2MBEA

Backbone 1h and 15n chemical shift assignments for the first domain of fat10
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
75
structure length
75
Chain Sequence
LCVHVRSEEWDLMTFDANPYDSVLKIKEHVRSKTKVPVQDQVLLLGSKILKPRRSLSSYGIDKEKTIHLTLKVVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin D
publication title Disruption of FAT10-MAD2 binding inhibits tumor progression.
pubmed doi rcsb
source organism Homo sapiens
total genus 5
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2013-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2mbeA00
3UQBA 4HPMB 4MJSA 2CHXA 3KUDB 4DHJD 1S1QB 1WFYA 2AYOB 4WJNA 2D2QA 3PT2B 4EZLA 2DZIA 2ZCCA 3H7PB 4NAWB 3CF6E 2XK5A 4GGQA 3ZTDA 4KZ0A 4MGYE 1WX8A 1WR6E 1J0GA 2REXA 4I6NB 2FUHB 4RM9A 4BKTA 1EO6A 4AUQC 3IHPC 5E6NA 5KHQA 4ASWC 4LDTB 2LJ5A 2BKRB 4II3B 1V81A 3BY4B 2RSUA 4M8NA 3QK0A 1WM2A 2AWTA 3JSVB 2ZZPB 2BWES 1WR1A 1UELA 1HE8A 3DQVA 1WZ0A 2C60A 3PHWB 4N9F4 1OEYJ 1WGHA 4HK2A 4AJYB 3VUWA 4FHJA 3ML9A 2PE9A 5JHBA 3A9KB 4MGZE 2HTHA 2UWQA 4ANUA 2K6DB 1V5OA 3NHEB 2WYQA 4MGKE 1R4NI 3M62B 5AZHA 4PS8A 3ZW3A 4MJSB 3L54A 5IAAC 2N7EA 2CKHB 2KVRA 1V49A 4BKGA 4EZKA 1G6JA 2XBBC 3TIXA 1RRBA 3PSEB 3JVZX 4WWOA 2KK8A 3N3KB 1UBIA 2LUEA 3KVFB 3L08A 4XC2A 3H6NA 4IWQA 1P9DU 1JRUA 4NJ6A 4I6LB 4MGIE 3RULA 3ENEA 4AWJA 2ZPNA 1YJ1A 2MBOA 2G45B 2N7DA 1E8WA 1J19A 2WWZA 2IO1B 4KSKC 3ZNID 4W9IA 2NBVB 4ANWA 5IA7A 4FHKA 4WAAA 5AZGA 1WE7A 2JRIB 1RLFA 2KX3A 3U7DA 4DHZE 2R2OA 2A4ZA 2C5LC 3PV1A 1WX7A 2GBRA 3QWZB 4FBJB 2G4DB 1UH6A 3RUIB 3VAWA 4ANVA 1Z2MA 2IY1B 3W1SA 3ZRFA 2K8CA 3VTUA 3PRMB 3B08A 3WAMA 2V4LA 1RFAA 2I1KA 3PLUA 3QIJA 2D07B 1WGDA 2DX5B 2BYVE 4B9KA 2HD5B 2NVUI 3PHXB 2R2QA 2ZEQA 2GBKA 1E8XA 1WJUA 2ZNVC 5TR5A 3UIPB 5L83A 3NY5A 2JRHA 4MDKE 2K8BA 3ZVVA 1TZ1A 2KLGA 4FN2A 4MM3A 4W9EA 3PRPB 4CHKA 4AOFA 1E8YA 3APCA 4J6IA 4KIKB 4BOZB 2LGYA 2J0MA 3WA0A 3NOBA 2DZKA 4BFRA 2LVPA 2JT4B 2KMCA 4IG7B 3TCAA 3PZDA 4M8MA 3ZNZB 2RGFA 3PVLA 4B6WA 1YD8U 4IM3A 2V1YA 1C3TA 2FCMA 1E8ZA 1X1MA 1FXTB 4GIVA 3R66C 4FULA 3SD5A 2J0JA 3HM6X 3LDZE 5E6PA 4E74A 2O6VD 2UYZB 3AXCA 5DPSA 5D2MB 4RM8A 1WJNA 2IY0B 2KDEB 4TKNA 4IUMB 4DHJB 2NPTB 2NCNA 1F9JA 4LJPB 2IO2B 4CYEA 1T0YA 1P0RA 3RZFA 2ZNVB 3ZDTA 2EMTA 4K1RB 3DBRI 4II2B 3R7QA 4DK5A 2DAFA 1AARA 2KD0A 3DBLI 2PE6B 3QQ8B 3DBHI 2M1MA 2KZRA 3Q3FA 4HJKA 3B0AA 3UGBB 2JXXA 4ICVA 3L0WB 2ZPYA 3X0WA 3VH4B 1Y8RC 2MP2B 1RAXA 2KC2A 2MQJA 4FJYA 1WF9A 2RR9A 5D7GA 2CS4A 2KFKA 4A20A 3V61A 1WJ4A 4KDLB 2JZZA 1NI2A 3VXWA 1SIFA 3NZUA 3QHTA 3ZNGC 2L7RA 3L10B 2EKEC 1E5WA 4DDID 4JIOU 3DVNU 3N32A 1UBQA 2LVOA 1E7UA 5GMVA 4AJWA 2JY6A 1SGHA 2DYMA 3HIZA 4W9JA 4ZRKA 4NY0A 1WH3A 3OAWA 2KTRA 2WX0A 1MG8A 3IFWB 4K7WA 4W9LA 2QHOA 3OLMD 4X57B 5J18A 3JYUA 4KDIC 4F1SA 4WWNA 4G11A 4FJZA 4W9GA 4JL9A 3PTFC 1S3SG 3QJZA 4DHZB 2KQ7A 2FCNA 1UGMA 1YX6B 2NBWB 4TQ1A 4GDKA 4ZRJA 4G50A 4F7ZA 2LRUA 4IWOA 2LGDA 1V80A 4KVGB 2N1WA 2NS5A 3VTVA 1I42A 2PJHA 2MA9B 1WGGA 3OJ4B 2KFKB 5EDSA 2BYEA 3ZO5B 3PS6A 3DDCB 2O6VA 2K25A 3K9OB 3KH0A 4WQOB 5DPWA 4JGHB 2C9WB 2KHWB 2XK5B 3UF8A 4W9DA 3HM3A 3A9JA 3RD2A 4A3PA 1WXVA 1KJTA 1PQSA 4GB9A 1SE9A 2Z0DB 1QZEA 3M95A 2C7HA 1WMHA 2OOBB 2BPSA 2L76A 1R4MI 3OJ3A 3X23A 2KTRB 2DAJA 2AL3A 3ZUNA 1GC6A 1CMXB 4CO7A 2L0FA 4K7SA 5DCNA 2PEAA 4B95A 4E71A 1ZGUB 2I1JA 1KLVA 2JUOA 4A3OA 3M63B 1TBEA 3APFA 3VTWA 4HLEA 5CX3A 4IC7B 4GDKB 2KC1A 2NBUA 2MBEA 5D6JB 3ZRCA 2L00B 2MX2A 1WXSA 1WM3A 1TTNA 2KOXA 4WJQA 5CTRC 2MCNB 2JZ3B 5AEKB 2KO3A 1K8RB 2LXCA 4GMVA 1E90A 2M8SA 3C0RB 5CHVC 2FAZA 1L2NA 3O65B 2ASQA 3PGEA 2O6VB 1V6EA 2D11A 3PRZA 2JWZA 2AL6A 4ZYNA 1GG3A 2KWUB 3WALA 5LXHA 3DPDA 2KKCA 2KN5A 2DZJA 3HHMA 2J7QB 3MJWA 1OTRB 4DDGD 4EUTA 5J17A 4GXBA 5C1ZA 3ZIMA 2GBJA 2WDTB 1XT9B 3A1QA 3S2AA 1GJZA 2IZVB 2ZVOA 2KDFB 4JQWC 3I3TB 4LJOB 3H7SA 4FLHA 1Q1OA 5CHWA 3CSTA 3ZNHB 4URKA 1VD2A 1Z5SB 2CR5A 2N9PC 1OGWA 1YX5B 5CHFA 3WAPA 5DPTA 1H4RA 3Q3JA 4HXDA 4NQLB 1WGYA 1WIAA 1ISNA 3LJ3A 1WZ3A 2AEHA 2JF5A 2KDBA 4TV3A 4ZDVA 5L95C 5J2RA 3TMPB 3JW0X 5BO4B 2FIFA 2BF8B 2MBHA 3U30A 2N9XA 4W9KA 3VVWB 1UZXB 3ECIA 1WY8A 3UINB 1IYFA 2LGXA 3VUXA 2DHZA 3TBLD 3H7PA 1WX9A 1XQQA 2K6QA 2KMAA 1E7VA 2LI5A 3V60A 4ANXA 3DVGX 4EEWA 3KUCB 1YIWA 4HDQA 5LXIB 3UIOB 1KOTA 1U4AA 3D32A 4LCDE 5JH5C 1Q5WB 3T8MA 3QC8B 2HJ8A 1EF1A 2L3ZA 3EECA 3QARA 2KQSA 1BT0A 2ZVNA 2EMSA 2FIDA 4FJVB 2M17A 3JSVA 3SHQA 1XD3B 4NQKE 2O2VA 2G3QB 2L8JA 5FR6A 3APDA 4HDOA 4YL8A 3TL5A 2FCSA 3KYDD 1P3QU 5JZEB 3L16A 4KSLC 4EFOA 4KV2A 3DOWA 3ONSA 4RMAA 1WE6A 4EZJA 4W9CA 4DWFA 1V2YA 3ZLZA 1UD7A 5E6OA 1EF5A 2MW5A 2Z0EB 4IW0A 2FNJB 5D94A 3ZTCA 2LZ6A 3AU4A 3R7RA 1EUVB 1P1AA 2KJ6A 1TGZB 2MBQA 1M94A 2YLMA 4HWIB 2MSED 2GMIC 3PPAA 3SU8X 3H9DA 3A33B 4HCPB 3DCGA 2KANA 4PYUA 4NNJB 2W9NA 3UQAA 3DVNV 2FCQA 4XZ4A 4BBNC 3PREA 1I35A 2DYBA 4IWPA 4WJOA 1WRDB 2GOWA 1WGRA 1IP9A 1V5TA 4G3XB 2BYFA 2NR2A 2MLBA 3EC8A 3PLVA 2Z59B 4GN1A 3TJPA 2RD0A 2JVCA 3QX1A 4K81A 4EKUA 2KDIA 5AZFA 2KXJA 2VRRB 2M0XA 3IBEA 3VUYA 1LXDA 2GBMA 3EHVA 2O2VB 3ZKJC 4HCNB 4FADA 1OEYA 2LRWA 2V3SA 1D3ZA 2IO0B 2LXAA 4PS3A 2M4NA 4HPLB 5DPRA 1NDDA 4I6PA 2KJHB 4M0WB 1Q0WB 2HE7A 4NJ7A 1KM7A 2N1VA 4OVVA 2WX1A 4LDTD 1LM8B 2DENB 3DBSA 4WWPA 2CU1A 2LWPA 4FA6A 3P2BA 2Y5BB 4ZRIA 3WAOA 3RT3B 3AI5A 3RYTA 4BKSD 2CHZA 4MEMA 4DBGA 2IO3B 3VFKA 1WXMA 2D3GA 3IG3A 2KWVB 4IM0A 3ZDMC 2K1FA 2B3AA 3GOEA 3T9LA 2BGFA 2MBBB 4KIKA 2PPHA 1V86A 2D10A 3CMMB 3L13A 2GBNA 4E3CA 1GUAB 1ZW7A 3VDZA 4BOSC 3QAQA 2YVCA 3HK0A 5LLIA 2IYDB 4W9HA 3WIMA 2LVQA 1WI0A 3V6EB 1LQBA 2C7NB 3M3JA 3U8ZA 2BKFA 2MRPA 2JPHA 3AULA 3RCZA 2DZMA 2IBIB 3H1UA 3R3MA 3ALBA 2KNBA 3A9JB 4OVUA 3VH3B 3A4SC 1ZKHA 2G4SA 4IM2A 2KX0A 4DXAB 2NPTA 2KTFA 5G2NA 1WMHB 1J8CA 2LASA 4ICUA 3K9PB 1NBFC 5C23A 1GNUA 3RZWC 4NPNA 5KHOA 2C7MB 3MHSD 3W1YA 3W1SC 3KYCD 5HKHA 2K39A 5JHAA 1WXAA 1H8CA 4GDLA 1P98A 4PS7A 4TQ0A 1V9JA 2RPQA 3B1LX 4TUUA 2MWSB 2MP2A 3KUZA 3ML8A 4G0NB 5G55A 1A5RA 2KWCA 2L05A 3WANA 3QCAA 1WJ6A 3QA8A 4MELA 4BVUC 3IVFA 2DYOA 3SDLC 3VQIA 1IPGA 4GOCA 3GZNI 4MH0E 3L17A 4NAWA 4AP4C 3V62A 4WJPA 3A4RA 1C1YB 3NS8A 4JLCA 4BBNF 4GU2A 3DVGY 3A1QB 2N4FA 4W9FA 4HVBA 2A5UA 1YQBA 4BKSA 2KFJA 3AU5A 2KJRA 4MSMB 4XX5A 2KLCA 1VCBA 3KW5B 2BWFA 2ZCBA 3V6CB 3N30A 1WYWB 2K8HA 3MTNB 3EFUA 3BINA 4KZCA 4P7IA 3NZSA 4GDLB 2CHWA 4K7UA 4EOYA 1OQYA 3A9KA 2J0KA 4GSWA 1LFDA 4PYZA 2N9EB 2ZJDA 3CSFA 3VHTC 1GC7A 1L7YA 2OJRA 2XEWA 2LD9A 4F8CB 4MSQB 2L0TA
chains in the Genus database with same CATH superfamily
