1E6EB

Adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH\:ADRENODOXIN OXIDOREDUCTASE
publication title Adrenodoxin Reductase-Adrenodoxin Complex Structure Suggests Electron Transfer Path in Steroid Biosynthesis.
pubmed doi rcsb
source organism Bos taurus
molecule tags Oxidoreductase
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e6eB00
2M56B 2PIAA 2WDVB 2HTME 2QIEB 1RYJA 1J7CA 4YSYB 1B9RA 1GAQB 1L5PA 2WDQB 1SIJA 1OFFA 1VLBA 2EKIA 2W3SA 2WU5B 1FO4A 1JQ4A 3LXFA 1DGJA 3P63A 1XLNA 1TKYA 2BS2B 1YQ3B 1QF6A 3ABVB 1CJEA 4N58A 1NEKB 1WXQA 1L6UA 4FXCA 5MPOA 1JALA 2N0SB 2CJOA 2JQRB 3NVWA 5AUIA 1PUTA 4US9A 2MJDA 5GXGB 2BS4B 2JX5A 4YT0B 3DWMA 3P4SB 4JX1C 1NVID 3AE4B 3AEAB 2BT6A 1XLQA 1WRIA 1FFUA 4YXDB 1ROEA 3AEBB 1XLOA 2PVGC 3SR6A 2PVOD 1ZOYB 1DOIA 1JROA 1QOGA 2DWQA 2Q5WD 3KWLA 1IUEA 4JWSC 5AUKA 1TYGB 2BS3B 4C7ZA 1GPXA 3AE9B 3WCQA 3AN1A 1YJJA 1FXIA 1R7SA 1N5WA 3CIRB 1FRDA 2MJ3A 1V97A 4N6EB 1VJKA 1RFKA 3AE3B 1DOYA 4A9AA 2PKOA 3LB8C 2Y5CA 1JWAD 2AX5A 2H89B 4LTUA 3NVZA 4HRSA 1EWYC 1I7HA 3B2FA 2W54A 4ZHPA 1N63A 1WWTA 3SFEB 1KFYB 3NVVA 1OQQA 4USAA 1L0VB 1YJIA 5EE1A 3FC4A 3AM9A 3NRZA 3ZYYX 1DOXA 2DBYA 3AECB 3L4PA 3SFDB 3AEGB 1NYRA 3CWIA 1TKEA 3W9CB 2L83A 3DWGC 2H88B 2K5PA 1TJEA 4WQMA 1QLBB 1PDXA 3HUIA 3VR9B 2ACZB 1L6VA 1QOFA 3P4RB 4WWMA 5H8YE 1A70A 3AEFB 1E10A 3P4PB 3AE5B 4YTMB 4KX6B 2WS3B 1KRHA 4C7YA 3RPFC 5EE9A 4ZHOA 4US8A 3B9JA 1T3QA 3AB5A 3VRBB 1RM6C 3NS1A 1AYFA 5C3JB 4YTPB 2MJEA 1CZPA 2W55A 1V8CA 4YSZB 1XLPA 2CU3A 3AH7A 3FAHA 1NENB 1QOBA 2WQYB 2L52A 3NVYA 1NYQA 1UWMA 1JW9D 3AV8A 2MH7A 2M19A 1N61A 1AWDA 3ETRA 4N59A 1RWSA 4HROA 3PO0A 3AE8B 3HVZA 3W5UB 2G1EA 1J7AA 4C80A 2WP9B 1E7PB 1FIQA 2WLBA 3AE6B 3W5VB 1NI3A 1TKGA 2B76B 4ZOHC 2E3TA 2CJNA 3VRAB 1F0ZA 1ZUD2 1XO3A 1OQRA 1VDVA 4YSXB 1E0ZA 2K22A 1FM0D 1WGKA 3AE1B 2QJLA 3AE7B 5G5GA 1FRRA 1WYGA 2FBWB 3AMZA 4YTNB 1N62A 3HRDD 5EE0A 1JWBD 2W3RA 5G5HA 3P1MA 1KF6B 1E6EB 1SB3C 2KAJA 3AEDB 3AEEB 2K9XA 1E9MA 1YQ4B 5EE3A 5C2TB 2OHFA 2WDRB 2WU2B 3B2GA 1ZP0B 3EUB2 3P4QB 1QT9A 3BIID 4P6VF 1FXAA 4JWUC 1FFVA 1QOAA 4IDIA 1J7BA 1SF0A 4ITKA 5H92C 1ZXIA 2LEKA 3AE2B 1JRPA 3VR8B 1FMAD 1PFDA 1N60A 2KMMA 1N5XA
chains in the Genus database with same CATH superfamily
2KMAA 2PIAA 2VZKB 2ZVNA 2LVPA 2WDQB 2L1AA 2LVOA 3DBLB 1WZ0A 3C19A 2RD0A 4FXCA 2CJOA 1PUTA 2NCNA 2EMTA 1WH3A 3PV1A 4YT0B 1XD3B 2BYFA 3PZ8A 1NVID 4BZAA 1WRIA 2L8JA 3N20C 1ROEA 3AEBB 4EEWA 2LHDA 3SR6A 4HVBA 4UDUC 1IUEA 1TYGB 2BS3B 1GPXA 2IJ0A 2AL6A 3ZNID 4WIPA 4GXBA 5T8IA 2DZIA 2MLBA 1B1ZA 1MG4A 2D2QA 1L0VB 4XX5A 1MFWA 2BB6A 3HIZA 5JH5C 3SFDB 3CWIA 4IUMB 3NUHB 2K5PA 2BKFA 3HUIA 4MH0E 2DZJA 2M0XA 3RCZA 3B9JA 3R3MA 5G2NA 2MJEA 4LNNA 2JF5A 3RD2A 3AV8A 2HJ8A 3ZNHB 3L0WB 2IO3B 3W5UB 2MQJA 2KDIA 1E7PB 2M0AA 2XK5A 4IWOA 2MRPA 1JRUA 2BWES 2NBVB 2N1VA 3WALA 1ZUD2 2CS4A 2ZZPB 3URYA 4WJNA 1Q5WB 2FBWB 2KDFB 3UI3A 4MT5A 4E74A 2KDBA 5AZFA 4RGOS 3R2TA 2WDRB 3TEXA 1OEYJ 3TIXA 4PS3A 2JSVX 4KV2A 4HWIB 4KDIC 4ZRPA 1XLNA 2ZW1A 3ABVB 2ZEQA 2QC8A 2LGIA 1WYWB 3JYUA 1PGAA 1SE3A 3P4SB 2WXGA 2M17A 2C60A 2RPVA 2KJ6A 2PVOD 4JWSC 1K8RB 1GB4A 2GI9A 1FXIA 3DBRB 2RDHA 1VJKA 2PE9A 1ZDXA 2D07B 2KQ7A 3QARA 4LNKA 1WJUA 4RMAA 2WXNA 2JRHA 1WZ3A 1RRBA 3ZW3A 2NS5A 3UIOB 3U7ZA 3PZ7A 3W1YA 1TS4A 1H4RA 1TIFA 2DLBA 3DBLI 4LNFA 2INCC 3GZNB 3Q3JA 4WWMA 1SGHA 3ZLZA 1A70A 2L0TA 2KX0A 2MBEA 2R2OA 3KUDB 4IM2A 1FEHA 3I5JC 3Q8AA 4HCPB 3VXWA 4MELA 2WXLA 2PE6B 2LRUA 2GBRA 5GMVA 2DAJA 3PO0A 1T0SC 2L00B 4GU2A 2WLBA 5LXHA 1ZDVA 4BKTA 3N3KB 4IW0A 1T0YA 2CHZA 1KJTA 2J7QB 4BFRA 4HDQA 4EUTA 1V2YA 3AEDB 2K9XA 3I57A 5C2TB 5JHBA 1ESFA 5E6NA 2BKRB 1N5XA 1WMHA 2WHIA 5LXIB 3IT6B 4DXFA 5DPWA 3T3NA 3Q3MC 3UQAA 1KH0A 1L5PA 2EKIA 1K53A 5IP4D 1BT0A 2KANA 2RGFA 4ICVA 4DXAB 5HI1A 4KZCA 4NJ7A 1JWMD 2O6VD 2KD0A 4GDKA 1HQRD 4W9CA 1L7YA 1EF1A 3C0RB 1UELA 3VHTC 1EU3A 1OTRB 4FJYA 1NBFC 4I6PA 1KLUD 4DHZE 1DOYA 4GLSC 4NQLB 3PHXB 2C7MB 1UZXB 3RNGC 1EWYC 2IY0B 2W54A 1KFYB 3IVFA 2KWDA 4CHKA 2PTLA 3E56A 2VH1A 3WAOA 5IN7A 3VFKA 3PLUA 2KTFA 1C9FA 1ZW7A 2NBWB 1KM7A 1UF0A 3AE5B 3OJ3A 1SE2A 4W9JA 4WAAA 3VTWA 4M01A 4DHJB 4K3BA 2WNMA 2M4NA 1FNVA 2WXQA 4W9GA 3ZJUA 4ANXA 1UBIA 5CHWA 3SDLC 5AEKB 1UWXA 3IT4B 3VUXA 2D11A 1C3TA 1E90A 3DBRI 1C79A 3M3JA 3AE6B 4EE2A 3UIPB 4Q2JA 3KLSX 2DZKA 4YSXB 4LDTB 4M8MA 1MHHE 1XXGA 4E3CA 2KZRA 3RNCC 4GN1A 1PFDA 3APDA 5D7GA 2JY6A 2WDVB 1XQQA 4W9FA 3PHWB 1MJDA 1VZ7A 2IDYA 5L95C 3ZJVA 3N32A 3I63C 1KLVA 1U4AA 3PSEB 1TZ1A 3VAWA 1E8WA 1L6UA 4O1NA 3TEZA 1S3SG 1PYWD 2L32A 1OQYA 3PRMB 5D3IB 1HE8A 2BT6A 4YXDB 2K8CA 3Q8FA 2LI5A 3VQIA 2KVRA 2KC2A 2Q5WD 4ACFA 1JWUD 4WWOA 1KTKA 3AE9B 4WJOA 4LNIA 5FKAC 4TQ0A 2DYBA 3PREA 1XCQL 1NDDA 4L1BA 3RNFC 4NQKE 2FE8A 3Q8CA 2ZNVC 2DAFA 4YL8A 1XF5L 3WAMA 5TR5A 2LGDA 3JVZX 1UGMA 3ZDMC 2H88B 1GUAB 2D10A 2MCNB 1E10A 3P4PB 4AJWA 3V6CB 1PGXA 1R4MB 4AS1A 1MHXA 1IGDA 4FULA 4IOIE 1V49A 2DYOA 3TSSA 4G0NB 1L0XB 3FAHA 2QMTA 2WQYB 5HG2A 3ZXVA 1WX7A 5E6OA 1FNWA 4MGZE 2B76B 4XWTA 3U30A 4MSQB 4KSLC 1L2NA 4I6LB 2JRIB 1M4VA 4M02A 2V3NA 4EKUA 1BMLC 5AZGA 3CMMB 3VR8B 4G50A 3CSFA 3EC8A 2KNBA 2QIEB 1ZGUB 4PK1A 4MJSA 1E5WA 3I9V1 4RGMA 4KSKC 1CJEA 1WI0A 4OW0A 1P7EA 4IM3A 1Z2MA 3A9JA 2LFIA 2FAZA 1YQBA 4BKSD 2KK8A 3AEAB 1XLQA 1FFUA 4BBNC 2BF8B 4BOSC 3GP7A 3CF6E 5HHDG 2LVQA 1ZXHA 4RM8A 4C7ZA 3AN1A 4FLHA 2UWQA 4N6EB 2JVCA 2JT4B 3RULA 3BK2A 1JWAD 4ZRJA 3NVZA 3L10B 3NVVA 3EA6A 4LJOB 1RLFA 1UH6A 3ZGZA 3DHHC 1SJED 1IYFA 2G4SA 2LRWA 3P4RB 1P3QU 1HTOA 3V6EB 3Q3OC 4JL9A 4K3CA 4C7YA 2ON8A 3X0WA 2AQ3B 3BINA 2C7HA 1IBXB 4XDDA 4JE3B 5KHQA 4W9LA 4DXGA 2LUEA 3MJWA 3ZVVA 1NYQA 4II3B 1FXTB 1HXYD 