1E6EB

Adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords NADPH\:ADRENODOXIN OXIDOREDUCTASE
publication title Adrenodoxin Reductase-Adrenodoxin Complex Structure Suggests Electron Transfer Path in Steroid Biosynthesis.
pubmed doi rcsb
source organism Bos taurus
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e6eB00
4YXDB 1PUTA 2MJEA 2DWQA 4N59A 3AE6B 2CJOA 4IDIA 2WU5B 4WWMA 1GPXA 1IUEA 1WYGA 3CWIA 1SB3C 1A70A 5H92C 4YSYB 1WRIA 4N58A 2K9XA 1V97A 1JROA 2WU2B 3B9JA 4HRSA 1F0ZA 1WWTA 1FFUA 3CIRB 1XO3A 1E10A 1SIJA 2Q5WD 4YSZB 1QF6A 1QOFA 2WLBA 1T3QA 1N5XA 3RPFC 3SR6A 3AE4B 1E9MA 2W55A 1L5PA 1TKEA 1OQQA 3W5VB 2HTME 4C7ZA 2MJDA 5C2TB 1R7SA 1N62A 1TYGB 5EE3A 1TKGA 1ZP0B 3AE1B 1FIQA 4ZOHC 1J7AA 4C80A 2QJLA 1XLPA 3NVYA 4US9A 1DOIA 4KX6B 1FXAA 3AN1A 5H8YE 1QOBA 1FRRA 2JX5A 1FXIA 2KAJA 1CJEA 3VR9B 1I7HA 1KF6B 1XLQA 1ZXIA 2PKOA 3VRBB 1YJIA 2B76B 1NEKB 1N61A 4WQMA 1ROEA 2M19A 3P4SB 1FO4A 2QIEB 2MJ3A 5C3JB 1RYJA 3EUB2 1PFDA 2BS2B 2EKIA 1QT9A 2WS3B 3LXFA 2KMMA 2L83A 2CJNA 1DOYA 4ZHPA 1J7CA 1N5WA 4ZHOA 1ZUD2 3ZYYX 1JQ4A 1AYFA 3VRAB 1YJJA 3BIID 1YQ3B 1JALA 1NYRA 4ITKA 2N0SB 1GAQB 3L4PA 2CU3A 2W3SA 3DWMA 3AECB 1B9RA 3P1MA 1FFVA 1XLNA 4JWSC 2Y5CA 1FMAD 2BS3B 2WQYB 1NVID 3AB5A 1V8CA 2ACZB 1VLBA 1CZPA 5EE1A 3P4PB 3SFDB 3AE2B 4N6EB 1XLOA 1TJEA 3AMZA 1OFFA 3AEAB 3NRZA 1ZOYB 3AEDB 4C7YA 4JWUC 4LTUA 2WDRB 3AV8A 3DWGC 3HVZA 3PO0A 1L6VA 4YTMB 3AE8B 2W3RA 3AE5B 1AWDA 4YT0B 2BS4B 2M56B 1NI3A 3AEEB 5GXGB 2FBWB 1FM0D 3VR8B 3AE7B 5G5HA 1DOXA 1WGKA 4YTNB 1SF0A 2PVGC 4P6VF 1N63A 3B2GA 2PIAA 1YQ4B 2E3TA 1VJKA 1DGJA 2BT6A 2JQRB 3AEFB 5EE0A 3FC4A 3LB8C 1NENB 1FRDA 1JW9D 2MH7A 2W54A 2H89B 1RM6C 3HRDD 3AE9B 4FXCA 3HUIA 1TKYA 1L0VB 2K5PA 2WDVB 2H88B 3AEGB 1KRHA 2K22A 1EWYC 1JWBD 1WXQA 1E6EB 3KWLA 3ETRA 1JWAD 2OHFA 3WCQA 1NYQA 3AE3B 1PDXA 3AM9A 2PVOD 4USAA 5EE9A 3P4RB 1L6UA 5MPOA 1QOAA 1E7PB 2AX5A 3AEBB 5AUIA 3P4QB 2L52A 3P63A 4YTPB 4A9AA 1UWMA 2G1EA 2LEKA 3AH7A 3NVZA 3NVWA 2WDQB 1J7BA 4JX1C 5AUKA 1RWSA 3W5UB 1KFYB 1RFKA 3ABVB 5G5GA 4YSXB 1QLBB 3SFEB 3W9CB 2DBYA 3NVVA 4US8A 1N60A 1OQRA 2WP9B 3NS1A 1VDVA 4HROA 3B2FA 1JRPA 3FAHA 1E0ZA 1QOGA
chains in the Genus database with same CATH superfamily
2HJ1A 4GDLA 4LK0M 4DWFA 4YSYB 4TQ0A 1PGBA 4II2B 3Q3FA 3L08A 5FR6A 2DZMA 4I6NB 5BYRA 2BVCA 3R7QA 2HJ8A 1TBEA 2KWUB 2Z8LA 1SEBD 3VR9B 3VRBB 3A4RA 1G6JA 3WAMA 3A33B 4PK1A 1IP9A 2YVCA 1EU3A 2CU1A 4REZA 5CHVC 5JHBA 4ITKA 1GOZA 1Y56A 3DWMA 4L23A 3RI7C 1FFVA 1ZGUB 3ZJTA 1E8WA 3H7PB 2TSSA 4OVZA 2N9LA 3BVGA 3AMZA 3NRZA 4EFOA 4JWUC 3GB1A 5DCNA 2GMIC 3V62A 4EE2A 3GOEA 1DYQA 2WX1A 2LGIA 4MGKE 4HPPA 1OEYA 4A6QA 2MH7A 1WSPA 3NZSA 4MH8A 1TKYA 2KN4A 2WDVB 1V5TA 2I1JA 1N6ZA 2HE7A 4XYCA 2N7JA 2BYEA 1ISNA 3ZRFA 3WAOA 2JXTA 3PRPB 5DPRA 3O65B 5AUKA 2KFJA 2R2OA 4NY0A 1WR6E 4GB9A 2JRIB 2XK5B 4JGHB 2FUG1 1EF1A 2C7MB 3QCAA 5AEKB 1L0YB 3HK0A 3V3XA 4IWOA 2KTRB 4NAWA 2JWUA 4GXBA 1T0SC 4ZDVA 3WALA 4ACFA 1N62A 5EE3A 1FIQA 2FIFA 3CMMB 3DCGA 3SHQA 4KX6B 2BGFA 3VUYA 1MG8A 3N32A 4GU2A 4M0WA 3A4SC 2B76B 1NEKB 3A1QB 1P7EA 3P4SB 5C3JB 2IJ0A 5L83A 3A9KA 3VUXA 3X0WA 2REXA 4JL9A 1C1YB 5FKAC 2W3SA 1YIWA 1KLGD 2KVRA 2LWPA 3PS6A 3Q3MC 2WNMA 2J0MA 3I5JC 3RNFC 3WANA 3RNGC 1YD8U 4KZCA 2KT7A 4EZLA 1P0RA 1GC7A 4CO7A 4GGQA 3ZJUA 1LFDA 4ZRJA 5J17A 1NI3A 3VTWA 1WGKA 2LGDA 5D6JB 1FNUA 2NTSA 4WIPA 2IO3B 2BPSA 1YQBA 1KTKA 3ETRA 4A55A 4W9CA 5LLIA 4RM8A 3APCA 1E8YA 1MHHE 1UZXB 2G1EA 3N1YC 2PE9A 4FJVB 4W9DA 3ZXVA 2LXAA 4WWPA 1CK1A 5G5GA 4YSXB 4GSWA 3RCZA 1ENFA 2AQ2B 3R66C 5IP4D 3IXSA 2ON8A 3JYUA 2DNFA 5HHDG 1FEHA 3ZUNA 3CWIA 4TUUA 2WXMA 1KLVA 5FK9C 3AXCA 1GB4A 4C7ZA 4OVVA 1DOIA 1E90A 4RF1A 5KHQA 4MJSA 1QOBA 2UU7A 4ANUA 2KAJA 3MC8A 3TJPA 1Q5WB 1MJDA 2QIEB 4MT5A 2MJ3A 3CF6E 4ANXA 1S1QB 3QARA 1SJHD 2KDBA 3URYA 4MH0E 1JALA 1Q0WB 1BUIC 2GBNA 2MSED 2K6QA 2ZNVB 1RFAA 2PE6B 1L4DB 3ZXRA 3VQIA 1P1AA 4Q2JA 3EFCA 2HD5B 4LNKA 3I57A 1VLBA 1ET6A 1GG3A 4HPLB 4XX5A 3ZNZB 2M0AA 2KTFA 3UIPB 2FCNA 1ACCA 5BYQA 4LJPB 3GE8C 4F7ZA 3MFGA 2QCZA 4JLCA 1WX9A 2BTEA 2I1KA 3M62B 2R61A 4DHJB 2KN5A 3PZDA 4B0EA 4BKTA 2KC1A 1WI0A 1I4QA 4BZAA 2MBBB 2L7RA 3U7ZA 1QLBB 5AZGA 2KMAA 4OZAA 3Q3OC 1L4ZB 4RNAA 3LJ3A 5DPTA 3TCAA 1L7YA 1PUTA 4N59A 2GRIA 3PRZA 3R2TA 1LGRA 4FN2A 2DAFA 4HRSA 4MELA 5DPWA 2LRUA 3CSTA 1MI0A 1WGRA 2JY6A 5TSSA 3RD2A 4K7UA 1OQQA 1ZE3D 4ICVA 1SE4A 3DOWA 4GDKB 5EDSA 1UF0A 4US9A 2JX5A 1I7HA 1KF6B 3Q8BA 1YJIA 4TQ1A 2MBOA 5GMVA 1T5XD 1TY0A 4W9HA 3HM3A 2ZVNA 3ZNGC 3RNCC 1N5WA 1R4MB 1MFWA 1SGHA 2KJRA 2CU3A 2E6XA 2BF8B 2LGXA 4BKSD 3VH4B 4HVBA 3B08A 1TGZB 4OW0A 4LDTD 1CZPA 3Q3NC 3PLVA 4LLGM 3JW0X 2J52A 1UNSA 3E56A 1XT9B 2ZW1A 2Z59B 2DZKA 1H8CA 1SF0A 3CSFA 1WX7A 2MW5A 1NENB 2D3BA 1YJ1A 2WXIA 1T6BX 4GN1A 4K7WA 4FXCA 4PS8A 1SSNA 1V2YA 2W9NA 3KQ4A 4USAA 1L6UA 3RT3B 4BKSA 1T0QC 5AUIA 1HXYD 2ZCCA 4LNFA 4M8NA 2INNE 4K3CA 2RGFA 2UYZB 1RWSA 4KGRA 3ABVB 2V0GA 2O2VA 2D10A 1JCKB 1F2RI 1TZ1A 3UQAA 3QX1A 3ZIMA 1ZDXA 2IZVB 2QMTA 1GPXA 5LNK1 1L2NA 1C4PA 3RNEC 1F0ZA 2Y5PA 3L16A 3K9PB 3EHVA 3NS8A 2MBQA 3R2IA 4PS3A 2W55A 3WA0A 1WGHA 2GBJA 4S17A 4HJGE 4WJPA 4ZOHC 2QJLA 1C78A 2K8CA 3TBLD 4M8MA 1FRRA 3GZNI 3H6NA 3NZ3A 5JXVA 1R4NB 4P7IA 3VVWB 3DBLB 2ZCBA 1QQRA 2DZJA 3RFZB 2BBCA 3BINA 2NPTB 1ZUD2 2XEWA 1I4HA 2X8XX 5J18A 1NYRA 3ZDTA 2L8JA 2KHWB 1I35A 2M8SA 4BOSC 2Y5CA 2BQQA 5EE1A 2N9PC 4KV2A 5IN7A 4IWPA 2GBKA 4KDIC 4HEA1 4G50A 3TEXA 2LASA 1ZXHA 4FJYA 4FHJA 1Z2MA 4OHJA 4J6IA 1VCBA 2JYEA 2IO0B 4E3CA 4AS1A 3R3MA 1Y8RC 5D94A 1XXGA 1DGJA 2JQRB 1YN4A 5G2NA 4ICUA 2EKEC 2CHWA 4HKZE 5HI1A 1X1MA 3QK0A 2ZW0A 1JWAD 3IVFA 1R4MI 1PGAA 3P4RB 4JQWC 2NVUI 