1IGCA

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igcA00
2J53A 1P7EA 1YNTE 2N7JA 1FD6A 1P7FA 1PGXA 3GB1A 4GLSC 1Q10A 2PW9A 3V3XA 3FILA 2JXTA 1XCTL 4KGTA 2GB1A 1PGBA 2N9LA 2QSDA 5JXVA 1UWXA 1HZ5A 1F2RI 4HJGE 2IGGA 2K0PA 1K51A 2I38A 2JSVX 1YMHE 1K50A 2ONQA 4IOIE 4KGRA 2J52A 1FCCC 4KGSA 5HG2A 4OZCA 5HFYA 1K52A 2NMQA 1D4BA 1MHXA 2QMTA 2RMMA 2ZW1A 2LHDA 5BMGA 2KQ4X 1JMLA 4HKZE 1HZ6A 2JWUA 1IGCA 2RPVA 1EM7A 2LUMA 2OEDA 1IGDA 2IGHA 2LHEA 1K53A 1QKZA 2JU6X 4D2KA 1XCQL 2KN4A 2EELA 2GI9A 2KACA 2PLPA 4OZAA 3UI3A 1IBXA 1C9FA 1MPEA 1XF5L 4IKGA 1FCLA 2KWDA 5BMIA 5HHDG 4MACA 2N9KA 1PGAA 1IBXB 1F2RC 5BMHA 2PTLA 1MHHE 1GB4A 2LGIA 2I2YA 2KDMA 2ON8A 1ZXHA 3MP9A 1GB1A 1HEZE 1KH0A 5HI1A 3FILB 2JZPA 1MI0A 1MVKA 2IGDA 4OZBA 4WH4A 2ZW0A
chains in the Genus database with same CATH superfamily
1NDDA 1ZOYB 3DPDA 3PT2B 2BPSA 3LB8C 2GOWA 1PGXA 2R2QA 4RF0A 1LM8B 4HLEA 3V6EB 1JWBD 2IY0B 3QC8B 5IKCM 1P3QU 2B76B 1XLNA 2CU3A 1HA5A 2GRIA 5DPTA 4US8A 2Y5PA 1NBFC 1VRAB 4GDLB 1CJEA 3ZKJC 2JSVX 4XC2A 4YWGG 3PTFC 2LZ6A 4L1BA 1SF0A 2NMQA 4W9LA 3RNGC 4HRSA 4JWUC 4DQOC 1AW7A 3H6NA 3A1QA 5IOIA 2AQ2B 3AI5A 3HVDA 1TT5B 3U2SC 1V1OA 1CK1A 1WY8A 3MFGA 3V05A 1OFFA 2OOBB 1N5WA 2LUMA 1EU4A 1EO6A 3A4SC 5I4DA 1K53A 1QKZA 2JU6X 2ZVOA 3AXCA 5JHBA 3ALBA 4KKJA 2GI9A 3NJTA 2J0JA 1WGGA 4RGNA 3VHTC 1FCLA 3RUIB 3B2FA 4BVUC 1MHHE 3BIID 4M00A 4ZYNA 1BT0A 4AOFA 2INCC 4MEMA 4XYCA 2CHWA 3MP9A 3BVZA 3FAHA 3R2TA 1L7YA 2ZW0A 2CJNA 3NVYA 2QCZA 2N7DA 5D3IB 3PLVA 1E7UA 1Q10A 4G0NB 2W3SA 4C4VB 3HVZA 5E6OA 1L4ZB 5J2RA 3Q8AA 4ZRJA 2X38A 5JH5C 1JWAD 4JQWC 5EE0A 3PRMB 1NI3A 2DHZA 1ZE3D 1QILA 1GG3A 2VZKD 4FLHA 1VDVA 1YQBA 4HPLB 5HG2A 2NBUA 2R61A 3QIJA 2V4IB 2KN5A 3S2AA 2KDBA 2KVZA 1VD2A 2A4ZA 2MH7A 2LGSA 1T5XD 1BMLC 1LFDA 1PFDA 2KQ4X 3RNCC 2WDRB 3Q6BA 3AE2B 