1WJ4A

Solution structure of the ubx domain of kiaa0794 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords KIAA0794 protein
publication title Solution structure of the UBX domain of KIAA0794 protein
rcsb
source organism Homo sapiens
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj4A01
3L17A 4KIKB 4ANWA 2NBVB 4NPNA 2JRIB 3V62A 4GU2A 3NY5A 1KOTA 2HJ8A 3TIXA 3ZRFA 1R4NI 3MTNB 2C7MB 4MEMA 3MHSD 3JVZX 2L3ZA 3A9JA 3TMPB 4AJYB 2Z0DB 2KLCA 2AYOB 4II2B 3AXCA 5AZFA 3V6CB 4BFRA 4F8CB 1WX8A 4WWOA 4FBJB 4ICVA 3H7PA 4PS7A 2JPHA 3DBSA 2N7EA 5G2NA 4K7UA 2KK8A 2K1FA 3AU4A 2KX0A 2VRRB 2MX2A 4GDLB 3ZNHB 3AULA 1RAXA 2MBQA 2Y5BB 3NOBA 3GZNI 4HDOA 1OEYJ 3W1SA 4B95A 2LRWA 5GMVA 4MGYE 2ZJDA 2XK5B 1GC7A 1LQBA 3N3KB 2KTRB 4TQ0A 4BVUC 2AL6A 2O6VD 2IY1B 2M8SA 4HWIB 3ZNZB 4EKUA 5IA7A 2KXJA 3QIJA 2XEWA 4CO7A 2J0JA 1A5RA 3RULA 2EKEC 2O2VB 1RRBA 4BOZB 2C7NB 2BWFA 2WX1A 5DPTA 4JGHB 1V86A 3A9KA 1K8RB 4W9EA 3PREA 4CHKA 1EF5A 2LI5A 4XX5A 2IO2B 2DZMA 2D10A 2MCNB 3VQIA 1WR6E 2UWQA 2EMSA 3Q3FA 3QWZB 4BOSC 2MSED 2JZ3B 2M0XA 4WWNA 5CHVC 3UQBA 2LUEA 3RZFA 4PS3A 2RGFA 4FJZA 4A3PA 3V6EB 4EOYA 2KKCA 1L7YA 2A4ZA 2DZJA 2KD0A 3SU8X 3PLUA 3TL5A 2Z0EB 1P3QU 2BYEA 3GOEA 1V80A 2FUHB 3QCAA 4BBNF 2N9PC 2BGFA 2G4SA 4PYZA 3NZSA 2KFKB 2MBBB 1UELA 4W9JA 1TGZB 2C60A 3DDCB 1GG3A 2IZVB 3ZTDA 3EHVA 1WR1A 3A4RA 4HJKA 4JQWC 2HD5B 4KV2A 4XZ4A 4AWJA 3U8ZA 3OJ4B 4GGQA 1E8ZA 2CKHB 2WWZA 2KFJA 3DBRI 4LCDE 1LFDA 5E6NA 2MRPA 4DK5A 4TV3A 2I1JA 4AP4C 3DCGA 3JSVA 5L83A 2ZVNA 4E3CA 1WX9A 3KH0A 3HM3A 3K9OB 4HVBA 1WRDB 3T9LA 1ZGUB 2BKFA 1Q0WB 5CHWA 1M94A 2YVCA 2JRHA 2ZPYA 3QX1A 1XQQA 3UIOB 1YX6B 2FCMA 5DPRA 1WGRA 1T0YA 1Q5WB 4ANVA 2DX5B 2KJ6A 3X23A 3ZNID 5J2RA 3PV1A 3JYUA 2MBHA 5FR6A 4HXDA 1WE6A 4I6NB 3SDLC 2CHZA 2FCSA 2R2OA 3UF8A 2BYFA 2MBEA 2NBUA 3EFUA 3EC8A 1UGMA 5EDSA 3OJ3A 3ZTCA 4ICUA 2KZRA 3U7DA 2RR9A 2PPHA 3ML8A 2D11A 4IWOA 1J8CA 1J19A 2KDFB 3ZRCA 1P0RA 2KDEB 4A3OA 3ML9A 4DXAB 2ZNVC 4F1SA 2KHWB 3W1SC 2W9NA 2CHWA 3N32A 3WAMA 2DYMA 4MM3A 3VUWA 1WFYA 4W9DA 4FJYA 5CX3A 5E6PA 2KWUB 2MP2A 4DBGA 4K7SA 1LXDA 4GDLA 4NNJB 4JLCA 4RM8A 2V4LA 4ZDVA 1NBFC 1YQBA 4FJVB 4BKGA 3PTFC 3ZDTA 1WZ0A 1X1MA 2ZVOA 3H6NA 2ZPNA 2MW5A 2BKRB 2XK5A 4K1RB 3TCAA 4KZ0A 4OVUA 1E8WA 1ZKHA 1EO6A 2KNBA 1U4AA 2NVUI 4ZRIA 3VFKA 2KO3A 4KVGB 3V60A 4AUQC 2M1MA 3VUYA 1HE8A 3M63B 2KOXA 4F7ZA 4GXBA 1PQSA 4E74A 2YLMA 2M17A 5AZHA 2EMTA 3KVFB 4ANUA 1E8YA 3RZWC 1WJ6A 1E7UA 1WXVA 2K8HA 4W9FA 2RSUA 2KMCA 4ZYNA 2FIFA 4LDTD 2CR5A 2B3AA 4W9LA 4NY0A 3UINB 5D2MB 5DCNA 2JVCA 2I1KA 3N30A 4FN2A 4IC7B 1UZXB 2BF8B 2K25A 3CMMB 3R7RA 3WAPA 5LXIB 1JRUA 2KWCA 5TR5A 3VUXA 3PHWB 4JIOU 1XD3B 1Z5SB 5C1ZA 1I42A 4B9KA 3A4SC 4KSLC 2NR2A 3L54A 1S3SG 1GC6A 2AWTA 4BKSA 4GDKA 2DYOA 2FAZA 3I3TB 2KC1A 2LGXA 5JHAA 2L8JA 2LXAA 4DDGD 1V9JA 4ZRKA 2GMIC 1AARA 2KMAA 3DVGY 3H7SA 2DAJA 4HK2A 1E5WA 2LVOA 2L05A 3TJPA 1V2YA 2O6VB 3PRZA 4HPLB 4IWPA 2PE9A 4WJNA 1V5OA 3EECA 4NAWB 1WIAA 4DWFA 2GBMA 2IBIB 2NPTA 3LJ3A 4KSKC 2KJHB 2KX3A 3NS8A 4EZKA 2LGYA 4W9KA 4A20A 4DHZB 2N9EB 2OOBB 4MH0E 3DPDA 3IBEA 3KUCB 1WMHB 2KJRA 3P2BA 1IYFA 2MQJA 3MJWA 3VHTC 2D07B 1TBEA 3AI5A 3M3JA 5LLIA 1SIFA 3DBLI 2K8CA 1WE7A 1KLVA 1UBQA 2MLBA 4TUUA 3LDZE 4BKSD 2J0KA 4TKNA 1NI2A 3QJZA 4CYEA 4WJPA 3HHMA 5J17A 4FHKA 2IY0B 2LGDA 3PT2B 2C5LC 2Z59B 3CSFA 2BPSA 4WWPA 2ZCCA 5D7GA 4MJSB 3DOWA 5J18A 5KHQA 2IYDB 3DVNV 2L00B 4RMAA 2PEAA 4I6LB 2G3QB 2KTFA 3A33B 3ONSA 3CF6E 1VCBA 2MA9B 3ZUNA 1UBIA 3ZVVA 3VXWA 3A9KB 2JZZA 1YX5B 2A5UA 4KIKA 3QAQA 3VH3B 2D3GA 4AOFA 4HCPB 1H4RA 2FCNA 2NBWB 4GB9A 1H8CA 1J0GA 2NCNA 3L16A 4NJ7A 5KHOA 2LWPA 3ZW3A 3HIZA 4FHJA 1P1AA 2BWES 3KUDB 3PRMB 3RCZA 3V61A 3PRPB 1GJZA 2IO1B 1P9DU 4FLHA 1IPGA 3PVLA 1E90A 3Q3JA 4HDQA 3ZLZA 4N9F4 3VTWA 2ZEQA 5JH5C 4NQKE 1P98A 2WDTB 3KYCD 2JF5A 3NHEB 3QA8A 4DHJD 3M62B 3VVWB 5AEKB 2DAFA 3OAWA 2C9WB 2BYVE 4ASWC 1WM2A 5L95C 2WYQA 2GBRA 4K81A 1LM8B 2KTRA 3S2AA 4LJPB 4FADA 1NDDA 4M8MA 4HPMB 3D32A 2D2QA 2PE6B 2O2VA 1GNUA 2N1WA 3VAWA 1CMXB 1WJUA 4WJOA 5D94A 5CHFA 3RT3B 3DVGX 2N9XA 2KVRA 1RFAA 5D6JB 4MGKE 2DZKA 4ZRJA 2J0MA 4EFOA 1WX7A 4MSMB 1KM7A 3VTUA 5JZEB 2O6VA 2PJHA 1GUAB 1ISNA 2ZCBA 3PZDA 4NAWA 3PSEB 1V5TA 2K39A 2LXCA 2CS4A 2L0FA 3HK0A 1BT0A 1YJ1A 3L10B 3R7QA 3ALBA 5G55A 3QK0A 3KYDD 4NJ6A 4URKA 1WH3A 3IG3A 3PGEA 1WZ3A 1WMHA 2HTHA 2ZZPB 2GBKA 1WY8A 2KFKA 3UIPB 4LDTB 2K6DB 3X0WA 5E6OA 4GMVA 3C0RB 4P7IA 3BINA 4PS8A 2K8BA 2LD9A 2MP2B 4RM9A 1VD2A 3L08A 4EEWA 4K7WA 1G6JA 1OGWA 3A1QB 4FULA 2JWZA 3NZUA 1Q1OA 2MBOA 2N7DA 1D3ZA 2GBNA 4HLEA 2OJRA 1V49A 2IO0B 4GIVA 1IP9A 1WGYA 4MJSA 1V6EA 1WJ4A 2AL3A 1OEYA 2JUOA 3DBHI 4WAAA 4B6WA 5HKHA 1V81A 2KN5A 3APCA 3QC8B 2KDBA 2N1VA 2HE7A 3A9JB 3KUZA 3R3MA 1I35A 4NQLB 5DPSA 2WX0A 1E8XA 4GSWA 4IW0A 1ZW7A 4EZJA 1SE9A 3H7PB 3PHXB 4M0WB 4BBNC 2M4NA 5BO4B 2ASQA 2LJ5A 1EF1A 2FNJB 2UYZB 3WANA 3ZO5B 4E71A 5C23A 2KLGA 3ECIA 3ZDMC 1XT9B 4J6IA 3WALA 1R4MI 1WI0A 4IG7B 2JY6A 1WGGA 1WJNA 3OLMD 4MDKE 2J7QB 3K9PB 4IM0A 1WF9A 1Y8RC 1OTRB 4G50A 5AZGA 2KWVB 2KC2A 3PS6A 3VTVA 4HCNB 2ZNVB 3IHPC 2KANA 3RUIB 3ZNGC 1C1YB 4YL8A 2V3SA 2LASA 2LZ6A 2DZIA 4W9CA 4BKTA 2DHZA 3ENEA 4IM2A 1YD8U 1KJTA 1WXAA 1C3TA 2XBBC 4KZCA 3VH4B 3R66C 1WXSA 3QARA 4I6PA 2FCQA 2REXA 4X57B 2MWSB 2JT4B 1E7VA 4EZLA 2LRUA 3L0WB 2AEHA 4IM3A 2C7HA 5DPWA 2FIDA 2RPQA 4G11A 4GDKB 1UD7A 3RYTA 3APDA 1MG8A 4W9IA 1YIWA 3H9DA 3SHQA 2IO3B 3BY4B 3H1UA 4M8NA 4EUTA 4II3B 1QZEA 1WGHA 1WM3A 3CSTA 4OVVA 1SGHA 4XC2A 3PPAA 4JL9A 3VDZA 3B1LX 3JW0X 3DVNU 4W9HA 3ZIMA 2G4DB 3AU5A 4MGIE 2L7RA 5LXHA 3UGBB 4WQOB 4IUMB 2NPTB 2CU1A 4G3XB 4KDLB 4MGZE 1F9JA 2NS5A 1S1QB 2K6QA 1OQYA 2V1YA 3APFA 2N4FA 3RD2A 3WAOA 3TBLD 3B0AA 2LVQA 3T8MA 2L76A 3SD5A 1FXTB 2R2QA 2L0TA 2LVPA 2DYBA 4W9GA 2DENB 3IFWB 4KDIC 3B08A 1EUVB 2JXXA 3WA0A 2GOWA 5IAAC 3M95A 1TZ1A 2RD0A 3KW5B 4ANXA 2CHXA 1WYWB 4MELA 4PYUA 5CTRC 4FA6A 5JHBA 3W1YA 2GBJA 3U30A 3QHTA 2G45B 4WJQA 3L13A 3O65B 4GOCA 2KDIA 3PLVA 4DHZE 3QQ8B 4TQ1A 2KQSA 3JSVB 4G0NB 4DDID 4DHJB 3ZKJC 4IWQA 2KQ7A 4LJOB 1Z2MA 3WIMA 3UQAA 4MSQB 3HM6X 1RLFA 3IVFA 2QHOA 4GN1A 1L2NA 4AJWA 1WGDA 1TTNA 1UH6A 1WXMA 3A1QA 3DQVA
chains in the Genus database with same CATH superfamily
