2INDC

Mn(ii) reconstituted toluene/o-xylene monooxygenase hydroxylase x-ray crystal structure
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
83
structure length
83
Chain Sequence
TFPIMSNFERDFVIQLVPVDTEDTMDQVAEKCAYHSINRRVHPQPEKILRVRRHEDGTLFPRGMIVSDAGLRPTETLDIIFMD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structures of manganese(II)-reconstituted and native toluene/o-xylene monooxygenase hydroxylase reveal rotamer shifts in conserved residues and an enhanced view of the protein interior.
pubmed doi rcsb
source organism Pseudomonas stutzeri
molecule tags Oxidoreductase
molecule keywords Toluene, o-xylene monooxygenase oxygenase subunit
total genus 23
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-10-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF06234 TmoB Toluene-4-monooxygenase system protein B (TmoB)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.270 Alpha Beta Roll Ubiquitin-like (UB roll) TmoB-like 2indC00
1T0QC 3Q2AC 2INDC 3GE3C 2INCC 3DHHC 3RMKC 1T0RC 1T0SC 3RI7C 3Q3MC 3DHGC 3I63C 3RNAC 3RNGC 3Q3NC 3DHIC 3RNEC 4P1CC 4P1BC 3N1ZC 3I5JC 3RN9C 3RNFC 3N1XC 3Q14C 3Q3OC 3GE8C 3N1YC 3RNBC 3RNCC 3N20C 2RDBC
chains in the Genus database with same CATH superfamily
4KKIA 3LJ3A 1Q10A 3DBSA 5E6NA 1Q1OA 4FBJB 5H8YE 1YQ3B 2MQJA 4G11A 3A4SC 1JWSD 2G4SA 5DPSA 2QILA 2ONQA 2N0SB 3H9DA 2KAJA 3D32A 4EEWA 2FCQA 2V3SA 4RFBA 1TY2A 2KD0A 4GOCA 4RF1A 1OFFA 2I1JA 3RNAC 3Q3NC 3RNGC 1IYFA 2GBRA 2BB5A 4J6IA 4REZA 2IO2B 3Q8EA 2XK5A 2B3AA 4TUUA 1XXGA 2IO0B 1G6JA 1ZXIA 2C5LC 3B9JA 3IHPC 3UGBB 2IY0B 1DOXA 1V1PB 1QILA 4XC2A 1WZ3A 2KHWB 1UBIA 1WR6E 4PK1A 1R4NB 4YSYB 1F52A 2N1WA 2Q5WD 3LB8C 4C7YA 2HDEA 1FCCC 2LGXA 2CU3A 3SEBA 1MHHE 3ABVB 2HJ8A 1TKGA 3CIRB 1TY0A 2VZKB 3ZLZA 1D6EC 4KIKA 2BS4B 3URYA 4IKGA 3TEWA 2WDQB 2ACZB 4GDLA 1STEA 3ZNZB 3Q8AA 2FUG1 3JVZX 1GC6A 3KYCD 1RAXA 2GBKA 1SE3A 5AZFA 3AEBB 3P2BA 3SR6A 3VRBB 1AW7A 1XT9B 1XLPA 2JZPA 2LGIA 5JHAA 4KKJA 2JRHA 2INDC 3C8YA 2INCC 1TKEA 3OG5A 2MJDA 3AU5A 4MDKE 1I4PA 5IP4D 2KTRB 3W1SA 1TGZB 1D3ZA 1BXTA 1WM2A 1Z2MA 2N9LA 1TS3A 1TBEA 3IG3A 4W9FA 3RNCC 1SE4A 4KDLB 2WXIA 1B9RA 3U7ZA 1K51A 3PSEB 1RYJA 2G1EA 3FAHA 5I4DA 3VUXA 4BAXA 2ZCCA 1V8CA 3UQAA 3PT2B 1E0ZA 2X8XX 4RCOA 5GMVA 2JXTA 1MFWA 1H4RA 1P7FA 2O6VD 1HA5A 3ZNGC 2WS3B 3PZDA 3V05A 3HVDA 5D2MB 4JLCA 4XGAB 3NJTA 1N60A 1IP9A 1J7AA 1E10A 1FFUA 1V80A 3DBRB 1WMHA 2KWVB 2WU2B 4K81A 4LK0M 1I42A 3NVVA 2HD5B 2CHZA 1WX7A 2BKRB 3W1YA 4WWOA 1ET6A 2L3ZA 1MVKA 4ICUA 5JH5C 1VZ8A 2ZNVB 2WGSA 4YTNB 3M63B 2HE7A 1EF1A 4OZBA 1C77A 4TSSA 1CK1A 1C4CA 4HCNB 2CU1A 4BVUC 3TEZA 3AE7B 4FJZA 5MPOA 1FNVA 3V61A 5G55A 1NEKB 5IA7A 5E6PA 4HEA1 4P6VF 2N9KA 3DBLB 4ZRQA 5BYQA 3FC4A 2PE9A 4LDTD 4II3B 2JXXA 3VTUA 2G9HD 1PQSA 2FUHB 1NDDA 3HVZA 3H7SA 2BWFA 2QC8A 2DNFA 3WANA 3RZWC 3GS2A 1XF5L 1KRHA 2XK5B 2QIEB 2V9HA 1KF6B 1PFDA 2MCNB 2K3UA 3RFZB 1GOZA 4NJ7A 1FRDA 3L10B 2V0GA 1YN3A 4IWPA 3VHTC 1IGCA 4WJQA 1V1PA 3U52E 1JCKB 4G0NB 2AQ2B 1MI0A 2NTSA 2WXNA 4ITKA 3P1MA 2KWCA 1I4HA 3E56A 3HHMA 2KTFA 1DOIA 4MACA 3PRZA 3Q3FA 2L00B 2IDYA 3JYUA 3CMMB 2J4XA 4KSKC 4ANWA 3APFA 4EOYA 1EM7A 2INNE 3ENEA 1L4ZB 2FIDA 2K25A 2FIFA 3EFCA 4GIVA 4RH6A 4US8A 4WIPA 5DPWA 2KT7A 3DBRI 2DZJA 3U30A 1UWXA 4B0EA 1PYWD 4DDGD 3NVWA 1TIFA 4DXFA 2RSUA 2D07B 2MJ3A 2EMTA 1UD7A 1SGHA 1TKYA 1WF9A 1RRBA 4JWUC 5D7GA 2SAKA 4EZJA 3NUHB 1UUPA 1OEYJ 2QDFA 2KTRA 3DVNU 1NYRA 4JPSA 4MELA 5FR3A 3DPDA 1AWDA 4FA6A 2J0KA 4GMVA 2WX0A 1F1HA 4HVBA 1FNWA 4PS8A 1KLVA 3T3OA 2ZW0A 3WAOA 3IXSA 2ZPNA 3R3MA 3AEEB 4WJNA 3H1UA 3QWZB 2MW5A 4C00A 5D3DA 2MA9B 3Q2AC 3TL5A 2NBWB 3ZXVA 2WX1A 1WY8A 3JW0X 3KWVA 4DXAB 1PGBA 5L95C 3N30A 2V3NA 3Q3JA 1N61A 1F9JA 4GN1A 1UGJA 4NPNA 1R4MB 3VFKA 1NI3A 1YQ4B 5EE3A 4II2B 2IGHA 