1E6EB

Adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH\:ADRENODOXIN OXIDOREDUCTASE
publication title Adrenodoxin Reductase-Adrenodoxin Complex Structure Suggests Electron Transfer Path in Steroid Biosynthesis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e6eB00
2L83A 2WLBA 1JRPA 1JROA 2CJNA 2JX5A 2ACZB 2QJLA 3FC4A 3L4PA 4USAA 3SFEB 4YTNB 1QOGA 2Y5CA 3AE1B 4YTMB 3AB5A 3VR8B 2WDQB 2H88B 1IUEA 1FXAA 1QOAA 1PFDA 1RM6C 1N5XA 3AE6B 4YXDB 1N61A 1SB3C 1L6UA 4A9AA 5C3JB 3AMZA 1DOYA 2G1EA 5H92C 4ITKA 1NVID 1VDVA 2W54A 1OFFA 4US9A 3P1MA 1B9RA 2AX5A 1TKEA 3SFDB 2MJEA 5EE9A 3ETRA 3NS1A 1JWBD 3KWLA 2K9XA 5MPOA 1J7AA 1N63A 1OQRA 1J7CA 3FAHA 3AECB 3W5UB 3HRDD 3AE5B 3HUIA 1DOXA 2W3SA 2WDVB 1V8CA 3NVZA 1F0ZA 1VJKA 1FRRA 5G5HA 1WRIA 2MJDA 4N58A 1GAQB 1N60A 1NEKB 1RWSA 1I7HA 2DWQA 2M56B 1YQ3B 2BS2B 4WQMA 2BS4B 1GPXA 4HROA 1ZUD2 1V97A 2MJ3A 3AEBB 2H89B 1DGJA 3AEFB 1WGKA 1E7PB 3B2FA 3LXFA 3P4QB 2WU2B 4US8A 3VRAB 3AM9A 3P63A 3VRBB 1A70A 2QIEB 2WDRB 3DWMA 4C7ZA 1QOBA 1R7SA 3AN1A 2PVOD 4JWSC 3ZYYX 1QF6A 1RFKA 3AEEB 2BT6A 3AE3B 2K22A 3P4RB 2LEKA 4ZHOA 3AE9B 1J7BA 1CJEA 3AE2B 5EE0A 1JWAD 4N6EB 1L0VB 2N0SB 4LTUA 1L6VA 1JQ4A 1ZP0B 3BIID 3HVZA 1E10A 1SIJA 4YSYB 1SF0A 2L52A 2OHFA 1FXIA 3ABVB 1DOIA 1WXQA 4HRSA 4P6VF 4ZOHC 1XLOA 1KFYB 1TKYA 3AEAB 3P4PB 5EE1A 1YQ4B 2M19A 4C80A 1AWDA 1XLNA 2CU3A 1QOFA 1XLPA 1QT9A 2W55A 2KMMA 1CZPA 1OQQA 2WS3B 3WCQA 5GXGB 1N5WA 1PDXA 1AYFA 1L5PA 3CIRB 3B9JA 3SR6A 1E9MA 2E3TA 5C2TB 4C7YA 1YJIA 2W3RA 1NENB 1VLBA 4WWMA 2EKIA 1XO3A 1JW9D 2WP9B 3B2GA 1WWTA 1N62A 4JX1C 5AUKA 3VR9B 2B76B 3AE8B 2KAJA 3NVWA 4YSXB 1ROEA 2WU5B 3AEGB 3AH7A 3RPFC 2MH7A 1UWMA 3AE7B 3DWGC 2DBYA 1FMAD 5G5GA 1EWYC 3EUB2 4ZHPA 1TYGB 3PO0A 3NRZA 4FXCA 1FO4A 1T3QA 1E0ZA 1KF6B 1TJEA 3W9CB 1QLBB 1FFUA 2PIAA 2PKOA 3AEDB 5H8YE 1RYJA 2FBWB 1JALA 1E6EB 1NI3A 4KX6B 2WQYB 5AUIA 3AE4B 3P4SB 1FM0D 4JWUC 3W5VB 2CJOA 1FRDA 1TKGA 3NVYA 1ZOYB 1NYRA 3NVVA 4YT0B 5EE3A 1NYQA 1XLQA 4YSZB 1ZXIA 2Q5WD 3AV8A 1WYGA 1PUTA 2K5PA 2BS3B 3CWIA 2HTME 2PVGC 3LB8C 4N59A 2JQRB 4YTPB 1FIQA 1KRHA 1YJJA 4IDIA 1FFVA
chains in the Genus database with same CATH superfamily
2WLBA 1JROA 2HD5B 2JX5A 3PVLA 4B0EA 2JVCA 4HVBA 1QOAA 1PFDA 3PT2B 2GLSA 4OZAA 3APCA 3AULA 2QEJC 5E6OA 4US9A 3L13A 1GC6A 4GGQA 3QA8A 3UIOB 1J7CA 2RDBC 1UWXA 3KWVA 2KT7A 3ZW3A 1V2YA 2N1WA 4GU2A 1L7YA 2Z8LA 1LM8B 3E56A 3TL5A 4J6IA 2KJRA 3DBHB 2BT6A 4ANXA 1L0YB 2MLBA 4BKTA 4OVUA 1J7BA 1CJEA 2IGDA 2FNJB 3VUYA 4FJYA 1YJ1A 3ZQ4A 1SIJA 2K8HA 1C4CA 1GPXA 3RFZB 4FHKA 2JRIB 1XXGA 4WIPA 3ZXRA 1TS2A 2WXMA 3B1LX 2INPE 2BWES 3GB1A 3QX1A 3VQIA 3B9JA 2E3TA 1WI0A 1FEHA 2B76B 2KAJA 2CR5A 1F2RI 2MQJA 3ZUNA 1E5WA 1YD8U 4NNJB 2N7DA 2JUOA 2PKOA 2YEPB 4DQOC 4M02A 5CTRC 4KGSA 1D3ZA 4CYEA 2RMMA 3VTUA 3A1QB 4W9IA 4WWNA 3KH0A 2DZKA 4A3OA 2HTME 2LXCA 2ZPYA 3HIZA 1T6BX 3MC0B 1P1AA 3NZSA 3GP7A 2VRRB 1KLGD 1XF5L 3U52E 3Q8CA 2GBJA 3QCAA 4B0MA 4TKNA 2DX5B 2FIDA 4GB9A 1C77A 3DVGY 2O6VB 3T3OA 1R4MI 2BQQA 3N32A 4P7IA 2WX1A 1V49A 1XT9B 2IGHA 4NQLB 4DXAB 4M8MA 4XX5A 3EHVA 2WXNA 1MI0A 2LXAA 4LJOB 4LDTB 4JLCA 2NVUI 2BYVE 3Q3JA 1AW7A 3T3NA 5EE0A 1WXSA 2J53A 1HE8A 3HM3A 3ZTCA 3ABVB 1WXQA 1D5MC 1S3SG 2G45B 4ANUA 1XLNA 1DYQA 3SR6A 4ZYSA 4HCPB 4RGMA 2EKIA 4WJQA 1KLUD 3PLVA 1E90A 3R66C 3I3TB 4DHZE 5EDSA 1PYWD 3DWGC 5JHBA 4ZHPA 2AQ2B 1E0ZA 2HE7A 1JALA 4H2AA 2A5UA 1UUPA 2JXTA 2LMCA 2MBHA 2X8XX 3ML9A 2KDEB 1PUTA 4E3CA 1UF0A 2INDC 4P1BC 1FFVA 3N1ZC 2D11A 3CSTA 4LDTD 3L0WB 2KDFB 2Y5CA 3AE1B 3KVFB 3TBLD 1G6JA 4RGTA 5CHWA 1EO6A 2BB5A 2D3AA 2JU6X 1DOYA 3L17A 2Y3AA 1TBEA 4G50A 5J17A 4OZBA 1F2RC 1R4MB 2FCQA 3LDZE 4OZCA 1YIWA 4PT5A 2MCNB 2N9PC 1STEA 1Q0WB 1V8CA 1VJKA 1WRIA 1WJ4A 4LJPB 3KUCB 1IGDA 1HZ6A 4AUQC 4C4VA 4IG7B 4BBNF 3V60A 2NTTA 1J8CA 3IVFA 3P63A 3VRBB 4OW0A 2WNMA 2MX2A 1UH6A 2ON8A 1V5TA 3GZNI 4ZHOA 1FNWA 4N6EB 5BYQA 1SJHD 3HVZA 4DXGA 4P6VF 4FADA 4ZOHC 3PPAA 2CHZA 5EE1A 3RCZA 4C80A 2KWCA 5C23A 1YN5A 2W55A 3WCQA 4WH4A 1D6EC 4L2YA 4II3B 4QAYA 1IGCA 3NVWA 3AH7A 2GBKA 3J9CA 1TYGB 3PV1A 2ZEQA 2PIAA 2BYTA 3UINB 3OWEB 5H8YE 3WAOA 1M4VA 2QMTA 1ZOYB 1YNTE 3NJTA 4K3CA 3SU8X 3ZNZB 5LXIB 4P16A 4L23A 1JRPA 2QHOA 2WDTB 3RNEC 4HDQA 4NJ6A 2WXHA 1HA5A 3I9V1 3ZXVA 1C9FA 4BOZB 3TEXA 2DLBA 4ITKA 1B9RA 1WX8A 1KLVA 3A1QA 4JE3B 5EE9A 3MHZA 2NBVB 3RNFC 2INNE 4NQKE 3SDLC 3U2SC 2WDVB 5AZFA 2B3AA 2MJDA 3UIPB 1CQVA 1C3TA 3GOEA 2JY6A 2VH2A 2IY0B 3KUZA 3T8MA 2NCNA 5IO9A 4KVGB 3JVZX 3H7SA 1ZW7A 2KVRA 1QF6A 2LEKA 1WXVA 3PZDA 4HLEA 5JHAA 2KC1A 3GZNB 3N9YC 4IUMB 2JRHA 2KO3A 2JSVX 4AWJA 2BYEA 1C79A 3IG3A 1KH0A 3A33B 3MP9A 1PDXA 2K8CA 5KHQA 4RM8A 1UNSA 3E9SA 3SD5A 1WGRA 3KQ4A 4UDUC 2I38A 4EOYA 1VZ7A 2MWSB 2RR9A 3O65B 4ASWC 1T0QC 1EWYC 4XDDA 1IP9A 1ZKHA 4PS7A 3IT4B 5JZEB 1NI2A 2KTFA 2LASA 3KUDB 3TIXA 2HJ1A 2YLMA 3B08A 1JWUD 5J18A 5E6PA 4YSZB 1ZXIA 1LFDA 2V9HA 5DPWA 3PGEA 4IM3A 1ZDVA 2D3BA 5AZHA 4B9KA 2QCZA 2IO0B 2KC2A 3PS6A 5HFYA 1OFFA 5DCNA 5FKAC 2LFIA 3UI3A 4TV3A 2JWZA 2KFKA 2K3UA 2ICIA 2HTHA 5L95C 3KWLA 2PLPA 2YEPF 1N63A 3FAHA 1TZ1A 3HHMA 4C00A 3EC8A 1C76A 2LJ5A 2BS2B 4K7UA 2DAFA 1BXTA 1E7PB 1L4DB 4US8A 3V3XA 3ALBA 3R7RA 1TS5A 2MP2B 3DPDA 4B6WA 1E8YA 1SBBB 2LVOA 3PSEB 1XQQA 4NJ7A 2M1MA 4GN1A 5AUKA 1UBIA 3ZJTA 1KFYB 4BBNC 1SE2A 3MJ5A 1XLPA 4IC7B 2WXQA 1OEYA 3PTFC 1ET9A 4EUTA 4FULA 4I6PA 5C2TB 3DBHI 3WAPA 4N9F4 3ZJVA 2WWZA 4LLGM 4GOCA 1C4AA 1XO3A 3VVWB 1WR1A 3AE8B 2IO2B 2N1VA 5IAAC 1AN8A 1UWMA 5JXVA 2WX0A 3EUB2 5LLIA 2KDMA 1FD6A 1T3QA 2N9KA 2LVPA 5G2NA 2WXLA 4XDCA 2KNBA 4KX6B 3A4SC 3ZRCA 2DENB 3VFKA 5IKCM 3W5VB 4IM2A 1FRDA 3C8YA 1WGYA 5DPSA 2QJLA 3FC4A 4USAA 