1WJ4A

Solution structure of the ubx domain of kiaa0794 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the UBX domain of KIAA0794 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
molecule keywords KIAA0794 protein
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj4A01
2ZNVC 4TV3A 3CSTA 2C7HA 3ZLZA 5KHQA 1P3QU 2OOBB 2D3GA 2PE9A 4WJPA 4LCDE 2O6VB 3B1LX 3DBSA 3GZNI 3WAOA 2REXA 4BBNC 2KWCA 2DYBA 2L8JA 3N30A 2KC2A 3ML8A 2KQSA 3DVNU 5D7GA 4ZRJA 1UZXB 3M95A 4JLCA 2IYDB 3W1YA 2KTRB 3M63B 4IC7B 4II3B 1WM3A 5DPRA 2PJHA 4IWPA 5D94A 4DWFA 1J0GA 3QQ8B 1GJZA 3A33B 3DQVA 1UH6A 3ONSA 3KVFB 4M8NA 4MEMA 3APCA 4N9F4 1UBIA 1EF1A 2FIDA 2K6DB 4GXBA 4TQ1A 2WWZA 4BKTA 5L95C 4BOZB 3V61A 1WXSA 4TQ0A 1Q5WB 4KIKA 2KX3A 2M1MA 3SDLC 1F9JA 3QA8A 2LRUA 2L3ZA 4P7IA 2NCNA 3QX1A 2C7NB 4EZJA 3WALA 1JRUA 3DVGX 2BKRB 1RAXA 2IBIB 4I6NB 1RLFA 4EOYA 2MCNB 1S1QB 3M3JA 3OLMD 3ZRFA 4A3OA 1I35A 2AL3A 4WJNA 1WF9A 2HE7A 1XT9B 2EMSA 3PZDA 4W9HA 3UINB 3UF8A 3CMMB 2Z0EB 4NNJB 4FULA 4DXAB 1WX8A 2RSUA 1GG3A 3H7PB 3WAMA 4MM3A 5C1ZA 2KOXA 3IVFA 3DBRI 2KZRA 2JF5A 3ZIMA 2LJ5A 4MGKE 1GNUA 2NBVB 5JHBA 3ZW3A 1G6JA 1KJTA 3TL5A 4NAWA 2KD0A 2AEHA 1NI2A 3APFA 1CMXB 2KK8A 2Z0DB 3L08A 1Q1OA 2LXCA 5EDSA 3AXCA 3L10B 4GSWA 1P98A 2N1VA 4IUMB 1H8CA 2FUHB 1WMHA 2JT4B 4K7UA 2GBMA 1QZEA 2MBOA 1Z2MA 3IG3A 1X1MA 3AI5A 3PVLA 2GOWA 2MW5A 5LXIB 3ZNZB 5CTRC 2V3SA 4CHKA 3PRPB 5DPTA 4EUTA 2KDBA 5E6NA 3V6CB 2K39A 4FLHA 2IZVB 1ZW7A 2ZPYA 3AU4A 2NS5A 3H1UA 4JL9A 1LM8B 2D2QA 1R4MI 3PT2B 5L83A 1WGGA 5CX3A 3ZRCA 2JRIB 5D2MB 4AWJA 1EF5A 2JZZA 2RR9A 3ZTDA 3JSVB 4LJOB 3MJWA 4KV2A 1WGHA 2KFKA 3HIZA 4GB9A 2LXAA 5HKHA 3RULA 4FA6A 3ZVVA 3PRZA 1WMHB 2JPHA 4AOFA 4NPNA 4AUQC 4GDKB 1WE6A 3BY4B 1E7UA 3P2BA 4LDTD 2BKFA 3I3TB 4W9CA 2FCNA 3PSEB 4GN1A 4JGHB 4W9KA 3ZTCA 1WXVA 3SU8X 3QCAA 2KHWB 3A9KB 3U8ZA 2K8BA 3VUWA 5JHAA 2PPHA 1WY8A 2L0FA 1GC7A 2LGYA 2MBBB 4EKUA 1WGRA 3TJPA 2FNJB 4WWNA 4CYEA 1YJ1A 4J6IA 3RZFA 2D07B 1KM7A 1WI0A 1WGDA 3LDZE 3VUXA 4BFRA 2KDIA 2HD5B 2HJ8A 5CHVC 2BGFA 2JRHA 2LVQA 2KLCA 2Z59B 5J17A 1HE8A 2FAZA 2J7QB 2N9EB 2I1KA 1E7VA 1LXDA 1VD2A 4MGIE 2WX0A 3VHTC 2KDFB 2ZPNA 5JH5C 2LZ6A 2M17A 3DVNV 3ECIA 2O6VA 4PS7A 1P0RA 3R3MA 4WJQA 2R2QA 3ZO5B 2ZZPB 4JQWC 2KMCA 4KDIC 4KZCA 2BWES 4KIKB 2B3AA 4F8CB 2GBNA 3L13A 4OVUA 2DZMA 5G55A 4RM8A 1ZGUB 3HK0A 1WX9A 2LI5A 2Y5BB 4MGYE 1PQSA 3RUIB 5D6JB 3VH3B 3ZNID 3ZNHB 4GDLA 2C5LC 2K1FA 2KJ6A 2PEAA 4K7SA 5C23A 4NQKE 2IO2B 4GOCA 4IM3A 4NJ7A 2LUEA 3KW5B 2CR5A 3ZDTA 2IY1B 1KOTA 2WDTB 4KDLB 4LJPB 3NY5A 3ML9A 5JZEB 1YD8U 2J0JA 2MLBA 2C7MB 3PPAA 1S3SG 4AP4C 2XK5A 2ZCBA 3MTNB 3H7PA 1YX5B 4HDOA 3PHXB 3KUDB 2A5UA 2JWZA 3RT3B 2CU1A 1TTNA 5DCNA 5LLIA 1MG8A 2KMAA 3KH0A 2WX1A 1Y8RC 2O2VB 4BKSA 3B08A 2L00B 5AZHA 3U7DA 2KDEB 3UQAA 3WAPA 1BT0A 2RGFA 3IHPC 2HTHA 4PS8A 5KHOA 4ZYNA 4KSKC 1V6EA 1TBEA 3EHVA 2LGDA 4DHZE 2JXXA 4NJ6A 1FXTB 1WGYA 2C60A 3ZDMC 3EC8A 4GDLB 2KFJA 4DHZB 2DAJA 2DYMA 2NBWB 5AEKB 1IYFA 2CS4A 1WZ3A 2N1WA 3NZSA 4HDQA 3JYUA 2KN5A 1WFYA 2AL6A 2L76A 2NPTB 4HK2A 2UWQA 2GBJA 2NR2A 3L16A 2FCQA 3HM6X 3B0AA 2FIFA 4NY0A 3QWZB 1E5WA 3N32A 3A9KA 4G3XB 1R4NI 4M8MA 3PRMB 3VTUA 5E6PA 1WRDB 4URKA 1E8ZA 2MA9B 2BWFA 3R7RA 2LD9A 2O2VA 3T8MA 4XZ4A 1U4AA 4ZRIA 1H4RA 4HPLB 2LASA 4F1SA 3ZUNA 3VTWA 2G4SA 4IM0A 3DBHI 5J2RA 1VCBA 3PLVA 4B95A 3BINA 2LWPA 4A20A 3Q3FA 4K7WA 2BYFA 4W9GA 1ZKHA 1WJUA 3DDCB 4MJSA 3VDZA 1WJ6A 3NZUA 5E6OA 2KNBA 1WIAA 3L0WB 2KJRA 4IM2A 2JVCA 4ICUA 5CHFA 2I1JA 3RCZA 4DHJB 3H7SA 3A9JB 4OVVA 2ZNVB 2V1YA 1C3TA 1EUVB 2K25A 3KYCD 3OJ3A 4K81A 4B9KA 1IPGA 3U30A 1OEYJ 3VAWA 2KTFA 2KFKB 4W9DA 1NBFC 4BKGA 1WM2A 1SE9A 4X57B 2D10A 4FADA 3APDA 1P9DU 4B6WA 4FBJB 1OTRB 1WYWB 3VUYA 4F7ZA 3HM3A 1WZ0A 2XK5B 3A1QA 2KX0A 2K8HA 2MSED 2MRPA 4FJVB 2JZ3B 4G0NB 2K8CA 2MBQA 3QHTA 3N3KB 5TR5A 4W9IA 3X0WA 4E3CA 2BF8B 3PV1A 2JY6A 2N9XA 3CF6E 3TMPB 2L05A 5IAAC 5AZFA 1EO6A 2BYVE 3IBEA 4WQOB 4E71A 4FN2A 4XC2A 1D3ZA 4GMVA 4EZLA 4IWQA 1M94A 3MHSD 4HLEA 4MDKE 4ZRKA 2NBUA 2CKHB 4II2B 2KLGA 2AWTA 4BBNF 1OGWA 4MSQB 3QK0A 4A3PA 3HHMA 1WR1A 4M0WB 4MJSB 4KVGB 1V49A 3EECA 1L2NA 2W9NA 3S2AA 2CHZA 4W9EA 1V5OA 2FCSA 3A4SC 3JSVA 1C1YB 1SIFA 4DDID 1V5TA 3JW0X 3JVZX 3V6EB 3ALBA 1UELA 2MBEA 5GMVA 4JIOU 3VQIA 1J19A 3L17A 3QAQA 1T0YA 1IP9A 1YX6B 2VRRB 3K9PB 4GIVA 4G50A 2JUOA 4NQLB 2O6VD 2KQ7A 4ANVA 2CHXA 3PHWB 1E8WA 4MELA 1SGHA 1WX7A 3DCGA 5DPSA 3RZWC 2N7EA 2GBRA 4PS3A 1RFAA 3CSFA 2KO3A 2R2OA 3AU5A 4MSMB 4CO7A 1LFDA 3V60A 4ANUA 2OJRA 3KYDD 1A5RA 2KC1A 3ZNGC 1P1AA 2G45B 3NS8A 4ASWC 2BPSA 3A9JA 4HWIB 1E90A 1OEYA 2MBHA 4WWOA 4NAWB 3UQBA 3QARA 3W1SA 2KANA 3C0RB 1L7YA 1WXMA 2KWUB 1KLVA 2EMTA 3NHEB 4XX5A 2ZEQA 4HVBA 5LXHA 2UYZB 1GC6A 1WH3A 4ANXA 1YQBA 2FCMA 2KWVB 2WYQA 3ZKJC 2KJHB 4E74A 2NPTA 3QC8B 4G11A 2K6QA 3PGEA 2IY0B 3PLUA 2M4NA 2IO1B 4YL8A 2DYOA 2ZCCA 3KUZA 1V86A 4BOSC 4GU2A 2GBKA 2KTRA 4FHJA 4HCNB 4BVUC 4FHKA 1Q0WB 4DK5A 1WR6E 1I42A 1V80A 2D11A 4HCPB 3VH4B 3VTVA 3K9OB 2LRWA 4IWOA 3R66C 1V2YA 3Q3JA 5IA7A 2ASQA 4IG7B 1UBQA 2N7DA 3T9LA 2G4DB 2IO3B 3WANA 3R7QA 4EZKA 2DAFA 4PYUA 3PTFC 4EFOA 3X23A 1WJ4A 4WWPA 3D32A 4I6PA 4DDGD 4K1RB 2XBBC 4BKSD 1E8XA 3OJ4B 3A1QB 3DPDA 4WAAA 3AULA 2M0XA 1UD7A 3SD5A 1TGZB 2DZKA 2IO0B 2RPQA 4LDTB 2KXJA 1WJNA 4FJYA 3VXWA 3LJ3A 4DBGA 2J0MA 2KVRA 3ENEA 2ZVNA 2BYEA 2PE6B 2M8SA 3H6NA 3O65B 4AJYB 1WE7A 2ZVOA 3A4RA 3TBLD 4HJKA 3TCAA 3PREA 2MP2A 2N9PC 4TKNA 2LVPA 2CHWA 3EFUA 2MWSB 4I6LB 4MGZE 2QHOA 3W1SC 3PS6A 4GGQA 3RYTA 1AARA 3RD2A 4IW0A 4ANWA 2LGXA 1XQQA 1YIWA 4RMAA 1RRBA 4EEWA 1NDDA 1OQYA 3DBLI 2RD0A 3IFWB 1V81A 3L54A 3OAWA 3TIXA 3QIJA 4MH0E 5CHWA 5FR6A 2J0KA 4KZ0A 4W9LA 1J8CA 4AJWA 1UGMA 2DENB 2N4FA 3WA0A 2DHZA 2AYOB 3DOWA 4WJOA 5AZGA 2ZJDA 3WIMA 1Z5SB 4W9JA 3UGBB 3VVWB 4DHJD 4GDKA 3UIPB 5BO4B 4W9FA 2G3QB 3KUCB 5G2NA 1LQBA 2DZIA 4PYZA 1V9JA 1GUAB 4ICVA 1WXAA 2XEWA 2L7RA 4TUUA 3M62B 2YVCA 4RM9A 4FJZA 1K8RB 1TZ1A 4HPMB 2C9WB 2DZJA 4HXDA 3DVGY 3V62A 2GMIC 3QJZA 1XD3B 2A4ZA 3VFKA 3SHQA 3H9DA 3NOBA 4KSLC 2L0TA 2V4LA 1ISNA 2EKEC 5J18A 2MQJA 1E8YA 2MX2A 2NVUI 2YLMA 5DPWA 3GOEA 3UIOB 2MP2B 2KKCA 2DX5B 2LVOA 4ZDVA
chains in the Genus database with same CATH superfamily
