2INDC

Mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of manganese(II)-reconstituted and native toluene/o-xylene monooxygenase hydroxylase reveal rotamer shifts in conserved residues and an enhanced view of the protein interior.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2indC00
2INDC 3DHGC 3RN9C 3RNCC 1T0RC 4P1CC 3RNAC 3I63C 2INCC 3N1ZC 3RNEC 3Q3OC 3RMKC 3RNGC 3Q3MC 3Q3NC 3DHHC 1T0QC 3N20C 3RI7C 4P1BC 3RNFC 3GE8C 3DHIC 1T0SC 3RNBC 3N1YC 3Q14C 3Q2AC 3GE3C 3N1XC 3I5JC 2RDBC
chains in the Genus database with same CATH superfamily
5LNK1 2AQ1B 5C1ZA 3ZKJC 3ENEA 3U7DA 4DDID 1FMAD 3P4RB 4J6IA 1K51A 1T0YA 1ISNA 1QT9A 2TSSA 4BBNF 3TMPB 3T3OA 3N1YC 2WDRB 2RMMA 4ANVA 2AL6A 1F77A 2OEDA 3OJ4B 2XEWA 2EKIA 1IGDA 2NBWB 2L7RA 1RLFA 4REZA 2IGDA 5IKCM 3AN1A 3SDLC 1FXTB 1WE6A 1YQ4B 1IGCA 1OEYJ 2MLBA 1RRBA 1TT5B 2FIFA 1UF0A 2KWCA 1GC7A 1TZOA 2L0TA 4JX1C 1NI2A 1EF1A 2J42A 3LXFA 2DBYA 2WGSA 5IOIA 4WJPA 2CHXA 3VHTC 2WX0A 3V60A 1TZ1A 1ZUD2 3OG5A 4HCNB 1UWXA 2XK5A 1UELA 2PLPA 1HQRD 1KM7A 4XGAB 5BO4B 4EE2A 2OJWA 2N9KA 1WZ3A 2BB5A 3BINA 1IP9A 3ZJUA 4OW0A 4MGIE 3Q8CA 1E90A 5LXHA 1CMXB 3I63C 1FD6A 1ENFA 1N5XA 5EE9A 4M0WA 3LJ3A 3APFA 3AI5A 1FFVA 2JUOA 3GZNI 4G3XB 5HHDG 2M1MA 2LRWA 2CJNA 4FHJA 4JL9A 2KDFB 1I4QA 2HJ1A 2L52A 3O65B 2QMTA 3VTWA 4KSKC 2N9PC 1I4RA 1QOGA 1WYWB 1DOIA 2UYZB 4ICUA 3W5VB 4NJ7A 1QKZA 3B9JA 2HJ8A 1E7PB 1JWSD 1WF9A 1J7AA 2QEJC 3APCA 1BXTA 1WR1A 3ZNZB 3MHSD 5FKAC 1D4BA 3SEBA 2BWFA 4WJNA 3VUWA 2BPSA 3ZVVA 4A3OA 2KMCA 4JPSA 1SE9A 4PS3A 3P4PB 3O13A 3T3NA 2DNFA 2GOWA 2MJEA 4KV2A 1RFAA 1V8CA 3TSSA 1T0RC 4JGHB 3ECIA 5T8IA 1OGWA 2DZMA 1TS2A 3RNGC 4GOCA 2CU1A 1TJEA 3IHPC 3P1MA 4DDGD 2BT6A 1SIFA 3RNFC 1YOVB 2KDMA 1E7VA 2K0PA 5G2NA 4AOFA 4WAAA 2I38A 2IO1B 2IZVB 3U30A 4F7ZA 3CSTA 3CWIA 3NS8A 2FCMA 2IY1B 2J0MA 4ARIA 1XEEA 5J18A 3ML8A 4QAYA 1IYFA 4IM2A 2JU6X 2FCNA 2HDEA 4EUTA 5E6PA 4EZJA 2JPHA 1GB4A 1S3SG 2KXJA 3ZRCA 3BVMA 4LNKA 3W9CB 2KHWB 3IG3A 2INDC 4BKTA 4MH0E 2G3QB 2D5GA 2GLSA 1D5MC 3SFDB 2N4FA 1KLGD 1HZ6A 1UBIA 1JQ4A 3R7RA 3UF8A 1XQQA 2N7DA 2GBMA 3ZNID 3W1YA 2HTME 3TCAA 2JXXA 3NG0A 2MJ3A 2KFKA 2Y3AA 2J52A 3VTUA 3ZXVA 4MGYE 2QCZA 1YD8U 3E9SA 3M62B 4ZHPA 3NY5A 5BMHA 2KFKB 2ZCBA 2KDIA 2Z0EB 2NTTA 2PEAA 1WGYA 1VJKA 2EMTA 1TS5A 1XLQA 4KKJA 4NAWA 1SE4A 1GAQB 4HKQA 2INPE 4LCDE 3KYCD 1PGBA 2LJ5A 3OAWA 3A33B 4LJOB 2GMIC 3IFWB 2LGSA 1LXDA 2GBRA 2EKEC 3RMKC 3U52E 2KJRA 3MFGA 4W9EA 4YSZB 4CO7A 3WAOA 1XCTL 3EFCA 1R4NI 3UGBB 3NUHB 2W9NA 4JIOU 3R8BA 1RM6C 2KX0A 3DBLB 4RFBA 1TKGA 3PRPB 2N9EB 2KK8A 2K3UA 5DCNA 2ZNVB 1YQBA 4KSLC 3C0RB 2Z8LA 2XNAC 3JYUA 4TQ1A 2IO3B 4MSMB 4A3PA 4WAFA 2ON8A 3PRZA 2A5UA 3RCZA 1MI0A 3CSFA 1WXVA 3TJPA 2UWQA 4LNNA 3VDZA 1F52A 3IXSA 1HTOA 3SD5A 1I4GA 2RPQA 1P1AA 1U4AA 4K7UA 1C79A 5I4DA 3ZNGC 1VZ8A 1DGJA 2M19A 3BZDB 4IWOA 1FRDA 2WHIA 3DDCB 4LNOA 4OVZA 1DOXA 1Q0WB 3AECB 2FE8A 2YVCA 4HK2A 3FAHA 4XWWA 4HCPB 4NNJB 3PLUA 2K5PA 1KF6B 1TBEA 3AE5B 3CF6E 4HPLB 3FILB 2M56B 2W54A 2IO2B 2O6VA 1SB3C 2RPVA 1J8CA 2CJOA 4TV3A 3RULA 4MJSB 1SBBB 2DYOA 1R4NB 2DZJA 1D3ZA 2M8SA 1UZXB 4A20A 3M63B 1YJIA 3L16A 3PPAA 3A9KB 1XF5L 2RSUA 3NOBA 4JWSC 3H7SA 4F8CB 1CK1A 4KIKB 2GBKA 1JROA 3AU5A 2D11A 2BW2A 3T8MA 3VR9B 3KQ4A 1YJJA 3P42A 4DXAB 1GUAB 3HK0A 3HUIA 4US8A 1EM7A 2QDFA 1V2YA 4YTNB 2WXQA 3VTVA 5JZEB 4DQOC 5L83A 4IG7B 2WXJA 1V5OA 1T5XD 3AU4A 2BF8B 1TKEA 4HRSA 4W9KA 2K6QA 1YIWA 5H8YE 2GRIA 3CIRB 4FXCA 1UNSA 1WH3A 3ZYYX 3U2SC 3J9CA 1MJDA 4A6QA 1L0VB 1D6EC 4KX6B 2KWVB 4G50A 4BVUC 3B0AA 2LMCA 4I6PA 4ARCA 3MC0B 2KTFA 2JZ3B 2PTLA 2MRPA 2AL3A 2KTRB 2WWZA 4KIKA 1AN8A 2G4DB 2K22A 2KN4A 2CKHB 4LDTD 3ZNHB 5BYQA 1N5WA 1CQVA 4AWJA 2FNJB 3A9KA 1WY8A 3KH0A 4ZHOA 