1E6EB

Adrenodoxin reductase/adrenodoxin complex of mitochondrial p450 systems
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
113
structure length
113
Chain Sequence
b'DKITVHFINRDGETLTTKGKIGDSLLDVVVQNNLDIDGFGACEGTLACSTCHLIFEQHIFEKLEAITDEENDMLDLAYGLTDRSRLGCQICLTKAMDNMTVRVPDAVSDARES'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NADPH\:ADRENODOXIN OXIDOREDUCTASE
molecule tags Oxidoreductase
source organism Bos taurus
publication title Adrenodoxin Reductase-Adrenodoxin Complex Structure Suggests Electron Transfer Path in Steroid Biosynthesis.
pubmed doi rcsb
total genus 27
structure length 113
sequence length 113
chains with identical sequence D
ec nomenclature
pdb deposition date 2000-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1e6eB00
1WYGA 2LEKA 3VR8B 4ZHPA 1R7SA 3NRZA 1J7AA 4WWMA 2DWQA 2WDVB 1L6UA 1E6EB 3NVZA 1VJKA 2BS2B 4JWUC 1RWSA 2K22A 2W3SA 5GXGB 1E10A 1DOIA 2PIAA 1SIJA 1L5PA 1PUTA 1QLBB 2PVOD 2WS3B 3AEBB 4USAA 1N5XA 1JQ4A 5MPOA 1GPXA 1V8CA 1L0VB 3P63A 2JQRB 1JW9D 4ZOHC 2WU5B 2W55A 1QOGA 1EWYC 5AUKA 3B2GA 1CJEA 5C3JB 4WQMA 4ZHOA 1WWTA 1QOAA 4FXCA 1J7BA 2BS4B 4YTMB 4HRSA 2Y5CA 2L83A 3AE5B 4YT0B 3HRDD 3HVZA 5EE1A 1VDVA 3DWGC 2JX5A 5C2TB 1OQQA 4LTUA 1QF6A 2WDQB 4YSXB 3AEEB 5G5GA 3P4SB 1I7HA 4YXDB 1FM0D 2ACZB 3KWLA 1FFVA 3B2FA 1TKYA 1FFUA 3W5UB 1DOXA 1NI3A 3P4RB 1WXQA 1FXAA 3P1MA 2W3RA 1TKEA 1PDXA 1OFFA 3PO0A 1TJEA 1FRRA 2KMMA 3ABVB 2K5PA 3AE2B 3AE9B 4N59A 3W9CB 1T3QA 1JWAD 4YTPB 2AX5A 3AB5A 1XO3A 1KF6B 1YJJA 4YTNB 3SFEB 2M56B 1CZPA 3FAHA 1FO4A 1E0ZA 3VRAB 1NYQA 1NYRA 1RM6C 3AEGB 3CWIA 3VRBB 3B9JA 1TKGA 1YQ3B 2HTME 3HUIA 1JWBD 1FMAD 1FXIA 2KAJA 3LB8C 3VR9B 2CU3A 3AV8A 4P6VF 2WP9B 1F0ZA 1L6VA 1WGKA 2L52A 1YJIA 2K9XA 3ETRA 1ZP0B 1FRDA 5EE9A 3RPFC 1QOBA 4JWSC 1NEKB 2Q5WD 1QT9A 1B9RA 2PVGC 3BIID 3FC4A 1DGJA 5H92C 2WLBA 1N61A 3AE4B 2CJNA 3AE6B 3AEDB 1N60A 3SFDB 1A70A 4YSZB 3NVYA 2BT6A 2MJDA 3ZYYX 2WQYB 2MH7A 1FIQA 1ROEA 2QIEB 1NENB 1XLQA 4ITKA 2E3TA 4KX6B 2QJLA 1TYGB 3L4PA 1PFDA 2BS3B 1ZOYB 3AH7A 4US8A 4HROA 2FBWB 3AE1B 4YSYB 2WDRB 4C7ZA 1RYJA 2OHFA 3NS1A 1AYFA 2W54A 3AEAB 4N6EB 5EE0A 1GAQB 1XLNA 1XLOA 1QOFA 1ZUD2 1KRHA 1N62A 1V97A 1WRIA 3CIRB 1JROA 2M19A 4N58A 5H8YE 1N5WA 3DWMA 3SR6A 3AN1A 1E9MA 1UWMA 2H88B 3W5VB 4C7YA 2WU2B 1RFKA 3AE7B 2EKIA 1E7PB 1JALA 1SB3C 3NVWA 4US9A 3AECB 1N63A 1OQRA 1XLPA 3AM9A 1VLBA 1SF0A 4JX1C 1AWDA 1J7CA 2G1EA 3AEFB 2PKOA 3WCQA 3AMZA 2DBYA 1YQ4B 5AUIA 4A9AA 1ZXIA 5G5HA 1NVID 2CJOA 1JRPA 2MJ3A 2N0SB 3EUB2 4C80A 3NVVA 2MJEA 3LXFA 4IDIA 1KFYB 3AE3B 3P4QB 2H89B 3P4PB 1DOYA 3AE8B 2B76B 1IUEA 5EE3A
chains in the Genus database with same CATH superfamily
2PJHA 3RI7C 4PS7A 2D3GA 3P42A 1OQYA 2W3SA 3R7RA 3H7SA 3TBLD 4KKJA 3SHQA 3JW0X 3C19A 2VZKD 4KV2A 4MGYE 5EDSA 3UIOB 4URKA 2BF8B 4HRSA 4NAMA 2L32A 1UNSA 4W9JA 3DWGC 4IKGA 4GDLB 4W9EA 1QF6A 2N9PC 5JZEB 4LDTB 1WI0A 1ZE3D 2BWFA 4TSSA 2LASA 4N59A 2C5LC 2NMQA 4YTPB 2N9XA 3QX1A 1KF6B 4KSKC 4RM9A 4I6LB 2WYQA 4LK0M 3ZDTA 2KAJA 1LQBA 3LB8C 4XC2A 4KZCA 2HE7A 2EMSA 3ETRA 1JWMD 1ZDVA 3MHZA 1E7VA 3Q3NC 4S0RA 1TT5B 3VUYA 4ZRQA 2KVRA 3A9JA 4EZJA 3UQBA 2XK5A 2LGYA 2ASQA 2BYFA 3Q3OC 2MRPA 2MW5A 3ZNZB 3EA6A 1QILA 3QC8B 1WGGA 4WH4A 3M95A 4AP4C 4ZYSA 4FLHA 1WRIA 1JROA 2JZ3B 2XNAC 4G11A 2C7HA 4TUUA 2FCNA 1UBIA 4NZLB 2D2QA 2V3SA 3BVGA 4IM3A 3RNCC 5IKCM 2N9LA 3AMZA 2DBYA 4HEA1 3PZDA 1FNVA 2KQSA 2IO1B 1KFYB 3CSTA 4FA6A 4K3CA 3NRZA 4CO7A 1K50A 4KZ0A 2WX1A 2LWPA 2BS2B 3QCAA 2IO3B 5HG2A 3EGRA 1E10A 4LDTD 2KX0A 1L0XB 2JUOA 1SE3A 1YX6B 3Q2AC 1EWYC 3ZRFA 4ZDVA 5G2NA 2JU6X 2HJ1A 4XWTA 4UDUC 2MHJA 2JYTA 1WM2A 1OQQA 4LTUA 5HFYA 1C4PA 2BB6A 1OTRB 3Q8FA 1T5XD 2LJ5A 2MQJA 1FXAA 2NBVB 4BBNC 4HKZE 2N7JA 1WMHA 2KD0A 1JWAD 1G6JA 3SU8X 1YOVB 1GOZA 4YTNB 2RPVA 1UZXB 3ZDMC 4D2KA 1D5MC 2OEDA 2V4IB 1FRDA 3LJ3A 3Q3MC 1B9RA 2WXRA 1DGJA 4KGRA 2L0FA 3AE6B 2MP2A 5J18A 2QMTA 3RNGC 3VH4B 2KWUB 2ZCCA 1XLQA 3TEYA 4LCDE 2KVZA 5G55A 1ZOYB 1PQSA 3UGBB 4US8A 4HROA 3IVFA 1D6EC 4DXGA 1RYJA 4JPSA 3CIRB 2KJHB 1Q10A 3DCGA 4XX5A 4KDLB 3OG5A 2K25A 2BBCA 1XLPA 2ZEQA 2AQ1B 3FILA 1V49A 1LXDA 3A9KA 2KN5A 4YL8A 3SEBA 3P2BA 3APDA 4A8XC 2O6VD 5E6PA 1SIJA 1PUTA 3FKYA 2C7NB 3V3XA 3IBEA 2J7QB 1VRAB 4ZOHC 1X1MA 1QOGA 4F8CB 2KZRA 2MBHA 2BS4B 3L16A 3ZRCA 2KDEB 1L4DB 2ACZB 3KW5B 3OWEB 1VZ7A 4MM3B 3P1MA 1LM8B 2GBMA 4M0WA 1N6ZA 1SIFA 1DYQA 1WH3A 2G45B 1Q0WB 4EOYA 1J8CA 4E71A 2BPSA 2BTEA 3VRAB 3NS8A 1PYWD 1KH0A 4C4VB 1JWBD 1Q1OA 3EC8A 2NTSA 2INDC 3PREA 1V81A 5E6JA 3I63C 2A5UA 4M00A 3AEDB 2ZNVC 4K1RB 2E6XA 2WQYB 5AEKB 4PYUA 1IP9A 1ZKHA 3QWZB 4IM2A 4RF1A 3U52E 3A33B 2LJIA 1I4RA 5LXIB 1WGRA 3NS1A 2W54A 1OGWA 2IZVB 3WAOA 4M8NA 1XLOA 1V97A 3MC0B 4A3OA 2KANA 2KDBA 4KIKB 1UD7A 2FIDA 2WNMA 3GZNI 3A9KB 3TCAA 1HXYD 1AWDA 5D7GA 4NJCA 4RH6A 3HK0A 4LNKA 4W9GA 1VZ6A 2N1WA 4DWFA 4AUQC 2N0SB 1WMHB 3V62A 3NVVA 4WJNA 1T0YA 3AE8B 2KX3A 2LEKA 2AQ3B 4IWPA 4IUMB 4DHZE 4NQLB 5BO4B 3CF6E 3DBRB 1C1YB 1QLBB 4FBJB 1R4NB 3OAWA 3I3TB 2JQRB 2AYOB 2IPKD 1C79A 2LGXA 4IW0A 3QHTA 2QCZA 3B2GA 3A1QA 2JWUA 2VH2A 2GBJA 2L83A 1FCCC 2KMCA 3HVDA 3WA0A 1XQQA 2Y5BB 4FADA 4W9LA 2L76A 2JY6A 2A4ZA 3DBRI 3WIMA 2J0JA 2KTRA 4CHKA 1V86A 2I1JA 2MSED 2KDIA 3RNAC 1MHXA 2DX5B 1P7EA 1FO4A 4W9FA 1NYRA 4E74A 4RGTA 1TIFA 3VTWA 3Q69A 3VR9B 1RFAA 4C00A 2WP9B 4MDKE 1K8RB 4N9F4 4AOFA 3RNBC 1YN4A 4HXDA 4NQKE 3DVGX 2ZW0A 3H7PB 1WZ3A 1WGDA 1Y8RC 1FIQA 2D3AA 4IC7B 4EUTA 4W9DA 2K1FA 2MBBB 4RM8A 1KLGD 3AU5A 1D4BA 3RNEC 2R2QA 2O6VA 2MLBA 4A6QA 2JWZA 1FEHA 1XLNA 2MEKA 3W1SA 1KRHA 2KYWA 1UWMA 1WX9A 1HZ5A 2GBRA 1ET9A 1JWUD 1JCKB 3AM9A 1VLBA 4MM3A 1WXMA 4R3DA 2REXA 4JX1C 3TSSA 5JXVA 3PPAA 1M4VA 4TQ0A 1HTOA 4PYZA 