1YJJA 3UQBA 4DHJD 1KLGD 4WJNA 1EWCA 1C78A 3H7PB 4GGQA 3IXSA 1N62A 4LNKA 5E6NA 1AWDA 2LJ5A 4II3B 3BY4B 2PKOA 2RSUA 2BVCA 3JSVB 2ZZPB 3AEFB 1WZ0A 1BMLC 3PHWB 1OEYJ 4AJYB 2FBWB 4L1BA 5JHBA 2HTHA 1V5OA 2WYQA 3BK2A 3M62B 3ZW3A 1G6JA 2KVRA 1V49A 3N1ZC 2XBBC 1RRBA 2LHEA 3JVZX 2KK8A 2QCZA 1STEA 4XC2A 4US9A 2PLPA 3NVZA 2RMMA 4IWQA 1OQQA 4AWJA 2ZPNA 2N7DA 2VH1A 3P4RB 5IA7A 4WAAA 4C00A 1WE7A 2KX3A 1RLFA 3U7DA 4DHZE 2R2OA 1WX7A 1J7BA 2IJ0A 2G9HD 1HA5A 2MJDA 1XEEA 3B08A 2V4LA 2ACZB 2DX5B 1F2RI 4B9KA 3IAM1 5TR5A 5HHDG 1IUEA 1PUTA 4MDKE 3EA6A 2KLGA 4MM3A 4W9EA 4AOFA 1R4NB 3AE5B 1KTKA 2FUG1 2LGYA 2INDC 2DZKA 3I9V1 4BFRA 4IG7B 3TCAA 4B6WA 1C3TA 1WRIA 1E8ZA 1F52A 4GIVA 1XCTL 2J0JA 1E0ZA 3LDZE 3AXCA 2DBYA 3TEXA 3TSSA 4OZAA 1PFDA 1T0YA 1KFYB 2ZNVB 3ZDTA 1NYQA 2DAFA 3V3XA 4WURA 1MFWA 3DBHI 2M1MA 2VZKD 4MM3B 1UWXA 5FR3A 1L0YB 4S17A 1WF9A 3IT4B 3Q8AA 2CS4A 4WAFA 1NI2A 3HVZA 4JIOU 5FKAC 3DVNU 2NMQA 2LVOA 2H88B 3HIZA 4ZRKA 3AECB 1XCQL 1JWAD 1MG8A 5J18A 1AYFA 4F1SA 1P7EA 4FJZA 1N6ZA 1PGAA 3LXFA 2FCNA 1YX6B 1NYRA 4ZRJA 2N9KA 2PTLA 4F7ZA 2LRUA 2LGDA 1V80A 1D5ZC 2G1EA 2N1WA 3AEGB 3VTVA 1I42A 2PJHA 3OJ4B 3R2IA 3ZJUA 3AB5A 1ZXHA 1GOZA 1MPEA 5TSSA 3NVWA 4JGHB 2C9WB 2KHWB 3KWVA 4RF0A 2K22A 2WXRA 2N0SB 3RD2A 4GB9A 2WU2B 2OJWA 1QZEA 4S0RA 2L76A 1R4MI 2V3NA 3X23A 1CMXB 4E71A 1AW7A 2JUOA 3OG5A 5BMHA 1TBEA 4HLEA 2Z8LA 4D2KA 2NBUA 3ZRCA 2MX2A 5AEKB 1WYGA 2MCNB 1SE4A 1D6EC 4GMVA 1K8RB 1FO4A 1L4DB 5CHVC 3PRZA 2D11A 4XGAB 1UGJA 3WALA 4YSZB 3MJWA 1FNUA 1SBBB 4HPPA 3ZIMA 3BIID 4EE2A 1XT9B 2XN9C 1V1PB 2IZVB 3AE6B 4C4VA 2ZVOA 4JQWC 2LJIA 3H7SA 3B2GA 1QOBA 3SR6A 3CSTA 3ZNHB 4URKA 2JU6X 2JYEA 1ISNA 3LJ3A 1MJDA 4C7ZA 2Y5PA 1KH0A 3TMPB 5AUIA 1AN8A 3R8BA 2MBHA 1FMAD 2IPKD 3ECIA 1IYFA 2DHZA 2I2YA 1E7VA 3Q8CA 3OWEB 3Q3OC 1SJHD 1YIWA 4HDQA 5LXIB 1FPYA 1QKZA 5JH5C 5D3DA 2L3ZA 3EECA 2GB1A 2KQSA 4FJVB 4YL8A 1P3QU 2QEJC 4DXGA 4YTNB 4IOIE 3L16A 4M0WA 1I4HA 3ONSA 4RMAA 2RDHA 4EZJA 4LNFA 4W9CA 4US8A 2VH2A 5E6OA 1EF5A 2Z0EB 3MC8A 2X38A 1HZ5A 3ZTCA 3AU4A 1TGZB 2YLMA 3PPAA 2WXNA 4P1CC 2W55A 2JZPA 3A33B 4UDUC 3BK1A 4PYUA 2W9NA 3UQAA 2GOWA 1YN5A 2NR2A 2INCC 4ZHOA 2RD0A 1I4GA 4K81A 4EKUA 1ZE3D 1MI0A 3EHVA 1FFVA 4FADA 3N9YC 2KACA 2V3SA 2IO0B 3NRZA 2JX5A 4M0WB 1VJKA 3AH7A 1RYJA 1V1OA 4LDTD 1BXTA 2Y5BB 1LGRA 1FNWA 3VR9B 2D3GA 2K1FA 2BGFA 3AM9A 4B0MA 2MBBB 2PPHA 1V86A 4E3CA 3L13A 2GBNA 3BWUD 1GUAB 3QAQA 3HK0A 1D5MC 1L4ZB 1WI0A 1LQBA 3U8ZA 3RCZA 2WXOA 1L6UA 1T3QA 2KNBA 2UU7A 4IM2A 3KLSX 2KX0A 1K50A 2LASA 5KHOA 1V97A 4YXDB 3B9JA 2J42A 1QOAA 2K39A 2KMMA 3N20C 5JHAA 3ZGZA 1H8CA 4HJGE 3GP7A 1MHHE 1V9JA 3P4QB 3B1LX 2MWSB 2MP2A 3ML8A 3HRDD 1V8CA 4A90A 2KWCA 1YJIA 3QCAA 3Q6BA 1TKYA 3IVFA 4RNAA 3L17A 4WJPA 1C1YB 3NS8A 4KGSA 1PYWD 2D5GA 4W9FA 2BW2A 4HEA1 2BWFA 1WYWB 1TY2A 4HKQA 1SB3C 2D3AA 1T0RC 4EOYA 1IGCA 1OQYA 3A9KA 1LFDA 4ARIA 2XEWA 3R2TA 2LD9A 4MSQB 2L0TA 4OW0A 1WFYA 2AYOB 3AE2B 5G5HA 2D2QA 4EZLA 3VRBB 2OHFA 2XK5A 1WX8A 1WR6E 1DOYA 1JMLA 4I6NB 4RM9A 4BKTA 5KHQA 5EE3A 2BKRB 5H8YE 2LGIA 4NAMA 1T0SC 1IBXA 1UELA 2KAJA 1WGHA 4IKGA 1SE3A 2IDYA 3VUWA 1KRHA 2DWQA 3ML9A 3A9KB 2LUMA 1R4NI 4XYCA 4PS8A 5IAAC 5IN7A 3PSEB 3CWIA 3KVFB 1ET9A 1L6VA 3AEAB 3L08A 2INNE 1L0VB 3RI7C 1ZP0B 1JRUA 1YJ1A 1J19A 2WDQB 2IO1B 3U7ZA 3ZNID 2NBVB 4FHKA 5AZGA 2C5LC 2GBRA 3QWZB 3RUIB 4ANVA 2K8CA 2PW9A 2QC8A 3PRMB 3FC4A 3WAMA 3PLUA 1WWTA 2D07B 4LNIA 2WQYB 4A9AA 2R2QA 2ZNVC 3UIPB 3NY5A 2WXPA 1FRRA 4FN2A 4CHKA 1C9FA 1E8YA 2FE8A 4KIKB 2LEKA 2J0MA 2L1AA 1IGDA 2AX5A 3PZDA 2RGFA 1YD8U 2V1YA 1FXTB 1HXYD 4M00A 3R66C 4FULA 1I4RA 4E74A 5E6PA 2O6VD 1ZDXA 3P1MA 5D2MB 4RM8A 1WJNA 2KDEB 4IUMB 4DHJB 2NPTB 2NCNA 2IO2B 5HI1A 3RZFA 1YMHE 2EMTA 3DBRI 4RFBA 4II2B 2KYWA 3HVDA 3R7QA 1I7HA 2L52A 1N60A 3QQ8B 3Q3FA 4HJKA 5BYQA 3B0AA 3X0WA 1Y8RC 4A6QA 1RAXA 2KC2A 2JYTA 4FJYA 4JX1C 3GE8C 3MFGA 3V61A 2N7JA 2MJEA 2JZZA 3NZUA 2EKEC 2WLBA 4DDID 4XE0A 3U52E 1E7UA 4AJWA 4W9JA 2DYMA 1UUPA 3Q2AC 3OAWA 5GMVA 2WX0A 4X57B 4K7WA 4KDIC 1C79A 3CIRB 4JL9A 3QJZA 1UGMA 4TQ1A 3I63C 4ZHPA 4GDKA 4G50A 1RWSA 1PGBA 2NS5A 4KGRA 3P4SB 3DBLB 1EU3A 2K25A 3KH0A 5DPWA 3HM3A 4N58A 2WDVB 2Z0DB 2JXTA 4LNOA 5LNK1 1WMHA 1ZUD2 3BYYB 4P16A 3EUB2 3OJ3A 1XLPA 2AL3A 2MHJA 3ZUNA 1GC6A 3MP9A 4K7SA 1RM6C 1ZGUB 2I1JA 4A3OA 2BTEA 3APFA 1BUIC 2Q5WD 3NJTA 4GDKB 3N1XC 2MBEA 2L00B 1TKGA 3U2SC 1WM3A 1TTNA 4WJQA 2LXCA 1E90A 2M8SA 3P42A 2FAZA 1MVKA 4MT5A 1LO5D 4DDGD 2J7QB 1OTRB 4EUTA 1GB4A 4GXBA 2K9XA 5EE0A 3S2AA 2WDTB 3A1QA 3N1YC 4LJOB 2VZKB 1Q1OA 2D3CA 3MC0B 1Z5SB 2CR5A 2N9PC 1YX5B 3WAPA 4NQLB 1WIAA 2KDBA 4TV3A 5L95C 1T5XD 1QF6A 1C4CA 3DHHC 3TBLD 1XQQA 2KMAA 3V60A 3J9CA 4YT0B 4EEWA 2LGSA 1DYQA 1KOTA 1U4AA 2V9HA 4RGTA 3D32A 4LCDE 1SXTA 3T8MA 3QC8B 1EF1A 3QARA 2PVOD 2KT7A 2ZVNA 1XD3B 3AE1B 4NQKE 4KKJA 2G3QB 3PO0A 5FR6A 4XDCA 3TL5A 1K51A 4KV2A 1PDXA 3DOWA 3RNEC 3ZJVA 4DWFA 1NI3A 1V2YA 3ZLZA 1UD7A 2MW5A 4IW0A 5D94A 1B9RA 2LZ6A 2TSSA 1P1AA 4HWIB 4WQMA 4AS1A 2MSED 3H9DA 4HCPB 3MJ5A 2WS3B 4NNJB 3AV8A 2ICIA 4XZ4A 3DBRB 4WJOA 1WRDB 1VZ8A 1QILA 1UNSA 1IP9A 1V5TA 3PLVA 5HG2A 2KDIA 5AZFA 2KXJA 3VUYA 1LXDA 1XF5L 2WGSA 3ABVB 1FCLA 2LRWA 1D3ZA 4PS3A 2I38A 3PZ8A 4I6PA 2KJHB 3GE3C 1KM7A 4OHJA 4WWPA 2W3SA 2BS4B 4M01A 4ZRIA 3AE9B 3RT3B 3AI5A 4BKSD 4MEMA 3RNCC 3VFKA 4IM0A 2B3AA 3T9LA 4N6EB 2LFIA 3RPFC 1ZW7A 3TEZA 1T6BX 5MPOA 2NTSA 3FAHA 4W9HA 2DLBA 2LVQA 3V6EB 4XDDA 2BKFA 3GB1A 2JPHA 3ALBA 2BB5A 1FCCC 3A4SC 2G4SA 4DXAB 2KTFA 1J8CA 1NBFC 5C23A 3RZWC 3W1YA 3MHSD 1VDVA 1WXQA 4JE3B 3W1SC 5HKHA 1GPXA 4GDLA 4RGOS 2RPQA 2ONQA 4A55A 1HTQA 4ZYSA 1NVID 3Q69A 4B0EA 1FXAA 2DYOA 3VQIA 5C2TB 3V62A 3RMKC 3A4RA 3AE4B 5E6JA 2SAKA 3DVGY 3ZYYX 2N4FA 4PK1A 1YQBA 2KFJA 4C4VB 1E10A 3L4PA 2K3UA 2KJRA 4XX5A 1VCBA 2RPVA 4HROA 2ZCBA 2WXLA 3EFUA 2M19A 1SJED 2WXHA 4XWWA 4GDLB 1C76A 4GSWA 4PYZA 2N9EB 2ZJDA 3VHTC 1OQRA 1GC7A 4WWMA 1UWMA 5G5GA 2CHXA 1S1QB 2DZIA 3CF6E 4MGYE 1J0GA 2REXA 2FUHB 3NVYA 1EO6A 3IHPC 4ASWC 4LDTB 3ZXRA 5BYRA 3GZNB 3ZJTA 3QK0A 1WM2A 2AWTA 1QQRA 2BWES 1HE8A 3DQVA 2C60A 4N9F4 4ARCA 1MHXA 1F77A 2K6DB 5H92C 2N7EA 1N5XA 3N3KB 1UBIA 2LUEA 4YTPB 1TJEA 1CZPA 1P9DU 1JALA 1MG4A 3RULA 2KWDA 3DWMA 3ENEA 2G45B 3AEBB 1E8WA 2WWZA 4KSKC 3NG0A 2OEDA 3Q8FA 2JSVX 2JRIB 3PV1A 4FBJB 2RDGA 2G4DB 3ETRA 1UH6A 1M4VA 1XLQA 3VR8B 1Z2MA 2IY1B 3W1SA 1VRAB 1A70A 1RFAA 3QIJA 1WGDA 2BYVE 2E6XA 1TKEA 2HD5B 2J4XA 3BYTB 2NVUI 1E8XA 1WJUA 5L83A 3AEDB 4ZRQA 2JRHA 2NTTA 4P6VF 1N5WA 3PRPB 5GXGB 3APCA 3T3OA 2K5PA 2BYTA 1TZOA 3BVGA 3WA0A 3NOBA 1JWBD 2LVPA 2KMCA 1FFUA 4M8MA 3ZNZB 3RN9C 1JW9D 2FCMA 4DXFA 2N9LA 1X1MA 3RNBC 3HM6X 3SD5A 3IAS1 4RGNA 1ZPSA 3URYA 4CYEA 1P0RA 1Y56A 1EM7A 3C8YA 2KD0A 3DBLI 2PE6B 2KZRA 2JXXA 3HUIA 3L0WB 2ZPYA 3VH4B 2MP2B 2L83A 2RR9A 3GS2A 5D7GA 4A20A 1N61A 1QOGA 1WJ4A 3VXWA 2ON8A 3QHTA 3ZNGC 2L7RA 4JWUC 3Q8BA 1KF6B 5BMGA 3N32A 4DQOC 1FNVA 4NY0A 2SEBD 1L2NA 4IDIA 4W9LA 3JYUA 4WWNA 3E9SA 4G11A 4W9GA 1S3SG 2BQQA 1QT9A 2KQ7A 1QOFA 2NBWB 4KVGB 4RCOA 4ACFA 1I4XA 3AMZA 3ZO5B 2O6VA 1SIJA 4K3CA 3FILA 2H89B 3K9OB 4WQOB 4ZRPA 3BVMA 2XK5B 3UF8A 4RH6A 3A9JA 4A3PA 1PQSA 1ENFA 1SE9A 1DGJA 3M95A 2C7HA 1CJEA 2OOBB 4K3BA 1WGKA 1E7PB 4CO7A 2L0FA 5DCNA 3Q3MC 4B95A 1IBXB 1KLVA 3M63B 1VR9A 2KC1A 3Q14C 5D6JB 2KOXA 2KO3A 4LK0M 4YTMB 3O65B 2ASQA 3PGEA 2O6VB 1V6EA 3FILB 3SFDB 2AL6A 4ZYNA 1GG3A 4TMAB 3DPDA 3EFCA 2KKCA 5BMIA 2DZJA 3HHMA 5J17A 1CQVA 5CHWA 1OGWA 2E3TA 5CHFA 5DPTA 3Q3JA 1E9MA 2BS2B 1WGYA 4O1NA 2EELA 2CJNA 3JW0X 1TYGB 2BBCA 5BO4B 1E6EB 4WH4A 2FIFA 2BF8B 3U30A 4W9KA 3UINB 3VUXA 3H7PA 1HEZE 1K52A 3MHZA 2IGGA 3BVZA 1NEKB 2AQ3B 2HJ8A 2EMSA 2FIDA 3JSVA 2O2VA 4HDOA 4ITKA 1ACCA 1CK1A 1JRPA 2FCSA 2M56B 4R3DA 2ZW1A 5JZEB 1WE6A 4A8XC 4N59A 4JPSA 4C80A 4M02A 2FNJB 4YWGG 3I57A 1EUVB 2KJ6A 1M94A 2GMIC 3SU8X 2KANA 1F0ZA 3DVNV 2FCQA 2DNFA 4BBNC 3SFEB 4IWPA 5JXVA 1WGRA 3AE3B 2BYFA 2WP9B 3FKYA 2Z59B 4GN1A 2M0AA 1XO3A 2M0XA 3IBEA 2LHDA 2O2VB 4RGMA 4HKZE 2M4NA 4HPLB 2PVGC 5DPRA 1NDDA 4L23A 1ET6A 1D5XC 4OVVA 2WX1A 2DENB 3DBSA 2CU1A 4FA6A 3WAOA 3E56A 1I4PA 3RYTA 