1QOAA 2IGGA 1R7SA 1P3QU 2D3GA 3WAOA 2O6VB 3GZNI 4BBNC 1I4PA 2DYBA 1MHHE 2L8JA 3N30A 3ML8A 2K5PA 2HDEA 3GB1A 3M95A 1CK1A 5DPRA 2PJHA 4IWPA 4DWFA 3DQVA 4MEMA 4N9F4 3WCQA 2K6DB 3Q3NC 4GXBA 4TQ1A 1WXSA 4KIKA 1F9JA 3Q6BA 2LRUA 2G1EA 1C4CA 4HJGE 1T0QC 1K52A 2LHDA 4EZJA 2LUMA 1S1QB 3AE3B 3OLMD 4HPPA 4WJNA 1K51A 2IGHA 2Y3AA 3R2TA 1GB4A 5JHBA 4RGOS 1KJTA 3TL5A 4NAWA 2AEHA 1FRRA 2KK8A 2Z0DB 1D6EC 2LXCA 3FKYA 3L10B 1WMHA 2JT4B 2GBMA 3AI5A 2MW5A 5LXIB 3ZNZB 4YWGG 2KDBA 2TSSA 1HTQA 2PMVA 2PVOD 1VDVA 4FLHA 4P16A 2ZPYA 3AU4A 3AEEB 1L6VA 3DHHC 4M0WA 5CX3A 5EE1A 2IJ0A 2JRIB 1EF5A 4JE3B 1OFFA 4C4VB 3MJWA 4ZRQA 4KV2A 1HA5A 2KFKA 3HIZA 4LNFA 4HEA1 1WMHB 3AE5B 2QEJC 4AUQC 4GDKB 3BY4B 4LDTD 3P2BA 2FCNA 4GN1A 1AW7A 4JGHB 3V3XA 4W9KA 5C2TB 2DLBA 3QCAA 2KHWB 3T3NA 1WY8A 2KT7A 4RH6A 4YT0B 2LGYA 4D2KA 3DBHB 2Z8LA 4WWNA 2YEPB 3VUXA 3Q14C 1TZOA 1F1HA 1HE8A 2J7QB 4MGIE 2WX0A 4A9AA 2ZZPB 4KZCA 4KIKB 4F8CB 1J7AA 2DZMA 1EWCA 4RM8A 3RUIB 1TY0A 4MGYE 1F77A 4GDLA 4XE0A 1LGRA 2YEPF 4HRSA 4NQKE 4GOCA 1KOTA 4KDLB 3NY5A 4AP4C 2XK5A 2WXOA 3MTNB 4ZRPA 1MJDA 2KQ4X 4US9A 3PHXB 4LTUA 5I4DA 2A5UA 3I5JC 5DCNA 2VZKD 1D5ZC 2KMAA 1FD6A 3AE4B 1J7CA 3E9SA 3RNBC 3WAPA 1BT0A 4P1BC 2HTHA 3P4SB 4ZYNA 4KSKC 2H89B 3ZQ4A 4US8A 4EE2A 2JXXA 5IP4D 3W9CB 2KFJA 1JMLA 3ETRA 3R8BA 5H8YE 3Q3OC 4HDQA 4HK2A 1WXQA 1QOBA 3L16A 3PRMB 3SFEB 3URYA 1WRDB 4B0MA 2BWFA 3KWLA 4OW0A 2LD9A 4XZ4A 1U4AA 5HG2A 1TJEA 4HPLB 3PZ8A 5IN7A 2WXIA 4JWSC 2LWPA 4A20A 1E9MA 3B2GA 3VDZA 1WJ6A 2KNBA 1UNSA 2SEBD 4JPSA 4DHJB 4OVVA 2ZNVB 2V1YA 2WXFA 4K81A 1IPGA 3MFGA 4FXCA 4NJCA 3U30A 1ZXHA 2AQ3B 3APDA 3NG0A 1DGJA 2V0GA 5BMHA 3MC0B 4FBJB 1WYWB 1TS4A 1ENFA 1WZ0A 2RDBC 2K8HA 4FJVB 2BVCA 3N3KB 4E3CA 3LXFA 1FM0D 1GB1A 4DQOC 2L05A 2V9HA 4KGSA 1FO4A 2W55A 4XC2A 2J4XA 1M94A 3MHSD 4HLEA 2BQQA 4II2B 2AWTA 2IPKD 1OGWA 1WR1A 1PDXA 1FFVA 1V5OA 1V5TA 3JW0X 3V6EB 3TEWA 1UELA 2MBEA 5GMVA 2RDGA 3VQIA 3L17A 2R61A 2VRRB 2WXKA 4NQLB 1SE2A 2MJEA 2O6VD 4G50A 1V97A 4M02A 3AE9B 1WX7A 1RFAA 4HKQA 1DOIA 1MFWA 2BS3B 2INPE 1FNWA 3NS8A 1IGCA 4ASWC 1E90A 3C0RB 1UGJA 1JCKB 1L7YA 5FKAC 2EMTA 1XF5L 1GC6A 2LMCA 3HVDA 4E74A 1FNUA 2K6QA 4G11A 3PGEA 2IY0B 2M4NA 3GE8C 3KUZA 1V86A 5GXGB 4GU2A 1SE4A 4IDIA 4HCNB 2CJNA 2AX5A 1WR6E 1I42A 1V80A 3VTVA 1BUIC 4KKJA 4YXDB 3Q3JA 2ASQA 3I9V1 1SE3A 1VRAB 4RGNA 1WJ4A 4K1RB 4BKSD 3DPDA 2JXTA 3ZJTA 1UD7A 1QT9A 1D5MC 3H8HA 1FRDA 1TS5A 1EU4A 1SSNA 1YQ4B 4DBGA 2ZVNA 2PE6B 2WXJA 2M8SA 3AN1A 1PGAA 3O65B 4AJYB 2MP2A 4TKNA 3EFUA 3PS6A 4GGQA 3RYTA 3AEDB 4L1BA 4RMAA 2MHJA 4ZHOA 3L54A 3N1XC 2WDVB 1KRHA 3TSSA 1KTKA 2DENB 2DHZA 2HJ1A 3KQ4A 4WJOA 1Z5SB 1L0YB 3UGBB 3VVWB 3UIPB 3KUCB 5G2NA 2PIAA 4ICVA 3M62B 3MP9A 4FJZA 3Q8FA 4HXDA 2OHFA 4N58A 3QJZA 1XD3B 2A4ZA 3NUHB 3VFKA 2WXLA 2I38A 1JW9D 1QILA 2L0TA 2EKEC 5J18A 5DPWA 3GOEA 5MPOA 1UF0A 1XQQA 1NI2A 2ZNVC 3CSTA 5FK9C 1ZE3D 1HQRD 2OOBB 3RI7C 3B1LX 3DBSA 2KWCA 3NVWA 4ZRJA 1ET6A 1WM3A 3ZJUA 3KVFB 4M8NA 3AE8B 1XLQA 4RNAA 3IT6B 3MC9A 3V61A 2PKOA 4TQ0A 2KX3A 2M1MA 3QA8A 3TEXA 2NCNA 2FBWB 2C7NB 3WALA 1NI3A 3DVGX 1I4RA 1MG4A 2AL3A 3SR6A 3U52E 2EMSA 3PZDA 1UWMA 3UF8A 4NNJB 4DXAB 2RSUA 1GG3A 1P7EA 2PW9A 3H7PB 2AQ2B 5BMGA 3IVFA 3DBRI 3BVGA 2KZRA 2CJOA 4ZHPA 2ACZB 5C3JB 2N9KA 3APFA 5HHDG 4KGTA 1P98A 2N1VA 4IUMB 1H8CA 2MBOA 4RGTA 1SXTA 1ZDVA 4WWMA 1N61A 5DPTA 2WXNA 4ARCA 3OG5A 2QILA 2K39A 1ESFA 2PLPA 4OHJA 1B9RA 1XCTL 2D2QA 3PT2B 2W3SA 1FFUA 2JZZA 3IAS1 3RMKC 4YTNB 2WS3B 4ZYSA 4GB9A 3DBLB 3LYYA 4A6QA 1WE6A 1Y56A 1I4HA 3ZTCA 2VZKB 1WXVA 3GS2A 3A9KB 2KAJA 2JSVX 1GC7A 2H88B 2MBBB 3Q8EA 2FNJB 1YJ1A 4J6IA 1KM7A 4BFRA 1DYQA 5CHVC 1YJIA 2LVQA 5J17A 2N9EB 3MHZA 2ZPNA 2LZ6A 2M17A 4WJQA 2O6VA 3ABVB 2R2QA 3ZO5B 2KMCA 4KDIC 2BWES 3N1YC 2GBNA 3P63A 1ZGUB 2LI5A 3ZNID 3FC4A 2C5LC 4K7SA 1N62A 5JXVA 3J9CA 4IM3A 1WRIA 3P4QB 1Q10A 4LJPB 3AMZA 3PPAA 4S0RA 1KFYB 1YX5B 4LNKA 3GP7A 1F2RI 2D3CA 5LLIA 1MG8A 1Y8RC 3B08A 3UQAA 1V1OA 5KHOA 1V6EA 1TBEA 1ET9A 4DHZE 3ZDMC 3EC8A 3AE6B 2DAJA 2DYMA 2NBWB 1IYFA 3DWMA 1UWXA 4XYCA 2NPTB 2AL6A 3B0AA 2FIFA 2L52A 1AWDA 3RNCC 3IXSA 5E6PA 5FR3A 2MA9B 2WNMA 3R7RA 2D3AA 3VRAB 2O2VA 3AECB 4KX6B 4F1SA 3ZUNA 3VTWA 2ONQA 3DBHI 4WH4A 3O13A 3PLVA 3SEBA 4B95A 3BINA 4K7WA 3RNGC 1ZKHA 4MJSA 4TSSA 4WIPA 1WIAA 2I1JA 3RCZA 2K25A 3KYCD 1HTOA 1OEYJ 2KVZA 4W9DA 2QJLA 4BKGA 1SE9A 4FADA 1JWSD 4B6WA 1OTRB 3VUYA 4F7ZA 3AV8A 3A1QA 2LFIA 2JZ3B 2WXGA 3AE1B 2MBQA 3W5VB 5TR5A 2M56B 1YN3A 2JWUA 2WU2B 2JY6A 3TMPB 5AZFA 3IBEA 4E71A 3Q8AA 4GMVA 4M00A 1STEA 3SFDB 4DXFA 3KLSX 4MSQB 1DOYA 3Q3MC 1ACCA 1L2NA 2W9NA 3S2AA 2Y5PA 1C1YB 3JVZX 3ZXRA 1HZ6A 3QAQA 1YX6B 4XGAB 4GIVA 2JUOA 2KQ7A 4ANVA 2CHXA 3PHWB 1E8WA 1SGHA 3DCGA 2GBRA 3HRDD 2WXPA 3CSFA 4MH8A 2IDYA 4MSMB 1QKZA 1TIFA 4ANUA 1A5RA 4XWTA 1EU3A 2QSDA 3ZNGC 2G45B 3L4PA 4HWIB 2MBHA 4NAWB 3UQBA 3QARA 2KANA 2KWUB 4XX5A 2ZEQA 3Q2AC 1P7FA 1WH3A 4ANXA 1YQBA 2X38A 2GLSA 3QC8B 4PK1A 2IO1B 4PT5A 1RYJA 1VZ6A 2KTRA 4FHJA 4JWUC 4DK5A 3RNAC 2D11A 3VH4B 2K9XA 1PFDA 3K9OB 3R66C 3W2DA 5IA7A 2PVGC 4IG7B 4C4VA 1UBQA 3T9LA 1T0RC 2G4DB 1MVKA 2OEDA 4A8XC 4EZKA 5H92C 4XDCA 1XLNA 3D32A 2XBBC 1E8XA 4MT5A 3A1QB 3AULA 2M0XA 2X8XX 3BWUD 3SD5A 3W5UB 2E6XA 2RPQA 2MJ3A 4FJYA 3LJ3A 2J0MA 2KVRA 1T0SC 2BYEA 3A4RA 3TCAA 2CHWA 2MWSB 4MGZE 2QHOA 4MM3B 5AUKA 2NMQA 4EEWA 4R3DA 1NEKB 2RD0A 2QIEB 3QIJA 5CHWA 5FR6A 4KZ0A 3DOWA 2KDMA 2DNFA 4W9JA 4RCOA 3NRZA 4W9FA 1V1PA 1LQBA 4DXGA 2DZIA 1JALA 1GUAB 1WXAA 2XEWA 4TUUA 3C19A 4RM9A 2I2YA 4YSXB 2Q5WD 1FEHA 3V62A 1JWAD 1K53A 3I63C 2V4LA 4ZOHC 3AEGB 2KKCA 2LVOA 1R4MB 2ICIA 3ZLZA 5KHQA 2PE9A 4WJPA 1VLBA 2REXA 2GI9A 2KC2A 2KQSA 1SIJA 4M01A 4JLCA 4BZAA 2KTRB 1XLOA 3M63B 4II3B 5D94A 1J0GA 3QQ8B 3A33B 1UH6A 3ONSA 3APCA 1L5PA 1TKYA 4BKTA 2W82A 2SAKA 1C4PA 1KLUD 3EUB2 3R2IA 3SDLC 4P7IA 3QX1A 1JRUA 1RAXA 1FCLA 4I6NB 1RLFA 1A70A 2MCNB 3M3JA 4A3OA 1TKEA 1WF9A 2Z0EB 4FULA 1WX8A 5C1ZA 4MM3A 2NTTA 2VH1A 1L4DB 2IGDA 4REZA 3FILB 1HEZE 4MGKE 1GNUA 2NBVB 2J42A 5G5GA 1G6JA 3U2SC 3L08A 3AXCA 1C76A 2VH2A 4YSZB 2FUHB 4K7UA 4BAXA 1QZEA 2KN4A 4RFBA 1FIQA 1Z2MA 1X1MA 3IG3A 1FCCC 3NS1A 1HZ5A 3PVLA 2V3SA 4EUTA 3V6CB 1YNTE 3NVYA 2QDFA 4LNOA 1WWTA 2LEKA 2BW2A 3H1UA 4JL9A 4K3BA 3RFZB 1DOXA 2W54A 5D2MB 4AWJA 2RR9A 2J53A 3JSVB 4LJOB 2OJWA 3N9YC 5HKHA 1WSPA 3RULA 3PRZA 2JPHA 4HROA 3DWGC 4MACA 4W9CA 1E7UA 3I3TB 3Q8BA 4XWWA 3DHIC 3U8ZA 5JHAA 1NENB 2L0FA 4RF0A 2BS2B 3ZGZA 4EKUA 3TJPA 3RZFA 2D07B 1WI0A 2KDIA 4P6VF 4C56C 1SJED 2HD5B 2HJ8A 2JRHA 2FAZA 2I1KA 1VD2A 1YQ3B 1YMHE 2KDFB 3BVMA 4PS7A 3ECIA 3R3MA 4WQMA 4JQWC 3BYTB 1AN8A 3DBRB 5EE0A 1WX9A 2Y5BB 4WURA 3ZNHB 2KJ6A 4ITKA 3IT4B 3NVZA 1MI0A 2W3RA 1SBBB 2CR5A 3ZDTA 2IY1B 3FILA 2WLBA 4ZDVA 1YD8U 4B0EA 4L2YA 1S3SG 2KYWA 1PUTA 4HDOA 5BYSA 1L4ZB 1IUEA 2CU1A 1TTNA 4TMAB 3FAHA 2L00B 2AQ1B 2RGFA 4PS8A 1RFKA 3EHVA 2BT6A 2N7JA 2C60A 3AE7B 5T8IA 4GDLB 4DHZB 3GZNB 5AEKB 3Q8CA 2CS4A 2KN5A 1WFYA 2L76A 4NZLB 2UWQA 2NR2A 3HM6X 1KH0A 1E5WA 3N32A 2HTME 1R4NI 4M8MA 2J52A 3RN9C 3VTUA 4URKA 4KKIA 4IOIE 4ZRIA 3BK1A 1T6BX 3TUOA 1RM6C 3Q3FA 4W9GA 3EGRA 1J7BA 3DDCB 3NZ3A 5E6OA 1FPYA 4IM2A 2JVCA 5CHFA 4N59A 2V3PA 3A9JB 3P1MA 3OJ3A 1V8CA 2MH7A 3RNFC 1NBFC 1WM2A 4X57B 2V3NA 2D10A 1P9DU 4LNIA 3HM3A 2XK5B 1FXIA 2MRPA 2K8CA 3BK2A 1TY2A 3QHTA 1IGDA 1BXTA 1N6ZA 2BF8B 3PV1A 3CF6E 1VR9A 2BYVE 1D3ZA 4WQOB 4FN2A 4EZLA 4IWQA 3LB8C 5E6JA 2NBUA 2CKHB 1MHXA 3EA6A 1JROA 1T3QA 3HHMA 4M0WB 4MJSB 4KVGB 2G9HD 4W9EA 4DDID 3JSVA 1SIFA 2BB6A 3BZDB 1VJKA 4JIOU 1J19A 1T0YA 2INCC 5IKCM 4CQNA 2LGIA 2N7EA 4PS3A 4YTMB 1E6EB 1C9FA 1LFDA 3V60A 2OJRA 3CWIA 1P1AA 5BMIA 2BBCA 3A9JA 3NHEB 5LXHA 2UYZB 1C78A 2NTSA 2WYQA 3ZKJC 1HXYD 2JYTA 2NPTA 2ZW1A 1ZP0B 2INNE 3V05A 1SF0A 2DYOA 2ZCCA 4RF1A 2GBKA 4BVUC 5D3IB 1RWSA 3P4RB 3B9JA 2INDC 4HCPB 2V4IB 5EE9A 4IWOA 1V2YA 2GRIA 2Y5CA 3WANA 2DAFA 4EFOA 4DDGD 1YJJA 4LNNA 4WAAA 3CIRB 1ZPSA 1TGZB 2DZKA 2KACA 2B76B 2LHEA 3GE3C 4AS1A 1T5XD 4LDTB 2KXJA 1WJNA 3KWVA 4ACFA 2GB1A 1WE7A 2ZVOA 4NAMA 3TBLD 4HJKA 3PREA 2MEKA 2N9PC 2L1AA 3VR8B 3RPFC 3W1SC 3RD2A 2LGXA 1YIWA 2BTEA 1RRBA 2FUG1 1B1ZA 3DBLI 1OQYA 2D5GA 4OZBA 4H2AA 4W9LA 1C4AA 1AYFA 2ZW0A 2N4FA 2JU6X 3WIMA 2WU5B 4DHJD 4GDKA 1CJEA 5BO4B 1F52A 4PYZA 2L7RA 4USAA 2ON8A 4A90A 1TZ1A 4HPMB 2C9WB 3DVGY 1XO3A 4J3OD 4XDDA 4KSLC 