4ANWA 1K52A 2JRIB 2HJ8A 3TIXA 1V1PB 2KQ4X 3AH7A 3AXCA 4BFRA 1WX8A 4WWOA 2N7EA 5G2NA 1N62A 3P4PB 2K1FA 3AULA 2MBQA 2MH7A 1N5WA 1WGKA 2M8SA 4HWIB 2OHFA 2XEWA 2J0JA 1I4PA 2EKEC 2AQ1B 2BWFA 3IXSA 4W9EA 4HJGE 4JE3B 2D10A 1KFYB 1WR6E 1XCQL 4BOSC 4WWNA 1PYWD 4KGRA 3RZFA 4FJZA 1D5MC 3V6EB 2A4ZA 3GZNB 1XLNA 4XYCA 1KRHA 2Z0EB 4RFBA 2BYEA 3GOEA 2BGFA 2W3RA 3RI7C 3DDCB 3ZTDA 3A4RA 4JQWC 4HJKA 4S0RA 3OJ4B 3PO0A 2AQ2B 2CKHB 5E6NA 2KFJA 3DBRI 2BT6A 2I1JA 4AP4C 2WXQA 2WXMA 3BK2A 4HVBA 1ZGUB 5CHWA 1M94A 3FILA 2JRHA 3QX1A 1XQQA 3UIOB 2FCMA 1JROA 3X23A 5FR6A 3JYUA 4I6NB 2YEPF 3UF8A 3EC8A 3NJTA 4ICUA 4RF1A 3N20C 3ML8A 4C4VA 1DOYA 1J19A 3W1SC 1YN4A 1IBXB 2CHWA 2LGIA 2MP2A 4ZDVA 1YQBA 4FJVB 1EWCA 3W5UB 3PTFC 3DHHC 3ZJTA 2BKRB 3UI3A 2QCZA 3BVMA 4KZ0A 3E56A 1EO6A 2NVUI 2WXRA 1F2RC 1JWSD 4KVGB 2M1MA 2WLBA 1TY0A 2KOXA 1YN5A 2W55A 1E7UA 1WXVA 4ZYNA 2FIFA 4LDTD 2B3AA 4NY0A 3B9JA 5D2MB 3DWMA 5DCNA 3N30A 5HI1A 1UZXB 3WAPA 2K25A 5LXIB 1JRUA 1SB3C 4C56C 3V05A 1GC6A 1UF0A 4YXDB 2FAZA 3P1MA 1L4ZB 5BMHA 4DDGD 1V9JA 4XDDA 1GB4A 1AARA 3H7SA 1EM7A 4LNOA 4HK2A 4MT5A 1PGBA 1K50A 2O6VB 4P16A 3AEBB 1RYJA 2VH2A 2GBMA 2NTSA 3NS8A 2LEKA 2AX5A 4EZKA 2BS3B 3IBEA 2PVOD 1C9FA 1F1HA 3MJ5A 2WQYB 5JXVA 2WHIA 1ET6A 3N1YC 3QJZA 4USAA 5J17A 2IY0B 2ZCCA 5D7GA 1AN8A 4MJSB 5J18A 2IYDB 1MI0A 2PEAA 4I6LB 3P4QB 4M01A 1JWUD 3ZUNA 1KH0A 1E10A 1N6ZA 2JZZA 2D3GA 4ZHPA 3BYYB 3H8HA 1H4RA 3RNGC 1FNWA 2NCNA 1I7HA 3ZW3A 4GLSC 4FHJA 2BWES 3PRMB 3PRPB 1GJZA 2W54A 3DBLB 4YSXB 3DHIC 3Q8CA 5JH5C 2WDTB 1N63A 2K9XA 4KX6B 4DHJD 1RM6C 3M62B 2C9WB 1PFDA 1IGCA 3ZXRA 3TEXA 1WM2A 4K81A 4YTMB 1LM8B 1ZXHA 5LNK1 4FADA 2D2QA 1UWXA 4IKGA 2RPVA 3VAWA 2WP9B 4WJOA 4HEA1 4ITKA 3DVGX 3GS2A 2BB6A 2KVRA 4RGOS 1GB1A 2FE8A 5D6JB 2DZKA 4ZRJA 2J0MA 1T6BX 1WX7A 3U2SC 1FNVA 5JZEB 1BXTA 3FC4A 4BZAA 1ISNA 2ZCBA 1V5TA 2K39A 2LXCA 3I5JC 3R7QA 3ZJUA 2V3NA 1ROEA 1WH3A 4LTUA 4MACA 3PGEA 1WZ3A 3AE8B 2ZZPB 3P4SB 2ZW0A 4LLGM 2UU7A 1VD2A 2YEPB 1ZP0B 2MBOA 5G5HA 2GBNA 2IO0B 2BS2B 1MHHE 4RNAA 3TEZA 2INCC 1XEEA 1V81A 2KN5A 2HE7A 3C19A 3R3MA 3NVZA 2WX0A 1E8XA 1ZW7A 3ZXVA 3PHXB 3RNFC 2M4NA 1NENB 2LJ5A 3Q14C 1YMHE 1WI0A 4MDKE 2J7QB 1EU3A 1WRIA 1Y8RC 4G50A 3ZJVA 3VTVA 3URYA 1C1YB 1FRDA 4OW0A 2DHZA 4H2AA 4KZCA 1L0XB 4L1BA 2MWSB 3B2FA 1E7VA 5IO9A 2PMVA 2AEHA 3N1XC 3WCQA 4GDKB 3APDA 1YIWA 3H1UA 4EUTA 4YTPB 3LB8C 4W9HA 1R4MB 3ZIMA 2ICIA 5IN7A 3UGBB 4IUMB 2NPTB 2CU1A 1F9JA 1OQYA 2SEBD 3WAOA 3B0AA 1KF6B 2R2QA 3SFEB 1V8CA 3IFWB 1PDXA 1EUVB 3WA0A 5IAAC 1TZ1A 5CTRC 2CJOA 3W1YA 2GBJA 4RGMA 3U30A 3L13A 4YSYB 3AM9A 4GOCA 2KDIA 4C80A 3QQ8B 5EE9A 1YJIA 3ZKJC 2KQ7A 1WXQA 2HDEA 2QHOA 2LGSA 1WXMA 1I4GA 3Q3NC 4LNNA 3L17A 4KIKB 1AW7A 4NPNA 3ZRFA 5BYQA 1R4NI 4MEMA 2INDC 3TMPB 4AJYB 2IDYA 5AZFA 3H7PA 2JPHA 2J53A 2V9HA 2ZW1A 4K7UA 4LNFA 4BAXA 1J7AA 4GDLB 1RAXA 2L52A 1SIJA 3HRDD 4HDOA 3W1SA 2WXKA 4MGYE 2D3CA 2ZJDA 2XK5B 1LQBA 4OHJA 4NZLB 2KTRB 3ZNZB 2L32A 3QIJA 1A5RA 3RULA 1HZ6A 4BOZB 1ZDVA 5DPTA 2INPE 1V86A 3BWUD 3PREA 4YWGG 2MJ3A 2UWQA 2EMSA 3QWZB 2JX5A 1RWSA 2M0XA 2LUEA 4PS3A 3ZQ4A 1SJHD 2KKCA 2KD0A 2WXLA 1CK1A 3TL5A 1HZ5A 3Q3OC 1NEKB 1TZOA 4HRSA 3QCAA 1B1ZA 4PYZA 2KFKB 1P7EA 3PZ7A 4W9JA 4A8XC 3RN9C 1WR1A 3TSSA 4AWJA 1OFFA 1BUIC 2MRPA 3NS1A 1TKEA 2ACZB 4DK5A 4TV3A 3DCGA 3I63C 4OZBA 4E3CA 3K9OB 1WRDB 2BKFA 1Q0WB 4L2YA 1C79A 3MC8A 4MH8A 1TIFA 5DPRA 3KWLA 3EGRA 1N5XA 3VR8B 2WU5B 3NVVA 5J2RA 4EE2A 1WE6A 2WXHA 2EELA 2R2OA 2MBEA 2NBUA 1UGMA 1XLPA 2IJ0A 3OJ3A 2RR9A 2PPHA 1J8CA 2KDFB 2WS3B 4F1SA 3T3NA 1TKGA 3DBRB 5D3IB 2DYMA 4MM3A 3VUWA 1WFYA 2X38A 1SBBB 2K3UA 4FJYA 4KKJA 4DBGA 4K7SA 4C7YA 4NNJB 4JLCA 2V4LA 3DWGC 1QILA 1D5ZC 3H6NA 2ZPNA 2MW5A 3J9CA 2KNBA 4HKQA 3I9V1 2KO3A 4WAFA 1TS4A 3C8YA 4ZRPA 1HEZE 2V4IB 2K8HA 2BW2A 2JYTA 4W9FA 1E0ZA 2RSUA 2KMMA 1J7BA 1JRPA 2JVCA 4ZHOA 4FN2A 2JQRB 4IC7B 2H89B 2VZKD 3VUXA 3Q3MC 1IUEA 1XD3B 3LXFA 1TYGB 1Y56A 1C78A 4B9KA 4KGTA 2NR2A 3NRZA 4KSLC 4ARCA 4A6QA 1ZOYB 1S3SG 2AWTA 1HA5A 1IGDA 2VH1A 2KC1A 3MC0B 2WU2B 5H92C 2DAJA 1E5WA 1K53A 4IWPA 3TEWA 1WYGA 1V5OA 4NAWB 1WIAA 4DWFA 1QF6A 4OVZA 3LJ3A 2KJHB 3BVGA 1FM0D 4W9KA 3DPDA 1TJEA 3MHZA 2WXPA 1WMHB 1IYFA 3VHTC 5IOIA 3AI5A 4JX1C 1JWBD 1SIFA 4FXCA 2G9HD 5EE1A 1B9RA 1A70A 3LDZE 1I4XA 4XE0A 5GXGB 4BKSD 1N61A 4N59A 4TKNA 1NI2A 4WJPA 3PT2B 2OEDA 2C5LC 4WWPA 1VRAB 3DVNV 2L00B 1GPXA 3A33B 3CF6E 2MA9B 2WXIA 3QAQA 4AOFA 2EKIA 3AE7B 2NBWB 4GB9A 1H8CA 1J0GA 1JWAD 3KUDB 2IO1B 2HTME 1WSPA 4P1BC 1L0YB 3CWIA 3PVLA 4HDQA 3Q3JA 3ZLZA 2NTTA 3MP9A 3VTWA 2ZEQA 2GRIA 4NQKE 3KYCD 1KLUD 5AEKB 1UGJA 3KQ4A 1TS3A 2WYQA 2GBRA 3P42A 4LJPB 4HPMB 4JWUC 2O2VA 2N1WA 1CMXB 1WJUA 2CU3A 2N9XA 1QOFA 3FILB 1OQRA 1XF5L 1YQ4B 2O6VA 2WXFA 1GUAB 1E9MA 4US9A 4B0MA 4RH6A 2J42A 4NJCA 3L10B 2WDRB 1LO5D 3IG3A 1NYRA 1FO4A 2N7JA 4XDCA 1SSNA 2K6DB 5EE0A 4GMVA 2K8BA 2MP2B 4JWSC 4K7WA 3RMKC 1VZ7A 1OGWA 4FULA 1Q1OA 2N7DA 3HVDA 1V49A 1ZPSA 5IKCM 1WGYA 4MJSA 4C00A 1OEYA 3DBHI 4WAAA 1CZPA 4S17A 3A9JB 5DPSA 5E6JA 4EZJA 3GP7A 4BBNC 3OG5A 2ASQA 2UYZB 5C23A 2KLGA 5TSSA 4J6IA 4IG7B 3K9PB 1FNUA 3AEAB 4J3OD 1MFWA 2J52A 2KWVB 3ZNGC 5FKAC 3IHPC 1V97A 2LASA 4W9CA 2DZIA 3AE3B 4IM2A 1YD8U 2DNFA 2FCQA 1C4AA 4L23A 4EZLA 2LRUA 2C7HA 2FIDA 1F77A 4G11A 1UD7A 3RYTA 3H9DA 1YJJA 3BY4B 4WURA 1WGHA 3CSTA 1MG4A 4XC2A 1SGHA 4B0EA 3DVNU 5LXHA 1KTKA 4MGZE 3Q8AA 3W2DA 3RD2A 2N4FA 1FPYA 2V0GA 4W9GA 4LNIA 2GOWA 2QJLA 3M95A 1WYWB 3AE9B 4MELA 4PYUA 5C3JB 4FA6A 5JHBA 2Y5CA 3QHTA 3SEBA 2WDQB 4WJQA 3EA6A 3O65B 4DHZE 4LK0M 3JSVB 4G0NB 3WIMA 2LHEA 3HM6X 3RFZB 1CQVA 1YN3A 1XLQA 3CIRB 2NBVB 4GU2A 1R7SA 2G1EA 3GE3C 1KOTA 1MVKA 2C7MB 1JQ4A 4RCOA 2L3ZA 2KLCA 3AEGB 2AYOB 4A90A 3V6CB 4ICVA 1MHXA 4PS7A 2PIAA 2RMMA 3EFCA 2N0SB 3AU4A 4IOIE 1VDVA 2VRRB 3ZNHB 1VR9A 2Y5BB 3NOBA 2JWUA 2BS4B 2MHJA 2LRWA 3N3KB 4AQ7A 3R8BA 4BVUC 2O6VD 2R61A 3W5VB 2M0AA 2H88B 2KXJA 4KGSA 4CO7A 3KWVA 3ZGZA 1R4NB 1RRBA 1ET9A 2V3PA 2C7NB 2WX1A 3A9KA 4CHKA 1EF5A 4A9AA 2LI5A 4XX5A 2IO2B 2DZMA 2MCNB 2JZ3B 3ABVB 4EOYA 1L7YA 2DZJA 4K3BA 1FXAA 3PLUA 4YSZB 4WIPA 1P3QU 3VRAB 3N1ZC 5BYRA 3NVYA 4BBNF 2N9PC 1P7FA 3Q69A 3NZSA 1JALA 1XXGA 4DXGA 1F0ZA 1I4HA 2C60A 1GG3A 2IZVB 2Z8LA 2HD5B 3T3OA 3U8ZA 1PGXA 1LFDA 3RNEC 1FIQA 1XO3A 3Q8BA 1WX9A 1QKZA 3T9LA 2YVCA 2ZPYA 3Q8FA 1YX6B 3R2IA 1WGRA 1Q5WB 4ANVA 2DX5B 2KJ6A 3ZNID 3PV1A 3SDLC 2BYFA 2FBWB 3EFUA 3RNAC 4IWOA 2D11A 2WXOA 1QQRA 3ZRCA 1P0RA 2KN4A 4A3OA 3ML9A 1PUTA 2KHWB 4HKZE 4JPSA 3U7ZA 4W9DA 5CX3A 3NUHB 4GDLA 5IP4D 4RM8A 1L6UA 4AS1A 3BYTB 1NBFC 2L1AA 3ZDTA 2K0PA 1WZ0A 1E7PB 1FFUA 1TS2A 2XK5A 4OVUA 1E8WA 3RPFC 2BQQA 4ZRIA 3VFKA 1ACCA 3V60A 1HE8A 2OJWA 4UDUC 2JU6X 4GXBA 1ZXIA 2YLMA 2KACA 2M17A 4M0WA 5AZHA 1E8YA 1WJ6A 3MC9A 1AYFA 5EE3A 2LJIA 2KMCA 2CR5A 4W9LA 2W3SA 1EU4A 1E6EB 2BF8B 2KWCA 5TR5A 4JIOU 1HXYD 1DGJA 5C1ZA 1I42A 1ESFA 3A4SC 2INNE 3L54A 2WXJA 4BKSA 4REZA 2MJEA 2L8JA 2LXAA 4ZRKA 2KMAA 2LVOA 2L05A 3TJPA 1V2YA 3PRZA 3EECA 5MPOA 1MPEA 2GB1A 2IBIB 4KSKC 3GE8C 2LGYA 4A20A 4DHZB 1ENFA 2N9EB 4MH0E 4NAMA 3PZ8A 4ZYSA 3KUCB 3MJWA 3M3JA 1WE7A 3RNCC 1KLVA 2Q5WD 4XWTA 1UNSA 2J0KA 4CYEA 3HHMA 1QOGA 2Z59B 3DOWA 2PKOA 3FAHA 2MJDA 3ONSA 2QIEB 1UBIA 3ZVVA 1FCLA 2XNAC 3VXWA 1YX5B 3VH3B 2IGDA 4HCPB 3L16A 5KHOA 2LWPA 4LNKA 1V1PA 1JW9D 4N58A 3V61A 4C7ZA 1LGRA 1IPGA 2B76B 1P98A 2JF5A 1STEA 3VVWB 3FKYA 2DAFA 3OAWA 2QDFA 1ZUD2 4ASWC 2E6XA 1MJDA 5H8YE 3S2AA 4M8MA 2PE6B 3EUB2 3RT3B 5HFYA 2QILA 4ZRQA 4K3CA 4MSMB 1KM7A 3VTUA 3W9CB 2PJHA 5D3DA 3PZDA 4NAWA 2PW9A 3PSEB 3N9YC 3HK0A 1YJ1A 5G55A 3QK0A 4URKA 4NJ6A 3OWEB 3AV8A 2DWQA 2QC8A 1WMHA 3AE1B 4D2KA 4LDTB 4MM3B 3X0WA 3BINA 4PS8A 1FXIA 1J7CA 3L08A 4ACFA 2M19A 3A1QB 2DLBA 2JWZA 3NZUA 1SXTA 2OJRA 4GIVA 1L6VA 1V6EA 2AL3A 4B6WA 2N9KA 5AUIA 5HKHA 3APCA 2BBCA 2K5PA 2JSVX 3KUZA 1I35A 4NQLB 2MEKA 4GSWA 1M4VA 1SE9A 5BO4B 2BB5A 2FNJB 3WANA 4YTNB 2PTLA 2LUMA 1F2RI 1XT9B 3ZDMC 1WGGA 1WJNA 5I4DA 1NYQA 1OTRB 5AZGA 3VR9B 2CJNA 2KC2A 1FRRA 3PS6A 2ZNVB 4HCNB 2KANA 2XN9C 1RFKA 1IBXA 5FK9C 1C4CA 2LZ6A 4TMAB 4BKTA 3AEFB 1L0VB 2XBBC 3R66C 1WXSA 3QARA 3DBHB 1SE2A 4I6PA 2REXA 4CQNA 4X57B 2HJ1A 4IM3A 3L0WB 5DPWA 2JZPA 4RGNA 4RGTA 3SHQA 2IO3B 4M8NA 1TKYA 4II3B 1WM3A 3PPAA 4JL9A 1TT5B 2G4DB 4MGIE 1T5XD 3E9SA 4HROA 4G3XB 1I4RA 4KDLB 3APFA 3TUOA 2LMCA 