2G4DB

Crystal structure of human senp1 mutant (c603s) in complex with sumo-1
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
78
structure length
78
Chain Sequence
EYIKLKVIGQDSSEIHFKVKMTTHLKKLKESYCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENP1 protein
publication title Crystal structure of the SENP1 mutant C603S-SUMO complex reveals the hydrolytic mechanism of SUMO-specific protease
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/protein binding
total genus 16
structure length 78
sequence length 78
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-02-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2g4dB00
4BBNC 2FIDA 4GN1A 4RMAA 4HCNB 2IZVB 4K7UA 1WM2A 2O2VB 4IM2A 4I6LB 3U30A 3UGBB 4DBGA 1E8XA 3O65B 3SHQA 1ZKHA 4KSLC 4W9IA 3ZLZA 2M4NA 2JZ3B 3PHXB 3ZVVA 4JLCA 5CHWA 3ZDTA 4HVBA 5GMVA 2L0FA 2KFKA 4II3B 3BY4B 1C3TA 3A9JB 2FAZA 4BKGA 1XQQA 4MSQB 3ML8A 4EUTA 2BKFA 2Z0DB 1J8CA 4MSMB 1H8CA 3NZUA 3ZTDA 4XX5A 3NZSA 2NPTB 3ZO5B 2KLCA 4DHZE 3WANA 3SD5A 4PS8A 3TMPB 4MGYE 4I6PA 2XEWA 3DPDA 3KYCD 4MJSB 1J0GA 5CHVC 3IFWB 2PE9A 4NY0A 2Y5BB 2KTFA 1XD3B 3KH0A 4F7ZA 1E90A 3H7PA 3L10B 4DHZB 5L95C 2N9PC 5AEKB 4M8MA 1NI2A 1UGMA 5J2RA 3AULA 2KJ6A 1WXAA 2DENB 4KIKB 3L16A 2JY6A 4GSWA 4MH0E 4B95A 4XC2A 2MW5A 2KFKB 4WJPA 2UYZB 3QWZB 4KZ0A 3VH3B 3ENEA 3DQVA 1WJ6A 2JZZA 4LDTB 4AOFA 3UQBA 4AUQC 1YIWA 3CF6E 1YX6B 2G45B 2JXXA 3K9OB 1OTRB 4LDTD 4M0WB 2L0TA 4NAWA 2RSUA 4NPNA 3PLUA 5KHOA 1IYFA 1G6JA 2RPQA 1WGRA 2K8CA 2C5LC 3QC8B 5J17A 4KZCA 3Q3JA 4A3PA 2KNBA 2J7QB 2KANA 5LXHA 2MWSB 3HM3A 3QJZA 2KDEB 2L7RA 4CYEA 1WH3A 4W9FA 2N7DA 3V6EB 2AYOB 3GOEA 2V3SA 3UIPB 3ZIMA 5CTRC 4MM3A 1EO6A 3RZWC 2CKHB 2JUOA 1ISNA 3KVFB 4W9CA 5E6PA 2GBMA 3W1SC 2V1YA 2K39A 4DXAB 4WAAA 2ZNVC 1NDDA 2OOBB 2MBEA 2FUHB 3WA0A 3DOWA 4FHKA 4GDLB 1P9DU 2VRRB 3QARA 2G4SA 3CMMB 4IC7B 1P3QU 4NAWB 4W9EA 3CSTA 1UELA 1GC7A 2GBKA 2IO0B 3V6CB 2KKCA 1ZGUB 2FIFA 3NS8A 2LWPA 2FCSA 2PEAA 2FCMA 2KD0A 1GUAB 3PPAA 3KUDB 4GDKA 4DK5A 2ZZPB 4JL9A 1TGZB 3VUYA 3R66C 1WI0A 2HE7A 2L8JA 4GGQA 3RD2A 2ZPYA 4KSKC 5AZGA 4JGHB 1WX7A 2KTRA 3HM6X 5C1ZA 3V60A 2KDIA 2KMCA 2MP2A 2LXCA 4TV3A 1WMHA 3DVGX 3ONSA 4J6IA 4MELA 3JSVB 4ZYNA 4ASWC 4W9JA 1WR1A 1GJZA 2B3AA 3A4SC 1CMXB 1MG8A 1V80A 2KHWB 1TTNA 2CR5A 3B0AA 1ZW7A 2L76A 3WIMA 3PV1A 4A20A 1YX5B 4AJWA 4F1SA 4E71A 2G4DB 2HD5B 3M3JA 1YQBA 4IWOA 3KW5B 2Z0EB 1E7VA 2O6VA 2XBBC 3N30A 5DCNA 5JH5C 2DAFA 3APFA 1EF5A 2AWTA 4LJOB 3PSEB 2EMSA 2KJRA 3MTNB 4CO7A 4MDKE 5DPTA 3RZFA 3P2BA 2KZRA 4WJNA 2K6DB 1U4AA 1WE7A 3L13A 4GOCA 2WX0A 2KJHB 2ZCCA 4K7WA 2BPSA 3EC8A 4W9DA 1BT0A 1WMHB 3WAPA 3OAWA 5LLIA 4LJPB 1LM8B 4FLHA 4PYUA 2N9XA 2DZMA 3DVNV 4W9GA 3A9KA 4RM8A 2CU1A 1P98A 4FADA 4MGKE 3RULA 4IM0A 1D3ZA 3TJPA 2PJHA 3IG3A 2ZEQA 4W9HA 3X23A 2NS5A 2LASA 4MGZE 3NHEB 3ZNHB 1WZ3A 2BYFA 2BWES 2ZVNA 2K8HA 2MBBB 3LJ3A 4HJKA 3JYUA 4ZRIA 4BOZB 2L00B 5G55A 4FA6A 1Q0WB 2MRPA 4KVGB 1V2YA 2IO3B 2O6VD 2MQJA 4G11A 3APDA 3QAQA 2M1MA 2LD9A 3JW0X 4B6WA 1V86A 4YL8A 2CHZA 3DDCB 2ZJDA 2DYOA 1TBEA 4GMVA 3QCAA 2BF8B 2IYDB 4KV2A 1OEYJ 1WY8A 3Q3FA 4TQ1A 1RFAA 3AU5A 3A9KB 3PGEA 1IPGA 2D3GA 1T0YA 2W9NA 4IW0A 4M8NA 3W1SA 1OGWA 3WAOA 2C60A 1L7YA 2AEHA 2UWQA 2IO2B 2JPHA 4NQLB 4HCPB 5E6OA 4W9KA 3AI5A 4AJYB 1P1AA 2MBQA 4KDLB 3VTUA 4GIVA 3M63B 2LUEA 3DBLI 4WWOA 1AARA 3SU8X 4E3CA 1LXDA 3R7RA 5BO4B 2KQ7A 3VUXA 3EHVA 2YLMA 4IM3A 4NQKE 2MBOA 2FNJB 2D2QA 4NJ7A 3H7PB 4I6NB 4HPLB 4FJYA 1I35A 3TL5A 2HTHA 2ZNVB 3A1QA 4II2B 3DVNU 1WX9A 2CHXA 2KDFB 1QZEA 5FR6A 3PTFC 4PYZA 5D94A 2N1WA 3PRZA 4NJ6A 2KMAA 3WAMA 5G2NA 5AZHA 3H7SA 1UZXB 2C7NB 1R4NI 1UBQA 1WZ0A 2LGDA 3VXWA 1I42A 2KK8A 3KUZA 4RM9A 2D07B 1WYWB 2RD0A 1WGDA 2DZKA 3R3MA 2CHWA 4IWQA 1WXMA 1Z5SB 4E74A 4G50A 3K9PB 1E5WA 3UF8A 5E6NA 1WRDB 3EECA 1WGHA 3H9DA 1WE6A 4LCDE 1C1YB 1L2NA 3C0RB 3DBRI 1WM3A 2LJ5A 2DZJA 2LGYA 3VH4B 3NY5A 3TBLD 4EZJA 2MX2A 2KLGA 2J0KA 1WGGA 4BFRA 3A1QB 1WIAA 4B9KA 3KYDD 1SGHA 2PPHA 3UINB 4WJOA 1SE9A 2IY1B 3VHTC 2REXA 4EZKA 3N3KB 1GC6A 2IY0B 2K1FA 4FJZA 1V5TA 1P0RA 4GU2A 1RLFA 3N32A 2KC2A 4X57B 5IA7A 1V49A 2JF5A 2NCNA 4XZ4A 2M8SA 2ZCBA 2I1KA 4EKUA 3CSFA 2D10A 3APCA 2GBJA 3UIOB 4GXBA 5D6JB 4AWJA 5TR5A 3VQIA 2L05A 4FN2A 3WALA 3ZW3A 3A33B 3DBHI 4HPMB 3L08A 4ZRJA 5C23A 1V81A 1WX8A 2XK5A 3IBEA 5AZFA 4GDKB 4HK2A 2GMIC 2A4ZA 1IP9A 4EOYA 1E7UA 3H1UA 4IWPA 1R4MI 3RT3B 2EKEC 2O2VA 1YD8U 2KTRB 3BINA 3X0WA 4HLEA 2LXAA 2MP2B 1VCBA 2R2QA 4HDQA 1E8ZA 2NR2A 1H4RA 2DYBA 3QK0A 2LZ6A 2MBHA 2Z59B 3OJ3A 3RYTA 2G3QB 5J18A 2M17A 3HIZA 4IG7B 3ZRFA 1K8RB 3ZDMC 1Q1OA 1WFYA 1Z2MA 3A9JA 3D32A 3W1YA 2KWCA 3V61A 1RRBA 4ANXA 3L0WB 2KC1A 2KFJA 3T9LA 2O6VB 1KOTA 2NPTA 2XK5B 3VUWA 3DVGY 3ML9A 4BVUC 4K7SA 4G0NB 2GBNA 4JIOU 2LGXA 3PT2B 4PS3A 4MJSA 3PS6A 4DDID 2N1VA 1VD2A 5DPRA 1OEYA 4BKSA 3VTVA 4FULA 3VTWA 4IUMB 1NBFC 5JZEB 1V9JA 2C7HA 2NVUI 3AU4A 5CHFA 2NBWB 4WWPA 4OVUA 4CHKA 2DHZA 1WJUA 2V4LA 1Y8RC 3ZNGC 2YVCA 4KIKA 3PRPB 4ANWA 4FHJA 3I3TB 2IO1B 4WJQA 2A5UA 4HWIB 1OQYA 3QA8A 1XT9B 3HK0A 5DPWA 3ZRCA 2KWUB 1YJ1A 2BYEA 3GZNI 4PS7A 5JHAA 2JVCA 1KJTA 2FCNA 2N4FA 2RGFA 3OLMD 3S2AA 4OVVA 3R7QA 4TKNA 1PQSA 1F9JA 2LI5A 4K1RB 2C9WB 4URKA 2JRIB 4EEWA 2ZVOA 2LRUA 2K25A 2KVRA 1X1MA 2NBUA 4WQOB 4WWNA 4P7IA 2WWZA 3ZKJC 2IBIB 4ANVA 4BKSD 1SIFA 2BGFA 2I1JA 2WX1A 4BBNF 2CS4A 3TIXA 3QHTA 4KDIC 3AXCA 3PHWB 1UD7A 2PE6B 2J0JA 3IHPC 4ANUA 5HKHA 5L83A 3B1LX 3PVLA 3EFUA 5LXIB 2ZPNA 4A3OA 3T8MA 1E8YA 5D7GA 1E8WA 1KM7A 3MHSD 1TZ1A 1WXVA 4GDLA 2J0MA 3DBSA 1GNUA 1V5OA 1WF9A 4BOSC 3DCGA 3H6NA 5JHBA 4ICVA 5D2MB 4FBJB 5IAAC 2ASQA 2KWVB 3VVWB 5DPSA 2JWZA 4FJVB 2K8BA 5KHQA 3ZNZB 2AL3A 3LDZE 1UH6A 4G3XB 1S3SG 2GBRA 2BKRB 2WDTB 3V62A 2AL6A 1GG3A 2FCQA 4DHJB 4TQ0A 3ZTCA 1WJNA 2DX5B 5EDSA 4HDOA 3JVZX 2C7MB 2K6QA 2KX0A 4ZRKA 2MCNB 3OJ4B 4DWFA 4ZDVA 2WYQA 3KUCB 4W9LA 3JSVA 3ECIA 1EF1A 2DZIA 2JRHA 4DHJD 1Q5WB 3U7DA 2OJRA 3QX1A 4HXDA 4ICUA 2RR9A 4EFOA 2JT4B 3U8ZA 2MLBA 3PZDA 2KO3A 1M94A 2N7EA 2KDBA 1LFDA 3B08A 2QHOA 4NNJB 2R2OA 3ZUNA 4EZLA 1UBIA 3RUIB 4N9F4 1WXSA 4TUUA 2DAJA 4BKTA 1WR6E 3VDZA 2L3ZA 3QIJA 3M95A 3MJWA 2KX3A 3VAWA 3IVFA 2BWFA 3A4RA 2KOXA 2LRWA 1HE8A 1J19A 2HJ8A 2NBVB 3UQAA 3ZNID 2BYVE 3ALBA 1A5RA 2DYMA 2KXJA 4DDGD 1V6EA 1RAXA 3QQ8B 2D11A 2KN5A 4AP4C 2MSED 2LVPA 3L54A 1EUVB 2LVOA 3M62B 4GB9A 2M0XA 3TCAA 3HHMA 2N9EB 4K81A 3RCZA 1WGYA 3NOBA 1KLVA 3PLVA 3SDLC 1FXTB 2KQSA 3L17A 5CX3A 2EMTA 4MGIE 1JRUA 1S1QB 2GOWA 3PRMB 4F8CB 3VFKA 1LQBA 3PREA 2LVQA 4MEMA 4JQWC 2MA9B 1WJ4A
chains in the Genus database with same CATH superfamily