1TY0A 3TEYA 2BTEA 2V0GA 2XNAC 5D7GA 2DZIA 1Z5SB 1SJED 1KOTA 1SB3C 2BPSA 5E6JA 4K1RB 4ZRPA 4LCDE 2GBMA 4MEMA 3NS1A 3UQAA 1VZ6A 1OQRA 4W9HA 1WXAA 1GC7A 2W3SA 4PYZA 3VTVA 2K6QA 4MACA 1GAQB 2ASQA 4WQMA 4A3PA 1FCCC 4C4VB 2M0XA 1ZUD2 3AEFB 3Q8EA 1WGKA 5FR6A 2HJ8A 2QIEB 4C7ZA 4W9DA 2N9XA 4JL9A 3M62B 2VZKB 1SE9A 4YSYB 2J7QB 4HEA1 4W9GA 3DVNU 4MGKE 4LK0M 4AS1A 2IBIB 2GMIC 2ZNVC 4ACFA 1P3QU 1WE7A 2LGYA 2W3RA 2JWUA 1E8ZA 4ICVA 4WWPA 4F1SA 4MM3B 2DYBA 4HPMB 1ROEA 2WU5B 3PZ7A 1ZPSA 4JGHB 3Q6BA 4RF1A 2J0MA 4XWTA 1EF1A 4BKSA 1QLBB 3VDZA 2C7NB 2BKRB 1TZOA 1NI3A 2CU1A 4MJSA 4JWUC 3NVYA 1J19A 2KD0A 2ZCCA 1I35A 5BYRA 1QILA 2PTLA 3U30A 4S0RA 1GUAB 2BBCA 2M17A 5J2RA 1IYFA 4MGIE 1ZE3D 4YTMB 4OVZA 1FPYA 5BMHA 3RYTA 1N61A 3Q2AC 2VZKD 3BY4B 5H92C 3RN9C 1C1YB 2M0AA 4RFBA 4BFRA 4BZAA 4MH0E 4MT5A 1WSPA 4KKIA 3IXSA 3DBRB 4WJPA 1I7HA 3MTNB 1WM3A 2H89B 2XN9C 1JMLA 3BINA 3ENEA 2IZVB 5D2MB 3EECA 2PJHA 2K39A 2KANA 3TEZA 3VUWA 3T9LA 1UBQA 4RNAA 1JQ4A 3BIID 2DYOA 2L52A 4GMVA 2DZMA 1LXDA 1WZ3A 4XWWA 2L1AA 1T5XD 3V05A 3VAWA 3IAM1 4AJWA 2JZZA 2MP2A 3VUXA 1E8WA 4JIOU 1YX5B 2WP9B 4A20A 3QWZB 3WIMA 4PYUA 4FBJB 1C78A 3NG0A 2I2YA 1YQBA 3ZNGC 2O2VA 3UGBB 4ARCA 1WY8A 3R3MA 1ZDXA 3V6EB 1YOVB 3B0AA 4IKGA 3BVMA 4ZRKA 4GXBA 5CX3A 2KX0A 3JSVB 4ARIA 2WXIA 2K5PA 1K53A 1F52A 4ZRJA 4IDIA 3JYUA 5AZGA 3WA0A 2C5LC 2ACZB 4NAMA 3M63B 1MHXA 1LGRA 1FXAA 1RM6C 3Q3FA 2TSSA 2GBRA 5C3JB 3AMZA 3ZNID 2NMQA 1VDVA 2MBEA 1TKEA 2KFKB 2PW9A 3IHPC 2L8JA 2AWTA 2L3ZA 4TSSA 3I5JC 1JRUA 2LGDA 3KYDD 1F9JA 2K1FA 3R2IA 1MG4A 3KYCD 2LI5A 3TMPB 3OLMD 4TQ0A 2PE6B 3HM6X 1GOZA 4HWIB 2C7MB 2JXXA 2WDRB 3FILB 3RNGC 1R7SA 5FR3A 3KLSX 3RT3B 4ZYNA 4NJCA 2D5GA 4WQOB 2RPVA 4KDIC 4W9CA 3RI7C 2WXJA 1QZEA 1DOIA 1XD3B 1XLOA 3EA6A 1L4ZB 1QOFA 3Q3MC 3ZGZA 4LNOA 3ZTDA 4JX1C 5D6JB 3B2GA 3L54A 2IO3B 2MH7A 3AE7B 4XE0A 5TR5A 1WMHA 3PO0A 2LHEA 2FUG1 2E6XA 2KZRA 3ECIA 2WXKA 2KX3A 2MRPA 1WH3A 4HKQA 1FM0D 1EU3A 2N4FA 2KKCA 5EE3A 2AYOB 1WYGA 4MGZE 2BW2A 1YJJA 4MM3A 2CJNA 3X0WA 4MDKE 1OTRB 1P9DU 4B95A 4E71A 1NDDA 2LGSA 4A9AA 2ZW0A 3K9OB 1WR6E 2CKHB 1KM7A 4BOSC 2BVCA 2MA9B 4BAXA 2MJEA 3ETRA 3OJ3A 1I4RA 5DPRA 2KWDA 2QDFA 2AL6A 4K81A 5MPOA 3W5UB 1RLFA 4JPSA 2KOXA 4XC2A 1PQSA 1TT5B 4M01A 3B2FA 4DHZB 1A70A 1EWCA 1GG3A 4RGNA 1RFKA 2VH1A 3R8BA 3C0RB 4DWFA 1ZP0B 3EGRA 3N30A 4HJGE 4MSQB 3ZDTA 3JW0X 3AEAB 4TMAB 2IYDB 3PRPB 2NTSA 1V1OA 4GDKA 3S2AA 3DVGX 1JWSD 4HK2A 3IAS1 3R2TA 1IBXA 2OJWA 2XK5B 3MC9A 1D4BA 2CHWA 2RDGA 2N7EA 2KWVB 4AOFA 3V62A 4DHJD 4FA6A 2V4IB 2LHDA 2DBYA 1FMAD 3Q8FA 1KF6B 2LRWA 3W9CB 1F77A 4HXDA 3ZLZA 4MJSB 3L08A 1FNVA 3BK1A 1TKGA 3NVVA 2WXPA 1YN4A 1X1MA 2WGSA 4TUUA 3NUHB 1WZ0A 2Y5PA 3TSSA 4CO7A 3L4PA 2KN4A 2DYMA 4M0WA 4IOIE 2K6DB 3BZDB 2KVZA 1L6UA 2UU7A 4YWGG 1H8CA 2G1EA 3QIJA 2LGXA 1P7FA 1WGGA 3JSVA 1E7UA 2K25A 3SFDB 3BWUD 2ZVOA 2V3NA 1J7AA 3ZKJC 2OJRA 2UWQA 3AE5B 2KDIA 3HUIA 4BKGA 2OEDA 1VR9A 5BYSA 4WWOA 2DZJA 2WXRA 5CHVC 3AEBB 1V97A 3ZDMC 3LXFA 2ZPNA 1V5OA 1BUIC 1WFYA 2DAJA 4HPPA 3VH4B 5D3IB 1UGJA 4JWSC 4ICUA 3AE9B 3NHEB 4GIVA 2N0SB 4X57B 4DDGD 1SF0A 4HRSA 3W1YA 2ZZPB 1HEZE 4OHJA 2Z59B 1MVKA 2LZ6A 2GOWA 1N5WA 4G11A 3QQ8B 4CHKA 2LRUA 3FILA 3RNBC 3URYA 1VLBA 2NPTA 2NR2A 4A8XC 1WM2A 3BYTB 1FCLA 4KGTA 2O2VB 3APDA 1FFUA 3VTWA 4OVVA 1GNUA 4HPLB 5TSSA 3D32A 1U4AA 1OEYJ 1WXMA 2BS3B 4N59A 1KRHA 2LWPA 1OQYA 2M8SA 1JCKB 1R4NI 2KMAA 2ZCBA 5CHFA 2KJ6A 3SFEB 1I4QA 4DBGA 1ENFA 4NAWA 4URKA 2H88B 1ISNA 3VH3B 2KQ7A 4W9LA 1UGMA 1P98A 3O13A 3N20C 3X23A 2D10A 2JZ3B 4NY0A 1F1HA 3W1SA 1NVID 1MJDA 4GLSC 2MBOA 2V3PA 1K8RB 2NBWB 3GS2A 2FIFA 4RCOA 4KIKA 3NVZA 2L0FA 4G3XB 2QC8A 4N58A 1BT0A 1SE3A 2KWUB 3OAWA 3QC8B 1XCQL 1XCTL 5HI1A 4HROA 2R2OA 3A9JA 3BVZA 5AEKB 1JWMD 4IM0A 2GB1A 3AN1A 2PVOD 4EE2A 4A55A 3P4RB 2KLGA 1K52A 2A4ZA 2RGFA 3ZVVA 1FXTB 3DBRI 1E10A 1EF5A 5L83A 3EFCA 1L2NA 4GSWA 3Q3NC 1EU4A 1CZPA 1OQQA 1SSNA 2BGFA 1L5PA 3Q8BA 3H9DA 3CIRB 4EKUA 2RSUA 4I6NB 2KDBA 4WWMA 1NENB 3RNAC 5IA7A 1V1PB 1CMXB 2EKEC 1A5RA 1WMHB 3ZO5B 2RD0A 3TCAA 1IPGA 1T0YA 2FAZA 2GBNA 3ONSA 1GJZA 1E6EB 3L16A 5AUIA 3UF8A 1ET6A 2XK5A 4LNFA 2Q5WD 3AV8A 1QQRA 3A9KB 3C19A 2FE8A 4AQ7A 3DVNV 4RM9A 2IPKD 2MEKA 2C7HA 4PK1A 3HK0A 1R4NB 2L0TA 1FNUA 2KXJA 2MW5A 1IUEA 4ZRQA 3V6CB 4EZJA 3I63C 2SAKA 3ZRFA 2JYEA 1Z2MA 4HJKA 1MPEA 2XBBC 2KMCA 3M3JA 3NZUA 3NS8A 4P1CC 5LNK1 4L1BA 1V80A 3APFA 1YQ3B 4O1NA 4TQ1A 2J0KA 5BO4B 2MJ3A 4FLHA 3P4QB 2L05A 1J0GA 3VRAB 4YL8A 2IY1B 1LO5D 2D3GA 4A90A 3AM9A 3CMMB 4XGAB 2KLCA 4ANWA 2K22A 1C4PA 1N6ZA 2K0PA 3OG5A 3Q3OC 1WJ6A 1I4GA 1L0VB 4C56C 2PEAA 3DHIC 1WYWB 4IWPA 3QK0A 4FJZA 3HVDA 3PHWB 2M19A 4GDKB 2CU3A 4I6LB 3H7PB 3LJ3A 1IBXB 4FN2A 2QILA 2SEBD 4MH8A 2CS4A 2IO1B 2WXGA 1P0RA 4PS8A 4RGOS 2Y5BB 4K7SA 4WJNA 4FXCA 1I4PA 1FO4A 4IW0A 1WIAA 3ZNHB 3MJWA 1HXYD 2KACA 4MELA 2WQYB 4XZ4A 2N9LA 3AE4B 3MC8A 1NYQA 3LYYA 1D5ZC 1UZXB 2G4SA 5T8IA 1SIFA 3DOWA 1ACCA 1WX7A 4HDOA 1TGZB 1CK1A 1EUVB 2FCSA 2BYFA 2INCC 4M0WB 1SXTA 3VR8B 4HKZE 1VZ8A 3IBEA 2N7JA 4K3BA 4KDLB 4F7ZA 1Q1OA 2JF5A 4HCNB 3GE8C 1YN3A 3BK2A 4II2B 3WANA 4FHJA 2IDYA 5KHOA 2V1YA 3ZIMA 1TIFA 1JWBD 2RDHA 2HDEA 3R7QA 2FUHB 1RFAA 1BMLC 1VRAB 1Y8RC 5G5HA 2OOBB 2KTRA 2M56B 1HZ5A 2D3CA 5C1ZA 5D94A 2DHZA 1DGJA 2WU2B 2EELA 3K9PB 2MBQA 1LQBA 1MFWA 1WJNA 4Q2JA 2V3SA 3SHQA 1Q10A 2KQSA 3H6NA 3DDCB 3AEEB 3RD2A 2WYQA 3AE2B 5E6NA 4MSMB 2O6VD 1EM7A 4R3DA 4PS3A 5BMIA 3TJPA 4CQNA 3A4RA 1HTOA 2JPHA 4KSLC 2N9EB 1TKYA 5HHDG 4ANVA 1Y56A 3MHSD 1XEEA 2KMMA 2WS3B 5GXGB 4KV2A 2D07B 2PPHA 3AU5A 4C7YA 2L76A 1YJIA 2LJIA 4XYCA 2BWFA 2NPTB 2G9HD 4J3OD 1PGXA 3AEGB 3BYYB 2I1KA 5BMGA 3RPFC 3DBLI 4GDLB 4RH6A 2L32A 