2IYDB 2L32A 3ZDTA 2MP2B 3FKYA 2PPHA 2PE6B 5AUIA 2IY0B 1D5XC 4W9FA 1GNUA 2LVPA 2BYTA 1S1QB 3JSVA 3ZQ4A 3RI7C 1YX5B 4DXFA 1AW7A 1QF6A 3I9V1 1EUVB 2NR2A 1E8WA 3QA8A 5KHQA 1P3QU 2PVOD 1L0XB 4N58A 5D3IB 2K1FA 2BYEA 3NZSA 1FRRA 1ZOYB 2DLBA 5FR6A 4XDCA 3TEZA 4KKIA 1ZE3D 1LFDA 3PV1A 1FXAA 1SSNA 5EE0A 2C5LC 4M8NA 3NHEB 3V05A 1VZ6A 2Y5PA 1PGXA 1ZW7A 2ZZPB 1E7UA 2XBBC 4YTMB 4DHJB 4RM9A 3WANA 2NCNA 3VH4B 3DVGY 1YN4A 4YWGG 3IBEA 4XE0A 2BKRB 4AQ7A 4P6VF 2VH2A 2DAJA 3HVDA 1MHHE 3MC9A 2A4ZA 3VH3B 3VFKA 2KQ7A 4K3CA 2L3ZA 3C8YA 1GPXA 1L5PA 5C23A 4WWMA 3DQVA 1FPYA 2CU3A 2NTSA 2BYVE 2PE9A 2MH7A 2IO0B 2L0FA 5C2TB 4GLSC 4E74A 2N1VA 2BS4B 4K3BA 1QZEA 1LM8B 3GOEA 4WQMA 2PW9A 5GMVA 2M17A 3PZDA 4FHKA 4KGRA 1T0QC 5DPTA 4HPMB 4GB9A 4NAMA 4DXGA 3FILA 3IT4B 4FLHA 4OHJA 2JWUA 5BYSA 4RGMA 2DYMA 3GP7A 3QX1A 1HE8A 2PMVA 2INCC 3QARA 1JCKB 2NPTA 4HEA1 4K7SA 4NAWB 2V1YA 3AE8B 3ZJTA 1FCLA 3A9JA 4N6EB 1ROEA 1I42A 1FNUA 1E0ZA 4CHKA 4DHJD 1QOBA 4GGQA 3ETRA 5E6JA 2FUHB 4PK1A 3Q14C 4LDTB 4XC2A 2BGFA 4NY0A 3DBRI 3L0WB 4NQKE 1TY2A 3WIMA 1WGHA 1Z2MA 3AE3B 3SR6A 3V6CB 4D2KA 1FO4A 1KRHA 2V3PA 2PKOA 4RGNA 4EOYA 2BTEA 3JW0X 3NRZA 1H8CA 1I4HA 2BB6A 1F2RI 2QIEB 2LJIA 5D94A 4LTUA 4S0RA 4C7ZA 3Q3MC 4RCOA 1SJED 3W1SC 2REXA 1V81A 4XX5A 5AEKB 2WXLA 4PYZA 2LHEA 3WAMA 2DZIA 2VH1A 1T3QA 4W9IA 1L2NA 4DBGA 2QILA 1V97A 1SGHA 2AQ3B 3RNCC 4KDIC 1YN3A 4OZCA 4AUQC 5IA7A 2OJRA 1SXTA 4JE3B 1EWYC 1OEYA 2JSVX 3ABVB 1JW9D 1TTNA 3DHHC 3JVZX 1DYQA 2SEBD 3QK0A 3Q8FA 1YX6B 2W3SA 2FCSA 3H8HA 3P4QB 2J7QB 1HA5A 1STEA 1QQRA 1C4PA 2VZKD 3KUCB 4FJVB 5TR5A 4NJCA 3V62A 2QHOA 4RGTA 3LYYA 2CHWA 1XLOA 3IAS1 2DZKA 1K50A 5H92C 1XLPA 1SJHD 3N20C 1UBQA 4W9HA 2NMQA 2BKFA 5C3JB 3VAWA 2C9WB 3EC8A 4ASWC 2D07B 1N62A 2N9LA 1LGRA 3I3TB 4MELA 1CJEA 3PRMB 3MJ5A 1V1OA 3EFUA 3P63A 3EUB2 1PQSA 2KZRA 3VR8B 3V3XA 1N63A 3AEAB 2RD0A 4RGOS 4RM8A 3MHZA 3VXWA 4MGKE 2UU7A 3WA0A 4MH8A 5D2MB 5AUKA 4HROA 3E56A 1PGAA 2KQSA 1WRIA 1UGJA 3TIXA 2KYWA 4B6WA 3FC4A 3GE3C 4ITKA 5CTRC 2J53A 1MPEA 3CMMB 4KGTA 4ACFA 3VQIA 1QOFA 3RNAC 4WJQA 1EU4A 3B1LX 2RDGA 2AWTA 1FCCC 2KVZA 1XT9B 3AULA 3PZ7A 2PVGC 4OZAA 1Q5WB 1TS4A 1F1HA 1GJZA 3AM9A 3NZ3A 1SE2A 4FJYA 2V0GA 4LJPB 2GBJA 1F9JA 3L17A 1F2RC 4M01A 4MDKE 2ZVNA 2O2VB 5CHVC 2XK5B 4GXBA 1NYQA 3PSEB 4ZRKA 4B9KA 5HKHA 4ANXA 3RT3B 4FULA 3ZXRA 1WJ4A 3BVZA 3QAQA 5IN7A 3Q2AC 4KVGB 2GB1A 4Q2JA 4US9A 2PJHA 4NPNA 1C4AA 1AWDA 1WSPA 2X8XX 4XDDA 1YN5A 2ZVOA 4R3DA 5IO9A 4YSXB 1N61A 1GC6A 2MCNB 2AQ2B 2JYEA 3W2DA 1WWTA 1VRAB 4EFOA 3MJWA 1I4XA 2JY6A 4GN1A 2N1WA 2N7EA 1JWMD 1V1PA 2D3CA 2FAZA 2MBOA 3UIPB 4F1SA 1ET6A 3Q8AA 5EE1A 2WU5B 4YL8A 2KMAA 2ASQA 2WNMA 3OWEB 4RMAA 1SEBD 3TBLD 5AZGA 1Q1OA 4FA6A 1BMLC 3LB8C 4ZOHC 3BYYB 2LRUA 1X1MA 4NJ6A 2WQYB 4YSYB 5HG2A 1IPGA 2I2YA 3M95A 3JSVB 5HI1A 1C77A 2CHZA 2ZPNA 5BYRA 1ZKHA 1E9MA 3OLMD 3L54A 4MJSA 1V49A 2MWSB 3NVZA 1QOAA 4LLGM 1Z5SB 1HTQA 1A70A 2WLBA 4J3OD 4JQWC 5DPWA 1LO5D 2C7NB 2X38A 2KTRA 1NVID 1ESFA 3PS6A 4WIPA 2K8CA 4YT0B 4C00A 1MFWA 2LXCA 2RR9A 4PS8A 4BKSA 1J0GA 4WWOA 1WM3A 3RYTA 1WXMA 1ZXIA 1KH0A 1JALA 2O2VA 1GG3A 4PS7A 2LZ6A 5HFYA 3QWZB 2QSDA 1Q10A 4W9GA 4MM3B 4G0NB 2H89B 3QIJA 4PT5A 2WP9B 1NYRA 2FUG1 5IP4D 2N0SB 1E6EB 2K9XA 3URYA 3B08A 4RNAA 2M0AA 1XXGA 1TYGB 4H2AA 2WDVB 1TY0A 4I6LB 4GDLB 4AP4C 1N6ZA 4W9JA 1E8YA 2W82A 4YXDB 5FK9C 2B76B 3AH7A 2V4LA 2KQ4X 1T0SC 1K52A 4WURA 3H1UA 2ZW1A 1C1YB 3K9OB 5JHAA 1WIAA 3AE1B 4IM3A 1YNTE 2R2QA 3A4RA 3P4SB 3IAM1 3ALBA 4KDLB 3AEBB 2RDHA 1JWBD 2W55A 2ZW0A 3N3KB 2O6VB 3KUZA 4ZRPA 4M00A 1EWCA 4JLCA 5J17A 3L10B 3RUIB 2MQJA 3MP9A 3I57A 2BVCA 2LUMA 4AJYB 1YJ1A 2JT4B 3ZJVA 2JYTA 3PHWB 2K6DB 4FBJB 2JF5A 1YQ3B 3IT6B 5G5GA 4DHZE 2KDEB 4ZYNA 3EA6A 