2D10A 4DK5A 3T8MA 4HKQA 4BKTA 1YNTE 4ZRJA 3QAQA 3GB1A 4A9AA 2YEPB 3Q69A 2H88B 5DPRA 5AZGA 3U4EG 4WAAA 1VZ6A 3RMKC 4JGHB 2BS2B 3BYTB 2J53A 3BVGA 1ZW7A 2BVCA 3RULA 1FPYA 4EFOA 1V97A 3KWLA 1L0YB 2JVCA 3VH4B 2W9NA 1J8CA 1M4VA 4JE3B 2GI9A 2JZZA 1WGDA 3FILA 1XO3A 1BMLC 2GB1A 3ZNHB 1T0SC 1HZ6A 1KFYB 1YJIA 1F0ZA 2KACA 1PUTA 4DXGA 2AEHA 5IOIA 5BMIA 4ARIA 1XD3B 3QIJA 3ZGZA 1JWMD 1YD8U 2IO3B 3GP7A 2KO3A 3DCGA 4BBNC 3X0WA 2MBOA 3W5VB 1XLOA 2IBIB 3TJPA 4XX5A 2LFIA 4WQOB 1C1YB 2DENB 4EKUA 1MPEA 2AX5A 3R66C 2K1FA 2EELA 3AECB 3GOEA 2BF8B 1WI0A 2LXCA 4W9IA 4A3PA 2KDBA 2N9XA 4DHJB 3R7RA 4K7UA 4WWPA 4E71A 1XQQA 1GNUA 3TCAA 1KJTA 1WGYA 5J2RA 1E90A 1YMHE 1NENB 3DQVA 3NHEB 4ZRPA 1V5OA 2KJRA 1OEYA 1WSPA 4E74A 3K9PB 3QA8A 2KX3A 2R2OA 2JSVX 1UGMA 2QJLA 3KUCB 2D11A 3RNBC 1QT9A 2J0JA 3M62B 4B9KA 5JZEB 1YJJA 4UDUC 2KOXA 5FK9C 1K8RB 3ZJUA 1VR9A 1L2NA 1WGHA 4M01A 2CR5A 3APDA 2PIAA 1JALA 5FR6A 3CSFA 2CKHB 3LYYA 4HJGE 1YIWA 3E9SA 1I7HA 5C23A 3DDCB 2QCZA 2ICIA 2O2VB 2FCSA 3AEAB 3SFEB 3TUOA 3KW5B 1PGXA 3P4PB 4LCDE 3SD5A 4PYUA 1HZ5A 2ZEQA 2VH2A 1E8XA 1JWBD 3V6CB 1JW9D 2FCMA 4XDDA 4HPMB 3PRPB 2Z8LA 4KIKB 3AE6B 4FXCA 4F7ZA 3U8ZA 5TSSA 2RR9A 3L13A 3I63C 2OHFA 3ZRCA 4IWQA 3AE5B 3AEGB 1FEHA 2LEKA 3PREA 2A5UA 2N9PC 5C3JB 4DHJD 2FBWB 1GB4A 5J18A 2LRUA 3BK2A 4X57B 4XWWA 2J52A 4JIOU 1VLBA 3ECIA 5EDSA 1S3SG 2WXLA 4RM8A 1V49A 3ZTCA 2AL6A 4D2KA 1D5XC 2YVCA 2N4FA 1WGGA 1E9MA 2C7NB 2CJNA 2BYVE 2M17A 4ZYNA 3RNFC 2JX5A 1YN4A 2LHDA 3Q3OC 4N59A 2GRIA 1HXYD 2BS3B 4Q2JA 1D5MC 1EUVB 2K9XA 4MH0E 4BKSD 3WIMA 4A8XC 2D3AA 5BYSA 4US9A 3NS1A 1IPGA 3L0WB 1LFDA 4AS1A 2L05A 2N9EB 4XZ4A 3T3NA 2L52A 4J3OD 4ANXA 2QEJC 3V62A 3W5UB 1SE2A 3MHSD 1WJ6A 3ZJVA 2LJ5A 3MJWA 5C2TB 2M1MA 1FD6A 2PMVA 3J9CA 2C60A 4A6QA 1E8WA 3WA0A 1ESFA 2LVPA 2KDEB 2UU7A 4N9F4 4ASWC 2GLSA 3O65B 2MBHA 1FRRA 3OWEB 4HCPB 2W3SA 2Y5CA 3AE2B 3R7QA 4O1NA 2K8BA 1HTQA 2DLBA 3ZVVA 3ZW3A 2DWQA 2RPVA 4A90A 1KM7A 4M8MA 2KX0A 5IO9A 2R2QA 3AM9A 2PVOD 4RMAA 1WX8A 3BY4B 3ML8A 4LNNA 3ML9A 1UZXB 4HROA 3APCA 2ZCBA 2ZVOA 4OVUA 1TYGB 4HPLB 1GAQB 3MJ5A 4ZRIA 3PZ7A 1JWUD 1VD2A 4L23A 4IC7B 2ZZPB 1B1ZA 1K52A 1OQQA 2D3CA 2LVOA 1XEEA 2QHOA 3ONSA 2DYMA 1LM8B 4DBGA 2FCNA 3MP9A 3UF8A 2LXAA 1A70A 3A9KA 1SXTA 2ON8A 2M0AA 1FXIA 2MBQA 3V3XA 1UWMA 3DWGC 1CMXB 2KDMA 2KWUB 1KH0A 2IO1B 3HUIA 4WWMA 1WJ4A 2NR2A 2C7HA 2LASA 1A5RA 1WR1A 3Q8FA 4K7SA 4FLHA 2YLMA 2WDTB 3ZDTA 2N7JA 3HIZA 3AULA 2NS5A 3P4RB 2NVUI 2REXA 3HM6X 1V6EA 5LLIA 1WWTA 1YQBA 1ZE3D 4JX1C 2DYOA 3EHVA 4GLSC 2UYZB 3VR9B 4CYEA 3H6NA 2PTLA 1FCLA 4W9JA 5JXVA 4HJKA 3DVNV 3UIOB 1C4PA 2W55A 1GC7A 4FULA 1HTOA 1WE6A 5HKHA 1E7UA 4A20A 1ENFA 1L0XB 1WRDB 2LMCA 3M95A 3Q6BA 3PHWB 2BGFA 1I35A 2KMAA 2D5GA 3AV8A 3VQIA 4YWGG 4PS7A 2L7RA 2WXJA 3N20C 4KVGB 1S1QB 1P9DU 1ZKHA 4L1BA 2JYEA 2JUOA 4DDID 4URKA 4ANVA 4DQOC 1OGWA 1N5WA 1L7YA 2KMCA 3DWMA 3UQBA 3ZIMA 1SJHD 2L83A 3H7PA 3JSVA 1NBFC 2D3BA 2KYWA 1EWYC 4XWTA 4YSXB 2Y3AA 2XBBC 4MGIE 2LWPA 2K6DB 2WXPA 1JWAD 2A4ZA 1E8ZA 2TSSA 2BW2A 1F77A 3DBHB 4P1BC 3H8HA 2KNBA 1YX6B 2CS4A 3AH7A 1JRPA 3Q8BA 2MH7A 4MSQB 2AQ3B 3DBLI 2CHXA 3IAS1 1K50A 3HK0A 3M3JA 2G4DB 4BBNF 4OW0A 2ASQA 2X38A 2AQ1B 4HKZE 1XCQL 4EZLA 5CHVC 1T0RC 4ZRKA 1N5XA 1WXQA 2OJRA 2KLCA 3OLMD 1MG8A 4GXBA 4IUMB 5D94A 4KSLC 2V3PA 1QOGA 1M94A 2C7MB 2WXGA 3DBHI 3BWUD 3RI7C 2L0TA 1LXDA 1UELA 1HEZE 4H2AA 2Z0EB 1N62A 1F2RI 1SB3C 4F1SA 3Q14C 4K3CA 1LGRA 1E5WA 1EF5A 1R4MI 4EZKA 2MBEA 2E3TA 1C9FA 2NTTA 3IVFA 4RM9A 3T9LA 3A9KB 2R61A 2I1KA 4W9KA 2KC1A 4AJYB 3BIID 3V6EB 1T3QA 3KVFB 2RD0A 2I38A 2KFKA 3PLUA 2INPE 3LXFA 3WAPA 3IAM1 4ANUA 2FAZA 2LUMA 3NOBA 1WXMA 2OJWA 4BZAA 5D6JB 4GGQA 2M19A 2D2QA 2V1YA 3WAMA 2G3QB 3GE3C 2EMSA 1XLQA 2YEPF 5AZHA 2FNJB 2IJ0A 2BYFA 4BFRA 4M0WA 5TR5A 4G50A 4FHKA 3IBEA 3MC8A 3P4QB 1U4AA 3EUB2 