2INDC

Mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit
publication title X-ray crystal structures of manganese(II)-reconstituted and native toluene/o-xylene monooxygenase hydroxylase reveal rotamer shifts in conserved residues and an enhanced view of the protein interior.
pubmed doi rcsb
source organism Pseudomonas stutzeri
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2indC00
3N1XC 3RMKC 3Q2AC 4P1BC 3N1YC 3DHGC 3I5JC 1T0RC 3Q3NC 3RNAC 3Q3MC 4P1CC 2INDC 1T0QC 3RNBC 3RNGC 3RNEC 2RDBC 3RNCC 2INCC 3DHHC 3RN9C 3N1ZC 3RI7C 3GE8C 3GE3C 3N20C 1T0SC 3I63C 3Q3OC 3Q14C 3RNFC 3DHIC
chains in the Genus database with same CATH superfamily
5GXGB 2XK5B 2Y5BB 1KM7A 2LGIA 2MWSB 2JRIB 1UGJA 2ON8A 5D3IB 3ZKJC 2XK5A 3GOEA 1P7EA 3U7DA 3BZDB 3TSSA 4BKTA 1TKYA 1J7AA 1IP9A 3UF8A 4KVGB 2I38A 2M4NA 3U52E 3AEBB 4RCOA 2KWDA 1LM8B 2OJRA 2LVPA 2IO3B 4OHJA 4BOSC 3DVGX 4LK0M 3WA0A 2A5UA 4W9CA 4PT5A 1AW7A 1XEEA 2Z0DB 2MSED 3I3TB 1GPXA 1ZPSA 2PE9A 1UNSA 2OEDA 3APCA 4FHKA 1WXAA 4NY0A 4XE0A 1PDXA 3L54A 1E6EB 3R7RA 5IN7A 1DGJA 1E8XA 3DBLI 1QZEA 3ZTCA 2IYDB 4YSZB 1QILA 4XGAB 1L0YB 4BAXA 4W9DA 1K52A 3H8HA 2LXAA 4G11A 3W2DA 2VZKB 3O65B 1VCBA 2JUOA 2N1WA 3OWEB 2K3UA 3LXFA 1A5RA 3JYUA 2ZPYA 4HCPB 4W9HA 4DXAB 2ACZB 3GP7A 3SDLC 4KX6B 4MSMB 2Y3AA 3L10B 3MJWA 4PS7A 1WGHA 1I4HA 2MHJA 4PS8A 4IOIE 3OLMD 4KIKB 1KLUD 2VH1A 2VRRB 3P4SB 5LXIB 1NENB 2O2VA 1CK1A 1ZUD2 1WGGA 1R4MI 3SR6A 2EMTA 3O13A 2BYFA 1L0VB 2M0XA 2MJEA 3EC8A 1V81A 4HXDA 5G55A 3HUIA 1OEYJ 1XO3A 3P1MA 4HROA 5G5GA 4ITKA 4S17A 3ZNZB 1U4AA 4ZRQA 4GGQA 3WAMA 2K8CA 3K9OB 4HPPA 3VUWA 4WH4A 4XWWA 5HHDG 2K1FA 4N59A 3V62A 2XEWA 1C1YB 2KANA 2ZNVB 2LHEA 4LNFA 4N6EB 1PGBA 4TQ1A 3V3XA 1T0RC 2K22A 2LGSA 4ZOHC 3IXSA 3ZRFA 2FCNA 3IG3A 3W5VB 1SGHA 1WX9A 2BPSA 3AEFB 1J7BA 2CJNA 2V9HA 3KQ4A 4E3CA 1TY2A 1E7UA 4DXGA 1QLBB 1WR6E 4XC2A 3ZGZA 1MFWA 2EKIA 5CX3A 2WXOA 2ICIA 5EE9A 1IBXB 1NI2A 3ZTDA 3MC0B 4R3DA 2KYWA 3OG5A 2CU3A 1C4PA 1LGRA 2G4DB 3IAM1 3ALBA 2BVCA 1F52A 4NQKE 4M0WB 1EU4A 4YXDB 4XDCA 1DOYA 3EUB2 3PRZA 3DBSA 3SU8X 1KTKA 4FULA 1XXGA 2D5GA 2KFJA 1TS4A 1FMAD 1SIFA 4M0WA 1AN8A 2L76A 3P63A 2NR2A 1SE2A 3Q3NC 4B6WA 1K8RB 4HKQA 2N9PC 4RGMA 3TMPB 2RDBC 2LMCA 3V61A 2JU6X 2J4XA 4G0NB 1V9JA 2N1VA 3DBLB 3Q8FA 4OZCA 3ZLZA 1E90A 1WXMA 3L08A 2WQYB 4IUMB 2TSSA 5BYSA 1XT9B 3EHVA 5EDSA 2X38A 3L4PA 3APDA 3UIOB 2J7QB 3FC4A 2KNBA 4J6IA 4IM0A 2NPTB 1E7VA 2WXQA 2SEBD 4HEA1 2BTEA 1KJTA 1RFKA 4YSYB 2KMAA 2KQ7A 5D7GA 4JWUC 4ANUA 3BYTB 2J0KA 1SF0A 3IAS1 3PT2B 2C60A 3AXCA 5AUIA 1TS5A 1N5WA 2Y5CA 1FEHA 3R2TA 1JALA 4KDLB 4II2B 2BW2A 1HA5A 4P1BC 2A4ZA 1TZOA 1YN4A 2BQQA 2MBOA 4YTMB 1GJZA 2D2QA 3KWLA 2UU7A 3KYDD 5IOIA 2NBWB 3KH0A 1R4MB 3FAHA 5DPRA 4FHJA 1VR9A 4A20A 3W9CB 3D32A 2JYTA 1HXYD 3OJ3A 3PPAA 1V1OA 1WJ6A 4S0RA 2GBKA 2VH2A 3RNBC 1IGDA 1D4BA 3CSFA 1J7CA 2MBQA 3NY5A 3U8ZA 2FUG1 2K25A 3EFCA 1AYFA 2V4IB 2EELA 5EE1A 2LXCA 2KJHB 3GZNI 1WYGA 2NS5A 2RSUA 2WXNA 5L95C 3V6EB 2G1EA 5HI1A 2W82A 4HKZE 1YQBA 2WXHA 5LNK1 1QQRA 3B1LX 4NJCA 3JSVB 2WXGA 3AMZA 2PMVA 3CF6E 1Q10A 1P0RA 2D11A 1MG8A 2LD9A 1FXAA 1V8CA 1ROEA 3JSVA 3M95A 4C56C 2HTME 4GN1A 2Z0EB 2D3GA 1N6ZA 1ZP0B 2BYEA 2IZVB 1UD7A 2IGDA 3AE8B 3T3NA 4DHJD 2CHWA 4W9JA 1V80A 1C4CA 4BVUC 4A55A 1LQBA 3AULA 1YQ3B 5E6PA 3T9LA 1VZ7A 4G50A 4KKIA 3NZUA 5IP4D 1ZGUB 3H7SA 2REXA 2KJRA 2LWPA 2LRUA 2L1AA 2LUEA 4EFOA 2MJDA 1FFVA 3KVFB 3VFKA 3RFZB 4RGTA 3UQAA 1N62A 4P7IA 4ASWC 1EUVB 3Q2AC 4MGKE 4HCNB 2JYEA 1PGAA 2RPVA 4WQOB 2PE6B 4B0EA 3MFGA 1WRIA 5IKCM 3RPFC 2FCSA 2HE7A 4LDTD 3VDZA 3NJTA 3VQIA 2KLCA 2QSDA 1JRUA 3C8YA 1C78A 2NCNA 3UQBA 4LLGM 5J18A 3AU5A 4LJPB 1IYFA 1DOXA 2ZEQA 5DPSA 2FBWB 1T3QA 2IO0B 2DAJA 4HJGE 2KJ6A 1WXVA 