4RGOS 2MJ3A 3P4QB 4JGHB 4ZRIA 1L6UA 1SE9A 1P3QU 1I42A 3X0WA 2WXHA 2L0TA 2Z0DB 2LXAA 1GG3A 2D3BA 2KO3A 2WGSA 5C1ZA 1L0VB 1CK1A 2MP2B 3OJ4B 5C3JB 3BVZA 2G4DB 4YTMB 1NI2A 4YT0B 4FHJA 1L7YA 1VDVA 4CQNA 5C2TB 3ZGZA 4MSMB 4MT5A 4M01A 4B6WA 1WYWB 3I57A 4ZRKA 4K7UA 4RGNA 2ONQA 3SD5A 2PE9A 5D94A 1TKEA 2YLMA 3ZXVA 2K5PA 3AE2B 5C23A 4RNAA 1A5RA 3O65B 4A3PA 2RD0A 3JSVB 1RM6C 4EFOA 4GOCA 1UGJA 1AN8A 1E8XA 1EF1A 2RMMA 1TS2A 2KTFA 3PLVA 4J3OD 4YWGG 1GC7A 1NDDA 2K6QA 1ACCA 1QT9A 3HM3A 4K3BA 1SE2A 1LGRA 1A70A 4ANXA 2JSVX 1WY8A 1C9FA 4WIPA 3ONSA 3QK0A 4L23A 2WXFA 4BBNF 2BS3B 2PMVA 2WDRB 3PRPB 4GU2A 4N6EB 3EHVA 1N62A 2EKEC 3BINA 4MJSA 1ET6A 4BVUC 4WQOB 4KGSA 1JALA 2FCQA 2WXLA 1WIAA 3OLMD 3X23A 1TY2A 1ZXIA 1UUPA 2K8HA 1WYGA 1XXGA 2KFJA 1F77A 3U8ZA 4B9KA 4FJZA 2LD9A 1K52A 1V1PA 1I4GA 3KYCD 3I9V1 2MWSB 3N32A 1JW9D 3BY4B 3ML8A 4ZRPA 4W9KA 3KUCB 3GS2A 1YIWA 4HCNB 2YEPF 2EMTA 2JX5A 4GB9A 1I4QA 2XN9C 3CSFA 3K9PB 1M94A 1V2YA 2MA9B 1WF9A 4FJYA 5E6OA 5L83A 2BQQA 2QC8A 4G50A 1WXAA 2JT4B 5LLIA 1R4MB 4M02A 3BK2A 1ZGUB 2I1KA 1WJUA 2BKRB 1F0ZA 4HJGE 2LGIA 4H2AA 3BIID 3PS6A 2KC2A 1I4PA 5H92C 4REZA 3EFUA 5IO9A 4MJSB 3T9LA 1AYFA 3A4SC 4N58A 3DWMA 2NBWB 4US9A 3NZ3A 2WXKA 3NY5A 2V0GA 3DHGC 1PGBA 1J7CA 3ZTDA 4L2YA 3U4EG 1EF5A 2PLPA 4XZ4A 3R2IA 4K7SA 1DOYA 3AE3B 2D3CA 4K7WA 3UI3A 1J7AA 4KDIC 2FUG1 2CU1A 2WXNA 1V5OA 4W9IA 3ENEA 1EO6A 1MVKA 2PVOD 2SAKA 1S1QB 3N20C 3EECA 5FR3A 2WU5B 4HDOA 3A9JB 4CYEA 3Q6BA 2Y5CA 4JLCA 4J6IA 2GMIC 1DOXA 2KFKA 3PLUA 2J42A 1OFFA 3RULA 1TJEA 3GP7A 2DENB 1YJJA 2UYZB 1P9DU 4WAFA 3AEGB 3N9YC 3TEXA 1TKGA 4HPLB 3HUIA 1WE7A 2CU3A 1WXVA 2VZKB 5TR5A 2DZJA 5DPWA 3DBLB 1YJIA 1QOBA 1NEKB 2N1VA 3GB1A 2WLBA 5IOIA 2AL6A 2LHEA 3IG3A 5CHVC 3TUOA 3BZDB 3NG0A 1ZDXA 2DZMA 1P0RA 2GBKA 4GDLA 4NAWB 3NUHB 4LNIA 4DHJD 3PTFC 3AEAB 1MI0A 1BUIC 1GAQB 3Q8BA 1C76A 3KUDB 2KKCA 2BKFA 4O1NA 1TZOA 1F1HA 5AZFA 1JWSD 3RUIB 2RDHA 3AE7B 3L13A 1LO5D 4OHJA 2KNBA 5CX3A 4HLEA 4A9AA 1F52A 1TZ1A 4C80A 1FPYA 2M0AA 4KGTA 2J0KA 3P4PB 3ZLZA 3HM6X 4GSWA 2DWQA 2DYOA 4JWUC 5GXGB 3Q8CA 1H8CA 1L5PA 2C9WB 1WGHA 1GPXA 3ZJVA 2GI9A 1QKZA 4WQMA 2O2VA 3MP9A 3N1XC 3UIPB 2PPHA 5HKHA 2DYBA 4YXDB 1YN5A 2LFIA 1TKYA 2K39A 1EM7A 2NTTA 3MJWA 3ABVB 3AE9B 1WM3A 3V60A 1E8WA 1D5XC 3L0WB 4S17A 1IYFA 1V80A 2CR5A 2Y5PA 3CMMB 2GLSA 3M63B 3BWUD 2JRHA 2NS5A 1SE4A 4LNFA 3AV8A 1XD3B 2FAZA 4LNOA 4KVGB 4IWQA 3RCZA 3NOBA 5DCNA 4XDDA 2IDYA 2RGFA 4ZYNA 4NAWA 2OOBB 4A55A 4RFBA 2WXGA 1NENB 3N1YC 5J17A 1IGCA 3R7QA 1TYGB 4TQ1A 4A20A 3U7ZA 2JVCA 4GDKA 3RD2A 3RT3B 2J0MA 3QA8A 2INCC 2RDBC 2GB1A 1ZUD2 2LRWA 1QZEA 2VRRB 1N5WA 2J53A 3SR6A 2IGGA 3AECB 2G4SA 1SF0A 3RFZB 1SBBB 4B0MA 2IO0B 1YQBA 4P1BC 2IGHA 3H8HA 3APFA 1NVID 2WHIA 4B95A 4HJKA 5E6NA 3LXFA 3BVMA 1T0QC 2H89B 1R4NI 4MSQB 2QJLA 1XT9B 4BKSA 3BYTB 2LGSA 4HPPA 3L10B 3IHPC 2LRUA 4KSLC 1WR6E 2PE6B 4DHJB 2DLBA 1XCTL 3P63A 1JRUA 3RZWC 3IAM1 1E8ZA 2R61A 5GMVA 2JZZA 1F2RI 3KUZA 3DPDA 4DQOC 1IBXA 4BZAA 3TJPA 4BAXA 4DK5A 2B3AA 4HK2A 3ZW3A 2KQ4X 1YNTE 4WWNA 1WXQA 2L8JA 2RPQA 2W3RA 3VVWB 3EFCA 3MTNB 4EZKA 2CS4A 2YVCA 3PHWB 5DPSA 2AX5A 3AB5A 1T0SC 1WGYA 3VFKA 3N3KB 4PS8A 2BYVE 2KXJA 1KOTA 5IP4D 2KDMA 3KYDD 2M17A 3AE4B 3VQIA 3M62B 1ZPSA 3NVYA 3KQ4A 4L1BA 4AQ7A 3ZIMA 2KK8A 4KX6B 1STEA 3APCA 3VTUA 3TMPB 1J0GA 1V1OA 1KTKA 1P1AA 3GE8C 3PRMB 4MGZE 3W1SC 2M19A 3RZFA 1E9MA 1YD8U 5CHWA 2D10A 4G3XB 3J9CA 1KJTA 2N4FA 2RR9A 1SJHD 4E3CA 1E7UA 2YEPB 3WCQA 4M0WB 1CMXB 3EUB2 4IDIA 2INNE 1HE8A 1IUEA 2JRIB 3QJZA 2JPHA 4II3B 2DAJA 2M0XA 1WJ6A 4HWIB 3VTVA 1D5ZC 3OJ3A 2PIAA 3GZNB 1MPEA 3NHEB 2EELA 1N5XA 2IYDB 4F1SA 1WFYA 4I6NB 2DAFA 2HD5B 2JXTA 4EEWA 3PRZA 3H6NA 3V6CB 1J7BA 4PT5A 2IJ0A 2AEHA 2KQ7A 2KLCA 3U30A 1NBFC 3RNFC 2LMCA 4MEMA 3KWLA 2RDGA 4IOIE 4WURA 3P4RB 3A1QB 2MX2A 2I38A 5IAAC 2KMMA 1YMHE 2L05A 1NYQA 3WAPA 1XEEA 2LUMA 4GMVA 1KLVA 5L95C 1GUAB 4AJWA 1WGKA 2BYTA 2L52A 1ZP0B 3DHHC 4XDCA 3VUWA 3WALA 1MFWA 1TGZB 4KKIA 2W9NA 2CJNA 2OJWA 2BT6A 2MJDA 2LI5A 5D6JB 3U7DA 2K0PA 4LJOB 1EUVB 2BWES 2CKHB 4BKTA 2TSSA 1V5TA 4BKSD 3RN9C 4AS1A 3BK1A 3DDCB 2N9KA 5IN7A 5CTRC 3N30A 4HDQA 3W2DA 2JYEA 5BYQA 3Q3JA 2FCMA 3C8YA 1BMLC 3QIJA 5DPRA 4GIVA 1HQRD 4LJPB 2IBIB 2AL3A 3B0AA 3ML9A 2QHOA 4WWPA 1RWSA 4IWOA 3VDZA 3NZUA 2V9HA 4NJ6A 5MPOA 2MBOA 3C0RB 2XEWA 2IY1B 3KLSX 3Q8EA 1CJEA 3JVZX 3MFGA 3DHIC 1V9JA 3ZJUA 1C3TA 1VD2A 3DVNU 1LFDA 2WDQB 4II2B 3VUXA 3GOEA 3B2FA 3ZNGC 1MJDA 1TY0A 1UELA 2QEJC 2KHWB 1I4XA 1ISNA 1L4ZB 4GN1A 3V61A 3TEWA 2HTHA 4MGKE 4TV3A 2KC1A 3I5JC 3AXCA 2X8XX 2ZW1A 1CZPA 4LLGM 3RYTA 3IT6B 3VRBB 2HTME 1FXIA 2BYEA 4IM0A 2ON8A 1WJNA 2K9XA 2FE8A 2KWCA 1E8YA 2O6VB 1FNUA 4MACA 3LYYA 2BGFA 2ICIA 1ROEA 4ITKA 1GB1A 3HHMA 1UF0A 4P1CC 1PFDA 3O13A 3AH7A 3PT2B 4YSYB 5D3IB 4OW0A 3L17A 1HEZE 5T8IA 3ZNHB 2QDFA 1TBEA 1FD6A 1SSNA 1XF5L 2FUHB 1IPGA 4RMAA 5J2RA 4F7ZA 5JHBA 3ZNID 3A4RA 2WXPA 1QQRA 2PTLA 2PKOA 1YQ4B 1JRPA 2QSDA 5EE3A 4ANWA 2ZVNA 1VJKA 1DOIA 1JQ4A 3WAMA 1F9JA 2N9EB 4QAYA 1ZW7A 4OZCA 1JMLA 2CHWA 4DBGA 3VXWA 4PK1A 4M8MA 2NCNA 4DXFA 3M3JA 5BMGA 2V3NA 3ZKJC 2L3ZA 3AE5B 1TS5A 3HRDD 3QAQA 3DQVA 4NJ7A 1C77A 3SDLC 2DNFA 5DPTA 4HCPB 2KOXA 4ARCA 1UGMA 2DYMA 1MG8A 3FILB 3W9CB 4KIKA 4JE3B 3QARA 2OJRA 2INPE 2ZNVB 3S2AA 4MELA 1YN3A 3ZO5B 1KLUD 2N7DA 4JQWC 1PGAA 5BYRA 3ALBA 1L6VA 2MBEA 2Q5WD 3DBHB 2WXIA 3R2TA 2WXQA 2E3TA 3NZSA 3VAWA 1FNWA 4X57B 4IG7B 4TMAB 2LZ6A 4C7ZA 2IGDA 2JXXA 1QOFA 2L1AA 2M1MA 3AN1A 3UINB 5BMHA 3IFWB 3PV1A 2G1EA 2JZPA 1Z5SB 5KHOA 2KN4A 3U2SC 2JF5A 4P7IA 4ANVA 4WJOA 2ZJDA 1CQVA 5LXHA 3PZ7A 3VR8B 2RSUA 2LUEA 4MH0E 4C4VA 4FHKA 2Z8LA 4RGMA 3NVZA 2KDFB 5I4DA 2IY0B 1VR9A 3IT4B 2K8BA 5JHAA 3AEBB 2O2VB 4DDID 3UF8A 5AUKA 3TEZA 2WX0A 