3CSFA 4FJVB 1E8XA 2V4LA 2UYZB 2WXOA 3Q8AA 4KKJA 3AEDB 2CJOA 3N3KB 5HG2A 2KQ4X 3I57A 3IT6B 2L83A 4WURA 2I1JA 4AP4C 1V1PA 4AJYB 2BF8B 4YTNB 1QOGA 2Z0DB 4NAWB 2WDQB 3AE6B 2DNFA 4YXDB 3PLUA 1D5XC 1TS3A 2JYTA 4KZCA 1WGHA 3RULA 5I4DA 2X38A 3VHTC 1WRDB 4RMAA 2AX5A 4W9KA 3QHTA 3A9KA 1M94A 3RZWC 2K9XA 1V6EA 4KIKB 3SEBA 2GRIA 1N60A 1RWSA 1RAXA 1T0SC 2R61A 2BS4B 5IOIA 3H8HA 3NOBA 4DHJB 5G55A 3BVGA 3A9JB 2FCMA 3U8ZA 3DWMA 2BKFA 4KSKC 2AEHA 4EFOA 4EZKA 3AE3B 2D2QA 2G4DB 3PZ8A 1L6VA 1KJTA 1I4HA 2OHFA 3W1SC 1VCBA 4NPNA 2L7RA 3P4PB 3UQBA 2MHJA 4G0NB 2MSED 1AWDA 3OJ4B 2YVCA 2PE9A 5D3DA 4D2KA 3PHXB 4ZDVA 1ZGUB 1RRBA 1N62A 3ML8A 4LNNA 3V61A 2KN5A 3AU4A 2GI9A 5G5GA 1WGDA 4EZLA 2AL3A 3DBLB 4JQWC 4WJOA 1TJEA 2FBWB 3H7PA 1NYRA 1NBFC 3QJZA 1AARA 3CWIA 2C9WB 2KK8A 1V9JA 1UD7A 2EMSA 4DDID 1H4RA 3U7DA 4WAAA 3TEWA 1YMHE 3DHGC 2WHIA 4BVUC 3AB5A 1N5XA 2L00B 1WX9A 1SEBD 2O6VA 2J42A 2W54A 3P1MA 3M95A 3RZFA 2ZVNA 1KTKA 1MHHE 2J0JA 4KGRA 3AECB 3HRDD 1SE4A 1VD2A 1ZXHA 1F0ZA 2DWQA 3DQVA 4W9FA 3PREA 1V86A 2LVQA 2KYWA 5FK9C 4K7WA 1OGWA 4A6QA 2K8BA 5HKHA 1QOBA 3AXCA 1I4XA 3RUIB 1MG8A 1JWAD 1T0RC 2KFJA 2WXFA 3L10B 4LTUA 2RPQA 3VXWA 2Z0EB 1FXIA 1TS4A 2JZPA 1QT9A 4KZ0A 1AYFA 1E7VA 3QARA 1E9MA 3DCGA 3GE3C 1L0XB 4REZA 3DHHC 2QSDA 1JW9D 1WWTA 4M00A 2J52A 5IP4D 4YSXB 1TY2A 3U7ZA 2IJ0A 5JH5C 2NS5A 2ZJDA 3NRZA 2KHWB 1GB4A 1TTNA 2ONQA 2LUMA 3ZJUA 5LXHA 3P4SB 4LNKA 1WF9A 2IGGA 4LNIA 4BKSD 1XLQA 4NZLB 2LD9A 3LB8C 1WJUA 3WAMA 4IWOA 2MBBB 4W9JA 2CHXA 3KW5B 4DK5A 2W9NA 4YTPB 3DBSA 1PGBA 1WE6A 4GDLA 4ZRIA 3RMKC 3Q69A 1Q5WB 2G3QB 2ZW1A 2AQ3B 3IFWB 3RNCC 2PMVA 2EMTA 2BB6A 3N1XC 4IWQA 1K51A 3N1YC 4EEWA 5IN7A 3EFUA 3W2DA 2KJHB 1DOXA 2M4NA 3TUOA 1ESFA 1FRRA 2JT4B 1NEKB 2KTRB 2W82A 4WAFA 5GMVA 3P2BA 2XEWA 2FCNA 2NBUA 3PRZA 1HQRD 3Q14C 1SGHA 3FKYA 4W9EA 4F8CB 3ZYYX 4M8NA 2R2QA 2J4XA 3H1UA 3AI5A 2LGIA 1YQ4B 1B1ZA 3NZ3A 1GB1A 2C60A 1V81A 2REXA 1UELA 5DPTA 2LUEA 3PRMB 4S17A 3WALA 1HTQA 1QKZA 1PGAA 4RF0A 1K50A 3VR9B 4E74A 3NY5A 1I42A 1RYJA 3CF6E 4MGYE 2AQ1B 1YX6B 3U4EG 4YT0B 3P42A 3QAQA 1S1QB 1P7EA 3MFGA 2PVGC 2ZNVB 2JQRB 1FIQA 4DXFA
chains in the Genus database with same CATH topology
2WLBA 1JROA 2CJNA 2JX5A 5T8IA 1ACCA 4B0EA 1CK1A 1ZDVA 1SXTA 3VR8B 4HKZE 1VZ8A 2N7JA 1QOAA 1PFDA 4OZAA 4A9AA 1YN3A 2QEJC 2ZW0A 3BK2A 5HFYA 4US9A 1OFFA 5FKAC 2LFIA 2IDYA 3UI3A 2MJEA 3ETRA 1I4RA 2K3UA 2ICIA 2KWDA 1JWBD 2RDHA 2PLPA 2HDEA 3KWLA 2YEPF 5MPOA 1N63A 3FAHA 1J7CA 3W5UB 1BMLC 1UWXA 1VRAB 5G5HA 3KWVA 4JPSA 2M56B 1C76A 1HZ5A 2BS2B 1BXTA 1DGJA 3B2FA 1E7PB 1L4DB 2WU2B 2Z8LA 4US8A 3V3XA 2EELA 1A70A 1EWCA 4Q2JA 1TS5A 3E56A 1SBBB 4RGNA 1Q10A 1RFKA 3AEEB 2BT6A 1L0YB 3R8BA 1J7BA 1CJEA 2IGDA 3AE2B 1EM7A 4R3DA 5BMIA 4CQNA 1ZP0B 3EGRA 4HJGE 3ZQ4A 1SIJA 1C4CA 5AUKA 1GPXA 3ZJTA 1KFYB 1TKYA 3AEAB 4TMAB 3RFZB 2NTSA 5HHDG 1SE2A 3MJ5A 1XXGA 1V1OA 4WIPA 1Y56A 1XLPA 1JWSD 1TS2A 1XEEA 2KMMA 2WS3B 2WXMA 2WXQA 2INPE 3IAS1 3R2TA 5GXGB 3GB1A 1IBXA 1ET9A 3VQIA 3B9JA 5C2TB 2E3TA 4C7YA 3ZJVA 1D4BA 4LLGM 1YJIA 2LJIA 1C4AA 2RDGA 1XO3A 1FEHA 2G9HD 2B76B 3AE8B 2KAJA 4J3OD 1PGXA 3AEGB 3BYYB 5BMGA 3RPFC 1F2RI 1AN8A 2V4IB 1UWMA 2LHDA 5JXVA 2DBYA 1FMAD 3Q8FA 4GDLB 4RH6A 2L32A 3EUB2 2KDMA 1FD6A 1T3QA 1KF6B 2N9KA 2WXOA 3W9CB 1F77A 3Q8AA 2PKOA 4KKJA 2WXLA 2YEPB 3AEDB 4XDCA 4DQOC 4KX6B 4KGSA 1FNVA 2CJOA 3W5VB 3BK1A 1FRDA 1TKGA 3C8YA 3NVVA 2RMMA 2WXPA 1YN4A 5HG2A 2KQ4X 2HTME 1T6BX 3I57A 3NUHB 3IT6B 3MC0B 2Y5PA 2L83A 4WURA 3TSSA 1V1PA 2QJLA 3GP7A 3FC4A 3L4PA 4USAA 1TY0A 3TEYA 2BTEA 2KN4A 4YTNB 1QOGA 2DYMA 2V0GA 4M0WA 1KLGD 2XNAC 1XF5L 3U52E 3Q8CA 4NAWB 5D7GA 2WDQB 4IOIE 4B0MA 3AE6B 3BZDB 4YXDB 1SJED 1SB3C 1L6UA 1D5XC 1TS3A 2JYTA 1C77A 5E6JA 2G1EA 4YWGG 3T3OA 5I4DA 2X38A 1P7FA 4ZRPA 2AX5A 3SFDB 3BWUD 3NS1A 2V3NA 1VZ6A 2K9XA 1J7AA 1OQRA 3HUIA 3AE5B 2IGHA 2W3SA 3SEBA 2GRIA 2OEDA 4MACA 1GAQB 1N60A 1RWSA 1VR9A 5BYSA 2R61A 4WQMA 2BS4B 1FCCC 2WXRA 2WXNA 1ZUD2 1V97A 3AEBB 3AEFB 3H8HA 1MI0A 3Q8EA 1WGKA 3LXFA 3BVGA 1BUIC 2QIEB 3DWMA 4C7ZA 5D3IB 1UGJA 4JWSC 1AW7A 3AE3B 3T3NA 2VZKB 3AE9B 5EE0A 3PZ8A 2J53A 2N0SB 1L6VA 1I4HA 4YSYB 1SF0A 2OHFA 4HRSA 4HEA1 3ABVB 1WXQA 1D5MC 3P4PB 4OHJA 1HEZE 1AWDA 1XLNA 4LK0M 4AS1A 1MVKA 1N5WA 1DYQA 5D3DA 4D2KA 3SR6A 4ZYSA 3FILA 4RGMA 2W3RA 3URYA 1VLBA 2EKIA 2JWUA 1N62A 4A8XC 1KLUD 4MM3B 1FCLA 3BYTB 1ROEA 2WU5B 3PZ7A 1ZPSA 2GI9A 4RF1A 1PYWD 3DWGC 4KGTA 4XWTA 5G5GA 4ZHPA 2AQ2B 1E0ZA 1TJEA 1QLBB 1FFUA 2FBWB 1JALA 1TZOA 1NI3A 4H2AA 5TSSA 1UUPA 4JWUC 2JXTA 3NVYA 2LMCA 1NYRA 5BYRA 1QILA 3CWIA 1PUTA 2BS3B 4N59A 1KRHA 2PTLA 1FFVA 2BBCA 1JCKB 3TEWA 1YMHE 3SFEB 1I4QA 2Y5CA 3AE1B 1ZE3D 4YTMB 3AB5A 1ENFA 4RGTA 2H88B 4OVZA 5BMHA 1N5XA 1N61A 2JU6X 2BB5A 3O13A 2VZKD 1DOYA 1SEBD 5H92C 2Y3AA 2J42A 3W1SA 1NVID 2W54A 4OZBA 3P1MA 1F2RC 2M0AA 1KTKA 4OZCA 4RFBA 4PT5A 4GLSC 1MHHE 2V3PA 1STEA 3GS2A 4KGRA 4MT5A 4RCOA 3AECB 3HRDD 1SE4A 1ZXHA 1WSPA 3NVZA 1V8CA 4KKIA 1F0ZA 1VJKA 1WRIA 3IXSA 4N58A 1SE3A 2DWQA 1I7HA 1XCQL 1XCTL 5HI1A 1IGDA 1HZ6A 4HROA 2H89B 2XN9C 2NTTA 5FK9C 1JMLA 4A6QA 3P63A 3VRBB 4OW0A 3BVZA 1JWMD 1QOBA 2WNMA 2GB1A 3AN1A 2PVOD 2ON8A 4EE2A 1I4XA 3P4RB 4A55A 4ZHOA 1K52A 1FNWA 3TEZA 1JWAD 2WXFA 4N6EB 1SJHD 5BYQA 4LTUA 4RNAA 1JQ4A 3BIID 2DYOA 3HVZA 4DXGA 1E10A 2L52A 4P6VF 1FXIA 4ZOHC 5EE1A 1TS4A 4C80A 2JZPA 1YN5A 4XWWA 2L1AA 1QT9A 2W55A 1EU4A 1CZPA 1OQQA 1SSNA 1T5XD 3WCQA 3V05A 3IAM1 1AYFA 1L5PA 3Q8BA 3CIRB 1E9MA 4WH4A 1D6EC 4L2YA 1L0XB 4REZA 1NENB 2QSDA 4WWMA 1JW9D 2WP9B 1WWTA 2J52A 1IGCA 3NVWA 4YSXB 1TY2A 1V1PB 3AH7A 3U7ZA 2IJ0A 1C78A 2I2YA 3J9CA 1TYGB 3NRZA 4ARCA 1GB4A 1ZDXA 2PIAA 2BYTA 3OWEB 