1WJ4A

Solution structure of the ubx domain of kiaa0794 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQESGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0794 protein
publication title Solution structure of the UBX domain of KIAA0794 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj4A01
1K8RB 1SE9A 2IO0B 2XEWA 3LDZE 4PS7A 3ONSA 4MM3A 2OJRA 1WXVA 1WJUA 3PREA 3VH4B 3QQ8B 2GBNA 4W9JA 3ZNGC 2LRUA 4DDGD 2Z59B 1AARA 3JSVB 2GMIC 3UQAA 3HM6X 3VH3B 2O2VB 1UBQA 2REXA 2ZPYA 3AU5A 1XT9B 3IHPC 3ZW3A 1D3ZA 3WALA 4G50A 3ZUNA 4KZCA 1Z2MA 2C5LC 3AULA 2LVQA 4MSMB 2LASA 4HPLB 2G45B 2KTRB 4NPNA 1P98A 4K7WA 4DK5A 2UWQA 2IY0B 2QHOA 4NAWA 2ZNVC 2ZCCA 4ZRKA 5AZHA 3H7PB 4HXDA 1WRDB 2LI5A 5LXHA 2FIDA 4G3XB 3PRZA 2N9EB 2FUHB 2K25A 2MLBA 1WY8A 5E6OA 3VXWA 2IBIB 4N9F4 1ZGUB 4HJKA 2LGXA 2KXJA 4JQWC 5IAAC 2N9PC 3DVGY 3ZO5B 4HPMB 3X0WA 3ZRCA 3A9KA 1WGGA 2DZIA 2M8SA 3KYCD 1OTRB 2DYOA 1PQSA 1WX9A 2CHZA 3B08A 3O65B 4NAWB 5HKHA 1V9JA 2BPSA 1JRUA 2BWES 3NOBA 1H4RA 2PPHA 2JWZA 2DHZA 2K8CA 3UINB 2KDBA 2JRHA 1F9JA 2KD0A 4W9LA 4WJPA 2ZZPB 2KFKA 1RRBA 3H9DA 3ML8A 4ZRJA 3ZTDA 4W9DA 2XK5A 2GOWA 2N7EA 2C7NB 3L10B 3QARA 4EEWA 2RPQA 2UYZB 3DCGA 1M94A 3A9KB 3EHVA 2O6VA 4EOYA 2CR5A 2IZVB 2KDEB 3HIZA 3R7QA 3VAWA 2KMAA 4KSKC 4XZ4A 4W9IA 2MBEA 1V49A 3NS8A 4A3OA 4IM0A 2I1KA 4PS3A 5CHFA 3WA0A 2XK5B 3TL5A 5D2MB 4HDOA 2JY6A 1WF9A 2MBHA 1YIWA 1SGHA 2Z0DB 1WZ3A 3B0AA 2JXXA 3V60A 2J7QB 3W1YA 2N4FA 2O6VB 2OOBB 2O6VD 2XBBC 1IPGA 4J6IA 2IO3B 1P3QU 2KJHB 2L3ZA 3KH0A 1R4MI 4G0NB 3TIXA 4MJSB 3CMMB 1EF1A 3MTNB 4AJYB 2NPTB 2MCNB 2KQ7A 2JRIB 3ZNHB 3ZVVA 4BKSA 1VD2A 3WAMA 1R4NI 4KDLB 1T0YA 3PZDA 3PLUA 1ZW7A 2MX2A 3A4RA 2B3AA 3BY4B 2FCSA 2AYOB 3DBSA 3L16A 5BO4B 3WAOA 4BBNF 3PLVA 3RT3B 3AI5A 3RD2A 1KLVA 5D94A 4W9GA 1E90A 2L0TA 3VHTC 2LGYA 1H8CA 5CHVC 3MJWA 3IVFA 3TMPB 3PT2B 3QA8A 1WXMA 5JH5C 3ZNID 2Y5BB 3QC8B 1BT0A 3DVNV 3U7DA 1G6JA 2ASQA 3VTWA 3APCA 1C3TA 2MQJA 4GDKA 1P1AA 4FJYA 4BKSD 4GB9A 3GOEA 1J0GA 4NNJB 2A4ZA 2ZPNA 3ECIA 4LDTB 2WYQA 4LDTD 2LWPA 2MBBB 4HDQA 4W9FA 1YJ1A 3UGBB 2D3GA 2N1WA 3PV1A 2DAJA 2NBVB 3H1UA 2RGFA 3R66C 3KW5B 4KV2A 4HVBA 4W9KA 3PTFC 5E6NA 5JHAA 3RCZA 2Z0EB 4NQLB 3VDZA 2KWCA 3HK0A 4EFOA 2NBUA 1XQQA 3B1LX 3D32A 2BKFA 3ZRFA 1E8WA 4MGIE 1LQBA 1WGHA 4GDKB 4GN1A 3N30A 5J2RA 1KJTA 2IO2B 4PYZA 1X1MA 4ZYNA 3JYUA 1XD3B 2AL6A 4W9EA 2D10A 5LLIA 3RZFA 3CSTA 4IM3A 4HK2A 5DCNA 2YVCA 2MA9B 2BF8B 3I3TB 3R3MA 4GU2A 1V81A 1ZKHA 2GBRA 3NY5A 1S1QB 3QX1A 3T8MA 4A20A 4K7SA 4FJZA 4K1RB 2RR9A 3PHWB 1TGZB 4PS8A 4NY0A 2M0XA 3PPAA 4XC2A 4IM2A 1GNUA 3IFWB 1YD8U 3DBRI 1HE8A 2KJ6A 3L0WB 3N3KB 1IYFA 2KANA 3EECA 1WR6E 3PGEA 4K81A 4JGHB 1WJNA 4OVUA 2J0KA 4WJNA 1E8XA 1C1YB 3RUIB 4FBJB 4GGQA 4B6WA 3L17A 1VCBA 3OAWA 3DVGX 4AWJA 2L00B 2J0MA 4JIOU 4WJOA 1TBEA 3OJ3A 2KQSA 3KUZA 3RYTA 4TQ0A 2MRPA 2LJ5A 4PYUA 2ZCBA 4BOZB 4TKNA 4LJPB 4IC7B 3KUCB 4URKA 2PE6B 5C1ZA 1WE7A 5KHOA 4I6NB 2MBOA 4JLCA 3EFUA 2DX5B 2K6DB 5DPRA 2GBKA 4FJVB 3W1SC 3KVFB 1IP9A 2D2QA 2FCNA 2LD9A 4KIKA 1GC7A 2KC2A 1WMHA 3NHEB 4WWOA 4DBGA 1WJ4A 4NQKE 3A1QA 4FHKA 4EZLA 1WJ6A 4TV3A 2KFKB 2G4DB 3WIMA 1YX5B 1WXSA 2VRRB 1Q5WB 3K9OB 5D7GA 4IWPA 5DPSA 3ZTCA 1WX7A 2BYFA 4IUMB 1LM8B 3L08A 2DYMA 2L0FA 4WAAA 2BGFA 3M63B 1V5TA 2K1FA 4MGKE 4AJWA 3DVNU 2KZRA 4A3PA 2EMTA 4FHJA 4KIKB 5KHQA 5G2NA 2PJHA 1E5WA 4ZRIA 4MSQB 1GC6A 4IG7B 2DZKA 3A1QB 4TQ1A 3U8ZA 1GJZA 5DPWA 4M8NA 3MHSD 1QZEA 1WGRA 1SIFA 1KOTA 3QCAA 3R7RA 2LRWA 2L76A 5DPTA 1RAXA 3ZLZA 4E71A 4ASWC 4NJ7A 3RULA 3DBLI 2M1MA 4WWNA 2N1VA 2ZNVB 3T9LA 1L7YA 5LXIB 4ICVA 2KWVB 5E6PA 3NZSA 3RZWC 4TUUA 1UD7A 3A9JA 5FR6A 3PVLA 4RM9A 5CX3A 3H7SA 4FULA 3HM3A 2KDIA 2ZVOA 2V3SA 1TZ1A 4GDLA 2ZJDA 4HLEA 2JZZA 3WAPA 5JZEB 2LGDA 3VUXA 1P9DU 2R2OA 3WANA 4BFRA 4LCDE 1Y8RC 4MGYE 3A33B 4BKGA 1V2YA 4KDIC 3W1SA 4M8MA 2C7MB 2WWZA 3H6NA 1ISNA 2V1YA 2FIFA 3LJ3A 4ANWA 2K8BA 5L83A 1WE6A 3L13A 3A9JB 2ZVNA 5IA7A 2GBMA 3VQIA 3AXCA 1E8ZA 2IO1B 4I6PA 4WWPA 3K9PB 3N32A 2KFJA 2I1JA 2K8HA 2JF5A 4MH0E 4DXAB 2LUEA 2D11A 1I35A 2BYEA 2A5UA 4B95A 2KDFB 4GIVA 2KHWB 3TBLD 1WZ0A 2LXAA 2KOXA 1WFYA 2ZEQA 4EZJA 4JL9A 1NI2A 1WIAA 2IY1B 3PSEB 4DDID 3ENEA 1OGWA 1WX8A 1E7VA 4KZ0A 1KM7A 1NDDA 5TR5A 3VUYA 2FNJB 4HWIB 3GZNI 1WR1A 1UGMA 3ZNZB 2KKCA 3H7PA 1UELA 1WH3A 1EF5A 4BVUC 2LXCA 1GG3A 4AOFA 4GXBA 4F8CB 1TTNA 2C9WB 2DYBA 3QAQA 1MG8A 4W9HA 2J0JA 4K7UA 2BWFA 2N7DA 4II3B 3BINA 1UBIA 3EC8A 3HHMA 4DHZE 2HJ8A 2KLCA 2RSUA 2EKEC 3SDLC 2R2QA 1CMXB 4IWQA 2KN5A 2L8JA 3DDCB 1LXDA 1YQBA 4E3CA 2G3QB 3X23A 2KK8A 4EKUA 3S2AA 4WQOB 2K39A 1RFAA 2JVCA 3UQBA 2CHWA 4EUTA 2AWTA 2CKHB 1EO6A 1NBFC 5CTRC 3SD5A 4M0WB 4X57B 2DZJA 3C0RB 1FXTB 2LVPA 2DENB 3ALBA 5AZFA 4I6LB 3VUWA 4ICUA 2C60A 4HCNB 1Z5SB 3M3JA 3V61A 4CO7A 3UIOB 4KSLC 4E74A 5AEKB 2PEAA 4ANXA 2MWSB 2AL3A 3PHXB 1RLFA 2KJRA 2BYVE 3A4SC 4LJOB 1E7UA 3TJPA 5D6JB 2MP2A 1A5RA 1I42A 1J8CA 2HE7A 1UH6A 4II2B 2C7HA 4GSWA 2NS5A 4BOSC 2HD5B 2M4NA 2NVUI 1U4AA 4KVGB 4B9KA 1WM3A 2KLGA 3CF6E 2KVRA 1WGDA 2W9NA 2FAZA 4P7IA 2BKRB 4W9CA 1WMHB 2DZMA 2JZ3B 1V80A 2L7RA 2M17A 3DBHI 4MJSA 1UZXB 2WX0A 3VTVA 2MBQA 2NPTA 3ZDMC 2RD0A 3JVZX 1WXAA 2LZ6A 1S3SG 2MP2B 3UIPB 2CU1A 1OEYA 2WX1A 1WM2A 3Q3FA 3PS6A 2NCNA 3SU8X 3CSFA 2IYDB 4AP4C 1LFDA 4F7ZA 3QHTA 2KMCA 2NR2A 2HTHA 5JHBA 4MDKE 5L95C 2G4SA 2CS4A 5C23A 3OJ4B 1V5OA 4IWOA 1YX6B 4YL8A 3ZKJC 1EUVB 3V6CB 2DAFA 2KO3A 2KNBA 4DHJB 3TCAA 3V62A 5J18A 4DHJD 4GOCA 5EDSA 1P0RA 2WDTB 3DOWA 5G55A 4HCPB 1OQYA 4EZKA 4DHZB 3M62B 3ML9A 2L05A 1J19A 4FN2A 2KTFA 4MGZE 3APDA 2EMSA 3NZUA 2KX3A 2V4LA 2LVOA 1Q0WB 4NJ6A 4OVVA 3KUDB 4ANVA 1GUAB 3P2BA 4IW0A 2MW5A 1WI0A 2AEHA 2MSED 3PRPB 4FLHA 1OEYJ 4GMVA 4MELA 4ANUA 4CYEA 3DQVA 3ZIMA 1WYWB 4WJQA 3AU4A 3UF8A 3APFA 3QIJA 2KX0A 2K6QA 3SHQA 3QK0A 3Q3JA 3ZDTA 1WGYA 4FA6A 2NBWB 3IBEA 3V6EB 4XX5A 4GDLB 2YLMA 2D07B 4MEMA 3DPDA 5CHWA 4BBNC 5J17A 3VFKA 3OLMD 4RMAA 3VTUA 2PE9A 2JT4B 1V86A 2GBJA 2N9XA 2JPHA 3VVWB 1L2NA 3QJZA 3JSVA 3QWZB 1V6EA 2KWUB 5GMVA 4DWFA 4F1SA 3JW0X 3PRMB 3KYDD 1E8YA 4FADA 2FCQA 2JUOA 2O2VA 4CHKA 3IG3A 3L54A 3M95A 5AZGA 4G11A 2CHXA 4BKTA 4AUQC 4ZDVA 2KC1A 4RM8A 2KTRA 1Q1OA 2FCMA 3U30A
chains in the Genus database with same CATH superfamily
