLA 1J0GA 1Z5SB 4W9LA 3BYTB 4E74A 2BW2A 5LNK1 1V86A 2C9WB 3WAPA 1T5XD 2WS3B 4WIPA 2NBVB 3JW0X 1SJHD 1WXSA 4CO7A 2JSVX 2HJ1A 3BYYB 1VDVA 4G11A 5J18A 5C1ZA 2JXTA 3ABVB 4BVUC 4TMAB 3WALA 2FE8A 3T3OA 2EKEC 2NTSA 2LGXA 4S17A 1IYFA 5HKHA 3IAM1 2CJNA 1C4CA 2KANA 3NVWA 1FPYA 2WXRA 1L4DB 4KZCA 2UYZB 2L32A 1YN4A 1DGJA 2WXPA 4H2AA 4MACA 2O6VA 4OZCA 3GE3C 1AWDA 2NBWB 3VUYA 2MEKA 2Y5CA 3RNBC 2FBWB 2N0SB 4ZRQA 1PUTA 2ZNVC 4FJVB 2LGIA 1E0ZA 2DZIA 1YQ3B 4DWFA 5JZEB 1IUEA 3KH0A 3MHZA 4LNKA 1WGGA 4EZLA 3H7SA 3M63B 2LFIA 4GMVA 2QILA 1T3QA 3ZLZA 3N30A 4ZHOA 1I4PA 2DZJA 2PIAA 4DHJD 2M19A 1KLGD 3CSTA 4MELA 3NRZA 4K3CA 1RFKA 1VR9A 4I6LB 4MEMA 3L17A 3W1SA 4AP4C 1ESFA 2KN4A 1B9RA 4IKGA 2V0GA 1UGJA 3TEXA 2ZEQA 3FAHA 1V1PB 1M94A 1K51A 3IHPC 5HHDG 1Q5WB 4ZRPA 3IT4B 4BKTA 1SIJA 4LDTD 5KHQA 1DOIA 2JT4B 5G5GA 3UQBA 1HEZE 4W9EA 2AL6A 4ZRJA 1C4PA 3AE7B 4A6QA 2FCQA 2WXNA 1WZ3A 4EUTA 2K6DB 2WU2B 1NDDA 2LHDA 4BKGA 4LTUA 3RI7C 5D94A 5L95C 4YXDB 2LGDA 3VRBB 2KDEB 2OJRA 1H8CA 5FK9C 1EU3A 2NCNA 5LLIA 2AWTA 1QOAA 1N63A 2PLPA 1IBXB 1J19A 3RN9C 1IGDA 3N1ZC 4BZAA 1WRIA 3RNGC 2K39A 1EU4A 3TUOA 3I5JC 2KJ6A 1KH0A 3ML8A 4HCPB 4W9DA 2AEHA 3O13A 2VZKD 1AARA 4DXAB 2ACZB 2Y5BB 1MI0A 3EHVA 1NEKB 2BB5A 4AUQC 3AEAB 4RF0A 1FXTB 5IAAC 2C60A 2KAJA 2JRIB 3E56A 4RGTA 1SF0A 4ANUA 2R61A 3V05A 4X57B 3HM6X 3VR8B 3Q6BA 1WGKA 1WE7A 1VJKA 1E7PB 3AB5A 3NG0A 1HA5A 2WWZA 3AU5A 2V3SA 1V80A 3H8HA 2I38A 3AXCA 1V5OA 3EC8A 3AH7A 5JHBA 2QJLA 2LXAA 1AW7A 4A3PA 3N1YC 3AMZA 2LASA 5JHAA 4JGHB 1U4AA 4GDKA 4WAAA 3ZRFA 3DWMA 2ZPYA 3HUIA 1TS5A 1FFVA 1PFDA 2HTHA 1YJJA 5D6JB 3OJ4B 2E6XA 3L13A 1HTOA 1MFWA 3ZJVA 4GDLA 3PLUA 3A9JA 3LXFA 1TYGB 2MX2A 1NVID 3KUZA 1QILA 4EOYA 4NNJB 4YTNB 4TSSA 4P1BC 4WJNA 1DOYA 4F1SA 1UWMA 3PT2B 1FNWA 2DWQA 2TSSA 3PHWB 4MH8A 3JSVB 3BINA 2DYBA 3DVNV 3V3XA 2EMTA 2KFJA 1MG8A 3HVZA 2JF5A 1WJNA 3SDLC 1JW9D 3FILB 4EKUA 1I35A 4IWPA 2I2YA 2K22A 2NPTA 3IG3A 4I6NB 3R2TA 3A4RA 2IGGA 1VCBA 2KJRA 4YSZB 4ICUA 4EE2A 3KUDB 3N32A 1N61A 1TGZB 2BKFA 4P7IA 3Q2AC 4RH6A 3VUXA 3Q8EA 5D3DA 3H9DA 1TS4A 1ROEA 1YJIA 3BZDB 1VRAB 1PGBA 4HPMB 1SSNA 3PRZA 2JUOA 2WYQA 2G4SA 3AEBB 1NYRA 2KDBA 4W9FA 4NPNA 2JYEA 3WANA 3N20C 2G4DB 1OFFA 1WR1A 2K1FA 2QMTA 1JMLA 3RNFC 2MRPA 3P63A 3W5UB 5E6NA 4OHJA 4KZ0A 5IO9A 4RGMA 4A3OA 3H7PA 1ZXIA 4BBNF 4JPSA 5IKCM 2M0XA 4G50A 3GB1A 1WY8A 3BVGA 4LJPB 3V61A 5E6OA 3PLVA 5G2NA 2PVOD 2QEJC 2SEBD 2CKHB 1LO5D 5DPSA 2MWSB 3U7ZA 2OEDA 2PE9A 4YT0B 3BWUD 1V6EA 2WP9B 4L2YA 2GBMA 1YQ4B 2MA9B 4KKIA 3TEZA 3L54A 3AU4A 1E90A 3KWVA 3URYA 4KDLB 4O1NA 1MG4A 4II2B 2MBEA 2J0MA 2FCSA 2KX3A 1C4AA 2WHIA 3B0AA 2WNMA 1WJ4A 1JALA 2ON8A 3ZNHB 3A1QB 5LXHA 5BO4B 2W3RA 2C5LC 4XGAB 4BOSC 2Z0EB 1RM6C 3QQ8B 1TKYA 4MH0E 2KX0A 4GGQA 1XLOA 2A4ZA 2WXGA 4P16A 2WQYB 2KQSA 4MJSB 2ZPNA 4REZA 3BVMA 1VD2A 1V5TA 2WX1A 4NJ6A 1KLVA 3EFCA 2MBBB 3OG5A 4HDOA 4WWPA 3ZXVA 4B9KA 1KF6B 2J0JA 3SHQA 1ACCA 3NS1A 3I57A 2L83A 3L10B 1FD6A 1WZ0A 1P1AA 1PDXA 3IBEA 4B95A 3DHHC 3JYUA 2WGSA 2WXJA 2WLBA 1M4VA 2I1KA 4IWQA 3TEYA 4HXDA 4GSWA 2GLSA 3BK1A 3TIXA 2C7NB 4GOCA 2JXXA 3DBLI 3LJ3A 3HIZA 1EUVB 4A9AA 3VR9B 3W5VB 3DBLB 2KXJA 4OZBA 3P4PB 2M1MA 2VH1A 3KYDD 2IY1B 3PRPB 4KX6B 4KV2A 1WIAA 2G3QB 1AYFA 1PGAA 2H88B 3NVZA 1WX7A 1EF1A 3TBLD 1VZ6A 1V2YA 1HTQA 3OJ3A 1E8ZA 3IXSA 2REXA 1XCQL 1XLNA 3ZXRA 2BS2B 3ZVVA 2L8JA 3A4SC 2KDIA 1PYWD 1ZXHA 2LVOA 4N6EB 4AQ7A 5T8IA 3AE3B 2WXQA 1K8RB 1UZXB 4ACFA 2QHOA 1LXDA 3HRDD 4LNIA 4J6IA 2CR5A 4I6PA 2D11A 3QHTA 3NS8A 2JU6X 3Q8BA 3GS2A 3RNAC 1LGRA 1E10A 1I4QA 1WJ6A 4WH4A 1E8YA 1T0SC 4P1CC 3EGRA 1PGXA 2MBHA 3VHTC 2AL3A 4C7YA 4MGKE 4PS8A 3D32A 4RNAA 5CTRC 2K8BA 2N7EA 4F8CB 3NVYA 3APDA 1OEYA 3PREA 5C2TB 2KO3A 2V4LA 3VH3B 3AV8A 2KVRA 2LGSA 1JWMD 3PZ8A 2DENB 1N5XA 2L1AA 1V97A 2Z59B 2G9HD 2BWES 2K3UA 4BBNC 2AQ3B 1D3ZA 4GIVA 3DOWA 1K53A 1WGRA 5MPOA 2VZKB 3DBRI 3UF8A 2O6VD 3UGBB 3DBRB 4HEA1 1P98A 1FFUA 4K81A 1T0QC 2D07B 3PO0A 2KKCA 3KYCD 4W9GA 1WGHA 2GI9A 3Q3JA 3HHMA 2FAZA 4MSQB 1L0XB 1XT9B 2RPQA 1K50A 3PRMB 1SJED 4YTPB 3VUWA 4NAWA 4IWOA 3SEBA 5AUKA 1ET6A 1PQSA 1SE2A 2KHWB 2AYOB 4CYEA 4JQWC 1OQYA 3AEFB 3Q8AA 3BVZA 2B76B 1B1ZA 2IJ0A 1N62A 1I4GA 3KQ4A 1FRRA 4LCDE 2INDC 2DAJA 4M8NA 1ZW7A 1BUIC 1V9JA 2ZJDA 4NY0A 1DOXA 1E7VA 1SB3C 2KNBA 1BMLC 2E3TA 1S1QB 3DHIC 4M8MA 2MP2B 4PS3A 4GDKB 4JIOU 3RFZB 4ZRIA 4K7SA 2AQ1B 5D3IB 3FKYA 1NI3A 2R2OA 2MQJA 5EE1A 4FHJA 3P4RB 3X23A 4WQOB 4WJOA 3K9OB 4ARCA 1JRUA 4CHKA 1STEA 2N9KA 5AUIA 4OVUA 4YSXB 1VZ8A 2OHFA 3PSEB 3V62A 3U8ZA 4EFOA 4G3XB 2LZ6A 2M56B 4FULA 3TEWA 4IG7B 3H1UA 4KGRA 5AZFA 4HPPA 3ALBA 5BMGA 2H89B 3Q3FA 1YQBA 4A55A 2D3GA 4DXGA 1Y8RC 1XEEA 2JZZA 1L0YB 3N1XC 3W2DA 3VQIA 1I7HA 4DDID 1KJTA 1V81A 3MHSD 4IM0A 2L3ZA 1TZOA 2HDEA 1UGMA 2HD5B 1F52A 5G55A 2N9LA 1IPGA 5HI1A 2CU1A 4BOZB 2D3AA 1C1YB 4FJYA 4K1RB 3P2BA 3APFA 2KDFB 3VRAB 2L0TA 3CIRB 1P7FA 2J0KA 4PT5A 5IA7A 2DZMA 2Y3AA 1IP9A 3L0WB 1WGDA 3QCAA 3R3MA 3PPAA 2DZKA 1TZ1A 1KTKA 2VH2A 3NOBA 5HFYA 2WXIA 2EKIA 2BF8B 3ZTCA 2L0FA 2WXKA 2K0PA 3EUB2 3CMMB 2KMMA 2MH7A 1MHXA 4CQNA 4RM9A 2PE6B 4W9KA 4F7ZA 2KFKB 4A8XC 1XO3A 2M0AA 3MC8A 3VAWA 4C7ZA 2CS4A 2KJHB 2LVQA 2PJHA 2W54A 4RGNA 1XCTL 5FR3A 1YN3A 4IM2A 1F1HA 1K52A 1YIWA 4AJWA 3ZRCA 3PV1A 4NJ7A 4FXCA 1GNUA 1A70A 4TUUA 3V6EB 3RPFC 4HKQA 2X38A 1F2RC 2N7JA 2QSDA 1XXGA 4ZHPA 4E3CA 2EELA 2IDYA 2J52A 4EZKA 3Q8CA 2ZZPB 1YX5B 1KOTA 1GC6A 2GB1A 4D2KA 3H6NA 1FRDA 4M02A 4LNFA 3ZQ4A 4ICVA 1GG3A 1RRBA 5D7GA 3PVLA 3TSSA 3QAQA 1T0YA 5H92C 5D2MB 3NVVA 4KGSA 1F0ZA 1WMHB 3DVNU 2INCC 3ML9A 2BT6A 3R2IA 5KHOA 1KRHA 2PW9A 2V3PA 2WDTB 1P9DU 4ZRKA 4C56C 4WWOA 1E5WA 4RM8A 2ONQA 2ZW0A 2KWCA 1OQQA 1VZ7A 3PGEA 4HLEA 2WDRB 2RR9A 2RD0A 4XZ4A 4YTMB 2NR2A 3DHGC 3TL5A 2W9NA 3ZUNA 4FADA 1D6EC 2WDQB 1MJDA 5EDSA 3A9KA 1FNVA 1F9JA 3RCZA 5AZHA 2KTRB 3RMKC 2BPSA 1T6BX 5G5HA 2LJIA 2YLMA 1FCCC 2D3BA 2ZCCA 4GU2A 5BMIA 3AEGB 3B9JA 3I9V1 1E7UA 3NJTA 3AE1B 1TS2A 2N9EB 3ECIA 4JE3B 3WCQA 2ZVOA 2KT7A 3I3TB 4KDIC 5DPRA 4HPLB 3ZNID 3L08A 1D5ZC 5CHWA 1C3TA 3DVGY 1TKEA 4OVVA 1R7SA 1RAXA 2ZNVB 1NBFC 5IOIA 1XD3B 3DDCB 2BWFA 1UELA 4IC7B 2PKOA 2BYFA 2D2QA 2KD0A 4L1BA 2M17A 1D5XC 3ZYYX 3RZWC 2L05A 1ZE3D 3QWZB 3B1LX 1WXMA 3DQVA 1X1MA 4C4VA 2BGFA 5BYRA 4TV3A 2LVPA 5DPTA 3FC4A 4AWJA 3MC0B 3IAS1 2QC8A 3WAOA 3RNEC 1V49A 1JWSD 1FXAA 1OTRB 4FLHA 1GOZA 3UINB 1SEBD 2MBQA 2A5UA 3DBSA 4GLSC 1CZPA 1WI0A 4LK0M 4Q2JA 2W3SA 4HVBA 2MW5A 3AE6B 2IGHA 1TT5B 1QT9A 1YD8U 2NS5A 1WWTA 2OJWA 4W9CA 5TSSA 1FIQA 4YSYB 1LQBA 1WXAA 1E6EB 2FCMA 4L23A 4ZOHC 1NYQA 3B08A 3EFUA 5EE9A 1CK1A 2O6VB 2J7QB 4MGYE 5AZGA 3WA0A 2JYTA 1ZKHA 2BYEA 4KVGB 3JSVA 1MHHE 3VVWB 1FXIA 3RD2A 2IGDA 1JQ4A 3T8MA 1SE3A
