2G4DB

Crystal structure of human senp1 mutant (c603s) in complex with sumo-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/protein binding
molecule keywords SENP1 protein
publication title Crystal structure of the SENP1 mutant C603S-SUMO complex reveals the hydrolytic mechanism of SUMO-specific protease
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4dB00
3KH0A 2O2VB 1KLVA 2NCNA 2C9WB 4URKA 4IWQA 3VVWB 4JQWC 4HLEA 4NAWB 4RM8A 3C0RB 4EKUA 2BWES 1UZXB 2LASA 4GN1A 2ZJDA 3L54A 3VUWA 2MWSB 1WJ6A 1E7VA 4FHKA 4HPMB 1WE6A 1YJ1A 1Q5WB 2KN5A 2N1VA 3B1LX 2DHZA 2IZVB 2PJHA 4MSQB 4FULA 4A20A 5JZEB 1WXAA 1KJTA 4GDKA 5BO4B 2G4DB 3DVGX 3RULA 3PT2B 3MJWA 1XT9B 1V6EA 2JXXA 1GJZA 1V86A 3V61A 3CSFA 4YL8A 4HDOA 2DZKA 1A5RA 1WXVA 2D3GA 2FUHB 4EZLA 2LGYA 4IWOA 3U30A 4GMVA 3ZNHB 3PREA 2AL3A 2B3AA 2RGFA 3KVFB 3AU5A 3QCAA 5LXHA 2HE7A 2L7RA 2IBIB 2NPTB 1WY8A 1RLFA 2MBOA 4OVVA 2C60A 4ICUA 1WXMA 2ZVOA 2KJHB 4FADA 5KHOA 2KOXA 4TV3A 4XC2A 1P1AA 2O6VA 3PRMB 3QARA 4DHJD 2CHZA 2IO2B 2KJRA 3EECA 2IO1B 4W9GA 3ZDTA 1ZW7A 1EF5A 2GBKA 3ECIA 2DZJA 1I35A 1LFDA 2KDEB 1E8ZA 3SHQA 3MHSD 4TKNA 2O2VA 3VUXA 1I42A 1WJNA 3HK0A 2HJ8A 4NAWA 2ZZPB 2ZNVB 4E3CA 3W1SC 3DVNV 1KM7A 4ANWA 4PYUA 2RR9A 3ALBA 2KQSA 3M63B 4ANXA 4CO7A 2KDIA 2QHOA 4LDTD 4P7IA 5LXIB 4XX5A 2GBRA 1YD8U 3SD5A 2DAJA 3BINA 4MJSB 1WGYA 4BOZB 5DPWA 2KWUB 4MSMB 4BVUC 4MDKE 3U7DA 2D07B 2A4ZA 2KX3A 5EDSA 2MBEA 3O65B 2D11A 2R2QA 3DQVA 1OTRB 3VAWA 4FBJB 4B95A 2MW5A 4MGZE 3ZUNA 3UGBB 5C1ZA 2R2OA 3WIMA 3H6NA 3VQIA 5AZFA 4IC7B 2MCNB 1QZEA 2G45B 2IY0B 3WAMA 5GMVA 3VTUA 2KDBA 3JW0X 4IM3A 1IYFA 1PQSA 1E7UA 2KMAA 2LGDA 2NPTA 4FJYA 1WYWB 4DK5A 4RM9A 1WH3A 2Y5BB 2L0TA 3GZNI 2BKFA 1EF1A 1V80A 3ENEA 3TMPB 3PS6A 3A33B 2C7HA 2K8HA 2KFJA 4AWJA 3V6CB 1UGMA 4ZDVA 4ASWC 2PE9A 2REXA 5FR6A 5CHWA 1OGWA 3L08A 3PGEA 4WQOB 2KXJA 3DDCB 3QC8B 4G3XB 2G4SA 3V60A 2KVRA 2KQ7A 4MGYE 3ZIMA 4AJWA 1E5WA 2KNBA 2ZPYA 1F9JA 4MJSA 3N3KB 1K8RB 4W9HA 4W9EA 3IFWB 4F7ZA 1P3QU 1TBEA 2MP2B 5J18A 4IM2A 2YVCA 4DHJB 5AZGA 1E90A 2C7MB 4PS3A 1E8XA 5G55A 2J0KA 4GB9A 3TJPA 1GC7A 2LVPA 3K9PB 2MBBB 3M62B 4GXBA 3WA0A 5AEKB 4CYEA 2M8SA 4ANUA 1P9DU 2D2QA 4NQKE 1WGHA 4ZYNA 3KYCD 2KLCA 4NJ6A 4II3B 3IBEA 5CHFA 3VH4B 2NBWB 2Z0DB 1YX5B 3PV1A 3VDZA 3WANA 2JT4B 5D94A 4PYZA 1Q0WB 5J17A 3PPAA 1WF9A 4LDTB 3IHPC 3P2BA 2JRHA 4FN2A 3EFUA 1WX7A 1E8WA 2ZVNA 2N4FA 4NQLB 2ZCCA 3AU4A 5G2NA 1WJUA 3T8MA 3HHMA 3QQ8B 1VCBA 4I6NB 4WWOA 1V2YA 3NHEB 1V81A 2J0JA 1AARA 2KDFB 4W9IA 2MBHA 4ZRKA 4HXDA 1H4RA 1E8YA 2PPHA 2KTRA 5JH5C 3DVGY 2JY6A 4GSWA 3S2AA 5L95C 3R3MA 4M8NA 2N7DA 4W9KA 3OJ3A 3ML8A 1GNUA 1WZ0A 1ZKHA 3L10B 4W9CA 1C3TA 2FIDA 2DYBA 1OQYA 4AOFA 2MP2A 2KK8A 2FNJB 3HM6X 2BPSA 3NY5A 3UINB 3WAOA 1UBQA 3UQAA 1WX9A 2FAZA 3R66C 3ZLZA 1L2NA 2ZNVC 4MELA 1D3ZA 3UF8A 4WAAA 3QA8A 1LQBA 2IYDB 4WWNA 4DDID 2LRWA 3SDLC 2BYFA 2EMSA 4KZCA 4BBNC 1WFYA 1VD2A 2CHXA 3B08A 2V4LA 4HK2A 1Z5SB 2K8BA 2KZRA 3DBSA 3H1UA 2MA9B 2LVQA 4FLHA 4HCPB 1BT0A 2XEWA 1Q1OA 4B6WA 3ZW3A 1GUAB 1WRDB 5DPSA 2BWFA 3U8ZA 3H7SA 4GU2A 1ZGUB 2WX1A 4IWPA 3RUIB 2LZ6A 2BKRB 3DBLI 3PHWB 1NDDA 3A9KB 1NI2A 2MQJA 1GG3A 3ZNGC 2JRIB 2RPQA 1UELA 2KFKB 4WJOA 2KMCA 1Y8RC 2RSUA 2WX0A 4MEMA 5AZHA 3SU8X 5C23A 2L00B 3LDZE 2LJ5A 4BKGA 3DVNU 2KWCA 5E6PA 1S3SG 4DXAB 3A1QB 4XZ4A 3MTNB 3TIXA 3LJ3A 2WYQA 2JVCA 5J2RA 3TL5A 2CR5A 1V5OA 3UQBA 3PLUA 1LM8B 4MH0E 3RD2A 3A4SC 2MBQA 4HVBA 4HCNB 2UWQA 3PZDA 4G0NB 3AI5A 2MLBA 4JL9A 1LXDA 1L7YA 1T0YA 4TQ1A 3DPDA 1SIFA 3H9DA 2FCMA 3VHTC 2DYMA 4JGHB 4LJPB 4KV2A 2CHWA 4AP4C 3HIZA 2MSED 4IG7B 4KIKB 3UIOB 1M94A 3VH3B 4EEWA 5KHQA 5LLIA 4EZKA 3N30A 5L83A 2I1JA 2L0FA 4WJPA 2FIFA 2UYZB 3VFKA 3CMMB 1S1QB 1YIWA 5JHAA 2K6DB 1IP9A 1TZ1A 2JUOA 1CMXB 3I3TB 4W9FA 5DPRA 3RT3B 2HD5B 3N32A 4ICVA 4BKTA 3ZKJC 4FA6A 1WJ4A 3RCZA 1WGDA 3OJ4B 2KKCA 3ZRCA 2NBVB 2L3ZA 2XBBC 3ZDMC 3A9KA 1P98A 2CS4A 3OLMD 2KFKA 4IW0A 4TQ0A 3VXWA 2LI5A 3ZVVA 3ZRFA 2JPHA 4HWIB 4HJKA 4K7UA 2D10A 2FCNA 3APDA 1UD7A 4GDLB 5IA7A 4EOYA 3KUDB 2K8CA 2N1WA 4DHZB 3KUCB 3A1QA 1TTNA 2GBJA 4K7SA 4II2B 2BF8B 3KUZA 2LVOA 1WM3A 2PEAA 3NS8A 3AXCA 2OOBB 3L13A 4PS8A 4AUQC 4W9LA 3PRPB 2EMTA 3NZUA 1WGRA 2N9XA 3JYUA 3NZSA 2N9PC 1V49A 1YQBA 1WR1A 2NR2A 3L17A 1ISNA 4BBNF 3A9JB 2G3QB 3ZNID 1OEYJ 3V62A 5IAAC 1WE7A 2IO0B 2OJRA 2M17A 2YLMA 4BKSD 4NPNA 2KD0A 2KLGA 3B0AA 1XD3B 3PLVA 1SGHA 3EC8A 3DBHI 1WI0A 3M95A 1WMHB 3CSTA 5D7GA 3M3JA 2MX2A 3EHVA 1U4AA 2V3SA 3A4RA 2WWZA 3RZFA 1X1MA 3ZNZB 4I6LB 2GBNA 2LUEA 2PE6B 3T9LA 3VTWA 2W9NA 3UIPB 1J0GA 1UBIA 2IY1B 4LJOB 3KYDD 4A3PA 4KVGB 2CKHB 3HM3A 4PS7A 3IVFA 3CF6E 1WGGA 4KZ0A 4N9F4 2BYVE 4WWPA 2FCSA 2LWPA 4I6PA 2Z0EB 4JIOU 4JLCA 3OAWA 4GDLA 2JZZA 4HPLB 1V5TA 3L16A 4B9KA 3ML9A 5CTRC 3ZTDA 4M0WB 2JF5A 3QAQA 4WJQA 4DDGD 4E74A 2KC1A 1C1YB 3PTFC 1P0RA 1WXSA 2DAFA 2GBMA 2KTFA 4EUTA 2XK5B 2GOWA 2O6VD 4KSKC 2DZIA 2M1MA 3AULA 4HDQA 4KDIC 4EFOA 3A9JA 4EZJA 3IG3A 3Q3JA 5HKHA 2BGFA 2K39A 3JSVB 3TBLD 5D6JB 1Z2MA 4M8MA 3V6EB 1WM2A 3H7PB 3WALA 3RYTA 3QX1A 1GC6A 3R7QA 4DBGA 1WMHA 3QWZB 4MM3A 3APCA 4K1RB 1TGZB 4X57B 3ZO5B 4NJ7A 2AYOB 1IPGA 4WJNA 2MRPA 3VTVA 4AJYB 3PRZA 1J8CA 4FHJA 3JVZX 1EO6A 2LRUA 3L0WB 2KO3A 3DCGA 4FJZA 2DYOA 4K7WA 4KDLB 4LCDE 4MGKE 3R7RA 3WAPA 1MG8A 1RFAA 1SE9A 3APFA 2M0XA 3GOEA 2Z59B 2FCQA 2C7NB 1J19A 2K25A 2K1FA 2ZEQA 2KC2A 3QHTA 1RAXA 1WZ3A 3DBRI 3X23A 2J0MA 2J7QB 2DX5B 4J6IA 4MGIE 4W9DA 2JWZA 4K81A 5E6OA 1WX8A 5TR5A 3TCAA 2NVUI 5CX3A 3D32A 4ZRJA 2L76A 4A3OA 2L8JA 5JHBA 1HE8A 3NOBA 2RD0A 3QIJA 2M4NA 3KW5B 1JRUA 4F8CB 1KOTA 2K6QA 4BOSC 2KHWB 2AWTA 4GGQA 4W9JA 2ASQA 2XK5A 1YX6B 2KJ6A 1R4MI 1UH6A 2NS5A 2ZPNA 2VRRB 3BY4B 1XQQA 2C5LC 1OEYA 3ONSA 4ZRIA 4OVUA 2GMIC 3QK0A 1WIAA 2L05A 4TUUA 3VUYA 2DENB 3QJZA 2JZ3B 3JSVA 4KSLC 4GDKB 5D2MB 5E6NA 2AL6A 3H7PA 4BFRA 4E71A 4RMAA 4G50A 2DZMA 2ZCBA 2LGXA 2CU1A 4IUMB 1RRBA 3PHXB 2V1YA 2LXCA 4G11A 2EKEC 2KWVB 2LXAA 2KANA 3K9OB 3W1YA 3ZTCA 5DCNA 3X0WA 4NY0A 2KTRB 2WDTB 3Q3FA 4GIVA 1FXTB 2N9EB 4F1SA 2LD9A 2AEHA 2KX0A 2A5UA 4DHZE 2NBUA 1H8CA 2IO3B 3PSEB 2HTHA 2BYEA 5DPTA 4GOCA 2N7EA 3W1SA 2O6VB 4DWFA 3DOWA 1WR6E 4FJVB 1R4NI 4ANVA 1V9JA 1NBFC 4IM0A 4CHKA 1G6JA 2I1KA 1EUVB 3PVLA 4NNJB 4KIKA 3RZWC 4BKSA 5CHVC
chains in the Genus database with same CATH superfamily