3EFCA 4GIVA 2X38A 3BZDB 1RWSA 1YX5B 4JLCA 1LFDA 2NTTA 3DOWA 3HVZA 2L05A 1YMHE 1FIQA 1K50A 3W5VB 1LO5D 2MWSB 2K1FA 2E3TA 3WAPA 4B95A 1E8YA 3JSVA 2HJ1A 3AE1B 5G5GA 3SEBA 2Y3AA 1FRRA 2PMVA 1QQRA 3B2GA 2WGSA 1FFVA 1SF0A 4NJCA 2N0SB 2HTME 3OJ4B 2K6DB 2KOXA 3V60A 1CMXB 3QHTA 4PYZA 1VLBA 4REZA 3BYYB 1ISNA 2BS2B 3NS8A 4WAFA 1D3ZA 4K7UA 2MP2B 3HM6X 4PS7A 3U4EG 1ACCA 3EGRA 4MACA 1SEBD 2BYEA 4ANVA 1SSNA 2WXFA 3TEYA 1IGCA 3NOBA 4C56C 3VUYA 4A20A 1XCTL 4A9AA 1L0YB 4MSMB 3L13A 3A4SC 3APCA 4WJQA 4ZHPA 4USAA 1STEA 4B6WA 3FC4A 3NRZA 3MFGA 3PLVA 1Y8RC 2BYVE 2DNFA 1F77A 4TV3A 2VRRB 4XZ4A 2KC1A 3K9OB 3O65B 3WA0A 3PZDA 1FPYA 4DWFA 2QCZA 2SAKA 2RMMA 1GC7A 2G9HD 2JPHA 4KIKA 4K81A 1NENB 3MC8A 3ZJTA 4A6QA 4RM9A 3KQ4A 5D2MB 2JZZA 3AE8B 4ZRQA 4HJGE 2LJIA 2O6VB 4RGNA 5FR6A 3VRAB 3MHZA 3ML8A 3NZSA 4PS8A 2V3SA 4M00A 2KXJA 1PGBA 2D3BA 1C4CA 4XDCA 3EUB2 2LWPA 3ML9A 2W9NA 3B0AA 4IDIA 4CYEA 4F8CB 2BW2A 3AE2B 4E71A 2HTHA 2RSUA 1I4XA 1HA5A 3RNBC 4NNJB 2INNE 1OGWA 3O13A 3L08A 3V3XA 4ZYSA 5AUIA 4K7SA 5C1ZA 3AE4B 3AU5A 1V81A 5J2RA 5AUKA 1BUIC 3N1ZC 3FILA 3CIRB 1R7SA 2FCSA 3HVDA 1TT5B 2G4DB 1WRDB 5IKCM 4BAXA 2N9PC 1I42A 3W1SA 2X8XX 4AP4C 1P9DU 2KTRA 1TS5A 4GSWA 4RCOA 4LCDE 2DYMA 4IKGA 2WYQA 1SE4A 3AU4A 3PRPB 4KX6B 4A90A 1YD8U 2GOWA 3B1LX 2XK5B 3QJZA 5BMHA 1C77A 5C3JB 1GNUA 3AH7A 4RF0A 2KO3A 3NVYA 1TS2A 3NG0A 4MH8A 4HROA 1WGGA 1J7AA 2Z8LA 2YVCA 3DHIC 1VDVA 4JPSA 1SXTA 3A1QA 2B3AA 1YIWA 2GB1A 3BYTB 1N62A 3FILB 3QIJA 3HRDD 5G5HA 1E6EB 2FCNA 3RNAC 4XGAB 2LEKA 2R61A 1FMAD 2XN9C 3KW5B 3BY4B 1C78A 1WX8A 1PQSA 2K3UA 3UINB 2KT7A 3IXSA 1JWSD 1WR6E 5J17A 4DBGA 4HPPA 1OFFA 3LXFA 5BYQA 2BTEA 3BVZA 2JZPA 4FA6A 2RPQA 1JALA 1HTQA 4KDLB 1M94A 2WXKA 2MJDA 2KDEB 2Z0DB 4BKSA 3V62A 3RZWC 3DDCB 1UGJA 2N1WA 3R66C 3N1YC 1L4DB 2HDEA 3M95A 4NZLB 2FIDA 1NI2A 1CQVA 4TUUA 2QEJC 1JMLA 3SFEB 3AM9A 4BBNF 1LXDA 1J8CA 1H8CA 4HJKA 4MM3A 4IM0A 5FR3A 2V4IB 4AJYB 2L83A 4CQNA 2V3PA 1WE6A 1ZKHA 2ZW0A 5H8YE 3PRZA 3SHQA 2LZ6A 1T3QA 3ZTDA 4YTPB 2W55A 2Z0EB 4FJVB 3R7RA 4F1SA 4HDOA 3LDZE 3NZ3A 1V5OA 4C4VA 2GRIA 3TEWA 4S0RA 3RT3B 5E6JA 4BVUC 2KHWB 4NPNA 1WMHB 1FM0D 2QHOA 4EZLA 1L4ZB 1JWBD 3V05A 1SB3C 2NPTA 5HFYA 1WGYA 3ZUNA 3BIID 4P6VF 1LQBA 3OLMD 4MDKE 3KVFB 4K7WA 3NJTA 1WF9A 1TZOA 2D5GA 3H1UA 1RYJA 4MM3B 4GDKB 2WU5B 2AWTA 4P1CC 1KOTA 1TKYA 1QF6A 1GOZA 1V5TA 2WXJA 4FHJA 2JU6X 1E7UA 4EFOA 4G11A 4ARIA 4IG7B 4L23A 2RR9A 2YLMA 2D3GA 4MGKE 2IO0B 3QQ8B 1EO6A 3OAWA 2KWUB 1P98A 3L54A 2IGHA 4C4VB 3A9KA 4M8NA 2MJ3A 4J3OD 1C4PA 1N63A 3CSTA 2FIFA 3I3TB 3BVMA 3AEGB 2NPTB 3VVWB 3W9CB 2JXXA 1VZ6A 4WQMA 4II2B 1QZEA 2ACZB 3QA8A 2WS3B 3ONSA 1KRHA 3A33B 3NS1A 2J0MA 5G55A 2J42A 2PEAA 3DBHB 1UWMA 2N7DA 3X23A 3ETRA 2G1EA 5JXVA 3W2DA 3GOEA 1T0QC 2GBKA 2ZPNA 5TSSA 2ZNVB 3P42A 1F0ZA 2BQQA 1K52A 2CU1A 5DPSA 3Q6BA 3DVGX 2DENB 2C7NB 3AE7B 3N30A 2ONQA 1SJHD 2RDGA 1Q0WB 4QAYA 5CX3A 4JWUC 1WXSA 3UQBA 4K1RB 4MGIE 4OVUA 4JQWC 4HKZE 1DGJA 2J4XA 2WXOA 3OG5A 2JXTA 1I4RA 2OJRA 3RNEC 2BS4B 2J52A 4WWNA 2DZMA 4JX1C 1J19A 2FUG1 2I1KA 2KLGA 1MPEA 1ZOYB 1G6JA 2MW5A 4L2YA 3H7PA 1E7VA 2NMQA 1YJJA 2KWVB 4IC7B 2L3ZA 2PKOA 2LJ5A 2CHWA 4LTUA 3KH0A 3ENEA 2GBNA 2BGFA 2TSSA 3QC8B 1YJIA 4LJPB 3T9LA 2ICIA 1GG3A 3N1XC 3AECB 2QDFA 1WJ4A 4TKNA 4ANUA 1R4NI 2J53A 2NR2A 3VR9B 1L6VA 1QOFA 1UNSA 2G3QB 4NY0A 3NHEB 3JW0X 2VH2A 1AYFA 1EWCA 2V0GA 1XLPA 2JZ3B 1Y56A 1D5ZC 2W82A 3KWVA 4C80A 2KVZA 3S2AA 4RFBA 1UD7A 4JIOU 2K22A 3J9CA 2CR5A 1AN8A 4DDGD 1C1YB 4YTNB 3PT2B 1F52A 1FD6A 4MJSB 1ENFA 1YQ4B 2O2VA 2GMIC 4KKIA 1QT9A 2NVUI 1FXAA 2I38A 4KGTA 5H92C 1ZXIA 2ZCBA 3A9JB 4P16A 2I2YA 4HPLB 4MGYE 3P2BA 3MTNB 3ZIMA 2RDBC 1Q10A 3ALBA 3ZXRA 2W3SA 3P63A 1ZE3D 2AQ1B 2INDC 3DBHI 2D3AA 4YWGG 5MPOA 1I4GA 1SBBB 2KJRA 4LNOA 1VCBA 5KHOA 3HHMA 5BYRA 5GXGB 1D5XC 1V1OA 3Q3NC 2HD5B 4LK0M 1XLOA 2PVGC 1JCKB 1CK1A 3PTFC 2V9HA 2K25A 3A4RA 1T5XD 4OVVA 1UBQA 4W9KA 2KMCA 1I7HA 3DQVA 4WURA 2N4FA 3VTVA 2DBYA 1S1QB 2IO1B 2L7RA 1A5RA 2IZVB 1EUVB 3D32A 4A3PA 2LGSA 4HCNB 3VRBB 4EOYA 1WSPA 2UYZB 1CZPA 3B08A 3UGBB 1QOBA 1YN4A 3JSVB 3DVNV 2M19A 5HKHA 2GLSA 2HE7A 2PW9A 1NI3A 2CJNA 4PT5A 1XO3A 1E0ZA 2MHJA 3TBLD 3IAM1 3ZO5B 2IBIB 1WGHA 2W3RA 3P1MA 3U8ZA 1XEEA 3E9SA 5DCNA 2WU2B 4ARCA 3P4QB 4EZKA 1WJNA 1QOAA 2Z59B 1YN5A 3OWEB 1YX6B 1N60A 3IBEA 2LXAA 4N9F4 2J0KA 5CHFA 2PJHA 2KFKA 3PGEA 1MI0A 1I4QA 1TGZB 1QKZA 1WX9A 1MG8A 2KN4A 2AQ2B 4NAMA 3QWZB 2GBMA 3NVWA 2JQRB 4ANWA 2JX5A 4GGQA 3R8BA 1FCLA 2JYTA 5D6JB 4FBJB 2L0FA 4XE0A 3RI7C 3TL5A 1EM7A 3L17A 2K8HA 1V97A 2KWCA 4HLEA 3L16A 4GB9A 3LB8C 5BMIA 1DYQA 3KUCB 5IAAC 4HXDA 1V1PA 2KLCA 4HK2A 2OJWA 3Q69A 1C76A 1I4PA 2AYOB 4KIKB 1F1HA 2MA9B 2JWUA 1D4BA 3FKYA 3H9DA 2YEPF 5LNK1 3GE3C 4B9KA 4XWWA 2J0JA 4FHKA 2KFKB 3EECA 4ZHOA 1LM8B 3AB5A 3QAQA 2ZPYA 1F9JA 2R2QA 4RGTA 5AZHA 1I35A 4AWJA 2FNJB 1EU4A 3QCAA 2L52A 5LLIA 2LUMA 3Q8EA 4GMVA 4AUQC 4IWPA 1GC6A 1MVKA 2N9KA 1TS3A 5JHAA 2ZVOA 1HZ6A 3K9PB 4MEMA 2MSED 3U2SC 4B0EA 1RAXA 5EE0A 1KF6B 2KAJA 3ZKJC 1WXMA 2EKEC 3AULA 4RH6A 1V6EA 4TMAB 2XEWA 1HZ5A 1FCCC 4ITKA 1V1PB 4ICUA 2N7JA 3GB1A 2M56B 1E8XA 5E6PA 1F2RC 1J7CA 3TJPA 1B9RA 2K39A 4DHZB 1YQ3B 1FNUA 3MJ5A 3KYCD 3W1SC 1WIAA 4KZ0A 1Z5SB 2MEKA 3QX1A 3GE8C 1T6BX 4W9EA 3SU8X 2KTRB 2DX5B 1GB1A 4DDID 2IY1B 1QILA 2QSDA 3LYYA 3LJ3A 2LASA 2AEHA 2Y5CA 1UUPA 2FCMA 4X57B 4NJ6A 3IAS1 2VZKD 3PS6A 3L4PA 1WFYA 4A55A 4FADA 3KUZA 1TKEA 4RF1A 1WM3A 2LGYA 1TJEA 3ZRFA 1PDXA 4IWQA 1ZPSA 4KGSA 2BWFA 1WGDA 4YTMB 4W9IA 2WXMA 2CHXA 3RPFC 5EE9A 3MC9A 1RM6C 4YSZB 1AARA 4A8XC 3IHPC 2A4ZA 2ZCCA 3A1QB 3DBSA 4AOFA 4N59A 2IPKD 3RN9C 4NAWA 4FN2A 1D5MC 1K51A 2WXPA 1TY0A 3ZNZB 1TKGA 2BPSA 4OZAA 