chains in the Genus database with same CATH topology
3DBHI 2O2VB 2Z0DB 1XQQA 2BKRB 3AULA 3UF8A 2K39A 2O6VD 2JRHA 3VTWA 1ZGUB 3UGBB 2KWVB 5DPWA 1P98A 1LFDA 2FCNA 2KJ6A 2IO2B 2O2VA 1WH3A 2PPHA 4K81A 3ML8A 4HCPB 3R66C 2D07B 2LGYA 3NY5A 1WM3A 2RSUA 4W9DA 5J2RA 2AEHA 2JZ3B 2KKCA 2PEAA 3KYCD 4W9GA 1WGHA 1YJ1A 2GBKA 4FJZA 1AARA 4DXAB 2KQ7A 3Q3JA 3HHMA 2FAZA 2Y5BB 3EHVA 4MSQB 3OAWA 4AUQC 4KIKB 4NAWB 1XT9B 1FXTB 4DBGA 2RPQA 3EECA 5IAAC 5GMVA 2C60A 3PRMB 1L7YA 5DCNA 3T9LA 2LWPA 2JRIB 4KIKA 2IYDB 4NAWA 3VUWA 4DHJB 4IWOA 5CX3A 3HM3A 2DHZA 2N9PC 3X0WA 4KSKC 1PQSA 2KHWB 2LRUA 2AYOB 4ANUA 3ZNGC 4JQWC 2MLBA 4CYEA 1OQYA 4BKSA 4X57B 1WRDB 3HM6X 3QJZA 4E71A 4B6WA 2LJ5A 3ZNZB 3ZDMC 3BY4B 1WE7A 1OEYJ 2LI5A 2LUEA 4LCDE 3ZTDA 2VRRB 2DAJA 4M8NA 4NQLB 1ZW7A 1V9JA 2ZJDA 2MSED 2N1WA 3PZDA 4MDKE 4NY0A 2DAFA 4XC2A 2WWZA 3AU5A 1E7VA 2KNBA 3L16A 2V3SA 1V80A 1S1QB 2KFKA 2IO1B 2KLGA 3KVFB 4M8MA 2MP2B 4PS3A 2IBIB 4GDKB 4JIOU 3AXCA 1V5OA 3EC8A 4ZRIA 5JHBA 3A33B 2LXAA 2GMIC 4A3PA 5JHAA 4K7SA 2LASA 2M4NA 4LDTB 5AEKB 2XBBC 1G6JA 4JGHB 1U4AA 4GDKA 4WAAA 4GN1A 3ZRFA 2ZPYA 2R2OA 3ZO5B 3CF6E 4DHZE 1TBEA 2MQJA 1WR6E 2JY6A 4FHJA 2XK5B 3TCAA 4A20A 2HTHA 2L7RA 3X23A 1I42A 4WQOB 1GUAB 4WJOA 2N9XA 3K9OB 5D6JB 3VTVA 4K7UA 3OJ4B 1JRUA 2KOXA 2NBUA 3L13A 4CHKA 3ZKJC 1A5RA 3U7DA 2XK5A 2CHXA 2YVCA 2KC1A 4OVUA 4GDLA 3PSEB 3PLUA 4EEWA 4ANXA 3A9JA 3V62A 2K8CA 2MX2A 4G0NB 4PS7A 3U8ZA 4EFOA 3SD5A 3KUZA 4RMAA 4G3XB 2ZVNA 4EOYA 2LZ6A 2C7MB 4FULA 2K6QA 4NNJB 4MM3A 4IG7B 2N4FA 3H1UA 3K9PB 3O65B 3RZFA 1J8CA 5AZFA 4WJNA 4F1SA 3ALBA 3PT2B 1WE6A 3A1QA 2IO3B 3PHWB 3DPDA 3JSVB 3QK0A 3BINA 3Q3FA 1YQBA 3HK0A 2DYBA 3DVNV 3QC8B 3W1YA 2EMTA 2D3GA 3AI5A 2KFJA 1Y8RC 1MG8A 3CSFA 5TR5A 1BT0A 2JZZA 1UBQA 1WJNA 2JF5A 4GB9A 3SDLC 1I35A 4EKUA 3KW5B 4IWPA 3R7QA 1WMHA 3VQIA 4ZDVA 2D10A 4IUMB 4ZYNA 2NPTA 1KJTA 1V81A 3IG3A 4DDID 3GZNI 2K25A 2LD9A 3MHSD 3QA8A 4I6NB 4IM0A 3A4RA 4MJSA 5E6PA 1VCBA 2KJRA 1E8XA 2N1VA 2L3ZA 4W9IA 4ICUA 4WJQA 1UGMA 3KUDB 1E8WA 2HD5B 2ASQA 3APCA 5G55A 2FIDA 1Z2MA 2ZCBA 3N32A 1KM7A 1IPGA 1UD7A 1WGYA 2CU1A 4BOZB 2NVUI 1C1YB 1TGZB 1RLFA 1TTNA 4FJYA 4K1RB 2BKFA 3KUCB 1YX6B 1WXVA 4II3B 4P7IA 2MCNB 1WFYA 3P2BA 3APFA 2KDFB 3VUXA 2JVCA 2L0TA 3M3JA 5J17A 3OLMD 3RT3B 3H9DA 4EZJA 2J0KA 3VFKA 4IM3A 5C23A 4URKA 2OOBB 5IA7A 1HE8A 2L76A 1P0RA 2DZMA 2KTRA 4HPMB 3PRZA 3RULA 1IP9A 3QARA 3R7RA 2UWQA 1WGDA 3L0WB 2JUOA 2WYQA 2DZKA 1TZ1A 3PPAA 3QCAA 3R3MA 2G4SA 4K7WA 2KDBA 4W9FA 4GXBA 3NOBA 4NPNA 3PTFC 3WANA 1P3QU 2BF8B 3ZTCA 2KLCA 4KSLC 2G4DB 2L0FA 3VXWA 2FNJB 1WR1A 2K8HA 1WJUA 2K1FA 3CMMB 1H4RA 2KMAA 4LJOB 4XX5A 4HJKA 2MRPA 4RM9A 2PE6B 3QX1A 3GOEA 4W9KA 4BKSD 2GBNA 2KTFA 5E6NA 4F7ZA 2KFKB 2GOWA 4KZ0A 1GJZA 1CMXB 2B3AA 2I1JA 3TMPB 3M95A 3VAWA 2CS4A 2KJHB 2LVQA 2PJHA 4A3OA 4MGZE 1EF5A 1L2NA 2C7HA 3M62B 3H7PA 4ASWC 4IM2A 4HCNB 4HDQA 4BBNF 2FIFA 3LDZE 4FBJB 2M0XA 1YIWA 4G50A 4AJWA 1WX9A 4YL8A 3ZDTA 1WY8A 3ZRCA 4AOFA 3PV1A 4LJPB 4M0WB 4WWNA 4NJ7A 4JLCA 3ZIMA 1UBIA 1GNUA 3NZSA 3PLVA 5E6OA 3V61A 1Q1OA 5G2NA 4TUUA 3V6EB 2CKHB 4IW0A 2MBOA 4FA6A 4PYZA 3V60A 5DPSA 2MWSB 2FUHB 3WIMA 4TQ1A 3IVFA 2PE9A 4DK5A 4E3CA 2IY0B 1V6EA 4EZKA 4FN2A 2GBMA 1WM2A 3QIJA 4GDLB 2ZZPB 2MA9B 1YX5B 3A9JB 2V1YA 1KOTA 3L54A 1GC6A 3AU4A 3MJWA 4MGIE 1E90A 1J0GA 3H6NA 1Z5SB 4W9LA 4KDLB 4E74A 1UH6A 4II2B 2MBEA 2J0MA 2FCSA 1V86A 4ICVA 2KX3A 3B0AA 1GG3A 1R4MI 3MTNB 1RRBA 1WJ4A 2C9WB 3RUIB 3WAPA 3ZNHB 3A1QB 3VDZA 5D7GA 5LXHA 2DX5B 2DYOA 2NBVB 3JW0X 3PVLA 5BO4B 4FHKA 2C5LC 3QAQA 1WXSA 1T0YA 4BOSC 4CO7A 4W9JA 2Z0EB 1OGWA 3UQAA 3QQ8B 4JL9A 2KWUB 5D2MB 4G11A 1SIFA 5J18A 4ANVA 2GBJA 1WMHB 4MH0E 3DVNU 2KX0A 5C1ZA 3ML9A 4GGQA 2A4ZA 2NPTB 3ZW3A 5KHOA 4BVUC 3UIPB 2KQSA 3WALA 4MJSB 5JH5C 2ZPNA 2WDTB 1P9DU 4ZRKA 2XEWA 1VD2A 4WWOA 1V5TA 3VTUA 2EKEC 1E5WA 2WX1A 2LGXA 2M8SA 4RM8A 3PS6A 1IYFA 3NZUA 2GBRA 5HKHA 4NJ6A 2KWCA 1KLVA 4N9F4 3S2AA 2MBBB 3A9KB 3PGEA 4HLEA 2RR9A 2RD0A 4HDOA 2KANA 2EMSA 4XZ4A 4WWPA 2NR2A 3ENEA 2BYVE 4B9KA 2J0JA 3TL5A 2W9NA 3ZUNA 4FADA 3SHQA 1QZEA 4KZCA 1SE9A 5EDSA 2UYZB 3A9KA 3DCGA 3L10B 2CHWA 1F9JA 1WZ0A 1P1AA 1LM8B 3IBEA 3RCZA 1NI2A 5AZHA 4B95A 2KTRB 3JYUA 2O6VA 2BPSA 2YLMA 2ZCCA 2I1KA 2NBWB 4GU2A 4IWQA 3VUYA 1RFAA 4HXDA 4GSWA 1S3SG 1E7UA 2KN5A 3TIXA 2C7NB 4GOCA 3WAMA 2ZNVC 2JXXA 3DBLI 3LJ3A 4FJVB 3HIZA 4MSMB 3RYTA 1EUVB 2N9EB 2DZIA 4PYUA 2KK8A 2HJ8A 3ECIA 4NQKE 4DWFA 5JZEB 2ZVOA 2KXJA 1EO6A 3I3TB 4KDIC 5DPRA 4DHZB 4HPLB 2M1MA 3ZNID 3L08A 3KH0A 4DDGD 5CHWA 1C3TA 3DVGY 1WF9A 3DVGX 2IO0B 4OVVA 3VH4B 3UIOB 3H7PB 3KYDD 1RAXA 4AJYB 2IY1B 2ZNVB 3PRPB 1NBFC 1WGGA 4EZLA 1XD3B 3DDCB 1WIAA 4KV2A 3TJPA 3W1SC 2G3QB 3H7SA 3JVZX 2BWFA 4W9HA 2RGFA 3M63B 1WX7A 1UELA 4GMVA 4IC7B 1EF1A 2BYFA 2D2QA 3TBLD 2KD0A 1V2YA 2M17A 3ZLZA 3N30A 3RZWC 3OJ3A 2JWZA 1R4NI 2DZJA 1E8ZA 2L05A 2REXA 3QWZB 3B1LX 1WXMA 4WJPA 3DQVA 4DHJD 1X1MA 2DYMA 3CSTA 4MELA 2KC2A 2BGFA 3ZVVA 2L8JA 4I6LB 3A4SC 4TV3A 2KDIA 2LVOA 4MEMA 3L17A 2LVPA 5DPTA 2LRWA 4AWJA 3W1SA 2IZVB 1WX8A 3V6CB 3NHEB 2HE7A 1K8RB 3WAOA 1UZXB 1V49A 4AP4C 2KZRA 2QHOA 1LXDA 1OTRB 5CHVC 1WYWB 4FLHA 4HK2A 3UINB 2MBQA 2A5UA 4J6IA 2KMCA 3DBSA 2CR5A 2ZEQA 2MP2A 4I6PA 2N7DA 1Q0WB 2D11A 3ONSA 1M94A 3NS8A 3QHTA 1WI0A 3SU8X 2JPHA 3IHPC 4HVBA 1Q5WB 2MW5A 3U30A 4BKTA 1WJ6A 2G45B 2R2QA 4LDTD 5KHQA 1E8YA 2JT4B 2CHZA 1YD8U 2L00B 2NS5A 4ANWA 2LXCA 3UQBA 2MBHA 2WX0A 3VHTC 2AL3A 4W9EA 4HWIB 2AL6A 4MGKE 4PS8A 3D32A 4W9CA 4ZRJA 5CTRC 2FCQA 1WZ3A 1LQBA 4EUTA 1WXAA 2K8BA 2N7EA 4F8CB 2K6DB 2FCMA 3APDA 3N3KB 1OEYA 3PREA 1ISNA 1NDDA 4BKGA 2KO3A 2V4LA 5CHFA 3VH3B 5D94A 5L95C 2KVRA 2LGDA 3B08A 2KDEB 3C0RB 5L83A 2OJRA 3EFUA 2DENB 4BFRA 1H8CA 2O6VB 2J7QB 2Z59B 4MGYE 5AZGA 3WA0A 1ZKHA 2BYEA 2BWES 2NCNA 4KVGB 4BBNC 3JSVA 3VVWB 5LLIA 2AWTA 5FR6A 4GIVA 1D3ZA 3DOWA 3RD2A 1WGRA 5LXIB 1J19A 4TQ0A 1SGHA 3T8MA 4TKNA 1GC7A 3IFWB 3PHXB 3DBRI