3VRBB 3PO0A 1ISNA 1E8YA 2YLMA 2NVUI 3NVVA 2WDRB 4TV3A 3ZYYX 1GPXA 2C7HA 1E7PB 4LCDE 3DVNU 3VR9B 5D7GA 3AH7A 1UZXB 4S17A 3W1YA 2IYDB 2JX5A 4IC7B 1GJZA 2RPVA 1L0VB 1UBIA 1EF1A 2FIDA 2WWZA 3UI3A 5L95C 4BOZB 1OQRA 1Q5WB 1YOVB 2L3ZA 1KLGD 2BKRB 2IBIB 3AEFB 4EOYA 3ZRFA 1I35A 2QMTA 4N6EB 2HE7A 1XT9B 4W9HA 3UINB 3CMMB 3WAMA 2D3BA 2KOXA 2JF5A 3ZIMA 2KMMA 2LJ5A 1QF6A 3AE2B 4QAYA 3MC8A 3ZW3A 1I4QA 2KD0A 1QQRA 1SB3C 1CMXB 1Q1OA 5EDSA 4C7YA 1E10A 3DHGC 4GSWA 2BYTA 1ZUD2 1YN5A 5HFYA 4K3CA 2GOWA 5CTRC 4CHKA 3PRPB 5E6NA 3TEYA 4UDUC 2EELA 1SJHD 2IZVB 1ZW7A 2NS5A 5G5HA 4C80A 1TT5B 2WP9B 1LM8B 1R4MI 5L83A 1WGGA 3ZRCA 2L83A 3ZTDA 1PGXA 1WGHA 2LXAA 4FA6A 2K3UA 3ZVVA 4AOFA 1I4GA 4NPNA 1N60A 1N5XA 2BKFA 3PSEB 3U4EG 1F2RC 3SU8X 1QLBB 2K8BA 3VUWA 2PPHA 2M19A 1WGRA 4CYEA 3RNEC 1WGDA 3LDZE 1OQQA 2BGFA 2KLCA 2Z59B 1E7VA 1LXDA 3B2FA 3VHTC 1CQVA 3DVNV 5JH5C 1P0RA 2B3AA 5D3DA 3L13A 4OVUA 1JRPA 5G55A 2XNAC 3HK0A 1PQSA 5D6JB 3VH3B 2K1FA 1JQ4A 2PEAA 1LO5D 1C77A 4WAFA 5C23A 2IO2B 4NJ7A 2LUEA 3KW5B 2WDTB 3ML9A 2E3TA 5JZEB 2MLBA 3HUIA 2J0JA 2C7MB 1F0ZA 2JQRB 2ZCBA 3H7PA 3KUDB 2JWZA 3RT3B 1XLPA 4LLGM 5IO9A 3KH0A 2WX1A 2O2VB 4BKSA 5AZHA 3U7DA 2KDEB 3IHPC 1TKGA 1E0ZA 2LGDA 4NJ6A 1FXTB 1WGYA 1GOZA 1ZDXA 1CZPA 3NZSA 1WZ3A 1ZXIA 2N0SB 2N1WA 3JYUA 3U7ZA 2GBJA 1NVID 2FCQA 4NY0A 3QWZB 3A9KA 4G3XB 1E8ZA 1PYWD 3AM9A 4O1NA 3ZJVA 4YTPB 3ZXVA 3T8MA 1H4RA 4C00A 2LASA 2G4SA 2BS4B 4IM0A 1IBXB 1TS3A 1VCBA 5J2RA 4KGRA 1XEEA 2DWQA 3BIID 2BYFA 1WJUA 3NZUA 3AEBB 3MJ5A 1K50A 2KJRA 3L0WB 2L32A 4ICUA 2N9LA 3H7SA 3AEAB 1C3TA 1EUVB 4B9KA 3VAWA 2KTFA 2KFKB 3EFCA 2K22A 3T3OA 2WXHA 1VZ8A 2KX0A 2MSED 4G0NB 1L6UA 3BVZA 3IAM1 1M4VA 1ZOYB 4W9IA 3X0WA 2JYEA 2N9XA 2M0AA 5IAAC 4AQ7A 1EO6A 2BB5A 3AB5A 2QC8A 1FMAD 5TSSA 4MDKE 1TS2A 4ZRKA 1ROEA 2KLGA 4BBNF 1NYRA 3QK0A 4A3PA 1V49A 2FE8A 3EECA 2CHZA 2FCSA 2WGSA 3A4SC 3OWEB 2MJDA 2WXRA 2XN9C 3ALBA 2EKIA 4RGMA 1R4NB 3HVZA 1IP9A 3K9PB 4IKGA 1V1PB 2PTLA 4MELA 5DPSA 1EM7A 3RZWC 3P4PB 2DBYA 2KO3A 2R2OA 3AU5A 5HI1A 5EE3A 4CO7A 1JWBD 3KYDD 1D4BA 1FXAA 2KC1A 4LK0M 5AUIA 2BPSA 1N5WA 1OEYA 1QOFA 4WWOA 2WXQA 3C8YA 1JWMD 3W1SA 1IBXA 1WXMA 1KLVA 4HVBA 2FCMA 2KWVB 2KJHB 3N20C 3TEZA 3PLUA 2RDHA 4YL8A 4BOSC 1MPEA 1I4XA 4FHKA 4Q2JA 1Q0WB 2QCZA 3N1ZC 1UUPA 4C7ZA 2LRWA 1JWUD 1EWYC 2N7DA 4L23A 2IO3B 3R7QA 4PYUA 3PTFC 2KWDA 3X23A 4WWPA 2CU3A 4I6PA 1XXGA 3OJ4B 2IO0B 4ARIA 3VXWA 3ENEA 2WHIA 1WGKA 3H6NA 3PZ7A 1PGBA 5BYRA 2LVPA 3P42A 4I6LB 2JZPA 1AARA 1XCQL 1NYQA 4IW0A 4P1CC 4ANWA 1WYGA 2LGSA 1D5XC 4OZAA 1BMLC 2K0PA 1NDDA 3IFWB 1SEBD 1V81A 3E56A 3OAWA 3TIXA 1VZ7A 1QOGA 2WXMA 4GLSC 4JX1C 4MH0E 2J0KA 1J8CA 4A55A 4AJWA 4YSYB 1UGMA 5BYQA 3WA0A 2AYOB 2UU7A 5AZGA 2LJIA 1FNVA 2ZJDA 1C79A 2G3QB 4OZCA 1V9JA 2WDQB 1I7HA 3Q69A 3BYYB 2YVCA 3NJTA 1K8RB 2RMMA 5IOIA 1L0XB 2DZJA 2GMIC 3I57A 3SHQA 3H9DA 1YN4A 1GAQB 4HKZE 2WQYB 2MQJA 5LNK1 1TYGB 2MX2A 1KF6B 3UIOB 2MP2B 3NOBA 2DX5B 4OVZA 1N63A
chains in the Genus database with same CATH topology
2ZNVC 4TV3A 3CSTA 2C7HA 3ZLZA 5KHQA 1P3QU 2OOBB 2D3GA 2PE9A 4WJPA 4LCDE 2O6VB 3B1LX 3DBSA 3GZNI 3WAOA 2REXA 4BBNC 2KWCA 2DYBA 2L8JA 3N30A 2KC2A 3ML8A 2KQSA 3DVNU 5D7GA 4ZRJA 1UZXB 3M95A 4JLCA 2IYDB 3W1YA 2KTRB 3M63B 4IC7B 4II3B 1WM3A 5DPRA 2PJHA 4IWPA 5D94A 4DWFA 1J0GA 3QQ8B 1GJZA 3A33B 3DQVA 1UH6A 3ONSA 3KVFB 4M8NA 4MEMA 3APCA 4N9F4 1UBIA 1EF1A 2FIDA 2K6DB 4GXBA 4TQ1A 2WWZA 4BKTA 5L95C 4BOZB 3V61A 1WXSA 4TQ0A 1Q5WB 4KIKA 2KX3A 2M1MA 3SDLC 1F9JA 3QA8A 2LRUA 2L3ZA 4P7IA 2NCNA 3QX1A 2C7NB 4EZJA 3WALA 1JRUA 3DVGX 2BKRB 1RAXA 2IBIB 4I6NB 1RLFA 4EOYA 2MCNB 1S1QB 3M3JA 3OLMD 3ZRFA 4A3OA 1I35A 2AL3A 4WJNA 1WF9A 2HE7A 1XT9B 2EMSA 3PZDA 4W9HA 3UINB 3UF8A 3CMMB 2Z0EB 4NNJB 4FULA 4DXAB 1WX8A 2RSUA 1GG3A 3H7PB 3WAMA 4MM3A 5C1ZA 2KOXA 3IVFA 3DBRI 2KZRA 2JF5A 3ZIMA 2LJ5A 4MGKE 1GNUA 2NBVB 5JHBA 3ZW3A 1G6JA 1KJTA 3TL5A 4NAWA 2KD0A 2AEHA 1NI2A 3APFA 1CMXB 2KK8A 2Z0DB 3L08A 1Q1OA 2LXCA 5EDSA 3AXCA 3L10B 4GSWA 1P98A 2N1VA 4IUMB 1H8CA 2FUHB 1WMHA 2JT4B 4K7UA 2GBMA 1QZEA 2MBOA 1Z2MA 3IG3A 1X1MA 3AI5A 3PVLA 2GOWA 2MW5A 5LXIB 3ZNZB 5CTRC 2V3SA 4CHKA 3PRPB 5DPTA 4EUTA 2KDBA 5E6NA 3V6CB 2K39A 4FLHA 2IZVB 1ZW7A 2ZPYA 3AU4A 2NS5A 3H1UA 4JL9A 1LM8B 2D2QA 1R4MI 3PT2B 5L83A 1WGGA 5CX3A 3ZRCA 2JRIB 5D2MB 4AWJA 1EF5A 2JZZA 2RR9A 3ZTDA 3JSVB 4LJOB 3MJWA 4KV2A 1WGHA 2KFKA 3HIZA 4GB9A 2LXAA 5HKHA 3RULA 4FA6A 3ZVVA 3PRZA 1WMHB 2JPHA 4AOFA 4NPNA 4AUQC 4GDKB 1WE6A 3BY4B 1E7UA 3P2BA 4LDTD 2BKFA 3I3TB 4W9CA 2FCNA 3PSEB 4GN1A 4JGHB 4W9KA 3ZTCA 1WXVA 3SU8X 3QCAA 2KHWB 3A9KB 3U8ZA 2K8BA 3VUWA 5JHAA 2PPHA 1WY8A 2L0FA 1GC7A 2LGYA 2MBBB 4EKUA 1WGRA 3TJPA 2FNJB 4WWNA 4CYEA 1YJ1A 4J6IA 3RZFA 2D07B 1KM7A 1WI0A 1WGDA 3LDZE 3VUXA 4BFRA 2KDIA 2HD5B 2HJ8A 5CHVC 2BGFA 2JRHA 2LVQA 2KLCA 2Z59B 5J17A 1HE8A 2FAZA 2J7QB 2N9EB 2I1KA 1E7VA 1LXDA 1VD2A 4MGIE 2WX0A 3VHTC 2KDFB 2ZPNA 5JH5C 2LZ6A 2M17A 3DVNV 3ECIA 2O6VA 4PS7A 1P0RA 3R3MA 4WJQA 2R2QA 3ZO5B 2ZZPB 4JQWC 2KMCA 4KDIC 4KZCA 2BWES 4KIKB 2B3AA 4F8CB 2GBNA 3L13A 4OVUA 2DZMA 5G55A 4RM8A 1ZGUB 3HK0A 1WX9A 2LI5A 2Y5BB 4MGYE 1PQSA 3RUIB 5D6JB 3VH3B 3ZNID 3ZNHB 4GDLA 2C5LC 2K1FA 2KJ6A 2PEAA 4K7SA 5C23A 4NQKE 2IO2B 4GOCA 4IM3A 4NJ7A 2LUEA 3KW5B 2CR5A 3ZDTA 2IY1B 1KOTA 2WDTB 4KDLB 4LJPB 3NY5A 3ML9A 5JZEB 1YD8U 2J0JA 2MLBA 2C7MB 3PPAA 1S3SG 4AP4C 2XK5A 2ZCBA 3MTNB 3H7PA 1YX5B 4HDOA 3PHXB 3KUDB 2A5UA 2JWZA 3RT3B 2CU1A 1TTNA 5DCNA 5LLIA 1MG8A 2KMAA 3KH0A 2WX1A 1Y8RC 2O2VB 4BKSA 3B08A 2L00B 5AZHA 3U7DA 2KDEB 3UQAA 3WAPA 1BT0A 2RGFA 3IHPC 2HTHA 4PS8A 5KHOA 4ZYNA 4KSKC 1V6EA 1TBEA 3EHVA 2LGDA 4DHZE 2JXXA 4NJ6A 1FXTB 1WGYA 2C60A 3ZDMC 3EC8A 4GDLB 2KFJA 4DHZB 2DAJA 2DYMA 2NBWB 5AEKB 1IYFA 2CS4A 1WZ3A 2N1WA 3NZSA 4HDQA 3JYUA 2KN5A 1WFYA 2AL6A 2L76A 2NPTB 4HK2A 2UWQA 2GBJA 2NR2A 3L16A 2FCQA 3HM6X 3B0AA 2FIFA 4NY0A 3QWZB 1E5WA 3N32A 3A9KA 4G3XB 1R4NI 4M8MA 3PRMB 3VTUA 5E6PA 1WRDB 4URKA 1E8ZA 2MA9B 2BWFA 3R7RA 2LD9A 2O2VA 3T8MA 4XZ4A 1U4AA 4ZRIA 1H4RA 4HPLB 2LASA 4F1SA 3ZUNA 3VTWA 2G4SA 4IM0A 3DBHI 5J2RA 1VCBA 3PLVA 4B95A 3BINA 2LWPA 4A20A 3Q3FA 4K7WA 2BYFA 4W9GA 1ZKHA 1WJUA 3DDCB 4MJSA 3VDZA 1WJ6A 3NZUA 5E6OA 2KNBA 1WIAA 3L0WB 2KJRA 4IM2A 2JVCA 4ICUA 5CHFA 2I1JA 3RCZA 4DHJB 3H7SA 3A9JB 4OVVA 2ZNVB 2V1YA 1C3TA 1EUVB 2K25A 3KYCD 3OJ3A 4K81A 4B9KA 1IPGA 3U30A 1OEYJ 3VAWA 2KTFA 2KFKB 4W9DA 1NBFC 4BKGA 1WM2A 1SE9A 4X57B 2D10A 4FADA 3APDA 1P9DU 4B6WA 4FBJB 1OTRB 1WYWB 3VUYA 4F7ZA 3HM3A 1WZ0A 2XK5B 3A1QA 2KX0A 2K8HA 2MSED 2MRPA 4FJVB 2JZ3B 4G0NB 2K8CA 2MBQA 3QHTA 3N3KB 5TR5A 4W9IA 3X0WA 4E3CA 2BF8B 3PV1A 2JY6A 2N9XA 3CF6E 3TMPB 2L05A 5IAAC 5AZFA 1EO6A 2BYVE 3IBEA 4WQOB 4E71A 4FN2A 4XC2A 1D3ZA 4GMVA 4EZLA 4IWQA 1M94A 3MHSD 4HLEA 4MDKE 4ZRKA 2NBUA 2CKHB 4II2B 2KLGA 2AWTA 4BBNF 1OGWA 4MSQB 3QK0A 4A3PA 3HHMA 1WR1A 4M0WB 4MJSB 4KVGB 1V49A 3EECA 1L2NA 2W9NA 3S2AA 2CHZA 4W9EA 1V5OA 2FCSA 3A4SC 3JSVA 1C1YB 1SIFA 4DDID 1V5TA 3JW0X 3JVZX 3V6EB 3ALBA 1UELA 2MBEA 5GMVA 4JIOU 3VQIA 1J19A 3L17A 3QAQA 1T0YA 1IP9A 1YX6B 2VRRB 3K9PB 4GIVA 4G50A 2JUOA 4NQLB 2O6VD 2KQ7A 4ANVA 2CHXA 3PHWB 1E8WA 4MELA 1SGHA 1WX7A 3DCGA 5DPSA 3RZWC 2N7EA 2GBRA 4PS3A 1RFAA 3CSFA 2KO3A 2R2OA 3AU5A 4MSMB 4CO7A 1LFDA 3V60A 4ANUA 2OJRA 3KYDD 1A5RA 2KC1A 