4BOZB 1L6VA 1EO6A 4CHKA 5AUKA 4A55A 5HI1A 2OEDA 3AEFB 5JHBA 1L6UA 2UWQA 4CO7A 1CQVA 1P98A 4C4VA 3NZ3A 1UBQA 3AB5A 3AE9B 1HE8A 4NY0A 2MJEA 4MGKE 3HRDD 3R2TA 1IUEA 2LI5A 4KGRA 2JY6A 1I4RA 1N6ZA 1OQRA 2IZVB 3BINA 1R7SA 4WURA 2RGFA 2KKCA 1N63A 4GB9A 5C1ZA 3NZSA 1KLGD 1MJDA 2N7DA 1WE7A 3OJ3A 2O2VA 3TBLD 3NZUA 3LDZE 4HDOA 3ZJTA 2XN9C 1ZOYB 3JSVB 1TJEA 1UH6A 3PV1A 4YL8A 1WM3A 4W9CA 2WNMA 4GDKB 2NBUA 1LO5D 2LGDA 2H89B 3RZFA 2PJHA 2KQ4X 4MGZE 2WXFA 2DZKA 3P42A 2GBJA 3PO0A 3VTVA 5G5GA 1IBXA 2JRIB 2DHZA 4M02A 3QJZA 1Y56A 2JWUA 1NVID 4ZOHC 4IOIE 4GU2A 4W9GA 1FXAA 1TS4A 3P63A 1C79A 3EECA 3QQ8B 1RWSA 3TEXA 4N58A 4HXDA 3W2DA 3I5JC 3NY5A 5HG2A 2DAJA 1J0GA 1LQBA 4NAMA 4RGOS 1V86A 4FJYA 2RPQA 3KQ4A 2WXRA 1SIFA 5G2NA 4HRSA 2V4IB 1OQYA 1P0RA 3WALA 4OZCA 4RGMA 4WH4A 2WXHA 4JQWC 2Y5BB 3UINB 4RF0A 2FE8A 4ZHOA 3C0RB 4IM2A 2VZKD 2WU5B 3VUWA 2JU6X 3BK1A 4KDIC 3DOWA 3KH0A 1C78A 4TQ1A 1J19A 2Y5PA 2WLBA 1P7EA 4RGNA 1QOBA 4DHZE 2LZ6A 3EFUA 1X1MA 2IY1B 2QSDA 1WX9A 4L2YA 4LTUA 1CJEA 3I9V1 3SFDB 2MBBB 4ACFA 4W9HA 1E7VA 4BOSC 5FKAC 1TZ1A 4C56C 3AE4B 3W1SC 3VUYA 1WXSA 4XYCA 3NRZA 4KGSA 2MSED 1QLBB 4HDQA 2J0MA 3AI5A 3N3KB 2LJIA 2OOBB 2WDRB 3QX1A 4C4VB 4GSWA 2CHWA 4FHJA 1WJNA 4NAWB 4W9DA 2MP2A 2KN4A 2ZNVC 1QOFA 4TKNA 2M4NA 1JQ4A 1QF6A 4PT5A 3AXCA 2JZ3B 5BMHA 1AN8A 1P3QU 3DHIC 3DVGY 5CHWA 2K6QA 2J7QB 1SJED 2NPTB 2N1VA 3DVGX 4HWIB 3KUDB 1NYQA 5AUIA 1FO4A 1GPXA 3VAWA 3X23A 1DOYA 5E6JA 3P4SB 2KWDA 2IPKD 2JWZA 1SF0A 2MX2A 1JMLA 1SBBB 2PVGC 1AARA 3UIPB 3TMPB 4P16A 2DAFA 3VH3B 1WXAA 2KMMA 1IGDA 4B6WA 1IBXB 3O13A 2K39A 4MH8A 2KK8A 4OVVA 4YTMB 2WP9B 4NQLB 4RGTA 2Z0DB 4EE2A 5LXIB 2KJ6A 1TZOA 2GOWA 3MC9A 2SEBD 1C76A 5E6OA 1Z5SB 2O6VB 2ZPYA 5H92C 3MTNB 3VXWA 1EU3A 5KHQA 4ZYSA 3QARA 2KDIA 2WYQA 4LNIA 5EE1A 3RYTA 2WWZA 1TTNA 4KV2A 5EE9A 4AQ7A 2PE6B 2L1AA 4BKSA 5HHDG 2ZVNA 2EKEC 3DHGC 4K1RB 3H7PB 5KHOA 1DGJA 5HFYA 3A4RA 4MGYE 2K0PA 1WIAA 1P1AA 3IFWB 3VTWA 1RFKA 3PS6A 1CZPA 5J17A 2PKOA 2K22A 2DYBA 3EA6A 4PS3A 4IG7B 1WRIA 4K7WA 3N1ZC 3AEDB 4CQNA 1TT5B 1GJZA 2BB6A 2M0XA 3QC8B 2AYOB 4LNOA 3VR8B 2K8CA 5L83A 4NZLB 3RT3B 2RDBC 3AU4A 3PLVA 2JQRB 3L08A 2KFJA 2KC2A 4FJVB 4QAYA 4TV3A 4AUQC 3IT6B 4LNKA 2LVQA 2BBCA 2MLBA 1AYFA 4AWJA 2PW9A 2XNAC 1E7PB 4FADA 5DCNA 2RMMA 1WJUA 3PTFC 2G45B 3CSTA 2PLPA 3GZNI 2K5PA 1D5ZC 2L76A 2BYTA 4M00A 5AEKB 2IGDA 3RN9C 1XCTL 3W9CB 5BYRA 1C3TA 2BPSA 1T6BX 1ACCA 3ZDMC 4YT0B 4IM0A 4NAWA 2KDFB 2VRRB 2MP2B 4G3XB 3VRAB 1XLNA 4BKGA 2JT4B 2E6XA 1ZDXA 4HK2A 3NS8A 4W9LA 3ZUNA 5CTRC 4S0RA 3UI3A 3DHHC 1GUAB 2WXKA 2B76B 3TSSA 1JRUA 4GDLB 4YTPB 3ZQ4A 2KFKB 1T0YA 3ZXRA 2MRPA 3R8BA 2L0FA 1KOTA 2M8SA 5CX3A 3B0AA 4M8NA 4AOFA 3KLSX 2W54A 1V9JA 1ZUD2 3PVLA 4HLEA 3A9JB 2HJ1A 2KZRA 4M0WB 3ZNID 4B0MA 2J42A 3I57A 3PPAA 2L8JA 1TS5A 3BZDB 3B08A 4R3DA 2IYDB 5D3IB 3SDLC 1SEBD 3K9OB 4S17A 2AWTA 1JROA 1ZDVA 5EE0A 4LJOB 4N6EB 4WWNA 3OJ4B 4A3OA 4DWFA 4PYZA 3BYYB 1ROEA 3ZO5B 3VDZA 2I2YA 3N9YC 3QCAA 1BT0A 2MEKA 3KUZA 3ZKJC 2AL3A 4MJSB 1E6EB 1J7CA 1YN5A 2C9WB 2RDHA 1QQRA 2W3RA 4KZCA 1SSNA 1T5XD 4K3BA 1QZEA 4OHJA 3ZTDA 2WHIA 1RFAA 5IAAC 4TMAB 4I6LB 1MG4A 3GZNB 1WGRA 2K8HA 3BVZA 1V2YA 1ET9A 4GDKA 3U2SC 1I4XA 3ZRFA 1FXTB 1ZXHA 3FKYA 1WYWB 1V81A 1QKZA 1D4BA 4DHZB 4W9EA 4NJCA 1SIJA 3OAWA 3B2FA 3GE8C 4WJPA 3AMZA 4LNFA 1FM0D 2M56B 3RD2A 4LLGM 4OZAA 2WQYB 2DBYA 2HTHA 1Y8RC 3EGRA 3RCZA 1ZPSA 1WH3A 3ALBA 2MHJA 4TQ0A 3SHQA 2QMTA 4JWSC 2PEAA 1H8CA 1YX5B 3Q8CA 5IKCM 3L4PA 4ARCA 1V5TA 2VH1A 2CJOA 1E8YA 1WYGA 3TIXA 3PRMB 1V1OA 4LJPB 3RUIB 3AN1A 1Q5WB 4HPPA 2KN5A 1ISNA 1MHXA 2NMQA 2LRWA 4NQKE 4ZDVA 2KLGA 2KANA 1L4DB 4IWOA 4IM3A 3AE8B 2MWSB 2KVZA 3A1QB 1KLUD 4XDCA 2BQQA 4USAA 4MM3A 3WCQA 2KVRA 3B2GA 1FMAD 3L17A 1WGKA 1ZGUB 4WAFA 5BMGA 4JL9A 1KTKA 3PZ8A 2ZJDA 3CWIA 2L32A 1L0VB 3RPFC 3MHZA 