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBH I;  2O2V B;  2Z0D B;  1XQQ A;  2BKR B;  3AUL A;  3UF8 A;  2K39 A;  2O6V D;  2JRH A;  3VTW A;  1ZGU B;  3UGB B;  2KWV B;  5DPW A;  1P98 A;  1LFD A;  2FCN A;  2KJ6 A;  2IO2 B;  2O2V A;  1WH3 A;  2PPH A;  4K81 A;  3ML8 A;  4HCP B;  3R66 C;  2D07 B;  2LGY A;  3NY5 A;  1WM3 A;  2RSU A;  4W9D A;  5J2R A;  2AEH A;  2JZ3 B;  2KKC A;  2PEA A;  3KYC D;  4W9G A;  1WGH A;  1YJ1 A;  2GBK A;  4FJZ A;  1AAR A;  4DXA B;  2KQ7 A;  3Q3J A;  3HHM A;  2FAZ A;  2Y5B B;  3EHV A;  4MSQ B;  3OAW A;  4AUQ C;  4KIK B;  4NAW B;  1XT9 B;  1FXT B;  4DBG A;  2RPQ A;  3EEC A;  5IAA C;  5GMV A;  2C60 A;  3PRM B;  1L7Y A;  5DCN A;  3T9L A;  2LWP A;  2JRI B;  4KIK A;  2IYD B;  4NAW A;  3VUW A;  4DHJ B;  4IWO A;  5CX3 A;  3HM3 A;  2DHZ A;  2N9P C;  3X0W A;  4KSK C;  1PQS A;  2KHW B;  2LRU A;  2AYO B;  4ANU A;  3ZNG C;  4JQW C;  2MLB A;  4CYE A;  1OQY A;  4BKS A;  4X57 B;  1WRD B;  3HM6 X;  3QJZ A;  4E71 A;  4B6W A;  2LJ5 A;  3ZNZ B;  3ZDM C;  3BY4 B;  1WE7 A;  1OEY J;  2LI5 A;  2LUE A;  4LCD E;  3ZTD A;  2VRR B;  2DAJ A;  4M8N A;  4NQL B;  1ZW7 A;  1V9J A;  2ZJD A;  2MSE D;  2N1W A;  3PZD A;  4MDK E;  4NY0 A;  2DAF A;  4XC2 A;  2WWZ A;  3AU5 A;  1E7V A;  2KNB A;  3L16 A;  2V3S A;  1V80 A;  1S1Q B;  2KFK A;  2IO1 B;  2KLG A;  3KVF B;  4M8M A;  2MP2 B;  4PS3 A;  2IBI B;  4GDK B;  4JIO U;  3AXC A;  1V5O A;  3EC8 A;  4ZRI A;  5JHB A;  3A33 B;  2LXA A;  2GMI C;  4A3P A;  5JHA A;  4K7S A;  2LAS A;  2M4N A;  4LDT B;  5AEK B;  2XBB C;  1G6J A;  4JGH B;  1U4A A;  4GDK A;  4WAA A;  4GN1 A;  3ZRF A;  2ZPY A;  2R2O A;  3ZO5 B;  3CF6 E;  4DHZ E;  1TBE A;  2MQJ A;  1WR6 E;  2JY6 A;  4FHJ A;  2XK5 B;  3TCA A;  4A20 A;  2HTH A;  2L7R A;  3X23 A;  1I42 A;  4WQO B;  1GUA B;  4WJO A;  2N9X A;  3K9O B;  5D6J B;  3VTV A;  4K7U A;  3OJ4 B;  1JRU A;  2KOX A;  2NBU A;  3L13 A;  4CHK A;  3ZKJ C;  1A5R A;  3U7D A;  2XK5 A;  2CHX A;  2YVC A;  2KC1 A;  4OVU A;  4GDL A;  3PSE B;  3PLU A;  4EEW A;  4ANX A;  3A9J A;  3V62 A;  2K8C A;  2MX2 A;  4G0N B;  4PS7 A;  3U8Z A;  4EFO A;  3SD5 A;  3KUZ A;  4RMA A;  4G3X B;  2ZVN A;  4EOY A;  2LZ6 A;  2C7M B;  4FUL A;  2K6Q A;  4NNJ B;  4MM3 A;  4IG7 B;  2N4F A;  3H1U A;  3K9P B;  3O65 B;  3RZF A;  1J8C A;  5AZF A;  4WJN A;  4F1S A;  3ALB A;  3PT2 B;  1WE6 A;  3A1Q A;  2IO3 B;  3PHW B;  3DPD A;  3JSV B;  3QK0 A;  3BIN A;  3Q3F A;  1YQB A;  3HK0 A;  2DYB A;  3DVN V;  3QC8 B;  3W1Y A;  2EMT A;  2D3G A;  3AI5 A;  2KFJ A;  1Y8R C;  1MG8 A;  3CSF A;  5TR5 A;  1BT0 A;  2JZZ A;  1UBQ A;  1WJN A;  2JF5 A;  4GB9 A;  3SDL C;  1I35 A;  4EKU A;  3KW5 B;  4IWP A;  3R7Q A;  1WMH A;  3VQI A;  4ZDV A;  2D10 A;  4IUM B;  4ZYN A;  2NPT A;  1KJT A;  1V81 A;  3IG3 A;  4DDI D;  3GZN I;  2K25 A;  2LD9 A;  3MHS D;  3QA8 A;  4I6N B;  4IM0 A;  3A4R A;  4MJS A;  5E6P A;  1VCB A;  2KJR A;  1E8X A;  2N1V A;  2L3Z A;  4W9I A;  4ICU A;  4WJQ A;  1UGM A;  3KUD B;  1E8W A;  2HD5 B;  2ASQ A;  3APC A;  5G55 A;  2FID A;  1Z2M A;  2ZCB A;  3N32 A;  1KM7 A;  1IPG A;  1UD7 A;  1WGY A;  2CU1 A;  4BOZ B;  2NVU I;  1C1Y B;  1TGZ B;  1RLF A;  1TTN A;  4FJY A;  4K1R B;  2BKF A;  3KUC B;  1YX6 B;  1WXV A;  4II3 B;  4P7I A;  2MCN B;  1WFY A;  3P2B A;  3APF A;  2KDF B;  3VUX A;  2JVC A;  2L0T A;  3M3J A;  5J17 A;  3OLM D;  3RT3 B;  3H9D A;  4EZJ A;  2J0K A;  3VFK A;  4IM3 A;  5C23 A;  4URK A;  2OOB B;  5IA7 A;  1HE8 A;  2L76 A;  1P0R A;  2DZM A;  2KTR A;  4HPM B;  3PRZ A;  3RUL A;  1IP9 A;  3QAR A;  3R7R A;  2UWQ A;  1WGD A;  3L0W B;  2JUO A;  2WYQ A;  2DZK A;  1TZ1 A;  3PPA A;  3QCA A;  3R3M A;  2G4S A;  4K7W A;  2KDB A;  4W9F A;  4GXB A;  3NOB A;  4NPN A;  3PTF C;  3WAN A;  1P3Q U;  2BF8 B;  3ZTC A;  2KLC A;  4KSL C;  2G4D B;  2L0F A;  3VXW A;  2FNJ B;  1WR1 A;  2K8H A;  1WJU A;  2K1F A;  3CMM B;  1H4R A;  2KMA A;  4LJO B;  4XX5 A;  4HJK A;  2MRP A;  4RM9 A;  2PE6 B;  3QX1 A;  3GOE A;  4W9K A;  4BKS D;  2GBN A;  2KTF A;  5E6N A;  4F7Z A;  2KFK B;  2GOW A;  4KZ0 A;  1GJZ A;  1CMX B;  2B3A A;  2I1J A;  3TMP B;  3M95 A;  3VAW A;  2CS4 A;  2KJH B;  2LVQ A;  2PJH A;  4A3O A;  4MGZ E;  1EF5 A;  1L2N A;  2C7H A;  3M62 B;  3H7P A;  4ASW C;  4IM2 A;  4HCN B;  4HDQ A;  4BBN F;  2FIF A;  3LDZ E;  4FBJ B;  2M0X A;  1YIW A;  4G50 A;  4AJW A;  1WX9 A;  4YL8 A;  3ZDT A;  1WY8 A;  3ZRC A;  4AOF A;  3PV1 A;  4LJP B;  4M0W B;  4WWN A;  4NJ7 A;  4JLC A;  3ZIM A;  1UBI A;  1GNU A;  3NZS A;  3PLV A;  5E6O A;  3V61 A;  1Q1O A;  5G2N A;  4TUU A;  3V6E B;  2CKH B;  4IW0 A;  2MBO A;  4FA6 A;  4PYZ A;  3V60 A;  5DPS A;  2MWS B;  2FUH B;  3WIM A;  4TQ1 A;  3IVF A;  2PE9 A;  4DK5 A;  4E3C A;  2IY0 B;  1V6E A;  4EZK A;  4FN2 A;  2GBM A;  1WM2 A;  3QIJ A;  4GDL B;  2ZZP B;  2MA9 B;  1YX5 B;  3A9J B;  2V1Y A;  1KOT A;  3L54 A;  1GC6 A;  3AU4 A;  3MJW A;  4MGI E;  1E90 A;  1J0G A;  3H6N A;  1Z5S B;  4W9L A;  4KDL B;  4E74 A;  1UH6 A;  4II2 B;  2MBE A;  2J0M A;  2FCS A;  1V86 A;  4ICV A;  2KX3 A;  3B0A A;  1GG3 A;  1R4M I;  3MTN B;  1RRB A;  1WJ4 A;  