3PGEA 1V6EA 5EE1A 1B1ZA 3L54A 5FK9C 4YSXB 3P4SB 1I7HA 3RMKC 2W82A 1ESFA 1BXTA 4W9CA 2FIFA 2PEAA 4EKUA 1XCQL 1XO3A 4XGAB 5TSSA 1YJ1A 2M56B 4NNJB 4ICUA 2BB5A 2Z59B 1UBQA 3ZXRA 1V1PB 2KTRB 2X38A 4XWWA 1S3SG 4JWSC 3T8MA 3MC8A 2C60A 2MH7A 3E56A 2MCNB 5JH5C 3ZUNA 4TKNA 4K81A 2OHFA 1P98A 1RAXA 3DBSA 4OVVA 1UH6A 3Q14C 2V3PA 5BYSA 3AI5A 4WAAA 2H88B 3W5VB 4BOZB 1SB3C 4BKGA 4MH8A 1C78A 2NVUI 1OEYA 2Y3AA 3NJTA 2M4NA 2UU7A 2WXMA 4WWMA 1HA5A 2R2OA 2D5GA 2KMAA 1L2NA 3ZTCA 2G3QB 1T0RC 2W55A 3H1UA 1WWTA 1RRBA 1WX7A 2XBBC 1GB4A 3DOWA 3IAS1 4EE2A 1WRDB 2WDTB 2WWZA 4P16A 1TTNA 1SJED 4OZBA 5CHFA 1FFVA 2C7MB 2WXJA 4ASWC 4Q2JA 1MHHE 4FJVB 2D11A 1T3QA 3R66C 2MBQA 3T3NA 1EU3A 1P7FA 1SGHA 4OVUA 3FAHA 1C4CA 3PVLA 1AARA 5IA7A 3B9JA 3MC9A 3MHSD 2NR2A 4GGQA 1ZXHA 1SEBD 1WR1A 4PS3A 2I2YA 3RPFC 5EE9A 3IXSA 3DVNV 2PVGC 1BT0A 1N61A 3SFDB 2GRIA 3ZQ4A 2LVQA 1WJ4A 1SXTA 2QILA 4DHZB 2K6DB 2DZKA 1E5WA 1WX8A 1WE6A 2HDEA 3L4PA 3LDZE 2M8SA 1T6BX 2KLGA 4FULA 2CHZA 1TS3A 1IBXB 4W9HA 1WSPA 2XK5B 4GLSC 4C7YA 2DHZA 4XE0A 1N63A 1KM7A 2J4XA 4ICVA 5LNK1 2LXCA 4EZLA 2V4LA 2G9HD 2ZPYA 1RLFA 2B76B 4ZHPA 1R7SA 2Z0EB 3DVGY 4HVBA 2LVOA 3V6EB 3AULA 2WS3B 4USAA 2HJ8A 3E9SA 3Q8AA 4OVZA 3TL5A 1QOAA 1VCBA 1FXTB 2L7RA 3HVZA 2ZCBA 4WJQA 3B08A 2PW9A 2KJ6A 3UQAA 4GDKB 5G5GA 3W1YA 2NBUA 1PGXA 1FFUA 2NPTA 3W5UB 2V1YA 1NI3A 3PO0A 1PDXA 5D3DA 4AWJA 5FR6A 2SEBD 3SFEB 1E0ZA 3L08A 1Z2MA 2L00B 1YX5B 1C4AA 1FMAD 3Q3FA 4HKQA 4P6VF 4DXAB 1R4MI 1MG4A 5FKAC 5D2MB 4A90A 3FC4A 4AJYB 3K9OB 3WANA 3V05A 2BVCA 3PSEB 2KWDA 3N1ZC 3QQ8B 2K3UA 4RF0A 2ZVOA 3H7PA 1WXSA 1I35A 5EE0A 2KJRA 4ARIA 2GOWA 3B1LX 4ACFA 3PHXB 4JL9A 2WU2B 1RFKA 2BW2A 2EKIA 5AZHA 3AEFB 4I6PA 4ZRJA 1HZ6A 4HPMB 4ANUA 5KHQA 5AUIA 5G5HA 2VH1A 4MGIE 2ZPNA 2MJEA 2CHXA 1I4HA 1GC6A 1OEYJ 5BMIA 1AW7A 2LHDA 3AU4A 3GE3C 1Q5WB 1Y56A 3R3MA 2WDVB 5AZGA 3ZVVA 1E6EB 3MJ5A 2J52A 2K22A 2KACA 3PZ8A 1H4RA 1V8CA 1D3ZA 3VH3B 3KWVA 2FNJB 4ZHOA 2ZZPB 2WXOA 4FXCA 2K8CA 2NPTB 4DDGD 1EWCA 4OZAA 1F2RC 1FCLA 1EU4A 3AEEB 4NY0A 1L0YB 1WZ0A 4NPNA 1FM0D 3ZJTA 2N7EA 3URYA 1IGDA 2AWTA 1VZ8A 2GBNA 5HHDG 3KVFB 1FRRA 4RCOA 2D07B 3BYYB 2LVPA 1K53A 1E90A 1ENFA 3VHTC 3CWIA 4XYCA 1YQ3B 1UWXA 3KH0A 4FN2A 3DBLI 4JIOU 2FCSA 4C56C 2LGDA 1N60A 3R8BA 4YSZB 3T3OA 3ZYYX 2UWQA 1HTQA 4WJPA 2AQ2B 1GNUA 2QIEB 1U4AA 3ECIA 1K51A 2FBWB 3AE1B 3D32A 3TIXA 1J19A 4LNNA 4BFRA 2IO2B 4G0NB 5H8YE 1GJZA 3JYUA 3DBHI 4BOSC 1E7PB 3NVWA 1OQRA 2KWVB 2KFKB 2DZIA 2KT7A 3JSVA 4WWOA 4B0EA 5HI1A 4GXBA 3HIZA 1TS4A 3H9DA 2CJOA
chains in the Genus database with same CATH topology
3VR8B 3BYTB 2Z8LA 4RGMA 1L6UA 3NVZA 5I4DA 3P42A 2W3SA 1VR9A 2WXHA 3IT4B 4KKJA 3AEBB 2DLBA 1XCTL 1L0VB 3P63A 1CK1A 2VZKD 5C3JB 3BVZA 3IAM1 5AUKA 3TEZA 2R61A 4YTMB 4HRSA 1F2RI 4NAMA 2L32A 4YT0B 5EE1A 1UNSA 1B1ZA 1VDVA 3DWGC 4IKGA 4DQOC 5C2TB 4CQNA 4GDLB 1IBXA 3ZGZA 1QF6A 4MT5A 5FK9C 4YSXB 3I57A 2KQ4X 3P4SB 1I7HA 4RGNA 1YNTE 2ONQA 1ZE3D 2W82A 1WXQA 1ESFA 1BXTA 2W3RA 1TKEA 4TSSA 2K5PA 3AE2B 4N59A 2NMQA 1XCQL 4YTPB 2AX5A 3AB5A 1XO3A 4RNAA 1KF6B 5TSSA 2M56B 1RM6C 2BB5A 1UGJA 1AN8A 4LK0M 2RMMA 1V1PB 2KAJA 3LB8C 1TS2A 2X38A 4J3OD 4XWWA 4YWGG 3ETRA 1ACCA 1JWMD 4JWSC 1QT9A 1ZDVA 2KDMA 3MHZA 1SE2A 3AE4B 3VQIA 1A70A 4ZRQA 1ZPSA 2JSVX 3KQ4A 3NVYA 1C9FA 4WIPA 2MH7A 3E56A 4L23A 4L1BA 4AQ7A 2WXFA 4KX6B 1STEA 2BS3B 3EA6A 1QILA 2PMVA 4WH4A 2WDRB 1V1OA 2OHFA 4ZYSA 1KTKA 4N6EB 1N62A 1WRIA 1JROA 2M19A 2V3PA 5BYSA 2XNAC 1E9MA 1ET6A 2H88B 3W5VB 4KGSA 4NZLB 1JALA 1SB3C 2WXLA 3J9CA 4MH8A 3BVGA 1SJHD 1C78A 2N9LA 2YEPB 3WCQA 3AMZA 2DBYA 1TY2A 4HEA1 1ZXIA 1UUPA 3EUB2 1FNVA 2Y3AA 4IDIA 1KFYB 2INNE 1IUEA 1WYGA 1XXGA 1F77A 3NRZA 2WXMA 4WWMA 1HA5A 1K50A 1K52A 1V1PA 2BS2B 2D5GA 1I4GA 5HG2A 1D5ZC 3EGRA 1E10A 1L0XB 2PIAA 1MPEA 2EELA 1N5XA 1SE3A 3I9V1 2JXTA 1JW9D 4ZRPA 2W55A 1EWYC 3GS2A 1WWTA 1J7BA 4PT5A 1GB4A 2IJ0A 2JU6X 2YEPF 3IAS1 4XWTA 4UDUC 4EE2A 2JYTA 2JX5A 1OQQA 4LTUA 5HFYA 4P16A 1I4QA 1C4PA 2BB6A 2LMCA 1SJED 2XN9C 4OZBA 3KWLA 2RDGA 1FFVA 4IOIE 4WURA 3Q8FA 1T5XD 2WXJA 3P4RB 1FXAA 4Q2JA 1MHHE 2I38A 4HKZE 2KMMA 2N7JA 1T3QA 1JWAD 1YMHE 3T3NA 1EU3A 1P7FA 1GOZA 4YTNB 3BK2A 3FAHA 1C4CA 1NYQA 2RPVA 3B9JA 1XEEA 1ZXHA 2LUMA 1SEBD 4D2KA 1D5MC 2OEDA 1F0ZA 2I2YA 1WGKA 2V4IB 4HJGE 2L52A 2LGIA 2BYTA 3RPFC 1ZP0B 1FRDA 5EE9A 1B9RA 3IXSA 4XDCA 2WXRA 4H2AA 2PVGC 3BIID 1DGJA 5H92C 1I4PA 4KKIA 4KGRA 1N61A 3SFDB 2CJNA 2GRIA 3AE6B 3ZQ4A 2QMTA 2BT6A 2MJDA 1SXTA 2QILA 4REZA 2K0PA 1XLQA 2HDEA 3TEYA 3L4PA 2TSSA 1ZOYB 1T6BX 4US8A 4HROA 4DXGA 1D6EC 4AS1A 1RYJA 3BK1A 4JPSA 1AYFA 2N9KA 1TS3A 3CIRB 4N58A 3W2DA 2JYEA 1IBXB 5BYQA 1Q10A 3DWMA 1WSPA 4GLSC 4C7YA 4XE0A 3C8YA 4US9A 3NZ3A 1N63A 2WXKA 2BBCA 2V0GA 2J4XA 1XLPA 5LNK1 1BMLC 1PGBA 1J7CA 4L2YA 3U4EG 2AQ1B 3FILA 2G9HD 2PLPA 3R2IA 1DOYA 3AE3B 1HQRD 3SEBA 2B76B 4ZHPA 1R7SA 3UI3A 4A8XC 1J7AA 2FUG1 1RWSA 2WXNA 1MVKA 1SIJA 2PVOD 1PUTA 2SAKA 2WS3B 4USAA 3V3XA 5MPOA 3E9SA 3Q8AA 5FR3A 1VRAB 4OVZA 4ZOHC 2WU5B 3KLSX 1QOGA 3Q8EA 1CJEA 3MFGA 1QOAA 2BS4B 3ZJUA 2Y5CA 3HVZA 2PW9A 2WDQB 4GDKB 5G5GA 1L4DB 2ACZB 1PGXA 3B2FA 3OWEB 1FFUA 1VZ7A 3W5UB 4MM3B 1DOXA 1NI3A 1TY0A 3P1MA 2J42A 1PDXA 1OFFA 3PO0A 1TJEA 3GP7A 4M0WA 5D3DA 2QEJC 1I4XA 1L4ZB 3TEWA 2SEBD 1DYQA 1YJJA 2ZW1A 3SFEB 1CZPA 4LLGM 1E0ZA 2BTEA 4WAFA 3VRAB 3AEGB 3IT6B 1PYWD 1KH0A 3N9YC 3TEXA 3VRBB 1TKGA 2HTME 3HUIA 1JWBD 1C4AA 1FMAD 1FXIA 4HKQA 2CU3A 4P6VF 2NTSA 2VZKB 2ON8A 1YJIA 2K9XA 1QOBA 2FE8A 1NEKB 5FKAC 5E6JA 4A90A 3FC4A 3GB1A 1FNUA 2WLBA 3AEDB 4MACA 2E6XA 2LHEA 3V05A 3LYYA 2WQYB 2KWDA 2ICIA 1ROEA 3TUOA 4ITKA 2K3UA 3BZDB 4RF0A 1GB1A 1ZDXA 1PFDA 3O13A 4NAWB 3AH7A 4RF1A 3NUHB 3U52E 2LJIA 1I4RA 4YSYB 5D3IB 4OW0A 3NS1A 2W54A 3AEAB 