3PREA 2ZPYA 2KXJA 1E5WA 1V9JA 3GE3C 4KKIA 1C4CA 3SFEB 1P98A 3TMPB 3NVVA 4US8A 3FKYA 4CQNA 2IY1B 2IYDB 2LJIA 4HROA 2V3SA 2W82A 4PYZA 3OAWA 4HDOA 5E6PA 2WXJA 2HDEA 3BK2A 4K7SA 3RPFC 2RDBC 1C4AA 3OG5A 2NTTA 3UI3A 4DXFA 5JZEB 2K1FA 2MQJA 3U2SC 1XEEA 3A9JB 5FR3A 5DPSA 3KW5B 1CJEA 4XGAB 1ZXIA 2BKFA 3U52E 3EFUA 2AL3A 1RYJA 2B3AA 1U4AA 2M4NA 4W9IA 4PS7A 4HK2A 4W9LA 2V1YA 3ZKJC 4MEMA 3RULA 2WXPA 4IM3A 3A1QA 2BS3B 3SFDB 5IAAC 3NZUA 2LHDA 1D5XC 1TS2A 2JUOA 3ZO5B 3KYDD 5C1ZA 1N63A 1YNTE 3VFKA 3Q3JA 3VUWA 2LMCA 1J8CA 3Q14C 3KWLA 4XDDA 2XBBC 5CTRC 2QHOA 2J4XA 2INDC 5MPOA 2WXRA 3AEBB 2L52A 2JU6X 1FPYA 2KDFB 1V86A 1P3QU 5D7GA 4HCNB 3L10B 1N60A 2FAZA 1JRPA 5E6NA 2FUHB 2MJEA 4MM3B 3J9CA 1YMHE 3AE6B 4LNNA 2WU5B 2D3AA 1JRUA 2LUMA 2JXXA 5H92C 1V97A 1JROA 4F8CB 1FFUA 4HWIB 4RMAA 2KANA 3DBRB 2M1MA 1TYGB 1TKGA 3AE1B 2MX2A 1XLPA 4NPNA 5CHWA 3W1SA 4ZYSA 3D32A 1ESFA 3OJ3A 4K1RB 3UGBB 2D2QA 4ARIA 3FILA 1ROEA 2GB1A 2BS2B 1AN8A 2BW2A 1HTQA 3K9OB 2RDHA 5JHAA 2L32A 4KIKB 1F52A 3IHPC 4XWTA 2CKHB 3TEWA 3U30A 1FMAD 4K3BA 2MWSB 1NVID 3MTNB 2MCNB 2KO3A 4KSKC 2VRRB 4RCOA 2BB5A 4XE0A 2MEKA 5L95C 3PO0A 1L6VA 2W3RA 4GDLB 1FD6A 3UF8A 2HTHA 3VR8B 5G5HA 4B9KA 4LCDE 2DYOA 1IBXA 3N20C 4M02A 4ZRQA 5EE0A 1P9DU 3IFWB 1Q10A 1WFYA 1GC6A 2BWFA 3OJ4B 1JWBD 4R3DA 3MC9A 4IUMB 1PDXA 1D6EC 2A5UA 4WJOA 3P4QB 4TV3A 2WXGA 2MLBA 4DXAB 4EZKA 2MHJA 4W9FA 4LJOB 4BBNC 1VR9A 3MJWA 4P1BC 1C79A 1NDDA 4YWGG 5BMHA 3OLMD 1E7VA 1E7UA 2CJOA 1HA5A 1IUEA 1WYGA 2CHXA 2G45B 3PRMB 1ZKHA 1UGJA 1J19A 1N5XA 4JIOU 4ZRPA 2WXFA 3T3OA 1MG4A 2PEAA 3UIOB 2JRHA 4C00A 2MP2A 1J0GA 2K8BA 1TZOA 1UWXA 2EKIA 2CR5A 3H8HA 4W9GA 4ZHOA 2ZZPB 3ZYYX 2JF5A 2WXQA 2KMCA 2FCQA 2N0SB 2QSDA 2WDTB 3OWEB 1B9RA 3PV1A 4MGZE 4FULA 1KM7A 4MSQB 2XN9C 2LI5A 4P1CC 1XLOA 3BK1A 1IPGA 1K53A 3DWGC 3HVZA 5IKCM 3RNAC 1CQVA 3M3JA 4NAWB 3MHSD 2O6VD 1WJNA 3SU8X 3PHWB 3AE9B 1WYWB 2FCSA 3TEZA 1D3ZA 2N7DA 2KQSA 3AM9A 1F9JA 3KUCB 4M0WB 1EWCA 2N9XA 3RN9C 1OEYJ 2N9KA 2L76A 3AU4A 3A9KB 2YLMA 2NR2A 1EO6A 4DQOC 4I6LB 1IGCA 2RPVA 1PYWD 2C7HA 2N1VA 3B2FA 2IDYA 3NUHB 3TIXA 1SB3C 1SE2A 2KDEB 2PPHA 2K9XA 2O6VA 1B1ZA 2ICIA 3NHEB 1QOFA 5E6JA 4AJWA 1WM2A 2M17A 2XNAC 2LVOA 1XQQA 3L13A 2QC8A 1WM3A 1HQRD 1STEA 4IM2A 1XF5L 3NVYA 3BVZA 1EM7A 3RZFA 4L2YA 2RDGA 2PKOA 5LXIB 3MHZA 3WAPA 1PFDA 2GBMA 2V4IB 4UDUC 1LQBA 3N9YC 1TY2A 3ZJVA 4WAFA 1JQ4A 1RLFA 1HZ5A 2MA9B 4NJCA 2KQ7A 3ZNHB 1PQSA 5C23A 4DHZB 1FNVA 4AP4C 2WQYB 3QJZA 2ACZB 3JSVB 1SXTA 2NPTA 2DZIA 4M01A 2DHZA 4AUQC 3O13A 1OGWA 3AE5B 1NBFC 5BO4B 1HE8A 3BZDB 3AEEB 2G9HD 3VXWA 1WJ6A 1V49A 3UINB 5D3IB 3JVZX 3C19A 2KC2A 3ZTCA 3HRDD 1F1HA 3Q2AC 1L0VB 4A20A 1EF5A 4MJSB 3ML8A 4WWNA 1E6EB 3AE3B 4D2KA 2Z0EB 4WH4A 2NMQA 3DHIC 1E7PB 3W1SC 3APDA 2ZVOA 2NS5A 2WGSA 1M4VA 4S0RA 4G11A 1FXTB 4AOFA 2KFKA 5E6OA 2IPKD 4O1NA 2RSUA 3FAHA 1E0ZA 1N61A 2VZKD 2KWDA 3ZDMC 2I38A 4K81A 2BWES 4IDIA 3PPAA 4KGTA 4HJKA 3N30A 1WMHA 1I4RA 2WU2B 1WWTA 2AWTA 3CIRB 1SIJA 3DBHB 3AE4B 4P16A 2JYTA 5C2TB 3BWUD 1FXAA 2ZNVC 3T8MA 1FXIA 3Q6BA 1TTNA 1SE9A 1WE6A 4C4VA 1QT9A 2V3PA 2CJNA 1WH3A 5D3DA 1F2RC 1AYFA 1AW7A 2WXHA 1YJJA 1GJZA 1WR1A 4W9JA 1E8ZA 5BMIA 2BB6A 1TJEA 1OFFA 4II3B 2KACA 2PTLA 3DVNU 4C7YA 3EGRA 5AZHA 4URKA 3AV8A 1TS5A 3IT4B 3DDCB 2M56B 2SAKA 1WGYA 3ML9A 2BKRB 2K3UA 4AJYB 3LDZE 1VZ8A 3C0RB 1VD2A 2LGSA 3AULA 2WXLA 2NCNA 1JW9D 1KJTA 2H89B 2I2YA 1TS4A 2C60A 4HLEA 2K22A 1LM8B 5AZFA 1NYQA 2PW9A 5EE9A 4A3OA 2K0PA 3X23A 1SIFA 4YTPB 3PHXB 3TSSA 4FBJB 4JX1C 2J0JA 3H7PA 3RUIB 1K52A 2JWZA 3W1YA 2DWQA 2Y5BB 3QA8A 5BMGA 3TUOA 2JT4B 3ENEA 4RGMA 4BAXA 3R7RA 4YSZB 3M95A 4MGYE 2L3ZA 2KJHB 3PZ7A 3Q69A 3VAWA 3RMKC 1ZP0B 1WX8A 3IAS1 4NZLB 3AN1A 5HKHA 1SJED 1Q1OA 4LNOA 4E74A 1WXVA 4CYEA 1YN5A 3I3TB 3VH3B 2LUEA 2JSVX 2LZ6A 3U4EG 3EUB2 4L1BA 1F77A 3SD5A 2NBUA 4A8XC 2L83A 4FLHA 2VH2A 2ASQA 1UBIA 1WZ3A 1V1OA 3BIID 2D07B 2KLGA 1NI2A 2IGDA 4FADA 2XK5A 2RR9A 3P42A 4LDTB 2GOWA 1SBBB 2C5LC 1IGDA 3ZLZA 2GI9A 2O2VB 2V4LA 4HDQA 4IWQA 3AEDB 2KTRA 4LTUA 2GBRA 2YEPF 4ARCA 4B0MA 3PGEA 2KJ6A 5GXGB 2AEHA 2OEDA 3UQBA 3DHHC 1C77A 4TSSA 1VJKA 2FNJB 1JMLA 1FNWA 3HUIA 3ZW3A 2LFIA 1EWYC 3WCQA 3BVMA 4JE3B 2PVOD 4TMAB 3ZRCA 2AX5A 3ECIA 1V1PB 2RD0A 2L0TA 3AH7A 3DPDA 2KX3A 3NG0A 1UUPA 5I4DA 1V6EA 2DLBA 2AQ1B 2MBEA 3HVDA 1R4NI 3DBLI 2D11A 2OJWA 1RAXA 3C8YA 2LRWA 2Y3AA 2PLPA 1KOTA 3H7SA 1BXTA 5HG2A 1A70A 1CMXB 3B9JA 3N1XC 4B95A 2G3QB 1T3QA 3SR6A 2QILA 2KZRA 3VTVA 3PTFC 3W5VB 1R7SA 5JH5C 4ZRKA 4BBNF 1FCLA 4RH6A 4NJ7A 4W9EA 1ZPSA 2OJRA 1V81A 1ZW7A 2M19A 1UGMA 1UBQA 1J7CA 3T3NA 2LVPA 3VRAB 2KD0A 1YQ3B 4J3OD 2D3CA 4RFBA 3MP9A 1ET9A 1MHXA 1BMLC 4JWSC 5HFYA 1LO5D 4OZBA 4ZYNA 4N9F4 2JZPA 3PVLA 1V8CA 4N6EB 2X38A 1MVKA 4WWOA 1GUAB 3IBEA 4EZJA 3AE8B 4BOZB 1AWDA 4BFRA 3T9LA 3ZNID 4G0NB 1KLUD 4I6PA 1E8XA 3V61A 3AEFB 4DDGD 3QQ8B 4KSLC 1HZ6A 1VZ7A 4BVUC 4ASWC 3PSEB 2KVZA 2H88B 4H2AA 4IM0A 1WXAA 4XC2A 4DHJD 4KDLB 3DVGY 2SEBD 1K8RB 2G4SA 3NS1A 3ZQ4A 2KX0A 2R2QA 1T0YA 1QOGA 3R8BA 1M94A 2KQ4X 4EUTA 3V05A 1QILA 1E10A 4XWWA 2DAJA 1JWSD 5T8IA 3I9V1 3KUDB 4NQLB 4C80A 4CHKA 1J7AA 3GP7A 4YL8A 1AARA 2EELA 2KNBA 4OZCA 2MBHA 4WQMA 1EU4A 1YOVB 4F1SA 3DHGC 3LYYA 2DENB 3H1UA 5LXHA 2EMTA 5CHFA 2KDMA 3QC8B 2LHEA 1GAQB 4NAMA 3H9DA 3Q8EA 2C7NB 2FCMA 1XD3B 4IKGA 1UD7A 2K25A 3S2AA 2WXKA 4EOYA 4A90A 1WGDA 3SEBA 1OTRB 4A3PA 2G4DB 2QDFA 4ANVA 3V6EB 4GDKA 2N7EA 3PLUA 3E9SA 3IG3A 2KLCA 4B6WA 4WAAA 3JSVA 2AL6A 2BT6A 1WRDB 2J53A 1HTOA 3HIZA 3FC4A 3LB8C 2W54A 3RYTA 4OVUA 2D5GA 3AEGB 1KRHA 1JWMD 3QIJA 4X57B 4XZ4A 2OHFA 2IGHA 1K51A 4IC7B 2DYBA 3DBSA 2K8HA 3FILB 3DBRI 1JWUD 1D5ZC 1WGGA 2INPE 3VHTC 3W9CB 2KKCA 2DBYA 