2WXOA 3AE3B 3V60A 3N1YC 3AE1B 1QOAA 4ZHPA 4I6NB 2BTEA 5BO4B 2BT6A 4KX6B 1FFVA 4KGTA 2GBNA 2HTME 3NVZA 2RDGA 1WXVA 1VCBA 3IT4B 4RNAA 2D3GA 2IGGA 3A9JA 3NVYA 1I4GA 4YXDB 5T8IA 2WXMA 2WDVB 1VDVA 1GG3A 2NBVB 4YSZB 4AJWA 3EC8A 1RM6C 2XEWA 3SU8X 1HQRD 4MT5A 5CHFA 1F2RC 1EWCA 2DX5B 4LDTB 3RNEC 4P1CC 4WJOA 3NG0A 4FN2A 3CF6E 4MEMA 2LHEA 2LGYA 1C4AA 4KZ0A 4MJSA 2BYEA 1Q0WB 2GBMA 1OTRB 1FIQA 2KQSA 2JYTA 3PGEA 3L54A 2KQ7A 1GB1A 5GXGB 3B1LX 1DYQA 1WZ0A 5LNK1 2WXQA 2BKFA 2NPTA 1RLFA 3N32A 4C80A 1YOVB 3S2AA 4MSMB 3ZYYX 4WQMA 4IDIA 2KJHB 3MC0B 3HM3A 2JPHA 1PGAA 2EKIA 3BVMA 5G5HA 4AP4C 2LD9A 4P7IA 3TEYA 2PPHA 2KXJA 4I6PA 3L16A 4E3CA 4IW0A 1PDXA 2JF5A 2V4LA 5LXHA 4F8CB 3MFGA 3PHXB 2BWES 1FNUA 2ZW1A 2N7EA 5IN7A 1J7BA 3U7DA 3FILB 1VJKA 2DZIA 3C19A 4B95A 4EUTA 2GMIC 1EU4A 3A33B 2DZMA 3Q3MC 3QHTA 4C7ZA 4NJ6A 1UNSA 1VZ7A 2O6VA 3KYDD 1ZP0B 3I3TB 2W82A 2LGSA 1T0QC 1UF0A 3QK0A 1VRAB 1WFYA 1SE9A 2Z59B 2LUEA 4OVZA 3ETRA 1L5PA 1WMHB 4NNJB 5DPTA 1NI2A 1R4NI 1TS2A 2NCNA 3N1XC 4ICVA 3A1QA 1I4QA 1BUIC 4XE0A 1K53A 3VVWB 1YJ1A 3R2IA 4MM3B
chains in the Genus database with same CATH topology
1T0QC 3Q2AC 2INDC 3GE3C 2INCC 3DHHC 3RMKC 1T0RC 1T0SC 3RI7C 3Q3MC 3DHGC 3I63C 3RNAC 3RNGC 3Q3NC 3DHIC 3RNEC 4P1CC 4P1BC 3N1ZC 3I5JC 3RN9C 3RNFC 3N1XC 3Q14C 3Q3OC 3GE8C 3N1YC 3RNBC 3RNCC 3N20C 2RDBC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T0Q C;  3Q2A C;  2IND C;  3GE3 C;  2INC C;  3DHH C;  3RMK C;  1T0R C;  1T0S C;  3RI7 C;  3Q3M C;  3DHG C;  3I63 C;  3RNA C;  3RNG C;  3Q3N C;  3DHI C;  3RNE C;  4P1C C;  4P1B C;  3N1Z C;  3I5J C;  3RN9 C;  3RNF C;  3N1X C;  3Q14 C;  3Q3O C;  3GE8 C;  3N1Y C;  3RNB C;  3RNC C;  3N20 C;  2RDB C; 
#chains in the Genus database with same CATH topology
 4KKI A;  3LJ3 A;  1Q10 A;  3DBS A;  5E6N A;  1Q1O A;  4FBJ B;  5H8Y E;  1YQ3 B;  2MQJ A;  4G11 A;  3A4S C;  1JWS D;  2G4S A;  5DPS A;  2QIL A;  2ONQ A;  2N0S B;  3H9D A;  2KAJ A;  3D32 A;  4EEW A;  2FCQ A;  2V3S A;  4RFB A;  1TY2 A;  2KD0 A;  4GOC A;  4RF1 A;  1OFF A;  2I1J A;  3RNA C;  3Q3N C;  3RNG C;  1IYF A;  2GBR A;  2BB5 A;  4J6I A;  4REZ A;  2IO2 B;  3Q8E A;  2XK5 A;  2B3A A;  4TUU A;  1XXG A;  2IO0 B;  1G6J A;  1ZXI A;  2C5L C;  3B9J A;  3IHP C;  3UGB B;  2IY0 B;  1DOX A;  1V1P B;  1QIL A;  4XC2 A;  1WZ3 A;  2KHW B;  1UBI A;  1WR6 E;  4PK1 A;  1R4N B;  4YSY B;  1F52 A;  2N1W A;  2Q5W D;  3LB8 C;  4C7Y A;  2HDE A;  1FCC C;  2LGX A;  2CU3 A;  3SEB A;  1MHH E;  3ABV B;  2HJ8 A;  1TKG A;  3CIR B;  1TY0 A;  2VZK B;  3ZLZ A;  1D6E C;  4KIK A;  2BS4 B;  3URY A;  4IKG A;  3TEW A;  2WDQ B;  2ACZ B;  4GDL A;  1STE A;  3ZNZ B;  3Q8A A;  2FUG 1;  3JVZ X;  1GC6 A;  3KYC D;  1RAX A;  2GBK A;  1SE3 A;  5AZF A;  3AEB B;  3P2B A;  3SR6 A;  3VRB B;  1AW7 A;  1XT9 B;  1XLP A;  2JZP A;  2LGI A;  5JHA A;  4KKJ A;  2JRH A;  2IND C;  3C8Y A;  2INC C;  1TKE A;  3OG5 A;  2MJD A;  3AU5 A;  4MDK E;  1I4P A;  5IP4 D;  2KTR B;  3W1S A;  1TGZ B;  1D3Z A;  1BXT A;  1WM2 A;  1Z2M A;  2N9L A;  1TS3 A;  1TBE A;  3IG3 A;  4W9F A;  3RNC C;  1SE4 A;  4KDL B;  2WXI A;  1B9R A;  3U7Z A;  1K51 A;  3PSE B;  1RYJ A;  2G1E A;  3FAH A;  5I4D A;  3VUX A;  4BAX A;  2ZCC A;  1V8C A;  3UQA A;  3PT2 B;  1E0Z A;  2X8X X;  4RCO A;  5GMV A;  2JXT A;  1MFW A;  1H4R A;  1P7F A;  2O6V D;  1HA5 A;  3ZNG C;  2WS3 B;  3PZD A;  3V05 A;  3HVD A;  5D2M B;  4JLC A;  4XGA B;  3NJT A;  1N60 A;  1IP9 A;  1J7A A;  1E10 A;  1FFU A;  1V80 A;  3DBR B;  1WMH A;  2KWV B;  2WU2 B;  4K81 A;  4LK0 M;  1I42 A;  3NVV A;  2HD5 B;  2CHZ A;  1WX7 A;  2BKR B;  3W1Y A;  4WWO A;  1ET6 A;  2L3Z A;  1MVK A;  4ICU A;  5JH5 C;  1VZ8 A;  2ZNV B;  2WGS A;  4YTN B;  3M63 B;  2HE7 A;  1EF1 A;  4OZB A;  1C77 A;  4TSS A;  1CK1 A;  1C4C A;  4HCN B;  