1WJ4A

Solution structure of the ubx domain of kiaa0794 protein
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
124
structure length
124
Chain Sequence
GSSGSSGTATNHQGLPAVDSEILEMPPEKADGVVEGIDVNGPKAQLMLRYPDGKREQITLPEQAKLLALVKHVQSKGYPNERFELLTNFPRRKLSHLDYDITLQEAGLCPQETVFVQESGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KIAA0794 protein
publication title Solution structure of the UBX domain of KIAA0794 protein
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 14
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2004-05-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00789 UBX UBX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1wj4A01
1V49A 3T8MA 2C60A 2KLGA 2QHOA 1EF5A 2YLMA 2PJHA 2LVOA 3UINB 3QC8B 3ZDTA 4W9LA 4J6IA 2G4SA 3VUYA 2IO3B 1Q1OA 4HCNB 1KM7A 2KOXA 4KV2A 2KXJA 4LDTB 5E6PA 4ASWC 2J0JA 4F1SA 1RLFA 1ZW7A 5JZEB 2FCQA 1WJ6A 2LVQA 4JQWC 2JZ3B 1WGHA 4GOCA 1KOTA 3TJPA 2KHWB 2G3QB 4W9DA 5EDSA 4II2B 2DHZA 4FN2A 3PS6A 4GMVA 4HXDA 4MH0E 5E6NA 4DXAB 2KWCA 2CKHB 4WAAA 2NBWB 4HCPB 3UIPB 2KO3A 1IP9A 2NPTB 4WWOA 3DOWA 3WIMA 2G45B 2WX0A 4JIOU 3M3JA 3LJ3A 2CS4A 5KHQA 1V6EA 4BOSC 1WH3A 4HDOA 5G2NA 3GZNI 1WMHA 3PVLA 4EKUA 4GU2A 2NBUA 2JT4B 3ZRFA 3A4RA 3PLVA 3A9JB 1GC6A 1WX7A 4HPMB 2KANA 1Y8RC 2KFKB 2L8JA 2IY1B 1V5TA 3L17A 3ZNGC 5C23A 4IC7B 3ZLZA 4CYEA 2D07B 1JRUA 2D2QA 1BT0A 2LZ6A 2BKFA 2JRHA 2MX2A 3JSVA 3KYDD 3V62A 1GNUA 1E8ZA 3PHXB 4KIKA 2JF5A 3OLMD 3CF6E 2ZZPB 3X0WA 3DVGY 2CHZA 2GBNA 2Y5BB 1V86A 3UGBB 3VTWA 4BBNF 4G0NB 4GGQA 2R2QA 3HK0A 5D6JB 1V2YA 3KYCD 2GBMA 2LXAA 3L0WB 3L08A 5BO4B 2C5LC 4M8MA 2B3AA 2NCNA 1TBEA 3NHEB 2JXXA 3PTFC 2FIFA 4K1RB 1WM3A 3GOEA 1EF1A 4EUTA 4NNJB 2LVPA 4G3XB 4DDID 2N9PC 2L0TA 4CHKA 2KJHB 2FNJB 5J18A 4MJSA 2DAJA 2LI5A 2MBHA 2N7EA 2KMAA 2GOWA 4XC2A 3M95A 3QQ8B 3RULA 3VFKA 1KLVA 1WZ0A 5KHOA 3JVZX 3U30A 2I1JA 4AP4C 3CSTA 1OGWA 2KDEB 1WGGA 4LDTD 4DDGD 4OVUA 3WANA 2RPQA 3APDA 2KWUB 5CHWA 3TL5A 3PGEA 4GN1A 4NPNA 3R7RA 3R66C 2KWVB 4WJPA 3VUXA 4BFRA 5J2RA 4W9EA 2MW5A 4AUQC 5DCNA 3ZTDA 4TUUA 1E5WA 2XK5B 3DBRI 3PZDA 2YVCA 4BKGA 1P1AA 2KDFB 2MQJA 4FA6A 3VH4B 1WY8A 3D32A 3P2BA 4E71A 4ZRIA 4CO7A 2MRPA 3QIJA 1P9DU 4W9CA 4HDQA 4EFOA 3DVNU 1IPGA 4FJYA 4LJOB 2ZJDA 1VCBA 3H7PA 4K7WA 4ANWA 4ICVA 3NOBA 3ONSA 4GDLA 4AJWA 1RRBA 4JGHB 4HK2A 2KDIA 1WGDA 2ZNVC 4KIKB 1WXAA 3H6NA 3UIOB 3B08A 2KK8A 2LRUA 1E7VA 2M1MA 1Z2MA 3HIZA 5CHVC 4PYUA 4I6PA 5FR6A 2KFJA 2M0XA 3PSEB 3QARA 3WAOA 2WYQA 4WWPA 3B0AA 4IM3A 2ZPYA 2KC2A 5LLIA 3I3TB 3X23A 3DBHI 2O2VA 3H7SA 2BYVE 4ZDVA 4WQOB 1WJUA 4W9JA 5JH5C 2REXA 3PPAA 1J19A 2FCSA 2KN5A 1UELA 3KUZA 3SDLC 3U8ZA 5E6OA 2L05A 1ZGUB 4IWOA 4KVGB 4MSQB 4P7IA 4PS3A 3VUWA 2L7RA 2KMCA 1YX5B 3KVFB 3L13A 1WJ4A 4G11A 4B9KA 1RAXA 4NQLB 4EZKA 2LWPA 4FBJB 1K8RB 1L2NA 5AZGA 3A1QA 4A3PA 2MP2A 3ZNHB 4M8NA 4OVVA 1V80A 1X1MA 4FHKA 4W9HA 2Z0EB 4A20A 3Q3JA 4M0WB 2BF8B 1E90A 3QJZA 2KNBA 1XQQA 2NVUI 2DYOA 2IO2B 4II3B 1C3TA 5AEKB 4MM3A 2R2OA 4YL8A 4F8CB 4MELA 3V6EB 4ZRJA 4WWNA 4DHJB 2BWES 4F7ZA 4GIVA 2LJ5A 4LCDE 2DZIA 1WIAA 2OJRA 2EMTA 2M17A 4IWQA 2HTHA 2DZJA 2ASQA 4AWJA 5JHAA 1WI0A 1GJZA 3K9OB 2AL3A 4HPLB 5J17A 4EZLA 3A9KA 2NBVB 4W9FA 3HM3A 4DK5A 5JHBA 2BYFA 2KTRA 3ML8A 2KKCA 3EHVA 5AZHA 1UZXB 2HD5B 3RUIB 1SE9A 2MSED 2DX5B 2BGFA 3R7QA 2ZVOA 2LASA 2RD0A 4I6LB 2N7DA 2WDTB 4E74A 4BKSD 1YD8U 2A4ZA 4W9IA 2GBJA 2Z0DB 3PHWB 2PE6B 3APFA 1P98A 2LGDA 3PLUA 4LJPB 1UBIA 2M8SA 1F9JA 3WA0A 2D11A 2KJ6A 4MDKE 1V9JA 1WR1A 2CR5A 2MBEA 3QK0A 3SU8X 4GDKA 3V61A 3W1YA 4HLEA 3V6CB 3HHMA 4IWPA 2K8BA 1J0GA 3NZUA 4FLHA 1R4MI 2HJ8A 2O2VB 4MGIE 3UQAA 1SGHA 3IHPC 5AZFA 4EOYA 2LD9A 1QZEA 4XX5A 4G50A 2GBRA 2DZMA 1E8XA 3RT3B 1WXMA 1T0YA 2I1KA 3VXWA 4EZJA 1SIFA 2KDBA 3IFWB 2L0FA 1L7YA 2MBOA 2XBBC 3OJ3A 1UBQA 2W9NA 2MBQA 2WX1A 4MGYE 3NY5A 3SD5A 3VHTC 2ZNVB 3NZSA 3PRPB 4K7SA 4NQKE 2CU1A 4MGZE 4NAWA 1WE6A 3UF8A 3DQVA 4URKA 1WGRA 2V4LA 1LFDA 2C7HA 1EO6A 2K6QA 4GSWA 1TGZB 1GG3A 2JY6A 1I35A 3IVFA 1J8CA 2O6VA 2DZKA 3ML9A 3ZRCA 3N30A 3VH3B 1WM2A 1WMHB 1RFAA 4FHJA 3DVGX 3O65B 2JWZA 1XT9B 3KUCB 4DHJD 2NPTA 3BY4B 4KSLC 2IBIB 4FADA 4ANUA 5D7GA 1NI2A 1UGMA 5LXIB 2L00B 5D94A 3JSVB 1WR6E 2K1FA 5CTRC 2K8CA 2K8HA 3KUDB 1FXTB 2IZVB 3A9JA 5D2MB 2PEAA 3PV1A 2FIDA 3AXCA 3OJ4B 2KFKA 2ZCBA 1I42A 3QX1A 3ZIMA 1WXSA 5DPWA 2LRWA 1P0RA 2DYBA 2NS5A 4KZ0A 2Z59B 3LDZE 4WJQA 3WALA 4RMAA 1OEYA 2KX3A 4N9F4 3EFUA 2ZPNA 4TV3A 4BKTA 3B1LX 3ZKJC 2MA9B 3DBLI 3JW0X 3QA8A 4BVUC 2BKRB 1ZKHA 1WFYA 3QHTA 4AOFA 4PYZA 4I6NB 2RSUA 3VAWA 4ANXA 4NY0A 1KJTA 2DENB 3HM6X 3RZWC 3MHSD 3ZW3A 4DWFA 2JVCA 2KTFA 1XD3B 2KZRA 4JL9A 2J7QB 3TMPB 4MJSB 1Q5WB 2ZCCA 2JUOA 2D3GA 2KQSA 4BOZB 2KQ7A 3ZTCA 1WZ3A 2AYOB 3K9PB 4TQ1A 3W1SA 1D3ZA 1LQBA 4KDLB 4MGKE 4K7UA 2VRRB 2IY0B 2AEHA 3M62B 4IM2A 5IAAC 5L83A 5L95C 2MCNB 2M4NA 2N9XA 3PREA 4WJNA 3M63B 1GUAB 3N3KB 4KDIC 3L10B 2V1YA 3QWZB 3U7DA 3TIXA 1WYWB 4NAWB 2K25A 5DPSA 1E8YA 3DDCB 4A3OA 2MBBB 3DPDA 2C9WB 2GBKA 5HKHA 2FAZA 1CMXB 1EUVB 3VTUA 2G4DB 2O6VB 2JPHA 2WWZA 3NS8A 2KLCA 2PE9A 5DPTA 4HJKA 2LXCA 2KX0A 3DCGA 3KH0A 1ISNA 2FCNA 3MJWA 3DVNV 4IM0A 2XK5A 4B95A 2UWQA 1R4NI 3EECA 1YIWA 2LGYA 3VDZA 2BWFA 2KJRA 2KVRA 2L76A 3H7PB 4EEWA 3BINA 3RD2A 4GDLB 1WRDB 4DBGA 3SHQA 4W9KA 3A33B 4B6WA 3OAWA 2IO1B 2J0MA 1Q0WB 1WE7A 3L16A 2MWSB 4WJOA 2J0KA 4IG7B 4BKSA 3VTVA 4IUMB 1WF9A 4MSMB 4NJ6A 1YX6B 4K81A 2XEWA 3IBEA 4TKNA 2D10A 2JZZA 4IW0A 2C7NB 2CHWA 3R3MA 3CMMB 2MLBA 3T9LA 3APCA 4NJ7A 1NDDA 2IO0B 1Z5SB 4JLCA 1YQBA 2C7MB 3L54A 4PS7A 3AULA 3S2AA 3Q3FA 1V5OA 4ANVA 1OTRB 3ZUNA 1AARA 3N32A 3ZVVA 3IG3A 5GMVA 4FJVB 4RM9A 4ICUA 2EKEC 3PRMB 1S3SG 1UH6A 1NBFC 1E7UA 3ZDMC 3KW5B 3RCZA 2HE7A 1WGYA 2NR2A 3H9DA 3A1QB 2MP2B 2L3ZA 3RYTA 4FJZA 1IYFA 1A5RA 2AL6A 1MG8A 1YJ1A 4GXBA 1WJNA 2OOBB 3AI5A 5TR5A 1P3QU 2N4FA 2PPHA 3QCAA 4ZRKA 5CX3A 4GB9A 2AWTA 3VQIA 1UD7A 1V81A 4PS8A 3V60A 3ALBA 1OEYJ 1OQYA 4MEMA 2IYDB 2N1VA 1VD2A 1LXDA 3DBSA 3JYUA 5G55A 4E3CA 1H8CA 1E8WA 4DHZE 4X57B 2FUHB 2K6DB 3A4SC 2UYZB 2A5UA 2CHXA 2EMSA 3ZNID 2BPSA 2JRIB 3A9KB 4BBNC 5LXHA 3ZO5B 5IA7A 3W1SC 4HVBA 1PQSA 2KTRB 2RGFA 1S1QB 4AJYB 2O6VD 4HWIB 2DAFA 3AU4A 1G6JA 2N1WA 5C1ZA 1C1YB 3WAMA 2LUEA 4XZ4A 1WX8A 2FCMA 1TTNA 3ECIA 1H4RA 3MTNB 3PRZA 3EC8A 1WXVA 4FULA 1TZ1A 3PT2B 1GC7A 2ZEQA 1U4AA 2V3SA 4ZYNA 3AU5A 4DHZB 2GMIC 2KC1A 3TCAA 2LGXA 3UQBA 4KSKC 5DPRA 5CHFA 1HE8A 4TQ0A 1M94A 2BYEA 2N9EB 3WAPA 3C0RB 3ZNZB 2RR9A 3H1UA 3VVWB 3CSFA 2KD0A 2K39A 4GDKB 3QAQA 1WX9A 4W9GA 2DYMA 3TBLD 1LM8B 2ZVNA 3RZFA 4RM8A 4KZCA 3ENEA
chains in the Genus database with same CATH superfamily
