1WJ4A

Solution structure of the ubx domain of kiaa0794 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0794 protein
publication title Solution structure of the UBX domain of KIAA0794 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj4A01
4OVUA 1K8RB 2KNBA 2Y5BB 3O65B 1WE7A 3AU5A 4A20A 5IAAC 3UF8A 2NBUA 3DBRI 3EECA 3NHEB 4IWPA 3APCA 3L17A 3QQ8B 3ZUNA 4M8MA 4RM9A 1I35A 2DZIA 3H9DA 3QC8B 3WANA 1J19A 3CMMB 4MJSA 4WWPA 4W9DA 3VAWA 2C7NB 3JYUA 3V62A 2KQSA 3ZTDA 3KH0A 1WGGA 1AARA 3WAOA 4FHJA 2C7MB 2MX2A 4WJQA 2PJHA 1RRBA 1WZ3A 4II2B 4E71A 1LFDA 2V3SA 2AL6A 2LVOA 2WX1A 5AZHA 2Z0EB 2LRUA 2IO0B 2K39A 2N7EA 4IC7B 4IG7B 3L08A 4A3OA 4RM8A 2G3QB 1WJ4A 2K1FA 3QK0A 3WAPA 5D94A 1L2NA 1YIWA 4W9FA 3TJPA 4EZLA 1WGRA 3PHXB 4A3PA 2KDIA 1WXAA 4GGQA 1ZGUB 5C1ZA 3ZNGC 2LUEA 2MBOA 3H7PA 3PGEA 4F7ZA 4PS3A 1Q1OA 5J17A 2A4ZA 3VXWA 3NY5A 2CR5A 4B95A 2K8HA 3QCAA 3M3JA 2PPHA 3M63B 1OTRB 1WXVA 3PT2B 3GZNI 4G0NB 1Q5WB 1S3SG 4XZ4A 4PS7A 3DPDA 2JZ3B 2LD9A 4GN1A 3R66C 4W9LA 4ICUA 5KHOA 2J0MA 3CF6E 4IM3A 3VUXA 3WA0A 2LXCA 2FCQA 1WM2A 4WJPA 2IY1B 3KUDB 2OOBB 4HXDA 3X23A 3X0WA 2BF8B 3A4SC 5DPSA 1TGZB 2FIFA 2B3AA 2EMTA 4KVGB 1E7UA 3NZSA 4HCPB 3APFA 5DPTA 4CYEA 5AZGA 1WJNA 2LWPA 4EKUA 5DPRA 2ZJDA 1RAXA 4KZ0A 1OGWA 4BVUC 3CSTA 2JF5A 4DK5A 2HJ8A 2KLCA 4DHZB 5CX3A 2MLBA 1WI0A 2AYOB 4EZJA 1TTNA 2GOWA 3RZFA 1E90A 4W9GA 4PYZA 3SD5A 4GB9A 3VDZA 2MBQA 1LXDA 2V4LA 5DCNA 2K6DB 2IO3B 4W9KA 2AEHA 2LJ5A 4ANUA 5GMVA 2KVRA 2BPSA 3QA8A 2MCNB 3MHSD 2D11A 1E8WA 1E8YA 2R2QA 3DQVA 3AXCA 2CHWA 1M94A 4IWQA 2J7QB 4MSQB 4IUMB 3KVFB 2ZVNA 3PPAA 4G3XB 3OAWA 3TBLD 2DAFA 2KTRA 1ISNA 1C3TA 4AOFA 2KLGA 5KHQA 3ZNID 4HDOA 1SIFA 2K8CA 3APDA 3QIJA 4ANXA 2CKHB 3WIMA 3VH3B 4NJ7A 3DVNU 3ZNHB 4FADA 4P7IA 1L7YA 4NQLB 1WJ6A 1XQQA 4M0WB 3UIOB 3KW5B 3NZUA 3QJZA 4XX5A 3VVWB 1H8CA 2N4FA 4MSMB 1P98A 2NCNA 4NJ6A 2GMIC 2KC1A 3VUWA 3T9LA 2L8JA 2M4NA 3ONSA 4FULA 3TL5A 4YL8A 1WIAA 3U7DA 2LGXA 3TCAA 1MG8A 4ZRKA 1GNUA 3QAQA 5LXIB 1V80A 2LRWA 3RUIB 1I42A 1WY8A 4MGKE 4II3B 2AWTA 2BYVE 4W9HA 3DBSA 3OJ4B 4DBGA 1KJTA 3A9JB 2KO3A 3MJWA 4ANVA 3PRZA 2KMCA 2XEWA 1C1YB 2J0KA 1V49A 2R2OA 4AJYB 3ZO5B 4EZKA 1V2YA 2V1YA 4I6LB 2L7RA 3H6NA 2FCSA 5D6JB 1RFAA 2ZNVC 4WWOA 2ZPYA 3PTFC 3QX1A 3R7RA 4IW0A 2KXJA 2KWVB 3PV1A 3R7QA 3TMPB 2LGDA 1P1AA 4EUTA 5JHAA 3ZLZA 1WF9A 1V6EA 3W1SC 1WR1A 1WRDB 4DDGD 2G45B 2I1KA 3TIXA 4LDTD 3N32A 1E8ZA 1UELA 3QHTA 5G2NA 4BKSA 4HVBA 3UQAA 4LJOB 2KJHB 4I6NB 2DX5B 3S2AA 1ZW7A 5E6OA 2NS5A 2KDFB 2JT4B 2L3ZA 1R4NI 3HM6X 3SU8X 3MTNB 2KDBA 2LI5A 1E8XA 2GBKA 3B08A 2N1VA 2I1JA 2O2VB 4ASWC 4EOYA 1V9JA 4K1RB 2HE7A 2DENB 4BKTA 1WJUA 2BKRB 5CHWA 3SDLC 4OVVA 2JVCA 3B0AA 2DZKA 5G55A 4M8NA 4URKA 4HJKA 2KWUB 3NS8A 4ANWA 2BGFA 1XT9B 1YJ1A 4NNJB 5JHBA 3JW0X 5LXHA 3ZNZB 3LJ3A 1IYFA 4AWJA 3OLMD 1P9DU 3U30A 2KX0A 2RR9A 3UGBB 1WE6A 5C23A 2ZEQA 4DXAB 2ASQA 2CS4A 2WX0A 3A1QB 3N30A 4RMAA 3D32A 3IVFA 2RD0A 2JUOA 5D7GA 2C9WB 4HCNB 5EDSA 1E5WA 1GC7A 2DYMA 2Z59B 4KIKB 4LCDE 2KWCA 3A33B 1QZEA 5CHFA 2LGYA 4FJVB 5J18A 3ML9A 1ZKHA 2JRHA 4EEWA 2PE6B 4KIKA 4GOCA 2WYQA 2D07B 3IG3A 4CHKA 5E6NA 3UINB 1KOTA 4LDTB 2G4SA 3A9KB 1WFYA 2MP2B 3M95A 2D2QA 4X57B 1UBIA 4BBNC 2CHXA 3C0RB 3A9KA 2MRPA 3WAMA 1TZ1A 2MP2A 4GIVA 2JRIB 4BOSC 4W9JA 2JZZA 2FUHB 1VD2A 3DBLI 4BBNF 1LM8B 3DCGA 2DHZA 3EHVA 4LJPB 1UBQA 3ZIMA 2BWES 2L76A 3ENEA 1J0GA 1SE9A 3H7SA 3AULA 3UQBA 3ZVVA 2D3GA 2DYBA 2C7HA 1RLFA 3NOBA 3VTVA 2DZJA 3DBHI 3JSVB 3VHTC 4CO7A 4JLCA 2W9NA 2MBEA 4HDQA 1HE8A 2KOXA 4MH0E 2MQJA 2YLMA 3DOWA 2L00B 3JSVA 1UGMA 1IP9A 2DYOA 1JRUA 1LQBA 1YQBA 2PE9A 1A5RA 4IWOA 5IA7A 4KV2A 3RULA 1EO6A 3K9OB 1GJZA 3Q3JA 3HK0A 2MA9B 2M17A 2MBBB 2KZRA 2KFKB 2M0XA 2D10A 4WJOA 5AEKB 1VCBA 2GBNA 2L0FA 1GG3A 1X1MA 2ZZPB 3IFWB 3KYCD 1KLVA 2KFKA 3IBEA 1GC6A 4HK2A 1UD7A 2KHWB 4DHJD 5DPWA 1WGHA 2MBHA 3N3KB 1SGHA 4IM0A 2K8BA 2ZCBA 1WH3A 2KANA 4GSWA 1G6JA 4HPMB 4PYUA 3ML8A 4E3CA 4TQ1A 3PSEB 4DWFA 4MM3A 2IO2B 3QARA 1WX8A 4GU2A 2DAJA 3AI5A 3V6EB 1NI2A 3QWZB 4DDID 1EF5A 1U4AA 3VTWA 2KTFA 4W9EA 4ZRIA 2L05A 3V6CB 2UYZB 2QHOA 5JH5C 2XK5B 3A4RA 5E6PA 3A9JA 4MGYE 3PZDA 5HKHA 3LDZE 1T0YA 2BYFA 2XK5A 1P0RA 3K9PB 4BFRA 2IO1B 3ZDTA 5L83A 4EFOA 1IPGA 2JXXA 3KUZA 2JPHA 3VQIA 4HPLB 1YD8U 2FNJB 2K25A 3Q3FA 3VUYA 4MJSB 2KQ7A 1TBEA 2J0JA 5J2RA 2CHZA 1EUVB 4MDKE 2FIDA 2M1MA 2M8SA 4TKNA 2KC2A 4NY0A 3ZW3A 4BOZB 1Y8RC 4FHKA 4ZDVA 4BKGA 4AJWA 4AUQC 4IM2A 4K7WA 4DHZE 5JZEB 3UIPB 3EC8A 2KX3A 2NVUI 3V60A 3ZRCA 4KDLB 4KZCA 2ZVOA 2HTHA 1V5OA 4HLEA 1XD3B 3R3MA 3DVNV 2K6QA 4NAWB 3PREA 2MWSB 3PHWB 3ZKJC 1NBFC 5BO4B 4JL9A 3IHPC 2KDEB 3ECIA 4NAWA 4JIOU 2LXAA 5CHVC 2EKEC 3BINA 3EFUA 2FCNA 1WX7A 2O2VA 4KSLC 3L10B 4B9KA 1Z5SB 4TV3A 2FCMA 1YX5B 5LLIA 4DHJB 4I6PA 2OJRA 4G50A 4TUUA 1WGDA 2JWZA 2AL3A 2IZVB 2VRRB 3PVLA 2LVQA 3L54A 4G11A 4PS8A 3M62B 2L0TA 2ZPNA 4GMVA 3ZDMC 1UH6A 1WX9A 1WXSA 2IBIB 2FAZA 3H7PB 5CTRC 5AZFA 2N1WA 2GBJA 2UWQA 2NPTB 2Z0DB 3PRMB 4FJYA 3W1YA 3ZTCA 1KM7A 3H1UA 1NDDA 3PRPB 4MELA 3ALBA 3WALA 2KKCA 2WDTB 2IYDB 3PS6A 4MEMA 1V81A 1Z2MA 2NPTA 4FN2A 2BYEA 2C5LC 4ZRJA 4FJZA 2BWFA 3U8ZA 3L13A 3A1QA 4MGZE 2ZCCA 2DZMA 4XC2A 2KN5A 2RGFA 4WWNA 4B6WA 3PLUA 2O6VD 2REXA 2JY6A 5L95C 2N9XA 2KK8A 1Q0WB 2N9PC 4W9IA 3DVGY 1E7VA 1J8CA 1UZXB 1WM3A 2LVPA 1OQYA 1WXMA 2NBVB 3VFKA 4K81A 4F8CB 3L0WB 2N9EB 4TQ0A 4GXBA 4ICVA 3GOEA 3RT3B 1WZ0A 1WGYA 4KSKC 2EMSA 2KFJA 2GBRA 1OEYJ 4NQKE 5D2MB 4GDKB 2WWZA 2GBMA 2NR2A 3RCZA 4FBJB 5TR5A 3T8MA 2ZNVB 4N9F4 1WMHB 3SHQA 4F1SA 2N7DA 4GDKA 3OJ3A 2MW5A 4K7SA 3HIZA 4J6IA 2LZ6A 3PLVA 1WMHA 4AP4C 1D3ZA 3B1LX 2A5UA 2KMAA 2G4DB 3RD2A 2RSUA 3V61A 2CU1A 1P3QU 1V86A 1GUAB 4NPNA 2YVCA 3W1SA 1R4MI 1F9JA 5FR6A 2KJ6A 1S1QB 3DVGX 2KJRA 4WAAA 3AU4A 3HHMA 1V5TA 4JGHB 4WJNA 2IY0B 3DDCB 3RZWC 2HD5B 2O6VB 1WYWB 2KTRB 4K7UA 3I3TB 3JVZX 3KUCB 1CMXB 3KYDD 1EF1A 3RYTA 2C60A 4GDLB 2O6VA 4W9CA 3VTUA 2BKFA 4FA6A 3BY4B 1OEYA 4FLHA 4HWIB 2NBWB 4ZYNA 4BKSD 1YX6B 4GDLA 4MGIE 3ZRFA 3HM3A 1PQSA 4KDIC 2PEAA 4E74A 2MSED 2XBBC 1H4RA 3L16A 3CSFA 1FXTB 1WR6E 2LASA 2KD0A 4WQOB 2RPQA 1BT0A 3VH4B 3P2BA 4JQWC
chains in the Genus database with same CATH superfamily