5BYSA 1SE9A 3ZXVA 2IO0B 4JWSC 4MM3A 1WJUA 1FXAA 4LNFA 4XE0A 3UQAA 3DWGC 1UBQA 2ZPYA 3AU5A 4ZOHC 2LVQA 1XLPA 4NPNA 2X8XX 2IY0B 2GB1A 3IAM1 3OWEB 1MHHE 2ONQA 3Q3OC 2FIDA 4G3XB 2V4IB 3N1ZC 4ITKA 3BVGA 2IBIB 4HJKA 2INNE 2N9PC 2PVGC 3X0WA 1WGGA 3AMZA 1PQSA 1WX9A 3B08A 1V9JA 1NI3A 2BPSA 2PPHA 2JWZA 4R3DA 1F9JA 3ZTDA 4ZRJA 2XK5A 4YTNB 3L10B 4EEWA 2UYZB 4LNIA 4REZA 1M94A 3EHVA 1F2RI 2SAKA 1GOZA 2KDEB 3AE3B 4P1CC 3TEYA 5T8IA 2MJDA 1L4ZB 1T6BX 4A3OA 2L32A 2I1KA 2G1EA 5H92C 2XK5B 5D2MB 3W5UB 1FO4A 5EE9A 3B0AA 3DBLB 3V60A 3W1YA 2N4FA 2OOBB 1MHXA 2XBBC 4J6IA 1VRAB 4G0NB 2KJHB 4MJSB 1EF1A 3KWLA 3ZNHB 1T0YA 2RDHA 3PLUA 2WHIA 3BY4B 5AUKA 3PLVA 3RT3B 2MEKA 1H8CA 3IVFA 3TMPB 3QA8A 3ZNID 3QC8B 3VR8B 2K0PA 1AN8A 1C78A 3VTWA 1YQ3B 4N6EB 4BKSD 1N5XA 1XXGA 4GB9A 1J0GA 4W9FA 2WYQA 3UGBB 2VZKD 1YJ1A 3SFEB 1GB1A 2DAJA 3Q8CA 4KGTA 1RFKA 3KW5B 1E6EB 3RCZA 5FR3A 2KWCA 4EFOA 3B1LX 2BKFA 2WXNA 1WGHA 1EWYC 3N30A 3MHZA 2M0AA 3JYUA 4W9EA 4HK2A 2YVCA 2MA9B 2WNMA 5HHDG 2BYTA 1SEBD 1S1QB 1I4GA 3AEEB 3Q14C 3PHWB 1TGZB 1HTQA 1L0VB 4XC2A 1GNUA 1YD8U 3DBRI 2KJ6A 1MG4A 1FRDA 1TS3A 4FBJB 4IKGA 4OZBA 2BS2B 2DWQA 2WXIA 1YQ4B 4PYUA 1QT9A 4KGSA 4TKNA 4ARIA 2WQYB 2PE6B 1WE7A 5KHOA 1TZOA 2MBOA 2K6DB 5DPRA 2DBYA 4FJVB 4M02A 2LD9A 3DHGC 4RGTA 2WXLA 1D4BA 2M19A 1WJ6A 3WIMA 2VRRB 1Q5WB 4XWTA 5EE1A 4IWPA 5DPSA 1WX7A 2BYFA 4IUMB 1LM8B 2BVCA 3L08A 1ZXIA 1PFDA 4OZCA 4AJWA 4FHJA 1NYQA 2LEKA 5KHQA 4ZRIA 3NVYA 4MSQB 3B2GA 2DZKA 1EU3A 4TQ1A 4A55A 3CIRB 2LHDA 1QZEA 4RGNA 3AEGB 1SIFA 1E9MA 1KOTA 3RNBC 3WCQA 2LRWA 3J9CA 4NJ7A 1SJHD 2M1MA 3T9LA 1BMLC 3NVZA 5IP4D 1RM6C 3FKYA 3H7SA 4FULA 2KDIA 2ZVOA 2ZJDA 2LGDA 3SFDB 1F2RC 1ENFA 3ZGZA 1V2YA 4M8MA 2WWZA 3P4RB 3LJ3A 5L83A 5EE3A 3AXCA 2NMQA 4MH0E 2LUEA 4ZHPA 2BYEA 2A5UA 4B95A 2KDFB 4GIVA 3PO0A 2KOXA 1WIAA 3ENEA 1BXTA 5TR5A 1QOGA 1FMAD 3VUYA 3H7PA 1VZ6A 1WH3A 4F8CB 3TEXA 2IGDA 1SSNA 3RMKC 3Q69A 3AEAB 2RSUA 2EKEC 3SDLC 3Q6BA 1CMXB 2L8JA 2VH2A 3DDCB 3V3XA 4WH4A 1DOIA 3S2AA 4WQOB 2JVCA 2CHWA 4EUTA 3RNEC 3SD5A 4YTMB 1QF6A 4M0WB 2LVPA 1PGXA 2DENB 4RF0A 4I6LB 1MVKA 1K52A 4HCNB 5EE0A 5AEKB 4ANXA 4O1NA 5D3IB 1E7UA 2WXPA 2MP2A 2HE7A 2BS3B 4II2B 2AQ2B 2C7HA 4GSWA 2NS5A 4BOSC 2E6XA 2HD5B 2INCC 4RNAA 1FXIA 2KVRA 2W9NA 2BKRB 2M17A 3DBHI 2WX0A 2NPTA 3ZDMC 2RD0A 2MP2B 2CU1A 3Q3FA 4LLGM 2NCNA 3SU8X 3DHHC 1LFDA 4F7ZA 1QKZA 2NR2A 1YJIA 2CS4A 3OJ4B 4IWOA 1YX6B 4YL8A 3V6CB 2KO3A 1AWDA 3TCAA 4HCPB 2KYWA 4DHZB 1Y56A 2Y5PA 3APDA 2J42A 2V4LA 2LVOA 4OVVA 1RYJA 4XYCA 4IW0A 4FLHA 3P42A 2WXMA 4MELA 4C7YA 1C79A 4WJQA 2QCZA 1F1HA 2KWDA 2QDFA 4FA6A 3IBEA 3VFKA 4MT5A 2AX5A 1V86A 2I38A 1L2NA 3JSVA 3QWZB 1V6EA 4DWFA 1C9FA 2BS4B 3L54A 5AZGA 4G11A 4BKTA 2KDMA 1XO3A 2KTRA 3NZ3A 4M00A 3RN9C 1I7HA 4W9JA 3AEDB 3JSVB 2GMIC 2E3TA 1AYFA 2LJIA 1CK1A 3VH3B 2WGSA 2REXA 3IHPC 1MFWA 2JSVX 3ZW3A 1NENB 1P7FA 1Z2MA 2C5LC 3AULA 2AQ3B 2D5GA 4HPLB 2KTRB 3FILA 1P98A 2ZCCA 2K3UA 4HXDA 1J7AA 1L6VA 1F52A 5LXHA 4XDDA 2L1AA 2FUHB 3U52E 4N9F4 5G5HA 2KXJA 3DVGY 3ZO5B 4HPMB 3A9KA 1L0YB 2YEPB 2M8SA 3O65B 2MJEA 2KAJA 2UU7A 2K8CA 2KDBA 3P63A 3ML8A 2GOWA 3QARA 2J4XA 4AS1A 3DHIC 3A9KB 2WXHA 4XGAB 4EOYA 2LMCA 2CR5A 3HIZA 4KSKC 4W9IA 2KT7A 1V49A 1FM0D 1OFFA 1R7SA 4PS3A 3WA0A 3TL5A 2JY6A 1WF9A 1YIWA 1K51A 2JXXA 2KACA 4NZLB 1ZPSA 1STEA 2O6VD 5BMHA 2IO3B 1P3QU 2PTLA 1C4AA 1CJEA 2JRIB 1VD2A 1R4NI 2N0SB 4KDLB 1JWSD 2MX2A 2W3RA 1FIQA 2FCSA 1GAQB 5BO4B 3WAOA 4BBNF 4TMAB 3AI5A 4W9GA 3VHTC 2LGYA 3U4EG 1QILA 3PT2B 1WXMA 5JH5C 2X38A 1BT0A 1UWMA 1G6JA 1NEKB 1WSPA 3FAHA 4YTPB 4US9A 1B9RA 3SEBA 4NNJB 2A4ZA 2ZPNA 3ECIA 4LDTD 4HDQA 3PV1A 1J7CA 2RGFA 4HVBA 5E6NA 4NQLB 1MPEA 5HG2A 3TEWA 1AW7A 1KJTA 4ZYNA 2W3SA 5LLIA 1MJDA 3CSTA 4IM3A 5DCNA 2Q5WD 1IUEA 3R3MA 1ZKHA 4C56C 2GBRA 3NY5A 2BQQA 3QX1A 4A20A 4PS8A 2RR9A 4J3OD 1M4VA 4IM2A 1TKYA 3AB5A 4N58A 1XEEA 3N3KB 3AEFB 1YN5A 3EECA 3LYYA 1VR9A 3PGEA 4MM3B 3Q8FA 1SXTA 1WJNA 4OVUA 4D2KA 2WXGA 4WJNA 4BZAA 1C1YB 3BZDB 1ET6A 1I4QA 1TS4A 1A70A 2WXFA 4AWJA 2L00B 1UWXA 4DXGA 1JWMD 4JIOU 3T3NA 2KQSA 1XLOA 4TQ0A 3NJTA 4LJPB 3KUCB 4URKA 5C1ZA 3EFUA 4RH6A 2AQ1B 2KN4A 2GBKA 2BB5A 3EA6A 2D2QA 2FCNA 1PGAA 1GC7A 1WMHA 3NHEB 1K50A 4DBGA 3B9JA 3W2DA 3TUOA 2G4DB 1UNSA 2JWUA 4CQNA 4L2YA 2V9HA 1TYGB 2L52A 1JWAD 2K1FA 2QJLA 4A3PA 1GC6A 3RNGC 3P4SB 3U8ZA 5DPWA 4M8NA 1WGRA 3QCAA 1C4PA 2L76A 5DPTA 2VH1A 3ZLZA 3RULA 3DBLI 4P6VF 2ZNVB 1L7YA 4ICVA 5E6PA 3NZSA 4TUUA 1UD7A 1DGJA 2IDYA 3PVLA 4RM9A 1TZ1A 1XCQL 2IGGA 5JZEB 3UI3A 3VUXA 2WXJA 4MGYE 2JX5A 3A33B 1ZDVA 4BKGA 3W1SA 2C7MB 1ISNA 2LHEA 4A8XC 1TKEA 2V1YA 3AM9A 1WE6A 3L13A 3NS1A 3U30A 3AE5B 1E8ZA 3EGRA 3K9PB 5BMGA 2I1JA 1C77A 1JROA 2WU2B 4HPPA 2JF5A 3BVMA 4DXAB 3NUHB 2D11A 1V97A 4S0RA 2LXAA 1WFYA 4JL9A 3PSEB 3R8BA 3RNFC 3AE1B 1SIJA 2FNJB 4EE2A 4HWIB 1WR1A 4NJCA 3ZNZB 1UELA 1EF5A 1DYQA 1SE2A 3Q3MC 1RWSA 4GXBA 1JQ4A 2C9WB 3QAQA 4W9HA 2J0JA 4K3CA 4IDIA 4II3B 3BINA 2WDQB 2KLCA 1P7EA 2R2QA 2KN5A 1LXDA 2G3QB 1TS5A 2KK8A 3Q2AC 5IKCM 5IN7A 3TEZA 2CJOA 3UQBA 1IGDA 1TJEA 2AWTA 1EO6A 5FKAC 1ZDXA 1IGCA 4C00A 3LB8C 1CZPA 1WWTA 3ALBA 4ICUA 2C60A 1Z5SB 3M3JA 3NRZA 1ET9A 3V61A 3UIOB 4E74A 2PEAA 1L6UA 1UF0A 4LJOB 3TJPA 5D6JB 1J8CA 1UH6A 5FK9C 2G9HD 2M4NA 1GB4A 3VRAB 3MJ5A 2KLGA 1WGDA 2L83A 1D5MC 1V80A 4YWGG 1R4MB 1UZXB 5JXVA 3JVZX 2LZ6A 1S3SG 4NAMA 2LGIA 2WX1A 3AE8B 1WM2A 3PS6A 4OVZA 2JQRB 5C2TB 3PZ7A 1SBBB 1L5PA 4MDKE 2HJ1A 1SE3A 1V5OA 2GI9A 3ZKJC 1EUVB 2DAFA 4DHJD 4GOCA 3RNCC 1OQRA 5G55A 3KLSX 1JRPA 4EZKA 2KQ4X 3M62B 4FN2A 4C4VA 5TSSA 4NJ6A 1T0QC 3KUDB 1KH0A 4DXFA 3P2BA 4GMVA 2AEHA 3PRPB 4ANUA 4ACFA 3ZIMA 1XF5L 1WYWB 3T3OA 2KX0A 3SHQA 3QK0A 3V6EB 2K5PA 5CHWA 5J17A 4KGRA 3OLMD 2QIEB 4RMAA 5AUIA 2PE9A 2JT4B 4C4VB 3ETRA 1KLUD 3QJZA 1N63A 5GMVA 2KWUB 2D3AA 3PRMB 3MC8A 4FADA 5IOIA 4CHKA 3RI7C 3M95A 2CHXA 3AV8A 2KC1A 4RM8A 3NS8A 1K8RB 3LDZE 3ONSA 4LNNA 3GE8C 3PREA 3NG0A 3VH4B 2GBNA 3ZNGC 4DDGD 2Z59B 1N5WA 1D3ZA 4IOIE 3WALA 4KZCA 3N1YC 2LASA 4K7WA 4DK5A 2QHOA 4NAWA 2ZNVC 3H7PB 1VZ8A 2LI5A 3IAS1 3PRZA 2JU6X 2K25A 5E6OA 1ZXHA 2INPE 1ZGUB 1QOAA 3ZRCA 2DZIA 2DYOA 1XCTL 2EELA 4NAWB 5HKHA 4HKZE 3NOBA 1H4RA 3URYA 2DHZA 1VDVA 2KD0A 2ZZPB 2KFKA 1RRBA 3C8YA 4WURA 2N7EA 2C7NB 2D3CA 4HJGE 2IPKD 3KQ4A 3AE2B 3AE6B 1SB3C 3CWIA 1GPXA 4RFBA 2J53A 4XDCA 2KMAA 3KWVA 2IGHA 4M01A 1CQVA 3SR6A 1JW9D 3P4PB 2GRIA 3IXSA 2Y5CA 1SGHA 2K9XA 2Z0DB 1WZ3A 3RPFC 1I4HA 1IPGA 3KH0A 4L1BA 2L3ZA 3TIXA 2V0GA 3CMMB 3LXFA 4AJYB 2NPTB 2KQ7A 3ZVVA 2W55A 4BKSA 3WAMA 1ZW7A 3A4RA 3MP9A 3BIID 2BBCA 2QILA 1KLVA 5D94A 1E90A 2L0TA 5CHVC 3MJWA 3TSSA 4ARCA 1FRRA 3E9SA 2CU3A 3DVNV 3U7DA 4ZHOA 1D5XC 2ASQA 3H8HA 1C3TA 2JZPA 4GDKA 5BYRA 1P1AA 1HZ6A 1DOXA 3GOEA 1V1OA 2VZKB 3I57A 3Q8EA 2KVZA 4RF1A 2N1WA 4Q2JA 3H1UA 3R66C 4KV2A 3PTFC 5JHAA 4OW0A 3VDZA 2NBUA 1QLBB 1XQQA 3D32A 3ZRFA 1E8WA 4MGIE 2TSSA 4GDKB 5J2RA 2INDC 4PYZA 1X1MA 4UDUC 1XD3B 2AL6A 3GZNB 1TS2A 3I3TB 4GU2A 1C76A 1PUTA 3T8MA 4FJZA 4NY0A 1HTOA 3W5VB 3IFWB 1IBXA 1HE8A 3L0WB 2JYEA 2XN9C 2BT6A 4PK1A 2KANA 1WR6E 4JGHB 5H8YE 3BYTB 2J0KA 1BUIC 1E8XA 4B6WA 3ZJVA 2WLBA 1IBXB 3FILB 1HA5A 2EKIA 3BYYB 2WXRA 4H2AA 2SEBD 1SF0A 3RYTA 2MRPA 2PW9A 2MHJA 4ZRPA 4BOZB 4BAXA 4IC7B 4I6NB 1NVID 1TIFA 2DX5B 1YOVB 4KX6B 4XWWA 2H89B 3KVFB 2KC2A 4WWOA 1JCKB 1WJ4A 3A1QA 3BWUD 4EZLA 1T0RC 1WXSA 4GLSC 3AN1A 5D7GA 2N9KA 2FBWB 2DYMA 2BGFA 1V5TA 4WIPA 1E5WA 4IG7B 3A1QB 1FCLA 1GJZA 3MHSD 2CJNA 1FFUA 2XNAC 1TY2A 2JYTA 5LXIB 2KWVB 1TKGA 3RZWC 3IT6B 5FR6A 5CX3A 3N20C 3HM3A 4GDLA 4HLEA 3WAPA 2WS3B 2D3BA 2R2OA 4BFRA 4LCDE 1Y8RC 3H6NA 4OZAA 2ZVNA 2GBMA 3VQIA 4K3BA 4S17A 4KKJA 4MACA 2KFJA 5GXGB 4HRSA 5D3DA 3TBLD 2KHWB 4EZJA 1NI2A 5HI1A 4DDID 1HXYD 1WX8A 4KZ0A 3BVZA 1KM7A 3GB1A 1NDDA 4RGMA 2OHFA 4AOFA 2RDGA 3AE7B 1TTNA 2DYBA 1XLNA 1K53A 2ON8A 1E7PB 2BWFA 4YT0B 4DHZE 2HJ8A 1ROEA 3DWMA 3C19A 1YQBA 4EKUA 2PLPA 2K39A 2CKHB 1WRIA 4PT5A 4MH8A 1F77A 3C0RB 1YN4A 1FNUA 3V05A 1N62A 1YNTE 3VUWA 3Q8BA 3HRDD 4CO7A 4KSLC 3N9YC 1E0ZA 3PHXB 2KJRA 2PKOA 4QAYA 3A4SC 1I42A 1A5RA 3MFGA 4USAA 2NTSA 2NVUI 4B9KA 1WM3A 1WMHB 2DZMA 3NVWA 2QEJC 4MJSA 2MBQA 3RFZB 4LNKA 3UIPB 3CSFA 4AP4C 1J7BA 3RNAC 2YEPF 2G4SA 2WP9B 1UUPA 2KNBA 4FXCA 2WXOA 5J18A 5EDSA 4RCOA 2WDTB 1OQYA 3B2FA 2PIAA 4MGZE 2EMSA 3NZUA 2KX3A 1GUAB 2B76B 