3ZNGC 1P1AA 2G45B 3NS8A 4ASWC 2BPSA 3A9JA 4HWIB 1E90A 1OEYA 2MBHA 4WWOA 4NAWB 3UQBA 3QARA 3W1SA 2KANA 3C0RB 1L7YA 1WXMA 2KWUB 1KLVA 2EMTA 3NHEB 4XX5A 2ZEQA 4HVBA 5LXHA 2UYZB 1GC6A 1WH3A 4ANXA 1YQBA 2FCMA 2KWVB 2WYQA 3ZKJC 2KJHB 4E74A 2NPTA 3QC8B 4G11A 2K6QA 3PGEA 2IY0B 3PLUA 2M4NA 2IO1B 4YL8A 2DYOA 2ZCCA 3KUZA 1V86A 4BOSC 4GU2A 2GBKA 2KTRA 4FHJA 4HCNB 4BVUC 4FHKA 1Q0WB 4DK5A 1WR6E 1I42A 1V80A 2D11A 4HCPB 3VH4B 3VTVA 3K9OB 2LRWA 4IWOA 3R66C 1V2YA 3Q3JA 5IA7A 2ASQA 4IG7B 1UBQA 2N7DA 3T9LA 2G4DB 2IO3B 3WANA 3R7QA 4EZKA 2DAFA 4PYUA 3PTFC 4EFOA 3X23A 1WJ4A 4WWPA 3D32A 4I6PA 4DDGD 4K1RB 2XBBC 4BKSD 1E8XA 3OJ4B 3A1QB 3DPDA 4WAAA 3AULA 2M0XA 1UD7A 3SD5A 1TGZB 2DZKA 2IO0B 2RPQA 4LDTB 2KXJA 1WJNA 4FJYA 3VXWA 3LJ3A 4DBGA 2J0MA 2KVRA 3ENEA 2ZVNA 2BYEA 2PE6B 2M8SA 3H6NA 3O65B 4AJYB 1WE7A 2ZVOA 3A4RA 3TBLD 4HJKA 3TCAA 3PREA 2MP2A 2N9PC 4TKNA 2LVPA 2CHWA 3EFUA 2MWSB 4I6LB 4MGZE 2QHOA 3W1SC 3PS6A 4GGQA 3RYTA 1AARA 3RD2A 4IW0A 4ANWA 2LGXA 1XQQA 1YIWA 4RMAA 1RRBA 4EEWA 1NDDA 1OQYA 3DBLI 2RD0A 3IFWB 1V81A 3L54A 3OAWA 3TIXA 3QIJA 4MH0E 5CHWA 5FR6A 2J0KA 4KZ0A 4W9LA 1J8CA 4AJWA 1UGMA 2DENB 2N4FA 3WA0A 2DHZA 2AYOB 3DOWA 4WJOA 5AZGA 2ZJDA 3WIMA 1Z5SB 4W9JA 3UGBB 3VVWB 4DHJD 4GDKA 3UIPB 5BO4B 4W9FA 2G3QB 3KUCB 5G2NA 1LQBA 2DZIA 4PYZA 1V9JA 1GUAB 4ICVA 1WXAA 2XEWA 2L7RA 4TUUA 3M62B 2YVCA 4RM9A 4FJZA 1K8RB 1TZ1A 4HPMB 2C9WB 2DZJA 4HXDA 3DVGY 3V62A 2GMIC 3QJZA 1XD3B 2A4ZA 3VFKA 3SHQA 3H9DA 3NOBA 4KSLC 2L0TA 2V4LA 1ISNA 2EKEC 5J18A 2MQJA 1E8YA 2MX2A 2NVUI 2YLMA 5DPWA 3GOEA 3UIOB 2MP2B 2KKCA 2DX5B 2LVOA 4ZDVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNV C;  4TV3 A;  3CST A;  2C7H A;  3ZLZ A;  5KHQ A;  1P3Q U;  2OOB B;  2D3G A;  2PE9 A;  4WJP A;  4LCD E;  2O6V B;  3B1L X;  3DBS A;  3GZN I;  3WAO A;  2REX A;  4BBN C;  2KWC A;  2DYB A;  2L8J A;  3N30 A;  2KC2 A;  3ML8 A;  2KQS A;  3DVN U;  5D7G A;  4ZRJ A;  1UZX B;  3M95 A;  4JLC A;  2IYD B;  3W1Y A;  2KTR B;  3M63 B;  4IC7 B;  4II3 B;  1WM3 A;  5DPR A;  2PJH A;  4IWP A;  5D94 A;  4DWF A;  1J0G A;  3QQ8 B;  1GJZ A;  3A33 B;  3DQV A;  1UH6 A;  3ONS A;  3KVF B;  4M8N A;  4MEM A;  3APC A;  4N9F 4;  1UBI A;  1EF1 A;  2FID A;  2K6D B;  4GXB A;  4TQ1 A;  2WWZ A;  4BKT A;  5L95 C;  4BOZ B;  3V61 A;  1WXS A;  4TQ0 A;  1Q5W B;  4KIK A;  2KX3 A;  2M1M A;  3SDL C;  1F9J A;  3QA8 A;  2LRU A;  2L3Z A;  4P7I A;  2NCN A;  3QX1 A;  2C7N B;  4EZJ A;  3WAL A;  1JRU A;  3DVG X;  2BKR B;  1RAX A;  2IBI B;  4I6N B;  1RLF A;  4EOY A;  2MCN B;  1S1Q B;  3M3J A;  3OLM D;  3ZRF A;  4A3O A;  1I35 A;  2AL3 A;  4WJN A;  1WF9 A;  2HE7 A;  1XT9 B;  2EMS A;  3PZD A;  4W9H A;  3UIN B;  3UF8 A;  3CMM B;  2Z0E B;  4NNJ B;  4FUL A;  4DXA B;  1WX8 A;  2RSU A;  1GG3 A;  3H7P B;  3WAM A;  4MM3 A;  5C1Z A;  2KOX A;  3IVF A;  3DBR I;  2KZR A;  2JF5 A;  3ZIM A;  2LJ5 A;  4MGK E;  1GNU A;  2NBV B;  5JHB A;  3ZW3 A;  1G6J A;  1KJT A;  3TL5 A;  4NAW A;  2KD0 A;  2AEH A;  1NI2 A;  3APF A;  1CMX B;  2KK8 A;  2Z0D B;  3L08 A;  1Q1O A;  2LXC A;  5EDS A;  3AXC A;  3L10 B;  4GSW A;  1P98 A;  2N1V A;  4IUM B;  1H8C A;  2FUH B;  1WMH A;  2JT4 B;  4K7U A;  2GBM A;  1QZE A;  2MBO A;  1Z2M A;  3IG3 A;  1X1M A;  3AI5 A;  3PVL A;  2GOW A;  2MW5 A;  5LXI B;  3ZNZ B;  5CTR C;  2V3S A;  4CHK A;  3PRP B;  5DPT A;  4EUT A;  2KDB A;  5E6N A;  3V6C B;  2K39 A;  4FLH A;  2IZV B;  1ZW7 A;  2ZPY A;  3AU4 A;  2NS5 A;  3H1U A;  4JL9 A;  1LM8 B;  2D2Q A;  1R4M I;  3PT2 B;  5L83 A;  1WGG A;  5CX3 A;  3ZRC A;  2JRI B;  5D2M B;  4AWJ A;  1EF5 A;  2JZZ A;  2RR9 A;  3ZTD A;  3JSV B;  4LJO B;  3MJW A;  4KV2 A;  1WGH A;  2KFK A;  3HIZ A;  4GB9 A;  2LXA A;  5HKH A;  3RUL A;  4FA6 A;  3ZVV A;  3PRZ A;  1WMH B;  2JPH A;  4AOF A;  4NPN A;  4AUQ C;  4GDK B;  1WE6 A;  3BY4 B;  1E7U A;  3P2B A;  4LDT D;  2BKF A;  3I3T B;  4W9C A;  2FCN A;  3PSE B;  4GN1 A;  4JGH B;  4W9K A;  3ZTC A;  1WXV A;  3SU8 X;  3QCA A;  2KHW B;  3A9K B;  3U8Z A;  2K8B A;  3VUW A;  5JHA A;  2PPH A;  1WY8 A;  2L0F A;  1GC7 A;  2LGY A;  2MBB B;  4EKU A;  1WGR A;  3TJP A;  2FNJ B;  4WWN A;  4CYE A;  1YJ1 A;  4J6I A;  3RZF A;  2D07 B;  1KM7 A;  1WI0 A;  1WGD A;  3LDZ E;  3VUX A;  4BFR A;  2KDI A;  2HD5 B;  2HJ8 A;  5CHV C;  2BGF A;  2JRH A;  2LVQ A;  2KLC A;  2Z59 B;  5J17 A;  1HE8 A;  2FAZ A;  2J7Q B;  2N9E B;  2I1K A;  1E7V A;  1LXD A;  1VD2 A;  4MGI E;  2WX0 A;  3VHT C;  2KDF B;  2ZPN A;  5JH5 C;  2LZ6 A;  2M17 A;  3DVN V;  3ECI A;  2O6V A;  4PS7 A;  1P0R A;  3R3M A;  4WJQ A;  2R2Q A;  3ZO5 B;  2ZZP B;  4JQW C;  2KMC A;  4KDI C;  4KZC A;  2BWE S;  4KIK B;  2B3A A;  4F8C B;  2GBN A;  3L13 A;  4OVU A;  2DZM A;  5G55 A;  4RM8 A;  1ZGU B;  3HK0 A;  1WX9 A;  2LI5 A;  2Y5B B;  4MGY E;  1PQS A;  3RUI B;  5D6J B;  3VH3 B;  3ZNI D;  3ZNH B;  4GDL A;  2C5L C;  2K1F A;  2KJ6 A;  2PEA A;  4K7S A;  5C23 A;  4NQK E;  2IO2 B;  4GOC A;  4IM3 A;  4NJ7 A;  2LUE A;  3KW5 B;  2CR5 A;  3ZDT A;  2IY1 B;  1KOT A;  2WDT B;  4KDL B;  4LJP B;  3NY5 A;  3ML9 A;  5JZE B;  1YD8 U;  2J0J A;  2MLB A;  2C7M B;  3PPA A;  1S3S G;  4AP4 C;  2XK5 A;  2ZCB A;  3MTN B;  3H7P A;  1YX5 B;  4HDO A;  3PHX B;  3KUD B;  2A5U A;  2JWZ A;  3RT3 B;  2CU1 A;  1TTN A;  5DCN A;  5LLI A;  1MG8 A;  2KMA A;  3KH0 A;  2WX1 A;  1Y8R C;  2O2V B;  4BKS A;  3B08 A;  2L00 B;  5AZH A;  3U7D A;  2KDE B;  3UQA A;  3WAP A;  1BT0 A;  2RGF A;  3IHP C;  2HTH A;  4PS8 A;  5KHO A;  4ZYN A;  4KSK C;  1V6E A;  1TBE A;  3EHV A;  2LGD A;  4DHZ E;  2JXX A;  4NJ6 A;  1FXT B;  1WGY A;  2C60 A;  3ZDM C;  3EC8 A;  4GDL B;  2KFJ A;  4DHZ B;  2DAJ A;  2DYM A;  2NBW B;  5AEK B;  1IYF A;  2CS4 A;  1WZ3 A;  2N1W A;  3NZS A;  4HDQ A;  3JYU A;  2KN5 A;  1WFY A;  2AL6 A;  2L76 A;  2NPT B;  4HK2 A;  2UWQ A;  2GBJ A;  2NR2 A;  3L16 A;  2FCQ A;  3HM6 X;  3B0A A;  2FIF A;  4NY0 A;  3QWZ B;  1E5W A;  3N32 A;  3A9K A;  4G3X B;  1R4N I;  4M8M A;  3PRM B;  3VTU A;  5E6P A;  1WRD B;  4URK A;  1E8Z A;  2MA9 B;  2BWF A;  3R7R A;  2LD9 A;  2O2V A;  3T8M A;  4XZ4 A;  1U4A A;  4ZRI A;  1H4R A;  4HPL B;  2LAS A;  4F1S A;  3ZUN A;  3VTW A;  2G4S A;  4IM0 A;  3DBH I;  5J2R A;  1VCB A;  3PLV A;  4B95 A;  3BIN A;  2LWP A;  4A20 A;  3Q3F A;  4K7W A;  2BYF A;  4W9G A;  1ZKH A;  1WJU A;  3DDC B;  4MJS A;  3VDZ A;  1WJ6 A;  3NZU A;  5E6O A;  2KNB A;  1WIA A;  3L0W B;  2KJR A;  4IM2 A;  2JVC A;  4ICU A;  5CHF A;  2I1J A;  3RCZ A;  4DHJ B;  3H7S A;  3A9J B;  4OVV A;  2ZNV B;  2V1Y A;  1C3T A;  1EUV B;  2K25 A;  3KYC D;  3OJ3 A;  4K81 A;  4B9K A;  1IPG A;  3U30 A;  1OEY J;  3VAW A;  2KTF A;  2KFK B;  4W9D A;  1NBF C;  4BKG A;  1WM2 A;  1SE9 A;  4X57 B;  2D10 A;  4FAD A;  3APD A;  1P9D U;  4B6W A;  4FBJ B;  1OTR B;  1WYW B;  3VUY A;  4F7Z A;  3HM3 A;  1WZ0 A;  2XK5 B;  3A1Q A;  2KX0 A;  2K8H A;  2MSE D;  2MRP A;  4FJV B;  2JZ3 B;  4G0N B;  2K8C A;  2MBQ A;  3QHT A;  3N3K B;  5TR5 A;  4W9I A;  3X0W A;  4E3C A;  2BF8 B;  3PV1 A;  2JY6 A;  2N9X A;  3CF6 E;  3TMP B;  2L05 A;  5IAA C;  5AZF A;  1EO6 A;  2BYV E;  3IBE A;  4WQO B;  4E71 A;  4FN2 A;  4XC2 A;  1D3Z A;  4GMV A;  4EZL A;  4IWQ A;  1M94 A;  3MHS D;  4HLE A;  4MDK E;  4ZRK A;  2NBU A;  