2SEBD 3T8MA 2IDYA 3RNAC 2QHOA 3I57A 2LVOA 1MPEA 3VUYA 5BYSA 4HCNB 1L4ZB 2LVQA 4ARCA 3Q8FA 3RMKC 3TJPA 4A9AA 3PS6A 4L1BA 4DXAB 3VR8B 2KO3A 2J42A 3Q69A 2G45B 2CS4A 4OZBA 4YXDB 1FNWA 4GU2A 1GC6A 3HVDA 1WX7A 2K22A 1SJHD 2KANA 2L8JA 4LNOA 1VZ6A 3NS1A 1BT0A 3TEXA 5LNK1 2MX2A 3PHXB 4KIKA 1WRIA 3SEBA 1B9RA 3OLMD 2CHZA 4ACFA 3UGBB 4G0NB 3KYCD 2M19A 2NCNA 1TBEA 4G3XB 4RF0A 4XC2A 2NTTA 1FCLA 3VFKA 1QF6A 1WZ0A 2BS2B 3U30A 2I1JA 1OGWA 4ARIA 1SIJA 1WGGA 4OVUA 2KWUB 5CHWA 3TL5A 3PGEA 3GS2A 4NPNA 2KWVB 4BFRA 3VUXA 1K53A 2MW5A 2M56B 2XK5B 3AE5B 1WY8A 3P2BA 1YMHE 4C7YA 2BS4B 4MACA 4EFOA 3PZ8A 3EGRA 5IO9A 2BB6A 2ZJDA 1VCBA 1JQ4A 4ANWA 2DLBA 4MH8A 3FILA 4HK2A 3HUIA 2ZNVC 1VDVA 4A90A 1EWCA 4RF1A 2LRUA 2M1MA 1Z2MA 4N6EB 4I6PA 2K0PA 4KGTA 3P4PB 3X23A 3AE7B 2AQ2B 2O2VA 1ACCA 4W9JA 5JH5C 1J19A 1SE2A 1UELA 3SDLC 2L05A 1ZGUB 4IWOA 4KVGB 4MSQB 3IAM1 3VUWA 4HKZE 1RAXA 1XO3A 3W9CB 1L2NA 4A3PA 4M8NA 2KACA 4W9HA 1AWDA 2Z0EB 3Q3JA 1EU4A 2KNBA 4S17A 5EE1A 1JWUD 2MEKA 4F8CB 5G5HA 4IOIE 1XCTL 2DZIA 2HTHA 1KF6B 2BBCA 5HFYA 1WI0A 2AL3A 3RFZB 3A9KA 3DWMA 4W9FA 5JHBA 2BYFA 3ML8A 3EHVA 1UZXB 1N5XA 2LASA 4E74A 4W9IA 2PE6B 3APFA 2R61A 2LGDA 1UBIA 3E56A 2D11A 1V9JA 4YTNB 1SF0A 4C7ZA 1TKGA 2JSVX 4GDKA 3V61A 4HLEA 3HHMA 4MGIE 1QZEA 4XX5A 3UI3A 3B9JA 2DZMA 1HQRD 1T0YA 3VXWA 4N58A 3W5UB 3IFWB 2D3CA 2XBBC 4EE2A 1UBQA 1L5PA 3SD5A 1IGCA 3RNFC 3VHTC 2ZNVB 2WXPA 4NQKE 4URKA 5BMIA 1RFKA 2K6QA 1GG3A 5BYRA 2DZKA 3ZRCA 3N30A 1WMHB 4KKIA 1EWYC 3DVGX 3BVGA 2JWZA 3KUCB 2NPTA 1SEBD 4KSLC 4US9A 3TEWA 4ANUA 2QSDA 1UGMA 2INPE 1FRDA 1WR6E 2K1FA 1I4RA 2WXMA 1FXTB 2XNAC 3A9JA 2J4XA 2FIDA 2PVGC 2KFKA 4PT5A 5C2TB 1I42A 3ZIMA 2LRWA 1P0RA 1XCQL 3U2SC 3LDZE 3IXSA 2GI9A 4YT0B 2KX3A 2N9LA 2BS3B 3DBLI 1WFYA 1K51A 3VAWA 4NY0A 2DENB 3ZW3A 3TMPB 1EM7A 2LGIA 2WXLA 1HTQA 2ZCCA 3KLSX 4REZA 2JUOA 2ON8A 4RGOS 3ZTCA 2LGSA 1HXYD 4MT5A 3AE3B 4K7UA 2VRRB 3AEEB 2IY0B 5L95C 2M4NA 2N9XA 3PREA 1V1PA 2KWDA 4LTUA 5BMGA 3QWZB 2DNFA 3NVYA 1WYWB 1RYJA 2C9WB 4S0RA 1UWXA 2FAZA 1EUVB 2WP9B 2WWZA 2WXIA 2OHFA 4HJKA 2BVCA 3DCGA 2FCNA 4B95A 2BWFA 2KVRA 2L76A 4J3OD 4PK1A 3BINA 1WRDB 2JXTA 3A33B 2IO1B 2J0MA 2VH2A 1WE7A 3L16A 4WJOA 1BXTA 1WF9A 4NJ6A 2ACZB 2XEWA 2FUG1 2D10A 2JZZA 4IW0A 3T9LA 4JLCA 2K5PA 2C7MB 1ENFA 3L54A 3AE8B 1P7FA 3GE8C 1XXGA 3ZUNA 1AARA 3IG3A 2B76B 1TKYA 1D5ZC 2DWQA 3ZDMC 3KW5B 1YJIA 2HE7A 1C4PA 3A1QB 2V9HA 1MG8A 2E3TA 2OOBB 1AN8A 5TR5A 2N4FA 4GB9A 2I38A 1CZPA 2QCZA 4PS8A 3ALBA 1OQYA 2PVOD 3FAHA 5AUKA 1WYGA 5T8IA 4E3CA 1JW9D 1L0YB 4M0WA 2BYTA 3RNGC 2A5UA 2OEDA 4ZHOA 2CHXA 2BPSA 2JRIB 4LK0M 4HVBA 1PQSA 4HWIB 3AU4A 4C4VA 3WAMA 2HTME 4LNFA 3PT2B 2ZEQA 3AU5A 3UQBA 2LGXA 2KMMA 2N9EB 3AEGB 3WAPA 2KD0A 2DYMA 2V3NA 1C9FA 4KZCA 3DHHC 3EA6A 1V97A 2C60A 1BUIC 2Y5PA 4HPPA 3UINB 4J6IA 1XLPA 2IO3B 1J7BA 2KOXA 2J0JA 1ZW7A 1WJ6A 4JQWC 3HRDD 2LFIA 3BZDB 1KOTA 2G3QB 4MH0E 2KWCA 4WAAA 5E6JA 3UIPB 1IP9A 2IGGA 2INDC 3WIMA 1L0XB 3L4PA 4ITKA 4RFBA 1V6EA 3Q3OC 4WIPA 1STEA 1KTKA 3ZRFA 2NBUA 2JT4B 3BK2A 1T0RC 3PLVA 3R8BA 4KGRA 2WXGA 1GOZA 1F52A 2HJ1A 1JRUA 3U4EG 2LEKA 2BKFA 1N60A 2IGHA 4HKQA 2WDVB 3RN9C 2L52A 3CF6E 3X0WA 2KQ4X 2NTSA 1V86A 1YN3A 3VTWA 5BO4B 3L0WB 2GBMA 3U7ZA 3Q8AA 2JXXA 2FIFA 1WM3A 2QDFA 1JRPA 4AQ7A 1VR9A 2L0TA 5HI1A 2KJHB 2FNJB 5J18A 2IGDA 2DAJA 2LI5A 2MBHA 4MJSA 2KMAA 3BVZA 3QQ8B 1KLVA 1F77A 3SFDB 3N1YC 2W82A 3WANA 2MJEA 2RPQA 3APDA 3R7RA 3R66C 1VZ8A 4WJPA 2J52A 4AUQC 4TUUA 1DOYA 4ZRQA 4OVZA 4BKGA 1P1AA 2BB5A 3PO0A 4CO7A 2MRPA 3DBLB 2ZW1A 2JX5A 2H88B 4HDQA 3DVNU 1IPGA 4FJYA 3H7PA 3I5JC 4OHJA 4N59A 3ONSA 3AEBB 3ZXRA 1RRBA 4JGHB 2KDIA 4KIKB 5BMHA 3B08A 3HIZA 5CHVC 1YN5A 2M0XA 3WAOA 1WSPA 4BZAA 2KC2A 4HJGE 3I3TB 3H7SA 2BYVE 3LXFA 4ZDVA 4RH6A 1WJUA 3U8ZA 4C00A 5H92C 4UDUC 4P7IA 3KVFB 4G11A 2SAKA 2LWPA 1TIFA 3ZNHB 4OVVA 1V80A 2JYEA 4A8XC 3AE9B 2UU7A 3QJZA 2NVUI 2DYOA 2W55A 1C3TA 4MM3A 2R2OA 4MELA 3BIID 4WWNA 2GRIA 2BWES 4F7ZA 4LCDE 2OJRA 5D3IB 2EMTA 2M17A 4IWQA 3Q6BA 4YSXB 2WXOA 4AWJA 2HDEA 1GJZA 5J17A 3NRZA 1T0QC 4WURA 2KKCA 2HD5B 3RUIB 3T3OA 3R7QA 2FBWB 2RD0A 3DWGC 2WDTB 3FKYA 3P42A 4I6LB 4BKSD 3O13A 1F0ZA 2Z0DB 4CQNA 1P98A 4KX6B 2M8SA 1YN4A 1NYRA 1WR1A 3C19A 4NZLB 3SU8X 3V6CB 5IP4D 1R4MI 2O2VB 3DHGC 3IHPC 3AEFB 3C8YA 3Q3MC 2KDBA 5IN7A 4MGYE 1ROEA 4RGMA 5H8YE 1T6BX 4K3CA 3N9YC 1LFDA 2C7HA 1OQQA 1EO6A 1VRAB 2O6VA 3ML9A 3VH3B 1FPYA 2K3UA 2N9KA 2KAJA 5IOIA 1HZ6A 4FADA 3Q2AC 1PGXA 1NI2A 1FO4A 3JSVB 5CTRC 2K8CA 3KUDB 1AYFA 2K8HA 2LUMA 3FC4A 1VJKA 3NVWA 2PW9A 3P63A 3WCQA 1OFFA 1WXSA 1N5WA 2NS5A 2Z59B 3OWEB 4WJQA 1OEYA 4N9F4 3EFUA 2ZPNA 3BVMA 3QA8A 4BVUC 4ZRPA 1ZKHA 4AOFA 5EE0A 1AW7A 3T3NA 1I4GA 2RSUA 1KJTA 3MHSD 1XD3B 1FEHA 4DQOC 2D3GA 3LYYA 4BOZB 1QT9A 1JCKB 1ZXIA 4MGKE 4IM2A 1C76A 2MCNB 4A55A 5D3DA 4KDIC 3N3KB 5FKAC 4ZOHC 3U7DA 2L83A 1TT5B 2V0GA 3DDCB 3DPDA 4RGTA 1F1HA 1CMXB 3ZYYX 1UNSA 5DPTA 1DOIA 1QOFA 1QILA 3MJWA 4XDDA 4IM0A 2OJWA 2XK5A 2UWQA 3EECA 5HHDG 2WXJA 3BYYB 1K50A 1YQ3B 4EEWA 4GDLB 4HROA 1E0ZA 3OAWA 4KGSA 2J0KA 1L4DB 1RM6C 4MSMB 3KWVA 1TS3A 4TKNA 1I4HA 1XF5L 4LNKA 2KYWA 4RCOA 3IT6B 1ZP0B 3P4QB 4NJ7A 2IO0B 1Z5SB 3S2AA 1FIQA 2XN9C 1MVKA 1JWSD 5GMVA 4RM9A 2EKEC 3PRMB 1S3SG 3RCZA 2NR2A 2MP2B 3P4RB 1KLUD 2WXFA 3BWUD 4GXBA 3QCAA 4ZRKA 1KH0A 4JPSA 2EKIA 2AWTA 3VQIA 1JWAD 2IYDB 2LMCA 2N1VA 1LXDA 3DBSA 1D5MC 4DHZE 4X57B 1ZOYB 2EMSA 1PYWD 2J53A 2MJ3A 3W1SC 2KTRB 2RGFA 4AJYB 1ET6A 1E9MA 3TUOA 5C1ZA 1QOGA 3TSSA 2FE8A 2QC8A 1N6ZA 1IBXB 3ECIA 1D5XC 1VZ7A 4M02A 1U4AA 4KSKC 5DPRA 3Q8BA 1HE8A 2BYEA 3ZNZB 4DXGA 3H1UA 5EE9A 4W9GA 1D4BA 2ICIA 1TJEA 3RZFA 2L1AA 4RM8A 3SR6A 3ENEA 1CK1A 2KLGA 1EF5A 2YLMA 2PJHA 4RGNA 3ZDTA 1LO5D 2INNE 2D3AA 3AN1A 4KV2A 5E6PA 4ASWC 4F1SA 4LDTB 4AS1A 4LNIA 3R2IA 2JZPA 2JZ3B 4GOCA 2KHWB 4FN2A 4GMVA 3AE1B 1HTOA 1R4NB 1CJEA 2CKHB 2NBWB 4C80A 4HCPB 3ZJVA 2X38A 2V4IB 1MG4A 1SJED 1P7EA 4L23A 3AH7A 2WX0A 4JIOU 3CIRB 5KHQA 4HDOA 2JWUA 4YSYB 3GZNI 1WMHA 3PVLA 4JX1C 4EKUA 3IAS1 3A4RA 1ZUD2 1V5TA 1L6VA 4CYEA 5C23A 1C77A 1R4MB 2D2QA 1T5XD 1QKZA 2E6XA 2LZ6A 3ETRA 3V62A 1GNUA 1E8ZA 1TS2A 2INCC 2ZZPB 4H2AA 2GBNA 3V3XA 4BBNF 4GGQA 3HK0A 3L08A 4P16A 2LXAA 1N62A 3W2DA 4M8MA 3ZGZA 3NHEB 3PTFC 4K1RB 1EF1A 4EUTA 4NNJB 2LVPA 2WU5B 4DDID 1I4QA 2N9PC 4L2YA 4CHKA 2N7EA 2GOWA 5IKCM 1B1ZA 1FRRA 3RI7C 4LDTD 2WXHA 2KN4A 1OQRA 1I4PA 5J2RA 4W9EA 3ZTDA 2WDRB 1D6EC 1E5WA 3DBRI 4BAXA 3PZDA 1L0VB 2MQJA 1ESFA 3D32A 4OZCA 4P6VF 1C4AA 4LNNA 3QIJA 1FNUA 1P9DU 4W9CA 2RDHA 4LJOB 4K7WA 4ICVA 3NUHB 4XGAB 1QQRA 1WXAA 3UIOB 1E7VA 2PIAA 4PYUA 2CJNA 3QARA 4WWPA 5LLIA 3HVZA 3DBHI 3Q14C 2REXA 3PPAA 2FCSA 3KUZA 3R2TA 4Q2JA 4PS3A 2L7RA 1UWMA 2KMCA 1YX5B 4B9KA 2QEJC 4NQLB 3RNEC 1TZOA 4EZKA 1YQ4B 4B0EA 5AZGA 3A1QA 1T3QA 4USAA 5G5GA 1SSNA 4FHKA 1E90A 1JWMD 1XQQA 1DGJA 2QJLA 3EUB2 2IO2B 4WAFA 5AEKB 4YL8A 4WH4A 3V6EB 1PUTA 2LJ5A 1WIAA 4YTMB 3Q8EA 1K52A 3SFEB 3MHZA 3K9OB 3NJTA 1RWSA 2NBVB 4DK5A 4US8A 5AZHA 4GLSC 3MFGA 2MSED 2DX5B 2WGSA 3VRBB 3MC9A 2ZVOA 2N7DA 1YD8U 2A4ZA 1C4CA 4WWMA 3PLUA 4FXCA 3N1ZC 3W5VB 2KJ6A 1NVID 3NG0A 2I2YA 2CR5A 2MBEA 1JALA 1J0GA 4IWPA 3I63C 4FLHA 3UQAA 2ZW0A 1SGHA 2G9HD 3TEZA 4G50A 2GBRA 1WXMA 2I1KA 1SIFA 1L7YA 2MBOA 3OJ3A 2W9NA 4XDCA 2WX1A 3NY5A 3PRPB 4K7SA 2LHEA 4NAWA 1WE6A 1GAQB 3DQVA 1NYQA 1WGRA 3Q8CA 2V4LA 2GLSA 4R3DA 3CWIA 1J8CA 1XLOA 3AEAB 1XT9B 2RPVA 3ABVB 5D7GA 5D94A 1E7PB 2IZVB 5D2MB 2ONQA 1DOXA 3AXCA 3OJ4B 3QX1A 5TSSA 5DPWA 2Y3AA 4KZ0A 2DYBA 3VRAB 4RMAA 1Q10A 4BKTA 4TV3A 4KKJA 3B1LX 3ZKJC 2MA9B 3JW0X 2BKRB 2VH1A 4PYZA 4ANXA 4DWFA 3OG5A 2JVCA 2KZRA 1XLNA 2J7QB 1PFDA 2KQSA 2WXNA 4YWGG 3K9PB 4TSSA 4TQ1A 2YEPB 1LQBA 4KDLB 4D2KA 5IAAC 2AEHA 3M62B 5L83A 4WJNA 1GPXA 3M63B 3AV8A 1EU3A 2QMTA 3GZNB 1CQVA 2V1YA 3TIXA 2K25A 1QOAA 2GBKA 5HKHA 3NVZA 3VTUA 2G4DB 2O6VB 2JPHA 3NS8A 1TY2A 2PE9A 2KX0A 1ISNA 1R4NI 2RDGA 1VLBA 3RD2A 3FILB 3SHQA 4W9KA 4B6WA 3I9V1 1Q0WB 2MWSB 4IG7B 4BKSA 4IUMB 2G1EA 3PZ7A 5C3JB 4K81A 1T0SC 3IBEA 5BYQA 3ZJTA 2C7NB 