4EZJA 1OQRA 2BYTA 2IGGA 2N9LA 4KGRA 1VD2A 4C00A 2KJHB 5EDSA 3MC0B 1JRPA 1ET9A 3TUOA 1P1AA 4S17A 2E6XA 4HEA1 3HM3A 2INPE 4YSYB 3VTUA 4PYUA 1SIJA 3ZDTA 2MBHA 4OZBA 1YJ1A 5BYSA 3N9YC 1NEKB 4B0MA 1Q1OA 2M1MA 4US9A 1AW7A 3BK1A 4D2KA 4RNAA 3HK0A 2LD9A 1JROA 1OEYA 3KWLA 4NAWB 3DVGY 2C9WB 1P7FA 2XBBC 1WXAA 4XYCA 3Q14C 1T0RC 2N7EA 1R4NB 1VZ8A 3VH3B 1WM2A 1V9JA 2H89B 4HRSA 5DPRA 4HKQA 5EE1A 1N6ZA 2WXHA 2KYWA 2WXIA 1X1MA 1I4HA 4URKA 4ASWC 2SEBD 3MP9A 5D3DA 3NZUA 4WJPA 3DHGC 1F2RI 4P7IA 3DPDA 4ZRKA 3MHSD 2KACA 3WANA 1SIFA 2LMCA 3VH4B 2QILA 2GBJA 4GOCA 3APFA 3TCAA 4FJZA 3H8HA 2MH7A 1N61A 1AWDA 3GZNI 1P0RA 2NBUA 2YEPB 4H2AA 4BOZB 2WP9B 2ASQA 1V80A 4DQOC 3Q2AC 1J0GA 2QJLA 1E8ZA 3IFWB 2MX2A 2KDMA 4HPMB 4LLGM 5L83A 1E9MA 2OEDA 2WXRA 3ECIA 5IA7A 3RFZB 2KX3A 4W9DA 3IG3A 4OZCA 4KKJA 2V1YA 3RZFA 3T3OA 5CHVC 4DK5A 4JGHB 1GJZA 3RYTA 1LGRA 4P1BC 1FO4A 5IOIA 2XNAC 3WIMA 1WXQA 4TSSA 3A9KB 4ZRIA 4OHJA 3ZQ4A 5BMGA 3VUWA 5I4DA 4F7ZA 3DWMA 1QOGA 2DWQA 2V4LA 3WCQA 2WWZA 1N5WA 3PPAA 1FRDA 2L76A 3AE3B 1WY8A 2AX5A 2NTSA 4GDLA 1DOXA 2WX0A 3H6NA 2JYEA 3C8YA 2JWZA 3DWGC 2K6QA 3ZTCA 3U7DA 5J18A 3AEFB 1HEZE 1XT9B 4WWPA 2EELA 5BO4B 2UU7A 2MBOA 2BB5A 1V8CA 3NY5A 2CU3A 1D6EC 2FUHB 5D94A 3M62B 1KLGD 4AQ7A 2AL3A 1YN3A 3R7QA 4ZOHC 1IBXA 3GS2A 3V61A 2ZJDA 3QK0A 5JZEB 2Y5BB 2M8SA 2A5UA 5EE3A 2OHFA 2KFJA 1ZP0B 4ZDVA 2G45B 3RMKC 1J7BA 4TQ1A 3DVNU 3M63B 3T8MA 3SD5A 2N9EB 4GDLB 2DHZA 1BXTA 2MBQA 4DHJD 3ZNGC 1GAQB 1JQ4A 4N58A 3Q8BA 3H7PB 4KVGB 1VRAB 3R2IA 4A3OA 1WR1A 4R3DA 1YOVB 2KN5A 4XC2A 3EHVA 4W9HA 4BKGA 5C23A 4M0WA 2IO2B 5IO9A 2EMSA 1DOIA 3BVGA 4ZYNA 2MP2A 4LDTD 2BVCA 5DPTA 1VR9A 1RFKA 2D3CA 2PLPA 2BBCA 1WJ6A 3KYDD 3Q3FA 3B2FA 2KQ4X 1TBEA 1WWTA 4G3XB 1OQQA 2MBBB 3ZYYX 3BWUD 2IGDA 1NYRA 1SE9A 2PPHA 2Y5PA 2OOBB 5CTRC 4OVZA 1QLBB 3TMPB 3DCGA 4WQOB 2LXCA 2WDTB 3AXCA 2KQSA 2IYDB 1YNTE 2CKHB 4US8A 1TY2A 2LHEA 2WX1A 2LGXA 1EF5A 1ET6A 4CO7A 1RFAA 3U52E 2C5LC 1TTNA 2FCQA 4I6NB 1JW9D 4WH4A 1WE7A 2O2VB 1R4MI 2I1JA 4J6IA 2JUOA 3UF8A 2N9XA 4M0WB 3RUIB 2KKCA 1V86A 3ZRCA 1IP9A 1IPGA 1WGKA 3EFUA 1WYGA 3AMZA 3PVLA 2K8BA 3AI5A 3AEEB 3VDZA 1WGRA 3H7SA 2O6VA 1WXVA 2REXA 1C4AA 5FK9C 2K0PA 2KMMA
chains in the Genus database with same CATH topology
2M56B 2D5GA 2PIAA 2QIEB 1F2RC 2VZKB 1RYJA 1J7CA 4MM3B 1B9RA 2WDQB 4GDKB 2L1AA 2WU5B 3I9V1 1TKYA 4RGMA 1YQ3B 1FNUA 1QF6A 1CJEA 1GOZA 3MJ5A 2WXJA 4OW0A 4FXCA 2JU6X 1P7EA 2CJOA 2LFIA 1PUTA 4YT0B 4ARIA 3PZ8A 1NVID 3AEAB 2MEKA 1XLQA 1WRIA 1FFUA 4L23A 1T6BX 1ROEA 3AEBB 2LHDA 3SR6A 3GP7A 4UDUC 5HHDG 1IUEA 1TYGB 2BS3B 1ZXHA 4C7ZA 1GPXA 2IGHA 3AN1A 1GB1A 2IJ0A 4N6EB 2MJ3A 1QILA 2QSDA 3LYYA 4J3OD 1C4PA 4WIPA 2Y5CA 3BK2A 1JWAD 1UUPA 3NVZA 5T8IA 1N63A 1B1ZA 3NVVA 3IAS1 1L0VB 3EA6A 2BB6A 3BVMA 2VZKD 3L4PA 3ZGZA 3SFDB 4A55A 1SJED 3AEGB 3CWIA 1TKEA 4RF1A 3W9CB 3NUHB 1VZ6A 2K5PA 1TJEA 4WQMA 1PDXA 3HUIA 2ACZB 1ZPSA 3P4RB 4KGSA 4YTMB 2WXMA 2WS3B 1KRHA 4C7YA 3RPFC 5EE9A 3B9JA 1RM6C 2ON8A 3NS1A 2AQ3B 2MJEA 4YSZB 1IBXB 4XDDA 4JE3B 2J42A 4A8XC 4DXGA 1NYQA 1UWMA 2IPKD 3AV8A 4N59A 1HXYD 3ETRA 2X38A 3BZDB 1RWSA 1D5MC 2NTTA 1K51A 3HVZA 3W5UB 2G1EA 5JXVA 2WXPA 1YMHE 1E7PB 1FIQA 1K50A 2M0AA 3W2DA 3W5VB 1LO5D 1TY0A 1TKGA 4OZAA 2E3TA 5TSSA 3P42A 1F0ZA 1ZUD2 1OQRA 1K52A 3URYA 2BYTA 2IGGA 2N9LA 3AE1B 3AE7B 5G5GA 3SEBA 2Y3AA 1FRRA 2FBWB 2ONQA 4KGRA 2PMVA 1SJHD 3UI3A 4MT5A 2RDGA 4RGOS 3R2TA 1QQRA 2WDRB 3B2GA 3TEXA 4JWUC 1FFVA 1SF0A 3MC0B 4NJCA 1JRPA 1ET9A 3TUOA 2N0SB 2HTME 2JSVX 2E6XA 4HEA1 2INPE 4YSYB 1SIJA 1VLBA 4REZA 4OZBA 4HKZE 1DGJA 3BYYB 5BYSA 4ZRPA 1XLNA 3N9YC 2BS2B 2ZW1A 4WAFA 3ABVB 2J4XA 1NEKB 2WXOA 2LGIA 4B0MA 2JXTA 1I4RA 4US9A 1AW7A 2BS4B 3U4EG 1PGAA 2J52A 1SE3A 1ACCA 3EGRA 3P4SB 3BK1A 4JX1C 2FUG1 1SEBD 2WXGA 4MACA 4RNAA 4D2KA 1SSNA 2WXFA 3TEYA 2RPVA 1IGCA 2PVOD 1MPEA 1ZOYB 1JROA 4C56C 3KWLA 4JWSC 4L2YA 4NAWB 1P7FA 1GB4A 2NMQA 2GI9A 1YJJA 1FXIA 2RDHA 1VJKA 1ZDXA 1XCTL 4A9AA 2PKOA 1VZ8A 1L0YB 2WXNA 2H89B 4LTUA 4HRSA 4ZHPA 3U7ZA 3PZ7A 4USAA 4HKQA 1STEA 2TSSA 1TS4A 1YJIA 5EE1A 3FC4A 2ICIA 2WXHA 3NRZA 2WXIA 3AECB 2DLBA 1I4HA 3MFGA 2SEBD 2J53A 1F77A 3MP9A 5D3DA 3VR9B 4WWMA 1L6VA 1QOFA 1UNSA 1F2RI 1A70A 1FEHA 2KACA 2LMCA 2SAKA 1AYFA 2RMMA 2G9HD 3Q8AA 1EWCA 2V0GA 1XLPA 2WXLA 2QILA 1NENB 1Y56A 1D5ZC 3ZJTA 2W82A 3H8HA 2MH7A 1N61A 1AWDA 4A6QA 3KQ4A 3KWVA 3AE8B 3PO0A 2YEPB 4ZRQA 4H2AA 4C80A 2WP9B 2WLBA 4HJGE 1ZDVA 2LJIA 4DQOC 4RGNA 4RFBA 3VRAB 3MHZA 2K22A 3J9CA 1AN8A 2QJLA 4YTNB 2KDMA 1FD6A 1PGBA 4LLGM 3AEDB 1C4CA 1E9MA 1ENFA 1YQ4B 2K9XA 2OEDA 3I57A 4XDCA 5C2TB 2WXRA 3EUB2 4KKIA 1QT9A 3RFZB 1FXAA 2I38A 4IDIA 4KGTA 4OZCA 1ZXIA 1ESFA 2BW2A 3AE2B 4KKJA 5H92C 4P16A 3T3OA 1N5XA 2I2YA 3IT6B 4DXFA 3T3NA 1I4XA 1Q10A 1HA5A 1KH0A 1L5PA 2EKIA 2W3SA 1FO4A 1K53A 3P63A 1ZE3D 2AQ1B 2XNAC 2INNE 4YWGG 1WXQA 3O13A 4TSSA 3V3XA 1I4GA 5MPOA 1SBBB 4ZYSA 4OHJA 5AUIA 3ZQ4A 5BYRA 5GXGB 1D5XC 5BMGA 1V1OA 5I4DA 5HI1A 1JWMD 3DWMA 3AE4B 4LK0M 1HQRD 1XLOA 2PVGC 1QOGA 1EU3A 1JCKB 1CK1A 2DWQA 5AUKA 1BUIC 3WCQA 3FILA 3CIRB 1R7SA 1N5WA 1FRDA 3HVDA 1KLUD 3AE3B 4GLSC 1DOYA 1T5XD 2AX5A 2NTSA 1EWYC 1I7HA 2W54A 3W1SA 4WURA 1KFYB 2KWDA 2PTLA 1DOXA 3E56A 1TS5A 2DBYA 2JYEA 3C8YA 4RCOA 3DWGC 2DYMA 1C9FA 4IKGA 1SE4A 3AEFB 1HEZE 3AE5B 1SE2A 4KX6B 4A90A 2EELA 2WNMA 5BMHA 1FNVA 3VRBB 1WSPA 1C77A 2BB5A 2WXQA 5C3JB 1CZPA 1V8CA 2CU3A 1D6EC 3ZJUA 3AH7A 4RF0A 1QOBA 1YN4A 1UWXA 3NVYA 3IT4B 1TS2A 2M19A 4MH8A 1KLGD 4HROA 2PW9A 4AQ7A 1YN3A 1J7AA 1C79A 3AE6B 2Z8LA 4EE2A 1NI3A 4Q2JA 3KLSX 4ZOHC 2CJNA 4PT5A 1IBXA 1XO3A 1VDVA 4JPSA 3GS2A 4YSXB 1E0ZA 3IAM1 1SXTA 2GB1A 3BYTB 1N62A 3FILB 3HRDD 2W3RA 5G5HA 3P1MA 1E6EB 