2CKH B;  4II2 B;  2KLG A;  2AWT A;  4BBN F;  1OGW A;  4MSQ B;  3QK0 A;  4A3P A;  3HHM A;  1WR1 A;  4M0W B;  4MJS B;  4KVG B;  1V49 A;  3EEC A;  1L2N A;  2W9N A;  3S2A A;  2CHZ A;  4W9E A;  1V5O A;  2FCS A;  3A4S C;  3JSV A;  1C1Y B;  1SIF A;  4DDI D;  1V5T A;  3JW0 X;  3JVZ X;  3V6E B;  3ALB A;  1UEL A;  2MBE A;  5GMV A;  4JIO U;  3VQI A;  1J19 A;  3L17 A;  3QAQ A;  1T0Y A;  1IP9 A;  1YX6 B;  2VRR B;  3K9P B;  4GIV A;  4G50 A;  2JUO A;  4NQL B;  2O6V D;  2KQ7 A;  4ANV A;  2CHX A;  3PHW B;  1E8W A;  4MEL A;  1SGH A;  1WX7 A;  3DCG A;  5DPS A;  3RZW C;  2N7E A;  2GBR A;  4PS3 A;  1RFA A;  3CSF A;  2KO3 A;  2R2O A;  3AU5 A;  4MSM B;  4CO7 A;  1LFD A;  3V60 A;  4ANU A;  2OJR A;  3KYD D;  1A5R A;  2KC1 A;  3ZNG C;  1P1A A;  2G45 B;  3NS8 A;  4ASW C;  2BPS A;  3A9J A;  4HWI B;  1E90 A;  1OEY A;  2MBH A;  4WWO A;  4NAW B;  3UQB A;  3QAR A;  3W1S A;  2KAN A;  3C0R B;  1L7Y A;  1WXM A;  2KWU B;  1KLV A;  2EMT A;  3NHE B;  4XX5 A;  2ZEQ A;  4HVB A;  5LXH A;  2UYZ B;  1GC6 A;  1WH3 A;  4ANX A;  1YQB A;  2FCM A;  2KWV B;  2WYQ A;  3ZKJ C;  2KJH B;  4E74 A;  2NPT A;  3QC8 B;  4G11 A;  2K6Q A;  3PGE A;  2IY0 B;  3PLU A;  2M4N A;  2IO1 B;  4YL8 A;  2DYO A;  2ZCC A;  3KUZ A;  1V86 A;  4BOS C;  4GU2 A;  2GBK A;  2KTR A;  4FHJ A;  4HCN B;  4BVU C;  4FHK A;  1Q0W B;  4DK5 A;  1WR6 E;  1I42 A;  1V80 A;  2D11 A;  4HCP B;  3VH4 B;  3VTV A;  3K9O B;  2LRW A;  4IWO A;  3R66 C;  1V2Y A;  3Q3J A;  5IA7 A;  2ASQ A;  4IG7 B;  1UBQ A;  2N7D A;  3T9L A;  2G4D B;  2IO3 B;  3WAN A;  3R7Q A;  4EZK A;  2DAF A;  4PYU A;  3PTF C;  4EFO A;  3X23 A;  1WJ4 A;  4WWP A;  3D32 A;  4I6P A;  4DDG D;  4K1R B;  2XBB C;  4BKS D;  1E8X A;  3OJ4 B;  3A1Q B;  3DPD A;  4WAA A;  3AUL A;  2M0X A;  1UD7 A;  3SD5 A;  1TGZ B;  2DZK A;  2IO0 B;  2RPQ A;  4LDT B;  2KXJ A;  1WJN A;  4FJY A;  3VXW A;  3LJ3 A;  4DBG A;  2J0M A;  2KVR A;  3ENE A;  2ZVN A;  2BYE A;  2PE6 B;  2M8S A;  3H6N A;  3O65 B;  4AJY B;  1WE7 A;  2ZVO A;  3A4R A;  3TBL D;  4HJK A;  3TCA A;  3PRE A;  2MP2 A;  2N9P C;  4TKN A;  2LVP A;  2CHW A;  3EFU A;  2MWS B;  4I6L B;  4MGZ E;  2QHO A;  3W1S C;  3PS6 A;  4GGQ A;  3RYT A;  1AAR A;  3RD2 A;  4IW0 A;  4ANW A;  2LGX A;  1XQQ A;  1YIW A;  4RMA A;  1RRB A;  4EEW A;  1NDD A;  1OQY A;  3DBL I;  2RD0 A;  3IFW B;  1V81 A;  3L54 A;  3OAW A;  3TIX A;  3QIJ A;  4MH0 E;  5CHW A;  5FR6 A;  2J0K A;  4KZ0 A;  4W9L A;  1J8C A;  4AJW A;  1UGM A;  2DEN B;  2N4F A;  3WA0 A;  2DHZ A;  2AYO B;  3DOW A;  4WJO A;  5AZG A;  2ZJD A;  3WIM A;  1Z5S B;  4W9J A;  3UGB B;  3VVW B;  4DHJ D;  4GDK A;  3UIP B;  5BO4 B;  4W9F A;  2G3Q B;  3KUC B;  5G2N A;  1LQB A;  2DZI A;  4PYZ A;  1V9J A;  1GUA B;  4ICV A;  1WXA A;  2XEW A;  2L7R A;  4TUU A;  3M62 B;  2YVC A;  4RM9 A;  4FJZ A;  1K8R B;  1TZ1 A;  4HPM B;  2C9W B;  2DZJ A;  4HXD A;  3DVG Y;  3V62 A;  2GMI C;  3QJZ A;  1XD3 B;  2A4Z A;  3VFK A;  3SHQ A;  3H9D A;  3NOB A;  4KSL C;  2L0T A;  2V4L A;  1ISN A;  2EKE C;  5J18 A;  2MQJ A;  1E8Y A;  2MX2 A;  2NVU I;  2YLM A;  5DPW A;  3GOE A;  3UIO B;  2MP2 B;  2KKC A;  2DX5 B;  2LVO A;  4ZDV A; 
#chains in the Genus database with same CATH topology
 1QOA A;  2IGG A;  1R7S A;  1P3Q U;  2D3G A;  3WAO A;  2O6V B;  3GZN I;  4BBN C;  1I4P A;  2DYB A;  1MHH E;  2L8J A;  3N30 A;  3ML8 A;  2K5P A;  2HDE A;  3GB1 A;  3M95 A;  1CK1 A;  5DPR A;  2PJH A;  4IWP A;  4DWF A;  3DQV A;  4MEM A;  4N9F 4;  3WCQ A;  2K6D B;  3Q3N C;  4GXB A;  4TQ1 A;  1WXS A;  4KIK A;  1F9J A;  3Q6B A;  2LRU A;  2G1E A;  1C4C A;  4HJG E;  1T0Q C;  1K52 A;  2LHD A;  4EZJ A;  2LUM A;  1S1Q B;  3AE3 B;  3OLM D;  4HPP A;  4WJN A;  1K51 A;  2IGH A;  2Y3A A;  3R2T A;  1GB4 A;  5JHB A;  4RGO S;  1KJT A;  3TL5 A;  4NAW A;  2AEH A;  1FRR A;  2KK8 A;  2Z0D B;  1D6E C;  2LXC A;  3FKY A;  3L10 B;  1WMH A;  2JT4 B;  2GBM A;  3AI5 A;  2MW5 A;  5LXI B;  3ZNZ B;  4YWG G;  2KDB A;  2TSS A;  1HTQ A;  2PMV A;  2PVO D;  1VDV A;  4FLH A;  4P16 A;  2ZPY A;  3AU4 A;  3AEE B;  1L6V A;  3DHH C;  4M0W A;  5CX3 A;  5EE1 A;  2IJ0 A;  2JRI B;  1EF5 A;  4JE3 B;  1OFF A;  4C4V B;  3MJW A;  4ZRQ A;  4KV2 A;  1HA5 A;  2KFK A;  3HIZ A;  4LNF A;  4HEA 1;  1WMH B;  3AE5 B;  2QEJ C;  4AUQ C;  4GDK B;  3BY4 B;  4LDT D;  3P2B A;  2FCN A;  4GN1 A;  1AW7 A;  4JGH B;  3V3X A;  4W9K A;  5C2T B;  2DLB A;  3QCA A;  2KHW B;  3T3N A;  1WY8 A;  2KT7 A;  4RH6 A;  4YT0 B;  2LGY A;  4D2K A;  3DBH B;  2Z8L A;  4WWN A;  2YEP B;  3VUX A;  3Q14 C;  1TZO A;  1F1H A;  1HE8 A;  2J7Q B;  4MGI E;  2WX0 A;  4A9A A;  2ZZP B;  4KZC A;  4KIK B;  4F8C B;  1J7A A;  2DZM A;  1EWC A;  4RM8 A;  3RUI B;  1TY0 A;  4MGY E;  1F77 A;  4GDL A;  4XE0 A;  1LGR A;  2YEP F;  4HRS A;  4NQK E;  4GOC A;  1KOT A;  4KDL B;  3NY5 A;  4AP4 C;  2XK5 A;  2WXO A;  3MTN B;  4ZRP A;  1MJD A;  2KQ4 X;  4US9 A;  3PHX B;  4LTU A;  5I4D A;  2A5U A;  3I5J C;  5DCN A;  2VZK D;  1D5Z C;  2KMA A;  1FD6 A;  3AE4 B;  1J7C A;  3E9S A;  3RNB C;  3WAP A;  1BT0 A;  4P1B C;  2HTH A;  3P4S B;  4ZYN A;  4KSK C;  2H89 B;  3ZQ4 A;  4US8 A;  4EE2 A;  2JXX A;  5IP4 D;  3W9C B;  2KFJ A;  1JML A;  3ETR A;  3R8B A;  5H8Y E;  3Q3O C;  4HDQ A;  4HK2 A;  1WXQ A;  1QOB A;  3L16 A;  3PRM B;  3SFE B;  3URY A;  1WRD B;  4B0M A;  2BWF A;  3KWL A;  4OW0 A;  2LD9 A;  4XZ4 A;  1U4A A;  5HG2 A;  1TJE A;  4HPL B;  3PZ8 A;  5IN7 A;  2WXI A;  4JWS C;  2LWP A;  4A20 A;  1E9M A;  3B2G A;  3VDZ A;  1WJ6 A;  2KNB A;  1UNS A;  2SEB D;  4JPS A;  4DHJ B;  4OVV A;  2ZNV B;  2V1Y A;  2WXF A;  4K81 A;  1IPG A;  3MFG A;  4FXC A;  4NJC A;  3U30 A;  1ZXH A;  2AQ3 B;  3APD A;  3NG0 A;  1DGJ A;  2V0G A;  5BMH A;  3MC0 B;  4FBJ B;  1WYW B;  1TS4 A;  1ENF A;  1WZ0 A;  2RDB C;  2K8H A;  4FJV B;  2BVC A;  3N3K B;  4E3C A;  3LXF A;  1FM0 D;  1GB1 A;  4DQO C;  2L05 A;  2V9H A;  4KGS A;  1FO4 A;  2W55 A;  4XC2 A;  2J4X A;  1M94 A;  3MHS D;  4HLE A;  2BQQ A;  4II2 B;  2AWT A;  2IPK D;  1OGW A;  1WR1 A;  1PDX A;  1FFV A;  1V5O A;  1V5T A;  3JW0 X;  3V6E B;  3TEW A;  1UEL A;  2MBE A;  5GMV A;  2RDG A;  3VQI A;  3L17 A;  2R61 A;  2VRR B;  2WXK A;  4NQL B;  1SE2 A;  2MJE A;  2O6V D;  4G50 A;  1V97 A;  4M02 A;  3AE9 B;  1WX7 A;  1RFA A;  4HKQ A;  1DOI A;  1MFW A;  2BS3 B;  2INP E;  1FNW A;  3NS8 A;  1IGC A;  4ASW C;  1E90 A;  3C0R B;  1UGJ A;  1JCK B;  1L7Y A;  5FKA C;  2EMT A;  1XF5 L;  1GC6 A;  2LMC A;  3HVD A;  4E74 A;  1FNU A;  2K6Q A;  4G11 A;  3PGE A;  2IY0 B;  2M4N A;  3GE8 C;  3KUZ A;  1V86 A;  5GXG B;  4GU2 A;  1SE4 A;  4IDI A;  4HCN B;  2CJN A;  2AX5 A;  1WR6 E;  1I42 A;  1V80 A;  3VTV A;  1BUI C;  4KKJ A;  4YXD B;  3Q3J A;  2ASQ A;  3I9V 1;  1SE3 A;  1VRA B;  4RGN A;  1WJ4 A;  4K1R B;  4BKS D;  3DPD A;  2JXT A;  3ZJT A;  1UD7 A;  1QT9 A;  1D5M C;  3H8H A;  1FRD A;  1TS5 A;  1EU4 A;  1SSN A;  1YQ4 B;  4DBG A;  2ZVN A;  2PE6 B;  2WXJ A;  2M8S A;  3AN1 A;  1PGA A;  3O65 B;  4AJY B;  2MP2 A;  4TKN A;  3EFU A;  3PS6 A;  4GGQ A;  3RYT A;  3AED B;  4L1B A;  4RMA A;  2MHJ A;  4ZHO A;  3L54 A;  3N1X C;  2WDV B;  1KRH A;  3TSS A;  1KTK A;  2DEN B;  2DHZ A;  2HJ1 A;  3KQ4 A;  4WJO A;  1Z5S B;  1L0Y B;  3UGB B;  3VVW B;  