4RF1A 1WXAA 2LD9A 3ZUNA 3Q3JA 4IC7B 1PUTA 1ACCA 2D3BA 3X23A 4MEMA 2ZCCA 3APDA 4ANUA 3DVGX 1HEZE 2J0KA 1NEKB 2C7MB 4HJKA 2KKCA 2PIAA 4PYUA 5TSSA 3SFEB 3BK2A 1C76A 1L4ZB 4GU2A 2DAFA 1JRPA 3H7PA 2HD5B 4DK5A 3PVLA 4EZKA 5E6NA 5BMGA 4DHZB 2IPKD 2MA9B 4URKA 1WZ0A 1DOYA 1M94A 1Y8RC 1UWMA 1V5TA 1E10A 4OZBA 4L2YA 2G4SA 5CHFA 4FADA 2JQRB 4C7YA 2YEPB 1L7YA 1UH6A 1T6BX 1WMHB 4GDKB 3MC8A 3W5UB 1EF5A 1P98A 1P7EA 1VDVA 1NDDA 2N7JA 1I35A 1XO3A 1Y56A 3OJ3A 3TEWA 3ZLZA 2KLCA 3D32A 3KYDD 1A5RA 2JXTA 4IOIE 4BOZB 4A55A 1FXIA 2L05A 4II3B 3NVVA 2LXAA 2KLGA 3Q6BA 3L08A 1VLBA 4P16A 1R4MB 3ZGZA 2LGIA 3VUXA 1I4PA 5AZFA 4BOSC 2KACA 3UIOB 3GE8C 2D10A 3DBRB 2DWQA 1D5ZC 2ZJDA 3PO0A 2LASA 4WWPA 3A9JB 1WR6E 2ONQA 2R2OA 1TS3A 4IKGA 2NPTB 3U7ZA 2MW5A 2MBEA 3ZIMA 2KX3A 1WGDA 1WXQA 1VD2A 1C4CA 3BY4B 3KW5B 3V61A 1NI3A 1WX8A 4ZRJA 5E6OA 5CX3A 3RZWC 3HVZA 4OVUA 1WFYA 1ZGUB 4DWFA 2K8BA 2KD0A 2WYQA 1QILA 2AYOB 2LI5A 1ET9A 4EKUA 3AMZA 4A9AA 2D2QA 2JZPA 3AE4B 2JWZA 2CR5A 1VR9A 5DPRA 1KLVA 3AB5A 2R61A 4W9LA 1FFUA 1VZ7A 3NS1A 4C80A 3DPDA 3B2GA 5G5HA 3W1SA 4NZLB 1EU3A 2C60A 1E8XA 4C4VB 2DENB 4FN2A 2MEKA 2QC8A 3BYTB 4XZ4A 4BFRA 4BAXA 2MHJA 2K25A 2BQQA 2G1EA 3ZO5B 2KAJA 3DCGA 2E6XA 3DBHB 4KZ0A 3NZUA 2BBCA 3AEEB 3V6EB 1OQRA 2KN5A 4XYCA 1K53A 3WCQA 4BZAA 2KVRA 4GMVA 1JWAD 4B0EA 1H4RA 3RFZB 2SAKA 4P1CC 5G55A 3DBSA 2KMMA 1BUIC 2Q5WD 3RNEC 1KLUD 1N60A 2JX5A 1BT0A 2L8JA 2V4IB 4HDOA 5IAAC 4ZYSA 3WAPA 4L23A 5MPOA 1V80A 2KWUB 4IWPA 2DHZA 5EDSA 4TMAB 4GIVA 1ZDXA 1WJUA 1OQYA 2N9XA 1L6VA 4USAA 3VRBB 1P0RA 2Y5CA 3WALA 1JWUD 4HJGE 2EELA 4O1NA 5DPSA 1I7HA 1V6EA 3QQ8B 2WX1A 2KJHB 2H88B 2VZKB 2JVCA 5LXIB 2MP2A 3I5JC 4LK0M 3AE7B 1UUPA 4HXDA 4M0WB 2KDBA 3PGEA 1FEHA 4CYEA 1MVKA 1ZXHA 4KZCA 1F0ZA 4IM0A 3ML9A 1AARA 1UGMA 3SHQA 3ZDMC 2WXPA 4A90A 1OTRB 4OVVA 4MACA 3KUDB 3R3MA 1WJNA 1RYJA 3N1ZC 1E8ZA 5GXGB 3KVFB 2V9HA 2BS3B 2IGGA 2MBHA 3R7QA 1GOZA 1XCQL 3QHTA 3B2FA 3H6NA 2FIDA 4WQOB 2DX5B 1C3TA 2Z0DB 3Q3OC 2OHFA 1TIFA 3Q8EA 2JRIB 2WXRA 3IVFA 3TL5A 3RD2A 1JRUA 3TEXA 3UQBA 2V3NA 2ZPYA 2LVOA 4I6NB 4HKZE 2QJLA 1NBFC 4TKNA 5AZHA 4L1BA 1L6UA 1J7CA 1P9DU 4WH4A 3DHGC 2LWPA 1WI0A 5JHBA 2KJ6A 4C4VA 4N9F4 3Q3NC 2MBBB 5KHOA 4UDUC 1C78A 1XLNA 3N9YC 2LGXA 2NS5A 1SF0A 1LQBA 2Z59B 1IBXB 3HM3A 2D3GA 2YLMA 4CQNA 2WXKA 3S2AA 4P7IA 2MSED 3RN9C 4BBNC 3AEGB 4AJWA 3A1QA 1MHXA 4II2B 2ZEQA 1WJ6A 4HWIB 2BYFA 4HDQA 4P1BC 4ZRQA 3DHIC 1V9JA 3RPFC 1RFKA 1UD7A 2INNE 1R7SA 4A8XC 4LNIA 3TUOA 4EEWA 2LUEA 2V3SA 4ICVA 3HM6X 3QJZA 3Q3FA 1AYFA 3L4PA 2G45B 2DYBA 3PREA 2L83A 1XD3B 1FM0D 1ZDVA 3ONSA 2WXIA 1WMHA 4IWQA 4WJOA 2MBQA 1E5WA 1ZPSA 3UI3A 5JXVA 3PTFC 5EE3A 2JZZA 1KJTA 4K1RB 3A4SC 2D3AA 1G6JA 3U8ZA 4EZLA 1RWSA 1QLBB 4N59A 3N30A 3AE6B 1C9FA 3QCAA 3NVYA 3R2IA 2EMSA 2JRHA 3QC8B 2IGHA 1HXYD 3DVNV 4JWUC 4B0MA 1J19A 2E3TA 2J4XA 1L4DB 3VRAB 1WXSA 2LGDA 4ZRIA 4WWNA 1WRDB 3KLSX 3TEYA 3H7PB 2L00B 1FNWA 4GDKA 2G9HD 3ZRFA 5D3DA 2ZNVC 3BIID 2CS4A 2IBIB 4MGZE 3DBLI 2KC2A 2L1AA 2M4NA 1WGGA 4MT5A 1YMHE 3LDZE 3AE9B 2WDTB 3K9PB 3DWGC 3L13A 2KNBA 1OQQA 3HRDD 2KFJA 2I1JA 2LEKA 2FCQA 2NVUI 3MTNB 3DWMA 3KWVA 1NENB 4NQLB 1KFYB 1PDXA 2Y5BB 4G11A 1WX7A 1HZ5A 4FJZA 3UQAA 4XWTA 3AXCA 2KANA 1TKYA 3UINB 5FR3A 1WX9A 2ACZB 2M0XA 1V86A 2RDBC 4S17A 2FBWB 2K8HA 2LVQA 1WYGA 1IUEA 2WXOA 3P2BA 4ZDVA 3NJTA 1PFDA 4K7WA 5L95C 1MG4A 2AX5A 1KTKA 4TQ0A 3ZW3A 3C19A 5LLIA 3PLVA 5D7GA 4BKSD 4MSQB 3RZFA 2NBVB 4IDIA 4IUMB 1MG8A 4RH6A 2XN9C 2W3RA 3BVGA 3NVWA 4W9DA 1J7BA 3A1QB 3ZTCA 2GBNA 4M02A 1WGKA 1WGRA 3BWUD 3H9DA 3N1XC 3DVNU 4ANWA 5CHWA 1JMLA 1KOTA 4TUUA 3EECA 2WXNA 3Q69A 2VRRB 1B9RA 3Q8BA 1B1ZA 2KC1A 1EO6A 1WE7A 2KOXA 2KWDA 1VCBA 2WDQB 1FIQA 3PZ8A 1WM2A 3EHVA 4B95A 2WXFA 