3AB5A 1NVID 2DYBA 2ZZPB 3I63C 4IM2A 3P4QB 3A4RA 4BKSD 1D5ZC 4F1SA 5GMVA 5BMHA 2BWES 1FM0D 3TJPA 3TL5A 2D10A 3R66C 4WQMA 3AI5A 4XYCA 1WMHB 1SE4A 4BOZB 3CMMB 3GZNB 3BVGA 2KMMA 1JWAD 3ZJUA 1C77A 2CU1A 2Y5PA 2ZCCA 4ARCA 2IY1B 2V3NA 4RNAA 3WAOA 3GE3C 1HE8A 4JIOU 2WDQB 4EOYA 1PGXA 1JROA 1UZXB 2GI9A 3PREA 4MJSB 3AE3B 3A9KB 1WX8A 4WWMA 4AS1A 2N7DA 2I1JA 2WP9B 1A70A 2DZJA 2INNE 1XD3B 1B9RA 4CHKA 4GSWA 2JPHA 2W3RA 4ICVA 3NG0A 3M62B 1C79A 3PLUA 1Z2MA 3URYA 3DWGC 1SB3C 3GB1A 2FCMA 4W9LA 5I4DA 3C19A 3SFEB 1I4PA 3L17A 5BMIA 2LJ5A 2ZJDA 4J3OD 4MEMA 3DVNV 3DBHI 2CS4A 3M63B 2AYOB 3BYYB 2PW9A 1D5MC 1ZE3D 3QIJA 1F1HA 3AECB 3QHTA 3N20C 1QOAA 1XQQA 1HEZE 2PPHA 2KK8A 3VR8B 1ET9A 2RMMA 1I7HA 3DVNU 1D5XC 1WGRA 3VTWA 1FFUA 2W3SA 1ISNA 2LZ6A 4FXCA 1J0GA 2NTSA 1D3ZA 3RNFC 1OTRB 2JRHA 3RULA 1MHXA 4LJOB 2KVRA 2G4SA 1QT9A 4QAYA 3HHMA 4JGHB 2GMIC 4MGIE 3AE1B 4GB9A 3IT4B 2JF5A 2WXKA 2I2YA 2MBEA 1NI3A 3IBEA 1YOVB 1NEKB 1JRPA 1N63A 3VRAB 3WAPA 5EE0A 2BBCA 4K7SA 3ZNGC 1N5XA 1LFDA 2KOXA 4C7ZA 1UF0A 3U30A 2KVZA 2BB6A 2QHOA 2LHDA 1V5OA 1EWYC 2CKHB 4N9F4 1TKEA 2N7JA 1FCCC 3DDCB 4ZRIA 1QF6A 1Z5SB 4AP4C 1ZKHA 4A90A 2QDFA 4LCDE 3I5JC 3EECA 3Q8CA 2KWVB 3VVWB 2AL3A 1V86A 1WM3A 1S3SG 1SE3A 1UWXA 2RGFA 3R3MA 4WJPA 2K5PA 2VZKD 4RM9A 3JW0X 1SJHD 1F2RI 3N3KB 2ZCBA 2WXMA 4M00A 4MELA 3MC8A 2RDGA 4WAFA 4YL8A 3T8MA 1YMHE 1N60A 3SD5A 1DOIA 2BS2B 3H6NA 1WZ0A 5DPWA 1QOFA 2MP2B 4KIKA 2BS4B 1I4QA 3EA6A 4C4VB 2GBRA 3NVZA 1T6BX 1E9MA 1FD6A 4LTUA 3NZ3A 2MP2A 1MPEA 1SEBD 2QCZA 4A3OA 2N9XA 4HJKA 1YNTE 4E71A 3PHWB 1TS2A 4F8CB 2N7EA 1P98A 3PVLA 4RF0A 4NAMA 2KXJA 2BYTA 3DBHB 1C3TA 1R4NI 2N0SB 2PKOA 2K0PA 1IUEA 3P2BA 3DWMA 4WJNA 4MGYE 1WM2A 2KLGA 3AEGB 1AARA 1ZXHA 4NAWB 1YJ1A 3OJ4B 4NNJB 2WXLA 4RH6A 2FUHB 1PYWD 2FIDA 2DENB 4OZBA 3FKYA 4GLSC 4GIVA 5DPTA 2JX5A 2WHIA 2HJ8A 4CQNA 4YTNB 2XBBC 1S1QB 4KZ0A 4ANWA 3QA8A 3P4RB 5C1ZA 2M56B 3RZWC 1E8YA 4P1CC 2WNMA 1HTOA 1IBXA 3J9CA 1VJKA 2KFKB 3B2GA 4FN2A 3RD2A 1ZDVA 3AEDB 1SIJA 1I4RA 1TT5B 1KRHA 1WWTA 1XCTL 4Q2JA 2R61A 3EFUA 2Z59B 3QCAA 1WJUA 2YVCA 4M02A 5HFYA 3RT3B 4NJ6A 2J42A 2LVQA 4HDQA 1WX7A 4AJYB 2ZVNA 4EZKA 2J0JA 1SE9A 2HTHA 3AE2B 2HDEA 4WWPA 3ZUNA 3BWUD 2FAZA 3QX1A 2R2QA 3AV8A 2LVOA 1Q0WB 4NJ7A 4HPMB 4IDIA 1T0QC 1X1MA 3RNEC 1VZ8A 1FCLA 4M8MA 4OVUA 2BKFA 3ECIA 2NPTA 4EE2A 2XNAC 5IO9A 4ZYSA 2MH7A 2BT6A 2L7RA 4LNOA 1V97A 2DHZA 3PZDA 3AE9B 4NQLB 3Q6BA 3B2FA 1GC6A 3LYYA 1TYGB 3B0AA 3TCAA 4WWNA 4MACA 1TGZB 3V60A 3ZW3A 1TKGA 2LJIA 4FLHA 4US9A 3EGRA 2PVOD 2MBHA 2UYZB 2PEAA 1OQRA 4WAAA 4BZAA 1JWSD 1C76A 2WX0A 2L32A 2WYQA 2JT4B 3A4SC 4N58A 5HKHA 2IPKD 2IO1B 4C80A 2BWFA 1LO5D 1R4NB 4HK2A 3R8BA 4K7UA 2WDVB 1UBIA 1T5XD 2KDIA 3AH7A 2BS3B 1JWUD 4GDLB 5TR5A 2PTLA 3A33B 3ZO5B 4DDID 3S2AA 3QAQA 3BK2A 3ZXVA 3MHZA 4IC7B 1F2RC 2DYOA 3X23A 4PYUA 2M17A 4GDLA 3U2SC 1WIAA 1GUAB 1GB1A 2NVUI 2GBJA 3NVVA 3KLSX 1WF9A 2GLSA 2DZIA 3B08A 2G45B 4HRSA 4IKGA 3ZJVA 4WWOA 1D6EC 2L05A 1GOZA 3ZJTA 1EWCA 2OJWA 3HVZA 4RMAA 2AWTA 1F9JA 2DAFA 2QJLA 3AN1A 3WALA 1FIQA 2LASA 3KUZA 2Q5WD 1MJDA 1EF1A 2ASQA 3UI3A 1G6JA 3HM6X 3Q8AA 4ICUA 3ML9A 2L83A 4DHJB 2E6XA 3AU4A 1I4XA 1TZ1A 4KKJA 2OHFA 1EF5A 2YEPF 2JQRB 3HVDA 3V05A 2INCC 3DBRI 1I35A 3T3OA 3ZQ4A 3NS1A 1YX6B 3TIXA 2WXIA 3VHTC 1WR1A 3AE5B 1V5TA 3AE7B 2B3AA 3ML8A 2KKCA 3Q3FA 1VD2A 1E8WA 2IJ0A 1Q5WB 2WLBA 2K6QA 3HM3A 4HPLB 2J53A 1E8ZA 2KQSA 1FRRA 2BYVE 4LDTB 2DX5B 1JW9D 4GOCA 2MLBA 1J8CA 4OW0A 4YTPB 5G5HA 3W1SC 2CHZA 4M01A 3RNCC 4F7ZA 4LNNA 4PS3A 1RYJA 1AWDA 4TMAB 3QK0A 4NZLB 5FR6A 3K9PB 3KUCB 1HTQA 2KN5A 2KO3A 4MH0E 2N4FA 4PYZA 1BMLC 4B0MA 2JWUA 1KF6B 1FNWA 1SXTA 2WX1A 4KSLC 2IO2B 2KMCA 3MP9A 3NHEB 4AOFA 4W9IA 2L0FA 3PSEB 1TJEA 1H8CA 2C7MB 3DVGY 2NBVB 1WMHA 