3AEBB 3P1MA 4HK2A 2V1YA 4GDKA 4HCNB 4EZKA 3T3OA 1OQRA 3RNAC 1RWSA 2JX5A 2EMTA 1G6JA 2NS5A 5H92C 3C8YA 1SJHD 2M0XA 3P4RB 3DOWA 2FCSA 3OWEB 4IC7B 2EKIA 3EFUA 2EELA 2JZZA 4RGMA 3PZ8A 2CU1A 2FBWB 3UIOB 1ZDXA 1QOFA 2GMIC 3HM6X 3PGEA 3X0WA 4CHKA 1TY0A 3DWMA 1MG8A 1UNSA 2KJ6A 2DAJA 3PVLA 5KHOA 1F0ZA 2QC8A 3SEBA 1IBXB 2Z59B 4LDTB 3BYYB 3TEYA 3KYCD 1A5RA 2XK5B 1ZXHA 4NAWA 3QQ8B 3ETRA 3AE8B 4MJSA 4W9FA 4DXAB 1E8YA 2RR9A 4FJVB 3APCA 4OZBA 4AWJA 2QIEB 2INPE 4PYUA 2KNBA 1P7EA 5BYRA 4W9IA 3MJWA 4NJ7A 2MA9B 1ZGUB 2QEJC 3K9OB 4CO7A 1XLQA 3AECB 3TJPA 4KGTA 4ARIA 1UWMA 1ET9A 1HZ5A 1NEKB 3NVVA 1XEEA 3HM3A 1YMHE 1J0GA 2XNAC 5IO9A 4EZJA 1KOTA 3A33B 4MGYE 2MP2B 3MC9A 4MH8A 2LRUA 2D5GA 1LQBA 3AE5B 3ZRCA 2FNJB 2NTTA 5J18A 2C7NB 3Q3JA 2M19A 5CHVC 3W1SC 1WM2A 2BKRB 5MPOA 4EOYA 2Z0EB 2REXA 3EFCA 4F8CB 4Q2JA 2YLMA 3CMMB 4KZCA 3L13A 1EM7A 3PLUA 3CSTA 3CSFA 1MFWA 2G4DB 5DPRA 2IGHA 3TEZA 3AMZA 4KIKA 4ZDVA 1ZUD2 2ZPYA 2DZKA 2LGDA 1X1MA 3JYUA 3Q8EA 4QAYA 4GN1A 3UI3A 3IXSA 1C9FA 2M17A 4IKGA 2GBRA 3UGBB 1EF1A 4HWIB 2PEAA 4HDOA 2Z0DB 2WXQA 3KWVA 1GB4A 1PQSA 3OJ3A 3BINA 3VRAB 3QHTA 1GAQB 2VH1A 2M56B 2LVPA 1WGKA 2WGSA 3PZDA 1XT9B 1GNUA 3RI7C 3GE3C 3AE3B 3RT3B 4W9EA 3AB5A 1P98A 2ZNVC 2BS4B 1TS5A 3TMPB 4UDUC 4W9DA 3I9V1 2BS2B 4IM3A 4WWOA 4DXFA 1NVID 2BBCA 3V3XA 4IUMB 4P6VF 3ZRFA 1C1YB 1WJ6A 3DVNV 4IG7B 5CTRC 5H8YE 1HTOA 2CJOA 2KANA 3C0RB 3VXWA 1WH3A 4IOIE 3BZDB 1DOXA 4PS7A 1KM7A 2H89B 4A20A 1E90A 3DBLI 1WSPA 4FULA 3PREA 1IYFA 3VRBB 2L83A 3P4SB 3WAOA 5D6JB 2I1KA 4OHJA 4II2B 5D7GA 1YX5B 2QJLA 2ASQA 2O6VD 3L4PA 2L52A 1KLGD 1OQYA 1WX8A 3U4EG 3L0WB 4IM0A 3DBLB 1MG4A 1SE9A 3UIPB 2KZRA 2GLSA 4WJNA 4MELA 4YSYB 2AEHA 3OLMD 4D2KA 1XCQL 2D3AA 3PSEB 2JRIB 2RDHA 2FIFA 2WXHA 2KACA 2LXCA 5AZGA 2O6VA 3SU8X 1PYWD 4ANUA 4WIPA 3ZNHB 1TS3A 2L8JA 