3RPFC 1WGKA 3CMMB 1YOVB 1NDDA 1YQBA 2Q5WD 3AULA 3Q3FA 4ANVA 1OTRB 3N32A 3ZVVA 1FFUA 4FJVB 4ICUA 1UH6A 1NBFC 1E7UA 1FD6A 3H9DA 1IYFA 3DBRB 1A5RA 2AL6A 3N1XC 1YJ1A 1WJNA 4ZYSA 2PPHA 5CX3A 3GB1A 1UD7A 3V60A 2PTLA 3NVVA 4ZHPA 5JXVA 4MEMA 5G55A 4NJCA 4XWTA 3DHIC 2K6DB 3A4SC 2JQRB 2N0SB 3NZ3A 1SB3C 1F2RI 3ZNID 5MPOA 3A9KB 5LXHA 1FM0D 1FNVA 2O6VD 3MC0B 4HRSA 3AM9A 1WX8A 2FCMA 1PDXA 3DBHB 2CJOA 1H4RA 1FXAA 3EC8A 4FULA 5GXGB 1GC7A 4JWSC 2LHDA 4DHZB 2V3SA 2GMIC 3KWLA 1DYQA 1SE4A 4TQ0A 3IT4B 3C0RB 2RR9A 3VVWB 3CSFA 4GDKB 2K39A 1WX9A 3ZQ4A 4IDIA 1TY0A 3LJ3A 3V05A 1V49A 3QC8B 4W9LA 2G4SA 1Q1OA 2CU3A 1KM7A 2KXJA 2VZKB 2X8XX 1RLFA 5JZEB 2FCQA 1WGHA 1Y56A 1TS5A 4W9DA 5EDSA 4II2B 2DHZA 4HXDA 1IGDA 1WWTA 5E6NA 2NPTB 4WWOA 1GB1A 3U52E 3DOWA 1HEZE 1N61A 3M3JA 4BOSC 1WH3A 5G2NA 1TKEA 2RDBC 3A9JB 1IUEA 3ZJUA 3MJ5A 4HPMB 1Y8RC 2KFKB 3L17A 2IY1B 1TYGB 3ZNGC 3ZLZA 4IC7B 1MJDA 2D07B 1BMLC 2JRHA 3KYDD 1FCCC 3JSVA 2JYTA 4M01A 2JF5A 3DVGY 1MFWA 2Y5BB 4P1CC 3P4SB 2R2QA 5D6JB 1V2YA 1M4VA 2KDMA 2C5LC 2B3AA 3AE6B 4JWUC 3GOEA 1ZE3D 1QLBB 1ZXHA 1V1PB 2KT7A 1YJJA 3M95A 3RULA 2BW2A 5KHOA 3JVZX 4AP4C 3CSTA 2KDEB 2VZKD 4DDGD 2TSSA 4GN1A 2BTEA 4NAMA 5DCNA 2Y5CA 3N20C 2NMQA 3GE3C 2YVCA 1J7AA 2KDFB 3H8HA 1MHHE 4FA6A 3VH4B 2EELA 4E71A 3GP7A 4ZRIA 2PLPA 1F2RC 4DXFA 1UF0A 1WXQA 3NOBA 4GDLA 4AJWA 1I4XA 1WGDA 1LGRA 3B2GA 3H6NA 1PGAA 2KK8A 2RMMA 1YNTE 2KVZA 5FR6A 2KFJA 3PSEB 2WYQA 2D5GA 3B0AA 4IM3A 4K3BA 2ZPYA 2MH7A 1NENB 4WQOB 4XE0A 2KN5A 5E6OA 3EFCA 3LB8C 2MJDA 1GB4A 3L13A 1WJ4A 2N7JA 4WQMA 4FBJB 1K8RB 2AX5A 2YEPF 2MP2A 2BQQA 1X1MA 4A20A 4M0WB 2BF8B 4II3B 4ZRJA 2W54A 4DHJB 4GIVA 1SE3A 2DZJA 4C4VB 1FMAD 2ASQA 3AECB 4HPLB 4EZLA 2BT6A 1UGJA 3HM3A 2KTRA 3URYA 1SE9A 2BGFA 1I7HA 1IBXA 2GBJA 3PHWB 2DBYA 4LJPB 1F9JA 3WA0A 4MDKE 1J7CA 2WDQB 3QK0A 3W1YA 2V3PA 2K8BA 3NZUA 2HJ8A 3AB5A 4EOYA 5AZFA 2LD9A 2IJ0A 1E8XA 3RT3B 2WXQA 5AUIA 4EZJA 2L0FA 2WXRA 2MBQA 4P1BC 2MHJA 3NZSA 3UF8A 1NEKB 2CU1A 2W3RA 4MGZE 5I4DA 1E6EB 3ZXVA 4OZAA 4GSWA 1TGZB 1L6UA 2JY6A 1I35A 3IVFA 1N63A 1SXTA 1WM2A 4FHJA 1RFAA 3TEYA 4HEA1 2WLBA 3O65B 4DHJD 4YTPB 1ZDVA 3BY4B 3BYTB 2IBIB 1QOBA 3AEDB 3B2FA 5LXIB 2L00B 2H89B 2PEAA 2WXKA 3PV1A 4QAYA 3AE4B 2WU2B 2ZCBA 2GB1A 1R7SA 1V8CA 3WALA 1JMLA 3QHTA 1ET9A 4I6NB 5JHAA 5EE3A 3HM6X 3RZWC 1E10A 5HG2A 1FFVA 2KTFA 1ZDXA 4JL9A 4MJSB 1NI3A 1Q5WB 1JWBD 1JROA 1KRHA 2KQ7A 2PKOA 1WZ3A 2AYOB 3W1SA 1D3ZA 1UUPA 1TS4A 1GUAB 1ZPSA 4OW0A 3L10B 4NAWB 5DPSA 1HZ5A 1E8YA 4A3OA 2MBBB 4RNAA 3MC8A 4XYCA 1XLQA 1KLGD 4LLGM 1HA5A 2KLCA 2LXCA 3KH0A 3RNCC 3VR9B 3DVNV 1YIWA 4A6QA 2LGYA 3VDZA 2KJRA 3H7PB 2JU6X 1SBBB 4B0MA 4DBGA 2QILA 2Z8LA 4C56C 1C78A 3VTVA 3E9SA 3J9CA 1YX6B 3P1MA 3MP9A 2CHWA 3R3MA 2IPKD 2MLBA 3AE2B 2PMVA 3AMZA 1PGBA 3APCA 2W3SA 4PS7A 1V5OA 2WNMA 1C79A 4TMAB 1WGYA 4O1NA 2L3ZA 3RYTA 2WHIA 4FJZA 2AQ1B 1MI0A 2WQYB 3AI5A 2AQ3B 1P3QU 5FK9C 4MM3B 2LJIA 1A70A 4XWWA 2D3BA 1V81A 1XEEA 2M0AA 4JE3B 1OEYJ 5FR3A 1FXIA 3Q3NC 1VD2A 3JYUA 4YSZB 1H8CA 1E8WA 2FUHB 2K9XA 2UYZB 1KFYB 4IKGA 4BBNC 3ZO5B 5IA7A 2L32A 1S1QB 2WS3B 2DAFA 1G6JA 2N1WA 1C1YB 2LUEA 4XZ4A 1TTNA 3RNBC 3MTNB 3PRZA 1WXVA 1TZ1A 4ZYNA 2KC1A 1V1OA 3TCAA 2QIEB 5CHFA 3KQ4A 1M94A 3QAQA 1MHXA 3BK1A 3TBLD 1LM8B 2ZVNA 4M00A
chains in the Genus database with same CATH topology
1V49A 3T8MA 2C60A 2KLGA 2QHOA 1EF5A 2YLMA 2PJHA 2LVOA 3UINB 3QC8B 3ZDTA 4W9LA 4J6IA 2G4SA 3VUYA 2IO3B 1Q1OA 4HCNB 1KM7A 2KOXA 4KV2A 2KXJA 4LDTB 5E6PA 4ASWC 2J0JA 4F1SA 1RLFA 1ZW7A 5JZEB 2FCQA 1WJ6A 2LVQA 4JQWC 2JZ3B 1WGHA 4GOCA 1KOTA 3TJPA 2KHWB 2G3QB 4W9DA 5EDSA 4II2B 2DHZA 4FN2A 3PS6A 4GMVA 4HXDA 4MH0E 5E6NA 4DXAB 2KWCA 2CKHB 4WAAA 2NBWB 4HCPB 3UIPB 2KO3A 1IP9A 2NPTB 4WWOA 3DOWA 3WIMA 2G45B 2WX0A 4JIOU 3M3JA 3LJ3A 2CS4A 5KHQA 1V6EA 4BOSC 1WH3A 4HDOA 5G2NA 3GZNI 1WMHA 3PVLA 4EKUA 4GU2A 2NBUA 2JT4B 3ZRFA 3A4RA 3PLVA 3A9JB 1GC6A 1WX7A 4HPMB 2KANA 1Y8RC 2KFKB 2L8JA 2IY1B 1V5TA 3L17A 3ZNGC 5C23A 4IC7B 3ZLZA 4CYEA 2D07B 1JRUA 2D2QA 1BT0A 2LZ6A 2BKFA 2JRHA 2MX2A 3JSVA 3KYDD 3V62A 1GNUA 1E8ZA 3PHXB 4KIKA 2JF5A 3OLMD 3CF6E 2ZZPB 3X0WA 3DVGY 2CHZA 2GBNA 2Y5BB 1V86A 3UGBB 3VTWA 4BBNF 4G0NB 4GGQA 2R2QA 3HK0A 5D6JB 1V2YA 3KYCD 2GBMA 2LXAA 3L0WB 3L08A 5BO4B 2C5LC 4M8MA 2B3AA 2NCNA 1TBEA 3NHEB 2JXXA 3PTFC 2FIFA 4K1RB 1WM3A 3GOEA 1EF1A 4EUTA 4NNJB 2LVPA 4G3XB 4DDID 2N9PC 2L0TA 4CHKA 2KJHB 2FNJB 5J18A 4MJSA 2DAJA 2LI5A 2MBHA 2N7EA 2KMAA 2GOWA 4XC2A 3M95A 3QQ8B 3RULA 3VFKA 1KLVA 1WZ0A 5KHOA 3JVZX 3U30A 2I1JA 4AP4C 3CSTA 1OGWA 2KDEB 1WGGA 4LDTD 4DDGD 4OVUA 3WANA 2RPQA 3APDA 2KWUB 5CHWA 3TL5A 3PGEA 4GN1A 4NPNA 3R7RA 3R66C 2KWVB 4WJPA 3VUXA 4BFRA 5J2RA 4W9EA 2MW5A 4AUQC 5DCNA 3ZTDA 4TUUA 1E5WA 2XK5B 3DBRI 3PZDA 2YVCA 4BKGA 1P1AA 2KDFB 2MQJA 4FA6A 3VH4B 1WY8A 3D32A 3P2BA 4E71A 4ZRIA 4CO7A 2MRPA 3QIJA 1P9DU 4W9CA 4HDQA 4EFOA 3DVNU 1IPGA 4FJYA 4LJOB 2ZJDA 1VCBA 3H7PA 4K7WA 4ANWA 4ICVA 3NOBA 3ONSA 4GDLA 4AJWA 1RRBA 4JGHB 4HK2A 2KDIA 1WGDA 2ZNVC 4KIKB 1WXAA 3H6NA 3UIOB 3B08A 2KK8A 2LRUA 1E7VA 2M1MA 1Z2MA 3HIZA 5CHVC 4PYUA 4I6PA 5FR6A 2KFJA 2M0XA 3PSEB 3QARA 3WAOA 2WYQA 4WWPA 3B0AA 4IM3A 2ZPYA 2KC2A 5LLIA 3I3TB 3X23A 3DBHI 2O2VA 3H7SA 2BYVE 4ZDVA 4WQOB 1WJUA 4W9JA 5JH5C 2REXA 3PPAA 1J19A 2FCSA 2KN5A 1UELA 3KUZA 3SDLC 3U8ZA 5E6OA 2L05A 1ZGUB 4IWOA 4KVGB 4MSQB 4P7IA 4PS3A 3VUWA 2L7RA 2KMCA 1YX5B 3KVFB 3L13A 1WJ4A 4G11A 4B9KA 1RAXA 4NQLB 4EZKA 2LWPA 4FBJB 1K8RB 1L2NA 5AZGA 3A1QA 4A3PA 2MP2A 3ZNHB 4M8NA 4OVVA 1V80A 1X1MA 4FHKA 4W9HA 2Z0EB 4A20A 3Q3JA 4M0WB 2BF8B 1E90A 3QJZA 2KNBA 1XQQA 2NVUI 2DYOA 2IO2B 4II3B 1C3TA 5AEKB 4MM3A 2R2OA 4YL8A 4F8CB 4MELA 3V6EB 4ZRJA 4WWNA 4DHJB 2BWES 4F7ZA 4GIVA 2LJ5A 4LCDE 2DZIA 1WIAA 2OJRA 2EMTA 2M17A 4IWQA 2HTHA 2DZJA 2ASQA 4AWJA 5JHAA 1WI0A 1GJZA 3K9OB 2AL3A 4HPLB 5J17A 4EZLA 3A9KA 2NBVB 4W9FA 3HM3A 4DK5A 5JHBA 2BYFA 2KTRA 3ML8A 2KKCA 3EHVA 5AZHA 1UZXB 2HD5B 3RUIB 1SE9A 2MSED 2DX5B 2BGFA 3R7QA 2ZVOA 2LASA 2RD0A 4I6LB 2N7DA 2WDTB 4E74A 4BKSD 1YD8U 2A4ZA 4W9IA 2GBJA 2Z0DB 3PHWB 2PE6B 3APFA 1P98A 2LGDA 3PLUA 4LJPB 1UBIA 2M8SA 1F9JA 3WA0A 2D11A 2KJ6A 4MDKE 1V9JA 1WR1A 2CR5A 2MBEA 3QK0A 3SU8X 4GDKA 3V61A 3W1YA 4HLEA 3V6CB 3HHMA 4IWPA 2K8BA 1J0GA 3NZUA 4FLHA 1R4MI 2HJ8A 2O2VB 4MGIE 3UQAA 1SGHA 3IHPC 5AZFA 4EOYA 2LD9A 1QZEA 4XX5A 4G50A 2GBRA 2DZMA 1E8XA 3RT3B 1WXMA 1T0YA 2I1KA 3VXWA 4EZJA 1SIFA 2KDBA 3IFWB 2L0FA 1L7YA 2MBOA 2XBBC 3OJ3A 1UBQA 2W9NA 2MBQA 2WX1A 4MGYE 3NY5A 3SD5A 3VHTC 2ZNVB 3NZSA 3PRPB 4K7SA 4NQKE 2CU1A 4MGZE 4NAWA 1WE6A 3UF8A 3DQVA 4URKA 1WGRA 2V4LA 1LFDA 2C7HA 1EO6A 2K6QA 4GSWA 1TGZB 1GG3A 2JY6A 1I35A 3IVFA 1J8CA 2O6VA 2DZKA 3ML9A 3ZRCA 3N30A 3VH3B 1WM2A 1WMHB 1RFAA 4FHJA 3DVGX 3O65B 2JWZA 1XT9B 3KUCB 4DHJD 2NPTA 3BY4B 4KSLC 2IBIB 4FADA 4ANUA 5D7GA 1NI2A 1UGMA 5LXIB 2L00B 5D94A 3JSVB 1WR6E 2K1FA 5CTRC 2K8CA 2K8HA 3KUDB 1FXTB 2IZVB 3A9JA 5D2MB 2PEAA 3PV1A 2FIDA 3AXCA 3OJ4B 2KFKA 2ZCBA 1I42A 3QX1A 3ZIMA 1WXSA 5DPWA 2LRWA 1P0RA 2DYBA 2NS5A 4KZ0A 2Z59B 3LDZE 4WJQA 3WALA 4RMAA 1OEYA 2KX3A 4N9F4 3EFUA 2ZPNA 4TV3A 4BKTA 3B1LX 3ZKJC 2MA9B 3DBLI 3JW0X 3QA8A 4BVUC 2BKRB 1ZKHA 1WFYA 3QHTA 4AOFA 4PYZA 4I6NB 2RSUA 3VAWA 4ANXA 4NY0A 1KJTA 2DENB 3HM6X 3RZWC 3MHSD 3ZW3A 4DWFA 2JVCA 2KTFA 1XD3B 2KZRA 4JL9A 2J7QB 3TMPB 4MJSB 1Q5WB 2ZCCA 2JUOA 2D3GA 