4EZLA 3SFDB 1ENFA 2JWZA 3L16A 4JWSC 2D3BA 3A1QB 2L00B 2MW5A 1UELA 4ZHPA 1UGMA 1R7SA 1GAQB 4ZHOA 5AZHA 3BK1A 4IWOA 3DHIC 3U7ZA 3VAWA 3N1YC 1VDVA 2SAKA 1GB4A 2DBYA 4MJSA 3IHPC 3A9KA 1GNUA 2V0GA 2GBNA 1N61A 3RYTA 2AQ2B 4NPNA 2LGXA 2W9NA 4KZCA 4ARIA 1K50A 1HQRD 3DQVA 1FXTB 2K9XA 3ZDTA 3KW5B 1L6VA 2RDHA 2O6VB 3KWVA 1L5PA 2KDEB 4IWQA 3RNAC 2C7HA 4DDGD 1RRBA 2O6VA 3M3JA 4P16A 4TKNA 2YLMA 2DWQA 4MM3B 1L4DB 3DBRB 4MH8A 4BKGA 2KQ4X 3N32A 1NDDA 3N30A 3Q3OC 4XZ4A 4MM3A 5D3DA 4X57B 1ZW7A 3RMKC 3LJ3A 3H9DA 2KZRA 1P1AA 3ETRA 2RR9A 2N9LA 2L8JA 4IM3A 3ZXRA 1QKZA 4GU2A 4I6NB 3QWZB 3AEAB 4K1RB 5AEKB 2PIAA 2MX2A 1WE6A 2JSVX 2LGDA 2HD5B 2D3CA 4FJYA 1ZXIA 4L23A 1EU3A 4CYEA 2D07B 3Q14C 4H2AA 1ESFA 2KTFA 1J19A 2IGGA 3PV1A 4RGNA 3E9SA 3VH4B 5D2MB 3PHXB 1FPYA 1WY8A 2C5LC 3H1UA 2IBIB 2K8BA 2M1MA 4KGRA 2KWUB 4FADA 4CO7A 3LDZE 3ENEA 1ET6A 2N9EB 2DLBA 1GG3A 5H8YE 4DBGA 3N1XC 5J17A 3UIPB 2ZW0A 3NVYA 1CJEA 3Q3MC 4FJVB 2KT7A 2GOWA 4HWIB 1Y8RC 2JZ3B 1EM7A 3FILB 2DZKA 4DHZE 4W9EA 2CHXA 4I6LB 1M4VA 3KUDB 3FILA 4GDKB 3ZYYX 5E6NA 1YD8U 1L4ZB 1WXQA 2H88B 4ZYNA 3ZNID 4GDKA 3PS6A 4C7YA 2K8HA 2CJOA 4UDUC 4L2YA 2ZW1A 4AUQC 1RM6C 2IDYA 3I9V1 1T0YA 2R2OA 4RGOS 2BGFA 4D2KA 4BFRA 4WJOA 1WXSA 3BY4B 1SBBB 4JQWC 1XLNA 1BUIC 3L0WB 3DOWA 3ZRCA 3TEZA 1HZ6A 2QC8A 2I1KA 1TIFA 2BF8B 1NYRA 4KGTA 1YIWA 3Q8EA 2AX5A 4URKA 2W54A 2KC2A 2O2VB 1L7YA 4O1NA 1XLPA 4C4VA 2WXPA 1XLQA 2GB1A 2JXTA 2RD0A 5KHQA 4M8NA 1HZ5A 1YX5B 2V1YA 1VLBA 1WGKA 1IGCA 1IPGA 3LB8C 1VRAB 3RN9C 1V6EA 2WU5B 1OQYA 2KX0A 1C9FA 2B76B 4XX5A 3HIZA 5JH5C 2EMSA 2NMQA 2KHWB 4MSQB 2C9WB 4L1BA 2RPQA 4NAWA 3PGEA 3CWIA 2L0TA 3ZIMA 2JXXA 4KSKC 5TSSA 4US8A 3P4PB 4RF1A 3N9YC 1E5WA 5H92C 5FR3A 2UWQA 5MPOA 4RFBA 5DCNA 2MEKA 1KOTA 5HG2A 3NRZA 1QOGA 2MCNB 2FNJB 4AQ7A 3NOBA 1WJ4A 4A9AA 2ONQA 4TV3A 3ZVVA 3MJ5A 2JY6A 3PRPB 1WRDB 4HLEA 2JVCA 2JZZA 2LEKA 2KFKA 1RLFA 1JCKB 2LUMA 1V1PB 1M94A 3VTUA 3A9JB 2OOBB 3MHSD 3QJZA 4FBJB 1KH0A 1MI0A 4C00A 3ONSA 4WJQA 1V1PA 2PLPA 1RWSA 2FIFA 4K7WA 5IAAC 3A9JA 5L83A 2ZNVC 3RUIB 1WYWB 3TBLD 2KWCA 2XN9C 3PO0A 1P3QU 2D3AA 2DNFA 2KD0A 2LI5A 2DZMA 2WGSA 1WGYA 1L2NA 1UBQA 1E10A 2K39A 4W9FA 3VXWA 2HJ1A 3QQ8B 1H4RA 4WURA 5C23A 1UH6A 2WDTB 1EO6A 1KLGD 4YSXB 3SEBA 1JQ4A 5CHVC 1I4GA 1XCQL 3TEXA 2WWZA 4ANXA 5G2NA 1FNUA 5EE3A 3VUYA 4MT5A 4YWGG 3RNGC 2X8XX 3DHHC 2NTTA 2QILA 3WANA 4DK5A 2G9HD 4EUTA 3WCQA 2J0MA 1JWMD 1T0SC 4A8XC 2FCQA 2WXJA 1GC7A 4JPSA 1P7FA 2KC1A 3ABVB 4USAA 4GMVA 4TSSA 4FA6A 4FJZA 2AQ1B 2DYMA 5CHFA 5KHOA 5IA7A 5JXVA 3PTFC 2KDFB 1OEYA 3CSTA 1WE7A 4DHZB 4A3PA 3BVMA 4RM8A 1TTNA 4OVVA 5BMGA 3KYCD 3H7PB 4W9KA 4ZRJA 4JE3B 3BVZA 1FXIA 3CIRB 3H7PA 1WSPA 2E3TA 2AEHA 2V4LA 2BKRB 3HK0A 1UUPA 2V3SA 4AWJA 1FO4A 1STEA 4IW0A 4XDDA 4GXBA 1MG4A 4IWPA 4REZA 4W9GA 4A6QA 3C0RB 3VTVA 1P9DU 1K51A 1OFFA 3NS8A 1KFYB 3WIMA 2W55A 5T8IA 2M0AA 4LNKA 1YQ4B 3PZ7A 1RFAA 1WI0A 1Y56A 4KV2A 1JMLA 5CHWA 5AZFA 3UINB 3OAWA 2WS3B 1SSNA 4ANVA 4AJWA 2CR5A 2IY0B 2YEPB 1MVKA 3R7QA 1MHHE 1YJJA 4WIPA 3ZDMC 4DQOC 2WXFA 4BBNF 4ACFA 2KTRB 4TUUA 4DXFA 2V3PA 1Q1OA 2WDRB 2KDBA 1RAXA 1LXDA 2GBMA 5BYQA 5JZEB 4YT0B 1SJED 3QC8B 2KTRA 3W1SA 4B95A 3N1ZC 1PQSA 2PVGC 2MBBB 2KX3A 5AUKA 3MC9A 4JL9A 2EKEC 1CMXB 3X0WA 3AM9A 2C7NB 3NZSA 5CTRC 3BIID 1XLOA 2INDC 4MGZE 5FKAC 1OQQA 2Z8LA 2MJ3A 2N9KA 2GRIA 2PJHA 1TBEA 2LFIA 2L52A 4BBNC 1YJIA 3PRMB 4EZJA 3Q69A 1E0ZA 2KACA 4P6VF 1ZOYB 2LRWA 1XF5L 2MQJA 3TUOA 1K53A 4LNIA 2MA9B 4EKUA 2G3QB 4JLCA 1I42A 4DWFA 1KLVA 1OGWA 1NYQA 1C4AA 4OZAA 2QIEB 3R2IA 4MDKE 1BXTA 5D6JB 2IGHA 1B1ZA 3VH3B 1ACCA 2H89B 2QEJC 2WXRA 3VUXA 1CZPA 1F0ZA 3RCZA 1JWBD 2QMTA 3AEEB 3IVFA 5LXHA 4II3B 2MRPA 1WFYA 4K3BA 4K81A 1YN3A 5C2TB 5D94A 3JVZX 1CQVA 4E74A 4BKSA 1BT0A 