1MI0A 1BUIC 1GAQB 1HEZE 3Q8BA 5EE0A 1XLOA 5T8IA 1C76A 4ARIA 1V97A 3MC0B 4O1NA 1FD6A 1SSNA 1TZOA 1XF5L 1JWSD 2WU2B 1RFKA 2BW2A 2RDHA 2EKIA 3AE7B 2WNMA 2WXPA 1LO5D 1QQRA 1HXYD 4OHJA 1AWDA 2PTLA 4NJCA 3AEFB 4RH6A 2PKOA 5D7GA 1HZ6A 5AUIA 1VZ6A 1YQ4B 4A9AA 5G5HA 4C80A 1JRPA 2N0SB 2M0AA 4KGTA 3NVVA 2MJEA 1I4HA 3P4PB 5BMIA 3AE8B 2QSDA 1AW7A 2LHDA 5EE3A 2LEKA 2AQ3B 1Y56A 2DWQA 2WDVB 2DYOA 1E6EB 3MJ5A 1VJKA 4JWUC 2J52A 2K22A 2KACA 3PZ8A 5GXGB 3Q8CA 1DOIA 1L5PA 1QLBB 1JQ4A 1GPXA 1V8CA 3ZJVA 4OZCA 1JMLA 1QKZA 2GI9A 2IPKD 1C79A 2JQRB 3KWVA 3B2GA 4WQMA 4DXFA 4ZHOA 5BMGA 2WXOA 4FXCA 2V3NA 2JWUA 3MP9A 2L83A 1FCCC 1TS5A 3AE5B 3HRDD 1C77A 3HVDA 1EWCA 4OZAA 1F2RC 1FCLA 1EU4A 3AEEB 1L0YB 4YXDB 1FM0D 1YN5A 2LFIA 1TKYA 3ZJTA 3URYA 1IGDA 1VZ8A 4ARCA 1EM7A 2DYMA 2NTTA 5HHDG 1FRRA 3ABVB 3FILB 3AE9B 4RCOA 3W9CB 3BYYB 4JE3B 1MHXA 2INPE 1D5XC 1K53A 1P7EA 1ENFA 1YN3A 1FO4A 1NYRA 2Y5PA 3CWIA 1KLUD 1YQ3B 4RGTA 3BWUD 1UWXA 1PGAA 3Q69A 1SE4A 5BYRA 3VR9B 3AV8A 2WP9B 1L6VA 2Q5WD 1YN4A 4XDDA 2IDYA 4C56C 3R8BA 1N60A 2WXIA 2ZW0A 4YSZB 3T3OA 3ZYYX 1FIQA 4A55A 4RFBA 2AQ2B 3R2TA 2WXGA 2QIEB 1NENB 2WXQA 2E3TA 1IGCA 2QJLA 1TYGB 1FNWA 1KLGD 4TQ1A 1K51A 3U7ZA 1D4BA 4TMAB 2FBWB 3AE1B 4C7ZA 2IGDA 4A6QA 2GB1A 2MEKA 1FEHA 1XLNA 1QOFA 1ZUD2 1KRHA 3W1SA 5H8YE 2L1AA 1N5WA 2J53A 3SR6A 3AN1A 1UWMA 1HZ5A 5BMHA 2IGGA 1E7PB 1ET9A 3NVWA 3AECB 1JWUD 1OQRA 1JCKB 3AM9A 1VLBA 4R3DA 1SF0A 4JX1C 2JZPA 2G1EA 3TSSA 5JXVA 1SBBB 3RFZB 4B0EA 1M4VA 4B0MA 4TQ0A 2KN4A 5HI1A 4RGOS 2IGHA 3H8HA 3U2SC 1NVID 2MJ3A 1TS4A 3LXFA 3BVMA 3P4QB 2H89B 1CQVA 2CJOA 3PZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WYG A;  2LEK A;  3VR8 B;  4ZHP A;  1R7S A;  3NRZ A;  1J7A A;  4WWM A;  2DWQ A;  2WDV B;  1L6U A;  1E6E B;  3NVZ A;  1VJK A;  2BS2 B;  4JWU C;  1RWS A;  2K22 A;  2W3S A;  5GXG B;  1E10 A;  1DOI A;  2PIA A;  1SIJ A;  1L5P A;  1PUT A;  1QLB B;  2PVO D;  2WS3 B;  3AEB B;  4USA A;  1N5X A;  1JQ4 A;  5MPO A;  1GPX A;  1V8C A;  1L0V B;  3P63 A;  2JQR B;  1JW9 D;  4ZOH C;  2WU5 B;  2W55 A;  1QOG A;  1EWY C;  5AUK A;  3B2G A;  1CJE A;  5C3J B;  4WQM A;  4ZHO A;  1WWT A;  1QOA A;  4FXC A;  1J7B A;  2BS4 B;  4YTM B;  4HRS A;  2Y5C A;  2L83 A;  3AE5 B;  4YT0 B;  3HRD D;  3HVZ A;  5EE1 A;  1VDV A;  3DWG C;  2JX5 A;  5C2T B;  1OQQ A;  4LTU A;  1QF6 A;  2WDQ B;  4YSX B;  3AEE B;  5G5G A;  3P4S B;  1I7H A;  4YXD B;  1FM0 D;  2ACZ B;  3KWL A;  1FFV A;  3B2F A;  1TKY A;  1FFU A;  3W5U B;  1DOX A;  1NI3 A;  3P4R B;  1WXQ A;  1FXA A;  3P1M A;  2W3R A;  1TKE A;  1PDX A;  1OFF A;  3PO0 A;  1TJE A;  1FRR A;  2KMM A;  3ABV B;  2K5P A;  3AE2 B;  3AE9 B;  4N59 A;  3W9C B;  1T3Q A;  1JWA D;  4YTP B;  2AX5 A;  3AB5 A;  1XO3 A;  1KF6 B;  1YJJ A;  4YTN B;  3SFE B;  2M56 B;  1CZP A;  3FAH A;  1FO4 A;  1E0Z A;  3VRA B;  1NYQ A;  1NYR A;  1RM6 C;  3AEG B;  3CWI A;  3VRB B;  3B9J A;  1TKG A;  1YQ3 B;  2HTM E;  3HUI A;  1JWB D;  1FMA D;  1FXI A;  2KAJ A;  3LB8 C;  3VR9 B;  2CU3 A;  3AV8 A;  4P6V F;  2WP9 B;  1F0Z A;  1L6V A;  1WGK A;  2L52 A;  1YJI A;  2K9X A;  3ETR A;  1ZP0 B;  1FRD A;  5EE9 A;  3RPF C;  1QOB A;  4JWS C;  1NEK B;  2Q5W D;  1QT9 A;  1B9R A;  2PVG C;  3BII D;  3FC4 A;  1DGJ A;  5H92 C;  2WLB A;  1N61 A;  3AE4 B;  2CJN A;  3AE6 B;  3AED B;  1N60 A;  3SFD B;  1A70 A;  4YSZ B;  3NVY A;  2BT6 A;  2MJD A;  3ZYY X;  2WQY B;  2MH7 A;  1FIQ A;  1ROE A;  2QIE B;  1NEN B;  1XLQ A;  4ITK A;  2E3T A;  4KX6 B;  2QJL A;  1TYG B;  3L4P A;  1PFD A;  2BS3 B;  1ZOY B;  3AH7 A;  4US8 A;  4HRO A;  2FBW B;  3AE1 B;  4YSY B;  2WDR B;  4C7Z A;  1RYJ A;  2OHF A;  3NS1 A;  1AYF A;  2W54 A;  3AEA B;  4N6E B;  5EE0 A;  1GAQ B;  1XLN A;  1XLO A;  1QOF A;  1ZUD 2;  1KRH A;  1N62 A;  1V97 A;  1WRI A;  3CIR B;  1JRO A;  2M19 A;  4N58 A;  5H8Y E;  1N5W A;  3DWM A;  3SR6 A;  3AN1 A;  1E9M A;  1UWM A;  2H88 B;  3W5V B;  4C7Y A;  2WU2 B;  1RFK A;  3AE7 B;  2EKI A;  1E7P B;  1JAL A;  1SB3 C;  3NVW A;  4US9 A;  3AEC B;  1N63 A;  1OQR A;  1XLP A;  3AM9 A;  1VLB A;  1SF0 A;  4JX1 C;  1AWD A;  1J7C A;  2G1E A;  3AEF B;  2PKO A;  3WCQ A;  3AMZ A;  2DBY A;  1YQ4 B;  5AUI A;  4A9A A;  1ZXI A;  5G5H A;  1NVI D;  2CJO A;  1JRP A;  2MJ3 A;  2N0S B;  3EUB 2;  4C80 A;  3NVV A;  2MJE A;  3LXF A;  4IDI A;  1KFY B;  3AE3 B;  3P4Q B;  2H89 B;  3P4P B;  1DOY A;  3AE8 B;  2B76 B;  1IUE A;  5EE3 A; 
#chains in the Genus database with same CATH topology
 2PJH A;  3RI7 C;  4PS7 A;  2D3G A;  3P42 A;  1OQY A;  2W3S A;  3R7R A;  3H7S A;  3TBL D;  4KKJ A;  3SHQ A;  3JW0 X;  3C19 A;  2VZK D;  4KV2 A;  4MGY E;  5EDS A;  3UIO B;  4URK A;  2BF8 B;  4HRS A;  4NAM A;  2L32 A;  1UNS A;  4W9J A;  3DWG C;  4IKG A;  4GDL B;  4W9E A;  1QF6 A;  2N9P C;  5JZE B;  4LDT B;  1WI0 A;  1ZE3 D;  2BWF A;  4TSS A;  2LAS A;  4N59 A;  2C5L C;  2NMQ A;  4YTP B;  2N9X A;  3QX1 A;  1KF6 B;  4KSK C;  4RM9 A;  4I6L B;  2WYQ A;  4LK0 M;  3ZDT A;  2KAJ A;  1LQB A;  3LB8 C;  4XC2 A;  4KZC A;  2HE7 A;  2EMS A;  3ETR A;  1JWM D;  1ZDV A;  3MHZ A;  1E7V A;  3Q3N C;  4S0R A;  1TT5 B;  3VUY A;  4ZRQ A;  2KVR A;  3A9J A;  4EZJ A;  3UQB A;  2XK5 A;  2LGY A;  2ASQ A;  2BYF A;  3Q3O C;  2MRP A;  2MW5 A;  3ZNZ B;  3EA6 A;  1QIL A;  3QC8 B;  1WGG A;  4WH4 A;  3M95 A;  4AP4 C;  4ZYS A;  4FLH A;  1WRI A;  1JRO A;  2JZ3 B;  2XNA C;  4G11 A;  2C7H A;  4TUU A;  2FCN A;  1UBI A;  4NZL B;  2D2Q A;  2V3S A;  3BVG A;  4IM3 A;  3RNC C;  5IKC M;  2N9L A;  3AMZ A;  2DBY A;  4HEA 1;  3PZD A;  1FNV A;  2KQS A;  2IO1 B;  1KFY B;  3CST A;  4FA6 A;  4K3C A;  3NRZ A;  4CO7 A;  1K50 A;  4KZ0 A;  2WX1 A;  2LWP A;  2BS2 B;  3QCA A;  2IO3 B;  5HG2 A;  3EGR