4KGRA 4RF1A 4HLEA 1KF6B 1E7VA 1WE6A 1YJ1A 3AEDB 3V3XA 1EWCA 1PFDA 4MSQB 3BVGA 4A20A 3TSSA 4P1CC 1XT9B 2INPE 1V86A 3CSFA 4HDOA 3RNEC 2DZKA 1WXVA 2D3GA 2FUHB 1XO3A 4GMVA 3P4PB 1R4NB 2RGFA 1ZE3D 5IP4D 2L7RA 2MBOA 2QDFA 4OVVA 2C60A 4FADA 1FNUA 2ZVOA 1C79A 2KOXA 1P1AA 4DHJD 2CHZA 2KJRA 1TKYA 1EF5A 2GBKA 3N1XC 2Q5WD 2RMMA 1LFDA 1E8ZA 2ZZPB 2ZNVB 4E3CA 3W1SC 1SSNA 4ANXA 4CO7A 1F0ZA 2KDIA 4P7IA 2GBRA 1YD8U 2BYTA 2DAJA 5DPWA 2K9XA 3Q3OC 2A4ZA 5EDSA 2D11A 3DQVA 1OTRB 2N0SB 2MW5A 3WIMA 2BQQA 2W54A 1D5XC 3AE2B 3WAMA 2KDBA 4IM3A 1E7UA 3AEEB 1WYWB 1KLGD 3RFZB 2HTME 1YN4A 3ZXRA 1WH3A 4REZA 2Y5BB 2J42A 1XEEA 3GZNI 1EF1A 1XLOA 5IOIA 1SE4A 2C7HA 2K8HA 3LYYA 4ASWC 2PLPA 3W5VB 3VRAB 2FUG1 1FNVA 1OGWA 1PGXA 3L08A 5G5GA 3DDCB 4G3XB 2Y5CA 2R61A 2RDGA 1F9JA 3N3KB 4W9EA 4QAYA 1TBEA 3P63A 2D3AA 2PVOD 5EE3A 2YVCA 3AEAB 5G55A 4L1BA 2J0KA 1UUPA 3NZ3A 4IOIE 1V1OA 1HTOA 4NQKE 2KLCA 1YX5B 2WHIA 3PV1A 3VDZA 3U52E 2OHFA 3IHPC 1F2RI 1WX7A 2ZVNA 3AU4A 3HHMA 1LGRA 1AARA 3Q6BA 1PGBA 1E8YA 1YJIA 2CU3A 4K3BA 2JY6A 4OZAA 3S2AA 4ZRPA 5L95C 3R3MA 4D2KA 4OZCA 3L10B 3AEFB 4AOFA 2FNJB 2BPSA 2WXFA 1L2NA 1D3ZA 4P1BC 1XXGA 4WAAA 3SDLC 1WFYA 2JXTA 2CHXA 2WXGA 1Z5SB 2AQ3B 2K8BA 2KZRA 1Q1OA 4KKIA 4RFBA 1HXYD 3RUIB 2M0AA 3I63C 1K53A 1NI2A 3ZNGC 2JRIB 1E0ZA 4J3OD 1V97A 3IXSA 2WX0A 5C23A 3DVNU 1J7BA 1S3SG 4XZ4A 3MTNB 3TIXA 3VR8B 3LJ3A 2WYQA 2CR5A 3UQBA 2PVGC 3IAS1 2SAKA 4G0NB 1LXDA 4S0RA 1T0YA 4TQ1A 4LJPB 1YOVB 4AP4C 3UIOB 3DWGC 4XWWA 2FIFA 2JSVX 1YIWA 3I3TB 4W9FA 3RT3B 2HD5B 3ZKJC 1OQQA 4M01A 4FA6A 2NBVB 3ZDMC 1SJHD 2CS4A 2LGIA 4RCOA 4HJKA 3GE8C 1UD7A 2WDVB 3BYYB 2V0GA 1N6ZA 3KUCB 1TTNA 1XLQA 5IKCM 3KUZA 1IGDA 2LVOA 1TT5B 1ET9A 4C7ZA 2WXNA 4Q2JA 2N9XA 1V49A 3ZJVA 4RF0A 3CIRB 5FKAC 3V62A 1R4MB 1YJJA 2GLSA 4HJGE 3B0AA 1SGHA 3DBHI 1WI0A 1VRAB 3CSTA 2OJWA 3EHVA 4MM3B 1JWUD 1WYGA 2KQ4X 4I6LB 2PE6B 3T9LA 4ARCA 4LJOB 3KYDD 4KKJA 2CKHB 1F2RC 3P4QB 4XE0A 3CF6E 5AUIA 4M00A 2HJ1A 3Q8FA 3OAWA 3L16A 1VDVA 4WJQA 3NUHB 2KC1A 3PTFC 1E6EB 3N1YC 1BXTA 4EUTA 4ZHPA 3IG3A 3Q3JA 4HKQA 1L0YB 5D6JB 1ZXIA 4MH8A 3RNAC 1K51A 1UF0A 4MM3A 1TY2A 1TGZB 3ZO5B 2BS4B 4AJYB 4YSZB 4GLSC 3L0WB 1EO6A 2KO3A 4KDLB 4MGKE 1SE9A 1RFAA 1EU3A 1I4XA 2FCQA 1HZ6A 3DBRI 1RM6C 2J7QB 4MGIE 2IPKD 3TCAA 1C9FA 3D32A 2L76A 1VLBA 1N61A 3NOBA 2M4NA 1JRUA 1YQ3B 2VH2A 2WXHA 2K6QA 5IN7A 4GGQA 1R4MI 2SEBD 2NS5A 4BZAA 1GB4A 2C5LC 1OEYA 4ZRIA 4OVUA 1WIAA 4KSLC 5GXGB 2JZPA 4N58A 2LGXA 1RRBA 3PHXB 5IO9A 4G11A 1WWTA 2KANA 3W1YA 2CJOA 4A8XC 4NY0A 2N9EB 1TS4A 2LD9A 2DLBA 1JCKB 1ROEA 1AYFA 3W1SA 1HEZE 1QOFA 2B76B 1FM0D 1WR6E 4ANVA 4IM0A 3PVLA 1STEA 3KH0A 4LTUA 3VVWB 4JQWC 4RM8A 4C00A 2LASA 3R2TA 5FK9C 3VUWA 1MI0A 3BVMA 4HPMB 1I4PA 3AE4B 4ARIA 3AMZA 2I2YA 5JZEB 3DVGX 1TKEA 2JXXA 4M02A 1VJKA 1TIFA 2M19A 3AH7A 1E9MA 1L4DB 1NENB 3OG5A 2AL3A 3QCAA 1V8CA 1WY8A 4ICUA 2KJHB 5KHOA 4PK1A 4TV3A 3TEWA 1FRRA 3C19A 3ZDTA 2W82A 1I35A 4AQ7A 2BS3B 3SHQA 1C4PA 3P4SB 3SEBA 3MJ5A 3DVNV 4WH4A 4ANWA 4PYUA 3ALBA 1L0VB 4A9AA 1UGJA 2QMTA 2QHOA 3BINA 4HEA1 3PO0A 1JWSD 1IUEA 4MSMB 2WNMA 1L4ZB 3O65B 4RH6A 4XGAB 2WXIA 1CJEA 4B95A 4MGZE 5C1ZA 3ZGZA 2R2OA 3VQIA 4RGMA 1QLBB 4L2YA 5LNK1 1JW9D 5GMVA 2H88B 4O1NA 2KMAA 2LGDA 3Q14C 2G9HD 4DK5A 2KN4A 3TMPB 3P4RB 2TSSA 2KFJA 4AWJA 3V6CB 1UGMA 4JWUC 1FCLA 3EUB2 2REXA 3DBLB 5FR6A 4LNKA 5CHWA 2IGDA 4WQOB 2GRIA 3HUIA 3W5UB 3V60A 1MPEA 2KQ7A 3W9CB 2KNBA 5G5HA 3BIID 1N5WA 1N62A 1K8RB 3IFWB 1JWMD 1E7PB 1I4GA 1SF0A 1P3QU 1IGCA 1EU4A 2KYWA 3U4EG 2N7JA 5BYRA 2LMCA 3TJPA 3K9PB 3T3OA 3WA0A 1FMAD 1L0XB 2M8SA 2D2QA 3ZXVA 3I57A 1F1HA 4ZYNA 2QSDA 4NJ6A 1MVKA 5CHFA 1T0QC 2Z0DB 1FCCC 4HPPA 3WANA 1FFVA 3RNCC 1MG4A 1CK1A 3P2BA 1VZ7A 4FN2A 3EFUA 5G2NA 2N4FA 1KH0A 2VH1A 3T8MA 2VZKB 1HZ5A 5HFYA 4I6NB 3ETRA 4WWOA 1V2YA 3NHEB 2N9KA 4ZRKA 4HXDA 2PPHA 1WGKA 4GSWA 1HA5A 1L5PA 4W9KA 3ML8A 4PT5A 2NMQA 4W9CA 5HHDG 2WXLA 1OQYA 4HRSA 3HM6X 3WAOA 3UINB 1N63A 1UBQA 2FAZA 4NAMA 1YQ4B 4MELA 1XCQL 2Y3AA 2NTSA 2IYDB 4WWNA 2CJNA 1QOBA 2EMSA 1D5ZC 3B08A 1VD2A 2V4LA 4HK2A 3DBSA 3Q8AA 4US8A 4FLHA 2LVQA 4HCPB 1XCTL 1GPXA 3O13A 3KWLA 1QF6A 3DBLI 3PHWB 1EM7A 2RPQA 2RSUA 1Y8RC 2V4IB 5AZHA 2L00B 4BKGA 2KWCA 1QOAA 3A1QB 2LHEA 3TL5A 2WXJA 4YSYB 1LM8B 4JPSA 3NVZA 2MBQA 2LGSA 2QILA 2N9LA 2FCMA 3VHTC 4JGHB 2INDC 3AEBB 4YWGG 4KIKB 1M94A 1FXAA 2PMVA 1Y56A 4ZRQA 3BVZA 2L0FA 2UYZB 3VFKA 2WDQB 3AV8A 1TZ1A 1VR9A 2FE8A 2WXOA 5DPRA 1F77A 3AE3B 3OJ4B 2KKCA 1JALA 2XBBC 1QOGA 3NVWA 4XYCA 2OEDA 3ZYYX 2Y5PA 4IW0A 4TQ0A 4HWIB 5T8IA 4YTMB 3APDA 5C3JB 4UDUC 3KUDB 2K8CA 3A1QA 2PEAA 3NS8A 3L13A 4AUQC 5EE9A 3NZUA 2MJDA 2N9PC 3RNBC 1YQBA 1K52A 2WXMA 2G3QB 3ZNID 1WSPA 5IAAC 1WE7A 4L23A 5HI1A 2KD0A 2KLGA 5C2TB 1F52A 5MPOA 1U4AA 5EE0A 3NRZA 3RZFA 1X1MA 4N59A 3ZNZB 2GBNA 3UIPB 4C80A 1J0GA 4KX6B 4LNIA 2IY1B 4WQMA 2RDHA 1VZ8A 4PS7A 1ESFA 4RNAA 2LWPA 1JQ4A 3ML9A 2WDRB 4LNFA 4M0WB 2JF5A 3QAQA 4P6VF 1MHXA 4JX1C 1P0RA 3DBHB 2UU7A 4KSKC 1ZUD2 2M1MA 3AE8B 2K39A 4NZLB 2EELA 3JSVB 3V6EB 1WM2A 3H7PB 1KRHA 3WALA 3R7QA 2KAJA 3VRBB 3APCA 1SE2A 1QT9A 4NJ7A 2MRPA 1TS3A 3JVZX 2DYOA 4K7WA 3R7RA 1QQRA 3GOEA 1TYGB 2K1FA 1WZ3A 2J0MA 4W9DA 5TR5A 4K81A 4C56C 4MT5A 3GB1A 4ZRJA 3AE5B 1HE8A 4M0WA 3Q3NC 1I4QA 2QJLA 1T6BX 4F8CB 4BOSC 2AWTA 1I4HA 4W9JA 1YX6B 1UH6A 3Q8EA 3RPFC 4RGTA 2VRRB 3BY4B 3NVYA 2K22A 2IJ0A 3ONSA 2AQ1B 2GMIC 3QK0A 2DENB 3JSVA 2L32A 5E6NA 3H7PA 1AWDA 2ACZB 4IUMB 3DBRB 2LXCA 1TKGA 2LXAA 3K9OB 5DCNA 2KTRB 2WDTB 4USAA 4F1SA 2NBUA 2IO3B 2BW2A 2BYEA 2JQRB 4GOCA 3C8YA 2KVZA 2O6VB 4DWFA 1OFFA 4FJVB 1V9JA 4NNJB 3UQAA 4BKSA 1C77A 3DHIC 1T0SC 3N1ZC 2O2VB 1KLVA 2NCNA 4URKA 3EFCA 3LXFA 4IWQA 2BTEA 1JRPA 3NS1A 3C0RB 4EKUA 1UZXB 4GN1A 4ZOHC 2ZJDA 3L54A 2E6XA 2LEKA 4TSSA 1Q5WB 2KN5A 2DHZA 4A6QA 2PJHA 4FULA 1SIJA 1ZXHA 3I5JC 1V1PB 3RULA 3PT2B 3MJWA 5FR3A 1GJZA 2X38A 3HVDA 3V61A 3FAHA 2D3BA 4YL8A 3TEZA 2JU6X 3AE7B 1A5RA 1JMLA 2LGYA 3U30A 3ZNHB 3PREA 3AU5A 2HE7A 2IBIB 3B2GA 2K0PA 4H2AA 2O6VA 1FD6A 2DNFA 2IO1B 1ZW7A 3ECIA 2DZJA 2KACA 2O2VA 1J7AA 3DWMA 1B9RA 1KM7A 2KQSA 3M63B 1CQVA 3AE9B 4XX5A 3UI3A 4MJSB 1WGYA 3EA6A 4BOZB 2KWUB 4BVUC 4MDKE 2VZKD 1D5MC 2D07B 1N5XA 1B1ZA 2KX3A 2R2QA 3VAWA 1PDXA 5AZFA 4IC7B 2MCNB 3ABVB 2LJIA 2IY0B 1I7HA 4R3DA 2MHJA 1IYFA 3VR9B 1WXQA 4FJYA 2AQ2B 5D3IB 4JWSC 3V05A 1V80A 3A33B 1NI3A 4XWTA 1TZOA 4IDIA 4ZDVA 1SEBD 4WIPA 1SXTA 1A70A 2BB6A 2W3RA 2KVRA 1TS2A 4AJWA 3RNGC 4MJSA 4MACA 4W9HA 2PIAA 2BB5A 2QIEB 1NYRA 2MP2B 5J18A 4IM2A 2W55A 2LHDA 5AZGA 1E90A 2C7MB 1E8XA 4GB9A 1GC7A 2LVPA 5AEKB 4WURA 4ANUA 1P9DU 1WGHA 3KYCD 2MEKA 4II3B 3VH4B 3WCQA 2JT4B 4PYZA 2BS2B 1Q0WB 5J17A 1WF9A 5D3DA 4LDTB 1KLUD 2JRHA 4NQLB 2WU2B 1WJUA 3QQ8B 2JYTA 1IBXB 5H8YE 3U7ZA 1V81A 2H89B 2J0JA 2KDFB 2MBHA 3TEYA 3FKYA 1H4RA 4C7YA 2RDBC 4HKZE 4B0MA 2N7DA 1WZ0A 1ZKHA 2DYBA 2MP2A 2KK8A 1WX9A 2BVCA 2PKOA 4YT0B 3UF8A 2K3UA 1LQBA 4DDID 2YEPB 3TUOA 4BBNC 4S17A 2MA9B 4B6WA 3ZW3A 2WXKA 1GUAB 3GE3C 2XN9C 5DPSA 3U8ZA 1ZGUB 4IWPA 2JWUA 3PZ7A 3RMKC 3A9KB 2MQJA 1IBXA 2JX5A 1R7SA 1MHHE 2KFKB 4MEMA 1T3QA 5E6PA 3SFDB 4DXAB 3Q2AC 3J9CA 4MH0E 1SB3C 3N20C 2J52A 4HVBA 2UWQA 4JL9A 1SBBB 3KQ4A 3DPDA 1SIFA 3H9DA 3U2SC 2DYMA 4KV2A 3VH3B 5L83A 2I1JA 2K6DB 1IP9A 2JUOA 2GI9A 3MFGA 4C4VB 4BKTA 3MC8A 3Q3MC 1WJ4A 4OVZA 3ZRCA 1FIQA 3A9KA 1P98A 4KGTA 2ZW0A 3OLMD 2KFKA 3T3NA 2J4XA 2K5PA 3VXWA 3ZRFA 2JPHA 4K7UA 2D10A 3FC4A 3BZDB 1RYJA 1C4CA 4DHZB 2M56B 2BF8B 4ITKA 1WM3A 3PZ8A 4DXGA 2QEJC 3PRPB 4US9A 2WS3B 1WGRA 1C76A 3NZSA 1K50A 2NR2A 3L17A 2IO0B 1QILA 1ZOYB 2OJRA 2M17A 2YLMA 4BKSD 3PLVA 3EC8A 1FO4A 1WMHB 5D7GA 2XNAC 4LNNA 3DHHC 3KWVA 3A4RA 4C4VA 2IDYA 5EE1A 2W9NA 3TEXA 1D4BA 4KGSA 4N9F4 4KZ0A 1OQRA 4WWPA 5I4DA 2FCSA 1Q10A 2MJEA 1SE3A 4JIOU 2JZZA 1V5TA 4B9KA 5CTRC 4OW0A 3ZTDA 1WXSA 2DAFA 2GBMA 3GS2A 1HTQA 4EE2A 3LB8C 2GOWA 2O6VD 2DZIA 1YMHE 3AULA 4HDQA 4KDIC 5H92C 2BGFA 1DOIA 4ZYSA 1Z2MA 4M8MA 4DXFA 3RYTA 1DOYA 1GC6A 1WMHA 1KTKA 1PYWD 4WJNA 3VTVA 4FJZA 4WAFA 4LCDE 1GB1A 2M0XA 2Z59B 2C7NB 3X23A 2K25A 2WQYB 4J6IA 2NVUI 4DQOC 4LK0M 4A3OA 2L8JA 1E10A 1BMLC 2I38A 5JHBA 3NJTA 2KWDA 5BMHA 1KOTA 5AUKA 2ASQA 2KJ6A 3P1MA 1XF5L 3RNFC 3E56A 4GDKB 2AL6A 4BFRA 4E71A 4RMAA 4G50A 3P42A 1NEKB 1BUIC 2EKEC 4N6EB 