1OEYJ 3DQVA 3AU4A 1I4RA 3UF8A 2ZW1A 2K6QA 2NBWB 1N6ZA 4MEMA 4B0MA 2LFIA 2LUMA 2N9XA 2WU5B 4ZYSA 3JW0X 1E8YA 2O2VA 3IG3A 4AUQC 4ZDVA 1VZ7A 3DBRB 1Q1OA 2FCMA 2XEWA 4PS7A 2OJRA 1WXVA 2OJWA 3QQ8B 1SJED 2LRUA 1AARA 2MH7A 3HM6X 1PYWD 2O2VB 2WXQA 1XT9B 3PZ8A 3GE3C 5IO9A 4G50A 3ZUNA 4MSMB 2G45B 2I2YA 2UWQA 4ZRKA 5AZHA 2JXTA 1WRDB 1T0SC 4N59A 5C3JB 1L0XB 2N9EB 2MLBA 1ZOYB 1WY8A 3VXWA 2RMMA 2LGXA 4JQWC 5IAAC 2M56B 1YN3A 3KYCD 1OTRB 2RPVA 4JWUC 2CHZA 1C4CA 1PDXA 1JRUA 2WXKA 2BWES 3UINB 2KMMA 1EM7A 1YJJA 2JRHA 3ABVB 4LNOA 4W9LA 4WJPA 3H9DA 4W9DA 2ACZB 1T3QA 2RPQA 3DCGA 4HEA1 2FE8A 2O6VA 1FD6A 4A6QA 2IZVB 3R7QA 3HUIA 3VAWA 4XZ4A 2MBEA 3EUB2 4IM0A 4DQOC 5CHFA 5BMIA 4HDOA 1EU4A 2MBHA 2MJ3A 2HDEA 1UGJA 1JWUD 2PVOD 2J7QB 2O6VB 1XLQA 1R4MI 1HZ5A 3MTNB 2MCNB 2DLBA 3PZDA 2B3AA 2W82A 3FC4A 2AYOB 3DBSA 3L16A 4WQMA 4C80A 3RD2A 1FNWA 2ZW0A 4JPSA 2Y5BB 1ZE3D 2Z8LA 4HROA 3APCA 3AE9B 2MQJA 4FJYA 1DOYA 4A90A 1FCCC 3R2IA 1VJKA 4LDTB 2LWPA 2MBBB 2D3GA 1N61A 5BYQA 1JMLA 4A9AA 3N1XC 4ZRQA 4OHJA 2NBVB 3ZJTA 3AE4B 4W9KA 2DNFA 2Z0EB 4AQ7A 3HK0A 1LQBA 4LK0M 4GN1A 5I4DA 2IO2B 2D10A 3RZFA 2BF8B 4WAFA 1V81A 1TY0A 4K7SA 2FUG1 4K1RB 2V3NA 2M0XA 3ZQ4A 3PPAA 2LGSA 1TT5B 4KKIA 4US8A 1IYFA 4K81A 3U2SC 1FEHA 4M0WA 3RUIB 4GGQA 3L17A 1VCBA 3OAWA 3DVGX 3ZXRA 1ZP0B 2J0MA 4P1BC 1VLBA 3BK2A 1V1PA 4YXDB 3L4PA 4WJOA 1TBEA 3OJ3A 3KUZA 1HQRD 1EWCA 2LJ5A 2GLSA 2ZCBA 3ZJUA 3IT4B 2N9LA 1B1ZA 2H88B 4JLCA 3W1SC 4LTUA 1IP9A 1V1PB 4KIKA 3DBHB 3W9CB 4NQKE 4FHKA 2N7JA 4TV3A 2KFKB 1YX5B 4RGOS 3VR9B 3K9OB 3ZTCA 1D6EC 4WWMA 4WAAA 2L0FA 3M63B 4MGKE 3DVNU 2KZRA 3E56A 2EMTA 3ZYYX 2BB6A 4KIKB 5G2NA 2PJHA 3GS2A 3NVVA 1JALA 1FNVA 1Q10A 4C7ZA 1F0ZA 3I5JC 3R2TA 1D5ZC 2K22A 3R7RA 1RAXA 3BK1A 4E71A 4ASWC 4WWNA 2N1VA 2Y3AA 1V8CA 3A9JA 2V3SA 1KTKA 1LO5D 2IJ0A 5HFYA 2JZZA 1P9DU 3WANA 2BTEA 1T5XD 2WDVB 3HVZA 4KDIC 2FIFA 1FPYA 4ANWA 2K8BA 1PGBA 3A9JB 1QQRA 4P16A 3AEBB 1E10A 5IA7A 1N60A 2IO1B 4I6PA 3Q3NC 4WWPA 2V3PA 3N32A 4B0EA 2K8HA 1WGKA 2QC8A 1I35A 1WZ0A 2ZEQA 2IY1B 1OGWA 3Q8AA 1KFYB 1E7VA 1MI0A 3OG5A 1QOBA 3GZNI 3P4QB 4JE3B 1UGMA 2KKCA 4BVUC 2LXCA 1GG3A 1MG8A 1LGRA 3EFCA 4K7UA 2N7DA 1UBIA 3EC8A 3HHMA 1ESFA 1KF6B 1L4DB 5E6JA 4IWQA 4E3CA 3X23A 2OEDA 1SE4A 3I63C 1RFAA 1JWBD 5CTRC 1NBFC 4X57B 2DZJA 4YSZB 1FXTB 3VRBB 5AZFA 2RDBC 4HKQA 3P1MA 3AH7A 2NTTA 1FFVA 2QSDA 2QMTA 1ZUD2 2MWSB 2AL3A 1RLFA 2BYVE 3MC9A 3U7ZA 1U4AA 4KVGB 3HVDA 3CF6E 5LNK1 2FAZA 4P7IA 4W9CA 2JZ3B 2L7RA 3VTVA 2PMVA 1R4NB 4YSXB 1WXAA 1I4PA 4L23A 1HEZE 1OEYA 2IYDB 3QHTA 2KMCA 2HTHA 5JHBA 5L95C 5C23A 1KRHA 1QOFA 2J52A 4DHJB 3V62A 1P0RA 3DOWA 3ML9A 4YSYB 2L05A 1J19A 1NYRA 2KTFA 3O13A 1Q0WB 4ANVA 3I9V1 2MW5A 1WI0A 4CYEA 2MSED 2HTME 1WYGA 3APFA 3QIJA 3Q3JA 3ZDTA 1WGYA 4TSSA 4XX5A 4GDLB 2YLMA 1KLGD 2D07B 3DPDA 4BBNC 2ICIA 3VTUA 3AECB 4JX1C 2GBJA 2JPHA 2R61A 1I4XA 3VVWB 2BW2A 4F1SA 1OQQA 5MPOA 3KYDD 2WDRB 2FCQA 2JUOA 1ACCA 1YMHE 3MC0B 1WXQA 2W54A 3GP7A 5G5GA
chains in the Genus database with same CATH topology
1K8RB 1SE9A 2IO0B 2XEWA 3LDZE 4PS7A 3ONSA 4MM3A 2OJRA 1WXVA 1WJUA 3PREA 3VH4B 3QQ8B 2GBNA 4W9JA 3ZNGC 2LRUA 4DDGD 2Z59B 1AARA 3JSVB 2GMIC 3UQAA 3HM6X 3VH3B 2O2VB 1UBQA 2REXA 2ZPYA 3AU5A 1XT9B 3IHPC 3ZW3A 1D3ZA 3WALA 4G50A 3ZUNA 4KZCA 1Z2MA 2C5LC 3AULA 2LVQA 4MSMB 2LASA 4HPLB 2G45B 2KTRB 4NPNA 1P98A 4K7WA 4DK5A 2UWQA 2IY0B 2QHOA 4NAWA 2ZNVC 2ZCCA 4ZRKA 5AZHA 3H7PB 4HXDA 1WRDB 2LI5A 5LXHA 2FIDA 4G3XB 3PRZA 2N9EB 2FUHB 2K25A 2MLBA 1WY8A 5E6OA 3VXWA 2IBIB 4N9F4 1ZGUB 4HJKA 2LGXA 2KXJA 4JQWC 5IAAC 2N9PC 3DVGY 3ZO5B 4HPMB 3X0WA 3ZRCA 3A9KA 1WGGA 2DZIA 2M8SA 3KYCD 1OTRB 2DYOA 1PQSA 1WX9A 2CHZA 3B08A 3O65B 4NAWB 5HKHA 1V9JA 2BPSA 1JRUA 2BWES 3NOBA 1H4RA 2PPHA 2JWZA 2DHZA 2K8CA 3UINB 2KDBA 2JRHA 1F9JA 2KD0A 4W9LA 4WJPA 2ZZPB 2KFKA 1RRBA 3H9DA 3ML8A 4ZRJA 3ZTDA 4W9DA 2XK5A 2GOWA 2N7EA 2C7NB 3L10B 3QARA 4EEWA 2RPQA 2UYZB 3DCGA 1M94A 3A9KB 3EHVA 2O6VA 4EOYA 2CR5A 2IZVB 2KDEB 3HIZA 3R7QA 3VAWA 2KMAA 4KSKC 4XZ4A 4W9IA 2MBEA 1V49A 3NS8A 4A3OA 4IM0A 2I1KA 4PS3A 5CHFA 3WA0A 2XK5B 3TL5A 5D2MB 4HDOA 2JY6A 1WF9A 2MBHA 1YIWA 1SGHA 2Z0DB 1WZ3A 3B0AA 2JXXA 3V60A 2J7QB 3W1YA 2N4FA 2O6VB 2OOBB 2O6VD 2XBBC 1IPGA 4J6IA 2IO3B 1P3QU 2KJHB 2L3ZA 3KH0A 1R4MI 4G0NB 3TIXA 4MJSB 3CMMB 1EF1A 3MTNB 4AJYB 2NPTB 2MCNB 2KQ7A 2JRIB 3ZNHB 3ZVVA 4BKSA 1VD2A 3WAMA 1R4NI 4KDLB 1T0YA 3PZDA 3PLUA 1ZW7A 2MX2A 3A4RA 2B3AA 3BY4B 2FCSA 2AYOB 3DBSA 3L16A 5BO4B 3WAOA 4BBNF 3PLVA 3RT3B 3AI5A 3RD2A 1KLVA 5D94A 4W9GA 1E90A 2L0TA 3VHTC 2LGYA 1H8CA 5CHVC 3MJWA 3IVFA 3TMPB 3PT2B 3QA8A 1WXMA 5JH5C 3ZNID 2Y5BB 3QC8B 1BT0A 3DVNV 3U7DA 1G6JA 2ASQA 3VTWA 3APCA 1C3TA 2MQJA 4GDKA 1P1AA 4FJYA 4BKSD 4GB9A 3GOEA 1J0GA 4NNJB 2A4ZA 2ZPNA 3ECIA 4LDTB 2WYQA 4LDTD 2LWPA 2MBBB 4HDQA 4W9FA 1YJ1A 3UGBB 2D3GA 2N1WA 3PV1A 2DAJA 2NBVB 3H1UA 2RGFA 3R66C 3KW5B 4KV2A 4HVBA 4W9KA 3PTFC 5E6NA 5JHAA 3RCZA 2Z0EB 4NQLB 3VDZA 2KWCA 3HK0A 4EFOA 2NBUA 1XQQA 3B1LX 3D32A 2BKFA 3ZRFA 1E8WA 4MGIE 1LQBA 1WGHA 4GDKB 4GN1A 3N30A 5J2RA 1KJTA 2IO2B 4PYZA 1X1MA 4ZYNA 3JYUA 1XD3B 2AL6A 4W9EA 2D10A 5LLIA 3RZFA 3CSTA 4IM3A 4HK2A 5DCNA 2YVCA 2MA9B 2BF8B 3I3TB 3R3MA 4GU2A 1V81A 1ZKHA 2GBRA 3NY5A 1S1QB 3QX1A 3T8MA 4A20A 4K7SA 4FJZA 4K1RB 2RR9A 3PHWB 1TGZB 4PS8A 4NY0A 2M0XA 3PPAA 4XC2A 4IM2A 1GNUA 3IFWB 1YD8U 3DBRI 1HE8A 2KJ6A 3L0WB 3N3KB 1IYFA 2KANA 3EECA 1WR6E 3PGEA 4K81A 4JGHB 1WJNA 4OVUA 2J0KA 4WJNA 1E8XA 1C1YB 3RUIB 4FBJB 4GGQA 4B6WA 3L17A 1VCBA 3OAWA 3DVGX 4AWJA 2L00B 2J0MA 4JIOU 4WJOA 1TBEA 3OJ3A 2KQSA 3KUZA 3RYTA 4TQ0A 2MRPA 2LJ5A 4PYUA 2ZCBA 4BOZB 4TKNA 4LJPB 4IC7B 3KUCB 4URKA 2PE6B 5C1ZA 1WE7A 5KHOA 4I6NB 2MBOA 4JLCA 3EFUA 2DX5B 2K6DB 5DPRA 2GBKA 4FJVB 3W1SC 3KVFB 1IP9A 2D2QA 2FCNA 2LD9A 4KIKA 1GC7A 2KC2A 1WMHA 3NHEB 4WWOA 4DBGA 1WJ4A 4NQKE 3A1QA 4FHKA 4EZLA 1WJ6A 4TV3A 2KFKB 2G4DB 3WIMA 1YX5B 1WXSA 2VRRB 1Q5WB 3K9OB 5D7GA 4IWPA 5DPSA 3ZTCA 1WX7A 2BYFA 4IUMB 1LM8B 3L08A 2DYMA 2L0FA 4WAAA 2BGFA 3M63B 1V5TA 2K1FA 4MGKE 4AJWA 3DVNU 2KZRA 4A3PA 2EMTA 4FHJA 4KIKB 5KHQA 5G2NA 2PJHA 1E5WA 4ZRIA 4MSQB 1GC6A 4IG7B 2DZKA 3A1QB 4TQ1A 3U8ZA 1GJZA 5DPWA 4M8NA 3MHSD 1QZEA 1WGRA 1SIFA 1KOTA 3QCAA 3R7RA 2LRWA 2L76A 5DPTA 1RAXA 3ZLZA 4E71A 4ASWC 4NJ7A 3RULA 3DBLI 2M1MA 4WWNA 2N1VA 2ZNVB 3T9LA 1L7YA 5LXIB 4ICVA 2KWVB 5E6PA 3NZSA 3RZWC 4TUUA 1UD7A 3A9JA 5FR6A 3PVLA 4RM9A 5CX3A 3H7SA 4FULA 3HM3A 2KDIA 2ZVOA 2V3SA 1TZ1A 4GDLA 2ZJDA 4HLEA 2JZZA 3WAPA 5JZEB 2LGDA 3VUXA 1P9DU 2R2OA 3WANA 4BFRA 4LCDE 1Y8RC 4MGYE 3A33B 4BKGA 1V2YA 4KDIC 3W1SA 4M8MA 2C7MB 2WWZA 3H6NA 1ISNA 2V1YA 2FIFA 3LJ3A 4ANWA 2K8BA 5L83A 1WE6A 3L13A 3A9JB 2ZVNA 5IA7A 2GBMA 3VQIA 3AXCA 1E8ZA 2IO1B 4I6PA 4WWPA 3K9PB 3N32A 2KFJA 2I1JA 2K8HA 2JF5A 4MH0E 4DXAB 2LUEA 2D11A 1I35A 2BYEA 2A5UA 4B95A 2KDFB 4GIVA 2KHWB 3TBLD 1WZ0A 2LXAA 2KOXA 1WFYA 2ZEQA 4EZJA 4JL9A 1NI2A 1WIAA 2IY1B 3PSEB 4DDID 3ENEA 1OGWA 1WX8A 1E7VA 4KZ0A 1KM7A 1NDDA 5TR5A 3VUYA 2FNJB 4HWIB 3GZNI 1WR1A 1UGMA 3ZNZB 2KKCA 3H7PA 1UELA 1WH3A 1EF5A 4BVUC 2LXCA 1GG3A 4AOFA 4GXBA 4F8CB 1TTNA 2C9WB 2DYBA 3QAQA 1MG8A 4W9HA 2J0JA 4K7UA 2BWFA 2N7DA 4II3B 3BINA 1UBIA 3EC8A 3HHMA 4DHZE 2HJ8A 2KLCA 2RSUA 2EKEC 3SDLC 2R2QA 1CMXB 4IWQA 2KN5A 2L8JA 3DDCB 1LXDA 1YQBA 4E3CA 2G3QB 