3UIP B;  3KUC B;  5G2N A;  2PIA A;  4ICV A;  3M62 B;  3MP9 A;  4FJZ A;  3Q8F A;  4HXD A;  2OHF A;  4N58 A;  3QJZ A;  1XD3 B;  2A4Z A;  3NUH B;  3VFK A;  2WXL A;  2I38 A;  1JW9 D;  1QIL A;  2L0T A;  2EKE C;  5J18 A;  5DPW A;  3GOE A;  5MPO A;  1UF0 A;  1XQQ A;  1NI2 A;  2ZNV C;  3CST A;  5FK9 C;  1ZE3 D;  1HQR D;  2OOB B;  3RI7 C;  3B1L X;  3DBS A;  2KWC A;  3NVW A;  4ZRJ A;  1ET6 A;  1WM3 A;  3ZJU A;  3KVF B;  4M8N A;  3AE8 B;  1XLQ A;  4RNA A;  3IT6 B;  3MC9 A;  3V61 A;  2PKO A;  4TQ0 A;  2KX3 A;  2M1M A;  3QA8 A;  3TEX A;  2NCN A;  2FBW B;  2C7N B;  3WAL A;  1NI3 A;  3DVG X;  1I4R A;  1MG4 A;  2AL3 A;  3SR6 A;  3U52 E;  2EMS A;  3PZD A;  1UWM A;  3UF8 A;  4NNJ B;  4DXA B;  2RSU A;  1GG3 A;  1P7E A;  2PW9 A;  3H7P B;  2AQ2 B;  5BMG A;  3IVF A;  3DBR I;  3BVG A;  2KZR A;  2CJO A;  4ZHP A;  2ACZ B;  5C3J B;  2N9K A;  3APF A;  5HHD G;  4KGT A;  1P98 A;  2N1V A;  4IUM B;  1H8C A;  2MBO A;  4RGT A;  1SXT A;  1ZDV A;  4WWM A;  1N61 A;  5DPT A;  2WXN A;  4ARC A;  3OG5 A;  2QIL A;  2K39 A;  1ESF A;  2PLP A;  4OHJ A;  1B9R A;  1XCT L;  2D2Q A;  3PT2 B;  2W3S A;  1FFU A;  2JZZ A;  3IAS 1;  3RMK C;  4YTN B;  2WS3 B;  4ZYS A;  4GB9 A;  3DBL B;  3LYY A;  4A6Q A;  1WE6 A;  1Y56 A;  1I4H A;  3ZTC A;  2VZK B;  1WXV A;  3GS2 A;  3A9K B;  2KAJ A;  2JSV X;  1GC7 A;  2H88 B;  2MBB B;  3Q8E A;  2FNJ B;  1YJ1 A;  4J6I A;  1KM7 A;  4BFR A;  1DYQ A;  5CHV C;  1YJI A;  2LVQ A;  5J17 A;  2N9E B;  3MHZ A;  2ZPN A;  2LZ6 A;  2M17 A;  4WJQ A;  2O6V A;  3ABV B;  2R2Q A;  3ZO5 B;  2KMC A;  4KDI C;  2BWE S;  3N1Y C;  2GBN A;  3P63 A;  1ZGU B;  2LI5 A;  3ZNI D;  3FC4 A;  2C5L C;  4K7S A;  1N62 A;  5JXV A;  3J9C A;  4IM3 A;  1WRI A;  3P4Q B;  1Q10 A;  4LJP B;  3AMZ A;  3PPA A;  4S0R A;  1KFY B;  1YX5 B;  4LNK A;  3GP7 A;  1F2R I;  2D3C A;  5LLI A;  1MG8 A;  1Y8R C;  3B08 A;  3UQA A;  1V1O A;  5KHO A;  1V6E A;  1TBE A;  1ET9 A;  4DHZ E;  3ZDM C;  3EC8 A;  3AE6 B;  2DAJ A;  2DYM A;  2NBW B;  1IYF A;  3DWM A;  1UWX A;  4XYC A;  2NPT B;  2AL6 A;  3B0A A;  2FIF A;  2L52 A;  1AWD A;  3RNC C;  3IXS A;  5E6P A;  5FR3 A;  2MA9 B;  2WNM A;  3R7R A;  2D3A A;  3VRA B;  2O2V A;  3AEC B;  4KX6 B;  4F1S A;  3ZUN A;  3VTW A;  2ONQ A;  3DBH I;  4WH4 A;  3O13 A;  3PLV A;  3SEB A;  4B95 A;  3BIN A;  4K7W A;  3RNG C;  1ZKH A;  4MJS A;  4TSS A;  4WIP A;  1WIA A;  2I1J A;  3RCZ A;  2K25 A;  3KYC D;  1HTO A;  1OEY J;  2KVZ A;  4W9D A;  2QJL A;  4BKG A;  1SE9 A;  4FAD A;  1JWS D;  4B6W A;  1OTR B;  3VUY A;  4F7Z A;  3AV8 A;  3A1Q A;  2LFI A;  2JZ3 B;  2WXG A;  3AE1 B;  2MBQ A;  3W5V B;  5TR5 A;  2M56 B;  1YN3 A;  2JWU A;  2WU2 B;  2JY6 A;  3TMP B;  5AZF A;  3IBE A;  4E71 A;  3Q8A A;  4GMV A;  4M00 A;  1STE A;  3SFD B;  4DXF A;  3KLS X;  4MSQ B;  1DOY A;  3Q3M C;  1ACC A;  1L2N A;  2W9N A;  3S2A A;  2Y5P A;  1C1Y B;  3JVZ X;  3ZXR A;  1HZ6 A;  3QAQ A;  1YX6 B;  4XGA B;  4GIV A;  2JUO A;  2KQ7 A;  4ANV A;  2CHX A;  3PHW B;  1E8W A;  1SGH A;  3DCG A;  2GBR A;  3HRD D;  2WXP A;  3CSF A;  4MH8 A;  2IDY A;  4MSM B;  1QKZ A;  1TIF A;  4ANU A;  1A5R A;  4XWT A;  1EU3 A;  2QSD A;  3ZNG C;  2G45 B;  3L4P A;  4HWI B;  2MBH A;  4NAW B;  3UQB A;  3QAR A;  2KAN A;  2KWU B;  4XX5 A;  2ZEQ A;  3Q2A C;  1P7F A;  1WH3 A;  4ANX A;  1YQB A;  2X38 A;  2GLS A;  3QC8 B;  4PK1 A;  2IO1 B;  4PT5 A;  1RYJ A;  1VZ6 A;  2KTR A;  4FHJ A;  4JWU C;  4DK5 A;  3RNA C;  2D11 A;  3VH4 B;  2K9X A;  1PFD A;  3K9O B;  3R66 C;  3W2D A;  5IA7 A;  2PVG C;  4IG7 B;  4C4V A;  1UBQ A;  3T9L A;  1T0R C;  2G4D B;  1MVK A;  2OED A;  4A8X C;  4EZK A;  5H92 C;  4XDC A;  1XLN A;  3D32 A;  2XBB C;  1E8X A;  4MT5 A;  3A1Q B;  3AUL A;  2M0X A;  2X8X X;  3BWU D;  3SD5 A;  3W5U B;  2E6X A;  2RPQ A;  2MJ3 A;  4FJY A;  3LJ3 A;  2J0M A;  2KVR A;  1T0S C;  2BYE A;  3A4R A;  3TCA A;  2CHW A;  2MWS B;  4MGZ E;  2QHO A;  4MM3 B;  5AUK A;  2NMQ A;  4EEW A;  4R3D A;  1NEK B;  2RD0 A;  2QIE B;  3QIJ A;  5CHW A;  5FR6 A;  4KZ0 A;  3DOW A;  2KDM A;  2DNF A;  4W9J A;  4RCO A;  3NRZ A;  4W9F A;  1V1P A;  1LQB A;  4DXG A;  2DZI A;  1JAL A;  1GUA B;  1WXA A;  2XEW A;  4TUU A;  3C19 A;  4RM9 A;  2I2Y A;  4YSX B;  2Q5W D;  1FEH A;  3V62 A;  1JWA D;  1K53 A;  3I63 C;  2V4L A;  4ZOH C;  3AEG B;  2KKC A;  2LVO A;  1R4M B;  2ICI A;  3ZLZ A;  5KHQ A;  2PE9 A;  4WJP A;  1VLB A;  2REX A;  2GI9 A;  2KC2 A;  2KQS A;  1SIJ A;  4M01 A;  4JLC A;  4BZA A;  2KTR B;  1XLO A;  3M63 B;  4II3 B;  5D94 A;  1J0G A;  3QQ8 B;  3A33 B;  1UH6 A;  3ONS A;  3APC A;  1L5P A;  1TKY A;  4BKT A;  2W82 A;  2SAK A;  1C4P A;  1KLU D;  3EUB 2;  3R2I A;  3SDL C;  4P7I A;  3QX1 A;  1JRU A;  1RAX A;  1FCL A;  4I6N B;  1RLF A;  1A70 A;  2MCN B;  3M3J A;  4A3O A;  1TKE A;  1WF9 A;  2Z0E B;  4FUL A;  1WX8 A;  5C1Z A;  4MM3 A;  2NTT A;  2VH1 A;  1L4D B;  2IGD A;  4REZ A;  3FIL B;  1HEZ E;  4MGK E;  1GNU A;  2NBV B;  2J42 A;  5G5G A;  1G6J A;  3U2S C;  3L08 A;  3AXC A;  1C76 A;  2VH2 A;  4YSZ B;  2FUH B;  4K7U A;  4BAX A;  1QZE A;  2KN4 A;  4RFB A;  1FIQ A;  1Z2M A;  1X1M A;  3IG3 A;  1FCC C;  3NS1 A;  1HZ5 A;  3PVL A;  2V3S A;  4EUT A;  3V6C B;  1YNT E;  3NVY A;  2QDF A;  4LNO A;  1WWT A;  2LEK A;  2BW2 A;  3H1U A;  4JL9 A;  4K3B A;  3RFZ B;  1DOX A;  2W54 A;  5D2M B;  4AWJ A;  2RR9 A;  2J53 A;  3JSV B;  4LJO B;  2OJW A;  3N9Y C;  5HKH A;  1WSP A;  3RUL A;  3PRZ A;  2JPH A;  4HRO A;  3DWG C;  4MAC A;  4W9C A;  1E7U A;  3I3T B;  3Q8B A;  4XWW A;  3DHI C;  3U8Z A;  5JHA A;  1NEN B;  2L0F A;  4RF0 A;  2BS2 B;  3ZGZ A;  4EKU A;  3TJP A;  3RZF A;  2D07 B;  1WI0 A;  2KDI A;  4P6V F;  4C56 C;  1SJE D;  2HD5 B;  2HJ8 A;  2JRH A;  2FAZ A;  2I1K A;  1VD2 A;  1YQ3 B;  1YMH E;  2KDF B;  3BVM A;  4PS7 A;  3ECI A;  3R3M A;  4WQM A;  4JQW C;  3BYT B;  1AN8 A;  3DBR B;  5EE0 A;  1WX9 A;  2Y5B B;  4WUR A;  3ZNH B;  2KJ6 A;  4ITK A;  3IT4 B;  3NVZ A;  1MI0 A;  2W3R A;  1SBB B;  2CR5 A;  3ZDT A;  2IY1 B;  3FIL A;  2WLB A;  4ZDV A;  1YD8 U;  4B0E A;  4L2Y A;  1S3S G;  2KYW A;  1PUT A;  4HDO A;  5BYS A;  1L4Z B;  1IUE A;  2CU1 A;  1TTN A;  4TMA B;  3FAH A;  2L00 B;  2AQ1 B;  2RGF A;  4PS8 A;  1RFK A;  3EHV A;  2BT6 A;  2N7J A;  2C60 A;  3AE7 B;  5T8I A;  4GDL B;  4DHZ B;  3GZN B;  5AEK B;  3Q8C A;  2CS4 A;  2KN5 A;  1WFY A;  2L76 A;  4NZL B;  2UWQ A;  2NR2 A;  3HM6 X;  1KH0 A;  1E5W A;  3N32 A;  2HTM E;  1R4N I;  4M8M A;  2J52 A;  3RN9 C;  3VTU A;  4URK A;  4KKI A;  4IOI E;  4ZRI A;  3BK1 A;  1T6B X;  3TUO A;  1RM6 C;  3Q3F A;  4W9G A;  3EGR A;  1J7B A;  3DDC B;  3NZ3 A;  5E6O A;  1FPY A;  4IM2 A;  2JVC A;  5CHF A;  4N59 A;  2V3P A;  3A9J B;  3P1M A;  3OJ3 A;  1V8C A;  2MH7 A;  3RNF C;  1NBF C;  1WM2 A;  4X57 B;  2V3N A;  2D10 A;  1P9D U;  4LNI A;  3HM3 A;  2XK5 B;  1FXI A;  2MRP A;  2K8C A;  3BK2 A;  1TY2 A;  3QHT A;  1IGD A;  1BXT A;  1N6Z A;  2BF8 B;  3PV1 A;  3CF6 E;  1VR9 A;  2BYV E;  1D3Z A;  4WQO B;  4FN2 A;  4EZL A;  4IWQ A;  3LB8 C;  5E6J A;  2NBU A;  2CKH B;  1MHX A;  3EA6 A;  1JRO A;  1T3Q A;  3HHM A;  4M0W B;  4MJS B;  4KVG B;  2G9H D;  4W9E A;  4DDI D;  3JSV A;  1SIF A;  2BB6 A;  3BZD B;  1VJK A;  4JIO U;  1J19 A;  1T0Y A;  