2AL6A 3PLVA 1E7PB 1V49A 1WZ3A 2ZVOA 1V2YA 2KDMA 5E6JA 2BB5A 1QOBA 1TY0A 3QARA 1PFDA 3AE4B 1FNVA 5FK9C 2AQ3B 4I6PA 1VZ6A 3GE8C 4KDIC 5J2RA 4HDOA 3A1QA 4PK1A 4HVBA 4ZRKA 3Q8BA 4ZDVA 4B9KA 2NBUA 3TEYA 2JZPA 3W5UB 1NBFC 2M8SA 3I57A 4XWTA 3DPDA 1F77A 3SHQA 3NUHB 2J52A 3E56A 3MTNB 3W1YA 3L13A 4IG7B 2KN4A 1FRDA 3U4EG 3DHGC 3V6CB 3GS2A 1WJNA 2WU2B 1WH3A 4EEWA 5JHAA 5BYRA 4JX1C 3Q3JA 3VRBB 2L3ZA 2O6VD 5BO4B 2ZPNA 3P42A 1L6UA 3RI7C 5C3JB 3UGBB 3HRDD 3IT6B 3APFA 5LLIA 3AE6B 2K6DB 2M19A 5AZGA 4KGSA 5E6OA 1WGDA 4G3XB 3IFWB 3B9JA 4K3CA 4TQ0A 1TS3A 2LGYA 3VR9B 3ZNHB 3BINA 2FE8A 3RZFA 1UWMA 3NVWA 5JHBA 2INPE 3PZ8A 1ZDXA 4OVZA 1DYQA 3DCGA 1L0XB 1YN5A 4ZRPA 3TEWA 2KAJA 1PUTA
chains in the Genus database with same CATH topology
3N1XC 3RMKC 3Q2AC 4P1BC 3N1YC 3DHGC 3I5JC 1T0RC 3Q3NC 3RNAC 3Q3MC 4P1CC 2INDC 1T0QC 3RNBC 3RNGC 3RNEC 2RDBC 3RNCC 2INCC 3DHHC 3RN9C 3N1ZC 3RI7C 3GE8C 3GE3C 3N20C 1T0SC 3I63C 3Q3OC 3Q14C 3RNFC 3DHIC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N1X C;  3RMK C;  3Q2A C;  4P1B C;  3N1Y C;  3DHG C;  3I5J C;  1T0R C;  3Q3N C;  3RNA C;  3Q3M C;  4P1C C;  2IND C;  1T0Q C;  3RNB C;  3RNG C;  3RNE C;  2RDB C;  3RNC C;  2INC C;  3DHH C;  3RN9 C;  3N1Z C;  3RI7 C;  3GE8 C;  3GE3 C;  3N20 C;  1T0S C;  3I63 C;  3Q3O C;  3Q14 C;  3RNF C;  3DHI C; 
#chains in the Genus database with same CATH topology
 5GXG B;  2XK5 B;  2Y5B B;  1KM7 A;  2LGI A;  2MWS B;  2JRI B;  1UGJ A;  2ON8 A;  5D3I B;  3ZKJ C;  2XK5 A;  3GOE A;  1P7E A;  3U7D A;  3BZD B;  3TSS A;  4BKT A;  1TKY A;  1J7A A;  1IP9 A;  3UF8 A;  4KVG B;  2I38 A;  2M4N A;  3U52 E;  3AEB B;  4RCO A;  2KWD A;  1LM8 B;  2OJR A;  2LVP A;  2IO3 B;  4OHJ A;  4BOS C;  3DVG X;  4LK0 M;  3WA0 A;  2A5U A;  4W9C A;  4PT5 A;  1AW7 A;  1XEE A;  2Z0D B;  2MSE D;  3I3T B;  1GPX A;  1ZPS A;  2PE9 A;  1UNS A;  2OED A;  3APC A;  4FHK A;  1WXA A;  4NY0 A;  4XE0 A;  1PDX A;  3L54 A;  1E6E B;  3R7R A;  5IN7 A;  1DGJ A;  1E8X A;  3DBL I;  1QZE A;  3ZTC A;  2IYD B;  4YSZ B;  1QIL A;  4XGA B;  1L0Y B;  4BAX A;  4W9D A;  1K52 A;  3H8H A;  2LXA A;  4G11 A;  3W2D A;  2VZK B;  3O65 B;  1VCB A;  2JUO A;  2N1W A;  3OWE B;  2K3U A;  3LXF A;  1A5R A;  3JYU A;  2ZPY A;  4HCP B;  4W9H A;  4DXA B;  2ACZ B;  3GP7 A;  3SDL C;  4KX6 B;  4MSM B;  2Y3A A;  3L10 B;  3MJW A;  4PS7 A;  1WGH A;  1I4H A;  2MHJ A;  4PS8 A;  4IOI E;  3OLM D;  4KIK B;  1KLU D;  2VH1 A;  2VRR B;  3P4S B;  5LXI B;  1NEN B;  2O2V A;  1CK1 A;  1ZUD 2;  1WGG A;  1R4M I;  3SR6 A;  2EMT A;  3O13 A;  2BYF A;  1L0V B;  2M0X A;  2MJE A;  3EC8 A;  1V81 A;  4HXD A;  5G55 A;  3HUI A;  1OEY J;  1XO3 A;  3P1M A;  4HRO A;  5G5G A;  4ITK A;  4S17 A;  3ZNZ B;  1U4A A;  4ZRQ A;  4GGQ A;  3WAM A;  2K8C A;  3K9O B;  4HPP A;  3VUW A;  4WH4 A;  4XWW A;  5HHD G;  2K1F A;  4N59 A;  3V62 A;  2XEW A;  1C1Y B;  2KAN A;  2ZNV B;  2LHE A;  4LNF A;  4N6E B;  1PGB A;  4TQ1 A;  3V3X A;  1T0R C;  2K22 A;  2LGS A;  4ZOH C;  3IXS A;  3ZRF A;  2FCN A;  3IG3 A;  3W5V B;  1SGH A;  1WX9 A;  2BPS A;  3AEF B;  1J7B A;  2CJN A;  2V9H A;  3KQ4 A;  4E3C A;  1TY2 A;  1E7U A;  4DXG A;  1QLB B;  1WR6 E;  4XC2 A;  3ZGZ A;  1MFW A;  2EKI A;  5CX3 A;  2WXO A;  2ICI A;  5EE9 A;  1IBX B;  1NI2 A;  3ZTD A;  3MC0 B;  4R3D A;  2KYW A;  3OG5 A;  2CU3 A;  1C4P A;  1LGR A;  2G4D B;  3IAM 1;  3ALB A;  2BVC A;  1F52 A;  4NQK E;  4M0W B;  1EU4 A;  4YXD B;  4XDC A;  1DOY A;  3EUB 2;  3PRZ A;  3DBS A;  3SU8 X;  1KTK A;  4FUL A;  1XXG A;  2D5G A;  2KFJ A;  1TS4 A;  1FMA D;  1SIF A;  4M0W A;  1AN8 A;  2L76 A;  3P63 A;  2NR2 A;  1SE2 A;  3Q3N C;  4B6W A;  1K8R B;  4HKQ A;  2N9P C;  4RGM A;  3TMP B;  2RDB C;  2LMC A;  3V61 