2FIDA 4GN1A 3MFGA 4HCNB 4K7UA 3UGBB 3I9V1 1YN5A 1E8XA 3O65B 4J3OD 2RDBC 1DYQA 1V97A 4M01A 1L5PA 5GMVA 4A55A 3NVZA 5HHDG 3RMKC 3A9JB 4BKGA 4MSQB 3ML8A 1J8CA 4MSMB 4XX5A 2KLCA 4US8A 3SD5A 3TMPB 4MGYE 4I6PA 4K3CA 3Q14C 3AB5A 4NY0A 4C7ZA 2Y5BB 2KTFA 4ZHPA 3L10B 2QILA 4HEA1 1NI2A 1WXAA 1STEA 4C56C 4B95A 2JY6A 1DGJA 1BMLC 4KZ0A 2DLBA 2JZZA 4LDTB 4AUQC 4YT0B 3C19A 1YX6B 1D6EC 3Q8AA 4NAWA 3PLUA 1FRRA 2RPQA 2K8CA 5J17A 2J7QB 5MPOA 3QJZA 2M56B 1NI3A 3NRZA 2VH2A 2BB6A 2V3SA 3HUIA 1EO6A 1V8CA 2V1YA 2ZNVC 2BS3B 2OOBB 4MT5A 3AEFB 2LHDA 4GDLB 4W9EA 3LB8C 3V6CB 3R8BA 2KKCA 1C79A 2FCSA 1NEKB 1C9FA 3PPAA 4RF0A 2VH1A 4RGNA 4JL9A 1JWBD 3R66C 3U52E 4WIPA 2HE7A 2YEPB 1WX7A 2KTRA 3HM6X 3V60A 2KMCA 4AQ7A 4J6IA 3BVZA 4W9JA 1WR1A 1DOIA 4OVZA 1HEZE 1SEBD 1V80A 2GI9A 3B0AA 1ZW7A 4AJWA 4F1SA 1YN3A 4E71A 3M3JA 1YQBA 3KW5B 4RCOA 1E7VA 5JH5C 2XBBC 2V0GA 5DCNA 1MHHE 2DAFA 3APFA 4NJCA 5DPTA 4HRSA 3P2BA 2K9XA 2KZRA 4WJNA 3L13A 4TSSA 5LLIA 2K3UA 1LM8B 2MJ3A 4YTMB 1QQRA 3PZ7A 2LFIA 1P98A 3RNAC 3VR9B 4MGKE 2PJHA 3DBLB 3IG3A 2JX5A 3W9CB 4MGZE 3ZNHB 4JWUC 2WP9B 4P1CC 5G55A 1Q0WB 3KWVA 1MI0A 4KVGB 4WH4A 4G11A 3P4SB 1E6EB 2CHZA 3DDCB 1N62A 3BK1A 2N7JA 2LGIA 1TBEA 5IO9A 2BF8B 1OEYJ 3Q3FA 3A9KB 3PGEA 1V1PA 2D3GA 2W9NA 4M8NA 4RGMA 1R4NB 1OGWA 3GE3C 3B2FA 2OEDA 1L7YA 1DOYA 4CQNA 3TEXA 1UGJA 2K0PA 5HG2A 2Y3AA 4HCPB 2BYTA 1B9RA 2XN9C 4W9KA 1UUPA 1AARA 3SU8X 3GE8C 2KQ7A 1FCLA 2MBOA 4HROA 3Q8CA 2ZNVB 1WX9A 2CHXA 3AE4B 5FR6A 1WGKA 4A6QA 3WAMA 5G2NA 4IKGA 5AZHA 1UZXB 2ZW0A 1OQQA 4ZRQA 2RD0A 4E74A 1V1OA 1WE6A 5EE0A 1WGGA 1EM7A 4BFRA 3KYDD 1SGHA 3UINB 1M4VA 4MM3B 3N3KB 1GC6A 2K1FA 1V5TA 4GU2A 5D3IB 2KC2A 2G9HD 2M8SA 2ZCBA 2I1KA 1QKZA 4ZRPA 3CSFA 2D10A 3UIOB 2GBJA 1FMAD 3ZW3A 3T3NA 3A33B 4ZRJA 4D2KA 4GDKB 5FR3A 4A90A 4IWPA 2B76B 4H2AA 2O2VA 2MJEA 1FFUA 2MP2B 3OJ3A 1FCCC 2D3CA 3RYTA 3ZXVA 2WXMA 1IBXB 2KWCA 1HTQA 4ANXA 2KFJA 2KWDA 1CZPA 2WU5B 3PT2B 4L2YA 2N1VA 5D3DA 3VTWA 2HJ1A 4GLSC 1NBFC 1V9JA 2D5GA 1R7SA 2X8XX 2NBWB 4WWPA 2V4LA 3ZNGC 2LUMA 2AQ3B 1KLGD 1ZUD2 4WJQA 3VRAB 5DPWA 1TKGA 3GZNI 4RF1A 2FCNA 5BYQA 2RGFA 3OLMD 2KDMA 3TEYA 2PKOA 4TKNA 2C9WB 2V3PA 2JRIB 4EEWA 3RNCC 2M19A 4LNFA 3MC0B 4P7IA 4WWNA 3VRBB 3BZDB 1QLBB 1KFYB 1UD7A 3RNEC 1L6UA 5IN7A 3PVLA 3T8MA 3Q8FA 1TZ1A 2J0MA 3BVMA 1V5OA 1SE2A 3DCGA 4NAMA 5D2MB 4FBJB 2WDVB 1IGDA 1TT5B 2KWVB 2JWZA 3FAHA 1YQ4B 2WDTB 2AL6A 5IP4D 1K51A 4TQ0A 3ZTCA 2Z8LA 5EDSA 3AN1A 1YJIA 2WYQA 3KUCB 4W9LA 4LNIA 4A9AA 2GRIA 2SEBD 2KO3A 3BYTB 1GPXA 4YSYB 2WDRB 2ACZB 3AEDB 4YSXB 1YQ3B 4NZLB 1UBIA 2WDQB 1ZXIA 2DAJA 4BKTA 3MP9A 4YTNB 1FEHA 2KX3A 3VAWA 3Q6BA 3N9YC 2D3BA 2WLBA 3U7ZA 2EELA 1N60A 2KVZA 1K52A 1A5RA 1EWYC 4DDGD 1MVKA 1RAXA 3L54A 3IAM1 2LVOA 2M0XA 2N9EB 1EWCA 1FXTB 2K5PA 1SE3A 2EMTA 3DHGC 1EU3A 3PRMB 1LQBA 1RM6C 4JQWC 3PV1A 2MA9B 4EE2A 2IZVB 4DBGA 1TS2A 3U30A 3SHQA 1AYFA 4W9IA 2JZ3B 2W3SA 3AE8B 3PHXB 4JLCA 3ZDTA 5I4DA 3BIID 1N6ZA 2KFKA 4II3B 2FAZA 2RDHA 1XQQA 4S0RA 1J7BA 3WANA 4AS1A 4MJSB 3KYCD 1ACCA 3IFWB 2N0SB 3URYA 4F7ZA 3Q3MC 3H7PA 5J2RA 2E6XA 2GLSA 3GP7A 3L16A 4XC2A 2MW5A 3QWZB 3VH3B 2D3AA 4LTUA 2NTSA 2BTEA 2G45B 2JXXA 1OTRB 4NPNA 5KHOA 1FNUA 2RSUA 3QC8B 4KZCA 3Q3JA 4P6VF 3HM3A 1UWXA 3V6EB 2AYOB 1ZE3D 3GOEA 1PGXA 5H8YE 3RZWC 2CKHB 4W9CA 1ISNA 3KVFB 1C77A 5E6PA 2QC8A 3Q3NC 2J53A 2GBMA 2TSSA 2WXLA 2K39A 2FUHB 4FHKA 2VRRB 2N9LA 3QARA 2G4SA 3CMMB 4NAWB 1NVID 2GBKA 1GC7A 2JZPA 1C76A 2PEAA 1FXAA 5FKAC 2ZZPB 4GGQA 2L8JA 5EE3A 2AQ2B 2KDIA 2H89B 1WMHA 3ONSA 4ZYNA 1GJZA 1MG8A 2CR5A 1MFWA 3WIMA 1YX5B 4IWOA 2Q5WD 2BBCA 1TZOA 2AWTA 3PSEB 3MTNB 4MDKE 2WXJA 2NTTA 3RZFA 2J4XA 3H8HA 4GOCA 2J42A 2WX0A 4W9DA 1HTOA 1SJHD 4LJPB 2N9XA 3E9SA 1K50A 3AE9B 3NG0A 3P4QB 4RM8A 4WWMA 4FADA 2KMMA 1TS3A 1P7FA 4IM0A 2JYTA 2WXQA 4MACA 1VRAB 4W9HA 3X23A 3NHEB 4BAXA 2PW9A 3MHZA 2MBBB 2PTLA 3N20C 2WQYB 4HJKA 2L00B 1TIFA 2MRPA 2L83A 3APDA 3ZXRA 1WSPA 3GS2A 2DYOA 3IT6B 4LNNA 4L23A 4TQ1A 2LHEA 1RFAA 3AU5A 3IAS1 3W1SA 3BYYB 4RGTA 2LGSA 2AEHA 2UWQA 5HFYA 1L4DB 3FKYA 4XE0A 4C4VB 3LXFA 3VTUA 2WXOA 3M63B 2WXHA 3WCQA 4WWOA 4E3CA 1LXDA 3R7RA 5BO4B 1FRDA 3VUXA 3EHVA 1WXQA 4NQKE 2CJNA 3SR6A 4HPLB 1V1PB 1XCTL 3TL5A 1NYQA 3A1QA 5LNK1 1L6VA 2PIAA 2DWQA 4PYZA 3PRZA 3FILA 1MG4A 1TKYA 4B0EA 4P16A 3KUZA 2D07B 1WYWB 1WGDA 2CHWA 1WXMA 4G50A 1WRDB 3O13A 1C1YB 3C0RB 3TBLD 2MX2A 4RNAA 1WIAA 1ENFA 4WJOA 1SE9A 2IY1B 2QDFA 3VHTC 3AEAB 4EZKA 3ZJUA 4FJZA 3N32A 4X57B 1V49A 2JF5A 1N5WA 4B0MA 1YMHE 2IGHA 1FIQA 3DBHI 2X38A 2IDYA 4HK2A 2GMIC 1IP9A 3RT3B 3KQ4A 1QT9A 3BINA 1AW7A 4ZYSA 1KRHA 2HTME 2E3TA 4HDQA 4KGTA 3GZNB 2LZ6A 5BMIA 3RFZB 2G3QB 3IT4B 3ZRFA 1TS5A 3ZDMC 3A9JA 3D32A 3W1YA 2I38A 1RRBA 3L0WB 4KGSA 2KC1A 4S17A 2O6VB 5IOIA 3ZGZA 4BVUC 1K53A 2GBNA 2LGXA 3IXSA 2QJLA 1FD6A 1VLBA 2C7HA 5TSSA 2YVCA 4YXDB 4ANWA 4FHJA 1WYGA 2A5UA 5IKCM 1OQYA 1E0ZA 4PS7A 3V3XA 4C7YA 2JVCA 1KJTA 1XLQA 3MC9A 3SFEB 1KTKA 4OVVA 3R7QA 2ZVOA 1VZ7A 2K25A 2NBUA 2WWZA 3ZKJC 2WXKA 4ARCA 1MHXA 4BKSD 2WX1A 2I1JA 2CS4A 3TIXA 1SIJA 3QHTA 1ZDVA 3AXCA 4ANUA 5HKHA 5L83A 3B1LX 5LXIB 1E8WA 1WRIA 2KT7A 2FBWB 4GDLA 4ZOHC 1OFFA 1I4HA 4YTPB 2IJ0A 4ICVA 4LLGM 2ASQA 5DPSA 2SAKA 5KHQA 2ONQA 4XYCA 3ZNZB 2PVGC 1UH6A 3ZJTA 1S3SG 2GBRA 2BKRB 2FE8A 3HVDA 2FCQA 1MJDA 4HDOA 1UF0A 2ON8A 3JVZX 2K6QA 2MCNB 3OJ4B 2QIEB 4DHJD 1ET9A 2INDC 3ECIA 1ZXHA 4DXGA 1Q5WB 4EFOA 2JT4B 1TS4A 2MLBA 3PZDA 1CK1A 2N7EA 3ZUNA 4EZLA 1QOBA 3RUIB 1WXSA 3M95A 1TYGB 4JPSA 4XGAB 4KKIA 5BMHA 1JW9D 2BB5A 1QOAA 2RMMA 4KGRA 1ZP0B 4JWSC 3UQAA 1XEEA 2BYVE 3L4PA 1C4AA 1SE4A 2I2YA 2DYMA 2KN4A 3QQ8B 2MSED 4Q2JA 1UNSA 3NOBA 4F8CB 1WJ4A 4BBNC 2EKIA 2GB1A 4IM2A 1T0SC 3C8YA 1ZKHA 3ZLZA 2M4NA 3EFCA 4DQOC 1QOGA 1SBBB 3ZVVA 5CHWA 4HVBA 2L0FA 1JWSD 2QEJC 1C3TA 4ARIA 5G5HA 2BKFA 1H8CA 3NZUA 4L1BA 2M0AA 1L0VB 3NZSA 2NPTB 2KYWA 4DHZE 4PS8A 3KH0A 1T5XD 1HQRD 4M00A 1E90A 5AEKB 3SFDB 3AULA 2KJ6A 4KIKB 4GSWA 4MH0E 2RPVA 2KFKB 4WJPA 2PVOD 4KKJA 3ENEA 3T3OA 1HXYD 1WJ6A 1I4RA 3BK2A 2L1AA 5C3JB 4LDTD 4M0WB 1QILA 1WGRA 3ZJVA 4A3PA 2KANA 1PGBA 4CYEA 1WH3A 4W9FA 2N7DA 1Q10A 3CWIA 3AE1B 3UIPB 5CTRC 3ZIMA 4MM3A 2XNAC 4OW0A 3W1SC 4DXAB 4WAAA 3DOWA 1P9DU 4IC7B 1PYWD 3MC8A 1KF6B 2PMVA 2FIFA 3NS8A 2LWPA 2FCMA 2KD0A 1GUAB 4GDKA 4DK5A 3VUYA 1TGZB 1L0YB 1WI0A 3AE6B 2ZPYA 4JGHB 4JE3B 4HPPA 5C1ZA 1JRPA 2MP2A 4MELA 3JSVB 1XLOA 3Q69A 2B3AA 2RDGA 1IBXA 2L76A 4A20A 1LO5D 1D4BA 4IDIA 3W5VB 2K6DB 1WE7A 2ZCCA 1BUIC 2BPSA 3EC8A 1J7AA 1WMHB 2JSVX 3OAWA 3WAPA 4PYUA 3DVNV 3NS1A 2CU1A 1VR9A 4HJGE 3N1XC 3RULA 1D3ZA 3PZ8A 3RI7C 3TJPA 1VZ8A 2NS5A 2LASA 1JWAD 1WZ3A 2BYFA 2BWES 2ZVNA 4PT5A 3AE2B 3LJ3A 3JYUA 4ZRIA 1TY0A 4FA6A 3DWGC 2IO3B 1FNVA 2O6VD 1N63A 3QAQA 2M1MA 3JW0X 1T0RC 4B6WA 1F77A 1PFDA 4C00A 2IYDB 4KV2A 3EA6A 1IPGA 1T0YA 2INPE 2IGDA 3P63A 3R2TA 3WAOA 2C60A 1HA5A 3NVWA 3RNFC 2JPHA 4OZAA 3DHIC 4AJYB 2MBQA 3I57A 4GIVA 5G5GA 2LUEA 4QAYA 4YWGG 1JWUD 1RFKA 1FM0D 4IM3A 4YSZB 4I6NB 1OQRA 1I35A 3U4EG 2HTHA 2W82A 4II2B 3DVNU 3RNGC 2WU2B 4NJ6A 2KMAA 4ZHOA 1JQ4A 1UBQA 2LGDA 3DBHB 1I42A 3R3MA 3HRDD 1Z5SB 3K9PB 1E5WA 3UF8A 5E6NA 3EECA 1WGHA 1YJJA 4LCDE 3DBRI 1WM3A 2LJ5A 2DZJA 2LGYA 2KLGA 1FPYA 3A1QB 4REZA 2VZKB 2DNFA 4USAA 3BVGA 1ET6A 2JQRB 1RLFA 4FXCA 4UDUC 4XZ4A 2AX5A 4EKUA 2INCC 1FO4A 1GAQB 3APCA 3RNBC 4GXBA 5TR5A 2L05A 3WALA 4XDDA 1ZPSA 2WNMA 4OZBA 1WWTA 1V81A 1WX8A 2XK5A 2K22A 1I4PA 3IBEA 3AV8A 5AZFA 1F0ZA 2A4ZA 1KLUD 1R4MI 1YD8U 2KTRB 3X0WA 1E9MA 2LXAA 5E6JA 1D5MC 2R2QA 2NR2A 5H92C 3QK0A 2Z59B 4OZCA 5J18A 3I5JC 4N59A 5AUIA 2M17A 3HIZA 4IG7B 1XLNA 1K8RB 3OWEB 1WFYA 2LJIA 2BW2A 2G1EA 2WXGA 5BYSA 1T0QC 2INNE 1KOTA 1XO3A 3VUWA 4K7SA 4G0NB 4PS3A 4JIOU 1SXTA 4MJSA 3PS6A 1JROA 1VD2A 2JU6X 3N1ZC 1OEYA 5DPRA 1BXTA 4BKSA 4FULA 1TKEA 4IUMB 2W54A 5JZEB 1QOFA 2NVUI 3AU4A 5CHFA 2KQ4X 3NJTA 1J7CA 1WJUA 1Y8RC 1ZDXA 3PRPB 2IO1B 3NVYA 4HWIB 3AEGB 3HK0A 1YJ1A 2WXFA 2BYEA 5JHAA 3E56A 2N4FA 2BS4B 3TEWA 1TJEA 2LI5A 4K1RB 2LRUA 1MPEA 2KVRA 1X1MA 2JXTA 2WS3B 2IBIB 4ANVA 1QF6A 1N5XA 