A;  1E10 A;  4LDT D;  2KX0 A;  1L0X B;  2JUO A;  1SE3 A;  1YX6 B;  3Q2A C;  1EWY C;  3ZRF A;  4ZDV A;  5G2N A;  2JU6 X;  2HJ1 A;  4XWT A;  4UDU C;  2MHJ A;  2JYT A;  1WM2 A;  1OQQ A;  4LTU A;  5HFY A;  1C4P A;  2BB6 A;  1OTR B;  3Q8F A;  1T5X D;  2LJ5 A;  2MQJ A;  1FXA A;  2NBV B;  4BBN C;  4HKZ E;  2N7J A;  1WMH A;  2KD0 A;  1JWA D;  1G6J A;  3SU8 X;  1YOV B;  1GOZ A;  4YTN B;  2RPV A;  1UZX B;  3ZDM C;  4D2K A;  1D5M C;  2OED A;  2V4I B;  1FRD A;  3LJ3 A;  3Q3M C;  1B9R A;  2WXR A;  1DGJ A;  4KGR A;  2L0F A;  3AE6 B;  2MP2 A;  5J18 A;  2QMT A;  3RNG C;  3VH4 B;  2KWU B;  2ZCC A;  1XLQ A;  3TEY A;  4LCD E;  2KVZ A;  5G55 A;  1ZOY B;  1PQS A;  3UGB B;  4US8 A;  4HRO A;  3IVF A;  1D6E C;  4DXG A;  1RYJ A;  4JPS A;  3CIR B;  2KJH B;  1Q10 A;  3DCG A;  4XX5 A;  4KDL B;  3OG5 A;  2K25 A;  2BBC A;  1XLP A;  2ZEQ A;  2AQ1 B;  3FIL A;  1V49 A;  1LXD A;  3A9K A;  2KN5 A;  4YL8 A;  3SEB A;  3P2B A;  3APD A;  4A8X C;  2O6V D;  5E6P A;  1SIJ A;  1PUT A;  3FKY A;  2C7N B;  3V3X A;  3IBE A;  2J7Q B;  1VRA B;  4ZOH C;  1X1M A;  1QOG A;  4F8C B;  2KZR A;  2MBH A;  2BS4 B;  3L16 A;  3ZRC A;  2KDE B;  1L4D B;  2ACZ B;  3KW5 B;  3OWE B;  1VZ7 A;  4MM3 B;  3P1M A;  1LM8 B;  2GBM A;  4M0W A;  1N6Z A;  1SIF A;  1DYQ A;  1WH3 A;  2G45 B;  1Q0W B;  4EOY A;  1J8C A;  4E71 A;  2BPS A;  2BTE A;  3VRA B;  3NS8 A;  1PYW D;  1KH0 A;  4C4V B;  1JWB D;  1Q1O A;  3EC8 A;  2NTS A;  2IND C;  3PRE A;  1V81 A;  5E6J A;  3I63 C;  2A5U A;  4M00 A;  3AED B;  2ZNV C;  4K1R B;  2E6X A;  2WQY B;  5AEK B;  4PYU A;  1IP9 A;  1ZKH A;  3QWZ B;  4IM2 A;  4RF1 A;  3U52 E;  3A33 B;  2LJI A;  1I4R A;  5LXI B;  1WGR A;  3NS1 A;  2W54 A;  1OGW A;  2IZV B;  3WAO A;  4M8N A;  1XLO A;  1V97 A;  3MC0 B;  4A3O A;  2KAN A;  2KDB A;  4KIK B;  1UD7 A;  2FID A;  2WNM A;  3GZN I;  3A9K B;  3TCA A;  1HXY D;  1AWD A;  5D7G A;  4NJC A;  4RH6 A;  3HK0 A;  4LNK A;  4W9G A;  1VZ6 A;  2N1W A;  4DWF A;  4AUQ C;  2N0S B;  1WMH B;  3V62 A;  3NVV A;  4WJN A;  1T0Y A;  3AE8 B;  2KX3 A;  2LEK A;  2AQ3 B;  4IWP A;  4IUM B;  4DHZ E;  4NQL B;  5BO4 B;  3CF6 E;  3DBR B;  1C1Y B;  1QLB B;  4FBJ B;  1R4N B;  3OAW A;  3I3T B;  2JQR B;  2AYO B;  2IPK D;  1C79 A;  2LGX A;  4IW0 A;  3QHT A;  2QCZ A;  3B2G A;  3A1Q A;  2JWU A;  2VH2 A;  2GBJ A;  2L83 A;  1FCC C;  2KMC A;  3HVD A;  3WA0 A;  1XQQ A;  2Y5B B;  4FAD A;  4W9L A;  2L76 A;  2JY6 A;  2A4Z A;  3DBR I;  3WIM A;  2J0J A;  2KTR A;  4CHK A;  1V86 A;  2I1J A;  2MSE D;  2KDI A;  3RNA C;  1MHX A;  2DX5 B;  1P7E A;  1FO4 A;  4W9F A;  1NYR A;  4E74 A;  4RGT A;  1TIF A;  3VTW A;  3Q69 A;  3VR9 B;  1RFA A;  4C00 A;  2WP9 B;  4MDK E;  1K8R B;  4N9F 4;  4AOF A;  3RNB C;  1YN4 A;  4HXD A;  4NQK E;  3DVG X;  2ZW0 A;  3H7P B;  1WZ3 A;  1WGD A;  1Y8R C;  1FIQ A;  2D3A A;  4IC7 B;  4EUT A;  4W9D A;  2K1F A;  2MBB B;  4RM8 A;  1KLG D;  3AU5 A;  1D4B A;  3RNE C;  2R2Q A;  2O6V A;  2MLB A;  4A6Q A;  2JWZ A;  1FEH A;  1XLN A;  2MEK A;  3W1S A;  1KRH A;  2KYW A;  1UWM A;  1WX9 A;  1HZ5 A;  2GBR A;  1ET9 A;  1JWU D;  1JCK B;  3AM9 A;  1VLB A;  4MM3 A;  1WXM A;  4R3D A;  2REX A;  4JX1 C;  3TSS A;  5JXV A;  3PPA A;  1M4V A;  4TQ0 A;  1HTO A;  4PYZ A;  4RGO S;  2MJ3 A;  3P4Q B;  4JGH B;  4ZRI A;  1L6U A;  1SE9 A;  1P3Q U;  1I42 A;  3X0W A;  2WXH A;  2L0T A;  2Z0D B;  2LXA A;  1GG3 A;  2D3B A;  2KO3 A;  2WGS A;  5C1Z A;  1L0V B;  1CK1 A;  2MP2 B;  3OJ4 B;  5C3J B;  3BVZ A;  2G4D B;  4YTM B;  1NI2 A;  4YT0 B;  4FHJ A;  1L7Y A;  1VDV A;  4CQN A;  5C2T B;  3ZGZ A;  4MSM B;  4MT5 A;  4M01 A;  4B6W A;  1WYW B;  3I57 A;  4ZRK A;  4K7U A;  4RGN A;  2ONQ A;  3SD5 A;  2PE9 A;  5D94 A;  1TKE A;  2YLM A;  3ZXV A;  2K5P A;  3AE2 B;  5C23 A;  4RNA A;  1A5R A;  3O65 B;  4A3P A;  2RD0 A;  3JSV B;  1RM6 C;  4EFO A;  4GOC A;  1UGJ A;  1AN8 A;  1E8X A;  1EF1 A;  2RMM A;  1TS2 A;  2KTF A;  3PLV A;  4J3O D;  4YWG G;  1GC7 A;  1NDD A;  2K6Q A;  1ACC A;  1QT9 A;  3HM3 A;  4K3B A;  1SE2 A;  1LGR A;  1A70 A;  4ANX A;  2JSV X;  1WY8 A;  1C9F A;  4WIP A;  3ONS A;  3QK0 A;  4L23 A;  2WXF A;  4BBN F;  2BS3 B;  2PMV A;  2WDR B;  3PRP B;  4GU2 A;  4N6E B;  3EHV A;  1N62 A;  2EKE C;  3BIN A;  4MJS A;  1ET6 A;  4BVU C;  4WQO B;  4KGS A;  1JAL A;  2FCQ A;  2WXL A;  1WIA A;  3OLM D;  3X23 A;  1TY2 A;  1ZXI A;  1UUP A;  2K8H A;  1WYG A;  1XXG A;  2KFJ A;  1F77 A;  3U8Z A;  4B9K A;  4FJZ A;  2LD9 A;  1K52 A;  1V1P A;  1I4G A;  3KYC D;  3I9V 1;  2MWS B;  3N32 A;  1JW9 D;  3BY4 B;  3ML8 A;  4ZRP A;  4W9K A;  3KUC B;  3GS2 A;  1YIW A;  4HCN B;  2YEP F;  2EMT A;  2JX5 A;  4GB9 A;  1I4Q A;  2XN9 C;  3CSF A;  3K9P B;  1M94 A;  1V2Y A;  2MA9 B;  1WF9 A;  4FJY A;  5E6O A;  5L83 A;  2BQQ A;  2QC8 A;  4G50 A;  1WXA A;  2JT4 B;  5LLI A;  1R4M B;  4M02 A;  3BK2 A;  1ZGU B;  2I1K A;  1WJU A;  2BKR B;  1F0Z A;  4HJG E;  2LGI A;  4H2A A;  3BII D;  3PS6 A;  2KC2 A;  1I4P A;  5H92 C;  4REZ A;  3EFU A;  5IO9 A;  4MJS B;  3T9L A;  1AYF A;  3A4S C;  4N58 A;  3DWM A;  2NBW B;  4US9 A;  3NZ3 A;  2WXK A;  3NY5 A;  2V0G A;  3DHG C;  1PGB A;  1J7C A;  3ZTD A;  4L2Y A;  3U4E G;  1EF5 A;  2PLP A;  4XZ4 A;  3R2I A;  4K7S A;  1DOY A;  3AE3 B;  2D3C A;  4K7W A;  3UI3 A;  1J7A A;  4KDI C;  2FUG 1;  2CU1 A;  2WXN A;  1V5O A;  4W9I A;  3ENE A;  1EO6 A;  1MVK A;  2PVO D;  2SAK A;  1S1Q B;  3N20 C;  3EEC A;  5FR3 A;  2WU5 B;  4HDO A;  3A9J B;  4CYE A;  3Q6B A;  2Y5C A;  4JLC A;  4J6I A;  2GMI C;  1DOX A;  2KFK A;  3PLU A;  2J42 A;  1OFF A;  3RUL A;  1TJE A;  3GP7 A;  2DEN B;  1YJJ A;  2UYZ B;  1P9D U;  4WAF A;  3AEG B;  3N9Y C;  3TEX A;  1TKG A;  4HPL B;  3HUI A;  