A;  2JU6 X;  2J4X A;  4G0N B;  1V9J A;  2N1V A;  3DBL B;  3Q8F A;  4OZC A;  3ZLZ A;  1E90 A;  1WXM A;  3L08 A;  2WQY B;  4IUM B;  2TSS A;  5BYS A;  1XT9 B;  3EHV A;  5EDS A;  2X38 A;  3L4P A;  3APD A;  3UIO B;  2J7Q B;  3FC4 A;  2KNB A;  4J6I A;  4IM0 A;  2NPT B;  1E7V A;  2WXQ A;  2SEB D;  4HEA 1;  2BTE A;  1KJT A;  1RFK A;  4YSY B;  2KMA A;  2KQ7 A;  5D7G A;  4JWU C;  4ANU A;  3BYT B;  2J0K A;  1SF0 A;  3IAS 1;  3PT2 B;  2C60 A;  3AXC A;  5AUI A;  1TS5 A;  1N5W A;  2Y5C A;  1FEH A;  3R2T A;  1JAL A;  4KDL B;  4II2 B;  2BW2 A;  1HA5 A;  4P1B C;  2A4Z A;  1TZO A;  1YN4 A;  2BQQ A;  2MBO A;  4YTM B;  1GJZ A;  2D2Q A;  3KWL A;  2UU7 A;  3KYD D;  5IOI A;  2NBW B;  3KH0 A;  1R4M B;  3FAH A;  5DPR A;  4FHJ A;  1VR9 A;  4A20 A;  3W9C B;  3D32 A;  2JYT A;  1HXY D;  3OJ3 A;  3PPA A;  1V1O A;  1WJ6 A;  4S0R A;  2GBK A;  2VH2 A;  3RNB C;  1IGD A;  1D4B A;  3CSF A;  1J7C A;  2MBQ A;  3NY5 A;  3U8Z A;  2FUG 1;  2K25 A;  3EFC A;  1AYF A;  2V4I B;  2EEL A;  5EE1 A;  2LXC A;  2KJH B;  3GZN I;  1WYG A;  2NS5 A;  2RSU A;  2WXN A;  5L95 C;  3V6E B;  2G1E A;  5HI1 A;  2W82 A;  4HKZ E;  1YQB A;  2WXH A;  5LNK 1;  1QQR A;  3B1L X;  4NJC A;  3JSV B;  2WXG A;  3AMZ A;  2PMV A;  3CF6 E;  1Q10 A;  1P0R A;  2D11 A;  1MG8 A;  2LD9 A;  1FXA A;  1V8C A;  1ROE A;  3JSV A;  3M95 A;  4C56 C;  2HTM E;  4GN1 A;  2Z0E B;  2D3G A;  1N6Z A;  1ZP0 B;  2BYE A;  2IZV B;  1UD7 A;  2IGD A;  3AE8 B;  3T3N A;  4DHJ D;  2CHW A;  4W9J A;  1V80 A;  1C4C A;  4BVU C;  4A55 A;  1LQB A;  3AUL A;  1YQ3 B;  5E6P A;  3T9L A;  1VZ7 A;  4G50 A;  4KKI A;  3NZU A;  5IP4 D;  1ZGU B;  3H7S A;  2REX A;  2KJR A;  2LWP A;  2LRU A;  2L1A A;  2LUE A;  4EFO A;  2MJD A;  1FFV A;  3KVF B;  3VFK A;  3RFZ B;  4RGT A;  3UQA A;  1N62 A;  4P7I A;  4ASW C;  1EUV B;  3Q2A C;  4MGK E;  4HCN B;  2JYE A;  1PGA A;  2RPV A;  4WQO B;  2PE6 B;  4B0E A;  3MFG A;  1WRI A;  5IKC M;  3RPF C;  2FCS A;  2HE7 A;  4LDT D;  3VDZ A;  3NJT A;  3VQI A;  2KLC A;  2QSD A;  1JRU A;  3C8Y A;  1C78 A;  2NCN A;  3UQB A;  4LLG M;  5J18 A;  3AU5 A;  4LJP B;  1IYF A;  1DOX A;  2ZEQ A;  5DPS A;  2FBW B;  1T3Q A;  2IO0 B;  2DAJ A;  4HJG E;  2KJ6 A;  1WXV A;  3AB5 A;  1NVI D;  2DYB A;  2ZZP B;  3I63 C;  4IM2 A;  3P4Q B;  3A4R A;  4BKS D;  1D5Z C;  4F1S A;  5GMV A;  5BMH A;  2BWE S;  1FM0 D;  3TJP A;  3TL5 A;  2D10 A;  3R66 C;  4WQM A;  3AI5 A;  4XYC A;  1WMH B;  1SE4 A;  4BOZ B;  3CMM B;  3GZN B;  3BVG A;  2KMM A;  1JWA D;  3ZJU A;  1C77 A;  2CU1 A;  2Y5P A;  2ZCC A;  4ARC A;  2IY1 B;  2V3N A;  4RNA A;  3WAO A;  3GE3 C;  1HE8 A;  4JIO U;  2WDQ B;  4EOY A;  1PGX A;  1JRO A;  1UZX B;  2GI9 A;  3PRE A;  4MJS B;  3AE3 B;  3A9K B;  1WX8 A;  4WWM A;  4AS1 A;  2N7D A;  2I1J A;  2WP9 B;  1A70 A;  2DZJ A;  2INN E;  1XD3 B;  1B9R A;  4CHK A;  4GSW A;  2JPH A;  2W3R A;  4ICV A;  3NG0 A;  3M62 B;  1C79 A;  3PLU A;  1Z2M A;  3URY A;  3DWG C;  1SB3 C;  3GB1 A;  2FCM A;  4W9L A;  5I4D A;  3C19 A;  3SFE B;  1I4P A;  3L17 A;  5BMI A;  2LJ5 A;  2ZJD A;  4J3O D;  4MEM A;  3DVN V;  3DBH I;  2CS4 A;  3M63 B;  2AYO B;  3BYY B;  2PW9 A;  1D5M C;  1ZE3 D;  3QIJ A;  1F1H A;  3AEC B;  3QHT A;  3N20 C;  1QOA A;  1XQQ A;  1HEZ E;  2PPH A;  2KK8 A;  3VR8 B;  1ET9 A;  2RMM A;  1I7H A;  3DVN U;  1D5X C;  1WGR A;  3VTW A;  1FFU A;  2W3S A;  1ISN A;  2LZ6 A;  4FXC A;  1J0G A;  2NTS A;  1D3Z A;  3RNF C;  1OTR B;  2JRH A;  3RUL A;  1MHX A;  4LJO B;  2KVR A;  2G4S A;  1QT9 A;  4QAY A;  3HHM A;  4JGH B;  2GMI C;  4MGI E;  3AE1 B;  4GB9 A;  3IT4 B;  2JF5 A;  2WXK A;  2I2Y A;  2MBE A;  1NI3 A;  3IBE A;  1YOV B;  1NEK B;  1JRP A;  1N63 A;  3VRA B;  3WAP A;  5EE0 A;  2BBC A;  4K7S