5JH5C 3AEFB 2LGYA 4TSSA 1SIJA 2O6VD 3AEDB 3AV8A 3DBHI 3R66C 3N32A 4BKGA 3T9LA 1K8RB 5D6JB 3VVWB 2BS2B 1GB1A 2BWES 3BK1A 3ZTDA 1M4VA 2WXGA 2I1KA 2KO3A 3RNBC 4X57B 1CZPA 2B3AA 2K39A 4C56C 3R2TA 5BMIA 1TGZB 4HLEA 3SU8X 4MM3A 4YTPB 3PT2B 2IDYA 2WU2B 4GSWA 3DOWA 5J2RA 4IW0A 1IBXA 1RAXA 3M3JA 2LFIA 1PYWD 3VUYA 2AEHA 2OOBB 1R4MI 2HE7A 4HPPA 2WS3B 1SE3A 2J0JA 2KT7A 2LHDA 4W9CA 3GS2A 1FNVA 2GI9A 2NBUA 2RGFA 1OFFA 3X0WA 4E71A 3EGRA 4M8MA 2YEPF 4AS1A 4KGSA 2MJDA 3HHMA 2C7HA 1L0YB 1P7FA 2WXMA 2L76A 3KWLA 1ZP0B 4LNFA 2MX2A 4GDLA 3AE2B 1V1PB 3GZNB 3GB1A 3HIZA 4HVBA 2IJ0A 4K81A 3PHXB 2ICIA 2HTHA 4RF0A 3U4EG 4E3CA 2WXHA
chains in the Genus database with same CATH topology
2INDC 3DHGC 3RN9C 3RNCC 1T0RC 4P1CC 3RNAC 3I63C 2INCC 3N1ZC 3RNEC 3Q3OC 3RMKC 3RNGC 3Q3MC 3Q3NC 3DHHC 1T0QC 3N20C 3RI7C 4P1BC 3RNFC 3GE8C 3DHIC 1T0SC 3RNBC 3N1YC 3Q14C 3Q2AC 3GE3C 3N1XC 3I5JC 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IND C;  3DHG C;  3RN9 C;  3RNC C;  1T0R C;  4P1C C;  3RNA C;  3I63 C;  2INC C;  3N1Z C;  3RNE C;  3Q3O C;  3RMK C;  3RNG C;  3Q3M C;  3Q3N C;  3DHH C;  1T0Q C;  3N20 C;  3RI7 C;  4P1B C;  3RNF C;  3GE8 C;  3DHI C;  1T0S C;  3RNB C;  3N1Y C;  3Q14 C;  3Q2A C;  3GE3 C;  3N1X C;  3I5J C;  2RDB C; 
#chains in the Genus database with same CATH topology
 5LNK 1;  2AQ1 B;  5C1Z A;  3ZKJ C;  3ENE A;  3U7D A;  4DDI D;  1FMA D;  3P4R B;  4J6I A;  1K51 A;  1T0Y A;  1ISN A;  1QT9 A;  2TSS A;  4BBN F;  3TMP B;  3T3O A;  3N1Y C;  2WDR B;  2RMM A;  4ANV A;  2AL6 A;  1F77 A;  2OED A;  3OJ4 B;  2XEW A;  2EKI A;  1IGD A;  2NBW B;  2L7R A;  1RLF A;  4REZ A;  2IGD A;  5IKC M;  3AN1 A;  3SDL C;  1FXT B;  1WE6 A;  1YQ4 B;  1IGC A;  1OEY J;  2MLB A;  1RRB A;  1TT5 B;  2FIF A;  1UF0 A;  2KWC A;  1GC7 A;  1TZO A;  2L0T A;  4JX1 C;  1NI2 A;  1EF1 A;  2J42 A;  3LXF A;  2DBY A;  2WGS A;  5IOI A;  4WJP A;  2CHX A;  3VHT C;  2WX0 A;  3V60 A;  1TZ1 A;  1ZUD 2;  3OG5 A;  4HCN B;  1UWX A;  2XK5 A;  1UEL A;  2PLP A;  1HQR D;  1KM7 A;  4XGA B;  5BO4 B;  4EE2 A;  2OJW A;  2N9K A;  1WZ3 A;  2BB5 A;  3BIN A;  1IP9 A;  3ZJU A;  4OW0 A;  4MGI E;  3Q8C A;  1E90 A;  5LXH A;  1CMX B;  3I63 C;  1FD6 A;  1ENF A;  1N5X A;  5EE9 A;  4M0W A;  3LJ3 A;  3APF A;  3AI5 A;  1FFV A;  2JUO A;  3GZN I;  4G3X B;  5HHD G;  2M1M A;  2LRW A;  2CJN A;  4FHJ A;  4JL9 A;  2KDF B;  1I4Q A;  2HJ1 A;  2L52 A;  3O65 B;  2QMT A;  3VTW A;  4KSK C;  2N9P C;  1I4R A;  1QOG A;  1WYW B;  1DOI A;  2UYZ B;  4ICU A;  3W5V B;  4NJ7 A;  1QKZ A;  3B9J A;  2HJ8 A;  1E7P B;  1JWS D;  1WF9 A;  1J7A A;  2QEJ C;  3APC A;  1BXT A;  1WR1 A;  3ZNZ B;  3MHS D;  5FKA C;  1D4B A;  3SEB A;  2BWF A;  4WJN A;  3VUW A;  2BPS A;  3ZVV A;  4A3O A;  2KMC A;  4JPS A;  1SE9 A;  4PS3 A;  3P4P B;  3O13 A;  3T3N A;  2DNF A;  2GOW A;  2MJE A;  4KV2 A;  1RFA A;  1V8C A;  3TSS A;  1T0R C;  4JGH B;  3ECI A;  5T8I A;  1OGW A;  2DZM A;  1TS2 A;  3RNG C;  4GOC A;  2CU1 A;  1TJE A;  3IHP C;  3P1M A;  4DDG D;  2BT6 A;  1SIF A;  3RNF C;  1YOV B;  2KDM A;  1E7V A;  2K0P A;  5G2N A;  4AOF A;  4WAA A;  2I38 A;  2IO1 B;  2IZV B;  3U30 A;  4F7Z A;  3CST A;  3CWI A;  3NS8 A;  2FCM A;  2IY1 B;  2J0M A;  4ARI A;  1XEE A;  5J18 A;  3ML8 A;  4QAY A;  1IYF A;  4IM2 A;  2JU6 X;  2FCN A;  2HDE A;  4EUT A;  5E6P A;  4EZJ A;  2JPH A;  1GB4 A;  1S3S G;  2KXJ A;  3ZRC A;  3BVM A;  4LNK A;  3W9C B;  2KHW B;  3IG3 A;  2IND C;  4BKT A;  4MH0 E;  2G3Q B;  2D5G A;  2GLS A;  1D5M C;  3SFD B;  2N4F A;  1KLG D;  1HZ6 A;  1UBI A;  1JQ4 A;  3R7R A;  3UF8 A;  1XQQ A;  2N7D A;  2GBM A;  3ZNI D;  3W1Y A;  2HTM E;  3TCA A;  2JXX A;  3NG0 A;  2MJ3 A;  2KFK A;  2Y3A A;  2J52 