3LB8C 4DBGA 1ROEA 2KWVB 3BZDB 2BB6A 3LYYA 1TS4A 2D10A 2J52A 3VDZA 4BOSC 1JQ4A 4AQ7A 2V0GA 2D3BA 3WIMA 1B1ZA 3VRAB 2C7NB 2MRPA 5T8IA 1JWMD 1FD6A 1WMHB 2MEKA 3K9PB 2C7MB 5EE1A 3ZXVA 1VZ7A 1VZ6A 3T3NA 3TEYA 1WXAA 2WHIA 4PS7A 4TQ0A 1A5RA 2L05A 3QA8A 4MELA 2L32A 3SDLC 3WCQA 1IPGA 3GZNI 4MH0E 1UF0A 4NAWA 1F2RC 2HJ1A 4JLCA 4OZBA 4GU2A 3A1QB 2HTME 2A5UA 3O13A 4BKSA 2HDEA 2KLCA 2YEPB 3N30A 2K8HA 3MTNB 3BINA 4OZCA 4P7IA 3Q8EA 1SSNA 3RNFC 2JQRB 3KQ4A 2OJRA 1L7YA 1H4RA 4F8CB 4ZOHC 1TT5B 4HPMB 4MJSA 1PGXA 3KUDB 2B76B 3PT2B 2BS3B 2ZCCA 4NAWB 1QLBB 3ZTDA 4KZ0A 2Y5CA 1FRDA 4AUQC 1V81A 1J7AA 1FEHA 4M8NA 2AQ2B 3AE7B 1WR1A 4HK2A 1YN4A 4FHJA 2PE9A 4MGZE 2WU5B 2UWQA 4ANUA 3NHEB 4MGKE 4TSSA 3I5JC 1YQ4B 5AZHA 4P1BC 4MJSB 3L54A 4EZKA 1T0QC 2CKHB 4BKGA 5HFYA 1XLOA 4QAYA 3TIXA 4WWOA 3H6NA 4L2YA 4LNNA 4NJ6A 4I6LB 4MGIE 2MBOA 1V1PA 2QMTA 3V05A 4ANWA 4W9IA 3DHGC 2A4ZA 2KVZA 2WXKA 3VAWA 3ZRFA 3VTUA 3PZ7A 3AN1A 2WXIA 2XNAC 4J3OD 5IOIA 2I1KA 1GAQB 1N63A 3PHXB 2ZEQA 4HRSA 2GBKA 4CQNA 2K8BA 3ZVVA 1TZ1A 4J6IA 1K53A 4BOZB 5FK9C 2JT4B 3DHIC 2V3PA 3PVLA 4IM3A 2WXMA 2UYZB 5DPSA 2IY0B 4TKNA 1F9JA 4LJPB 1TS5A 3AE8B 3NVVA 4Q2JA 4K1RB 4DK5A 1AARA 1XXGA 3W9CB 3UGBB 4ICVA 2W3RA 5I4DA 4C56C 3ZQ4A 4KKIA 3SEBA 4JWSC 2MQJA 2BT6A 2KFKA 4KDLB 2RDBC 1XLNA 1SIFA 4WIPA 3L10B 1E5WA 3RFZB 3U4EG 3TEWA 1UBQA 2GI9A 1I4QA 2JY6A 1SGHA 2WXQA 1WH3A 2QIEB 1JWUD 1YOVB 2KTRA 3IFWB 2QHOA 3OLMD 1TIFA 3PTFC 4DHZB 1YNTE 4IWOA 3NUHB 5BYSA 1SE2A 2MA9B 1C4AA 1WGGA 2KFKB 5EDSA 3DBHB 2BYEA 1KLUD 3PS6A 3DDCB 2J53A 2IGHA 2PIAA 4W9DA 1WXVA 1KJTA 1SEBD 2BPSA 2W82A 2KTRB 2DAJA 2WNMA 2QSDA 5EE9A 2PEAA 1GB1A 3KWLA 3VTWA 5CX3A 4IC7B 1DOXA 1WXSA 5CTRC 2JZ3B 1EU4A 1ZOYB 5D3IB 3C0RB 1ESFA 2JWZA 2KWUB 5LXHA 2KN5A 1HQRD 1YN3A 5C1ZA 2GBJA 1GJZA 2LMCA 2JWUA 2GRIA 2KDFB 4NZLB 3I3TB 4FLHA 2CJOA 1VD2A 1TY0A 5AUKA 4HXDA 1R4MB 5J2RA 1WZ3A 2AEHA 2JF5A 4ZDVA 1JCKB 1C77A 3W5VB 4XWTA 2N9XA 3VVWB 3TUOA 1DOIA 1OFFA 1UZXB 1WY8A 1TS2A 3W2DA 2LGXA 1J7CA 1WX9A 2K6QA 2LI5A 4GLSC 4ANXA 2X8XX 3DVGX 1FIQA 3KUCB 3UIOB 3AEEB 4C7YA 1Q5WB 4KX6B 4YSYB 1Q10A 4MH8A 2R61A 1BT0A 5C3JB 2WXGA 2M17A 3SHQA 4H2AA 2L8JA 3APDA 1NENB 3KYDD 3P63A 2QJLA 1EWYC 3C19A 4KSLC 4EFOA 3R7RA 3RNAC 3RNGC 2MBQA 1R7SA 3DCGA 4REZA 2KQ4X 3IT6B 1P7FA 2Y3AA 3Q3NC 3PREA 3NS1A 2DYBA 4MACA 1I35A 1JWSD 4NJCA 4G3XB 2MLBA 3EC8A 3TJPA 1HZ6A 2JVCA 3QX1A 2VRRB 1RFKA 2GBMA 1F1HA 3ZKJC 4HCNB 1OEYA 2LXAA 5IO9A 3H8HA 2KN4A 1JROA 1Q0WB 3UI3A 2HE7A 4NJ7A 1SF0A 2N1VA 3DWGC 1LM8B 2LWPA 3P2BA 4USAA 2WXJA 4BAXA 2GLSA 1TS3A 2CHZA 4LTUA 2IO3B 1WXMA 3IG3A 2YEPF 3ZDMC 2V4IB 3GOEA 2MH7A 1C4PA 4KIKA 3CMMB 4FXCA 2YVCA 4KGTA 1FM0D 1ZXIA 5LLIA 2IYDB 3W5UB 4LLGM 3M3JA 3AULA 2DZMA 2IBIB 3H1UA 3R3MA 4RF1A 3A9JB 4BZAA 4OVUA 3VH3B 1ZKHA 2AQ1B 2NPTA 1WSPA 2IGDA 2MJ3A 2WDRB 5G2NA 4ICUA 1GNUA 2WXFA 3MC9A 4NPNA 2QILA 3KYCD 1L5PA 1FXIA 3NZ3A 2W54A 1P98A 2QDFA 3P4PB 1D4BA 1L0XB 4TUUA 3KUZA 4G0NB 5G55A 4YSXB 3WANA 2KDMA 1WJ6A 4OVZA 4BVUC 2EKIA 4GOCA 2CU3A 1ZDVA 2ZW0A 4AP4C 2PMVA 1YQ3B 4BBNF 2INPE 4HVBA 3AU5A 4MSMB 3KW5B 3V6CB 5IKCM 2K0PA 4KZCA 1VLBA 3NZSA 2CHWA 3B2FA 4K7UA 2J0KA 1HTOA 4PT5A 3CSFA 5IP4D 3EGRA
chains in the Genus database with same CATH topology
3UQBA 4HPMB 4MJSA 2CHXA 3KUDB 4DHJD 1S1QB 1WFYA 2AYOB 4WJNA 2D2QA 3PT2B 4EZLA 2DZIA 2ZCCA 3H7PB 4NAWB 3CF6E 2XK5A 4GGQA 3ZTDA 4KZ0A 4MGYE 1WX8A 1WR6E 1J0GA 2REXA 4I6NB 2FUHB 4RM9A 4BKTA 1EO6A 4AUQC 3IHPC 5E6NA 5KHQA 4ASWC 4LDTB 2LJ5A 2BKRB 4II3B 1V81A 3BY4B 2RSUA 4M8NA 3QK0A 1WM2A 2AWTA 3JSVB 2ZZPB 2BWES 1WR1A 1UELA 1HE8A 3DQVA 1WZ0A 2C60A 3PHWB 4N9F4 1OEYJ 1WGHA 4HK2A 4AJYB 3VUWA 4FHJA 3ML9A 2PE9A 5JHBA 3A9KB 4MGZE 2HTHA 2UWQA 4ANUA 2K6DB 1V5OA 3NHEB 2WYQA 4MGKE 1R4NI 3M62B 5AZHA 4PS8A 3ZW3A 4MJSB 3L54A 5IAAC 2N7EA 2CKHB 2KVRA 1V49A 4BKGA 4EZKA 1G6JA 2XBBC 3TIXA 1RRBA 3PSEB 3JVZX 4WWOA 2KK8A 3N3KB 1UBIA 2LUEA 3KVFB 3L08A 4XC2A 3H6NA 4IWQA 1P9DU 1JRUA 4NJ6A 4I6LB 4MGIE 3RULA 3ENEA 4AWJA 2ZPNA 1YJ1A 2MBOA 2G45B 2N7DA 1E8WA 1J19A 2WWZA 2IO1B 4KSKC 3ZNID 4W9IA 2NBVB 4ANWA 5IA7A 4FHKA 4WAAA 5AZGA 1WE7A 2JRIB 1RLFA 2KX3A 3U7DA 4DHZE 2R2OA 2A4ZA 2C5LC 3PV1A 1WX7A 2GBRA 3QWZB 4FBJB 2G4DB 1UH6A 3RUIB 3VAWA 4ANVA 1Z2MA 2IY1B 3W1SA 3ZRFA 2K8CA 3VTUA 3PRMB 3B08A 3WAMA 2V4LA 1RFAA 2I1KA 3PLUA 3QIJA 2D07B 1WGDA 2DX5B 2BYVE 4B9KA 2HD5B 2NVUI 3PHXB 2R2QA 2ZEQA 2GBKA 1E8XA 1WJUA 2ZNVC 5TR5A 3UIPB 5L83A 3NY5A 2JRHA 4MDKE 2K8BA 3ZVVA 1TZ1A 2KLGA 4FN2A 4MM3A 4W9EA 3PRPB 4CHKA 4AOFA 1E8YA 3APCA 4J6IA 4KIKB 4BOZB 2LGYA 2J0MA 3WA0A 3NOBA 2DZKA 4BFRA 2LVPA 2JT4B 2KMCA 4IG7B 3TCAA 3PZDA 4M8MA 3ZNZB 2RGFA 3PVLA 4B6WA 1YD8U 4IM3A 2V1YA 1C3TA 2FCMA 1E8ZA 1X1MA 1FXTB 4GIVA 3R66C 4FULA 3SD5A 2J0JA 3HM6X 3LDZE 5E6PA 4E74A 2O6VD 2UYZB 3AXCA 5DPSA 5D2MB 4RM8A 1WJNA 2IY0B 2KDEB 4TKNA 4IUMB 4DHJB 2NPTB 2NCNA 1F9JA 4LJPB 2IO2B 4CYEA 1T0YA 1P0RA 3RZFA 2ZNVB 3ZDTA 2EMTA 4K1RB 3DBRI 4II2B 3R7QA 4DK5A 2DAFA 1AARA 2KD0A 3DBLI 2PE6B 3QQ8B 3DBHI 2M1MA 2KZRA 3Q3FA 4HJKA 3B0AA 3UGBB 2JXXA 4ICVA 3L0WB 2ZPYA 3X0WA 3VH4B 1Y8RC 2MP2B 1RAXA 2KC2A 2MQJA 4FJYA 1WF9A 2RR9A 5D7GA 2CS4A 2KFKA 4A20A 3V61A 1WJ4A 4KDLB 2JZZA 1NI2A 3VXWA 1SIFA 3NZUA 3QHTA 3ZNGC 2L7RA 3L10B 2EKEC 1E5WA 4DDID 4JIOU 3DVNU 3N32A 1UBQA 2LVOA 1E7UA 5GMVA 4AJWA 2JY6A 1SGHA 2DYMA 3HIZA 4W9JA 4ZRKA 4NY0A 1WH3A 3OAWA 2KTRA 2WX0A 1MG8A 3IFWB 4K7WA 4W9LA 2QHOA 3OLMD 4X57B 5J18A 3JYUA 4KDIC 4F1SA 4WWNA 4G11A 4FJZA 4W9GA 4JL9A 3PTFC 1S3SG 3QJZA 4DHZB 2KQ7A 2FCNA 1UGMA 1YX6B 2NBWB 4TQ1A 4GDKA 4ZRJA 4G50A 4F7ZA 2LRUA 4IWOA 2LGDA 1V80A 4KVGB 2N1WA 2NS5A 3VTVA 1I42A 2PJHA 2MA9B 1WGGA 3OJ4B 2KFKB 5EDSA 2BYEA 3ZO5B 3PS6A 3DDCB 2O6VA 2K25A 3K9OB 3KH0A 4WQOB 5DPWA 4JGHB 2C9WB 2KHWB 2XK5B 3UF8A 4W9DA 3HM3A 3A9JA 3RD2A 4A3PA 1WXVA 1KJTA 1PQSA 4GB9A 1SE9A 2Z0DB 1QZEA 3M95A 2C7HA 1WMHA 2OOBB 2BPSA 2L76A 1R4MI 3OJ3A 3X23A 2KTRB 2DAJA 2AL3A 3ZUNA 1GC6A 1CMXB 4CO7A 2L0FA 4K7SA 5DCNA 2PEAA 4B95A 4E71A 1ZGUB 2I1JA 1KLVA 2JUOA 4A3OA 3M63B 1TBEA 3APFA 3VTWA 4HLEA 5CX3A 4IC7B 4GDKB 2KC1A 2NBUA 2MBEA 5D6JB 3ZRCA 2L00B 2MX2A 1WXSA 1WM3A 1TTNA 2KOXA 4WJQA 5CTRC 2MCNB 2JZ3B 5AEKB 2KO3A 1K8RB 2LXCA 4GMVA 1E90A 2M8SA 3C0RB 5CHVC 2FAZA 1L2NA 3O65B 2ASQA 3PGEA 2O6VB 1V6EA 2D11A 3PRZA 2JWZA 2AL6A 4ZYNA 1GG3A 2KWUB 3WALA 5LXHA 3DPDA 2KKCA 2KN5A 2DZJA 3HHMA 2J7QB 3MJWA 1OTRB 4DDGD 4EUTA 5J17A 4GXBA 5C1ZA 3ZIMA 2GBJA 2WDTB 1XT9B 3A1QA 3S2AA 1GJZA 2IZVB 2ZVOA 2KDFB 4JQWC 3I3TB 4LJOB 3H7SA 4FLHA 1Q1OA 5CHWA 3CSTA 3ZNHB 4URKA 1VD2A 1Z5SB 2CR5A 2N9PC 1OGWA 1YX5B 5CHFA 3WAPA 5DPTA 1H4RA 3Q3JA 4HXDA 4NQLB 1WGYA 1WIAA 1ISNA 3LJ3A 1WZ3A 2AEHA 2JF5A 2KDBA 4TV3A 4ZDVA 5L95C 5J2RA 3TMPB 3JW0X 5BO4B 2FIFA 2BF8B 2MBHA 3U30A 2N9XA 4W9KA 3VVWB 1UZXB 3ECIA 1WY8A 3UINB 1IYFA 2LGXA 3VUXA 2DHZA 3TBLD 3H7PA 1WX9A 1XQQA 2K6QA 2KMAA 1E7VA 2LI5A 3V60A 4ANXA 3DVGX 4EEWA 3KUCB 1YIWA 4HDQA 5LXIB 3UIOB 1KOTA 1U4AA 3D32A 4LCDE 5JH5C 1Q5WB 3T8MA 3QC8B 2HJ8A 1EF1A 2L3ZA 3EECA 3QARA 2KQSA 1BT0A 2ZVNA 2EMSA 2FIDA 4FJVB 2M17A 3JSVA 3SHQA 1XD3B 4NQKE 2O2VA 2G3QB 2L8JA 5FR6A 3APDA 4HDOA 4YL8A 3TL5A 2FCSA 3KYDD 1P3QU 5JZEB 3L16A 4KSLC 4EFOA 4KV2A 3DOWA 3ONSA 4RMAA 1WE6A 4EZJA 4W9CA 4DWFA 1V2YA 3ZLZA 1UD7A 5E6OA 1EF5A 2MW5A 2Z0EB 4IW0A 2FNJB 5D94A 3ZTCA 2LZ6A 3AU4A 