2Y5BB 3AU5A 3AEAB 2QILA 5IAAC 3UF8A 1WXQA 4IWPA 4YT0B 3QQ8B 1SEBD 4OHJA 2N0SB 1YQ3B 1YMHE 3WANA 3CMMB 5BYQA 2KQSA 1K50A 5IKCM 1RFKA 2AQ3B 2C7MB 2NMQA 4HRSA 4II2B 4RF1A 3FILA 2WXMA 2LRUA 2K39A 3SEBA 2K22A 2EELA 2V9HA 2OHFA 1WJ4A 3QK0A 3WAPA 4EZLA 1WGRA 1WXAA 4GGQA 1ZGUB 2LUEA 3DHHC 2RDHA 4YTPB 2A4ZA 2K0PA 1KF6B 2PPHA 1WXVA 4XZ4A 2AQ2B 4GN1A 1N6ZA 2J53A 5TSSA 2J0MA 4HPPA 2WXQA 2FCQA 1WM2A 5MPOA 1YNTE 2CJOA 3KUDB 3AE6B 4OW0A 1KTKA 1HQRD 2EMTA 1NEKB 3C19A 3W5UB 3APFA 5DPTA 2SEBD 4IDIA 2LWPA 4EKUA 5DPRA 2ZJDA 4BVUC 1N62A 3VRBB 3C8YA 1F0ZA 2WS3B 2AX5A 1TTNA 3PO0A 3SD5A 2V4LA 5DCNA 3BIID 4ANUA 3RFZB 1L0XB 2KVRA 4A8XC 2BPSA 1E8WA 3AV8A 1M94A 3BYTB 1NVID 1XO3A 3OAWA 2DAFA 2KTRA 5HI1A 2BW2A 1EU4A 2K8CA 4HROA 4FADA 1L7YA 4LLGM 1XQQA 4OZBA 3KW5B 3NZUA 3V05A 4H2AA 3CWIA 5D3IB 2JSVX 1L4DB 3RNGC 1WIAA 3TCAA 4ZRKA 2LGSA 5LXIB 3RUIB 1I42A 1WY8A 4MGKE 4II3B 4W9HA 3VR9B 2J4XA 3OWEB 2W54A 1KJTA 3A9JB 3I63C 2KMCA 2XEWA 3P4QB 2R2OA 4AJYB 4EZKA 3BK2A 4BAXA 2L7RA 3AE1B 5D6JB 2ZPYA 3R7RA 4IW0A 3TMPB 5JXVA 4RF0A 3ZLZA 2G45B 4LDTD 3RN9C 4HVBA 4LJOB 2KJHB 2V3PA 4I6NB 2NS5A 2KDFB 3HM6X 1SJED 3HRDD 1E8XA 2GBKA 2INCC 4OZCA 4ASWC 2O2VB 4EOYA 4K1RB 4BKTA 3SDLC 3R8BA 4OVVA 2PVOD 2DZKA 2QCZA 1PGBA 3Q6BA 4HJKA 3NS8A 2WXNA 2BGFA 2OJWA 3Q3NC 3TEWA 1DOXA 1SE4A 2KAJA 3ZNZB 4AWJA 1P9DU 2JWUA 2RR9A 1ACCA 1L0YB 1JALA 3N30A 4RMAA 4C4VB 3IVFA 2C9WB 4US9A 2BB5A 4HCNB 3U4EG 1B1ZA 2DYMA 4WAFA 4C4VA 3BYYB 2KYWA 1UUPA 2LGYA 3ML9A 1ZKHA 2PE6B 2WYQA 2D07B 4PT5A 2LGIA 3IG3A 1KOTA 4XDCA 4BBNC 1XXGA 2CHXA 1WSPA 3C0RB 2JXTA 5C3JB 2JZZA 3NVZA 2HDEA 1VD2A 4S0RA 4BBNF 1LM8B 4N58A 3EHVA 1XLQA 1UBQA 2JYEA 1J0GA 3H7SA 3AULA 2D3GA 2DZJA 3N1ZC 2BYTA 2X38A 1ROEA 1SXTA 2L00B 1XLOA 3GE3C 1FCLA 3AE9B 1EO6A 1N5XA 3HK0A 1YJIA 1C4PA 1NYRA 1C9FA 2L0FA 3KYCD 3IBEA 1NENB 3GE8C 3BVZA 4HK2A 4NZLB 4DHJD 2PIAA 1FXAA 1ENFA 4YWGG 2ZCBA 5D3DA 4HPMB 1FRRA 4DWFA 1WX8A 3V6EB 3EGRA 2MEKA 4ZRIA 3ZJTA 5E6PA 1FRDA 3PZDA 1SF0A 1J7CA 4YSYB 3VQIA 2K25A 1JMLA 2WXLA 2M1MA 4US8A 4RGNA 4ZDVA 4YSZB 4AJWA 4IM2A 2VZKB 2PKOA 4HLEA 5AUIA 4ACFA 2N9LA 3PHWB 3ZKJC 3IHPC 2GLSA 3BINA 4EE2A 3L10B 1ZXHA 2FCMA 4G50A 4TUUA 1WGDA 4AQ7A 1FM0D 2AL3A 2VRRB 3PVLA 2LVQA 2E6XA 3P4RB 3IAS1 2IBIB 4WQMA 3NG0A 2NPTB 3PRMB 4FJYA 3W1YA 2D3BA 3H1UA 1NDDA 3I57A 2NPTA 4FN2A 4ZRPA 2BWFA 1VZ6A 3DBLB 4MGZE 2DZMA 4JPSA 2RGFA 2REXA 2JY6A 4USAA 5EE0A 3U2SC 2VH1A 3DBHB 1BXTA 3DVGY 5BMHA 2LVPA 1JCKB 1RYJA 2GB1A 2R61A 3VFKA 1AYFA 2IDYA 3AEGB 4GXBA 2BT6A 3GOEA 3RT3B 2EMSA 2GBRA 1OEYJ 2GBMA 2NR2A 2DNFA 5TR5A 3T8MA 2LZ6A 3NUHB 2A5UA 1VZ8A 1T0QC 2KMAA 1D5ZC 2RSUA 2CU1A 1ET9A 1R4MI 1JW9D 1F9JA 2KJ6A 2CU3A 1S1QB 3DVGX 3AU4A 1QOFA 2PTLA 3FKYA 2HD5B 2LFIA 3JVZX 2RMMA 3P4SB 1CMXB 3KYDD 4C56C 1EF1A 3VTUA 3BK1A 4LNOA 4RFBA 1YX6B 2QMTA 4MGIE 3HVZA 3ZRFA 1PQSA 2Y3AA 5IO9A 4CQNA 3BVMA 3CSFA 5BYSA 3MJ5A 2RPQA 1M4VA 1WE7A 2MH7A 1IGDA 1DGJA 3DBRI 3NHEB 3APCA 4KGSA 3L17A 2QIEB 1CJEA 2LEKA 4M8MA 4RM9A 1I35A 3L4PA 2DZIA 3N1YC 4XE0A 1YN3A 2J52A 1MI0A 3HUIA 3QC8B 1FEHA 4MJSA 4WWPA 1VRAB 4W9DA 3VAWA 2C7NB 3JYUA 3ZTDA 3KH0A 2Z8LA 2WP9B 3Q8CA 4ZYSA 2FUG1 3RNBC 1GPXA 1RRBA 4E71A 4RNAA 1ZDXA 2IO0B 4S17A 4IG7B 4HKZE 4M02A 1KH0A 1VZ7A 1YIWA 3TJPA 1TZOA 2KT7A 5C1ZA 2VH2A 2WXIA 1TKGA 2MBOA 3H7PA 3AEBB 4PS3A 5BMGA 5J17A 2MJDA 3VXWA 2CR5A 2EKIA 1HZ5A 1OTRB 4OZAA 4G0NB 1S3SG 3V3XA 1XEEA 1MPEA 2L52A 1V1OA 3RNFC 2WXPA 3N9YC 2OOBB 3X0WA 1FFVA 3A4SC 3LYYA 3Q8BA 2FIFA 4KVGB 1GAQB 4HCPB 2WDQB 1K53A 3ZGZA 1JWSD 4DK5A 2JF5A 2HJ8A 2KLCA 4N6EB 5CX3A 2AYOB 4EZJA 2GOWA 3KLSX 4PYZA 5EE9A 1MG4A 3ABVB 4W9KA 3NZ3A 5GMVA 2MCNB 3MHSD 2D11A 2Y5PA 1SE2A 1E8YA 2R2QA 1I7HA 4IWQA 3KQ4A 2ZVNA 3PPAA 4G3XB 1CQVA 3MC9A 3Q14C 1WYGA 3ZNID 1N5WA 1SIFA 4HDOA 4RCOA 2CKHB 1I4QA 2B76B 3VH3B 1N61A 3DVNU 3ZNHB 4P7IA 5I4DA 3QJZA 4XX5A 1ESFA 3MC0B 1H8CA 4NJ6A 2WDRB 2WU5B 3VUWA 3T9LA 3ONSA 2L83A 4MM3B 3U7DA 1MG8A 2TSSA 1N63A 1V80A 2LRWA 4B0MA 1TS5A 1E10A 2AWTA 3OJ4B 4DBGA 2WXFA 5GXGB 4ANVA 1TKEA 1GB4A 3E9SA 1F52A 3TEXA 2D5GA 2BBCA 3QX1A 2KXJA 2KWVB 4UDUC 3GZNB 4ZOHC 1XCTL 5JHAA 3IAM1 1V6EA 3W1SC 1WR1A 3Q69A 3NVWA 2I1KA 3TIXA 1KFYB 5G2NA 4BKSA 2LHDA 3UQAA 2DX5B 1P7EA 1ZW7A 2JT4B 1R4NI 3MTNB 3B08A 2N1VA 1V9JA 2HE7A 3LB8C 2DENB 1FFUA 1WJUA 2BKRB 2KQ4X 4LTUA 4M8NA 1XT9B 1NI3A 4PK1A 2IGDA 3LJ3A 1IYFA 1ZPSA 3U30A 2WXJA 2CS4A 3AMZA 3A1QB 3D32A 2RD0A 5D7GA 5LNK1 5EDSA 1E5WA 4LCDE 3A33B 4LNFA 1QZEA 5CHFA 4FJVB 3SFEB 4A9AA 2JRHA 3NVVA 3T3NA 3H8HA 4WIPA 4LDTB 4J3OD 1L6VA 1STEA 4HJGE 3WAMA 3TEYA 3AB5A 4C7ZA 2DHZA 4A90A 3ZIMA 2L76A 1SE9A 3DWMA 3Q8AA 3NOBA 3VTVA 2W9NA 3P63A 2KOXA 2MQJA 3DOWA 1HXYD 2WU2B 3P4PB 1YQBA 3GP7A 1XF5L 5IA7A 2M17A 3NS1A 3W2DA 1GG3A 4QAYA 3ZXVA 3RNAC 3PZ7A 1GC6A 1V1PB 3N20C 5DPWA 2MBHA 3N3KB 1V1PA 4IM0A 1FMAD 1WH3A 2KANA 1G6JA 1TS2A 3ML8A 4TQ1A 2G1EA 3PSEB 1NI2A 2FE8A 4DDID 1EF5A 4WH4A 2UYZB 3A9JA 4MGYE 1C4CA 2QEJC 1P0RA 2L32A 2IO1B 5L83A 3KUZA 2FNJB 3Q3FA 3WCQA 3ZJVA 2KQ7A 1KRHA 3DHIC 2CHZA 4NY0A 3ZW3A 1N60A 1KLGD 3FAHA 3Q8EA 4DHZE 2ZVOA 4TSSA 3ZJUA 5HG2A 3PREA 2MWSB 1ZP0B 3IXSA 5BO4B 2KDEB 4ARIA 3TSSA 1T6BX 2LXAA 3EFUA 2FCNA 2O2VA 1JWAD 1Z5SB 1DYQA 1YX5B 4DHJB 2OJRA 1K51A 4BZAA 1FO4A 1QILA 4G11A 1L5PA 2L0TA 2N7JA 4GMVA 4ARCA 1WX9A 1WXSA 1GB1A 2FAZA 2BVCA 5AZFA 2N1WA 1PFDA 2BQQA 2RDBC 2X8XX 3ZTCA 1UF0A 4FXCA 2KKCA 2WDTB 4MEMA 3PS6A 1V81A 1Z2MA 3VRAB 2INDC 4DQOC 2C5LC 3GB1A 4AS1A 4M00A 2O6VD 4RGTA 5L95C 3P42A 1TY0A 2N9XA 1Q0WB 1E7VA 5G5GA 1C77A 3O13A 1OQYA 1E0ZA 3SR6A 3UI3A 1A70A 3L0WB 2N9EB 4ICVA 2KACA 3ZQ4A 4GDKB 2WWZA 5IOIA 3RCZA 2DWQA 2ZNVB 2N7DA 4GDKA 3OJ3A 2MW5A 3HIZA 3URYA 1EM7A 3PLVA 4AP4C 1F77A 1TS3A 2G4DB 1V86A 1GUAB 4NPNA 4K3BA 1K52A 1LGRA 4ITKA 1D4BA 4WAAA 1JWUD 4K7UA 1F1HA 2BS4B 3RYTA 4GDLB 1QKZA 1OEYA 2NBWB 4ZYNA 4GDLA 1DOIA 3HM3A 2PEAA 1UWXA 4HKQA 3LXFA 1FXTB 1WR6E 4WQOB 1UWMA 2JZPA 2RPVA 5BMIA 4JQWC 1K8RB 4A20A 3O65B 1TY2A 2NBUA 4K3CA 3ZUNA 1QLBB 3H9DA 4R3DA 3PZ8A 1I4PA 1J19A 2WXHA 1JQ4A 3EFCA 5E6JA 2INNE 1WGGA 3ZYYX 4FHJA 1L6UA 2MX2A 2LJIA 1WZ3A 3RNCC 2D3AA 1LFDA 2V3SA 2AL6A 2LVOA 2Z0EB 4IC7B 3L08A 5EE3A 1VLBA 2G3QB 5D94A 2KDIA 3ZNGC 5FR3A 3PGEA 3AE5B 4F7ZA 3AN1A 2CJNA 1FCCC 3QCAA 3B2GA 2WQYB 1HTQA 2V4IB 2WNMA 3PT2B 1Q5WB 4PS7A 1DOYA 2JZ3B 3R66C 1CK1A 4ICUA 5KHOA 3CF6E 2BTEA 3VUXA 2LXCA 4WJPA 1YQ4B 2IY1B 2ONQA 4MT5A 1VDVA 5T8IA 4B0EA 1TGZB 3R2TA 2B3AA 3DWGC 1E7UA 4CYEA 4KZ0A 2MLBA 2QSDA 2K3UA 1HEZE 1C4AA 3RZFA 2WHIA 1FXIA 2ACZB 4W9GA 4GB9A 3VDZA 4A55A 1EWCA 5C2TB 2KWDA 2ZW0A 2IO3B 4LNNA 3NVYA 3AE2B 1AWDA 3AXCA 2CHWA 1UGJA 2J7QB 4IUMB 3R2IA 1ISNA 1L0VB 1VR9A 5KHQA 3AM9A 3TEZA 2XN9C 3APDA 4KKJA 4ANXA 2VZKD 4NQLB 2GRIA 1MHHE 4XWTA 5H92C 2N4FA 1KLUD 4MSMB 1P98A 1ZUD2 2NCNA 2KC1A 4L2YA 2L8JA 2M4NA 1FNWA 4FULA 4YL8A 2LGXA 1GNUA 3QAQA 2WGSA 2WDVB 3SFDB 2KO3A 3PRZA 2J0KA 2SAKA 1V49A 3W9CB 4JX1C 1AN8A 1FNVA 1V2YA 4I6LB 2JU6X 4WWOA 3PTFC 1D5MC 3PV1A 1JWMD 4EUTA 2V3NA 1MJDA 1WF9A 4DDGD 1PDXA 1UNSA 2K9XA 3N32A 3NJTA 3S2AA 1T0RC 3SU8X 2QC8A 2WXOA 2BS2B 3I5JC 2JVCA 1SE3A 3IT4B 2KWUB 4ANWA 4NNJB 3RPFC 2KDMA 3JW0X 1JRPA 2MJ3A 2KX0A 1QF6A 5C23A 2ZEQA 4DXAB 2WX0A 1ZXIA 1XLNA 1YN4A 2JUOA 1SBBB 1GC7A 1D6EC 2WLBA 1MVKA 3AEFB 4GOCA 3UINB 2W3RA 3A9KB 3M95A 4XDDA 4NAMA 3A9KA 2MRPA 1TZ1A 2JRIB 3Q3OC 4W9JA 2FUHB 3EUB2 3DBLI 3DCGA 2BWES 3ZVVA 1BMLC 2DYBA 1RLFA 4CO7A 3DBHI 3JSVB 3VHTC 4JLCA 2MBEA 2JYTA 4ZHOA 4L23A 1EU3A 2YLMA 4D2KA 2OEDA 3JSVA 1UGMA 2DYOA 1JRUA 3NRZA 1FIQA 3Q8FA 1A5RA 4KV2A 2I38A 3RULA 3K9OB 3Q3JA 2MA9B 2KZRA 2M0XA 2D10A 4WJOA 1VCBA 5AUKA 2PLPA 1X1MA 1KLVA 5FKAC 1RM6C 1UD7A 3RNEC 2KHWB 1E7PB 1XLPA 5HFYA 2K8BA 2Q5WD 4MM3A 1U4AA 3VTWA 2KTFA 4W9EA 2QHOA 2XK5B 3B9JA 3A4RA 1SIJA 2H88B 5HKHA 2QDFA 2BYFA 2XK5A 4BFRA 4EFOA 1IPGA 2JXXA 1YD8U 1PUTA 3VUYA 5J2RA 1EUVB 2FIDA 2M8SA 3Q2AC 4BOZB 4JE3B 1Y8RC 2BS3B 4BKGA 3BVGA 1YOVB 4AUQC 4K7WA 1GOZA 3UIPB 1NYQA 2NVUI 3V60A 2LHEA 4KDLB 4KZCA 2HTHA 1XD3B 3R3MA 3DVNV 2K6QA 4KGTA 2MHJA 3FILB 4JL9A 4XWWA 1Q10A 4KSLC 1WX7A 4RH6A 4B9KA 4I6PA 2IZVB 2J42A 3L54A 3M62B 1I4RA 2KVZA 2D3CA 3ZDMC 2UWQA 2Z0DB 3OG5A 1KM7A 4MELA 2KMMA 3WALA 2IYDB 1I4HA 2BYEA 1C78A 4ZRJA 4FJZA 3A1QA 1HA5A 2ZCCA 4XC2A 4WWNA 4B6WA 2INPE 4C00A 3Q3MC 2N9PC 5G5HA 4DXFA 2KN4A 1UZXB 2N9KA 1WXMA 2NBVB 1WRIA 4K81A 4F8CB 2ICIA 2V0GA 