A;  3VTU A;  3ZXV A;  4MGY E;  2QCZ A;  1YD8 U;  3E9S A;  3M62 B;  4ZHP A;  3NY5 A;  5BMH A;  2KFK B;  2ZCB A;  2KDI A;  2Z0E B;  2NTT A;  2PEA A;  1WGY A;  1VJK A;  2EMT A;  1TS5 A;  1XLQ A;  4KKJ A;  4NAW A;  1SE4 A;  1GAQ B;  4HKQ A;  2INP E;  4LCD E;  3KYC D;  1PGB A;  2LJ5 A;  3OAW A;  3A33 B;  4LJO B;  2GMI C;  3IFW B;  2LGS A;  1LXD A;  2GBR A;  2EKE C;  3RMK C;  3U52 E;  2KJR A;  3MFG A;  4W9E A;  4YSZ B;  4CO7 A;  3WAO A;  1XCT L;  3EFC A;  1R4N I;  3UGB B;  3NUH B;  2W9N A;  4JIO U;  3R8B A;  1RM6 C;  2KX0 A;  3DBL B;  4RFB A;  1TKG A;  3PRP B;  2N9E B;  2KK8 A;  2K3U A;  5DCN A;  2ZNV B;  1YQB A;  4KSL C;  3C0R B;  2Z8L A;  2XNA C;  3JYU A;  4TQ1 A;  2IO3 B;  4MSM B;  4A3P A;  4WAF A;  2ON8 A;  3PRZ A;  2A5U A;  3RCZ A;  1MI0 A;  3CSF A;  1WXV A;  3TJP A;  2UWQ A;  4LNN A;  3VDZ A;  1F52 A;  3IXS A;  1HTO A;  3SD5 A;  1I4G A;  2RPQ A;  1P1A A;  1U4A A;  4K7U A;  1C79 A;  5I4D A;  3ZNG C;  1VZ8 A;  1DGJ A;  2M19 A;  3BZD B;  4IWO A;  1FRD A;  2WHI A;  3DDC B;  4LNO A;  4OVZ A;  1DOX A;  1Q0W B;  3AEC B;  2FE8 A;  2YVC A;  4HK2 A;  3FAH A;  4XWW A;  4HCP B;  4NNJ B;  3PLU A;  2K5P A;  1KF6 B;  1TBE A;  3AE5 B;  3CF6 E;  4HPL B;  3FIL B;  2M56 B;  2W54 A;  2IO2 B;  2O6V A;  1SB3 C;  2RPV A;  1J8C A;  2CJO A;  4TV3 A;  3RUL A;  4MJS B;  1SBB B;  2DYO A;  1R4N B;  2DZJ A;  1D3Z A;  2M8S A;  1UZX B;  4A20 A;  3M63 B;  1YJI A;  3L16 A;  3PPA A;  3A9K B;  1XF5 L;  2RSU A;  3NOB A;  4JWS C;  3H7S A;  4F8C B;  1CK1 A;  4KIK B;  2GBK A;  1JRO A;  3AU5 A;  2D11 A;  2BW2 A;  3T8M A;  3VR9 B;  3KQ4 A;  1YJJ A;  3P42 A;  4DXA B;  1GUA B;  3HK0 A;  3HUI A;  4US8 A;  1EM7 A;  2QDF A;  1V2Y A;  4YTN B;  2WXQ A;  3VTV A;  5JZE B;  4DQO C;  5L83 A;  4IG7 B;  2WXJ A;  1V5O A;  1T5X D;  3AU4 A;  2BF8 B;  1TKE A;  4HRS A;  4W9K A;  2K6Q A;  1YIW A;  5H8Y E;  2GRI A;  3CIR B;  4FXC A;  1UNS A;  1WH3 A;  3ZYY X;  3U2S C;  3J9C A;  1MJD A;  4A6Q A;  1L0V B;  1D6E C;  4KX6 B;  2KWV B;  4G50 A;  4BVU C;  3B0A A;  2LMC A;  4I6P A;  4ARC A;  3MC0 B;  2KTF A;  2JZ3 B;  2PTL A;  2MRP A;  2AL3 A;  2KTR B;  2WWZ A;  4KIK A;  1AN8 A;  2G4D B;  2K22 A;  2KN4 A;  2CKH B;  4LDT D;  3ZNH B;  5BYQ A;  1N5W A;  1CQV A;  4AWJ A;  2FNJ B;  3A9K A;  1WY8 A;  3KH0 A;  4ZHO A;  2IYD B;  2L32 A;  3ZDT A;  2MP2 B;  3FKY A;  2PPH A;  2PE6 B;  5AUI A;  2IY0 B;  1D5X C;  4W9F A;  1GNU A;  2LVP A;  2BYT A;  1S1Q B;  3JSV A;  3ZQ4 A;  3RI7 C;  1YX5 B;  4DXF A;  1AW7 A;  1QF6 A;  3I9V 1;  1EUV B;  2NR2 A;  1E8W A;  3QA8 A;  5KHQ A;  1P3Q U;  2PVO D;  1L0X B;  4N58 A;  5D3I B;  2K1F A;  2BYE A;  3NZS A;  1FRR A;  1ZOY B;  2DLB A;  5FR6 A;  4XDC A;  3TEZ A;  4KKI A;  1ZE3 D;  1LFD A;  3PV1 A;  1FXA A;  1SSN A;  5EE0 A;  2C5L C;  4M8N A;  3NHE B;  3V05 A;  1VZ6 A;  2Y5P A;  1PGX A;  1ZW7 A;  2ZZP B;  1E7U A;  2XBB C;  4YTM B;  4DHJ B;  4RM9 A;  3WAN A;  2NCN A;  3VH4 B;  3DVG Y;  1YN4 A;  4YWG G;  3IBE A;  4XE0 A;  2BKR B;  4AQ7 A;  4P6V F;  2VH2 A;  2DAJ A;  3HVD A;  1MHH E;  3MC9 A;  2A4Z A;  3VH3 B;  3VFK A;  2KQ7 A;  4K3C A;  2L3Z A;  3C8Y A;  1GPX A;  1L5P A;  5C23 A;  4WWM A;  3DQV A;  1FPY A;  2CU3 A;  2NTS A;  2BYV E;  2PE9 A;  2MH7 A;  2IO0 B;  2L0F A;  5C2T B;  4GLS C;  4E74 A;  2N1V A;  2BS4 B;  4K3B A;  1QZE A;  1LM8 B;  3GOE A;  4WQM A;  2PW9 A;  5GMV A;  2M17 A;  3PZD A;  4FHK A;  4KGR A;  1T0Q C;  5DPT A;  4HPM B;  4GB9 A;  4NAM A;  4DXG A;  3FIL A;  3IT4 B;  4FLH A;  4OHJ A;  2JWU A;  5BYS A;  4RGM A;  2DYM A;  3GP7 A;  3QX1 A;  1HE8 A;  2PMV A;  2INC C;  3QAR A;  1JCK B;  2NPT A;  4HEA 1;  4K7S A;  4NAW B;  2V1Y A;  3AE8 B;  3ZJT A;  1FCL A;  3A9J A;  4N6E