1WE7 A;  2CU3 A;  1WXV A;  2VZK B;  5TR5 A;  2DZJ A;  5DPW A;  3DBL B;  1YJI A;  1QOB A;  1NEK B;  2N1V A;  3GB1 A;  2WLB A;  5IOI A;  2AL6 A;  2LHE A;  3IG3 A;  5CHV C;  3TUO A;  3BZD B;  3NG0 A;  1ZDX A;  2DZM A;  1P0R A;  2GBK A;  4GDL A;  4NAW B;  3NUH B;  4LNI A;  4DHJ D;  3PTF C;  3AEA B;  1MI0 A;  1BUI C;  1GAQ B;  3Q8B A;  1C76 A;  3KUD B;  2KKC A;  2BKF A;  4O1N A;  1TZO A;  1F1H A;  5AZF A;  1JWS D;  3RUI B;  2RDH A;  3AE7 B;  3L13 A;  1LO5 D;  4OHJ A;  2KNB A;  5CX3 A;  4HLE A;  4A9A A;  1F52 A;  1TZ1 A;  4C80 A;  1FPY A;  2M0A A;  4KGT A;  2J0K A;  3P4P B;  3ZLZ A;  3HM6 X;  4GSW A;  2DWQ A;  2DYO A;  4JWU C;  5GXG B;  3Q8C A;  1H8C A;  1L5P A;  2C9W B;  1WGH A;  1GPX A;  3ZJV A;  2GI9 A;  1QKZ A;  4WQM A;  2O2V A;  3MP9 A;  3N1X C;  3UIP B;  2PPH A;  5HKH A;  2DYB A;  4YXD B;  1YN5 A;  2LFI A;  1TKY A;  2K39 A;  1EM7 A;  2NTT A;  3MJW A;  3ABV B;  3AE9 B;  1WM3 A;  3V60 A;  1E8W A;  1D5X C;  3L0W B;  4S17 A;  1IYF A;  1V80 A;  2CR5 A;  2Y5P A;  3CMM B;  2GLS A;  3M63 B;  3BWU D;  2JRH A;  2NS5 A;  1SE4 A;  4LNF A;  3AV8 A;  1XD3 B;  2FAZ A;  4LNO A;  4KVG B;  4IWQ A;  3RCZ A;  3NOB A;  5DCN A;  4XDD A;  2IDY A;  2RGF A;  4ZYN A;  4NAW A;  2OOB B;  4A55 A;  4RFB A;  2WXG A;  1NEN B;  3N1Y C;  5J17 A;  1IGC A;  3R7Q A;  1TYG B;  4TQ1 A;  4A20 A;  3U7Z A;  2JVC A;  4GDK A;  3RD2 A;  3RT3 B;  2J0M A;  3QA8 A;  2INC C;  2RDB C;  2GB1 A;  1ZUD 2;  2LRW A;  1QZE A;  2VRR B;  1N5W A;  2J53 A;  3SR6 A;  2IGG A;  3AEC B;  2G4S A;  1SF0 A;  3RFZ B;  1SBB B;  4B0M A;  2IO0 B;  1YQB A;  4P1B C;  2IGH A;  3H8H A;  3APF A;  1NVI D;  2WHI A;  4B95 A;  4HJK A;  5E6N A;  3LXF A;  3BVM A;  1T0Q C;  2H89 B;  1R4N I;  4MSQ B;  2QJL A;  1XT9 B;  4BKS A;  3BYT B;  2LGS A;  4HPP A;  3L10 B;  3IHP C;  2LRU A;  4KSL C;  1WR6 E;  2PE6 B;  4DHJ B;  2DLB A;  1XCT L;  3P63 A;  1JRU A;  3RZW C;  3IAM 1;  1E8Z A;  2R61 A;  5GMV A;  2JZZ A;  1F2R I;  3KUZ A;  3DPD A;  4DQO C;  1IBX A;  4BZA A;  3TJP A;  4BAX A;  4DK5 A;  2B3A A;  4HK2 A;  3ZW3 A;  2KQ4 X;  1YNT E;  4WWN A;  1WXQ A;  2L8J A;  2RPQ A;  2W3R A;  3VVW B;  3EFC A;  3MTN B;  4EZK A;  2CS4 A;  2YVC A;  3PHW B;  5DPS A;  2AX5 A;  3AB5 A;  1T0S C;  1WGY A;  3VFK A;  3N3K B;  4PS8 A;  2BYV E;  2KXJ A;  1KOT A;  5IP4 D;  2KDM A;  3KYD D;  2M17 A;  3AE4 B;  3VQI A;  3M62 B;  1ZPS A;  3NVY A;  3KQ4 A;  4L1B A;  4AQ7 A;  3ZIM A;  2KK8 A;  4KX6 B;  1STE A;  3APC A;  3VTU A;  3TMP B;  1J0G A;  1V1O A;  1KTK A;  1P1A A;  3GE8 C;  3PRM B;  4MGZ E;  3W1S C;  2M19 A;  3RZF A;  1E9M A;  1YD8 U;  5CHW A;  2D10 A;  4G3X B;  3J9C A;  1KJT A;  2N4F A;  2RR9 A;  1SJH D;  4E3C A;  1E7U A;  2YEP B;  3WCQ A;  4M0W B;  1CMX B;  3EUB 2;  4IDI A;  2INN E;  1HE8 A;  1IUE A;  2JRI B;  3QJZ A;  2JPH A;  4II3 B;  2DAJ A;  2M0X A;  1WJ6 A;  4HWI B;  3VTV A;  1D5Z C;  3OJ3 A;  2PIA A;  3GZN B;  1MPE A;  3NHE B;  2EEL A;  1N5X A;  2IYD B;  4F1S A;  1WFY A;  4I6N B;  2DAF A;  2HD5 B;  2JXT A;  4EEW A;  3PRZ A;  3H6N A;  3V6C B;  1J7B A;  4PT5 A;  2IJ0 A;  2AEH A;  2KQ7 A;  2KLC A;  3U30 A;  1NBF C;  3RNF C;  2LMC A;  4MEM A;  3KWL A;  2RDG A;  4IOI E;  4WUR A;  3P4R B;  3A1Q B;  2MX2 A;  2I38 A;  5IAA C;  2KMM A;  1YMH E;  2L05 A;  1NYQ A;  3WAP A;  1XEE A;  2LUM A;  4GMV A;  1KLV A;  5L95 C;  1GUA B;  4AJW A;  1WGK A;  2BYT A;  2L52 A;  1ZP0 B;  3DHH C;  4XDC A;  3VUW A;  3WAL A;  1MFW A;  1TGZ B;  4KKI A;  2W9N A;  2CJN A;  2OJW A;  2BT6 A;  2MJD A;  2LI5 A;  5D6J B;  3U7D A;  2K0P A;  4LJO B;  1EUV B;  2BWE S;  2CKH B;  4BKT A;  2TSS A;  1V5T A;  4BKS D;  3RN9 C;  4AS1 A;  3BK1 A;  3DDC B;  2N9K A;  5IN7 A;  5CTR C;  3N30 A;  4HDQ A;  3W2D A;  2JYE A;  5BYQ A;  3Q3J A;  2FCM A;  3C8Y A;  1BML C;  3QIJ A;  5DPR A;  4GIV A;  1HQR D;  4LJP B;  2IBI B;  2AL3 A;  3B0A A;  3ML9 A;  2QHO A;  4WWP A;  1RWS A;  4IWO A;  3VDZ A;  3NZU A;  2V9H A;  4NJ6 A;  5MPO A;  2MBO A;  3C0R B;  2XEW A;  2IY1 B;  3KLS X;  3Q8E A;  1CJE A;  3JVZ X;  3MFG A;  3DHI C;  1V9J A;  3ZJU A;  1C3T A;  1VD2 A;  3DVN U;  1LFD A;  2WDQ B;  4II2 B;  3VUX A;  3GOE A;  3B2F A;  3ZNG C;  1MJD A;  1TY0 A;  1UEL A;  2QEJ C;  2KHW B;  1I4X A;  1ISN A;  1L4Z B;  4GN1 A;  3V61 A;  3TEW A;  2HTH A;  4MGK E;  4TV3 A;  2KC1 A;  3I5J C;  3AXC A;  2X8X X;  2ZW1 A;  1CZP A;  4LLG M;  3RYT A;  3IT6 B;  3VRB B;  2HTM E;  1FXI A;  2BYE A;  4IM0 A;  2ON8 A;  1WJN A;  2K9X A;  2FE8 A;  2KWC A;  1E8Y A;  2O6V B;  1FNU A;  4MAC A;  3LYY A;  2BGF A;  2ICI A;  1ROE A;  4ITK A;  1GB1 A;  3HHM A;  1UF0 A;  4P1C C;  1PFD A;  3O13 A;  3AH7 A;  3PT2 B;  4YSY B;  5D3I B;  4OW0 A;  3L17 A;  1HEZ E;  5T8I A;  3ZNH B;  2QDF A;  1TBE A;  1FD6 A;  1SSN A;  1XF5 L;  2FUH B;  1IPG A;  4RMA A;  5J2R A;  4F7Z A;  5JHB A;  3ZNI D;  3A4R A;  2WXP A;  1QQR A;  2PTL A;  2PKO A;  1YQ4 B;  1JRP A;  2QSD A;  5EE3 A;  4ANW A;  2ZVN A;  1VJK A;  1DOI A;  1JQ4 A;  3WAM A;  1F9J A;  2N9E B;  4QAY A;  1ZW7 A;  4OZC A;  1JML A;  2CHW A;  4DBG A;  3VXW A;  4PK1 A;  4M8M A;  2NCN A;  4DXF A;  3M3J A;  5BMG A;  2V3N A;  3ZKJ C;  2L3Z A;  3AE5 B;  1TS5 A;  3HRD D;  3QAQ A;  3DQV A;  4NJ7 A;  1C77 A;  3SDL C;  2DNF A;  5DPT A;  4HCP B;  2KOX A;  4ARC A;  1UGM A;  2DYM A;  1MG8 A;  3FIL B;  3W9C B;  4KIK A;  4JE3 B;  3QAR A;  2OJR A;  2INP E;  2ZNV B;  3S2A A;  4MEL A;  1YN3 A;  3ZO5 B;  1KLU D;  2N7D A;  4JQW C;  1PGA A;  5BYR A;  3ALB A;  1L6V A;  2MBE A;  2Q5W D;  3DBH B;  2WXI A;  3R2T A;  2WXQ A;  2E3T A;  3NZS A;  3VAW A;  1FNW A;  4X57 B;  4IG7 B;  4TMA B;  2LZ6 A;  4C7Z A;  2IGD A;  2JXX A;  1QOF A;  2L1A A;  2M1M A;  