1D5XC 4KGRA 5H8YE 4KSKC 2KFJA 2MJEA 5D2MB 4RGMA 3GS2A 4N9F4 2L1AA 3KWLA 4J6IA 4LNKA 4P1BC 1HTOA 3V61A 2NTTA 3RD2A 2W82A 5FR6A 2Y5CA 1IGCA 4WJNA 3DDCB 3CIRB 3RZWC 2NTSA 2O6VB 1WYWB 2KTRB 1TT5B 3KUCB 1AW7A 4W9CA 2O6VA 2K5PA 3BY4B 4FLHA 1V97A 4BKSD 3AE7B 4KDIC 3W5VB 2MSED 2XBBC 1H4RA 3L16A 2KD0A 1T0SC 1BT0A 3VH4B 1I4XA 4ZHPA 2GI9A 4OVUA 2KNBA 1ET6A 2YEPB 3EECA 2BB6A 3V62A 2DBYA 3WAOA 1AARA 4JWUC 1TS4A 4WJQA 2PJHA 4O1NA 1JROA 4GLSC 2WX1A 5AZHA 2N7EA 4A3OA 2ZW1A 4RM8A 2K1FA 1IUEA 1FPYA 1L2NA 4W9FA 3PHXB 4A3PA 5EE1A 5IP4D 2JX5A 1Q1OA 1OFFA 3NY5A 4B95A 2K8HA 2W3SA 3M3JA 1ZOYB 2JQRB 1R7SA 3M63B 3GZNI 3DPDA 2LD9A 4W9LA 2ON8A 4NJCA 4IM3A 3ZXRA 3WA0A 4HXDA 3P1MA 3X23A 2LMCA 1R4MB 2BF8B 5DPSA 3NZSA 5AZGA 1WJNA 5BYRA 1E9MA 1TJEA 2IGHA 1RAXA 1OGWA 3CSTA 2YEPF 4DHZB 1WI0A 3RMKC 3EA6A 2LUMA 1QT9A 4XYCA 1PGAA 1E90A 4KKIA 2MBQA 1LXDA 2K6DB 3U7ZA 2AEHA 2LJ5A 1C76A 3QA8A 4LK0M 3U52E 1C79A 3DQVA 4OVZA 3AE3B 4MSQB 3KVFB 3DBRB 4M01A 3TBLD 3KWVA 1C3TA 4AOFA 2KLGA 1QOGA 1MHXA 3QIJA 3WIMA 3HVDA 4NJ7A 1F2RC 1WJ6A 4M0WB 1PYWD 3UIOB 4DXGA 3VVWB 4P1CC 1L4ZB 1J7BA 4M0WA 2IJ0A 2GMIC 3AH7A 3E56A 4ZRQA 4Q2JA 3VR8B 3TL5A 2BYVE 3DBSA 2W55A 1JWBD 4KX6B 3MJWA 4MACA 3IT6B 1J7AA 1C1YB 2FBWB 3FC4A 3ZO5B 2V1YA 3H6NA 2DLBA 4WURA 2FCSA 1RFAA 2ZNVC 1SSNA 3BZDB 3R7QA 2LGDA 3RI7C 4C7YA 4LNIA 1P1AA 1WRDB 4IKGA 1E8ZA 2QJLA 1UELA 3QHTA 2H89B 5E6OA 2L3ZA 4XGAB 2KDBA 2LI5A 1B9RA 2I1JA 1VJKA 5CHWA 3B0AA 5G55A 4URKA 1SJHD 1YJ1A 1QOBA 3MHZA 5JHBA 5LXHA 3BWUD 3OLMD 3UGBB 1WE6A 4P16A 2ASQA 2Z59B 4L1BA 4KIKB 2KWCA 5J18A 4EEWA 3ETRA 4KIKA 2IPKD 4CHKA 5E6NA 1IBXB 2G4SA 1WFYA 1XCQL 2MP2B 2D2QA 4X57B 1UBIA 1IBXA 1TKYA 4C80A 2MP2A 1ZDVA 3N1XC 4GIVA 1T5XD 4BOSC 1F2RI 2I2YA 4YSXB 1TIFA 4LJPB 3ENEA 2AQ1B 3UQBA 1FNUA 2C7HA 1OQQA 4HDQA 1HE8A 4MH0E 2M19A 1IP9A 4IOIE 1MFWA 1LQBA 2PE9A 4IWOA 2XNAC 1GJZA 4HEA1 2MBBB 4YTMB 2KFKB 2WXKA 5AEKB 2GBNA 3TUOA 1EWYC 3IFWB 2ZZPB 3AEDB 2KFKA 2G9HD 2PMVA 2M0AA 1WGHA 1SGHA 2PVGC 4GSWA 4PYUA 4RGOS 4E3CA 1SB3C 2IO2B 3QARA 4GU2A 2DAJA 3AI5A 3QWZB 1R4NB 2L05A 3V6CB 5HHDG 5JH5C 3LDZE 1T0YA 3K9PB 3ZDTA 2JPHA 4HPLB 3MFGA 3MC8A 4MJSB 1TBEA 2J0JA 4MDKE 1WWTA 2RDGA 4TKNA 2KC2A 4FHKA 1OQRA 1FD6A 5JZEB 5FK9C 3EC8A 2KX3A 4TMAB 3ZRCA 1V5OA 3J9CA 4NAWB 1WGKA 3DHGC 1PGXA 1NBFC 3ECIA 2M56B 4NAWA 4JIOU 5CHVC 2EKEC 1P7FA 2UU7A 4TV3A 5LLIA 4YXDB 2WXRA 3B2FA 2JWZA 1T3QA 2HJ1A 4PS8A 2ZPNA 1YJJA 1UH6A 5CTRC 3T3OA 3H7PB 3AEEB 2GBJA 3PRPB 3ALBA 3I9V1 3U8ZA 3L13A 3AE4B 2KN5A 3PLUA 3AE8B 2KK8A 1Y56A 4W9IA 1J8CA 1WM3A 4P6VF 3AECB 1HZ6A 4TQ0A 4JWSC 5IN7A 1WZ0A 1WGYA 1QQRA 4WWMA 4NQKE 4FBJB 3SHQA 1WMHB 4F1SA 1E6EB 1V8CA 4K7SA 1WMHA 3MP9A 4YTNB 1D3ZA 3B1LX 4REZA 4A6QA 4MH8A 1P3QU 2YVCA 1YN5A 1BUIC 3W1SA 2E3TA 2KJRA 1TYGB 3HHMA 4JGHB 1V5TA 2IY0B 3I3TB 1I4GA 2HTME 2C60A 2BKFA 4FA6A 1LO5D 4HWIB 1ZE3D 1QOAA 1RWSA 1CZPA 2IGGA 4E74A 2PW9A 4N59A 2LASA 2WXGA 3P2BA
chains in the Genus database with same CATH topology
4OVUA 1K8RB 2KNBA 2Y5BB 3O65B 1WE7A 3AU5A 4A20A 5IAAC 3UF8A 2NBUA 3DBRI 3EECA 3NHEB 4IWPA 3APCA 3L17A 3QQ8B 3ZUNA 4M8MA 4RM9A 1I35A 2DZIA 3H9DA 3QC8B 3WANA 1J19A 3CMMB 4MJSA 4WWPA 4W9DA 3VAWA 2C7NB 3JYUA 3V62A 2KQSA 3ZTDA 3KH0A 1WGGA 1AARA 3WAOA 4FHJA 2C7MB 2MX2A 4WJQA 2PJHA 1RRBA 1WZ3A 4II2B 4E71A 1LFDA 2V3SA 2AL6A 2LVOA 2WX1A 5AZHA 2Z0EB 2LRUA 2IO0B 2K39A 2N7EA 4IC7B 4IG7B 3L08A 4A3OA 4RM8A 2G3QB 1WJ4A 2K1FA 3QK0A 3WAPA 5D94A 1L2NA 1YIWA 4W9FA 3TJPA 4EZLA 1WGRA 3PHXB 4A3PA 2KDIA 1WXAA 4GGQA 1ZGUB 5C1ZA 3ZNGC 2LUEA 2MBOA 3H7PA 3PGEA 4F7ZA 4PS3A 1Q1OA 5J17A 2A4ZA 3VXWA 3NY5A 2CR5A 4B95A 2K8HA 3QCAA 3M3JA 2PPHA 3M63B 1OTRB 1WXVA 3PT2B 3GZNI 4G0NB 1Q5WB 1S3SG 4XZ4A 4PS7A 3DPDA 2JZ3B 2LD9A 4GN1A 3R66C 4W9LA 4ICUA 5KHOA 2J0MA 3CF6E 4IM3A 3VUXA 3WA0A 2LXCA 2FCQA 1WM2A 4WJPA 2IY1B 3KUDB 2OOBB 4HXDA 3X23A 3X0WA 2BF8B 3A4SC 5DPSA 1TGZB 2FIFA 2B3AA 2EMTA 4KVGB 1E7UA 3NZSA 4HCPB 3APFA 5DPTA 4CYEA 5AZGA 1WJNA 2LWPA 4EKUA 5DPRA 2ZJDA 1RAXA 4KZ0A 1OGWA 4BVUC 3CSTA 2JF5A 4DK5A 2HJ8A 2KLCA 4DHZB 5CX3A 2MLBA 1WI0A 2AYOB 4EZJA 1TTNA 2GOWA 3RZFA 1E90A 4W9GA 4PYZA 3SD5A 4GB9A 3VDZA 2MBQA 1LXDA 2V4LA 5DCNA 2K6DB 2IO3B 4W9KA 2AEHA 2LJ5A 4ANUA 5GMVA 2KVRA 2BPSA 3QA8A 2MCNB 3MHSD 2D11A 1E8WA 1E8YA 2R2QA 3DQVA 3AXCA 2CHWA 1M94A 4IWQA 2J7QB 4MSQB 4IUMB 3KVFB 2ZVNA 3PPAA 4G3XB 3OAWA 3TBLD 2DAFA 2KTRA 1ISNA 1C3TA 4AOFA 2KLGA 5KHQA 3ZNID 4HDOA 1SIFA 2K8CA 3APDA 3QIJA 4ANXA 2CKHB 3WIMA 3VH3B 4NJ7A 3DVNU 3ZNHB 4FADA 4P7IA 1L7YA 4NQLB 1WJ6A 1XQQA 4M0WB 3UIOB 3KW5B 3NZUA 3QJZA 4XX5A 3VVWB 1H8CA 2N4FA 4MSMB 1P98A 2NCNA 4NJ6A 2GMIC 2KC1A 3VUWA 3T9LA 2L8JA 2M4NA 3ONSA 4FULA 3TL5A 4YL8A 1WIAA 3U7DA 2LGXA 3TCAA 1MG8A 4ZRKA 1GNUA 3QAQA 5LXIB 1V80A 2LRWA 3RUIB 1I42A 1WY8A 4MGKE 4II3B 2AWTA 2BYVE 4W9HA 3DBSA 3OJ4B 4DBGA 1KJTA 3A9JB 2KO3A 3MJWA 4ANVA 3PRZA 2KMCA 2XEWA 1C1YB 2J0KA 1V49A 2R2OA 4AJYB 3ZO5B 4EZKA 1V2YA 2V1YA 4I6LB 2L7RA 3H6NA 2FCSA 5D6JB 1RFAA 2ZNVC 4WWOA 2ZPYA 3PTFC 3QX1A 3R7RA 4IW0A 2KXJA 2KWVB 3PV1A 3R7QA 3TMPB 2LGDA 1P1AA 4EUTA 5JHAA 3ZLZA 1WF9A 1V6EA 3W1SC 1WR1A 1WRDB 4DDGD 2G45B 2I1KA 3TIXA 4LDTD 3N32A 1E8ZA 1UELA 3QHTA 5G2NA 4BKSA 4HVBA 3UQAA 4LJOB 2KJHB 4I6NB 2DX5B 3S2AA 1ZW7A 5E6OA 2NS5A 2KDFB 2JT4B 2L3ZA 1R4NI 3HM6X 3SU8X 3MTNB 2KDBA 2LI5A 1E8XA 2GBKA 3B08A 2N1VA 2I1JA 2O2VB 4ASWC 4EOYA 1V9JA 4K1RB 2HE7A 2DENB 4BKTA 1WJUA 2BKRB 5CHWA 3SDLC 4OVVA 2JVCA 3B0AA 2DZKA 5G55A 4M8NA 4URKA 4HJKA 2KWUB 3NS8A 4ANWA 2BGFA 1XT9B 1YJ1A 4NNJB 5JHBA 3JW0X 5LXHA 3ZNZB 3LJ3A 1IYFA 4AWJA 3OLMD 1P9DU 3U30A 2KX0A 2RR9A 3UGBB 1WE6A 5C23A 2ZEQA 4DXAB 2ASQA 2CS4A 2WX0A 3A1QB 3N30A 4RMAA 3D32A 3IVFA 2RD0A 2JUOA 5D7GA 2C9WB 4HCNB 5EDSA 1E5WA 1GC7A 2DYMA 2Z59B 4KIKB 4LCDE 2KWCA 3A33B 1QZEA 5CHFA 2LGYA 4FJVB 5J18A 3ML9A 1ZKHA 2JRHA 4EEWA 2PE6B 4KIKA 4GOCA 2WYQA 2D07B 3IG3A 4CHKA 5E6NA 3UINB 1KOTA 4LDTB 2G4SA 3A9KB 1WFYA 2MP2B 3M95A 2D2QA 4X57B 1UBIA 4BBNC 2CHXA 3C0RB 3A9KA 2MRPA 3WAMA 1TZ1A 2MP2A 4GIVA 2JRIB 4BOSC 4W9JA 2JZZA 2FUHB 1VD2A 3DBLI 4BBNF 1LM8B 3DCGA 2DHZA 3EHVA 4LJPB 1UBQA 3ZIMA 2BWES 2L76A 3ENEA 1J0GA 1SE9A 3H7SA 3AULA 3UQBA 3ZVVA 2D3GA 2DYBA 2C7HA 1RLFA 3NOBA 3VTVA 2DZJA 3DBHI 3JSVB 3VHTC 4CO7A 4JLCA 2W9NA 2MBEA 4HDQA 1HE8A 2KOXA 4MH0E 2MQJA 2YLMA 3DOWA 2L00B 3JSVA 1UGMA 1IP9A 2DYOA 1JRUA 1LQBA 1YQBA 2PE9A 1A5RA 4IWOA 5IA7A 4KV2A 3RULA 1EO6A 3K9OB 1GJZA 3Q3JA 3HK0A 2MA9B 2M17A 2MBBB 2KZRA 2KFKB 2M0XA 2D10A 4WJOA 5AEKB 1VCBA 2GBNA 2L0FA 1GG3A 1X1MA 2ZZPB 3IFWB 3KYCD 1KLVA 2KFKA 3IBEA 1GC6A 4HK2A 1UD7A 2KHWB 4DHJD 5DPWA 1WGHA 2MBHA 3N3KB 1SGHA 4IM0A 2K8BA 2ZCBA 1WH3A 2KANA 4GSWA 1G6JA 4HPMB 4PYUA 3ML8A 4E3CA 4TQ1A 3PSEB 4DWFA 4MM3A 2IO2B 3QARA 1WX8A 4GU2A 2DAJA 3AI5A 3V6EB 1NI2A 3QWZB 4DDID 1EF5A 1U4AA 3VTWA 2KTFA 4W9EA 4ZRIA 2L05A 3V6CB 2UYZB 2QHOA 5JH5C 2XK5B 3A4RA 5E6PA 3A9JA 4MGYE 3PZDA 5HKHA 3LDZE 1T0YA 2BYFA 2XK5A 1P0RA 3K9PB 4BFRA 2IO1B 3ZDTA 5L83A 4EFOA 1IPGA 2JXXA 3KUZA 2JPHA 3VQIA 4HPLB 1YD8U 2FNJB 2K25A 3Q3FA 3VUYA 4MJSB 2KQ7A 1TBEA 2J0JA 5J2RA 2CHZA 1EUVB 4MDKE 2FIDA 2M1MA 2M8SA 4TKNA 2KC2A 4NY0A 3ZW3A 4BOZB 1Y8RC 4FHKA 4ZDVA 4BKGA 4AJWA 4AUQC 4IM2A 4K7WA 4DHZE 5JZEB 3UIPB 3EC8A 2KX3A 2NVUI 3V60A 3ZRCA 4KDLB 4KZCA 2ZVOA 2HTHA 