2INC C;  5IKC M;  4CQN A;  2LGI A;  2N7E A;  4PS3 A;  4YTM B;  1E6E B;  1C9F A;  1LFD A;  3V60 A;  2OJR A;  3CWI A;  1P1A A;  5BMI A;  2BBC A;  3A9J A;  3NHE B;  5LXH A;  2UYZ B;  1C78 A;  2NTS A;  2WYQ A;  3ZKJ C;  1HXY D;  2JYT A;  2NPT A;  2ZW1 A;  1ZP0 B;  2INN E;  3V05 A;  1SF0 A;  2DYO A;  2ZCC A;  4RF1 A;  2GBK A;  4BVU C;  5D3I B;  1RWS A;  3P4R B;  3B9J A;  2IND C;  4HCP B;  2V4I B;  5EE9 A;  4IWO A;  1V2Y A;  2GRI A;  2Y5C A;  3WAN A;  2DAF A;  4EFO A;  4DDG D;  1YJJ A;  4LNN A;  4WAA A;  3CIR B;  1ZPS A;  1TGZ B;  2DZK A;  2KAC A;  2B76 B;  2LHE A;  3GE3 C;  4AS1 A;  1T5X D;  4LDT B;  2KXJ A;  1WJN A;  3KWV A;  4ACF A;  2GB1 A;  1WE7 A;  2ZVO A;  4NAM A;  3TBL D;  4HJK A;  3PRE A;  2MEK A;  2N9P C;  2L1A A;  3VR8 B;  3RPF C;  3W1S C;  3RD2 A;  2LGX A;  1YIW A;  2BTE A;  1RRB A;  2FUG 1;  1B1Z A;  3DBL I;  1OQY A;  2D5G A;  4OZB A;  4H2A A;  4W9L A;  1C4A A;  1AYF A;  2ZW0 A;  2N4F A;  2JU6 X;  3WIM A;  2WU5 B;  4DHJ D;  4GDK A;  1CJE A;  5BO4 B;  1F52 A;  4PYZ A;  2L7R A;  4USA A;  2ON8 A;  4A90 A;  1TZ1 A;  4HPM B;  2C9W B;  3DVG Y;  1XO3 A;  4J3O D;  4XDD A;  4KSL C;  3VRB B;  3PO0 A;  1ISN A;  1E8Y A;  2YLM A;  2NVU I;  3NVV A;  2WDR B;  4TV3 A;  3ZYY X;  1GPX A;  2C7H A;  1E7P B;  4LCD E;  3DVN U;  3VR9 B;  5D7G A;  3AH7 A;  1UZX B;  4S17 A;  3W1Y A;  2IYD B;  2JX5 A;  4IC7 B;  1GJZ A;  2RPV A;  1L0V B;  1UBI A;  1EF1 A;  2FID A;  2WWZ A;  3UI3 A;  5L95 C;  4BOZ B;  1OQR A;  1Q5W B;  1YOV B;  2L3Z A;  1KLG D;  2BKR B;  2IBI B;  3AEF B;  4EOY A;  3ZRF A;  1I35 A;  2QMT A;  4N6E B;  2HE7 A;  1XT9 B;  4W9H A;  3UIN B;  3CMM B;  3WAM A;  2D3B A;  2KOX A;  2JF5 A;  3ZIM A;  2KMM A;  2LJ5 A;  1QF6 A;  3AE2 B;  4QAY A;  3MC8 A;  3ZW3 A;  1I4Q A;  2KD0 A;  1QQR A;  1SB3 C;  1CMX B;  1Q1O A;  5EDS A;  4C7Y A;  1E10 A;  3DHG C;  4GSW A;  2BYT A;  1ZUD 2;  1YN5 A;  5HFY A;  4K3C A;  2GOW A;  5CTR C;  4CHK A;  3PRP B;  5E6N A;  3TEY A;  4UDU C;  2EEL A;  1SJH D;  2IZV B;  1ZW7 A;  2NS5 A;  5G5H A;  4C80 A;  1TT5 B;  2WP9 B;  1LM8 B;  1R4M I;  5L83 A;  1WGG A;  3ZRC A;  2L83 A;  3ZTD A;  1PGX A;  1WGH A;  2LXA A;  4FA6 A;  2K3U A;  3ZVV A;  4AOF A;  1I4G A;  4NPN A;  1N60 A;  1N5X A;  2BKF A;  3PSE B;  3U4E G;  1F2R C;  3SU8 X;  1QLB B;  2K8B A;  3VUW A;  2PPH A;  2M19 A;  1WGR A;  4CYE A;  3RNE C;  1WGD A;  3LDZ E;  1OQQ A;  2BGF A;  2KLC A;  2Z59 B;  1E7V A;  1LXD A;  3B2F A;  3VHT C;  1CQV A;  3DVN V;  5JH5 C;  1P0R A;  2B3A A;  5D3D A;  3L13 A;  4OVU A;  1JRP A;  5G55 A;  2XNA C;  3HK0 A;  1PQS A;  5D6J B;  3VH3 B;  2K1F A;  1JQ4 A;  2PEA A;  1LO5 D;  1C77 A;  4WAF A;  5C23 A;  2IO2 B;  4NJ7 A;  2LUE A;  3KW5 B;  2WDT B;  3ML9 A;  2E3T A;  5JZE B;  2MLB A;  3HUI A;  2J0J A;  2C7M B;  1F0Z A;  2JQR B;  2ZCB A;  3H7P A;  3KUD B;  2JWZ A;  3RT3 B;  1XLP A;  4LLG M;  5IO9 A;  3KH0 A;  2WX1 A;  2O2V B;  4BKS A;  5AZH A;  3U7D A;  2KDE B;  3IHP C;  1TKG A;  1E0Z A;  2LGD A;  4NJ6 A;  1FXT B;  1WGY A;  1GOZ A;  1ZDX A;  1CZP A;  3NZS A;  1WZ3 A;  1ZXI A;  2N0S B;  2N1W A;  3JYU A;  3U7Z A;  2GBJ A;  1NVI D;  2FCQ A;  4NY0 A;  3QWZ B;  3A9K A;  4G3X B;  1E8Z A;  1PYW D;  3AM9 A;  4O1N A;  3ZJV A;  4YTP B;  3ZXV A;  3T8M A;  1H4R A;  4C00 A;  2LAS A;  2G4S A;  2BS4 B;  4IM0 A;  1IBX B;  1TS3 A;  1VCB A;  5J2R A;  4KGR A;  1XEE A;  2DWQ A;  3BII D;  2BYF A;  1WJU A;  3NZU A;  3AEB B;  3MJ5 A;  1K50 A;  2KJR A;  3L0W B;  2L32 A;  4ICU A;  2N9L A;  3H7S A;  3AEA B;  1C3T A;  1EUV B;  4B9K A;  3VAW A;  2KTF A;  2KFK B;  3EFC A;  2K22 A;  3T3O A;  2WXH A;  1VZ8 A;  2KX0 A;  2MSE D;  4G0N B;  1L6U A;  3BVZ A;  3IAM 1;  1M4V A;  1ZOY B;  4W9I A;  3X0W A;  2JYE A;  2N9X A;  2M0A A;  5IAA C;  4AQ7 A;  1EO6 A;  2BB5 A;  3AB5 A;  2QC8 A;  1FMA D;  5TSS A;  4MDK E;  1TS2 A;  4ZRK A;  1ROE A;  2KLG A;  4BBN F;  1NYR A;  3QK0 A;  4A3P A;  1V49 A;  2FE8 A;  3EEC A;  2CHZ A;  2FCS A;  2WGS A;  3A4S C;  3OWE B;  2MJD A;  2WXR A;  2XN9 C;  3ALB A;  2EKI A;  4RGM A;  1R4N B;  3HVZ A;  1IP9 A;  3K9P B;  4IKG A;  1V1P B;  2PTL A;  4MEL A;  5DPS A;  1EM7 A;  3RZW C;  3P4P B;  2DBY A;  2KO3 A;  2R2O A;  3AU5 A;  5HI1 A;  5EE3 A;  4CO7 A;  1JWB D;  3KYD D;  1D4B A;  1FXA A;  2KC1 A;  4LK0 M;  5AUI A;  2BPS A;  1N5W A;  1OEY A;  1QOF A;  4WWO A;  2WXQ A;  3C8Y A;  1JWM D;  3W1S A;  1IBX A;  1WXM A;  1KLV A;  4HVB A;  2FCM A;  2KWV B;  2KJH B;  3N20 C;  3TEZ A;  3PLU A;  2RDH A;  4YL8 A;  4BOS C;  1MPE A;  1I4X A;  4FHK A;  4Q2J A;  1Q0W B;  2QCZ A;  3N1Z C;  1UUP A;  4C7Z A;  2LRW A;  1JWU D;  1EWY C;  2N7D A;  4L23 A;  2IO3 B;  3R7Q A;  4PYU A;  3PTF C;  2KWD A;  3X23 A;  4WWP A;  2CU3 A;  4I6P A;  1XXG A;  3OJ4 B;  2IO0 B;  4ARI A;  3VXW A;  3ENE A;  2WHI A;  1WGK A;  3H6N A;  3PZ7 A;  1PGB A;  5BYR A;  2LVP A;  3P42 A;  4I6L B;  2JZP A;  1AAR A;  1XCQ L;  1NYQ A;  4IW0 A;  4P1C C;  4ANW A;  1WYG A;  2LGS A;  1D5X C;  4OZA A;  1BML C;  2K0P A;  1NDD A;  3IFW B;  1SEB D;  1V81 A;  3E56 A;  3OAW A;  3TIX A;  1VZ7 A;  1QOG A;  2WXM A;  4GLS C;  4JX1 C;  4MH0 E;  2J0K A;  1J8C A;  4A55 A;  4AJW A;  4YSY B;  1UGM A;  5BYQ A;  3WA0 A;  2AYO B;  2UU7 A;  5AZG A;  2LJI A;  1FNV A;  2ZJD A;  1C79 A;  2G3Q B;  4OZC A;  1V9J A;  2WDQ B;  1I7H A;  3Q69 A;  3BYY B;  2YVC A;  3NJT A;  1K8R B;  2RMM A;  5IOI A;  1L0X B;  2DZJ A;  2GMI C;  3I57 A;  3SHQ A;  3H9D A;  1YN4 A;  1GAQ B;  4HKZ E;  2WQY B;  2MQJ A;  5LNK 1;  1TYG B;  2MX2 A;  1KF6 B;  3UIO B;  2MP2 B;  3NOB A;  2DX5 B;  4OVZ A;  1N63 A; 
#chains in the Genus database with same CATH homology
 2ZNV C;  4TV3 A;  3CST A;  2C7H A;  3ZLZ A;  5KHQ A;  1P3Q U;  2OOB B;  2D3G A;  2PE9 A;  4WJP A;  4LCD E;  2O6V B;  3B1L X;  3DBS A;  3GZN I;  3WAO A;  2REX A;  4BBN C;  2KWC A;  2DYB A;  2L8J A;  3N30 A;  2KC2 A;  3ML8 A;  2KQS A;  3DVN U;  5D7G A;  4ZRJ A;  1UZX B;  3M95 A;  4JLC A;  2IYD B;  3W1Y A;  2KTR B;  3M63 B;  4IC7 B;  4II3 B;  1WM3 A;  5DPR A;  2PJH A;  4IWP A;  5D94 A;  4DWF A;  1J0G A;  3QQ8 B;  1GJZ A;  3A33 B;  3DQV A;  1UH6 A;  3ONS A;  3KVF B;  4M8N A;  4MEM A;  3APC A;  4N9F 4;  1UBI A;  1EF1 A;  2FID A;  2K6D B;  4GXB A;  4TQ1 A;  2WWZ A;  4BKT A;  5L95 C;  4BOZ B;  3V61 A;  1WXS A;  4TQ0 A;  1Q5W B;  4KIK A;  2KX3 A;  2M1M A;  3SDL C;  1F9J A;  3QA8 A;  2LRU A;  2L3Z A;  4P7I A;  2NCN A;  3QX1 A;  2C7N B;  4EZJ A;  3WAL A;  1JRU A;  3DVG X;  2BKR B;  1RAX A;  2IBI B;  4I6N B;  1RLF A;  4EOY A;  2MCN B;  1S1Q B;  3M3J A;  3OLM D;  3ZRF A;  4A3O A;  1I35 A;  2AL3 A;  4WJN A;  1WF9 A;  2HE7 A;  1XT9 B;  2EMS A;  3PZD A;  4W9H A;  3UIN B;  3UF8 A;  3CMM B;  2Z0E B;  4NNJ B;  4FUL A;  4DXA B;  1WX8 A;  2RSU A;  1GG3 A;  3H7P B;  3WAM A;  4MM3 A;  5C1Z A;  2KOX A;  3IVF A;  3DBR I;  2KZR A;  2JF5 A;  3ZIM A;  2LJ5 A;  4MGK E;  1GNU A;  2NBV B;  5JHB A;  3ZW3 A;  1G6J A;  1KJT A;  3TL5 A;  4NAW A;  2KD0 A;  2AEH A;  1NI2 A;  3APF A;  1CMX B;  2KK8 A;  2Z0D B;  3L08 A;  1Q1O A;  2LXC A;  5EDS A;  3AXC A;  3L10 B;  4GSW A;  1P98 A;  2N1V A;  4IUM B;  1H8C A;  2FUH B;  1WMH A;  2JT4 B;  4K7U A;  2GBM A;  1QZE A;  2MBO A;  1Z2M