B;  1ROE A;  1I42 A;  1FNU A;  1E0Z A;  4CHK A;  4DHJ D;  1QOB A;  4GGQ A;  3ETR A;  5E6J A;  2FUH B;  4PK1 A;  3Q14 C;  4LDT B;  4XC2 A;  2BGF A;  4NY0 A;  3DBR I;  3L0W B;  4NQK E;  1TY2 A;  3WIM A;  1WGH A;  1Z2M A;  3AE3 B;  3SR6 A;  3V6C B;  4D2K A;  1FO4 A;  1KRH A;  2V3P A;  2PKO A;  4RGN A;  4EOY A;  2BTE A;  3JW0 X;  3NRZ A;  1H8C A;  1I4H A;  2BB6 A;  1F2R I;  2QIE B;  2LJI A;  5D94 A;  4LTU A;  4S0R A;  4C7Z A;  3Q3M C;  4RCO A;  1SJE D;  3W1S C;  2REX A;  1V81 A;  4XX5 A;  5AEK B;  2WXL A;  4PYZ A;  2LHE A;  3WAM A;  2DZI A;  2VH1 A;  1T3Q A;  4W9I A;  1L2N A;  4DBG A;  2QIL A;  1V97 A;  1SGH A;  2AQ3 B;  3RNC C;  4KDI C;  1YN3 A;  4OZC A;  4AUQ C;  5IA7 A;  2OJR A;  1SXT A;  4JE3 B;  1EWY C;  1OEY A;  2JSV X;  3ABV B;  1JW9 D;  1TTN A;  3DHH C;  3JVZ X;  1DYQ A;  2SEB D;  3QK0 A;  3Q8F A;  1YX6 B;  2W3S A;  2FCS A;  3H8H A;  3P4Q B;  2J7Q B;  1HA5 A;  1STE A;  1QQR A;  1C4P A;  2VZK D;  3KUC B;  4FJV B;  5TR5 A;  4NJC A;  3V62 A;  2QHO A;  4RGT A;  3LYY A;  2CHW A;  1XLO A;  3IAS 1;  2DZK A;  1K50 A;  5H92 C;  1XLP A;  1SJH D;  3N20 C;  1UBQ A;  4W9H A;  2NMQ A;  2BKF A;  5C3J B;  3VAW A;  2C9W B;  3EC8 A;  4ASW C;  2D07 B;  1N62 A;  2N9L A;  1LGR A;  3I3T B;  4MEL A;  1CJE A;  3PRM B;  3MJ5 A;  1V1O A;  3EFU A;  3P63 A;  3EUB 2;  1PQS A;  2KZR A;  3VR8 B;  3V3X A;  1N63 A;  3AEA B;  2RD0 A;  4RGO S;  4RM8 A;  3MHZ A;  3VXW A;  4MGK E;  2UU7 A;  3WA0 A;  4MH8 A;  5D2M B;  5AUK A;  4HRO A;  3E56 A;  1PGA A;  2KQS A;  1WRI A;  1UGJ A;  3TIX A;  2KYW A;  4B6W A;  3FC4 A;  3GE3 C;  4ITK A;  5CTR C;  2J53 A;  1MPE A;  3CMM B;  4KGT A;  4ACF A;  3VQI A;  1QOF A;  3RNA C;  4WJQ A;  1EU4 A;  3B1L X;  2RDG A;  2AWT A;  1FCC C;  2KVZ A;  1XT9 B;  3AUL A;  3PZ7 A;  2PVG C;  4OZA A;  1Q5W B;  1TS4 A;  1F1H A;  1GJZ A;  3AM9 A;  3NZ3 A;  1SE2 A;  4FJY A;  2V0G A;  4LJP B;  2GBJ A;  1F9J A;  3L17 A;  1F2R C;  4M01 A;  4MDK E;  2ZVN A;  2O2V B;  5CHV C;  2XK5 B;  4GXB A;  1NYQ A;  3PSE B;  4ZRK A;  4B9K A;  5HKH A;  4ANX A;  3RT3 B;  4FUL A;  3ZXR A;  1WJ4 A;  3BVZ A;  3QAQ A;  5IN7 A;  3Q2A C;  4KVG B;  2GB1 A;  4Q2J A;  4US9 A;  2PJH A;  4NPN A;  1C4A A;  1AWD A;  1WSP A;  2X8X X;  4XDD A;  1YN5 A;  2ZVO A;  4R3D A;  5IO9 A;  4YSX B;  1N61 A;  1GC6 A;  2MCN B;  2AQ2 B;  2JYE A;  3W2D A;  1WWT A;  1VRA B;  4EFO A;  3MJW A;  1I4X A;  2JY6 A;  4GN1 A;  2N1W A;  2N7E A;  1JWM D;  1V1P A;  2D3C A;  2FAZ A;  2MBO A;  3UIP B;  4F1S A;  1ET6 A;  3Q8A A;  5EE1 A;  2WU5 B;  4YL8 A;  2KMA A;  2ASQ A;  2WNM A;  3OWE B;  4RMA A;  1SEB D;  3TBL D;  5AZG A;  1Q1O A;  4FA6 A;  1BML C;  3LB8 C;  4ZOH C;  3BYY B;  2LRU A;  1X1M A;  4NJ6 A;  2WQY B;  4YSY B;  5HG2 A;  1IPG A;  2I2Y A;  3M95 A;  3JSV B;  5HI1 A;  1C77 A;  2CHZ A;  2ZPN A;  5BYR A;  1ZKH A;  1E9M A;  3OLM D;  3L54 A;  4MJS A;  1V49 A;  2MWS B;  3NVZ A;  1QOA A;  4LLG M;  1Z5S B;  1HTQ A;  1A70 A;  2WLB A;  4J3O D;  4JQW C;  5DPW A;  1LO5 D;  2C7N B;  2X38 A;  2KTR A;  1NVI D;  1ESF A;  3PS6 A;  4WIP A;  2K8C A;  4YT0 B;  4C00 A;  1MFW A;  2LXC A;  2RR9 A;  4PS8 A;  4BKS A;  1J0G A;  4WWO A;  1WM3 A;  3RYT A;  1WXM A;  1ZXI A;  1KH0 A;  1JAL A;  2O2V A;  1GG3 A;  4PS7 A;  2LZ6 A;  5HFY A;  3QWZ B;  2QSD A;  1Q10 A;  4W9G A;  4MM3 B;  4G0N B;  2H89 B;  3QIJ A;  4PT5 A;  2WP9 B;  1NYR A;  2FUG 1;  5IP4 D;  2N0S B;  1E6E B;  2K9X A;  3URY A;  3B08 A;  4RNA A;  2M0A A;  1XXG A;  1TYG B;  4H2A A;  2WDV B;  1TY0 A;  4I6L B;  4GDL B;  4AP4 C;  1N6Z A;  4W9J A;  1E8Y A;  2W82 A;  4YXD B;  5FK9 C;  2B76 B;  3AH7 A;  2V4L A;  2KQ4 X;  1T0S C;  1K52 A;  4WUR A;  3H1U A;  2ZW1 A;  1C1Y B;  