1XEEA 1MHHE 1XXGA 3E9SA 5EE3A 2OHFA 2WU2B 4ARCA 3P4QB 1ZP0B 1QOAA 1J7BA 4TQ1A 1YN5A 3OWEB 2LEKA 2R61A 1FMAD 2XN9C 1PFDA 1N60A 5D7GA 2WDVB 4GDLB 1C78A 1BXTA 2K3UA 1MI0A 3IXSA 1I4QA 1VZ7A 1JWSD 1GAQB 2IDYA 3ZJVA 1OFFA 1JQ4A 3LXFA 1QKZA 5BYQA 2BTEA 3BVZA 2KN4A 2JZPA 4N58A 2AQ2B 3Q8BA 1L6UA 4NAMA 1JALA 3NVWA 2JQRB 1VRAB 2WXKA 4O1NA 3R2IA 3TEZA 1PYWD 2MJDA 4R3DA 2JX5A 2L32A 5D3IB 3R8BA 1FCLA 2JYTA 2BT6A 1UGJA 4M0WA 4YXDB 3Q8FA 3VQIA 1DOIA 2Q5WD 1JWUD 3BVGA 4XE0A 1KTKA 1L4DB 3AE9B 5FKAC 1EM7A 4TQ0A 1V97A 1VR9A 1RFKA 2PLPA 1XCQL 2HDEA 2BBCA 4L1BA 3GB1A 3LB8C 4NZLB 5BMIA 1DYQA 1V1PA 2FE8A 3B2FA 2KQ4X 1CQVA 3Q8CA 1WWTA 2QEJC 1JMLA 3Q69A 3SFEB 1OQQA 1C76A 3AM9A 1I4PA 3ZYYX 1XF5L 3BWUD 2IGDA 1NYRA 5FR3A 2V4IB 2Y5PA 2L83A 2H88B 2JWUA 4OVZA 1QLBB 4CQNA 2V3PA 2ZW0A 5H8YE 1D4BA 1E10A 3P4PB 1PGXA 4AS1A 2YEPF 1MHXA 5LNK1 1IGDA 4XWWA 1YNTE 4ZHOA 4US8A 1T3QA 3AB5A 1TY2A 4IOIE 2LHEA 4RGTA 4YTPB 2DYOA 3TSSA 2W55A 1ET6A 1L0XB 3FAHA 2QMTA 3U52E 1EU4A 2WQYB 2L52A 1JW9D 5HG2A 4WH4A 2LUMA 3NZ3A 3Q8EA 2GRIA 3TEWA 5E6JA 1FNWA 2B76B 1MVKA 4XWTA 2N9KA 1TS3A 1FM0D 1HZ6A 1WGKA 1WYGA 3U2SC 1L4ZB 3AMZA 4B0EA 5EE0A 1JWBD 3V05A 1M4VA 1KF6B 1SB3C 2KAJA 3AEEB 4RH6A 5HFYA 2V3NA 4TMAB 1HZ5A 3BIID 4P6VF 1FCCC 1C4AA 4ITKA 1BMLC 1V1PB 5FK9C 2K0PA 3VR8B 2N7JA 2KMMA 1TZOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M56 B;  2PIA A;  2WDV B;  2HTM E;  2QIE B;  1RYJ A;  1J7C A;  4YSY B;  1B9R A;  1GAQ B;  1L5P A;  2WDQ B;  1SIJ A;  1OFF A;  1VLB A;  2EKI A;  2W3S A;  2WU5 B;  1FO4 A;  1JQ4 A;  3LXF A;  1DGJ A;  3P63 A;  1XLN A;  1TKY A;  2BS2 B;  1YQ3 B;  1QF6 A;  3ABV B;  1CJE A;  4N58 A;  1NEK B;  1WXQ A;  1L6U A;  4FXC A;  5MPO A;  1JAL A;  2N0S B;  2CJO A;  2JQR B;  3NVW A;  5AUI A;  1PUT A;  4US9 A;  2MJD A;  5GXG B;  2BS4 B;  2JX5 A;  4YT0 B;  3DWM A;  3P4S B;  4JX1 C;  1NVI D;  3AE4 B;  3AEA B;  2BT6 A;  1XLQ A;  1WRI A;  1FFU A;  4YXD B;  1ROE A;  3AEB B;  1XLO A;  2PVG C;  3SR6 A;  2PVO D;  1ZOY B;  1DOI A;  1JRO A;  1QOG A;  2DWQ A;  2Q5W D;  3KWL A;  1IUE A;  4JWS C;  5AUK A;  1TYG B;  2BS3 B;  4C7Z A;  1GPX A;  3AE9 B;  3WCQ A;  3AN1 A;  1YJJ A;  1FXI A;  1R7S A;  1N5W A;  3CIR B;  1FRD A;  2MJ3 A;  1V97 A;  4N6E B;  1VJK A;  1RFK A;  3AE3 B;  1DOY A;  4A9A A;  2PKO A;  3LB8 C;  2Y5C A;  1JWA D;  2AX5 A;  2H89 B;  4LTU A;  3NVZ A;  4HRS A;  1EWY C;  1I7H A;  3B2F A;  2W54 A;  4ZHP A;  1N63 A;  1WWT A;  3SFE B;  1KFY B;  3NVV A;  1OQQ A;  4USA A;  1L0V B;  1YJI A;  5EE1 A;  3FC4 A;  3AM9 A;  3NRZ A;  3ZYY X;  1DOX A;  2DBY A;  3AEC B;  3L4P A;  3SFD B;  3AEG B;  1NYR A;  3CWI A;  1TKE A;  3W9C B;  2L83 A;  3DWG C;  2H88 B;  2K5P A;  1TJE A;  4WQM A;  1QLB B;  1PDX A;  3HUI A;  3VR9 B;  2ACZ B;  1L6V A;  1QOF A;  3P4R B;  4WWM A;  5H8Y E;  1A70 A;  3AEF B;  1E10 A;  3P4P B;  3AE5 B;  4YTM B;  4KX6 B;  2WS3 B;  1KRH A;  4C7Y A;  3RPF C;  5EE9 A;  4ZHO A;  4US8 A;  3B9J A;  1T3Q A;  3AB5 A;  3VRB B;  1RM6 C;  3NS1 A;  1AYF A;  5C3J B;  4YTP B;  2MJE A;  1CZP A;  2W55 A;  1V8C A;  4YSZ B;  1XLP A;  2CU3 A;  3AH7 A;  3FAH A;  1NEN B;  1QOB A;  2WQY B;  2L52 A;  3NVY A;  1NYQ A;  1UWM A;  1JW9 D;  3AV8 A;  2MH7 A;  2M19 A;  1N61 A;  1AWD A;  3ETR A;  4N59 A;  1RWS A;  4HRO A;  3PO0 A;  3AE8 B;  3HVZ A;  3W5U B;  2G1E A;  1J7A A;  4C80 A;  2WP9 B;  1E7P B;  1FIQ A;  2WLB A;  3AE6 B;  3W5V B;  1NI3 A;  1TKG A;  2B76 B;  4ZOH C;  2E3T A;  2CJN A;  3VRA B;  1F0Z A;  1ZUD 2;  1XO3 A;  1OQR A;  1VDV A;  4YSX B;  1E0Z A;  2K22 A;  1FM0 D;  1WGK A;  3AE1 B;  2QJL A;  3AE7 B;  5G5G A;  1FRR A;  1WYG A;  2FBW B;  3AMZ A;  4YTN B;  1N62 A;  3HRD D;  5EE0 A;  1JWB D;  2W3R A;  5G5H A;  3P1M A;  1KF6 B;  1E6E B;  1SB3 C;  2KAJ A;  3AED B;  3AEE B;  2K9X A;  1E9M A;  1YQ4 B;  5EE3 A;  5C2T B;  2OHF A;  2WDR B;  2WU2 B;  3B2G A;  1ZP0 B;  3EUB 2;  3P4Q B;  1QT9 A;  3BII D;  4P6V F;  1FXA A;  4JWU C;  1FFV A;  1QOA A;  4IDI A;  1J7B A;  1SF0 A;  4ITK A;  5H92 C;  1ZXI A;  2LEK A;  3AE2 B;  1JRP A;  3VR8 B;  1FMA D;  1PFD A;  1N60 A;  2KMM A;  1N5X A; 
#chains in the Genus database with same CATH topology
 2KMA A;  2PIA A;  2VZK B;  2ZVN A;  2LVP A;  2WDQ B;  2L1A A;  2LVO A;  3DBL B;  1WZ0 A;  3C19 A;  2RD0 A;  4FXC A;  2CJO A;  1PUT A;  2NCN A;  2EMT A;  1WH3 A;  3PV1 A;  4YT0 B;  1XD3 B;  2BYF A;  3PZ8 A;  1NVI D;  4BZA A;  1WRI A;  2L8J A;  3N20 C;  1ROE A;  3AEB B;  4EEW A;  2LHD A;  3SR6 A;  4HVB A;  4UDU C;  1IUE A;  1TYG B;  2BS3 B;  1GPX A;  2IJ0 A;  2AL6 A;  3ZNI D;  4WIP A;  4GXB A;  5T8I A;  2DZI A;  2MLB A;  1B1Z A;  1MG4 A;  2D2Q A;  1L0V B;  4XX5 A;  1MFW A;  2BB6 A;  3HIZ A;  5JH5 C;  3SFD B;  3CWI A;  4IUM B;  3NUH B;  2K5P A;  2BKF A;  3HUI A;  4MH0 E;  2DZJ A;  2M0X A;  3RCZ A;  3B9J A;  3R3M A;  5G2N A;  2MJE A;  4LNN A;  2JF5 A;  3RD2 A;  3AV8 A;  2HJ8 A;  3ZNH B;  3L0W B;  2IO3 B;  3W5U B;  2MQJ A;  2KDI A;  1E7P B;  2M0A A;  2XK5 A;  4IWO A;  2MRP A;  1JRU A;  2BWE S;  2NBV B;  2N1V A;  3WAL A;  1ZUD 2;  2CS4 A;  2ZZP B;  3URY A;  4WJN A;  1Q5W B;  2FBW B;  2KDF B;  3UI3 A;  4MT5 A;  4E74 A;  2KDB A;  5AZF A;  4RGO S;  3R2T A;  2WDR B;  3TEX A;  1OEY J;  3TIX A;  4PS3 A;  2JSV X;  4KV2 A;  4HWI B;  4KDI C;  4ZRP A;  1XLN A;  2ZW1 A;  3ABV B;  2ZEQ A;  2QC8 A;  2LGI A;  1WYW B;  3JYU A;  1PGA A;  1SE3 A;  3P4S B;  2WXG A;  2M17 A;  2C60 A;  2RPV A;  2KJ6 A;  2PVO D;  4JWS C;  1K8R B;  1GB4 A;  2GI9 A;  1FXI A;  3DBR B;  2RDH A;  1VJK A;  2PE9 A;  1ZDX A;  2D07 B;  2KQ7 A;  3QAR A;  4LNK A;  1WJU A;  4RMA A;  2WXN A;  2JRH