2YEPF 3X0WA 3Q3FA 4GIVA 2AEHA 3NVVA 2A5UA 2WP9B 1H8CA 3PSEB 1FXIA 2HTHA 2W3SA 1T0RC 3EGRA 3IT6B 3AE6B 1R4NI 5BYQA 4CHKA 1EUVB 4YSXB 3MP9A 4KIKA 4TMAB 5CHVC 2LUMA 2C9WB 1ZPSA 1T5XD 4NAWB 2BWES 2MWSB 1WJ6A 4FHKA 3ZJUA 3R2IA 1JROA 2N1VA 3B1LX 2IZVB 3B2FA 4LNOA 1WXAA 2KT7A 1KJTA 2HDEA 4GDKA 5BO4B 2G4DB 3ZJTA 3MC9A 1V6EA 3URYA 4EZLA 4IWOA 2B3AA 3KVFB 5LXHA 2Z8LA 1C78A 2NPTB 1NYQA 1DOXA 1RLFA 3MC0B 1FRDA 1WXMA 1GOZA 2QCZA 4IKGA 4A90A 4XC2A 3QARA 1L6VA 3PRMB 2IO2B 1ZDVA 4W9GA 3EECA 1ZDXA 3AN1A 2KDEB 3MHSD 4TKNA 3VUXA 1I42A 3BWUD 4K3CA 5JXVA 1WJNA 3HK0A 2HJ8A 3DHGC 4NAWA 2V3PA 1DYQA 2RR9A 5LXIB 4LDTD 1L6UA 3SD5A 1P7EA 3L4PA 4ACFA 3U7DA 2KMMA 2X8XX 2MBEA 2L83A 2QC8A 4FBJB 4RGOS 3ZUNA 3UGBB 3AE1B 4YTNB 3H6NA 3IT4B 1AW7A 4XDDA 1QZEA 3BK1A 2G45B 4NJCA 1NVID 3VTUA 3JW0X 1PQSA 4ZHOA 2NPTA 2WGSA 3I9V1 5BMGA 4CQNA 4RM9A 2L0TA 4AS1A 2BKFA 3ENEA 3SR6A 3PS6A 1MJDA 2INNE 3RN9C 3RI7C 2G1EA 2KDMA 2PE9A 1AN8A 1ACCA 3PGEA 2KXJA 3QC8B 2EKIA 2G4SA 4MGYE 3ZIMA 1E5WA 2ZPYA 4F7ZA 3Q8CA 4YXDB 1TY0A 2ONQA 4DHJB 4PS3A 4A55A 3NG0A 3ZQ4A 2MBBB 2AX5A 3M62B 4GXBA 3OWEB 4CYEA 3AEGB 3IBEA 2NBWB 2V9HA 2ICIA 5D94A 1TJEA 1D6EC 3PPAA 1HQRD 4YTPB 3H8HA 1E8WA 2ZCCA 1GAQB 1VCBA 1I4RA 2DBYA 1PGAA 2MJ3A 4W9IA 2INCC 2PTLA 2KTRA 5JH5C 3DVGY 3AM9A 4XDCA 1ZP0B 4M8NA 3OJ3A 1GNUA 3BYTB 1C3TA 2FIDA 1SJED 3NY5A 3R66C 3ZLZA 2ZNVC 3QA8A 2LRWA 2BYFA 4KZCA 3H1UA 1BT0A 2XEWA 2FBWB 1WRDB 2BWFA 3H7SA 4GU2A 2V3NA 2WX1A 2LZ6A 2BKRB 1NDDA 1V1PA 1GG3A 1FEHA 1UELA 2IGGA 2KMCA 3Q8BA 4WJOA 3SU8X 4P16A 3LDZE 2LJ5A 4HROA 3SFEB 1YNTE 2JVCA 5J2RA 1UNSA 3MHZA 1V5OA 3PLUA 4BAXA 2RPVA 3RD2A 1RWSA 3A4SC 4HCNB 3PZDA 3AI5A 2MLBA 2LFIA 1L7YA 2CHWA 3E9SA 3HIZA 2MSED 4IG7B 4EEWA 5KHQA 5LLIA 4EZKA 3N30A 4WJPA 3CMMB 1S1QB 3HVZA 5JHAA 2MH7A 1CMXB 3N32A 4ICVA 1N60A 3RCZA 1WGDA 5TSSA 1C4AA 2L3ZA 2ON8A 5E6JA 3BK2A 1UWMA 2D3CA 2LI5A 3ZVVA 2FCNA 4GDLB 5IA7A 4EOYA 1ENFA 2N1WA 5BMIA 2GBJA 4K7SA 4II2B 3AXCA 2OOBB 4PS8A 4W9LA 1JWAD 1DGJA 2EMTA 3JYUA 3HRDD 1WR1A 4BBNF 1ISNA 3A9JB 1FPYA 1OEYJ 1QKZA 4FXCA 2L52A 4NPNA 1XD3B 4LLGM 1KFYB 3M95A 3KLSX 3M3JA 2MX2A 3W2DA 2V3SA 1YN5A 2WWZA 3AECB 5HG2A 1WRIA 2E3TA 5BYSA 2LUEA 3VTWA 2DWQA 2D5GA 1J7CA 1MFWA 1UBIA 4B0EA 4A3PA 4KVGB 3GP7A 3HM3A 3IVFA 4OZBA 1WGGA 1RFKA 2BYVE 2JYEA 4I6PA 2Z0EB 4JLCA 4GDLA 4HPLB 4DDGD 4RGNA 4E74A 1P7FA 1C1YB 2ZW1A 2KTFA 2WLBA 1LO5D 4JE3B 2XK5B 3B9JA 3FILB 4OHJA 4EFOA 3A9JA 4EZJA 5HKHA 1TS5A 3TBLD 3QX1A 4DBGA 3QWZB 4K1RB 4X57B 2AYOB 1IPGA 3R8BA 3PRZA 3IAM1 1J8CA 1ET6A 4FHJA 2LRUA 1UWXA 3DCGA 3WAPA 1CZPA 1MG8A 3APFA 3QHTA 1XLNA 1J19A 2ZEQA 2KC2A 1RAXA 2DX5B 2JWZA 5E6OA 1WX8A 2J53A 5CX3A 2BBCA 3Q69A 2RD0A 3QIJA 1FNWA 3KW5B 2L1AA 2WXRA 2KHWB 2XK5A 1JWBD 1XLPA 4WWMA 3FILA 2ZPNA 2WXPA 1XQQA 1PUTA 4TUUA 2L05A 3VUYA 3QJZA 2JZ3B 5D2MB 1VZ6A 2IGHA 2NTTA 1YN3A 2DZMA 2ZCBA 2CU1A 2V1YA 2KWVB 3ZTCA 2GB1A 2PW9A 2WU5B 1FXTB 2KX0A 4DHZE 1FFUA 5DPTA 2N7EA 2WXQA 3AB5A 2BT6A 3CWIA 3DOWA 1EWYC 1M4VA 1NBFC 3N9YC 1G6JA 2I1KA 3RZWC 3GZNB
chains in the Genus database with same CATH topology
3KH0A 2O2VB 1KLVA 2NCNA 2C9WB 4URKA 4IWQA 3VVWB 4JQWC 4HLEA 4NAWB 4RM8A 3C0RB 4EKUA 2BWES 1UZXB 2LASA 4GN1A 2ZJDA 3L54A 3VUWA 2MWSB 1WJ6A 1E7VA 4FHKA 4HPMB 1WE6A 1YJ1A 1Q5WB 2KN5A 2N1VA 3B1LX 2DHZA 2IZVB 2PJHA 4MSQB 4FULA 4A20A 5JZEB 1WXAA 1KJTA 4GDKA 5BO4B 2G4DB 3DVGX 3RULA 3PT2B 3MJWA 1XT9B 1V6EA 2JXXA 1GJZA 1V86A 3V61A 3CSFA 4YL8A 4HDOA 2DZKA 1A5RA 1WXVA 2D3GA 2FUHB 4EZLA 2LGYA 4IWOA 3U30A 4GMVA 3ZNHB 3PREA 2AL3A 2B3AA 2RGFA 3KVFB 3AU5A 3QCAA 5LXHA 2HE7A 2L7RA 2IBIB 2NPTB 1WY8A 1RLFA 2MBOA 4OVVA 2C60A 4ICUA 1WXMA 2ZVOA 2KJHB 4FADA 5KHOA 2KOXA 4TV3A 4XC2A 1P1AA 2O6VA 3PRMB 3QARA 4DHJD 2CHZA 2IO2B 2KJRA 3EECA 2IO1B 4W9GA 3ZDTA 1ZW7A 1EF5A 2GBKA 3ECIA 2DZJA 1I35A 1LFDA 2KDEB 1E8ZA 3SHQA 3MHSD 4TKNA 2O2VA 3VUXA 1I42A 1WJNA 3HK0A 2HJ8A 4NAWA 2ZZPB 2ZNVB 4E3CA 3W1SC 3DVNV 1KM7A 4ANWA 4PYUA 2RR9A 3ALBA 2KQSA 3M63B 4ANXA 4CO7A 2KDIA 2QHOA 4LDTD 4P7IA 5LXIB 4XX5A 2GBRA 1YD8U 3SD5A 2DAJA 3BINA 4MJSB 1WGYA 4BOZB 5DPWA 2KWUB 4MSMB 4BVUC 4MDKE 3U7DA 2D07B 2A4ZA 2KX3A 5EDSA 2MBEA 3O65B 2D11A 2R2QA 3DQVA 1OTRB 3VAWA 4FBJB 4B95A 2MW5A 4MGZE 3ZUNA 3UGBB 5C1ZA 2R2OA 3WIMA 3H6NA 3VQIA 5AZFA 4IC7B 2MCNB 1QZEA 2G45B 2IY0B 3WAMA 5GMVA 3VTUA 2KDBA 3JW0X 4IM3A 1IYFA 1PQSA 1E7UA 2KMAA 2LGDA 2NPTA 4FJYA 1WYWB 4DK5A 4RM9A 1WH3A 2Y5BB 2L0TA 3GZNI 2BKFA 1EF1A 1V80A 3ENEA 3TMPB 3PS6A 3A33B 2C7HA 2K8HA 2KFJA 4AWJA 3V6CB 1UGMA 4ZDVA 4ASWC 2PE9A 2REXA 5FR6A 5CHWA 1OGWA 3L08A 3PGEA 4WQOB 2KXJA 3DDCB 3QC8B 4G3XB 2G4SA 3V60A 2KVRA 2KQ7A 4MGYE 3ZIMA 4AJWA 1E5WA 2KNBA 2ZPYA 1F9JA 4MJSA 3N3KB 1K8RB 4W9HA 4W9EA 3IFWB 4F7ZA 1P3QU 1TBEA 2MP2B 5J18A 4IM2A 2YVCA 4DHJB 5AZGA 1E90A 2C7MB 4PS3A 1E8XA 5G55A 2J0KA 4GB9A 3TJPA 1GC7A 2LVPA 3K9PB 2MBBB 3M62B 4GXBA 3WA0A 5AEKB 4CYEA 2M8SA 4ANUA 1P9DU 2D2QA 4NQKE 1WGHA 4ZYNA 3KYCD 2KLCA 4NJ6A 4II3B 3IBEA 5CHFA 3VH4B 2NBWB 2Z0DB 1YX5B 3PV1A 3VDZA 3WANA 2JT4B 5D94A 4PYZA 1Q0WB 5J17A 3PPAA 1WF9A 4LDTB 3IHPC 3P2BA 2JRHA 4FN2A 3EFUA 1WX7A 1E8WA 2ZVNA 2N4FA 4NQLB 2ZCCA 3AU4A 5G2NA 1WJUA 3T8MA 3HHMA 3QQ8B 1VCBA 4I6NB 4WWOA 1V2YA 3NHEB 1V81A 2J0JA 1AARA 2KDFB 4W9IA 2MBHA 4ZRKA 4HXDA 1H4RA 1E8YA 2PPHA 2KTRA 5JH5C 3DVGY 2JY6A 4GSWA 3S2AA 5L95C 3R3MA 4M8NA 2N7DA 4W9KA 3OJ3A 3ML8A 1GNUA 1WZ0A 1ZKHA 3L10B 4W9CA 1C3TA 2FIDA 2DYBA 1OQYA 4AOFA 2MP2A 2KK8A 2FNJB 3HM6X 2BPSA 3NY5A 3UINB 3WAOA 1UBQA 3UQAA 1WX9A 2FAZA 3R66C 3ZLZA 1L2NA 2ZNVC 4MELA 1D3ZA 3UF8A 4WAAA 3QA8A 1LQBA 2IYDB 4WWNA 4DDID 2LRWA 3SDLC 2BYFA 2EMSA 4KZCA 4BBNC 1WFYA 1VD2A 2CHXA 3B08A 2V4LA 4HK2A 1Z5SB 2K8BA 2KZRA 3DBSA 3H1UA 2MA9B 2LVQA 4FLHA 4HCPB 1BT0A 2XEWA 1Q1OA 4B6WA 3ZW3A 1GUAB 1WRDB 5DPSA 2BWFA 3U8ZA 3H7SA 4GU2A 1ZGUB 2WX1A 4IWPA 3RUIB 2LZ6A 2BKRB 3DBLI 3PHWB 1NDDA 3A9KB 1NI2A 2MQJA 1GG3A 3ZNGC 2JRIB 2RPQA 1UELA 2KFKB 4WJOA 2KMCA 1Y8RC 2RSUA 2WX0A 4MEMA 5AZHA 3SU8X 5C23A 2L00B 3LDZE 2LJ5A 4BKGA 3DVNU 2KWCA 5E6PA 1S3SG 4DXAB 3A1QB 4XZ4A 3MTNB 3TIXA 3LJ3A 2WYQA 2JVCA 5J2RA 3TL5A 2CR5A 1V5OA 3UQBA 3PLUA 1LM8B 4MH0E 3RD2A 3A4SC 2MBQA 4HVBA 4HCNB 2UWQA 3PZDA 4G0NB 3AI5A 2MLBA 4JL9A 1LXDA 1L7YA 1T0YA 4TQ1A 3DPDA 1SIFA 3H9DA 2FCMA 3VHTC 2DYMA 4JGHB 4LJPB 4KV2A 2CHWA 4AP4C 3HIZA 2MSED 4IG7B 4KIKB 3UIOB 1M94A 3VH3B 4EEWA 5KHQA 5LLIA 4EZKA 3N30A 5L83A 2I1JA 2L0FA 4WJPA 2FIFA 2UYZB 3VFKA 3CMMB 1S1QB 1YIWA 5JHAA 2K6DB 1IP9A 1TZ1A 2JUOA 1CMXB 3I3TB 4W9FA 5DPRA 3RT3B 2HD5B 3N32A 4ICVA 4BKTA 3ZKJC 4FA6A 1WJ4A 3RCZA 1WGDA 3OJ4B 2KKCA 3ZRCA 2NBVB 2L3ZA 2XBBC 3ZDMC 3A9KA 1P98A 2CS4A 3OLMD 2KFKA 4IW0A 4TQ0A 3VXWA 2LI5A 3ZVVA 3ZRFA 2JPHA 4HWIB 4HJKA 4K7UA 2D10A 2FCNA 3APDA 1UD7A 4GDLB 5IA7A 4EOYA 3KUDB 2K8CA 2N1WA 4DHZB 3KUCB 3A1QA 1TTNA 2GBJA 4K7SA 4II2B 2BF8B 3KUZA 2LVOA 1WM3A 2PEAA 3NS8A 3AXCA 2OOBB 3L13A 4PS8A 4AUQC 4W9LA 3PRPB 2EMTA 3NZUA 1WGRA 2N9XA 3JYUA 3NZSA 2N9PC 1V49A 1YQBA 1WR1A 2NR2A 3L17A 1ISNA 4BBNF 3A9JB 2G3QB 3ZNID 1OEYJ 3V62A 5IAAC 1WE7A 2IO0B 2OJRA 2M17A 2YLMA 4BKSD 4NPNA 2KD0A 2KLGA 3B0AA 1XD3B 3PLVA 1SGHA 3EC8A 3DBHI 1WI0A 3M95A 1WMHB 3CSTA 5D7GA 3M3JA 2MX2A 3EHVA 1U4AA 2V3SA 3A4RA 2WWZA 3RZFA 1X1MA 3ZNZB 4I6LB 2GBNA 2LUEA 2PE6B 3T9LA 3VTWA 2W9NA 3UIPB 1J0GA 1UBIA 2IY1B 