1F2RI 4BBNF 2OJWA 4KDIC 3PHWB 2PE6B 3NUHB 3EFUA 1GOZA 1KM7A 3H6NA 5JHBA 1VZ6A 5IAAC 3I63C 1L4ZB 3CIRB 2K8BA 3P1MA 1HZ5A 3V62A 3B2GA 3ABVB 1WJNA 1IUEA 4P1BC 2C7MB 4ZDVA 4ZRKA 1EF1A 2DZIA 2JRHA 2NMQA 2OJRA 3P4RB 3QX1A 2RR9A 4LNKA 3U8ZA 1M94A 3B9JA 3AH7A 2KDBA 2H88B 1LFDA 1JCKB 3B08A 4C80A 1AN8A 2R2OA 2W3RA 3AECB 1AWDA 3VDZA 2L3ZA 3QIJA 4WURA 3MJWA 1JMLA 3IVFA 2BWFA 3A4RA 2KOXA 1J19A 2HJ8A 2NBVB 2MHJA 1Y56A 4ITKA 1I4XA 1F1HA 2KXJA 2KN5A 1EUVB 2V4IB 4XWWA 3TCAA 3HHMA 1PGAA 4K81A 1WGYA 3PLVA 1B1ZA 3HVZA 3L17A 1JRUA 2GOWA 3PREA 2LVQA 1CJEA 3PO0A 4G3XB 4RMAA 1WM2A 2O2VB 4MH8A 4I6LB 4KSLC 3P42A 1XF5L 3Q8BA 1E7PB 3BY4B 3KWLA 4C4VA 2L52A 2W55A 2Z0DB 4EUTA 2MJDA 3ZTDA 1C78A 3ZO5B 1JWMD 3SEBA 1J0GA 2XEWA 3DPDA 3ETRA 5CHVC 3AE7B 2PE9A 1XD3B 5GXGB 4HKZE 4DHZB 5L95C 2N9PC 1SJED 5EE1A 4M8MA 1UGMA 2DENB 1RWSA 3AEEB 2UYZB 4N6EB 3DQVA 4AOFA 3UQBA 1YIWA 3CF6E 3AMZA 3K9OB 1G6JA 2L0TA 1IYFA 1I4QA 2C5LC 3ZYYX 2N9KA 2KNBA 5LXHA 2MWSB 2BQQA 2KDEB 2L7RA 1UWMA 1XCQL 2JUOA 1DOXA 1FXIA 1NDDA 2MBEA 3WA0A 2Y5PA 1LGRA 1P3QU 3CSTA 1UELA 2IO0B 3GB1A 1ZGUB 3KUDB 3FC4A 1IGCA 4WQMA 4LK0M 4KSKC 5AZGA 3MJ5A 1VDVA 2LXCA 4TV3A 3DVGX 2VZKD 4ASWC 1E10A 1ESFA 3DHHC 3A4SC 2BT6A 1CMXB 2KHWB 1TTNA 4KX6B 2JWUA 1CQVA 2G4DB 2HD5B 2Z0EB 2O6VA 2V3NA 3N30A 1EF5A 4LJOB 1GB4A 2EMSA 2BS2B 2KJRA 4CO7A 2LMCA 2PLPA 2LEKA 1NENB 1U4AA 2KJHB 4K7WA 1BT0A 3RPFC 4FLHA 3NVVA 2WHIA 4LNOA 2DZMA 4W9GA 3A9KA 2ZW1A 2CU3A 4IOIE 3N1YC 2ZEQA 3LYYA 3P4PB 2K8HA 4HKQA 1PDXA 1EU4A 4M02A 4BOZB 2AQ1B 3J9CA 1V2YA 5C2TB 2MQJA 1FFVA 2LD9A 1V86A 4YL8A 2ZJDA 4BZAA 4GMVA 1F2RC 3QCAA 3AE3B 1WY8A 1F52A 4IW0A 2IGGA 2WXPA 3EUB2 1C4CA 2YEPF 2IO2B 1A70A 4K3BA 4NQLB 5E6OA 2V9HA 3AI5A 4R3DA 1P1AA 4KDLB 3DBRB 1D5XC 2R61A 3DBLI 1JALA 2YLMA 2FNJB 2D2QA 4NJ7A 3H7PB 1SF0A 4FJYA 2FUG1 5BMGA 2KDFB 1QZEA 1KH0A 3Q8EA 1FNWA 3PTFC 5D94A 2N1WA 2WXIA 3H7SA 2C7NB 3Q2AC 1N61A 1R4NI 1WZ0A 3VXWA 2KK8A 1XLPA 4RM9A 2QSDA 2DZKA 4IWQA 4A8XC 1R4MB 3W2DA 3UI3A 3H9DA 3TEZA 1L2NA 3VH4B 3NY5A 4EZJA 4US9A 2J0KA 4B9KA 2ICIA 2PPHA 1T3QA 2REXA 2MEKA 1T6BX 2IY0B 1P0RA 5IA7A 2NCNA 4XDCA 5D6JB 3RN9C 4AWJA 1SB3C 3VQIA 4FN2A 2BVCA 4PK1A 4HPMB 3L08A 5C23A 1NYRA 2KAJA 4TMAB 3AM9A 4EOYA 2IPKD 1E7UA 3H1UA 2EKEC 1GB1A 4HLEA 1I4GA 1VCBA 1E8ZA 1H4RA 1XXGA 2DYBA 2MBHA 3DWMA 1ROEA 1Q1OA 1RYJA 1Z2MA 3V61A 4DXFA 3T9LA 4XWTA 2DBYA 2NPTA 2XK5B 3DVGY 3ML9A 4DDID 3AE5B 3VTVA 3R2IA 5JXVA 4OHJA 1PUTA 2WGSA 5HI1A 5BYRA 4N58A 4OVUA 4CHKA 2DHZA 1YOVB 3NZ3A 1YN4A 4KIKA 4JX1C 3I3TB 4O1NA 4RH6A 3QA8A 1XT9B 3ZRCA 2KWUB 5AUKA 5FK9C 3S2AA 1D5ZC 1PQSA 1F9JA 4M0WA 4URKA 4WQOB 4WAFA 1VJKA 2UU7A 1SIFA 2BGFA 5EE9A 2MH7A 2J0JA 3IHPC 4RGOS 2ZPNA 4A3OA 2QMTA 1E8YA 5D7GA 3VR8B 2WXRA 3V05A 3MHSD 1WXVA 2WXNA 1L0XB 1GNUA 3DBSA 1WF9A 4BOSC 3U2SC 3VVWB 4FJVB 3EGRA 2AL3A 3LDZE 2Y5CA 1GG3A 4DHJB 2DX5B 3OG5A 2KX0A 4DWFA 3JSVA 1HZ6A 3U7DA 1ZOYB 4HXDA 4ICUA 2HDEA 3FILB 2JYEA 2QCZA 2CJOA 2QHOA 2L32A 4NNJB 2KACA 4N9F4 2J52A 3KLSX 4TUUA 1WR6E 4ACFA 2LRWA 1HE8A 5T8IA 3ZQ4A 1TY2A 3ZNID 3Q3OC 3W5UB 3ALBA 1P7EA 1V6EA 2D11A 4AP4C 2LVPA 3BWUD 2OHFA 4RFBA 3M62B 4GB9A 3RCZA 1KLVA 3SDLC 2KQSA 3TUOA 5CX3A 1I7HA 1YNTE 3TSSA 1SSNA 1C4PA 4MGIE 1S1QB 3VFKA 4MEMA 3AEBB 3RD2A
chains in the Genus database with same CATH topology
4BBNC 2FIDA 4GN1A 4RMAA 4HCNB 2IZVB 4K7UA 1WM2A 2O2VB 4IM2A 4I6LB 3U30A 3UGBB 4DBGA 1E8XA 3O65B 3SHQA 1ZKHA 4KSLC 4W9IA 3ZLZA 2M4NA 2JZ3B 3PHXB 3ZVVA 4JLCA 5CHWA 3ZDTA 4HVBA 5GMVA 2L0FA 2KFKA 4II3B 3BY4B 1C3TA 3A9JB 2FAZA 4BKGA 1XQQA 4MSQB 3ML8A 4EUTA 2BKFA 2Z0DB 1J8CA 4MSMB 1H8CA 3NZUA 3ZTDA 4XX5A 3NZSA 2NPTB 3ZO5B 2KLCA 4DHZE 3WANA 3SD5A 4PS8A 3TMPB 4MGYE 4I6PA 2XEWA 3DPDA 3KYCD 4MJSB 1J0GA 5CHVC 3IFWB 2PE9A 4NY0A 2Y5BB 2KTFA 1XD3B 3KH0A 4F7ZA 1E90A 3H7PA 3L10B 4DHZB 5L95C 2N9PC 5AEKB 4M8MA 1NI2A 1UGMA 5J2RA 3AULA 2KJ6A 1WXAA 2DENB 4KIKB 3L16A 2JY6A 4GSWA 4MH0E 4B95A 4XC2A 2MW5A 2KFKB 4WJPA 2UYZB 3QWZB 4KZ0A 3VH3B 3ENEA 3DQVA 1WJ6A 2JZZA 4LDTB 4AOFA 3UQBA 4AUQC 1YIWA 3CF6E 1YX6B 2G45B 2JXXA 3K9OB 1OTRB 4LDTD 4M0WB 2L0TA 4NAWA 2RSUA 4NPNA 3PLUA 5KHOA 1IYFA 1G6JA 2RPQA 1WGRA 2K8CA 2C5LC 3QC8B 5J17A 4KZCA 3Q3JA 4A3PA 2KNBA 2J7QB 2KANA 5LXHA 2MWSB 3HM3A 3QJZA 2KDEB 2L7RA 4CYEA 1WH3A 4W9FA 2N7DA 3V6EB 2AYOB 3GOEA 2V3SA 3UIPB 3ZIMA 5CTRC 4MM3A 1EO6A 3RZWC 2CKHB 2JUOA 1ISNA 3KVFB 4W9CA 5E6PA 2GBMA 3W1SC 2V1YA 2K39A 4DXAB 4WAAA 2ZNVC 1NDDA 2OOBB 2MBEA 2FUHB 3WA0A 3DOWA 4FHKA 4GDLB 1P9DU 2VRRB 3QARA 2G4SA 3CMMB 4IC7B 1P3QU 4NAWB 4W9EA 3CSTA 1UELA 1GC7A 2GBKA 2IO0B 3V6CB 2KKCA 1ZGUB 2FIFA 3NS8A 2LWPA 2FCSA 2PEAA 2FCMA 2KD0A 1GUAB 3PPAA 3KUDB 4GDKA 4DK5A 2ZZPB 4JL9A 1TGZB 3VUYA 3R66C 1WI0A 2HE7A 2L8JA 4GGQA 3RD2A 2ZPYA 4KSKC 5AZGA 4JGHB 1WX7A 2KTRA 3HM6X 5C1ZA 3V60A 2KDIA 2KMCA 2MP2A 2LXCA 4TV3A 1WMHA 3DVGX 3ONSA 4J6IA 4MELA 3JSVB 4ZYNA 4ASWC 4W9JA 1WR1A 1GJZA 2B3AA 3A4SC 1CMXB 1MG8A 1V80A 2KHWB 1TTNA 2CR5A 3B0AA 1ZW7A 2L76A 3WIMA 3PV1A 4A20A 1YX5B 4AJWA 4F1SA 4E71A 2G4DB 2HD5B 3M3JA 1YQBA 4IWOA 3KW5B 2Z0EB 1E7VA 2O6VA 2XBBC 3N30A 5DCNA 5JH5C 2DAFA 3APFA 1EF5A 2AWTA 4LJOB 3PSEB 2EMSA 2KJRA 3MTNB 4CO7A 4MDKE 5DPTA 3RZFA 3P2BA 2KZRA 4WJNA 2K6DB 1U4AA 1WE7A 3L13A 4GOCA 2WX0A 2KJHB 2ZCCA 4K7WA 2BPSA 3EC8A 4W9DA 1BT0A 1WMHB 3WAPA 3OAWA 5LLIA 4LJPB 1LM8B 4FLHA 4PYUA 2N9XA 2DZMA 3DVNV 4W9GA 3A9KA 4RM8A 2CU1A 1P98A 4FADA 4MGKE 3RULA 4IM0A 1D3ZA 3TJPA 2PJHA 3IG3A 2ZEQA 4W9HA 3X23A 2NS5A 2LASA 4MGZE 3NHEB 3ZNHB 1WZ3A 2BYFA 2BWES 2ZVNA 2K8HA 2MBBB 3LJ3A 4HJKA 3JYUA 4ZRIA 4BOZB 2L00B 5G55A 4FA6A 1Q0WB 2MRPA 4KVGB 1V2YA 2IO3B 2O6VD 2MQJA 4G11A 3APDA 3QAQA 2M1MA 2LD9A 3JW0X 4B6WA 1V86A 4YL8A 2CHZA 3DDCB 2ZJDA 2DYOA 1TBEA 4GMVA 3QCAA 2BF8B 2IYDB 4KV2A 1OEYJ 1WY8A 3Q3FA 4TQ1A 1RFAA 3AU5A 3A9KB 3PGEA 1IPGA 2D3GA 1T0YA 2W9NA 4IW0A 4M8NA 3W1SA 1OGWA 3WAOA 2C60A 1L7YA 2AEHA 2UWQA 2IO2B 2JPHA 4NQLB 4HCPB 5E6OA 4W9KA 3AI5A 4AJYB 1P1AA 2MBQA 4KDLB 3VTUA 4GIVA 3M63B 2LUEA 3DBLI 4WWOA 1AARA 3SU8X 4E3CA 1LXDA 3R7RA 5BO4B 2KQ7A 3VUXA 3EHVA 2YLMA 4IM3A 4NQKE 2MBOA 2FNJB 2D2QA 4NJ7A 3H7PB 4I6NB 4HPLB 4FJYA 1I35A 3TL5A 2HTHA 2ZNVB 3A1QA 4II2B 3DVNU 1WX9A 2CHXA 2KDFB 1QZEA 5FR6A 3PTFC 4PYZA 5D94A 2N1WA 3PRZA 4NJ6A 2KMAA 3WAMA 5G2NA 5AZHA 3H7SA 1UZXB 2C7NB 1R4NI 1UBQA 1WZ0A 2LGDA 3VXWA 1I42A 2KK8A 3KUZA 4RM9A 2D07B 1WYWB 2RD0A 1WGDA 2DZKA 3R3MA 2CHWA 4IWQA 1WXMA 1Z5SB 4E74A 4G50A 3K9PB 1E5WA 3UF8A 5E6NA 1WRDB 3EECA 1WGHA 3H9DA 1WE6A 4LCDE 1C1YB 1L2NA 3C0RB 3DBRI 1WM3A 2LJ5A 2DZJA 2LGYA 3VH4B 3NY5A 3TBLD 4EZJA 2MX2A 2KLGA 2J0KA 1WGGA 4BFRA 3A1QB 1WIAA 4B9KA 3KYDD 1SGHA 2PPHA 3UINB 4WJOA 1SE9A 2IY1B 3VHTC 2REXA 4EZKA 3N3KB 1GC6A 2IY0B 2K1FA 4FJZA 1V5TA 1P0RA 4GU2A 1RLFA 3N32A 2KC2A 4X57B 5IA7A 1V49A 2JF5A 2NCNA 4XZ4A 2M8SA 2ZCBA 2I1KA 4EKUA 3CSFA 2D10A 3APCA 2GBJA 3UIOB 4GXBA 5D6JB 4AWJA 5TR5A 3VQIA 2L05A 4FN2A 3WALA 3ZW3A 3A33B 3DBHI 4HPMB 3L08A 4ZRJA 5C23A 1V81A 1WX8A 2XK5A 3IBEA 5AZFA 4GDKB 4HK2A 2GMIC 2A4ZA 1IP9A 4EOYA 1E7UA 3H1UA 4IWPA 1R4MI 3RT3B 2EKEC 2O2VA 1YD8U 2KTRB 3BINA 3X0WA 4HLEA 2LXAA 2MP2B 1VCBA 2R2QA 4HDQA 1E8ZA 2NR2A 1H4RA 2DYBA 3QK0A 2LZ6A 2MBHA 2Z59B 3OJ3A 3RYTA 2G3QB 5J18A 2M17A 3HIZA 4IG7B 3ZRFA 1K8RB 3ZDMC 1Q1OA 1WFYA 1Z2MA 3A9JA 3D32A 3W1YA 2KWCA 3V61A 1RRBA 4ANXA 3L0WB 2KC1A 