3NY5A 2ZPNA 2NBWB 4WWMA 4K3BA 3BVMA 1ZKHA 3EGRA 3PRPB 3AE7B 3KUCB 3BK1A 3ML8A 3NOBA 1R4MI 2WXFA 5JHAA 4LNKA 2LJIA 3SFEB 3I63C 2UWQA 1YN3A 2NPTB 4B0EA 2BQQA 4W9GA 2CKHB 3PO0A 3NVZA 2K9XA 2LWPA 3OG5A 1R4MB 3DHHC 5EE1A 3NZ3A 2GB1A 2N9LA 3CIRB 3IBEA 1E8XA 4K7WA 1RLFA 2BF8B 4DK5A 3N1ZC 2QHOA 2BYVE 1NYQA 1JWSD 4P1BC 1I4GA 3O65B 4DHZE 2J7QB 2KC1A 2L00B 1C4CA 2LHDA 1T0QC 1TKEA 3DHIC 1C3TA 3Q8CA 1JMLA 1RYJA 3W1SA 3T3NA 2IBIB 4P1CC 4RM8A 3ML9A 1KLVA 1TYGB 1ZW7A 1VZ7A 3QJZA 4EKUA 1C4PA 4M02A 2KN4A 2MW5A 3U8ZA 3DQVA 4NY0A 3Q3MC 4OZAA 3PRZA 2BVCA 1YJIA 4KKIA 4EE2A 2KYWA 3NVWA 2KDEB 1MJDA 4MACA 2NR2A 4BKSD 1Z5SB 1F2RC 2IJ0A 1YJ1A 2BWFA 3K9PB 1GJZA 4EEWA 2K8HA 1N62A 2MBEA 5HI1A 1ET6A 2JZPA 5T8IA 4XDCA 2MSED 2OJWA 4HXDA 2BTEA 3RN9C 1V9JA 1WIAA 3ZQ4A 1CZPA 1WZ3A 2DZMA 4BKSA 4ZYSA 1DYQA 1WXMA 2KWUB 1R4NB 3UQBA 1DOYA 1E7PB 2JZ3B 2DNFA 5C2TB 4NJCA 3LJ3A 3L10B 4K1RB 5FKAC 2VH2A 1FXIA 1L6UA 3I3TB 4K81A 5TR5A 3ZDMC 4XGAB 2JVCA 4FHKA 4LLGM 1Q5WB 2IDYA 2ONQA 2HDEA 2RSUA 2KWCA 1TKGA 3URYA 1J19A 5FR6A 2Q5WD 4DDID 2MQJA 2WU2B 1TTNA 3NS1A 1JWMD 3VDZA 4ANVA 3DCGA 2MBOA 2W54A 3ZVVA 4LJPB 1UELA 1I4HA 1U4AA 1UBQA 3MHSD 1V5OA 2UYZB 3B9JA 2G9HD 2WXNA 3KQ4A 4IWQA 4LJOB 3I5JC 2OEDA 2AYOB 2LASA 2KAJA 1F9JA 4KDIC 1IPGA 4BFRA 2V3NA 1JWUD 2KK8A 2KFKA 2A5UA 2BWES 4MM3B 2JF5A 3VR9B 2WQYB 1IBXA 4IWOA 1VJKA 1VLBA 2BGFA 3H7PB 3Q3OC 1JCKB 3RNEC 2YEPF 4GXBA 3GOEA 4OW0A 2LGXA 1I42A 4AS1A 3TCAA 2DWQA 1GB1A 4MSMB 2PVOD 1YJJA 1FNUA 2IYDB 1J7BA 3M3JA 3TSSA 3QCAA 1Q0WB 4J6IA 5AEKB 2RPQA 1MI0A 1WI0A 3FKYA 2DZIA 1YNTE 1TIFA 2BW2A 3GB1A 5BYQA 4K3CA 1ZPSA 1L0YB 3W2DA 1KLUD 3FILA 3TUOA 5G2NA 3VQIA 2AQ3B 4ZOHC 1PDXA 2J42A 3AEDB 1ESFA 1K8RB 2BYEA 2L7RA 3WANA 4YTMB 5EE9A 1AWDA 2WWZA 2HD5B 1I4XA 1E7VA 1WRIA 2BKFA 3ZGZA 1UGMA 2CHZA 3BWUD 3KUDB 4OZCA 