1XCTL 2LVQA 3T8MA 1FXTB 1FFVA 2LVPA 3IAM1 5AUKA 2DENB 4KDIC 4QAYA 4IDIA 2CHXA 5C2TB 5BYSA 2G45B 2IGGA 4M00A 3PLVA 4TQ1A 3AEDB 2KAJA 2KQSA 4DDID 4DHJB 4WQMA 4LJOB 1Z2MA 3UQAA 4MSQB 1RLFA 3IVFA 1DYQA 1WGDA 3DQVA 4WJNA 1SE4A 1F52A 3BIID 3V62A 1HTQA 3NY5A 4OZCA 3MTNB 3MHSD 3JVZX 3A9JA 3NVWA 2Z0DB 3HUIA 4II2B 4F8CB 4FBJB 4C4VB 1K51A 3DBSA 2KK8A 2N9LA 1HQRD 2KX0A 2MX2A 1SEBD 3GZNI 1OEYJ 4B95A 5GMVA 1GC7A 4TQ0A 2AL6A 2IY1B 4EKUA 3MFGA 5IA7A 2O2VB 3KLSX 4JGHB 1K8RB 3HVZA 3VQIA 3L4PA 4O1NA 2JXTA 3Q3FA 2MSED 2D3AA 3UQBA 5CHVC 2BYTA 2BTEA 3VRBB 3BVZA 2WDVB 2RGFA 4A3PA 3SU8X 4TSSA 1V80A 2FUHB 1HTOA 2G4SA 1T3QA 2MBBB 3AE4B 1UELA 1TGZB 2RDGA 3Q6BA 1YOVB 3EHVA 2WXGA 2D3BA 4N6EB 4KV2A 3Q2AC 3NZ3A 4XZ4A 4RF0A 4GGQA 1E8ZA 4LCDE 2WWZA 5BMIA 3JSVA 1QOBA 5L83A 2ZVNA 3KH0A 4US8A 3HM3A 4PK1A 3LYYA 2GLSA 1T0YA 2D5GA 2MBHA 4ARIA 4HXDA 3I57A 1QT9A 2CHZA 2FCSA 3AE6B 1BMLC 1TS5A 2I38A 5EDSA 3ZTCA 3U7DA 2KZRA 2KDEB 1T0QC 4PT5A 4DXAB 2ZNVC 1YQ3B 2W9NA 3AE5B 3N32A 3WAMA 5E6PA 2RDBC 2KWUB 1LXDA 4BKGA 3AN1A 2AQ3B 1X1MA 2ZVOA 3V3XA 2NMQA 1I4QA 4K1RB 3TCAA 1ZKHA 1U4AA 1VJKA 1L5PA 4XGAB 4AUQC 3VUYA 1ZDXA 3M63B 4F7ZA 1N60A 1UUPA 2QEJC 1PQSA 4E74A 1DOIA 2QMTA 1D5XC 2EMTA 3KVFB 4ANUA 3RZWC 2ON8A 1CJEA 3AB5A 3GB1A 3UINB 2I1KA 3R7RA 3CMMB 3TEYA 3AECB 1D6EC 2W82A 3PHWB 1Z5SB 1Q10A 1TY2A 1PGAA 2WXNA 1FMAD 4GDKA 2DYOA 3I3TB 5JHAA 2LGXA 2GMIC 3DVGY 4ZOHC 4HPLB 1GAQB 2KYWA 2PE9A 4WH4A 2IGHA 2NPTA 2QSDA 1SJED 2KX3A 2WGSA 1C4PA 2OOBB 1ZE3D 1DOXA 2KJRA 3P2BA 1WWTA 2MQJA 3ZYYX 2D07B 1TBEA 1FEHA 5LLIA 1QOAA 3DBLI 3IT6B 2K8CA 2GI9A 1UBQA 2MLBA 3B2GA 4TUUA 1C77A 4FHKA 2LGDA 3CSFA 2BPSA 2J4XA 5KHQA 4RMAA 1VLBA 2KT7A 2G3QB 2KTFA 1VCBA 5BMGA 3P63A 3A9KB 2FUG1 4KIKA 2A5UA 2KVZA 2PLPA 5T8IA 4HPPA 2FCNA 4A55A 4NJ7A 3HIZA 2Y3AA 1P1AA 3RCZA 3P4RB 1P9DU 4FLHA 2L83A 4P1CC 1E90A 4N9F4 3O13A 2I2YA 4YT0B 1SF0A 3QA8A 3NHEB 2LFIA 1NI3A 1VZ8A 2BYVE 1V1OA 2PVGC 5L95C 2KTRA 1NDDA 2TSSA 3D32A 3DHGC 1FD6A 1GNUA 5D94A 5CHFA 1XLOA 2SAKA 1JWMD 1RFAA 4XWWA 4MGKE 4EFOA 1YNTE 2LHDA 2CS4A 2L0FA 1BT0A 1SE3A 3ALBA 3KYDD 3AEEB 4KKIA 1C76A 1GOZA 2HTHA 2GBKA 1WY8A 2KFKA 3UIPB 5E6OA 3C0RB 4P7IA 2LD9A 4RM9A 3BK1A 4P6VF 4EEWA 1G6JA 3IT4B 2VZKB 1D3ZA 1JCKB 1QLBB 4HLEA 1IP9A 1WJ4A 2JUOA 3BZDB 2WNMA 3QC8B 2KDBA 2N1VA 4M02A 3Q8EA 2X8XX 4IW0A 1T0SC 3H7PB 4M0WB 4OZAA 1EF1A 3ZO5B 4E71A 3ECIA 3WALA 1NVID 1R4MI 2JY6A 3OLMD 1UWMA 4IM0A 1WF9A 4DXFA 3AE2B 3RUIB 1JMLA 2KDMA 2K22A 4YL8A 2V3SA 2ONQA 3ENEA 1KJTA 1WXAA 3AMZA 1C3TA 3VH4B 2IPKD 4Q2JA 1OQQA 4R3DA 2JT4B 3SFDB 1KLGD 1VZ6A 2RPQA 1MG8A 4W9IA 1QZEA 4OVVA 5FR3A 3VDZA 4WWMA 3B1LX 3JW0X 1FCCC 2Y5PA 3AU5A 2L7RA 3IAS1 4WQOB 2M56B 2NS5A 1S1QB 2K6QA 2V1YA 1L4DB 4DQOC 3TBLD 1AWDA 2DBYA 3RNBC 2RDHA 1D4BA 2L76A 3SD5A 3SR6A 2L0TA 2DYBA 3ETRA 3B08A 2JXXA 2E3TA 3U4EG 3R2TA 2RD0A 3KW5B 4ANXA 3NG0A 2BVCA 2JYEA 1EWYC 5HG2A 1T0RC 2KWDA 5HHDG 4IWQA 5G5GA 4GN1A 1L2NA 4AJWA 1TTNA 1UH6A 3A1QA 3U52E
chains in the Genus database with same CATH topology
3L17A 4KIKB 4ANWA 2NBVB 4NPNA 2JRIB 3V62A 4GU2A 3NY5A 1KOTA 2HJ8A 3TIXA 3ZRFA 1R4NI 3MTNB 2C7MB 4MEMA 3MHSD 3JVZX 2L3ZA 3A9JA 3TMPB 4AJYB 2Z0DB 2KLCA 2AYOB 4II2B 3AXCA 5AZFA 3V6CB 4BFRA 4F8CB 1WX8A 4WWOA 4FBJB 4ICVA 3H7PA 4PS7A 2JPHA 3DBSA 2N7EA 5G2NA 4K7UA 2KK8A 2K1FA 3AU4A 2KX0A 2VRRB 2MX2A 4GDLB 3ZNHB 3AULA 1RAXA 2MBQA 2Y5BB 3NOBA 3GZNI 4HDOA 1OEYJ 3W1SA 4B95A 2LRWA 5GMVA 4MGYE 2ZJDA 2XK5B 1GC7A 1LQBA 3N3KB 2KTRB 4TQ0A 4BVUC 2AL6A 2O6VD 2IY1B 2M8SA 4HWIB 3ZNZB 4EKUA 5IA7A 2KXJA 3QIJA 2XEWA 4CO7A 2J0JA 1A5RA 3RULA 2EKEC 2O2VB 1RRBA 4BOZB 2C7NB 2BWFA 2WX1A 5DPTA 4JGHB 1V86A 3A9KA 1K8RB 4W9EA 3PREA 4CHKA 1EF5A 2LI5A 4XX5A 2IO2B 2DZMA 2D10A 2MCNB 3VQIA 1WR6E 2UWQA 2EMSA 3Q3FA 3QWZB 4BOSC 2MSED 2JZ3B 2M0XA 4WWNA 5CHVC 3UQBA 2LUEA 3RZFA 4PS3A 2RGFA 4FJZA 4A3PA 3V6EB 4EOYA 2KKCA 1L7YA 2A4ZA 2DZJA 2KD0A 3SU8X 3PLUA 3TL5A 2Z0EB 1P3QU 2BYEA 3GOEA 1V80A 2FUHB 3QCAA 4BBNF 2N9PC 2BGFA 2G4SA 4PYZA 3NZSA 2KFKB 2MBBB 1UELA 4W9JA 1TGZB 2C60A 3DDCB 1GG3A 2IZVB 3ZTDA 3EHVA 1WR1A 3A4RA 4HJKA 4JQWC 2HD5B 4KV2A 4XZ4A 4AWJA 3U8ZA 3OJ4B 4GGQA 1E8ZA 2CKHB 2WWZA 2KFJA 3DBRI 4LCDE 1LFDA 5E6NA 2MRPA 4DK5A 4TV3A 2I1JA 4AP4C 3DCGA 3JSVA 5L83A 2ZVNA 4E3CA 1WX9A 3KH0A 3HM3A 3K9OB 4HVBA 1WRDB 3T9LA 1ZGUB 2BKFA 1Q0WB 5CHWA 1M94A 2YVCA 2JRHA 2ZPYA 3QX1A 1XQQA 3UIOB 1YX6B 2FCMA 5DPRA 1WGRA 1T0YA 1Q5WB 4ANVA 2DX5B 2KJ6A 3X23A 3ZNID 5J2RA 3PV1A 3JYUA 2MBHA 5FR6A 4HXDA 1WE6A 4I6NB 3SDLC 2CHZA 2FCSA 2R2OA 3UF8A 2BYFA 2MBEA 2NBUA 3EFUA 3EC8A 1UGMA 5EDSA 3OJ3A 3ZTCA 4ICUA 2KZRA 3U7DA 2RR9A 2PPHA 3ML8A 2D11A 4IWOA 1J8CA 1J19A 2KDFB 3ZRCA 1P0RA 2KDEB 4A3OA 3ML9A 4DXAB 2ZNVC 4F1SA 2KHWB 3W1SC 2W9NA 2CHWA 3N32A 3WAMA 2DYMA 4MM3A 3VUWA 1WFYA 4W9DA 4FJYA 5CX3A 5E6PA 2KWUB 2MP2A 4DBGA 4K7SA 1LXDA 4GDLA 4NNJB 4JLCA 4RM8A 2V4LA 4ZDVA 1NBFC 1YQBA 4FJVB 4BKGA 3PTFC 3ZDTA 1WZ0A 1X1MA 2ZVOA 3H6NA 2ZPNA 2MW5A 2BKRB 2XK5A 4K1RB 3TCAA 4KZ0A 4OVUA 1E8WA 1ZKHA 1EO6A 2KNBA 1U4AA 2NVUI 4ZRIA 3VFKA 2KO3A 4KVGB 3V60A 4AUQC 2M1MA 3VUYA 1HE8A 3M63B 2KOXA 4F7ZA 4GXBA 1PQSA 4E74A 2YLMA 2M17A 5AZHA 2EMTA 3KVFB 4ANUA 1E8YA 3RZWC 1WJ6A 1E7UA 1WXVA 2K8HA 4W9FA 2RSUA 2KMCA 4ZYNA 2FIFA 4LDTD 2CR5A 2B3AA 4W9LA 4NY0A 3UINB 5D2MB 5DCNA 2JVCA 2I1KA 3N30A 4FN2A 4IC7B 1UZXB 2BF8B 2K25A 3CMMB 3R7RA 3WAPA 5LXIB 1JRUA 2KWCA 5TR5A 3VUXA 3PHWB 4JIOU 1XD3B 1Z5SB 5C1ZA 1I42A 4B9KA 3A4SC 4KSLC 2NR2A 3L54A 1S3SG 1GC6A 2AWTA 4BKSA 4GDKA 2DYOA 2FAZA 3I3TB 2KC1A 2LGXA 5JHAA 2L8JA 2LXAA 4DDGD 1V9JA 4ZRKA 2GMIC 1AARA 2KMAA 3DVGY 3H7SA 2DAJA 4HK2A 1E5WA 2LVOA 2L05A 3TJPA 1V2YA 2O6VB 3PRZA 4HPLB 4IWPA 2PE9A 4WJNA 1V5OA 3EECA 4NAWB 1WIAA 4DWFA 2GBMA 2IBIB 2NPTA 3LJ3A 4KSKC 2KJHB 2KX3A 3NS8A 4EZKA 2LGYA 4W9KA 4A20A 4DHZB 2N9EB 2OOBB 4MH0E 3DPDA 3IBEA 3KUCB 1WMHB 2KJRA 3P2BA 1IYFA 2MQJA 3MJWA 3VHTC 2D07B 1TBEA 3AI5A 3M3JA 5LLIA 1SIFA 3DBLI 2K8CA 1WE7A 1KLVA 1UBQA 2MLBA 4TUUA 3LDZE 4BKSD 2J0KA 4TKNA 1NI2A 3QJZA 4CYEA 4WJPA 3HHMA 5J17A 4FHKA 2IY0B 2LGDA 3PT2B 2C5LC 2Z59B 3CSFA 2BPSA 4WWPA 2ZCCA 5D7GA 4MJSB 3DOWA 5J18A 5KHQA 2IYDB 3DVNV 2L00B 4RMAA 2PEAA 4I6LB 2G3QB 2KTFA 3A33B 3ONSA 3CF6E 1VCBA 2MA9B 3ZUNA 1UBIA 3ZVVA 3VXWA 3A9KB 2JZZA 1YX5B 2A5UA 4KIKA 3QAQA 3VH3B 2D3GA 4AOFA 4HCPB 1H4RA 2FCNA 2NBWB 4GB9A 1H8CA 1J0GA 2NCNA 3L16A 4NJ7A 5KHOA 2LWPA 3ZW3A 3HIZA 4FHJA 1P1AA 2BWES 3KUDB 3PRMB 3RCZA 3V61A 3PRPB 1GJZA 2IO1B 1P9DU 4FLHA 1IPGA 3PVLA 1E90A 3Q3JA 4HDQA 3ZLZA 4N9F4 3VTWA 2ZEQA 5JH5C 4NQKE 1P98A 2WDTB 3KYCD 2JF5A 3NHEB 3QA8A 4DHJD 3M62B 3VVWB 5AEKB 2DAFA 3OAWA 2C9WB 2BYVE 4ASWC 1WM2A 5L95C 2WYQA 2GBRA 4K81A 1LM8B 2KTRA 3S2AA 4LJPB 4FADA 1NDDA 4M8MA 4HPMB 3D32A 2D2QA 2PE6B 2O2VA 1GNUA 2N1WA 3VAWA 1CMXB 1WJUA 4WJOA 5D94A 5CHFA 3RT3B 3DVGX 2N9XA 2KVRA 1RFAA 5D6JB 4MGKE 2DZKA 4ZRJA 2J0MA 4EFOA 1WX7A 4MSMB 1KM7A 3VTUA 5JZEB 2O6VA 2PJHA 1GUAB 1ISNA 2ZCBA 3PZDA 4NAWA 3PSEB 1V5TA 2K39A 2LXCA 2CS4A 2L0FA 3HK0A 1BT0A 1YJ1A 3L10B 3R7QA 3ALBA 5G55A 3QK0A 3KYDD 4NJ6A 4URKA 1WH3A 3IG3A 3PGEA 1WZ3A 1WMHA 2HTHA 2ZZPB 2GBKA 1WY8A 2KFKA 3UIPB 4LDTB 2K6DB 3X0WA 5E6OA 4GMVA 3C0RB 4P7IA 3BINA 4PS8A 2K8BA 2LD9A 2MP2B 4RM9A 1VD2A 3L08A 4EEWA 4K7WA 1G6JA 1OGWA 3A1QB 4FULA 2JWZA 3NZUA 