2C9W B;  3RUI B;  3WAP A;  3ZNH B;  3A1Q B;  3VDZ A;  5D7G A;  5LXH A;  2DX5 B;  2DYO A;  2NBV B;  3JW0 X;  3PVL A;  5BO4 B;  4FHK A;  2C5L C;  3QAQ A;  1WXS A;  1T0Y A;  4BOS C;  4CO7 A;  4W9J A;  2Z0E B;  1OGW A;  3UQA A;  3QQ8 B;  4JL9 A;  2KWU B;  5D2M B;  4G11 A;  1SIF A;  5J18 A;  4ANV A;  2GBJ A;  1WMH B;  4MH0 E;  3DVN U;  2KX0 A;  5C1Z A;  3ML9 A;  4GGQ A;  2A4Z A;  2NPT B;  3ZW3 A;  5KHO A;  4BVU C;  3UIP B;  2KQS A;  3WAL A;  4MJS B;  5JH5 C;  2ZPN A;  2WDT B;  1P9D U;  4ZRK A;  2XEW A;  1VD2 A;  4WWO A;  1V5T A;  3VTU A;  2EKE C;  1E5W A;  2WX1 A;  2LGX A;  2M8S A;  4RM8 A;  3PS6 A;  1IYF A;  3NZU A;  2GBR A;  5HKH A;  4NJ6 A;  2KWC A;  1KLV A;  4N9F 4;  3S2A A;  2MBB B;  3A9K B;  3PGE A;  4HLE A;  2RR9 A;  2RD0 A;  4HDO A;  2KAN A;  2EMS A;  4XZ4 A;  4WWP A;  2NR2 A;  3ENE A;  2BYV E;  4B9K A;  2J0J A;  3TL5 A;  2W9N A;  3ZUN A;  4FAD A;  3SHQ A;  1QZE A;  4KZC A;  1SE9 A;  5EDS A;  2UYZ B;  3A9K A;  3DCG A;  3L10 B;  2CHW A;  1F9J A;  1WZ0 A;  1P1A A;  1LM8 B;  3IBE A;  3RCZ A;  1NI2 A;  5AZH A;  4B95 A;  2KTR B;  3JYU A;  2O6V A;  2BPS A;  2YLM A;  2ZCC A;  2I1K A;  2NBW B;  4GU2 A;  4IWQ A;  3VUY A;  1RFA A;  4HXD A;  4GSW A;  1S3S G;  1E7U A;  2KN5 A;  3TIX A;  2C7N B;  4GOC A;  3WAM A;  2ZNV C;  2JXX A;  3DBL I;  3LJ3 A;  4FJV B;  3HIZ A;  4MSM B;  3RYT A;  1EUV B;  2N9E B;  2DZI A;  4PYU A;  2KK8 A;  2HJ8 A;  3ECI A;  4NQK E;  4DWF A;  5JZE B;  2ZVO A;  2KXJ A;  1EO6 A;  3I3T B;  4KDI C;  5DPR A;  4DHZ B;  4HPL B;  2M1M A;  3ZNI D;  3L08 A;  3KH0 A;  4DDG D;  5CHW A;  1C3T A;  3DVG Y;  1WF9 A;  3DVG X;  2IO0 B;  4OVV A;  3VH4 B;  3UIO B;  3H7P B;  3KYD D;  1RAX A;  4AJY B;  2IY1 B;  2ZNV B;  3PRP B;  1NBF C;  1WGG A;  4EZL A;  1XD3 B;  3DDC B;  1WIA A;  4KV2 A;  3TJP A;  3W1S C;  2G3Q B;  3H7S A;  3JVZ X;  2BWF A;  4W9H A;  2RGF A;  3M63 B;  1WX7 A;  1UEL A;  4GMV A;  4IC7 B;  1EF1 A;  2BYF A;  2D2Q A;  3TBL D;  2KD0 A;  1V2Y A;  2M17 A;  3ZLZ A;  3N30 A;  3RZW C;  3OJ3 A;  2JWZ A;  1R4N I;  2DZJ A;  1E8Z A;  2L05 A;  2REX A;  3QWZ B;  3B1L X;  1WXM A;  4WJP A;  3DQV A;  4DHJ D;  1X1M A;  2DYM A;  3CST A;  4MEL A;  2KC2 A;  2BGF A;  3ZVV A;  2L8J A;  4I6L B;  3A4S C;  4TV3 A;  2KDI A;  2LVO A;  4MEM A;  3L17 A;  2LVP A;  5DPT A;  2LRW A;  4AWJ A;  3W1S A;  2IZV B;  1WX8 A;  3V6C B;  3NHE B;  2HE7 A;  1K8R B;  3WAO A;  1UZX B;  1V49 A;  4AP4 C;  2KZR A;  2QHO A;  1LXD A;  1OTR B;  5CHV C;  1WYW B;  4FLH A;  4HK2 A;  3UIN B;  2MBQ A;  2A5U A;  4J6I A;  2KMC A;  3DBS A;  2CR5 A;  2ZEQ A;  2MP2 A;  4I6P A;  2N7D A;  1Q0W B;  2D11 A;  3ONS A;  1M94 A;  3NS8 A;  3QHT A;  1WI0 A;  3SU8 X;  2JPH A;  3IHP C;  4HVB A;  1Q5W B;  2MW5 A;  3U30 A;  4BKT A;  1WJ6 A;  2G45 B;  2R2Q A;  4LDT D;  5KHQ A;  1E8Y A;  2JT4 B;  2CHZ A;  1YD8 U;  2L00 B;  2NS5 A;  4ANW A;  2LXC A;  3UQB A;  2MBH A;  2WX0 A;  3VHT C;  2AL3 A;  4W9E A;  4HWI B;  2AL6 A;  4MGK E;  4PS8 A;  3D32 A;  4W9C A;  4ZRJ A;  5CTR C;  2FCQ A;  1WZ3 A;  1LQB A;  4EUT A;  1WXA A;  2K8B A;  2N7E A;  4F8C B;  2K6D B;  2FCM A;  3APD A;  3N3K B;  1OEY A;  3PRE A;  1ISN A;  1NDD A;  4BKG A;  2KO3 A;  2V4L A;  5CHF A;  3VH3 B;  5D94 A;  5L95 C;  2KVR A;  2LGD A;  3B08 A;  2KDE B;  3C0R B;  5L83 A;  2OJR A;  3EFU A;  2DEN B;  4BFR A;  1H8C A;  2O6V B;  2J7Q B;  2Z59 B;  4MGY E;  5AZG A;  3WA0 A;  1ZKH A;  2BYE A;  2BWE S;  2NCN A;  4KVG B;  4BBN C;  3JSV A;  3VVW B;  5LLI A;  2AWT A;  5FR6 A;  4GIV A;  1D3Z A;  3DOW A;  3RD2 A;  1WGR A;  5LXI B;  1J19 A;  4TQ0 A;  1SGH A;  3T8M A;  4TKN A;  1GC7 A;  3IFW B;  3PHX B;  3DBR I; 
#chains in the Genus database with same CATH topology
 3DBH I;  2BKR B;  3FIL A;  3VTW A;  1V1O A;  2KWV B;  3DBH B;  5DPW A;  1Y56 A;  4XDD A;  2FCN A;  3AE2 B;  2O2V A;  2PPH A;  3SR6 A;  1EWY C;  2LGY A;  3NY5 A;  1WM3 A;  3AE8 B;  2JZ3 B;  2PEA A;  5J2R A;  2GBK A;  2MHJ A;  4BAX A;  1XF5 L;  2RPV A;  3OAW A;  4NAW B;  4P6V F;  1D5M C;  3B2F A;  4DBG A;  3EEC A;  3R8B A;  1C77 A;  1L7Y A;  5DCN A;  4KIK A;  2IYD B;  4DHJ B;  3HM3 A;  2DHZ A;  4MT5 A;  3X0W A;  4KSK C;  2LRU A;  2MLB A;  2BS4 B;  2Q5W D;  1RWS A;  2WXO A;  2XNA C;  4WUR A;  4BKS A;  4E71 A;  2LJ5 A;  4WAF A;  3ZDM C;  1OEY J;  4XDC A;  2LI5 A;  1J7B A;  2L52 A;  3I63 C;  3EA6 A;  2BTE A;  2MJE A;  3DWG C;  2N1W A;  3PZD A;  2DAF A;  4XC2 A;  3L16 A;  1OQR A;  1YN5 A;  3KVF B;  1ZOY B;  2IBI B;  4IOI E;  4LDT B;  4S0R A;  4HRO A;  4PK1 A;  3CF6 E;  1RYJ A;  1TBE A;  4N59 A;  1WR6 E;  2JY6 A;  4A20 A;  1I42 A;  1QOG A;  2ZW1 A;  2NTT A;  1GUA B;  5GXG B;  2KOX A;  2KYW A;  2NBU A;  3U4E G;  2XK5 A;  1FMA D;  2CHX A;  2KC1 A;  3ZGZ A;  4EEW A;  4K3B A;  2GRI A;  4ANX A;  2K8C A;  2WU5 B;  3SD5 A;  2C7M B;  1QLB B;  2K6Q A;  4MM3 A;  5EE0 A;  1TJE A;  2QIE B;  2HTM E;  3IT6 B;  4HRS A;  1N60 A;  2LMC A;  3J9C A;  1WE6 A;  2CU3 A;  3Q3N C;  3A1Q A;  2IO3 B;  1IGC A;  3DPD A;  3HK0 A;  3QC8 B;  3AI5 A;  1BT0 A;  2V3N A;  4GB9 A;  2RDG A;  1ZP0 B;  3R7Q A;  4ZDV A;  2D10 A;  2DBY A;  4IUM B;  2IPK D;  5BYQ A;  3GZN I;  2K25 A;  2LD9 A;  5E6P A;  4MJS A;  4RGO S;  1YMH E;  3GZN B;  2W55 A;  1E8W A;  2ASQ A;  3APC A;  1EM7 A;  1L6V A;  2ZCB A;  4NZL B;  1QOF A;  1KM7 A;  2NVU I;  4II3 B;  3P42 A;  1WFY A;  3OLM D;  1MPE A;  5E6J A;  1HE8 A;  2L76 A;  1P0R A;  2QCZ A;  3RUL A;  2KDM A;  3Q14 C;  3GP7 A;  1J7C A;  3BK2 A;  2ICI A;  1L5P A;  2J53 A;  2K8H A;  4WWM A;  1H4R A;  4XX5 A;  3GOE A;  1KFY B;  2KTF A;  1GJZ A;  2XN9 C;  1VLB A;  2B3A A;  2I1J A;  3TMP B;  2WXF A;  3M95 A;  4MGZ E;  1EF5 A;  1L2N A;  3M62 B;  4HCN B;  2FIF A;  4FBJ B;  4QAY A;  4YL8 A;  3ZDT A;  4AOF A;  1FO4 A;  3U2S C;  3AE5 B;  3ZIM A;  2KAC A;  4M01 A;  1Q1O A;  1L4Z B;  4FA6 A;  3NZ3 A;  4M0W A;  