2KQSA 4BOZB 2KQ7A 3ZTCA 1WZ3A 2AYOB 3K9PB 4TQ1A 3W1SA 1D3ZA 1LQBA 4KDLB 4MGKE 4K7UA 2VRRB 2IY0B 2AEHA 3M62B 4IM2A 5IAAC 5L83A 5L95C 2MCNB 2M4NA 2N9XA 3PREA 4WJNA 3M63B 1GUAB 3N3KB 4KDIC 3L10B 2V1YA 3QWZB 3U7DA 3TIXA 1WYWB 4NAWB 2K25A 5DPSA 1E8YA 3DDCB 4A3OA 2MBBB 3DPDA 2C9WB 2GBKA 5HKHA 2FAZA 1CMXB 1EUVB 3VTUA 2G4DB 2O6VB 2JPHA 2WWZA 3NS8A 2KLCA 2PE9A 5DPTA 4HJKA 2LXCA 2KX0A 3DCGA 3KH0A 1ISNA 2FCNA 3MJWA 3DVNV 4IM0A 2XK5A 4B95A 2UWQA 1R4NI 3EECA 1YIWA 2LGYA 3VDZA 2BWFA 2KJRA 2KVRA 2L76A 3H7PB 4EEWA 3BINA 3RD2A 4GDLB 1WRDB 4DBGA 3SHQA 4W9KA 3A33B 4B6WA 3OAWA 2IO1B 2J0MA 1Q0WB 1WE7A 3L16A 2MWSB 4WJOA 2J0KA 4IG7B 4BKSA 3VTVA 4IUMB 1WF9A 4MSMB 4NJ6A 1YX6B 4K81A 2XEWA 3IBEA 4TKNA 2D10A 2JZZA 4IW0A 2C7NB 2CHWA 3R3MA 3CMMB 2MLBA 3T9LA 3APCA 4NJ7A 1NDDA 2IO0B 1Z5SB 4JLCA 1YQBA 2C7MB 3L54A 4PS7A 3AULA 3S2AA 3Q3FA 1V5OA 4ANVA 1OTRB 3ZUNA 1AARA 3N32A 3ZVVA 3IG3A 5GMVA 4FJVB 4RM9A 4ICUA 2EKEC 3PRMB 1S3SG 1UH6A 1NBFC 1E7UA 3ZDMC 3KW5B 3RCZA 2HE7A 1WGYA 2NR2A 3H9DA 3A1QB 2MP2B 2L3ZA 3RYTA 4FJZA 1IYFA 1A5RA 2AL6A 1MG8A 1YJ1A 4GXBA 1WJNA 2OOBB 3AI5A 5TR5A 1P3QU 2N4FA 2PPHA 3QCAA 4ZRKA 5CX3A 4GB9A 2AWTA 3VQIA 1UD7A 1V81A 4PS8A 3V60A 3ALBA 1OEYJ 1OQYA 4MEMA 2IYDB 2N1VA 1VD2A 1LXDA 3DBSA 3JYUA 5G55A 4E3CA 1H8CA 1E8WA 4DHZE 4X57B 2FUHB 2K6DB 3A4SC 2UYZB 2A5UA 2CHXA 2EMSA 3ZNID 2BPSA 2JRIB 3A9KB 4BBNC 5LXHA 3ZO5B 5IA7A 3W1SC 4HVBA 1PQSA 2KTRB 2RGFA 1S1QB 4AJYB 2O6VD 4HWIB 2DAFA 3AU4A 1G6JA 2N1WA 5C1ZA 1C1YB 3WAMA 2LUEA 4XZ4A 1WX8A 2FCMA 1TTNA 3ECIA 1H4RA 3MTNB 3PRZA 3EC8A 1WXVA 4FULA 1TZ1A 3PT2B 1GC7A 2ZEQA 1U4AA 2V3SA 4ZYNA 3AU5A 4DHZB 2GMIC 2KC1A 3TCAA 2LGXA 3UQBA 4KSKC 5DPRA 5CHFA 1HE8A 4TQ0A 1M94A 2BYEA 2N9EB 3WAPA 3C0RB 3ZNZB 2RR9A 3H1UA 3VVWB 3CSFA 2KD0A 2K39A 4GDKB 3QAQA 1WX9A 4W9GA 2DYMA 3TBLD 1LM8B 2ZVNA 3RZFA 4RM8A 4KZCA 3ENEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1V49 A;  3T8M A;  2C60 A;  2KLG A;  2QHO A;  1EF5 A;  2YLM A;  2PJH A;  2LVO A;  3UIN B;  3QC8 B;  3ZDT A;  4W9L A;  4J6I A;  2G4S A;  3VUY A;  2IO3 B;  1Q1O A;  4HCN B;  1KM7 A;  2KOX A;  4KV2 A;  2KXJ A;  4LDT B;  5E6P A;  4ASW C;  2J0J A;  4F1S A;  1RLF A;  1ZW7 A;  5JZE B;  2FCQ A;  1WJ6 A;  2LVQ A;  4JQW C;  2JZ3 B;  1WGH A;  4GOC A;  1KOT A;  3TJP A;  2KHW B;  2G3Q B;  4W9D A;  5EDS A;  4II2 B;  2DHZ A;  4FN2 A;  3PS6 A;  4GMV A;  4HXD A;  4MH0 E;  5E6N A;  4DXA B;  2KWC A;  2CKH B;  4WAA A;  2NBW B;  4HCP B;  3UIP B;  2KO3 A;  1IP9 A;  2NPT B;  4WWO A;  3DOW A;  3WIM A;  2G45 B;  2WX0 A;  4JIO U;  3M3J A;  3LJ3 A;  2CS4 A;  5KHQ A;  1V6E A;  4BOS C;  1WH3 A;  4HDO A;  5G2N A;  3GZN I;  1WMH A;  3PVL A;  4EKU A;  4GU2 A;  2NBU A;  2JT4 B;  3ZRF A;  3A4R A;  3PLV A;  3A9J B;  1GC6 A;  1WX7 A;  4HPM B;  2KAN A;  1Y8R C;  2KFK B;  2L8J A;  2IY1 B;  1V5T A;  3L17 A;  3ZNG C;  5C23 A;  4IC7 B;  3ZLZ A;  4CYE A;  2D07 B;  1JRU A;  2D2Q A;  1BT0 A;  2LZ6 A;  2BKF A;  2JRH A;  2MX2 A;  3JSV A;  3KYD D;  3V62 A;  1GNU A;  1E8Z A;  3PHX B;  4KIK A;  2JF5 A;  3OLM D;  3CF6 E;  2ZZP B;  3X0W A;  3DVG Y;  2CHZ A;  2GBN A;  2Y5B B;  1V86 A;  3UGB B;  3VTW A;  4BBN F;  4G0N B;  4GGQ A;  2R2Q A;  3HK0 A;  5D6J B;  1V2Y A;  3KYC D;  2GBM A;  2LXA A;  3L0W B;  3L08 A;  5BO4 B;  2C5L C;  4M8M A;  2B3A A;  2NCN A;  1TBE A;  3NHE B;  2JXX A;  3PTF C;  2FIF A;  4K1R B;  1WM3 A;  3GOE A;  1EF1 A;  4EUT A;  4NNJ B;  2LVP A;  4G3X B;  4DDI D;  2N9P C;  2L0T A;  4CHK A;  2KJH B;  2FNJ B;  5J18 A;  4MJS A;  2DAJ A;  2LI5 A;  2MBH A;  2N7E A;  2KMA A;  2GOW A;  4XC2 A;  3M95 A;  3QQ8 B;  3RUL A;  3VFK A;  1KLV A;  1WZ0 A;  5KHO A;  3JVZ X;  3U30 A;  2I1J A;  4AP4 C;  3CST A;  1OGW A;  2KDE B;  1WGG A;  4LDT D;  4DDG D;  4OVU A;  3WAN A;  2RPQ A;  3APD A;  2KWU B;  5CHW A;  3TL5 A;  3PGE A;  4GN1 A;  4NPN A;  3R7R A;  3R66 C;  2KWV B;  4WJP A;  3VUX A;  4BFR A;  5J2R A;  4W9E A;  2MW5 A;  4AUQ C;  5DCN A;  3ZTD A;  4TUU A;  1E5W A;  2XK5 B;  3DBR I;  3PZD A;  2YVC A;  4BKG A;  1P1A A;  2KDF B;  2MQJ A;  4FA6 A;  3VH4 B;  1WY8 A;  3D32 A;  3P2B A;  4E71 A;  4ZRI A;  4CO7 A;  2MRP A;  3QIJ A;  1P9D U;  4W9C A;  4HDQ A;  4EFO A;  3DVN U;  1IPG A;  4FJY A;  4LJO B;  2ZJD A;  1VCB A;  3H7P A;  4K7W A;  4ANW A;  4ICV A;  3NOB A;  3ONS A;  4GDL A;  4AJW A;  1RRB A;  4JGH B;  4HK2 A;  2KDI A;  1WGD A;  2ZNV C;  4KIK B;  1WXA A;  3H6N A;  3UIO B;  3B08 A;  2KK8 A;  2LRU A;  1E7V A;  2M1M A;  1Z2M A;  3HIZ A;  5CHV C;  4PYU A;  4I6P A;  5FR6 A;  2KFJ A;  2M0X A;  3PSE B;  3QAR A;  3WAO A;  2WYQ A;  4WWP A;  3B0A A;  4IM3 A;  2ZPY A;  2KC2 A;  5LLI A;  3I3T B;  3X23 A;  3DBH I;  2O2V A;  3H7S A;  2BYV E;  4ZDV A;  4WQO B;  1WJU A;  4W9J A;  5JH5 C;  2REX A;  3PPA A;  1J19 A;  2FCS A;  2KN5 A;  1UEL A;  3KUZ A;  3SDL C;  3U8Z A;  5E6O A;  2L05 A;  1ZGU B;  4IWO A;  4KVG B;  4MSQ B;  4P7I A;  4PS3 A;  3VUW A;  2L7R A;  2KMC A;  1YX5 B;  3KVF B;  3L13 A;  1WJ4 A;  4G11 A;  4B9K A;  1RAX A;  4NQL B;  4EZK A;  2LWP A;  4FBJ B;  1K8R B;  1L2N A;  5AZG A;  3A1Q A;  4A3P A;  2MP2 A;  3ZNH B;  4M8N A;  4OVV A;  1V80 A;  1X1M A;  4FHK A;  4W9H A;  2Z0E B;  4A20 A;  3Q3J A;  4M0W B;  2BF8 B;  1E90 A;  3QJZ A;  2KNB A;  1XQQ A;  2NVU I;  2DYO A;  2IO2 B;  4II3 B;  1C3T A;  5AEK B;  4MM3 A;  2R2O A;  4YL8 A;  4F8C B;  4MEL A;  3V6E B;  4ZRJ A;  4WWN A;  4DHJ B;  2BWE S;  4F7Z A;  4GIV A;  2LJ5 A;  4LCD E;  2DZI A;  1WIA A;  2OJR A;  2EMT A;  2M17 A;  4IWQ A;  2HTH A;  2DZJ A;  2ASQ A;  4AWJ A;  5JHA A;  1WI0 A;  1GJZ A;  3K9O B;  2AL3 A;  4HPL B;  5J17 A;  4EZL A;  3A9K A;  2NBV B;  4W9F A;  3HM3 A;  4DK5 A;  5JHB A;  2BYF A;  2KTR A;  3ML8 A;  2KKC A;  3EHV A;  5AZH A;  1UZX B;  2HD5 B;  3RUI B;  1SE9 A;  2MSE D;  2DX5 B;  2BGF A;  3R7Q A;  2ZVO A;  2LAS A;  2RD0 A;  4I6L B;  2N7D A;  2WDT B;  4E74 A;  4BKS D;  1YD8 U;  2A4Z A;  4W9I A;  2GBJ A;  2Z0D B;  3PHW B;  2PE6 B;  3APF A;  1P98 A;  2LGD A;  3PLU A;  4LJP B;  1UBI A;  2M8S A;  1F9J A;  3WA0 A;  2D11 A;  2KJ6 A;  4MDK E;  1V9J A;  1WR1 A;  2CR5 A;  2MBE A;  3QK0 A;  3SU8 X;  4GDK A;  3V61 A;  3W1Y A;  4HLE A;  3V6C B;  3HHM A;  4IWP A;  2K8B A;  1J0G A;  3NZU A;  4FLH A;  1R4M I;  2HJ8 A;  2O2V B;  4MGI E;  3UQA A;  1SGH A;  3IHP C;  5AZF A;  4EOY A;  2LD9 A;  1QZE A;  4XX5 A;  4G50 A;  2GBR A;  2DZM A;  1E8X A;  3RT3 B;  1WXM A;  1T0Y A;  2I1K A;  3VXW A;  4EZJ A;  1SIF A;  2KDB A;  3IFW B;  2L0F A;  1L7Y A;  2MBO A;  2XBB C;  3OJ3 A;  1UBQ A;  2W9N A;  2MBQ A;  2WX1 A;  4MGY E;  3NY5 A;  3SD5 A;  3VHT C;  2ZNV B;  3NZS A;  3PRP B;  4K7S A;  4NQK E;  2CU1 A;  4MGZ E;  4NAW A;  1WE6 A;  3UF8 A;  3DQV A;  4URK A;  1WGR A;  2V4L A;  1LFD A;  2C7H A;  1EO6 A;  2K6Q A;  4GSW A;  1TGZ B;  1GG3 A;  2JY6 A;  1I35 A;  3IVF A;  1J8C A;  2O6V A;  2DZK A;  3ML9 A;  3ZRC A;  3N30 A;  3VH3 B;  1WM2 A;  1WMH B;  1RFA A;  4FHJ A;  3DVG X;  3O65 B;  2JWZ A;  1XT9 B;  3KUC B;  4DHJ D;  2NPT A;  3BY4 B;  4KSL C;  2IBI B;  4FAD A;  4ANU A;  5D7G A;  1NI2 A;  1UGM A;  5LXI B;  2L00 B;  5D94 A;  3JSV B;  1WR6 E;  2K1F A;  5CTR C;  2K8C A;  2K8H A;  3KUD B;  1FXT B;  2IZV B;  3A9J A;  5D2M B;  2PEA A;  3PV1 A;  2FID A;  3AXC A;  3OJ4 B;  2KFK