1Q1OA 2MBOA 2N7DA 1D3ZA 2GBNA 4HLEA 2OJRA 1V49A 2IO0B 4GIVA 1IP9A 1WGYA 4MJSA 1V6EA 1WJ4A 2AL3A 1OEYA 2JUOA 3DBHI 4WAAA 4B6WA 5HKHA 1V81A 2KN5A 3APCA 3QC8B 2KDBA 2N1VA 2HE7A 3A9JB 3KUZA 3R3MA 1I35A 4NQLB 5DPSA 2WX0A 1E8XA 4GSWA 4IW0A 1ZW7A 4EZJA 1SE9A 3H7PB 3PHXB 4M0WB 4BBNC 2M4NA 5BO4B 2ASQA 2LJ5A 1EF1A 2FNJB 2UYZB 3WANA 3ZO5B 4E71A 5C23A 2KLGA 3ECIA 3ZDMC 1XT9B 4J6IA 3WALA 1R4MI 1WI0A 4IG7B 2JY6A 1WGGA 1WJNA 3OLMD 4MDKE 2J7QB 3K9PB 4IM0A 1WF9A 1Y8RC 1OTRB 4G50A 5AZGA 2KWVB 2KC2A 3PS6A 3VTVA 4HCNB 2ZNVB 3IHPC 2KANA 3RUIB 3ZNGC 1C1YB 4YL8A 2V3SA 2LASA 2LZ6A 2DZIA 4W9CA 4BKTA 2DHZA 3ENEA 4IM2A 1YD8U 1KJTA 1WXAA 1C3TA 2XBBC 4KZCA 3VH4B 3R66C 1WXSA 3QARA 4I6PA 2FCQA 2REXA 4X57B 2MWSB 2JT4B 1E7VA 4EZLA 2LRUA 3L0WB 2AEHA 4IM3A 2C7HA 5DPWA 2FIDA 2RPQA 4G11A 4GDKB 1UD7A 3RYTA 3APDA 1MG8A 4W9IA 1YIWA 3H9DA 3SHQA 2IO3B 3BY4B 3H1UA 4M8NA 4EUTA 4II3B 1QZEA 1WGHA 1WM3A 3CSTA 4OVVA 1SGHA 4XC2A 3PPAA 4JL9A 3VDZA 3B1LX 3JW0X 3DVNU 4W9HA 3ZIMA 2G4DB 3AU5A 4MGIE 2L7RA 5LXHA 3UGBB 4WQOB 4IUMB 2NPTB 2CU1A 4G3XB 4KDLB 4MGZE 1F9JA 2NS5A 1S1QB 2K6QA 1OQYA 2V1YA 3APFA 2N4FA 3RD2A 3WAOA 3TBLD 3B0AA 2LVQA 3T8MA 2L76A 3SD5A 1FXTB 2R2QA 2L0TA 2LVPA 2DYBA 4W9GA 2DENB 3IFWB 4KDIC 3B08A 1EUVB 2JXXA 3WA0A 2GOWA 5IAAC 3M95A 1TZ1A 2RD0A 3KW5B 4ANXA 2CHXA 1WYWB 4MELA 4PYUA 5CTRC 4FA6A 5JHBA 3W1YA 2GBJA 3U30A 3QHTA 2G45B 4WJQA 3L13A 3O65B 4GOCA 2KDIA 3PLVA 4DHZE 3QQ8B 4TQ1A 2KQSA 3JSVB 4G0NB 4DDID 4DHJB 3ZKJC 4IWQA 2KQ7A 4LJOB 1Z2MA 3WIMA 3UQAA 4MSQB 3HM6X 1RLFA 3IVFA 2QHOA 4GN1A 1L2NA 4AJWA 1WGDA 1TTNA 1UH6A 1WXMA 3A1QA 3DQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L17 A;  4KIK B;  4ANW A;  2NBV B;  4NPN A;  2JRI B;  3V62 A;  4GU2 A;  3NY5 A;  1KOT A;  2HJ8 A;  3TIX A;  3ZRF A;  1R4N I;  3MTN B;  2C7M B;  4MEM A;  3MHS D;  3JVZ X;  2L3Z A;  3A9J A;  3TMP B;  4AJY B;  2Z0D B;  2KLC A;  2AYO B;  4II2 B;  3AXC A;  5AZF A;  3V6C B;  4BFR A;  4F8C B;  1WX8 A;  4WWO A;  4FBJ B;  4ICV A;  3H7P A;  4PS7 A;  2JPH A;  3DBS A;  2N7E A;  5G2N A;  4K7U A;  2KK8 A;  2K1F A;  3AU4 A;  2KX0 A;  2VRR B;  2MX2 A;  4GDL B;  3ZNH B;  3AUL A;  1RAX A;  2MBQ A;  2Y5B B;  3NOB A;  3GZN I;  4HDO A;  1OEY J;  3W1S A;  4B95 A;  2LRW A;  5GMV A;  4MGY E;  2ZJD A;  2XK5 B;  1GC7 A;  1LQB A;  3N3K B;  2KTR B;  4TQ0 A;  4BVU C;  2AL6 A;  2O6V D;  2IY1 B;  2M8S A;  4HWI B;  3ZNZ B;  4EKU A;  5IA7 A;  2KXJ A;  3QIJ A;  2XEW A;  4CO7 A;  2J0J A;  1A5R A;  3RUL A;  2EKE C;  2O2V B;  1RRB A;  4BOZ B;  2C7N B;  2BWF A;  2WX1 A;  5DPT A;  4JGH B;  1V86 A;  3A9K A;  1K8R B;  4W9E A;  3PRE A;  4CHK A;  1EF5 A;  2LI5 A;  4XX5 A;  2IO2 B;  2DZM A;  2D10 A;  2MCN B;  3VQI A;  1WR6 E;  2UWQ A;  2EMS A;  3Q3F A;  3QWZ B;  4BOS C;  2MSE D;  2JZ3 B;  2M0X A;  4WWN A;  5CHV C;  3UQB A;  2LUE A;  3RZF A;  4PS3 A;  2RGF A;  4FJZ A;  4A3P A;  3V6E B;  4EOY A;  2KKC A;  1L7Y A;  2A4Z A;  2DZJ A;  2KD0 A;  3SU8 X;  3PLU A;  3TL5 A;  2Z0E B;  1P3Q U;  2BYE A;  3GOE A;  1V80 A;  2FUH B;  3QCA A;  4BBN F;  2N9P C;  2BGF A;  2G4S A;  4PYZ A;  3NZS A;  2KFK B;  2MBB B;  1UEL A;  4W9J A;  1TGZ B;  2C60 A;  3DDC B;  1GG3 A;  2IZV B;  3ZTD A;  3EHV A;  1WR1 A;  3A4R A;  4HJK A;  4JQW C;  2HD5 B;  4KV2 A;  4XZ4 A;  4AWJ A;  3U8Z A;  3OJ4 B;  4GGQ A;  1E8Z A;  2CKH B;  2WWZ A;  2KFJ A;  3DBR I;  4LCD E;  1LFD A;  5E6N A;  2MRP A;  4DK5 A;  4TV3 A;  2I1J A;  4AP4 C;  3DCG A;  3JSV A;  5L83 A;  2ZVN A;  4E3C A;  1WX9 A;  3KH0 A;  3HM3 A;  3K9O B;  4HVB A;  1WRD B;  3T9L A;  1ZGU B;  2BKF A;  1Q0W B;  5CHW A;  1M94 A;  2YVC A;  2JRH A;  2ZPY A;  3QX1 A;  1XQQ A;  3UIO B;  1YX6 B;  2FCM A;  5DPR A;  1WGR A;  1T0Y A;  1Q5W B;  4ANV A;  2DX5 B;  2KJ6 A;  3X23 A;  3ZNI D;  5J2R A;  3PV1 A;  3JYU A;  2MBH A;  5FR6 A;  4HXD A;  1WE6 A;  4I6N B;  3SDL C;  2CHZ A;  2FCS A;  2R2O A;  3UF8 A;  2BYF A;  2MBE A;  2NBU A;  3EFU A;  3EC8 A;  1UGM A;  5EDS A;  3OJ3 A;  3ZTC A;  4ICU A;  2KZR A;  3U7D A;  2RR9 A;  2PPH A;  3ML8 A;  2D11 A;  4IWO A;  1J8C A;  1J19 A;  2KDF B;  3ZRC A;  1P0R A;  2KDE B;  4A3O A;  3ML9 A;  4DXA B;  2ZNV C;  4F1S A;  2KHW B;  3W1S C;  2W9N A;  2CHW A;  3N32 A;  3WAM A;  2DYM A;  4MM3 A;  3VUW A;  1WFY A;  4W9D A;  4FJY A;  5CX3 A;  5E6P A;  2KWU B;  2MP2 A;  4DBG A;  4K7S A;  1LXD A;  4GDL A;  4NNJ B;  4JLC A;  4RM8 A;  2V4L A;  4ZDV A;  1NBF C;  1YQB A;  4FJV B;  4BKG A;  3PTF C;  3ZDT A;  1WZ0 A;  1X1M A;  2ZVO A;  3H6N A;  2ZPN A;  2MW5 A;  2BKR B;  2XK5 A;  4K1R B;  3TCA A;  4KZ0 A;  4OVU A;  1E8W A;  1ZKH A;  1EO6 A;  2KNB A;  1U4A A;  2NVU I;  4ZRI A;  3VFK A;  2KO3 A;  4KVG B;  3V60 A;  4AUQ C;  2M1M A;  3VUY A;  1HE8 A;  3M63 B;  2KOX A;  4F7Z A;  4GXB A;  1PQS A;  4E74 A;  2YLM A;  2M17 A;  5AZH A;  2EMT A;  3KVF B;  4ANU A;  1E8Y A;  3RZW C;  1WJ6 A;  1E7U A;  1WXV A;  2K8H A;  4W9F A;  2RSU A;  2KMC A;  4ZYN A;  2FIF A;  4LDT D;  2CR5 A;  2B3A A;  4W9L A;  4NY0 A;  3UIN B;  5D2M B;  5DCN A;  2JVC A;  2I1K A;  3N30 A;  4FN2 A;  4IC7 B;  1UZX B;  2BF8 B;  2K25 A;  3CMM B;  3R7R A;  3WAP A;  5LXI B;  1JRU A;  2KWC A;  5TR5 A;  3VUX A;  3PHW B;  4JIO U;  1XD3 B;  1Z5S B;  5C1Z A;  1I42 A;  4B9K A;  3A4S C;  4KSL C;  2NR2 A;  3L54 A;  1S3S G;  1GC6 A;  2AWT A;  4BKS A;  4GDK A;  2DYO A;  2FAZ A;  3I3T B;  2KC1 A;  2LGX A;  5JHA A;  2L8J A;  2LXA A;  4DDG D;  1V9J A;  4ZRK A;  2GMI C;  1AAR A;  2KMA A;  3DVG Y;  3H7S A;  2DAJ A;  4HK2 A;  1E5W A;  2LVO A;  2L05 A;  3TJP A;  1V2Y A;  2O6V B;  3PRZ A;  4HPL B;  4IWP A;  2PE9 A;  4WJN A;  1V5O A;  3EEC A;  4NAW B;  1WIA A;  4DWF A;  2GBM A;  2IBI B;  2NPT A;  3LJ3 A;  4KSK C;  2KJH B;  2KX3 A;  3NS8 A;  4EZK A;  2LGY A;  4W9K A;  4A20 A;  4DHZ B;  2N9E B;  2OOB B;  4MH0 E;  3DPD A;  3IBE A;  3KUC B;  1WMH B;  2KJR A;  3P2B A;  1IYF A;  2MQJ A;  3MJW A;  3VHT C;  2D07 B;  1TBE A;  3AI5 A;  3M3J A;  5LLI A;  1SIF A;  3DBL I;  2K8C A;  1WE7 A;  1KLV A;  1UBQ A;  2MLB A;  4TUU A;  3LDZ E;  4BKS D;  2J0K A;  4TKN A;  1NI2 A;  3QJZ A;  4CYE A;  4WJP A;  3HHM A;  5J17 A;  4FHK A;  2IY0 B;  2LGD A;  3PT2 B;  2C5L C;  2Z59 B;  3CSF A;  2BPS A;  4WWP A;  2ZCC A;  5D7G A;  4MJS B;  3DOW A;  5J18 A;  5KHQ A;  2IYD B;  3DVN V;  2L00 B;  4RMA A;  2PEA A;  4I6L B;  2G3Q B;  2KTF A;  3A33 B;  3ONS A;  3CF6 E;  1VCB A;  2MA9 B;  3ZUN A;  1UBI A;  3ZVV A;  3VXW A;  3A9K B;  2JZZ A;  1YX5 B;  2A5U A;  4KIK A;  3QAQ A;  3VH3 B;  2D3G A;  4AOF A;  4HCP B;  1H4R A;  2FCN A;  2NBW B;  4GB9 A;  1H8C A;  1J0G A;  2NCN A;  3L16 A;  4NJ7 A;  5KHO A;  2LWP A;  3ZW3 A;  3HIZ A;  4FHJ A;  1P1A A;  2BWE S;  3KUD B;  3PRM B;  3RCZ A;  3V61 A;  3PRP B;  1GJZ A;  2IO1 B;  1P9D U;  4FLH A;  1IPG A;  3PVL A;  1E90 A;  3Q3J A;  4HDQ A;  3ZLZ A;  4N9F 4;  3VTW A;  2ZEQ A;  5JH5 C;  4NQK E;  1P98 A;  2WDT B;  3KYC D;  2JF5 A;  3NHE B;  3QA8 A;  4DHJ D;  3M62 B;  3VVW B;  5AEK B;  2DAF A;  3OAW A;  2C9W B;  2BYV E;  4ASW C;  1WM2 A;  5L95 C;  2WYQ A;  2GBR A;  4K81 A;  1LM8 B;  2KTR A;  3S2A A;  4LJP B;  4FAD A;  1NDD A;  4M8M A;  4HPM B;  3D32 A;  2D2Q A;  2PE6 B;  2O2V A;  1GNU A;  2N1W A;  3VAW A;  1CMX B;  