A;  3ZNG C;  1N5X A;  1LFD A;  2KOX A;  4C7Z A;  1UF0 A;  3U30 A;  2KVZ A;  2BB6 A;  2QHO A;  2LHD A;  1V5O A;  1EWY C;  2CKH B;  4N9F 4;  1TKE A;  2N7J A;  1FCC C;  3DDC B;  4ZRI A;  1QF6 A;  1Z5S B;  4AP4 C;  1ZKH A;  4A90 A;  2QDF A;  4LCD E;  3I5J C;  3EEC A;  3Q8C A;  2KWV B;  3VVW B;  2AL3 A;  1V86 A;  1WM3 A;  1S3S G;  1SE3 A;  1UWX A;  2RGF A;  3R3M A;  4WJP A;  2K5P A;  2VZK D;  4RM9 A;  3JW0 X;  1SJH D;  1F2R I;  3N3K B;  2ZCB A;  2WXM A;  4M00 A;  4MEL A;  3MC8 A;  2RDG A;  4WAF A;  4YL8 A;  3T8M A;  1YMH E;  1N60 A;  3SD5 A;  1DOI A;  2BS2 B;  3H6N A;  1WZ0 A;  5DPW A;  1QOF A;  2MP2 B;  4KIK A;  2BS4 B;  1I4Q A;  3EA6 A;  4C4V B;  2GBR A;  3NVZ A;  1T6B X;  1E9M A;  1FD6 A;  4LTU A;  3NZ3 A;  2MP2 A;  1MPE A;  1SEB D;  2QCZ A;  4A3O A;  2N9X A;  4HJK A;  1YNT E;  4E71 A;  3PHW B;  1TS2 A;  4F8C B;  2N7E A;  1P98 A;  3PVL A;  4RF0 A;  4NAM A;  2KXJ A;  2BYT A;  3DBH B;  1C3T A;  1R4N I;  2N0S B;  2PKO A;  2K0P A;  1IUE A;  3P2B A;  3DWM A;  4WJN A;  4MGY E;  1WM2 A;  2KLG A;  3AEG B;  1AAR A;  1ZXH A;  4NAW B;  1YJ1 A;  3OJ4 B;  4NNJ B;  2WXL A;  4RH6 A;  2FUH B;  1PYW D;  2FID A;  2DEN B;  4OZB A;  3FKY A;  4GLS C;  4GIV A;  5DPT A;  2JX5 A;  2WHI A;  2HJ8 A;  4CQN A;  4YTN B;  2XBB C;  1S1Q B;  4KZ0 A;  4ANW A;  3QA8 A;  3P4R B;  5C1Z A;  2M56 B;  3RZW C;  1E8Y A;  4P1C C;  2WNM A;  1HTO A;  1IBX A;  3J9C A;  1VJK A;  2KFK B;  3B2G A;  4FN2 A;  3RD2 A;  1ZDV A;  3AED B;  1SIJ A;  1I4R A;  1TT5 B;  1KRH A;  1WWT A;  1XCT L;  4Q2J A;  2R61 A;  3EFU A;  2Z59 B;  3QCA A;  1WJU A;  2YVC A;  4M02 A;  5HFY A;  3RT3 B;  4NJ6 A;  2J42 A;  2LVQ A;  4HDQ A;  1WX7 A;  4AJY B;  2ZVN A;  4EZK A;  2J0J A;  1SE9 A;  2HTH A;  3AE2 B;  2HDE A;  4WWP A;  3ZUN A;  3BWU D;  2FAZ A;  3QX1 A;  2R2Q A;  3AV8 A;  2LVO A;  1Q0W B;  4NJ7 A;  4HPM B;  4IDI A;  1T0Q C;  1X1M A;  3RNE C;  1VZ8 A;  1FCL A;  4M8M A;  4OVU A;  2BKF A;  3ECI A;  2NPT A;  4EE2 A;  2XNA C;  5IO9 A;  4ZYS A;  2MH7 A;  2BT6 A;  2L7R A;  4LNO A;  1V97 A;  2DHZ A;  3PZD A;  3AE9 B;  4NQL B;  3Q6B A;  3B2F A;  1GC6 A;  3LYY A;  1TYG B;  3B0A A;  3TCA A;  4WWN A;  4MAC A;  1TGZ B;  3V60 A;  3ZW3 A;  1TKG A;  2LJI A;  4FLH A;  4US9 A;  3EGR A;  2PVO D;  2MBH A;  2UYZ B;  2PEA A;  1OQR A;  4WAA A;  4BZA A;  1JWS D;  1C76 A;  2WX0 A;  2L32 A;  2WYQ A;  2JT4 B;  3A4S C;  4N58 A;  5HKH A;  2IPK D;  2IO1 B;  4C80 A;  2BWF A;  1LO5 D;  1R4N B;  4HK2 A;  3R8B A;  4K7U A;  2WDV B;  1UBI A;  1T5X D;  2KDI A;  3AH7 A;  2BS3 B;  1JWU D;  4GDL B;  5TR5 A;  2PTL A;  3A33 B;  3ZO5 B;  4DDI D;  3S2A A;  3QAQ A;  3BK2 A;  3ZXV A;  3MHZ A;  4IC7 B;  1F2R C;  2DYO A;  3X23 A;  4PYU A;  2M17 A;  4GDL A;  3U2S C;  1WIA A;  1GUA B;  1GB1 A;  2NVU I;  2GBJ A;  3NVV A;  3KLS X;  1WF9 A;  2GLS A;  2DZI A;  3B08 A;  2G45 B;  4HRS A;  4IKG A;  3ZJV A;  4WWO A;  1D6E C;  2L05 A;  1GOZ A;  3ZJT A;  1EWC A;  2OJW A;  3HVZ A;  4RMA A;  2AWT A;  1F9J A;  2DAF A;  2QJL A;  3AN1 A;  3WAL A;  1FIQ A;  2LAS A;  3KUZ A;  2Q5W D;  1MJD A;  1EF1 A;  2ASQ A;  3UI3 A;  1G6J A;  3HM6 X;  3Q8A A;  4ICU A;  3ML9 A;  2L83 A;  4DHJ B;  2E6X A;  3AU4 A;  1I4X A;  1TZ1 A;  4KKJ A;  2OHF A;  1EF5 A;  2YEP F;  2JQR B;  3HVD A;  3V05 A;  2INC C;  3DBR I;  1I35 A;  3T3O A;  3ZQ4 A;  3NS1 A;  1YX6 B;  3TIX A;  2WXI A;  3VHT C;  1WR1 A;  3AE5 B;  1V5T A;  3AE7 B;  2B3A A;  3ML8 A;  2KKC A;  3Q3F A;  1VD2 A;  1E8W A;  2IJ0 A;  1Q5W B;  2WLB A;  2K6Q A;  3HM3 A;  4HPL B;  2J53 A;  1E8Z A;  2KQS A;  1FRR A;  2BYV E;  4LDT B;  2DX5 B;  1JW9 D;  4GOC A;  2MLB A;  1J8C A;  4OW0 A;  4YTP B;  5G5H A;  3W1S C;  2CHZ A;  4M01 A;  3RNC C;  4F7Z