2CU1 A;  4BVU C;  3TEZ A;  3AE7 B;  4FJZ A;  5MPO A;  1FNV A;  3V61 A;  5G55 A;  1NEK B;  5IA7 A;  5E6P A;  4HEA 1;  4P6V F;  2N9K A;  3DBL B;  4ZRQ A;  5BYQ A;  3FC4 A;  2PE9 A;  4LDT D;  4II3 B;  2JXX A;  3VTU A;  2G9H D;  1PQS A;  2FUH B;  1NDD A;  3HVZ A;  3H7S A;  2BWF A;  2QC8 A;  2DNF A;  3WAN A;  3RZW C;  3GS2 A;  1XF5 L;  1KRH A;  2XK5 B;  2QIE B;  2V9H A;  1KF6 B;  1PFD A;  2MCN B;  2K3U A;  3RFZ B;  1GOZ A;  4NJ7 A;  1FRD A;  3L10 B;  2V0G A;  1YN3 A;  4IWP A;  3VHT C;  1IGC A;  4WJQ A;  1V1P A;  3U52 E;  1JCK B;  4G0N B;  2AQ2 B;  1MI0 A;  2NTS A;  2WXN A;  4ITK A;  3P1M A;  2KWC A;  1I4H A;  3E56 A;  3HHM A;  2KTF A;  1DOI A;  4MAC A;  3PRZ A;  3Q3F A;  2L00 B;  2IDY A;  3JYU A;  3CMM B;  2J4X A;  4KSK C;  4ANW A;  3APF A;  4EOY A;  1EM7 A;  2INN E;  3ENE A;  1L4Z B;  2FID A;  2K25 A;  2FIF A;  3EFC A;  4GIV A;  4RH6 A;  4US8 A;  4WIP A;  5DPW A;  2KT7 A;  3DBR I;  2DZJ A;  3U30 A;  1UWX A;  4B0E A;  1PYW D;  4DDG D;  3NVW A;  1TIF A;  4DXF A;  2RSU A;  2D07 B;  2MJ3 A;  2EMT A;  1UD7 A;  1SGH A;  1TKY A;  1WF9 A;  1RRB A;  4JWU C;  5D7G A;  2SAK A;  4EZJ A;  3NUH B;  1UUP A;  1OEY J;  2QDF A;  2KTR A;  3DVN U;  1NYR A;  4JPS A;  4MEL A;  5FR3 A;  3DPD A;  1AWD A;  4FA6 A;  2J0K A;  4GMV A;  2WX0 A;  1F1H A;  4HVB A;  1FNW A;  4PS8 A;  1KLV A;  3T3O A;  2ZW0 A;  3WAO A;  3IXS A;  2ZPN A;  3R3M A;  3AEE B;  4WJN A;  3H1U A;  3QWZ B;  2MW5 A;  4C00 A;  5D3D A;  2MA9 B;  3Q2A C;  3TL5 A;  2NBW B;  3ZXV A;  2WX1 A;  1WY8 A;  3JW0 X;  3KWV A;  4DXA B;  1PGB A;  5L95 C;  3N30 A;  2V3N A;  3Q3J A;  1N61 A;  1F9J A;  4GN1 A;  1UGJ A;  4NPN A;  1R4M B;  3VFK A;  1NI3 A;  1YQ4 B;  5EE3 A;  4II2 B;  2IGH A;  2D10 A;  4DK5 A;  3T8M A;  4HKQ A;  4BKT A;  1YNT E;  4ZRJ A;  3QAQ A;  3GB1 A;  4A9A A;  2YEP B;  3Q69 A;  2H88 B;  5DPR A;  5AZG A;  3U4E G;  4WAA A;  1VZ6 A;  3RMK C;  4JGH B;  2BS2 B;  3BYT B;  2J53 A;  3BVG A;  1ZW7 A;  2BVC A;  3RUL A;  1FPY A;  4EFO A;  1V97 A;  3KWL A;  1L0Y B;  2JVC A;  3VH4 B;  2W9N A;  1J8C A;  1M4V A;  4JE3 B;  2GI9 A;  2JZZ A;  1WGD A;  3FIL A;  1XO3 A;  1BML C;  2GB1 A;  3ZNH B;  1T0S C;  1HZ6 A;  1KFY B;  1YJI A;  1F0Z A;  2KAC A;  1PUT A;  4DXG A;  2AEH A;  5IOI A;  5BMI A;  4ARI A;  1XD3 B;  3QIJ A;  3ZGZ A;  1JWM D;  1YD8 U;  2IO3 B;  3GP7 A;  2KO3 A;  3DCG A;  4BBN C;  3X0W A;  2MBO A;  3W5V B;  1XLO A;  2IBI B;  3TJP A;  4XX5 A;  2LFI A;  4WQO B;  1C1Y B;  2DEN B;  4EKU A;  1MPE A;  2AX5 A;  3R66 C;  2K1F A;  2EEL A;  3AEC B;  3GOE A;  2BF8 B;  1WI0 A;  2LXC A;  4W9I A;  4A3P A;  2KDB A;  2N9X A;  4DHJ B;  3R7R A;  4K7U A;  4WWP A;  4E71 A;  1XQQ A;  1GNU A;  3TCA A;  1KJT A;  1WGY A;  5J2R A;  1E90 A;  1YMH E;  1NEN B;  3DQV A;  3NHE B;  4ZRP A;  1V5O A;  2KJR A;  1OEY A;  1WSP A;  4E74 A;  3K9P B;  3QA8 A;  2KX3 A;  2R2O A;  2JSV X;  1UGM A;  2QJL A;  3KUC B;  2D11 A;  3RNB C;  1QT9 A;  2J0J A;  3M62 B;  4B9K A;  5JZE B;  1YJJ A;  4UDU C;  2KOX A;  5FK9 C;  1K8R B;  3ZJU A;  1VR9 A;  1L2N A;  1WGH A;  4M01 A;  2CR5 A;  3APD A;  2PIA A;  1JAL A;  5FR6 A;  3CSF A;  2CKH B;  3LYY A;  4HJG E;  1YIW A;  3E9S A;  1I7H A;  5C23 A;  3DDC B;  2QCZ A;  2ICI A;  2O2V B;  2FCS A;  3AEA B;  3SFE B;  3TUO A;  3KW5 B;  1PGX A;  3P4P B;  4LCD E;  3SD5 A;  4PYU A;  1HZ5 A;  2ZEQ A;  2VH2 A;  1E8X A;  1JWB D;  3V6C B;  1JW9 D;  2FCM A;  4XDD A;  4HPM B;  3PRP B;  2Z8L A;  4KIK B;  3AE6 B;  4FXC A;  4F7Z A;  3U8Z A;  5TSS A;  2RR9 A;  3L13 A;  3I63 C;  2OHF A;  3ZRC A;  4IWQ A;  3AE5 B;  3AEG B;  1FEH A;  2LEK A;  3PRE A;  2A5U A;  2N9P C;  5C3J B;  4DHJ D;  2FBW B;  1GB4 A;  5J18 A;  2LRU A;  3BK2 A;  4X57 B;  4XWW A;  2J52 A;  4JIO U;  1VLB A;  3ECI A;  5EDS A;  1S3S G;  2WXL A;  