A;  2ZCB A;  1I42 A;  3QX1 A;  3ZIM A;  1WXS A;  5DPW A;  2LRW A;  1P0R A;  2DYB A;  2NS5 A;  4KZ0 A;  2Z59 B;  3LDZ E;  4WJQ A;  3WAL A;  4RMA A;  1OEY A;  2KX3 A;  4N9F 4;  3EFU A;  2ZPN A;  4TV3 A;  4BKT A;  3B1L X;  3ZKJ C;  2MA9 B;  3DBL I;  3JW0 X;  3QA8 A;  4BVU C;  2BKR B;  1ZKH A;  1WFY A;  3QHT A;  4AOF A;  4PYZ A;  4I6N B;  2RSU A;  3VAW A;  4ANX A;  4NY0 A;  1KJT A;  2DEN B;  3HM6 X;  3RZW C;  3MHS D;  3ZW3 A;  4DWF A;  2JVC A;  2KTF A;  1XD3 B;  2KZR A;  4JL9 A;  2J7Q B;  3TMP B;  4MJS B;  1Q5W B;  2ZCC A;  2JUO A;  2D3G A;  2KQS A;  4BOZ B;  2KQ7 A;  3ZTC A;  1WZ3 A;  2AYO B;  3K9P B;  4TQ1 A;  3W1S A;  1D3Z A;  1LQB A;  4KDL B;  4MGK E;  4K7U A;  2VRR B;  2IY0 B;  2AEH A;  3M62 B;  4IM2 A;  5IAA C;  5L83 A;  5L95 C;  2MCN B;  2M4N A;  2N9X A;  3PRE A;  4WJN A;  3M63 B;  1GUA B;  3N3K B;  4KDI C;  3L10 B;  2V1Y A;  3QWZ B;  3U7D A;  3TIX A;  1WYW B;  4NAW B;  2K25 A;  5DPS A;  1E8Y A;  3DDC B;  4A3O A;  2MBB B;  3DPD A;  2C9W B;  2GBK A;  5HKH A;  2FAZ A;  1CMX B;  1EUV B;  3VTU A;  2G4D B;  2O6V B;  2JPH A;  2WWZ A;  3NS8 A;  2KLC A;  2PE9 A;  5DPT A;  4HJK A;  2LXC A;  2KX0 A;  3DCG A;  3KH0 A;  1ISN A;  2FCN A;  3MJW A;  3DVN V;  4IM0 A;  2XK5 A;  4B95 A;  2UWQ A;  1R4N I;  3EEC A;  1YIW A;  2LGY A;  3VDZ A;  2BWF A;  2KJR A;  2KVR A;  2L76 A;  3H7P B;  4EEW A;  3BIN A;  3RD2 A;  4GDL B;  1WRD B;  4DBG A;  3SHQ A;  4W9K A;  3A33 B;  4B6W A;  3OAW A;  2IO1 B;  2J0M A;  1Q0W B;  1WE7 A;  3L16 A;  2MWS B;  4WJO A;  2J0K A;  4IG7 B;  4BKS A;  3VTV A;  4IUM B;  1WF9 A;  4MSM B;  4NJ6 A;  1YX6 B;  4K81 A;  2XEW A;  3IBE A;  4TKN A;  2D10 A;  2JZZ A;  4IW0 A;  2C7N B;  2CHW A;  3R3M A;  3CMM B;  2MLB A;  3T9L A;  3APC A;  4NJ7 A;  1NDD A;  2IO0 B;  1Z5S B;  4JLC A;  1YQB A;  2C7M B;  3L54 A;  4PS7 A;  3AUL A;  3S2A A;  3Q3F A;  1V5O A;  4ANV A;  1OTR B;  3ZUN A;  1AAR A;  3N32 A;  3ZVV A;  3IG3 A;  5GMV A;  4FJV B;  4RM9 A;  4ICU A;  2EKE C;  3PRM B;  1S3S G;  1UH6 A;  1NBF C;  1E7U A;  3ZDM C;  3KW5 B;  3RCZ A;  2HE7 A;  1WGY A;  2NR2 A;  3H9D A;  3A1Q B;  2MP2 B;  2L3Z A;  3RYT A;  4FJZ A;  1IYF A;  1A5R A;  2AL6 A;  1MG8 A;  1YJ1 A;  4GXB A;  1WJN A;  2OOB B;  3AI5 A;  5TR5 A;  1P3Q U;  2N4F A;  2PPH A;  3QCA A;  4ZRK A;  5CX3 A;  4GB9 A;  2AWT A;  3VQI A;  1UD7 A;  1V81 A;  4PS8 A;  3V60 A;  3ALB A;  1OEY J;  1OQY A;  4MEM A;  2IYD B;  2N1V A;  1VD2 A;  1LXD A;  3DBS A;  3JYU A;  5G55 A;  4E3C A;  1H8C A;  1E8W A;  4DHZ E;  4X57 B;  2FUH B;  2K6D B;  3A4S C;  2UYZ B;  2A5U A;  2CHX A;  2EMS A;  3ZNI D;  2BPS A;  2JRI B;  3A9K B;  4BBN C;  5LXH A;  3ZO5 B;  5IA7 A;  3W1S C;  4HVB A;  1PQS A;  2KTR B;  2RGF A;  1S1Q B;  4AJY B;  2O6V D;  4HWI B;  2DAF A;  3AU4 A;  1G6J A;  2N1W A;  5C1Z A;  1C1Y B;  3WAM A;  2LUE A;  4XZ4 A;  1WX8 A;  2FCM A;  1TTN A;  3ECI A;  1H4R A;  3MTN B;  3PRZ A;  3EC8 A;  1WXV A;  4FUL A;  1TZ1 A;  3PT2 B;  1GC7 A;  2ZEQ A;  1U4A A;  2V3S A;  4ZYN A;  3AU5 A;  4DHZ B;  2GMI C;  2KC1 A;  3TCA A;  2LGX A;  3UQB A;  4KSK C;  5DPR A;  5CHF A;  1HE8 A;  4TQ0 A;  1M94 A;  2BYE A;  2N9E B;  3WAP A;  3C0R B;  3ZNZ B;  2RR9 A;  3H1U A;  3VVW B;  3CSF A;  2KD0 A;  2K39 A;  4GDK B;  3QAQ A;  1WX9 A;  4W9G A;  2DYM A;  3TBL D;  1LM8 B;  2ZVN A;  3RZF A;  4RM8 A;  4KZC A;  3ENE A; 
#chains in the Genus database with same CATH topology
 2SEB D;  3T8M A;  2IDY A;  3RNA C;  2QHO A;  3I57 A;  2LVO A;  1MPE A;  3VUY A;  5BYS A;  4HCN B;  1L4Z B;  2LVQ A;  4ARC A;  3Q8F A;  3RMK C;  3TJP A;  4A9A A;  3PS6 A;  4L1B A;  4DXA B;  3VR8 B;  2KO3 A;  2J42 A;  3Q69 A;  2G45 B;  2CS4 A;  4OZB A;  4YXD B;  1FNW A;  4GU2 A;  1GC6 A;  3HVD A;  1WX7 A;  2K22 A;  1SJH D;  2KAN A;  2L8J A;  4LNO A;  1VZ6 A;  3NS1 A;  1BT0 A;  3TEX A;  5LNK 1;  2MX2 A;  3PHX B;  4KIK A;  1WRI A;  3SEB A;  1B9R A;  3OLM D;  2CHZ A;  4ACF A;  3UGB B;  4G0N B;  3KYC D;  2M19 A;  2NCN A;  1TBE A;  4G3X B;  4RF0 A;  4XC2 A;  2NTT A;  1FCL A;  3VFK A;  1QF6 A;  1WZ0 A;  2BS2 B;  3U30 A;  2I1J A;  1OGW A;  4ARI A;  1SIJ A;  1WGG A;  4OVU A;  2KWU B;  5CHW A;  3TL5 A;  3PGE A;  3GS2 A;  4NPN A;  2KWV B;  4BFR A;  3VUX A;  1K53 A;  2MW5 A;  2M56 B;  2XK5 B;  3AE5 B;  1WY8 A;  3P2B A;  1YMH E;  4C7Y A;  2BS4 B;  4MAC A;  4EFO A;  3PZ8 A;  3EGR A;  5IO9 A;  2BB6 A;  2ZJD A;  1VCB A;  1JQ4 A;  4ANW A;  2DLB A;  4MH8 A;  3FIL A;  4HK2 A;  3HUI A;  2ZNV C;  1VDV A;  4A90 A;  1EWC A;  4RF1 A;  2LRU A;  2M1M A;  1Z2M A;  4N6E B;  4I6P A;  2K0P A;  4KGT A;  3P4P B;  3X23 A;  3AE7 B;  2AQ2 B;  2O2V A;  1ACC A;  4W9J A;  5JH5 C;  1J19 A;  1SE2 A;  1UEL A;  3SDL C;  2L05 A;  1ZGU B;  4IWO A;  4KVG B;  4MSQ B;  3IAM 1;  3VUW A;  4HKZ E;  1RAX A;  1XO3 A;  3W9C B;  1L2N A;  4A3P A;  4M8N A;  2KAC A;  4W9H A;  1AWD A;  2Z0E B;  3Q3J A;  1EU4 A;  2KNB A;  4S17 A;  5EE1 A;  1JWU D;  2MEK A;  4F8C B;  5G5H A;  4IOI E;  1XCT L;  2DZI A;  2HTH A;  1KF6 B;  2BBC A;  5HFY A;  1WI0 A;  2AL3 A;  3RFZ B;  3A9K A;  3DWM A;  4W9F A;  5JHB A;  2BYF A;  3ML8 A;  3EHV A;  1UZX B;  1N5X A;  2LAS A;  4E74 A;  4W9I A;  2PE6 B;  3APF A;  2R61 A;  2LGD A;  1UBI A;  3E56 A;  2D11 A;  1V9J A;  4YTN B;  1SF0 A;  4C7Z A;  1TKG A;  2JSV X;  4GDK A;  3V61 A;  4HLE A;  3HHM A;  4MGI E;  1QZE A;  4XX5 A;  3UI3 A;  3B9J A;  2DZM A;  1HQR D;  1T0Y A;  3VXW A;  4N58 A;  3W5U B;  3IFW B;  2D3C A;  2XBB C;  4EE2 A;  1UBQ A;  1L5P A;  3SD5 A;  1IGC A;  3RNF C;  3VHT C;  2ZNV B;  2WXP A;  4NQK E;  4URK A;  5BMI A;  1RFK A;  2K6Q A;  1GG3 A;  5BYR A;  2DZK A;  3ZRC A;  3N30 A;  1WMH B;  4KKI A;  1EWY C;  3DVG X;  3BVG A;  2JWZ A;  3KUC B;  2NPT A;  1SEB D;  4KSL C;  4US9 A;  3TEW A;  4ANU A;  2QSD A;  1UGM A;  2INP E;  1FRD A;  1WR6 E;  2K1F A;  1I4R A;  2WXM A;  1FXT B;  2XNA C;  3A9J A;  2J4X A;  2FID A;  2PVG C;  2KFK A;  4PT5 A;  5C2T B;  1I42 A;  3ZIM A;  2LRW A;  1P0R A;  1XCQ L;  3U2S C;  3LDZ E;  3IXS A;  2GI9 A;  4YT0 B;  2KX3 A;  2N9L A;  2BS3 B;  3DBL I;  1WFY A;  1K51 A;  3VAW A;  4NY0 A;  2DEN B;  3ZW3 A;  3TMP B;  1EM7 A;  2LGI A;  2WXL A;  1HTQ A;  2ZCC A;  3KLS X;  4REZ A;  2JUO A;  2ON8 A;  4RGO S;  3ZTC A;  2LGS A;  1HXY D;  4MT5 A;  3AE3 B;  4K7U A;  2VRR B;  3AEE B;  2IY0 B;  5L95 C;  2M4N A;  2N9X A;  3PRE A;  1V1P A;  2KWD A;  4LTU A;  5BMG A;  3QWZ B;  2DNF A;  3NVY A;  1WYW B;  1RYJ A;  2C9W B;  4S0R A;  1UWX A;  2FAZ A;  1EUV B;  2WP9 B;  2WWZ A;  2WXI A;  2OHF A;  4HJK A;  2BVC A;  3DCG A;  2FCN A;  4B95 A;  2BWF A;  2KVR A;  2L76 A;  4J3O D;  4PK1 A;  3BIN A;  1WRD B;  2JXT A;  3A33 B;  2IO1 B;  2J0M A;  2VH2 A;  1WE7 A;  3L16 A;  4WJO A;  1BXT A;  1WF9 A;  4NJ6 A;  2ACZ B;  2XEW A;  2FUG 1;  2D10 A;  2JZZ A;  4IW0 A;  3T9L A;  4JLC A;  2K5P A;  2C7M B;  1ENF A;  3L54 A;  3AE8 B;  1P7F A;  3GE8 C;  1XXG A;  3ZUN A;  1AAR A;  3IG3 A;  2B76 B;  1TKY A;  1D5Z C;  2DWQ A;  3ZDM C;  3KW5 B;  1YJI A;  2HE7 A;  1C4P A;  3A1Q B;  2V9H A;  1MG8 A;  2E3T A;  2OOB B;  1AN8 A;  5TR5 A;  2N4F A;  4GB9 A;  2I38 A;  1CZP A;  2QCZ A;  4PS8 A;  3ALB A;  1OQY A;  2PVO D;  3FAH A;  5AUK A;  1WYG A;  5T8I A;  4E3C A;  1JW9 D;  1L0Y B;  4M0W A;  2BYT A;  3RNG C;  