A;  4LNN A;  4PS3 A;  1RYJ A;  1AWD A;  4TMA B;  3QK0 A;  4NZL B;  5FR6 A;  3K9P B;  3KUC B;  1HTQ A;  2KN5 A;  2KO3 A;  4MH0 E;  2N4F A;  4PYZ A;  1BML C;  4B0M A;  2JWU A;  1KF6 B;  1FNW A;  1SXT A;  2WX1 A;  4KSL C;  2IO2 B;  2KMC A;  3MP9 A;  3NHE B;  4AOF A;  4W9I A;  2L0F A;  3PSE B;  1TJE A;  1H8C A;  2C7M B;  3DVG Y;  2NBV B;  1WMH A;  4EZL A;  3SFD B;  1ENF A;  2JWZ A;  3L16 A;  4JWS C;  2D3B A;  3A1Q B;  2L00 B;  2MW5 A;  1UEL A;  4ZHP A;  1UGM A;  1R7S A;  1GAQ B;  4ZHO A;  5AZH A;  3BK1 A;  4IWO A;  3DHI C;  3U7Z A;  3VAW A;  3N1Y C;  1VDV A;  2SAK A;  1GB4 A;  2DBY A;  4MJS A;  3IHP C;  3A9K A;  1GNU A;  2V0G A;  2GBN A;  1N61 A;  3RYT A;  2AQ2 B;  4NPN A;  2LGX A;  2W9N A;  4KZC A;  4ARI A;  1K50 A;  1HQR D;  3DQV A;  1FXT B;  2K9X A;  3ZDT A;  3KW5 B;  1L6V A;  2RDH A;  2O6V B;  3KWV A;  1L5P A;  2KDE B;  4IWQ A;  3RNA C;  2C7H A;  4DDG D;  1RRB A;  2O6V A;  3M3J A;  4P16 A;  4TKN A;  2YLM A;  2DWQ A;  4MM3 B;  1L4D B;  3DBR B;  4MH8 A;  4BKG A;  2KQ4 X;  3N32 A;  1NDD A;  3N30 A;  3Q3O C;  4XZ4 A;  4MM3 A;  5D3D A;  4X57 B;  1ZW7 A;  3RMK C;  3LJ3 A;  3H9D A;  2KZR A;  1P1A A;  3ETR A;  2RR9 A;  2N9L A;  2L8J A;  4IM3 A;  3ZXR A;  1QKZ A;  4GU2 A;  4I6N B;  3QWZ B;  3AEA B;  4K1R B;  5AEK B;  2PIA A;  2MX2 A;  1WE6 A;  2JSV X;  2LGD A;  2HD5 B;  2D3C A;  4FJY A;  1ZXI A;  4L23 A;  1EU3 A;  4CYE A;  2D07 B;  3Q14 C;  4H2A A;  1ESF A;  2KTF A;  1J19 A;  2IGG A;  3PV1 A;  4RGN A;  3E9S A;  3VH4 B;  5D2M B;  3PHX B;  1FPY A;  1WY8 A;  2C5L C;  3H1U A;  2IBI B;  2K8B A;  2M1M A;  4KGR A;  2KWU B;  4FAD A;  4CO7 A;  3LDZ E;  3ENE A;  1ET6 A;  2N9E B;  2DLB A;  1GG3 A;  5H8Y E;  4DBG A;  3N1X C;  5J17 A;  3UIP B;  2ZW0 A;  3NVY A;  1CJE A;  3Q3M C;  4FJV B;  2KT7 A;  2GOW A;  4HWI B;  1Y8R C;  2JZ3 B;  1EM7 A;  3FIL B;  2DZK A;  4DHZ E;  4W9E A;  2CHX A;  4I6L B;  1M4V A;  3KUD B;  3FIL A;  4GDK B;  3ZYY X;  5E6N A;  1YD8 U;  1L4Z B;  1WXQ A;  2H88 B;  4ZYN A;  3ZNI D;  4GDK A;  3PS6 A;  4C7Y A;  2K8H A;  2CJO A;  4UDU C;  4L2Y A;  2ZW1 A;  4AUQ C;  1RM6 C;  2IDY A;  3I9V 1;  1T0Y A;  2R2O A;  4RGO S;  2BGF A;  4D2K A;  4BFR A;  4WJO A;  1WXS A;  3BY4 B;  1SBB B;  4JQW C;  1XLN A;  1BUI C;  3L0W B;  3DOW A;  3ZRC A;  3TEZ A;  1HZ6 A;  2QC8 A;  2I1K A;  1TIF A;  2BF8 B;  1NYR A;  4KGT A;  1YIW A;  3Q8E A;  2AX5 A;  4URK A;  2W54 A;  2KC2 A;  2O2V B;  1L7Y A;  4O1N A;  1XLP A;  4C4V A;  2WXP A;  1XLQ A;  2GB1 A;  2JXT A;  2RD0 A;  5KHQ A;  4M8N A;  1HZ5 A;  1YX5 B;  2V1Y A;  1VLB A;  1WGK A;  1IGC A;  1IPG A;  3LB8 C;  1VRA B;  3RN9 C;  1V6E A;  2WU5 B;  1OQY A;  2KX0 A;  1C9F A;  2B76 B;  4XX5 A;  3HIZ A;  5JH5 C;  2EMS A;  2NMQ A;  2KHW B;  4MSQ B;  2C9W B;  4L1B A;  2RPQ A;  4NAW A;  3PGE A;  3CWI A;  2L0T A;  3ZIM A;  2JXX A;  4KSK C;  5TSS A;  4US8 A;  3P4P B;  4RF1 A;  3N9Y C;  1E5W A;  5H92 C;  5FR3 A;  2UWQ A;  5MPO A;  4RFB A;  5DCN A;  2MEK A;  1KOT A;  5HG2 A;  3NRZ A;  1QOG A;  2MCN B;  2FNJ B;  4AQ7 A;  3NOB A;  1WJ4 A;  4A9A A;  2ONQ A;  4TV3 A;  3ZVV A;  3MJ5 A;  2JY6 A;  3PRP B;  1WRD B;  4HLE A;  2JVC A;  2JZZ A;  2LEK A;  2KFK A;  1RLF A;  1JCK B;  2LUM A;  1V1P B;  1M94 A;  3VTU A;  3A9J B;  2OOB B;  3MHS D;  3QJZ A;  4FBJ B;  1KH0 A;  1MI0 A;  4C00 A;  3ONS A;  4WJQ A;  1V1P A;  2PLP A;  1RWS A;  2FIF A;  4K7W A;  5IAA C;  3A9J A;  5L83 A;  2ZNV C;  3RUI B;  1WYW B;  3TBL D;  2KWC A;  2XN9 C;  3PO0 A;  1P3Q U;  2D3A A;  2DNF A;  2KD0 A;  2LI5 A;  2DZM A;  2WGS A;  1WGY A;  1L2N A;  1UBQ A;  1E10 A;  2K39 A;  4W9F A;  3VXW A;  2HJ1 A;  3QQ8 B;  1H4R A;  4WUR A;  5C23 A;  1UH6 A;  2WDT B;  1EO6 A;  1KLG D;  4YSX B;  