4M0WA 5HFYA 2IO3B 3PV1A 1J8CA 1I4QA 3HRDD 2DLBA 2YEPB 4J3OD 5AUKA 1FXTB 4PYZA 3N30A 4MT5A 4N59A 3IHPC 4G11A 1SBBB 3AE9B 4JIOU 3RNFC 2MLBA 2PE9A 4W9JA 2JWUA 1NYRA 4IM2A 3HHMA 3VR8B 2WXJA 1YIWA 2KJRA 3ZJTA 4YSXB 3RZWC 2LGYA 2EKEC 2KLCA 4FN2A 3A9KA 2V3SA 2PMVA 3LYYA 1NI2A 3V61A 2HTHA 4PT5A 4A3PA 2LEKA 2N9KA 1UF0A 4NAMA 4AP4C 2K6DB 2FCMA 5BMHA 2JQRB 4LCDE 1A70A 4XWWA 4FBJB 1B9RA 2DYBA 3RZFA 1T0YA 4HROA 2FCNA 4EUTA 4W9CA 4S0RA 2FCQA 3N1YC 4S17A 1XD3B 1I7HA 1WXAA 4BAXA 5JZEB 4WQOB 3M62B 2KQ7A 1VCBA 4HPPA 4W9HA 1UZXB 5KHQA 5G55A 1FRRA 2R2OA 4ITKA 1F77A 1OEYA 3CWIA 2D3CA 1ENFA 4XDDA 3H1UA 1N6ZA 3A1QB 1S1QB 2KX3A 1WX7A 2WU5B 1OTRB 2KOXA 4DHJD 3Q3FA 3VUWA 3R8BA 4M01A 3SDLC 3ZTDA 1FCCC 4KGSA 5TSSA 4PK1A 3RCZA 1K52A 3IVFA 3HIZA 1QQRA 2KT7A 3J9CA 2YVCA 3L08A 1SSNA 4E71A 4PS3A 1E9MA 2WXPA 5AUIA 1WXQA 4HKZE 3QWZB 4X57B 1UH6A 5L83A 3Q14C 3VUYA 1LGRA 1YQ3B 1IGCA 2RPVA 4MGIE 4C7ZA 5IAAC 1IGDA 2GBJA 1ZP0B 2IY1B 1WX9A 3PPAA 1B1ZA 4BBNF 4M8NA 3WA0A 1P1AA 4RM9A 1MPEA 3P42A 3AE4B 1XLPA 2G45B 5BMIA 4WWNA 3VH3B 2H88B 2V0GA 3EA6A 3SHQA 4RCOA 3ONSA 2LJ5A 4WQMA 3N9YC 2WXLA 1EU3A 2KWVB 2WDTB 2CS4A 1D6EC 2K8BA 1KH0A 1KTKA 4ACFA 2LRWA 1RFAA 1GUAB 4WAAA 4KZ0A 2M0AA 3KH0A 3B0AA 1BXTA 2C7HA 2GBMA 1FO4A 1WF9A 4RMAA 1WE7A 2DYMA 2HTME 1M4VA 4YT0B 2WLBA 3WALA 3C19A 3ZIMA 1F2RI 3L54A 4FJZA 4II3B 1KJTA 4F1SA 3NHEB 4HEA1 2BS3B 4GDKB 1QT9A 4YTPB 4I6NB 3ZYYX 5FK9C 1ZXIA 1RM6C 1AARA 2RMMA 1E0ZA 1BUIC 5D94A 4B95A 4I6PA 3SFDB 2J0MA 2K1FA 3ZLZA 1XXGA 4RFBA 1SXTA 2W82A 3RD2A 2TSSA 1GOZA 1WWTA 2WX1A 1WZ0A 2IO2B 2ZZPB 2KTRA 3A9JA 1WGDA 5E6NA 3AU4A 1WMHA 3N32A 2UU7A 4HPMB 1WJNA 1YD8U 2O2VA 2WDQB 3DDCB 1SEBD 2JXXA 4MJSB 4DBGA 2IPKD 1EWYC 5IP4D 5HKHA 2PVGC 4TUUA 3WAMA 1TZ1A 3U30A 2K3UA 2PPHA 2PTLA 4EZLA 4KX6B 2G1EA 4LNNA 2PJHA 3ZW3A 3R2IA 