3X23A 2KK8A 4EKUA 3S2AA 4WQOB 2K39A 1RFAA 2JVCA 3UQBA 2CHWA 4EUTA 2AWTA 2CKHB 1EO6A 1NBFC 5CTRC 3SD5A 4M0WB 4X57B 2DZJA 3C0RB 1FXTB 2LVPA 2DENB 3ALBA 5AZFA 4I6LB 3VUWA 4ICUA 2C60A 4HCNB 1Z5SB 3M3JA 3V61A 4CO7A 3UIOB 4KSLC 4E74A 5AEKB 2PEAA 4ANXA 2MWSB 2AL3A 3PHXB 1RLFA 2KJRA 2BYVE 3A4SC 4LJOB 1E7UA 3TJPA 5D6JB 2MP2A 1A5RA 1I42A 1J8CA 2HE7A 1UH6A 4II2B 2C7HA 4GSWA 2NS5A 4BOSC 2HD5B 2M4NA 2NVUI 1U4AA 4KVGB 4B9KA 1WM3A 2KLGA 3CF6E 2KVRA 1WGDA 2W9NA 2FAZA 4P7IA 2BKRB 4W9CA 1WMHB 2DZMA 2JZ3B 1V80A 2L7RA 2M17A 3DBHI 4MJSA 1UZXB 2WX0A 3VTVA 2MBQA 2NPTA 3ZDMC 2RD0A 3JVZX 1WXAA 2LZ6A 1S3SG 2MP2B 3UIPB 2CU1A 1OEYA 2WX1A 1WM2A 3Q3FA 3PS6A 2NCNA 3SU8X 3CSFA 2IYDB 4AP4C 1LFDA 4F7ZA 3QHTA 2KMCA 2NR2A 2HTHA 5JHBA 4MDKE 5L95C 2G4SA 2CS4A 5C23A 3OJ4B 1V5OA 4IWOA 1YX6B 4YL8A 3ZKJC 1EUVB 3V6CB 2DAFA 2KO3A 2KNBA 4DHJB 3TCAA 3V62A 5J18A 4DHJD 4GOCA 5EDSA 1P0RA 2WDTB 3DOWA 5G55A 4HCPB 1OQYA 4EZKA 4DHZB 3M62B 3ML9A 2L05A 1J19A 4FN2A 2KTFA 4MGZE 3APDA 2EMSA 3NZUA 2KX3A 2V4LA 2LVOA 1Q0WB 4NJ6A 4OVVA 3KUDB 4ANVA 1GUAB 3P2BA 4IW0A 2MW5A 1WI0A 2AEHA 2MSED 3PRPB 4FLHA 1OEYJ 4GMVA 4MELA 4ANUA 4CYEA 3DQVA 3ZIMA 1WYWB 4WJQA 3AU4A 3UF8A 3APFA 3QIJA 2KX0A 2K6QA 3SHQA 3QK0A 3Q3JA 3ZDTA 1WGYA 4FA6A 2NBWB 3IBEA 3V6EB 4XX5A 4GDLB 2YLMA 2D07B 4MEMA 3DPDA 5CHWA 4BBNC 5J17A 3VFKA 3OLMD 4RMAA 3VTUA 2PE9A 2JT4B 1V86A 2GBJA 2N9XA 2JPHA 3VVWB 1L2NA 3QJZA 3JSVA 3QWZB 1V6EA 2KWUB 5GMVA 4DWFA 4F1SA 3JW0X 3PRMB 3KYDD 1E8YA 4FADA 2FCQA 2JUOA 2O2VA 4CHKA 3IG3A 3L54A 3M95A 5AZGA 4G11A 2CHXA 4BKTA 4AUQC 4ZDVA 2KC1A 4RM8A 2KTRA 1Q1OA 2FCMA 3U30A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K8R B;  1SE9 A;  2IO0 B;  2XEW A;  3LDZ E;  4PS7 A;  3ONS A;  4MM3 A;  2OJR A;  1WXV A;  1WJU A;  3PRE A;  3VH4 B;  3QQ8 B;  2GBN A;  4W9J A;  3ZNG C;  2LRU A;  4DDG D;  2Z59 B;  1AAR A;  3JSV B;  2GMI C;  3UQA A;  3HM6 X;  3VH3 B;  2O2V B;  1UBQ A;  2REX A;  2ZPY A;  3AU5 A;  1XT9 B;  3IHP C;  3ZW3 A;  1D3Z A;  3WAL A;  4G50 A;  3ZUN A;  4KZC A;  1Z2M A;  2C5L C;  3AUL A;  2LVQ A;  4MSM B;  2LAS A;  4HPL B;  2G45 B;  2KTR B;  4NPN A;  1P98 A;  4K7W A;  4DK5 A;  2UWQ A;  2IY0 B;  2QHO A;  4NAW A;  2ZNV C;  2ZCC A;  4ZRK A;  5AZH A;  3H7P B;  4HXD A;  1WRD B;  2LI5 A;  5LXH A;  2FID A;  4G3X B;  3PRZ A;  2N9E B;  2FUH B;  2K25 A;  2MLB A;  1WY8 A;  5E6O A;  3VXW A;  2IBI B;  4N9F 4;  1ZGU B;  4HJK A;  2LGX A;  2KXJ A;  4JQW C;  5IAA C;  2N9P C;  3DVG Y;  3ZO5 B;  4HPM B;  3X0W A;  3ZRC A;  3A9K A;  1WGG A;  2DZI A;  2M8S A;  3KYC D;  1OTR B;  2DYO A;  1PQS A;  1WX9 A;  2CHZ A;  3B08 A;  3O65 B;  4NAW B;  5HKH A;  1V9J A;  2BPS A;  1JRU A;  2BWE S;  3NOB A;  1H4R A;  2PPH A;  2JWZ A;  2DHZ A;  2K8C A;  3UIN B;  2KDB A;  2JRH A;  1F9J A;  2KD0 A;  4W9L A;  4WJP A;  2ZZP B;  2KFK A;  1RRB A;  3H9D A;  3ML8 A;  4ZRJ A;  3ZTD A;  4W9D A;  2XK5 A;  2GOW A;  2N7E A;  2C7N B;  3L10 B;  3QAR A;  4EEW A;  2RPQ A;  2UYZ B;  3DCG A;  1M94 A;  3A9K B;  3EHV A;  2O6V A;  4EOY A;  2CR5 A;  2IZV B;  2KDE B;  3HIZ A;  3R7Q A;  3VAW A;  2KMA A;  4KSK C;  4XZ4 A;  4W9I A;  2MBE A;  1V49 A;  3NS8 A;  4A3O A;  4IM0 A;  2I1K A;  4PS3 A;  5CHF A;  3WA0 A;  2XK5 B;  3TL5 A;  5D2M B;  4HDO A;  2JY6 A;  1WF9 A;  2MBH A;  1YIW A;  1SGH A;  2Z0D B;  1WZ3 A;  3B0A A;  2JXX A;  3V60 A;  2J7Q B;  3W1Y A;  2N4F A;  2O6V B;  2OOB B;  2O6V D;  2XBB C;  1IPG A;  4J6I A;  2IO3 B;  1P3Q U;  2KJH B;  2L3Z A;  3KH0 A;  1R4M I;  4G0N B;  3TIX A;  4MJS B;  3CMM B;  1EF1 A;  3MTN B;  4AJY B;  2NPT B;  2MCN B;  2KQ7 A;  2JRI B;  3ZNH B;  3ZVV A;  4BKS A;  1VD2 A;  3WAM A;  1R4N I;  4KDL B;  1T0Y A;  3PZD A;  3PLU A;  1ZW7 A;  2MX2 A;  3A4R A;  2B3A A;  3BY4 B;  2FCS A;  2AYO B;  3DBS A;  3L16 A;  5BO4 B;  3WAO A;  4BBN F;  3PLV A;  3RT3 B;  3AI5 A;  3RD2 A;  1KLV A;  5D94 A;  4W9G A;  1E90 A;  2L0T A;  3VHT C;  2LGY A;  1H8C A;  5CHV C;  3MJW A;  3IVF A;  3TMP B;  3PT2 B;  3QA8 A;  1WXM A;  5JH5 C;  3ZNI D;  2Y5B B;  3QC8 B;  1BT0 A;  3DVN V;  3U7D A;  1G6J A;  2ASQ A;  3VTW A;  3APC A;  1C3T A;  2MQJ A;  4GDK A;  1P1A A;  4FJY A;  4BKS D;  4GB9 A;  3GOE A;  1J0G A;  4NNJ B;  2A4Z A;  2ZPN A;  3ECI A;  4LDT B;  2WYQ A;  4LDT D;  2LWP A;  2MBB B;  4HDQ A;  4W9F A;  1YJ1 A;  3UGB B;  2D3G A;  2N1W A;  3PV1 A;  2DAJ A;  2NBV B;  3H1U A;  2RGF A;  3R66 C;  3KW5 B;  4KV2 A;  4HVB A;  4W9K A;  3PTF C;  5E6N A;  5JHA A;  3RCZ A;  2Z0E B;  4NQL B;  3VDZ A;  2KWC A;  3HK0 A;  4EFO A;  2NBU A;  1XQQ A;  3B1L X;  3D32 A;  2BKF A;  3ZRF A;  1E8W A;  4MGI E;  1LQB A;  1WGH A;  4GDK B;  4GN1 A;  3N30 A;  5J2R A;  1KJT A;  2IO2 B;  4PYZ A;  1X1M A;  4ZYN A;  3JYU A;  1XD3 B;  2AL6 A;  4W9E A;  2D10 A;  5LLI A;  3RZF A;  3CST A;  4IM3 A;  4HK2 A;  5DCN A;  2YVC A;  2MA9 B;  2BF8 B;  3I3T B;  3R3M A;  4GU2 A;  1V81 A;  1ZKH A;  2GBR A;  3NY5 A;  1S1Q B;  3QX1 A;  3T8M A;  4A20 A;  4K7S A;  4FJZ A;  4K1R B;  2RR9 A;  3PHW B;  1TGZ B;  4PS8 A;  4NY0 A;  2M0X A;  3PPA A;  4XC2 A;  4IM2 A;  1GNU A;  3IFW B;  1YD8 U;  3DBR I;  1HE8 A;  2KJ6 A;  3L0W B;  3N3K B;  1IYF A;  2KAN A;  3EEC A;  1WR6 E;  3PGE A;  4K81 A;  4JGH B;  1WJN A;  4OVU A;  2J0K A;  4WJN A;  1E8X A;  1C1Y B;  3RUI B;  4FBJ B;  4GGQ A;  4B6W A;  3L17 A;  1VCB A;  3OAW A;  3DVG X;  4AWJ A;  2L00 B;  2J0M A;  4JIO U;  4WJO A;  1TBE A;  3OJ3 A;  2KQS A;  3KUZ A;  3RYT A;  4TQ0 A;  2MRP A;  2LJ5 A;  4PYU A;  2ZCB A;  4BOZ B;  4TKN A;  4LJP B;  4IC7 B;  3KUC B;  4URK A;  2PE6 B;  5C1Z A;  1WE7 A;  5KHO A;  4I6N B;  2MBO A;  4JLC A;  3EFU A;  2DX5 B;  2K6D B;  5DPR A;  2GBK A;  4FJV B;  3W1S C;  3KVF B;  1IP9 A;  2D2Q A;  2FCN A;  2LD9 A;  4KIK A;  1GC7 A;  2KC2 A;  1WMH A;  3NHE B;  4WWO A;  4DBG A;  1WJ4 A;  4NQK E;  3A1Q A;  4FHK A;  4EZL A;  1WJ6 A;  4TV3 A;  2KFK B;  2G4D B;  3WIM A;  1YX5 B;  1WXS A;  2VRR B;  1Q5W B;  3K9O B;  5D7G A;  4IWP A;  5DPS A;  3ZTC A;  1WX7 A;  2BYF A;  4IUM B;  1LM8 B;  3L08 A;  2DYM A;  2L0F A;  4WAA A;  2BGF A;  3M63 B;  1V5T A;  2K1F A;  4MGK E;  4AJW A;  3DVN U;  2KZR A;  4A3P A;  2EMT A;  4FHJ A;  4KIK B;  5KHQ A;  5G2N A;  2PJH A;  1E5W A;  4ZRI A;  4MSQ B;  1GC6 A;  4IG7 B;  2DZK A;  3A1Q B;  4TQ1 A;  3U8Z A;  1GJZ A;  5DPW A;  4M8N A;  3MHS D;  1QZE A;  1WGR A;  1SIF A;  1KOT A;  3QCA A;  3R7R A;  2LRW A;  2L76 A;  5DPT A;  1RAX A;  3ZLZ A;  4E71 A;  4ASW C;  4NJ7 A;  3RUL A;  3DBL I;  2M1M A;  4WWN A;  2N1V A;  2ZNV B;  3T9L A;  1L7Y A;  5LXI B;  4ICV A;  2KWV B;  5E6P A;  3NZS A;  3RZW C;  4TUU A;  1UD7 A;  3A9J A;  5FR6 A;  3PVL A;  4RM9 A;  5CX3 A;  3H7S A;  4FUL A;  3HM3 A;  2KDI A;  2ZVO A;  2V3S A;  1TZ1 A;  4GDL A;  2ZJD A;  4HLE A;  2JZZ A;  3WAP A;  5JZE B;  2LGD A;  3VUX A;  1P9D U;  2R2O A;  3WAN A;  4BFR A;  4LCD E;  1Y8R C;  4MGY E;  3A33 B;  4BKG A;  1V2Y A;  4KDI C;  3W1S A;  4M8M A;  2C7M B;  2WWZ A;  3H6N A;  1ISN A;  2V1Y A;  2FIF A;  3LJ3 A;  4ANW A;  2K8B A;  5L83 A;  1WE6 A;  3L13 A;  3A9J B;  2ZVN A;  5IA7 A;  2GBM A;  3VQI A;  3AXC A;  1E8Z A;  2IO1 B;  4I6P A;  4WWP A;  3K9P B;  3N32 A;  2KFJ A;  2I1J A;  2K8H A;  2JF5 A;  4MH0 E;  4DXA B;  2LUE A;  