4M00 A;  1EWC A;  3WIM A;  4TQ1 A;  3IVF A;  2J4X A;  3AN1 A;  1QF6 A;  1QKZ A;  3AE4 B;  4NAM A;  4GDL B;  3NUH B;  3QIJ A;  2WDV B;  3PZ7 A;  3A9J B;  3MFG A;  3MJW A;  4MGI E;  4ARI A;  4JWS C;  1UH6 A;  1ENF A;  1R4M I;  3MTN B;  4NJC A;  3RUI B;  3CWI A;  3VDZ A;  2DX5 B;  2DYO A;  1R4M B;  4FHK A;  4W9J A;  2WXM A;  4DXF A;  3U52 E;  1OGW A;  3UQA A;  4JL9 A;  2KWU B;  1SIF A;  4ANV A;  2GBJ A;  2K5P A;  2NPT B;  3ZW3 A;  3UIP B;  1JRP A;  5JH5 C;  4AS1 A;  2XEW A;  2BVC A;  3VTU A;  2M8S A;  3PS6 A;  3NZU A;  2GBR A;  2UU7 A;  4N9F 4;  3S2A A;  3A9K B;  1QQR A;  2EMS A;  3ENE A;  2BYV E;  1L0V B;  2SAK A;  2BS3 B;  1QZE A;  3ZJT A;  1SE9 A;  2K9X A;  3DCG A;  2CHW A;  3KLS X;  1TY2 A;  1LM8 B;  1Q10 A;  1NI2 A;  3T3N A;  5IN7 A;  4XE0 A;  1RFA A;  2J42 A;  1S3S G;  2KN5 A;  3WAM A;  5H8Y E;  3RYT A;  4MSM B;  1HXY D;  1TS3 A;  4PYU A;  2KK8 A;  2HJ8 A;  4NQK E;  2D3C A;  4C00 A;  1UNS A;  1EO6 A;  4DHZ B;  1I4X A;  2D5G A;  4DDG D;  1WF9 A;  3DVG X;  2IO0 B;  2X8X X;  2Y5P A;  3VH4 B;  3UIO B;  3H7P B;  4AJY B;  4KKJ A;  4R3D A;  1JCK B;  4US9 A;  4IDI A;  2JQR B;  1JWU D;  3AED B;  3TJP A;  3W1S C;  3JVZ X;  4W9H A;  1XLQ A;  2RGF A;  1T0R C;  2AX5 A;  1C9F A;  4C4V B;  5BYS A;  2JWZ A;  1R4N I;  1JWA D;  1C78 A;  4JX1 C;  1GPX A;  4WJP A;  1R4N B;  2DYM A;  2KC2 A;  1HZ6 A;  2RDB C;  2LRW A;  3MC9 A;  2IZV B;  1WX8 A;  3V6C B;  1FEH A;  3NHE B;  1SXT A;  2HE7 A;  1HZ5 A;  2KZR A;  1UUP A;  3L4P A;  5CHV C;  1WYW B;  4HK2 A;  2YEP B;  1D4B A;  2KMC A;  2MP2 A;  2N7D A;  1Q0W B;  4A90 A;  3ONS A;  4LNO A;  3SU8 X;  1ZPS A;  2V4I B;  2JPH A;  1TKG A;  1N6Z A;  3U30 A;  1SE4 A;  1HQR D;  1V1P A;  2G45 B;  2R2Q A;  4RF1 A;  3OWE B;  2CHZ A;  2L00 B;  4ANW A;  2LXC A;  2WX0 A;  4HWI B;  3KWL A;  2JZP A;  4UDU C;  1V8C A;  4N58 A;  2RDH A;  5HG2 A;  1UF0 A;  3N3K B;  1ISN A;  1C79 A;  3P4Q B;  5CHF A;  1YOV B;  2INP E;  3C0R B;  1WYG A;  5L83 A;  4BFR A;  1CQV A;  1F77 A;  2YEP F;  5EE3 A;  1AN8 A;  5FR6 A;  1WXQ A;  5LXI B;  2MJ3 A;  4TQ0 A;  3W9C B;  1SGH A;  4TKN A;  1QOB A;  2MJD A;  1GC7 A;  3IFW B;  3PHX B;  3P4S B;  4DQO C;  2O2V B;  1C76 A;  2Z0D B;  1XQQ A;  3AUL A;  2JRH A;  1ZGU B;  1LFD A;  3AEC B;  1IBX A;  4WQM A;  2IO2 B;  1WH3 A;  5IP4 D;  1XLP A;  3R66 C;  4RFB A;  2RSU A;  1TIF A;  1YJ1 A;  3MJ5 A;  4FJZ A;  2KQ7 A;  1ZUD 2;  3RNC C;  2KVZ A;  4KIK B;  4RCO A;  3P1M A;  1FM0 D;  1P7E A;  3LYY A;  5GMV A;  1J7A A;  2WXL A;  1TY0 A;  2JX5 A;  3T9L A;  2LWP A;  5CX3 A;  2N9P C;  1NEN B;  3ZNG C;  1WRD B;  3GE8 C;  3QJZ A;  3LB8 C;  2W82 A;  4B6W A;  3ZNZ B;  3BY4 B;  2LUE A;  2CJO A;  3ZTD A;  2VRR B;  4NQL B;  3MP9 A;  3AEE B;  2MSE D;  4MDK E;  2LEK A;  1I4R A;  2KFK A;  2IO1 B;  2KLG A;  4KGT A;  4HJG E;  3A33 B;  4ITK A;  2GMI C;  2M4N A;  5AEK B;  2XBB C;  1G6J A;  3Q3O C;  4B0M A;  4GN1 A;  1DYQ A;  5FKA C;  1JRO A;  3ZO5 B;  4USA A;  4DHZ E;  4LLG M;  2XK5 B;  1L6U A;  3TCA A;  2L7R A;  2WXH A;  1BXT A;  3VTV A;  2N9X A;  4K7U A;  3ZJU A;  1CJE A;  4MM3 B;  3ZKJ C;  1A5R A;  3U7D A;  2YVC A;  2FUG 1;  2KQ4 X;  2NMQ A;  3ETR A;  4G0N B;  4PS7 A;  4YWG G;  2ZVN A;  2BYT A;  3BII D;  2LHE A;  2N4F A;  3K9P B;  3O65 B;  3RZF A;  1N5W A;  1J8C A;  1E9M A;  3HVD A;  5JXV A;  3QK0 A;  3AE9 B;  3SFD B;  2JWU A;  3W1Y A;  2QDF A;  3CSF A;  5TR5 A;  1I4H A;  1UBQ A;  1MVK A;  3KW5 B;  1WMH A;  4ZYN A;  3UI3 A;  2INN E;  3QA8 A;  3Q8F A;  1GB1 A;  1E8X A;  2N1V A;  4W9I A;  2KWD A;  4WJQ A;  4LNN A;  1UWX A;  2PVG C;  2FID A;  1Z2M A;  3Q3M C;  1WGY A;  1UD7 A;  4OVZ A;  4HKZ E;  3B2G A;  1RLF A;  1TTN A;  3KUC B;  1YX6 B;  1WXV A;  2PTL A;  2MCN B;  1FNU A;  2BBC A;  2JVC A;  2V9H A;  3M3J A;  5J17 A;  3RT3 B;  4XWW A;  3VFK A;  4URK A;  4IM3 A;  5C23 A;  2OOB B;  2DNF A;  2AQ2 B;  2KTR A;  4US8 A;  3Q69 A;  5C3J B;  3QAR A;  3R7R A;  1ZDV A;  3C8Y A;  1KLU D;  2UWQ A;  1ET9 A;  4RMA A;  4EZJ A;  4K7W A;  4GXB A;  3PTF C;  1P3Q U;  1SBB B;  4XWT A;  2KLC A;  4KSL C;  3C19 A;  3VXW A;  2FNJ B;  2LUM A;  1WJU A;  2Z8L A;  2KMA A;  4LJO B;  3N9Y C;  4HJK A;  4J3O D;  3SFE B;  3QX1 A;  4BKS D;  2BQQ A;  2GBN A;  2GOW A;  1CMX B;  2G1E A;  4B0E A;  2C7H A;  4ASW C;  4OZA A;  4HDQ A;  3LDZ E;  1GAQ B;  1WX9 A;  4M0W B;  4WWN A;  4JLC A;  1JWB D;  1UBI A;  3NZS A;  4ZYS A;  5BMH A;  4JWU C;  2BB6 A;  4IW0 A;  2MBO A;  2DLB A;  3E9S A;  5I4D A;  4PYZ A;  3V60 A;  3AM9 A;  1YNT E;  4XYC A;  2FUH B;  1ZDX A;  4DK5 A;  2IY0 B;  1GB4 A;  4C80 A;  4OW0 A;  4FN2 A;  1WM2 A;  1WSP A;  2PMV A;  2RMM A;  2V1Y A;  1F2R I;  1FCL A;  1J0G A;  1Z5S B;  4W9L A;  3BYT B;  4E74 A;  2BW2 A;  5LNK 1;  1V86 A;  2C9W B;  3WAP A;  1T5X D;  2WS3 B;  4WIP A;  2NBV B;  3JW0 X;  1SJH D;  1WXS A;  4CO7 A;  2JSV X;  2HJ1 A;  3BYY B;  1VDV A;  4G11 A;  5J18 A;  5C1Z A;  2JXT A;  3ABV B;  4BVU C;  4TMA B;  3WAL A;  2FE8 A;  3T3O A;  2EKE C;  2NTS A;  2LGX A;  4S17 A;  1IYF A;  5HKH A;  3IAM 1;  2CJN A;  1C4C A;  2KAN A;  3NVW A;  1FPY A;  2WXR A;  1L4D B;  4KZC A;  2UYZ B;  2L32 A;  1YN4 A;  1DGJ A;  2WXP A;  4H2A A;  4MAC A;  2O6V A;  4OZC A;  3GE3 C;  1AWD A;  2NBW B;  3VUY A;  2MEK A;  2Y5C A;  3RNB C;  2FBW B;  2N0S B;  4ZRQ A;  1PUT A;  2ZNV C;  4FJV B;  2LGI A;  1E0Z A;  2DZI A;  1YQ3 B;  4DWF A;  5JZE B;  1IUE A;  3KH0 A;  3MHZ A;  4LNK A;  1WGG A;  4EZL A;  3H7S A;  3M63 B;  2LFI A;  4GMV A;  2QIL A;  1T3Q A;  3ZLZ A;  3N30 A;  4ZHO A;  1I4P A;  2DZJ A;  2PIA A;  4DHJ D;  2M19 A;  1KLG D;  3CST A;  4MEL A;  3NRZ A;  4K3C A;  1RFK A;  1VR9 A;  4I6L B;  4MEM A;  3L17 A;  3W1S A;  4AP4 C;  1ESF A;  2KN4 A;  1B9R A;  4IKG A;  2V0G A;  1UGJ A;  3TEX A;  2ZEQ A;  3FAH A;  1V1P B;  1M94 A;  1K51 A;  3IHP C;  5HHD G;  1Q5W B;  4ZRP A;  