4LJOB 3KYDD 4A3PA 4KVGB 2CKHB 3HM3A 4PS7A 3IVFA 3CF6E 1WGGA 4KZ0A 4N9F4 2BYVE 4WWPA 2FCSA 2LWPA 4I6PA 2Z0EB 4JIOU 4JLCA 3OAWA 4GDLA 2JZZA 4HPLB 1V5TA 3L16A 4B9KA 3ML9A 5CTRC 3ZTDA 4M0WB 2JF5A 3QAQA 4WJQA 4DDGD 4E74A 2KC1A 1C1YB 3PTFC 1P0RA 1WXSA 2DAFA 2GBMA 2KTFA 4EUTA 2XK5B 2GOWA 2O6VD 4KSKC 2DZIA 2M1MA 3AULA 4HDQA 4KDIC 4EFOA 3A9JA 4EZJA 3IG3A 3Q3JA 5HKHA 2BGFA 2K39A 3JSVB 3TBLD 5D6JB 1Z2MA 4M8MA 3V6EB 1WM2A 3H7PB 3WALA 3RYTA 3QX1A 1GC6A 3R7QA 4DBGA 1WMHA 3QWZB 4MM3A 3APCA 4K1RB 1TGZB 4X57B 3ZO5B 4NJ7A 2AYOB 1IPGA 4WJNA 2MRPA 3VTVA 4AJYB 3PRZA 1J8CA 4FHJA 3JVZX 1EO6A 2LRUA 3L0WB 2KO3A 3DCGA 4FJZA 2DYOA 4K7WA 4KDLB 4LCDE 4MGKE 3R7RA 3WAPA 1MG8A 1RFAA 1SE9A 3APFA 2M0XA 3GOEA 2Z59B 2FCQA 2C7NB 1J19A 2K25A 2K1FA 2ZEQA 2KC2A 3QHTA 1RAXA 1WZ3A 3DBRI 3X23A 2J0MA 2J7QB 2DX5B 4J6IA 4MGIE 4W9DA 2JWZA 4K81A 5E6OA 1WX8A 5TR5A 3TCAA 2NVUI 5CX3A 3D32A 4ZRJA 2L76A 4A3OA 2L8JA 5JHBA 1HE8A 3NOBA 2RD0A 3QIJA 2M4NA 3KW5B 1JRUA 4F8CB 1KOTA 2K6QA 4BOSC 2KHWB 2AWTA 4GGQA 4W9JA 2ASQA 2XK5A 1YX6B 2KJ6A 1R4MI 1UH6A 2NS5A 2ZPNA 2VRRB 3BY4B 1XQQA 2C5LC 1OEYA 3ONSA 4ZRIA 4OVUA 2GMIC 3QK0A 1WIAA 2L05A 4TUUA 3VUYA 2DENB 3QJZA 2JZ3B 3JSVA 4KSLC 4GDKB 5D2MB 5E6NA 2AL6A 3H7PA 4BFRA 4E71A 4RMAA 4G50A 2DZMA 2ZCBA 2LGXA 2CU1A 4IUMB 1RRBA 3PHXB 2V1YA 2LXCA 4G11A 2EKEC 2KWVB 2LXAA 2KANA 3K9OB 3W1YA 3ZTCA 5DCNA 3X0WA 4NY0A 2KTRB 2WDTB 3Q3FA 4GIVA 1FXTB 2N9EB 4F1SA 2LD9A 2AEHA 2KX0A 2A5UA 4DHZE 2NBUA 1H8CA 2IO3B 3PSEB 2HTHA 2BYEA 5DPTA 4GOCA 2N7EA 3W1SA 2O6VB 4DWFA 3DOWA 1WR6E 4FJVB 1R4NI 4ANVA 1V9JA 1NBFC 4IM0A 4CHKA 1G6JA 2I1KA 1EUVB 3PVLA 4NNJB 4KIKA 3RZWC 4BKSA 5CHVC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KH0 A;  2O2V B;  1KLV A;  2NCN A;  2C9W B;  4URK A;  4IWQ A;  3VVW B;  4JQW C;  4HLE A;  4NAW B;  4RM8 A;  3C0R B;  4EKU A;  2BWE S;  1UZX B;  2LAS A;  4GN1 A;  2ZJD A;  3L54 A;  3VUW A;  2MWS B;  1WJ6 A;  1E7V A;  4FHK A;  4HPM B;  1WE6 A;  1YJ1 A;  1Q5W B;  2KN5 A;  2N1V A;  3B1L X;  2DHZ A;  2IZV B;  2PJH A;  4MSQ B;  4FUL A;  4A20 A;  5JZE B;  1WXA A;  1KJT A;  4GDK A;  5BO4 B;  2G4D B;  3DVG X;  3RUL A;  3PT2 B;  3MJW A;  1XT9 B;  1V6E A;  2JXX A;  1GJZ A;  1V86 A;  3V61 A;  3CSF A;  4YL8 A;  4HDO A;  2DZK A;  1A5R A;  1WXV A;  2D3G A;  2FUH B;  4EZL A;  2LGY A;  4IWO A;  3U30 A;  4GMV A;  3ZNH B;  3PRE A;  2AL3 A;  2B3A A;  2RGF A;  3KVF B;  3AU5 A;  3QCA A;  5LXH A;  2HE7 A;  2L7R A;  2IBI B;  2NPT B;  1WY8 A;  1RLF A;  2MBO A;  4OVV A;  2C60 A;  4ICU A;  1WXM A;  2ZVO A;  2KJH B;  4FAD A;  5KHO A;  2KOX A;  4TV3 A;  4XC2 A;  1P1A A;  2O6V A;  3PRM B;  3QAR A;  4DHJ D;  2CHZ A;  2IO2 B;  2KJR A;  3EEC A;  2IO1 B;  4W9G A;  3ZDT A;  1ZW7 A;  1EF5 A;  2GBK A;  3ECI A;  2DZJ A;  1I35 A;  1LFD A;  2KDE B;  1E8Z A;  3SHQ A;  3MHS D;  4TKN A;  2O2V A;  3VUX A;  1I42 A;  1WJN A;  3HK0 A;  2HJ8 A;  4NAW A;  2ZZP B;  2ZNV B;  4E3C A;  3W1S C;  3DVN V;  1KM7 A;  4ANW A;  4PYU A;  2RR9 A;  3ALB A;  2KQS A;  3M63 B;  4ANX A;  4CO7 A;  2KDI A;  2QHO A;  4LDT D;  4P7I A;  5LXI B;  4XX5 A;  2GBR A;  1YD8 U;  3SD5 A;  2DAJ A;  3BIN A;  4MJS B;  1WGY A;  4BOZ B;  5DPW A;  2KWU B;  4MSM B;  4BVU C;  4MDK E;  3U7D A;  2D07 B;  2A4Z A;  2KX3 A;  5EDS A;  2MBE A;  3O65 B;  2D11 A;  2R2Q A;  3DQV A;  1OTR B;  3VAW A;  4FBJ B;  4B95 A;  2MW5 A;  4MGZ E;  3ZUN A;  3UGB B;  5C1Z A;  2R2O A;  3WIM A;  3H6N A;  3VQI A;  5AZF A;  4IC7 B;  2MCN B;  1QZE A;  2G45 B;  2IY0 B;  3WAM A;  5GMV A;  3VTU A;  2KDB A;  3JW0 X;  4IM3 A;  1IYF A;  1PQS A;  1E7U A;  2KMA A;  2LGD A;  2NPT A;  4FJY A;  1WYW B;  4DK5 A;  4RM9 A;  1WH3 A;  2Y5B B;  2L0T A;  3GZN I;  2BKF A;  1EF1 A;  1V80 A;  3ENE A;  3TMP B;  3PS6 A;  3A33 B;  2C7H A;  2K8H A;  2KFJ A;  4AWJ A;  3V6C B;  1UGM A;  4ZDV A;  4ASW C;  2PE9 A;  2REX A;  5FR6 A;  5CHW A;  1OGW A;  3L08 A;  3PGE A;  4WQO B;  2KXJ A;  3DDC B;  3QC8 B;  4G3X B;  2G4S A;  3V60 A;  2KVR A;  2KQ7 A;  4MGY E;  3ZIM A;  4AJW A;  1E5W A;  2KNB A;  2ZPY A;  1F9J A;  4MJS A;  3N3K B;  1K8R B;  4W9H A;  4W9E A;  3IFW B;  4F7Z A;  1P3Q U;  1TBE A;  2MP2 B;  5J18 A;  4IM2 A;  2YVC A;  4DHJ B;  5AZG A;  1E90 A;  2C7M B;  4PS3 A;  1E8X A;  5G55 A;  2J0K A;  4GB9 A;  3TJP A;  1GC7 A;  2LVP A;  3K9P B;  2MBB B;  3M62 B;  4GXB A;  3WA0 A;  5AEK B;  4CYE A;  2M8S A;  4ANU A;  1P9D U;  2D2Q A;  4NQK E;  1WGH A;  4ZYN A;  3KYC D;  2KLC A;  4NJ6 A;  4II3 B;  3IBE A;  5CHF A;  3VH4 B;  2NBW B;  2Z0D B;  1YX5 B;  3PV1 A;  3VDZ A;  3WAN A;  2JT4 B;  5D94 A;  4PYZ A;  1Q0W B;  5J17 A;  3PPA A;  1WF9 A;  4LDT B;  3IHP C;  3P2B A;  2JRH A;  4FN2 A;  3EFU A;  1WX7 A;  1E8W A;  2ZVN A;  2N4F A;  4NQL B;  2ZCC A;  3AU4 A;  5G2N A;  1WJU A;  3T8M A;  3HHM A;  3QQ8 B;  1VCB A;  4I6N B;  4WWO A;  1V2Y A;  3NHE B;  1V81 A;  2J0J A;  1AAR A;  2KDF B;  4W9I A;  2MBH A;  4ZRK A;  4HXD A;  1H4R A;  1E8Y A;  2PPH A;  2KTR A;  5JH5 C;  3DVG Y;  2JY6 A;  4GSW A;  3S2A A;  5L95 C;  3R3M A;  4M8N A;  2N7D A;  4W9K A;  3OJ3 A;  3ML8 A;  1GNU A;  1WZ0 A;  1ZKH A;  3L10 B;  4W9C A;  1C3T A;  2FID A;  2DYB A;  1OQY A;  4AOF A;  2MP2 A;  2KK8 A;  2FNJ B;  3HM6 X;  2BPS A;  3NY5 A;  3UIN B;  3WAO A;  1UBQ A;  3UQA A;  1WX9 A;  2FAZ A;  3R66 C;  3ZLZ A;  1L2N A;  2ZNV C;  4MEL A;  1D3Z A;  3UF8 A;  4WAA A;  3QA8 A;  1LQB A;  2IYD B;  4WWN A;  4DDI D;  2LRW A;  3SDL C;  2BYF A;  2EMS A;  4KZC A;  4BBN C;  1WFY A;  1VD2 A;  2CHX A;  3B08 A;  2V4L A;  4HK2 A;  1Z5S B;  2K8B A;  2KZR A;  3DBS A;  3H1U A;  2MA9 B;  2LVQ A;  4FLH A;  4HCP B;  1BT0 A;  2XEW A;  1Q1O A;  4B6W A;  3ZW3 A;  1GUA B;  1WRD B;  5DPS A;  2BWF A;  3U8Z A;  3H7S A;  4GU2 A;  1ZGU B;  2WX1 A;  4IWP A;  3RUI B;  2LZ6 A;  2BKR B;  3DBL I;  3PHW B;  1NDD A;  3A9K B;  1NI2 A;  2MQJ A;  1GG3 A;  3ZNG C;  2JRI B;  2RPQ A;  1UEL A;  2KFK B;  4WJO A;  2KMC A;  1Y8R C;  2RSU A;  2WX0 A;  4MEM A;  5AZH A;  3SU8 X;  5C23 A;  2L00 B;  3LDZ E;  2LJ5 A;  4BKG A;  3DVN U;  2KWC A;  5E6P A;  1S3S G;  4DXA B;  3A1Q B;  4XZ4 A;  3MTN B;  3TIX A;  3LJ3 A;  2WYQ A;  2JVC A;  5J2R A;  3TL5 A;  2CR5 A;  1V5O A;  3UQB A;  3PLU A;  1LM8 B;  4MH0 E;  3RD2 A;  3A4S C;  2MBQ A;  4HVB A;  4HCN B;  2UWQ A;  3PZD A;  4G0N B;  3AI5 A;  2MLB A;  4JL9 A;  1LXD A;  1L7Y A;  1T0Y A;  4TQ1 A;  3DPD A;  1SIF A;  3H9D A;  2FCM A;  3VHT C;  2DYM A;  4JGH B;  4LJP B;  4KV2 A;  2CHW A;  4AP4 C;  3HIZ A;  2MSE D;  4IG7 B;  4KIK B;  3UIO B;  1M94 A;  3VH3 B;  4EEW A;  5KHQ A;  5LLI A;  4EZK A;  3N30 A;  5L83 A;  2I1J A;  2L0F A;  4WJP A;  2FIF A;  2UYZ B;  3VFK A;  3CMM B;  1S1Q B;  1YIW A;  5JHA A;  2K6D B;  1IP9 A;  1TZ1 A;  2JUO A;  1CMX B;  3I3T B;  4W9F A;  5DPR A;  3RT3 B;  2HD5 B;  3N32 A;  4ICV A;  4BKT A;  3ZKJ C;  4FA6 A;  1WJ4 A;  3RCZ A;  1WGD A;  3OJ4 B;  2KKC A;  3ZRC A;  2NBV B;  2L3Z A;  2XBB C;  3ZDM C;  3A9K A;  1P98 A;  2CS4 A;  3OLM D;  2KFK A;  4IW0 A;  4TQ0 A;  3VXW A;  2LI5 A;  3ZVV A;  3ZRF A;  2JPH A;  4HWI B;  4HJK A;  4K7U A;  2D10 A;  2FCN A;  3APD A;  1UD7 A;  4GDL B;  5IA7 A;  4EOY A;  3KUD B;  2K8C A;  2N1W A;  4DHZ B;  3KUC B;  3A1Q A;  1TTN A;  2GBJ A;  4K7S A;  