4RM8 A;  1V49 A;  3ZTC A;  2AL6 A;  4D2K A;  1D5X C;  2YVC A;  2N4F A;  1WGG A;  1E9M A;  2C7N B;  2CJN A;  2BYV E;  2M17 A;  4ZYN A;  3RNF C;  2JX5 A;  1YN4 A;  2LHD A;  3Q3O C;  4N59 A;  2GRI A;  1HXY D;  2BS3 B;  4Q2J A;  1D5M C;  1EUV B;  2K9X A;  4MH0 E;  4BKS D;  3WIM A;  4A8X C;  2D3A A;  5BYS A;  4US9 A;  3NS1 A;  1IPG A;  3L0W B;  1LFD A;  4AS1 A;  2L05 A;  2N9E B;  4XZ4 A;  3T3N A;  2L52 A;  4J3O D;  4ANX A;  2QEJ C;  3V62 A;  3W5U B;  1SE2 A;  3MHS D;  1WJ6 A;  3ZJV A;  2LJ5 A;  3MJW A;  5C2T B;  2M1M A;  1FD6 A;  2PMV A;  3J9C A;  2C60 A;  4A6Q A;  1E8W A;  3WA0 A;  1ESF A;  2LVP A;  2KDE B;  2UU7 A;  4N9F 4;  4ASW C;  2GLS A;  3O65 B;  2MBH A;  1FRR A;  3OWE B;  4HCP B;  2W3S A;  2Y5C A;  3AE2 B;  3R7Q A;  4O1N A;  2K8B A;  1HTQ A;  2DLB A;  3ZVV A;  3ZW3 A;  2DWQ A;  2RPV A;  4A90 A;  1KM7 A;  4M8M A;  2KX0 A;  5IO9 A;  2R2Q A;  3AM9 A;  2PVO D;  4RMA A;  1WX8 A;  3BY4 B;  3ML8 A;  4LNN A;  3ML9 A;  1UZX B;  4HRO A;  3APC A;  2ZCB A;  2ZVO A;  4OVU A;  1TYG B;  4HPL B;  1GAQ B;  3MJ5 A;  4ZRI A;  3PZ7 A;  1JWU D;  1VD2 A;  4L23 A;  4IC7 B;  2ZZP B;  1B1Z A;  1K52 A;  1OQQ A;  2D3C A;  2LVO A;  1XEE A;  2QHO A;  3ONS A;  2DYM A;  1LM8 B;  4DBG A;  2FCN A;  3MP9 A;  3UF8 A;  2LXA A;  1A70 A;  3A9K A;  1SXT A;  2ON8 A;  2M0A A;  1FXI A;  2MBQ A;  3V3X A;  1UWM A;  3DWG C;  1CMX B;  2KDM A;  2KWU B;  1KH0 A;  2IO1 B;  3HUI A;  4WWM A;  1WJ4 A;  2NR2 A;  2C7H A;  2LAS A;  1A5R A;  1WR1 A;  3Q8F A;  4K7S A;  4FLH A;  2YLM A;  2WDT B;  3ZDT A;  2N7J A;  3HIZ A;  3AUL A;  2NS5 A;  3P4R B;  2NVU I;  2REX A;  3HM6 X;  1V6E A;  5LLI A;  1WWT A;  1YQB A;  1ZE3 D;  4JX1 C;  2DYO A;  3EHV A;  4GLS C;  2UYZ B;  3VR9 B;  4CYE A;  3H6N A;  2PTL A;  1FCL A;  4W9J A;  5JXV A;  4HJK A;  3DVN V;  3UIO B;  1C4P A;  2W55 A;  1GC7 A;  4FUL A;  1HTO A;  1WE6 A;  5HKH A;  1E7U A;  4A20 A;  1ENF A;  1L0X B;  1WRD B;  2LMC A;  3M95 A;  3Q6B A;  3PHW B;  2BGF A;  1I35 A;  2KMA A;  2D5G A;  3AV8 A;  3VQI A;  4YWG G;  4PS7 A;  2L7R A;  2WXJ A;  3N20 C;  4KVG B;  1S1Q B;  1P9D U;  1ZKH A;  4L1B A;  2JYE A;  2JUO A;  4DDI D;  4URK A;  4ANV A;  4DQO C;  1OGW A;  1N5W A;  1L7Y A;  2KMC A;  3DWM A;  3UQB A;  3ZIM A;  1SJH D;  2L83 A;  3H7P A;  3JSV A;  1NBF C;  2D3B A;  2KYW A;  1EWY C;  4XWT A;  4YSX B;  2Y3A A;  2XBB C;  4MGI E;  2LWP A;  2K6D B;  2WXP A;  1JWA D;  2A4Z A;  1E8Z A;  2TSS A;  2BW2 A;  1F77 A;  3DBH B;  4P1B C;  3H8H A;  2KNB A;  1YX6 B;  2CS4 A;  3AH7 A;  1JRP A;  3Q8B A;  2MH7 A;  4MSQ B;  2AQ3 B;  3DBL I;  2CHX A;  3IAS 1;  1K50 A;  3HK0 A;  3M3J A;  2G4D B;  4BBN F;  4OW0 A;  2ASQ A;  2X38 A;  2AQ1 B;  4HKZ E;  1XCQ L;  4EZL A;  5CHV C;  1T0R C;  4ZRK A;  1N5X A;  1WXQ A;  2OJR A;  2KLC A;  3OLM D;  1MG8 A;  4GXB A;  4IUM B;  5D94 A;  4KSL C;  2V3P A;  1QOG A;  1M94 A;  2C7M B;  2WXG A;  3DBH I;  3BWU D;  3RI7 C;  2L0T A;  1LXD A;  1UEL A;  1HEZ E;  4H2A A;  2Z0E B;  1N62 A;  1F2R I;  1SB3 C;  4F1S A;  3Q14 C;  4K3C A;  1LGR A;  1E5W A;  1EF5 A;  1R4M I;  4EZK A;  2MBE A;  2E3T A;  1C9F A;  2NTT A;  3IVF A;  4RM9 A;  3T9L A;  3A9K B;  2R61 A;  2I1K A;  4W9K A;  2KC1 A;  4AJY B;  3BII D;  3V6E B;  1T3Q A;  3KVF B;  2RD0 A;  2I38 A;  2KFK A;  3PLU A;  2INP E;  3LXF A;  3WAP A;  3IAM 1;  4ANU A;  2FAZ A;  2LUM A;  3NOB A;  1WXM A;  2OJW A;  4BZA A;  5D6J B;  4GGQ A;  2M19 A;  2D2Q A;  2V1Y A;  3WAM A;  2G3Q B;  3GE3 C;  2EMS A;  1XLQ A;  2YEP F;  5AZH A;  2FNJ B;  2IJ0 A;  2BYF A;  4BFR A;  4M0W A;  5TR5 A;  4G50 A;  4FHK A;  3IBE A;  3MC8 A;  3P4Q B;  1U4A A;  3EUB 2;  4BOZ B;  1L6V A;  1EO6 A;  4CHK A;  5AUK A;  4A55 A;  5HI1 A;  2OED A;  3AEF B;  5JHB A;  1L6U A;  2UWQ A;  4CO7 A;  1CQV A;  1P98 A;  4C4V A;  