3IT4 B;  4BKT A;  1SIJ A;  4LDT D;  5KHQ A;  1DOI A;  2JT4 B;  5G5G A;  3UQB A;  1HEZ E;  4W9E A;  2AL6 A;  4ZRJ A;  1C4P A;  3AE7 B;  4A6Q A;  2FCQ A;  2WXN A;  1WZ3 A;  4EUT A;  2K6D B;  2WU2 B;  1NDD A;  2LHD A;  4BKG A;  4LTU A;  3RI7 C;  5D94 A;  5L95 C;  4YXD B;  2LGD A;  3VRB B;  2KDE B;  2OJR A;  1H8C A;  5FK9 C;  1EU3 A;  2NCN A;  5LLI A;  2AWT A;  1QOA A;  1N63 A;  2PLP A;  1IBX B;  1J19 A;  3RN9 C;  1IGD A;  3N1Z C;  4BZA A;  1WRI A;  3RNG C;  2K39 A;  1EU4 A;  3TUO A;  3I5J C;  2KJ6 A;  1KH0 A;  3ML8 A;  4HCP B;  4W9D A;  2AEH A;  3O13 A;  2VZK D;  1AAR A;  4DXA B;  2ACZ B;  2Y5B B;  1MI0 A;  3EHV A;  1NEK B;  2BB5 A;  4AUQ C;  3AEA B;  4RF0 A;  1FXT B;  5IAA C;  2C60 A;  2KAJ A;  2JRI B;  3E56 A;  4RGT A;  1SF0 A;  4ANU A;  2R61 A;  3V05 A;  4X57 B;  3HM6 X;  3VR8 B;  3Q6B A;  1WGK A;  1WE7 A;  1VJK A;  1E7P B;  3AB5 A;  3NG0 A;  1HA5 A;  2WWZ A;  3AU5 A;  2V3S A;  1V80 A;  3H8H A;  2I38 A;  3AXC A;  1V5O A;  3EC8 A;  3AH7 A;  5JHB A;  2QJL A;  2LXA A;  1AW7 A;  4A3P A;  3N1Y C;  3AMZ A;  2LAS A;  5JHA A;  4JGH B;  1U4A A;  4GDK A;  4WAA A;  3ZRF A;  3DWM A;  2ZPY A;  3HUI A;  1TS5 A;  1FFV A;  1PFD A;  2HTH A;  1YJJ A;  5D6J B;  3OJ4 B;  2E6X A;  3L13 A;  1HTO A;  1MFW A;  3ZJV A;  4GDL A;  3PLU A;  3A9J A;  3LXF A;  1TYG B;  2MX2 A;  1NVI D;  3KUZ A;  1QIL A;  4EOY A;  4NNJ B;  4YTN B;  4TSS A;  4P1B C;  4WJN A;  1DOY A;  4F1S A;  1UWM A;  3PT2 B;  1FNW A;  2DWQ A;  2TSS A;  3PHW B;  4MH8 A;  3JSV B;  3BIN A;  2DYB A;  3DVN V;  3V3X A;  2EMT A;  2KFJ A;  1MG8 A;  3HVZ A;  2JF5 A;  1WJN A;  3SDL C;  1JW9 D;  3FIL B;  4EKU A;  1I35 A;  4IWP A;  2I2Y A;  2K22 A;  2NPT A;  3IG3 A;  4I6N B;  3R2T A;  3A4R A;  2IGG A;  1VCB A;  2KJR A;  4YSZ B;  4ICU A;  4EE2 A;  3KUD B;  3N32 A;  1N61 A;  1TGZ B;  2BKF A;  4P7I A;  3Q2A C;  4RH6 A;  3VUX A;  3Q8E A;  5D3D A;  3H9D A;  1TS4 A;  1ROE A;  1YJI A;  3BZD B;  1VRA B;  1PGB A;  4HPM B;  1SSN A;  3PRZ A;  2JUO A;  2WYQ A;  2G4S A;  3AEB B;  1NYR A;  2KDB A;  4W9F A;  4NPN A;  2JYE A;  3WAN A;  3N20 C;  2G4D B;  1OFF A;  1WR1 A;  2K1F A;  2QMT A;  1JML A;  3RNF C;  2MRP A;  3P63 A;  3W5U B;  5E6N A;  4OHJ A;  4KZ0 A;  5IO9 A;  4RGM A;  4A3O A;  3H7P A;  1ZXI A;  4BBN F;  4JPS A;  5IKC M;  2M0X A;  4G50 A;  3GB1 A;  1WY8 A;  3BVG A;  4LJP B;  3V61 A;  5E6O A;  3PLV A;  5G2N A;  2PVO D;  2QEJ C;  2SEB D;  2CKH B;  1LO5 D;  5DPS A;  2MWS B;  3U7Z A;  2OED A;  2PE9 A;  4YT0 B;  3BWU D;  1V6E A;  2WP9 B;  4L2Y A;  2GBM A;  1YQ4 B;  2MA9 B;  4KKI A;  3TEZ A;  3L54 A;  3AU4 A;  1E90 A;  3KWV A;  3URY A;  4KDL B;  4O1N A;  1MG4 A;  4II2 B;  2MBE A;  2J0M A;  2FCS A;  2KX3 A;  1C4A A;  2WHI A;  3B0A A;  2WNM A;  1WJ4 A;  1JAL A;  2ON8 A;  3ZNH B;  3A1Q B;  5LXH A;  5BO4 B;  2W3R A;  2C5L C;  4XGA B;  4BOS C;  2Z0E B;  1RM6 C;  3QQ8 B;  1TKY A;  4MH0 E;  2KX0 A;  4GGQ A;  1XLO A;  2A4Z A;  2WXG A;  4P16 A;  2WQY B;  2KQS A;  4MJS B;  2ZPN A;  4REZ A;  3BVM A;  1VD2 A;  1V5T A;  2WX1 A;  4NJ6 A;  1KLV A;  3EFC A;  2MBB B;  3OG5 A;  4HDO A;  4WWP A;  3ZXV A;  4B9K A;  1KF6 B;  2J0J A;  3SHQ A;  1ACC A;  3NS1 A;  3I57 A;  2L83 A;  3L10 B;  1FD6 A;  1WZ0 A;  1P1A A;  1PDX A;  3IBE A;  4B95 A;  3DHH C;  3JYU A;  2WGS A;  2WXJ A;  2WLB A;  1M4V A;  2I1K A;  4IWQ A;  3TEY A;  4HXD A;  4GSW A;  2GLS A;  3BK1 A;  3TIX A;  2C7N B;  4GOC A;  2JXX A;  3DBL I;  3LJ3 A;  3HIZ A;  1EUV B;  4A9A A;  3VR9 B;  3W5V B;  3DBL B;  2KXJ A;  4OZB A;  3P4P B;  2M1M A;  2VH1 A;  3KYD D;  2IY1 B;  3PRP B;  4KX6 B;  4KV2 A;  1WIA A;  2G3Q B;  1AYF A;  1PGA A;  2H88 B;  3NVZ A;  1WX7 A;  1EF1 A;  3TBL D;  1VZ6 A;  1V2Y A;  1HTQ A;  3OJ3 A;  1E8Z A;  3IXS A;  2REX A;  1XCQ L;  1XLN A;  3ZXR A;  2BS2 B;  3ZVV A;  2L8J A;  3A4S C;  2KDI A;  1PYW D;  1ZXH A;  2LVO A;  4N6E B;  4AQ7 A;  5T8I A;  3AE3 B;  2WXQ A;  1K8R B;  1UZX B;  4ACF A;  2QHO A;  1LXD A;  3HRD D;  4LNI A;  4J6I A;  2CR5 A;  4I6P A;  2D11 A;  3QHT A;  3NS8 A;  2JU6 X;  3Q8B A;  3GS2 A;  3RNA C;  1LGR A;  1E10 A;  1I4Q A;  1WJ6 A;  4WH4 A;  1E8Y A;  1T0S C;  4P1C C;  3EGR A;  1PGX A;  2MBH A;  3VHT C;  2AL3 A;  4C7Y A;  4MGK E;  4PS8 A;  3D32 A;  4RNA A;  5CTR C;  2K8B A;  2N7E A;  4F8C B;  3NVY A;  3APD A;  1OEY A;  3PRE A;  5C2T B;  2KO3 A;  2V4L A;  3VH3 B;  3AV8 A;  2KVR A;  2LGS A;  1JWM D;  3PZ8 A;  2DEN B;  1N5X A;  2L1A A;  1V97 A;  2Z59 B;  2G9H D;  2BWE S;  2K3U A;  4BBN C;  2AQ3 B;  1D3Z A;  4GIV A;  3DOW A;  1K53 A;  1WGR A;  5MPO A;  2VZK B;  3DBR I;  3UF8 A;  2O6V D;  3UGB B;  3DBR B;  4HEA 1;  1P98 A;  1FFU A;  4K81 A;  1T0Q C;  2D07 B;  3PO0 A;  2KKC A;  3KYC D;  4W9G A;  1WGH A;  2GI9 A;  3Q3J A;  3HHM A;  2FAZ A;  4MSQ B;  1L0X B;  1XT9 B;  2RPQ A;  1K50 A;  3PRM B;  1SJE D;  4YTP B;  3VUW A;  4NAW A;  4IWO A;  3SEB A;  5AUK A;  1ET6 A;  1PQS A;  1SE2 A;  2KHW B;  2AYO B;  4CYE A;  4JQW C;  1OQY A;  3AEF B;  3Q8A A;  3BVZ A;  2B76 B;  1B1Z A;  2IJ0 A;  1N62 A;  1I4G A;  3KQ4 A;  1FRR A;  4LCD E;  2IND C;  2DAJ A;  4M8N A;  1ZW7 A;  1BUI C;  1V9J A;  2ZJD A;  4NY0 A;  1DOX A;  1E7V A;  1SB3 C;  2KNB A;  1BML C;  2E3T A;  1S1Q B;  3DHI C;  4M8M A;  2MP2 B;  4PS3 A;  4GDK B;  4JIO U;  3RFZ B;  4ZRI A;  4K7S A;  2AQ1 B;  5D3I B;  3FKY A;  1NI3 A;  2R2O A;  2MQJ A;  5EE1 A;  4FHJ A;  3P4R B;  3X23 A;  4WQO B;  4WJO A;  3K9O B;  4ARC A;  1JRU A;  4CHK A;  1STE A;  2N9K A;  5AUI A;  4OVU A;  4YSX B;  1VZ8 A;  2OHF A;  3PSE B;  3V62 A;  3U8Z A;  4EFO A;  4G3X B;  2LZ6 A;  2M56 B;  4FUL A;  3TEW A;  4IG7 B;  3H1U A;  4KGR A;  5AZF A;  4HPP A;  3ALB A;  5BMG A;  2H89 B;  3Q3F A;  1YQB A;  4A55 A;  2D3G A;  4DXG A;  1Y8R C;  1XEE A;  2JZZ A;  1L0Y B;  3N1X C;  3W2D A;  3VQI A;  1I7H A;  4DDI D;  1KJT A;  1V81 A;  3MHS D;  4IM0 A;  