1V5OA 4HLEA 1XD3B 3R3MA 3DVNV 2K6QA 4NAWB 3PREA 2MWSB 3PHWB 3ZKJC 1NBFC 5BO4B 4JL9A 3IHPC 2KDEB 3ECIA 4NAWA 4JIOU 2LXAA 5CHVC 2EKEC 3BINA 3EFUA 2FCNA 1WX7A 2O2VA 4KSLC 3L10B 4B9KA 1Z5SB 4TV3A 2FCMA 1YX5B 5LLIA 4DHJB 4I6PA 2OJRA 4G50A 4TUUA 1WGDA 2JWZA 2AL3A 2IZVB 2VRRB 3PVLA 2LVQA 3L54A 4G11A 4PS8A 3M62B 2L0TA 2ZPNA 4GMVA 3ZDMC 1UH6A 1WX9A 1WXSA 2IBIB 2FAZA 3H7PB 5CTRC 5AZFA 2N1WA 2GBJA 2UWQA 2NPTB 2Z0DB 3PRMB 4FJYA 3W1YA 3ZTCA 1KM7A 3H1UA 1NDDA 3PRPB 4MELA 3ALBA 3WALA 2KKCA 2WDTB 2IYDB 3PS6A 4MEMA 1V81A 1Z2MA 2NPTA 4FN2A 2BYEA 2C5LC 4ZRJA 4FJZA 2BWFA 3U8ZA 3L13A 3A1QA 4MGZE 2ZCCA 2DZMA 4XC2A 2KN5A 2RGFA 4WWNA 4B6WA 3PLUA 2O6VD 2REXA 2JY6A 5L95C 2N9XA 2KK8A 1Q0WB 2N9PC 4W9IA 3DVGY 1E7VA 1J8CA 1UZXB 1WM3A 2LVPA 1OQYA 1WXMA 2NBVB 3VFKA 4K81A 4F8CB 3L0WB 2N9EB 4TQ0A 4GXBA 4ICVA 3GOEA 3RT3B 1WZ0A 1WGYA 4KSKC 2EMSA 2KFJA 2GBRA 1OEYJ 4NQKE 5D2MB 4GDKB 2WWZA 2GBMA 2NR2A 3RCZA 4FBJB 5TR5A 3T8MA 2ZNVB 4N9F4 1WMHB 3SHQA 4F1SA 2N7DA 4GDKA 3OJ3A 2MW5A 4K7SA 3HIZA 4J6IA 2LZ6A 3PLVA 1WMHA 4AP4C 1D3ZA 3B1LX 2A5UA 2KMAA 2G4DB 3RD2A 2RSUA 3V61A 2CU1A 1P3QU 1V86A 1GUAB 4NPNA 2YVCA 3W1SA 1R4MI 1F9JA 5FR6A 2KJ6A 1S1QB 3DVGX 2KJRA 4WAAA 3AU4A 3HHMA 1V5TA 4JGHB 4WJNA 2IY0B 3DDCB 3RZWC 2HD5B 2O6VB 1WYWB 2KTRB 4K7UA 3I3TB 3JVZX 3KUCB 1CMXB 3KYDD 1EF1A 3RYTA 2C60A 4GDLB 2O6VA 4W9CA 3VTUA 2BKFA 4FA6A 3BY4B 1OEYA 4FLHA 4HWIB 2NBWB 4ZYNA 4BKSD 1YX6B 4GDLA 4MGIE 3ZRFA 3HM3A 1PQSA 4KDIC 2PEAA 4E74A 2MSED 2XBBC 1H4RA 3L16A 3CSFA 1FXTB 1WR6E 2LASA 2KD0A 4WQOB 2RPQA 1BT0A 3VH4B 3P2BA 4JQWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVU A;  1K8R B;  2KNB A;  2Y5B B;  3O65 B;  1WE7 A;  3AU5 A;  4A20 A;  5IAA C;  3UF8 A;  2NBU A;  3DBR I;  3EEC A;  3NHE B;  4IWP A;  3APC A;  3L17 A;  3QQ8 B;  3ZUN A;  4M8M A;  4RM9 A;  1I35 A;  2DZI A;  3H9D A;  3QC8 B;  3WAN A;  1J19 A;  3CMM B;  4MJS A;  4WWP A;  4W9D A;  3VAW A;  2C7N B;  3JYU A;  3V62 A;  2KQS A;  3ZTD A;  3KH0 A;  1WGG A;  1AAR A;  3WAO A;  4FHJ A;  2C7M B;  2MX2 A;  4WJQ A;  2PJH A;  1RRB A;  1WZ3 A;  4II2 B;  4E71 A;  1LFD A;  2V3S A;  2AL6 A;  2LVO A;  2WX1 A;  5AZH A;  2Z0E B;  2LRU A;  2IO0 B;  2K39 A;  2N7E A;  4IC7 B;  4IG7 B;  3L08 A;  4A3O A;  4RM8 A;  2G3Q B;  1WJ4 A;  2K1F A;  3QK0 A;  3WAP A;  5D94 A;  1L2N A;  1YIW A;  4W9F A;  3TJP A;  4EZL A;  1WGR A;  3PHX B;  4A3P A;  2KDI A;  1WXA A;  4GGQ A;  1ZGU B;  5C1Z A;  3ZNG C;  2LUE A;  2MBO A;  3H7P A;  3PGE A;  4F7Z A;  4PS3 A;  1Q1O A;  5J17 A;  2A4Z A;  3VXW A;  3NY5 A;  2CR5 A;  4B95 A;  2K8H A;  3QCA A;  3M3J A;  2PPH A;  3M63 B;  1OTR B;  1WXV A;  3PT2 B;  3GZN I;  4G0N B;  1Q5W B;  1S3S G;  4XZ4 A;  4PS7 A;  3DPD A;  2JZ3 B;  2LD9 A;  4GN1 A;  3R66 C;  4W9L A;  4ICU A;  5KHO A;  2J0M A;  3CF6 E;  4IM3 A;  3VUX A;  3WA0 A;  2LXC A;  2FCQ A;  1WM2 A;  4WJP A;  2IY1 B;  3KUD B;  2OOB B;  4HXD A;  3X23 A;  3X0W A;  2BF8 B;  3A4S C;  5DPS A;  1TGZ B;  2FIF A;  2B3A A;  2EMT A;  4KVG B;  1E7U A;  3NZS A;  4HCP B;  3APF A;  5DPT A;  4CYE A;  5AZG A;  1WJN A;  2LWP A;  4EKU A;  5DPR A;  2ZJD A;  1RAX A;  4KZ0 A;  1OGW A;  4BVU C;  3CST A;  2JF5 A;  4DK5 A;  2HJ8 A;  2KLC A;  4DHZ B;  5CX3 A;  2MLB A;  1WI0 A;  2AYO B;  4EZJ A;  1TTN A;  2GOW A;  3RZF A;  1E90 A;  4W9G A;  4PYZ A;  3SD5 A;  4GB9 A;  3VDZ A;  2MBQ A;  1LXD A;  2V4L A;  5DCN A;  2K6D B;  2IO3 B;  4W9K A;  2AEH A;  2LJ5 A;  4ANU A;  5GMV A;  2KVR A;  2BPS A;  3QA8 A;  2MCN B;  3MHS D;  2D11 A;  1E8W A;  1E8Y A;  2R2Q A;  3DQV A;  3AXC A;  2CHW A;  1M94 A;  4IWQ A;  2J7Q B;  4MSQ B;  4IUM B;  3KVF B;  2ZVN A;  3PPA A;  4G3X B;  3OAW A;  3TBL D;  2DAF A;  2KTR A;  1ISN A;  1C3T A;  4AOF A;  2KLG A;  5KHQ A;  3ZNI D;  4HDO A;  1SIF A;  2K8C A;  3APD A;  3QIJ A;  4ANX A;  2CKH B;  3WIM A;  3VH3 B;  4NJ7 A;  3DVN U;  3ZNH B;  4FAD A;  4P7I A;  1L7Y A;  4NQL B;  1WJ6 A;  1XQQ A;  4M0W B;  3UIO B;  3KW5 B;  3NZU A;  3QJZ A;  4XX5 A;  3VVW B;  1H8C A;  2N4F A;  4MSM B;  1P98 A;  2NCN A;  4NJ6 A;  2GMI C;  2KC1 A;  3VUW A;  3T9L A;  2L8J A;  2M4N A;  3ONS A;  4FUL A;  3TL5 A;  4YL8 A;  1WIA A;  3U7D A;  2LGX A;  3TCA A;  1MG8 A;  4ZRK A;  1GNU A;  3QAQ A;  5LXI B;  1V80 A;  2LRW A;  3RUI B;  1I42 A;  1WY8 A;  4MGK E;  4II3 B;  2AWT A;  2BYV E;  4W9H A;  3DBS A;  3OJ4 B;  4DBG A;  1KJT A;  3A9J B;  2KO3 A;  3MJW A;  4ANV A;  3PRZ A;  2KMC A;  2XEW A;  1C1Y B;  2J0K A;  1V49 A;  2R2O A;  4AJY B;  3ZO5 B;  4EZK A;  1V2Y A;  2V1Y A;  4I6L B;  2L7R A;  3H6N A;  2FCS A;  5D6J B;  1RFA A;  2ZNV C;  4WWO A;  2ZPY A;  3PTF C;  3QX1 A;  3R7R A;  4IW0 A;  2KXJ A;  2KWV B;  3PV1 A;  3R7Q A;  3TMP B;  2LGD A;  1P1A A;  4EUT A;  5JHA A;  3ZLZ A;  1WF9 A;  1V6E A;  3W1S C;  1WR1 A;  1WRD B;  4DDG D;  2G45 B;  2I1K A;  3TIX A;  4LDT D;  3N32 A;  1E8Z A;  1UEL A;  3QHT A;  5G2N A;  4BKS A;  4HVB A;  3UQA A;  4LJO B;  2KJH B;  4I6N B;  2DX5 B;  3S2A A;  1ZW7 A;  5E6O A;  2NS5 A;  2KDF B;  2JT4 B;  2L3Z A;  1R4N I;  3HM6 X;  3SU8 X;  3MTN B;  2KDB A;  2LI5 A;  1E8X A;  2GBK A;  3B08 A;  2N1V A;  2I1J A;  2O2V B;  4ASW C;  4EOY A;  1V9J A;  4K1R B;  2HE7 A;  2DEN B;  4BKT A;  1WJU A;  2BKR B;  5CHW A;  3SDL C;  4OVV A;  2JVC A;  3B0A A;  2DZK A;  5G55 A;  4M8N A;  4URK A;  4HJK A;  2KWU B;  3NS8 A;  4ANW A;  2BGF A;  1XT9 B;  1YJ1 A;  4NNJ B;  5JHB A;  3JW0 X;  5LXH A;  3ZNZ B;  3LJ3 A;  1IYF A;  4AWJ A;  3OLM D;  1P9D U;  3U30 A;  2KX0 A;  2RR9 A;  3UGB B;  1WE6 A;  5C23 A;  2ZEQ A;  4DXA B;  2ASQ A;  2CS4 A;  2WX0 A;  3A1Q B;  3N30 A;  4RMA A;  3D32 A;  3IVF A;  2RD0 A;  2JUO A;  5D7G A;  2C9W B;  4HCN B;  5EDS A;  1E5W A;  1GC7 A;  2DYM A;  2Z59 B;  4KIK B;  4LCD E;  2KWC A;  3A33 B;  1QZE A;  5CHF A;  2LGY A;  4FJV B;  5J18 A;  3ML9 A;  1ZKH A;  2JRH A;  4EEW A;  2PE6 B;  4KIK A;  4GOC A;  2WYQ A;  2D07 B;  3IG3 A;  4CHK A;  5E6N A;  3UIN B;  1KOT A;  4LDT B;  2G4S A;  3A9K B;  1WFY A;  2MP2 B;  3M95 A;  2D2Q A;  4X57 B;  1UBI A;  4BBN C;  2CHX A;  3C0R B;  3A9K A;  2MRP A;  3WAM A;  1TZ1 A;  2MP2 A;  4GIV A;  2JRI B;  4BOS C;  4W9J A;  2JZZ A;  2FUH B;  1VD2 A;  3DBL I;  4BBN F;  1LM8 B;  3DCG A;  2DHZ A;  3EHV A;  4LJP B;  1UBQ A;  3ZIM A;  2BWE S;  2L76 A;  3ENE A;  1J0G A;  1SE9 A;  3H7S A;  3AUL A;  3UQB A;  3ZVV A;  2D3G A;  2DYB A;  2C7H A;  1RLF A;  3NOB A;  3VTV A;  2DZJ A;  3DBH I;  3JSV B;  3VHT C;  4CO7 A;  4JLC A;  2W9N A;  2MBE A;  4HDQ A;  1HE8 A;  2KOX A;  4MH0 E;  2MQJ A;  2YLM A;  3DOW A;  2L00 B;  3JSV A;  1UGM A;  1IP9 A;  2DYO A;  1JRU A;  1LQB A;  1YQB A;  2PE9 A;  1A5R A;  4IWO A;  5IA7 A;  4KV2 A;  3RUL A;  1EO6 A;  3K9O B;  1GJZ A;  3Q3J A;  3HK0 A;  2MA9 B;  2M17 A;  2MBB B;  2KZR A;  2KFK B;  2M0X A;  2D10 A;  4WJO A;  5AEK B;  1VCB A;  2GBN A;  2L0F A;  1GG3 A;  1X1M A;  2ZZP B;  3IFW B;  3KYC D;  1KLV A;  2KFK A;  3IBE A;  1GC6 A;  4HK2 A;  1UD7 A;  2KHW B;  4DHJ D;  5DPW A;  1WGH A;  2MBH A;  3N3K B;  1SGH A;  4IM0 A;  2K8B A;  2ZCB A;  1WH3 A;  2KAN A;  4GSW A;  1G6J A;  4HPM B;  4PYU A;  3ML8 A;  4E3C A;  4TQ1 A;  3PSE B;  4DWF A;  4MM3 A;  2IO2 B;  3QAR A;  1WX8 A;  4GU2 A;  2DAJ A;  