3NZ3 A;  1UBQ A;  3AB5 A;  3AE9 B;  1HE8 A;  4NY0 A;  2MJE A;  4MGK E;  3HRD D;  3R2T A;  1IUE A;  2LI5 A;  4KGR A;  2JY6 A;  1I4R A;  1N6Z A;  1OQR A;  2IZV B;  3BIN A;  1R7S A;  4WUR A;  2RGF A;  2KKC A;  1N63 A;  4GB9 A;  5C1Z A;  3NZS A;  1KLG D;  1MJD A;  2N7D A;  1WE7 A;  3OJ3 A;  2O2V A;  3TBL D;  3NZU A;  3LDZ E;  4HDO A;  3ZJT A;  2XN9 C;  1ZOY B;  3JSV B;  1TJE A;  1UH6 A;  3PV1 A;  4YL8 A;  1WM3 A;  4W9C A;  2WNM A;  4GDK B;  2NBU A;  1LO5 D;  2LGD A;  2H89 B;  3RZF A;  2PJH A;  2KQ4 X;  4MGZ E;  2WXF A;  2DZK A;  3P42 A;  2GBJ A;  3PO0 A;  3VTV A;  5G5G A;  1IBX A;  2JRI B;  2DHZ A;  4M02 A;  3QJZ A;  1Y56 A;  2JWU A;  1NVI D;  4ZOH C;  4IOI E;  4GU2 A;  4W9G A;  1FXA A;  1TS4 A;  3P63 A;  1C79 A;  3EEC A;  3QQ8 B;  1RWS A;  3TEX A;  4N58 A;  4HXD A;  3W2D A;  3I5J C;  3NY5 A;  5HG2 A;  2DAJ A;  1J0G A;  1LQB A;  4NAM A;  4RGO S;  1V86 A;  4FJY A;  2RPQ A;  3KQ4 A;  2WXR A;  1SIF A;  5G2N A;  4HRS A;  2V4I B;  1OQY A;  1P0R A;  3WAL A;  4OZC A;  4RGM A;  4WH4 A;  2WXH A;  4JQW C;  2Y5B B;  3UIN B;  4RF0 A;  2FE8 A;  4ZHO A;  3C0R B;  4IM2 A;  2VZK D;  2WU5 B;  3VUW A;  2JU6 X;  3BK1 A;  4KDI C;  3DOW A;  3KH0 A;  1C78 A;  4TQ1 A;  1J19 A;  2Y5P A;  2WLB A;  1P7E A;  4RGN A;  1QOB A;  4DHZ E;  2LZ6 A;  3EFU A;  1X1M A;  2IY1 B;  2QSD A;  1WX9 A;  4L2Y A;  4LTU A;  1CJE A;  3I9V 1;  3SFD B;  2MBB B;  4ACF A;  4W9H A;  1E7V A;  4BOS C;  5FKA C;  1TZ1 A;  4C56 C;  3AE4 B;  3W1S C;  3VUY A;  1WXS A;  4XYC A;  3NRZ A;  4KGS A;  2MSE D;  1QLB B;  4HDQ A;  2J0M A;  3AI5 A;  3N3K B;  2LJI A;  2OOB B;  2WDR B;  3QX1 A;  4C4V B;  4GSW A;  2CHW A;  4FHJ A;  1WJN A;  4NAW B;  4W9D A;  2MP2 A;  2KN4 A;  2ZNV C;  1QOF A;  4TKN A;  2M4N A;  1JQ4 A;  1QF6 A;  4PT5 A;  3AXC A;  2JZ3 B;  5BMH A;  1AN8 A;  1P3Q U;  3DHI C;  3DVG Y;  5CHW A;  2K6Q A;  2J7Q B;  1SJE D;  2NPT B;  2N1V A;  3DVG X;  4HWI B;  3KUD B;  1NYQ A;  5AUI A;  1FO4 A;  1GPX A;  3VAW A;  3X23 A;  1DOY A;  5E6J A;  3P4S B;  2KWD A;  2IPK D;  2JWZ A;  1SF0 A;  2MX2 A;  1JML A;  1SBB B;  2PVG C;  1AAR A;  3UIP B;  3TMP B;  4P16 A;  2DAF A;  3VH3 B;  1WXA A;  2KMM A;  1IGD A;  4B6W A;  1IBX B;  3O13 A;  2K39 A;  4MH8 A;  2KK8 A;  4OVV A;  4YTM B;  2WP9 B;  4NQL B;  4RGT A;  2Z0D B;  4EE2 A;  5LXI B;  2KJ6 A;  1TZO A;  2GOW A;  3MC9 A;  2SEB D;  1C76 A;  5E6O A;  1Z5S B;  2O6V B;  2ZPY A;  5H92 C;  3MTN B;  3VXW A;  1EU3 A;  5KHQ A;  4ZYS A;  3QAR A;  2KDI A;  2WYQ A;  4LNI A;  5EE1 A;  3RYT A;  2WWZ A;  1TTN A;  4KV2 A;  5EE9 A;  4AQ7 A;  2PE6 B;  2L1A A;  4BKS A;  5HHD G;  2ZVN A;  2EKE C;  3DHG C;  4K1R B;  3H7P B;  5KHO A;  1DGJ A;  5HFY A;  3A4R A;  4MGY E;  2K0P A;  1WIA A;  1P1A A;  3IFW B;  3VTW A;  1RFK A;  3PS6 A;  1CZP A;  5J17 A;  2PKO A;  2K22 A;  2DYB A;  3EA6 A;  4PS3 A;  4IG7 B;  1WRI A;  4K7W A;  3N1Z C;  3AED B;  4CQN A;  1TT5 B;  1GJZ A;  2BB6 A;  2M0X A;  3QC8 B;  2AYO B;  4LNO A;  3VR8 B;  2K8C A;  5L83 A;  4NZL B;  3RT3 B;  2RDB C;  3AU4 A;  3PLV A;  2JQR B;  3L08 A;  2KFJ A;  2KC2 A;  4FJV B;  4QAY A;  4TV3 A;  4AUQ C;  3IT6 B;  4LNK A;  2LVQ A;  2BBC A;  2MLB A;  1AYF A;  4AWJ A;  2PW9 A;  2XNA C;  1E7P B;  4FAD A;  5DCN A;  2RMM A;  1WJU A;  3PTF C;  2G45 B;  3CST A;  2PLP A;  3GZN I;  2K5P A;  1D5Z C;  2L76 A;  2BYT A;  4M00 A;  5AEK B;  2IGD A;  3RN9 C;  1XCT L;  3W9C B;  5BYR A;  1C3T A;  2BPS A;  1T6B X;  1ACC A;  3ZDM C;  4YT0 B;  4IM0 A;  4NAW A;  2KDF B;  2VRR B;  2MP2 B;  4G3X B;  3VRA B;  1XLN A;  4BKG A;  2JT4 B;  2E6X A;  1ZDX A;  4HK2 A;  3NS8 A;  4W9L A;  3ZUN A;  5CTR C;  4S0R A;  3UI3 A;  3DHH C;  1GUA B;  2WXK A;  2B76 B;  3TSS A;  1JRU A;  4GDL B;  4YTP B;  3ZQ4 A;  2KFK B;  1T0Y A;  3ZXR A;  2MRP A;  3R8B A;  