3R7RA 1EUVB 1P1AA 2KJ6A 1TGZB 2MBQA 1M94A 2YLMA 4HWIB 2MSED 2GMIC 3PPAA 3SU8X 3H9DA 3A33B 4HCPB 3DCGA 2KANA 4PYUA 4NNJB 2W9NA 3UQAA 3DVNV 2FCQA 4XZ4A 4BBNC 3PREA 1I35A 2DYBA 4IWPA 4WJOA 1WRDB 2GOWA 1WGRA 1IP9A 1V5TA 4G3XB 2BYFA 2NR2A 2MLBA 3EC8A 3PLVA 2Z59B 4GN1A 3TJPA 2RD0A 2JVCA 3QX1A 4K81A 4EKUA 2KDIA 5AZFA 2KXJA 2VRRB 2M0XA 3IBEA 3VUYA 1LXDA 2GBMA 3EHVA 2O2VB 3ZKJC 4HCNB 4FADA 1OEYA 2LRWA 2V3SA 1D3ZA 2IO0B 2LXAA 4PS3A 2M4NA 4HPLB 5DPRA 1NDDA 4I6PA 2KJHB 4M0WB 1Q0WB 2HE7A 4NJ7A 1KM7A 2N1VA 4OVVA 2WX1A 4LDTD 1LM8B 2DENB 3DBSA 4WWPA 2CU1A 2LWPA 4FA6A 3P2BA 2Y5BB 4ZRIA 3WAOA 3RT3B 3AI5A 3RYTA 4BKSD 2CHZA 4MEMA 4DBGA 2IO3B 3VFKA 1WXMA 2D3GA 3IG3A 2KWVB 4IM0A 3ZDMC 2K1FA 2B3AA 3GOEA 3T9LA 2BGFA 2MBBB 4KIKA 2PPHA 1V86A 2D10A 3CMMB 3L13A 2GBNA 4E3CA 1GUAB 1ZW7A 3VDZA 4BOSC 3QAQA 2YVCA 3HK0A 5LLIA 2IYDB 4W9HA 3WIMA 2LVQA 1WI0A 3V6EB 1LQBA 2C7NB 3M3JA 3U8ZA 2BKFA 2MRPA 2JPHA 3AULA 3RCZA 2DZMA 2IBIB 3H1UA 3R3MA 3ALBA 2KNBA 3A9JB 4OVUA 3VH3B 3A4SC 1ZKHA 2G4SA 4IM2A 2KX0A 4DXAB 2NPTA 2KTFA 5G2NA 1WMHB 1J8CA 2LASA 4ICUA 3K9PB 1NBFC 5C23A 1GNUA 3RZWC 4NPNA 5KHOA 2C7MB 3MHSD 3W1YA 3W1SC 3KYCD 5HKHA 2K39A 5JHAA 1WXAA 1H8CA 4GDLA 1P98A 4PS7A 4TQ0A 1V9JA 2RPQA 3B1LX 4TUUA 2MWSB 2MP2A 3KUZA 3ML8A 4G0NB 5G55A 1A5RA 2KWCA 2L05A 3WANA 3QCAA 1WJ6A 3QA8A 4MELA 4BVUC 3IVFA 2DYOA 3SDLC 3VQIA 1IPGA 4GOCA 3GZNI 4MH0E 3L17A 4NAWA 4AP4C 3V62A 4WJPA 3A4RA 1C1YB 3NS8A 4JLCA 4BBNF 4GU2A 3DVGY 3A1QB 2N4FA 4W9FA 4HVBA 2A5UA 1YQBA 4BKSA 2KFJA 3AU5A 2KJRA 4MSMB 4XX5A 2KLCA 1VCBA 3KW5B 2BWFA 2ZCBA 3V6CB 3N30A 1WYWB 2K8HA 3MTNB 3EFUA 3BINA 4KZCA 4P7IA 3NZSA 4GDLB 2CHWA 4K7UA 4EOYA 1OQYA 3A9KA 2J0KA 4GSWA 1LFDA 4PYZA 2N9EB 2ZJDA 3CSFA 3VHTC 1GC7A 1L7YA 2OJRA 2XEWA 2LD9A 4F8CB 4MSQB 2L0TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UQB A;  4HPM B;  4MJS A;  2CHX A;  3KUD B;  4DHJ D;  1S1Q B;  1WFY A;  2AYO B;  4WJN A;  2D2Q A;  3PT2 B;  4EZL A;  2DZI A;  2ZCC A;  3H7P B;  4NAW B;  3CF6 E;  2XK5 A;  4GGQ A;  3ZTD A;  4KZ0 A;  4MGY E;  1WX8 A;  1WR6 E;  1J0G A;  2REX A;  4I6N B;  2FUH B;  4RM9 A;  4BKT A;  1EO6 A;  4AUQ C;  3IHP C;  5E6N A;  5KHQ A;  4ASW C;  4LDT B;  2LJ5 A;  2BKR B;  4II3 B;  1V81 A;  3BY4 B;  2RSU A;  4M8N A;  3QK0 A;  1WM2 A;  2AWT A;  3JSV B;  2ZZP B;  2BWE S;  1WR1 A;  1UEL A;  1HE8 A;  3DQV A;  1WZ0 A;  2C60 A;  3PHW B;  4N9F 4;  1OEY J;  1WGH A;  4HK2 A;  4AJY B;  3VUW A;  4FHJ A;  3ML9 A;  2PE9 A;  5JHB A;  3A9K B;  4MGZ E;  2HTH A;  2UWQ A;  4ANU A;  2K6D B;  1V5O A;  3NHE B;  2WYQ A;  4MGK E;  1R4N I;  3M62 B;  5AZH A;  4PS8 A;  3ZW3 A;  4MJS B;  3L54 A;  5IAA C;  2N7E A;  2CKH B;  2KVR A;  1V49 A;  4BKG A;  4EZK A;  1G6J A;  2XBB C;  3TIX A;  1RRB A;  3PSE B;  3JVZ X;  4WWO A;  2KK8 A;  3N3K B;  1UBI A;  2LUE A;  3KVF B;  3L08 A;  4XC2 A;  3H6N A;  4IWQ A;  1P9D U;  1JRU A;  4NJ6 A;  4I6L B;  4MGI E;  3RUL A;  3ENE A;  4AWJ A;  2ZPN A;  1YJ1 A;  2MBO A;  2G45 B;  2N7D A;  1E8W A;  1J19 A;  2WWZ A;  2IO1 B;  4KSK C;  3ZNI D;  4W9I A;  2NBV B;  4ANW A;  5IA7 A;  4FHK A;  4WAA A;  5AZG A;  1WE7 A;  2JRI B;  1RLF A;  2KX3 A;  3U7D A;  4DHZ E;  2R2O A;  2A4Z A;  2C5L C;  3PV1 A;  1WX7 A;  2GBR A;  3QWZ B;  4FBJ B;  2G4D B;  1UH6 A;  3RUI B;  3VAW A;  4ANV A;  1Z2M A;  2IY1 B;  3W1S A;  3ZRF A;  2K8C A;  3VTU A;  3PRM B;  3B08 A;  3WAM A;  2V4L A;  1RFA A;  2I1K A;  3PLU A;  3QIJ A;  2D07 B;  1WGD A;  2DX5 B;  2BYV E;  4B9K A;  2HD5 B;  2NVU I;  3PHX B;  2R2Q A;  2ZEQ A;  2GBK A;  1E8X A;  1WJU A;  2ZNV C;  5TR5 A;  3UIP B;  5L83 A;  3NY5 A;  2JRH A;  4MDK E;  2K8B A;  3ZVV A;  1TZ1 A;  2KLG A;  4FN2 A;  4MM3 A;  4W9E A;  3PRP B;  4CHK A;  4AOF A;  1E8Y A;  3APC A;  4J6I A;  4KIK B;  4BOZ B;  2LGY A;  2J0M A;  3WA0 A;  3NOB A;  2DZK A;  4BFR A;  2LVP A;  2JT4 B;  2KMC A;  4IG7 B;  3TCA A;  3PZD A;  4M8M A;  3ZNZ B;  2RGF A;  3PVL A;  4B6W A;  1YD8 U;  4IM3 A;  2V1Y A;  1C3T A;  2FCM A;  1E8Z A;  1X1M A;  1FXT B;  4GIV A;  3R66 C;  4FUL A;  3SD5 A;  2J0J A;  3HM6 X;  3LDZ E;  5E6P A;  4E74 A;  2O6V D;  2UYZ B;  3AXC A;  5DPS A;  5D2M B;  4RM8 A;  1WJN A;  2IY0 B;  2KDE B;  4TKN A;  4IUM B;  4DHJ B;  2NPT B;  2NCN A;  1F9J A;  4LJP B;  2IO2 B;  4CYE A;  1T0Y A;  1P0R A;  3RZF A;  2ZNV B;  3ZDT A;  2EMT A;  4K1R B;  3DBR I;  4II2 B;  3R7Q A;  4DK5 A;  2DAF A;  1AAR A;  2KD0 A;  3DBL I;  2PE6 B;  3QQ8 B;  3DBH I;  2M1M A;  2KZR A;  3Q3F A;  4HJK A;  3B0A A;  3UGB B;  2JXX A;  4ICV A;  3L0W B;  2ZPY A;  3X0W A;  3VH4 B;  1Y8R C;  2MP2 B;  1RAX A;  2KC2 A;  2MQJ A;  4FJY A;  1WF9 A;  2RR9 A;  5D7G A;  2CS4 A;  2KFK A;  4A20 A;  3V61 A;  1WJ4 A;  4KDL B;  2JZZ A;  1NI2 A;  3VXW A;  1SIF A;  3NZU A;  3QHT A;  3ZNG C;  2L7R A;  3L10 B;  2EKE C;  1E5W A;  4DDI D;  4JIO U;  3DVN U;  3N32 A;  1UBQ A;  2LVO A;  1E7U A;  5GMV A;  4AJW A;  2JY6 A;  1SGH A;  2DYM A;  3HIZ A;  4W9J A;  4ZRK A;  4NY0 A;  1WH3 A;  3OAW A;  2KTR A;  2WX0 A;  1MG8 A;  3IFW B;  4K7W A;  4W9L A;  2QHO A;  3OLM D;  4X57 B;  5J18 A;  3JYU A;  4KDI C;  4F1S A;  4WWN A;  4G11 A;  4FJZ A;  4W9G A;  4JL9 A;  3PTF C;  1S3S G;  3QJZ A;  4DHZ B;  2KQ7 A;  2FCN A;  1UGM A;  1YX6 B;  2NBW B;  4TQ1 A;  4GDK A;  4ZRJ A;  4G50 A;  4F7Z A;  2LRU A;  4IWO A;  2LGD A;  1V80 A;  4KVG B;  2N1W A;  2NS5 A;  3VTV A;  1I42 A;  2PJH A;  2MA9 B;  1WGG A;  3OJ4 B;  2KFK B;  5EDS A;  2BYE A;  3ZO5 B;  3PS6 A;  3DDC B;  2O6V A;  2K25 A;  3K9O B;  3KH0 A;  4WQO B;  5DPW A;  4JGH B;  2C9W B;  2KHW B;  2XK5 B;  3UF8 A;  4W9D A;  3HM3 A;  3A9J A;  3RD2 A;  4A3P A;  1WXV A;  1KJT A;  1PQS A;  4GB9 A;  1SE9 A;  2Z0D B;  1QZE A;  3M95 A;  2C7H A;  1WMH A;  2OOB B;  2BPS A;  2L76 A;  1R4M I;  3OJ3 A;  3X23 A;  2KTR B;  2DAJ A;  2AL3 A;  3ZUN A;  1GC6 A;  1CMX B;  4CO7 A;  2L0F A;  4K7S A;  5DCN A;  2PEA A;  4B95 A;  4E71 A;  1ZGU B;  2I1J A;  1KLV A;  2JUO A;  4A3O A;  3M63 B;  1TBE A;  3APF A;  3VTW A;  4HLE A;  5CX3 A;  4IC7 B;  4GDK B;  2KC1 A;  2NBU A;  2MBE A;  5D6J B;  3ZRC A;  2L00 B;  2MX2 A;  1WXS A;  1WM3 A;  1TTN A;  2KOX A;  4WJQ A;  5CTR C;  2MCN B;  2JZ3 B;  5AEK B;  2KO3 A;  1K8R B;  2LXC A;  4GMV A;  1E90 A;  2M8S A;  3C0R B;  5CHV C;  2FAZ A;  1L2N A;  3O65 B;  2ASQ A;  3PGE A;  2O6V B;  1V6E A;  2D11 A;  3PRZ A;  2JWZ A;  2AL6 A;  4ZYN A;  1GG3 A;  2KWU B;  3WAL A;  5LXH A;  3DPD A;  2KKC A;  2KN5 A;  2DZJ A;  3HHM A;  2J7Q B;  3MJW A;  1OTR B;  4DDG D;  4EUT A;  5J17 A;  4GXB A;  5C1Z A;  3ZIM A;  2GBJ A;  2WDT B;  1XT9 B;  3A1Q A;  3S2A A;  1GJZ A;  2IZV B;  2ZVO A;  2KDF B;  4JQW C;  3I3T B;  4LJO B;  3H7S A;  4FLH A;  1Q1O A;  5CHW A;  3CST A;  3ZNH B;  4URK A;  1VD2 A;  1Z5S B;  2CR5 A;  2N9P C;  1OGW A;  1YX5 B;  5CHF A;  3WAP A;  5DPT A;  1H4R A;  3Q3J A;  4HXD A;  4NQL B;  1WGY A;  1WIA A;  1ISN A;  3LJ3 A;  1WZ3 A;  2AEH A;  2JF5 A;  2KDB A;  4TV3 A;  4ZDV A;  5L95 C;  5J2R A;  3TMP B;  3JW0 X;  5BO4 B;  2FIF A;  2BF8 B;  2MBH A;  3U30 A;  2N9X A;  4W9K A;  3VVW B;  1UZX B;  3ECI A;  1WY8 A;  3UIN B;  1IYF A;  2LGX A;  3VUX A;  2DHZ A;  3TBL D;  3H7P A;  1WX9 A;  1XQQ A;  2K6Q A;  2KMA A;  1E7V A;  2LI5 A;  3V60 A;  4ANX A;  3DVG X;  4EEW