4II2 B;  2BF8 B;  3KUZ A;  2LVO A;  1WM3 A;  2PEA A;  3NS8 A;  3AXC A;  2OOB B;  3L13 A;  4PS8 A;  4AUQ C;  4W9L A;  3PRP B;  2EMT A;  3NZU A;  1WGR A;  2N9X A;  3JYU A;  3NZS A;  2N9P C;  1V49 A;  1YQB A;  1WR1 A;  2NR2 A;  3L17 A;  1ISN A;  4BBN F;  3A9J B;  2G3Q B;  3ZNI D;  1OEY J;  3V62 A;  5IAA C;  1WE7 A;  2IO0 B;  2OJR A;  2M17 A;  2YLM A;  4BKS D;  4NPN A;  2KD0 A;  2KLG A;  3B0A A;  1XD3 B;  3PLV A;  1SGH A;  3EC8 A;  3DBH I;  1WI0 A;  3M95 A;  1WMH B;  3CST A;  5D7G A;  3M3J A;  2MX2 A;  3EHV A;  1U4A A;  2V3S A;  3A4R A;  2WWZ A;  3RZF A;  1X1M A;  3ZNZ B;  4I6L B;  2GBN A;  2LUE A;  2PE6 B;  3T9L A;  3VTW A;  2W9N A;  3UIP B;  1J0G A;  1UBI A;  2IY1 B;  4LJO B;  3KYD D;  4A3P A;  4KVG B;  2CKH B;  3HM3 A;  4PS7 A;  3IVF A;  3CF6 E;  1WGG A;  4KZ0 A;  4N9F 4;  2BYV E;  4WWP A;  2FCS A;  2LWP A;  4I6P A;  2Z0E B;  4JIO U;  4JLC A;  3OAW A;  4GDL A;  2JZZ A;  4HPL B;  1V5T A;  3L16 A;  4B9K A;  3ML9 A;  5CTR C;  3ZTD A;  4M0W B;  2JF5 A;  3QAQ A;  4WJQ A;  4DDG D;  4E74 A;  2KC1 A;  1C1Y B;  3PTF C;  1P0R A;  1WXS A;  2DAF A;  2GBM A;  2KTF A;  4EUT A;  2XK5 B;  2GOW A;  2O6V D;  4KSK C;  2DZI A;  2M1M A;  3AUL A;  4HDQ A;  4KDI C;  4EFO A;  3A9J A;  4EZJ A;  3IG3 A;  3Q3J A;  5HKH A;  2BGF A;  2K39 A;  3JSV B;  3TBL D;  5D6J B;  1Z2M A;  4M8M A;  3V6E B;  1WM2 A;  3H7P B;  3WAL A;  3RYT A;  3QX1 A;  1GC6 A;  3R7Q A;  4DBG A;  1WMH A;  3QWZ B;  4MM3 A;  3APC A;  4K1R B;  1TGZ B;  4X57 B;  3ZO5 B;  4NJ7 A;  2AYO B;  1IPG A;  4WJN A;  2MRP A;  3VTV A;  4AJY B;  3PRZ A;  1J8C A;  4FHJ A;  3JVZ X;  1EO6 A;  2LRU A;  3L0W B;  2KO3 A;  3DCG A;  4FJZ A;  2DYO A;  4K7W A;  4KDL B;  4LCD E;  4MGK E;  3R7R A;  3WAP A;  1MG8 A;  1RFA A;  1SE9 A;  3APF A;  2M0X A;  3GOE A;  2Z59 B;  2FCQ A;  2C7N B;  1J19 A;  2K25 A;  2K1F A;  2ZEQ A;  2KC2 A;  3QHT A;  1RAX A;  1WZ3 A;  3DBR I;  3X23 A;  2J0M A;  2J7Q B;  2DX5 B;  4J6I A;  4MGI E;  4W9D A;  2JWZ A;  4K81 A;  5E6O A;  1WX8 A;  5TR5 A;  3TCA A;  2NVU I;  5CX3 A;  3D32 A;  4ZRJ A;  2L76 A;  4A3O A;  2L8J A;  5JHB A;  1HE8 A;  3NOB A;  2RD0 A;  3QIJ A;  2M4N A;  3KW5 B;  1JRU A;  4F8C B;  1KOT A;  2K6Q A;  4BOS C;  2KHW B;  2AWT A;  4GGQ A;  4W9J A;  2ASQ A;  2XK5 A;  1YX6 B;  2KJ6 A;  1R4M I;  1UH6 A;  2NS5 A;  2ZPN A;  2VRR B;  3BY4 B;  1XQQ A;  2C5L C;  1OEY A;  3ONS A;  4ZRI A;  4OVU A;  2GMI C;  3QK0 A;  1WIA A;  2L05 A;  4TUU A;  3VUY A;  2DEN B;  3QJZ A;  2JZ3 B;  3JSV A;  4KSL C;  4GDK B;  5D2M B;  5E6N A;  2AL6 A;  3H7P A;  4BFR A;  4E71 A;  4RMA A;  4G50 A;  2DZM A;  2ZCB A;  2LGX A;  2CU1 A;  4IUM B;  1RRB A;  3PHX B;  2V1Y A;  2LXC A;  4G11 A;  2EKE C;  2KWV B;  2LXA A;  2KAN A;  3K9O B;  3W1Y A;  3ZTC A;  5DCN A;  3X0W A;  4NY0 A;  2KTR B;  2WDT B;  3Q3F A;  4GIV A;  1FXT B;  2N9E B;  4F1S A;  2LD9 A;  2AEH A;  2KX0 A;  2A5U A;  4DHZ E;  2NBU A;  1H8C A;  2IO3 B;  3PSE B;  2HTH A;  2BYE A;  5DPT A;  4GOC A;  2N7E A;  3W1S A;  2O6V B;  4DWF A;  3DOW A;  1WR6 E;  4FJV B;  1R4N I;  4ANV A;  1V9J A;  1NBF C;  4IM0 A;  4CHK A;  1G6J A;  2I1K A;  1EUV B;  3PVL A;  4NNJ B;  4KIK A;  3RZW C;  4BKS A;  5CHV C; 
#chains in the Genus database with same CATH topology
 4KGR A;  4RF1 A;  4HLE A;  1KF6 B;  1E7V A;  1WE6 A;  1YJ1 A;  3AED B;  3V3X A;  1EWC A;  1PFD A;  4MSQ B;  3BVG A;  4A20 A;  3TSS A;  4P1C C;  1XT9 B;  2INP E;  1V86 A;  3CSF A;  4HDO A;  3RNE C;  2DZK A;  1WXV A;  2D3G A;  2FUH B;  1XO3 A;  4GMV A;  3P4P B;  1R4N B;  2RGF A;  1ZE3 D;  5IP4 D;  2L7R A;  2MBO A;  2QDF A;  4OVV A;  2C60 A;  4FAD A;  1FNU A;  2ZVO A;  1C79 A;  2KOX A;  1P1A A;  4DHJ D;  2CHZ A;  2KJR A;  1TKY A;  1EF5 A;  2GBK A;  3N1X C;  2Q5W D;  2RMM A;  1LFD A;  1E8Z A;  2ZZP B;  2ZNV B;  4E3C A;  3W1S C;  1SSN A;  4ANX A;  4CO7 A;  1F0Z A;  2KDI A;  4P7I A;  2GBR A;  1YD8 U;  2BYT A;  2DAJ A;  5DPW A;  2K9X A;  3Q3O C;  2A4Z A;  5EDS A;  2D11 A;  3DQV A;  1OTR B;  2N0S B;  2MW5 A;  3WIM A;  2BQQ A;  2W54 A;  1D5X C;  3AE2 B;  3WAM A;  2KDB A;  4IM3 A;  1E7U A;  3AEE B;  1WYW B;  1KLG D;  3RFZ B;  2HTM E;  1YN4 A;  3ZXR A;  1WH3 A;  4REZ A;  2Y5B B;  2J42 A;  1XEE A;  3GZN I;  1EF1 A;  1XLO A;  5IOI A;  1SE4 A;  2C7H A;  2K8H A;  3LYY A;  4ASW C;  2PLP A;  3W5V B;  3VRA B;  2FUG 1;  1FNV A;  1OGW A;  1PGX A;  3L08 A;  5G5G A;  3DDC B;  4G3X B;  2Y5C A;  2R61 A;  2RDG A;  1F9J A;  3N3K B;  4W9E A;  4QAY A;  1TBE A;  3P63 A;  2D3A A;  2PVO D;  5EE3 A;  2YVC A;  3AEA B;  5G55 A;  4L1B A;  2J0K A;  1UUP A;  3NZ3 A;  4IOI E;  1V1O A;  1HTO A;  4NQK E;  2KLC A;  1YX5 B;  2WHI A;  3PV1 A;  3VDZ A;  3U52 E;  2OHF A;  3IHP C;  1F2R I;  1WX7 A;  2ZVN A;  3AU4 A;  3HHM A;  1LGR A;  1AAR A;  3Q6B A;  1PGB A;  1E8Y A;  1YJI A;  2CU3 A;  4K3B A;  2JY6 A;  4OZA A;  3S2A A;  4ZRP A;  5L95 C;  3R3M A;  4D2K A;  4OZC A;  3L10 B;  3AEF B;  4AOF A;  2FNJ B;  2BPS A;  2WXF A;  1L2N A;  1D3Z A;  4P1B C;  1XXG A;  4WAA A;  3SDL C;  1WFY A;  2JXT A;  2CHX A;  2WXG A;  1Z5S B;  2AQ3 B;  2K8B A;  2KZR A;  1Q1O A;  4KKI A;  4RFB A;  1HXY D;  3RUI B;  2M0A A;  3I63 C;  1K53 A;  1NI2 A;  3ZNG C;  2JRI B;  1E0Z A;  4J3O D;  1V97 A;  3IXS A;  2WX0 A;  5C23 A;  3DVN U;  1J7B A;  1S3S G;  4XZ4 A;  3MTN B;  3TIX A;  3VR8 B;  3LJ3 A;  2WYQ A;  2CR5 A;  3UQB A;  2PVG C;  3IAS 1;  2SAK A;  4G0N B;  1LXD A;  4S0R A;  1T0Y A;  4TQ1 A;  4LJP B;  1YOV B;  4AP4 C;  3UIO B;  3DWG C;  4XWW A;  2FIF A;  2JSV X;  1YIW A;  3I3T B;  4W9F A;  3RT3 B;  2HD5 B;  3ZKJ C;  1OQQ A;  4M01 A;  4FA6 A;  2NBV B;  3ZDM C;  1SJH D;  2CS4 A;  2LGI A;  4RCO A;  4HJK A;  3GE8 C;  1UD7 A;  2WDV B;  3BYY B;  2V0G A;  1N6Z A;  3KUC B;  1TTN A;  1XLQ A;  5IKC M;  3KUZ A;  1IGD A;  2LVO A;  1TT5 B;  1ET9 A;  4C7Z A;  2WXN A;  4Q2J A;  2N9X A;  1V49 A;  3ZJV A;  4RF0 A;  3CIR B;  5FKA C;  3V62 A;  1R4M B;  1YJJ A;  2GLS A;  4HJG E;  3B0A A;  1SGH A;  3DBH I;  1WI0 A;  1VRA B;  3CST A;  2OJW A;  3EHV A;  4MM3 B;  1JWU D;  1WYG A;  2KQ4 X;  4I6L B;  2PE6 B;  3T9L A;  4ARC A;  4LJO B;  3KYD D;  4KKJ A;  2CKH B;  1F2R C;  3P4Q B;  4XE0 A;  3CF6 E;  5AUI A;  4M00 A;  2HJ1 A;  3Q8F A;  3OAW A;  3L16 A;  1VDV A;  4WJQ A;  3NUH B;  2KC1 A;  3PTF C;  1E6E B;  3N1Y C;  1BXT A;  4EUT A;  4ZHP A;  3IG3 A;  3Q3J A;  4HKQ A;  1L0Y B;  5D6J B;  1ZXI A;  4MH8 A;  3RNA C;  1K51 A;  1UF0 A;  4MM3 A;  1TY2 A;  1TGZ B;  3ZO5 B;  2BS4 B;  4AJY B;  4YSZ B;  4GLS C;  3L0W B;  1EO6 A;  2KO3 A;  4KDL B;  4MGK E;  1SE9 A;  1RFA A;  1EU3 A;  1I4X A;  2FCQ A;  1HZ6 A;  3DBR I;  1RM6 C;  2J7Q B;  4MGI E;  2IPK D;  3TCA A;  1C9F A;  3D32 A;  2L76 A;  1VLB A;  1N61 A;  3NOB A;  2M4N A;  1JRU A;  1YQ3 B;  2VH2 A;  2WXH A;  2K6Q A;  5IN7 A;  4GGQ A;  1R4M I;  2SEB D;  2NS5 A;  4BZA A;  1GB4 A;  2C5L C;  1OEY A;  4ZRI A;  4OVU A;  1WIA A;  4KSL C;  5GXG B;  2JZP A;  4N58 A;  2LGX A;  1RRB A;  3PHX B;  5IO9 A;  4G11 A;  1WWT A;  2KAN A;  3W1Y A;  2CJO A;  4A8X C;  4NY0 A;  2N9E B;  1TS4 A;  2LD9 A;  2DLB A;  1JCK B;  1ROE A;  1AYF A;  3W1S A;  1HEZ E;  1QOF A;  2B76 B;  1FM0 D;  1WR6 E;  4ANV A;  4IM0 A;  3PVL A;  1STE A;  3KH0 A;  4LTU