3L17A 4DDID 2WDQB 3MJ5A 4FHKA 5CX3A 1VZ6A 4WWMA 4DXGA 3AU5A 1WZ0A 5BYSA 3L0WB 1P7FA 1TS3A 2PJHA 2Q5WD 4RGTA 1QF6A 1GB1A 1E9MA 3EECA 2HTME 3KVFB 1VRAB 3AI5A 4EEWA 2KYWA 2WWZA 1L0XB 5H8YE 4LNIA 1IBXB 1I42A 4NNJB 1QKZA 1FO4A 1UH6A 1V5OA 2LJ5A 2J0KA 2KWVB 4ZRIA 1WJ4A 3L54A 2J7QB 4RGOS 4M00A 3HHMA 1XCTL 5TR5A 3PZ8A 4RGNA 1PGXA 3P1MA 1XLNA 1OQYA 2FIDA 3AB5A 4G3XB 4MGIE 4WQOB 1EUVB 4TKNA 3P4PB 3APFA 3GZNB 2WDRB 2ZPNA 4MDKE 2GLSA 2IBIB 3QWZB 1H4RA 2BS4B 4IG7B 4W9KA 1DOXA 4IOIE 2PVGC 1YQ4B 1I4GA 3TL5A 1C76A 3U7DA 1FRDA 1KH0A 2V3NA 3NOBA 1D5MC 1D4BA 2QEJC 4KGSA 4JPSA 4HCPB 2WX0A 3ZVVA 2MP2B 2J42A 2NBWB 2VH1A 3NVZA 3IT6B 3RZWC 3W5UB 4GLSC 1KFYB 1RFKA 2CHZA 2WHIA 2M0XA 2EMSA 2WP9B 1YX5B 3IAM1 2NBVB 4GMVA 3TEYA 3P2BA 1UELA 2ONQA 3BYTB 3RNBC 3N1ZC 2WLBA 1L5PA 2MJDA 3MC0B 2LD9A 1WE7A 2N4FA 2UWQA 4AWJA 5J2RA 1XLQA 2IO1B 2K39A 3ALBA 2L05A 4MACA 2CS4A 2KK8A 3LXFA 1DOYA 1RRBA 1SE3A 4KVGB 4IW0A 2KWCA 4FA6A 4GOCA 1BT0A 4ANWA 2RMMA 3W2DA 4XDCA 4QAYA 1I4XA 2D3GA 3V60A 3AE2B 5IA7A 1V80A 3AEAB 1ZOYB 1FCCC 2AYOB 2BYTA 4E71A 2LGYA 2FBWB 1FM0D 4NJ6A 3AE7B 2O6VB 3A9JA 4P6VF 4HPMB 2JZ3B 3B2GA 1WXSA 2E3TA 3PT2B 3BY4B 2RPQA 3N3KB 2AQ3B 1RM6C 1ZDVA 2K5PA 3M63B 4C56C 2L00B 2JPHA 4NQKE 3SDLC 4DHZE 3V6CB 3VDZA 2BYVE 1QOAA 1C3TA 2K6DB 2KDIA 3P63A 4DBGA 2JZZA 4MSMB 3QAQA 2N9EB 1J7BA 3NY5A 2IY0B 3Q8FA 3QHTA 4PT5A 4DK5A 1HEZE 4WJNA 1S3SG 1OQRA 2V9HA 4RM9A 3GS2A 2OOBB 1Z5SB 2KOXA 4YXDB 2IO2B 2N1WA 4BKGA 1V1PA 4AQ7A 1A5RA 3KWVA 2BYFA 1WRIA 4N58A 2WXOA 2PMVA 1XCQL 4KZ0A 3B1LX 1XO3A 3U8ZA 3NJTA 2C9WB 1I4PA 1TKEA 5IOIA 3VTUA 5IO9A 3ZTDA 2WYQA 2Z0DB 3I63C 4KKJA 3KH0A 4FJZA 1LXDA 4HKQA 2ZJDA 3EC8A 2ZEQA 2WS3B 3HM6X 2KMMA 4WJQA 4ZHPA 2INCC 4GIVA 1YN3A 3DVNV 2DX5B 3L4PA 3B0AA 5G55A 1C9FA 1T0RC 1IYFA 3AECB 1WJUA 2L1AA 4MM3A 3WIMA 2WXNA 2YEPB 2LVQA 4HXDA 4RF0A 5D2MB 3Q8AA 1WY8A 1MPEA 2KFKB 1TT5B 4EKUA 3ONSA 5KHOA 1TIFA 1WF9A 1QZEA 4YTMB 4YT0B 2LXCA 2L0FA 3BYYB 1WMHB 3KLSX 4YTNB 1WXMA 2JVCA 4PYUA 2PIAA 2DYMA 3KUZA 4WURA 1WXQA 2A4ZA 2FE8A 3DQVA 3KYCD 3Q8CA 3ZGZA 3DBHI 3EA6A 4KIKA 4A9AA 1UWMA 2LEKA 1GNUA 4C4VB 3NVWA 1K50A 1YX6B 1WIAA 2VZKB 2MRPA 2IGGA 1VDVA 3DVGX
chains in the Genus database with same CATH topology
2IDYA 3R8BA 1ZDXA 2QMTA 3NUHB 2KQ4X 1GPXA 5LNK1 4LK0M 1SB3C 1SE2A 4YSYB 2K9XA 4TQ0A 3V05A 1C4PA 1PGBA 1QILA 1F0ZA 2Y5PA 1B1ZA 1E10A 2ICIA 1QOFA 4XWWA 5E6JA 3R2IA 2W55A 2XNAC 1JWSD 5T8IA 3I9V1 4C80A 5BYRA 1HQRD 4HJGE 1J7AA 1STEA 4ZOHC 2QJLA 1XF5L 1C78A 3NVYA 3BVZA 1EM7A 3GP7A 4L2YA 2Z8LA 1SEBD 1FRRA 2RDGA 2EELA 3VR9B 3NZ3A 4OZCA 2PKOA 5JXVA 3VRBB 3MHZA 4WQMA 1QQRA 1EU4A 1PFDA 2V4IB 3RFZB 4UDUC 2BBCA 3LYYA 1EU3A 3N9YC 4REZA 1TY2A 3ZJVA 1ZUD2 4WAFA 1JQ4A 1I4HA 1HZ5A 4ITKA 2KDMA 1NYRA 1GOZA 1Y56A 2LHEA 1GAQB 4NJCA 4NAMA 3DWMA 3Q8EA 4L23A 1FFVA 1FNVA 2Y5CA 4IKGA 3ZJTA 2WQYB 2ACZB 5EE1A 1SXTA 2TSSA 2WXKA 4OVZA 2N9LA 4A90A 3BVGA 3AMZA 4HEA1 3NRZA 3SEBA 3TEXA 1ZXHA 3O13A 4JWUC 3GB1A 3AE5B 4OHJA 4EE2A 3BZDB 3AEEB 1DYQA 2G9HD 2JYEA 5D3IB 2LGIA 3E9SA 4AS1A 1XXGA 1DGJA 2BT6A 2J53A 2JQRB 4A6QA 3FC4A 3LB8C 2MH7A 1YN4A 2W54A 3HRDD 1WSPA 2D5GA 4HKZE 4MH8A 5HI1A 1TKYA 1L0VB 2KN4A 2WDVB 3AEGB 1KRHA 1JWMD 2ZW0A 1E6EB 1JWAD 2OHFA 2IGHA 1K51A 3AE3B 4D2KA 1PGAA 3P4RB 3FILB 2NMQA 2N7JA 4WH4A 1E7PB 1JWUD 2JXTA 1D5ZC 1M4VA 2INPE 4KKIA 5AUKA 1C4CA 3SFEB 3W9CB 2DBYA 3NVVA 4US8A 4CQNA 2LJIA 4HROA 2IPKD 4O1NA 3FAHA 1E0ZA 1N61A 2VZKD 2W82A 2KWDA 2WDQB 3MJ5A 2I38A 2FUG1 4IDIA 1VZ6A 4WWMA 4KGTA 4DXGA 1I4RA 1L0YB 2WU2B 2WXJA 2HDEA 3V3XA 1WWTA 3BK2A 3CIRB 1P7FA 1TS3A 5BYSA 1SIJA 2Q5WD 4RGTA 1QF6A 3RPFC 2JWUA 1GB1A 3AE4B 1E9MA 4P16A 1C4AA 2HTME 2JYTA 5C2TB 2NTTA 1N62A 5EE3A 1FIQA 3UI3A 4DXFA 3BWUD 1VRAB 3U2SC 4KX6B 1FXAA 1XEEA 5FR3A 1L0XB 5H8YE 1IBXB 1FXIA 1CJEA 1ZXIA 4M0WA 2B76B 3U52E 1NEKB 1QKZA 1FO4A 3P4SB 1P7EA 5C3JB 2IJ0A 1RYJA 1QT9A 2V3PA 2CJNA 5D3DA 1F2RC 1AYFA 1AW7A 2WXHA 1YJJA 4RGOS 5FKAC 2W3SA 1KLGD 1XCTL 3PZ8A 2WXPA 4RGNA 1PGXA 3P1MA 1XLNA 2WNMA 5BMIA 2BS3B 3AB5A 2BB6A 3SFDB 3P4PB 1TJEA 1OFFA 2KACA 2PTLA 4C7YA 2LHDA 2WDRB 3EGRA 3AV8A 1D5XC 3ZJUA 1TS2A 1TS5A 3IT4B 2BS4B 2M56B 1NI3A 2SAKA 2K3UA 1DOXA 1WGKA 4IOIE 2PVGC 1N63A 1YNTE 1FNUA 1VZ8A 2NTSA 1YQ4B 1I4GA 4WIPA 1C76A 1FRDA 2WXLA 1JW9D 2H89B 1KH0A 2V3NA 1D5MC 1KTKA 2LMCA 2I2YA 1TS4A 3KWLA 2K22A 2QEJC 1D4BA 4XDDA 3ETRA 4A55A 4KGSA 1NYQA 2J4XA 4JPSA 2PW9A 5EE9A 2K0PA 5MPOA 2WXRA 3AEBB 2J42A 2L52A 4YTPB 1MHHE 2JU6X 2G1EA 3NVZA 3IT6B 3TSSA 5D7GA 4JX1C 3W5UB 4GLSC 1KFYB 1CK1A 1RFKA 5G5GA 1K52A 4YSXB 1ENFA 2AQ2B 1N60A 2WP9B 3IXSA 2ON8A 3IAM1 1JRPA 5HHDG 2MJEA 4MM3B 2DWQA 3J9CA 1YMHE 3AE6B 1FEHA 2WU5B 5BMGA 3TUOA 2LUMA 3CWIA 5H92C 3TEYA 1V97A 1JROA 2WXMA 4RGMA 2ONQA 3BYTB 1FFUA 5FK9C 4YSZB 2WLBA 1GB4A 1L5PA 3PZ7A 3Q69A 4C7ZA 2MJDA 3MC0B 1TYGB 1TKGA 1ZP0B 3AE1B 1XLPA 3IAS1 1DOIA 3W1SA 4ZYSA 4RF1A 4NZLB 3AN1A 1QOBA 1ESFA 2KAJA 1XLQA 4ARIA 1SJED 3FILA 1ROEA 1YN5A 2QIEB 2GB1A 4MT5A 2JSVX 3U4EG 2MJ3A 3EUB2 2BS2B 4MACA 1AN8A 4L1BA 1F77A 4A8XC 3LXFA 2L83A 1DOYA 2BW2A 1SJHD 3URYA 1V1OA 1SE3A 3BIID 1JALA 2RDHA 2L32A 1BUIC 2IGDA 4XWTA 3P42A 1L4DB 1SBBB 3TEWA 1IGDA 2RMMA 3VQIA 1FMAD 4Q2JA 3W2DA 2GI9A 1NVID 4XDCA 3I57A 1I4XA 1VLBA 3AE2B 4RCOA 1ET6A 2BB5A 4XE0A 3AEAB 1ZOYB 3AEDB 2MEKA 1FCCC 4LTUA 2BYTA 2YEPF 3PO0A 4ARCA 4B0MA 1L6VA 2W3RA 4GDLB 1FD6A 5GXGB 2FBWB 1FM0D 3VR8B 2OEDA 3AE7B 5G5HA 2M0AA 2DYOA 4P6VF 1IBXA 3B2GA 4ZRQA 1C77A 2E3TA 1VJKA 1ACCA 4TSSA 5EE0A 2AQ3B 5BYQA 1JMLA 1Q10A 1RM6C 1FNWA 1ZDVA 3HUIA 2K5PA 2LFIA 3MFGA 1EWYC 1JWBD 4R3DA 4C56C 3WCQA 2BTEA 3BVMA 1PDXA 4JE3B 2PVOD 1D6EC 4TMAB 2R61A 1QOAA 2AX5A 3P4QB 3P63A 