2ONQA 5H8YE 4IKGA 1E6EB 3BVMA 5AUIA 2LUMA 3ZJUA 3P4SB 1ET6A 1M4VA 2QMTA 2IGGA 1ZOYB 1YNTE 4ARIA 1XLQA 4NZLB 2Q5WD 2WXIA 3AV8A 2K5PA 3LB8C 1QQRA 1K53A 4IDIA 4P16A 4YTPB 4L23A 1JRPA 2FE8A 4AQ7A 2ACZB 1PGBA 2IPKD 2MEKA 2WXHA 1HA5A 4NAMA 3I9V1 3Q69A 1MHXA 1FNUA 2ZW1A 1IUEA 1FXAA 1RM6C 2AQ3B 4ZRQA 2PMVA 2TSSA 1C9FA 5C3JB 3AMZA 2SAKA 3TEXA 2JYEA 2BB6A 2DLBA 2NMQA 4ITKA 1VDVA 1B9RA 1K51A 1TKEA 4JE3B 1MPEA 5EE9A 2PW9A 3MHZA 3W2DA 2INNE 4TSSA 3U2SC 2WDVB 1DOXA 3TUOA 1ESFA 5LNK1 1FRRA 4L1BA 2MJDA 1NEKB 1CQVA 1YQ3B 4O1NA 4TQ1A 2W82A 4WAFA 3R2IA 2MJ3A 3P4QB 4TQ0A 1HQRD 3VRAB 1GOZA 4A90A 1LO5D 3AM9A 2WDRB 3FILB 1R7SA 5FR3A 3ZYYX 1QF6A 3KLSX 2K22A 1C4PA 2LEKA 2K0PA 4NJCA 2D5GA 2RPVA 1I4GA 1L0VB 3N9YC 4C56C 2J4XA 2WXJA 1DOIA 2LGIA 2JSVX 1XLOA 3HVDA 3EA6A 1YQ4B 1B1ZA 3NZ3A 2M19A 1L4ZB 1GB1A 4GDKB 2CU3A 1QOFA 1C79A 1KH0A 3MP9A 3ZGZA 1PDXA 1IBXB 1UNSA 3E9SA 2QILA 2SEBD 1QKZA 4MH8A 3KQ4A 1PGAA 4RF0A 2WXGA 4JX1C 1K50A 3B2GA 4UDUC 3VR9B 2I38A 1VZ7A 2MH7A 3AE7B 4XE0A 1EWYC 4RGOS 3PO0A 2LHEA 1I4PA 2FUG1 4FXCA 4XDDA 1FO4A 3IT4B 1HXYD 2E6XA 1RYJA 2WXKA 2KACA 2WQYB 2N9LA 2AQ1B 3AE4B 4HKQA 1FM0D 1EU3A 1JWUD 3U4EG 5EE3A 4YT0B 3P42A 1NYQA 4YSZB 1ZXIA 3LYYA 1D5ZC 1WYGA 1P7EA 3MFGA 2PVGC 2JQRB 1FIQA 2BW2A 1YJJA 4DXFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L83 A;  2WLB A;  1JRP A;  1JRO A;  2CJN A;  2JX5 A;  2ACZ B;  2QJL A;  3FC4 A;  3L4P A;  4USA A;  3SFE B;  4YTN B;  1QOG A;  2Y5C A;  3AE1 B;  4YTM B;  3AB5 A;  3VR8 B;  2WDQ B;  2H88 B;  1IUE A;  1FXA A;  1QOA A;  1PFD A;  1RM6 C;  1N5X A;  3AE6 B;  4YXD B;  1N61 A;  1SB3 C;  1L6U A;  4A9A A;  5C3J B;  3AMZ A;  1DOY A;  2G1E A;  5H92 C;  4ITK A;  1NVI D;  1VDV A;  2W54 A;  1OFF A;  4US9 A;  3P1M A;  1B9R A;  2AX5 A;  1TKE A;  3SFD B;  2MJE A;  5EE9 A;  3ETR A;  3NS1 A;  1JWB D;  3KWL A;  2K9X A;  5MPO A;  1J7A A;  1N63 A;  1OQR A;  1J7C A;  3FAH A;  3AEC B;  3W5U B;  3HRD D;  3AE5 B;  3HUI A;  1DOX A;  2W3S A;  2WDV B;  1V8C A;  3NVZ A;  1F0Z A;  1VJK A;  1FRR A;  5G5H A;  1WRI A;  2MJD A;  4N58 A;  1GAQ B;  1N60 A;  1NEK B;  1RWS A;  1I7H A;  2DWQ A;  2M56 B;  1YQ3 B;  2BS2 B;  4WQM A;  2BS4 B;  1GPX A;  4HRO A;  1ZUD 2;  1V97 A;  2MJ3 A;  3AEB B;  2H89 B;  1DGJ A;  3AEF B;  1WGK A;  1E7P B;  3B2F A;  3LXF A;  3P4Q B;  2WU2 B;  4US8 A;  3VRA B;  3AM9 A;  3P63 A;  3VRB B;  1A70 A;  2QIE B;  2WDR B;  3DWM A;  4C7Z A;  1QOB A;  1R7S A;  3AN1 A;  2PVO D;  4JWS C;  3ZYY X;  1QF6 A;  1RFK A;  3AEE B;  2BT6 A;  3AE3 B;  2K22 A;  3P4R B;  2LEK A;  4ZHO A;  3AE9 B;  1J7B A;  1CJE A;  3AE2 B;  5EE0 A;  1JWA D;  4N6E B;  1L0V B;  2N0S B;  4LTU A;  1L6V A;  1JQ4 A;  1ZP0 B;  3BII D;  3HVZ A;  1E10 A;  1SIJ A;  4YSY B;  1SF0 A;  2L52 A;  2OHF A;  1FXI A;  3ABV B;  1DOI A;  1WXQ A;  4HRS A;  4P6V F;  4ZOH C;  1XLO A;  1KFY B;  1TKY A;  3AEA B;  3P4P B;  5EE1 A;  1YQ4 B;  2M19 A;  4C80 A;  1AWD A;  1XLN A;  2CU3 A;  1QOF A;  1XLP A;  1QT9 A;  2W55 A;  2KMM A;  1CZP A;  1OQQ A;  2WS3 B;  3WCQ A;  5GXG B;  1N5W A;  1PDX A;  1AYF A;  1L5P A;  3CIR B;  3B9J A;  3SR6 A;  1E9M A;  2E3T A;  5C2T B;  4C7Y A;  1YJI A;  2W3R A;  1NEN B;  1VLB A;  4WWM A;  2EKI A;  1XO3 A;  1JW9 D;  2WP9 B;  3B2G A;  1WWT A;  1N62 A;  4JX1 C;  5AUK A;  3VR9 B;  2B76 B;  3AE8 B;  2KAJ A;  3NVW A;  4YSX B;  1ROE A;  2WU5 B;  3AEG B;  3AH7 A;  3RPF C;  2MH7 A;  1UWM A;  3AE7 B;  3DWG C;  2DBY A;  1FMA D;  5G5G A;  1EWY C;  3EUB 2;  4ZHP A;  1TYG B;  3PO0 A;  3NRZ A;  4FXC A;  1FO4 A;  1T3Q A;  1E0Z A;  1KF6 B;  1TJE A;  3W9C B;  1QLB B;  1FFU A;  2PIA A;  2PKO A;  3AED B;  5H8Y E;  1RYJ A;  2FBW B;  1JAL A;  1E6E B;  1NI3 A;  4KX6 B;  2WQY B;  5AUI A;  3AE4 B;  3P4S B;  1FM0 D;  4JWU C;  3W5V B;  2CJO A;  1FRD A;  1TKG A;  3NVY A;  1ZOY B;  1NYR A;  3NVV A;  4YT0 B;  5EE3 A;  1NYQ A;  1XLQ A;  4YSZ B;  1ZXI A;  2Q5W D;  3AV8 A;  1WYG A;  1PUT A;  2K5P A;  2BS3 B;  3CWI A;  2HTM E;  2PVG C;  3LB8 C;  4N59 A;  2JQR B;  4YTP B;  1FIQ A;  1KRH A;  1YJJ A;  4IDI A;  1FFV A; 
#chains in the Genus database with same CATH topology
 2WLB A;  1JRO A;  2HD5 B;  2JX5 A;  3PVL A;  4B0E A;  2JVC A;  4HVB A;  1QOA A;  1PFD A;  3PT2 B;  2GLS A;  4OZA A;  3APC A;  3AUL A;  2QEJ C;  5E6O A;  4US9 A;  3L13 A;  1GC6 A;  4GGQ A;  3QA8 A;  3UIO B;  1J7C A;  2RDB C;  1UWX A;  3KWV A;  2KT7 A;  3ZW3 A;  1V2Y A;  2N1W A;  4GU2 A;  1L7Y A;  2Z8L A;  1LM8 B;  3E56 A;  3TL5 A;  4J6I A;  2KJR A;  3DBH B;  2BT6 A;  4ANX A;  1L0Y B;  2MLB A;  4BKT A;  4OVU A;  1J7B A;  1CJE A;  2IGD A;  2FNJ B;  3VUY A;  4FJY A;  1YJ1 A;  3ZQ4 A;  1SIJ A;  2K8H A;  1C4C A;  1GPX A;  3RFZ B;  4FHK A;  2JRI B;  1XXG A;  4WIP A;  3ZXR A;  1TS2 A;  2WXM A;  3B1L X;  2INP E;  2BWE S;  3GB1 A;  3QX1 A;  3VQI A;  3B9J A;  2E3T A;  1WI0 A;  1FEH A;  2B76 B;  2KAJ A;  2CR5 A;  1F2R I;  2MQJ A;  3ZUN A;  1E5W A;  1YD8 U;  4NNJ B;  2N7D A;  2JUO A;  2PKO A;  2YEP B;  4DQO C;  4M02 A;  5CTR C;  4KGS A;  1D3Z A;  4CYE A;  2RMM A;  3VTU A;  3A1Q B;  4W9I A;  4WWN A;  3KH0 A;  2DZK A;  4A3O A;  2HTM E;  2LXC A;  2ZPY A;  3HIZ A;  1T6B X;  3MC0 B;  1P1A A;  3NZS A;  3GP7 A;  2VRR B;  1KLG D;  1XF5 L;  3U52 E;  3Q8C A;  2GBJ A;  3QCA A;  4B0M A;  4TKN A;  2DX5 B;  2FID A;  4GB9 A;  1C77 A;  3DVG Y;  2O6V B;  3T3O A;  1R4M I;  2BQQ A;  3N32 A;  4P7I A;  2WX1 A;  1V49 A;  1XT9 B;  2IGH A;  4NQL B;  4DXA B;  4M8M A;  4XX5 A;  3EHV A;  2WXN A;  1MI0 A;  2LXA A;  4LJO B;  4LDT B;  4JLC A;  2NVU I;  2BYV E;  3Q3J A;  1AW7 A;  3T3N A;  5EE0 A;  1WXS A;  2J53 A;  1HE8 