A;  3VVW B;  4JQW C;  4RM8 A;  4C00 A;  2LAS A;  3R2T A;  5FK9 C;  3VUW A;  1MI0 A;  3BVM A;  4HPM B;  1I4P A;  3AE4 B;  4ARI A;  3AMZ A;  2I2Y A;  5JZE B;  3DVG X;  1TKE A;  2JXX A;  4M02 A;  1VJK A;  1TIF A;  2M19 A;  3AH7 A;  1E9M A;  1L4D B;  1NEN B;  3OG5 A;  2AL3 A;  3QCA A;  1V8C A;  1WY8 A;  4ICU A;  2KJH B;  5KHO A;  4PK1 A;  4TV3 A;  3TEW A;  1FRR A;  3C19 A;  3ZDT A;  2W82 A;  1I35 A;  4AQ7 A;  2BS3 B;  3SHQ A;  1C4P A;  3P4S B;  3SEB A;  3MJ5 A;  3DVN V;  4WH4 A;  4ANW A;  4PYU A;  3ALB A;  1L0V B;  4A9A A;  1UGJ A;  2QMT A;  2QHO A;  3BIN A;  4HEA 1;  3PO0 A;  1JWS D;  1IUE A;  4MSM B;  2WNM A;  1L4Z B;  3O65 B;  4RH6 A;  4XGA B;  2WXI A;  1CJE A;  4B95 A;  4MGZ E;  5C1Z A;  3ZGZ A;  2R2O A;  3VQI A;  4RGM A;  1QLB B;  4L2Y A;  5LNK 1;  1JW9 D;  5GMV A;  2H88 B;  4O1N A;  2KMA A;  2LGD A;  3Q14 C;  2G9H D;  4DK5 A;  2KN4 A;  3TMP B;  3P4R B;  2TSS A;  2KFJ A;  4AWJ A;  3V6C B;  1UGM A;  4JWU C;  1FCL A;  3EUB 2;  2REX A;  3DBL B;  5FR6 A;  4LNK A;  5CHW A;  2IGD A;  4WQO B;  2GRI A;  3HUI A;  3W5U B;  3V60 A;  1MPE A;  2KQ7 A;  3W9C B;  2KNB A;  5G5H A;  3BII D;  1N5W A;  1N62 A;  1K8R B;  3IFW B;  1JWM D;  1E7P B;  1I4G A;  1SF0 A;  1P3Q U;  1IGC A;  1EU4 A;  2KYW A;  3U4E G;  2N7J A;  5BYR A;  2LMC A;  3TJP A;  3K9P B;  3T3O A;  3WA0 A;  1FMA D;  1L0X B;  2M8S A;  2D2Q A;  3ZXV A;  3I57 A;  1F1H A;  4ZYN A;  2QSD A;  4NJ6 A;  1MVK A;  5CHF A;  1T0Q C;  2Z0D B;  1FCC C;  4HPP A;  3WAN A;  1FFV A;  3RNC C;  1MG4 A;  1CK1 A;  3P2B A;  1VZ7 A;  4FN2 A;  3EFU A;  5G2N A;  2N4F A;  1KH0 A;  2VH1 A;  3T8M A;  2VZK B;  1HZ5 A;  5HFY A;  4I6N B;  3ETR A;  4WWO A;  1V2Y A;  3NHE B;  2N9K A;  4ZRK A;  4HXD A;  2PPH A;  1WGK A;  4GSW A;  1HA5 A;  1L5P A;  4W9K A;  3ML8 A;  4PT5 A;  2NMQ A;  4W9C A;  5HHD G;  2WXL A;  1OQY A;  4HRS A;  3HM6 X;  3WAO A;  3UIN B;  1N63 A;  1UBQ A;  2FAZ A;  4NAM A;  1YQ4 B;  4MEL A;  1XCQ L;  2Y3A A;  2NTS A;  2IYD B;  4WWN A;  2CJN A;  1QOB A;  2EMS A;  1D5Z C;  3B08 A;  1VD2 A;  2V4L A;  4HK2 A;  3DBS A;  3Q8A A;  4US8 A;  4FLH A;  2LVQ A;  4HCP B;  1XCT L;  1GPX A;  3O13 A;  3KWL A;  1QF6 A;  3DBL I;  3PHW B;  1EM7 A;  2RPQ A;  2RSU A;  1Y8R C;  2V4I B;  5AZH A;  2L00 B;  4BKG A;  2KWC A;  1QOA A;  3A1Q B;  2LHE A;  3TL5 A;  2WXJ A;  4YSY B;  1LM8 B;  4JPS A;  3NVZ A;  2MBQ A;  2LGS A;  2QIL A;  2N9L A;  2FCM A;  3VHT C;  4JGH B;  2IND C;  3AEB B;  4YWG G;  4KIK B;  1M94 A;  1FXA A;  2PMV A;  1Y56 A;  4ZRQ A;  3BVZ A;  2L0F A;  2UYZ B;  3VFK A;  2WDQ B;  3AV8 A;  1TZ1 A;  1VR9 A;  2FE8 A;  2WXO A;  5DPR A;  1F77 A;  3AE3 B;  3OJ4 B;  2KKC A;  1JAL A;  2XBB C;  1QOG A;  3NVW A;  4XYC A;  2OED A;  3ZYY X;  2Y5P A;  4IW0 A;  4TQ0 A;  4HWI B;  5T8I A;  4YTM B;  3APD A;  5C3J B;  4UDU C;  3KUD B;  2K8C A;  3A1Q A;  2PEA A;  3NS8 A;  3L13 A;  4AUQ C;  5EE9 A;  3NZU A;  2MJD A;  2N9P C;  3RNB C;  1YQB A;  1K52 A;  2WXM A;  2G3Q B;  3ZNI D;  1WSP A;  5IAA C;  1WE7 A;  4L23 A;  5HI1 A;  2KD0 A;  2KLG A;  5C2T B;  1F52 A;  5MPO A;  1U4A A;  5EE0 A;  3NRZ A;  3RZF A;  1X1M A;  4N59 A;  3ZNZ B;  2GBN A;  3UIP B;  4C80 A;  1J0G A;  4KX6 B;  4LNI A;  2IY1 B;  4WQM A;  2RDH A;  1VZ8 A;  4PS7 A;  1ESF A;  4RNA A;  2LWP A;  1JQ4 A;  3ML9 A;  2WDR B;  4LNF A;  4M0W B;  2JF5 A;  3QAQ A;  4P6V F;  1MHX A;  4JX1 C;  1P0R A;  3DBH B;  2UU7 A;  4KSK C;  1ZUD 2;  2M1M A;  3AE8 B;  2K39 A;  4NZL B;  2EEL A;  3JSV B;  3V6E B;  1WM2 A;  3H7P B;  1KRH A;  3WAL A;  3R7Q A;  2KAJ A;  3VRB B;  3APC A;  1SE2 A;  1QT9 A;  4NJ7 A;  2MRP A;  1TS3 A;  3JVZ X;  2DYO A;  4K7W A;  3R7R A;  1QQR A;  3GOE A;  1TYG B;  2K1F A;  1WZ3 A;  2J0M A;  4W9D A;  5TR5 A;  4K81 A;  4C56 C;  4MT5 A;  3GB1 A;  4ZRJ A;  3AE5 B;  1HE8 A;  4M0W A;  3Q3N C;  1I4Q A;  2QJL A;  1T6B X;  4F8C B;  4BOS C;  2AWT A;  1I4H A;  4W9J A;  1YX6 B;  1UH6 A;  3Q8E A;  3RPF C;  4RGT A;  2VRR B;  3BY4 B;  3NVY A;  2K22 A;  2IJ0 A;  3ONS A;  2AQ1 B;  2GMI C;  3QK0 A;  2DEN B;  3JSV A;  2L32 A;  5E6N A;  3H7P A;  1AWD A;  2ACZ B;  4IUM B;  3DBR B;  2LXC A;  1TKG A;  2LXA A;  3K9O B;  5DCN A;  2KTR B;  2WDT B;  4USA A;  4F1S A;  2NBU A;  2IO3 B;  2BW2 A;  2BYE A;  2JQR B;  4GOC A;  3C8Y A;  2KVZ A;  2O6V B;  4DWF A;  1OFF A;  4FJV B;  1V9J A;  4NNJ B;  3UQA A;  4BKS A;  1C77 A;  3DHI C;  1T0S C;  3N1Z C;  2O2V B;  1KLV A;  2NCN A;  4URK A;  3EFC A;  3LXF A;  4IWQ A;  2BTE A;  1JRP A;  3NS1 A;  3C0R B;  4EKU A;  1UZX B;  4GN1 A;  4ZOH C;  2ZJD A;  3L54 A;  2E6X A;  2LEK A;  4TSS A;  1Q5W B;  2KN5 A;  2DHZ A;  4A6Q A;  2PJH A;  4FUL A;  1SIJ A;  1ZXH A;  3I5J C;  1V1P B;  3RUL A;  3PT2 B;  3MJW A;  5FR3 A;  1GJZ A;  2X38 A;  3HVD A;  3V61 A;  3FAH A;  2D3B A;  4YL8 A;  3TEZ A;  2JU6 X;  3AE7 B;  1A5R A;  1JML A;  2LGY A;  3U30 A;  3ZNH B;  3PRE A;  3AU5 A;  2HE7 A;  2IBI B;  3B2G A;  2K0P A;  4H2A A;  2O6V A;  1FD6 A;  2DNF A;  2IO1 B;  1ZW7 A;  3ECI A;  2DZJ A;  2KAC A;  2O2V A;  1J7A A;  3DWM A;  1B9R A;  1KM7 A;  2KQS A;  3M63 B;  1CQV A;  3AE9 B;  4XX5 A;  3UI3 A;  4MJS B;  1WGY A;  3EA6 A;  4BOZ B;  2KWU B;  4BVU C;  4MDK E;  2VZK D;  1D5M C;  2D07 B;  1N5X A;  1B1Z A;  2KX3 A;  2R2Q A;  3VAW A;  1PDX A;  5AZF A;  4IC7 B;  2MCN B;  3ABV B;  2LJI A;  2IY0 B;  1I7H A;  4R3D A;  2MHJ A;  1IYF A;  3VR9 B;  1WXQ A;  4FJY A;  2AQ2 B;  5D3I B;  4JWS C;  3V05 A;  1V80 A;  3A33 B;  1NI3 A;  4XWT A;  1TZO A;  4IDI A;  4ZDV A;  1SEB D;  4WIP A;  1SXT A;  1A70 A;  2BB6 A;  2W3R A;  2KVR A;  1TS2 A;  4AJW A;  3RNG C;  4MJS A;  4MAC A;  4W9H A;  2PIA A;  2BB5 A;  2QIE B;  1NYR A;  2MP2 B;  5J18 A;  4IM2 A;  2W55 A;  2LHD A;  5AZG A;  1E90 A;  2C7M B;  1E8X A;  4GB9 A;  1GC7 A;  2LVP A;  5AEK B;  4WUR A;  4ANU A;  1P9D U;  1WGH A;  3KYC D;  2MEK A;  4II3 B;  3VH4 B;  3WCQ A;  2JT4 B;  4PYZ A;  2BS2 B;  1Q0W B;  5J17 A;  1WF9 A;  5D3D A;  4LDT B;  1KLU D;  2JRH A;  4NQL B;  2WU2 B;  1WJU A;  3QQ8 B;  2JYT A;  1IBX B;  5H8Y E;  3U7Z A;  1V81 A;  2H89 B;  2J0J A;  2KDF B;  2MBH A;  3TEY A;  3FKY A;  1H4R A;  4C7Y A;  2RDB C;  4HKZ E;  4B0M A;  2N7D A;  1WZ0 A;  1ZKH A;  2DYB A;  2MP2 A;  2KK8 A;  1WX9 A;  2BVC A;  2PKO A;  4YT0 B;  3UF8 A;  2K3U A;  1LQB A;  4DDI D;  2YEP B;  3TUO A;  4BBN C;  4S17 A;  2MA9 B;  4B6W A;  3ZW3 A;  2WXK A;  1GUA B;  3GE3 C;  2XN9 C;  5DPS A;  3U8Z A;  1ZGU B;  4IWP A;  2JWU A;  3PZ7 A;  3RMK C;  3A9K B;  2MQJ A;  1IBX A;  2JX5 A;  1R7S A;  1MHH E;  2KFK B;  4MEM A;  1T3Q A;  5E6P A;  3SFD B;  4DXA B;  3Q2A C;  3J9C A;  4MH0 E;  1SB3 C;  3N20 C;  2J52 A;  4HVB A;  2UWQ A;  4JL9 A;  1SBB B;  3KQ4 A;  3DPD A;  1SIF A;  3H9D A;  3U2S C;  2DYM A;  4KV2 A;  3VH3 B;  5L83 A;  2I1J A;  2K6D B;  1IP9 A;  2JUO A;  2GI9 A;  3MFG A;  4C4V B;  4BKT A;  3MC8 A;  3Q3M C;  1WJ4 A;  4OVZ A;  3ZRC A;  1FIQ A;  3A9K A;  1P98 A;  4KGT A;  2ZW0 A;  3OLM D;  2KFK A;  3T3N A;  2J4X A;  2K5P A;  3VXW A;  3ZRF A;  2JPH A;  4K7U A;  2D10 A;  3FC4 A;  3BZD B;  1RYJ A;  1C4C A;  4DHZ B;  2M56 B;  2BF8 B;  4ITK A;  1WM3 A;  3PZ8 A;  4DXG A;  2QEJ C;  3PRP B;  4US9 A;  2WS3 B;  1WGR A;  1C76 A;  3NZS A;  1K50 A;  2NR2 A;  3L17 A;  2IO0 B;  1QIL A;  1ZOY B;  2OJR A;  2M17 A;  2YLM A;  4BKS D;  3PLV A;  3EC8 A;  1FO4 A;  1WMH B;  5D7G A;  2XNA C;  4LNN A;  3DHH C;  3KWV A;  3A4R A;  4C4V A;  2IDY A;  5EE1 A;  2W9N A;  3TEX A;  1D4B A;  4KGS A;  4N9F 4;  4KZ0 A;  1OQR A;  4WWP A;  5I4D A;  2FCS A;  1Q10 A;  2MJE A;  1SE3 A;  4JIO U;  2JZZ A;  1V5T A;  4B9K A;  5CTR C;  4OW0 A;  3ZTD A;  1WXS A;  2DAF A;  2GBM A;  3GS2 A;  1HTQ A;  4EE2 A;  3LB8 C;  2GOW A;  2O6V D;  2DZI A;  1YMH E;  3AUL A;  4HDQ A;  4KDI C;  5H92 C;  2BGF A;  1DOI A;  4ZYS A;  1Z2M A;  4M8M A;  4DXF A;  3RYT A;  1DOY A;  1GC6 A;  1WMH A;  1KTK A;  1PYW D;  4WJN A;  3VTV A;  4FJZ A;  4WAF A;  4LCD E;  1GB1 A;  2M0X A;  2Z59 B;  2C7N B;  3X23 A;  2K25 A;  2WQY B;  4J6I A;  2NVU I;  4DQO C;  4LK0 M;  4A3O A;  2L8J A;  1E10 A;  1BML C;  2I38 A;  5JHB A;  3NJT A;  2KWD A;  5BMH A;  1KOT A;  5AUK A;  2ASQ A;  2KJ6 A;  3P1M A;  1XF5 L;  3RNF C;  3E56 A;  4GDK B;  2AL6 A;  4BFR A;  4E71 A;  4RMA A;  4G50 A;  3P42 A;  1NEK B;  1BUI C;  2EKE C;  4N6E B;  2YEP F;  3X0W A;  3Q3F A;  4GIV A;  2AEH A;  3NVV A;  2A5U A;  2WP9 B;  1H8C A;  3PSE B;  1FXI A;  2HTH A;  2W3S A;  1T0R C;  3EGR A;  3IT6 B;  3AE6 B;  1R4N I;  5BYQ A;  4CHK A;  1EUV B;  4YSX B;  3MP9 A;  4KIK A;  4TMA B;  5CHV C;  2LUM A;  2C9W B;  1ZPS A;  1T5X D;  4NAW B;  2BWE S;  2MWS B;  1WJ6 A;  4FHK A;  3ZJU A;  3R2I A;  1JRO A;  2N1V A;  3B1L X;  2IZV B;  3B2F A;  4LNO A;  1WXA A;  2KT7 A;  1KJT A;  2HDE A;  4GDK A;  5BO4 B;  2G4D B;  3ZJT A;  3MC9 A;  1V6E A;  3URY A;  4EZL A;  4IWO A;  2B3A A;  3KVF B;  5LXH A;  2Z8L A;  1C78 A;  2NPT B;  1NYQ A;  1DOX A;  1RLF A;  3MC0 B;  1FRD A;  1WXM A;  1GOZ A;  2QCZ A;  4IKG A;  4A90 A;  4XC2 A;  3QAR A;  1L6V A;  3PRM B;  2IO2 B;  1ZDV A;  4W9G A;  3EEC A;  1ZDX A;  3AN1 A;  2KDE B;  3MHS D;  4TKN A;  3VUX A;  1I42 A;  3BWU D;  4K3C A;  5JXV A;  1WJN A;  3HK0 A;  2HJ8 A;  3DHG C;  4NAW A;  2V3P A;  1DYQ A;  2RR9 A;  5LXI B;  4LDT D;  1L6U A;  3SD5 A;  1P7E A;  3L4P A;  4ACF A;  3U7D A;  2KMM A;  2X8X X;  2MBE A;  2L83 A;  2QC8 A;  4FBJ B;  4RGO S;  3ZUN A;  3UGB B;  3AE1 B;  4YTN B;  3H6N A;  3IT4 B;  1AW7 A;  4XDD A;  1QZE A;  3BK1 A;  2G45 B;  4NJC A;  1NVI D;  3VTU A;  3JW0 X;  1PQS A;  4ZHO A;  2NPT A;  2WGS A;  3I9V 1;  5BMG A;  4CQN A;  4RM9 A;  2L0T A;  4AS1 A;  2BKF A;  3ENE A;  3SR6 A;  3PS6 A;  1MJD A;  2INN E;  3RN9 C;  3RI7 C;  2G1E A;  2KDM A;  2PE9 A;  1AN8 A;  1ACC A;  3PGE A;  2KXJ A;  3QC8 B;  2EKI A;  2G4S A;  4MGY E;  3ZIM A;  1E5W A;  2ZPY A;  4F7Z A;  3Q8C A;  4YXD B;  1TY0 A;  2ONQ A;  4DHJ B;  4PS3 A;  4A55 A;  3NG0 A;  3ZQ4 A;  2MBB B;  2AX5 A;  3M62 B;  4GXB A;  3OWE B;  4CYE A;  3AEG B;  3IBE A;  2NBW B;  2V9H A;  2ICI A;  5D94 A;  1TJE A;  1D6E C;  3PPA A;  1HQR D;  4YTP B;  3H8H A;  1E8W A;  2ZCC A;  1GAQ B;  1VCB A;  1I4R A;  2DBY A;  1PGA A;  2MJ3 A;  4W9I A;  2INC C;  2PTL A;  2KTR A;  5JH5 C;  3DVG Y;  3AM9 A;  4XDC A;  1ZP0 B;  4M8N A;  3OJ3 A;  1GNU A;  3BYT B;  1C3T A;  2FID A;  1SJE D;  3NY5 A;  3R66 C;  3ZLZ A;  2ZNV C;  3QA8 A;  2LRW A;  2BYF A;  4KZC A;  3H1U A;  1BT0 A;  2XEW A;  2FBW B;  1WRD B;  2BWF A;  3H7S A;  4GU2 A;  2V3N A;  2WX1 A;  2LZ6 A;  2BKR B;  1NDD A;  1V1P A;  1GG3 A;  1FEH A;  1UEL A;  2IGG A;  2KMC A;  3Q8B A;  4WJO A;  3SU8 X;  4P16 A;  3LDZ E;  2LJ5 A;  4HRO A;  3SFE B;  1YNT E;  2JVC A;  5J2R A;  1UNS A;  3MHZ A;  1V5O A;  3PLU A;  4BAX A;  2RPV A;  3RD2 A;  1RWS A;  3A4S C;  4HCN B;  3PZD A;  3AI5 A;  2MLB A;  2LFI A;  1L7Y A;  2CHW A;  3E9S A;  3HIZ A;  2MSE D;  4IG7 B;  4EEW A;  5KHQ A;  5LLI A;  4EZK A;  3N30 A;  4WJP A;  3CMM B;  1S1Q B;  3HVZ A;  5JHA A;  2MH7 A;  1CMX B;  3N32 A;  4ICV A;  1N60 A;  3RCZ A;  1WGD A;  5TSS A;  1C4A A;  2L3Z A;  2ON8 A;  5E6J A;  3BK2 A;  1UWM A;  2D3C A;  2LI5 A;  3ZVV A;  2FCN A;  4GDL B;  5IA7 A;  4EOY A;  1ENF A;  2N1W A;  5BMI A;  2GBJ A;  4K7S A;  4II2 B;  3AXC A;  2OOB B;  4PS8 A;  4W9L A;  1JWA D;  1DGJ A;  2EMT A;  3JYU A;  3HRD D;  1WR1 A;  4BBN F;  1ISN A;  3A9J B;  1FPY A;  1OEY J;  1QKZ A;  4FXC A;  2L52 A;  4NPN A;  1XD3 B;  4LLG M;  1KFY B;  3M95 A;  3KLS X;  3M3J A;  2MX2 A;  3W2D A;  2V3S A;  1YN5 A;  2WWZ A;  3AEC B;  5HG2 A;  1WRI A;  2E3T A;  5BYS A;  2LUE A;  3VTW A;  2DWQ A;  2D5G A;  1J7C A;  1MFW A;  1UBI A;  4B0E A;  4A3P A;  4KVG B;  3GP7 A;  3HM3 A;  3IVF A;  4OZB A;  1WGG A;  1RFK A;  2BYV E;  2JYE A;  4I6P A;  2Z0E B;  4JLC A;  4GDL A;  4HPL B;  4DDG D;  4RGN A;  4E74 A;  1P7F A;  1C1Y B;  2ZW1 A;  2KTF A;  2WLB A;  1LO5 D;  4JE3 B;  2XK5 B;  3B9J A;  3FIL B;  4OHJ A;  4EFO A;  3A9J A;  4EZJ A;  5HKH A;  1TS5 A;  3TBL D;  3QX1 A;  4DBG A;  3QWZ B;  4K1R B;  4X57 B;  2AYO B;  1IPG A;  3R8B A;  3PRZ A;  3IAM 1;  1J8C A;  1ET6 A;  4FHJ A;  2LRU A;  1UWX A;  3DCG A;  3WAP A;  1CZP A;  1MG8 A;  3APF A;  3QHT A;  1XLN A;  1J19 A;  2ZEQ A;  2KC2 A;  1RAX A;  2DX5 B;  2JWZ A;  5E6O A;  1WX8 A;  2J53 A;  5CX3 A;  2BBC A;  3Q69 A;  2RD0 A;  3QIJ A;  1FNW A;  3KW5 B;  2L1A A;  2WXR A;  2KHW B;  2XK5 A;  1JWB D;  1XLP A;  4WWM A;  3FIL A;  2ZPN A;  2WXP A;  1XQQ A;  1PUT A;  4TUU A;  2L05 A;  3VUY A;  3QJZ A;  2JZ3 B;  5D2M B;  1VZ6 A;  2IGH A;  2NTT A;  1YN3 A;  2DZM A;  2ZCB A;  2CU1 A;  2V1Y A;  2KWV B;  3ZTC A;  2GB1 A;  2PW9 A;  2WU5 B;  1FXT B;  2KX0 A;  4DHZ E;  1FFU A;  5DPT A;  2N7E A;  2WXQ A;  3AB5 A;  2BT6 A;  3CWI A;  3DOW A;  1EWY C;  1M4V A;  1NBF C;  3N9Y C;  1G6J A;  2I1K A;  3RZW C;  3GZN B; 
#chains in the Genus database with same CATH homology
 3KH0 A;  2O2V B;  1KLV A;  2NCN A;  2C9W B;  4URK A;  4IWQ A;  3VVW B;  4JQW C;  4HLE A;  4NAW B;  4RM8 A;  3C0R B;  4EKU A;  2BWE S;  1UZX B;  2LAS A;  4GN1 A;  2ZJD A;  3L54 A;  3VUW A;  2MWS B;  1WJ6 A;  1E7V A;  4FHK A;  4HPM B;  1WE6 A;  1YJ1 A;  1Q5W B;  2KN5 A;  2N1V A;  3B1L X;  2DHZ A;  2IZV B;  2PJH A;  4MSQ B;  4FUL A;  4A20 A;  5JZE B;  1WXA A;  1KJT A;  4GDK A;  5BO4 B;  2G4D B;  3DVG X;  3RUL A;  3PT2 B;  3MJW A;  1XT9 B;  1V6E A;  2JXX A;  1GJZ A;  1V86 A;  3V61 A;  3CSF A;  4YL8 A;  4HDO A;  2DZK A;  1A5R A;  1WXV A;  2D3G A;  2FUH B;  4EZL A;  2LGY A;  4IWO A;  3U30 A;  4GMV A;  3ZNH B;  3PRE A;  2AL3 A;  2B3A A;  2RGF A;  3KVF B;  3AU5 A;  3QCA A;  5LXH A;  2HE7 A;  2L7R A;  2IBI B;  2NPT B;  1WY8 A;  1RLF A;  2MBO A;  4OVV A;  2C60 A;  4ICU A;  1WXM A;  2ZVO A;  2KJH B;  4FAD A;  5KHO A;  2KOX A;  4TV3 A;  4XC2 A;  1P1A A;  2O6V A;  3PRM B;  3QAR A;  4DHJ D;  2CHZ A;  2IO2 B;  2KJR A;  3EEC A;  2IO1 B;  4W9G A;  3ZDT A;  1ZW7 A;  1EF5 A;  2GBK A;  3ECI A;  2DZJ A;  1I35 A;  1LFD A;  2KDE B;  1E8Z A;  3SHQ A;  3MHS D;  4TKN A;  2O2V A;  3VUX A;  1I42 A;  1WJN A;  3HK0 A;  2HJ8 A;  4NAW A;  2ZZP B;  2ZNV B;  4E3C A;  3W1S C;  3DVN V;  1KM7 A;  4ANW A;  4PYU A;  2RR9 A;  3ALB A;  2KQS A;  3M63 B;  4ANX A;  4CO7 A;  2KDI A;  2QHO A;  4LDT D;  4P7I A;  5LXI B;  4XX5 A;  2GBR A;  1YD8 U;  3SD5 A;  2DAJ A;  3BIN A;  4MJS B;  1WGY A;  4BOZ B;  5DPW A;  2KWU B;  4MSM B;  4BVU C;  4MDK E;  3U7D A;  2D07 B;  2A4Z A;  2KX3 