2A5U A;  2OED A;  4ZHO A;  2CHX A;  2BPS A;  2JRI B;  4LK0 M;  4HVB A;  1PQS A;  4HWI B;  3AU4 A;  4C4V A;  3WAM A;  2HTM E;  4LNF A;  3PT2 B;  2ZEQ A;  3AU5 A;  3UQB A;  2LGX A;  2KMM A;  2N9E B;  3AEG B;  3WAP A;  2KD0 A;  2DYM A;  2V3N A;  1C9F A;  4KZC A;  3DHH C;  3EA6 A;  1V97 A;  2C60 A;  1BUI C;  2Y5P A;  4HPP A;  3UIN B;  4J6I A;  1XLP A;  2IO3 B;  1J7B A;  2KOX A;  2J0J A;  1ZW7 A;  1WJ6 A;  4JQW C;  3HRD D;  2LFI A;  3BZD B;  1KOT A;  2G3Q B;  4MH0 E;  2KWC A;  4WAA A;  5E6J A;  3UIP B;  1IP9 A;  2IGG A;  2IND C;  3WIM A;  1L0X B;  3L4P A;  4ITK A;  4RFB A;  1V6E A;  3Q3O C;  4WIP A;  1STE A;  1KTK A;  3ZRF A;  2NBU A;  2JT4 B;  3BK2 A;  1T0R C;  3PLV A;  3R8B A;  4KGR A;  2WXG A;  1GOZ A;  1F52 A;  2HJ1 A;  1JRU A;  3U4E G;  2LEK A;  2BKF A;  1N60 A;  2IGH A;  4HKQ A;  2WDV B;  3RN9 C;  2L52 A;  3CF6 E;  3X0W A;  2KQ4 X;  2NTS A;  1V86 A;  1YN3 A;  3VTW A;  5BO4 B;  3L0W B;  2GBM A;  3U7Z A;  3Q8A A;  2JXX A;  2FIF A;  1WM3 A;  2QDF A;  1JRP A;  4AQ7 A;  1VR9 A;  2L0T A;  5HI1 A;  2KJH B;  2FNJ B;  5J18 A;  2IGD A;  2DAJ A;  2LI5 A;  2MBH A;  4MJS A;  2KMA A;  3BVZ A;  3QQ8 B;  1KLV A;  1F77 A;  3SFD B;  3N1Y C;  2W82 A;  3WAN A;  2MJE A;  2RPQ A;  3APD A;  3R7R A;  3R66 C;  1VZ8 A;  4WJP A;  2J52 A;  4AUQ C;  4TUU A;  1DOY A;  4ZRQ A;  4OVZ A;  4BKG A;  1P1A A;  2BB5 A;  3PO0 A;  4CO7 A;  2MRP A;  3DBL B;  2ZW1 A;  2JX5 A;  2H88 B;  4HDQ A;  3DVN U;  1IPG A;  4FJY A;  3H7P A;  3I5J C;  4OHJ A;  4N59 A;  3ONS A;  3AEB B;  3ZXR A;  1RRB A;  4JGH B;  2KDI A;  4KIK B;  5BMH A;  3B08 A;  3HIZ A;  5CHV C;  1YN5 A;  2M0X A;  3WAO A;  1WSP A;  4BZA A;  2KC2 A;  4HJG E;  3I3T B;  3H7S A;  2BYV E;  3LXF A;  4ZDV A;  4RH6 A;  1WJU A;  3U8Z A;  4C00 A;  5H92 C;  4UDU C;  4P7I A;  3KVF B;  4G11 A;  2SAK A;  2LWP A;  1TIF A;  3ZNH B;  4OVV A;  1V80 A;  2JYE A;  4A8X C;  3AE9 B;  2UU7 A;  3QJZ A;  2NVU I;  2DYO A;  2W55 A;  1C3T A;  4MM3 A;  2R2O A;  4MEL A;  3BII D;  4WWN A;  2GRI A;  2BWE S;  4F7Z A;  4LCD E;  2OJR A;  5D3I B;  2EMT A;  2M17 A;  4IWQ A;  3Q6B A;  4YSX B;  2WXO A;  4AWJ A;  2HDE A;  1GJZ A;  5J17 A;  3NRZ A;  1T0Q C;  4WUR A;  2KKC A;  2HD5 B;  3RUI B;  3T3O A;  3R7Q A;  2FBW B;  2RD0 A;  3DWG C;  2WDT B;  3FKY A;  3P42 A;  4I6L B;  4BKS D;  3O13 A;  1F0Z A;  2Z0D B;  4CQN A;  1P98 A;  4KX6 B;  2M8S A;  1YN4 A;  1NYR A;  1WR1 A;  3C19 A;  4NZL B;  3SU8 X;  3V6C B;  5IP4 D;  1R4M I;  2O2V B;  3DHG C;  3IHP C;  3AEF B;  3C8Y A;  3Q3M C;  2KDB A;  5IN7 A;  4MGY E;  1ROE A;  4RGM A;  5H8Y E;  1T6B X;  4K3C A;  3N9Y C;  1LFD A;  2C7H A;  1OQQ A;  1EO6 A;  1VRA B;  2O6V A;  3ML9 A;  3VH3 B;  1FPY A;  2K3U A;  2N9K A;  2KAJ A;  5IOI A;  1HZ6 A;  4FAD A;  3Q2A C;  1PGX A;  1NI2 A;  1FO4 A;  3JSV B;  5CTR C;  2K8C A;  3KUD B;  1AYF A;  2K8H A;  2LUM A;  3FC4 A;  1VJK A;  3NVW A;  2PW9 A;  3P63 A;  3WCQ A;  1OFF A;  1WXS A;  1N5W A;  2NS5 A;  2Z59 B;  3OWE B;  4WJQ A;  1OEY A;  4N9F 4;  3EFU A;  2ZPN A;  3BVM A;  3QA8 A;  4BVU C;  4ZRP A;  1ZKH A;  4AOF A;  5EE0 A;  1AW7 A;  3T3N A;  1I4G A;  2RSU A;  1KJT A;  3MHS D;  1XD3 B;  1FEH A;  4DQO C;  2D3G A;  3LYY A;  4BOZ B;  1QT9 A;  1JCK B;  1ZXI A;  4MGK E;  4IM2 A;  1C76 A;  2MCN B;  4A55 A;  5D3D A;  4KDI C;  3N3K B;  5FKA C;  4ZOH C;  3U7D A;  2L83 A;  1TT5 B;  2V0G A;  3DDC B;  3DPD A;  4RGT A;  1F1H A;  1CMX B;  3ZYY X;  1UNS A;  5DPT A;  1DOI A;  1QOF A;  1QIL A;  3MJW A;  4XDD A;  4IM0 A;  2OJW A;  2XK5 A;  2UWQ A;  3EEC A;  5HHD G;  2WXJ A;  3BYY B;  1K50 A;  1YQ3 B;  4EEW A;  4GDL B;  4HRO A;  1E0Z A;  3OAW A;  4KGS A;  2J0K A;  1L4D B;  1RM6 C;  4MSM B;  3KWV A;  1TS3 A;  4TKN A;  1I4H A;  1XF5 L;  4LNK A;  2KYW A;  4RCO A;  3IT6 B;  1ZP0 B;  3P4Q B;  4NJ7 A;  2IO0 B;  1Z5S B;  3S2A A;  1FIQ A;  2XN9 C;  1MVK A;  1JWS D;  5GMV A;  4RM9 A;  2EKE C;  3PRM B;  1S3S G;  3RCZ A;  2NR2 A;  2MP2 B;  3P4R B;  1KLU D;  2WXF A;  3BWU D;  4GXB A;  3QCA A;  4ZRK A;  1KH0 A;  4JPS A;  2EKI A;  2AWT A;  3VQI A;  1JWA D;  2IYD B;  2LMC A;  2N1V A;  1LXD A;  3DBS A;  1D5M C;  4DHZ E;  4X57 B;  1ZOY B;  2EMS A;  1PYW D;  2J53 A;  2MJ3 A;  3W1S C;  2KTR B;  2RGF A;  4AJY B;  1ET6 A;  1E9M A;  3TUO A;  5C1Z A;  1QOG A;  3TSS A;  2FE8 A;  2QC8 A;  1N6Z A;  1IBX B;  3ECI A;  1D5X C;  1VZ7 A;  4M02 A;  1U4A A;  4KSK C;  5DPR A;  3Q8B A;  1HE8 A;  2BYE A;  3ZNZ B;  4DXG A;  3H1U A;  5EE9 A;  4W9G A;  1D4B A;  2ICI A;  1TJE A;  3RZF A;  2L1A A;  4RM8 A;  3SR6 A;  3ENE A;  1CK1 A;  2KLG A;  1EF5 A;  2YLM A;  2PJH A;  4RGN A;  3ZDT A;  1LO5 D;  2INN E;  2D3A A;  3AN1 A;  4KV2 A;  5E6P A;  4ASW C;  4F1S A;  4LDT B;  4AS1 A;  4LNI A;  3R2I A;  2JZP A;  2JZ3 B;  4GOC A;  2KHW B;  4FN2 A;  4GMV A;  3AE1 B;  1HTO A;  1R4N B;  1CJE A;  2CKH B;  2NBW B;  4C80 A;  4HCP B;  3ZJV A;  2X38 A;  2V4I B;  1MG4 A;  1SJE D;  1P7E A;  4L23 A;  3AH7 A;  2WX0 A;  4JIO U;  3CIR B;  5KHQ A;  4HDO A;  2JWU A;  4YSY B;  3GZN I;  1WMH A;  3PVL A;  4JX1 C;  4EKU A;  3IAS 1;  3A4R A;  1ZUD 2;  1V5T A;  1L6V A;  4CYE A;  5C23 A;  1C77 A;  1R4M B;  2D2Q A;  1T5X D;  1QKZ A;  2E6X A;  2LZ6 A;  3ETR A;  3V62 A;  1GNU A;  1E8Z A;  1TS2 A;  2INC C;  2ZZP B;  4H2A A;  2GBN A;  3V3X A;  4BBN F;  4GGQ A;  3HK0 A;  3L08 A;  4P16 A;  2LXA A;  1N62 A;  3W2D A;  4M8M A;  3ZGZ A;  3NHE B;  3PTF C;  4K1R B;  1EF1 A;  4EUT A;  4NNJ B;  2LVP A;  2WU5 B;  4DDI D;  1I4Q A;  2N9P C;  4L2Y A;  4CHK A;  2N7E A;  2GOW A;  5IKC M;  1B1Z A;  1FRR A;  3RI7 C;  4LDT D;  2WXH A;  2KN4 A;  1OQR A;  1I4P A;  5J2R A;  4W9E A;  3ZTD A;  2WDR B;  1D6E C;  1E5W A;  3DBR I;  4BAX A;  3PZD A;  1L0V B;  2MQJ A;  1ESF A;  3D32 A;  4OZC A;  4P6V F;  1C4A A;  4LNN A;  3QIJ A;  1FNU A;  1P9D U;  4W9C A;  2RDH A;  4LJO B;  4K7W A;  4ICV A;  3NUH B;  4XGA B;  1QQR A;  1WXA A;  3UIO B;  1E7V A;  2PIA A;  4PYU A;  2CJN A;  3QAR A;  4WWP A;  5LLI A;  3HVZ A;  3DBH I;  3Q14 C;  2REX A;  3PPA A;  2FCS A;  3KUZ A;  3R2T A;  4Q2J A;  4PS3 A;  2L7R A;  1UWM A;  2KMC A;  1YX5 B;  4B9K A;  2QEJ C;  4NQL B;  3RNE C;  1TZO A;  4EZK A;  1YQ4 B;  4B0E A;  5AZG A;  3A1Q A;  1T3Q A;  4USA A;  5G5G A;  1SSN A;  4FHK A;  1E90 A;  1JWM D;  1XQQ A;  1DGJ A;  2QJL A;  3EUB 2;  2IO2 B;  4WAF A;  5AEK B;  4YL8 A;  4WH4 A;  3V6E B;  1PUT A;  2LJ5 A;  1WIA A;  4YTM B;  3Q8E A;  1K52 A;  3SFE B;  3MHZ A;  3K9O B;  3NJT A;  1RWS A;  2NBV B;  4DK5 A;  4US8 A;  5AZH A;  4GLS C;  3MFG A;  2MSE D;  2DX5 B;  2WGS A;  3VRB B;  3MC9 A;  2ZVO A;  2N7D A;  1YD8 U;  2A4Z A;  1C4C A;  4WWM A;  3PLU A;  4FXC A;  3N1Z C;  3W5V B;  2KJ6 A;  1NVI D;  3NG0 A;  2I2Y A;  2CR5 A;  2MBE A;  1JAL A;  1J0G A;  4IWP A;  3I63 C;  4FLH A;  3UQA A;  2ZW0 A;  1SGH A;  2G9H D;  3TEZ A;  4G50 A;  2GBR A;  1WXM A;  2I1K A;  1SIF A;  1L7Y A;  2MBO A;  3OJ3 A;  2W9N A;  4XDC A;  2WX1 A;  3NY5 A;  3PRP B;  4K7S A;  2LHE A;  4NAW A;  1WE6 A;  1GAQ B;  3DQV A;  1NYQ A;  1WGR A;  3Q8C A;  2V4L A;  2GLS A;  4R3D A;  3CWI A;  1J8C A;  1XLO A;  3AEA B;  1XT9 B;  2RPV A;  3ABV B;  5D7G A;  5D94 A;  1E7P B;  2IZV B;  5D2M B;  2ONQ A;  1DOX A;  3AXC A;  3OJ4 B;  3QX1 A;  5TSS A;  5DPW A;  