A;  3HM3 A;  3ZTC A;  3ABV B;  1WXQ A;  1D5M C;  1S3S G;  2G45 B;  4ANU A;  1XLN A;  1DYQ A;  3SR6 A;  4ZYS A;  4HCP B;  4RGM A;  2EKI A;  4WJQ A;  1KLU D;  3PLV A;  1E90 A;  3R66 C;  3I3T B;  4DHZ E;  5EDS A;  1PYW D;  3DWG C;  5JHB A;  4ZHP A;  2AQ2 B;  1E0Z A;  2HE7 A;  1JAL A;  4H2A A;  2A5U A;  1UUP A;  2JXT A;  2LMC A;  2MBH A;  2X8X X;  3ML9 A;  2KDE B;  1PUT A;  4E3C A;  1UF0 A;  2IND C;  4P1B C;  1FFV A;  3N1Z C;  2D11 A;  3CST A;  4LDT D;  3L0W B;  2KDF B;  2Y5C A;  3AE1 B;  3KVF B;  3TBL D;  1G6J A;  4RGT A;  5CHW A;  1EO6 A;  2BB5 A;  2D3A A;  2JU6 X;  1DOY A;  3L17 A;  2Y3A A;  1TBE A;  4G50 A;  5J17 A;  4OZB A;  1F2R C;  1R4M B;  2FCQ A;  3LDZ E;  4OZC A;  1YIW A;  4PT5 A;  2MCN B;  2N9P C;  1STE A;  1Q0W B;  1V8C A;  1VJK A;  1WRI A;  1WJ4 A;  4LJP B;  3KUC B;  1IGD A;  1HZ6 A;  4AUQ C;  4C4V A;  4IG7 B;  4BBN F;  3V60 A;  2NTT A;  1J8C A;  3IVF A;  3P63 A;  3VRB B;  4OW0 A;  2WNM A;  2MX2 A;  1UH6 A;  2ON8 A;  1V5T A;  3GZN I;  4ZHO A;  1FNW A;  4N6E B;  5BYQ A;  1SJH D;  3HVZ A;  4DXG A;  4P6V F;  4FAD A;  4ZOH C;  3PPA A;  2CHZ A;  5EE1 A;  3RCZ A;  4C80 A;  2KWC A;  5C23 A;  1YN5 A;  2W55 A;  3WCQ A;  4WH4 A;  1D6E C;  4L2Y A;  4II3 B;  4QAY A;  1IGC A;  3NVW A;  3AH7 A;  2GBK A;  3J9C A;  1TYG B;  3PV1 A;  2ZEQ A;  2PIA A;  2BYT A;  3UIN B;  3OWE B;  5H8Y E;  3WAO A;  1M4V A;  2QMT A;  1ZOY B;  1YNT E;  3NJT A;  4K3C A;  3SU8 X;  3ZNZ B;  5LXI B;  4P16 A;  4L23 A;  1JRP A;  2QHO A;  2WDT B;  3RNE C;  4HDQ A;  4NJ6 A;  2WXH A;  1HA5 A;  3I9V 1;  3ZXV A;  1C9F A;  4BOZ B;  3TEX A;  2DLB A;  4ITK A;  1B9R A;  1WX8 A;  1KLV A;  3A1Q A;  4JE3 B;  5EE9 A;  3MHZ A;  2NBV B;  3RNF C;  2INN E;  4NQK E;  3SDL C;  3U2S C;  2WDV B;  5AZF A;  2B3A A;  2MJD A;  3UIP B;  1CQV A;  1C3T A;  3GOE A;  2JY6 A;  2VH2 A;  2IY0 B;  3KUZ A;  3T8M A;  2NCN A;  5IO9 A;  4KVG B;  3JVZ X;  3H7S A;  1ZW7 A;  2KVR A;  1QF6 A;  2LEK A;  1WXV A;  3PZD A;  4HLE A;  5JHA A;  2KC1 A;  3GZN B;  3N9Y C;  4IUM B;  2JRH A;  2KO3 A;  2JSV X;  4AWJ A;  2BYE A;  1C79 A;  3IG3 A;  1KH0 A;  3A33 B;  3MP9 A;  1PDX A;  2K8C A;  5KHQ A;  4RM8 A;  1UNS A;  3E9S A;  3SD5 A;  1WGR A;  3KQ4 A;  4UDU C;  2I38 A;  4EOY A;  1VZ7 A;  2MWS B;  2RR9 A;  3O65 B;  4ASW C;  1T0Q C;  1EWY C;  4XDD A;  1IP9 A;  1ZKH A;  4PS7 A;  3IT4 B;  5JZE B;  1NI2 A;  2KTF A;  2LAS A;  3KUD B;  3TIX A;  2HJ1 A;  2YLM A;  3B08 A;  1JWU D;  5J18 A;  5E6P A;  4YSZ B;  1ZXI A;  1LFD A;  2V9H A;  5DPW A;  3PGE A;  4IM3 A;  1ZDV A;  2D3B A;  5AZH A;  4B9K A;  2QCZ A;  2IO0 B;  2KC2 A;  3PS6 A;  5HFY A;  1OFF A;  5DCN A;  5FKA C;  2LFI A;  3UI3 A;  4TV3 A;  2JWZ A;  2KFK A;  2K3U A;  2ICI A;  2HTH A;  5L95 C;  3KWL A;  2PLP A;  2YEP F;  1N63 A;  3FAH A;  1TZ1 A;  3HHM A;  4C00 A;  3EC8 A;  1C76 A;  2LJ5 A;  2BS2 B;  4K7U A;  2DAF A;  1BXT A;  1E7P B;  1L4D B;  4US8 A;  3V3X A;  3ALB A;  3R7R A;  1TS5 A;  2MP2 B;  3DPD A;  4B6W A;  1E8Y A;  1SBB B;  2LVO A;  3PSE B;  1XQQ A;  4NJ7 A;  2M1M A;  4GN1 A;  5AUK A;  1UBI A;  3ZJT A;  1KFY B;  4BBN C;  1SE2 A;  3MJ5 A;  1XLP A;  4IC7 B;  2WXQ A;  1OEY A;  3PTF C;  1ET9 A;  4EUT A;  4FUL A;  4I6P A;  5C2T B;  3DBH I;  3WAP A;  4N9F 4;  3ZJV A;  2WWZ A;  4LLG M;  4GOC A;  1C4A A;  1XO3 A;  3VVW B;  1WR1 A;  3AE8 B;  2IO2 B;  2N1V A;  5IAA C;  1AN8 A;  1UWM A;  5JXV A;  2WX0 A;  3EUB 2;  5LLI A;  2KDM A;  1FD6 A;  1T3Q A;  2N9K A;  2LVP A;  5G2N A;  2WXL A;  4XDC A;  2KNB A;  4KX6 B;  3A4S C;  3ZRC A;  2DEN B;  3VFK A;  5IKC M;  3W5V B;  4IM2 A;  1FRD A;  3C8Y A;  1WGY A;  5DPS A;  2QJL A;  3FC4 A;  4USA A;  1TY0 A;  3TEY A;  2BTE A;  2V0G A;  2XNA C;  5D7G A;  2DZI A;  1Z5S B;  1SJE D;  1KOT A;  1SB3 C;  2BPS A;  5E6J A;  4K1R B;  4ZRP A;  4LCD E;  2GBM A;  4MEM A;  3NS1 A;  3UQA A;  1VZ6 A;  1OQR A;  4W9H A;  1WXA A;  1GC7 A;  2W3S A;  4PYZ A;  3VTV A;  2K6Q A;  4MAC A;  1GAQ B;  2ASQ A;  4WQM A;  4A3P A;  1FCC C;  4C4V B;  2M0X A;  1ZUD 2;  3AEF B;  3Q8E A;  1WGK A;  5FR6 A;  2HJ8 A;  2QIE B;  4C7Z A;  4W9D A;  2N9X A;  4JL9 A;  3M62 B;  2VZK B;  1SE9 A;  4YSY B;  2J7Q B;  4HEA 1;  4W9G A;  3DVN U;  4MGK E;  4LK0 M;  4AS1 A;  2IBI B;  2GMI C;  2ZNV C;  4ACF A;  1P3Q U;  1WE7 A;  2LGY A;  2W3R A;  2JWU A;  1E8Z A;  4ICV A;  4WWP A;  4F1S A;  4MM3 B;  2DYB A;  4HPM B;  1ROE A;  2WU5 B;  3PZ7 A;  1ZPS A;  4JGH B;  3Q6B A;  4RF1 A;  2J0M A;  4XWT A;  1EF1 A;  4BKS A;  1QLB B;  3VDZ A;  2C7N B;  2BKR B;  1TZO A;  1NI3 A;  2CU1 A;  4MJS A;  4JWU C;  3NVY A;  1J19 A;  2KD0 A;  2ZCC A;  1I35 A;  5BYR A;  1QIL A;  2PTL A;  3U30 A;  4S0R A;  1GUA B;  2BBC A;  2M17 A;  5J2R A;  1IYF A;  4MGI E;  1ZE3 D;  4YTM B;  4OVZ A;  1FPY A;  5BMH A;  3RYT A;  1N61 A;  3Q2A C;  2VZK D;  3BY4 B;  5H92 C;  3RN9 C;  1C1Y B;  2M0A A;  4RFB A;  4BFR A;  4BZA A;  4MH0 E;  4MT5 A;  1WSP A;  4KKI A;  3IXS A;  3DBR B;  4WJP A;  1I7H A;  3MTN B;  1WM3 A;  2H89 B;  2XN9 C;  1JML A;  3BIN A;  3ENE A;  2IZV B;  5D2M B;  3EEC A;  2PJH A;  2K39 A;  2KAN A;  3TEZ A;  3VUW A;  3T9L A;  1UBQ A;  4RNA A;  1JQ4 A;  3BII D;  2DYO A;  2L52 A;  4GMV A;  2DZM A;  1LXD A;  1WZ3 A;  4XWW A;  2L1A A;  1T5X D;  3V05 A;  3VAW A;  3IAM 1;  4AJW A;  2JZZ A;  2MP2 A;  3VUX A;  1E8W A;  4JIO U;  1YX5 B;  2WP9 B;  4A20 A;  3QWZ B;  3WIM A;  4PYU A;  4FBJ B;  1C78 A;  3NG0 A;  2I2Y A;  1YQB A;  3ZNG C;  2O2V A;  3UGB B;  4ARC A;  1WY8 A;  3R3M A;  1ZDX A;  3V6E B;  1YOV B;  3B0A A;  4IKG A;  3BVM A;  4ZRK A;  4GXB A;  5CX3 A;  2KX0 A;  3JSV B;  4ARI A;  2WXI