3SEB A;  1JQ4 A;  5CHV C;  1I4G A;  1XCQ L;  3TEX A;  2WWZ A;  4ANX A;  5G2N A;  1FNU A;  5EE3 A;  3VUY A;  4MT5 A;  4YWG G;  3RNG C;  2X8X X;  3DHH C;  2NTT A;  2QIL A;  3WAN A;  4DK5 A;  2G9H D;  4EUT A;  3WCQ A;  2J0M A;  1JWM D;  1T0S C;  4A8X C;  2FCQ A;  2WXJ A;  1GC7 A;  4JPS A;  1P7F A;  2KC1 A;  3ABV B;  4USA A;  4GMV A;  4TSS A;  4FA6 A;  4FJZ A;  2AQ1 B;  2DYM A;  5CHF A;  5KHO A;  5IA7 A;  5JXV A;  3PTF C;  2KDF B;  1OEY A;  3CST A;  1WE7 A;  4DHZ B;  4A3P A;  3BVM A;  4RM8 A;  1TTN A;  4OVV A;  5BMG A;  3KYC D;  3H7P B;  4W9K A;  4ZRJ A;  4JE3 B;  3BVZ A;  1FXI A;  3CIR B;  3H7P A;  1WSP A;  2E3T A;  2AEH A;  2V4L A;  2BKR B;  3HK0 A;  1UUP A;  2V3S A;  4AWJ A;  1FO4 A;  1STE A;  4IW0 A;  4XDD A;  4GXB A;  1MG4 A;  4IWP A;  4REZ A;  4W9G A;  4A6Q A;  3C0R B;  3VTV A;  1P9D U;  1K51 A;  1OFF A;  3NS8 A;  1KFY B;  3WIM A;  2W55 A;  5T8I A;  2M0A A;  4LNK A;  1YQ4 B;  3PZ7 A;  1RFA A;  1WI0 A;  1Y56 A;  4KV2 A;  1JML A;  5CHW A;  5AZF A;  3UIN B;  3OAW A;  2WS3 B;  1SSN A;  4ANV A;  4AJW A;  2CR5 A;  2IY0 B;  2YEP B;  1MVK A;  3R7Q A;  1MHH E;  1YJJ A;  4WIP A;  3ZDM C;  4DQO C;  2WXF A;  4BBN F;  4ACF A;  2KTR B;  4TUU A;  4DXF A;  2V3P A;  1Q1O A;  2WDR B;  2KDB A;  1RAX A;  1LXD A;  2GBM A;  5BYQ A;  5JZE B;  4YT0 B;  1SJE D;  3QC8 B;  2KTR A;  3W1S A;  4B95 A;  3N1Z C;  1PQS A;  2PVG C;  2MBB B;  2KX3 A;  5AUK A;  3MC9 A;  4JL9 A;  2EKE C;  1CMX B;  3X0W A;  3AM9 A;  2C7N B;  3NZS A;  5CTR C;  3BII D;  1XLO A;  2IND C;  4MGZ E;  5FKA C;  1OQQ A;  2Z8L A;  2MJ3 A;  2N9K A;  2GRI A;  2PJH A;  1TBE A;  2LFI A;  2L52 A;  4BBN C;  1YJI A;  3PRM B;  4EZJ A;  3Q69 A;  1E0Z A;  2KAC A;  4P6V F;  1ZOY B;  2LRW A;  1XF5 L;  2MQJ A;  3TUO A;  1K53 A;  4LNI A;  2MA9 B;  4EKU A;  2G3Q B;  4JLC A;  1I42 A;  4DWF A;  1KLV A;  1OGW A;  1NYQ A;  1C4A A;  4OZA A;  2QIE B;  3R2I A;  4MDK E;  1BXT A;  5D6J B;  2IGH A;  1B1Z A;  3VH3 B;  1ACC A;  2H89 B;  2QEJ C;  2WXR A;  3VUX A;  1CZP A;  1F0Z A;  3RCZ A;  1JWB D;  2QMT A;  3AEE B;  3IVF A;  5LXH A;  4II3 B;  2MRP A;  1WFY A;  4K3B A;  4K81 A;  1YN3 A;  5C2T B;  5D94 A;  3JVZ X;  1CQV A;  4E74 A;  4BKS A;  1BT0 A;  2AL6 A;  3PLV A;  1E7P B;  1V49 A;  1WZ3 A;  2ZVO A;  1V2Y A;  2KDM A;  5E6J A;  2BB5 A;  1QOB A;  1TY0 A;  3QAR A;  1PFD A;  3AE4 B;  1FNV A;  5FK9 C;  2AQ3 B;  4I6P A;  1VZ6 A;  3GE8 C;  4KDI C;  5J2R A;  4HDO A;  3A1Q A;  4PK1 A;  4HVB A;  4ZRK A;  3Q8B A;  4ZDV A;  4B9K A;  2NBU A;  3TEY A;  2JZP A;  3W5U B;  1NBF C;  2M8S A;  3I57 A;  4XWT A;  3DPD A;  1F77 A;  3SHQ A;  3NUH B;  2J52 A;  3E56 A;  3MTN B;  3W1Y A;  3L13 A;  4IG7 B;  2KN4 A;  1FRD A;  3U4E G;  3DHG C;  3V6C B;  3GS2 A;  1WJN A;  2WU2 B;  1WH3 A;  4EEW A;  5JHA A;  5BYR A;  4JX1 C;  3Q3J A;  3VRB B;  2L3Z A;  2O6V D;  5BO4 B;  2ZPN A;  3P42 A;  1L6U A;  3RI7 C;  5C3J B;  3UGB B;  3HRD D;  3IT6 B;  3APF A;  5LLI A;  3AE6 B;  2K6D B;  2M19 A;  5AZG A;  4KGS A;  5E6O A;  1WGD A;  4G3X B;  3IFW B;  3B9J A;  4K3C A;  4TQ0 A;  1TS3 A;  2LGY A;  3VR9 B;  3ZNH B;  3BIN A;  2FE8 A;  3RZF A;  1UWM A;  3NVW A;  5JHB A;  2INP E;  3PZ8 A;  1ZDX A;  4OVZ A;  1DYQ A;  3DCG A;  1L0X B;  1YN5 A;  4ZRP A;  3TEW A;  2KAJ A;  1PUT A; 
#chains in the Genus database with same CATH homology
 3N1X C;  3RMK C;  3Q2A C;  4P1B C;  3N1Y C;  3DHG C;  3I5J C;  1T0R C;  3Q3N C;  3RNA C;  3Q3M C;  4P1C C;  2IND C;  1T0Q C;  3RNB C;  3RNG C;  3RNE C;  2RDB C;  3RNC C;  2INC C;  3DHH C;  3RN9 C;  3N1Z C;  3RI7 C;  3GE8 C;  3GE3 C;  3N20 C;  1T0S C;  3I63 C;  3Q3O C;  3Q14 C;  3RNF C;  3DHI C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...