2KFJA 3T9LA 2O6VB 1KOTA 2NPTA 2XK5B 3VUWA 3DVGY 3ML9A 4BVUC 4K7SA 4G0NB 2GBNA 4JIOU 2LGXA 3PT2B 4PS3A 4MJSA 3PS6A 4DDID 2N1VA 1VD2A 5DPRA 1OEYA 4BKSA 3VTVA 4FULA 3VTWA 4IUMB 1NBFC 5JZEB 1V9JA 2C7HA 2NVUI 3AU4A 5CHFA 2NBWB 4WWPA 4OVUA 4CHKA 2DHZA 1WJUA 2V4LA 1Y8RC 3ZNGC 2YVCA 4KIKA 3PRPB 4ANWA 4FHJA 3I3TB 2IO1B 4WJQA 2A5UA 4HWIB 1OQYA 3QA8A 1XT9B 3HK0A 5DPWA 3ZRCA 2KWUB 1YJ1A 2BYEA 3GZNI 4PS7A 5JHAA 2JVCA 1KJTA 2FCNA 2N4FA 2RGFA 3OLMD 3S2AA 4OVVA 3R7QA 4TKNA 1PQSA 1F9JA 2LI5A 4K1RB 2C9WB 4URKA 2JRIB 4EEWA 2ZVOA 2LRUA 2K25A 2KVRA 1X1MA 2NBUA 4WQOB 4WWNA 4P7IA 2WWZA 3ZKJC 2IBIB 4ANVA 4BKSD 1SIFA 2BGFA 2I1JA 2WX1A 4BBNF 2CS4A 3TIXA 3QHTA 4KDIC 3AXCA 3PHWB 1UD7A 2PE6B 2J0JA 3IHPC 4ANUA 5HKHA 5L83A 3B1LX 3PVLA 3EFUA 5LXIB 2ZPNA 4A3OA 3T8MA 1E8YA 5D7GA 1E8WA 1KM7A 3MHSD 1TZ1A 1WXVA 4GDLA 2J0MA 3DBSA 1GNUA 1V5OA 1WF9A 4BOSC 3DCGA 3H6NA 5JHBA 4ICVA 5D2MB 4FBJB 5IAAC 2ASQA 2KWVB 3VVWB 5DPSA 2JWZA 4FJVB 2K8BA 5KHQA 3ZNZB 2AL3A 3LDZE 1UH6A 4G3XB 1S3SG 2GBRA 2BKRB 2WDTB 3V62A 2AL6A 1GG3A 2FCQA 4DHJB 4TQ0A 3ZTCA 1WJNA 2DX5B 5EDSA 4HDOA 3JVZX 2C7MB 2K6QA 2KX0A 4ZRKA 2MCNB 3OJ4B 4DWFA 4ZDVA 2WYQA 3KUCB 4W9LA 3JSVA 3ECIA 1EF1A 2DZIA 2JRHA 4DHJD 1Q5WB 3U7DA 2OJRA 3QX1A 4HXDA 4ICUA 2RR9A 4EFOA 2JT4B 3U8ZA 2MLBA 3PZDA 2KO3A 1M94A 2N7EA 2KDBA 1LFDA 3B08A 2QHOA 4NNJB 2R2OA 3ZUNA 4EZLA 1UBIA 3RUIB 4N9F4 1WXSA 4TUUA 2DAJA 4BKTA 1WR6E 3VDZA 2L3ZA 3QIJA 3M95A 3MJWA 2KX3A 3VAWA 3IVFA 2BWFA 3A4RA 2KOXA 2LRWA 1HE8A 1J19A 2HJ8A 2NBVB 3UQAA 3ZNID 2BYVE 3ALBA 1A5RA 2DYMA 2KXJA 4DDGD 1V6EA 1RAXA 3QQ8B 2D11A 2KN5A 4AP4C 2MSED 2LVPA 3L54A 1EUVB 2LVOA 3M62B 4GB9A 2M0XA 3TCAA 3HHMA 2N9EB 4K81A 3RCZA 1WGYA 3NOBA 1KLVA 3PLVA 3SDLC 1FXTB 2KQSA 3L17A 5CX3A 2EMTA 4MGIE 1JRUA 1S1QB 2GOWA 3PRMB 4F8CB 3VFKA 1LQBA 3PREA 2LVQA 4MEMA 4JQWC 2MA9B 1WJ4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BBN C;  2FID A;  4GN1 A;  4RMA A;  4HCN B;  2IZV B;  4K7U A;  1WM2 A;  2O2V B;  4IM2 A;  4I6L B;  3U30 A;  3UGB B;  4DBG A;  1E8X A;  3O65 B;  3SHQ A;  1ZKH A;  4KSL C;  4W9I A;  3ZLZ A;  2M4N A;  2JZ3 B;  3PHX B;  3ZVV A;  4JLC A;  5CHW A;  3ZDT A;  4HVB A;  5GMV A;  2L0F A;  2KFK A;  4II3 B;  3BY4 B;  1C3T A;  3A9J B;  2FAZ A;  4BKG A;  1XQQ A;  4MSQ B;  3ML8 A;  4EUT A;  2BKF A;  2Z0D B;  1J8C A;  4MSM B;  1H8C A;  3NZU A;  3ZTD A;  4XX5 A;  3NZS A;  2NPT B;  3ZO5 B;  2KLC A;  4DHZ E;  3WAN A;  3SD5 A;  4PS8 A;  3TMP B;  4MGY E;  4I6P A;  2XEW A;  3DPD A;  3KYC D;  4MJS B;  1J0G A;  5CHV C;  3IFW B;  2PE9 A;  4NY0 A;  2Y5B B;  2KTF A;  1XD3 B;  3KH0 A;  4F7Z A;  1E90 A;  3H7P A;  3L10 B;  4DHZ B;  5L95 C;  2N9P C;  5AEK B;  4M8M A;  1NI2 A;  1UGM A;  5J2R A;  3AUL A;  2KJ6 A;  1WXA A;  2DEN B;  4KIK B;  3L16 A;  2JY6 A;  4GSW A;  4MH0 E;  4B95 A;  4XC2 A;  2MW5 A;  2KFK B;  4WJP A;  2UYZ B;  3QWZ B;  4KZ0 A;  3VH3 B;  3ENE A;  3DQV A;  1WJ6 A;  2JZZ A;  4LDT B;  4AOF A;  3UQB A;  4AUQ C;  1YIW A;  3CF6 E;  1YX6 B;  2G45 B;  2JXX A;  3K9O B;  1OTR B;  4LDT D;  4M0W B;  2L0T A;  4NAW A;  2RSU A;  4NPN A;  3PLU A;  5KHO A;  1IYF A;  1G6J A;  2RPQ A;  1WGR A;  2K8C A;  2C5L C;  3QC8 B;  5J17 A;  4KZC A;  3Q3J A;  4A3P A;  2KNB A;  2J7Q B;  2KAN A;  5LXH A;  2MWS B;  3HM3 A;  3QJZ A;  2KDE B;  2L7R A;  4CYE A;  1WH3 A;  4W9F A;  2N7D A;  3V6E B;  2AYO B;  3GOE A;  2V3S A;  3UIP B;  3ZIM A;  5CTR C;  4MM3 A;  1EO6 A;  3RZW C;  2CKH B;  2JUO A;  1ISN A;  3KVF B;  4W9C A;  5E6P A;  2GBM A;  3W1S C;  2V1Y A;  2K39 A;  4DXA B;  4WAA A;  2ZNV C;  1NDD A;  2OOB B;  2MBE A;  2FUH B;  3WA0 A;  3DOW A;  4FHK A;  4GDL B;  1P9D U;  2VRR B;  3QAR A;  2G4S A;  3CMM B;  4IC7 B;  1P3Q U;  4NAW B;  4W9E A;  3CST A;  1UEL A;  1GC7 A;  2GBK A;  2IO0 B;  3V6C B;  2KKC A;  1ZGU B;  2FIF A;  3NS8 A;  2LWP A;  2FCS A;  2PEA A;  2FCM A;  2KD0 A;  1GUA B;  3PPA A;  3KUD B;  4GDK A;  4DK5 A;  2ZZP B;  4JL9 A;  1TGZ B;  3VUY A;  3R66 C;  1WI0 A;  2HE7 A;  2L8J A;  4GGQ A;  3RD2 A;  2ZPY A;  4KSK C;  5AZG A;  4JGH B;  1WX7 A;  2KTR A;  3HM6 X;  5C1Z A;  3V60 A;  2KDI A;  2KMC A;  2MP2 A;  2LXC A;  4TV3 A;  1WMH A;  3DVG X;  3ONS A;  4J6I A;  4MEL A;  3JSV B;  4ZYN A;  4ASW C;  4W9J A;  1WR1 A;  1GJZ A;  2B3A A;  3A4S C;  1CMX B;  1MG8 A;  1V80 A;  2KHW B;  1TTN A;  2CR5 A;  3B0A A;  1ZW7 A;  2L76 A;  3WIM A;  3PV1 A;  4A20 A;  1YX5 B;  4AJW A;  4F1S A;  4E71 A;  2G4D B;  2HD5 B;  3M3J A;  1YQB A;  4IWO A;  3KW5 B;  2Z0E B;  1E7V A;  2O6V A;  2XBB C;  3N30 A;  5DCN A;  5JH5 C;  2DAF A;  3APF A;  1EF5 A;  2AWT A;  4LJO B;  3PSE B;  2EMS A;  2KJR A;  3MTN B;  4CO7 A;  4MDK E;  5DPT A;  3RZF A;  3P2B A;  2KZR A;  4WJN A;  2K6D B;  1U4A A;  1WE7 A;  3L13 A;  4GOC A;  2WX0 A;  2KJH B;  2ZCC A;  4K7W A;  2BPS A;  3EC8 A;  4W9D A;  1BT0 A;  1WMH B;  3WAP A;  3OAW A;  5LLI A;  4LJP B;  1LM8 B;  4FLH A;  4PYU A;  2N9X A;  2DZM A;  3DVN V;  4W9G A;  3A9K A;  4RM8 A;  2CU1 A;  1P98 A;  4FAD A;  4MGK E;  3RUL A;  4IM0 A;  1D3Z A;  3TJP A;  2PJH A;  3IG3 A;  2ZEQ A;  4W9H A;  3X23 A;  2NS5 A;  2LAS A;  4MGZ E;  3NHE B;  3ZNH B;  1WZ3 A;  2BYF A;  2BWE S;  2ZVN A;  2K8H A;  2MBB B;  3LJ3 A;  4HJK A;  3JYU A;  4ZRI A;  4BOZ B;  2L00 B;  5G55 A;  4FA6 A;  1Q0W B;  2MRP A;  4KVG B;  1V2Y A;  2IO3 B;  2O6V D;  2MQJ A;  4G11 A;  3APD A;  3QAQ A;  2M1M A;  2LD9 A;  3JW0 X;  4B6W A;  1V86 A;  4YL8 A;  2CHZ A;  3DDC B;  2ZJD A;  2DYO A;  1TBE A;  4GMV A;  3QCA A;  2BF8 B;  2IYD B;  4KV2 A;  1OEY J;  1WY8 A;  3Q3F A;  4TQ1 A;  1RFA A;  3AU5 A;  3A9K B;  3PGE A;  1IPG A;  2D3G A;  1T0Y A;  2W9N A;  4IW0 A;  4M8N A;  3W1S A;  1OGW A;  3WAO A;  2C60 A;  1L7Y A;  2AEH A;  2UWQ A;  2IO2 B;  2JPH A;  4NQL B;  4HCP B;  5E6O A;  4W9K A;  3AI5 A;  4AJY B;  1P1A A;  2MBQ A;  4KDL B;  3VTU A;  4GIV A;  3M63 B;  2LUE A;  3DBL I;  4WWO A;  1AAR A;  3SU8 X;  4E3C A;  1LXD A;  3R7R A;  5BO4 B;  2KQ7 A;  3VUX A;  3EHV A;  2YLM A;  4IM3 A;  4NQK E;  2MBO A;  2FNJ B;  2D2Q A;  4NJ7 A;  3H7P B;  4I6N B;  4HPL B;  4FJY A;  1I35 A;  3TL5 A;  2HTH A;  2ZNV B;  3A1Q A;  4II2 B;  3DVN U;  1WX9 A;  2CHX A;  2KDF B;  1QZE A;  5FR6 A;  3PTF C;  4PYZ A;  5D94 A;  2N1W A;  3PRZ A;  4NJ6 A;  2KMA A;  3WAM A;  5G2N A;  5AZH A;  3H7S A;  1UZX B;  2C7N B;  1R4N I;  1UBQ A;  1WZ0 A;  2LGD A;  3VXW A;  1I42 A;  2KK8 A;  3KUZ A;  4RM9 A;  2D07 B;  1WYW B;  2RD0 A;  1WGD A;  2DZK A;  3R3M A;  2CHW A;  4IWQ A;  1WXM A;  1Z5S B;  4E74 A;  4G50 A;  3K9P B;  1E5W A;  3UF8 A;  5E6N A;  1WRD B;  3EEC A;  1WGH A;  3H9D A;  1WE6 A;  4LCD E;  1C1Y B;  1L2N A;  3C0R B;  3DBR I;  1WM3 A;  2LJ5 A;  2DZJ A;  2LGY A;  3VH4 B;  3NY5 A;  3TBL D;  4EZJ A;  2MX2 A;  2KLG A;  2J0K A;  1WGG A;  4BFR A;  3A1Q B;  1WIA A;  4B9K A;  3KYD D;  1SGH A;  2PPH A;  3UIN B;  4WJO A;  1SE9 A;  2IY1 B;  3VHT C;  2REX A;  4EZK A;  3N3K B;  1GC6 A;  2IY0 B;  2K1F A;  4FJZ A;  1V5T A;  1P0R A;  4GU2 A;  1RLF A;  3N32 A;  2KC2 A;  4X57 B;  5IA7 A;  1V49 A;  2JF5 A;  2NCN A;  4XZ4 A;  2M8S A;  2ZCB A;  2I1K A;  4EKU A;  3CSF A;  2D10 A;  3APC A;  2GBJ A;  3UIO B;  4GXB A;  5D6J B;  4AWJ A;  5TR5 A;  3VQI A;  2L05 A;  4FN2 A;  3WAL A;  3ZW3 A;  3A33 B;  3DBH I;  4HPM B;  