3AI5 A;  3V6E B;  1NI2 A;  3QWZ B;  4DDI D;  1EF5 A;  1U4A A;  3VTW A;  2KTF A;  4W9E A;  4ZRI A;  2L05 A;  3V6C B;  2UYZ B;  2QHO A;  5JH5 C;  2XK5 B;  3A4R A;  5E6P A;  3A9J A;  4MGY E;  3PZD A;  5HKH A;  3LDZ E;  1T0Y A;  2BYF A;  2XK5 A;  1P0R A;  3K9P B;  4BFR A;  2IO1 B;  3ZDT A;  5L83 A;  4EFO A;  1IPG A;  2JXX A;  3KUZ A;  2JPH A;  3VQI A;  4HPL B;  1YD8 U;  2FNJ B;  2K25 A;  3Q3F A;  3VUY A;  4MJS B;  2KQ7 A;  1TBE A;  2J0J A;  5J2R A;  2CHZ A;  1EUV B;  4MDK E;  2FID A;  2M1M A;  2M8S A;  4TKN A;  2KC2 A;  4NY0 A;  3ZW3 A;  4BOZ B;  1Y8R C;  4FHK A;  4ZDV A;  4BKG A;  4AJW A;  4AUQ C;  4IM2 A;  4K7W A;  4DHZ E;  5JZE B;  3UIP B;  3EC8 A;  2KX3 A;  2NVU I;  3V60 A;  3ZRC A;  4KDL B;  4KZC A;  2ZVO A;  2HTH A;  1V5O A;  4HLE A;  1XD3 B;  3R3M A;  3DVN V;  2K6Q A;  4NAW B;  3PRE A;  2MWS B;  3PHW B;  3ZKJ C;  1NBF C;  5BO4 B;  4JL9 A;  3IHP C;  2KDE B;  3ECI A;  4NAW A;  4JIO U;  2LXA A;  5CHV C;  2EKE C;  3BIN A;  3EFU A;  2FCN A;  1WX7 A;  2O2V A;  4KSL C;  3L10 B;  4B9K A;  1Z5S B;  4TV3 A;  2FCM A;  1YX5 B;  5LLI A;  4DHJ B;  4I6P A;  2OJR A;  4G50 A;  4TUU A;  1WGD A;  2JWZ A;  2AL3 A;  2IZV B;  2VRR B;  3PVL A;  2LVQ A;  3L54 A;  4G11 A;  4PS8 A;  3M62 B;  2L0T A;  2ZPN A;  4GMV A;  3ZDM C;  1UH6 A;  1WX9 A;  1WXS A;  2IBI B;  2FAZ A;  3H7P B;  5CTR C;  5AZF A;  2N1W A;  2GBJ A;  2UWQ A;  2NPT B;  2Z0D B;  3PRM B;  4FJY A;  3W1Y A;  3ZTC A;  1KM7 A;  3H1U A;  1NDD A;  3PRP B;  4MEL A;  3ALB A;  3WAL A;  2KKC A;  2WDT B;  2IYD B;  3PS6 A;  4MEM A;  1V81 A;  1Z2M A;  2NPT A;  4FN2 A;  2BYE A;  2C5L C;  4ZRJ A;  4FJZ A;  2BWF A;  3U8Z A;  3L13 A;  3A1Q A;  4MGZ E;  2ZCC A;  2DZM A;  4XC2 A;  2KN5 A;  2RGF A;  4WWN A;  4B6W A;  3PLU A;  2O6V D;  2REX A;  2JY6 A;  5L95 C;  2N9X A;  2KK8 A;  1Q0W B;  2N9P C;  4W9I A;  3DVG Y;  1E7V A;  1J8C A;  1UZX B;  1WM3 A;  2LVP A;  1OQY A;  1WXM A;  2NBV B;  3VFK A;  4K81 A;  4F8C B;  3L0W B;  2N9E B;  4TQ0 A;  4GXB A;  4ICV A;  3GOE A;  3RT3 B;  1WZ0 A;  1WGY A;  4KSK C;  2EMS A;  2KFJ A;  2GBR A;  1OEY J;  4NQK E;  5D2M B;  4GDK B;  2WWZ A;  2GBM A;  2NR2 A;  3RCZ A;  4FBJ B;  5TR5 A;  3T8M A;  2ZNV B;  4N9F 4;  1WMH B;  3SHQ A;  4F1S A;  2N7D A;  4GDK A;  3OJ3 A;  2MW5 A;  4K7S A;  3HIZ A;  4J6I A;  2LZ6 A;  3PLV A;  1WMH A;  4AP4 C;  1D3Z A;  3B1L X;  2A5U A;  2KMA A;  2G4D B;  3RD2 A;  2RSU A;  3V61 A;  2CU1 A;  1P3Q U;  1V86 A;  1GUA B;  4NPN A;  2YVC A;  3W1S A;  1R4M I;  1F9J A;  5FR6 A;  2KJ6 A;  1S1Q B;  3DVG X;  2KJR A;  4WAA A;  3AU4 A;  3HHM A;  1V5T A;  4JGH B;  4WJN A;  2IY0 B;  3DDC B;  3RZW C;  2HD5 B;  2O6V B;  1WYW B;  2KTR B;  4K7U A;  3I3T B;  3JVZ X;  3KUC B;  1CMX B;  3KYD D;  1EF1 A;  3RYT A;  2C60 A;  4GDL B;  2O6V A;  4W9C A;  3VTU A;  2BKF A;  4FA6 A;  3BY4 B;  1OEY A;  4FLH A;  4HWI B;  2NBW B;  4ZYN A;  4BKS D;  1YX6 B;  4GDL A;  4MGI E;  3ZRF A;  3HM3 A;  1PQS A;  4KDI C;  2PEA A;  4E74 A;  2MSE D;  2XBB C;  1H4R A;  3L16 A;  3CSF A;  1FXT B;  1WR6 E;  2LAS A;  2KD0 A;  4WQO B;  2RPQ A;  1BT0 A;  3VH4 B;  3P2B A;  4JQW C; 
#chains in the Genus database with same CATH topology
 2Y5B B;  3AU5 A;  3AEA B;  2QIL A;  5IAA C;  3UF8 A;  1WXQ A;  4IWP A;  4YT0 B;  3QQ8 B;  1SEB D;  4OHJ A;  2N0S B;  1YQ3 B;  1YMH E;  3WAN A;  3CMM B;  5BYQ A;  2KQS A;  1K50 A;  5IKC M;  1RFK A;  2AQ3 B;  2C7M B;  2NMQ A;  4HRS A;  4II2 B;  4RF1 A;  3FIL A;  2WXM A;  2LRU A;  2K39 A;  3SEB A;  2K22 A;  2EEL A;  2V9H A;  2OHF A;  1WJ4 A;  3QK0 A;  3WAP A;  4EZL A;  1WGR A;  1WXA A;  4GGQ A;  1ZGU B;  2LUE A;  3DHH C;  2RDH A;  4YTP B;  2A4Z A;  2K0P A;  1KF6 B;  2PPH A;  1WXV A;  4XZ4 A;  2AQ2 B;  4GN1 A;  1N6Z A;  2J53 A;  5TSS A;  2J0M A;  4HPP A;  2WXQ A;  2FCQ A;  1WM2 A;  5MPO A;  1YNT E;  2CJO A;  3KUD B;  3AE6 B;  4OW0 A;  1KTK A;  1HQR D;  2EMT A;  1NEK B;  3C19 A;  3W5U B;  3APF A;  5DPT A;  2SEB D;  4IDI A;  2LWP A;  4EKU A;  5DPR A;  2ZJD A;  4BVU C;  1N62 A;  3VRB B;  3C8Y A;  1F0Z A;  2WS3 B;  2AX5 A;  1TTN A;  3PO0 A;  3SD5 A;  2V4L A;  5DCN A;  3BII D;  4ANU A;  3RFZ B;  1L0X B;  2KVR A;  4A8X C;  2BPS A;  1E8W A;  3AV8 A;  1M94 A;  3BYT B;  1NVI D;  1XO3 A;  3OAW A;  2DAF A;  2KTR A;  5HI1 A;  2BW2 A;  1EU4 A;  2K8C A;  4HRO A;  4FAD A;  1L7Y A;  4LLG M;  1XQQ A;  4OZB A;  3KW5 B;  3NZU A;  3V05 A;  4H2A A;  3CWI A;  5D3I B;  2JSV X;  1L4D B;  3RNG C;  1WIA A;  3TCA A;  4ZRK A;  2LGS A;  5LXI B;  3RUI B;  1I42 A;  1WY8 A;  4MGK E;  4II3 B;  4W9H A;  3VR9 B;  2J4X A;  3OWE B;  2W54 A;  1KJT A;  3A9J B;  3I63 C;  2KMC A;  2XEW A;  3P4Q B;  2R2O A;  4AJY B;  4EZK A;  3BK2 A;  4BAX A;  2L7R A;  3AE1 B;  5D6J B;  2ZPY A;  3R7R A;  4IW0 A;  3TMP B;  5JXV A;  4RF0 A;  3ZLZ A;  2G45 B;  4LDT D;  3RN9 C;  4HVB A;  4LJO B;  2KJH B;  2V3P A;  4I6N B;  2NS5 A;  2KDF B;  3HM6 X;  1SJE D;  3HRD D;  1E8X A;  2GBK A;  2INC C;  4OZC A;  4ASW C;  2O2V B;  4EOY A;  4K1R B;  4BKT A;  3SDL C;  3R8B A;  4OVV A;  2PVO D;  2DZK A;  2QCZ A;  1PGB A;  3Q6B A;  4HJK A;  3NS8 A;  2WXN A;  2BGF A;  2OJW A;  3Q3N C;  3TEW A;  1DOX A;  1SE4 A;  2KAJ A;  3ZNZ B;  4AWJ A;  1P9D U;  2JWU A;  2RR9 A;  1ACC A;  1L0Y B;  1JAL A;  3N30 A;  4RMA A;  4C4V B;  3IVF A;  2C9W B;  4US9 A;  2BB5 A;  4HCN B;  3U4E G;  1B1Z A;  2DYM A;  4WAF A;  4C4V A;  3BYY B;  2KYW A;  1UUP A;  2LGY A;  3ML9 A;  1ZKH A;  2PE6 B;  2WYQ A;  2D07 B;  4PT5 A;  2LGI A;  3IG3 A;  1KOT A;  4XDC A;  4BBN C;  1XXG A;  2CHX A;  1WSP A;  3C0R B;  2JXT A;  5C3J B;  2JZZ A;  3NVZ A;  2HDE A;  1VD2 A;  4S0R A;  4BBN F;  1LM8 B;  4N58 A;  3EHV A;  1XLQ A;  1UBQ A;  2JYE A;  1J0G A;  3H7S A;  3AUL A;  2D3G A;  2DZJ A;  3N1Z C;  2BYT A;  2X38 A;  1ROE A;  1SXT A;  2L00 B;  1XLO A;  3GE3 C;  1FCL A;  3AE9 B;  1EO6 A;  1N5X A;  3HK0 A;  1YJI A;  1C4P A;  1NYR A;  1C9F A;  2L0F A;  3KYC D;  3IBE A;  1NEN B;  3GE8 C;  3BVZ A;  4HK2 A;  4NZL B;  4DHJ D;  2PIA A;  1FXA A;  1ENF A;  4YWG G;  2ZCB A;  5D3D A;  4HPM B;  1FRR A;  4DWF A;  1WX8 A;  3V6E B;  3EGR A;  2MEK A;  4ZRI A;  3ZJT A;  5E6P A;  1FRD A;  3PZD A;  1SF0 A;  1J7C A;  4YSY B;  3VQI A;  2K25 A;  1JML A;  2WXL A;  2M1M A;  4US8 A;  4RGN A;  4ZDV A;  4YSZ B;  4AJW A;  4IM2 A;  2VZK B;  2PKO A;  4HLE A;  5AUI A;  4ACF A;  2N9L A;  3PHW B;  3ZKJ C;  3IHP C;  2GLS A;  3BIN A;  4EE2 A;  3L10 B;  1ZXH A;  2FCM A;  4G50 A;  4TUU A;  1WGD A;  4AQ7 A;  1FM0 D;  2AL3 A;  2VRR B;  3PVL A;  2LVQ A;  2E6X A;  3P4R B;  3IAS 1;  2IBI B;  4WQM A;  3NG0 A;  2NPT B;  3PRM B;  4FJY A;  3W1Y A;  2D3B A;  3H1U A;  1NDD A;  3I57 A;  2NPT A;  4FN2 A;  4ZRP A;  2BWF A;  1VZ6 A;  3DBL B;  4MGZ E;  2DZM A;  4JPS A;  2RGF A;  2REX A;  2JY6 A;  4USA A;  5EE0 A;  3U2S C;  2VH1 A;  3DBH B;  1BXT A;  3DVG Y;  5BMH A;  2LVP A;  1JCK B;  1RYJ A;  2GB1 A;  2R61 A;  3VFK A;  1AYF A;  2IDY A;  3AEG B;  4GXB A;  2BT6 A;  3GOE A;  3RT3 B;  2EMS A;  2GBR A;  1OEY J;  2GBM A;  2NR2 A;  2DNF A;  5TR5 A;  3T8M A;  2LZ6 A;  3NUH B;  2A5U A;  1VZ8 A;  1T0Q C;  2KMA A;  1D5Z C;  2RSU A;  2CU1 A;  1ET9 A;  1R4M I;  1JW9 D;  1F9J A;  2KJ6 A;  2CU3 