A;  3KUC B;  1YIW A;  4HDQ A;  5LXI B;  3UIO B;  1KOT A;  1U4A A;  3D32 A;  4LCD E;  5JH5 C;  1Q5W B;  3T8M A;  3QC8 B;  2HJ8 A;  1EF1 A;  2L3Z A;  3EEC A;  3QAR A;  2KQS A;  1BT0 A;  2ZVN A;  2EMS A;  2FID A;  4FJV B;  2M17 A;  3JSV A;  3SHQ A;  1XD3 B;  4NQK E;  2O2V A;  2G3Q B;  2L8J A;  5FR6 A;  3APD A;  4HDO A;  4YL8 A;  3TL5 A;  2FCS A;  3KYD D;  1P3Q U;  5JZE B;  3L16 A;  4KSL C;  4EFO A;  4KV2 A;  3DOW A;  3ONS A;  4RMA A;  1WE6 A;  4EZJ A;  4W9C A;  4DWF A;  1V2Y A;  3ZLZ A;  1UD7 A;  5E6O A;  1EF5 A;  2MW5 A;  2Z0E B;  4IW0 A;  2FNJ B;  5D94 A;  3ZTC A;  2LZ6 A;  3AU4 A;  3R7R A;  1EUV B;  1P1A A;  2KJ6 A;  1TGZ B;  2MBQ A;  1M94 A;  2YLM A;  4HWI B;  2MSE D;  2GMI C;  3PPA A;  3SU8 X;  3H9D A;  3A33 B;  4HCP B;  3DCG A;  2KAN A;  4PYU A;  4NNJ B;  2W9N A;  3UQA A;  3DVN V;  2FCQ A;  4XZ4 A;  4BBN C;  3PRE A;  1I35 A;  2DYB A;  4IWP A;  4WJO A;  1WRD B;  2GOW A;  1WGR A;  1IP9 A;  1V5T A;  4G3X B;  2BYF A;  2NR2 A;  2MLB A;  3EC8 A;  3PLV A;  2Z59 B;  4GN1 A;  3TJP A;  2RD0 A;  2JVC A;  3QX1 A;  4K81 A;  4EKU A;  2KDI A;  5AZF A;  2KXJ A;  2VRR B;  2M0X A;  3IBE A;  3VUY A;  1LXD A;  2GBM A;  3EHV A;  2O2V B;  3ZKJ C;  4HCN B;  4FAD A;  1OEY A;  2LRW A;  2V3S A;  1D3Z A;  2IO0 B;  2LXA A;  4PS3 A;  2M4N A;  4HPL B;  5DPR A;  1NDD A;  4I6P A;  2KJH B;  4M0W B;  1Q0W B;  2HE7 A;  4NJ7 A;  1KM7 A;  2N1V A;  4OVV A;  2WX1 A;  4LDT D;  1LM8 B;  2DEN B;  3DBS A;  4WWP A;  2CU1 A;  2LWP A;  4FA6 A;  3P2B A;  2Y5B B;  4ZRI A;  3WAO A;  3RT3 B;  3AI5 A;  3RYT A;  4BKS D;  2CHZ A;  4MEM A;  4DBG A;  2IO3 B;  3VFK A;  1WXM A;  2D3G A;  3IG3 A;  2KWV B;  4IM0 A;  3ZDM C;  2K1F A;  2B3A A;  3GOE A;  3T9L A;  2BGF A;  2MBB B;  4KIK A;  2PPH A;  1V86 A;  2D10 A;  3CMM B;  3L13 A;  2GBN A;  4E3C A;  1GUA B;  1ZW7 A;  3VDZ A;  4BOS C;  3QAQ A;  2YVC A;  3HK0 A;  5LLI A;  2IYD B;  4W9H A;  3WIM A;  2LVQ A;  1WI0 A;  3V6E B;  1LQB A;  2C7N B;  3M3J A;  3U8Z A;  2BKF A;  2MRP A;  2JPH A;  3AUL A;  3RCZ A;  2DZM A;  2IBI B;  3H1U A;  3R3M A;  3ALB A;  2KNB A;  3A9J B;  4OVU A;  3VH3 B;  3A4S C;  1ZKH A;  2G4S A;  4IM2 A;  2KX0 A;  4DXA B;  2NPT A;  2KTF A;  5G2N A;  1WMH B;  1J8C A;  2LAS A;  4ICU A;  3K9P B;  1NBF C;  5C23 A;  1GNU A;  3RZW C;  4NPN A;  5KHO A;  2C7M B;  3MHS D;  3W1Y A;  3W1S C;  3KYC D;  5HKH A;  2K39 A;  5JHA A;  1WXA A;  1H8C A;  4GDL A;  1P98 A;  4PS7 A;  4TQ0 A;  1V9J A;  2RPQ A;  3B1L X;  4TUU A;  2MWS B;  2MP2 A;  3KUZ A;  3ML8 A;  4G0N B;  5G55 A;  1A5R A;  2KWC A;  2L05 A;  3WAN A;  3QCA A;  1WJ6 A;  3QA8 A;  4MEL A;  4BVU C;  3IVF A;  2DYO A;  3SDL C;  3VQI A;  1IPG A;  4GOC A;  3GZN I;  4MH0 E;  3L17 A;  4NAW A;  4AP4 C;  3V62 A;  4WJP A;  3A4R A;  1C1Y B;  3NS8 A;  4JLC A;  4BBN F;  4GU2 A;  3DVG Y;  3A1Q B;  2N4F A;  4W9F A;  4HVB A;  2A5U A;  1YQB A;  4BKS A;  2KFJ A;  3AU5 A;  2KJR A;  4MSM B;  4XX5 A;  2KLC A;  1VCB A;  3KW5 B;  2BWF A;  2ZCB A;  3V6C B;  3N30 A;  1WYW B;  2K8H A;  3MTN B;  3EFU A;  3BIN A;  4KZC A;  4P7I A;  3NZS A;  4GDL B;  2CHW A;  4K7U A;  4EOY A;  1OQY A;  3A9K A;  2J0K A;  4GSW A;  1LFD A;  4PYZ A;  2N9E B;  2ZJD A;  3CSF A;  3VHT C;  1GC7 A;  1L7Y A;  2OJR A;  2XEW A;  2LD9 A;  4F8C B;  4MSQ B;  2L0T A; 
#chains in the Genus database with same CATH topology
 1YJJ A;  3UQB A;  4DHJ D;  1KLG D;  4WJN A;  1EWC A;  1C78 A;  3H7P B;  4GGQ A;  3IXS A;  1N62 A;  4LNK A;  5E6N A;  1AWD A;  2LJ5 A;  4II3 B;  3BY4 B;  2PKO A;  2RSU A;  2BVC A;  3JSV B;  2ZZP B;  3AEF B;  1WZ0 A;  1BML C;  3PHW B;  1OEY J;  4AJY B;  2FBW B;  4L1B A;  5JHB A;  2HTH A;  1V5O A;  2WYQ A;  3BK2 A;  3M62 B;  3ZW3 A;  1G6J A;  2KVR A;  1V49 A;  3N1Z C;  2XBB C;  1RRB A;  2LHE A;  3JVZ X;  2KK8 A;  2QCZ A;  1STE A;  4XC2 A;  4US9 A;  2PLP A;  3NVZ A;  2RMM A;  4IWQ A;  1OQQ A;  4AWJ A;  2ZPN A;  2N7D A;  2VH1 A;  3P4R B;  5IA7 A;  4WAA A;  4C00 A;  1WE7 A;  2KX3 A;  1RLF A;  3U7D A;  4DHZ E;  2R2O A;  1WX7 A;  1J7B A;  2IJ0 A;  2G9H D;  1HA5 A;  2MJD A;  1XEE A;  3B08 A;  2V4L A;  2ACZ B;  2DX5 B;  1F2R I;  4B9K A;  3IAM 1;  5TR5 A;  5HHD G;  1IUE A;  1PUT A;  4MDK E;  3EA6 A;  2KLG A;  4MM3 A;  4W9E A;  4AOF A;  1R4N B;  3AE5 B;  1KTK A;  2FUG 1;  2LGY A;  2IND C;  2DZK A;  3I9V 1;  4BFR A;  4IG7 B;  3TCA A;  4B6W A;  1C3T A;  1WRI A;  1E8Z A;  1F52 A;  4GIV A;  1XCT L;  2J0J A;  1E0Z A;  3LDZ E;  3AXC A;  2DBY A;  3TEX A;  3TSS A;  4OZA A;  1PFD A;  1T0Y A;  1KFY B;  2ZNV B;  3ZDT A;  1NYQ A;  2DAF A;  3V3X A;  4WUR A;  1MFW A;  3DBH I;  2M1M A;  2VZK D;  4MM3 B;  1UWX A;  5FR3 A;  1L0Y B;  4S17 A;  1WF9 A;  3IT4 B;  3Q8A A;  2CS4 A;  4WAF A;  1NI2 A;  3HVZ A;  4JIO U;  5FKA C;  3DVN U;  2NMQ A;  2LVO A;  2H88 B;  3HIZ A;  4ZRK A;  3AEC B;  1XCQ L;  1JWA D;  1MG8 A;  5J18 A;  1AYF A;  4F1S A;  1P7E A;  4FJZ A;  1N6Z A;  1PGA A;  3LXF A;  2FCN A;  1YX6 B;  1NYR A;  4ZRJ A;  2N9K A;  2PTL A;  4F7Z A;  2LRU A;  2LGD A;  1V80 A;  1D5Z C;  2G1E A;  2N1W A;  3AEG B;  3VTV A;  1I42 A;  2PJH A;  3OJ4 B;  3R2I A;  3ZJU A;  3AB5 A;  1ZXH A;  1GOZ A;  1MPE A;  5TSS A;  3NVW A;  4JGH B;  2C9W B;  2KHW B;  3KWV A;  4RF0 A;  2K22 A;  2WXR A;  2N0S B;  3RD2 A;  4GB9 A;  2WU2 B;  2OJW A;  1QZE A;  4S0R A;  2L76 A;  1R4M I;  2V3N A;  3X23 A;  1CMX B;  4E71 A;  1AW7 A;  2JUO A;  3OG5 A;  5BMH A;  1TBE A;  4HLE A;  2Z8L A;  4D2K A;  2NBU A;  3ZRC A;  2MX2 A;  5AEK B;  1WYG A;  2MCN B;  1SE4 A;  1D6E C;  4GMV A;  1K8R B;  1FO4 A;  1L4D B;  5CHV C;  3PRZ A;  2D11 A;  4XGA B;  1UGJ A;  3WAL A;  4YSZ B;  3MJW A;  1FNU A;  1SBB B;  4HPP A;  3ZIM A;  3BII D;  4EE2 A;  1XT9 B;  2XN9 C;  1V1P B;  2IZV B;  3AE6 B;  4C4V A;  2ZVO A;  4JQW C;  2LJI A;  3H7S A;  3B2G A;  1QOB A;  3SR6 A;  3CST A;  3ZNH B;  4URK A;  2JU6 X;  2JYE A;  1ISN A;  3LJ3 A;  1MJD A;  4C7Z A;  2Y5P A;  1KH0 A;  3TMP B;  5AUI A;  1AN8 A;  3R8B A;  2MBH A;  1FMA D;  2IPK D;  3ECI A;  1IYF A;  2DHZ A;  2I2Y A;  1E7V A;  3Q8C A;  3OWE B;  3Q3O C;  1SJH D;  1YIW A;  4HDQ A;  5LXI B;  1FPY A;  1QKZ A;  5JH5 C;  5D3D A;  2L3Z A;  3EEC A;  2GB1 A;  2KQS A;  4FJV B;  4YL8 A;  1P3Q U;  2QEJ C;  4DXG A;  4YTN B;  4IOI E;  3L16 A;  4M0W A;  1I4H A;  3ONS A;  4RMA A;  2RDH A;  4EZJ A;  4LNF A;  4W9C A;  4US8 A;  2VH2 A;  5E6O A;  1EF5 A;  2Z0E B;  3MC8 A;  2X38 A;  1HZ5 A;  3ZTC A;  3AU4 A;  1TGZ B;  2YLM A;  3PPA A;  2WXN A;  4P1C C;  2W55 A;  2JZP A;  3A33 B;  4UDU C;  3BK1 A;  4PYU A;  2W9N A;  3UQA A;  2GOW A;  1YN5 A;  2NR2 A;  2INC C;  4ZHO A;  2RD0 A;  1I4G A;  4K81 A;  4EKU A;  1ZE3 D;  1MI0 A;  3EHV A;  1FFV A;  4FAD A;  3N9Y C;  2KAC A;  2V3S A;  2IO0 B;  3NRZ A;  2JX5 A;  4M0W B;  1VJK A;  3AH7 A;  1RYJ A;  1V1O A;  4LDT D;  1BXT A;  2Y5B B;  1LGR A;  1FNW A;  3VR9 B;  2D3G A;  2K1F A;  2BGF A;  3AM9 A;  4B0M A;  2MBB B;  2PPH A;  1V86 A;  4E3C A;  3L13 A;  2GBN A;  3BWU D;  1GUA B;  3QAQ A;  3HK0 A;  1D5M C;  1L4Z B;  1WI0 A;  1LQB A;  3U8Z A;  3RCZ A;  2WXO A;  1L6U A;  1T3Q A;  2KNB A;  2UU7 A;  4IM2 A;  3KLS X;  2KX0 A;  1K50 A;  2LAS A;  5KHO A;  1V97 A;  4YXD B;  3B9J A;  2J42 A;  1QOA A;  2K39 A;  2KMM A;  3N20 C;  