2D11 A;  1I35 A;  2BYE A;  2A5U A;  4B95 A;  2KDF B;  4GIV A;  2KHW B;  3TBL D;  1WZ0 A;  2LXA A;  2KOX A;  1WFY A;  2ZEQ A;  4EZJ A;  4JL9 A;  1NI2 A;  1WIA A;  2IY1 B;  3PSE B;  4DDI D;  3ENE A;  1OGW A;  1WX8 A;  1E7V A;  4KZ0 A;  1KM7 A;  1NDD A;  5TR5 A;  3VUY A;  2FNJ B;  4HWI B;  3GZN I;  1WR1 A;  1UGM A;  3ZNZ B;  2KKC A;  3H7P A;  1UEL A;  1WH3 A;  1EF5 A;  4BVU C;  2LXC A;  1GG3 A;  4AOF A;  4GXB A;  4F8C B;  1TTN A;  2C9W B;  2DYB A;  3QAQ A;  1MG8 A;  4W9H A;  2J0J A;  4K7U A;  2BWF A;  2N7D A;  4II3 B;  3BIN A;  1UBI A;  3EC8 A;  3HHM A;  4DHZ E;  2HJ8 A;  2KLC A;  2RSU A;  2EKE C;  3SDL C;  2R2Q A;  1CMX B;  4IWQ A;  2KN5 A;  2L8J A;  3DDC B;  1LXD A;  1YQB A;  4E3C A;  2G3Q B;  3X23 A;  2KK8 A;  4EKU A;  3S2A A;  4WQO B;  2K39 A;  1RFA A;  2JVC A;  3UQB A;  2CHW A;  4EUT A;  2AWT A;  2CKH B;  1EO6 A;  1NBF C;  5CTR C;  3SD5 A;  4M0W B;  4X57 B;  2DZJ A;  3C0R B;  1FXT B;  2LVP A;  2DEN B;  3ALB A;  5AZF A;  4I6L B;  3VUW A;  4ICU A;  2C60 A;  4HCN B;  1Z5S B;  3M3J A;  3V61 A;  4CO7 A;  3UIO B;  4KSL C;  4E74 A;  5AEK B;  2PEA A;  4ANX A;  2MWS B;  2AL3 A;  3PHX B;  1RLF A;  2KJR A;  2BYV E;  3A4S C;  4LJO B;  1E7U A;  3TJP A;  5D6J B;  2MP2 A;  1A5R A;  1I42 A;  1J8C A;  2HE7 A;  1UH6 A;  4II2 B;  2C7H A;  4GSW A;  2NS5 A;  4BOS C;  2HD5 B;  2M4N A;  2NVU I;  1U4A A;  4KVG B;  4B9K A;  1WM3 A;  2KLG A;  3CF6 E;  2KVR A;  1WGD A;  2W9N A;  2FAZ A;  4P7I A;  2BKR B;  4W9C A;  1WMH B;  2DZM A;  2JZ3 B;  1V80 A;  2L7R A;  2M17 A;  3DBH I;  4MJS A;  1UZX B;  2WX0 A;  3VTV A;  2MBQ A;  2NPT A;  3ZDM C;  2RD0 A;  3JVZ X;  1WXA A;  2LZ6 A;  1S3S G;  2MP2 B;  3UIP B;  2CU1 A;  1OEY A;  2WX1 A;  1WM2 A;  3Q3F A;  3PS6 A;  2NCN A;  3SU8 X;  3CSF A;  2IYD B;  4AP4 C;  1LFD A;  4F7Z A;  3QHT A;  2KMC A;  2NR2 A;  2HTH A;  5JHB A;  4MDK E;  5L95 C;  2G4S A;  2CS4 A;  5C23 A;  3OJ4 B;  1V5O A;  4IWO A;  1YX6 B;  4YL8 A;  3ZKJ C;  1EUV B;  3V6C B;  2DAF A;  2KO3 A;  2KNB A;  4DHJ B;  3TCA A;  3V62 A;  5J18 A;  4DHJ D;  4GOC A;  5EDS A;  1P0R A;  2WDT B;  3DOW A;  5G55 A;  4HCP B;  1OQY A;  4EZK A;  4DHZ B;  3M62 B;  3ML9 A;  2L05 A;  1J19 A;  4FN2 A;  2KTF A;  4MGZ E;  3APD A;  2EMS A;  3NZU A;  2KX3 A;  2V4L A;  2LVO A;  1Q0W B;  4NJ6 A;  4OVV A;  3KUD B;  4ANV A;  1GUA B;  3P2B A;  4IW0 A;  2MW5 A;  1WI0 A;  2AEH A;  2MSE D;  3PRP B;  4FLH A;  1OEY J;  4GMV A;  4MEL A;  4ANU A;  4CYE A;  3DQV A;  3ZIM A;  1WYW B;  4WJQ A;  3AU4 A;  3UF8 A;  3APF A;  3QIJ A;  2KX0 A;  2K6Q A;  3SHQ A;  3QK0 A;  3Q3J A;  3ZDT A;  1WGY A;  4FA6 A;  2NBW B;  3IBE A;  3V6E B;  4XX5 A;  4GDL B;  2YLM A;  2D07 B;  4MEM A;  3DPD A;  5CHW A;  4BBN C;  5J17 A;  3VFK A;  3OLM D;  4RMA A;  3VTU A;  2PE9 A;  2JT4 B;  1V86 A;  2GBJ A;  2N9X A;  2JPH A;  3VVW B;  1L2N A;  3QJZ A;  3JSV A;  3QWZ B;  1V6E A;  2KWU B;  5GMV A;  4DWF A;  4F1S A;  3JW0 X;  3PRM B;  3KYD D;  1E8Y A;  4FAD A;  2FCQ A;  2JUO A;  2O2V A;  4CHK A;  3IG3 A;  3L54 A;  3M95 A;  5AZG A;  4G11 A;  2CHX A;  4BKT A;  4AUQ C;  4ZDV A;  2KC1 A;  4RM8 A;  2KTR A;  1Q1O A;  2FCM A;  3U30 A; 
#chains in the Genus database with same CATH topology
 5BYS A;  1SE9 A;  3ZXV A;  2IO0 B;  4JWS C;  4MM3 A;  1WJU A;  1FXA A;  4LNF A;  4XE0 A;  3UQA A;  3DWG C;  1UBQ A;  2ZPY A;  3AU5 A;  4ZOH C;  2LVQ A;  1XLP A;  4NPN A;  2X8X X;  2IY0 B;  2GB1 A;  3IAM 1;  3OWE B;  1MHH E;  2ONQ A;  3Q3O C;  2FID A;  4G3X B;  2V4I B;  3N1Z C;  4ITK A;  3BVG A;  2IBI B;  4HJK A;  2INN E;  2N9P C;  2PVG C;  3X0W A;  1WGG A;  3AMZ A;  1PQS A;  1WX9 A;  3B08 A;  1V9J A;  1NI3 A;  2BPS A;  2PPH A;  2JWZ A;  4R3D A;  1F9J A;  3ZTD A;  4ZRJ A;  2XK5 A;  4YTN B;  3L10 B;  4EEW A;  2UYZ B;  4LNI A;  4REZ A;  1M94 A;  3EHV A;  1F2R I;  2SAK A;  1GOZ A;  2KDE B;  3AE3 B;  4P1C C;  3TEY A;  5T8I A;  2MJD A;  1L4Z B;  1T6B X;  4A3O A;  2L32 A;  2I1K A;  2G1E A;  5H92 C;  2XK5 B;  5D2M B;  3W5U B;  1FO4 A;  5EE9 A;  3B0A A;  3DBL B;  3V60 A;  3W1Y A;  2N4F A;  2OOB B;  1MHX A;  2XBB C;  4J6I A;  1VRA B;  4G0N B;  2KJH B;  4MJS B;  1EF1 A;  3KWL A;  3ZNH B;  1T0Y A;  2RDH A;  3PLU A;  2WHI A;  3BY4 B;  5AUK A;  3PLV A;  3RT3 B;  2MEK A;  1H8C A;  3IVF A;  3TMP B;  3QA8 A;  3ZNI D;  3QC8 B;  3VR8 B;  2K0P A;  1AN8 A;  1C78 A;  3VTW A;  1YQ3 B;  4N6E B;  4BKS D;  1N5X A;  1XXG A;  4GB9 A;  1J0G A;  4W9F A;  2WYQ A;  3UGB B;  2VZK D;  1YJ1 A;  3SFE B;  1GB1 A;  2DAJ A;  3Q8C A;  4KGT A;  1RFK A;  3KW5 B;  1E6E B;  3RCZ A;  5FR3 A;  2KWC A;  4EFO A;  3B1L X;  2BKF A;  2WXN A;  1WGH A;  1EWY C;  3N30 A;  3MHZ A;  2M0A A;  3JYU A;  4W9E A;  4HK2 A;  2YVC A;  2MA9 B;  2WNM A;  5HHD G;  2BYT A;  1SEB D;  1S1Q B;  1I4G A;  3AEE B;  3Q14 C;  3PHW B;  1TGZ B;  1HTQ A;  1L0V B;  4XC2 A;  1GNU A;  1YD8 U;  3DBR I;  2KJ6 A;  1MG4 A;  1FRD A;  1TS3 A;  4FBJ B;  4IKG A;  4OZB A;  2BS2 B;  2DWQ A;  2WXI A;  1YQ4 B;  4PYU A;  1QT9 A;  4KGS A;  4TKN A;  4ARI A;  2WQY B;  2PE6 B;  1WE7 A;  5KHO A;  1TZO A;  2MBO A;  2K6D B;  5DPR A;  2DBY A;  4FJV B;  4M02 A;  2LD9 A;  3DHG C;  4RGT A;  2WXL A;  1D4B A;  2M19 A;  1WJ6 A;  3WIM A;  2VRR B;  1Q5W B;  4XWT A;  5EE1 A;  4IWP A;  5DPS A;  1WX7 A;  2BYF A;  4IUM B;  1LM8 B;  2BVC A;  3L08 A;  1ZXI A;  1PFD A;  4OZC A;  4AJW A;  4FHJ A;  1NYQ A;  2LEK A;  5KHQ A;  4ZRI A;  3NVY A;  4MSQ B;  3B2G A;  2DZK A;  1EU3 A;  4TQ1 A;  4A55 A;  3CIR B;  2LHD A;  1QZE A;  4RGN A;  3AEG B;  1SIF A;  1E9M A;  1KOT A;  3RNB C;  3WCQ A;  2LRW A;  3J9C A;  4NJ7 A;  1SJH D;  2M1M A;  3T9L A;  1BML C;  3NVZ A;  5IP4 D;  1RM6 C;  3FKY A;  3H7S A;  4FUL A;  2KDI A;  2ZVO A;  2ZJD A;  2LGD A;  3SFD B;  1F2R C;  1ENF A;  3ZGZ A;  1V2Y A;  4M8M A;  2WWZ A;  3P4R B;  3LJ3 A;  5L83 A;  5EE3 A;  3AXC A;  2NMQ A;  4MH0 E;  2LUE A;  4ZHP A;  2BYE A;  2A5U A;  4B95 A;  2KDF B;  4GIV A;  3PO0 A;  2KOX A;  1WIA A;  3ENE A;  1BXT A;  5TR5 A;  1QOG A;  1FMA D;  3VUY A;  3H7P A;  1VZ6 A;  1WH3 A;  4F8C B;  3TEX A;  2IGD A;  1SSN A;  3RMK C;  3Q69 A;  3AEA B;  2RSU A;  2EKE C;  3SDL C;  3Q6B A;  1CMX B;  2L8J A;  2VH2 A;  3DDC B;  3V3X A;  4WH4 A;  1DOI A;  3S2A A;  4WQO B;  2JVC A;  2CHW A;  4EUT A;  3RNE C;  3SD5 A;  4YTM B;  1QF6 A;  4M0W B;  2LVP A;  1PGX A;  2DEN B;  4RF0 A;  4I6L B;  1MVK A;  1K52 A;  4HCN B;  5EE0 A;  5AEK B;  4ANX A;  4O1N A;  5D3I B;  1E7U A;  2WXP A;  2MP2 A;  2HE7 A;  2BS3 B;  4II2 B;  2AQ2 B;  2C7H A;  4GSW A;  2NS5 A;  4BOS C;  2E6X A;  2HD5 B;  2INC C;  4RNA A;  1FXI A;  2KVR A;  2W9N A;  2BKR B;  2M17 A;  3DBH I;  2WX0 A;  2NPT A;  3ZDM C;  2RD0 A;  2MP2 B;  2CU1 A;  3Q3F A;  4LLG M;  2NCN A;  3SU8 X;  3DHH C;  1LFD A;  4F7Z A;  1QKZ A;  2NR2 A;  1YJI A;  2CS4 A;  3OJ4 B;  4IWO A;  1YX6 B;  4YL8 A;  3V6C B;  2KO3 A;  1AWD A;  3TCA A;  4HCP B;  2KYW A;  4DHZ B;  1Y56 A;  2Y5P A;  3APD A;  2J42 A;  2V4L A;  2LVO A;  4OVV A;  1RYJ A;  4XYC A;  4IW0 A;  4FLH A;  3P42 A;  2WXM A;  4MEL A;  4C7Y A;  1C79 A;  4WJQ A;  2QCZ A;  1F1H A;  2KWD A;  2QDF A;  4FA6 A;  3IBE A;  3VFK A;  4MT5 A;  2AX5 A;  1V86 A;  2I38 A;  1L2N A;  3JSV A;  3QWZ B;  