2L3Z A;  1TZO A;  2HDE A;  1UGM A;  2HD5 B;  1F52 A;  5G55 A;  2N9L A;  1IPG A;  5HI1 A;  2CU1 A;  4BOZ B;  2D3A A;  1C1Y B;  4FJY A;  4K1R B;  3P2B A;  3APF A;  2KDF B;  3VRA B;  2L0T A;  3CIR B;  1P7F A;  2J0K A;  4PT5 A;  5IA7 A;  2DZM A;  2Y3A A;  1IP9 A;  3L0W B;  1WGD A;  3QCA A;  3R3M A;  3PPA A;  2DZK A;  1TZ1 A;  1KTK A;  2VH2 A;  3NOB A;  5HFY A;  2WXI A;  2EKI A;  2BF8 B;  3ZTC A;  2L0F A;  2WXK A;  2K0P A;  3EUB 2;  3CMM B;  2KMM A;  2MH7 A;  1MHX A;  4CQN A;  4RM9 A;  2PE6 B;  4W9K A;  4F7Z A;  2KFK B;  4A8X C;  1XO3 A;  2M0A A;  3MC8 A;  3VAW A;  4C7Z A;  2CS4 A;  2KJH B;  2LVQ A;  2PJH A;  2W54 A;  4RGN A;  1XCT L;  5FR3 A;  1YN3 A;  4IM2 A;  1F1H A;  1K52 A;  1YIW A;  4AJW A;  3ZRC A;  3PV1 A;  4NJ7 A;  4FXC A;  1GNU A;  1A70 A;  4TUU A;  3V6E B;  3RPF C;  4HKQ A;  2X38 A;  1F2R C;  2N7J A;  2QSD A;  1XXG A;  4ZHP A;  4E3C A;  2EEL A;  2IDY A;  2J52 A;  4EZK A;  3Q8C A;  2ZZP B;  1YX5 B;  1KOT A;  1GC6 A;  2GB1 A;  4D2K A;  3H6N A;  1FRD A;  4M02 A;  4LNF A;  3ZQ4 A;  4ICV A;  1GG3 A;  1RRB A;  5D7G A;  3PVL A;  3TSS A;  3QAQ A;  1T0Y A;  5H92 C;  5D2M B;  3NVV A;  4KGS A;  1F0Z A;  1WMH B;  3DVN U;  2INC C;  3ML9 A;  2BT6 A;  3R2I A;  5KHO A;  1KRH A;  2PW9 A;  2V3P A;  2WDT B;  1P9D U;  4ZRK A;  4C56 C;  4WWO A;  1E5W A;  4RM8 A;  2ONQ A;  2ZW0 A;  2KWC A;  1OQQ A;  1VZ7 A;  3PGE A;  4HLE A;  2WDR B;  2RR9 A;  2RD0 A;  4XZ4 A;  4YTM B;  2NR2 A;  3DHG C;  3TL5 A;  2W9N A;  3ZUN A;  4FAD A;  1D6E C;  2WDQ B;  1MJD A;  5EDS A;  3A9K A;  1FNV A;  1F9J A;  3RCZ A;  5AZH A;  2KTR B;  3RMK C;  2BPS A;  1T6B X;  5G5H A;  2LJI A;  2YLM A;  1FCC C;  2D3B A;  2ZCC A;  4GU2 A;  5BMI A;  3AEG B;  3B9J A;  3I9V 1;  1E7U A;  3NJT A;  3AE1 B;  1TS2 A;  2N9E B;  3ECI A;  4JE3 B;  3WCQ A;  2ZVO A;  2KT7 A;  3I3T B;  4KDI C;  5DPR A;  4HPL B;  3ZNI D;  3L08 A;  1D5Z C;  5CHW A;  1C3T A;  3DVG Y;  1TKE A;  4OVV A;  1R7S A;  1RAX A;  2ZNV B;  1NBF C;  5IOI A;  1XD3 B;  3DDC B;  2BWF A;  1UEL A;  4IC7 B;  2PKO A;  2BYF A;  2D2Q A;  2KD0 A;  4L1B A;  2M17 A;  1D5X C;  3ZYY X;  3RZW C;  2L05 A;  1ZE3 D;  3QWZ B;  3B1L X;  1WXM A;  3DQV A;  1X1M A;  4C4V A;  2BGF A;  5BYR A;  4TV3 A;  2LVP A;  5DPT A;  3FC4 A;  4AWJ A;  3MC0 B;  3IAS 1;  2QC8 A;  3WAO A;  3RNE C;  1V49 A;  1JWS D;  1FXA A;  1OTR B;  4FLH A;  1GOZ A;  3UIN B;  1SEB D;  2MBQ A;  2A5U A;  3DBS A;  4GLS C;  1CZP A;  1WI0 A;  4LK0 M;  4Q2J A;  2W3S A;  4HVB A;  2MW5 A;  3AE6 B;  2IGH A;  1TT5 B;  1QT9 A;  1YD8 U;  2NS5 A;  1WWT A;  2OJW A;  4W9C A;  5TSS A;  1FIQ A;  4YSY B;  1LQB A;  1WXA A;  1E6E B;  2FCM A;  4L23 A;  4ZOH C;  1NYQ A;  3B08 A;  3EFU A;  5EE9 A;  1CK1 A;  2O6V B;  2J7Q B;  4MGY E;  5AZG A;  3WA0 A;  2JYT A;  1ZKH A;  2BYE A;  4KVG B;  3JSV A;  1MHH E;  3VVW B;  1FXI A;  3RD2 A;  2IGD A;  1JQ4 A;  3T8M A;  1SE3 A; 
#chains in the Genus database with same CATH homology
 3DBH I;  2O2V B;  2Z0D B;  1XQQ A;  2BKR B;  3AUL A;  3UF8 A;  2K39 A;  2O6V D;  2JRH A;  3VTW A;  1ZGU B;  3UGB B;  2KWV B;  5DPW A;  1P98 A;  1LFD A;  2FCN A;  2KJ6 A;  2IO2 B;  2O2V A;  1WH3 A;  2PPH A;  4K81 A;  3ML8 A;  4HCP B;  3R66 C;  2D07 B;  2LGY A;  3NY5 A;  1WM3 A;  2RSU A;  4W9D A;  5J2R A;  2AEH A;  2JZ3 B;  2KKC A;  2PEA A;  3KYC D;  4W9G A;  1WGH A;  1YJ1 A;  2GBK A;  4FJZ A;  1AAR A;  4DXA B;  2KQ7 A;  3Q3J A;  3HHM A;  2FAZ A;  2Y5B B;  3EHV A;  4MSQ B;  3OAW A;  4AUQ C;  4KIK B;  4NAW B;  1XT9 B;  1FXT B;  4DBG A;  2RPQ A;  3EEC A;  5IAA C;  5GMV A;  2C60 A;  3PRM B;  1L7Y A;  5DCN A;  3T9L A;  2LWP A;  2JRI B;  4KIK A;  2IYD B;  4NAW A;  3VUW A;  4DHJ B;  4IWO A;  5CX3 A;  3HM3 A;  2DHZ A;  2N9P C;  3X0W A;  4KSK C;  1PQS A;  2KHW B;  2LRU A;  2AYO B;  4ANU A;  3ZNG C;  4JQW C;  2MLB A;  4CYE A;  1OQY A;  4BKS A;  4X57 B;  1WRD B;  3HM6 X;  3QJZ A;  4E71 A;  4B6W A;  2LJ5 A;  3ZNZ B;  3ZDM C;  3BY4 B;  1WE7 A;  1OEY J;  2LI5 A;  2LUE A;  4LCD E;  3ZTD A;  2VRR B;  2DAJ A;  4M8N A;  4NQL B;  1ZW7 A;  1V9J A;  2ZJD A;  2MSE D;  2N1W A;  3PZD A;  4MDK E;  4NY0 A;  2DAF A;  4XC2 A;  2WWZ A;  3AU5 A;  1E7V A;  2KNB A;  3L16 A;  2V3S A;  1V80 A;  1S1Q B;  2KFK A;  2IO1 B;  2KLG A;  3KVF B;  4M8M A;  2MP2 B;  4PS3 A;  2IBI B;  4GDK B;  4JIO U;  3AXC A;  1V5O A;  3EC8 A;  4ZRI A;  5JHB A;  3A33 B;  2LXA A;  2GMI C;  4A3P A;  5JHA A;  4K7S A;  2LAS A;  2M4N A;  4LDT B;  5AEK B;  2XBB C;  1G6J A;  4JGH B;  1U4A A;  4GDK A;  4WAA A;  4GN1 A;  3ZRF A;  2ZPY A;  2R2O A;  3ZO5 B;  3CF6 E;  4DHZ E;  1TBE A;  2MQJ A;  1WR6 E;  2JY6 A;  4FHJ A;  2XK5 B;  3TCA A;  4A20 A;  2HTH A;  2L7R A;  3X23 A;  1I42 A;  4WQO B;  1GUA B;  4WJO A;  2N9X A;  3K9O B;  5D6J B;  3VTV A;  4K7U A;  3OJ4 B;  1JRU A;  2KOX A;  2NBU A;  3L13 A;  4CHK A;  3ZKJ C;  1A5R A;  3U7D A;  2XK5 A;  2CHX A;  2YVC A;  2KC1 A;  4OVU A;  4GDL A;  3PSE B;  3PLU A;  4EEW A;  4ANX A;  3A9J A;  3V62 A;  2K8C A;  2MX2 A;  4G0N B;  4PS7 A;  3U8Z A;  4EFO A;  3SD5 A;  3KUZ A;  4RMA A;  4G3X B;  2ZVN A;  4EOY A;  2LZ6 A;  2C7M B;  4FUL A;  2K6Q A;  4NNJ B;  4MM3 A;  4IG7 B;  2N4F A;  3H1U A;  3K9P B;  3O65 B;  3RZF A;  1J8C A;  5AZF A;  4WJN A;  4F1S A;  3ALB A;  3PT2 B;  1WE6 A;  3A1Q A;  2IO3 B;  3PHW B;  3DPD A;  3JSV B;  3QK0 A;  3BIN A;  3Q3F A;  1YQB A;  3HK0 A;  2DYB A;  3DVN V;  3QC8 B;  3W1Y A;  2EMT A;  2D3G A;  3AI5 A;  2KFJ A;  1Y8R C;  1MG8 A;  3CSF A;  5TR5 A;  1BT0 A;  2JZZ A;  1UBQ A;  1WJN A;  2JF5 A;  4GB9 A;  3SDL C;  1I35 A;  4EKU A;  3KW5 B;  4IWP A;  3R7Q A;  1WMH A;  3VQI A;  4ZDV A;  2D10 A;  4IUM B;  4ZYN A;  2NPT A;  1KJT A;  1V81 A;  3IG3 A;  4DDI D;  3GZN I;  2K25 A;  2LD9 A;  3MHS D;  3QA8 A;  4I6N B;  4IM0 A;  3A4R A;  4MJS A;  5E6P A;  1VCB A;  2KJR A;  1E8X A;  2N1V A;  2L3Z A;  4W9I A;  