5JHA A;  3ZGZ A;  1H8C A;  4HJG E;  3GP7 A;  1MHH E;  1V9J A;  3P4Q B;  3B1L X;  2MWS B;  2MP2 A;  3ML8 A;  3HRD D;  1V8C A;  4A90 A;  2KWC A;  1YJI A;  3QCA A;  3Q6B A;  1TKY A;  3IVF A;  4RNA A;  3L17 A;  4WJP A;  1C1Y B;  3NS8 A;  4KGS A;  1PYW D;  2D5G A;  4W9F A;  2BW2 A;  4HEA 1;  2BWF A;  1WYW B;  1TY2 A;  4HKQ A;  1SB3 C;  2D3A A;  1T0R C;  4EOY A;  1IGC A;  1OQY A;  3A9K A;  1LFD A;  4ARI A;  2XEW A;  3R2T A;  2LD9 A;  4MSQ B;  2L0T A;  4OW0 A;  1WFY A;  2AYO B;  3AE2 B;  5G5H A;  2D2Q A;  4EZL A;  3VRB B;  2OHF A;  2XK5 A;  1WX8 A;  1WR6 E;  1DOY A;  1JML A;  4I6N B;  4RM9 A;  4BKT A;  5KHQ A;  5EE3 A;  2BKR B;  5H8Y E;  2LGI A;  4NAM A;  1T0S C;  1IBX A;  1UEL A;  2KAJ A;  1WGH A;  4IKG A;  1SE3 A;  2IDY A;  3VUW A;  1KRH A;  2DWQ A;  3ML9 A;  3A9K B;  2LUM A;  1R4N I;  4XYC A;  4PS8 A;  5IAA C;  5IN7 A;  3PSE B;  3CWI A;  3KVF B;  1ET9 A;  1L6V A;  3AEA B;  3L08 A;  2INN E;  1L0V B;  3RI7 C;  1ZP0 B;  1JRU A;  1YJ1 A;  1J19 A;  2WDQ B;  2IO1 B;  3U7Z A;  3ZNI D;  2NBV B;  4FHK A;  5AZG A;  2C5L C;  2GBR A;  3QWZ B;  3RUI B;  4ANV A;  2K8C A;  2PW9 A;  2QC8 A;  3PRM B;  3FC4 A;  3WAM A;  3PLU A;  1WWT A;  2D07 B;  4LNI A;  2WQY B;  4A9A A;  2R2Q A;  2ZNV C;  3UIP B;  3NY5 A;  2WXP A;  1FRR A;  4FN2 A;  4CHK A;  1C9F A;  1E8Y A;  2FE8 A;  4KIK B;  2LEK A;  2J0M A;  2L1A A;  1IGD A;  2AX5 A;  3PZD A;  2RGF A;  1YD8 U;  2V1Y A;  1FXT B;  1HXY D;  4M00 A;  3R66 C;  4FUL A;  1I4R A;  4E74 A;  5E6P A;  2O6V D;  1ZDX A;  3P1M A;  5D2M B;  4RM8 A;  1WJN A;  2KDE B;  4IUM B;  4DHJ B;  2NPT B;  2NCN A;  2IO2 B;  5HI1 A;  3RZF A;  1YMH E;  2EMT A;  3DBR I;  4RFB A;  4II2 B;  2KYW A;  3HVD A;  3R7Q A;  1I7H A;  2L52 A;  1N60 A;  3QQ8 B;  3Q3F A;  4HJK A;  5BYQ A;  3B0A A;  3X0W A;  1Y8R C;  4A6Q A;  1RAX A;  2KC2 A;  2JYT A;  4FJY A;  4JX1 C;  3GE8 C;  3MFG A;  3V61 A;  2N7J A;  2MJE A;  2JZZ A;  3NZU A;  2EKE C;  2WLB A;  4DDI D;  4XE0 A;  3U52 E;  1E7U A;  4AJW A;  4W9J A;  2DYM A;  1UUP A;  3Q2A C;  3OAW A;  5GMV A;  2WX0 A;  4X57 B;  4K7W A;  4KDI C;  1C79 A;  3CIR B;  4JL9 A;  3QJZ A;  1UGM A;  4TQ1 A;  3I63 C;  4ZHP A;  4GDK A;  4G50 A;  1RWS A;  1PGB A;  2NS5 A;  4KGR A;  3P4S B;  3DBL B;  1EU3 A;  2K25 A;  3KH0 A;  5DPW A;  3HM3 A;  4N58 A;  2WDV B;  2Z0D B;  2JXT A;  4LNO A;  5LNK 1;  1WMH A;  1ZUD 2;  3BYY B;  4P16 A;  3EUB 2;  3OJ3 A;  1XLP A;  2AL3 A;  2MHJ A;  3ZUN A;  1GC6 A;  3MP9 A;  4K7S A;  1RM6 C;  1ZGU B;  2I1J A;  4A3O A;  2BTE A;  3APF A;  1BUI C;  2Q5W D;  3NJT A;  4GDK B;  3N1X C;  2MBE A;  2L00 B;  1TKG A;  3U2S C;  1WM3 A;  1TTN A;  4WJQ A;  2LXC A;  1E90 A;  2M8S A;  3P42 A;  2FAZ A;  1MVK A;  4MT5 A;  1LO5 D;  4DDG D;  2J7Q B;  1OTR B;  4EUT A;  1GB4 A;  4GXB A;  2K9X A;  5EE0 A;  3S2A A;  2WDT B;  3A1Q A;  3N1Y C;  4LJO B;  2VZK B;  1Q1O A;  2D3C A;  3MC0 B;  1Z5S B;  2CR5 A;  2N9P C;  1YX5 B;  3WAP A;  4NQL B;  1WIA A;  2KDB A;  4TV3 A;  5L95 C;  1T5X D;  1QF6 A;  1C4C A;  3DHH C;  3TBL D;  1XQQ A;  2KMA A;  3V60 A;  3J9C A;  4YT0 B;  4EEW A;  2LGS A;  1DYQ A;  1KOT A;  1U4A A;  2V9H A;  4RGT A;  3D32 A;  4LCD E;  1SXT A;  3T8M A;  3QC8 B;  1EF1 A;  3QAR A;  2PVO D;  2KT7 A;  2ZVN A;  1XD3 B;  3AE1 B;  4NQK E;  4KKJ A;  2G3Q B;  3PO0 A;  5FR6 A;  4XDC A;  3TL5 A;  1K51 A;  4KV2 A;  1PDX A;  3DOW A;  3RNE C;  3ZJV A;  4DWF A;  1NI3 A;  1V2Y A;  3ZLZ A;  1UD7 A;  2MW5 A;  4IW0 A;  5D94 A;  1B9R A;  2LZ6 A;  2TSS A;  1P1A A;  4HWI B;  4WQM A;  4AS1 A;  2MSE D;  3H9D A;  4HCP B;  3MJ5 A;  2WS3 B;  4NNJ B;  3AV8 A;  2ICI A;  4XZ4 A;  3DBR B;  4WJO A;  1WRD B;  1VZ8 A;  1QIL A;  1UNS A;  1IP9 A;  1V5T A;  3PLV A;  5HG2 A;  2KDI A;  5AZF A;  2KXJ A;  3VUY A;  1LXD A;  1XF5 L;  2WGS A;  3ABV B;  1FCL A;  2LRW A;  1D3Z A;  4PS3 A;  2I38 A;  3PZ8 A;  4I6P A;  2KJH B;  3GE3 C;  1KM7 A;  4OHJ A;  4WWP A;  2W3S A;  2BS4 B;  4M01 A;  4ZRI A;  3AE9 B;  3RT3 B;  3AI5 A;  4BKS D;  4MEM A;  3RNC C;  3VFK A;  4IM0 A;  2B3A A;  3T9L A;  4N6E B;  2LFI A;  3RPF C;  1ZW7 A;  3TEZ A;  1T6B X;  5MPO A;  2NTS A;  3FAH A;  4W9H A;  2DLB A;  2LVQ A;  3V6E B;  4XDD A;  2BKF A;  3GB1 A;  2JPH A;  3ALB A;  2BB5 A;  1FCC C;  3A4S C;  2G4S A;  4DXA B;  2KTF A;  1J8C A;  1NBF C;  5C23 A;  3RZW C;  3W1Y A;  3MHS D;  1VDV A;  1WXQ A;  4JE3 B;  3W1S C;  5HKH A;  1GPX A;  4GDL A;  4RGO S;  2RPQ A;  2ONQ A;  4A55 A;  1HTQ A;  4ZYS A;  1NVI D;  3Q69 A;  4B0E A;  1FXA A;  2DYO A;  3VQI A;  5C2T B;  3V62 A;  3RMK C;  3A4R A;  3AE4 B;  5E6J A;  2SAK A;  3DVG Y;  3ZYY X;  2N4F A;  4PK1 A;  1YQB A;  2KFJ A;  4C4V B;  1E10 A;  3L4P A;  2K3U A;  2KJR A;  4XX5 A;  1VCB A;  2RPV A;  4HRO A;  2ZCB A;  2WXL A;  3EFU A;  2M19 A;  1SJE D;  2WXH A;  4XWW A;  4GDL B;  1C76 A;  4GSW A;  4PYZ A;  2N9E B;  2ZJD A;  3VHT C;  1OQR A;  1GC7 A;  4WWM A;  1UWM A;  5G5G A;  2CHX A;  1S1Q B;  2DZI A;  3CF6 E;  4MGY E;  1J0G A;  2REX A;  2FUH B;  3NVY A;  1EO6 A;  3IHP C;  4ASW C;  4LDT B;  3ZXR A;  5BYR A;  3GZN B;  3ZJT A;  3QK0 A;  1WM2 A;  2AWT A;  1QQR A;  2BWE S;  1HE8 A;  3DQV A;  2C60 A;  4N9F 4;  4ARC A;  1MHX A;  1F77 A;  2K6D B;  5H92 C;  2N7E A;  1N5X A;  3N3K B;  1UBI A;  2LUE A;  4YTP B;  1TJE A;  1CZP A;  1P9D U;  1JAL A;  1MG4 A;  3RUL A;  2KWD A;  3DWM A;  3ENE A;  2G45 B;  3AEB B;  1E8W A;  2WWZ A;  4KSK C;  3NG0 A;  2OED A;  3Q8F A;  2JSV X;  2JRI B;  3PV1 A;  4FBJ B;  2RDG A;  2G4D B;  3ETR A;  1UH6 A;  1M4V A;  1XLQ A;  3VR8 B;  1Z2M A;  2IY1 B;  3W1S A;  1VRA B;  1A70 A;  1RFA A;  3QIJ A;  1WGD A;  2BYV E;  2E6X A;  1TKE A;  2HD5 B;  2J4X A;  3BYT B;  2NVU I;  1E8X A;  1WJU A;  5L83 A;  3AED B;  4ZRQ A;  2JRH A;  2NTT A;  4P6V F;  1N5W A;  3PRP B;  5GXG B;  3APC A;  3T3O A;  2K5P A;  2BYT A;  1TZO A;  3BVG A;  3WA0 A;  3NOB A;  1JWB D;  2LVP A;  2KMC A;  1FFU A;  4M8M A;  3ZNZ B;  3RN9 C;  1JW9 D;  2FCM A;  4DXF A;  2N9L A;  1X1M A;  3RNB C;  3HM6 X;  3SD5 A;  3IAS 1;  4RGN A;  1ZPS A;  3URY A;  4CYE A;  1P0R A;  1Y56 A;  1EM7 A;  3C8Y A;  2KD0 A;  3DBL I;  2PE6 B;  2KZR A;  2JXX A;  3HUI A;  3L0W B;  2ZPY A;  3VH4 B;  2MP2 B;  2L83 A;  2RR9 A;  3GS2 A;  5D7G A;  4A20 A;  1N61 A;  1QOG A;  1WJ4 A;  3VXW A;  2ON8 A;  3QHT A;  3ZNG C;  2L7R A;  4JWU C;  3Q8B A;  1KF6 B;  5BMG A;  3N32 A;  4DQO C;  1FNV A;  4NY0 A;  2SEB D;  1L2N A;  4IDI A;  4W9L A;  3JYU A;  4WWN A;  3E9S A;  4G11 A;  4W9G A;  1S3S G;  2BQQ A;  1QT9 A;  2KQ7 A;  1QOF A;  2NBW B;  4KVG B;  4RCO A;  4ACF A;  1I4X A;  3AMZ A;  3ZO5 B;  2O6V A;  1SIJ A;  4K3C A;  3FIL A;  2H89 B;  3K9O B;  4WQO B;  4ZRP A;  3BVM A;  2XK5 B;  3UF8 A;  4RH6 A;  3A9J A;  4A3P A;  1PQS A;  1ENF A;  1SE9 A;  1DGJ A;  3M95 A;  2C7H A;  1CJE A;  2OOB B;  4K3B A;  1WGK A;  1E7P B;  4CO7 A;  2L0F A;  5DCN A;  3Q3M C;  4B95 A;  1IBX B;  1KLV A;  3M63 B;  1VR9 A;  2KC1 A;  3Q14 C;  5D6J B;  2KOX A;  2KO3 A;  4LK0 M;  4YTM B;  3O65 B;  2ASQ A;  3PGE A;  2O6V B;  1V6E A;  3FIL B;  3SFD B;  2AL6 A;  4ZYN A;  1GG3 A;  4TMA B;  3DPD A;  3EFC A;  2KKC A;  5BMI A;  2DZJ A;  3HHM A;  5J17 A;  1CQV A;  5CHW A;  1OGW A;  2E3T A;  5CHF A;  5DPT A;  3Q3J A;  1E9M A;  2BS2 B;  