1V6E A;  4DWF A;  1C9F A;  2BS4 B;  3L54 A;  5AZG A;  4G11 A;  4BKT A;  2KDM A;  1XO3 A;  2KTR A;  3NZ3 A;  4M00 A;  3RN9 C;  1I7H A;  4W9J A;  3AED B;  3JSV B;  2GMI C;  2E3T A;  1AYF A;  2LJI A;  1CK1 A;  3VH3 B;  2WGS A;  2REX A;  3IHP C;  1MFW A;  2JSV X;  3ZW3 A;  1NEN B;  1P7F A;  1Z2M A;  2C5L C;  3AUL A;  2AQ3 B;  2D5G A;  4HPL B;  2KTR B;  3FIL A;  1P98 A;  2ZCC A;  2K3U A;  4HXD A;  1J7A A;  1L6V A;  1F52 A;  5LXH A;  4XDD A;  2L1A A;  2FUH B;  3U52 E;  4N9F 4;  5G5H A;  2KXJ A;  3DVG Y;  3ZO5 B;  4HPM B;  3A9K A;  1L0Y B;  2YEP B;  2M8S A;  3O65 B;  2MJE A;  2KAJ A;  2UU7 A;  2K8C A;  2KDB A;  3P63 A;  3ML8 A;  2GOW A;  3QAR A;  2J4X A;  4AS1 A;  3DHI C;  3A9K B;  2WXH A;  4XGA B;  4EOY A;  2LMC A;  2CR5 A;  3HIZ A;  4KSK C;  4W9I A;  2KT7 A;  1V49 A;  1FM0 D;  1OFF A;  1R7S A;  4PS3 A;  3WA0 A;  3TL5 A;  2JY6 A;  1WF9 A;  1YIW A;  1K51 A;  2JXX A;  2KAC A;  4NZL B;  1ZPS A;  1STE A;  2O6V D;  5BMH A;  2IO3 B;  1P3Q U;  2PTL A;  1C4A A;  1CJE A;  2JRI B;  1VD2 A;  1R4N I;  2N0S B;  4KDL B;  1JWS D;  2MX2 A;  2W3R A;  1FIQ A;  2FCS A;  1GAQ B;  5BO4 B;  3WAO A;  4BBN F;  4TMA B;  3AI5 A;  4W9G A;  3VHT C;  2LGY A;  3U4E G;  1QIL A;  3PT2 B;  1WXM A;  5JH5 C;  2X38 A;  1BT0 A;  1UWM A;  1G6J A;  1NEK B;  1WSP A;  3FAH A;  4YTP B;  4US9 A;  1B9R A;  3SEB A;  4NNJ B;  2A4Z A;  2ZPN A;  3ECI A;  4LDT D;  4HDQ A;  3PV1 A;  1J7C A;  2RGF A;  4HVB A;  5E6N A;  4NQL B;  1MPE A;  5HG2 A;  3TEW A;  1AW7 A;  1KJT A;  4ZYN A;  2W3S A;  5LLI A;  1MJD A;  3CST A;  4IM3 A;  5DCN A;  2Q5W D;  1IUE A;  3R3M A;  1ZKH A;  4C56 C;  2GBR A;  3NY5 A;  2BQQ A;  3QX1 A;  4A20 A;  4PS8 A;  2RR9 A;  4J3O D;  1M4V A;  4IM2 A;  1TKY A;  3AB5 A;  4N58 A;  1XEE A;  3N3K B;  3AEF B;  1YN5 A;  3EEC A;  3LYY A;  1VR9 A;  3PGE A;  4MM3 B;  3Q8F A;  1SXT A;  1WJN A;  4OVU A;  4D2K A;  2WXG A;  4WJN A;  4BZA A;  1C1Y B;  3BZD B;  1ET6 A;  1I4Q A;  1TS4 A;  1A70 A;  2WXF A;  4AWJ A;  2L00 B;  1UWX A;  4DXG A;  1JWM D;  4JIO U;  3T3N A;  2KQS A;  1XLO A;  4TQ0 A;  3NJT A;  4LJP B;  3KUC B;  4URK A;  5C1Z A;  3EFU A;  4RH6 A;  2AQ1 B;  2KN4 A;  2GBK A;  2BB5 A;  3EA6 A;  2D2Q A;  2FCN A;  1PGA A;  1GC7 A;  1WMH A;  3NHE B;  1K50 A;  4DBG A;  3B9J A;  3W2D A;  3TUO A;  2G4D B;  1UNS A;  2JWU A;  4CQN A;  4L2Y A;  2V9H A;  1TYG B;  2L52 A;  1JWA D;  2K1F A;  2QJL A;  4A3P A;  1GC6 A;  3RNG C;  3P4S B;  3U8Z A;  5DPW A;  4M8N A;  1WGR A;  3QCA A;  1C4P A;  2L76 A;  5DPT A;  2VH1 A;  3ZLZ A;  3RUL A;  3DBL I;  4P6V F;  2ZNV B;  1L7Y A;  4ICV A;  5E6P A;  3NZS A;  4TUU A;  1UD7 A;  1DGJ A;  2IDY A;  3PVL A;  4RM9 A;  1TZ1 A;  1XCQ L;  2IGG A;  5JZE B;  3UI3 A;  3VUX A;  2WXJ A;  4MGY E;  2JX5 A;  3A33 B;  1ZDV A;  4BKG A;  3W1S A;  2C7M B;  1ISN A;  2LHE A;  4A8X C;  1TKE A;  2V1Y A;  3AM9 A;  1WE6 A;  3L13 A;  3NS1 A;  3U30 A;  3AE5 B;  1E8Z A;  3EGR A;  3K9P B;  5BMG A;  2I1J A;  1C77 A;  1JRO A;  2WU2 B;  4HPP A;  2JF5 A;  3BVM A;  4DXA B;  3NUH B;  2D11 A;  1V97 A;  4S0R A;  2LXA A;  1WFY A;  4JL9 A;  3PSE B;  3R8B A;  3RNF C;  3AE1 B;  1SIJ A;  2FNJ B;  4EE2 A;  4HWI B;  1WR1 A;  4NJC A;  3ZNZ B;  1UEL A;  1EF5 A;  1DYQ A;  1SE2 A;  3Q3M C;  1RWS A;  4GXB A;  1JQ4 A;  2C9W B;  3QAQ A;  4W9H A;  2J0J A;  4K3C A;  4IDI A;  4II3 B;  3BIN A;  2WDQ B;  2KLC A;  1P7E A;  2R2Q A;  2KN5 A;  1LXD A;  2G3Q B;  1TS5 A;  2KK8 A;  3Q2A C;  5IKC M;  5IN7 A;  3TEZ A;  2CJO A;  3UQB A;  1IGD A;  1TJE A;  2AWT A;  1EO6 A;  5FKA C;  1ZDX A;  1IGC A;  4C00 A;  3LB8 C;  1CZP A;  1WWT A;  3ALB A;  4ICU A;  2C60 A;  1Z5S B;  3M3J A;  3NRZ A;  1ET9 A;  3V61 A;  3UIO B;  4E74 A;  2PEA A;  1L6U A;  1UF0 A;  4LJO B;  3TJP A;  5D6J B;  1J8C A;  1UH6 A;  5FK9 C;  2G9H D;  2M4N A;  1GB4 A;  3VRA B;  3MJ5 A;  2KLG A;  1WGD A;  2L83 A;  1D5M C;  1V80 A;  4YWG G;  1R4M B;  1UZX B;  5JXV A;  3JVZ X;  2LZ6 A;  1S3S G;  4NAM A;  2LGI A;  2WX1 A;  3AE8 B;  1WM2 A;  3PS6 A;  4OVZ A;  2JQR B;  5C2T B;  3PZ7 A;  1SBB B;  1L5P A;  4MDK E;  2HJ1 A;  1SE3 A;  1V5O A;  2GI9 A;  3ZKJ C;  1EUV B;  2DAF A;  4DHJ D;  4GOC A;  3RNC C;  1OQR A;  5G55 A;  3KLS X;  1JRP A;  4EZK A;  2KQ4 X;  3M62 B;  4FN2 A;  4C4V A;  5TSS A;  4NJ6 A;  1T0Q C;  3KUD B;  1KH0 A;  4DXF A;  3P2B A;  4GMV A;  2AEH A;  3PRP B;  4ANU A;  4ACF A;  3ZIM A;  1XF5 L;  1WYW B;  3T3O A;  2KX0 A;  3SHQ A;  3QK0 A;  3V6E B;  2K5P A;  5CHW A;  5J17 A;  4KGR A;  3OLM D;  2QIE B;  4RMA A;  5AUI A;  2PE9 A;  2JT4 B;  4C4V B;  3ETR A;  1KLU D;  3QJZ A;  1N63 A;  5GMV A;  2KWU B;  2D3A A;  3PRM B;  3MC8 A;  4FAD A;  5IOI A;  4CHK A;  3RI7 C;  3M95 A;  2CHX A;  3AV8 A;  2KC1 A;  4RM8 A;  3NS8 A;  1K8R B;  3LDZ E;  3ONS A;  4LNN A;  3GE8 C;  3PRE A;  3NG0 A;  3VH4 B;  2GBN A;  3ZNG C;  4DDG D;  2Z59 B;  1N5W A;  1D3Z A;  4IOI E;  3WAL A;  4KZC A;  3N1Y C;  2LAS A;  4K7W A;  4DK5 A;  2QHO A;  4NAW A;  2ZNV C;  3H7P B;  1VZ8 A;  2LI5 A;  3IAS 1;  3PRZ A;  2JU6 X;  2K25 A;  5E6O A;  1ZXH A;  2INP E;  1ZGU B;  1QOA A;  3ZRC A;  2DZI A;  2DYO A;  1XCT L;  2EEL A;  4NAW B;  5HKH A;  4HKZ E;  3NOB A;  1H4R A;  3URY A;  2DHZ A;  1VDV A;  2KD0 A;  2ZZP B;  2KFK A;  1RRB A;  3C8Y A;  4WUR A;  2N7E A;  2C7N B;  2D3C A;  4HJG E;  2IPK D;  3KQ4 A;  3AE2 B;  3AE6 B;  1SB3 C;  3CWI A;  1GPX A;  4RFB A;  2J53 A;  4XDC A;  2KMA A;  3KWV A;  2IGH A;  4M01 A;  1CQV A;  3SR6 A;  1JW9 D;  3P4P B;  2GRI A;  3IXS A;  2Y5C A;  1SGH A;  2K9X A;  2Z0D B;  1WZ3 A;  3RPF C;  1I4H A;  1IPG A;  3KH0 A;  4L1B A;  2L3Z A;  3TIX A;  2V0G A;  3CMM B;  3LXF A;  4AJY B;  2NPT B;  2KQ7 A;  3ZVV A;  2W55 A;  4BKS A;  3WAM A;  1ZW7 A;  3A4R A;  3MP9 A;  3BII D;  2BBC A;  2QIL A;  1KLV A;  5D94 A;  1E90 A;  2L0T A;  5CHV C;  3MJW A;  3TSS A;  4ARC A;  1FRR A;  3E9S A;  2CU3 A;  3DVN V;  3U7D A;  4ZHO A;  1D5X C;  2ASQ A;  3H8H A;  1C3T A;  2JZP A;  4GDK A;  5BYR A;  1P1A A;  1HZ6 A;  1DOX A;  3GOE A;  1V1O A;  2VZK B;  3I57 A;  3Q8E A;  2KVZ A;  4RF1 A;  2N1W A;  4Q2J A;  3H1U A;  3R66 C;  4KV2 A;  3PTF C;  5JHA A;  4OW0 A;  3VDZ A;  2NBU A;  1QLB B;  1XQQ A;  3D32 A;  3ZRF A;  1E8W A;  4MGI E;  2TSS A;  4GDK B;  5J2R A;  2IND C;  4PYZ A;  1X1M A;  4UDU C;  1XD3 B;  2AL6 A;  3GZN B;  1TS2 A;  3I3T B;  4GU2 A;  1C76 A;  1PUT A;  3T8M A;  4FJZ A;  4NY0 A;  1HTO A;  3W5V B;  3IFW B;  1IBX A;  1HE8 A;  3L0W B;  2JYE A;  2XN9 C;  2BT6 A;  4PK1 A;  2KAN A;  1WR6 E;  4JGH B;  5H8Y E;  3BYT B;  2J0K A;  1BUI C;  1E8X A;  4B6W A;  3ZJV A;  2WLB A;  1IBX B;  3FIL B;  1HA5 A;  2EKI A;  3BYY B;  2WXR A;  4H2A A;  2SEB D;  1SF0 A;  3RYT A;  2MRP A;  2PW9 A;  2MHJ A;  4ZRP A;  4BOZ B;  4BAX A;  4IC7 B;  4I6N B;  1NVI D;  1TIF A;  2DX5 B;  1YOV B;  4KX6 B;  4XWW A;  2H89 B;  3KVF B;  2KC2 A;  4WWO A;  1JCK B;  1WJ4 A;  3A1Q A;  3BWU D;  4EZL A;  1T0R C;  1WXS A;  4GLS C;  3AN1 A;  5D7G A;  2N9K A;  2FBW B;  2DYM A;  2BGF A;  1V5T A;  4WIP A;  1E5W A;  4IG7 B;  3A1Q B;  1FCL A;  1GJZ A;  3MHS D;  2CJN A;  1FFU A;  2XNA C;  1TY2 A;  2JYT A;  5LXI B;  2KWV B;  1TKG A;  3RZW C;  3IT6 B;  5FR6 A;  5CX3 A;  3N20 C;  3HM3 A;  4GDL