1WJU A;  4WJO A;  5D94 A;  5CHF A;  3RT3 B;  3DVG X;  2N9X A;  2KVR A;  1RFA A;  5D6J B;  4MGK E;  2DZK A;  4ZRJ A;  2J0M A;  4EFO A;  1WX7 A;  4MSM B;  1KM7 A;  3VTU A;  5JZE B;  2O6V A;  2PJH A;  1GUA B;  1ISN A;  2ZCB A;  3PZD A;  4NAW A;  3PSE B;  1V5T A;  2K39 A;  2LXC A;  2CS4 A;  2L0F A;  3HK0 A;  1BT0 A;  1YJ1 A;  3L10 B;  3R7Q A;  3ALB A;  5G55 A;  3QK0 A;  3KYD D;  4NJ6 A;  4URK A;  1WH3 A;  3IG3 A;  3PGE A;  1WZ3 A;  1WMH A;  2HTH A;  2ZZP B;  2GBK A;  1WY8 A;  2KFK A;  3UIP B;  4LDT B;  2K6D B;  3X0W A;  5E6O A;  4GMV A;  3C0R B;  4P7I A;  3BIN A;  4PS8 A;  2K8B A;  2LD9 A;  2MP2 B;  4RM9 A;  1VD2 A;  3L08 A;  4EEW A;  4K7W A;  1G6J A;  1OGW A;  3A1Q B;  4FUL A;  2JWZ A;  3NZU A;  1Q1O A;  2MBO A;  2N7D A;  1D3Z A;  2GBN A;  4HLE A;  2OJR A;  1V49 A;  2IO0 B;  4GIV A;  1IP9 A;  1WGY A;  4MJS A;  1V6E A;  1WJ4 A;  2AL3 A;  1OEY A;  2JUO A;  3DBH I;  4WAA A;  4B6W A;  5HKH A;  1V81 A;  2KN5 A;  3APC A;  3QC8 B;  2KDB A;  2N1V A;  2HE7 A;  3A9J B;  3KUZ A;  3R3M A;  1I35 A;  4NQL B;  5DPS A;  2WX0 A;  1E8X A;  4GSW A;  4IW0 A;  1ZW7 A;  4EZJ A;  1SE9 A;  3H7P B;  3PHX B;  4M0W B;  4BBN C;  2M4N A;  5BO4 B;  2ASQ A;  2LJ5 A;  1EF1 A;  2FNJ B;  2UYZ B;  3WAN A;  3ZO5 B;  4E71 A;  5C23 A;  2KLG A;  3ECI A;  3ZDM C;  1XT9 B;  4J6I A;  3WAL A;  1R4M I;  1WI0 A;  4IG7 B;  2JY6 A;  1WGG A;  1WJN A;  3OLM D;  4MDK E;  2J7Q B;  3K9P B;  4IM0 A;  1WF9 A;  1Y8R C;  1OTR B;  4G50 A;  5AZG A;  2KWV B;  2KC2 A;  3PS6 A;  3VTV A;  4HCN B;  2ZNV B;  3IHP C;  2KAN A;  3RUI B;  3ZNG C;  1C1Y B;  4YL8 A;  2V3S A;  2LAS A;  2LZ6 A;  2DZI A;  4W9C A;  4BKT A;  2DHZ A;  3ENE A;  4IM2 A;  1YD8 U;  1KJT A;  1WXA A;  1C3T A;  2XBB C;  4KZC A;  3VH4 B;  3R66 C;  1WXS A;  3QAR A;  4I6P A;  2FCQ A;  2REX A;  4X57 B;  2MWS B;  2JT4 B;  1E7V A;  4EZL A;  2LRU A;  3L0W B;  2AEH A;  4IM3 A;  2C7H A;  5DPW A;  2FID A;  2RPQ A;  4G11 A;  4GDK B;  1UD7 A;  3RYT A;  3APD A;  1MG8 A;  4W9I A;  1YIW A;  3H9D A;  3SHQ A;  2IO3 B;  3BY4 B;  3H1U A;  4M8N A;  4EUT A;  4II3 B;  1QZE A;  1WGH A;  1WM3 A;  3CST A;  4OVV A;  1SGH A;  4XC2 A;  3PPA A;  4JL9 A;  3VDZ A;  3B1L X;  3JW0 X;  3DVN U;  4W9H A;  3ZIM A;  2G4D B;  3AU5 A;  4MGI E;  2L7R A;  5LXH A;  3UGB B;  4WQO B;  4IUM B;  2NPT B;  2CU1 A;  4G3X B;  4KDL B;  4MGZ E;  1F9J A;  2NS5 A;  1S1Q B;  2K6Q A;  1OQY A;  2V1Y A;  3APF A;  2N4F A;  3RD2 A;  3WAO A;  3TBL D;  3B0A A;  2LVQ A;  3T8M A;  2L76 A;  3SD5 A;  1FXT B;  2R2Q A;  2L0T A;  2LVP A;  2DYB A;  4W9G A;  2DEN B;  3IFW B;  4KDI C;  3B08 A;  1EUV B;  2JXX A;  3WA0 A;  2GOW A;  5IAA C;  3M95 A;  1TZ1 A;  2RD0 A;  3KW5 B;  4ANX A;  2CHX A;  1WYW B;  4MEL A;  4PYU A;  5CTR C;  4FA6 A;  5JHB A;  3W1Y A;  2GBJ A;  3U30 A;  3QHT A;  2G45 B;  4WJQ A;  3L13 A;  3O65 B;  4GOC A;  2KDI A;  3PLV A;  4DHZ E;  3QQ8 B;  4TQ1 A;  2KQS A;  3JSV B;  4G0N B;  4DDI D;  4DHJ B;  3ZKJ C;  4IWQ A;  2KQ7 A;  4LJO B;  1Z2M A;  3WIM A;  3UQA A;  4MSQ B;  3HM6 X;  1RLF A;  3IVF A;  2QHO A;  4GN1 A;  1L2N A;  4AJW A;  1WGD A;  1TTN A;  1UH6 A;  1WXM A;  3A1Q A;  3DQV A; 
#chains in the Genus database with same CATH topology
 4ANW A;  1K52 A;  2JRI B;  2HJ8 A;  3TIX A;  1V1P B;  2KQ4 X;  3AH7 A;  3AXC A;  4BFR A;  1WX8 A;  4WWO A;  2N7E A;  5G2N A;  1N62 A;  3P4P B;  2K1F A;  3AUL A;  2MBQ A;  2MH7 A;  1N5W A;  1WGK A;  2M8S A;  4HWI B;  2OHF A;  2XEW A;  2J0J A;  1I4P A;  2EKE C;  2AQ1 B;  2BWF A;  3IXS A;  4W9E A;  4HJG E;  4JE3 B;  2D10 A;  1KFY B;  1WR6 E;  1XCQ L;  4BOS C;  4WWN A;  1PYW D;  4KGR A;  3RZF A;  4FJZ A;  1D5M C;  3V6E B;  2A4Z A;  3GZN B;  1XLN A;  4XYC A;  1KRH A;  2Z0E B;  4RFB A;  2BYE A;  3GOE A;  2BGF A;  2W3R A;  3RI7 C;  3DDC B;  3ZTD A;  3A4R A;  4JQW C;  4HJK A;  4S0R A;  3OJ4 B;  3PO0 A;  2AQ2 B;  2CKH B;  5E6N A;  2KFJ A;  3DBR I;  2BT6 A;  2I1J A;  4AP4 C;  2WXQ A;  2WXM A;  3BK2 A;  4HVB A;  1ZGU B;  5CHW A;  1M94 A;  3FIL A;  2JRH A;  3QX1 A;  1XQQ A;  3UIO B;  2FCM A;  1JRO A;  3X23 A;  5FR6 A;  3JYU A;  4I6N B;  2YEP F;  3UF8 A;  3EC8 A;  3NJT A;  4ICU A;  4RF1 A;  3N20 C;  3ML8 A;  4C4V A;  1DOY A;  1J19 A;  3W1S C;  1YN4 A;  1IBX B;  2CHW A;  2LGI A;  2MP2 A;  4ZDV A;  1YQB A;  4FJV B;  1EWC A;  3W5U B;  3PTF C;  3DHH C;  3ZJT A;  2BKR B;  3UI3 A;  2QCZ A;  3BVM A;  4KZ0 A;  3E56 A;  1EO6 A;  2NVU I;  2WXR A;  1F2R C;  1JWS D;  4KVG B;  2M1M A;  2WLB A;  1TY0 A;  2KOX A;  1YN5 A;  2W55 A;  1E7U A;  1WXV A;  4ZYN A;  2FIF A;  4LDT D;  2B3A A;  4NY0 A;  3B9J A;  5D2M B;  3DWM A;  5DCN A;  3N30 A;  5HI1 A;  1UZX B;  3WAP A;  2K25 A;  5LXI B;  1JRU A;  1SB3 C;  4C56 C;  3V05 A;  1GC6 A;  1UF0 A;  4YXD B;  2FAZ A;  3P1M A;  1L4Z B;  5BMH A;  4DDG D;  1V9J A;  4XDD A;  1GB4 A;  1AAR A;  3H7S A;  1EM7 A;  4LNO A;  4HK2 A;  4MT5 A;  1PGB A;  1K50 A;  2O6V B;  4P16 A;  3AEB B;  1RYJ A;  2VH2 A;  2GBM A;  2NTS A;  3NS8 A;  2LEK A;  2AX5 A;  4EZK A;  2BS3 B;  3IBE A;  2PVO D;  1C9F A;  1F1H A;  3MJ5 A;  2WQY B;  5JXV A;  2WHI A;  1ET6 A;  3N1Y C;  3QJZ A;  4USA A;  5J17 A;  2IY0 B;  2ZCC A;  5D7G A;  1AN8 A;  4MJS B;  5J18 A;  2IYD B;  1MI0 A;  2PEA A;  4I6L B;  3P4Q B;  4M01 A;  1JWU D;  3ZUN A;  1KH0 A;  1E10 A;  1N6Z A;  2JZZ A;  2D3G A;  4ZHP A;  3BYY B;  3H8H A;  1H4R A;  3RNG C;  1FNW A;  2NCN A;  1I7H A;  3ZW3 A;  4GLS C;  4FHJ A;  2BWE S;  3PRM B;  3PRP B;  1GJZ A;  2W54 A;  3DBL B;  4YSX B;  3DHI C;  3Q8C A;  5JH5 C;  2WDT B;  1N63 A;  2K9X A;  4KX6 B;  4DHJ D;  1RM6 C;  3M62 B;  2C9W B;  1PFD A;  1IGC A;  3ZXR A;  3TEX A;  1WM2 A;  4K81 A;  4YTM B;  1LM8 B;  1ZXH A;  5LNK 1;  4FAD A;  2D2Q A;  1UWX A;  4IKG A;  2RPV A;  3VAW A;  2WP9 B;  4WJO A;  4HEA 1;  4ITK A;  3DVG X;  3GS2 A;  2BB6 A;  2KVR A;  4RGO S;  1GB1 A;  2FE8 A;  5D6J B;  2DZK A;  4ZRJ A;  2J0M A;  1T6B X;  1WX7 A;  3U2S C;  1FNV A;  5JZE B;  1BXT A;  3FC4 A;  4BZA A;  1ISN A;  2ZCB A;  1V5T A;  2K39 A;  2LXC A;  3I5J C;  3R7Q A;  3ZJU A;  2V3N A;  1ROE A;  1WH3 A;  4LTU A;  4MAC A;  3PGE A;  1WZ3 A;  3AE8 B;  2ZZP B;  3P4S B;  2ZW0 A;  4LLG M;  2UU7 A;  1VD2 A;  2YEP B;  1ZP0 B;  2MBO A;  5G5H A;  2GBN A;  2IO0 B;  2BS2 B;  1MHH E;  4RNA A;  3TEZ A;  2INC C;  1XEE A;  1V81 A;  2KN5 A;  2HE7 A;  3C19 A;  3R3M A;  3NVZ A;  2WX0 A;  1E8X A;  1ZW7 A;  3ZXV A;  3PHX B;  3RNF C;  2M4N A;  1NEN B;  2LJ5 A;  3Q14 C;  1YMH E;  1WI0 A;  4MDK E;  2J7Q B;  1EU3 A;  1WRI A;  1Y8R C;  4G50 A;  3ZJV A;  3VTV A;  3URY A;  1C1Y B;  1FRD A;  4OW0 A;  2DHZ A;  4H2A A;  4KZC A;  1L0X B;  4L1B A;  2MWS B;  3B2F A;  1E7V A;  5IO9 A;  2PMV A;  2AEH A;  3N1X C;  3WCQ A;  4GDK B;  3APD A;  1YIW A;  3H1U A;  4EUT A;  4YTP B;  3LB8 C;  4W9H A;  1R4M B;  3ZIM A;  2ICI A;  5IN7 A;  3UGB B;  4IUM B;  2NPT B;  2CU1 A;  1F9J A;  1OQY A;  2SEB D;  3WAO A;  3B0A A;  1KF6 B;  2R2Q A;  3SFE B;  1V8C A;  3IFW B;  1PDX A;  1EUV B;  3WA0 A;  5IAA C;  1TZ1 A;  5CTR C;  2CJO A;  3W1Y A;  2GBJ A;  4RGM A;  3U30 A;  3L13 A;  4YSY B;  3AM9 A;  4GOC A;  2KDI A;  4C80 A;  3QQ8 B;  5EE9 A;  1YJI A;  3ZKJ C;  2KQ7 A;  1WXQ A;  2HDE A;  2QHO A;  