A;  2K5P A;  1K53 A;  1F52 A;  4ZRJ A;  4IDI A;  3JYU A;  5AZG A;  3WA0 A;  2C5L C;  2ACZ B;  4NAM A;  3M63 B;  1MHX A;  1LGR A;  1FXA A;  1RM6 C;  3Q3F A;  2TSS A;  2GBR A;  5C3J B;  3AMZ A;  3ZNI D;  2NMQ A;  1VDV A;  2MBE A;  1TKE A;  2KFK B;  2PW9 A;  3IHP C;  2L8J A;  2AWT A;  2L3Z A;  4TSS A;  3I5J C;  1JRU A;  2LGD A;  3KYD D;  1F9J A;  2K1F A;  3R2I A;  1MG4 A;  3KYC D;  2LI5 A;  3TMP B;  3OLM D;  4TQ0 A;  2PE6 B;  3HM6 X;  1GOZ A;  4HWI B;  2C7M B;  2JXX A;  2WDR B;  3FIL B;  3RNG C;  1R7S A;  5FR3 A;  3KLS X;  3RT3 B;  4ZYN A;  4NJC A;  2D5G A;  4WQO B;  2RPV A;  4KDI C;  4W9C A;  3RI7 C;  2WXJ A;  1QZE A;  1DOI A;  1XD3 B;  1XLO A;  3EA6 A;  1L4Z B;  1QOF A;  3Q3M C;  3ZGZ A;  4LNO A;  3ZTD A;  4JX1 C;  5D6J B;  3B2G A;  3L54 A;  2IO3 B;  2MH7 A;  3AE7 B;  4XE0 A;  5TR5 A;  1WMH A;  3PO0 A;  2LHE A;  2FUG 1;  2E6X A;  2KZR A;  3ECI A;  2WXK A;  2KX3 A;  2MRP A;  1WH3 A;  4HKQ A;  1FM0 D;  1EU3 A;  2N4F A;  2KKC A;  5EE3 A;  2AYO B;  1WYG A;  4MGZ E;  2BW2 A;  1YJJ A;  4MM3 A;  2CJN A;  3X0W A;  4MDK E;  1OTR B;  1P9D U;  4B95 A;  4E71 A;  1NDD A;  2LGS A;  4A9A A;  2ZW0 A;  3K9O B;  1WR6 E;  2CKH B;  1KM7 A;  4BOS C;  2BVC A;  2MA9 B;  4BAX A;  2MJE A;  3ETR A;  3OJ3 A;  1I4R A;  5DPR A;  2KWD A;  2QDF A;  2AL6 A;  4K81 A;  5MPO A;  3W5U B;  1RLF A;  4JPS A;  2KOX A;  4XC2 A;  1PQS A;  1TT5 B;  4M01 A;  3B2F A;  4DHZ B;  1A70 A;  1EWC A;  1GG3 A;  4RGN A;  1RFK A;  2VH1 A;  3R8B A;  3C0R B;  4DWF A;  1ZP0 B;  3EGR A;  3N30 A;  4HJG E;  4MSQ B;  3ZDT A;  3JW0 X;  3AEA B;  4TMA B;  2IYD B;  3PRP B;  2NTS A;  1V1O A;  4GDK A;  3S2A A;  3DVG X;  1JWS D;  4HK2 A;  3IAS 1;  3R2T A;  1IBX A;  2OJW A;  2XK5 B;  3MC9 A;  1D4B A;  2CHW A;  2RDG A;  2N7E A;  2KWV B;  4AOF A;  3V62 A;  4DHJ D;  4FA6 A;  2V4I B;  2LHD A;  2DBY A;  1FMA D;  3Q8F A;  1KF6 B;  2LRW A;  3W9C B;  1F77 A;  4HXD A;  3ZLZ A;  4MJS B;  3L08 A;  1FNV A;  3BK1 A;  1TKG A;  3NVV A;  2WXP A;  1YN4 A;  1X1M A;  2WGS A;  4TUU A;  3NUH B;  1WZ0 A;  2Y5P A;  3TSS A;  4CO7 A;  3L4P A;  2KN4 A;  2DYM A;  4M0W A;  4IOI E;  2K6D B;  3BZD B;  2KVZ A;  1L6U A;  2UU7 A;  4YWG G;  1H8C A;  2G1E A;  3QIJ A;  2LGX A;  1P7F A;  1WGG A;  3JSV A;  1E7U A;  2K25 A;  3SFD B;  3BWU D;  2ZVO A;  2V3N A;  1J7A A;  3ZKJ C;  2OJR A;  2UWQ A;  3AE5 B;  2KDI A;  3HUI A;  4BKG A;  2OED A;  1VR9 A;  5BYS A;  4WWO A;  2DZJ A;  2WXR A;  5CHV C;  3AEB B;  1V97 A;  3ZDM C;  3LXF A;  2ZPN A;  1V5O A;  1BUI C;  1WFY A;  2DAJ A;  4HPP A;  3VH4 B;  5D3I B;  1UGJ A;  4JWS C;  4ICU A;  3AE9 B;  3NHE B;  4GIV A;  2N0S B;  4X57 B;  4DDG D;  1SF0 A;  4HRS A;  3W1Y A;  2ZZP B;  1HEZ E;  4OHJ A;  2Z59 B;  1MVK A;  2LZ6 A;  2GOW A;  1N5W A;  4G11 A;  3QQ8 B;  4CHK A;  2LRU A;  3FIL A;  3RNB C;  3URY A;  1VLB A;  2NPT A;  2NR2 A;  4A8X C;  1WM2 A;  3BYT B;  1FCL A;  4KGT A;  2O2V B;  3APD A;  1FFU A;  3VTW A;  4OVV A;  1GNU A;  4HPL B;  5TSS A;  3D32 A;  1U4A A;  1OEY J;  1WXM A;  2BS3 B;  4N59 A;  1KRH A;  2LWP A;  1OQY A;  2M8S A;  1JCK B;  1R4N I;  2KMA A;  2ZCB A;  5CHF A;  2KJ6 A;  3SFE B;  1I4Q A;  4DBG A;  1ENF A;  4NAW A;  4URK A;  2H88 B;  1ISN A;  3VH3 B;  2KQ7 A;  4W9L A;  1UGM A;  1P98 A;  3O13 A;  3N20 C;  3X23 A;  2D10 A;  2JZ3 B;  4NY0 A;  1F1H A;  3W1S A;  1NVI D;  1MJD A;  4GLS C;  2MBO A;  2V3P A;  1K8R B;  2NBW B;  3GS2 A;  2FIF A;  4RCO A;  4KIK A;  3NVZ A;  2L0F A;  4G3X B;  2QC8 A;  4N58 A;  1BT0 A;  1SE3 A;  2KWU B;  3OAW A;  3QC8 B;  1XCQ L;  1XCT L;  5HI1 A;  4HRO A;  2R2O A;  3A9J A;  3BVZ A;  5AEK B;  1JWM D;  4IM0 A;  2GB1 A;  3AN1 A;  2PVO D;  4EE2 A;  4A55 A;  3P4R B;  2KLG A;  1K52 A;  2A4Z A;  2RGF A;  3ZVV A;  1FXT B;  3DBR I;  1E10 A;  1EF5 A;  5L83 A;  3EFC A;  1L2N A;  4GSW A;  3Q3N C;  1EU4 A;  1CZP A;  1OQQ A;  1SSN A;  2BGF A;  1L5P A;  3Q8B A;  3H9D A;  3CIR B;  4EKU A;  2RSU A;  4I6N B;  2KDB A;  4WWM A;  1NEN B;  3RNA C;  5IA7 A;  1V1P B;  1CMX B;  2EKE C;  1A5R A;  1WMH B;  3ZO5 B;  2RD0 A;  3TCA A;  1IPG A;  1T0Y A;  2FAZ A;  2GBN A;  3ONS A;  1GJZ A;  1E6E B;  3L16 A;  5AUI A;  3UF8 A;  1ET6 A;  2XK5 A;  4LNF A;  2Q5W D;  3AV8 A;  1QQR A;  3A9K B;  3C19 A;  2FE8 A;  4AQ7 A;  3DVN V;  4RM9 A;  2IPK D;  2MEK A;  2C7H A;  4PK1 A;  3HK0 A;  1R4N B;  2L0T A;  1FNU A;  2KXJ A;  2MW5 A;  1IUE A;  4ZRQ A;  3V6C B;  4EZJ A;  3I63 C;  2SAK A;  3ZRF A;  2JYE A;  1Z2M A;  4HJK A;  1MPE A;  2XBB C;  2KMC A;  3M3J A;  3NZU A;  3NS8 A;  4P1C C;  5LNK 1;  4L1B A;  1V80 A;  3APF A;  1YQ3 B;  4O1N A;  4TQ1 A;  2J0K A;  5BO4 B;  2MJ3 A;  4FLH A;  3P4Q B;  2L05 A;  1J0G A;  3VRA B;  4YL8 A;  2IY1 B;  1LO5 D;  2D3G A;  4A90 A;  3AM9 A;  3CMM B;  4XGA B;  2KLC A;  4ANW A;  2K22 A;  1C4P A;  1N6Z A;  2K0P A;  3OG5 A;  3Q3O C;  1WJ6 A;  1I4G A;  1L0V B;  4C56 C;  2PEA A;  3DHI C;  1WYW B;  4IWP A;  3QK0 A;  4FJZ A;  3HVD A;  3PHW B;  2M19 A;  4GDK B;  2CU3 A;  4I6L B;  3H7P B;  3LJ3 A;  1IBX B;  4FN2 A;  2QIL A;  2SEB D;  4MH8 A;  2CS4 A;  2IO1 B;  2WXG A;  1P0R A;  4PS8 A;  4RGO S;  2Y5B B;  4K7S A;  4WJN A;  4FXC A;  1I4P A;  1FO4 A;  4IW0 A;  1WIA A;  3ZNH B;  3MJW A;  1HXY D;  2KAC A;  4MEL A;  2WQY B;  4XZ4 A;  2N9L A;  3AE4 B;  3MC8 A;  1NYQ A;  3LYY A;  1D5Z C;  1UZX B;  2G4S A;  5T8I A;  1SIF A;  3DOW A;  1ACC A;  1WX7 A;  4HDO A;  1TGZ B;  1CK1 A;  1EUV B;  2FCS A;  2BYF A;  2INC C;  4M0W B;  1SXT A;  3VR8 B;  4HKZ E;  1VZ8 A;  3IBE A;  2N7J A;  4K3B A;  4KDL B;  4F7Z A;  1Q1O A;  2JF5 A;  4HCN B;  3GE8 C;  1YN3 A;  3BK2 A;  4II2 