2Y3A A;  4KZ0 A;  2DYB A;  3VRA B;  4RMA A;  1Q10 A;  4BKT A;  4TV3 A;  4KKJ A;  3B1L X;  3ZKJ C;  2MA9 B;  3JW0 X;  2BKR B;  2VH1 A;  4PYZ A;  4ANX A;  4DWF A;  3OG5 A;  2JVC A;  2KZR A;  1XLN A;  2J7Q B;  1PFD A;  2KQS A;  2WXN A;  4YWG G;  3K9P B;  4TSS A;  4TQ1 A;  2YEP B;  1LQB A;  4KDL B;  4D2K A;  5IAA C;  2AEH A;  3M62 B;  5L83 A;  4WJN A;  1GPX A;  3M63 B;  3AV8 A;  1EU3 A;  2QMT A;  3GZN B;  1CQV A;  2V1Y A;  3TIX A;  2K25 A;  1QOA A;  2GBK A;  5HKH A;  3NVZ A;  3VTU A;  2G4D B;  2O6V B;  2JPH A;  3NS8 A;  1TY2 A;  2PE9 A;  2KX0 A;  1ISN A;  1R4N I;  2RDG A;  1VLB A;  3RD2 A;  3FIL B;  3SHQ A;  4W9K A;  4B6W A;  3I9V 1;  1Q0W B;  2MWS B;  4IG7 B;  4BKS A;  4IUM B;  2G1E A;  3PZ7 A;  5C3J B;  4K81 A;  1T0S C;  3IBE A;  5BYQ A;  3ZJT A;  2C7N B;  3RPF C;  1WGK A;  3CMM B;  1YOV B;  1NDD A;  1YQB A;  2Q5W D;  3AUL A;  3Q3F A;  4ANV A;  1OTR B;  3N32 A;  3ZVV A;  1FFU A;  4FJV B;  4ICU A;  1UH6 A;  1NBF C;  1E7U A;  1FD6 A;  3H9D A;  1IYF A;  3DBR B;  1A5R A;  2AL6 A;  3N1X C;  1YJ1 A;  1WJN A;  4ZYS A;  2PPH A;  5CX3 A;  3GB1 A;  1UD7 A;  3V60 A;  2PTL A;  3NVV A;  4ZHP A;  5JXV A;  4MEM A;  5G55 A;  4NJC A;  4XWT A;  3DHI C;  2K6D B;  3A4S C;  2JQR B;  2N0S B;  3NZ3 A;  1SB3 C;  1F2R I;  3ZNI D;  5MPO A;  3A9K B;  5LXH A;  1FM0 D;  1FNV A;  2O6V D;  3MC0 B;  4HRS A;  3AM9 A;  1WX8 A;  2FCM A;  1PDX A;  3DBH B;  2CJO A;  1H4R A;  1FXA A;  3EC8 A;  4FUL A;  5GXG B;  1GC7 A;  4JWS C;  2LHD A;  4DHZ B;  2V3S A;  2GMI C;  3KWL A;  1DYQ A;  1SE4 A;  4TQ0 A;  3IT4 B;  3C0R B;  2RR9 A;  3VVW B;  3CSF A;  4GDK B;  2K39 A;  1WX9 A;  3ZQ4 A;  4IDI A;  1TY0 A;  3LJ3 A;  3V05 A;  1V49 A;  3QC8 B;  4W9L A;  2G4S A;  1Q1O A;  2CU3 A;  1KM7 A;  2KXJ A;  2VZK B;  2X8X X;  1RLF A;  5JZE B;  2FCQ A;  1WGH A;  1Y56 A;  1TS5 A;  4W9D A;  5EDS A;  4II2 B;  2DHZ A;  4HXD A;  1IGD A;  1WWT A;  5E6N A;  2NPT B;  4WWO A;  1GB1 A;  3U52 E;  3DOW A;  1HEZ E;  1N61 A;  3M3J A;  4BOS C;  1WH3 A;  5G2N A;  1TKE A;  2RDB C;  3A9J B;  1IUE A;  3ZJU A;  3MJ5 A;  4HPM B;  1Y8R C;  2KFK B;  3L17 A;  2IY1 B;  1TYG B;  3ZNG C;  3ZLZ A;  4IC7 B;  1MJD A;  2D07 B;  1BML C;  2JRH A;  3KYD D;  1FCC C;  3JSV A;  2JYT A;  4M01 A;  2JF5 A;  3DVG Y;  1MFW A;  2Y5B B;  4P1C C;  3P4S B;  2R2Q A;  5D6J B;  1V2Y A;  1M4V A;  2KDM A;  2C5L C;  2B3A A;  3AE6 B;  4JWU C;  3GOE A;  1ZE3 D;  1QLB B;  1ZXH A;  1V1P B;  2KT7 A;  1YJJ A;  3M95 A;  3RUL A;  2BW2 A;  5KHO A;  3JVZ X;  4AP4 C;  3CST A;  2KDE B;  2VZK D;  4DDG D;  2TSS A;  4GN1 A;  2BTE A;  4NAM A;  5DCN A;  2Y5C A;  3N20 C;  2NMQ A;  3GE3 C;  2YVC A;  1J7A A;  2KDF B;  3H8H A;  1MHH E;  4FA6 A;  3VH4 B;  2EEL A;  4E71 A;  3GP7 A;  4ZRI A;  2PLP A;  1F2R C;  4DXF A;  1UF0 A;  1WXQ A;  3NOB A;  4GDL A;  4AJW A;  1I4X A;  1WGD A;  1LGR A;  3B2G A;  3H6N A;  1PGA A;  2KK8 A;  2RMM A;  1YNT E;  2KVZ A;  5FR6 A;  2KFJ A;  3PSE B;  2WYQ A;  2D5G A;  3B0A A;  4IM3 A;  4K3B A;  2ZPY A;  2MH7 A;  1NEN B;  4WQO B;  4XE0 A;  2KN5 A;  5E6O A;  3EFC A;  3LB8 C;  2MJD A;  1GB4 A;  3L13 A;  1WJ4 A;  2N7J A;  4WQM A;  4FBJ B;  1K8R B;  2AX5 A;  2YEP F;  2MP2 A;  2BQQ A;  1X1M A;  4A20 A;  4M0W B;  2BF8 B;  4II3 B;  4ZRJ A;  2W54 A;  4DHJ B;  4GIV A;  1SE3 A;  2DZJ A;  4C4V B;  1FMA D;  2ASQ A;  3AEC B;  4HPL B;  4EZL A;  2BT6 A;  1UGJ A;  3HM3 A;  2KTR A;  3URY A;  1SE9 A;  2BGF A;  1I7H A;  1IBX A;  2GBJ A;  3PHW B;  2DBY A;  4LJP B;  1F9J A;  3WA0 A;  4MDK E;  1J7C A;  2WDQ B;  3QK0 A;  3W1Y A;  2V3P A;  2K8B A;  3NZU A;  2HJ8 A;  3AB5 A;  4EOY A;  5AZF A;  2LD9 A;  2IJ0 A;  1E8X A;  3RT3 B;  2WXQ A;  5AUI A;  4EZJ A;  2L0F A;  2WXR A;  2MBQ A;  4P1B C;  2MHJ A;  3NZS A;  3UF8 A;  1NEK B;  2CU1 A;  2W3R A;  4MGZ E;  5I4D A;  1E6E B;  3ZXV A;  4OZA A;  4GSW A;  1TGZ B;  1L6U A;  2JY6 A;  1I35 A;  3IVF A;  1N63 A;  1SXT A;  1WM2 A;  4FHJ A;  1RFA A;  3TEY A;  4HEA 1;  2WLB A;  3O65 B;  4DHJ D;  4YTP B;  1ZDV A;  3BY4 B;  3BYT B;  2IBI B;  1QOB A;  3AED B;  3B2F A;  5LXI B;  2L00 B;  2H89 B;  2PEA A;  2WXK A;  3PV1 A;  4QAY A;  3AE4 B;  2WU2 B;  2ZCB A;  2GB1 A;  1R7S A;  1V8C A;  3WAL A;  1JML A;  3QHT A;  1ET9 A;  4I6N B;  5JHA A;  5EE3 A;  3HM6 X;  3RZW C;  1E10 A;  5HG2 A;  1FFV A;  2KTF A;  1ZDX A;  4JL9 A;  4MJS B;  1NI3 A;  1Q5W B;  1JWB D;  1JRO A;  1KRH A;  2KQ7 A;  2PKO A;  1WZ3 A;  2AYO B;  3W1S A;  1D3Z A;  1UUP A;  1TS4 A;  1GUA B;  1ZPS A;  4OW0 A;  3L10 B;  4NAW B;  5DPS A;  1HZ5 A;  1E8Y A;  4A3O A;  2MBB B;  4RNA A;  3MC8 A;  4XYC A;  1XLQ A;  1KLG D;  4LLG M;  1HA5 A;  2KLC A;  2LXC A;  3KH0 A;  3RNC C;  3VR9 B;  3DVN V;  1YIW A;  4A6Q A;  2LGY A;  3VDZ A;  2KJR A;  3H7P B;  2JU6 X;  1SBB B;  4B0M A;  4DBG A;  2QIL A;  2Z8L A;  4C56 C;  1C78 A;  3VTV A;  3E9S A;  3J9C A;  1YX6 B;  3P1M A;  3MP9 A;  2CHW A;  3R3M A;  2IPK D;  2MLB A;  3AE2 B;  2PMV A;  3AMZ A;  1PGB A;  3APC A;  2W3S A;  4PS7 A;  1V5O A;  2WNM A;  1C79 A;  4TMA B;  1WGY A;  4O1N A;  2L3Z A;  3RYT A;  2WHI A;  4FJZ A;  2AQ1 B;  1MI0 A;  2WQY B;  3AI5 A;  2AQ3 B;  1P3Q U;  5FK9 C;  4MM3 B;  2LJI A;  1A70 A;  4XWW A;  2D3B A;  1V81 A;  1XEE A;  2M0A A;  4JE3 B;  1OEY J;  5FR3 A;  1FXI A;  3Q3N C;  1VD2 A;  3JYU A;  4YSZ B;  1H8C A;  1E8W A;  2FUH B;  2K9X A;  2UYZ B;  1KFY B;  4IKG A;  4BBN C;  3ZO5 B;  5IA7 A;  2L32 A;  1S1Q B;  2WS3 B;  2DAF A;  1G6J A;  2N1W A;  1C1Y B;  2LUE A;  4XZ4 A;  1TTN A;  3RNB C;  3MTN B;  3PRZ A;  1WXV A;  1TZ1 A;  4ZYN A;  2KC1 A;  1V1O A;  3TCA A;  2QIE B;  5CHF A;  3KQ4 A;  1M94 A;  3QAQ A;  1MHX A;  3BK1 A;  3TBL D;  1LM8 B;  2ZVN A;  4M00 A; 
#chains in the Genus database with same CATH homology
 1V49 A;  3T8M A;  2C60 A;  2KLG A;  2QHO A;  1EF5 A;  2YLM A;  2PJH A;  2LVO A;  3UIN B;  3QC8 B;  3ZDT A;  4W9L A;  4J6I A;  2G4S A;  3VUY A;  2IO3 B;  1Q1O A;  4HCN B;  1KM7 A;  2KOX A;  4KV2 A;  2KXJ A;  4LDT B;  5E6P A;  4ASW C;  2J0J A;  4F1S A;  1RLF A;  1ZW7 A;  5JZE B;  2FCQ A;  1WJ6 A;  2LVQ A;  4JQW C;  2JZ3 B;  1WGH A;  4GOC A;  1KOT A;  3TJP A;  2KHW B;  2G3Q B;  4W9D A;  5EDS A;  4II2 B;  2DHZ A;  4FN2 A;  3PS6 A;  4GMV A;  4HXD A;  4MH0 E;  5E6N A;  4DXA B;  2KWC A;  2CKH B;  4WAA A;  2NBW B;  4HCP B;  3UIP B;  2KO3 A;  1IP9 A;  2NPT B;  4WWO A;  3DOW A;  3WIM A;  2G45 B;  2WX0 A;  4JIO U;  3M3J A;  3LJ3 A;  2CS4 A;  5KHQ A;  1V6E A;  4BOS C;  1WH3 A;  4HDO A;  5G2N A;  3GZN I;  1WMH A;  3PVL A;  4EKU A;  4GU2 A;  2NBU A;  2JT4 B;  3ZRF A;  3A4R A;  3PLV A;  3A9J B;  1GC6 A;  1WX7 A;  4HPM B;  2KAN A;  1Y8R C;  2KFK B;  2L8J A;  2IY1 B;  1V5T A;  3L17 A;  3ZNG C;  5C23 A;  4IC7 B;  3ZLZ A;  4CYE A;  2D07 B;  1JRU A;  2D2Q A;  1BT0 A;  2LZ6 A;  2BKF A;  2JRH A;  2MX2 A;  3JSV A;  3KYD D;  3V62 A;  1GNU A;  1E8Z A;  3PHX B;  4KIK A;  2JF5 A;  3OLM D;  3CF6 E;  2ZZP B;  3X0W A;  3DVG Y;  2CHZ A;  2GBN A;  2Y5B B;  1V86 A;  3UGB B;  3VTW A;  4BBN F;  4G0N B;  4GGQ A;  2R2Q A;  3HK0 A;  5D6J B;  1V2Y A;  3KYC D;  2GBM A;  2LXA A;  3L0W B;  3L08 A;  5BO4 B;  2C5L C;  4M8M A;  2B3A A;  2NCN A;  1TBE A;  3NHE B;  2JXX A;  3PTF C;  2FIF A;  4K1R B;  1WM3 A;  3GOE A;  1EF1 A;  4EUT A;  4NNJ B;  2LVP A;  4G3X B;  4DDI D;  2N9P C;  2L0T A;  4CHK A;  2KJH B;  2FNJ B;  5J18 A;  4MJS A;  2DAJ A;  2LI5 A;  2MBH A;  2N7E A;  2KMA A;  2GOW A;  4XC2 A;  3M95 A;  3QQ8 B;  3RUL A;  3VFK A;  1KLV A;  1WZ0 A;  5KHO A;  3JVZ X;  3U30 A;  2I1J A;  4AP4 C;  3CST A;  1OGW A;  2KDE B;  1WGG A;  4LDT D;  4DDG D;  4OVU A;  3WAN A;  2RPQ A;  3APD A;  2KWU B;  5CHW A;  3TL5 A;  3PGE A;  4GN1 A;  4NPN A;  3R7R A;  3R66 C;  2KWV B;  4WJP A;  3VUX A;  4BFR A;  5J2R A;  4W9E A;  2MW5 A;  4AUQ C;  5DCN A;  3ZTD A;  4TUU A;  1E5W A;  2XK5 B;  3DBR I;  3PZD A;  2YVC A;  4BKG A;  1P1A A;  2KDF B;  2MQJ A;  4FA6 A;  3VH4 B;  1WY8 A;  3D32 A;  3P2B A;  4E71 A;  4ZRI A;  4CO7 A;  2MRP A;  3QIJ A;  1P9D U;  4W9C A;  4HDQ A;  4EFO A;  3DVN U;  1IPG A;  4FJY A;  4LJO B;  2ZJD A;  1VCB A;  3H7P A;  4K7W A;  4ANW A;  4ICV A;  3NOB A;  3ONS A;  4GDL A;  4AJW A;  1RRB A;  4JGH B;  4HK2 A;  2KDI A;  1WGD A;  2ZNV C;  4KIK B;  1WXA A;  3H6N A;  3UIO B;  3B08 A;  2KK8 A;  2LRU A;  1E7V A;  2M1M A;  1Z2M A;  3HIZ A;  5CHV C;  4PYU A;  4I6P A;  5FR6 A;  2KFJ A;  2M0X A;  3PSE B;  3QAR A;  3WAO A;  2WYQ A;  4WWP A;  3B0A A;  4IM3 A;  2ZPY A;  2KC2 A;  5LLI A;  3I3T B;  3X23 A;  3DBH I;  2O2V A;  3H7S A;  2BYV E;  4ZDV A;  4WQO B;  1WJU A;  4W9J A;  5JH5 C;  2REX A;  3PPA A;  1J19 A;  2FCS A;  2KN5 A;  1UEL A;  3KUZ A;  3SDL C;  3U8Z A;  5E6O A;  2L05 A;  1ZGU B;  4IWO A;  4KVG B;  4MSQ B;  4P7I A;  4PS3 A;  3VUW A;  2L7R A;  2KMC A;  1YX5 B;  3KVF B;  3L13 A;  1WJ4 A;  4G11 A;  4B9K A;  1RAX A;  4NQL B;  4EZK A;  2LWP A;  4FBJ B;  1K8R B;  1L2N A;  5AZG A;  3A1Q A;  4A3P A;  2MP2 A;  3ZNH B;  4M8N A;  4OVV A;  1V80 A;  1X1M A;  4FHK A;  4W9H A;  2Z0E B;  4A20 A;  3Q3J A;  4M0W B;  2BF8 B;  1E90 A;  3QJZ A;  2KNB A;  1XQQ A;  2NVU I;  2DYO A;  2IO2 B;  4II3 B;  1C3T A;  5AEK B;  4MM3 A;  2R2O A;  4YL8 A;  4F8C B;  4MEL A;  3V6E B;  4ZRJ A;  4WWN A;  4DHJ B;  2BWE S;  4F7Z A;  4GIV A;  2LJ5 A;  4LCD E;  2DZI A;  1WIA A;  2OJR A;  2EMT A;  2M17 A;  4IWQ A;  2HTH A;  2DZJ A;  2ASQ A;  4AWJ A;  5JHA A;  1WI0 A;  1GJZ A;  3K9O B;  2AL3 A;  4HPL B;  5J17 A;  4EZL A;  3A9K A;  2NBV B;  4W9F A;  3HM3 A;  4DK5 A;  5JHB A;  2BYF A;  2KTR A;  3ML8 A;  2KKC A;  3EHV A;  5AZH A;  1UZX B;  2HD5 B;  3RUI B;  1SE9 A;  2MSE D;  2DX5 B;  2BGF A;  3R7Q A;  2ZVO A;  2LAS A;  2RD0 A;  4I6L B;  2N7D A;  2WDT B;  4E74 A;  4BKS D;  1YD8 U;  2A4Z A;  4W9I A;  2GBJ A;  2Z0D B;  3PHW B;  2PE6 B;  3APF A;  1P98 A;  2LGD A;  3PLU A;  4LJP B;  1UBI A;  2M8S A;  1F9J A;  3WA0 A;  2D11 A;  2KJ6 A;  4MDK E;  1V9J A;  1WR1 A;  2CR5 A;  2MBE A;  3QK0 A;  3SU8 X;  4GDK A;  3V61 A;  3W1Y A;  4HLE A;  3V6C B;  3HHM A;  4IWP A;  2K8B A;  1J0G A;  3NZU A;  4FLH A;  1R4M I;  2HJ8 A;  2O2V B;  4MGI E;  3UQA A;  1SGH A;  3IHP C;  5AZF A;  4EOY A;  2LD9 A;  1QZE A;  4XX5 A;  4G50 A;  2GBR A;  2DZM A;  1E8X A;  3RT3 B;  1WXM A;  1T0Y A;  2I1K A;  3VXW A;  4EZJ A;  1SIF A;  2KDB A;  3IFW B;  2L0F A;  1L7Y A;  2MBO A;  2XBB C;  3OJ3 A;  1UBQ A;  2W9N A;  2MBQ A;  2WX1 A;  4MGY E;  3NY5 A;  3SD5 A;  3VHT C;  2ZNV B;  3NZS A;  3PRP B;  4K7S A;  4NQK E;  2CU1 A;  4MGZ E;  4NAW A;  1WE6 A;  3UF8 A;  3DQV A;  4URK A;  1WGR A;  2V4L A;  1LFD A;  2C7H A;  1EO6 A;  2K6Q A;  4GSW A;  1TGZ B;  1GG3 A;  2JY6 A;  1I35 A;  3IVF A;  1J8C A;  2O6V A;  2DZK A;  3ML9 A;  3ZRC A;  3N30 A;  3VH3 B;  1WM2 A;  1WMH B;  1RFA A;  4FHJ A;  3DVG X;  3O65 B;  2JWZ A;  1XT9 B;  3KUC B;  4DHJ D;  2NPT A;  3BY4 B;  4KSL C;  2IBI B;  4FAD A;  4ANU A;  5D7G A;  1NI2 A;  1UGM A;  5LXI B;  2L00 B;  5D94 A;  3JSV B;  1WR6 E;  2K1F A;  5CTR C;  2K8C A;  2K8H A;  3KUD B;  1FXT B;  2IZV B;  3A9J A;  5D2M B;  2PEA A;  3PV1 A;  2FID A;  3AXC A;  3OJ4 B;  2KFK A;  2ZCB A;  1I42 A;  3QX1 A;  3ZIM A;  1WXS A;  5DPW A;  2LRW A;  1P0R A;  2DYB A;  2NS5 A;  4KZ0 A;  2Z59 B;  3LDZ E;  4WJQ A;  3WAL A;  4RMA A;  1OEY A;  2KX3 A;  4N9F 4;  3EFU A;  2ZPN A;  4TV3 A;  4BKT A;  3B1L X;  3ZKJ C;  2MA9 B;  3DBL I;  3JW0 X;  3QA8 A;  4BVU C;  2BKR B;  1ZKH A;  1WFY A;  3QHT A;  4AOF A;  4PYZ A;  4I6N B;  2RSU A;  3VAW A;  4ANX A;  4NY0 A;  1KJT A;  2DEN B;  3HM6 X;  3RZW C;  3MHS D;  3ZW3 A;  4DWF A;  2JVC A;  2KTF A;  1XD3 B;  2KZR A;  4JL9 A;  2J7Q B;  3TMP B;  4MJS B;  1Q5W B;  2ZCC A;  2JUO A;  2D3G A;  2KQS A;  4BOZ B;  2KQ7 A;  3ZTC A;  1WZ3 A;  2AYO B;  3K9P B;  4TQ1 A;  3W1S A;  1D3Z A;  1LQB A;  4KDL B;  4MGK E;  4K7U A;  2VRR B;  2IY0 B;  2AEH A;  3M62 B;  4IM2 A;  5IAA C;  5L83 A;  5L95 C;  2MCN B;  2M4N A;  2N9X A;  3PRE A;  4WJN A;  3M63 B;  1GUA B;  3N3K B;  4KDI C;  3L10 B;  2V1Y A;  3QWZ B;  3U7D A;  3TIX A;  1WYW B;  4NAW B;  2K25 A;  5DPS A;  1E8Y A;  3DDC B;  4A3O A;  2MBB B;  3DPD A;  2C9W B;  2GBK A;  5HKH A;  2FAZ A;  1CMX B;  1EUV B;  3VTU A;  2G4D B;  2O6V B;  2JPH A;  2WWZ A;  3NS8 A;  2KLC A;  2PE9 A;  5DPT A;  4HJK A;  2LXC A;  2KX0 A;  3DCG A;  3KH0 A;  1ISN A;  2FCN A;  3MJW A;  3DVN V;  4IM0 A;  2XK5 A;  4B95 A;  2UWQ A;  1R4N I;  3EEC A;  1YIW A;  2LGY A;  3VDZ A;  2BWF A;  2KJR A;  2KVR A;  2L76 A;  3H7P B;  4EEW A;  3BIN A;  3RD2 A;  4GDL B;  1WRD B;  4DBG A;  3SHQ A;  4W9K A;  3A33 B;  4B6W A;  3OAW A;  2IO1 B;  2J0M A;  1Q0W B;  1WE7 A;  3L16 A;  2MWS B;  4WJO A;  2J0K A;  4IG7 B;  4BKS A;  3VTV A;  4IUM B;  1WF9 A;  4MSM B;  4NJ6 A;  1YX6 B;  4K81 A;  2XEW A;  3IBE A;  4TKN A;  2D10 A;  2JZZ A;  4IW0 A;  2C7N B;  2CHW A;  3R3M A;  3CMM B;  2MLB A;  3T9L A;  3APC A;  4NJ7 A;  1NDD A;  2IO0 B;  1Z5S B;  4JLC A;  1YQB A;  2C7M B;  3L54 A;  4PS7 A;  3AUL A;  3S2A A;  3Q3F A;  1V5O A;  4ANV A;  1OTR B;  3ZUN A;  1AAR A;  3N32 A;  3ZVV A;  3IG3 A;  5GMV A;  4FJV B;  4RM9 A;  4ICU A;  2EKE C;  3PRM B;  1S3S G;  1UH6 A;  1NBF C;  1E7U A;  3ZDM C;  3KW5 B;  3RCZ A;  2HE7 A;  1WGY A;  2NR2 A;  3H9D A;  3A1Q B;  2MP2 B;  2L3Z A;  3RYT A;  4FJZ A;  1IYF A;  1A5R A;  2AL6 A;  1MG8 A;  1YJ1 A;  4GXB A;  1WJN A;  2OOB B;  3AI5 A;  5TR5 A;  1P3Q U;  2N4F A;  2PPH A;  3QCA A;  4ZRK A;  5CX3 A;  4GB9 A;  2AWT A;  3VQI A;  1UD7 A;  1V81 A;  4PS8 A;  3V60 A;  3ALB A;  1OEY J;  1OQY A;  4MEM A;  2IYD B;  2N1V A;  1VD2 A;  1LXD A;  3DBS A;  3JYU A;  5G55 A;  4E3C A;  1H8C A;  1E8W A;  4DHZ E;  4X57 B;  2FUH B;  2K6D B;  3A4S C;  2UYZ B;  2A5U A;  2CHX A;  2EMS A;  3ZNI D;  2BPS A;  2JRI B;  3A9K B;  4BBN C;  5LXH A;  3ZO5 B;  5IA7 A;  3W1S C;  4HVB A;  1PQS A;  2KTR B;  2RGF A;  1S1Q B;  4AJY B;  2O6V D;  4HWI B;  2DAF A;  3AU4 A;  1G6J A;  2N1W A;  5C1Z A;  1C1Y B;  3WAM A;  2LUE A;  4XZ4 A;  1WX8 A;  2FCM A;  1TTN A;  3ECI A;  1H4R A;  3MTN B;  3PRZ A;  3EC8 A;  1WXV A;  4FUL A;  1TZ1 A;  3PT2 B;  1GC7 A;  2ZEQ A;  1U4A A;  2V3S A;  4ZYN A;  3AU5 A;  4DHZ B;  2GMI C;  2KC1 A;  3TCA A;  2LGX A;  3UQB A;  4KSK C;  5DPR A;  5CHF A;  1HE8 A;  4TQ0 A;  1M94 A;  2BYE A;  2N9E B;  3WAP A;  3C0R B;  3ZNZ B;  2RR9 A;  3H1U A;  3VVW B;  3CSF A;  2KD0 A;  2K39 A;  4GDK B;  3QAQ A;  1WX9 A;  4W9G A;  2DYM A;  3TBL D;  1LM8 B;  2ZVN A;  3RZF A;  4RM8 A;  4KZC A;  3ENE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...