A;  5EDS A;  2MBE A;  3O65 B;  2D11 A;  2R2Q A;  3DQV A;  1OTR B;  3VAW A;  4FBJ B;  4B95 A;  2MW5 A;  4MGZ E;  3ZUN A;  3UGB B;  5C1Z A;  2R2O A;  3WIM A;  3H6N A;  3VQI A;  5AZF A;  4IC7 B;  2MCN B;  1QZE A;  2G45 B;  2IY0 B;  3WAM A;  5GMV A;  3VTU A;  2KDB A;  3JW0 X;  4IM3 A;  1IYF A;  1PQS A;  1E7U A;  2KMA A;  2LGD A;  2NPT A;  4FJY A;  1WYW B;  4DK5 A;  4RM9 A;  1WH3 A;  2Y5B B;  2L0T A;  3GZN I;  2BKF A;  1EF1 A;  1V80 A;  3ENE A;  3TMP B;  3PS6 A;  3A33 B;  2C7H A;  2K8H A;  2KFJ A;  4AWJ A;  3V6C B;  1UGM A;  4ZDV A;  4ASW C;  2PE9 A;  2REX A;  5FR6 A;  5CHW A;  1OGW A;  3L08 A;  3PGE A;  4WQO B;  2KXJ A;  3DDC B;  3QC8 B;  4G3X B;  2G4S A;  3V60 A;  2KVR A;  2KQ7 A;  4MGY E;  3ZIM A;  4AJW A;  1E5W A;  2KNB A;  2ZPY A;  1F9J A;  4MJS A;  3N3K B;  1K8R B;  4W9H A;  4W9E A;  3IFW B;  4F7Z A;  1P3Q U;  1TBE A;  2MP2 B;  5J18 A;  4IM2 A;  2YVC A;  4DHJ B;  5AZG A;  1E90 A;  2C7M B;  4PS3 A;  1E8X A;  5G55 A;  2J0K A;  4GB9 A;  3TJP A;  1GC7 A;  2LVP A;  3K9P B;  2MBB B;  3M62 B;  4GXB A;  3WA0 A;  5AEK B;  4CYE A;  2M8S A;  4ANU A;  1P9D U;  2D2Q A;  4NQK E;  1WGH A;  4ZYN A;  3KYC D;  2KLC A;  4NJ6 A;  4II3 B;  3IBE A;  5CHF A;  3VH4 B;  2NBW B;  2Z0D B;  1YX5 B;  3PV1 A;  3VDZ A;  3WAN A;  2JT4 B;  5D94 A;  4PYZ A;  1Q0W B;  5J17 A;  3PPA A;  1WF9 A;  4LDT B;  3IHP C;  3P2B A;  2JRH A;  4FN2 A;  3EFU A;  1WX7 A;  1E8W A;  2ZVN A;  2N4F A;  4NQL B;  2ZCC A;  3AU4 A;  5G2N A;  1WJU A;  3T8M A;  3HHM A;  3QQ8 B;  1VCB A;  4I6N B;  4WWO A;  1V2Y A;  3NHE B;  1V81 A;  2J0J A;  1AAR A;  2KDF B;  4W9I A;  2MBH A;  4ZRK A;  4HXD A;  1H4R A;  1E8Y A;  2PPH A;  2KTR A;  5JH5 C;  3DVG Y;  2JY6 A;  4GSW A;  3S2A A;  5L95 C;  3R3M A;  4M8N A;  2N7D A;  4W9K A;  3OJ3 A;  3ML8 A;  1GNU A;  1WZ0 A;  1ZKH A;  3L10 B;  4W9C A;  1C3T A;  2FID A;  2DYB A;  1OQY A;  4AOF A;  2MP2 A;  2KK8 A;  2FNJ B;  3HM6 X;  2BPS A;  3NY5 A;  3UIN B;  3WAO A;  1UBQ A;  3UQA A;  1WX9 A;  2FAZ A;  3R66 C;  3ZLZ A;  1L2N A;  2ZNV C;  4MEL A;  1D3Z A;  3UF8 A;  4WAA A;  3QA8 A;  1LQB A;  2IYD B;  4WWN A;  4DDI D;  2LRW A;  3SDL C;  2BYF A;  2EMS A;  4KZC A;  4BBN C;  1WFY A;  1VD2 A;  2CHX A;  3B08 A;  2V4L A;  4HK2 A;  1Z5S B;  2K8B A;  2KZR A;  3DBS A;  3H1U A;  2MA9 B;  2LVQ A;  4FLH A;  4HCP B;  1BT0 A;  2XEW A;  1Q1O A;  4B6W A;  3ZW3 A;  1GUA B;  1WRD B;  5DPS A;  2BWF A;  3U8Z A;  3H7S A;  4GU2 A;  1ZGU B;  2WX1 A;  4IWP A;  3RUI B;  2LZ6 A;  2BKR B;  3DBL I;  3PHW B;  1NDD A;  3A9K B;  1NI2 A;  2MQJ A;  1GG3 A;  3ZNG C;  2JRI B;  2RPQ A;  1UEL A;  2KFK B;  4WJO A;  2KMC A;  1Y8R C;  2RSU A;  2WX0 A;  4MEM A;  5AZH A;  3SU8 X;  5C23 A;  2L00 B;  3LDZ E;  2LJ5 A;  4BKG A;  3DVN U;  2KWC A;  5E6P A;  1S3S G;  4DXA B;  3A1Q B;  4XZ4 A;  3MTN B;  3TIX A;  3LJ3 A;  2WYQ A;  2JVC A;  5J2R A;  3TL5 A;  2CR5 A;  1V5O A;  3UQB A;  3PLU A;  1LM8 B;  4MH0 E;  3RD2 A;  3A4S C;  2MBQ A;  4HVB A;  4HCN B;  2UWQ A;  3PZD A;  4G0N B;  3AI5 A;  2MLB A;  4JL9 A;  1LXD A;  1L7Y A;  1T0Y A;  4TQ1 A;  3DPD A;  1SIF A;  3H9D A;  2FCM A;  3VHT C;  2DYM A;  4JGH B;  4LJP B;  4KV2 A;  2CHW A;  4AP4 C;  3HIZ A;  2MSE D;  4IG7 B;  4KIK B;  3UIO B;  1M94 A;  3VH3 B;  4EEW A;  5KHQ A;  5LLI A;  4EZK A;  3N30 A;  5L83 A;  2I1J A;  2L0F A;  4WJP A;  2FIF A;  2UYZ B;  3VFK A;  3CMM B;  1S1Q B;  1YIW A;  5JHA A;  2K6D B;  1IP9 A;  1TZ1 A;  2JUO A;  1CMX B;  3I3T B;  4W9F A;  5DPR A;  3RT3 B;  2HD5 B;  3N32 A;  4ICV A;  4BKT A;  3ZKJ C;  4FA6 A;  1WJ4 A;  3RCZ A;  1WGD A;  3OJ4 B;  2KKC A;  3ZRC A;  2NBV B;  2L3Z A;  2XBB C;  3ZDM C;  3A9K A;  1P98 A;  2CS4 A;  3OLM D;  2KFK A;  4IW0 A;  4TQ0 A;  3VXW A;  2LI5 A;  3ZVV A;  3ZRF A;  2JPH A;  4HWI B;  4HJK A;  4K7U A;  2D10 A;  2FCN A;  3APD A;  1UD7 A;  4GDL B;  5IA7 A;  4EOY A;  3KUD B;  2K8C A;  2N1W A;  4DHZ B;  3KUC B;  3A1Q A;  1TTN A;  2GBJ A;  4K7S A;  4II2 B;  2BF8 B;  3KUZ A;  2LVO A;  1WM3 A;  2PEA A;  3NS8 A;  3AXC A;  2OOB B;  3L13 A;  4PS8 A;  4AUQ C;  4W9L A;  3PRP B;  2EMT A;  3NZU A;  1WGR A;  2N9X A;  3JYU A;  3NZS A;  2N9P C;  1V49 A;  1YQB A;  1WR1 A;  2NR2 A;  3L17 A;  1ISN A;  4BBN F;  3A9J B;  2G3Q B;  3ZNI D;  1OEY J;  3V62 A;  5IAA C;  1WE7 A;  2IO0 B;  2OJR A;  2M17 A;  2YLM A;  4BKS D;  4NPN A;  2KD0 A;  2KLG A;  3B0A A;  1XD3 B;  3PLV A;  1SGH A;  3EC8 A;  3DBH I;  1WI0 A;  3M95 A;  1WMH B;  3CST A;  5D7G A;  3M3J A;  2MX2 A;  3EHV A;  1U4A A;  2V3S A;  3A4R A;  2WWZ A;  3RZF A;  1X1M A;  3ZNZ B;  4I6L B;  2GBN A;  2LUE A;  2PE6 B;  3T9L A;  3VTW A;  2W9N A;  3UIP B;  1J0G A;  1UBI A;  2IY1 B;  4LJO B;  3KYD D;  4A3P A;  4KVG B;  2CKH B;  3HM3 A;  4PS7 A;  3IVF A;  3CF6 E;  1WGG A;  4KZ0 A;  4N9F 4;  2BYV E;  4WWP A;  2FCS A;  2LWP A;  4I6P A;  2Z0E B;  4JIO U;  4JLC A;  3OAW A;  4GDL A;  2JZZ A;  4HPL B;  1V5T A;  3L16 A;  4B9K A;  3ML9 A;  5CTR C;  3ZTD A;  4M0W B;  2JF5 A;  3QAQ A;  4WJQ A;  4DDG D;  4E74 A;  2KC1 A;  1C1Y B;  3PTF C;  1P0R A;  1WXS A;  2DAF A;  2GBM A;  2KTF A;  4EUT A;  2XK5 B;  2GOW A;  2O6V D;  4KSK C;  2DZI A;  2M1M A;  3AUL A;  4HDQ A;  4KDI C;  4EFO A;  3A9J A;  4EZJ A;  3IG3 A;  3Q3J A;  5HKH A;  2BGF A;  2K39 A;  3JSV B;  3TBL D;  5D6J B;  1Z2M A;  4M8M A;  3V6E B;  1WM2 A;  3H7P B;  3WAL A;  3RYT A;  3QX1 A;  1GC6 A;  3R7Q A;  4DBG A;  1WMH A;  3QWZ B;  4MM3 A;  3APC A;  4K1R B;  1TGZ B;  4X57 B;  3ZO5 B;  4NJ7 A;  2AYO B;  1IPG A;  4WJN A;  2MRP A;  3VTV A;  4AJY B;  3PRZ A;  1J8C A;  4FHJ A;  3JVZ X;  1EO6 A;  2LRU A;  3L0W B;  2KO3 A;  3DCG A;  4FJZ A;  2DYO A;  4K7W A;  4KDL B;  4LCD E;  4MGK E;  3R7R A;  3WAP A;  1MG8 A;  1RFA A;  1SE9 A;  3APF A;  2M0X A;  3GOE A;  2Z59 B;  2FCQ A;  2C7N B;  1J19 A;  2K25 A;  2K1F A;  2ZEQ A;  2KC2 A;  3QHT A;  1RAX A;  1WZ3 A;  3DBR I;  3X23 A;  2J0M A;  2J7Q B;  2DX5 B;  4J6I A;  4MGI E;  4W9D A;  2JWZ A;  4K81 A;  5E6O A;  1WX8 A;  5TR5 A;  3TCA A;  2NVU I;  5CX3 A;  3D32 A;  4ZRJ A;  2L76 A;  4A3O A;  2L8J A;  5JHB A;  1HE8 A;  3NOB A;  2RD0 A;  3QIJ A;  2M4N A;  3KW5 B;  1JRU A;  4F8C B;  1KOT A;  2K6Q A;  4BOS C;  2KHW B;  2AWT A;  4GGQ A;  4W9J A;  2ASQ A;  2XK5 A;  1YX6 B;  2KJ6 A;  1R4M I;  1UH6 A;  2NS5 A;  2ZPN A;  2VRR B;  3BY4 B;  1XQQ A;  2C5L C;  1OEY A;  3ONS A;  4ZRI A;  4OVU A;  2GMI C;  3QK0 A;  1WIA A;  2L05 A;  4TUU A;  3VUY A;  2DEN B;  3QJZ A;  2JZ3 B;  3JSV A;  4KSL C;  4GDK B;  5D2M B;  5E6N A;  2AL6 A;  3H7P A;  4BFR A;  4E71 A;  4RMA A;  4G50 A;  2DZM A;  2ZCB A;  2LGX A;  2CU1 A;  4IUM B;  1RRB A;  3PHX B;  2V1Y A;  2LXC A;  4G11 A;  2EKE C;  2KWV B;  2LXA A;  2KAN A;  3K9O B;  3W1Y A;  3ZTC A;  5DCN A;  3X0W A;  4NY0 A;  2KTR B;  2WDT B;  3Q3F A;  4GIV A;  1FXT B;  2N9E B;  4F1S A;  2LD9 A;  2AEH A;  2KX0 A;  2A5U A;  4DHZ E;  2NBU A;  1H8C A;  2IO3 B;  3PSE B;  2HTH A;  2BYE A;  5DPT A;  4GOC A;  2N7E A;  3W1S A;  2O6V B;  4DWF A;  3DOW A;  1WR6 E;  4FJV B;  1R4N I;  4ANV A;  1V9J A;  1NBF C;  4IM0 A;  4CHK A;  1G6J A;  2I1K A;  1EUV B;  3PVL A;  4NNJ B;  4KIK A;  3RZW C;  4BKS A;  5CHV C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...