A;  1WZ3 A;  1RRB A;  3ZW3 A;  2NS5 A;  3UIO B;  3U7Z A;  3PZ7 A;  3W1Y A;  1TS4 A;  1H4R A;  1TIF A;  2DLB A;  3DBL I;  4LNF A;  2INC C;  3GZN B;  3Q3J A;  4WWM A;  1SGH A;  3ZLZ A;  1A70 A;  2L0T A;  2KX0 A;  2MBE A;  2R2O A;  3KUD B;  4IM2 A;  1FEH A;  3I5J C;  3Q8A A;  4HCP B;  3VXW A;  4MEL A;  2WXL A;  2PE6 B;  2LRU A;  2GBR A;  5GMV A;  2DAJ A;  3PO0 A;  1T0S C;  2L00 B;  4GU2 A;  2WLB A;  5LXH A;  1ZDV A;  4BKT A;  3N3K B;  4IW0 A;  1T0Y A;  2CHZ A;  1KJT A;  2J7Q B;  4BFR A;  4HDQ A;  4EUT A;  1V2Y A;  3AED B;  2K9X A;  3I57 A;  5C2T B;  5JHB A;  1ESF A;  5E6N A;  2BKR B;  1N5X A;  1WMH A;  2WHI A;  5LXI B;  3IT6 B;  4DXF A;  5DPW A;  3T3N A;  3Q3M C;  3UQA A;  1KH0 A;  1L5P A;  2EKI A;  1K53 A;  5IP4 D;  1BT0 A;  2KAN A;  2RGF A;  4ICV A;  4DXA B;  5HI1 A;  4KZC A;  4NJ7 A;  1JWM D;  2O6V D;  2KD0 A;  4GDK A;  1HQR D;  4W9C A;  1L7Y A;  1EF1 A;  3C0R B;  1UEL A;  3VHT C;  1EU3 A;  1OTR B;  4FJY A;  1NBF C;  4I6P A;  1KLU D;  4DHZ E;  1DOY A;  4GLS C;  4NQL B;  3PHX B;  2C7M B;  1UZX B;  3RNG C;  1EWY C;  2IY0 B;  2W54 A;  1KFY B;  3IVF A;  2KWD A;  4CHK A;  2PTL A;  3E56 A;  2VH1 A;  3WAO A;  5IN7 A;  3VFK A;  3PLU A;  2KTF A;  1C9F A;  1ZW7 A;  2NBW B;  1KM7 A;  1UF0 A;  3AE5 B;  3OJ3 A;  1SE2 A;  4W9J A;  4WAA A;  3VTW A;  4M01 A;  4DHJ B;  4K3B A;  2WNM A;  2M4N A;  1FNV A;  2WXQ A;  4W9G A;  3ZJU A;  4ANX A;  1UBI A;  5CHW A;  3SDL C;  5AEK B;  1UWX A;  3IT4 B;  3VUX A;  2D11 A;  1C3T A;  1E90 A;  3DBR I;  1C79 A;  3M3J A;  3AE6 B;  4EE2 A;  3UIP B;  4Q2J A;  3KLS X;  2DZK A;  4YSX B;  4LDT B;  4M8M A;  1MHH E;  1XXG A;  4E3C A;  2KZR A;  3RNC C;  4GN1 A;  1PFD A;  3APD A;  5D7G A;  2JY6 A;  2WDV B;  1XQQ A;  4W9F A;  3PHW B;  1MJD A;  1VZ7 A;  2IDY A;  5L95 C;  3ZJV A;  3N32 A;  3I63 C;  1KLV A;  1U4A A;  3PSE B;  1TZ1 A;  3VAW A;  1E8W A;  1L6U A;  4O1N A;  3TEZ A;  1S3S G;  1PYW D;  2L32 A;  1OQY A;  3PRM B;  5D3I B;  1HE8 A;  2BT6 A;  4YXD B;  2K8C A;  3Q8F A;  2LI5 A;  3VQI A;  2KVR A;  2KC2 A;  2Q5W D;  4ACF A;  1JWU D;  4WWO A;  1KTK A;  3AE9 B;  4WJO A;  4LNI A;  5FKA C;  4TQ0 A;  2DYB A;  3PRE A;  1XCQ L;  1NDD A;  4L1B A;  3RNF C;  4NQK E;  2FE8 A;  3Q8C A;  2ZNV C;  2DAF A;  4YL8 A;  1XF5 L;  3WAM A;  5TR5 A;  2LGD A;  3JVZ X;  1UGM A;  3ZDM C;  2H88 B;  1GUA B;  2D10 A;  2MCN B;  1E10 A;  3P4P B;  4AJW A;  3V6C B;  1PGX A;  1R4M B;  4AS1 A;  1MHX A;  1IGD A;  4FUL A;  4IOI E;  1V49 A;  2DYO A;  3TSS A;  4G0N B;  1L0X B;  3FAH A;  2QMT A;  2WQY B;  5HG2 A;  3ZXV A;  1WX7 A;  5E6O A;  1FNW A;  4MGZ E;  2B76 B;  4XWT A;  3U30 A;  4MSQ B;  4KSL C;  1L2N A;  4I6L B;  2JRI B;  1M4V A;  4M02 A;  2V3N A;  4EKU A;  1BML C;  5AZG A;  3CMM B;  3VR8 B;  4G50 A;  3CSF A;  3EC8 A;  2KNB A;  2QIE B;  1ZGU B;  4PK1 A;  4MJS A;  1E5W A;  3I9V 1;  4RGM A;  4KSK C;  1CJE A;  1WI0 A;  4OW0 A;  1P7E A;  4IM3 A;  1Z2M A;  3A9J A;  2LFI A;  2FAZ A;  1YQB A;  4BKS D;  2KK8 A;  3AEA B;  1XLQ A;  1FFU A;  4BBN C;  2BF8 B;  4BOS C;  3GP7 A;  3CF6 E;  5HHD G;  2LVQ A;  1ZXH A;  4RM8 A;  4C7Z A;  3AN1 A;  4FLH A;  2UWQ A;  4N6E B;  2JVC A;  2JT4 B;  3RUL A;  3BK2 A;  1JWA D;  4ZRJ A;  3NVZ A;  3L10 B;  3NVV A;  3EA6 A;  4LJO B;  1RLF A;  1UH6 A;  3ZGZ A;  3DHH C;  1SJE D;  1IYF A;  2G4S A;  2LRW A;  3P4R B;  1P3Q U;  1HTO A;  3V6E B;  3Q3O C;  4JL9 A;  4K3C A;  4C7Y A;  2ON8 A;  3X0W A;  2AQ3 B;  3BIN A;  2C7H A;  1IBX B;  4XDD A;  4JE3 B;  5KHQ A;  4W9L A;  4DXG A;  2LUE A;  3MJW A;  3ZVV A;  1NYQ A;  4II3 B;  1FXT B;  1HXY D;  3EFC A;  4GIV A;  2X38 A;  3BZD B;  1RWS A;  1YX5 B;  4JLC A;  1LFD A;  2NTT A;  3DOW A;  3HVZ A;  2L05 A;  1YMH E;  1FIQ A;  1K50 A;  3W5V B;  1LO5 D;  2MWS B;  2K1F A;  2E3T A;  3WAP A;  4B95 A;  1E8Y A;  3JSV A;  2HJ1 A;  3AE1 B;  5G5G A;  3SEB A;  2Y3A A;  1FRR A;  2PMV A;  1QQR A;  3B2G A;  2WGS A;  1FFV A;  1SF0 A;  4NJC A;  2N0S B;  2HTM E;  3OJ4 B;  2K6D B;  2KOX A;  3V60 A;  1CMX B;  3QHT A;  4PYZ A;  1VLB A;  4REZ A;  3BYY B;  1ISN A;  2BS2 B;  3NS8 A;  4WAF A;  1D3Z A;  4K7U A;  2MP2 B;  3HM6 X;  4PS7 A;  3U4E G;  1ACC A;  3EGR A;  4MAC A;  1SEB D;  2BYE A;  4ANV A;  1SSN A;  2WXF A;  3TEY A;  1IGC A;  3NOB A;  4C56 C;  3VUY A;  4A20 A;  1XCT L;  4A9A A;  1L0Y B;  4MSM B;  3L13 A;  3A4S C;  3APC A;  4WJQ A;  4ZHP A;  4USA A;  1STE A;  4B6W A;  3FC4 A;  3NRZ A;  3MFG A;  3PLV A;  1Y8R C;  2BYV E;  2DNF A;  1F77 A;  4TV3 A;  2VRR B;  4XZ4 A;  2KC1 A;  3K9O B;  3O65 B;  3WA0 A;  3PZD A;  1FPY A;  4DWF A;  2QCZ A;  2SAK A;  2RMM A;  1GC7 A;  2G9H D;  2JPH A;  4KIK A;  4K81 A;  1NEN B;  3MC8 A;  3ZJT A;  4A6Q A;  4RM9 A;  3KQ4 A;  5D2M B;  2JZZ A;  3AE8 B;  4ZRQ A;  4HJG E;  2LJI A;  2O6V B;  4RGN A;  5FR6 A;  3VRA B;  3MHZ A;  3ML8 A;  3NZS A;  4PS8 A;  2V3S A;  4M00 A;  2KXJ A;  1PGB A;  2D3B A;  1C4C A;  4XDC A;  3EUB 2;  2LWP A;  3ML9 A;  2W9N A;  3B0A A;  4IDI A;  4CYE A;  4F8C B;  2BW2 A;  3AE2 B;  4E71 A;  2HTH A;  2RSU A;  1I4X A;  1HA5 A;  3RNB C;  4NNJ B;  2INN E;  1OGW A;  3O13 A;  3L08 A;  3V3X A;  4ZYS A;  5AUI A;  4K7S A;  5C1Z A;  3AE4 B;  3AU5 A;  1V81 A;  5J2R A;  5AUK A;  1BUI C;  3N1Z C;  3FIL A;  3CIR B;  1R7S A;  2FCS A;  3HVD A;  1TT5 B;  2G4D B;  1WRD B;  5IKC M;  4BAX A;  2N9P C;  1I42 A;  3W1S A;  2X8X X;  4AP4 C;  1P9D U;  2KTR A;  1TS5 A;  4GSW A;  4RCO A;  4LCD E;  2DYM A;  4IKG A;  2WYQ A;  1SE4 A;  3AU4 A;  3PRP B;  4KX6 B;  4A90 A;  1YD8 U;  2GOW A;  3B1L X;  2XK5 B;  3QJZ A;  5BMH A;  1C77 A;  5C3J B;  1GNU A;  3AH7 A;  4RF0 A;  2KO3 