A;  4HLE A;  3WAP A;  2WS3 B;  2D3B A;  2R2O A;  4BFR A;  4LCD E;  1Y8R C;  3H6N A;  4OZA A;  2ZVN A;  2GBM A;  3VQI A;  4K3B A;  4S17 A;  4KKJ A;  4MAC A;  2KFJ A;  5GXG B;  4HRS A;  5D3D A;  3TBL D;  2KHW B;  4EZJ A;  1NI2 A;  5HI1 A;  4DDI D;  1HXY D;  1WX8 A;  4KZ0 A;  3BVZ A;  1KM7 A;  3GB1 A;  1NDD A;  4RGM A;  2OHF A;  4AOF A;  2RDG A;  3AE7 B;  1TTN A;  2DYB A;  1XLN A;  1K53 A;  2ON8 A;  1E7P B;  2BWF A;  4YT0 B;  4DHZ E;  2HJ8 A;  1ROE A;  3DWM A;  3C19 A;  1YQB A;  4EKU A;  2PLP A;  2K39 A;  2CKH B;  1WRI A;  4PT5 A;  4MH8 A;  1F77 A;  3C0R B;  1YN4 A;  1FNU A;  3V05 A;  1N62 A;  1YNT E;  3VUW A;  3Q8B A;  3HRD D;  4CO7 A;  4KSL C;  3N9Y C;  1E0Z A;  3PHX B;  2KJR A;  2PKO A;  4QAY A;  3A4S C;  1I42 A;  1A5R A;  3MFG A;  4USA A;  2NTS A;  2NVU I;  4B9K A;  1WM3 A;  1WMH B;  2DZM A;  3NVW A;  2QEJ C;  4MJS A;  2MBQ A;  3RFZ B;  4LNK A;  3UIP B;  3CSF A;  4AP4 C;  1J7B A;  3RNA C;  2YEP F;  2G4S A;  2WP9 B;  1UUP A;  2KNB A;  4FXC A;  2WXO A;  5J18 A;  5EDS A;  4RCO A;  2WDT B;  1OQY A;  3B2F A;  2PIA A;  4MGZ E;  2EMS A;  3NZU A;  2KX3 A;  1GUA B;  2B76 B;  1OEY J;  3DQV A;  3AU4 A;  1I4R A;  3UF8 A;  2ZW1 A;  2K6Q A;  2NBW B;  1N6Z A;  4MEM A;  4B0M A;  2LFI A;  2LUM A;  2N9X A;  2WU5 B;  4ZYS A;  3JW0 X;  1E8Y A;  2O2V A;  3IG3 A;  4AUQ C;  4ZDV A;  1VZ7 A;  3DBR B;  1Q1O A;  2FCM A;  2XEW A;  4PS7 A;  2OJR A;  1WXV A;  2OJW A;  3QQ8 B;  1SJE D;  2LRU A;  1AAR A;  2MH7 A;  3HM6 X;  1PYW D;  2O2V B;  2WXQ A;  1XT9 B;  3PZ8 A;  3GE3 C;  5IO9 A;  4G50 A;  3ZUN A;  4MSM B;  2G45 B;  2I2Y A;  2UWQ A;  4ZRK A;  5AZH A;  2JXT A;  1WRD B;  1T0S C;  4N59 A;  5C3J B;  1L0X B;  2N9E B;  2MLB A;  1ZOY B;  1WY8 A;  3VXW A;  2RMM A;  2LGX A;  4JQW C;  5IAA C;  2M56 B;  1YN3 A;  3KYC D;  1OTR B;  2RPV A;  4JWU C;  2CHZ A;  1C4C A;  1PDX A;  1JRU A;  2WXK A;  2BWE S;  3UIN B;  2KMM A;  1EM7 A;  1YJJ A;  2JRH A;  3ABV B;  4LNO A;  4W9L A;  4WJP A;  3H9D A;  4W9D A;  2ACZ B;  1T3Q A;  2RPQ A;  3DCG A;  4HEA 1;  2FE8 A;  2O6V A;  1FD6 A;  4A6Q A;  2IZV B;  3R7Q A;  3HUI A;  3VAW A;  4XZ4 A;  2MBE A;  3EUB 2;  4IM0 A;  4DQO C;  5CHF A;  5BMI A;  4HDO A;  1EU4 A;  2MBH A;  2MJ3 A;  2HDE A;  1UGJ A;  1JWU D;  2PVO D;  2J7Q B;  2O6V B;  1XLQ A;  1R4M I;  1HZ5 A;  3MTN B;  2MCN B;  2DLB A;  3PZD A;  2B3A A;  2W82 A;  3FC4 A;  2AYO B;  3DBS A;  3L16 A;  4WQM A;  4C80 A;  3RD2 A;  1FNW A;  2ZW0 A;  4JPS A;  2Y5B B;  1ZE3 D;  2Z8L A;  4HRO A;  3APC A;  3AE9 B;  2MQJ A;  4FJY A;  1DOY A;  4A90 A;  1FCC C;  3R2I A;  1VJK A;  4LDT B;  2LWP A;  2MBB B;  2D3G A;  1N61 A;  5BYQ A;  1JML A;  4A9A A;  3N1X C;  4ZRQ A;  4OHJ A;  2NBV B;  3ZJT A;  3AE4 B;  4W9K A;  2DNF A;  2Z0E B;  4AQ7 A;  3HK0 A;  1LQB A;  4LK0 M;  4GN1 A;  5I4D A;  2IO2 B;  2D10 A;  3RZF A;  2BF8 B;  4WAF A;  1V81 A;  1TY0 A;  4K7S A;  2FUG 1;  4K1R B;  2V3N A;  2M0X A;  3ZQ4 A;  3PPA A;  2LGS A;  1TT5 B;  4KKI A;  4US8 A;  1IYF A;  4K81 A;  3U2S C;  1FEH A;  4M0W A;  3RUI B;  4GGQ A;  3L17 A;  1VCB A;  3OAW A;  3DVG X;  3ZXR A;  1ZP0 B;  2J0M A;  4P1B C;  1VLB A;  3BK2 A;  1V1P A;  4YXD B;  3L4P A;  4WJO A;  1TBE A;  3OJ3 A;  3KUZ A;  1HQR D;  1EWC A;  2LJ5 A;  2GLS A;  2ZCB A;  3ZJU A;  3IT4 B;  2N9L A;  1B1Z A;  2H88 B;  4JLC A;  3W1S C;  4LTU A;  1IP9 A;  1V1P B;  4KIK A;  3DBH B;  3W9C B;  4NQK E;  4FHK A;  2N7J A;  4TV3 A;  2KFK B;  1YX5 B;  4RGO S;  3VR9 B;  3K9O B;  3ZTC A;  1D6E C;  4WWM A;  4WAA A;  2L0F A;  3M63 B;  4MGK E;  3DVN U;  2KZR A;  3E56 A;  2EMT A;  3ZYY X;  2BB6 A;  4KIK B;  5G2N A;  2PJH A;  3GS2 A;  3NVV A;  1JAL A;  1FNV A;  1Q10 A;  4C7Z A;  1F0Z A;  3I5J C;  3R2T A;  1D5Z C;  2K22 A;  3R7R A;  1RAX A;  3BK1 A;  4E71 A;  4ASW C;  4WWN A;  2N1V A;  2Y3A A;  1V8C A;  3A9J A;  2V3S A;  1KTK A;  1LO5 D;  2IJ0 A;  5HFY A;  2JZZ A;  1P9D U;  3WAN A;  2BTE A;  1T5X D;  2WDV B;  3HVZ A;  4KDI C;  2FIF A;  1FPY A;  4ANW A;  2K8B A;  1PGB A;  3A9J B;  1QQR A;  4P16 A;  3AEB B;  1E10 A;  5IA7 A;  1N60 A;  2IO1 B;  4I6P A;  3Q3N C;  4WWP A;  2V3P A;  3N32 A;  4B0E A;  2K8H A;  1WGK A;  2QC8 A;  1I35 A;  1WZ0 A;  2ZEQ A;  2IY1 B;  1OGW A;  3Q8A A;  1KFY B;  1E7V A;  1MI0 A;  3OG5 A;  1QOB A;  3GZN I;  3P4Q B;  4JE3 B;  1UGM A;  2KKC A;  4BVU C;  2LXC A;  1GG3 A;  1MG8 A;  1LGR A;  3EFC A;  4K7U A;  2N7D A;  1UBI A;  3EC8 A;  3HHM A;  1ESF A;  1KF6 B;  1L4D B;  5E6J A;  4IWQ A;  4E3C A;  3X23 A;  2OED A;  1SE4 A;  3I63 C;  1RFA A;  1JWB D;  5CTR C;  1NBF C;  4X57 B;  2DZJ A;  4YSZ B;  1FXT B;  3VRB B;  5AZF A;  2RDB C;  4HKQ A;  3P1M A;  3AH7 A;  2NTT A;  1FFV A;  2QSD A;  2QMT A;  1ZUD 2;  2MWS B;  2AL3 A;  1RLF A;  2BYV E;  3MC9 A;  3U7Z A;  1U4A A;  4KVG B;  3HVD A;  3CF6 E;  5LNK 1;  2FAZ A;  4P7I A;  4W9C A;  2JZ3 B;  2L7R A;  3VTV A;  2PMV A;  1R4N B;  4YSX B;  1WXA A;  1I4P A;  4L23 A;  1HEZ E;  1OEY A;  2IYD B;  3QHT A;  2KMC A;  2HTH A;  5JHB A;  5L95 C;  5C23 A;  1KRH A;  1QOF A;  2J52 A;  4DHJ B;  3V62 A;  1P0R A;  3DOW A;  3ML9 A;  4YSY B;  2L05 A;  1J19 A;  1NYR A;  2KTF A;  3O13 A;  1Q0W B;  4ANV A;  3I9V 1;  2MW5 A;  1WI0 A;  4CYE A;  2MSE D;  2HTM E;  1WYG A;  3APF A;  3QIJ A;  3Q3J A;  3ZDT A;  1WGY A;  4TSS A;  4XX5 A;  4GDL B;  2YLM A;  1KLG D;  2D07 B;  3DPD A;  4BBN C;  2ICI A;  3VTU A;  3AEC B;  4JX1 C;  2GBJ A;  2JPH A;  2R61 A;  1I4X A;  3VVW B;  2BW2 A;  4F1S A;  1OQQ A;  5MPO A;  3KYD D;  2WDR B;  2FCQ A;  2JUO A;  1ACC A;  1YMH E;  3MC0 B;  1WXQ A;  2W54 A;  3GP7 A;  5G5G A; 
#chains in the Genus database with same CATH homology
 1K8R B;  1SE9 A;  2IO0 B;  2XEW A;  3LDZ E;  4PS7 A;  3ONS A;  4MM3 A;  2OJR A;  1WXV A;  1WJU A;  3PRE A;  3VH4 B;  3QQ8 B;  2GBN A;  4W9J A;  3ZNG C;  2LRU A;  4DDG D;  2Z59 B;  1AAR A;  3JSV B;  2GMI C;  3UQA A;  3HM6 X;  3VH3 B;  2O2V B;  1UBQ A;  2REX A;  2ZPY A;  3AU5 A;  1XT9 B;  3IHP C;  3ZW3 A;  1D3Z A;  3WAL A;  4G50 A;  3ZUN A;  4KZC A;  1Z2M A;  2C5L C;  3AUL A;  2LVQ A;  4MSM B;  2LAS A;  4HPL B;  2G45 B;  2KTR B;  4NPN A;  1P98 A;  4K7W A;  4DK5 A;  2UWQ A;  2IY0 B;  2QHO A;  4NAW A;  2ZNV C;  2ZCC A;  4ZRK A;  5AZH A;  3H7P B;  4HXD A;  1WRD B;  2LI5 A;  5LXH A;  2FID A;  4G3X B;  3PRZ A;  2N9E B;  2FUH B;  2K25 A;  2MLB A;  1WY8 A;  5E6O A;  3VXW A;  2IBI B;  4N9F 4;  1ZGU B;  4HJK A;  2LGX A;  2KXJ A;  4JQW C;  5IAA C;  2N9P C;  3DVG Y;  3ZO5 B;  4HPM B;  3X0W A;  3ZRC A;  3A9K A;  1WGG A;  2DZI A;  2M8S A;  3KYC D;  1OTR B;  2DYO A;  1PQS A;  1WX9 A;  2CHZ A;  3B08 A;  3O65 B;  4NAW B;  5HKH A;  1V9J A;  2BPS A;  1JRU A;  2BWE S;  3NOB A;  1H4R A;  2PPH A;  2JWZ A;  2DHZ A;  2K8C A;  3UIN B;  2KDB A;  2JRH A;  1F9J A;  2KD0 A;  4W9L A;  4WJP A;  2ZZP B;  2KFK A;  1RRB A;  3H9D A;  3ML8 A;  4ZRJ A;  3ZTD A;  4W9D A;  2XK5 A;  2GOW A;  2N7E A;  2C7N B;  3L10 B;  3QAR A;  4EEW A;  2RPQ A;  2UYZ B;  3DCG A;  1M94 A;  3A9K B;  3EHV A;  2O6V A;  4EOY A;  2CR5 A;  2IZV B;  2KDE B;  3HIZ A;  3R7Q A;  3VAW A;  2KMA A;  4KSK C;  4XZ4 A;  4W9I A;  2MBE A;  1V49 A;  3NS8 A;  4A3O A;  4IM0 A;  2I1K A;  4PS3 A;  5CHF A;  3WA0 A;  2XK5 