A;  1S1Q B;  3DVG X;  3AU4 A;  1QOF A;  2PTL A;  3FKY A;  2HD5 B;  2LFI A;  3JVZ X;  2RMM A;  3P4S B;  1CMX B;  3KYD D;  4C56 C;  1EF1 A;  3VTU A;  3BK1 A;  4LNO A;  4RFB A;  1YX6 B;  2QMT A;  4MGI E;  3HVZ A;  3ZRF A;  1PQS A;  2Y3A A;  5IO9 A;  4CQN A;  3BVM A;  3CSF A;  5BYS A;  3MJ5 A;  2RPQ A;  1M4V A;  1WE7 A;  2MH7 A;  1IGD A;  1DGJ A;  3DBR I;  3NHE B;  3APC A;  4KGS A;  3L17 A;  2QIE B;  1CJE A;  2LEK A;  4M8M A;  4RM9 A;  1I35 A;  3L4P A;  2DZI A;  3N1Y C;  4XE0 A;  1YN3 A;  2J52 A;  1MI0 A;  3HUI A;  3QC8 B;  1FEH A;  4MJS A;  4WWP A;  1VRA B;  4W9D A;  3VAW A;  2C7N B;  3JYU A;  3ZTD A;  3KH0 A;  2Z8L A;  2WP9 B;  3Q8C A;  4ZYS A;  2FUG 1;  3RNB C;  1GPX A;  1RRB A;  4E71 A;  4RNA A;  1ZDX A;  2IO0 B;  4S17 A;  4IG7 B;  4HKZ E;  4M02 A;  1KH0 A;  1VZ7 A;  1YIW A;  3TJP A;  1TZO A;  2KT7 A;  5C1Z A;  2VH2 A;  2WXI A;  1TKG A;  2MBO A;  3H7P A;  3AEB B;  4PS3 A;  5BMG A;  5J17 A;  2MJD A;  3VXW A;  2CR5 A;  2EKI A;  1HZ5 A;  1OTR B;  4OZA A;  4G0N B;  1S3S G;  3V3X A;  1XEE A;  1MPE A;  2L52 A;  1V1O A;  3RNF C;  2WXP A;  3N9Y C;  2OOB B;  3X0W A;  1FFV A;  3A4S C;  3LYY A;  3Q8B A;  2FIF A;  4KVG B;  1GAQ B;  4HCP B;  2WDQ B;  1K53 A;  3ZGZ A;  1JWS D;  4DK5 A;  2JF5 A;  2HJ8 A;  2KLC A;  4N6E B;  5CX3 A;  2AYO B;  4EZJ A;  2GOW A;  3KLS X;  4PYZ A;  5EE9 A;  1MG4 A;  3ABV B;  4W9K A;  3NZ3 A;  5GMV A;  2MCN B;  3MHS D;  2D11 A;  2Y5P A;  1SE2 A;  1E8Y A;  2R2Q A;  1I7H A;  4IWQ A;  3KQ4 A;  2ZVN A;  3PPA A;  4G3X B;  1CQV A;  3MC9 A;  3Q14 C;  1WYG A;  3ZNI D;  1N5W A;  1SIF A;  4HDO A;  4RCO A;  2CKH B;  1I4Q A;  2B76 B;  3VH3 B;  1N61 A;  3DVN U;  3ZNH B;  4P7I A;  5I4D A;  3QJZ A;  4XX5 A;  1ESF A;  3MC0 B;  1H8C A;  4NJ6 A;  2WDR B;  2WU5 B;  3VUW A;  3T9L A;  3ONS A;  2L83 A;  4MM3 B;  3U7D A;  1MG8 A;  2TSS A;  1N63 A;  1V80 A;  2LRW A;  4B0M A;  1TS5 A;  1E10 A;  2AWT A;  3OJ4 B;  4DBG A;  2WXF A;  5GXG B;  4ANV A;  1TKE A;  1GB4 A;  3E9S A;  1F52 A;  3TEX A;  2D5G A;  2BBC A;  3QX1 A;  2KXJ A;  2KWV B;  4UDU C;  3GZN B;  4ZOH C;  1XCT L;  5JHA A;  3IAM 1;  1V6E A;  3W1S C;  1WR1 A;  3Q69 A;  3NVW A;  2I1K A;  3TIX A;  1KFY B;  5G2N A;  4BKS A;  2LHD A;  3UQA A;  2DX5 B;  1P7E A;  1ZW7 A;  2JT4 B;  1R4N I;  3MTN B;  3B08 A;  2N1V A;  1V9J A;  2HE7 A;  3LB8 C;  2DEN B;  1FFU A;  1WJU A;  2BKR B;  2KQ4 X;  4LTU A;  4M8N A;  1XT9 B;  1NI3 A;  4PK1 A;  2IGD A;  3LJ3 A;  1IYF A;  1ZPS A;  3U30 A;  2WXJ A;  2CS4 A;  3AMZ A;  3A1Q B;  3D32 A;  2RD0 A;  5D7G A;  5LNK 1;  5EDS A;  1E5W A;  4LCD E;  3A33 B;  4LNF A;  1QZE A;  5CHF A;  4FJV B;  3SFE B;  4A9A A;  2JRH A;  3NVV A;  3T3N A;  3H8H A;  4WIP A;  4LDT B;  4J3O D;  1L6V A;  1STE A;  4HJG E;  3WAM A;  3TEY A;  3AB5 A;  4C7Z A;  2DHZ A;  4A90 A;  3ZIM A;  2L76 A;  1SE9 A;  3DWM A;  3Q8A A;  3NOB A;  3VTV A;  2W9N A;  3P63 A;  2KOX A;  2MQJ A;  3DOW A;  1HXY D;  2WU2 B;  3P4P B;  1YQB A;  3GP7 A;  1XF5 L;  5IA7 A;  2M17 A;  3NS1 A;  3W2D A;  1GG3 A;  4QAY A;  3ZXV A;  3RNA C;  3PZ7 A;  1GC6 A;  1V1P B;  3N20 C;  5DPW A;  2MBH A;  3N3K B;  1V1P A;  4IM0 A;  1FMA D;  1WH3 A;  2KAN A;  1G6J A;  1TS2 A;  3ML8 A;  4TQ1 A;  2G1E A;  3PSE B;  1NI2 A;  2FE8 A;  4DDI D;  1EF5 A;  4WH4 A;  2UYZ B;  3A9J A;  4MGY E;  1C4C A;  2QEJ C;  1P0R A;  2L32 A;  2IO1 B;  5L83 A;  3KUZ A;  2FNJ B;  3Q3F A;  3WCQ A;  3ZJV A;  2KQ7 A;  1KRH A;  3DHI C;  2CHZ A;  4NY0 A;  3ZW3 A;  1N60 A;  1KLG D;  3FAH A;  3Q8E A;  4DHZ E;  2ZVO A;  4TSS A;  3ZJU A;  5HG2 A;  3PRE A;  2MWS B;  1ZP0 B;  3IXS A;  5BO4 B;  2KDE B;  4ARI A;  3TSS A;  1T6B X;  2LXA A;  3EFU A;  2FCN A;  2O2V A;  1JWA D;  1Z5S B;  1DYQ A;  1YX5 B;  4DHJ B;  2OJR A;  1K51 A;  4BZA A;  1FO4 A;  1QIL A;  4G11 A;  1L5P A;  2L0T A;  2N7J A;  4GMV A;  4ARC A;  1WX9 A;  1WXS A;  1GB1 A;  2FAZ A;  2BVC A;  5AZF A;  2N1W A;  1PFD A;  2BQQ A;  2RDB C;  2X8X X;  3ZTC A;  1UF0 A;  4FXC A;  2KKC A;  2WDT B;  4MEM A;  3PS6 A;  1V81 A;  1Z2M A;  3VRA B;  2IND C;  4DQO C;  2C5L C;  3GB1 A;  4AS1 A;  4M00 A;  2O6V D;  4RGT A;  5L95 C;  3P42 A;  1TY0 A;  2N9X A;  1Q0W B;  1E7V A;  5G5G A;  1C77 A;  3O13 A;  1OQY A;  1E0Z A;  3SR6 A;  3UI3 A;  1A70 A;  3L0W B;  2N9E B;  4ICV A;  2KAC A;  3ZQ4 A;  4GDK B;  2WWZ A;  5IOI A;  3RCZ A;  2DWQ A;  2ZNV B;  2N7D A;  4GDK A;  3OJ3 A;  2MW5 A;  3HIZ A;  3URY A;  1EM7 A;  3PLV A;  4AP4 C;  1F77 A;  1TS3 A;  2G4D B;  1V86 A;  1GUA B;  4NPN A;  4K3B A;  1K52 A;  1LGR A;  4ITK A;  1D4B A;  4WAA A;  1JWU D;  4K7U A;  1F1H A;  2BS4 B;  3RYT A;  4GDL B;  1QKZ A;  1OEY A;  2NBW B;  4ZYN A;  4GDL A;  1DOI A;  3HM3 A;  2PEA A;  1UWX A;  4HKQ A;  3LXF A;  1FXT B;  1WR6 E;  4WQO B;  1UWM A;  2JZP A;  2RPV A;  5BMI A;  4JQW C;  1K8R B;  4A20 A;  3O65 B;  1TY2 A;  2NBU A;  4K3C A;  3ZUN A;  1QLB B;  3H9D A;  4R3D A;  3PZ8 A;  1I4P A;  1J19 A;  2WXH A;  1JQ4 A;  3EFC A;  5E6J A;  2INN E;  1WGG A;  3ZYY X;  4FHJ A;  1L6U A;  2MX2 A;  2LJI A;  1WZ3 A;  3RNC C;  2D3A A;  1LFD A;  2V3S A;  2AL6 A;  2LVO A;  2Z0E B;  4IC7 B;  3L08 A;  5EE3 A;  1VLB A;  2G3Q B;  5D94 A;  2KDI A;  3ZNG C;  5FR3 A;  3PGE A;  3AE5 B;  4F7Z A;  3AN1 A;  2CJN A;  1FCC C;  3QCA A;  3B2G A;  2WQY B;  1HTQ A;  2V4I B;  2WNM A;  3PT2 B;  1Q5W B;  4PS7 A;  1DOY A;  2JZ3 B;  3R66 C;  1CK1 A;  4ICU A;  5KHO A;  3CF6 E;  2BTE A;  3VUX A;  2LXC A;  4WJP A;  1YQ4 B;  2IY1 B;  2ONQ A;  4MT5 A;  1VDV A;  5T8I A;  4B0E A;  1TGZ B;  3R2T A;  2B3A A;  3DWG C;  1E7U A;  4CYE A;  4KZ0 A;  2MLB A;  2QSD A;  2K3U A;  1HEZ E;  1C4A A;  3RZF A;  2WHI A;  1FXI A;  2ACZ B;  4W9G A;  4GB9 A;  3VDZ A;  4A55 A;  1EWC A;  5C2T B;  2KWD A;  2ZW0 A;  2IO3 B;  4LNN A;  3NVY A;  3AE2 B;  1AWD A;  3AXC A;  2CHW A;  1UGJ A;  2J7Q B;  4IUM B;  3R2I A;  1ISN A;  1L0V B;  1VR9 A;  5KHQ A;  3AM9 A;  3TEZ A;  2XN9 C;  3APD A;  4KKJ A;  4ANX A;  2VZK D;  4NQL B;  2GRI A;  1MHH E;  4XWT A;  5H92 C;  2N4F A;  1KLU D;  4MSM B;  1P98 A;  1ZUD 2;  2NCN A;  2KC1 A;  4L2Y A;  2L8J A;  2M4N A;  1FNW A;  4FUL A;  4YL8 A;  2LGX A;  1GNU A;  3QAQ A;  2WGS A;  2WDV B;  3SFD B;  2KO3 A;  3PRZ A;  2J0K A;  2SAK A;  1V49 A;  3W9C B;  4JX1 C;  1AN8 A;  1FNV A;  1V2Y A;  4I6L B;  2JU6 X;  4WWO A;  3PTF C;  1D5M C;  3PV1 A;  1JWM D;  4EUT A;  2V3N A;  1MJD A;  1WF9 A;  4DDG D;  1PDX A;  1UNS A;  2K9X A;  3N32 A;  3NJT A;  3S2A A;  1T0R C;  3SU8 X;  2QC8 A;  2WXO A;  2BS2 B;  3I5J C;  2JVC A;  1SE3 A;  3IT4 B;  2KWU B;  4ANW A;  4NNJ B;  3RPF C;  2KDM A;  3JW0 X;  1JRP A;  2MJ3 A;  2KX0 A;  1QF6 A;  5C23 A;  2ZEQ A;  4DXA B;  2WX0 A;  1ZXI A;  1XLN A;  1YN4 A;  2JUO A;  1SBB B;  1GC7 A;  1D6E C;  2WLB A;  1MVK A;  3AEF B;  4GOC A;  3UIN B;  2W3R A;  3A9K B;  3M95 A;  4XDD A;  4NAM A;  3A9K A;  2MRP A;  1TZ1 A;  2JRI B;  3Q3O C;  4W9J A;  2FUH B;  3EUB 2;  3DBL I;  3DCG A;  2BWE S;  3ZVV A;  1BML C;  2DYB A;  1RLF A;  4CO7 A;  3DBH I;  3JSV B;  3VHT C;  4JLC A;  2MBE A;  2JYT A;  4ZHO A;  4L23 A;  1EU3 A;  2YLM A;  4D2K A;  2OED A;  3JSV A;  1UGM A;  2DYO A;  1JRU A;  3NRZ A;  1FIQ A;  3Q8F A;  1A5R A;  4KV2 A;  2I38 A;  