2WXGA 4B0EA 1V1PB 3AH7A 1I4QA 1J7BA 1UUPA 5I4DA 3Q8FA 2DLBA 4PT5A 2AQ1B 1VR9A 3U7ZA 1HEZE 1QLBB 1C79A 3HVDA 4OZAA 1OQRA 4YWGG 5BMHA 1L4ZB 3C8YA 4RNAA 3GS2A 4YXDB 1PUTA 2Y3AA 2PLPA 4N59A 2CJOA 1HA5A 2GRIA 1V1PA 3R2TA 1BXTA 1IUEA 1WYGA 3KWVA 1A70A 5HG2A 4AQ7A 1WRIA 4N58A 2WXOA 3B9JA 4HRSA 2PMVA 1XCQL 1XO3A 1MI0A 1UGJA 5TSSA 1T3QA 1N5XA 3SR6A 2QILA 4ZRPA 1I4PA 1TKEA 1OQQA 1ZE3D 3W5VB 2WXFA 3T3OA 1SE4A 1R7SA 4GDKB 4US9A 4KKJA 2JX5A 1FCLA 4RH6A 1ZPSA 1I7HA 1KF6B 3Q8BA 1YJIA 4TQ1A 4HKQA 2M19A 1T5XD 1TY0A 1TZOA 1UWXA 2EKIA 2WS3B 2KMMA 3H8HA 4ZHPA 1J7CA 1N5WA 4ZHOA 3T3NA 3ZYYX 3VRAB 2WXQA 1YN3A 1YQ3B 4J3OD 4RFBA 2N0SB 3MP9A 3L4PA 2QSDA 1C9FA 2CU3A 2E6XA 1ET9A 1MHXA 3AECB 3OWEB 1B9RA 1BMLC 4JWSC 2L1AA 5HFYA 1LO5D 4OZBA 2WXNA 2YEPB 2JZPA 4RF0A 4OW0A 3Q8AA 1V8CA 2XN9C 1CZPA 1MPEA 4N6EB 1XLOA 2X38A 3BK1A 1MVKA 1K53A 4LLGM 2J52A 3DWGC 1UNSA 3E56A 3HVZA 4YTMB 3AE8B 1AWDA 2ZW1A 4YT0B 3BYYB 3KLSX 1KLUD 4YTNB 1SF0A 1CQVA 4NAWB 2PIAA 3AEFB 2DYMA 1NENB 1HZ6A 1VZ7A 2WXIA 1T6BX 3AE9B 4FXCA 1SSNA 4WURA 3TEZA 2H88B 1WXQA 2FE8A 4H2AA 3KQ4A 3Q8CA 3AM9A 3ZGZA 4USAA 3EA6A 1L6UA 1EWCA 5AUIA 4A9AA 1HXYD 1UWMA 2N9KA 2LEKA 3NVWA 2INNE 1K50A 1RWSA 2SEBD 4KGRA 4DQOC 3ABVB 1IGCA 2VZKB 2RPVA 2V0GA 1PYWD 2IGGA 3NS1A 1JCKB 1VDVA 1F2RI 3ZQ4A 3B2FA 1QOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YXD B;  1PUT A;  2MJE A;  2DWQ A;  4N59 A;  3AE6 B;  2CJO A;  4IDI A;  2WU5 B;  4WWM A;  1GPX A;  1IUE A;  1WYG A;  3CWI A;  1SB3 C;  1A70 A;  5H92 C;  4YSY B;  1WRI A;  4N58 A;  2K9X A;  1V97 A;  1JRO A;  2WU2 B;  3B9J A;  4HRS A;  1F0Z A;  1WWT A;  1FFU A;  3CIR B;  1XO3 A;  1E10 A;  1SIJ A;  2Q5W D;  4YSZ B;  1QF6 A;  1QOF A;  2WLB A;  1T3Q A;  1N5X A;  3RPF C;  3SR6 A;  3AE4 B;  1E9M A;  2W55 A;  1L5P A;  1TKE A;  1OQQ A;  3W5V B;  2HTM E;  4C7Z A;  2MJD A;  5C2T B;  1R7S A;  1N62 A;  1TYG B;  5EE3 A;  1TKG A;  1ZP0 B;  3AE1 B;  1FIQ A;  4ZOH C;  1J7A A;  4C80 A;  2QJL A;  1XLP A;  3NVY A;  4US9 A;  1DOI A;  4KX6 B;  1FXA A;  3AN1 A;  5H8Y E;  1QOB A;  1FRR A;  2JX5 A;  1FXI A;  2KAJ A;  1CJE A;  3VR9 B;  1I7H A;  1KF6 B;  1XLQ A;  1ZXI A;  2PKO A;  3VRB B;  1YJI A;  2B76 B;  1NEK B;  1N61 A;  4WQM A;  1ROE A;  2M19 A;  3P4S B;  1FO4 A;  2QIE B;  2MJ3 A;  5C3J B;  1RYJ A;  3EUB 2;  1PFD A;  2BS2 B;  2EKI A;  1QT9 A;  2WS3 B;  3LXF A;  2KMM A;  2L83 A;  2CJN A;  1DOY A;  4ZHP A;  1J7C A;  1N5W A;  4ZHO A;  1ZUD 2;  3ZYY X;  1JQ4 A;  1AYF A;  3VRA B;  1YJJ A;  3BII D;  1YQ3 B;  1JAL A;  1NYR A;  4ITK A;  2N0S B;  1GAQ B;  3L4P A;  2CU3 A;  2W3S A;  3DWM A;  3AEC B;  1B9R A;  3P1M A;  1FFV A;  1XLN A;  4JWS C;  2Y5C A;  1FMA D;  2BS3 B;  2WQY B;  1NVI D;  3AB5 A;  1V8C A;  2ACZ B;  1VLB A;  1CZP A;  5EE1 A;  3P4P B;  3SFD B;  3AE2 B;  4N6E B;  1XLO A;  1TJE A;  3AMZ A;  1OFF A;  3AEA B;  3NRZ A;  1ZOY B;  3AED B;  4C7Y A;  4JWU C;  4LTU A;  2WDR B;  3AV8 A;  3DWG C;  3HVZ A;  3PO0 A;  1L6V A;  4YTM B;  3AE8 B;  2W3R A;  3AE5 B;  1AWD A;  4YT0 B;  2BS4 B;  2M56 B;  1NI3 A;  3AEE B;  5GXG B;  2FBW B;  1FM0 D;  3VR8 B;  3AE7 B;  5G5H A;  1DOX A;  1WGK A;  4YTN B;  1SF0 A;  2PVG C;  4P6V F;  1N63 A;  3B2G A;  2PIA A;  1YQ4 B;  2E3T A;  1VJK A;  1DGJ A;  2BT6 A;  2JQR B;  3AEF B;  5EE0 A;  3FC4 A;  3LB8 C;  1NEN B;  1FRD A;  1JW9 D;  2MH7 A;  2W54 A;  2H89 B;  1RM6 C;  3HRD D;  3AE9 B;  4FXC A;  3HUI A;  1TKY A;  1L0V B;  2K5P A;  2WDV B;  2H88 B;  3AEG B;  1KRH A;  2K22 A;  1EWY C;  1JWB D;  1WXQ A;  1E6E B;  3KWL A;  3ETR A;  1JWA D;  2OHF A;  3WCQ A;  1NYQ A;  3AE3 B;  1PDX A;  3AM9 A;  2PVO D;  4USA A;  5EE9 A;  3P4R B;  1L6U A;  5MPO A;  1QOA A;  1E7P B;  2AX5 A;  3AEB B;  5AUI A;  3P4Q B;  2L52 A;  3P63 A;  4YTP B;  4A9A A;  1UWM A;  2G1E A;  2LEK A;  3AH7 A;  3NVZ A;  3NVW A;  2WDQ B;  1J7B A;  4JX1 C;  5AUK A;  1RWS A;  3W5U B;  1KFY B;  1RFK A;  3ABV B;  5G5G A;  4YSX B;  1QLB B;  3SFE B;  3W9C B;  2DBY A;  3NVV A;  4US8 A;  1N60 A;  1OQR A;  2WP9 B;  3NS1 A;  1VDV A;  4HRO A;  3B2F A;  1JRP A;  3FAH A;  1E0Z A;  1QOG A; 
#chains in the Genus database with same CATH topology
 2HJ1 A;  4GDL A;  4LK0 M;  4DWF A;  4YSY B;  4TQ0 A;  1PGB A;  4II2 B;  3Q3F A;  3L08 A;  5FR6 A;  2DZM A;  4I6N B;  5BYR A;  2BVC A;  3R7Q A;  2HJ8 A;  1TBE A;  2KWU B;  2Z8L A;  1SEB D;  3VR9 B;  3VRB B;  3A4R A;  1G6J A;  3WAM A;  3A33 B;  4PK1 A;  1IP9 A;  2YVC A;  1EU3 A;  2CU1 A;  4REZ A;  5CHV C;  5JHB A;  4ITK A;  1GOZ A;  1Y56 A;  3DWM A;  4L23 A;  3RI7 C;  1FFV A;  1ZGU B;  3ZJT A;  1E8W A;  3H7P B;  2TSS A;  4OVZ A;  2N9L A;  3BVG A;  3AMZ A;  3NRZ A;  4EFO A;  4JWU C;  3GB1 A;  5DCN A;  2GMI C;  3V62 A;  4EE2 A;  3GOE A;  1DYQ A;  2WX1 A;  2LGI A;  4MGK E;  4HPP A;  1OEY A;  4A6Q A;  2MH7 A;  1WSP A;  3NZS A;  4MH8 A;  1TKY A;  2KN4 A;  2WDV B;  1V5T A;  2I1J A;  1N6Z A;  2HE7 A;  4XYC A;  2N7J A;  2BYE A;  1ISN A;  3ZRF A;  3WAO A;  2JXT A;  3PRP B;  5DPR A;  3O65 B;  5AUK A;  2KFJ A;  2R2O A;  4NY0 A;  1WR6 E;  4GB9 A;  2JRI B;  2XK5 B;  4JGH B;  2FUG 1;  1EF1 A;  2C7M B;  3QCA A;  5AEK B;  1L0Y B;  3HK0 A;  3V3X A;  4IWO A;  2KTR B;  4NAW A;  2JWU A;  4GXB A;  1T0S C;  4ZDV A;  3WAL A;  4ACF A;  1N62 A;  5EE3 A;  1FIQ A;  2FIF A;  3CMM B;  3DCG A;  3SHQ A;  4KX6 B;  2BGF A;  3VUY A;  1MG8 A;  3N32 A;  4GU2 A;  4M0W A;  3A4S C;  2B76 B;  1NEK B;  3A1Q B;  1P7E A;  3P4S B;  5C3J B;  2IJ0 A;  5L83 A;  3A9K A;  3VUX A;  3X0W A;  2REX A;  4JL9 A;  1C1Y B;  5FKA C;  2W3S A;  1YIW A;  1KLG D;  2KVR A;  2LWP A;  3PS6 A;  3Q3M C;  2WNM A;  2J0M