A;  3NVY A;  1TS2 A;  3NG0 A;  4MH8 A;  4HRO A;  1WGG A;  1J7A A;  2Z8L A;  2YVC A;  3DHI C;  1VDV A;  4JPS A;  1SXT A;  3A1Q A;  2B3A A;  1YIW A;  2GB1 A;  3BYT B;  1N62 A;  3FIL B;  3QIJ A;  3HRD D;  5G5H A;  1E6E B;  2FCN A;  3RNA C;  4XGA B;  2LEK A;  2R61 A;  1FMA D;  2XN9 C;  3KW5 B;  3BY4 B;  1C78 A;  1WX8 A;  1PQS A;  2K3U A;  3UIN B;  2KT7 A;  3IXS A;  1JWS D;  1WR6 E;  5J17 A;  4DBG A;  4HPP A;  1OFF A;  3LXF A;  5BYQ A;  2BTE A;  3BVZ A;  2JZP A;  4FA6 A;  2RPQ A;  1JAL A;  1HTQ A;  4KDL B;  1M94 A;  2WXK A;  2MJD A;  2KDE B;  2Z0D B;  4BKS A;  3V62 A;  3RZW C;  3DDC B;  1UGJ A;  2N1W A;  3R66 C;  3N1Y C;  1L4D B;  2HDE A;  3M95 A;  4NZL B;  2FID A;  1NI2 A;  1CQV A;  4TUU A;  2QEJ C;  1JML A;  3SFE B;  3AM9 A;  4BBN F;  1LXD A;  1J8C A;  1H8C A;  4HJK A;  4MM3 A;  4IM0 A;  5FR3 A;  2V4I B;  4AJY B;  2L83 A;  4CQN A;  2V3P A;  1WE6 A;  1ZKH A;  2ZW0 A;  5H8Y E;  3PRZ A;  3SHQ A;  2LZ6 A;  1T3Q A;  3ZTD A;  4YTP B;  2W55 A;  2Z0E B;  4FJV B;  3R7R A;  4F1S A;  4HDO A;  3LDZ E;  3NZ3 A;  1V5O A;  4C4V A;  2GRI A;  3TEW A;  4S0R A;  3RT3 B;  5E6J A;  4BVU C;  2KHW B;  4NPN A;  1WMH B;  1FM0 D;  2QHO A;  4EZL A;  1L4Z B;  1JWB D;  3V05 A;  1SB3 C;  2NPT A;  5HFY A;  1WGY A;  3ZUN A;  3BII D;  4P6V F;  1LQB A;  3OLM D;  4MDK E;  3KVF B;  4K7W A;  3NJT A;  1WF9 A;  1TZO A;  2D5G A;  3H1U A;  1RYJ A;  4MM3 B;  4GDK B;  2WU5 B;  2AWT A;  4P1C C;  1KOT A;  1TKY A;  1QF6 A;  1GOZ A;  1V5T A;  2WXJ A;  4FHJ A;  2JU6 X;  1E7U A;  4EFO A;  4G11 A;  4ARI A;  4IG7 B;  4L23 A;  2RR9 A;  2YLM A;  2D3G A;  4MGK E;  2IO0 B;  3QQ8 B;  1EO6 A;  3OAW A;  2KWU B;  1P98 A;  3L54 A;  2IGH A;  4C4V B;  3A9K A;  4M8N A;  2MJ3 A;  4J3O D;  1C4P A;  1N63 A;  3CST A;  2FIF A;  3I3T B;  3BVM A;  3AEG B;  2NPT B;  3VVW B;  3W9C B;  2JXX A;  1VZ6 A;  4WQM A;  4II2 B;  1QZE A;  2ACZ B;  3QA8 A;  2WS3 B;  3ONS A;  1KRH A;  3A33 B;  3NS1 A;  2J0M A;  5G55 A;  2J42 A;  2PEA A;  3DBH B;  1UWM A;  2N7D A;  3X23 A;  3ETR A;  2G1E A;  5JXV A;  3W2D A;  3GOE A;  1T0Q C;  2GBK A;  2ZPN A;  5TSS A;  2ZNV B;  3P42 A;  1F0Z A;  2BQQ A;  1K52 A;  2CU1 A;  5DPS A;  3Q6B A;  3DVG X;  2DEN B;  2C7N B;  3AE7 B;  3N30 A;  2ONQ A;  1SJH D;  2RDG A;  1Q0W B;  4QAY A;  5CX3 A;  4JWU C;  1WXS A;  3UQB A;  4K1R B;  4MGI E;  4OVU A;  4JQW C;  4HKZ E;  1DGJ A;  2J4X A;  2WXO A;  3OG5 A;  2JXT A;  1I4R A;  2OJR A;  3RNE C;  2BS4 B;  2J52 A;  4WWN A;  2DZM A;  4JX1 C;  1J19 A;  2FUG 1;  2I1K A;  2KLG A;  1MPE A;  1ZOY B;  1G6J A;  2MW5 A;  4L2Y A;  3H7P A;  1E7V A;  2NMQ A;  1YJJ A;  2KWV B;  4IC7 B;  2L3Z A;  2PKO A;  2LJ5 A;  2CHW A;  4LTU A;  3KH0 A;  3ENE A;  2GBN A;  2BGF A;  2TSS A;  3QC8 B;  1YJI A;  4LJP B;  3T9L A;  2ICI A;  1GG3 A;  3N1X C;  3AEC B;  2QDF A;  1WJ4 A;  4TKN A;  4ANU A;  1R4N I;  2J53 A;  2NR2 A;  3VR9 B;  1L6V A;  1QOF A;  1UNS A;  2G3Q B;  4NY0 A;  3NHE B;  3JW0 X;  2VH2 A;  1AYF A;  1EWC A;  2V0G A;  1XLP A;  2JZ3 B;  1Y56 A;  1D5Z C;  2W82 A;  3KWV A;  4C80 A;  2KVZ A;  3S2A A;  4RFB A;  1UD7 A;  4JIO U;  2K22 A;  3J9C A;  2CR5 A;  1AN8 A;  4DDG D;  1C1Y B;  4YTN B;  3PT2 B;  1F52 A;  1FD6 A;  4MJS B;  1ENF A;  1YQ4 B;  2O2V A;  2GMI C;  4KKI A;  1QT9 A;  2NVU I;  1FXA A;  2I38 A;  4KGT A;  5H92 C;  1ZXI A;  2ZCB A;  3A9J B;  4P16 A;  2I2Y A;  4HPL B;  4MGY E;  3P2B A;  3MTN B;  3ZIM A;  2RDB C;  1Q10 A;  3ALB A;  3ZXR A;  2W3S A;  3P63 A;  1ZE3 D;  2AQ1 B;  2IND C;  3DBH I;  2D3A A;  4YWG G;  5MPO A;  1I4G A;  1SBB B;  2KJR A;  4LNO A;  1VCB A;  5KHO A;  3HHM A;  5BYR A;  5GXG B;  1D5X C;  1V1O A;  3Q3N C;  2HD5 B;  4LK0 M;  1XLO A;  2PVG C;  1JCK B;  1CK1 A;  3PTF C;  2V9H A;  2K25 A;  3A4R A;  1T5X D;  4OVV A;  1UBQ A;  4W9K A;  2KMC A;  1I7H A;  3DQV A;  4WUR A;  2N4F A;  3VTV A;  2DBY A;  1S1Q B;  2IO1 B;  2L7R A;  1A5R A;  2IZV B;  1EUV B;  3D32 A;  4A3P A;  2LGS A;  4HCN B;  3VRB B;  4EOY A;  1WSP A;  2UYZ B;  1CZP A;  3B08 A;  3UGB B;  1QOB A;  1YN4 A;  3JSV B;  3DVN V;  2M19 A;  5HKH A;  2GLS A;  2HE7 A;  2PW9 A;  1NI3 A;  2CJN A;  4PT5 A;  1XO3 A;  1E0Z A;  2MHJ A;  3TBL D;  3IAM 1;  3ZO5 B;  2IBI B;  1WGH A;  2W3R A;  3P1M A;  3U8Z A;  1XEE A;  3E9S A;  5DCN A;  2WU2 B;  4ARC A;  3P4Q B;  4EZK A;  1WJN A;  1QOA A;  2Z59 B;  1YN5 A;  3OWE B;  1YX6 B;  1N60 A;  3IBE A;  2LXA A;  4N9F 4;  2J0K A;  5CHF A;  2PJH A;  2KFK A;  3PGE A;  1MI0 A;  1I4Q A;  1TGZ B;  1QKZ A;  1WX9 A;  1MG8 A;  2KN4 A;  2AQ2 B;  4NAM A;  3QWZ B;  2GBM A;  3NVW A;  2JQR B;  4ANW A;  2JX5 A;  4GGQ A;  3R8B A;  1FCL A;  2JYT A;  5D6J B;  4FBJ B;  2L0F A;  4XE0 A;  3RI7 C;  3TL5 A;  1EM7 A;  3L17 A;  2K8H A;  1V97 A;  2KWC A;  4HLE A;  3L16 A;  4GB9 A;  3LB8 C;  5BMI A;  1DYQ A;  3KUC B;  5IAA C;  4HXD A;  1V1P A;  2KLC A;  4HK2 A;  2OJW A;  3Q69 A;  1C76 A;  1I4P A;  2AYO B;  4KIK B;  1F1H A;  2MA9 B;  2JWU A;  1D4B A;  3FKY A;  3H9D A;  2YEP F;  5LNK 1;  3GE3 C;  4B9K A;  4XWW A;  2J0J A;  4FHK A;  2KFK B;  3EEC A;  4ZHO A;  1LM8 B;  3AB5 A;  3QAQ A;  2ZPY A;  1F9J A;  2R2Q A;  4RGT A;  5AZH A;  1I35 A;  4AWJ A;  2FNJ B;  1EU4 A;  3QCA A;  2L52 A;  5LLI A;  2LUM A;  3Q8E A;  4GMV A;  4AUQ C;  4IWP A;  1GC6 A;  1MVK A;  2N9K A;  1TS3 A;  5JHA A;  2ZVO A;  1HZ6 A;  3K9P B;  4MEM A;  2MSE D;  3U2S C;  4B0E A;  1RAX A;  5EE0 A;  1KF6 B;  2KAJ A;  3ZKJ C;  1WXM A;  2EKE C;  3AUL A;  4RH6 A;  1V6E A;  4TMA B;  2XEW A;  1HZ5 A;  1FCC C;  4ITK A;  1V1P B;  4ICU A;  2N7J A;  3GB1 A;  2M56 B;  1E8X A;  5E6P A;  1F2R C;  1J7C A;  3TJP A;  1B9R