2L0F A;  1KOT A;  2M8S A;  5CX3 A;  3B0A A;  4M8N A;  4AOF A;  3KLS X;  2W54 A;  1V9J A;  1ZUD 2;  3PVL A;  4HLE A;  3A9J B;  2HJ1 A;  2KZR A;  4M0W B;  3ZNI D;  4B0M A;  2J42 A;  3I57 A;  3PPA A;  2L8J A;  1TS5 A;  3BZD B;  3B08 A;  4R3D A;  2IYD B;  5D3I B;  3SDL C;  1SEB D;  3K9O B;  4S17 A;  2AWT A;  1JRO A;  1ZDV A;  5EE0 A;  4LJO B;  4N6E B;  4WWN A;  3OJ4 B;  4A3O A;  4DWF A;  4PYZ A;  3BYY B;  1ROE A;  3ZO5 B;  3VDZ A;  2I2Y A;  3N9Y C;  3QCA A;  1BT0 A;  2MEK A;  3KUZ A;  3ZKJ C;  2AL3 A;  4MJS B;  1E6E B;  1J7C A;  1YN5 A;  2C9W B;  2RDH A;  1QQR A;  2W3R A;  4KZC A;  1SSN A;  1T5X D;  4K3B A;  1QZE A;  4OHJ A;  3ZTD A;  2WHI A;  1RFA A;  5IAA C;  4TMA B;  4I6L B;  1MG4 A;  3GZN B;  1WGR A;  2K8H A;  3BVZ A;  1V2Y A;  1ET9 A;  4GDK A;  3U2S C;  1I4X A;  3ZRF A;  1FXT B;  1ZXH A;  3FKY A;  1WYW B;  1V81 A;  1QKZ A;  1D4B A;  4DHZ B;  4W9E A;  4NJC A;  1SIJ A;  3OAW A;  3B2F A;  3GE8 C;  4WJP A;  3AMZ A;  4LNF A;  1FM0 D;  2M56 B;  3RD2 A;  4LLG M;  4OZA A;  2WQY B;  2DBY A;  2HTH A;  1Y8R C;  3EGR A;  3RCZ A;  1ZPS A;  1WH3 A;  3ALB A;  2MHJ A;  4TQ0 A;  3SHQ A;  2QMT A;  4JWS C;  2PEA A;  1H8C A;  1YX5 B;  3Q8C A;  5IKC M;  3L4P A;  4ARC A;  1V5T A;  2VH1 A;  2CJO A;  1E8Y A;  1WYG A;  3TIX A;  3PRM B;  1V1O A;  4LJP B;  3RUI B;  3AN1 A;  1Q5W B;  4HPP A;  2KN5 A;  1ISN A;  1MHX A;  2NMQ A;  2LRW A;  4NQK E;  4ZDV A;  2KLG A;  2KAN A;  1L4D B;  4IWO A;  4IM3 A;  3AE8 B;  2MWS B;  2KVZ A;  3A1Q B;  1KLU D;  4XDC A;  2BQQ A;  4USA A;  4MM3 A;  3WCQ A;  2KVR A;  3B2G A;  1FMA D;  3L17 A;  1WGK A;  1ZGU B;  4WAF A;  5BMG A;  4JL9 A;  1KTK A;  3PZ8 A;  2ZJD A;  3CWI A;  2L32 A;  1L0V B;  3RPF C;  3MHZ A;  2WXO A;  3AE3 B;  3V60 A;  3N1Y C;  3AE1 B;  1QOA A;  4ZHP A;  4I6N B;  2BTE A;  5BO4 B;  2BT6 A;  4KX6 B;  1FFV A;  4KGT A;  2GBN A;  2HTM E;  3NVZ A;  2RDG A;  1WXV A;  1VCB A;  3IT4 B;  4RNA A;  2D3G A;  2IGG A;  3A9J A;  3NVY A;  1I4G A;  4YXD B;  5T8I A;  2WXM A;  2WDV B;  1VDV A;  1GG3 A;  2NBV B;  4YSZ B;  4AJW A;  3EC8 A;  1RM6 C;  2XEW A;  3SU8 X;  1HQR D;  4MT5 A;  5CHF A;  1F2R C;  1EWC A;  2DX5 B;  4LDT B;  3RNE C;  4P1C C;  4WJO A;  3NG0 A;  4FN2 A;  3CF6 E;  4MEM A;  2LHE A;  2LGY A;  1C4A A;  4KZ0 A;  4MJS A;  2BYE A;  1Q0W B;  2GBM A;  1OTR B;  1FIQ A;  2KQS A;  2JYT A;  3PGE A;  3L54 A;  2KQ7 A;  1GB1 A;  5GXG B;  3B1L X;  1DYQ A;  1WZ0 A;  5LNK 1;  2WXQ A;  2BKF A;  2NPT A;  1RLF A;  3N32 A;  4C80 A;  1YOV B;  3S2A A;  4MSM B;  3ZYY X;  4WQM A;  4IDI A;  2KJH B;  3MC0 B;  3HM3 A;  2JPH A;  1PGA A;  2EKI A;  3BVM A;  5G5H A;  4AP4 C;  2LD9 A;  4P7I A;  3TEY A;  2PPH A;  2KXJ A;  4I6P A;  3L16 A;  4E3C A;  4IW0 A;  1PDX A;  2JF5 A;  2V4L A;  5LXH A;  4F8C B;  3MFG A;  3PHX B;  2BWE S;  1FNU A;  2ZW1 A;  2N7E A;  5IN7 A;  1J7B A;  3U7D A;  3FIL B;  1VJK A;  2DZI A;  3C19 A;  4B95 A;  4EUT A;  2GMI C;  1EU4 A;  3A33 B;  2DZM A;  3Q3M C;  3QHT A;  4C7Z A;  4NJ6 A;  1UNS A;  1VZ7 A;  2O6V A;  3KYD D;  1ZP0 B;  3I3T B;  2W82 A;  2LGS A;  1T0Q C;  1UF0 A;  3QK0 A;  1VRA B;  1WFY A;  1SE9 A;  2Z59 B;  2LUE A;  4OVZ A;  3ETR A;  1L5P A;  1WMH B;  4NNJ B;  5DPT A;  1NI2 A;  1R4N I;  1TS2 A;  2NCN A;  3N1X C;  4ICV A;  3A1Q A;  1I4Q A;  1BUI C;  4XE0 A;  1K53 A;  3VVW B;  1YJ1 A;  3R2I A;  4MM3 B; 
#chains in the Genus database with same CATH homology
 1T0Q C;  3Q2A C;  2IND C;  3GE3 C;  2INC C;  3DHH C;  3RMK C;  1T0R C;  1T0S C;  3RI7 C;  3Q3M C;  3DHG C;  3I63 C;  3RNA C;  3RNG C;  3Q3N C;  3DHI C;  3RNE C;  4P1C C;  4P1B C;  3N1Z C;  3I5J C;  3RN9 C;  3RNF C;  3N1X C;  3Q14 C;  3Q3O C;  3GE8 C;  3N1Y C;  3RNB C;  3RNC C;  3N20 C;  2RDB C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...