B;  3WAN A;  4FHJ A;  2IDY A;  5KHO A;  2V1Y A;  3ZIM A;  1TIF A;  1JWB D;  2RDH A;  2HDE A;  3R7Q A;  2FUH B;  1RFA A;  1BML C;  1VRA B;  1Y8R C;  5G5H A;  2OOB B;  2KTR A;  2M56 B;  1HZ5 A;  2D3C A;  5C1Z A;  5D94 A;  2DHZ A;  1DGJ A;  2WU2 B;  2EEL A;  3K9P B;  2MBQ A;  1LQB A;  1MFW A;  1WJN A;  4Q2J A;  2V3S A;  3SHQ A;  1Q10 A;  2KQS A;  3H6N A;  3DDC B;  3AEE B;  3RD2 A;  2WYQ A;  3AE2 B;  5E6N A;  4MSM B;  2O6V D;  1EM7 A;  4R3D A;  4PS3 A;  5BMI A;  3TJP A;  4CQN A;  3A4R A;  1HTO A;  2JPH A;  4KSL C;  2N9E B;  1TKY A;  5HHD G;  4ANV A;  1Y56 A;  3MHS D;  1XEE A;  2KMM A;  2WS3 B;  5GXG B;  4KV2 A;  2D07 B;  2PPH A;  3AU5 A;  4C7Y A;  2L76 A;  1YJI A;  2LJI A;  4XYC A;  2BWF A;  2NPT B;  2G9H D;  4J3O D;  1PGX A;  3AEG B;  3BYY B;  2I1K A;  5BMG A;  3RPF C;  3DBL I;  4GDL B;  4RH6 A;  2L32 A;  3CSF A;  4FJV B;  1E8X A;  2V4L A;  2UYZ B;  2WXO A;  3Q8A A;  4KKJ A;  3AED B;  2CJO A;  3N3K B;  5HG2 A;  2KQ4 X;  3I57 A;  3IT6 B;  2L83 A;  4WUR A;  2I1J A;  4AP4 C;  1V1P A;  4AJY B;  2BF8 B;  4YTN B;  1QOG A;  2Z0D B;  4NAW B;  2WDQ B;  3AE6 B;  2DNF A;  4YXD B;  3PLU A;  1D5X C;  1TS3 A;  2JYT A;  4KZC A;  1WGH A;  3RUL A;  5I4D A;  2X38 A;  3VHT C;  1WRD B;  4RMA A;  2AX5 A;  4W9K A;  3QHT A;  3A9K A;  1M94 A;  3RZW C;  2K9X A;  1V6E A;  4KIK B;  3SEB A;  2GRI A;  1N60 A;  1RWS A;  1RAX A;  1T0S C;  2R61 A;  2BS4 B;  5IOI A;  3H8H A;  3NOB A;  4DHJ B;  5G55 A;  3BVG A;  3A9J B;  2FCM A;  3U8Z A;  3DWM A;  2BKF A;  4KSK C;  2AEH A;  4EFO A;  4EZK A;  3AE3 B;  2D2Q A;  2G4D B;  3PZ8 A;  1L6V A;  1KJT A;  1I4H A;  2OHF A;  3W1S C;  1VCB A;  4NPN A;  2L7R A;  3P4P B;  3UQB A;  2MHJ A;  4G0N B;  2MSE D;  1AWD A;  3OJ4 B;  2YVC A;  2PE9 A;  5D3D A;  4D2K A;  3PHX B;  4ZDV A;  1ZGU B;  1RRB A;  1N62 A;  3ML8 A;  4LNN A;  3V61 A;  2KN5 A;  3AU4 A;  2GI9 A;  5G5G A;  1WGD A;  4EZL A;  2AL3 A;  3DBL B;  4JQW C;  4WJO A;  1TJE A;  2FBW B;  3H7P A;  1NYR A;  1NBF C;  3QJZ A;  1AAR A;  3CWI A;  2C9W B;  2KK8 A;  1V9J A;  1UD7 A;  2EMS A;  4DDI D;  1H4R A;  3U7D A;  4WAA A;  3TEW A;  1YMH E;  3DHG C;  2WHI A;  4BVU C;  3AB5 A;  1N5X A;  2L00 B;  1WX9 A;  1SEB D;  2O6V A;  2J42 A;  2W54 A;  3P1M A;  3M95 A;  3RZF A;  2ZVN A;  1KTK A;  1MHH E;  2J0J A;  4KGR A;  3AEC B;  3HRD D;  1SE4 A;  1VD2 A;  1ZXH A;  1F0Z A;  2DWQ A;  3DQV A;  4W9F A;  3PRE A;  1V86 A;  2LVQ A;  2KYW A;  5FK9 C;  4K7W A;  1OGW A;  4A6Q A;  2K8B A;  5HKH A;  1QOB A;  3AXC A;  1I4X A;  3RUI B;  1MG8 A;  1JWA D;  1T0R C;  2KFJ A;  2WXF A;  3L10 B;  4LTU A;  2RPQ A;  3VXW A;  2Z0E B;  1FXI A;  1TS4 A;  2JZP A;  1QT9 A;  4KZ0 A;  1AYF A;  1E7V A;  3QAR A;  1E9M A;  3DCG A;  3GE3 C;  1L0X B;  4REZ A;  3DHH C;  2QSD A;  1JW9 D;  1WWT A;  4M00 A;  2J52 A;  5IP4 D;  4YSX B;  1TY2 A;  3U7Z A;  2IJ0 A;  5JH5 C;  2NS5 A;  2ZJD A;  3NRZ A;  2KHW B;  1GB4 A;  1TTN A;  2ONQ A;  2LUM A;  3ZJU A;  5LXH A;  3P4S B;  4LNK A;  1WF9 A;  2IGG A;  4LNI A;  4BKS D;  1XLQ A;  4NZL B;  2LD9 A;  3LB8 C;  1WJU A;  3WAM A;  4IWO A;  2MBB B;  4W9J A;  2CHX A;  3KW5 B;  4DK5 A;  2W9N A;  4YTP B;  3DBS A;  1PGB A;  1WE6 A;  4GDL A;  4ZRI A;  3RMK C;  3Q69 A;  1Q5W B;  2G3Q B;  2ZW1 A;  2AQ3 B;  3IFW B;  3RNC C;  2PMV A;  2EMT A;  2BB6 A;  3N1X C;  4IWQ A;  1K51 A;  3N1Y C;  4EEW A;  5IN7 A;  3EFU A;  3W2D A;  2KJH B;  1DOX A;  2M4N A;  3TUO A;  1ESF A;  1FRR A;  2JT4 B;  1NEK B;  2KTR B;  2W82 A;  4WAF A;  5GMV A;  3P2B A;  2XEW A;  2FCN A;  2NBU A;  3PRZ A;  1HQR D;  3Q14 C;  1SGH A;  3FKY A;  4W9E A;  4F8C B;  3ZYY X;  4M8N A;  2R2Q A;  2J4X A;  3H1U A;  3AI5 A;  2LGI A;  1YQ4 B;  1B1Z A;  3NZ3 A;  1GB1 A;  2C60 A;  1V81 A;  2REX A;  1UEL A;  5DPT A;  2LUE A;  3PRM B;  4S17 A;  3WAL A;  1HTQ A;  1QKZ A;  1PGA A;  4RF0 A;  1K50 A;  3VR9 B;  4E74 A;  3NY5 A;  1I42 A;  1RYJ A;  3CF6 E;  4MGY E;  2AQ1 B;  1YX6 B;  3U4E G;  4YT0 B;  3P42 A;  3QAQ A;  1S1Q B;  1P7E A;  3MFG A;  2PVG C;  2ZNV B;  2JQR B;  1FIQ A;  4DXF A; 
#chains in the Genus database with same CATH homology
 2WLB A;  1JRO A;  2CJN A;  2JX5 A;  5T8I A;  1ACC A;  4B0E A;  1CK1 A;  1ZDV A;  1SXT A;  3VR8 B;  4HKZ E;  1VZ8 A;  2N7J A;  1QOA A;  1PFD A;  4OZA A;  4A9A A;  1YN3 A;  2QEJ C;  2ZW0 A;  3BK2 A;  5HFY A;  4US9 A;  1OFF A;  5FKA C;  2LFI A;  2IDY A;  3UI3 A;  2MJE A;  3ETR A;  1I4R A;  2K3U A;  2ICI A;  2KWD A;  1JWB D;  2RDH A;  2PLP A;  2HDE A;  3KWL A;  2YEP F;  5MPO A;  1N63 A;  3FAH A;  1J7C A;  3W5U B;  1BML C;  1UWX A;  1VRA B;  5G5H A;  3KWV A;  4JPS A;  2M56 B;  1C76 A;  1HZ5 A;  2BS2 B;  1BXT A;  1DGJ A;  3B2F A;  1E7P B;  1L4D B;  2WU2 B;  2Z8L A;  4US8 A;  3V3X A;  2EEL A;  1A70 A;  1EWC A;  4Q2J A;  1TS5 A;  3E56 A;  1SBB B;  4RGN A;  1Q10 A;  1RFK A;  3AEE B;  2BT6 A;  1L0Y B;  3R8B A;  1J7B A;  1CJE A;  2IGD A;  3AE2 B;  1EM7 A;  4R3D A;  5BMI A;  4CQN A;  1ZP0 B;  3EGR A;  4HJG E;  3ZQ4 A;  1SIJ A;  1C4C A;  5AUK A;  1GPX A;  3ZJT A;  1KFY B;  1TKY A;  3AEA B;  4TMA B;  3RFZ B;  2NTS A;  5HHD G;  1SE2 A;  3MJ5 A;  1XXG A;  1V1O A;  4WIP A;  1Y56 A;  1XLP A;  1JWS D;  1TS2 A;  1XEE A;  2KMM A;  2WS3 B;  2WXM A;  2WXQ A;  2INP E;  3IAS 1;  3R2T A;  5GXG B;  3GB1 A;  1IBX A;  1ET9 A;  3VQI A;  3B9J A;  5C2T B;  2E3T A;  4C7Y A;  3ZJV A;  1D4B A;  4LLG M;  1YJI A;  2LJI A;  1C4A A;  2RDG A;  1XO3 A;  1FEH A;  2G9H D;  2B76 B;  3AE8 B;  2KAJ A;  4J3O D;  1PGX A;  3AEG B;  3BYY B;  5BMG A;  3RPF C;  1F2R I;  1AN8 A;  2V4I B;  1UWM A;  2LHD A;  5JXV A;  2DBY A;  1FMA D;  3Q8F