A;  2K39 A;  4DHZ B;  1YQ3 B;  1FNU A;  3MJ5 A;  3KYC D;  3W1S C;  1WIA A;  4KZ0 A;  1Z5S B;  2MEK A;  3QX1 A;  3GE8 C;  1T6B X;  4W9E A;  3SU8 X;  2KTR B;  2DX5 B;  1GB1 A;  4DDI D;  2IY1 B;  1QIL A;  2QSD A;  3LYY A;  3LJ3 A;  2LAS A;  2AEH A;  2Y5C A;  1UUP A;  2FCM A;  4X57 B;  4NJ6 A;  3IAS 1;  2VZK D;  3PS6 A;  3L4P A;  1WFY A;  4A55 A;  4FAD A;  3KUZ A;  1TKE A;  4RF1 A;  1WM3 A;  2LGY A;  1TJE A;  3ZRF A;  1PDX A;  4IWQ A;  1ZPS A;  4KGS A;  2BWF A;  1WGD A;  4YTM B;  4W9I A;  2WXM A;  2CHX A;  3RPF C;  5EE9 A;  3MC9 A;  1RM6 C;  4YSZ B;  1AAR A;  4A8X C;  3IHP C;  2A4Z A;  2ZCC A;  3A1Q B;  3DBS A;  4AOF A;  4N59 A;  2IPK D;  3RN9 C;  4NAW A;  4FN2 A;  1D5M C;  1K51 A;  2WXP A;  1TY0 A;  3ZNZ B;  1TKG A;  2BPS A;  4OZA A;  4EZJ A;  1OQR A;  2BYT A;  2IGG A;  2N9L A;  4KGR A;  1VD2 A;  4C00 A;  2KJH B;  5EDS A;  3MC0 B;  1JRP A;  1ET9 A;  3TUO A;  1P1A A;  4S17 A;  2E6X A;  4HEA 1;  3HM3 A;  2INP E;  4YSY B;  3VTU A;  4PYU A;  1SIJ A;  3ZDT A;  2MBH A;  4OZB A;  1YJ1 A;  5BYS A;  3N9Y C;  1NEK B;  4B0M A;  1Q1O A;  2M1M A;  4US9 A;  1AW7 A;  3BK1 A;  4D2K A;  4RNA A;  3HK0 A;  2LD9 A;  1JRO A;  1OEY A;  3KWL A;  4NAW B;  3DVG Y;  2C9W B;  1P7F A;  2XBB C;  1WXA A;  4XYC A;  3Q14 C;  1T0R C;  2N7E A;  1R4N B;  1VZ8 A;  3VH3 B;  1WM2 A;  1V9J A;  2H89 B;  4HRS A;  5DPR A;  4HKQ A;  5EE1 A;  1N6Z A;  2WXH A;  2KYW A;  2WXI A;  1X1M A;  1I4H A;  4URK A;  4ASW C;  2SEB D;  3MP9 A;  5D3D A;  3NZU A;  4WJP A;  3DHG C;  1F2R I;  4P7I A;  3DPD A;  4ZRK A;  3MHS D;  2KAC A;  3WAN A;  1SIF A;  2LMC A;  3VH4 B;  2QIL A;  2GBJ A;  4GOC A;  3APF A;  3TCA A;  4FJZ A;  3H8H A;  2MH7 A;  1N61 A;  1AWD A;  3GZN I;  1P0R A;  2NBU A;  2YEP B;  4H2A A;  4BOZ B;  2WP9 B;  2ASQ A;  1V80 A;  4DQO C;  3Q2A C;  1J0G A;  2QJL A;  1E8Z A;  3IFW B;  2MX2 A;  2KDM A;  4HPM B;  4LLG M;  5L83 A;  1E9M A;  2OED A;  2WXR A;  3ECI A;  5IA7 A;  3RFZ B;  2KX3 A;  4W9D A;  3IG3 A;  4OZC A;  4KKJ A;  2V1Y A;  3RZF A;  3T3O A;  5CHV C;  4DK5 A;  4JGH B;  1GJZ A;  3RYT A;  1LGR A;  4P1B C;  1FO4 A;  5IOI A;  2XNA C;  3WIM A;  1WXQ A;  4TSS A;  3A9K B;  4ZRI A;  4OHJ A;  3ZQ4 A;  5BMG A;  3VUW A;  5I4D A;  4F7Z A;  3DWM A;  1QOG A;  2DWQ A;  2V4L A;  3WCQ A;  2WWZ A;  1N5W A;  3PPA A;  1FRD A;  2L76 A;  3AE3 B;  1WY8 A;  2AX5 A;  2NTS A;  4GDL A;  1DOX A;  2WX0 A;  3H6N A;  2JYE A;  3C8Y A;  2JWZ A;  3DWG C;  2K6Q A;  3ZTC A;  3U7D A;  5J18 A;  3AEF B;  1HEZ E;  1XT9 B;  4WWP A;  2EEL A;  5BO4 B;  2UU7 A;  2MBO A;  2BB5 A;  1V8C A;  3NY5 A;  2CU3 A;  1D6E C;  2FUH B;  5D94 A;  3M62 B;  1KLG D;  4AQ7 A;  2AL3 A;  1YN3 A;  3R7Q A;  4ZOH C;  1IBX A;  3GS2 A;  3V61 A;  2ZJD A;  3QK0 A;  5JZE B;  2Y5B B;  2M8S A;  2A5U A;  5EE3 A;  2OHF A;  2KFJ A;  1ZP0 B;  4ZDV A;  2G45 B;  3RMK C;  1J7B A;  4TQ1 A;  3DVN U;  3M63 B;  3T8M A;  3SD5 A;  2N9E B;  4GDL B;  2DHZ A;  1BXT A;  2MBQ A;  4DHJ D;  3ZNG C;  1GAQ B;  1JQ4 A;  4N58 A;  3Q8B A;  3H7P B;  4KVG B;  1VRA B;  3R2I A;  4A3O A;  1WR1 A;  4R3D A;  1YOV B;  2KN5 A;  4XC2 A;  3EHV A;  4W9H A;  4BKG A;  5C23 A;  4M0W A;  2IO2 B;  5IO9 A;  2EMS A;  1DOI A;  3BVG A;  4ZYN A;  2MP2 A;  4LDT D;  2BVC A;  5DPT A;  1VR9 A;  1RFK A;  2D3C A;  2PLP A;  2BBC A;  1WJ6 A;  3KYD D;  3Q3F A;  3B2F A;  2KQ4 X;  1TBE A;  1WWT A;  4G3X B;  1OQQ A;  2MBB B;  3ZYY X;  3BWU D;  2IGD A;  1NYR A;  1SE9 A;  2PPH A;  2Y5P A;  2OOB B;  5CTR C;  4OVZ A;  1QLB B;  3TMP B;  3DCG A;  4WQO B;  2LXC A;  2WDT B;  3AXC A;  2KQS A;  2IYD B;  1YNT E;  2CKH B;  4US8 A;  1TY2 A;  2LHE A;  2WX1 A;  2LGX A;  1EF5 A;  1ET6 A;  4CO7 A;  1RFA A;  3U52 E;  2C5L C;  1TTN A;  2FCQ A;  4I6N B;  1JW9 D;  4WH4 A;  1WE7 A;  2O2V B;  1R4M I;  2I1J A;  4J6I A;  2JUO A;  3UF8 A;  2N9X A;  4M0W B;  3RUI B;  2KKC A;  1V86 A;  3ZRC A;  1IP9 A;  1IPG A;  1WGK A;  3EFU A;  1WYG A;  3AMZ A;  3PVL A;  2K8B A;  3AI5 A;  3AEE B;  3VDZ A;  1WGR A;  3H7S A;  2O6V A;  1WXV A;  2REX A;  1C4A A;  5FK9 C;  2K0P A;  2KMM A; 
#chains in the Genus database with same CATH homology
 2M56 B;  2D5G A;  2PIA A;  2QIE B;  1F2R C;  2VZK B;  1RYJ A;  1J7C A;  4MM3 B;  1B9R A;  2WDQ B;  4GDK B;  2L1A A;  2WU5 B;  3I9V 1;  1TKY A;  4RGM A;  1YQ3 B;  1FNU A;  1QF6 A;  1CJE A;  1GOZ A;  3MJ5 A;  2WXJ A;  4OW0 A;  4FXC A;  2JU6 X;  1P7E A;  2CJO A;  2LFI A;  1PUT A;  4YT0 B;  4ARI A;  3PZ8 A;  1NVI D;  3AEA B;  2MEK A;  1XLQ A;  1WRI A;  1FFU A;  4L23 A;  1T6B X;  1ROE A;  3AEB B;  2LHD A;  3SR6 A;  3GP7 A;  4UDU C;  5HHD G;  1IUE A;  1TYG B;  2BS3 B;  1ZXH A;  4C7Z A;  1GPX A;  2IGH A;  3AN1 A;  1GB1 A;  2IJ0 A;  4N6E B;  2MJ3 A;  1QIL A;  2QSD A;  3LYY A;  4J3O D;  1C4P A;  4WIP A;  2Y5C A;  3BK2 A;  1JWA D;  1UUP A;  3NVZ A;  5T8I A;  1N63 A;  1B1Z A;  3NVV A;  3IAS 1;  1L0V B;  3EA6 A;  2BB6 A;  3BVM A;  2VZK D;  3L4P A;  3ZGZ A;  3SFD B;  4A55 A;  1SJE D;  3AEG B;  3CWI A;  1TKE A;  4RF1 A;  3W9C B;  3NUH B;  1VZ6 A;  2K5P A;  1TJE A;  4WQM A;  1PDX A;  3HUI A;  2ACZ B;  1ZPS A;  3P4R B;  4KGS A;  4YTM B;  2WXM A;  2WS3 B;  1KRH A;  4C7Y A;  3RPF C;  5EE9 A;  3B9J A;  1RM6 C;  2ON8 A;  3NS1 A;  2AQ3 B;  2MJE A;  4YSZ B;  1IBX B;  4XDD A;  4JE3 B;  2J42 A;  4A8X C;  4DXG A;  1NYQ A;  1UWM A;  2IPK D;  3AV8 A;  4N59 A;  1HXY D;  3ETR A;  2X38 A;  3BZD B;  1RWS A;  1D5M C;  2NTT A;  1K51 A;  3HVZ A;  3W5U B;  2G1E A;  5JXV A;  2WXP A;  1YMH E;  1E7P B;  1FIQ A;  1K50 A;  2M0A A;  3W2D A;  3W5V B;  1LO5 D;  1TY0 A;  1TKG A;  4OZA A;  2E3T A;  5TSS A;  3P42 A;  1F0Z