4ICU A;  4WJQ A;  1UGM A;  3KUD B;  1E8W A;  2HD5 B;  2ASQ A;  3APC A;  5G55 A;  2FID A;  1Z2M A;  2ZCB A;  3N32 A;  1KM7 A;  1IPG A;  1UD7 A;  1WGY A;  2CU1 A;  4BOZ B;  2NVU I;  1C1Y B;  1TGZ B;  1RLF A;  1TTN A;  4FJY A;  4K1R B;  2BKF A;  3KUC B;  1YX6 B;  1WXV A;  4II3 B;  4P7I A;  2MCN B;  1WFY A;  3P2B A;  3APF A;  2KDF B;  3VUX A;  2JVC A;  2L0T A;  3M3J A;  5J17 A;  3OLM D;  3RT3 B;  3H9D A;  4EZJ A;  2J0K A;  3VFK A;  4IM3 A;  5C23 A;  4URK A;  2OOB B;  5IA7 A;  1HE8 A;  2L76 A;  1P0R A;  2DZM A;  2KTR A;  4HPM B;  3PRZ A;  3RUL A;  1IP9 A;  3QAR A;  3R7R A;  2UWQ A;  1WGD A;  3L0W B;  2JUO A;  2WYQ A;  2DZK A;  1TZ1 A;  3PPA A;  3QCA A;  3R3M A;  2G4S A;  4K7W A;  2KDB A;  4W9F A;  4GXB A;  3NOB A;  4NPN A;  3PTF C;  3WAN A;  1P3Q U;  2BF8 B;  3ZTC A;  2KLC A;  4KSL C;  2G4D B;  2L0F A;  3VXW A;  2FNJ B;  1WR1 A;  2K8H A;  1WJU A;  2K1F A;  3CMM B;  1H4R A;  2KMA A;  4LJO B;  4XX5 A;  4HJK A;  2MRP A;  4RM9 A;  2PE6 B;  3QX1 A;  3GOE A;  4W9K A;  4BKS D;  2GBN A;  2KTF A;  5E6N A;  4F7Z A;  2KFK B;  2GOW A;  4KZ0 A;  1GJZ A;  1CMX B;  2B3A A;  2I1J A;  3TMP B;  3M95 A;  3VAW A;  2CS4 A;  2KJH B;  2LVQ A;  2PJH A;  4A3O A;  4MGZ E;  1EF5 A;  1L2N A;  2C7H A;  3M62 B;  3H7P A;  4ASW C;  4IM2 A;  4HCN B;  4HDQ A;  4BBN F;  2FIF A;  3LDZ E;  4FBJ B;  2M0X A;  1YIW A;  4G50 A;  4AJW A;  1WX9 A;  4YL8 A;  3ZDT A;  1WY8 A;  3ZRC A;  4AOF A;  3PV1 A;  4LJP B;  4M0W B;  4WWN A;  4NJ7 A;  4JLC A;  3ZIM A;  1UBI A;  1GNU A;  3NZS A;  3PLV A;  5E6O A;  3V61 A;  1Q1O A;  5G2N A;  4TUU A;  3V6E B;  2CKH B;  4IW0 A;  2MBO A;  4FA6 A;  4PYZ A;  3V60 A;  5DPS A;  2MWS B;  2FUH B;  3WIM A;  4TQ1 A;  3IVF A;  2PE9 A;  4DK5 A;  4E3C A;  2IY0 B;  1V6E A;  4EZK A;  4FN2 A;  2GBM A;  1WM2 A;  3QIJ A;  4GDL B;  2ZZP B;  2MA9 B;  1YX5 B;  3A9J B;  2V1Y A;  1KOT A;  3L54 A;  1GC6 A;  3AU4 A;  3MJW A;  4MGI E;  1E90 A;  1J0G A;  3H6N A;  1Z5S B;  4W9L A;  4KDL B;  4E74 A;  1UH6 A;  4II2 B;  2MBE A;  2J0M A;  2FCS A;  1V86 A;  4ICV A;  2KX3 A;  3B0A A;  1GG3 A;  1R4M I;  3MTN B;  1RRB A;  1WJ4 A;  2C9W B;  3RUI B;  3WAP A;  3ZNH B;  3A1Q B;  3VDZ A;  5D7G A;  5LXH A;  2DX5 B;  2DYO A;  2NBV B;  3JW0 X;  3PVL A;  5BO4 B;  4FHK A;  2C5L C;  3QAQ A;  1WXS A;  1T0Y A;  4BOS C;  4CO7 A;  4W9J A;  2Z0E B;  1OGW A;  3UQA A;  3QQ8 B;  4JL9 A;  2KWU B;  5D2M B;  4G11 A;  1SIF A;  5J18 A;  4ANV A;  2GBJ A;  1WMH B;  4MH0 E;  3DVN U;  2KX0 A;  5C1Z A;  3ML9 A;  4GGQ A;  2A4Z A;  2NPT B;  3ZW3 A;  5KHO A;  4BVU C;  3UIP B;  2KQS A;  3WAL A;  4MJS B;  5JH5 C;  2ZPN A;  2WDT B;  1P9D U;  4ZRK A;  2XEW A;  1VD2 A;  4WWO A;  1V5T A;  3VTU A;  2EKE C;  1E5W A;  2WX1 A;  2LGX A;  2M8S A;  4RM8 A;  3PS6 A;  1IYF A;  3NZU A;  2GBR A;  5HKH A;  4NJ6 A;  2KWC A;  1KLV A;  4N9F 4;  3S2A A;  2MBB B;  3A9K B;  3PGE A;  4HLE A;  2RR9 A;  2RD0 A;  4HDO A;  2KAN A;  2EMS A;  4XZ4 A;  4WWP A;  2NR2 A;  3ENE A;  2BYV E;  4B9K A;  2J0J A;  3TL5 A;  2W9N A;  3ZUN A;  4FAD A;  3SHQ A;  1QZE A;  4KZC A;  1SE9 A;  5EDS A;  2UYZ B;  3A9K A;  3DCG A;  3L10 B;  2CHW A;  1F9J A;  1WZ0 A;  1P1A A;  1LM8 B;  3IBE A;  3RCZ A;  1NI2 A;  5AZH A;  4B95 A;  2KTR B;  3JYU A;  2O6V A;  2BPS A;  2YLM A;  2ZCC A;  2I1K A;  2NBW B;  4GU2 A;  4IWQ A;  3VUY A;  1RFA A;  4HXD A;  4GSW A;  1S3S G;  1E7U A;  2KN5 A;  3TIX A;  2C7N B;  4GOC A;  3WAM A;  2ZNV C;  2JXX A;  3DBL I;  3LJ3 A;  4FJV B;  3HIZ A;  4MSM B;  3RYT A;  1EUV B;  2N9E B;  2DZI A;  4PYU A;  2KK8 A;  2HJ8 A;  3ECI A;  4NQK E;  4DWF A;  5JZE B;  2ZVO A;  2KXJ A;  1EO6 A;  3I3T B;  4KDI C;  5DPR A;  4DHZ B;  4HPL B;  2M1M A;  3ZNI D;  3L08 A;  3KH0 A;  4DDG D;  5CHW A;  1C3T A;  3DVG Y;  1WF9 A;  3DVG X;  2IO0 B;  4OVV A;  3VH4 B;  3UIO B;  3H7P B;  3KYD D;  1RAX A;  4AJY B;  2IY1 B;  2ZNV B;  3PRP B;  1NBF C;  1WGG A;  4EZL A;  1XD3 B;  3DDC B;  1WIA A;  4KV2 A;  3TJP A;  3W1S C;  2G3Q B;  3H7S A;  3JVZ X;  2BWF A;  4W9H A;  2RGF A;  3M63 B;  1WX7 A;  1UEL A;  4GMV A;  4IC7 B;  1EF1 A;  2BYF A;  2D2Q A;  3TBL D;  2KD0 A;  1V2Y A;  2M17 A;  3ZLZ A;  3N30 A;  3RZW C;  3OJ3 A;  2JWZ A;  1R4N I;  2DZJ A;  1E8Z A;  2L05 A;  2REX A;  3QWZ B;  3B1L X;  1WXM A;  4WJP A;  3DQV A;  4DHJ D;  1X1M A;  2DYM A;  3CST A;  4MEL A;  2KC2 A;  2BGF A;  3ZVV A;  2L8J A;  4I6L B;  3A4S C;  4TV3 A;  2KDI A;  2LVO A;  4MEM A;  3L17 A;  2LVP A;  5DPT A;  2LRW A;  4AWJ A;  3W1S A;  2IZV B;  1WX8 A;  3V6C B;  3NHE B;  2HE7 A;  1K8R B;  3WAO A;  1UZX B;  1V49 A;  4AP4 C;  2KZR A;  2QHO A;  1LXD A;  1OTR B;  5CHV C;  1WYW B;  4FLH A;  4HK2 A;  3UIN B;  2MBQ A;  2A5U A;  4J6I A;  2KMC A;  3DBS A;  2CR5 A;  2ZEQ A;  2MP2 A;  4I6P A;  2N7D A;  1Q0W B;  2D11 A;  3ONS A;  1M94 A;  3NS8 A;  3QHT A;  1WI0 A;  3SU8 X;  2JPH A;  3IHP C;  4HVB A;  1Q5W B;  2MW5 A;  3U30 A;  4BKT A;  1WJ6 A;  2G45 B;  2R2Q A;  4LDT D;  5KHQ A;  1E8Y A;  2JT4 B;  2CHZ A;  1YD8 U;  2L00 B;  2NS5 A;  4ANW A;  2LXC A;  3UQB A;  2MBH A;  2WX0 A;  3VHT C;  2AL3 A;  4W9E A;  4HWI B;  2AL6 A;  4MGK E;  4PS8 A;  3D32 A;  4W9C A;  4ZRJ A;  5CTR C;  2FCQ A;  1WZ3 A;  1LQB A;  4EUT A;  1WXA A;  2K8B A;  2N7E A;  4F8C B;  2K6D B;  2FCM A;  3APD A;  3N3K B;  1OEY A;  3PRE A;  1ISN A;  1NDD A;  4BKG A;  2KO3 A;  2V4L A;  5CHF A;  3VH3 B;  5D94 A;  5L95 C;  2KVR A;  2LGD A;  3B08 A;  2KDE B;  3C0R B;  5L83 A;  2OJR A;  3EFU A;  2DEN B;  4BFR A;  1H8C A;  2O6V B;  2J7Q B;  2Z59 B;  4MGY E;  5AZG A;  3WA0 A;  1ZKH A;  2BYE A;  2BWE S;  2NCN A;  4KVG B;  4BBN C;  3JSV A;  3VVW B;  5LLI A;  2AWT A;  5FR6 A;  4GIV A;  1D3Z A;  3DOW A;  3RD2 A;  1WGR A;  5LXI B;  1J19 A;  4TQ0 A;  1SGH A;  3T8M A;  4TKN A;  1GC7 A;  3IFW B;  3PHX B;  3DBR I; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...