2LGS A;  1WXM A;  1I4G A;  3Q3N C;  4LNN A;  3L17 A;  4KIK B;  1AW7 A;  4NPN A;  3ZRF A;  5BYQ A;  1R4N I;  4MEM A;  2IND C;  3TMP B;  4AJY B;  2IDY A;  5AZF A;  3H7P A;  2JPH A;  2J53 A;  2V9H A;  2ZW1 A;  4K7U A;  4LNF A;  4BAX A;  1J7A A;  4GDL B;  1RAX A;  2L52 A;  1SIJ A;  3HRD D;  4HDO A;  3W1S A;  2WXK A;  4MGY E;  2D3C A;  2ZJD A;  2XK5 B;  1LQB A;  4OHJ A;  4NZL B;  2KTR B;  3ZNZ B;  2L32 A;  3QIJ A;  1A5R A;  3RUL A;  1HZ6 A;  4BOZ B;  1ZDV A;  5DPT A;  2INP E;  1V86 A;  3BWU D;  3PRE A;  4YWG G;  2MJ3 A;  2UWQ A;  2EMS A;  3QWZ B;  2JX5 A;  1RWS A;  2M0X A;  2LUE A;  4PS3 A;  3ZQ4 A;  1SJH D;  2KKC A;  2KD0 A;  2WXL A;  1CK1 A;  3TL5 A;  1HZ5 A;  3Q3O C;  1NEK B;  1TZO A;  4HRS A;  3QCA A;  1B1Z A;  4PYZ A;  2KFK B;  1P7E A;  3PZ7 A;  4W9J A;  4A8X C;  3RN9 C;  1WR1 A;  3TSS A;  4AWJ A;  1OFF A;  1BUI C;  2MRP A;  3NS1 A;  1TKE A;  2ACZ B;  4DK5 A;  4TV3 A;  3DCG A;  3I63 C;  4OZB A;  4E3C A;  3K9O B;  1WRD B;  2BKF A;  1Q0W B;  4L2Y A;  1C79 A;  3MC8 A;  4MH8 A;  1TIF A;  5DPR A;  3KWL A;  3EGR A;  1N5X A;  3VR8 B;  2WU5 B;  3NVV A;  5J2R A;  4EE2 A;  1WE6 A;  2WXH A;  2EEL A;  2R2O A;  2MBE A;  2NBU A;  1UGM A;  1XLP A;  2IJ0 A;  3OJ3 A;  2RR9 A;  2PPH A;  1J8C A;  2KDF B;  2WS3 B;  4F1S A;  3T3N A;  1TKG A;  3DBR B;  5D3I B;  2DYM A;  4MM3 A;  3VUW A;  1WFY A;  2X38 A;  1SBB B;  2K3U A;  4FJY A;  4KKJ A;  4DBG A;  4K7S A;  4C7Y A;  4NNJ B;  4JLC A;  2V4L A;  3DWG C;  1QIL A;  1D5Z C;  3H6N A;  2ZPN A;  2MW5 A;  3J9C A;  2KNB A;  4HKQ A;  3I9V 1;  2KO3 A;  4WAF A;  1TS4 A;  3C8Y A;  4ZRP A;  1HEZ E;  2V4I B;  2K8H A;  2BW2 A;  2JYT A;  4W9F A;  1E0Z A;  2RSU A;  2KMM A;  1J7B A;  1JRP A;  2JVC A;  4ZHO A;  4FN2 A;  2JQR B;  4IC7 B;  2H89 B;  2VZK D;  3VUX A;  3Q3M C;  1IUE A;  1XD3 B;  3LXF A;  1TYG B;  1Y56 A;  1C78 A;  4B9K A;  4KGT A;  2NR2 A;  3NRZ A;  4KSL C;  4ARC A;  4A6Q A;  1ZOY B;  1S3S G;  2AWT A;  1HA5 A;  1IGD A;  2VH1 A;  2KC1 A;  3MC0 B;  2WU2 B;  5H92 C;  2DAJ A;  1E5W A;  1K53 A;  4IWP A;  3TEW A;  1WYG A;  1V5O A;  4NAW B;  1WIA A;  4DWF A;  1QF6 A;  4OVZ A;  3LJ3 A;  2KJH B;  3BVG A;  1FM0 D;  4W9K A;  3DPD A;  1TJE A;  3MHZ A;  2WXP A;  1WMH B;  1IYF A;  3VHT C;  5IOI A;  3AI5 A;  4JX1 C;  1JWB D;  1SIF A;  4FXC A;  2G9H D;  5EE1 A;  1B9R A;  1A70 A;  3LDZ E;  1I4X A;  4XE0 A;  5GXG B;  4BKS D;  1N61 A;  4N59 A;  4TKN A;  1NI2 A;  4WJP A;  3PT2 B;  2OED A;  2C5L C;  4WWP A;  1VRA B;  3DVN V;  2L00 B;  1GPX A;  3A33 B;  3CF6 E;  2MA9 B;  2WXI A;  3QAQ A;  4AOF A;  2EKI A;  3AE7 B;  2NBW B;  4GB9 A;  1H8C A;  1J0G A;  1JWA D;  3KUD B;  2IO1 B;  2HTM E;  1WSP A;  4P1B C;  1L0Y B;  3CWI A;  3PVL A;  4HDQ A;  3Q3J A;  3ZLZ A;  2NTT A;  3MP9 A;  3VTW A;  2ZEQ A;  2GRI A;  4NQK E;  3KYC D;  1KLU D;  5AEK B;  1UGJ A;  3KQ4 A;  1TS3 A;  2WYQ A;  2GBR A;  3P42 A;  4LJP B;  4HPM B;  4JWU C;  2O2V A;  2N1W A;  1CMX B;  1WJU A;  2CU3 A;  2N9X A;  1QOF A;  3FIL B;  1OQR A;  1XF5 L;  1YQ4 B;  2O6V A;  2WXF A;  1GUA B;  1E9M A;  4US9 A;  4B0M A;  4RH6 A;  2J42 A;  4NJC A;  3L10 B;  2WDR B;  1LO5 D;  3IG3 A;  1NYR A;  1FO4 A;  2N7J A;  4XDC A;  1SSN A;  2K6D B;  5EE0 A;  4GMV A;  2K8B A;  2MP2 B;  4JWS C;  4K7W A;  3RMK C;  1VZ7 A;  1OGW A;  4FUL A;  1Q1O A;  2N7D A;  3HVD A;  1V49 A;  1ZPS A;  5IKC M;  1WGY A;  4MJS A;  4C00 A;  1OEY A;  3DBH I;  4WAA A;  1CZP A;  4S17 A;  3A9J B;  5DPS A;  5E6J A;  4EZJ A;  3GP7 A;  4BBN C;  3OG5 A;  2ASQ A;  2UYZ B;  5C23 A;  2KLG A;  5TSS A;  4J6I A;  4IG7 B;  3K9P B;  1FNU A;  3AEA B;  4J3O D;  1MFW A;  2J52 A;  2KWV B;  3ZNG C;  5FKA C;  3IHP C;  1V97 A;  2LAS A;  4W9C A;  2DZI A;  3AE3 B;  4IM2 A;  1YD8 U;  2DNF A;  2FCQ A;  1C4A A;  4L23 A;  4EZL A;  2LRU A;  2C7H A;  2FID A;  1F77 A;  4G11 A;  1UD7 A;  3RYT A;  3H9D A;  1YJJ A;  3BY4 B;  4WUR A;  1WGH A;  3CST A;  1MG4 A;  4XC2 A;  1SGH A;  4B0E A;  3DVN U;  5LXH A;  1KTK A;  4MGZ E;  3Q8A A;  3W2D A;  3RD2 A;  2N4F A;  1FPY A;  2V0G A;  4W9G A;  4LNI A;  2GOW A;  2QJL A;  3M95 A;  1WYW B;  3AE9 B;  4MEL A;  4PYU A;  5C3J B;  4FA6 A;  5JHB A;  2Y5C A;  3QHT A;  3SEB A;  2WDQ B;  4WJQ A;  3EA6 A;  3O65 B;  4DHZ E;  4LK0 M;  3JSV B;  4G0N B;  3WIM A;  2LHE A;  3HM6 X;  3RFZ B;  1CQV A;  1YN3 A;  1XLQ A;  3CIR B;  2NBV B;  4GU2 A;  1R7S A;  2G1E A;  3GE3 C;  1KOT A;  1MVK A;  2C7M B;  1JQ4 A;  4RCO A;  2L3Z A;  2KLC A;  3AEG B;  2AYO B;  4A90 A;  3V6C B;  4ICV A;  1MHX A;  4PS7 A;  2PIA A;  2RMM A;  3EFC A;  2N0S B;  3AU4 A;  4IOI E;  1VDV A;  2VRR B;  3ZNH B;  1VR9 A;  2Y5B B;  3NOB A;  2JWU A;  2BS4 B;  2MHJ A;  2LRW A;  3N3K B;  4AQ7 A;  3R8B A;  4BVU C;  2O6V D;  2R61 A;  3W5V B;  2M0A A;  2H88 B;  2KXJ A;  4KGS A;  4CO7 A;  3KWV A;  3ZGZ A;  1R4N B;  1RRB A;  1ET9 A;  2V3P A;  2C7N B;  2WX1 A;  3A9K A;  4CHK A;  1EF5 A;  4A9A A;  2LI5 A;  4XX5 A;  2IO2 B;  2DZM A;  2MCN B;  2JZ3 B;  3ABV B;  4EOY A;  1L7Y A;  2DZJ A;  4K3B A;  1FXA A;  3PLU A;  4YSZ B;  4WIP A;  1P3Q U;  3VRA B;  3N1Z C;  5BYR A;  3NVY A;  4BBN F;  2N9P C;  1P7F A;  3Q69 A;  3NZS A;  1JAL A;  1XXG A;  4DXG A;  1F0Z A;  1I4H A;  2C60 A;  1GG3 A;  2IZV B;  2Z8L A;  2HD5 B;  3T3O A;  3U8Z A;  1PGX A;  1LFD A;  3RNE C;  1FIQ A;  1XO3 A;  3Q8B A;  1WX9 A;  1QKZ A;  3T9L A;  2YVC A;  2ZPY A;  3Q8F A;  1YX6 B;  3R2I A;  1WGR A;  1Q5W B;  4ANV A;  2DX5 B;  2KJ6 A;  3ZNI D;  3PV1 A;  3SDL C;  2BYF A;  2FBW B;  3EFU A;  3RNA C;  4IWO A;  2D11 A;  2WXO A;  1QQR A;  3ZRC A;  1P0R A;  2KN4 A;  4A3O A;  3ML9 A;  1PUT A;  2KHW B;  4HKZ E;  4JPS A;  3U7Z A;  4W9D A;  5CX3 A;  3NUH B;  4GDL A;  5IP4 D;  4RM8 A;  1L6U A;  4AS1 A;  3BYT B;  1NBF C;  2L1A A;  3ZDT A;  2K0P A;  1WZ0 A;  1E7P B;  1FFU A;  1TS2 A;  2XK5 A;  4OVU A;  1E8W A;  3RPF C;  2BQQ A;  4ZRI A;  3VFK A;  1ACC A;  3V60 A;  1HE8 A;  2OJW A;  4UDU C;  2JU6 X;  4GXB A;  1ZXI A;  2YLM A;  2KAC A;  2M17 A;  4M0W A;  5AZH A;  1E8Y A;  1WJ6 A;  3MC9 A;  1AYF A;  5EE3 A;  2LJI A;  2KMC A;  2CR5 A;  4W9L A;  2W3S A;  1EU4 A;  1E6E B;  2BF8 B;  2KWC A;  5TR5 A;  4JIO U;  1HXY D;  1DGJ A;  5C1Z A;  1I42 A;  1ESF A;  3A4S C;  2INN E;  3L54 A;  2WXJ A;  4BKS A;  4REZ A;  2MJE A;  2L8J A;  2LXA A;  4ZRK A;  2KMA A;  2LVO A;  2L05 A;  3TJP A;  1V2Y A;  3PRZ A;  3EEC A;  5MPO A;  1MPE A;  2GB1 A;  2IBI B;  4KSK C;  3GE8 C;  2LGY A;  4A20 A;  4DHZ B;  1ENF A;  2N9E B;  4MH0 E;  4NAM A;  3PZ8 A;  4ZYS A;  3KUC B;  3MJW A;  3M3J A;  1WE7 A;  3RNC C;  1KLV A;  2Q5W D;  4XWT A;  1UNS A;  2J0K A;  4CYE A;  3HHM A;  1QOG A;  2Z59 B;  3DOW A;  2PKO A;  3FAH A;  2MJD A;  3ONS A;  2QIE B;  1UBI A;  3ZVV A;  1FCL A;  2XNA C;  3VXW A;  1YX5 B;  3VH3 B;  2IGD A;  4HCP B;  3L16 A;  5KHO A;  2LWP A;  4LNK A;  1V1P A;  1JW9 D;  4N58 A;  3V61 A;  4C7Z A;  1LGR A;  1IPG A;  2B76 B;  1P98 A;  2JF5 A;  1STE A;  3VVW B;  3FKY A;  2DAF A;  3OAW A;  2QDF A;  1ZUD 2;  4ASW C;  2E6X A;  1MJD A;  5H8Y E;  3S2A A;  4M8M A;  2PE6 B;  3EUB 2;  3RT3 B;  5HFY A;  2QIL A;  4ZRQ A;  4K3C A;  4MSM B;  1KM7 A;  3VTU A;  3W9C B;  2PJH A;  5D3D A;  3PZD A;  4NAW A;  2PW9 A;  3PSE