3AN1 A;  3UIN B;  5BMH A;  3IFW B;  3PV1 A;  2G1E A;  2JZP A;  1Z5S B;  5KHO A;  2KN4 A;  3U2S C;  2JF5 A;  4P7I A;  4ANV A;  4WJO A;  2ZJD A;  1CQV A;  5LXH A;  3PZ7 A;  3VR8 B;  2RSU A;  2LUE A;  4MH0 E;  4C4V A;  4FHK A;  2Z8L A;  4RGM A;  3NVZ A;  2KDF B;  5I4D A;  2IY0 B;  1VR9 A;  3IT4 B;  2K8B A;  5JHA A;  3AEB B;  2O2V B;  4DDI D;  3UF8 A;  5AUK A;  3TEZ A;  2WX0 A;  3PGE A;  1V6E A;  5EE1 A;  1B1Z A;  3L54 A;  5FK9 C;  4YSX B;  3P4S B;  1I7H A;  3RMK C;  2W82 A;  1ESF A;  1BXT A;  4W9C A;  2FIF A;  2PEA A;  4EKU A;  1XCQ L;  1XO3 A;  4XGA B;  5TSS A;  1YJ1 A;  2M56 B;  4NNJ B;  4ICU A;  2BB5 A;  2Z59 B;  1UBQ A;  3ZXR A;  1V1P B;  2KTR B;  2X38 A;  4XWW A;  1S3S G;  4JWS C;  3T8M A;  3MC8 A;  2C60 A;  2MH7 A;  3E56 A;  2MCN B;  5JH5 C;  3ZUN A;  4TKN A;  4K81 A;  2OHF A;  1P98 A;  1RAX A;  3DBS A;  4OVV A;  1UH6 A;  3Q14 C;  2V3P A;  5BYS A;  3AI5 A;  4WAA A;  2H88 B;  3W5V B;  4BOZ B;  1SB3 C;  4BKG A;  4MH8 A;  1C78 A;  2NVU I;  1OEY A;  2Y3A A;  3NJT A;  2M4N A;  2UU7 A;  2WXM A;  4WWM A;  1HA5 A;  2R2O A;  2D5G A;  2KMA A;  1L2N A;  3ZTC A;  2G3Q B;  1T0R C;  2W55 A;  3H1U A;  1WWT A;  1RRB A;  1WX7 A;  2XBB C;  1GB4 A;  3DOW A;  3IAS 1;  4EE2 A;  1WRD B;  2WDT B;  2WWZ A;  4P16 A;  1TTN A;  1SJE D;  4OZB A;  5CHF A;  1FFV A;  2C7M B;  2WXJ A;  4ASW C;  4Q2J A;  1MHH E;  4FJV B;  2D11 A;  1T3Q A;  3R66 C;  2MBQ A;  3T3N A;  1EU3 A;  1P7F A;  1SGH A;  4OVU A;  3FAH A;  1C4C A;  3PVL A;  1AAR A;  5IA7 A;  3B9J A;  3MC9 A;  3MHS D;  2NR2 A;  4GGQ A;  1ZXH A;  1SEB D;  1WR1 A;  4PS3 A;  2I2Y A;  3RPF C;  5EE9 A;  3IXS A;  3DVN V;  2PVG C;  1BT0 A;  1N61 A;  3SFD B;  2GRI A;  3ZQ4 A;  2LVQ A;  1WJ4 A;  1SXT A;  2QIL A;  4DHZ B;  2K6D B;  2DZK A;  1E5W A;  1WX8 A;  1WE6 A;  2HDE A;  3L4P A;  3LDZ E;  2M8S A;  1T6B X;  2KLG A;  4FUL A;  2CHZ A;  1TS3 A;  1IBX B;  4W9H A;  1WSP A;  2XK5 B;  4GLS C;  4C7Y A;  2DHZ A;  4XE0 A;  1N63 A;  1KM7 A;  2J4X A;  4ICV A;  5LNK 1;  2LXC A;  4EZL A;  2V4L A;  2G9H D;  2ZPY A;  1RLF A;  2B76 B;  4ZHP A;  1R7S A;  2Z0E B;  3DVG Y;  4HVB A;  2LVO A;  3V6E B;  3AUL A;  2WS3 B;  4USA A;  2HJ8 A;  3E9S A;  3Q8A A;  4OVZ A;  3TL5 A;  1QOA A;  1VCB A;  1FXT B;  2L7R A;  3HVZ A;  2ZCB A;  4WJQ A;  3B08 A;  2PW9 A;  2KJ6 A;  3UQA A;  4GDK B;  5G5G A;  3W1Y A;  2NBU A;  1PGX A;  1FFU A;  2NPT A;  3W5U B;  2V1Y A;  1NI3 A;  3PO0 A;  1PDX A;  5D3D A;  4AWJ A;  5FR6 A;  2SEB D;  3SFE B;  1E0Z A;  3L08 A;  1Z2M A;  2L00 B;  1YX5 B;  1C4A A;  1FMA D;  3Q3F A;  4HKQ A;  4P6V F;  4DXA B;  1R4M I;  1MG4 A;  5FKA C;  5D2M B;  4A90 A;  3FC4 A;  4AJY B;  3K9O B;  3WAN A;  3V05 A;  2BVC A;  3PSE B;  2KWD A;  3N1Z C;  3QQ8 B;  2K3U A;  4RF0 A;  2ZVO A;  3H7P A;  1WXS A;  1I35 A;  5EE0 A;  2KJR A;  4ARI A;  2GOW A;  3B1L X;  4ACF A;  3PHX B;  4JL9 A;  2WU2 B;  1RFK A;  2BW2 A;  2EKI A;  5AZH A;  3AEF B;  4I6P A;  4ZRJ A;  1HZ6 A;  4HPM B;  4ANU A;  5KHQ A;  5AUI A;  5G5H A;  2VH1 A;  4MGI E;  2ZPN A;  2MJE A;  2CHX A;  1I4H A;  1GC6 A;  1OEY J;  5BMI A;  1AW7 A;  2LHD A;  3AU4 A;  3GE3 C;  1Q5W B;  1Y56 A;  3R3M A;  2WDV B;  5AZG A;  3ZVV A;  1E6E B;  3MJ5 A;  2J52 A;  2K22 A;  2KAC A;  3PZ8 A;  1H4R A;  1V8C A;  1D3Z A;  3VH3 B;  3KWV A;  2FNJ B;  4ZHO A;  2ZZP B;  2WXO A;  4FXC A;  2K8C A;  2NPT B;  4DDG D;  1EWC A;  4OZA A;  1F2R C;  1FCL A;  1EU4 A;  3AEE B;  4NY0 A;  1L0Y B;  1WZ0 A;  4NPN A;  1FM0 D;  3ZJT A;  2N7E A;  3URY A;  1IGD A;  2AWT A;  1VZ8 A;  2GBN A;  5HHD G;  3KVF B;  1FRR A;  4RCO A;  2D07 B;  3BYY B;  2LVP A;  1K53 A;  1E90 A;  1ENF A;  3VHT C;  3CWI A;  4XYC A;  1YQ3 B;  1UWX A;  3KH0 A;  4FN2 A;  3DBL I;  4JIO U;  2FCS A;  4C56 C;  2LGD A;  1N60 A;  3R8B A;  4YSZ B;  3T3O A;  3ZYY X;  2UWQ A;  1HTQ A;  4WJP A;  2AQ2 B;  1GNU A;  2QIE B;  1U4A A;  3ECI A;  1K51 A;  2FBW B;  3AE1 B;  3D32 A;  3TIX A;  1J19 A;  4LNN A;  4BFR A;  2IO2 B;  4G0N B;  5H8Y E;  1GJZ A;  3JYU A;  3DBH I;  4BOS C;  1E7P B;  3NVW A;  1OQR A;  2KWV B;  2KFK B;  2DZI A;  2KT7 A;  3JSV A;  4WWO A;  4B0E A;  5HI1 A;  4GXB A;  3HIZ A;  1TS4 A;  3H9D A;  2CJO A; 
#chains in the Genus database with same CATH homology
 3VR8 B;  3BYT B;  2Z8L A;  4RGM A;  1L6U A;  3NVZ A;  5I4D A;  3P42 A;  2W3S A;  1VR9 A;  2WXH A;  3IT4 B;  4KKJ A;  3AEB B;  2DLB A;  1XCT L;  1L0V B;  3P63 A;  1CK1 A;  2VZK D;  5C3J B;  3BVZ A;  3IAM 1;  5AUK A;  3TEZ A;  2R61 A;  4YTM B;  4HRS A;  1F2R I;  4NAM A;  2L32 A;  4YT0 B;  5EE1 A;  1UNS A;  1B1Z A;  1VDV A;  3DWG C;  4IKG A;  4DQO C;  5C2T B;  4CQN A;  4GDL B;  1IBX A;  3ZGZ A;  1QF6 A;  4MT5 A;  5FK9 C;  4YSX B;  3I57 A;  2KQ4 X;  3P4S B;  1I7H A;  4RGN A;  1YNT E;  2ONQ A;  1ZE3 D;  2W82 A;  1WXQ A;  1ESF A;  1BXT A;  2W3R A;  1TKE A;  4TSS A;  2K5P A;  3AE2 B;  4N59 A;  2NMQ A;  1XCQ L;  4YTP B;  2AX5 A;  3AB5 A;  1XO3 A;  4RNA A;  1KF6 B;  5TSS A;  2M56 B;  1RM6 C;  2BB5 A;  1UGJ A;  1AN8 A;  4LK0 M;  2RMM A;  1V1P B;  2KAJ A;  3LB8 C;  1TS2 A;  2X38 A;  4J3O D;  4XWW A;  4YWG G;  3ETR A;  1ACC A;  1JWM D;  4JWS C;  1QT9 A;  1ZDV A;  2KDM A;  3MHZ A;  1SE2 A;  3AE4 B;  3VQI A;  1A70 A;  4ZRQ A;  1ZPS A;  2JSV X;  3KQ4 A;  3NVY A;  1C9F A;  4WIP A;  2MH7 A;  3E56 A;  4L23 A;  4L1B A;  4AQ7 A;  2WXF A;  4KX6 B;  1STE A;  2BS3 B;  3EA6 A;  1QIL A;  2PMV A;  4WH4 A;  2WDR B;  1V1O A;  2OHF A;  4ZYS A;  1KTK A;  4N6E B;  1N62 A;  1WRI A;  1JRO A;  2M19 A;  2V3P A;  5BYS A;  2XNA C;  1E9M A;  1ET6 A;  2H88 B;  3W5V B;  4KGS A;  4NZL B;  1JAL A;  1SB3 C;  2WXL A;  3J9C A;  4MH8 A;  3BVG A;  1SJH D;  1C78 A;  2N9L