3L08 A;  4ZRJ A;  5C23 A;  1V81 A;  1WX8 A;  2XK5 A;  3IBE A;  5AZF A;  4GDK B;  4HK2 A;  2GMI C;  2A4Z A;  1IP9 A;  4EOY A;  1E7U A;  3H1U A;  4IWP A;  1R4M I;  3RT3 B;  2EKE C;  2O2V A;  1YD8 U;  2KTR B;  3BIN A;  3X0W A;  4HLE A;  2LXA A;  2MP2 B;  1VCB A;  2R2Q A;  4HDQ A;  1E8Z A;  2NR2 A;  1H4R A;  2DYB A;  3QK0 A;  2LZ6 A;  2MBH A;  2Z59 B;  3OJ3 A;  3RYT A;  2G3Q B;  5J18 A;  2M17 A;  3HIZ A;  4IG7 B;  3ZRF A;  1K8R B;  3ZDM C;  1Q1O A;  1WFY A;  1Z2M A;  3A9J A;  3D32 A;  3W1Y A;  2KWC A;  3V61 A;  1RRB A;  4ANX A;  3L0W B;  2KC1 A;  2KFJ A;  3T9L A;  2O6V B;  1KOT A;  2NPT A;  2XK5 B;  3VUW A;  3DVG Y;  3ML9 A;  4BVU C;  4K7S A;  4G0N B;  2GBN A;  4JIO U;  2LGX A;  3PT2 B;  4PS3 A;  4MJS A;  3PS6 A;  4DDI D;  2N1V A;  1VD2 A;  5DPR A;  1OEY A;  4BKS A;  3VTV A;  4FUL A;  3VTW A;  4IUM B;  1NBF C;  5JZE B;  1V9J A;  2C7H A;  2NVU I;  3AU4 A;  5CHF A;  2NBW B;  4WWP A;  4OVU A;  4CHK A;  2DHZ A;  1WJU A;  2V4L A;  1Y8R C;  3ZNG C;  2YVC A;  4KIK A;  3PRP B;  4ANW A;  4FHJ A;  3I3T B;  2IO1 B;  4WJQ A;  2A5U A;  4HWI B;  1OQY A;  3QA8 A;  1XT9 B;  3HK0 A;  5DPW A;  3ZRC A;  2KWU B;  1YJ1 A;  2BYE A;  3GZN I;  4PS7 A;  5JHA A;  2JVC A;  1KJT A;  2FCN A;  2N4F A;  2RGF A;  3OLM D;  3S2A A;  4OVV A;  3R7Q A;  4TKN A;  1PQS A;  1F9J A;  2LI5 A;  4K1R B;  2C9W B;  4URK A;  2JRI B;  4EEW A;  2ZVO A;  2LRU A;  2K25 A;  2KVR A;  1X1M A;  2NBU A;  4WQO B;  4WWN A;  4P7I A;  2WWZ A;  3ZKJ C;  2IBI B;  4ANV A;  4BKS D;  1SIF A;  2BGF A;  2I1J A;  2WX1 A;  4BBN F;  2CS4 A;  3TIX A;  3QHT A;  4KDI C;  3AXC A;  3PHW B;  1UD7 A;  2PE6 B;  2J0J A;  3IHP C;  4ANU A;  5HKH A;  5L83 A;  3B1L X;  3PVL A;  3EFU A;  5LXI B;  2ZPN A;  4A3O A;  3T8M A;  1E8Y A;  5D7G A;  1E8W A;  1KM7 A;  3MHS D;  1TZ1 A;  1WXV A;  4GDL A;  2J0M A;  3DBS A;  1GNU A;  1V5O A;  1WF9 A;  4BOS C;  3DCG A;  3H6N A;  5JHB A;  4ICV A;  5D2M B;  4FBJ B;  5IAA C;  2ASQ A;  2KWV B;  3VVW B;  5DPS A;  2JWZ A;  4FJV B;  2K8B A;  5KHQ A;  3ZNZ B;  2AL3 A;  3LDZ E;  1UH6 A;  4G3X B;  1S3S G;  2GBR A;  2BKR B;  2WDT B;  3V62 A;  2AL6 A;  1GG3 A;  2FCQ A;  4DHJ B;  4TQ0 A;  3ZTC A;  1WJN A;  2DX5 B;  5EDS A;  4HDO A;  3JVZ X;  2C7M B;  2K6Q A;  2KX0 A;  4ZRK A;  2MCN B;  3OJ4 B;  4DWF A;  4ZDV A;  2WYQ A;  3KUC B;  4W9L A;  3JSV A;  3ECI A;  1EF1 A;  2DZI A;  2JRH A;  4DHJ D;  1Q5W B;  3U7D A;  2OJR A;  3QX1 A;  4HXD A;  4ICU A;  2RR9 A;  4EFO A;  2JT4 B;  3U8Z A;  2MLB A;  3PZD A;  2KO3 A;  1M94 A;  2N7E A;  2KDB A;  1LFD A;  3B08 A;  2QHO A;  4NNJ B;  2R2O A;  3ZUN A;  4EZL A;  1UBI A;  3RUI B;  4N9F 4;  1WXS A;  4TUU A;  2DAJ A;  4BKT A;  1WR6 E;  3VDZ A;  2L3Z A;  3QIJ A;  3M95 A;  3MJW A;  2KX3 A;  3VAW A;  3IVF A;  2BWF A;  3A4R A;  2KOX A;  2LRW A;  1HE8 A;  1J19 A;  2HJ8 A;  2NBV B;  3UQA A;  3ZNI D;  2BYV E;  3ALB A;  1A5R A;  2DYM A;  2KXJ A;  4DDG D;  1V6E A;  1RAX A;  3QQ8 B;  2D11 A;  2KN5 A;  4AP4 C;  2MSE D;  2LVP A;  3L54 A;  1EUV B;  2LVO A;  3M62 B;  4GB9 A;  2M0X A;  3TCA A;  3HHM A;  2N9E B;  4K81 A;  3RCZ A;  1WGY A;  3NOB A;  1KLV A;  3PLV A;  3SDL C;  1FXT B;  2KQS A;  3L17 A;  5CX3 A;  2EMT A;  4MGI E;  1JRU A;  1S1Q B;  2GOW A;  3PRM B;  4F8C B;  3VFK A;  1LQB A;  3PRE A;  2LVQ A;  4MEM A;  4JQW C;  2MA9 B;  1WJ4 A; 
#chains in the Genus database with same CATH topology
 2FID A;  4GN1 A;  3MFG A;  4HCN B;  4K7U A;  3UGB B;  3I9V 1;  1YN5 A;  1E8X A;  3O65 B;  4J3O D;  2RDB C;  1DYQ A;  1V97 A;  4M01 A;  1L5P A;  5GMV A;  4A55 A;  3NVZ A;  5HHD G;  3RMK C;  3A9J B;  4BKG A;  4MSQ B;  3ML8 A;  1J8C A;  4MSM B;  4XX5 A;  2KLC A;  4US8 A;  3SD5 A;  3TMP B;  4MGY E;  4I6P A;  4K3C A;  3Q14 C;  3AB5 A;  4NY0 A;  4C7Z A;  2Y5B B;  2KTF A;  4ZHP A;  3L10 B;  2QIL A;  4HEA 1;  1NI2 A;  1WXA A;  1STE A;  4C56 C;  4B95 A;  2JY6 A;  1DGJ A;  1BML C;  4KZ0 A;  2DLB A;  2JZZ A;  4LDT B;  4AUQ C;  4YT0 B;  3C19 A;  1YX6 B;  1D6E C;  3Q8A A;  4NAW A;  3PLU A;  1FRR A;  2RPQ A;  2K8C A;  5J17 A;  2J7Q B;  5MPO A;  3QJZ A;  2M56 B;  1NI3 A;  3NRZ A;  2VH2 A;  2BB6 A;  2V3S A;  3HUI A;  1EO6 A;  1V8C A;  2V1Y A;  2ZNV C;  2BS3 B;  2OOB B;  4MT5 A;  3AEF B;  2LHD A;  4GDL B;  4W9E A;  3LB8 C;  3V6C B;  3R8B A;  2KKC A;  1C79 A;  2FCS A;  1NEK B;  1C9F A;  3PPA A;  4RF0 A;  2VH1 A;  4RGN A;  4JL9 A;  1JWB D;  3R66 C;  3U52 E;  4WIP A;  2HE7 A;  2YEP B;  1WX7 A;  2KTR A;  3HM6 X;  3V60 A;  2KMC A;  4AQ7 A;  4J6I A;  3BVZ A;  4W9J A;  1WR1 A;  1DOI A;  4OVZ A;  1HEZ E;  1SEB D;  1V80 A;  2GI9 A;  3B0A A;  1ZW7 A;  4AJW A;  4F1S A;  1YN3 A;  4E71 A;  3M3J A;  1YQB A;  3KW5 B;  4RCO A;  1E7V A;  5JH5 C;  2XBB C;  2V0G A;  5DCN A;  1MHH E;  2DAF A;  3APF A;  4NJC A;  5DPT A;  4HRS A;  3P2B A;  2K9X A;  2KZR A;  4WJN A;  3L13 A;  4TSS A;  5LLI A;  2K3U A;  1LM8 B;  2MJ3 A;  4YTM B;  1QQR A;  3PZ7 A;  2LFI A;  1P98 A;  3RNA C;  3VR9 B;  4MGK E;  2PJH A;  3DBL B;  3IG3 A;  2JX5 A;  3W9C B;  4MGZ E;  3ZNH B;  4JWU C;  2WP9 B;  4P1C C;  5G55 A;  1Q0W B;  3KWV A;  1MI0 A;  4KVG B;  4WH4 A;  4G11 A;  3P4S B;  1E6E B;  2CHZ A;  3DDC B;  1N62 A;  3BK1 A;  2N7J A;  2LGI A;  1TBE A;  5IO9 A;  2BF8 B;  1OEY J;  3Q3F A;  3A9K B;  3PGE A;  1V1P A;  2D3G A;  2W9N A;  4M8N A;  4RGM A;  1R4N B;  1OGW A;  3GE3 C;  3B2F A;  2OED A;  1L7Y A;  1DOY A;  4CQN A;  3TEX A;  1UGJ A;  2K0P A;  5HG2 A;  2Y3A A;  4HCP B;  2BYT A;  1B9R A;  2XN9 C;  4W9K A;  1UUP A;  1AAR A;  3SU8 X;  3GE8 C;  2KQ7 A;  1FCL A;  2MBO A;  4HRO A;  3Q8C A;  2ZNV B;  1WX9 A;  2CHX A;  3AE4 B;  5FR6 A;  1WGK A;  4A6Q A;  3WAM A;  5G2N A;  4IKG A;  5AZH A;  1UZX B;  2ZW0 A;  1OQQ A;  4ZRQ A;  2RD0 A;  4E74 A;  1V1O A;  1WE6 A;  5EE0 A;  1WGG A;  1EM7 A;  4BFR A;  3KYD D;  1SGH A;  3UIN B;  1M4V A;  4MM3 B;  3N3K B;  1GC6 A;  2K1F A;  1V5T A;  4GU2 A;  5D3I B;  2KC2 A;  2G9H D;  2M8S A;  2ZCB A;  2I1K A;  1QKZ A;  4ZRP A;  3CSF A;  2D10 A;  3UIO B;  2GBJ A;  1FMA D;  3ZW3 A;  3T3N A;  3A33 B;  4ZRJ A;  4D2K A;  4GDK B;  5FR3 A;  4A90 A;  4IWP A;  2B76 B;  4H2A A;  2O2V A;  2MJE A;  1FFU A;  2MP2 B;  3OJ3 A;  1FCC C;  2D3C A;  3RYT A;  3ZXV A;  2WXM A;  1IBX B;  2KWC A;  1HTQ A;  4ANX A;  2KFJ A;  2KWD A;  1CZP A;  2WU5 B;  3PT2 B;  4L2Y A;  2N1V A;  5D3D A;  3VTW A;  2HJ1 A;  4GLS C;  1NBF C;  1V9J A;  2D5G A;  1R7S A;  2X8X X;  2NBW B;  4WWP A;  2V4L A;  3ZNG C;  2LUM A;  2AQ3 B;  1KLG D;  1ZUD 2;  4WJQ A;  3VRA B;  5DPW A;  1TKG A;  3GZN I;  4RF1 A;  2FCN A;  5BYQ A;  2RGF A;  3OLM D;  2KDM A;  3TEY A;  2PKO A;  4TKN A;  2C9W B;  2V3P A;  2JRI B;  4EEW A;  3RNC C;  2M19 A;  4LNF A;  3MC0 B;  4P7I A;  4WWN A;  3VRB B;  3BZD B;  1QLB B;  1KFY B;  1UD7 A;  3RNE C;  1L6U A;  5IN7 A;  3PVL A;  3T8M A;  3Q8F A;  1TZ1 A;  2J0M A;  3BVM A;  1V5O A;  1SE2 A;  3DCG A;  4NAM A;  5D2M B;  4FBJ B;  2WDV B;  1IGD A;  1TT5 B;  2KWV B;  2JWZ A;  3FAH A;  1YQ4 B;  2WDT B;  2AL6 A;  5IP4 D;  1K51 A;  4TQ0 A;  3ZTC A;  2Z8L A;  5EDS A;  3AN1 A;  1YJI A;  2WYQ A;  3KUC B;  4W9L A;  4LNI A;  4A9A A;  2GRI A;  2SEB D;  2KO3 A;  3BYT B;  1GPX A;  4YSY B;  2WDR B;  2ACZ B;  3AED B;  4YSX B;  1YQ3 B;  4NZL B;  1UBI A;  