3RUL A;  3K9O B;  3Q3J A;  2MA9 B;  2KZR A;  2M0X A;  2D10 A;  4WJO A;  1VCB A;  5AUK A;  2PLP A;  1X1M A;  1KLV A;  5FKA C;  1RM6 C;  1UD7 A;  3RNE C;  2KHW B;  1E7P B;  1XLP A;  5HFY A;  2K8B A;  2Q5W D;  4MM3 A;  1U4A A;  3VTW A;  2KTF A;  4W9E A;  2QHO A;  2XK5 B;  3B9J A;  3A4R A;  1SIJ A;  2H88 B;  5HKH A;  2QDF A;  2BYF A;  2XK5 A;  4BFR A;  4EFO A;  1IPG A;  2JXX A;  1YD8 U;  1PUT A;  3VUY A;  5J2R A;  1EUV B;  2FID A;  2M8S A;  3Q2A C;  4BOZ B;  4JE3 B;  1Y8R C;  2BS3 B;  4BKG A;  3BVG A;  1YOV B;  4AUQ C;  4K7W A;  1GOZ A;  3UIP B;  1NYQ A;  2NVU I;  3V60 A;  2LHE A;  4KDL B;  4KZC A;  2HTH A;  1XD3 B;  3R3M A;  3DVN V;  2K6Q A;  4KGT A;  2MHJ A;  3FIL B;  4JL9 A;  4XWW A;  1Q10 A;  4KSL C;  1WX7 A;  4RH6 A;  4B9K A;  4I6P A;  2IZV B;  2J42 A;  3L54 A;  3M62 B;  1I4R A;  2KVZ A;  2D3C A;  3ZDM C;  2UWQ A;  2Z0D B;  3OG5 A;  1KM7 A;  4MEL A;  2KMM A;  3WAL A;  2IYD B;  1I4H A;  2BYE A;  1C78 A;  4ZRJ A;  4FJZ A;  3A1Q A;  1HA5 A;  2ZCC A;  4XC2 A;  4WWN A;  4B6W A;  2INP E;  4C00 A;  3Q3M C;  2N9P C;  5G5H A;  4DXF A;  2KN4 A;  1UZX B;  2N9K A;  1WXM A;  2NBV B;  1WRI A;  4K81 A;  4F8C B;  2ICI A;  2V0G A;  1D5X C;  4KGR A;  5H8Y E;  4KSK C;  2KFJ A;  2MJE A;  5D2M B;  4RGM A;  3GS2 A;  4N9F 4;  2L1A A;  3KWL A;  4J6I A;  4LNK A;  4P1B C;  1HTO A;  3V61 A;  2NTT A;  3RD2 A;  2W82 A;  5FR6 A;  2Y5C A;  1IGC A;  4WJN A;  3DDC B;  3CIR B;  3RZW C;  2NTS A;  2O6V B;  1WYW B;  2KTR B;  1TT5 B;  3KUC B;  1AW7 A;  4W9C A;  2O6V A;  2K5P A;  3BY4 B;  4FLH A;  1V97 A;  4BKS D;  3AE7 B;  4KDI C;  3W5V B;  2MSE D;  2XBB C;  1H4R A;  3L16 A;  2KD0 A;  1T0S C;  1BT0 A;  3VH4 B;  1I4X A;  4ZHP A;  2GI9 A;  4OVU A;  2KNB A;  1ET6 A;  2YEP B;  3EEC A;  2BB6 A;  3V62 A;  2DBY A;  3WAO A;  1AAR A;  4JWU C;  1TS4 A;  4WJQ A;  2PJH A;  4O1N A;  1JRO A;  4GLS C;  2WX1 A;  5AZH A;  2N7E A;  4A3O A;  2ZW1 A;  4RM8 A;  2K1F A;  1IUE A;  1FPY A;  1L2N A;  4W9F A;  3PHX B;  4A3P A;  5EE1 A;  5IP4 D;  2JX5 A;  1Q1O A;  1OFF A;  3NY5 A;  4B95 A;  2K8H A;  2W3S A;  3M3J A;  1ZOY B;  2JQR B;  1R7S A;  3M63 B;  3GZN I;  3DPD A;  2LD9 A;  4W9L A;  2ON8 A;  4NJC A;  4IM3 A;  3ZXR A;  3WA0 A;  4HXD A;  3P1M A;  3X23 A;  2LMC A;  1R4M B;  2BF8 B;  5DPS A;  3NZS A;  5AZG A;  1WJN A;  5BYR A;  1E9M A;  1TJE A;  2IGH A;  1RAX A;  1OGW A;  3CST A;  2YEP F;  4DHZ B;  1WI0 A;  3RMK C;  3EA6 A;  2LUM A;  1QT9 A;  4XYC A;  1PGA A;  1E90 A;  4KKI A;  2MBQ A;  1LXD A;  2K6D B;  3U7Z A;  2AEH A;  2LJ5 A;  1C76 A;  3QA8 A;  4LK0 M;  3U52 E;  1C79 A;  3DQV A;  4OVZ A;  3AE3 B;  4MSQ B;  3KVF B;  3DBR B;  4M01 A;  3TBL D;  3KWV A;  1C3T A;  4AOF A;  2KLG A;  1QOG A;  1MHX A;  3QIJ A;  3WIM A;  3HVD A;  4NJ7 A;  1F2R C;  1WJ6 A;  4M0W B;  1PYW D;  3UIO B;  4DXG A;  3VVW B;  4P1C C;  1L4Z B;  1J7B A;  4M0W A;  2IJ0 A;  2GMI C;  3AH7 A;  3E56 A;  4ZRQ A;  4Q2J A;  3VR8 B;  3TL5 A;  2BYV E;  3DBS A;  2W55 A;  1JWB D;  4KX6 B;  3MJW A;  4MAC A;  3IT6 B;  1J7A A;  1C1Y B;  2FBW B;  3FC4 A;  3ZO5 B;  2V1Y A;  3H6N A;  2DLB A;  4WUR A;  2FCS A;  1RFA A;  2ZNV C;  1SSN A;  3BZD B;  3R7Q A;  2LGD A;  3RI7 C;  4C7Y A;  4LNI A;  1P1A A;  1WRD B;  4IKG A;  1E8Z A;  2QJL A;  1UEL A;  3QHT A;  2H89 B;  5E6O A;  2L3Z A;  4XGA B;  2KDB A;  2LI5 A;  1B9R A;  2I1J A;  1VJK A;  5CHW A;  3B0A A;  5G55 A;  4URK A;  1SJH D;  1YJ1 A;  1QOB A;  3MHZ A;  5JHB A;  5LXH A;  3BWU D;  3OLM D;  3UGB B;  1WE6 A;  4P16 A;  2ASQ A;  2Z59 B;  4L1B A;  4KIK B;  2KWC A;  5J18 A;  4EEW A;  3ETR A;  4KIK A;  2IPK D;  4CHK A;  5E6N A;  1IBX B;  2G4S A;  1WFY A;  1XCQ L;  2MP2 B;  2D2Q A;  4X57 B;  1UBI A;  1IBX A;  1TKY A;  4C80 A;  2MP2 A;  1ZDV A;  3N1X C;  4GIV A;  1T5X D;  4BOS C;  1F2R I;  2I2Y A;  4YSX B;  1TIF A;  4LJP B;  3ENE A;  2AQ1 B;  3UQB A;  1FNU A;  2C7H A;  1OQQ A;  4HDQ A;  1HE8 A;  4MH0 E;  2M19 A;  1IP9 A;  4IOI E;  1MFW A;  1LQB A;  2PE9 A;  4IWO A;  2XNA C;  1GJZ A;  4HEA 1;  2MBB B;  4YTM B;  2KFK B;  2WXK A;  5AEK B;  2GBN A;  3TUO A;  1EWY C;  3IFW B;  2ZZP B;  3AED B;  2KFK A;  2G9H D;  2PMV A;  2M0A A;  1WGH A;  1SGH A;  2PVG C;  4GSW A;  4PYU A;  4RGO S;  4E3C A;  1SB3 C;  2IO2 B;  3QAR A;  4GU2 A;  2DAJ A;  3AI5 A;  3QWZ B;  1R4N B;  2L05 A;  3V6C B;  5HHD G;  5JH5 C;  3LDZ E;  1T0Y A;  3K9P B;  3ZDT A;  2JPH A;  4HPL B;  3MFG A;  3MC8 A;  4MJS B;  1TBE A;  2J0J A;  4MDK E;  1WWT A;  2RDG A;  4TKN A;  2KC2 A;  4FHK A;  1OQR A;  1FD6 A;  5JZE B;  5FK9 C;  3EC8 A;  2KX3 A;  4TMA B;  3ZRC A;  1V5O A;  3J9C A;  4NAW B;  1WGK A;  3DHG C;  1PGX A;  1NBF C;  3ECI A;  2M56 B;  4NAW A;  4JIO U;  5CHV C;  2EKE C;  1P7F A;  2UU7 A;  4TV3 A;  5LLI A;  4YXD B;  2WXR A;  3B2F A;  2JWZ A;  1T3Q A;  2HJ1 A;  4PS8 A;  2ZPN A;  1YJJ A;  1UH6 A;  5CTR C;  3T3O A;  3H7P B;  3AEE B;  2GBJ A;  3PRP B;  3ALB A;  3I9V 1;  3U8Z A;  3L13 A;  3AE4 B;  2KN5 A;  3PLU A;  3AE8 B;  2KK8 A;  1Y56 A;  4W9I A;  1J8C A;  1WM3 A;  4P6V F;  3AEC B;  1HZ6 A;  4TQ0 A;  4JWS C;  5IN7 A;  1WZ0 A;  1WGY A;  1QQR A;  4WWM A;  4NQK E;  4FBJ B;  3SHQ A;  1WMH B;  4F1S A;  1E6E B;  1V8C A;  4K7S A;  1WMH A;  3MP9 A;  4YTN B;  1D3Z A;  3B1L X;  4REZ A;  4A6Q A;  4MH8 A;  1P3Q U;  2YVC A;  1YN5 A;  1BUI C;  3W1S A;  2E3T A;  2KJR A;  1TYG B;  3HHM A;  4JGH B;  1V5T A;  2IY0 B;  3I3T B;  1I4G A;  2HTM E;  2C60 A;  2BKF A;  4FA6 A;  1LO5 D;  4HWI B;  1ZE3 D;  1QOA A;  1RWS A;  1CZP A;  2IGG A;  4E74 A;  2PW9 A;  4N59 A;  2LAS A;  2WXG A;  3P2B A; 
#chains in the Genus database with same CATH homology
 4OVU A;  1K8R B;  2KNB A;  2Y5B B;  3O65 B;  1WE7 A;  3AU5 A;  4A20 A;  5IAA C;  3UF8 A;  2NBU A;  3DBR I;  3EEC A;  3NHE B;  4IWP A;  3APC A;  3L17 A;  3QQ8 B;  3ZUN A;  4M8M A;  4RM9 A;  1I35 A;  2DZI A;  3H9D A;  3QC8 B;  3WAN A;  1J19 A;  3CMM B;  4MJS A;  4WWP A;  4W9D A;  3VAW A;  2C7N B;  3JYU A;  3V62 A;  2KQS A;  3ZTD A;  3KH0 A;  1WGG A;  1AAR A;  3WAO A;  4FHJ A;  2C7M B;  2MX2 A;  4WJQ A;  2PJH A;  1RRB A;  1WZ3 A;  4II2 B;  4E71 A;  1LFD A;  2V3S A;  2AL6 A;  2LVO A;  2WX1 A;  5AZH A;  2Z0E B;  2LRU A;  2IO0 B;  2K39 A;  2N7E A;  4IC7 B;  4IG7 B;  3L08 A;  4A3O A;  4RM8 A;  2G3Q B;  1WJ4 A;  2K1F A;  3QK0 A;  3WAP A;  5D94 A;  1L2N A;  1YIW A;  4W9F A;  3TJP A;  4EZL A;  1WGR A;  3PHX B;  4A3P A;  2KDI A;  1WXA A;  4GGQ A;  1ZGU B;  5C1Z A;  3ZNG C;  2LUE A;  2MBO A;  3H7P A;  3PGE A;  4F7Z A;  4PS3 A;  1Q1O A;  5J17 A;  2A4Z A;  3VXW A;  3NY5 A;  2CR5 A;  4B95 A;  2K8H A;  3QCA A;  3M3J A;  2PPH A;  3M63 B;  1OTR B;  1WXV A;  3PT2 B;  3GZN I;  4G0N B;  1Q5W B;  1S3S G;  4XZ4 A;  4PS7 A;  3DPD A;  2JZ3 B;  2LD9 A;  4GN1 A;  3R66 C;  4W9L A;  4ICU A;  5KHO A;  2J0M A;  3CF6 E;  4IM3 A;  3VUX A;  3WA0 A;  2LXC A;  2FCQ A;  1WM2 A;  4WJP A;  2IY1 B;  3KUD B;  2OOB B;  4HXD A;  3X23 A;  3X0W A;  2BF8 B;  3A4S C;  5DPS A;  1TGZ B;  2FIF A;  2B3A A;  2EMT A;  4KVG B;  1E7U A;  3NZS A;  4HCP B;  3APF A;  5DPT A;  4CYE A;  5AZG A;  1WJN A;  2LWP A;  4EKU A;  5DPR A;  2ZJD A;  1RAX A;  4KZ0 A;  1OGW A;  4BVU C;  3CST A;  2JF5 A;  4DK5 A;  