A;  3I5J C;  3RNF C;  3WAN A;  3RNG C;  1YD8 U;  4KZC A;  2KT7 A;  4EZL A;  1P0R A;  1GC7 A;  4CO7 A;  4GGQ A;  3ZJU A;  1LFD A;  4ZRJ A;  5J17 A;  1NI3 A;  3VTW A;  1WGK A;  2LGD A;  5D6J B;  1FNU A;  2NTS A;  4WIP A;  2IO3 B;  2BPS A;  1YQB A;  1KTK A;  3ETR A;  4A55 A;  4W9C A;  5LLI A;  4RM8 A;  3APC A;  1E8Y A;  1MHH E;  1UZX B;  2G1E A;  3N1Y C;  2PE9 A;  4FJV B;  4W9D A;  3ZXV A;  2LXA A;  4WWP A;  1CK1 A;  5G5G A;  4YSX B;  4GSW A;  3RCZ A;  1ENF A;  2AQ2 B;  3R66 C;  5IP4 D;  3IXS A;  2ON8 A;  3JYU A;  2DNF A;  5HHD G;  1FEH A;  3ZUN A;  3CWI A;  4TUU A;  2WXM A;  1KLV A;  5FK9 C;  3AXC A;  1GB4 A;  4C7Z A;  4OVV A;  1DOI A;  1E90 A;  4RF1 A;  5KHQ A;  4MJS A;  1QOB A;  2UU7 A;  4ANU A;  2KAJ A;  3MC8 A;  3TJP A;  1Q5W B;  1MJD A;  2QIE B;  4MT5 A;  2MJ3 A;  3CF6 E;  4ANX A;  1S1Q B;  3QAR A;  1SJH D;  2KDB A;  3URY A;  4MH0 E;  1JAL A;  1Q0W B;  1BUI C;  2GBN A;  2MSE D;  2K6Q A;  2ZNV B;  1RFA A;  2PE6 B;  1L4D B;  3ZXR A;  3VQI A;  1P1A A;  4Q2J A;  3EFC A;  2HD5 B;  4LNK A;  3I57 A;  1VLB A;  1ET6 A;  1GG3 A;  4HPL B;  4XX5 A;  3ZNZ B;  2M0A A;  2KTF A;  3UIP B;  2FCN A;  1ACC A;  5BYQ A;  4LJP B;  3GE8 C;  4F7Z A;  3MFG A;  2QCZ A;  4JLC A;  1WX9 A;  2BTE A;  2I1K A;  3M62 B;  2R61 A;  4DHJ B;  2KN5 A;  3PZD A;  4B0E A;  4BKT A;  2KC1 A;  1WI0 A;  1I4Q A;  4BZA A;  2MBB B;  2L7R A;  3U7Z A;  1QLB B;  5AZG A;  2KMA A;  4OZA A;  3Q3O C;  1L4Z B;  4RNA A;  3LJ3 A;  5DPT A;  3TCA A;  1L7Y A;  1PUT A;  4N59 A;  2GRI A;  3PRZ A;  3R2T A;  1LGR A;  4FN2 A;  2DAF A;  4HRS A;  4MEL A;  5DPW A;  2LRU A;  3CST A;  1MI0 A;  1WGR A;  2JY6 A;  5TSS A;  3RD2 A;  4K7U A;  1OQQ A;  1ZE3 D;  4ICV A;  1SE4 A;  3DOW A;  4GDK B;  5EDS A;  1UF0 A;  4US9 A;  2JX5 A;  1I7H A;  1KF6 B;  3Q8B A;  1YJI A;  4TQ1 A;  2MBO A;  5GMV A;  1T5X D;  1TY0 A;  4W9H A;  3HM3 A;  2ZVN A;  3ZNG C;  3RNC C;  1N5W A;  1R4M B;  1MFW A;  1SGH A;  2KJR A;  2CU3 A;  2E6X A;  2BF8 B;  2LGX A;  4BKS D;  3VH4 B;  4HVB A;  3B08 A;  1TGZ B;  4OW0 A;  4LDT D;  1CZP A;  3Q3N C;  3PLV A;  4LLG M;  3JW0 X;  2J52 A;  1UNS A;  3E56 A;  1XT9 B;  2ZW1 A;  2Z59 B;  2DZK A;  1H8C A;  1SF0 A;  3CSF A;  1WX7 A;  2MW5 A;  1NEN B;  2D3B A;  1YJ1 A;  2WXI A;  1T6B X;  4GN1 A;  4K7W A;  4FXC A;  4PS8 A;  1SSN A;  1V2Y A;  2W9N A;  3KQ4 A;  4USA A;  1L6U A;  3RT3 B;  4BKS A;  1T0Q C;  5AUI A;  1HXY D;  2ZCC A;  4LNF A;  4M8N A;  2INN E;  4K3C A;  2RGF A;  2UYZ B;  1RWS A;  4KGR A;  3ABV B;  2V0G A;  2O2V A;  2D10 A;  1JCK B;  1F2R I;  1TZ1 A;  3UQA A;  3QX1 A;  3ZIM A;  1ZDX A;  2IZV B;  2QMT A;  1GPX A;  5LNK 1;  1L2N A;  1C4P A;  3RNE C;  1F0Z A;  2Y5P A;  3L16 A;  3K9P B;  3EHV A;  3NS8 A;  2MBQ A;  3R2I A;  4PS3 A;  2W55 A;  3WA0 A;  1WGH A;  2GBJ A;  4S17 A;  4HJG E;  4WJP A;  4ZOH C;  2QJL A;  1C78 A;  2K8C A;  3TBL D;  4M8M A;  1FRR A;  3GZN I;  3H6N A;  3NZ3 A;  5JXV A;  1R4N B;  4P7I A;  3VVW B;  3DBL B;  2ZCB A;  1QQR A;  2DZJ A;  3RFZ B;  2BBC A;  3BIN A;  2NPT B;  1ZUD 2;  2XEW A;  1I4H A;  2X8X X;  5J18 A;  1NYR A;  3ZDT A;  2L8J A;  2KHW B;  1I35 A;  2M8S A;  4BOS C;  2Y5C A;  2BQQ A;  5EE1 A;  2N9P C;  4KV2 A;  5IN7 A;  4IWP A;  2GBK A;  4KDI C;  4HEA 1;  4G50 A;  3TEX A;  2LAS A;  1ZXH A;  4FJY A;  4FHJ A;  1Z2M A;  4OHJ A;  4J6I A;  1VCB A;  2JYE A;  2IO0 B;  4E3C A;  4AS1 A;  3R3M A;  1Y8R C;  5D94 A;  1XXG A;  1DGJ A;  2JQR B;  1YN4 A;  5G2N A;  4ICU A;  2EKE C;  2CHW A;  4HKZ E;  5HI1 A;  1X1M A;  3QK0 A;  2ZW0 A;  1JWA D;  3IVF A;  1R4M I;  1PGA A;  3P4R B;  4JQW C;  2NVU I;  3PRE A;  2ZPY A;  2KXJ A;  1E5W A;  1V9J A;  3GE3 C;  4KKI A;  1C4C A;  3SFE B;  1P98 A;  3TMP B;  3NVV A;  4US8 A;  3FKY A;  4CQN A;  2IY1 B;  2IYD B;  2LJI A;  4HRO A;  2V3S A;  2W82 A;  4PYZ A;  3OAW A;  4HDO A;  5E6P A;  2WXJ A;  2HDE A;  3BK2 A;  4K7S A;  3RPF C;  2RDB C;  1C4A A;  3OG5 A;  2NTT A;  3UI3 A;  4DXF A;  5JZE B;  2K1F A;  2MQJ A;  3U2S C;  1XEE A;  3A9J B;  5FR3 A;  5DPS A;  3KW5 B;  1CJE A;  4XGA B;  1ZXI A;  2BKF A;  3U52 E;  3EFU A;  2AL3 A;  1RYJ A;  2B3A A;  1U4A A;  2M4N A;  4W9I A;  4PS7 A;  4HK2 A;  4W9L A;  2V1Y A;  3ZKJ C;  4MEM A;  3RUL A;  2WXP A;  4IM3 A;  3A1Q A;  2BS3 B;  3SFD B;  5IAA C;  3NZU A;  2LHD A;  1D5X C;  1TS2 A;  2JUO A;  3ZO5 B;  3KYD D;  5C1Z A;  1N63 A;  1YNT E;  3VFK A;  3Q3J A;  3VUW A;  2LMC A;  1J8C A;  3Q14 C;  3KWL A;  4XDD A;  2XBB C;  5CTR C;  2QHO A;  2J4X A;  2IND C;  5MPO A;  2WXR A;  3AEB B;  2L52 A;  2JU6 X;  1FPY A;  2KDF B;  1V86 A;  1P3Q U;  5D7G A;  4HCN B;  3L10 B;  1N60 A;  2FAZ A;  1JRP A;  5E6N A;  2FUH B;  2MJE A;  4MM3 B;  3J9C A;  1YMH E;  3AE6 B;  4LNN A;  2WU5 B;  2D3A A;  1JRU A;  2LUM A;  2JXX A;  5H92 C;  1V97 A;  1JRO A;  4F8C B;  1FFU A;  4HWI B;  4RMA A;  2KAN A;  3DBR B;  2M1M A;  1TYG B;  1TKG A;  3AE1 B;  2MX2 A;  1XLP A;  4NPN A;  5CHW A;  3W1S A;  4ZYS A;  3D32 A;  1ESF A;  3OJ3 A;  4K1R B;  3UGB B;  2D2Q A;  4ARI A;  3FIL A;  1ROE A;  2GB1 A;  2BS2 B;  1AN8 A;  2BW2 A;  1HTQ A;  3K9O B;  2RDH A;  5JHA A;  2L32 A;  4KIK B;  1F52 A;  3IHP C;  4XWT A;  2CKH B;  3TEW A;  3U30 A;  1FMA D;  4K3B A;  2MWS B;  1NVI D;  3MTN B;  2MCN B;  2KO3 A;  4KSK C;  2VRR B;  4RCO A;  2BB5 A;  4XE0 A;  2MEK A;  5L95 C;  3PO0 A;  1L6V A;  2W3R A;  4GDL B;  1FD6 A;  3UF8 A;  2HTH A;  3VR8 B;  5G5H A;  4B9K A;  4LCD E;  2DYO A;  1IBX A;  3N20 C;  4M02 A;  4ZRQ A;  5EE0 A;  1P9D U;  3IFW B;  1Q10 A;  1WFY A;  1GC6 A;  2BWF A;  3OJ4 B;  1JWB D;  4R3D A;  3MC9 A;  4IUM B;  1PDX A;  1D6E C;  2A5U