2WDQ B;  1ZXI A;  2DAJ A;  4BKT A;  3MP9 A;  4YTN B;  1FEH A;  2KX3 A;  3VAW A;  3Q6B A;  3N9Y C;  2D3B A;  2WLB A;  3U7Z A;  2EEL A;  1N60 A;  2KVZ A;  1K52 A;  1A5R A;  1EWY C;  4DDG D;  1MVK A;  1RAX A;  3L54 A;  3IAM 1;  2LVO A;  2M0X A;  2N9E B;  1EWC A;  1FXT B;  2K5P A;  1SE3 A;  2EMT A;  3DHG C;  1EU3 A;  3PRM B;  1LQB A;  1RM6 C;  4JQW C;  3PV1 A;  2MA9 B;  4EE2 A;  2IZV B;  4DBG A;  1TS2 A;  3U30 A;  3SHQ A;  1AYF A;  4W9I A;  2JZ3 B;  2W3S A;  3AE8 B;  3PHX B;  4JLC A;  3ZDT A;  5I4D A;  3BII D;  1N6Z A;  2KFK A;  4II3 B;  2FAZ A;  2RDH A;  1XQQ A;  4S0R A;  1J7B A;  3WAN A;  4AS1 A;  4MJS B;  3KYC D;  1ACC A;  3IFW B;  2N0S B;  3URY A;  4F7Z A;  3Q3M C;  3H7P A;  5J2R A;  2E6X A;  2GLS A;  3GP7 A;  3L16 A;  4XC2 A;  2MW5 A;  3QWZ B;  3VH3 B;  2D3A A;  4LTU A;  2NTS A;  2BTE A;  2G45 B;  2JXX A;  1OTR B;  4NPN A;  5KHO A;  1FNU A;  2RSU A;  3QC8 B;  4KZC A;  3Q3J A;  4P6V F;  3HM3 A;  1UWX A;  3V6E B;  2AYO B;  1ZE3 D;  3GOE A;  1PGX A;  5H8Y E;  3RZW C;  2CKH B;  4W9C A;  1ISN A;  3KVF B;  1C77 A;  5E6P A;  2QC8 A;  3Q3N C;  2J53 A;  2GBM A;  2TSS A;  2WXL A;  2K39 A;  2FUH B;  4FHK A;  2VRR B;  2N9L A;  3QAR A;  2G4S A;  3CMM B;  4NAW B;  1NVI D;  2GBK A;  1GC7 A;  2JZP A;  1C76 A;  2PEA A;  1FXA A;  5FKA C;  2ZZP B;  4GGQ A;  2L8J A;  5EE3 A;  2AQ2 B;  2KDI A;  2H89 B;  1WMH A;  3ONS A;  4ZYN A;  1GJZ A;  1MG8 A;  2CR5 A;  1MFW A;  3WIM A;  1YX5 B;  4IWO A;  2Q5W D;  2BBC A;  1TZO A;  2AWT A;  3PSE B;  3MTN B;  4MDK E;  2WXJ A;  2NTT A;  3RZF A;  2J4X A;  3H8H A;  4GOC A;  2J42 A;  2WX0 A;  4W9D A;  1HTO A;  1SJH D;  4LJP B;  2N9X A;  3E9S A;  1K50 A;  3AE9 B;  3NG0 A;  3P4Q B;  4RM8 A;  4WWM A;  4FAD A;  2KMM A;  1TS3 A;  1P7F A;  4IM0 A;  2JYT A;  2WXQ A;  4MAC A;  1VRA B;  4W9H A;  3X23 A;  3NHE B;  4BAX A;  2PW9 A;  3MHZ A;  2MBB B;  2PTL A;  3N20 C;  2WQY B;  4HJK A;  2L00 B;  1TIF A;  2MRP A;  2L83 A;  3APD A;  3ZXR A;  1WSP A;  3GS2 A;  2DYO A;  3IT6 B;  4LNN A;  4L23 A;  4TQ1 A;  2LHE A;  1RFA A;  3AU5 A;  3IAS 1;  3W1S A;  3BYY B;  4RGT A;  2LGS A;  2AEH A;  2UWQ A;  5HFY A;  1L4D B;  3FKY A;  4XE0 A;  4C4V B;  3LXF A;  3VTU A;  2WXO A;  3M63 B;  2WXH A;  3WCQ A;  4WWO A;  4E3C A;  1LXD A;  3R7R A;  5BO4 B;  1FRD A;  3VUX A;  3EHV A;  1WXQ A;  4NQK E;  2CJN A;  3SR6 A;  4HPL B;  1V1P B;  1XCT L;  3TL5 A;  1NYQ A;  3A1Q A;  5LNK 1;  1L6V A;  2PIA A;  2DWQ A;  4PYZ A;  3PRZ A;  3FIL A;  1MG4 A;  1TKY A;  4B0E A;  4P16 A;  3KUZ A;  2D07 B;  1WYW B;  1WGD A;  2CHW A;  1WXM A;  4G50 A;  1WRD B;  3O13 A;  1C1Y B;  3C0R B;  3TBL D;  2MX2 A;  4RNA A;  1WIA A;  1ENF A;  4WJO A;  1SE9 A;  2IY1 B;  2QDF A;  3VHT C;  3AEA B;  4EZK A;  3ZJU A;  4FJZ A;  3N32 A;  4X57 B;  1V49 A;  2JF5 A;  1N5W A;  4B0M A;  1YMH E;  2IGH A;  1FIQ A;  3DBH I;  2X38 A;  2IDY A;  4HK2 A;  2GMI C;  1IP9 A;  3RT3 B;  3KQ4 A;  1QT9 A;  3BIN A;  1AW7 A;  4ZYS A;  1KRH A;  2HTM E;  2E3T A;  4HDQ A;  4KGT A;  3GZN B;  2LZ6 A;  5BMI A;  3RFZ B;  2G3Q B;  3IT4 B;  3ZRF A;  1TS5 A;  3ZDM C;  3A9J A;  3D32 A;  3W1Y A;  2I38 A;  1RRB A;  3L0W B;  4KGS A;  2KC1 A;  4S17 A;  2O6V B;  5IOI A;  3ZGZ A;  4BVU C;  1K53 A;  2GBN A;  2LGX A;  3IXS A;  2QJL A;  1FD6 A;  1VLB A;  2C7H A;  5TSS A;  2YVC A;  4YXD B;  4ANW A;  4FHJ A;  1WYG A;  2A5U A;  5IKC M;  1OQY A;  1E0Z A;  4PS7 A;  3V3X A;  4C7Y A;  2JVC A;  1KJT A;  1XLQ A;  3MC9 A;  3SFE B;  1KTK A;  4OVV A;  3R7Q A;  2ZVO A;  1VZ7 A;  2K25 A;  2NBU A;  2WWZ A;  3ZKJ C;  2WXK A;  4ARC A;  1MHX A;  4BKS D;  2WX1 A;  2I1J A;  2CS4 A;  3TIX A;  1SIJ A;  3QHT A;  1ZDV A;  3AXC A;  4ANU A;  5HKH A;  5L83 A;  3B1L X;  5LXI B;  1E8W A;  1WRI A;  2KT7 A;  2FBW B;  4GDL A;  4ZOH C;  1OFF A;  1I4H A;  4YTP B;  2IJ0 A;  4ICV A;  4LLG M;  2ASQ A;  5DPS A;  2SAK A;  5KHQ A;  2ONQ A;  4XYC A;  3ZNZ B;  2PVG C;  1UH6 A;  3ZJT A;  1S3S G;  2GBR A;  2BKR B;  2FE8 A;  3HVD A;  2FCQ A;  1MJD A;  4HDO A;  1UF0 A;  2ON8 A;  3JVZ X;  2K6Q A;  2MCN B;  3OJ4 B;  2QIE B;  4DHJ D;  1ET9 A;  2IND C;  3ECI A;  1ZXH A;  4DXG A;  1Q5W B;  4EFO A;  2JT4 B;  1TS4 A;  2MLB A;  3PZD A;  1CK1 A;  2N7E A;  3ZUN A;  4EZL A;  1QOB A;  3RUI B;  1WXS A;  3M95 A;  1TYG B;  4JPS A;  4XGA B;  4KKI A;  5BMH A;  1JW9 D;  2BB5 A;  1QOA A;  2RMM A;  4KGR A;  1ZP0 B;  4JWS C;  3UQA A;  1XEE A;  2BYV E;  3L4P A;  1C4A A;  1SE4 A;  2I2Y A;  2DYM A;  2KN4 A;  3QQ8 B;  2MSE D;  4Q2J A;  1UNS A;  3NOB A;  4F8C B;  1WJ4 A;  4BBN C;  2EKI A;  2GB1 A;  4IM2 A;  1T0S C;  3C8Y A;  1ZKH A;  3ZLZ A;  2M4N A;  3EFC A;  4DQO C;  1QOG A;  1SBB B;  3ZVV A;  5CHW A;  4HVB A;  2L0F A;  1JWS D;  2QEJ C;  1C3T A;  4ARI A;  5G5H A;  2BKF A;  1H8C A;  3NZU A;  4L1B A;  2M0A A;  1L0V B;  3NZS A;  2NPT B;  2KYW A;  4DHZ E;  4PS8 A;  3KH0 A;  1T5X D;  1HQR D;  4M00 A;  1E90 A;  5AEK B;  3SFD B;  3AUL A;  2KJ6 A;  4KIK B;  4GSW A;  4MH0 E;  2RPV A;  2KFK B;  4WJP A;  2PVO D;  4KKJ A;  3ENE A;  3T3O A;  1HXY D;  1WJ6 A;  1I4R A;  3BK2 A;  2L1A A;  5C3J B;  4LDT D;  4M0W B;  1QIL A;  1WGR A;  3ZJV A;  4A3P A;  2KAN A;  1PGB A;  4CYE A;  1WH3 A;  4W9F A;  2N7D A;  1Q10 A;  3CWI A;  3AE1 B;  3UIP B;  5CTR C;  3ZIM A;  4MM3 A;  2XNA C;  4OW0 A;  3W1S C;  4DXA B;  4WAA A;  3DOW A;  1P9D U;  4IC7 B;  1PYW D;  3MC8 A;  1KF6 B;  2PMV A;  2FIF A;  3NS8 A;  2LWP A;  2FCM A;  2KD0 A;  1GUA B;  4GDK A;  4DK5 A;  3VUY A;  1TGZ B;  1L0Y B;  1WI0 A;  3AE6 B;  2ZPY A;  4JGH B;  4JE3 B;  4HPP A;  5C1Z A;  1JRP A;  2MP2 A;  4MEL A;  3JSV B;  1XLO A;  3Q69 A;  2B3A A;  2RDG A;  1IBX A;  2L76 A;  4A20 A;  1LO5 D;  1D4B A;  4IDI A;  3W5V B;  2K6D B;  1WE7 A;  2ZCC A;  1BUI C;  2BPS A;  3EC8 A;  1J7A A;  1WMH B;  2JSV X;  3OAW A;  3WAP A;  4PYU A;  3DVN V;  3NS1 A;  2CU1 A;  1VR9 A;  4HJG E;  3N1X C;  3RUL A;  1D3Z A;  3PZ8 A;  3RI7 C;  3TJP A;  1VZ8 A;  2NS5 A;  2LAS A;  1JWA D;  1WZ3 A;  2BYF A;  2BWE S;  2ZVN A;  4PT5 A;  3AE2 B;  3LJ3 A;  3JYU A;  4ZRI A;  1TY0 A;  4FA6 A;  3DWG C;  2IO3 B;  1FNV A;  2O6V D;  1N63 A;  3QAQ A;  2M1M A;  3JW0 X;  1T0R C;  4B6W A;  1F77 A;  1PFD A;  4C00 A;  2IYD B;  4KV2 A;  3EA6 A;  1IPG A;  1T0Y A;  2INP E;  2IGD A;  3P63 A;  3R2T A;  3WAO A;  2C60 A;  1HA5 A;  3NVW A;  3RNF C;  2JPH A;  4OZA A;  3DHI C;  4AJY B;  2MBQ A;  3I57 A;  4GIV A;  5G5G A;  2LUE A;  4QAY A;  4YWG G;  1JWU D;  1RFK A;  1FM0 D;  4IM3 A;  4YSZ B;  4I6N B;  1OQR A;  1I35 A;  3U4E G;  2HTH A;  2W82 A;  4II2 B;  3DVN U;  3RNG C;  2WU2 B;  4NJ6 A;  2KMA A;  4ZHO A;  1JQ4 A;  1UBQ A;  2LGD A;  3DBH B;  1I42 A;  3R3M A;  3HRD D;  1Z5S B;  3K9P B;  1E5W A;  3UF8 A;  5E6N A;  3EEC A;  1WGH A;  1YJJ A;  4LCD E;  3DBR I;  1WM3 A;  2LJ5 A;  2DZJ A;  2LGY A;  2KLG A;  1FPY A;  3A1Q B;  4REZ A;  2VZK B;  2DNF A;  4USA A;  3BVG A;  1ET6 A;  2JQR B;  1RLF A;  4FXC A;  4UDU C;  4XZ4 A;  2AX5 A;  4EKU A;  2INC C;  1FO4 A;  1GAQ B;  3APC A;  3RNB C;  4GXB A;  5TR5 A;  2L05 A;  3WAL A;  4XDD A;  1ZPS A;  2WNM A;  4OZB A;  1WWT A;  1V81 A;  1WX8 A;  2XK5 A;  2K22 A;  1I4P A;  3IBE A;  3AV8 A;  5AZF A;  1F0Z A;  2A4Z A;  1KLU D;  1R4M I;  1YD8 U;  2KTR B;  3X0W A;  1E9M A;  