5G5GA 1WR6E 3DVGX 2LVOA 3KLSX 3RPFC 3PS6A 4RGTA 1V8CA 3JSVA 5EDSA 1R7SA 3IT6B 3NZSA 3W9CB 3RNBC 4FADA 1EWCA 3RFZB 1JRUA 1N61A 3T9LA 2K25A 4BKGA 4AQ7A 3NRZA 2NVUI 3R66C 1JROA 2JWZA 4DDGD 1L0VB 4MSQB 4OVVA 4XWTA 3IG3A 3APDA 4ANWA 2I38A 4GGQA 2LUEA 3V6CB 4C80A 3CF6E 4FXCA 4HDQA 2JY6A 1EF5A 1D4BA 1MHXA 2FUHB 3R7RA 3TEWA 3PHWB 3E9SA 2RDGA 4GDLA 4KIKB 4DHZB 3W1YA 1LXDA 1KFYB 4RNAA 2L1AA 4L2YA 1ISNA 5CX3A 2DZJA 2ZVNA 2FE8A 1JALA 1E10A 2JYEA 4MDKE 2DENB 3AH7A 1Y56A 1KF6B 4DWFA 3V62A 3WAPA 1Q1OA 3TIXA 3B08A 2AL6A 2NTSA 1QLBB 3GP7A 2NCNA 3W5UB 2LXAA 2JRHA 4M8MA 3D32A 4A3OA 4ZHOA 3BK2A 2QDFA 1WGRA 1IUEA 5LLIA 3ZTCA 4MGZE 1UD7A 1TJEA 4YSZB 2ON8A 3QK0A 3QX1A 2CR5A 3U52E 2RD0A 3OJ4B 1J7AA 4PS8A 2FAZA 3M95A 2N0SB 5C1ZA 2C7MB 4ARCA 1VZ8A 3N1XC 4GLSC 1E8WA 3GE8C 3ZDTA 3Q2AC 2D10A 1YQ4B 2JXTA 3ZXRA 3ENEA 3AEGB 2EMSA 3LDZE 2KMAA 2SEBD 3AN1A 2PIAA 3MJ5A 1CMXB 3GZNI 1TKYA 1FIQA 4C4VA 2WXRA 2B3AA 2MJ3A 5AZHA 1YN5A 2ZCCA 1WM3A 3VFKA 4NNJB 4US9A 4XX5A 2D11A 2WXIA 1I35A 1D3ZA 4HCPB 1L5PA 2ACZB 3ABVB 3IAS1 4C7YA 4TQ0A 1M94A 2KKCA 4NJ6A 1PUTA 1STEA 1JW9D 1OQQA 4EFOA 5FR3A 1SGHA 2O6VB 2MEKA 2N4FA 1VZ6A 3VAWA 2DYOA 2MBQA 1C78A 2DBYA 5C23A 5EE3A 3IAM1 1XO3A 2MCNB 2E6XA 4ZRIA 2LVQA 2PE6B 1HXYD 2W9NA 2N9XA 4GIVA 3AULA 1EUVB 1V97A 1YOVB 4LDTD 2D3GA 4TV3A 1GC7A 1PGAA 1S3SG 2N1WA 2J4XA 3A4RA 4KSKC 2KDMA 4A8XC 5BYSA 5GMVA 1WGHA 2N9PC 2Z8LA 4A90A 1JQ4A 4USAA 5CHFA 1WE6A 4AJWA 3KYDD 3QARA 3SD5A 2XK5A 1DOIA 1V81A 4RH6A 2ZCBA 1FNVA 1TBEA 4H2AA 3VH4B 3TBLD 3P2BA 2FIDA 3E56A 1SB3C 2QSDA 3Q69A 4RGOS 3AV8A 5GXGB 4ZHPA 4LK0M 3P4PB 1SE3A 5E6JA 1K51A 4LTUA 1Z2MA 1WRDB 3DBRI 4MGKE 1TZOA 1C79A 2L32A 4B0MA 3BY4B 4KSLC 2C5LC 2GBKA 2AL3A 2KLGA 2HJ1A 1JRPA 2E3TA 3DBRB 3U7ZA 2KJHB 2AX5A 3GS2A 4JL9A 1HZ6A 3W5VB 2MP2A 1FPYA 1P9DU 3DVNU 3N3KB 