A;  1ZUD 2;  1OQR A;  1K52 A;  3URY A;  2BYT A;  2IGG A;  2N9L A;  3AE1 B;  3AE7 B;  5G5G A;  3SEB A;  2Y3A A;  1FRR A;  2FBW B;  2ONQ A;  4KGR A;  2PMV A;  1SJH D;  3UI3 A;  4MT5 A;  2RDG A;  4RGO S;  3R2T A;  1QQR A;  2WDR B;  3B2G A;  3TEX A;  4JWU C;  1FFV A;  1SF0 A;  3MC0 B;  4NJC A;  1JRP A;  1ET9 A;  3TUO A;  2N0S B;  2HTM E;  2JSV X;  2E6X A;  4HEA 1;  2INP E;  4YSY B;  1SIJ A;  1VLB A;  4REZ A;  4OZB A;  4HKZ E;  1DGJ A;  3BYY B;  5BYS A;  4ZRP A;  1XLN A;  3N9Y C;  2BS2 B;  2ZW1 A;  4WAF A;  3ABV B;  2J4X A;  1NEK B;  2WXO A;  2LGI A;  4B0M A;  2JXT A;  1I4R A;  4US9 A;  1AW7 A;  2BS4 B;  3U4E G;  1PGA A;  2J52 A;  1SE3 A;  1ACC A;  3EGR A;  3P4S B;  3BK1 A;  4JX1 C;  2FUG 1;  1SEB D;  2WXG A;  4MAC A;  4RNA A;  4D2K A;  1SSN A;  2WXF A;  3TEY A;  2RPV A;  1IGC A;  2PVO D;  1MPE A;  1ZOY B;  1JRO A;  4C56 C;  3KWL A;  4JWS C;  4L2Y A;  4NAW B;  1P7F A;  1GB4 A;  2NMQ A;  2GI9 A;  1YJJ A;  1FXI A;  2RDH A;  1VJK A;  1ZDX A;  1XCT L;  4A9A A;  2PKO A;  1VZ8 A;  1L0Y B;  2WXN A;  2H89 B;  4LTU A;  4HRS A;  4ZHP A;  3U7Z A;  3PZ7 A;  4USA A;  4HKQ A;  1STE A;  2TSS A;  1TS4 A;  1YJI A;  5EE1 A;  3FC4 A;  2ICI A;  2WXH A;  3NRZ A;  2WXI A;  3AEC B;  2DLB A;  1I4H A;  3MFG A;  2SEB D;  2J53 A;  1F77 A;  3MP9 A;  5D3D A;  3VR9 B;  4WWM A;  1L6V A;  1QOF A;  1UNS A;  1F2R I;  1A70 A;  1FEH A;  2KAC A;  2LMC A;  2SAK A;  1AYF A;  2RMM A;  2G9H D;  3Q8A A;  1EWC A;  2V0G A;  1XLP A;  2WXL A;  2QIL A;  1NEN B;  1Y56 A;  1D5Z C;  3ZJT A;  2W82 A;  3H8H A;  2MH7 A;  1N61 A;  1AWD A;  4A6Q A;  3KQ4 A;  3KWV A;  3AE8 B;  3PO0 A;  2YEP B;  4ZRQ A;  4H2A A;  4C80 A;  2WP9 B;  2WLB A;  4HJG E;  1ZDV A;  2LJI A;  4DQO C;  4RGN A;  4RFB A;  3VRA B;  3MHZ A;  2K22 A;  3J9C A;  1AN8 A;  2QJL A;  4YTN B;  2KDM A;  1FD6 A;  1PGB A;  4LLG M;  3AED B;  1C4C A;  1E9M A;  1ENF A;  1YQ4 B;  2K9X A;  2OED A;  3I57 A;  4XDC A;  5C2T B;  2WXR A;  3EUB 2;  4KKI A;  1QT9 A;  3RFZ B;  1FXA A;  2I38 A;  4IDI A;  4KGT A;  4OZC A;  1ZXI A;  1ESF A;  2BW2 A;  3AE2 B;  4KKJ A;  5H92 C;  4P16 A;  3T3O A;  1N5X A;  2I2Y A;  3IT6 B;  4DXF A;  3T3N A;  1I4X A;  1Q10 A;  1HA5 A;  1KH0 A;  1L5P A;  2EKI A;  2W3S A;  1FO4 A;  1K53 A;  3P63 A;  1ZE3 D;  2AQ1 B;  2XNA C;  2INN E;  4YWG G;  1WXQ A;  3O13 A;  4TSS A;  3V3X A;  1I4G A;  5MPO A;  1SBB B;  4ZYS A;  4OHJ A;  5AUI A;  3ZQ4 A;  5BYR A;  5GXG B;  1D5X C;  5BMG A;  1V1O A;  5I4D A;  5HI1 A;  1JWM D;  3DWM A;  3AE4 B;  4LK0 M;  1HQR D;  1XLO A;  2PVG C;  1QOG A;  1EU3 A;  1JCK B;  1CK1 A;  2DWQ A;  5AUK A;  1BUI C;  3WCQ A;  3FIL A;  3CIR B;  1R7S A;  1N5W A;  1FRD A;  3HVD A;  1KLU D;  3AE3 B;  4GLS C;  1DOY A;  1T5X D;  2AX5 A;  2NTS A;  1EWY C;  1I7H A;  2W54 A;  3W1S A;  4WUR A;  1KFY B;  2KWD A;  2PTL A;  1DOX A;  3E56 A;  1TS5 A;  2DBY A;  2JYE A;  3C8Y A;  4RCO A;  3DWG C;  2DYM A;  1C9F A;  4IKG A;  1SE4 A;  3AEF B;  1HEZ E;  3AE5 B;  1SE2 A;  4KX6 B;  4A90 A;  2EEL A;  2WNM A;  5BMH A;  1FNV A;  3VRB B;  1WSP A;  1C77 A;  2BB5 A;  2WXQ A;  5C3J B;  1CZP A;  1V8C A;  2CU3 A;  1D6E C;  3ZJU A;  3AH7 A;  4RF0 A;  1QOB A;  1YN4 A;  1UWX A;  3NVY A;  3IT4 B;  1TS2 A;  2M19 A;  4MH8 A;  1KLG D;  4HRO A;  2PW9 A;  4AQ7 A;  1YN3 A;  1J7A A;  1C79 A;  3AE6 B;  2Z8L A;  4EE2 A;  1NI3 A;  4Q2J A;  3KLS X;  4ZOH C;  2CJN A;  4PT5 A;  1IBX A;  1XO3 A;  1VDV A;  4JPS A;  3GS2 A;  4YSX B;  1E0Z A;  3IAM 1;  1SXT A;  2GB1 A;  3BYT B;  1N62 A;  3FIL B;  3HRD D;  2W3R A;  5G5H A;  3P1M A;  1E6E B;  1XEE A;  1MHH E;  1XXG A;  3E9S A;  5EE3 A;  2OHF A;  2WU2 B;  4ARC A;  3P4Q B;  1ZP0 B;  1QOA A;  1J7B A;  4TQ1 A;  1YN5 A;  3OWE B;  2LEK A;  2R61 A;  1FMA D;  2XN9 C;  1PFD A;  1N60 A;  5D7G A;  2WDV B;  4GDL B;  1C78 A;  1BXT A;  2K3U A;  1MI0 A;  3IXS A;  1I4Q A;  1VZ7 A;  1JWS D;  1GAQ B;  2IDY A;  3ZJV A;  1OFF A;  1JQ4 A;  3LXF A;  1QKZ A;  5BYQ A;  2BTE A;  3BVZ A;  2KN4 A;  2JZP A;  4N58 A;  2AQ2 B;  3Q8B A;  1L6U A;  4NAM A;  1JAL A;  3NVW A;  2JQR B;  1VRA B;  2WXK A;  4O1N A;  3R2I A;  3TEZ A;  1PYW D;  2MJD A;  4R3D A;  2JX5 A;  2L32 A;  5D3I B;  3R8B A;  1FCL A;  2JYT A;  2BT6 A;  1UGJ A;  4M0W A;  4YXD B;  3Q8F A;  3VQI A;  1DOI A;  2Q5W D;  1JWU D;  3BVG A;  4XE0 A;  1KTK A;  1L4D B;  3AE9 B;  5FKA C;  1EM7 A;  4TQ0 A;  1V97 A;  1VR9 A;  1RFK A;  2PLP A;  1XCQ L;  2HDE A;  2BBC A;  4L1B A;  3GB1 A;  3LB8 C;  4NZL B;  5BMI A;  1DYQ A;  1V1P A;  2FE8 A;  3B2F A;  2KQ4 X;  1CQV A;  3Q8C A;  1WWT A;  2QEJ C;  1JML A;  3Q69 A;  3SFE B;  1OQQ A;  1C76 A;  3AM9 A;  1I4P A;  3ZYY X;  1XF5 L;  3BWU D;  2IGD A;  1NYR A;  5FR3 A;  2V4I B;  2Y5P A;  2L83 A;  2H88 B;  2JWU A;  4OVZ A;  1QLB B;  4CQN A;  2V3P A;  2ZW0 A;  5H8Y E;  1D4B A;  1E10 A;  3P4P B;  1PGX A;  4AS1 A;  2YEP F;  1MHX A;  5LNK 1;  1IGD A;  4XWW A;  1YNT E;  4ZHO A;  4US8 A;  1T3Q A;  3AB5 A;  1TY2 A;  4IOI E;  2LHE A;  4RGT A;  4YTP B;  2DYO A;  3TSS A;  2W55 A;  1ET6 A;  1L0X B;  3FAH A;  2QMT A;  3U52 E;  1EU4 A;  2WQY B;  2L52 A;  1JW9 D;  5HG2 A;  4WH4 A;  2LUM A;  3NZ3 A;  3Q8E A;  2GRI A;  3TEW A;  5E6J A;  1FNW A;  2B76 B;  1MVK A;  4XWT A;  2N9K A;  1TS3 A;  1FM0 D;  1HZ6 A;  1WGK A;  1WYG A;  3U2S C;  1L4Z B;  3AMZ A;  4B0E A;  5EE0 A;  1JWB D;  3V05 A;  1M4V A;  1KF6 B;  1SB3 C;  2KAJ A;  3AEE B;  4RH6 A;  5HFY A;  2V3N A;  4TMA B;  1HZ5 A;  3BII D;  4P6V F;  1FCC C;  1C4A A;  4ITK A;  1BML C;  1V1P B;  5FK9 C;  2K0P A;  3VR8 B;  2N7J A;  2KMM A;  1TZO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...