B;  3TL5 A;  5D2M B;  4HDO A;  2JY6 A;  1WF9 A;  2MBH A;  1YIW A;  1SGH A;  2Z0D B;  1WZ3 A;  3B0A A;  2JXX A;  3V60 A;  2J7Q B;  3W1Y A;  2N4F A;  2O6V B;  2OOB B;  2O6V D;  2XBB C;  1IPG A;  4J6I A;  2IO3 B;  1P3Q U;  2KJH B;  2L3Z A;  3KH0 A;  1R4M I;  4G0N B;  3TIX A;  4MJS B;  3CMM B;  1EF1 A;  3MTN B;  4AJY B;  2NPT B;  2MCN B;  2KQ7 A;  2JRI B;  3ZNH B;  3ZVV A;  4BKS A;  1VD2 A;  3WAM A;  1R4N I;  4KDL B;  1T0Y A;  3PZD A;  3PLU A;  1ZW7 A;  2MX2 A;  3A4R A;  2B3A A;  3BY4 B;  2FCS A;  2AYO B;  3DBS A;  3L16 A;  5BO4 B;  3WAO A;  4BBN F;  3PLV A;  3RT3 B;  3AI5 A;  3RD2 A;  1KLV A;  5D94 A;  4W9G A;  1E90 A;  2L0T A;  3VHT C;  2LGY A;  1H8C A;  5CHV C;  3MJW A;  3IVF A;  3TMP B;  3PT2 B;  3QA8 A;  1WXM A;  5JH5 C;  3ZNI D;  2Y5B B;  3QC8 B;  1BT0 A;  3DVN V;  3U7D A;  1G6J A;  2ASQ A;  3VTW A;  3APC A;  1C3T A;  2MQJ A;  4GDK A;  1P1A A;  4FJY A;  4BKS D;  4GB9 A;  3GOE A;  1J0G A;  4NNJ B;  2A4Z A;  2ZPN A;  3ECI A;  4LDT B;  2WYQ A;  4LDT D;  2LWP A;  2MBB B;  4HDQ A;  4W9F A;  1YJ1 A;  3UGB B;  2D3G A;  2N1W A;  3PV1 A;  2DAJ A;  2NBV B;  3H1U A;  2RGF A;  3R66 C;  3KW5 B;  4KV2 A;  4HVB A;  4W9K A;  3PTF C;  5E6N A;  5JHA A;  3RCZ A;  2Z0E B;  4NQL B;  3VDZ A;  2KWC A;  3HK0 A;  4EFO A;  2NBU A;  1XQQ A;  3B1L X;  3D32 A;  2BKF A;  3ZRF A;  1E8W A;  4MGI E;  1LQB A;  1WGH A;  4GDK B;  4GN1 A;  3N30 A;  5J2R A;  1KJT A;  2IO2 B;  4PYZ A;  1X1M A;  4ZYN A;  3JYU A;  1XD3 B;  2AL6 A;  4W9E A;  2D10 A;  5LLI A;  3RZF A;  3CST A;  4IM3 A;  4HK2 A;  5DCN A;  2YVC A;  2MA9 B;  2BF8 B;  3I3T B;  3R3M A;  4GU2 A;  1V81 A;  1ZKH A;  2GBR A;  3NY5 A;  1S1Q B;  3QX1 A;  3T8M A;  4A20 A;  4K7S A;  4FJZ A;  4K1R B;  2RR9 A;  3PHW B;  1TGZ B;  4PS8 A;  4NY0 A;  2M0X A;  3PPA A;  4XC2 A;  4IM2 A;  1GNU A;  3IFW B;  1YD8 U;  3DBR I;  1HE8 A;  2KJ6 A;  3L0W B;  3N3K B;  1IYF A;  2KAN A;  3EEC A;  1WR6 E;  3PGE A;  4K81 A;  4JGH B;  1WJN A;  4OVU A;  2J0K A;  4WJN A;  1E8X A;  1C1Y B;  3RUI B;  4FBJ B;  4GGQ A;  4B6W A;  3L17 A;  1VCB A;  3OAW A;  3DVG X;  4AWJ A;  2L00 B;  2J0M A;  4JIO U;  4WJO A;  1TBE A;  3OJ3 A;  2KQS A;  3KUZ A;  3RYT A;  4TQ0 A;  2MRP A;  2LJ5 A;  4PYU A;  2ZCB A;  4BOZ B;  4TKN A;  4LJP B;  4IC7 B;  3KUC B;  4URK A;  2PE6 B;  5C1Z A;  1WE7 A;  5KHO A;  4I6N B;  2MBO A;  4JLC A;  3EFU A;  2DX5 B;  2K6D B;  5DPR A;  2GBK A;  4FJV B;  3W1S C;  3KVF B;  1IP9 A;  2D2Q A;  2FCN A;  2LD9 A;  4KIK A;  1GC7 A;  2KC2 A;  1WMH A;  3NHE B;  4WWO A;  4DBG A;  1WJ4 A;  4NQK E;  3A1Q A;  4FHK A;  4EZL A;  1WJ6 A;  4TV3 A;  2KFK B;  2G4D B;  3WIM A;  1YX5 B;  1WXS A;  2VRR B;  1Q5W B;  3K9O B;  5D7G A;  4IWP A;  5DPS A;  3ZTC A;  1WX7 A;  2BYF A;  4IUM B;  1LM8 B;  3L08 A;  2DYM A;  2L0F A;  4WAA A;  2BGF A;  3M63 B;  1V5T A;  2K1F A;  4MGK E;  4AJW A;  3DVN U;  2KZR A;  4A3P A;  2EMT A;  4FHJ A;  4KIK B;  5KHQ A;  5G2N A;  2PJH A;  1E5W A;  4ZRI A;  4MSQ B;  1GC6 A;  4IG7 B;  2DZK A;  3A1Q B;  4TQ1 A;  3U8Z A;  1GJZ A;  5DPW A;  4M8N A;  3MHS D;  1QZE A;  1WGR A;  1SIF A;  1KOT A;  3QCA A;  3R7R A;  2LRW A;  2L76 A;  5DPT A;  1RAX A;  3ZLZ A;  4E71 A;  4ASW C;  4NJ7 A;  3RUL A;  3DBL I;  2M1M A;  4WWN A;  2N1V A;  2ZNV B;  3T9L A;  1L7Y A;  5LXI B;  4ICV A;  2KWV B;  5E6P A;  3NZS A;  3RZW C;  4TUU A;  1UD7 A;  3A9J A;  5FR6 A;  3PVL A;  4RM9 A;  5CX3 A;  3H7S A;  4FUL A;  3HM3 A;  2KDI A;  2ZVO A;  2V3S A;  1TZ1 A;  4GDL A;  2ZJD A;  4HLE A;  2JZZ A;  3WAP A;  5JZE B;  2LGD A;  3VUX A;  1P9D U;  2R2O A;  3WAN A;  4BFR A;  4LCD E;  1Y8R C;  4MGY E;  3A33 B;  4BKG A;  1V2Y A;  4KDI C;  3W1S A;  4M8M A;  2C7M B;  2WWZ A;  3H6N A;  1ISN A;  2V1Y A;  2FIF A;  3LJ3 A;  4ANW A;  2K8B A;  5L83 A;  1WE6 A;  3L13 A;  3A9J B;  2ZVN A;  5IA7 A;  2GBM A;  3VQI A;  3AXC A;  1E8Z A;  2IO1 B;  4I6P A;  4WWP A;  3K9P B;  3N32 A;  2KFJ A;  2I1J A;  2K8H A;  2JF5 A;  4MH0 E;  4DXA B;  2LUE A;  2D11 A;  1I35 A;  2BYE A;  2A5U A;  4B95 A;  2KDF B;  4GIV A;  2KHW B;  3TBL D;  1WZ0 A;  2LXA A;  2KOX A;  1WFY A;  2ZEQ A;  4EZJ A;  4JL9 A;  1NI2 A;  1WIA A;  2IY1 B;  3PSE B;  4DDI D;  3ENE A;  1OGW A;  1WX8 A;  1E7V A;  4KZ0 A;  1KM7 A;  1NDD A;  5TR5 A;  3VUY A;  2FNJ B;  4HWI B;  3GZN I;  1WR1 A;  1UGM A;  3ZNZ B;  2KKC A;  3H7P A;  1UEL A;  1WH3 A;  1EF5 A;  4BVU C;  2LXC A;  1GG3 A;  4AOF A;  4GXB A;  4F8C B;  1TTN A;  2C9W B;  2DYB A;  3QAQ A;  1MG8 A;  4W9H A;  2J0J A;  4K7U A;  2BWF A;  2N7D A;  4II3 B;  3BIN A;  1UBI A;  3EC8 A;  3HHM A;  4DHZ E;  2HJ8 A;  2KLC A;  2RSU A;  2EKE C;  3SDL C;  2R2Q A;  1CMX B;  4IWQ A;  2KN5 A;  2L8J A;  3DDC B;  1LXD A;  1YQB A;  4E3C A;  2G3Q B;  3X23 A;  2KK8 A;  4EKU A;  3S2A A;  4WQO B;  2K39 A;  1RFA A;  2JVC A;  3UQB A;  2CHW A;  4EUT A;  2AWT A;  2CKH B;  1EO6 A;  1NBF C;  5CTR C;  3SD5 A;  4M0W B;  4X57 B;  2DZJ A;  3C0R B;  1FXT B;  2LVP A;  2DEN B;  3ALB A;  5AZF A;  4I6L B;  3VUW A;  4ICU A;  2C60 A;  4HCN B;  1Z5S B;  3M3J A;  3V61 A;  4CO7 A;  3UIO B;  4KSL C;  4E74 A;  5AEK B;  2PEA A;  4ANX A;  2MWS B;  2AL3 A;  3PHX B;  1RLF A;  2KJR A;  2BYV E;  3A4S C;  4LJO B;  1E7U A;  3TJP A;  5D6J B;  2MP2 A;  1A5R A;  1I42 A;  1J8C A;  2HE7 A;  1UH6 A;  4II2 B;  2C7H A;  4GSW A;  2NS5 A;  4BOS C;  2HD5 B;  2M4N A;  2NVU I;  1U4A A;  4KVG B;  4B9K A;  1WM3 A;  2KLG A;  3CF6 E;  2KVR A;  1WGD A;  2W9N A;  2FAZ A;  4P7I A;  2BKR B;  4W9C A;  1WMH B;  2DZM A;  2JZ3 B;  1V80 A;  2L7R A;  2M17 A;  3DBH I;  4MJS A;  1UZX B;  2WX0 A;  3VTV A;  2MBQ A;  2NPT A;  3ZDM C;  2RD0 A;  3JVZ X;  1WXA A;  2LZ6 A;  1S3S G;  2MP2 B;  3UIP B;  2CU1 A;  1OEY A;  2WX1 A;  1WM2 A;  3Q3F A;  3PS6 A;  2NCN A;  3SU8 X;  3CSF A;  2IYD B;  4AP4 C;  1LFD A;  4F7Z A;  3QHT A;  2KMC A;  2NR2 A;  2HTH A;  5JHB A;  4MDK E;  5L95 C;  2G4S A;  2CS4 A;  5C23 A;  3OJ4 B;  1V5O A;  4IWO A;  1YX6 B;  4YL8 A;  3ZKJ C;  1EUV B;  3V6C B;  2DAF A;  2KO3 A;  2KNB A;  4DHJ B;  3TCA A;  3V62 A;  5J18 A;  4DHJ D;  4GOC A;  5EDS A;  1P0R A;  2WDT B;  3DOW A;  5G55 A;  4HCP B;  1OQY A;  4EZK A;  4DHZ B;  3M62 B;  3ML9 A;  2L05 A;  1J19 A;  4FN2 A;  2KTF A;  4MGZ E;  3APD A;  2EMS A;  3NZU A;  2KX3 A;  2V4L A;  2LVO A;  1Q0W B;  4NJ6 A;  4OVV A;  3KUD B;  4ANV A;  1GUA B;  3P2B A;  4IW0 A;  2MW5 A;  1WI0 A;  2AEH A;  2MSE D;  3PRP B;  4FLH A;  1OEY J;  4GMV A;  4MEL A;  4ANU A;  4CYE A;  3DQV A;  3ZIM A;  1WYW B;  4WJQ A;  3AU4 A;  3UF8 A;  3APF A;  3QIJ A;  2KX0 A;  2K6Q A;  3SHQ A;  3QK0 A;  3Q3J A;  3ZDT A;  1WGY A;  4FA6 A;  2NBW B;  3IBE A;  3V6E B;  4XX5 A;  4GDL B;  2YLM A;  2D07 B;  4MEM A;  3DPD A;  5CHW A;  4BBN C;  5J17 A;  3VFK A;  3OLM D;  4RMA A;  3VTU A;  2PE9 A;  2JT4 B;  1V86 A;  2GBJ A;  2N9X A;  2JPH A;  3VVW B;  1L2N A;  3QJZ A;  3JSV A;  3QWZ B;  1V6E A;  2KWU B;  5GMV A;  4DWF A;  4F1S A;  3JW0 X;  3PRM B;  3KYD D;  1E8Y A;  4FAD A;  2FCQ A;  2JUO A;  2O2V A;  4CHK A;  3IG3 A;  3L54 A;  3M95 A;  5AZG A;  4G11 A;  2CHX A;  4BKT A;  4AUQ C;  4ZDV A;  2KC1 A;  4RM8 A;  2KTR A;  1Q1O A;  2FCM A;  3U30 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...