1WGY A;  4O1N A;  2EEL A;  2CJN A;  3JW0 X;  1TYG B;  2BBC A;  5BO4 B;  1E6E B;  4WH4 A;  2FIF A;  2BF8 B;  3U30 A;  4W9K A;  3UIN B;  3VUX A;  3H7P A;  1HEZ E;  1K52 A;  3MHZ A;  2IGG A;  3BVZ A;  1NEK B;  2AQ3 B;  2HJ8 A;  2EMS A;  2FID A;  3JSV A;  2O2V A;  4HDO A;  4ITK A;  1ACC A;  1CK1 A;  1JRP A;  2FCS A;  2M56 B;  4R3D A;  2ZW1 A;  5JZE B;  1WE6 A;  4A8X C;  4N59 A;  4JPS A;  4C80 A;  4M02 A;  2FNJ B;  4YWG G;  3I57 A;  1EUV B;  2KJ6 A;  1M94 A;  2GMI C;  3SU8 X;  2KAN A;  1F0Z A;  3DVN V;  2FCQ A;  2DNF A;  4BBN C;  3SFE B;  4IWP A;  5JXV A;  1WGR A;  3AE3 B;  2BYF A;  2WP9 B;  3FKY A;  2Z59 B;  4GN1 A;  2M0A A;  1XO3 A;  2M0X A;  3IBE A;  2LHD A;  2O2V B;  4RGM A;  4HKZ E;  2M4N A;  4HPL B;  2PVG C;  5DPR A;  1NDD A;  4L23 A;  1ET6 A;  1D5X C;  4OVV A;  2WX1 A;  2DEN B;  3DBS A;  2CU1 A;  4FA6 A;  3WAO A;  3E56 A;  1I4P A;  3RYT A;  3LB8 C;  4DBG A;  1ROE A;  2KWV B;  3BZD B;  2BB6 A;  3LYY A;  1TS4 A;  2D10 A;  2J52 A;  3VDZ A;  4BOS C;  1JQ4 A;  4AQ7 A;  2V0G A;  2D3B A;  3WIM A;  1B1Z A;  3VRA B;  2C7N B;  2MRP A;  5T8I A;  1JWM D;  1FD6 A;  1WMH B;  2MEK A;  3K9P B;  2C7M B;  5EE1 A;  3ZXV A;  1VZ7 A;  1VZ6 A;  3T3N A;  3TEY A;  1WXA A;  2WHI A;  4PS7 A;  4TQ0 A;  1A5R A;  2L05 A;  3QA8 A;  4MEL A;  2L32 A;  3SDL C;  3WCQ A;  1IPG A;  3GZN I;  4MH0 E;  1UF0 A;  4NAW A;  1F2R C;  2HJ1 A;  4JLC A;  4OZB A;  4GU2 A;  3A1Q B;  2HTM E;  2A5U A;  3O13 A;  4BKS A;  2HDE A;  2KLC A;  2YEP B;  3N30 A;  2K8H A;  3MTN B;  3BIN A;  4OZC A;  4P7I A;  3Q8E A;  1SSN A;  3RNF C;  2JQR B;  3KQ4 A;  2OJR A;  1L7Y A;  1H4R A;  4F8C B;  4ZOH C;  1TT5 B;  4HPM B;  4MJS A;  1PGX A;  3KUD B;  2B76 B;  3PT2 B;  2BS3 B;  2ZCC A;  4NAW B;  1QLB B;  3ZTD A;  4KZ0 A;  2Y5C A;  1FRD A;  4AUQ C;  1V81 A;  1J7A A;  1FEH A;  4M8N A;  2AQ2 B;  3AE7 B;  1WR1 A;  4HK2 A;  1YN4 A;  4FHJ A;  2PE9 A;  4MGZ E;  2WU5 B;  2UWQ A;  4ANU A;  3NHE B;  4MGK E;  4TSS A;  3I5J C;  1YQ4 B;  5AZH A;  4P1B C;  4MJS B;  3L54 A;  4EZK A;  1T0Q C;  2CKH B;  4BKG A;  5HFY A;  1XLO A;  4QAY A;  3TIX A;  4WWO A;  3H6N A;  4L2Y A;  4LNN A;  4NJ6 A;  4I6L B;  4MGI E;  2MBO A;  1V1P A;  2QMT A;  3V05 A;  4ANW A;  4W9I A;  3DHG C;  2A4Z A;  2KVZ A;  2WXK A;  3VAW A;  3ZRF A;  3VTU A;  3PZ7 A;  3AN1 A;  2WXI A;  2XNA C;  4J3O D;  5IOI A;  2I1K A;  1GAQ B;  1N63 A;  3PHX B;  2ZEQ A;  4HRS A;  2GBK A;  4CQN A;  2K8B A;  3ZVV A;  1TZ1 A;  4J6I A;  1K53 A;  4BOZ B;  5FK9 C;  2JT4 B;  3DHI C;  2V3P A;  3PVL A;  4IM3 A;  2WXM A;  2UYZ B;  5DPS A;  2IY0 B;  4TKN A;  1F9J A;  4LJP B;  1TS5 A;  3AE8 B;  3NVV A;  4Q2J A;  4K1R B;  4DK5 A;  1AAR A;  1XXG A;  3W9C B;  3UGB B;  4ICV A;  2W3R A;  5I4D A;  4C56 C;  3ZQ4 A;  4KKI A;  3SEB A;  4JWS C;  2MQJ A;  2BT6 A;  2KFK A;  4KDL B;  2RDB C;  1XLN A;  1SIF A;  4WIP A;  3L10 B;  1E5W A;  3RFZ B;  3U4E G;  3TEW A;  1UBQ A;  2GI9 A;  1I4Q A;  2JY6 A;  1SGH A;  2WXQ A;  1WH3 A;  2QIE B;  1JWU D;  1YOV B;  2KTR A;  3IFW B;  2QHO A;  3OLM D;  1TIF A;  3PTF C;  4DHZ B;  1YNT E;  4IWO A;  3NUH B;  5BYS A;  1SE2 A;  2MA9 B;  1C4A A;  1WGG A;  2KFK B;  5EDS A;  3DBH B;  2BYE A;  1KLU D;  3PS6 A;  3DDC B;  2J53 A;  2IGH A;  2PIA A;  4W9D A;  1WXV A;  1KJT A;  1SEB D;  2BPS A;  2W82 A;  2KTR B;  2DAJ A;  2WNM A;  2QSD A;  5EE9 A;  2PEA A;  1GB1 A;  3KWL A;  3VTW A;  5CX3 A;  4IC7 B;  1DOX A;  1WXS A;  5CTR C;  2JZ3 B;  1EU4 A;  1ZOY B;  5D3I B;  3C0R B;  1ESF A;  2JWZ A;  2KWU B;  5LXH A;  2KN5 A;  1HQR D;  1YN3 A;  5C1Z A;  2GBJ A;  1GJZ A;  2LMC A;  2JWU A;  2GRI A;  2KDF B;  4NZL B;  3I3T B;  4FLH A;  2CJO A;  1VD2 A;  1TY0 A;  5AUK A;  4HXD A;  1R4M B;  5J2R A;  1WZ3 A;  2AEH A;  2JF5 A;  4ZDV A;  1JCK B;  1C77 A;  3W5V B;  4XWT A;  2N9X A;  3VVW B;  3TUO A;  1DOI A;  1OFF A;  1UZX B;  1WY8 A;  1TS2 A;  3W2D A;  2LGX A;  1J7C A;  1WX9 A;  2K6Q A;  2LI5 A;  4GLS C;  4ANX A;  2X8X X;  3DVG X;  1FIQ A;  3KUC B;  3UIO B;  3AEE B;  4C7Y A;  1Q5W B;  4KX6 B;  4YSY B;  1Q10 A;  4MH8 A;  2R61 A;  1BT0 A;  5C3J B;  2WXG A;  2M17 A;  3SHQ A;  4H2A A;  2L8J A;  3APD A;  1NEN B;  3KYD D;  3P63 A;  2QJL A;  1EWY C;  3C19 A;  4KSL C;  4EFO A;  3R7R A;  3RNA C;  3RNG C;  2MBQ A;  1R7S A;  3DCG A;  4REZ A;  2KQ4 X;  3IT6 B;  1P7F A;  2Y3A A;  3Q3N C;  3PRE A;  3NS1 A;  2DYB A;  4MAC A;  1I35 A;  1JWS D;  4NJC A;  4G3X B;  2MLB A;  3EC8 A;  3TJP A;  1HZ6 A;  2JVC A;  3QX1 A;  2VRR B;  1RFK A;  2GBM A;  1F1H A;  3ZKJ C;  4HCN B;  1OEY A;  2LXA A;  5IO9 A;  3H8H A;  2KN4 A;  1JRO A;  1Q0W B;  3UI3 A;  2HE7 A;  4NJ7 A;  1SF0 A;  2N1V A;  3DWG C;  1LM8 B;  2LWP A;  3P2B A;  4USA A;  2WXJ A;  4BAX A;  2GLS A;  1TS3 A;  2CHZ A;  4LTU A;  2IO3 B;  1WXM A;  3IG3 A;  2YEP F;  3ZDM C;  2V4I B;  3GOE A;  2MH7 A;  1C4P A;  4KIK A;  3CMM B;  4FXC A;  2YVC A;  4KGT A;  1FM0 D;  1ZXI A;  5LLI A;  2IYD B;  3W5U B;  4LLG M;  3M3J A;  3AUL A;  2DZM A;  2IBI B;  3H1U A;  3R3M A;  4RF1 A;  3A9J B;  4BZA A;  4OVU A;  3VH3 B;  1ZKH A;  2AQ1 B;  2NPT A;  1WSP A;  2IGD A;  2MJ3 A;  2WDR B;  5G2N A;  4ICU A;  1GNU A;  2WXF A;  3MC9 A;  4NPN A;  2QIL A;  3KYC D;  1L5P A;  1FXI A;  3NZ3 A;  2W54 A;  1P98 A;  2QDF A;  3P4P B;  1D4B A;  1L0X B;  4TUU A;  3KUZ A;  4G0N B;  5G55 A;  4YSX B;  3WAN A;  2KDM A;  1WJ6 A;  4OVZ A;  4BVU C;  2EKI A;  4GOC A;  2CU3 A;  1ZDV A;  2ZW0 A;  4AP4 C;  2PMV A;  1YQ3 B;  4BBN F;  2INP E;  4HVB A;  3AU5 A;  4MSM B;  3KW5 B;  3V6C B;  5IKC M;  2K0P A;  4KZC A;  1VLB A;  3NZS A;  2CHW A;  3B2F A;  4K7U A;  2J0K A;  1HTO A;  4PT5 A;  3CSF A;  5IP4 D;  3EGR A; 
#chains in the Genus database with same CATH homology
 3UQB A;  4HPM B;  4MJS A;  2CHX A;  3KUD B;  4DHJ D;  1S1Q B;  1WFY A;  2AYO B;  4WJN A;  2D2Q A;  3PT2 B;  4EZL A;  2DZI A;  2ZCC A;  3H7P B;  4NAW B;  3CF6 E;  2XK5 A;  4GGQ A;  3ZTD A;  4KZ0 A;  4MGY E;  1WX8 A;  1WR6 E;  1J0G A;  2REX A;  4I6N B;  2FUH B;  4RM9 A;  4BKT A;  1EO6 A;  4AUQ C;  3IHP C;  5E6N A;  5KHQ A;  4ASW C;  4LDT B;  2LJ5 A;  2BKR B;  4II3 B;  1V81 A;  3BY4 B;  2RSU A;  4M8N A;  3QK0 A;  1WM2 A;  2AWT A;  3JSV B;  2ZZP B;  2BWE S;  1WR1 A;  1UEL A;  1HE8 A;  3DQV A;  1WZ0 A;  2C60 A;  3PHW B;  4N9F 4;  1OEY J;  1WGH A;  4HK2 A;  4AJY B;  3VUW A;  4FHJ A;  3ML9 A;  2PE9 A;  5JHB A;  3A9K B;  4MGZ E;  2HTH A;  2UWQ A;  4ANU A;  2K6D B;  1V5O A;  3NHE B;  2WYQ A;  4MGK E;  1R4N I;  3M62 B;  5AZH A;  4PS8 A;  3ZW3 A;  4MJS B;  3L54 A;  5IAA C;  2N7E A;  2CKH B;  2KVR A;  1V49 A;  4BKG A;  4EZK A;  1G6J A;  2XBB C;  3TIX A;  1RRB A;  3PSE B;  3JVZ X;  4WWO A;  2KK8 A;  3N3K B;  1UBI A;  2LUE A;  3KVF B;  3L08 A;  4XC2 A;  3H6N A;  4IWQ A;  1P9D U;  1JRU A;  4NJ6 A;  4I6L B;  4MGI E;  3RUL A;  3ENE A;  4AWJ A;  2ZPN A;  1YJ1 A;  2MBO A;  2G45 B;  2N7D A;  1E8W A;  1J19 A;  2WWZ A;  2IO1 B;  4KSK C;  3ZNI D;  4W9I A;  2NBV B;  4ANW A;  5IA7 A;  4FHK A;  4WAA A;  5AZG A;  1WE7 A;  2JRI B;  1RLF A;  2KX3 A;  3U7D A;  4DHZ E;  2R2O A;  2A4Z A;  2C5L C;  3PV1 A;  1WX7 A;  2GBR A;  3QWZ B;  4FBJ B;  2G4D B;  1UH6 A;  3RUI B;  3VAW A;  4ANV A;  1Z2M A;  2IY1 B;  3W1S A;  3ZRF A;  2K8C A;  3VTU A;  