2LXA A;  5E6J A;  1D5M C;  2R2Q A;  2NR2 A;  5H92 C;  3QK0 A;  2Z59 B;  4OZC A;  5J18 A;  3I5J C;  4N59 A;  5AUI A;  2M17 A;  3HIZ A;  4IG7 B;  1XLN A;  1K8R B;  3OWE B;  1WFY A;  2LJI A;  2BW2 A;  2G1E A;  2WXG A;  5BYS A;  1T0Q C;  2INN E;  1KOT A;  1XO3 A;  3VUW A;  4K7S A;  4G0N B;  4PS3 A;  4JIO U;  1SXT A;  4MJS A;  3PS6 A;  1JRO A;  1VD2 A;  2JU6 X;  3N1Z C;  1OEY A;  5DPR A;  1BXT A;  4BKS A;  4FUL A;  1TKE A;  4IUM B;  2W54 A;  5JZE B;  1QOF A;  2NVU I;  3AU4 A;  5CHF A;  2KQ4 X;  3NJT A;  1J7C A;  1WJU A;  1Y8R C;  1ZDX A;  3PRP B;  2IO1 B;  3NVY A;  4HWI B;  3AEG B;  3HK0 A;  1YJ1 A;  2WXF A;  2BYE A;  5JHA A;  3E56 A;  2N4F A;  2BS4 B;  3TEW A;  1TJE A;  2LI5 A;  4K1R B;  2LRU A;  1MPE A;  2KVR A;  1X1M A;  2JXT A;  2WS3 B;  2IBI B;  4ANV A;  1QF6 A;  1N5X A;  1F2R I;  4BBN F;  2OJW A;  4KDI C;  3PHW B;  2PE6 B;  3NUH B;  3EFU A;  1GOZ A;  1KM7 A;  3H6N A;  5JHB A;  1VZ6 A;  5IAA C;  3I63 C;  1L4Z B;  3CIR B;  2K8B A;  3P1M A;  1HZ5 A;  3V62 A;  3B2G A;  3ABV B;  1WJN A;  1IUE A;  4P1B C;  2C7M B;  4ZDV A;  4ZRK A;  1EF1 A;  2DZI A;  2JRH A;  2NMQ A;  2OJR A;  3P4R B;  3QX1 A;  2RR9 A;  4LNK A;  3U8Z A;  1M94 A;  3B9J A;  3AH7 A;  2KDB A;  2H88 B;  1LFD A;  1JCK B;  3B08 A;  4C80 A;  1AN8 A;  2R2O A;  2W3R A;  3AEC B;  1AWD A;  3VDZ A;  2L3Z A;  3QIJ A;  4WUR A;  3MJW A;  1JML A;  3IVF A;  2BWF A;  3A4R A;  2KOX A;  1J19 A;  2HJ8 A;  2NBV B;  2MHJ A;  1Y56 A;  4ITK A;  1I4X A;  1F1H A;  2KXJ A;  2KN5 A;  1EUV B;  2V4I B;  4XWW A;  3TCA A;  3HHM A;  1PGA A;  4K81 A;  1WGY A;  3PLV A;  1B1Z A;  3HVZ A;  3L17 A;  1JRU A;  2GOW A;  3PRE A;  2LVQ A;  1CJE A;  3PO0 A;  4G3X B;  4RMA A;  1WM2 A;  2O2V B;  4MH8 A;  4I6L B;  4KSL C;  3P42 A;  1XF5 L;  3Q8B A;  1E7P B;  3BY4 B;  3KWL A;  4C4V A;  2L52 A;  2W55 A;  2Z0D B;  4EUT A;  2MJD A;  3ZTD A;  1C78 A;  3ZO5 B;  1JWM D;  3SEB A;  1J0G A;  2XEW A;  3DPD A;  3ETR A;  5CHV C;  3AE7 B;  2PE9 A;  1XD3 B;  5GXG B;  4HKZ E;  4DHZ B;  5L95 C;  2N9P C;  1SJE D;  5EE1 A;  4M8M A;  1UGM A;  2DEN B;  1RWS A;  3AEE B;  2UYZ B;  4N6E B;  3DQV A;  4AOF A;  3UQB A;  1YIW A;  3CF6 E;  3AMZ A;  3K9O B;  1G6J A;  2L0T A;  1IYF A;  1I4Q A;  2C5L C;  3ZYY X;  2N9K A;  2KNB A;  5LXH A;  2MWS B;  2BQQ A;  2KDE B;  2L7R A;  1UWM A;  1XCQ L;  2JUO A;  1DOX A;  1FXI A;  1NDD A;  2MBE A;  3WA0 A;  2Y5P A;  1LGR A;  1P3Q U;  3CST A;  1UEL A;  2IO0 B;  3GB1 A;  1ZGU B;  3KUD B;  3FC4 A;  1IGC A;  4WQM A;  4LK0 M;  4KSK C;  5AZG A;  3MJ5 A;  1VDV A;  2LXC A;  4TV3 A;  3DVG X;  2VZK D;  4ASW C;  1E10 A;  1ESF A;  3DHH C;  3A4S C;  2BT6 A;  1CMX B;  2KHW B;  1TTN A;  4KX6 B;  2JWU A;  1CQV A;  2G4D B;  2HD5 B;  2Z0E B;  2O6V A;  2V3N A;  3N30 A;  1EF5 A;  4LJO B;  1GB4 A;  2EMS A;  2BS2 B;  2KJR A;  4CO7 A;  2LMC A;  2PLP A;  2LEK A;  1NEN B;  1U4A A;  2KJH B;  4K7W A;  1BT0 A;  3RPF C;  4FLH A;  3NVV A;  2WHI A;  4LNO A;  2DZM A;  4W9G A;  3A9K A;  2ZW1 A;  2CU3 A;  4IOI E;  3N1Y C;  2ZEQ A;  3LYY A;  3P4P B;  2K8H A;  4HKQ A;  1PDX A;  1EU4 A;  4M02 A;  4BOZ B;  2AQ1 B;  3J9C A;  1V2Y A;  5C2T B;  2MQJ A;  1FFV A;  2LD9 A;  1V86 A;  4YL8 A;  2ZJD A;  4BZA A;  4GMV A;  1F2R C;  3QCA A;  3AE3 B;  1WY8 A;  1F52 A;  4IW0 A;  2IGG A;  2WXP A;  3EUB 2;  1C4C A;  2YEP F;  2IO2 B;  1A70 A;  4K3B A;  4NQL B;  5E6O A;  2V9H A;  3AI5 A;  4R3D A;  1P1A A;  4KDL B;  3DBR B;  1D5X C;  2R61 A;  3DBL I;  1JAL A;  2YLM A;  2FNJ B;  2D2Q A;  4NJ7 A;  3H7P B;  1SF0 A;  4FJY A;  2FUG 1;  5BMG A;  2KDF B;  1QZE A;  1KH0 A;  3Q8E A;  1FNW A;  3PTF C;  5D94 A;  2N1W A;  2WXI A;  3H7S A;  2C7N B;  3Q2A C;  1N61 A;  1R4N I;  1WZ0 A;  3VXW A;  2KK8 A;  1XLP A;  4RM9 A;  2QSD A;  2DZK A;  4IWQ A;  4A8X C;  1R4M B;  3W2D A;  3UI3 A;  3H9D A;  3TEZ A;  1L2N A;  3VH4 B;  3NY5 A;  4EZJ A;  4US9 A;  2J0K A;  4B9K A;  2ICI A;  2PPH A;  1T3Q A;  2REX A;  2MEK A;  1T6B X;  2IY0 B;  1P0R A;  5IA7 A;  2NCN A;  4XDC A;  5D6J B;  3RN9 C;  4AWJ A;  1SB3 C;  3VQI A;  4FN2 A;  2BVC A;  4PK1 A;  4HPM B;  3L08 A;  5C23 A;  1NYR A;  2KAJ A;  4TMA B;  3AM9 A;  4EOY A;  2IPK D;  1E7U A;  3H1U A;  2EKE C;  1GB1 A;  4HLE A;  1I4G A;  1VCB A;  1E8Z A;  1H4R A;  1XXG A;  2DYB A;  2MBH A;  3DWM A;  1ROE A;  1Q1O A;  1RYJ A;  1Z2M A;  3V61 A;  4DXF A;  3T9L A;  4XWT A;  2DBY A;  2NPT A;  2XK5 B;  3DVG Y;  3ML9 A;  4DDI D;  3AE5 B;  3VTV A;  3R2I A;  5JXV A;  4OHJ A;  1PUT A;  2WGS A;  5HI1 A;  5BYR A;  4N58 A;  4OVU A;  4CHK A;  2DHZ A;  1YOV B;  3NZ3 A;  1YN4 A;  4KIK A;  4JX1 C;  3I3T B;  4O1N A;  4RH6 A;  3QA8 A;  1XT9 B;  3ZRC A;  2KWU B;  5AUK A;  5FK9 C;  3S2A A;  1D5Z C;  1PQS A;  1F9J A;  4M0W A;  4URK A;  4WQO B;  4WAF A;  1VJK A;  2UU7 A;  1SIF A;  2BGF A;  5EE9 A;  2MH7 A;  2J0J A;  3IHP C;  4RGO S;  2ZPN A;  4A3O A;  2QMT A;  1E8Y A;  5D7G A;  3VR8 B;  2WXR A;  3V05 A;  3MHS D;  1WXV A;  2WXN A;  1L0X B;  1GNU A;  3DBS A;  1WF9 A;  4BOS C;  3U2S C;  3VVW B;  4FJV B;  3EGR A;  2AL3 A;  3LDZ E;  2Y5C A;  1GG3 A;  4DHJ B;  2DX5 B;  3OG5 A;  2KX0 A;  4DWF A;  3JSV A;  1HZ6 A;  3U7D A;  1ZOY B;  4HXD A;  4ICU A;  2HDE A;  3FIL B;  2JYE A;  2QCZ A;  2CJO A;  2QHO A;  2L32 A;  4NNJ B;  2KAC A;  4N9F 4;  2J52 A;  3KLS X;  4TUU A;  1WR6 E;  4ACF A;  2LRW A;  1HE8 A;  5T8I A;  3ZQ4 A;  1TY2 A;  3ZNI D;  3Q3O C;  3W5U B;  3ALB A;  1P7E A;  1V6E A;  2D11 A;  4AP4 C;  2LVP A;  3BWU D;  2OHF A;  4RFB A;  3M62 B;  4GB9 A;  3RCZ A;  1KLV A;  3SDL C;  2KQS A;  3TUO A;  5CX3 A;  1I7H A;  1YNT E;  3TSS A;  1SSN A;  1C4P A;  4MGI E;  1S1Q B;  3VFK A;  4MEM A;  3AEB B;  3RD2 A; 
#chains in the Genus database with same CATH homology
 4BBN C;  2FID A;  4GN1 A;  4RMA A;  4HCN B;  2IZV B;  4K7U A;  1WM2 A;  2O2V B;  4IM2 A;  4I6L B;  3U30 A;  3UGB B;  4DBG A;  1E8X A;  3O65 B;  3SHQ A;  1ZKH A;  4KSL C;  4W9I A;  3ZLZ A;  2M4N A;  2JZ3 B;  3PHX B;  3ZVV A;  4JLC A;  5CHW A;  3ZDT A;  4HVB A;  5GMV A;  2L0F A;  2KFK A;  4II3 B;  3BY4 B;  1C3T A;  3A9J B;  2FAZ A;  4BKG A;  1XQQ A;  4MSQ B;  3ML8 A;  4EUT A;  2BKF A;  2Z0D B;  1J8C A;  4MSM B;  1H8C A;  3NZU A;  3ZTD A;  4XX5 A;  3NZS A;  2NPT B;  3ZO5 B;  2KLC A;  4DHZ E;  3WAN A;  3SD5 A;  4PS8 A;  3TMP B;  4MGY E;  4I6P A;  2XEW A;  3DPD A;  3KYC D;  4MJS B;  1J0G A;  5CHV C;  3IFW B;  2PE9 A;  4NY0 A;  2Y5B B;  2KTF A;  1XD3 B;  3KH0 A;  4F7Z A;  1E90 A;  3H7P A;  3L10 B;  4DHZ B;  5L95 C;  2N9P C;  5AEK B;  4M8M A;  1NI2 A;  1UGM A;  5J2R A;  3AUL A;  2KJ6 A;  1WXA A;  2DEN B;  4KIK B;  3L16 A;  2JY6 A;  4GSW A;  4MH0 E;  4B95 A;  4XC2 A;  2MW5 A;  2KFK B;  4WJP A;  2UYZ B;  3QWZ B;  4KZ0 A;  3VH3 B;  3ENE A;  3DQV A;  1WJ6 A;  2JZZ A;  4LDT B;  4AOF A;  3UQB A;  4AUQ C;  1YIW A;  3CF6 E;  1YX6 B;  2G45 B;  2JXX A;  3K9O B;  1OTR B;  4LDT D;  4M0W B;  2L0T A;  4NAW A;  2RSU A;  4NPN A;  3PLU A;  5KHO A;  1IYF A;  1G6J A;  2RPQ A;  1WGR A;  2K8C A;  2C5L C;  3QC8 B;  5J17 A;  4KZC A;  3Q3J A;  4A3P A;  2KNB A;  2J7Q B;  2KAN A;  5LXH A;  2MWS B;  3HM3 A;  3QJZ A;  2KDE B;  2L7R A;  4CYE A;  1WH3 A;  4W9F A;  2N7D A;  3V6E B;  2AYO B;  3GOE A;  2V3S A;  3UIP B;  3ZIM A;  5CTR