A;  2YEP B;  3WCQ A;  3AMZ A;  2DBY A;  1TY2 A;  4HEA 1;  1ZXI A;  1UUP A;  3EUB 2;  1FNV A;  2Y3A A;  4IDI A;  1KFY B;  2INN E;  1IUE A;  1WYG A;  1XXG A;  1F77 A;  3NRZ A;  2WXM A;  4WWM A;  1HA5 A;  1K50 A;  1K52 A;  1V1P A;  2BS2 B;  2D5G A;  1I4G A;  5HG2 A;  1D5Z C;  3EGR A;  1E10 A;  1L0X B;  2PIA A;  1MPE A;  2EEL A;  1N5X A;  1SE3 A;  3I9V 1;  2JXT A;  1JW9 D;  4ZRP A;  2W55 A;  1EWY C;  3GS2 A;  1WWT A;  1J7B A;  4PT5 A;  1GB4 A;  2IJ0 A;  2JU6 X;  2YEP F;  3IAS 1;  4XWT A;  4UDU C;  4EE2 A;  2JYT A;  2JX5 A;  1OQQ A;  4LTU A;  5HFY A;  4P16 A;  1I4Q A;  1C4P A;  2BB6 A;  2LMC A;  1SJE D;  2XN9 C;  4OZB A;  3KWL A;  2RDG A;  1FFV A;  4IOI E;  4WUR A;  3Q8F A;  1T5X D;  2WXJ A;  3P4R B;  1FXA A;  4Q2J A;  1MHH E;  2I38 A;  4HKZ E;  2KMM A;  2N7J A;  1T3Q A;  1JWA D;  1YMH E;  3T3N A;  1EU3 A;  1P7F A;  1GOZ A;  4YTN B;  3BK2 A;  3FAH A;  1C4C A;  1NYQ A;  2RPV A;  3B9J A;  1XEE A;  1ZXH A;  2LUM A;  1SEB D;  4D2K A;  1D5M C;  2OED A;  1F0Z A;  2I2Y A;  1WGK A;  2V4I B;  4HJG E;  2L52 A;  2LGI A;  2BYT A;  3RPF C;  1ZP0 B;  1FRD A;  5EE9 A;  1B9R A;  3IXS A;  4XDC A;  2WXR A;  4H2A A;  2PVG C;  3BII D;  1DGJ A;  5H92 C;  1I4P A;  4KKI A;  4KGR A;  1N61 A;  3SFD B;  2CJN A;  2GRI A;  3AE6 B;  3ZQ4 A;  2QMT A;  2BT6 A;  2MJD A;  1SXT A;  2QIL A;  4REZ A;  2K0P A;  1XLQ A;  2HDE A;  3TEY A;  3L4P A;  2TSS A;  1ZOY B;  1T6B X;  4US8 A;  4HRO A;  4DXG A;  1D6E C;  4AS1 A;  1RYJ A;  3BK1 A;  4JPS A;  1AYF A;  2N9K A;  1TS3 A;  3CIR B;  4N58 A;  3W2D A;  2JYE A;  1IBX B;  5BYQ A;  1Q10 A;  3DWM A;  1WSP A;  4GLS C;  4C7Y A;  4XE0 A;  3C8Y A;  4US9 A;  3NZ3 A;  1N63 A;  2WXK A;  2BBC A;  2V0G A;  2J4X A;  1XLP A;  5LNK 1;  1BML C;  1PGB A;  1J7C A;  4L2Y A;  3U4E G;  2AQ1 B;  3FIL A;  2G9H D;  2PLP A;  3R2I A;  1DOY A;  3AE3 B;  1HQR D;  3SEB A;  2B76 B;  4ZHP A;  1R7S A;  3UI3 A;  4A8X C;  1J7A A;  2FUG 1;  1RWS A;  2WXN A;  1MVK A;  1SIJ A;  2PVO D;  1PUT A;  2SAK A;  2WS3 B;  4USA A;  3V3X A;  5MPO A;  3E9S A;  3Q8A A;  5FR3 A;  1VRA B;  4OVZ A;  4ZOH C;  2WU5 B;  3KLS X;  1QOG A;  3Q8E A;  1CJE A;  3MFG A;  1QOA A;  2BS4 B;  3ZJU A;  2Y5C A;  3HVZ A;  2PW9 A;  2WDQ B;  4GDK B;  5G5G A;  1L4D B;  2ACZ B;  1PGX A;  3B2F A;  3OWE B;  1FFU A;  1VZ7 A;  3W5U B;  4MM3 B;  1DOX A;  1NI3 A;  1TY0 A;  3P1M A;  2J42 A;  1PDX A;  1OFF A;  3PO0 A;  1TJE A;  3GP7 A;  4M0W A;  5D3D A;  2QEJ C;  1I4X A;  1L4Z B;  3TEW A;  2SEB D;  1DYQ A;  1YJJ A;  2ZW1 A;  3SFE B;  1CZP A;  4LLG M;  1E0Z A;  2BTE A;  4WAF A;  3VRA B;  3AEG B;  3IT6 B;  1PYW D;  1KH0 A;  3N9Y C;  3TEX A;  3VRB B;  1TKG A;  2HTM E;  3HUI A;  1JWB D;  1C4A A;  1FMA D;  1FXI A;  4HKQ A;  2CU3 A;  4P6V F;  2NTS A;  2VZK B;  2ON8 A;  1YJI A;  2K9X A;  1QOB A;  2FE8 A;  1NEK B;  5FKA C;  5E6J A;  4A90 A;  3FC4 A;  3GB1 A;  1FNU A;  2WLB A;  3AED B;  4MAC A;  2E6X A;  2LHE A;  3V05 A;  3LYY A;  2WQY B;  2KWD A;  2ICI A;  1ROE A;  3TUO A;  4ITK A;  2K3U A;  3BZD B;  4RF0 A;  1GB1 A;  1ZDX A;  1PFD A;  3O13 A;  4NAW B;  3AH7 A;  4RF1 A;  3NUH B;  3U52 E;  2LJI A;  1I4R A;  4YSY B;  5D3I B;  4OW0 A;  3NS1 A;  2W54 A;  3AEA B;  1MI0 A;  1BUI C;  1GAQ B;  1HEZ E;  3Q8B A;  5EE0 A;  1XLO A;  5T8I A;  1C76 A;  4ARI A;  1V97 A;  3MC0 B;  4O1N A;  1FD6 A;  1SSN A;  1TZO A;  1XF5 L;  1JWS D;  2WU2 B;  1RFK A;  2BW2 A;  2RDH A;  2EKI A;  3AE7 B;  2WNM A;  2WXP A;  1LO5 D;  1QQR A;  1HXY D;  4OHJ A;  1AWD A;  2PTL A;  4NJC A;  3AEF B;  4RH6 A;  2PKO A;  5D7G A;  1HZ6 A;  5AUI A;  1VZ6 A;  1YQ4 B;  4A9A A;  5G5H A;  4C80 A;  1JRP A;  2N0S B;  2M0A A;  4KGT A;  3NVV A;  2MJE A;  1I4H A;  3P4P B;  5BMI A;  3AE8 B;  2QSD A;  1AW7 A;  2LHD A;  5EE3 A;  2LEK A;  2AQ3 B;  1Y56 A;  2DWQ A;  2WDV B;  2DYO A;  1E6E B;  3MJ5 A;  1VJK A;  4JWU C;  2J52 A;  2K22 A;  2KAC A;  3PZ8 A;  5GXG B;  3Q8C A;  1DOI A;  1L5P A;  1QLB B;  1JQ4 A;  1GPX A;  1V8C A;  3ZJV A;  4OZC A;  1JML A;  1QKZ A;  2GI9 A;  2IPK D;  1C79 A;  2JQR B;  3KWV A;  3B2G A;  4WQM A;  4DXF A;  4ZHO A;  5BMG A;  2WXO A;  4FXC A;  2V3N A;  2JWU A;  3MP9 A;  2L83 A;  1FCC C;  1TS5 A;  3AE5 B;  3HRD D;  1C77 A;  3HVD A;  1EWC A;  4OZA A;  1F2R C;  1FCL A;  1EU4 A;  3AEE B;  1L0Y B;  4YXD B;  1FM0 D;  1YN5 A;  2LFI A;  1TKY A;  3ZJT A;  3URY A;  1IGD A;  1VZ8 A;  4ARC A;  1EM7 A;  2DYM A;  2NTT A;  5HHD G;  1FRR A;  3ABV B;  3FIL B;  3AE9 B;  4RCO A;  3W9C B;  3BYY B;  4JE3 B;  1MHX A;  2INP E;  1D5X C;  1K53 A;  1P7E A;  1ENF A;  1YN3 A;  1FO4 A;  1NYR A;  2Y5P A;  3CWI A;  1KLU D;  1YQ3 B;  4RGT A;  3BWU D;  1UWX A;  1PGA A;  3Q69 A;  1SE4 A;  5BYR A;  3VR9 B;  3AV8 A;  2WP9 B;  1L6V A;  2Q5W D;  1YN4 A;  4XDD A;  2IDY A;  4C56 C;  3R8B A;  1N60 A;  2WXI A;  2ZW0 A;  4YSZ B;  3T3O A;  3ZYY X;  1FIQ A;  4A55 A;  4RFB A;  2AQ2 B;  3R2T A;  2WXG A;  2QIE B;  1NEN B;  2WXQ A;  2E3T A;  1IGC A;  2QJL A;  1TYG B;  1FNW A;  1KLG D;  4TQ1 A;  1K51 A;  3U7Z A;  1D4B A;  4TMA B;  2FBW B;  3AE1 B;  4C7Z A;  2IGD A;  4A6Q A;  2GB1 A;  2MEK A;  1FEH A;  1XLN A;  1QOF A;  1ZUD 2;  1KRH A;  3W1S A;  5H8Y E;  2L1A A;  1N5W A;  2J53 A;  3SR6 A;  3AN1 A;  1UWM A;  1HZ5 A;  5BMH A;  2IGG A;  1E7P B;  1ET9 A;  3NVW A;  3AEC B;  1JWU D;  1OQR A;  1JCK B;  3AM9 A;  1VLB A;  4R3D A;  1SF0 A;  4JX1 C;  2JZP A;  2G1E A;  3TSS A;  5JXV A;  1SBB B;  3RFZ B;  4B0E A;  1M4V A;  4B0M A;  4TQ0 A;  2KN4 A;  5HI1 A;  4RGO S;  2IGH A;  3H8H A;  3U2S C;  1NVI D;  2MJ3 A;  1TS4 A;  3LXF A;  3BVM A;  3P4Q B;  2H89 B;  1CQV A;  2CJO A;  3PZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...