3K9O B;  5JHA A;  1WIA A;  3AE1 B;  4IM3 A;  1YNT E;  2R2Q A;  3A4R A;  3P4S B;  3IAM 1;  3ALB A;  4KDL B;  3AEB B;  2RDH A;  1JWB D;  2W55 A;  2ZW0 A;  3N3K B;  2O6V B;  3KUZ A;  4ZRP A;  4M00 A;  1EWC A;  4JLC A;  5J17 A;  3L10 B;  3RUI B;  2MQJ A;  3MP9 A;  3I57 A;  2BVC A;  2LUM A;  4AJY B;  1YJ1 A;  2JT4 B;  3ZJV A;  2JYT A;  3PHW B;  2K6D B;  4FBJ B;  2JF5 A;  1YQ3 B;  3IT6 B;  5G5G A;  4DHZ E;  2KDE B;  4ZYN A;  3EA6 A;  4RF1 A;  1WXA A;  2LD9 A;  3ZUN A;  3Q3J A;  4IC7 B;  1PUT A;  1ACC A;  2D3B A;  3X23 A;  4MEM A;  2ZCC A;  3APD A;  4ANU A;  3DVG X;  1HEZ E;  2J0K A;  1NEK B;  2C7M B;  4HJK A;  2KKC A;  2PIA A;  4PYU A;  5TSS A;  3SFE B;  3BK2 A;  1C76 A;  1L4Z B;  4GU2 A;  2DAF A;  1JRP A;  3H7P A;  2HD5 B;  4DK5 A;  3PVL A;  4EZK A;  5E6N A;  5BMG A;  4DHZ B;  2IPK D;  2MA9 B;  4URK A;  1WZ0 A;  1DOY A;  1M94 A;  1Y8R C;  1UWM A;  1V5T A;  1E10 A;  4OZB A;  4L2Y A;  2G4S A;  5CHF A;  4FAD A;  2JQR B;  4C7Y A;  2YEP B;  1L7Y A;  1UH6 A;  1T6B X;  1WMH B;  4GDK B;  3MC8 A;  3W5U B;  1EF5 A;  1P98 A;  1P7E A;  1VDV A;  1NDD A;  2N7J A;  1I35 A;  1XO3 A;  1Y56 A;  3OJ3 A;  3TEW A;  3ZLZ A;  2KLC A;  3D32 A;  3KYD D;  1A5R A;  2JXT A;  4IOI E;  4BOZ B;  4A55 A;  1FXI A;  2L05 A;  4II3 B;  3NVV A;  2LXA A;  2KLG A;  3Q6B A;  3L08 A;  1VLB A;  4P16 A;  1R4M B;  3ZGZ A;  2LGI A;  3VUX A;  1I4P A;  5AZF A;  4BOS C;  2KAC A;  3UIO B;  3GE8 C;  2D10 A;  3DBR B;  2DWQ A;  1D5Z C;  2ZJD A;  3PO0 A;  2LAS A;  4WWP A;  3A9J B;  1WR6 E;  2ONQ A;  2R2O A;  1TS3 A;  4IKG A;  2NPT B;  3U7Z A;  2MW5 A;  2MBE A;  3ZIM A;  2KX3 A;  1WGD A;  1WXQ A;  1VD2 A;  1C4C A;  3BY4 B;  3KW5 B;  3V61 A;  1NI3 A;  1WX8 A;  4ZRJ A;  5E6O A;  5CX3 A;  3RZW C;  3HVZ A;  4OVU A;  1WFY A;  1ZGU B;  4DWF A;  2K8B A;  2KD0 A;  2WYQ A;  1QIL A;  2AYO B;  2LI5 A;  1ET9 A;  4EKU A;  3AMZ A;  4A9A A;  2D2Q A;  2JZP A;  3AE4 B;  2JWZ A;  2CR5 A;  1VR9 A;  5DPR A;  1KLV A;  3AB5 A;  2R61 A;  4W9L A;  1FFU A;  1VZ7 A;  3NS1 A;  4C80 A;  3DPD A;  3B2G A;  5G5H A;  3W1S A;  4NZL B;  1EU3 A;  2C60 A;  1E8X A;  4C4V B;  2DEN B;  4FN2 A;  2MEK A;  2QC8 A;  3BYT B;  4XZ4 A;  4BFR A;  4BAX A;  2MHJ A;  2K25 A;  2BQQ A;  2G1E A;  3ZO5 B;  2KAJ A;  3DCG A;  2E6X A;  3DBH B;  4KZ0 A;  3NZU A;  2BBC A;  3AEE B;  3V6E B;  1OQR A;  2KN5 A;  4XYC A;  1K53 A;  3WCQ A;  4BZA A;  2KVR A;  4GMV A;  1JWA D;  4B0E A;  1H4R A;  3RFZ B;  2SAK A;  4P1C C;  5G55 A;  3DBS A;  2KMM A;  1BUI C;  2Q5W D;  3RNE C;  1KLU D;  1N60 A;  2JX5 A;  1BT0 A;  2L8J A;  2V4I B;  4HDO A;  5IAA C;  4ZYS A;  3WAP A;  4L23 A;  5MPO A;  1V80 A;  2KWU B;  4IWP A;  2DHZ A;  5EDS A;  4TMA B;  4GIV A;  1ZDX A;  1WJU A;  1OQY A;  2N9X A;  1L6V A;  4USA A;  3VRB B;  1P0R A;  2Y5C A;  3WAL A;  1JWU D;  4HJG E;  2EEL A;  4O1N A;  5DPS A;  1I7H A;  1V6E A;  3QQ8 B;  2WX1 A;  2KJH B;  2H88 B;  2VZK B;  2JVC A;  5LXI B;  2MP2 A;  3I5J C;  4LK0 M;  3AE7 B;  1UUP A;  4HXD A;  4M0W B;  2KDB A;  3PGE A;  1FEH A;  4CYE A;  1MVK A;  1ZXH A;  4KZC A;  1F0Z A;  4IM0 A;  3ML9 A;  1AAR A;  1UGM A;  3SHQ A;  3ZDM C;  2WXP A;  4A90 A;  1OTR B;  4OVV A;  4MAC A;  3KUD B;  3R3M A;  1WJN A;  1RYJ A;  3N1Z C;  1E8Z A;  5GXG B;  3KVF B;  2V9H A;  2BS3 B;  2IGG A;  2MBH A;  3R7Q A;  1GOZ A;  1XCQ L;  3QHT A;  3B2F A;  3H6N A;  2FID A;  4WQO B;  2DX5 B;  1C3T A;  2Z0D B;  3Q3O C;  2OHF A;  1TIF A;  3Q8E A;  2JRI B;  2WXR A;  3IVF A;  3TL5 A;  3RD2 A;  1JRU A;  3TEX A;  3UQB A;  2V3N A;  2ZPY A;  2LVO A;  4I6N B;  4HKZ E;  2QJL A;  1NBF C;  4TKN A;  5AZH A;  4L1B A;  1L6U A;  1J7C A;  1P9D U;  4WH4 A;  3DHG C;  2LWP A;  1WI0 A;  5JHB