B;  3N9Y C;  3HK0 A;  1YJ1 A;  5G55 A;  3QK0 A;  4URK A;  4NJ6 A;  3OWE B;  3AV8 A;  2DWQ A;  2QC8 A;  1WMH A;  3AE1 B;  4D2K A;  4LDT B;  4MM3 B;  3X0W A;  3BIN A;  4PS8 A;  1FXI A;  1J7C A;  3L08 A;  4ACF A;  2M19 A;  3A1Q B;  2DLB A;  2JWZ A;  3NZU A;  1SXT A;  2OJR A;  4GIV A;  1L6V A;  1V6E A;  2AL3 A;  4B6W A;  2N9K A;  5AUI A;  5HKH A;  3APC A;  2BBC A;  2K5P A;  2JSV X;  3KUZ A;  1I35 A;  4NQL B;  2MEK A;  4GSW A;  1M4V A;  1SE9 A;  5BO4 B;  2BB5 A;  2FNJ B;  3WAN A;  4YTN B;  2PTL A;  2LUM A;  1F2R I;  1XT9 B;  3ZDM C;  1WGG A;  1WJN A;  5I4D A;  1NYQ A;  1OTR B;  5AZG A;  3VR9 B;  2CJN A;  2KC2 A;  1FRR A;  3PS6 A;  2ZNV B;  4HCN B;  2KAN A;  2XN9 C;  1RFK A;  1IBX A;  5FK9 C;  1C4C A;  2LZ6 A;  4TMA B;  4BKT A;  3AEF B;  1L0V B;  2XBB C;  3R66 C;  1WXS A;  3QAR A;  3DBH B;  1SE2 A;  4I6P A;  2REX A;  4CQN A;  4X57 B;  2HJ1 A;  4IM3 A;  3L0W B;  5DPW A;  2JZP A;  4RGN A;  4RGT A;  3SHQ A;  2IO3 B;  4M8N A;  1TKY A;  4II3 B;  1WM3 A;  3PPA A;  4JL9 A;  1TT5 B;  2G4D B;  4MGI E;  1T5X D;  3E9S A;  4HRO A;  4G3X B;  1I4R A;  4KDL B;  3APF A;  3TUO A;  2LMC A;  1XCT L;  2LVQ A;  3T8M A;  1FXT B;  1FFV A;  2LVP A;  3IAM 1;  5AUK A;  2DEN B;  4KDI C;  4QAY A;  4IDI A;  2CHX A;  5C2T B;  5BYS A;  2G45 B;  2IGG A;  4M00 A;  3PLV A;  4TQ1 A;  3AED B;  2KAJ A;  2KQS A;  4DDI D;  4DHJ B;  4WQM A;  4LJO B;  1Z2M A;  3UQA A;  4MSQ B;  1RLF A;  3IVF A;  1DYQ A;  1WGD A;  3DQV A;  4WJN A;  1SE4 A;  1F52 A;  3BII D;  3V62 A;  1HTQ A;  3NY5 A;  4OZC A;  3MTN B;  3MHS D;  3JVZ X;  3A9J A;  3NVW A;  2Z0D B;  3HUI A;  4II2 B;  4F8C B;  4FBJ B;  4C4V B;  1K51 A;  3DBS A;  2KK8 A;  2N9L A;  1HQR D;  2KX0 A;  2MX2 A;  1SEB D;  3GZN I;  1OEY J;  4B95 A;  5GMV A;  1GC7 A;  4TQ0 A;  2AL6 A;  2IY1 B;  4EKU A;  3MFG A;  5IA7 A;  2O2V B;  3KLS X;  4JGH B;  1K8R B;  3HVZ A;  3VQI A;  3L4P A;  4O1N A;  2JXT A;  3Q3F A;  2MSE D;  2D3A A;  3UQB A;  5CHV C;  2BYT A;  2BTE A;  3VRB B;  3BVZ A;  2WDV B;  2RGF A;  4A3P A;  3SU8 X;  4TSS A;  1V80 A;  2FUH B;  1HTO A;  2G4S A;  1T3Q A;  2MBB B;  3AE4 B;  1UEL A;  1TGZ B;  2RDG A;  3Q6B A;  1YOV B;  3EHV A;  2WXG A;  2D3B A;  4N6E B;  4KV2 A;  3Q2A C;  3NZ3 A;  4XZ4 A;  4RF0 A;  4GGQ A;  1E8Z A;  4LCD E;  2WWZ A;  5BMI A;  3JSV A;  1QOB A;  5L83 A;  2ZVN A;  3KH0 A;  4US8 A;  3HM3 A;  4PK1 A;  3LYY A;  2GLS A;  1T0Y A;  2D5G A;  2MBH A;  4ARI A;  4HXD A;  3I57 A;  1QT9 A;  2CHZ A;  2FCS A;  3AE6 B;  1BML C;  1TS5 A;  2I38 A;  5EDS A;  3ZTC A;  3U7D A;  2KZR A;  2KDE B;  1T0Q C;  4PT5 A;  4DXA B;  2ZNV C;  1YQ3 B;  2W9N A;  3AE5 B;  3N32 A;  3WAM A;  5E6P A;  2RDB C;  2KWU B;  1LXD A;  4BKG A;  3AN1 A;  2AQ3 B;  1X1M A;  2ZVO A;  3V3X A;  2NMQ A;  1I4Q A;  4K1R B;  3TCA A;  1ZKH A;  1U4A A;  1VJK A;  1L5P A;  4XGA B;  4AUQ C;  3VUY A;  1ZDX A;  3M63 B;  4F7Z A;  1N60 A;  1UUP A;  2QEJ C;  1PQS A;  4E74 A;  1DOI A;  2QMT A;  1D5X C;  2EMT A;  3KVF B;  4ANU A;  3RZW C;  2ON8 A;  1CJE A;  3AB5 A;  3GB1 A;  3UIN B;  2I1K A;  3R7R A;  3CMM B;  3TEY A;  3AEC B;  1D6E C;  2W82 A;  3PHW B;  1Z5S B;  1Q10 A;  1TY2 A;  1PGA A;  2WXN A;  1FMA D;  4GDK A;  2DYO A;  3I3T B;  5JHA A;  2LGX A;  2GMI C;  3DVG Y;  4ZOH C;  4HPL B;  1GAQ B;  2KYW A;  2PE9 A;  4WH4 A;  2IGH A;  2NPT A;  2QSD A;  1SJE D;  2KX3 A;  2WGS A;  1C4P A;  2OOB B;  1ZE3 D;  1DOX A;  2KJR A;  3P2B A;  1WWT A;  2MQJ A;  3ZYY X;  2D07 B;  1TBE A;  1FEH A;  5LLI A;  1QOA A;  3DBL I;  3IT6 B;  2K8C A;  2GI9 A;  1UBQ A;  2MLB A;  3B2G A;  4TUU A;  1C77 A;  4FHK A;  2LGD A;  3CSF A;  2BPS A;  2J4X A;  5KHQ A;  4RMA A;  1VLB A;  2KT7 A;  2G3Q B;  2KTF A;  1VCB A;  5BMG A;  3P63 A;  3A9K B;  2FUG 1;  4KIK A;  2A5U A;  2KVZ A;  2PLP A;  5T8I A;  4HPP A;  2FCN A;  4A55 A;  4NJ7 A;  3HIZ A;  2Y3A A;  1P1A A;  3RCZ A;  3P4R B;  1P9D U;  4FLH A;  2L83 A;  4P1C C;  1E90 A;  4N9F 4;  3O13 A;  2I2Y A;  4YT0 B;  1SF0 A;  3QA8 A;  3NHE B;  2LFI A;  1NI3 A;  1VZ8 A;  2BYV E;  1V1O A;  2PVG C;  5L95 C;  2KTR A;  1NDD A;  2TSS A;  3D32 A;  3DHG C;  1FD6 A;  1GNU A;  5D94 A;  5CHF A;  1XLO A;  2SAK A;  1JWM D;  1RFA A;  4XWW A;  4MGK E;  4EFO A;  1YNT E;  2LHD A;  2CS4 A;  2L0F A;  1BT0 A;  1SE3 A;  3ALB A;  3KYD D;  3AEE B;  4KKI A;  1C76 A;  1GOZ A;  2HTH A;  2GBK A;  1WY8 A;  2KFK A;  3UIP B;  5E6O A;  3C0R B;  4P7I A;  2LD9 A;  4RM9 A;  3BK1 A;  4P6V F;  4EEW A;  1G6J A;  3IT4 B;  2VZK B;  1D3Z A;  1JCK B;  1QLB B;  4HLE A;  1IP9 A;  1WJ4 A;  2JUO A;  3BZD B;  2WNM A;  3QC8 B;  2KDB A;  2N1V A;  4M02 A;  3Q8E A;  2X8X X;  4IW0 A;  1T0S C;  3H7P B;  4M0W B;  4OZA A;  1EF1 A;  3ZO5 B;  4E71 A;  3ECI A;  3WAL A;  1NVI D;  1R4M I;  2JY6 A;  3OLM D;  1UWM A;  4IM0 A;  1WF9 A;  4DXF A;  3AE2 B;  3RUI B;  1JML A;  2KDM A;  2K22 A;  4YL8 A;  2V3S A;  2ONQ A;  3ENE A;  1KJT A;  1WXA A;  3AMZ A;  1C3T A;  3VH4 B;  2IPK D;  4Q2J A;  1OQQ A;  4R3D A;  2JT4 B;  3SFD B;  1KLG D;  1VZ6 A;  2RPQ A;  1MG8 A;  4W9I A;  1QZE A;  4OVV A;  5FR3 A;  3VDZ A;  4WWM A;  3B1L X;  3JW0 X;  1FCC C;  2Y5P A;  3AU5 A;  2L7R A;  3IAS 1;  4WQO B;  2M56 B;  2NS5 A;  1S1Q B;  2K6Q A;  2V1Y A;  1L4D B;  4DQO C;  3TBL D;  1AWD A;  2DBY A;  3RNB C;  2RDH A;  1D4B A;  2L76 A;  3SD5 A;  3SR6 A;  2L0T A;  2DYB A;  3ETR A;  3B08 A;  2JXX A;  2E3T A;  3U4E G;  3R2T A;  2RD0 A;  3KW5 B;  4ANX A;  3NG0 A;  2BVC A;  2JYE A;  1EWY C;  5HG2 A;  1T0R C;  2KWD A;  5HHD G;  4IWQ A;  5G5G A;  4GN1 A;  1L2N A;  4AJW A;  1TTN A;  1UH6 A;  3A1Q A;  3U52 E; 
#chains in the Genus database with same CATH homology
 3L17 A;  4KIK B;  4ANW A;  2NBV B;  4NPN A;  2JRI B;  3V62 A;  4GU2 A;  3NY5 A;  1KOT A;  2HJ8 A;  3TIX A;  3ZRF A;  1R4N I;  3MTN B;  2C7M B;  4MEM A;  3MHS D;  3JVZ X;  2L3Z A;  3A9J A;  3TMP B;  4AJY B;  2Z0D B;  2KLC A;  2AYO B;  4II2 B;  3AXC A;  5AZF A;  3V6C B;  4BFR A;  4F8C B;  1WX8 A;  4WWO A;  4FBJ B;  4ICV A;  3H7P A;  4PS7 A;  2JPH A;  3DBS A;  2N7E A;  5G2N A;  4K7U A;  2KK8 A;  2K1F A;  3AU4 A;  2KX0 A;  2VRR B;  2MX2 A;  4GDL B;  3ZNH B;  3AUL A;  1RAX A;  2MBQ A;  2Y5B B;  3NOB A;  3GZN I;  4HDO A;  1OEY J;  3W1S A;  4B95 A;  2LRW A;  5GMV A;  4MGY E;  2ZJD A;  2XK5 B;  1GC7 A;  1LQB A;  3N3K B;  2KTR B;  4TQ0 A;  4BVU C;  2AL6 A;  2O6V D;  2IY1 B;  2M8S A;  4HWI B;  3ZNZ B;  4EKU A;  5IA7 A;  2KXJ A;  3QIJ A;  2XEW A;  4CO7 A;  2J0J A;  1A5R A;  3RUL A;  2EKE C;  2O2V B;  1RRB A;  4BOZ B;  2C7N B;  2BWF A;  2WX1 A;  5DPT A;  4JGH B;  1V86 A;  3A9K A;  1K8R B;  4W9E A;  3PRE A;  4CHK A;  1EF5 A;  2LI5 A;  4XX5 A;  2IO2 B;  2DZM A;  2D10 A;  2MCN B;  3VQI A;  1WR6 E;  2UWQ A;  2EMS A;  3Q3F A;  3QWZ B;  4BOS C;  2MSE D;  2JZ3 B;  2M0X A;  4WWN A;  5CHV C;  3UQB A;  2LUE A;  3RZF A;  4PS3 A;  2RGF A;  4FJZ A;  4A3P A;  3V6E B;  4EOY A;  2KKC A;  1L7Y A;  2A4Z A;  2DZJ A;  2KD0 A;  3SU8 X;  3PLU A;  3TL5 A;  2Z0E B;  1P3Q U;  2BYE A;  3GOE A;  1V80 A;  2FUH B;  3QCA A;  4BBN F;  2N9P C;  2BGF A;  2G4S A;  4PYZ A;  3NZS A;  2KFK B;  2MBB B;  1UEL A;  4W9J A;  1TGZ B;  2C60 A;  3DDC B;  1GG3 A;  2IZV B;  3ZTD A;  3EHV A;  1WR1 