A;  4WJO A;  3P4Q B;  4TV3 A;  2WXG A;  2MLB A;  4DXA B;  4EZK A;  2MHJ A;  4W9F A;  4LJO B;  4BBN C;  1VR9 A;  3MJW A;  4P1B C;  1C79 A;  1NDD A;  4YWG G;  5BMH A;  3OLM D;  1E7V A;  1E7U A;  2CJO A;  1HA5 A;  1IUE A;  1WYG A;  2CHX A;  2G45 B;  3PRM B;  1ZKH A;  1UGJ A;  1J19 A;  1N5X A;  4JIO U;  4ZRP A;  2WXF A;  3T3O A;  1MG4 A;  2PEA A;  3UIO B;  2JRH A;  4C00 A;  2MP2 A;  1J0G A;  2K8B A;  1TZO A;  1UWX A;  2EKI A;  2CR5 A;  3H8H A;  4W9G A;  4ZHO A;  2ZZP B;  3ZYY X;  2JF5 A;  2WXQ A;  2KMC A;  2FCQ A;  2N0S B;  2QSD A;  2WDT B;  3OWE B;  1B9R A;  3PV1 A;  4MGZ E;  4FUL A;  1KM7 A;  4MSQ B;  2XN9 C;  2LI5 A;  4P1C C;  1XLO A;  3BK1 A;  1IPG A;  1K53 A;  3DWG C;  3HVZ A;  5IKC M;  3RNA C;  1CQV A;  3M3J A;  4NAW B;  3MHS D;  2O6V D;  1WJN A;  3SU8 X;  3PHW B;  3AE9 B;  1WYW B;  2FCS A;  3TEZ A;  1D3Z A;  2N7D A;  2KQS A;  3AM9 A;  1F9J A;  3KUC B;  4M0W B;  1EWC A;  2N9X A;  3RN9 C;  1OEY J;  2N9K A;  2L76 A;  3AU4 A;  3A9K B;  2YLM A;  2NR2 A;  1EO6 A;  4DQO C;  4I6L B;  1IGC A;  2RPV A;  1PYW D;  2C7H A;  2N1V A;  3B2F A;  2IDY A;  3NUH B;  3TIX A;  1SB3 C;  1SE2 A;  2KDE B;  2PPH A;  2K9X A;  2O6V A;  1B1Z A;  2ICI A;  3NHE B;  1QOF A;  5E6J A;  4AJW A;  1WM2 A;  2M17 A;  2XNA C;  2LVO A;  1XQQ A;  3L13 A;  2QC8 A;  1WM3 A;  1HQR D;  1STE A;  4IM2 A;  1XF5 L;  3NVY A;  3BVZ A;  1EM7 A;  3RZF A;  4L2Y A;  2RDG A;  2PKO A;  5LXI B;  3MHZ A;  3WAP A;  1PFD A;  2GBM A;  2V4I B;  4UDU C;  1LQB A;  3N9Y C;  1TY2 A;  3ZJV A;  4WAF A;  1JQ4 A;  1RLF A;  1HZ5 A;  2MA9 B;  4NJC A;  2KQ7 A;  3ZNH B;  1PQS A;  5C23 A;  4DHZ B;  1FNV A;  4AP4 C;  2WQY B;  3QJZ A;  2ACZ B;  3JSV B;  1SXT A;  2NPT A;  2DZI A;  4M01 A;  2DHZ A;  4AUQ C;  3O13 A;  1OGW A;  3AE5 B;  1NBF C;  5BO4 B;  1HE8 A;  3BZD B;  3AEE B;  2G9H D;  3VXW A;  1WJ6 A;  1V49 A;  3UIN B;  5D3I B;  3JVZ X;  3C19 A;  2KC2 A;  3ZTC A;  3HRD D;  1F1H A;  3Q2A C;  1L0V B;  4A20 A;  1EF5 A;  4MJS B;  3ML8 A;  4WWN A;  1E6E B;  3AE3 B;  4D2K A;  2Z0E B;  4WH4 A;  2NMQ A;  3DHI C;  1E7P B;  3W1S C;  3APD A;  2ZVO A;  2NS5 A;  2WGS A;  1M4V A;  4S0R A;  4G11 A;  1FXT B;  4AOF A;  2KFK A;  5E6O A;  2IPK D;  4O1N A;  2RSU A;  3FAH A;  1E0Z A;  1N61 A;  2VZK D;  2KWD A;  3ZDM C;  2I38 A;  4K81 A;  2BWE S;  4IDI A;  3PPA A;  4KGT A;  4HJK A;  3N30 A;  1WMH A;  1I4R A;  2WU2 B;  1WWT A;  2AWT A;  3CIR B;  1SIJ A;  3DBH B;  3AE4 B;  4P16 A;  2JYT A;  5C2T B;  3BWU D;  1FXA A;  2ZNV C;  3T8M A;  1FXI A;  3Q6B A;  1TTN A;  1SE9 A;  1WE6 A;  4C4V A;  1QT9 A;  2V3P A;  2CJN A;  1WH3 A;  5D3D A;  1F2R C;  1AYF A;  1AW7 A;  2WXH A;  1YJJ A;  1GJZ A;  1WR1 A;  4W9J A;  1E8Z A;  5BMI A;  2BB6 A;  1TJE A;  1OFF A;  4II3 B;  2KAC A;  2PTL A;  3DVN U;  4C7Y A;  3EGR A;  5AZH A;  4URK A;  3AV8 A;  1TS5 A;  3IT4 B;  3DDC B;  2M56 B;  2SAK A;  1WGY A;  3ML9 A;  2BKR B;  2K3U A;  4AJY B;  3LDZ E;  1VZ8 A;  3C0R B;  1VD2 A;  2LGS A;  3AUL A;  2WXL A;  2NCN A;  1JW9 D;  1KJT A;  2H89 B;  2I2Y A;  1TS4 A;  2C60 A;  4HLE A;  2K22 A;  1LM8 B;  5AZF A;  1NYQ A;  2PW9 A;  5EE9 A;  4A3O A;  2K0P A;  3X23 A;  1SIF A;  4YTP B;  3PHX B;  3TSS A;  4FBJ B;  4JX1 C;  2J0J A;  3H7P A;  3RUI B;  1K52 A;  2JWZ A;  3W1Y A;  2DWQ A;  2Y5B B;  3QA8 A;  5BMG A;  3TUO A;  2JT4 B;  3ENE A;  4RGM A;  4BAX A;  3R7R A;  4YSZ B;  3M95 A;  4MGY E;  2L3Z A;  2KJH B;  3PZ7 A;  3Q69 A;  3VAW A;  3RMK C;  1ZP0 B;  1WX8 A;  3IAS 1;  4NZL B;  3AN1 A;  5HKH A;  1SJE D;  1Q1O A;  4LNO A;  4E74 A;  1WXV A;  4CYE A;  1YN5 A;  3I3T B;  3VH3 B;  2LUE A;  2JSV X;  2LZ6 A;  3U4E G;  3EUB 2;  4L1B A;  1F77 A;  3SD5 A;  2NBU A;  4A8X C;  2L83 A;  4FLH A;  2VH2 A;  2ASQ A;  1UBI A;  1WZ3 A;  1V1O A;  3BII D;  2D07 B;  2KLG A;  1NI2 A;  2IGD A;  4FAD A;  2XK5 A;  2RR9 A;  3P42 A;  4LDT B;  2GOW A;  1SBB B;  2C5L C;  1IGD A;  3ZLZ A;  2GI9 A;  2O2V B;  2V4L A;  4HDQ A;  4IWQ A;  3AED B;  2KTR A;  4LTU A;  2GBR A;  2YEP F;  4ARC A;  4B0M A;  3PGE A;  2KJ6 A;  5GXG B;  2AEH A;  2OED A;  3UQB A;  3DHH C;  1C77 A;  4TSS A;  1VJK A;  2FNJ B;  1JML A;  1FNW A;  3HUI A;  3ZW3 A;  2LFI A;  1EWY C;  3WCQ A;  3BVM A;  4JE3 B;  2PVO D;  4TMA B;  3ZRC A;  2AX5 A;  3ECI A;  1V1P B;  2RD0 A;  2L0T A;  3AH7 A;  3DPD A;  2KX3 A;  3NG0 A;  1UUP A;  5I4D A;  1V6E A;  2DLB A;  2AQ1 B;  2MBE A;  3HVD A;  1R4N I;  3DBL I;  2D11 A;  2OJW A;  1RAX A;  3C8Y A;  2LRW A;  2Y3A A;  2PLP A;  1KOT A;  3H7S A;  1BXT A;  5HG2 A;  1A70 A;  1CMX B;  3B9J A;  3N1X C;  4B95 A;  2G3Q B;  1T3Q A;  3SR6 A;  2QIL A;  2KZR A;  3VTV A;  3PTF C;  3W5V B;  1R7S A;  5JH5 C;  4ZRK A;  4BBN F;  1FCL A;  4RH6 A;  4NJ7 A;  4W9E A;  1ZPS A;  2OJR A;  1V81 A;  1ZW7 A;  2M19 A;  1UGM A;  1UBQ A;  1J7C A;  3T3N A;  2LVP A;  3VRA B;  2KD0 A;  1YQ3 B;  4J3O D;  2D3C A;  4RFB A;  3MP9 A;  1ET9 A;  1MHX A;  1BML C;  4JWS C;  5HFY A;  1LO5 D;  4OZB A;  4ZYN A;  4N9F 4;  2JZP A;  3PVL A;  1V8C A;  4N6E B;  2X38 A;  1MVK A;  4WWO A;  1GUA B;  3IBE A;  4EZJ A;  3AE8 B;  4BOZ B;  1AWD A;  4BFR A;  3T9L A;  3ZNI D;  4G0N B;  1KLU D;  4I6P A;  1E8X A;  3V61 A;  3AEF B;  4DDG D;  3QQ8 B;  4KSL C;  1HZ6 A;  1VZ7 A;  4BVU C;  4ASW C;  3PSE B;  2KVZ A;  2H88 B;  4H2A A;  4IM0 A;  1WXA A;  4XC2 A;  4DHJ D;  4KDL B;  3DVG Y;  2SEB D;  1K8R B;  2G4S A;  3NS1 A;  3ZQ4 A;  2KX0 A;  2R2Q A;  1T0Y A;  1QOG A;  3R8B A;  1M94 A;  2KQ4 X;  4EUT A;  3V05 A;  1QIL A;  1E10 A;  4XWW A;  2DAJ A;  1JWS D;  5T8I A;  3I9V 1;  3KUD B;  4NQL B;  4C80 A;  4CHK A;  1J7A A;  3GP7 A;  4YL8 A;  