A;  2KJ6 A;  4C4V A;  4N9F 4;  3Q3N C;  2MBB B;  5KHO A;  4UDU C;  1C78 A;  1XLN A;  3N9Y C;  2LGX A;  2NS5 A;  1SF0 A;  1LQB A;  2Z59 B;  1IBX B;  3HM3 A;  2D3G A;  2YLM A;  4CQN A;  2WXK A;  3S2A A;  4P7I A;  2MSE D;  3RN9 C;  4BBN C;  3AEG B;  4AJW A;  3A1Q A;  1MHX A;  4II2 B;  2ZEQ A;  1WJ6 A;  4HWI B;  2BYF A;  4HDQ A;  4P1B C;  4ZRQ A;  3DHI C;  1V9J A;  3RPF C;  1RFK A;  1UD7 A;  2INN E;  1R7S A;  4A8X C;  4LNI A;  3TUO A;  4EEW A;  2LUE A;  2V3S A;  4ICV A;  3HM6 X;  3QJZ A;  3Q3F A;  1AYF A;  3L4P A;  2G45 B;  2DYB A;  3PRE A;  2L83 A;  1XD3 B;  1FM0 D;  1ZDV A;  3ONS A;  2WXI A;  1WMH A;  4IWQ A;  4WJO A;  2MBQ A;  1E5W A;  1ZPS A;  3UI3 A;  5JXV A;  3PTF C;  5EE3 A;  2JZZ A;  1KJT A;  4K1R B;  3A4S C;  2D3A A;  1G6J A;  3U8Z A;  4EZL A;  1RWS A;  1QLB B;  4N59 A;  3N30 A;  3AE6 B;  1C9F A;  3QCA A;  3NVY A;  3R2I A;  2EMS A;  2JRH A;  3QC8 B;  2IGH A;  1HXY D;  3DVN V;  4JWU C;  4B0M A;  1J19 A;  2E3T A;  2J4X A;  1L4D B;  3VRA B;  1WXS A;  2LGD A;  4ZRI A;  4WWN A;  1WRD B;  3KLS X;  3TEY A;  3H7P B;  2L00 B;  1FNW A;  4GDK A;  2G9H D;  3ZRF A;  5D3D A;  2ZNV C;  3BII D;  2CS4 A;  2IBI B;  4MGZ E;  3DBL I;  2KC2 A;  2L1A A;  2M4N A;  1WGG A;  4MT5 A;  1YMH E;  3LDZ E;  3AE9 B;  2WDT B;  3K9P B;  3DWG C;  3L13 A;  2KNB A;  1OQQ A;  3HRD D;  2KFJ A;  2I1J A;  2LEK A;  2FCQ A;  2NVU I;  3MTN B;  3DWM A;  3KWV A;  1NEN B;  4NQL B;  1KFY B;  1PDX A;  2Y5B B;  4G11 A;  1WX7 A;  1HZ5 A;  4FJZ A;  3UQA A;  4XWT A;  3AXC A;  2KAN A;  1TKY A;  3UIN B;  5FR3 A;  1WX9 A;  2ACZ B;  2M0X A;  1V86 A;  2RDB C;  4S17 A;  2FBW B;  2K8H A;  2LVQ A;  1WYG A;  1IUE A;  2WXO A;  3P2B A;  4ZDV A;  3NJT A;  1PFD A;  4K7W A;  5L95 C;  1MG4 A;  2AX5 A;  1KTK A;  4TQ0 A;  3ZW3 A;  3C19 A;  5LLI A;  3PLV A;  5D7G A;  4BKS D;  4MSQ B;  3RZF A;  2NBV B;  4IDI A;  4IUM B;  1MG8 A;  4RH6 A;  2XN9 C;  2W3R A;  3BVG A;  3NVW A;  4W9D A;  1J7B A;  3A1Q B;  3ZTC A;  2GBN A;  4M02 A;  1WGK A;  1WGR A;  3BWU D;  3H9D A;  3N1X C;  3DVN U;  4ANW A;  5CHW A;  1JML A;  1KOT A;  4TUU A;  3EEC A;  2WXN A;  3Q69 A;  2VRR B;  1B9R A;  3Q8B A;  1B1Z A;  2KC1 A;  1EO6 A;  1WE7 A;  2KOX A;  2KWD A;  1VCB A;  2WDQ B;  1FIQ A;  3PZ8 A;  1WM2 A;  3EHV A;  4B95 A;  2WXF A;  5JH5 C;  3AEF B;  2LGY A;  4TSS A;  1SIJ A;  2O6V D;  3AED B;  3AV8 A;  3DBH I;  3R66 C;  3N32 A;  4BKG A;  3T9L A;  1K8R B;  5D6J B;  3VVW B;  2BS2 B;  1GB1 A;  2BWE S;  3BK1 A;  3ZTD A;  1M4V A;  2WXG A;  2I1K A;  2KO3 A;  3RNB C;  4X57 B;  1CZP A;  2B3A A;  2K39 A;  4C56 C;  3R2T A;  5BMI A;  1TGZ B;  4HLE A;  3SU8 X;  4MM3 A;  4YTP B;  3PT2 B;  2IDY A;  2WU2 B;  4GSW A;  3DOW A;  5J2R A;  4IW0 A;  1IBX A;  1RAX A;  3M3J A;  2LFI A;  1PYW D;  3VUY A;  2AEH A;  2OOB B;  1R4M I;  2HE7 A;  4HPP A;  2WS3 B;  1SE3 A;  2J0J A;  2KT7 A;  2LHD A;  4W9C A;  3GS2 A;  1FNV A;  2GI9 A;  2NBU A;  2RGF A;  1OFF A;  3X0W A;  4E71 A;  3EGR A;  4M8M A;  2YEP F;  4AS1 A;  4KGS A;  2MJD A;  3HHM A;  2C7H A;  1L0Y B;  1P7F A;  2WXM A;  2L76 A;  3KWL A;  1ZP0 B;  4LNF A;  2MX2 A;  4GDL A;  3AE2 B;  1V1P B;  3GZN B;  3GB1 A;  3HIZ A;  4HVB A;  2IJ0 A;  4K81 A;  3PHX B;  2ICI A;  2HTH A;  4RF0 A;  3U4E G;  4E3C A;  2WXH A; 
#chains in the Genus database with same CATH homology
 2IND C;  3DHG C;  3RN9 C;  3RNC C;  1T0R C;  4P1C C;  3RNA C;  3I63 C;  2INC C;  3N1Z C;  3RNE C;  3Q3O C;  3RMK C;  3RNG C;  3Q3M C;  3Q3N C;  3DHH C;  1T0Q C;  3N20 C;  3RI7 C;  4P1B C;  3RNF C;  3GE8 C;  3DHI C;  1T0S C;  3RNB C;  3N1Y C;  3Q14 C;  3Q2A C;  3GE3 C;  3N1X C;  3I5J C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...