3PRM B;  3B08 A;  3WAM A;  2V4L A;  1RFA A;  2I1K A;  3PLU A;  3QIJ A;  2D07 B;  1WGD A;  2DX5 B;  2BYV E;  4B9K A;  2HD5 B;  2NVU I;  3PHX B;  2R2Q A;  2ZEQ A;  2GBK A;  1E8X A;  1WJU A;  2ZNV C;  5TR5 A;  3UIP B;  5L83 A;  3NY5 A;  2JRH A;  4MDK E;  2K8B A;  3ZVV A;  1TZ1 A;  2KLG A;  4FN2 A;  4MM3 A;  4W9E A;  3PRP B;  4CHK A;  4AOF A;  1E8Y A;  3APC A;  4J6I A;  4KIK B;  4BOZ B;  2LGY A;  2J0M A;  3WA0 A;  3NOB A;  2DZK A;  4BFR A;  2LVP A;  2JT4 B;  2KMC A;  4IG7 B;  3TCA A;  3PZD A;  4M8M A;  3ZNZ B;  2RGF A;  3PVL A;  4B6W A;  1YD8 U;  4IM3 A;  2V1Y A;  1C3T A;  2FCM A;  1E8Z A;  1X1M A;  1FXT B;  4GIV A;  3R66 C;  4FUL A;  3SD5 A;  2J0J A;  3HM6 X;  3LDZ E;  5E6P A;  4E74 A;  2O6V D;  2UYZ B;  3AXC A;  5DPS A;  5D2M B;  4RM8 A;  1WJN A;  2IY0 B;  2KDE B;  4TKN A;  4IUM B;  4DHJ B;  2NPT B;  2NCN A;  1F9J A;  4LJP B;  2IO2 B;  4CYE A;  1T0Y A;  1P0R A;  3RZF A;  2ZNV B;  3ZDT A;  2EMT A;  4K1R B;  3DBR I;  4II2 B;  3R7Q A;  4DK5 A;  2DAF A;  1AAR A;  2KD0 A;  3DBL I;  2PE6 B;  3QQ8 B;  3DBH I;  2M1M A;  2KZR A;  3Q3F A;  4HJK A;  3B0A A;  3UGB B;  2JXX A;  4ICV A;  3L0W B;  2ZPY A;  3X0W A;  3VH4 B;  1Y8R C;  2MP2 B;  1RAX A;  2KC2 A;  2MQJ A;  4FJY A;  1WF9 A;  2RR9 A;  5D7G A;  2CS4 A;  2KFK A;  4A20 A;  3V61 A;  1WJ4 A;  4KDL B;  2JZZ A;  1NI2 A;  3VXW A;  1SIF A;  3NZU A;  3QHT A;  3ZNG C;  2L7R A;  3L10 B;  2EKE C;  1E5W A;  4DDI D;  4JIO U;  3DVN U;  3N32 A;  1UBQ A;  2LVO A;  1E7U A;  5GMV A;  4AJW A;  2JY6 A;  1SGH A;  2DYM A;  3HIZ A;  4W9J A;  4ZRK A;  4NY0 A;  1WH3 A;  3OAW A;  2KTR A;  2WX0 A;  1MG8 A;  3IFW B;  4K7W A;  4W9L A;  2QHO A;  3OLM D;  4X57 B;  5J18 A;  3JYU A;  4KDI C;  4F1S A;  4WWN A;  4G11 A;  4FJZ A;  4W9G A;  4JL9 A;  3PTF C;  1S3S G;  3QJZ A;  4DHZ B;  2KQ7 A;  2FCN A;  1UGM A;  1YX6 B;  2NBW B;  4TQ1 A;  4GDK A;  4ZRJ A;  4G50 A;  4F7Z A;  2LRU A;  4IWO A;  2LGD A;  1V80 A;  4KVG B;  2N1W A;  2NS5 A;  3VTV A;  1I42 A;  2PJH A;  2MA9 B;  1WGG A;  3OJ4 B;  2KFK B;  5EDS A;  2BYE A;  3ZO5 B;  3PS6 A;  3DDC B;  2O6V A;  2K25 A;  3K9O B;  3KH0 A;  4WQO B;  5DPW A;  4JGH B;  2C9W B;  2KHW B;  2XK5 B;  3UF8 A;  4W9D A;  3HM3 A;  3A9J A;  3RD2 A;  4A3P A;  1WXV A;  1KJT A;  1PQS A;  4GB9 A;  1SE9 A;  2Z0D B;  1QZE A;  3M95 A;  2C7H A;  1WMH A;  2OOB B;  2BPS A;  2L76 A;  1R4M I;  3OJ3 A;  3X23 A;  2KTR B;  2DAJ A;  2AL3 A;  3ZUN A;  1GC6 A;  1CMX B;  4CO7 A;  2L0F A;  4K7S A;  5DCN A;  2PEA A;  4B95 A;  4E71 A;  1ZGU B;  2I1J A;  1KLV A;  2JUO A;  4A3O A;  3M63 B;  1TBE A;  3APF A;  3VTW A;  4HLE A;  5CX3 A;  4IC7 B;  4GDK B;  2KC1 A;  2NBU A;  2MBE A;  5D6J B;  3ZRC A;  2L00 B;  2MX2 A;  1WXS A;  1WM3 A;  1TTN A;  2KOX A;  4WJQ A;  5CTR C;  2MCN B;  2JZ3 B;  5AEK B;  2KO3 A;  1K8R B;  2LXC A;  4GMV A;  1E90 A;  2M8S A;  3C0R B;  5CHV C;  2FAZ A;  1L2N A;  3O65 B;  2ASQ A;  3PGE A;  2O6V B;  1V6E A;  2D11 A;  3PRZ A;  2JWZ A;  2AL6 A;  4ZYN A;  1GG3 A;  2KWU B;  3WAL A;  5LXH A;  3DPD A;  2KKC A;  2KN5 A;  2DZJ A;  3HHM A;  2J7Q B;  3MJW A;  1OTR B;  4DDG D;  4EUT A;  5J17 A;  4GXB A;  5C1Z A;  3ZIM A;  2GBJ A;  2WDT B;  1XT9 B;  3A1Q A;  3S2A A;  1GJZ A;  2IZV B;  2ZVO A;  2KDF B;  4JQW C;  3I3T B;  4LJO B;  3H7S A;  4FLH A;  1Q1O A;  5CHW A;  3CST A;  3ZNH B;  4URK A;  1VD2 A;  1Z5S B;  2CR5 A;  2N9P C;  1OGW A;  1YX5 B;  5CHF A;  3WAP A;  5DPT A;  1H4R A;  3Q3J A;  4HXD A;  4NQL B;  1WGY A;  1WIA A;  1ISN A;  3LJ3 A;  1WZ3 A;  2AEH A;  2JF5 A;  2KDB A;  4TV3 A;  4ZDV A;  5L95 C;  5J2R A;  3TMP B;  3JW0 X;  5BO4 B;  2FIF A;  2BF8 B;  2MBH A;  3U30 A;  2N9X A;  4W9K A;  3VVW B;  1UZX B;  3ECI A;  1WY8 A;  3UIN B;  1IYF A;  2LGX A;  3VUX A;  2DHZ A;  3TBL D;  3H7P A;  1WX9 A;  1XQQ A;  2K6Q A;  2KMA A;  1E7V A;  2LI5 A;  3V60 A;  4ANX A;  3DVG X;  4EEW A;  3KUC B;  1YIW A;  4HDQ A;  5LXI B;  3UIO B;  1KOT A;  1U4A A;  3D32 A;  4LCD E;  5JH5 C;  1Q5W B;  3T8M A;  3QC8 B;  2HJ8 A;  1EF1 A;  2L3Z A;  3EEC A;  3QAR A;  2KQS A;  1BT0 A;  2ZVN A;  2EMS A;  2FID A;  4FJV B;  2M17 A;  3JSV A;  3SHQ A;  1XD3 B;  4NQK E;  2O2V A;  2G3Q B;  2L8J A;  5FR6 A;  3APD A;  4HDO A;  4YL8 A;  3TL5 A;  2FCS A;  3KYD D;  1P3Q U;  5JZE B;  3L16 A;  4KSL C;  4EFO A;  4KV2 A;  3DOW A;  3ONS A;  4RMA A;  1WE6 A;  4EZJ A;  4W9C A;  4DWF A;  1V2Y A;  3ZLZ A;  1UD7 A;  5E6O A;  1EF5 A;  2MW5 A;  2Z0E B;  4IW0 A;  2FNJ B;  5D94 A;  3ZTC A;  2LZ6 A;  3AU4 A;  3R7R A;  1EUV B;  1P1A A;  2KJ6 A;  1TGZ B;  2MBQ A;  1M94 A;  2YLM A;  4HWI B;  2MSE D;  2GMI C;  3PPA A;  3SU8 X;  3H9D A;  3A33 B;  4HCP B;  3DCG A;  2KAN A;  4PYU A;  4NNJ B;  2W9N A;  3UQA A;  3DVN V;  2FCQ A;  4XZ4 A;  4BBN C;  3PRE A;  1I35 A;  2DYB A;  4IWP A;  4WJO A;  1WRD B;  2GOW A;  1WGR A;  1IP9 A;  1V5T A;  4G3X B;  2BYF A;  2NR2 A;  2MLB A;  3EC8 A;  3PLV A;  2Z59 B;  4GN1 A;  3TJP A;  2RD0 A;  2JVC A;  3QX1 A;  4K81 A;  4EKU A;  2KDI A;  5AZF A;  2KXJ A;  2VRR B;  2M0X A;  3IBE A;  3VUY A;  1LXD A;  2GBM A;  3EHV A;  2O2V B;  3ZKJ C;  4HCN B;  4FAD A;  1OEY A;  2LRW A;  2V3S A;  1D3Z A;  2IO0 B;  2LXA A;  4PS3 A;  2M4N A;  4HPL B;  5DPR A;  1NDD A;  4I6P A;  2KJH B;  4M0W B;  1Q0W B;  2HE7 A;  4NJ7 A;  1KM7 A;  2N1V A;  4OVV A;  2WX1 A;  4LDT D;  1LM8 B;  2DEN B;  3DBS A;  4WWP A;  2CU1 A;  2LWP A;  4FA6 A;  3P2B A;  2Y5B B;  4ZRI A;  3WAO A;  3RT3 B;  3AI5 A;  3RYT A;  4BKS D;  2CHZ A;  4MEM A;  4DBG A;  2IO3 B;  3VFK A;  1WXM A;  2D3G A;  3IG3 A;  2KWV B;  4IM0 A;  3ZDM C;  2K1F A;  2B3A A;  3GOE A;  3T9L A;  2BGF A;  2MBB B;  4KIK A;  2PPH A;  1V86 A;  2D10 A;  3CMM B;  3L13 A;  2GBN A;  4E3C A;  1GUA B;  1ZW7 A;  3VDZ A;  4BOS C;  3QAQ A;  2YVC A;  3HK0 A;  5LLI A;  2IYD B;  4W9H A;  3WIM A;  2LVQ A;  1WI0 A;  3V6E B;  1LQB A;  2C7N B;  3M3J A;  3U8Z A;  2BKF A;  2MRP A;  2JPH A;  3AUL A;  3RCZ A;  2DZM A;  2IBI B;  3H1U A;  3R3M A;  3ALB A;  2KNB A;  3A9J B;  4OVU A;  3VH3 B;  3A4S C;  1ZKH A;  2G4S A;  4IM2 A;  2KX0 A;  4DXA B;  2NPT A;  2KTF A;  5G2N A;  1WMH B;  1J8C A;  2LAS A;  4ICU A;  3K9P B;  1NBF C;  5C23 A;  1GNU A;  3RZW C;  4NPN A;  5KHO A;  2C7M B;  3MHS D;  3W1Y A;  3W1S C;  3KYC D;  5HKH A;  2K39 A;  5JHA A;  1WXA A;  1H8C A;  4GDL A;  1P98 A;  4PS7 A;  4TQ0 A;  1V9J A;  2RPQ A;  3B1L X;  4TUU A;  2MWS B;  2MP2 A;  3KUZ A;  3ML8 A;  4G0N B;  5G55 A;  1A5R A;  2KWC A;  2L05 A;  3WAN A;  3QCA A;  1WJ6 A;  3QA8 A;  4MEL A;  4BVU C;  3IVF A;  2DYO A;  3SDL C;  3VQI A;  1IPG A;  4GOC A;  3GZN I;  4MH0 E;  3L17 A;  4NAW A;  4AP4 C;  3V62 A;  4WJP A;  3A4R A;  1C1Y B;  3NS8 A;  4JLC A;  4BBN F;  4GU2 A;  3DVG Y;  3A1Q B;  2N4F A;  4W9F A;  4HVB A;  2A5U A;  1YQB A;  4BKS A;  2KFJ A;  3AU5 A;  2KJR A;  4MSM B;  4XX5 A;  2KLC A;  1VCB A;  3KW5 B;  2BWF A;  2ZCB A;  3V6C B;  3N30 A;  1WYW B;  2K8H A;  3MTN B;  3EFU A;  3BIN A;  4KZC A;  4P7I A;  3NZS A;  4GDL B;  2CHW A;  4K7U A;  4EOY A;  1OQY A;  3A9K A;  2J0K A;  4GSW A;  1LFD A;  4PYZ A;  2N9E B;  2ZJD A;  3CSF A;  3VHT C;  1GC7 A;  1L7Y A;  2OJR A;  2XEW A;  2LD9 A;  4F8C B;  4MSQ B;  2L0T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...