A;  3IG3 A;  1X1M A;  3AI5 A;  3PVL A;  2GOW A;  2MW5 A;  5LXI B;  3ZNZ B;  5CTR C;  2V3S A;  4CHK A;  3PRP B;  5DPT A;  4EUT A;  2KDB A;  5E6N A;  3V6C B;  2K39 A;  4FLH A;  2IZV B;  1ZW7 A;  2ZPY A;  3AU4 A;  2NS5 A;  3H1U A;  4JL9 A;  1LM8 B;  2D2Q A;  1R4M I;  3PT2 B;  5L83 A;  1WGG A;  5CX3 A;  3ZRC A;  2JRI B;  5D2M B;  4AWJ A;  1EF5 A;  2JZZ A;  2RR9 A;  3ZTD A;  3JSV B;  4LJO B;  3MJW A;  4KV2 A;  1WGH A;  2KFK A;  3HIZ A;  4GB9 A;  2LXA A;  5HKH A;  3RUL A;  4FA6 A;  3ZVV A;  3PRZ A;  1WMH B;  2JPH A;  4AOF A;  4NPN A;  4AUQ C;  4GDK B;  1WE6 A;  3BY4 B;  1E7U A;  3P2B A;  4LDT D;  2BKF A;  3I3T B;  4W9C A;  2FCN A;  3PSE B;  4GN1 A;  4JGH B;  4W9K A;  3ZTC A;  1WXV A;  3SU8 X;  3QCA A;  2KHW B;  3A9K B;  3U8Z A;  2K8B A;  3VUW A;  5JHA A;  2PPH A;  1WY8 A;  2L0F A;  1GC7 A;  2LGY A;  2MBB B;  4EKU A;  1WGR A;  3TJP A;  2FNJ B;  4WWN A;  4CYE A;  1YJ1 A;  4J6I A;  3RZF A;  2D07 B;  1KM7 A;  1WI0 A;  1WGD A;  3LDZ E;  3VUX A;  4BFR A;  2KDI A;  2HD5 B;  2HJ8 A;  5CHV C;  2BGF A;  2JRH A;  2LVQ A;  2KLC A;  2Z59 B;  5J17 A;  1HE8 A;  2FAZ A;  2J7Q B;  2N9E B;  2I1K A;  1E7V A;  1LXD A;  1VD2 A;  4MGI E;  2WX0 A;  3VHT C;  2KDF B;  2ZPN A;  5JH5 C;  2LZ6 A;  2M17 A;  3DVN V;  3ECI A;  2O6V A;  4PS7 A;  1P0R A;  3R3M A;  4WJQ A;  2R2Q A;  3ZO5 B;  2ZZP B;  4JQW C;  2KMC A;  4KDI C;  4KZC A;  2BWE S;  4KIK B;  2B3A A;  4F8C B;  2GBN A;  3L13 A;  4OVU A;  2DZM A;  5G55 A;  4RM8 A;  1ZGU B;  3HK0 A;  1WX9 A;  2LI5 A;  2Y5B B;  4MGY E;  1PQS A;  3RUI B;  5D6J B;  3VH3 B;  3ZNI D;  3ZNH B;  4GDL A;  2C5L C;  2K1F A;  2KJ6 A;  2PEA A;  4K7S A;  5C23 A;  4NQK E;  2IO2 B;  4GOC A;  4IM3 A;  4NJ7 A;  2LUE A;  3KW5 B;  2CR5 A;  3ZDT A;  2IY1 B;  1KOT A;  2WDT B;  4KDL B;  4LJP B;  3NY5 A;  3ML9 A;  5JZE B;  1YD8 U;  2J0J A;  2MLB A;  2C7M B;  3PPA A;  1S3S G;  4AP4 C;  2XK5 A;  2ZCB A;  3MTN B;  3H7P A;  1YX5 B;  4HDO A;  3PHX B;  3KUD B;  2A5U A;  2JWZ A;  3RT3 B;  2CU1 A;  1TTN A;  5DCN A;  5LLI A;  1MG8 A;  2KMA A;  3KH0 A;  2WX1 A;  1Y8R C;  2O2V B;  4BKS A;  3B08 A;  2L00 B;  5AZH A;  3U7D A;  2KDE B;  3UQA A;  3WAP A;  1BT0 A;  2RGF A;  3IHP C;  2HTH A;  4PS8 A;  5KHO A;  4ZYN A;  4KSK C;  1V6E A;  1TBE A;  3EHV A;  2LGD A;  4DHZ E;  2JXX A;  4NJ6 A;  1FXT B;  1WGY A;  2C60 A;  3ZDM C;  3EC8 A;  4GDL B;  2KFJ A;  4DHZ B;  2DAJ A;  2DYM A;  2NBW B;  5AEK B;  1IYF A;  2CS4 A;  1WZ3 A;  2N1W A;  3NZS A;  4HDQ A;  3JYU A;  2KN5 A;  1WFY A;  2AL6 A;  2L76 A;  2NPT B;  4HK2 A;  2UWQ A;  2GBJ A;  2NR2 A;  3L16 A;  2FCQ A;  3HM6 X;  3B0A A;  2FIF A;  4NY0 A;  3QWZ B;  1E5W A;  3N32 A;  3A9K A;  4G3X B;  1R4N I;  4M8M A;  3PRM B;  3VTU A;  5E6P A;  1WRD B;  4URK A;  1E8Z A;  2MA9 B;  2BWF A;  3R7R A;  2LD9 A;  2O2V A;  3T8M A;  4XZ4 A;  1U4A A;  4ZRI A;  1H4R A;  4HPL B;  2LAS A;  4F1S A;  3ZUN A;  3VTW A;  2G4S A;  4IM0 A;  3DBH I;  5J2R A;  1VCB A;  3PLV A;  4B95 A;  3BIN A;  2LWP A;  4A20 A;  3Q3F A;  4K7W A;  2BYF A;  4W9G A;  1ZKH A;  1WJU A;  3DDC B;  4MJS A;  3VDZ A;  1WJ6 A;  3NZU A;  5E6O A;  2KNB A;  1WIA A;  3L0W B;  2KJR A;  4IM2 A;  2JVC A;  4ICU A;  5CHF A;  2I1J A;  3RCZ A;  4DHJ B;  3H7S A;  3A9J B;  4OVV A;  2ZNV B;  2V1Y A;  1C3T A;  1EUV B;  2K25 A;  3KYC D;  3OJ3 A;  4K81 A;  4B9K A;  1IPG A;  3U30 A;  1OEY J;  3VAW A;  2KTF A;  2KFK B;  4W9D A;  1NBF C;  4BKG A;  1WM2 A;  1SE9 A;  4X57 B;  2D10 A;  4FAD A;  3APD A;  1P9D U;  4B6W A;  4FBJ B;  1OTR B;  1WYW B;  3VUY A;  4F7Z A;  3HM3 A;  1WZ0 A;  2XK5 B;  3A1Q A;  2KX0 A;  2K8H A;  2MSE D;  2MRP A;  4FJV B;  2JZ3 B;  4G0N B;  2K8C A;  2MBQ A;  3QHT A;  3N3K B;  5TR5 A;  4W9I A;  3X0W A;  4E3C A;  2BF8 B;  3PV1 A;  2JY6 A;  2N9X A;  3CF6 E;  3TMP B;  2L05 A;  5IAA C;  5AZF A;  1EO6 A;  2BYV E;  3IBE A;  4WQO B;  4E71 A;  4FN2 A;  4XC2 A;  1D3Z A;  4GMV A;  4EZL A;  4IWQ A;  1M94 A;  3MHS D;  4HLE A;  4MDK E;  4ZRK A;  2NBU A;  2CKH B;  4II2 B;  2KLG A;  2AWT A;  4BBN F;  1OGW A;  4MSQ B;  3QK0 A;  4A3P A;  3HHM A;  1WR1 A;  4M0W B;  4MJS B;  4KVG B;  1V49 A;  3EEC A;  1L2N A;  2W9N A;  3S2A A;  2CHZ A;  4W9E A;  1V5O A;  2FCS A;  3A4S C;  3JSV A;  1C1Y B;  1SIF A;  4DDI D;  1V5T A;  3JW0 X;  3JVZ X;  3V6E B;  3ALB A;  1UEL A;  2MBE A;  5GMV A;  4JIO U;  3VQI A;  1J19 A;  3L17 A;  3QAQ A;  1T0Y A;  1IP9 A;  1YX6 B;  2VRR B;  3K9P B;  4GIV A;  4G50 A;  2JUO A;  4NQL B;  2O6V D;  2KQ7 A;  4ANV A;  2CHX A;  3PHW B;  1E8W A;  4MEL A;  1SGH A;  1WX7 A;  3DCG A;  5DPS A;  3RZW C;  2N7E A;  2GBR A;  4PS3 A;  1RFA A;  3CSF A;  2KO3 A;  2R2O A;  3AU5 A;  4MSM B;  4CO7 A;  1LFD A;  3V60 A;  4ANU A;  2OJR A;  3KYD D;  1A5R A;  2KC1 A;  3ZNG C;  1P1A A;  2G45 B;  3NS8 A;  4ASW C;  2BPS A;  3A9J A;  4HWI B;  1E90 A;  1OEY A;  2MBH A;  4WWO A;  4NAW B;  3UQB A;  3QAR A;  3W1S A;  2KAN A;  3C0R B;  1L7Y A;  1WXM A;  2KWU B;  1KLV A;  2EMT A;  3NHE B;  4XX5 A;  2ZEQ A;  4HVB A;  5LXH A;  2UYZ B;  1GC6 A;  1WH3 A;  4ANX A;  1YQB A;  2FCM A;  2KWV B;  2WYQ A;  3ZKJ C;  2KJH B;  4E74 A;  2NPT A;  3QC8 B;  4G11 A;  2K6Q A;  3PGE A;  2IY0 B;  3PLU A;  2M4N A;  2IO1 B;  4YL8 A;  2DYO A;  2ZCC A;  3KUZ A;  1V86 A;  4BOS C;  4GU2 A;  2GBK A;  2KTR A;  4FHJ A;  4HCN B;  4BVU C;  4FHK A;  1Q0W B;  4DK5 A;  1WR6 E;  1I42 A;  1V80 A;  2D11 A;  4HCP B;  3VH4 B;  3VTV A;  3K9O B;  2LRW A;  4IWO A;  3R66 C;  1V2Y A;  3Q3J A;  5IA7 A;  2ASQ A;  4IG7 B;  1UBQ A;  2N7D A;  3T9L A;  2G4D B;  2IO3 B;  3WAN A;  3R7Q A;  4EZK A;  2DAF A;  4PYU A;  3PTF C;  4EFO A;  3X23 A;  1WJ4 A;  4WWP A;  3D32 A;  4I6P A;  4DDG D;  4K1R B;  2XBB C;  4BKS D;  1E8X A;  3OJ4 B;  3A1Q B;  3DPD A;  4WAA A;  3AUL A;  2M0X A;  1UD7 A;  3SD5 A;  1TGZ B;  2DZK A;  2IO0 B;  2RPQ A;  4LDT B;  2KXJ A;  1WJN A;  4FJY A;  3VXW A;  3LJ3 A;  4DBG A;  2J0M A;  2KVR A;  3ENE A;  2ZVN A;  2BYE A;  2PE6 B;  2M8S A;  3H6N A;  3O65 B;  4AJY B;  1WE7 A;  2ZVO A;  3A4R A;  3TBL D;  4HJK A;  3TCA A;  3PRE A;  2MP2 A;  2N9P C;  4TKN A;  2LVP A;  2CHW A;  3EFU A;  2MWS B;  4I6L B;  4MGZ E;  2QHO A;  3W1S C;  3PS6 A;  4GGQ A;  3RYT A;  1AAR A;  3RD2 A;  4IW0 A;  4ANW A;  2LGX A;  1XQQ A;  1YIW A;  4RMA A;  1RRB A;  4EEW A;  1NDD A;  1OQY A;  3DBL I;  2RD0 A;  3IFW B;  1V81 A;  3L54 A;  3OAW A;  3TIX A;  3QIJ A;  4MH0 E;  5CHW A;  5FR6 A;  2J0K A;  4KZ0 A;  4W9L A;  1J8C A;  4AJW A;  1UGM A;  2DEN B;  2N4F A;  3WA0 A;  2DHZ A;  2AYO B;  3DOW A;  4WJO A;  5AZG A;  2ZJD A;  3WIM A;  1Z5S B;  4W9J A;  3UGB B;  3VVW B;  4DHJ D;  4GDK A;  3UIP B;  5BO4 B;  4W9F A;  2G3Q B;  3KUC B;  5G2N A;  1LQB A;  2DZI A;  4PYZ A;  1V9J A;  1GUA B;  4ICV A;  1WXA A;  2XEW A;  2L7R A;  4TUU A;  3M62 B;  2YVC A;  4RM9 A;  4FJZ A;  1K8R B;  1TZ1 A;  4HPM B;  2C9W B;  2DZJ A;  4HXD A;  3DVG Y;  3V62 A;  2GMI C;  3QJZ A;  1XD3 B;  2A4Z A;  3VFK A;  3SHQ A;  3H9D A;  3NOB A;  4KSL C;  2L0T A;  2V4L A;  1ISN A;  2EKE C;  5J18 A;  2MQJ A;  1E8Y A;  2MX2 A;  2NVU I;  2YLM A;  5DPW A;  3GOE A;  3UIO B;  2MP2 B;  2KKC A;  2DX5 B;  2LVO A;  4ZDV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...