1AAR A;  2EEL A;  2KNB A;  4OZC A;  2MBH A;  4WQM A;  1EU4 A;  1YOV B;  4F1S A;  3DHG C;  3LYY A;  2DEN B;  3H1U A;  5LXH A;  2EMT A;  5CHF A;  2KDM A;  3QC8 B;  2LHE A;  1GAQ B;  4NAM A;  3H9D A;  3Q8E A;  2C7N B;  2FCM A;  1XD3 B;  4IKG A;  1UD7 A;  2K25 A;  3S2A A;  2WXK A;  4EOY A;  4A90 A;  1WGD A;  3SEB A;  1OTR B;  4A3P A;  2G4D B;  2QDF A;  4ANV A;  3V6E B;  4GDK A;  2N7E A;  3PLU A;  3E9S A;  3IG3 A;  2KLC A;  4B6W A;  4WAA A;  3JSV A;  2AL6 A;  2BT6 A;  1WRD B;  2J53 A;  1HTO A;  3HIZ A;  3FC4 A;  3LB8 C;  2W54 A;  3RYT A;  4OVU A;  2D5G A;  3AEG B;  1KRH A;  1JWM D;  3QIJ A;  4X57 B;  4XZ4 A;  2OHF A;  2IGH A;  1K51 A;  4IC7 B;  2DYB A;  3DBS A;  2K8H A;  3FIL B;  3DBR I;  1JWU D;  1D5Z C;  1WGG A;  2INP E;  3VHT C;  3W9C B;  2KKC A;  2DBY A;  3L17 A;  4DDI D;  2WDQ B;  3MJ5 A;  4FHK A;  5CX3 A;  1VZ6 A;  4WWM A;  4DXG A;  3AU5 A;  1WZ0 A;  5BYS A;  3L0W B;  1P7F A;  1TS3 A;  2PJH A;  2Q5W D;  4RGT A;  1QF6 A;  1GB1 A;  1E9M A;  3EEC A;  2HTM E;  3KVF B;  1VRA B;  3AI5 A;  4EEW A;  2KYW A;  2WWZ A;  1L0X B;  5H8Y E;  4LNI A;  1IBX B;  1I42 A;  4NNJ B;  1QKZ A;  1FO4 A;  1UH6 A;  1V5O A;  2LJ5 A;  2J0K A;  2KWV B;  4ZRI A;  1WJ4 A;  3L54 A;  2J7Q B;  4RGO S;  4M00 A;  3HHM A;  1XCT L;  5TR5 A;  3PZ8 A;  4RGN A;  1PGX A;  3P1M A;  1XLN A;  1OQY A;  2FID A;  3AB5 A;  4G3X B;  4MGI E;  4WQO B;  1EUV B;  4TKN A;  3P4P B;  3APF A;  3GZN B;  2WDR B;  2ZPN A;  4MDK E;  2GLS A;  2IBI B;  3QWZ B;  1H4R A;  2BS4 B;  4IG7 B;  4W9K A;  1DOX A;  4IOI E;  2PVG C;  1YQ4 B;  1I4G A;  3TL5 A;  1C76 A;  3U7D A;  1FRD A;  1KH0 A;  2V3N A;  3NOB A;  1D5M C;  1D4B A;  2QEJ C;  4KGS A;  4JPS A;  4HCP B;  2WX0 A;  3ZVV A;  2MP2 B;  2J42 A;  2NBW B;  2VH1 A;  3NVZ A;  3IT6 B;  3RZW C;  3W5U B;  4GLS C;  1KFY B;  1RFK A;  2CHZ A;  2WHI A;  2M0X A;  2EMS A;  2WP9 B;  1YX5 B;  3IAM 1;  2NBV B;  4GMV A;  3TEY A;  3P2B A;  1UEL A;  2ONQ A;  3BYT B;  3RNB C;  3N1Z C;  2WLB A;  1L5P A;  2MJD A;  3MC0 B;  2LD9 A;  1WE7 A;  2N4F A;  2UWQ A;  4AWJ A;  5J2R A;  1XLQ A;  2IO1 B;  2K39 A;  3ALB A;  2L05 A;  4MAC A;  2CS4 A;  2KK8 A;  3LXF A;  1DOY A;  1RRB A;  1SE3 A;  4KVG B;  4IW0 A;  2KWC A;  4FA6 A;  4GOC A;  1BT0 A;  4ANW A;  2RMM A;  3W2D A;  4XDC A;  4QAY A;  1I4X A;  2D3G A;  3V60 A;  3AE2 B;  5IA7 A;  1V80 A;  3AEA B;  1ZOY B;  1FCC C;  2AYO B;  2BYT A;  4E71 A;  2LGY A;  2FBW B;  1FM0 D;  4NJ6 A;  3AE7 B;  2O6V B;  3A9J A;  4P6V F;  4HPM B;  2JZ3 B;  3B2G A;  1WXS A;  2E3T A;  3PT2 B;  3BY4 B;  2RPQ A;  3N3K B;  2AQ3 B;  1RM6 C;  1ZDV A;  2K5P A;  3M63 B;  4C56 C;  2L00 B;  2JPH A;  4NQK E;  3SDL C;  4DHZ E;  3V6C B;  3VDZ A;  2BYV E;  1QOA A;  1C3T A;  2K6D B;  2KDI A;  3P63 A;  4DBG A;  2JZZ A;  4MSM B;  3QAQ A;  2N9E B;  1J7B A;  3NY5 A;  2IY0 B;  3Q8F A;  3QHT A;  4PT5 A;  4DK5 A;  1HEZ E;  4WJN A;  1S3S G;  1OQR A;  2V9H A;  4RM9 A;  3GS2 A;  2OOB B;  1Z5S B;  2KOX A;  4YXD B;  2IO2 B;  2N1W A;  4BKG A;  1V1P A;  4AQ7 A;  1A5R A;  3KWV A;  2BYF A;  1WRI A;  4N58 A;  2WXO A;  2PMV A;  1XCQ L;  4KZ0 A;  3B1L X;  1XO3 A;  3U8Z A;  3NJT A;  2C9W B;  1I4P A;  1TKE A;  5IOI A;  3VTU A;  5IO9 A;  3ZTD A;  2WYQ A;  2Z0D B;  3I63 C;  4KKJ A;  3KH0 A;  4FJZ A;  1LXD A;  4HKQ A;  2ZJD A;  3EC8 A;  2ZEQ A;  2WS3 B;  3HM6 X;  2KMM A;  4WJQ A;  4ZHP A;  2INC C;  4GIV A;  1YN3 A;  3DVN V;  2DX5 B;  3L4P A;  3B0A A;  5G55 A;  1C9F A;  1T0R C;  1IYF A;  3AEC B;  1WJU A;  2L1A A;  4MM3 A;  3WIM A;  2WXN A;  2YEP B;  2LVQ A;  4HXD A;  4RF0 A;  5D2M B;  3Q8A A;  1WY8 A;  1MPE A;  2KFK B;  1TT5 B;  4EKU A;  3ONS A;  5KHO A;  1TIF A;  1WF9 A;  1QZE A;  4YTM B;  4YT0 B;  2LXC A;  2L0F A;  3BYY B;  1WMH B;  3KLS X;  4YTN B;  1WXM A;  2JVC A;  4PYU A;  2PIA A;  2DYM A;  3KUZ A;  4WUR A;  1WXQ A;  2A4Z A;  2FE8 A;  3DQV A;  3KYC D;  3Q8C A;  3ZGZ A;  3DBH I;  3EA6 A;  4KIK A;  4A9A A;  1UWM A;  2LEK A;  1GNU A;  4C4V B;  3NVW A;  1K50 A;  1YX6 B;  1WIA A;  2VZK B;  2MRP A;  2IGG A;  1VDV A;  3DVG X; 
#chains in the Genus database with same CATH homology
 2IDY A;  3R8B A;  1ZDX A;  2QMT A;  3NUH B;  2KQ4 X;  1GPX A;  5LNK 1;  4LK0 M;  1SB3 C;  1SE2 A;  4YSY B;  2K9X A;  4TQ0 A;  3V05 A;  1C4P A;  1PGB A;  1QIL A;  1F0Z A;  2Y5P A;  1B1Z A;  1E10 A;  2ICI A;  1QOF A;  4XWW A;  5E6J A;  3R2I A;  2W55 A;  2XNA C;  1JWS D;  5T8I A;  3I9V 1;  4C80 A;  5BYR A;  1HQR D;  4HJG E;  1J7A A;  1STE A;  4ZOH C;  2QJL A;  1XF5 L;  1C78 A;  3NVY A;  3BVZ A;  1EM7 A;  3GP7 A;  4L2Y A;  2Z8L A;  1SEB D;  1FRR A;  2RDG A;  2EEL A;  3VR9 B;  3NZ3 A;  4OZC A;  2PKO A;  5JXV A;  3VRB B;  3MHZ A;  4WQM A;  1QQR A;  1EU4 A;  1PFD A;  2V4I B;  3RFZ B;  4UDU C;  2BBC A;  3LYY A;  1EU3 A;  3N9Y C;  4REZ A;  1TY2 A;  3ZJV A;  1ZUD 2;  4WAF A;  1JQ4 A;  1I4H A;  1HZ5 A;  4ITK A;  2KDM A;  1NYR A;  1GOZ A;  1Y56 A;  2LHE A;  1GAQ B;  4NJC A;  4NAM A;  3DWM A;  3Q8E A;  4L23 A;  1FFV A;  1FNV A;  2Y5C A;  4IKG A;  3ZJT A;  2WQY B;  2ACZ B;  5EE1 A;  1SXT A;  2TSS A;  2WXK A;  4OVZ A;  2N9L A;  4A90 A;  3BVG A;  3AMZ A;  4HEA 1;  3NRZ A;  3SEB A;  3TEX A;  1ZXH A;  3O13 A;  4JWU C;  3GB1 A;  3AE5 B;  4OHJ A;  4EE2 A;  3BZD B;  3AEE B;  1DYQ A;  2G9H D;  2JYE A;  5D3I B;  2LGI A;  3E9S A;  4AS1 A;  1XXG A;  1DGJ A;  2BT6 A;  2J53 A;  2JQR B;  4A6Q A;  3FC4 A;  3LB8 C;  2MH7 A;  1YN4 A;  2W54 A;  3HRD D;  1WSP A;  2D5G A;  4HKZ E;  4MH8 A;  5HI1 A;  1TKY A;  1L0V B;  2KN4 A;  2WDV B;  3AEG B;  1KRH A;  1JWM D;  2ZW0 A;  1E6E B;  1JWA D;  2OHF A;  2IGH A;  1K51 A;  