C;  4MM3 A;  1EO6 A;  3RZW C;  2CKH B;  2JUO A;  1ISN A;  3KVF B;  4W9C A;  5E6P A;  2GBM A;  3W1S C;  2V1Y A;  2K39 A;  4DXA B;  4WAA A;  2ZNV C;  1NDD A;  2OOB B;  2MBE A;  2FUH B;  3WA0 A;  3DOW A;  4FHK A;  4GDL B;  1P9D U;  2VRR B;  3QAR A;  2G4S A;  3CMM B;  4IC7 B;  1P3Q U;  4NAW B;  4W9E A;  3CST A;  1UEL A;  1GC7 A;  2GBK A;  2IO0 B;  3V6C B;  2KKC A;  1ZGU B;  2FIF A;  3NS8 A;  2LWP A;  2FCS A;  2PEA A;  2FCM A;  2KD0 A;  1GUA B;  3PPA A;  3KUD B;  4GDK A;  4DK5 A;  2ZZP B;  4JL9 A;  1TGZ B;  3VUY A;  3R66 C;  1WI0 A;  2HE7 A;  2L8J A;  4GGQ A;  3RD2 A;  2ZPY A;  4KSK C;  5AZG A;  4JGH B;  1WX7 A;  2KTR A;  3HM6 X;  5C1Z A;  3V60 A;  2KDI A;  2KMC A;  2MP2 A;  2LXC A;  4TV3 A;  1WMH A;  3DVG X;  3ONS A;  4J6I A;  4MEL A;  3JSV B;  4ZYN A;  4ASW C;  4W9J A;  1WR1 A;  1GJZ A;  2B3A A;  3A4S C;  1CMX B;  1MG8 A;  1V80 A;  2KHW B;  1TTN A;  2CR5 A;  3B0A A;  1ZW7 A;  2L76 A;  3WIM A;  3PV1 A;  4A20 A;  1YX5 B;  4AJW A;  4F1S A;  4E71 A;  2G4D B;  2HD5 B;  3M3J A;  1YQB A;  4IWO A;  3KW5 B;  2Z0E B;  1E7V A;  2O6V A;  2XBB C;  3N30 A;  5DCN A;  5JH5 C;  2DAF A;  3APF A;  1EF5 A;  2AWT A;  4LJO B;  3PSE B;  2EMS A;  2KJR A;  3MTN B;  4CO7 A;  4MDK E;  5DPT A;  3RZF A;  3P2B A;  2KZR A;  4WJN A;  2K6D B;  1U4A A;  1WE7 A;  3L13 A;  4GOC A;  2WX0 A;  2KJH B;  2ZCC A;  4K7W A;  2BPS A;  3EC8 A;  4W9D A;  1BT0 A;  1WMH B;  3WAP A;  3OAW A;  5LLI A;  4LJP B;  1LM8 B;  4FLH A;  4PYU A;  2N9X A;  2DZM A;  3DVN V;  4W9G A;  3A9K A;  4RM8 A;  2CU1 A;  1P98 A;  4FAD A;  4MGK E;  3RUL A;  4IM0 A;  1D3Z A;  3TJP A;  2PJH A;  3IG3 A;  2ZEQ A;  4W9H A;  3X23 A;  2NS5 A;  2LAS A;  4MGZ E;  3NHE B;  3ZNH B;  1WZ3 A;  2BYF A;  2BWE S;  2ZVN A;  2K8H A;  2MBB B;  3LJ3 A;  4HJK A;  3JYU A;  4ZRI A;  4BOZ B;  2L00 B;  5G55 A;  4FA6 A;  1Q0W B;  2MRP A;  4KVG B;  1V2Y A;  2IO3 B;  2O6V D;  2MQJ A;  4G11 A;  3APD A;  3QAQ A;  2M1M A;  2LD9 A;  3JW0 X;  4B6W A;  1V86 A;  4YL8 A;  2CHZ A;  3DDC B;  2ZJD A;  2DYO A;  1TBE A;  4GMV A;  3QCA A;  2BF8 B;  2IYD B;  4KV2 A;  1OEY J;  1WY8 A;  3Q3F A;  4TQ1 A;  1RFA A;  3AU5 A;  3A9K B;  3PGE A;  1IPG A;  2D3G A;  1T0Y A;  2W9N A;  4IW0 A;  4M8N A;  3W1S A;  1OGW A;  3WAO A;  2C60 A;  1L7Y A;  2AEH A;  2UWQ A;  2IO2 B;  2JPH A;  4NQL B;  4HCP B;  5E6O A;  4W9K A;  3AI5 A;  4AJY B;  1P1A A;  2MBQ A;  4KDL B;  3VTU A;  4GIV A;  3M63 B;  2LUE A;  3DBL I;  4WWO A;  1AAR A;  3SU8 X;  4E3C A;  1LXD A;  3R7R A;  5BO4 B;  2KQ7 A;  3VUX A;  3EHV A;  2YLM A;  4IM3 A;  4NQK E;  2MBO A;  2FNJ B;  2D2Q A;  4NJ7 A;  3H7P B;  4I6N B;  4HPL B;  4FJY A;  1I35 A;  3TL5 A;  2HTH A;  2ZNV B;  3A1Q A;  4II2 B;  3DVN U;  1WX9 A;  2CHX A;  2KDF B;  1QZE A;  5FR6 A;  3PTF C;  4PYZ A;  5D94 A;  2N1W A;  3PRZ A;  4NJ6 A;  2KMA A;  3WAM A;  5G2N A;  5AZH A;  3H7S A;  1UZX B;  2C7N B;  1R4N I;  1UBQ A;  1WZ0 A;  2LGD A;  3VXW A;  1I42 A;  2KK8 A;  3KUZ A;  4RM9 A;  2D07 B;  1WYW B;  2RD0 A;  1WGD A;  2DZK A;  3R3M A;  2CHW A;  4IWQ A;  1WXM A;  1Z5S B;  4E74 A;  4G50 A;  3K9P B;  1E5W A;  3UF8 A;  5E6N A;  1WRD B;  3EEC A;  1WGH A;  3H9D A;  1WE6 A;  4LCD E;  1C1Y B;  1L2N A;  3C0R B;  3DBR I;  1WM3 A;  2LJ5 A;  2DZJ A;  2LGY A;  3VH4 B;  3NY5 A;  3TBL D;  4EZJ A;  2MX2 A;  2KLG A;  2J0K A;  1WGG A;  4BFR A;  3A1Q B;  1WIA A;  4B9K A;  3KYD D;  1SGH A;  2PPH A;  3UIN B;  4WJO A;  1SE9 A;  2IY1 B;  3VHT C;  2REX A;  4EZK A;  3N3K B;  1GC6 A;  2IY0 B;  2K1F A;  4FJZ A;  1V5T A;  1P0R A;  4GU2 A;  1RLF A;  3N32 A;  2KC2 A;  4X57 B;  5IA7 A;  1V49 A;  2JF5 A;  2NCN A;  4XZ4 A;  2M8S A;  2ZCB A;  2I1K A;  4EKU A;  3CSF A;  2D10 A;  3APC A;  2GBJ A;  3UIO B;  4GXB A;  5D6J B;  4AWJ A;  5TR5 A;  3VQI A;  2L05 A;  4FN2 A;  3WAL A;  3ZW3 A;  3A33 B;  3DBH I;  4HPM B;  3L08 A;  4ZRJ A;  5C23 A;  1V81 A;  1WX8 A;  2XK5 A;  3IBE A;  5AZF A;  4GDK B;  4HK2 A;  2GMI C;  2A4Z A;  1IP9 A;  4EOY A;  1E7U A;  3H1U A;  4IWP A;  1R4M I;  3RT3 B;  2EKE C;  2O2V A;  1YD8 U;  2KTR B;  3BIN A;  3X0W A;  4HLE A;  2LXA A;  2MP2 B;  1VCB A;  2R2Q A;  4HDQ A;  1E8Z A;  2NR2 A;  1H4R A;  2DYB A;  3QK0 A;  2LZ6 A;  2MBH A;  2Z59 B;  3OJ3 A;  3RYT A;  2G3Q B;  5J18 A;  2M17 A;  3HIZ A;  4IG7 B;  3ZRF A;  1K8R B;  3ZDM C;  1Q1O A;  1WFY A;  1Z2M A;  3A9J A;  3D32 A;  3W1Y A;  2KWC A;  3V61 A;  1RRB A;  4ANX A;  3L0W B;  2KC1 A;  2KFJ A;  3T9L A;  2O6V B;  1KOT A;  2NPT A;  2XK5 B;  3VUW A;  3DVG Y;  3ML9 A;  4BVU C;  4K7S A;  4G0N B;  2GBN A;  4JIO U;  2LGX A;  3PT2 B;  4PS3 A;  4MJS A;  3PS6 A;  4DDI D;  2N1V A;  1VD2 A;  5DPR A;  1OEY A;  4BKS A;  3VTV A;  4FUL A;  3VTW A;  4IUM B;  1NBF C;  5JZE B;  1V9J A;  2C7H A;  2NVU I;  3AU4 A;  5CHF A;  2NBW B;  4WWP A;  4OVU A;  4CHK A;  2DHZ A;  1WJU A;  2V4L A;  1Y8R C;  3ZNG C;  2YVC A;  4KIK A;  3PRP B;  4ANW A;  4FHJ A;  3I3T B;  2IO1 B;  4WJQ A;  2A5U A;  4HWI B;  1OQY A;  3QA8 A;  1XT9 B;  3HK0 A;  5DPW A;  3ZRC A;  2KWU B;  1YJ1 A;  2BYE A;  3GZN I;  4PS7 A;  5JHA A;  2JVC A;  1KJT A;  2FCN A;  2N4F A;  2RGF A;  3OLM D;  3S2A A;  4OVV A;  3R7Q A;  4TKN A;  1PQS A;  1F9J A;  2LI5 A;  4K1R B;  2C9W B;  4URK A;  2JRI B;  4EEW A;  2ZVO A;  2LRU A;  2K25 A;  2KVR A;  1X1M A;  2NBU A;  4WQO B;  4WWN A;  4P7I A;  2WWZ A;  3ZKJ C;  2IBI B;  4ANV A;  4BKS D;  1SIF A;  2BGF A;  2I1J A;  2WX1 A;  4BBN F;  2CS4 A;  3TIX A;  3QHT A;  4KDI C;  3AXC A;  3PHW B;  1UD7 A;  2PE6 B;  2J0J A;  3IHP C;  4ANU A;  5HKH A;  5L83 A;  3B1L X;  3PVL A;  3EFU A;  5LXI B;  2ZPN A;  4A3O A;  3T8M A;  1E8Y A;  5D7G A;  1E8W A;  1KM7 A;  3MHS D;  1TZ1 A;  1WXV A;  4GDL A;  2J0M A;  3DBS A;  1GNU A;  1V5O A;  1WF9 A;  4BOS C;  3DCG A;  3H6N A;  5JHB A;  4ICV A;  5D2M B;  4FBJ B;  5IAA C;  2ASQ A;  2KWV B;  3VVW B;  5DPS A;  2JWZ A;  4FJV B;  2K8B A;  5KHQ A;  3ZNZ B;  2AL3 A;  3LDZ E;  1UH6 A;  4G3X B;  1S3S G;  2GBR A;  2BKR B;  2WDT B;  3V62 A;  2AL6 A;  1GG3 A;  2FCQ A;  4DHJ B;  4TQ0 A;  3ZTC A;  1WJN A;  2DX5 B;  5EDS A;  4HDO A;  3JVZ X;  2C7M B;  2K6Q A;  2KX0 A;  4ZRK A;  2MCN B;  3OJ4 B;  4DWF A;  4ZDV A;  2WYQ A;  3KUC B;  4W9L A;  3JSV A;  3ECI A;  1EF1 A;  2DZI A;  2JRH A;  4DHJ D;  1Q5W B;  3U7D A;  2OJR A;  3QX1 A;  4HXD A;  4ICU A;  2RR9 A;  4EFO A;  2JT4 B;  3U8Z A;  2MLB A;  3PZD A;  2KO3 A;  1M94 A;  2N7E A;  2KDB A;  1LFD A;  3B08 A;  2QHO A;  4NNJ B;  2R2O A;  3ZUN A;  4EZL A;  1UBI A;  3RUI B;  4N9F 4;  1WXS A;  4TUU A;  2DAJ A;  4BKT A;  1WR6 E;  3VDZ A;  2L3Z A;  3QIJ A;  3M95 A;  3MJW A;  2KX3 A;  3VAW A;  3IVF A;  2BWF A;  3A4R A;  2KOX A;  2LRW A;  1HE8 A;  1J19 A;  2HJ8 A;  2NBV B;  3UQA A;  3ZNI D;  2BYV E;  3ALB A;  1A5R A;  2DYM A;  2KXJ A;  4DDG D;  1V6E A;  1RAX A;  3QQ8 B;  2D11 A;  2KN5 A;  4AP4 C;  2MSE D;  2LVP A;  3L54 A;  1EUV B;  2LVO A;  3M62 B;  4GB9 A;  2M0X A;  3TCA A;  3HHM A;  2N9E B;  4K81 A;  3RCZ A;  1WGY A;  3NOB A;  1KLV A;  3PLV A;  3SDL C;  1FXT B;  2KQS A;  3L17 A;  5CX3 A;  2EMT A;  4MGI E;  1JRU A;  1S1Q B;  2GOW A;  3PRM B;  4F8C B;  3VFK A;  1LQB A;  3PRE A;  2LVQ A;  4MEM A;  4JQW C;  2MA9 B;  1WJ4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...