A;  3A4R A;  4HJK A;  4JQW C;  2HD5 B;  4KV2 A;  4XZ4 A;  4AWJ A;  3U8Z A;  3OJ4 B;  4GGQ A;  1E8Z A;  2CKH B;  2WWZ A;  2KFJ A;  3DBR I;  4LCD E;  1LFD A;  5E6N A;  2MRP A;  4DK5 A;  4TV3 A;  2I1J A;  4AP4 C;  3DCG A;  3JSV A;  5L83 A;  2ZVN A;  4E3C A;  1WX9 A;  3KH0 A;  3HM3 A;  3K9O B;  4HVB A;  1WRD B;  3T9L A;  1ZGU B;  2BKF A;  1Q0W B;  5CHW A;  1M94 A;  2YVC A;  2JRH A;  2ZPY A;  3QX1 A;  1XQQ A;  3UIO B;  1YX6 B;  2FCM A;  5DPR A;  1WGR A;  1T0Y A;  1Q5W B;  4ANV A;  2DX5 B;  2KJ6 A;  3X23 A;  3ZNI D;  5J2R A;  3PV1 A;  3JYU A;  2MBH A;  5FR6 A;  4HXD A;  1WE6 A;  4I6N B;  3SDL C;  2CHZ A;  2FCS A;  2R2O A;  3UF8 A;  2BYF A;  2MBE A;  2NBU A;  3EFU A;  3EC8 A;  1UGM A;  5EDS A;  3OJ3 A;  3ZTC A;  4ICU A;  2KZR A;  3U7D A;  2RR9 A;  2PPH A;  3ML8 A;  2D11 A;  4IWO A;  1J8C A;  1J19 A;  2KDF B;  3ZRC A;  1P0R A;  2KDE B;  4A3O A;  3ML9 A;  4DXA B;  2ZNV C;  4F1S A;  2KHW B;  3W1S C;  2W9N A;  2CHW A;  3N32 A;  3WAM A;  2DYM A;  4MM3 A;  3VUW A;  1WFY A;  4W9D A;  4FJY A;  5CX3 A;  5E6P A;  2KWU B;  2MP2 A;  4DBG A;  4K7S A;  1LXD A;  4GDL A;  4NNJ B;  4JLC A;  4RM8 A;  2V4L A;  4ZDV A;  1NBF C;  1YQB A;  4FJV B;  4BKG A;  3PTF C;  3ZDT A;  1WZ0 A;  1X1M A;  2ZVO A;  3H6N A;  2ZPN A;  2MW5 A;  2BKR B;  2XK5 A;  4K1R B;  3TCA A;  4KZ0 A;  4OVU A;  1E8W A;  1ZKH A;  1EO6 A;  2KNB A;  1U4A A;  2NVU I;  4ZRI A;  3VFK A;  2KO3 A;  4KVG B;  3V60 A;  4AUQ C;  2M1M A;  3VUY A;  1HE8 A;  3M63 B;  2KOX A;  4F7Z A;  4GXB A;  1PQS A;  4E74 A;  2YLM A;  2M17 A;  5AZH A;  2EMT A;  3KVF B;  4ANU A;  1E8Y A;  3RZW C;  1WJ6 A;  1E7U A;  1WXV A;  2K8H A;  4W9F A;  2RSU A;  2KMC A;  4ZYN A;  2FIF A;  4LDT D;  2CR5 A;  2B3A A;  4W9L A;  4NY0 A;  3UIN B;  5D2M B;  5DCN A;  2JVC A;  2I1K A;  3N30 A;  4FN2 A;  4IC7 B;  1UZX B;  2BF8 B;  2K25 A;  3CMM B;  3R7R A;  3WAP A;  5LXI B;  1JRU A;  2KWC A;  5TR5 A;  3VUX A;  3PHW B;  4JIO U;  1XD3 B;  1Z5S B;  5C1Z A;  1I42 A;  4B9K A;  3A4S C;  4KSL C;  2NR2 A;  3L54 A;  1S3S G;  1GC6 A;  2AWT A;  4BKS A;  4GDK A;  2DYO A;  2FAZ A;  3I3T B;  2KC1 A;  2LGX A;  5JHA A;  2L8J A;  2LXA A;  4DDG D;  1V9J A;  4ZRK A;  2GMI C;  1AAR A;  2KMA A;  3DVG Y;  3H7S A;  2DAJ A;  4HK2 A;  1E5W A;  2LVO A;  2L05 A;  3TJP A;  1V2Y A;  2O6V B;  3PRZ A;  4HPL B;  4IWP A;  2PE9 A;  4WJN A;  1V5O A;  3EEC A;  4NAW B;  1WIA A;  4DWF A;  2GBM A;  2IBI B;  2NPT A;  3LJ3 A;  4KSK C;  2KJH B;  2KX3 A;  3NS8 A;  4EZK A;  2LGY A;  4W9K A;  4A20 A;  4DHZ B;  2N9E B;  2OOB B;  4MH0 E;  3DPD A;  3IBE A;  3KUC B;  1WMH B;  2KJR A;  3P2B A;  1IYF A;  2MQJ A;  3MJW A;  3VHT C;  2D07 B;  1TBE A;  3AI5 A;  3M3J A;  5LLI A;  1SIF A;  3DBL I;  2K8C A;  1WE7 A;  1KLV A;  1UBQ A;  2MLB A;  4TUU A;  3LDZ E;  4BKS D;  2J0K A;  4TKN A;  1NI2 A;  3QJZ A;  4CYE A;  4WJP A;  3HHM A;  5J17 A;  4FHK A;  2IY0 B;  2LGD A;  3PT2 B;  2C5L C;  2Z59 B;  3CSF A;  2BPS A;  4WWP A;  2ZCC A;  5D7G A;  4MJS B;  3DOW A;  5J18 A;  5KHQ A;  2IYD B;  3DVN V;  2L00 B;  4RMA A;  2PEA A;  4I6L B;  2G3Q B;  2KTF A;  3A33 B;  3ONS A;  3CF6 E;  1VCB A;  2MA9 B;  3ZUN A;  1UBI A;  3ZVV A;  3VXW A;  3A9K B;  2JZZ A;  1YX5 B;  2A5U A;  4KIK A;  3QAQ A;  3VH3 B;  2D3G A;  4AOF A;  4HCP B;  1H4R A;  2FCN A;  2NBW B;  4GB9 A;  1H8C A;  1J0G A;  2NCN A;  3L16 A;  4NJ7 A;  5KHO A;  2LWP A;  3ZW3 A;  3HIZ A;  4FHJ A;  1P1A A;  2BWE S;  3KUD B;  3PRM B;  3RCZ A;  3V61 A;  3PRP B;  1GJZ A;  2IO1 B;  1P9D U;  4FLH A;  1IPG A;  3PVL A;  1E90 A;  3Q3J A;  4HDQ A;  3ZLZ A;  4N9F 4;  3VTW A;  2ZEQ A;  5JH5 C;  4NQK E;  1P98 A;  2WDT B;  3KYC D;  2JF5 A;  3NHE B;  3QA8 A;  4DHJ D;  3M62 B;  3VVW B;  5AEK B;  2DAF A;  3OAW A;  2C9W B;  2BYV E;  4ASW C;  1WM2 A;  5L95 C;  2WYQ A;  2GBR A;  4K81 A;  1LM8 B;  2KTR A;  3S2A A;  4LJP B;  4FAD A;  1NDD A;  4M8M A;  4HPM B;  3D32 A;  2D2Q A;  2PE6 B;  2O2V A;  1GNU A;  2N1W A;  3VAW A;  1CMX B;  1WJU A;  4WJO A;  5D94 A;  5CHF A;  3RT3 B;  3DVG X;  2N9X A;  2KVR A;  1RFA A;  5D6J B;  4MGK E;  2DZK A;  4ZRJ A;  2J0M A;  4EFO A;  1WX7 A;  4MSM B;  1KM7 A;  3VTU A;  5JZE B;  2O6V A;  2PJH A;  1GUA B;  1ISN A;  2ZCB A;  3PZD A;  4NAW A;  3PSE B;  1V5T A;  2K39 A;  2LXC A;  2CS4 A;  2L0F A;  3HK0 A;  1BT0 A;  1YJ1 A;  3L10 B;  3R7Q A;  3ALB A;  5G55 A;  3QK0 A;  3KYD D;  4NJ6 A;  4URK A;  1WH3 A;  3IG3 A;  3PGE A;  1WZ3 A;  1WMH A;  2HTH A;  2ZZP B;  2GBK A;  1WY8 A;  2KFK A;  3UIP B;  4LDT B;  2K6D B;  3X0W A;  5E6O A;  4GMV A;  3C0R B;  4P7I A;  3BIN A;  4PS8 A;  2K8B A;  2LD9 A;  2MP2 B;  4RM9 A;  1VD2 A;  3L08 A;  4EEW A;  4K7W A;  1G6J A;  1OGW A;  3A1Q B;  4FUL A;  2JWZ A;  3NZU A;  1Q1O A;  2MBO A;  2N7D A;  1D3Z A;  2GBN A;  4HLE A;  2OJR A;  1V49 A;  2IO0 B;  4GIV A;  1IP9 A;  1WGY A;  4MJS A;  1V6E A;  1WJ4 A;  2AL3 A;  1OEY A;  2JUO A;  3DBH I;  4WAA A;  4B6W A;  5HKH A;  1V81 A;  2KN5 A;  3APC A;  3QC8 B;  2KDB A;  2N1V A;  2HE7 A;  3A9J B;  3KUZ A;  3R3M A;  1I35 A;  4NQL B;  5DPS A;  2WX0 A;  1E8X A;  4GSW A;  4IW0 A;  1ZW7 A;  4EZJ A;  1SE9 A;  3H7P B;  3PHX B;  4M0W B;  4BBN C;  2M4N A;  5BO4 B;  2ASQ A;  2LJ5 A;  1EF1 A;  2FNJ B;  2UYZ B;  3WAN A;  3ZO5 B;  4E71 A;  5C23 A;  2KLG A;  3ECI A;  3ZDM C;  1XT9 B;  4J6I A;  3WAL A;  1R4M I;  1WI0 A;  4IG7 B;  2JY6 A;  1WGG A;  1WJN A;  3OLM D;  4MDK E;  2J7Q B;  3K9P B;  4IM0 A;  1WF9 A;  1Y8R C;  1OTR B;  4G50 A;  5AZG A;  2KWV B;  2KC2 A;  3PS6 A;  3VTV A;  4HCN B;  2ZNV B;  3IHP C;  2KAN A;  3RUI B;  3ZNG C;  1C1Y B;  4YL8 A;  2V3S A;  2LAS A;  2LZ6 A;  2DZI A;  4W9C A;  4BKT A;  2DHZ A;  3ENE A;  4IM2 A;  1YD8 U;  1KJT A;  1WXA A;  1C3T A;  2XBB C;  4KZC A;  3VH4 B;  3R66 C;  1WXS A;  3QAR A;  4I6P A;  2FCQ A;  2REX A;  4X57 B;  2MWS B;  2JT4 B;  1E7V A;  4EZL A;  2LRU A;  3L0W B;  2AEH A;  4IM3 A;  2C7H A;  5DPW A;  2FID A;  2RPQ A;  4G11 A;  4GDK B;  1UD7 A;  3RYT A;  3APD A;  1MG8 A;  4W9I A;  1YIW A;  3H9D A;  3SHQ A;  2IO3 B;  3BY4 B;  3H1U A;  4M8N A;  4EUT A;  4II3 B;  1QZE A;  1WGH A;  1WM3 A;  3CST A;  4OVV A;  1SGH A;  4XC2 A;  3PPA A;  4JL9 A;  3VDZ A;  3B1L X;  3JW0 X;  3DVN U;  4W9H A;  3ZIM A;  2G4D B;  3AU5 A;  4MGI E;  2L7R A;  5LXH A;  3UGB B;  4WQO B;  4IUM B;  2NPT B;  2CU1 A;  4G3X B;  4KDL B;  4MGZ E;  1F9J A;  2NS5 A;  1S1Q B;  2K6Q A;  1OQY A;  2V1Y A;  3APF A;  2N4F A;  3RD2 A;  3WAO A;  3TBL D;  3B0A A;  2LVQ A;  3T8M A;  2L76 A;  3SD5 A;  1FXT B;  2R2Q A;  2L0T A;  2LVP A;  2DYB A;  4W9G A;  2DEN B;  3IFW B;  4KDI C;  3B08 A;  1EUV B;  2JXX A;  3WA0 A;  2GOW A;  5IAA C;  3M95 A;  1TZ1 A;  2RD0 A;  3KW5 B;  4ANX A;  2CHX A;  1WYW B;  4MEL A;  4PYU A;  5CTR C;  4FA6 A;  5JHB A;  3W1Y A;  2GBJ A;  3U30 A;  3QHT A;  2G45 B;  4WJQ A;  3L13 A;  3O65 B;  4GOC A;  2KDI A;  3PLV A;  4DHZ E;  3QQ8 B;  4TQ1 A;  2KQS A;  3JSV B;  4G0N B;  4DDI D;  4DHJ B;  3ZKJ C;  4IWQ A;  2KQ7 A;  4LJO B;  1Z2M A;  3WIM A;  3UQA A;  4MSQ B;  3HM6 X;  1RLF A;  3IVF A;  2QHO A;  4GN1 A;  1L2N A;  4AJW A;  1WGD A;  1TTN A;  1UH6 A;  1WXM A;  3A1Q A;  3DQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...