3AE3 B;  4D2K A;  1PGA A;  3P4R B;  3FIL B;  2NMQ A;  2N7J A;  4WH4 A;  1E7P B;  1JWU D;  2JXT A;  1D5Z C;  1M4V A;  2INP E;  4KKI A;  5AUK A;  1C4C A;  3SFE B;  3W9C B;  2DBY A;  3NVV A;  4US8 A;  4CQN A;  2LJI A;  4HRO A;  2IPK D;  4O1N A;  3FAH A;  1E0Z A;  1N61 A;  2VZK D;  2W82 A;  2KWD A;  2WDQ B;  3MJ5 A;  2I38 A;  2FUG 1;  4IDI A;  1VZ6 A;  4WWM A;  4KGT A;  4DXG A;  1I4R A;  1L0Y B;  2WU2 B;  2WXJ A;  2HDE A;  3V3X A;  1WWT A;  3BK2 A;  3CIR B;  1P7F A;  1TS3 A;  5BYS A;  1SIJ A;  2Q5W D;  4RGT A;  1QF6 A;  3RPF C;  2JWU A;  1GB1 A;  3AE4 B;  1E9M A;  4P16 A;  1C4A A;  2HTM E;  2JYT A;  5C2T B;  2NTT A;  1N62 A;  5EE3 A;  1FIQ A;  3UI3 A;  4DXF A;  3BWU D;  1VRA B;  3U2S C;  4KX6 B;  1FXA A;  1XEE A;  5FR3 A;  1L0X B;  5H8Y E;  1IBX B;  1FXI A;  1CJE A;  1ZXI A;  4M0W A;  2B76 B;  3U52 E;  1NEK B;  1QKZ A;  1FO4 A;  3P4S B;  1P7E A;  5C3J B;  2IJ0 A;  1RYJ A;  1QT9 A;  2V3P A;  2CJN A;  5D3D A;  1F2R C;  1AYF A;  1AW7 A;  2WXH A;  1YJJ A;  4RGO S;  5FKA C;  2W3S A;  1KLG D;  1XCT L;  3PZ8 A;  2WXP A;  4RGN A;  1PGX A;  3P1M A;  1XLN A;  2WNM A;  5BMI A;  2BS3 B;  3AB5 A;  2BB6 A;  3SFD B;  3P4P B;  1TJE A;  1OFF A;  2KAC A;  2PTL A;  4C7Y A;  2LHD A;  2WDR B;  3EGR A;  3AV8 A;  1D5X C;  3ZJU A;  1TS2 A;  1TS5 A;  3IT4 B;  2BS4 B;  2M56 B;  1NI3 A;  2SAK A;  2K3U A;  1DOX A;  1WGK A;  4IOI E;  2PVG C;  1N63 A;  1YNT E;  1FNU A;  1VZ8 A;  2NTS A;  1YQ4 B;  1I4G A;  4WIP A;  1C76 A;  1FRD A;  2WXL A;  1JW9 D;  2H89 B;  1KH0 A;  2V3N A;  1D5M C;  1KTK A;  2LMC A;  2I2Y A;  1TS4 A;  3KWL A;  2K22 A;  2QEJ C;  1D4B A;  4XDD A;  3ETR A;  4A55 A;  4KGS A;  1NYQ A;  2J4X A;  4JPS A;  2PW9 A;  5EE9 A;  2K0P A;  5MPO A;  2WXR A;  3AEB B;  2J42 A;  2L52 A;  4YTP B;  1MHH E;  2JU6 X;  2G1E A;  3NVZ A;  3IT6 B;  3TSS A;  5D7G A;  4JX1 C;  3W5U B;  4GLS C;  1KFY B;  1CK1 A;  1RFK A;  5G5G A;  1K52 A;  4YSX B;  1ENF A;  2AQ2 B;  1N60 A;  2WP9 B;  3IXS A;  2ON8 A;  3IAM 1;  1JRP A;  5HHD G;  2MJE A;  4MM3 B;  2DWQ A;  3J9C A;  1YMH E;  3AE6 B;  1FEH A;  2WU5 B;  5BMG A;  3TUO A;  2LUM A;  3CWI A;  5H92 C;  3TEY A;  1V97 A;  1JRO A;  2WXM A;  4RGM A;  2ONQ A;  3BYT B;  1FFU A;  5FK9 C;  4YSZ B;  2WLB A;  1GB4 A;  1L5P A;  3PZ7 A;  3Q69 A;  4C7Z A;  2MJD A;  3MC0 B;  1TYG B;  1TKG A;  1ZP0 B;  3AE1 B;  1XLP A;  3IAS 1;  1DOI A;  3W1S A;  4ZYS A;  4RF1 A;  4NZL B;  3AN1 A;  1QOB A;  1ESF A;  2KAJ A;  1XLQ A;  4ARI A;  1SJE D;  3FIL A;  1ROE A;  1YN5 A;  2QIE B;  2GB1 A;  4MT5 A;  2JSV X;  3U4E G;  2MJ3 A;  3EUB 2;  2BS2 B;  4MAC A;  1AN8 A;  4L1B A;  1F77 A;  4A8X C;  3LXF A;  2L83 A;  1DOY A;  2BW2 A;  1SJH D;  3URY A;  1V1O A;  1SE3 A;  3BII D;  1JAL A;  2RDH A;  2L32 A;  1BUI C;  2IGD A;  4XWT A;  3P42 A;  1L4D B;  1SBB B;  3TEW A;  1IGD A;  2RMM A;  3VQI A;  1FMA D;  4Q2J A;  3W2D A;  2GI9 A;  1NVI D;  4XDC A;  3I57 A;  1I4X A;  1VLB A;  3AE2 B;  4RCO A;  1ET6 A;  2BB5 A;  4XE0 A;  3AEA B;  1ZOY B;  3AED B;  2MEK A;  1FCC C;  4LTU A;  2BYT A;  2YEP F;  3PO0 A;  4ARC A;  4B0M A;  1L6V A;  2W3R A;  4GDL B;  1FD6 A;  5GXG B;  2FBW B;  1FM0 D;  3VR8 B;  2OED A;  3AE7 B;  5G5H A;  2M0A A;  2DYO A;  4P6V F;  1IBX A;  3B2G A;  4ZRQ A;  1C77 A;  2E3T A;  1VJK A;  1ACC A;  4TSS A;  5EE0 A;  2AQ3 B;  5BYQ A;  1JML A;  1Q10 A;  1RM6 C;  1FNW A;  1ZDV A;  3HUI A;  2K5P A;  2LFI A;  3MFG A;  1EWY C;  1JWB D;  4R3D A;  4C56 C;  3WCQ A;  2BTE A;  3BVM A;  1PDX A;  4JE3 B;  2PVO D;  1D6E C;  4TMA B;  2R61 A;  1QOA A;  2AX5 A;  3P4Q B;  3P63 A;  2WXG A;  4B0E A;  1V1P B;  3AH7 A;  1I4Q A;  1J7B A;  1UUP A;  5I4D A;  3Q8F A;  2DLB A;  4PT5 A;  2AQ1 B;  1VR9 A;  3U7Z A;  1HEZ E;  1QLB B;  1C79 A;  3HVD A;  4OZA A;  1OQR A;  4YWG G;  5BMH A;  1L4Z B;  3C8Y A;  4RNA A;  3GS2 A;  4YXD B;  1PUT A;  2Y3A A;  2PLP A;  4N59 A;  2CJO A;  1HA5 A;  2GRI A;  1V1P A;  3R2T A;  1BXT A;  1IUE A;  1WYG A;  3KWV A;  1A70 A;  5HG2 A;  4AQ7 A;  1WRI A;  4N58 A;  2WXO A;  3B9J A;  4HRS A;  2PMV A;  1XCQ L;  1XO3 A;  1MI0 A;  1UGJ A;  5TSS A;  1T3Q A;  1N5X A;  3SR6 A;  2QIL A;  4ZRP A;  1I4P A;  1TKE A;  1OQQ A;  1ZE3 D;  3W5V B;  2WXF A;  3T3O A;  1SE4 A;  1R7S A;  4GDK B;  4US9 A;  4KKJ A;  2JX5 A;  1FCL A;  4RH6 A;  1ZPS A;  1I7H A;  1KF6 B;  3Q8B A;  1YJI A;  4TQ1 A;  4HKQ A;  2M19 A;  1T5X D;  1TY0 A;  1TZO A;  1UWX A;  2EKI A;  2WS3 B;  2KMM A;  3H8H A;  4ZHP A;  1J7C A;  1N5W A;  4ZHO A;  3T3N A;  3ZYY X;  3VRA B;  2WXQ A;  1YN3 A;  1YQ3 B;  4J3O D;  4RFB A;  2N0S B;  3MP9 A;  3L4P A;  2QSD A;  1C9F A;  2CU3 A;  2E6X A;  1ET9 A;  1MHX A;  3AEC B;  3OWE B;  1B9R A;  1BML C;  4JWS C;  2L1A A;  5HFY A;  1LO5 D;  4OZB A;  2WXN A;  2YEP B;  2JZP A;  4RF0 A;  4OW0 A;  3Q8A A;  1V8C A;  2XN9 C;  1CZP A;  1MPE A;  4N6E B;  1XLO A;  2X38 A;  3BK1 A;  1MVK A;  1K53 A;  4LLG M;  2J52 A;  3DWG C;  1UNS A;  3E56 A;  3HVZ A;  4YTM B;  3AE8 B;  1AWD A;  2ZW1 A;  4YT0 B;  3BYY B;  3KLS X;  1KLU D;  4YTN B;  1SF0 A;  1CQV A;  4NAW B;  2PIA A;  3AEF B;  2DYM A;  1NEN B;  1HZ6 A;  1VZ7 A;  2WXI A;  1T6B X;  3AE9 B;  4FXC A;  1SSN A;  4WUR A;  3TEZ A;  2H88 B;  1WXQ A;  2FE8 A;  4H2A A;  3KQ4 A;  3Q8C A;  3AM9 A;  3ZGZ A;  4USA A;  3EA6 A;  1L6U A;  1EWC A;  5AUI A;  4A9A A;  1HXY D;  1UWM A;  2N9K A;  2LEK A;  3NVW A;  2INN E;  1K50 A;  1RWS A;  2SEB D;  4KGR A;  4DQO C;  3ABV B;  1IGC A;  2VZK B;  2RPV A;  2V0G A;  1PYW D;  2IGG A;  3NS1 A;  1JCK B;  1VDV A;  1F2R I;  3ZQ4 A;  3B2F A;  1QOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...