4JGHB 1V1PB 2RGFA 4N9F4 4YL8A 5G5HA 3EC8A 2WS3B 3B2GA 3L17A 2KVRA 5LXHA 3JVZX 2KFJA 2AWTA 4GU2A 4C00A 2KWDA 4ZRQA 5LNK1 1FRDA 1SE2A 2K22A 2BYFA 5IN7A 2I2YA 4WWPA 1D5MC 1HEZE 4P7IA 2G3QB 2ZEQA 4REZA 2ZNVB 1MVKA 1WYGA 4ANXA 2V3PA 3APFA 1C76A 3TL5A 1T0SC 3DHGC 3MTNB 4WAFA 1UGJA 1Y8RC 2INDC 4TQ1A 2IO0B 2LD9A 4AUQC 4P16A 2KMCA 4GB9A 1XLOA 3VUXA 2JPHA 3ZNZB 1UWXA 2KC2A 4HJGE 2QILA 3UINB 1D5ZC 2N7EA 4NZLB 1N60A 2K0PA 4KVGB 4JLCA 4IWPA 4G50A 1GC6A 1WJ4A 3U7DA 3TEXA 3HK0A 1FFUA 4KDLB 1RRBA 5CHWA 1YN4A 4I6LB 5E6PA 2QMTA 1V5TA 3NG0A 3WCQA 1E5WA 1QF6A 3DBHI 2KFKB 1WFYA 4K7UA 1FEHA 2INNE 2L76A 4ICUA 2M1MA 4WURA 4HVBA 5D3DA 4K7SA 2KDIA 3DBHB 3H9DA 1F1HA 4ZRPA 3ZUNA 2LI5A 4LNOA 3ZO5B 2K6QA 2L3ZA 3WIMA 3BVGA 1I4RA 4L23A 4KV2A 2KQSA 2KO3A 4O1NA 1T0RC 2C60A 1NENB 2LGIA 2J0KA 1ZDVA 1TGZB 1V49A 4IDIA 5AZFA 2ZJDA 2W55A 2FUG1 1TS4A 2PKOA 1FFVA 3FILB 1UBIA 4WJOA 4NQLB 3ZJUA 4HKQA 1P7FA 1V6EA 2RDBC 3QAQA 3EUB2 2WYQA 1GPXA 1TS2A 1E8ZA 2BB5A 2PW9A 2G4SA 2KX0A 4JX1C 4M0WB 1PGBA 5LXIB 4ICVA 2NPTA 3PHXB 3OAWA 1QOAA 3NZUA 1K50A 2W3RA 4ASWC 2D2QA 1TY2A 4XZ4A 3P63A 1WYWB 4MH0E 4IW0A 4WJPA 3FC4A 3AEEB 1N63A 3VTWA 2MJDA 2KXJA 4AJYB 4N58A 4RF1A 4BOSC 1HE8A 3A9KB 2WXOA 1FNWA 4A9AA 1UUPA 4URKA 2NBVB 1LO5D 5C3JB 2D3BA 2WDVB 2KDFB 2VZKB 2LHEA 2CHXA 1IP9A 4TKNA 1ROEA 3R7QA 1CQVA 4GOCA 3UQAA 1E6EB 3MC0B 2KD0A 1ACCA 4CYEA 1P0RA 1VR9A 1WJUA 3MHZA 3VTVA 4OVZA 2IZVB 2OHFA 2VRRB 1L0XB 2JYTA 2V4LA 2WXMA 3B1LX 3P4QB 2K5PA 2D07B 3UF8A 1H8CA 3KVFB 4NAWB 2I1JA 1V86A 2K8CA 3ZNGC 1WXSA 2IGDA 3AEFB 4LNFA 2KHWB 5D2MB 1N5XA 1RFKA 2N7JA 1FD6A 2MJEA 1D5XC 2WHIA 2MBHA 2BT6A 1XCTL 1KRHA 2WP9B 2LMCA 5JXVA 4A55A 3Q8FA 4FHJA 4DXGA 5J17A 2X8XX 2MX2A 4W9KA 2M8SA 3DBSA 1SE4A 4TMAB 3RMKC 2J52A 4FJYA 2L0FA 1T6BX 4DHJB 3AE1B 1WGYA 4LNIA 3R3MA 4N6EB 4FA6A 