A;  4GDL B;  4RH6 A;  2L32 A;  3EUB 2;  2KDM A;  1FD6 A;  1T3Q A;  1KF6 B;  2N9K A;  2WXO A;  3W9C B;  1F77 A;  3Q8A A;  2PKO A;  4KKJ A;  2WXL A;  2YEP B;  3AED B;  4XDC A;  4DQO C;  4KX6 B;  4KGS A;  1FNV A;  2CJO A;  3W5V B;  3BK1 A;  1FRD A;  1TKG A;  3C8Y A;  3NVV A;  2RMM A;  2WXP A;  1YN4 A;  5HG2 A;  2KQ4 X;  2HTM E;  1T6B X;  3I57 A;  3NUH B;  3IT6 B;  3MC0 B;  2Y5P A;  2L83 A;  4WUR A;  3TSS A;  1V1P A;  2QJL A;  3GP7 A;  3FC4 A;  3L4P A;  4USA A;  1TY0 A;  3TEY A;  2BTE A;  2KN4 A;  4YTN B;  1QOG A;  2DYM A;  2V0G A;  4M0W A;  1KLG D;  2XNA C;  1XF5 L;  3U52 E;  3Q8C A;  4NAW B;  5D7G A;  2WDQ B;  4IOI E;  4B0M A;  3AE6 B;  3BZD B;  4YXD B;  1SJE D;  1SB3 C;  1L6U A;  1D5X C;  1TS3 A;  2JYT A;  1C77 A;  5E6J A;  2G1E A;  4YWG G;  3T3O A;  5I4D A;  2X38 A;  1P7F A;  4ZRP A;  2AX5 A;  3SFD B;  3BWU D;  3NS1 A;  2V3N A;  1VZ6 A;  2K9X A;  1J7A A;  1OQR A;  3HUI A;  3AE5 B;  2IGH A;  2W3S A;  3SEB A;  2GRI A;  2OED A;  4MAC A;  1GAQ B;  1N60 A;  1RWS A;  1VR9 A;  5BYS A;  2R61 A;  4WQM A;  2BS4 B;  1FCC C;  2WXR A;  2WXN A;  1ZUD 2;  1V97 A;  3AEB B;  3AEF B;  3H8H A;  1MI0 A;  3Q8E A;  1WGK A;  3LXF A;  3BVG A;  1BUI C;  2QIE B;  3DWM A;  4C7Z A;  5D3I B;  1UGJ A;  4JWS C;  1AW7 A;  3AE3 B;  3T3N A;  2VZK B;  3AE9 B;  5EE0 A;  3PZ8 A;  2J53 A;  2N0S B;  1L6V A;  1I4H A;  4YSY B;  1SF0 A;  2OHF A;  4HRS A;  4HEA 1;  3ABV B;  1WXQ A;  1D5M C;  3P4P B;  4OHJ A;  1HEZ E;  1AWD A;  1XLN A;  4LK0 M;  4AS1 A;  1MVK A;  1N5W A;  1DYQ A;  5D3D A;  4D2K A;  3SR6 A;  4ZYS A;  3FIL A;  4RGM A;  2W3R A;  3URY A;  1VLB A;  2EKI A;  2JWU A;  1N62 A;  4A8X C;  1KLU D;  4MM3 B;  1FCL A;  3BYT B;  1ROE A;  2WU5 B;  3PZ7 A;  1ZPS A;  2GI9 A;  4RF1 A;  1PYW D;  3DWG C;  4KGT A;  4XWT A;  5G5G A;  4ZHP A;  2AQ2 B;  1E0Z A;  1TJE A;  1QLB B;  1FFU A;  2FBW B;  1JAL A;  1TZO A;  1NI3 A;  4H2A A;  5TSS A;  1UUP A;  4JWU C;  2JXT A;  3NVY A;  2LMC A;  1NYR A;  5BYR A;  1QIL A;  3CWI A;  1PUT A;  2BS3 B;  4N59 A;  1KRH A;  2PTL A;  1FFV A;  2BBC A;  1JCK B;  3TEW A;  1YMH E;  3SFE B;  1I4Q A;  2Y5C A;  3AE1 B;  1ZE3 D;  4YTM B;  3AB5 A;  1ENF A;  4RGT A;  2H88 B;  4OVZ A;  5BMH A;  1N5X A;  1N61 A;  2JU6 X;  2BB5 A;  3O13 A;  2VZK D;  1DOY A;  1SEB D;  5H92 C;  2Y3A A;  2J42 A;  3W1S A;  1NVI D;  2W54 A;  4OZB A;  3P1M A;  1F2R C;  2M0A A;  1KTK A;  4OZC A;  4RFB A;  4PT5 A;  4GLS C;  1MHH E;  2V3P A;  1STE A;  3GS2 A;  4KGR A;  4MT5 A;  4RCO A;  3AEC B;  3HRD D;  1SE4 A;  1ZXH A;  1WSP A;  3NVZ A;  1V8C A;  4KKI A;  1F0Z A;  1VJK A;  1WRI A;  3IXS A;  4N58 A;  1SE3 A;  2DWQ A;  1I7H A;  1XCQ L;  1XCT L;  5HI1 A;  1IGD A;  1HZ6 A;  4HRO A;  2H89 B;  2XN9 C;  2NTT A;  5FK9 C;  1JML A;  4A6Q A;  3P63 A;  3VRB B;  4OW0 A;  3BVZ A;  1JWM D;  1QOB A;  2WNM A;  2GB1 A;  3AN1 A;  2PVO D;  2ON8 A;  4EE2 A;  1I4X A;  3P4R B;  4A55 A;  4ZHO A;  1K52 A;  1FNW A;  3TEZ A;  1JWA D;  2WXF A;  4N6E B;  1SJH D;  5BYQ A;  4LTU A;  4RNA A;  1JQ4 A;  3BII D;  2DYO A;  3HVZ A;  4DXG A;  1E10 A;  2L52 A;  4P6V F;  1FXI A;  4ZOH C;  5EE1 A;  1TS4 A;  4C80 A;  2JZP A;  1YN5 A;  4XWW A;  2L1A A;  1QT9 A;  2W55 A;  1EU4 A;  1CZP A;  1OQQ A;  1SSN A;  1T5X D;  3WCQ A;  3V05 A;  3IAM 1;  1AYF A;  1L5P A;  3Q8B A;  3CIR B;  1E9M A;  4WH4 A;  1D6E C;  4L2Y A;  1L0X B;  4REZ A;  1NEN B;  2QSD A;  4WWM A;  1JW9 D;  2WP9 B;  1WWT A;  2J52 A;  1IGC A;  3NVW A;  4YSX B;  1TY2 A;  1V1P B;  3AH7 A;  3U7Z A;  2IJ0 A;  1C78 A;  2I2Y A;  3J9C A;  1TYG B;  3NRZ A;  4ARC A;  1GB4 A;  1ZDX A;  2PIA A;  2BYT A;  3OWE B;  2ONQ A;  5H8Y E;  4IKG A;  1E6E B;  3BVM A;  5AUI A;  2LUM A;  3ZJU A;  3P4S B;  1ET6 A;  1M4V A;  2QMT A;  2IGG A;  1ZOY B;  1YNT E;  4ARI A;  1XLQ A;  4NZL B;  2Q5W D;  2WXI A;  3AV8 A;  2K5P A;  3LB8 C;  1QQR A;  1K53 A;  4IDI A;  4P16 A;  4YTP B;  4L23 A;  1JRP A;  2FE8 A;  4AQ7 A;  2ACZ B;  1PGB A;  2IPK D;  2MEK A;  2WXH A;  1HA5 A;  4NAM A;  3I9V 1;  3Q69 A;  1MHX A;  1FNU A;  2ZW1 A;  1IUE A;  1FXA A;  1RM6 C;  2AQ3 B;  4ZRQ A;  2PMV A;  2TSS A;  1C9F A;  5C3J B;  3AMZ A;  2SAK A;  3TEX A;  2JYE A;  2BB6 A;  2DLB A;  2NMQ A;  4ITK A;  1VDV A;  1B9R A;  1K51 A;  1TKE A;  4JE3 B;  1MPE A;  5EE9 A;  2PW9 A;  3MHZ A;  3W2D A;  2INN E;  4TSS A;  3U2S C;  2WDV B;  1DOX A;  3TUO A;  1ESF A;  5LNK 1;  1FRR A;  4L1B A;  2MJD A;  1NEK B;  1CQV A;  1YQ3 B;  4O1N A;  4TQ1 A;  2W82 A;  4WAF A;  3R2I A;  2MJ3 A;  3P4Q B;  4TQ0 A;  1HQR D;  3VRA B;  1GOZ A;  4A90 A;  1LO5 D;  3AM9 A;  2WDR B;  3FIL B;  1R7S A;  5FR3 A;  3ZYY X;  1QF6 A;  3KLS X;  2K22 A;  1C4P A;  2LEK A;  2K0P A;  4NJC A;  2D5G A;  2RPV A;  1I4G A;  1L0V B;  3N9Y C;  4C56 C;  2J4X A;  2WXJ A;  1DOI A;  2LGI A;  2JSV X;  1XLO A;  3HVD A;  3EA6 A;  1YQ4 B;  1B1Z A;  3NZ3 A;  2M19 A;  1L4Z B;  1GB1 A;  4GDK B;  2CU3 A;  1QOF A;  1C79 A;  1KH0 A;  3MP9 A;  3ZGZ A;  1PDX A;  1IBX B;  1UNS A;  3E9S A;  2QIL A;  2SEB D;  1QKZ A;  4MH8 A;  3KQ4 A;  1PGA A;  4RF0 A;  2WXG A;  4JX1 C;  1K50 A;  3B2G A;  4UDU C;  3VR9 B;  2I38 A;  1VZ7 A;  2MH7 A;  3AE7 B;  4XE0 A;  1EWY C;  4RGO S;  3PO0 A;  2LHE A;  1I4P A;  2FUG 1;  4FXC A;  4XDD A;  1FO4 A;  3IT4 B;  1HXY D;  2E6X A;  1RYJ A;  2WXK A;  2KAC A;  2WQY B;  2N9L A;  2AQ1 B;  3AE4 B;  4HKQ A;  1FM0 D;  1EU3 A;  1JWU D;  3U4E G;  5EE3 A;  4YT0 B;  3P42 A;  1NYQ A;  4YSZ B;  1ZXI A;  3LYY A;  1D5Z C;  1WYG A;  1P7E A;  3MFG A;  2PVG C;  2JQR B;  1FIQ A;  2BW2 A;  1YJJ A;  4DXF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...