2HJ8 A;  2KLC A;  4DHZ B;  5CX3 A;  2MLB A;  1WI0 A;  2AYO B;  4EZJ A;  1TTN A;  2GOW A;  3RZF A;  1E90 A;  4W9G A;  4PYZ A;  3SD5 A;  4GB9 A;  3VDZ A;  2MBQ A;  1LXD A;  2V4L A;  5DCN A;  2K6D B;  2IO3 B;  4W9K A;  2AEH A;  2LJ5 A;  4ANU A;  5GMV A;  2KVR A;  2BPS A;  3QA8 A;  2MCN B;  3MHS D;  2D11 A;  1E8W A;  1E8Y A;  2R2Q A;  3DQV A;  3AXC A;  2CHW A;  1M94 A;  4IWQ A;  2J7Q B;  4MSQ B;  4IUM B;  3KVF B;  2ZVN A;  3PPA A;  4G3X B;  3OAW A;  3TBL D;  2DAF A;  2KTR A;  1ISN A;  1C3T A;  4AOF A;  2KLG A;  5KHQ A;  3ZNI D;  4HDO A;  1SIF A;  2K8C A;  3APD A;  3QIJ A;  4ANX A;  2CKH B;  3WIM A;  3VH3 B;  4NJ7 A;  3DVN U;  3ZNH B;  4FAD A;  4P7I A;  1L7Y A;  4NQL B;  1WJ6 A;  1XQQ A;  4M0W B;  3UIO B;  3KW5 B;  3NZU A;  3QJZ A;  4XX5 A;  3VVW B;  1H8C A;  2N4F A;  4MSM B;  1P98 A;  2NCN A;  4NJ6 A;  2GMI C;  2KC1 A;  3VUW A;  3T9L A;  2L8J A;  2M4N A;  3ONS A;  4FUL A;  3TL5 A;  4YL8 A;  1WIA A;  3U7D A;  2LGX A;  3TCA A;  1MG8 A;  4ZRK A;  1GNU A;  3QAQ A;  5LXI B;  1V80 A;  2LRW A;  3RUI B;  1I42 A;  1WY8 A;  4MGK E;  4II3 B;  2AWT A;  2BYV E;  4W9H A;  3DBS A;  3OJ4 B;  4DBG A;  1KJT A;  3A9J B;  2KO3 A;  3MJW A;  4ANV A;  3PRZ A;  2KMC A;  2XEW A;  1C1Y B;  2J0K A;  1V49 A;  2R2O A;  4AJY B;  3ZO5 B;  4EZK A;  1V2Y A;  2V1Y A;  4I6L B;  2L7R A;  3H6N A;  2FCS A;  5D6J B;  1RFA A;  2ZNV C;  4WWO A;  2ZPY A;  3PTF C;  3QX1 A;  3R7R A;  4IW0 A;  2KXJ A;  2KWV B;  3PV1 A;  3R7Q A;  3TMP B;  2LGD A;  1P1A A;  4EUT A;  5JHA A;  3ZLZ A;  1WF9 A;  1V6E A;  3W1S C;  1WR1 A;  1WRD B;  4DDG D;  2G45 B;  2I1K A;  3TIX A;  4LDT D;  3N32 A;  1E8Z A;  1UEL A;  3QHT A;  5G2N A;  4BKS A;  4HVB A;  3UQA A;  4LJO B;  2KJH B;  4I6N B;  2DX5 B;  3S2A A;  1ZW7 A;  5E6O A;  2NS5 A;  2KDF B;  2JT4 B;  2L3Z A;  1R4N I;  3HM6 X;  3SU8 X;  3MTN B;  2KDB A;  2LI5 A;  1E8X A;  2GBK A;  3B08 A;  2N1V A;  2I1J A;  2O2V B;  4ASW C;  4EOY A;  1V9J A;  4K1R B;  2HE7 A;  2DEN B;  4BKT A;  1WJU A;  2BKR B;  5CHW A;  3SDL C;  4OVV A;  2JVC A;  3B0A A;  2DZK A;  5G55 A;  4M8N A;  4URK A;  4HJK A;  2KWU B;  3NS8 A;  4ANW A;  2BGF A;  1XT9 B;  1YJ1 A;  4NNJ B;  5JHB A;  3JW0 X;  5LXH A;  3ZNZ B;  3LJ3 A;  1IYF A;  4AWJ A;  3OLM D;  1P9D U;  3U30 A;  2KX0 A;  2RR9 A;  3UGB B;  1WE6 A;  5C23 A;  2ZEQ A;  4DXA B;  2ASQ A;  2CS4 A;  2WX0 A;  3A1Q B;  3N30 A;  4RMA A;  3D32 A;  3IVF A;  2RD0 A;  2JUO A;  5D7G A;  2C9W B;  4HCN B;  5EDS A;  1E5W A;  1GC7 A;  2DYM A;  2Z59 B;  4KIK B;  4LCD E;  2KWC A;  3A33 B;  1QZE A;  5CHF A;  2LGY A;  4FJV B;  5J18 A;  3ML9 A;  1ZKH A;  2JRH A;  4EEW A;  2PE6 B;  4KIK A;  4GOC A;  2WYQ A;  2D07 B;  3IG3 A;  4CHK A;  5E6N A;  3UIN B;  1KOT A;  4LDT B;  2G4S A;  3A9K B;  1WFY A;  2MP2 B;  3M95 A;  2D2Q A;  4X57 B;  1UBI A;  4BBN C;  2CHX A;  3C0R B;  3A9K A;  2MRP A;  3WAM A;  1TZ1 A;  2MP2 A;  4GIV A;  2JRI B;  4BOS C;  4W9J A;  2JZZ A;  2FUH B;  1VD2 A;  3DBL I;  4BBN F;  1LM8 B;  3DCG A;  2DHZ A;  3EHV A;  4LJP B;  1UBQ A;  3ZIM A;  2BWE S;  2L76 A;  3ENE A;  1J0G A;  1SE9 A;  3H7S A;  3AUL A;  3UQB A;  3ZVV A;  2D3G A;  2DYB A;  2C7H A;  1RLF A;  3NOB A;  3VTV A;  2DZJ A;  3DBH I;  3JSV B;  3VHT C;  4CO7 A;  4JLC A;  2W9N A;  2MBE A;  4HDQ A;  1HE8 A;  2KOX A;  4MH0 E;  2MQJ A;  2YLM A;  3DOW A;  2L00 B;  3JSV A;  1UGM A;  1IP9 A;  2DYO A;  1JRU A;  1LQB A;  1YQB A;  2PE9 A;  1A5R A;  4IWO A;  5IA7 A;  4KV2 A;  3RUL A;  1EO6 A;  3K9O B;  1GJZ A;  3Q3J A;  3HK0 A;  2MA9 B;  2M17 A;  2MBB B;  2KZR A;  2KFK B;  2M0X A;  2D10 A;  4WJO A;  5AEK B;  1VCB A;  2GBN A;  2L0F A;  1GG3 A;  1X1M A;  2ZZP B;  3IFW B;  3KYC D;  1KLV A;  2KFK A;  3IBE A;  1GC6 A;  4HK2 A;  1UD7 A;  2KHW B;  4DHJ D;  5DPW A;  1WGH A;  2MBH A;  3N3K B;  1SGH A;  4IM0 A;  2K8B A;  2ZCB A;  1WH3 A;  2KAN A;  4GSW A;  1G6J A;  4HPM B;  4PYU A;  3ML8 A;  4E3C A;  4TQ1 A;  3PSE B;  4DWF A;  4MM3 A;  2IO2 B;  3QAR A;  1WX8 A;  4GU2 A;  2DAJ A;  3AI5 A;  3V6E B;  1NI2 A;  3QWZ B;  4DDI D;  1EF5 A;  1U4A A;  3VTW A;  2KTF A;  4W9E A;  4ZRI A;  2L05 A;  3V6C B;  2UYZ B;  2QHO A;  5JH5 C;  2XK5 B;  3A4R A;  5E6P A;  3A9J A;  4MGY E;  3PZD A;  5HKH A;  3LDZ E;  1T0Y A;  2BYF A;  2XK5 A;  1P0R A;  3K9P B;  4BFR A;  2IO1 B;  3ZDT A;  5L83 A;  4EFO A;  1IPG A;  2JXX A;  3KUZ A;  2JPH A;  3VQI A;  4HPL B;  1YD8 U;  2FNJ B;  2K25 A;  3Q3F A;  3VUY A;  4MJS B;  2KQ7 A;  1TBE A;  2J0J A;  5J2R A;  2CHZ A;  1EUV B;  4MDK E;  2FID A;  2M1M A;  2M8S A;  4TKN A;  2KC2 A;  4NY0 A;  3ZW3 A;  4BOZ B;  1Y8R C;  4FHK A;  4ZDV A;  4BKG A;  4AJW A;  4AUQ C;  4IM2 A;  4K7W A;  4DHZ E;  5JZE B;  3UIP B;  3EC8 A;  2KX3 A;  2NVU I;  3V60 A;  3ZRC A;  4KDL B;  4KZC A;  2ZVO A;  2HTH A;  1V5O A;  4HLE A;  1XD3 B;  3R3M A;  3DVN V;  2K6Q A;  4NAW B;  3PRE A;  2MWS B;  3PHW B;  3ZKJ C;  1NBF C;  5BO4 B;  4JL9 A;  3IHP C;  2KDE B;  3ECI A;  4NAW A;  4JIO U;  2LXA A;  5CHV C;  2EKE C;  3BIN A;  3EFU A;  2FCN A;  1WX7 A;  2O2V A;  4KSL C;  3L10 B;  4B9K A;  1Z5S B;  4TV3 A;  2FCM A;  1YX5 B;  5LLI A;  4DHJ B;  4I6P A;  2OJR A;  4G50 A;  4TUU A;  1WGD A;  2JWZ A;  2AL3 A;  2IZV B;  2VRR B;  3PVL A;  2LVQ A;  3L54 A;  4G11 A;  4PS8 A;  3M62 B;  2L0T A;  2ZPN A;  4GMV A;  3ZDM C;  1UH6 A;  1WX9 A;  1WXS A;  2IBI B;  2FAZ A;  3H7P B;  5CTR C;  5AZF A;  2N1W A;  2GBJ A;  2UWQ A;  2NPT B;  2Z0D B;  3PRM B;  4FJY A;  3W1Y A;  3ZTC A;  1KM7 A;  3H1U A;  1NDD A;  3PRP B;  4MEL A;  3ALB A;  3WAL A;  2KKC A;  2WDT B;  2IYD B;  3PS6 A;  4MEM A;  1V81 A;  1Z2M A;  2NPT A;  4FN2 A;  2BYE A;  2C5L C;  4ZRJ A;  4FJZ A;  2BWF A;  3U8Z A;  3L13 A;  3A1Q A;  4MGZ E;  2ZCC A;  2DZM A;  4XC2 A;  2KN5 A;  2RGF A;  4WWN A;  4B6W A;  3PLU A;  2O6V D;  2REX A;  2JY6 A;  5L95 C;  2N9X A;  2KK8 A;  1Q0W B;  2N9P C;  4W9I A;  3DVG Y;  1E7V A;  1J8C A;  1UZX B;  1WM3 A;  2LVP A;  1OQY A;  1WXM A;  2NBV B;  3VFK A;  4K81 A;  4F8C B;  3L0W B;  2N9E B;  4TQ0 A;  4GXB A;  4ICV A;  3GOE A;  3RT3 B;  1WZ0 A;  1WGY A;  4KSK C;  2EMS A;  2KFJ A;  2GBR A;  1OEY J;  4NQK E;  5D2M B;  4GDK B;  2WWZ A;  2GBM A;  2NR2 A;  3RCZ A;  4FBJ B;  5TR5 A;  3T8M A;  2ZNV B;  4N9F 4;  1WMH B;  3SHQ A;  4F1S A;  2N7D A;  4GDK A;  3OJ3 A;  2MW5 A;  4K7S A;  3HIZ A;  4J6I A;  2LZ6 A;  3PLV A;  1WMH A;  4AP4 C;  1D3Z A;  3B1L X;  2A5U A;  2KMA A;  2G4D B;  3RD2 A;  2RSU A;  3V61 A;  2CU1 A;  1P3Q U;  1V86 A;  1GUA B;  4NPN A;  2YVC A;  3W1S A;  1R4M I;  1F9J A;  5FR6 A;  2KJ6 A;  1S1Q B;  3DVG X;  2KJR A;  4WAA A;  3AU4 A;  3HHM A;  1V5T A;  4JGH B;  4WJN A;  2IY0 B;  3DDC B;  3RZW C;  2HD5 B;  2O6V B;  1WYW B;  2KTR B;  4K7U A;  3I3T B;  3JVZ X;  3KUC B;  1CMX B;  3KYD D;  1EF1 A;  3RYT A;  2C60 A;  4GDL B;  2O6V A;  4W9C A;  3VTU A;  2BKF A;  4FA6 A;  3BY4 B;  1OEY A;  4FLH A;  4HWI B;  2NBW B;  4ZYN A;  4BKS D;  1YX6 B;  4GDL A;  4MGI E;  3ZRF A;  3HM3 A;  1PQS A;  4KDI C;  2PEA A;  4E74 A;  2MSE D;  2XBB C;  1H4R A;  3L16 A;  3CSF A;  1FXT B;  1WR6 E;  2LAS A;  2KD0 A;  4WQO B;  2RPQ A;  1BT0 A;  3VH4 B;  3P2B A;  4JQW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...