1SIFA 1T3QA 3V60A 5BMGA 1I4PA 3HUIA 4JWSC 3QA8A 3AU5A 2Y3AA 1HQRD 4GMVA 2BB6A 1OEYJ 2L0TA 2SAKA 1SIJA 4ZRKA 4NPNA 2HE7A 2V9HA 3DWGC 1J7CA 2AQ1B 3Q3NC 3AE6B 3AM9A 2LFIA 2MRPA 5IA7A 3PZ7A 1QOBA 3NS8A 4BOZB 3AEAB 2L05A 4JE3B 2BYTA 2PLPA 1XF5L 1WR1A 5HHDG 1L4DB 1WXVA 3VVWB 3M63B 4CQNA 4WJQA 2XBBC 3NUHB 4MM3A 3H8HA 2HJ8A 3IFWB 3RYTA 1OGWA 2N9EB 1L2NA 2WNMA 1V80A 5DCNA 3H7PA 3EECA 1V2YA 4WH4A 1YX6B 2J53A 4B9KA 2IO1B 2WX0A 3X23A 2Y5CA 2ICIA 1FXAA 2MWSB 3IT4B 2K39A 1FM0D 5BO4B 1AN8A 2M4NA 2N1VA 4R3DA 3RULA 2GBNA 3MC8A 1C77A 5DPSA 3VTUA 4NQKE 2IGGA 2KTFA 1FMAD 4BKTA 2MHJA 2C9WB 1L6VA 1RAXA 4KGRA 2KMMA 4G3XB 4B6WA 4YTNB 4A6QA 1SJED 3ZJVA 1HTQA 2DX5B 2KTRB 3A9JB 1H4RA 4TSSA 2ZW1A 3T8MA 4BBNC 1DGJA 2WXGA 3EHVA 4XE0A 1WMHB 2JUOA 4HJKA 4F7ZA 2O2VB 2WXKA 5DPWA 2XN9C 3O13A 3KWLA 3LXFA 2XEWA 3BYTB 1V1PA 2OJRA 4E74A 4JPSA 1R4NI 2Y5BB 1AYFA 1F52A 3Q8BA 3ZXVA 3GZNB 3L16A 2MBBB 1XQQA 4E3CA 3DVGY 1C4AA 3H7SA 1QOGA 2JT4B 3KUZA 3JSVB 3I57A 3KW5B 3JW0X 2DAFA 4OVUA 3ZNID 3N20C 4BZAA 4C56C 5L95C 1QZEA 4YXDB 3SR6A 3ECIA 4GSWA
chains in the Genus database with same CATH topology
1ZOYB 2V3PA 1C76A 1YN3A 4WAFA 4B0EA 3LB8C 1UGJA 1PGXA 4RF0A 4TQ1A 2M0AA 3PO0A 3NVZA 4P16A 1JWBD 2K9XA 1BXTA 1FO4A 5EE1A 2B76B 3NZ3A 1XLNA 2CU3A 1XLOA 2GB1A 2N9LA 1HA5A 3CIRB 2GRIA 2DYMA 2HTME 1M4VA 4YT0B 1UWXA 2WLBA 4US8A 2Y5PA 1F2RI 4HJGE 2QILA 1VRAB 4GDLB 1NYQA 1D5ZC 1JWSD 1CJEA 4NZLB 1N60A 2K0PA 1I4GA 2JSVX 4YWGG 4HEA1 4L1BA 3TEXA 1SF0A 2BS3B 4GDKB 1QT9A 4YTPB 1FFUA 3ZYYX 2NMQA 5FK9C 1YN4A 4HRSA 1ZXIA 1RM6C 2QMTA 4JWUC 4DQOC 1AW7A 2RMMA 1C4CA 2LHDA 1E0ZA 1BUIC 3WCQA 3SFDB 1QF6A 1TKEA 1XXGA 4RFBA 2AQ2B 3HVDA 1SXTA 1FEHA 2W82A 3Q8CA 3U2SC 1JMLA 1RYJA 1V1OA 2TSSA 1GOZA 1WWTA 3W1SA 1CK1A 3MFGA 3T3NA 3V05A 1OFFA 2INNE 1N5WA 2LUMA 1TYGB 1EU4A 5I4DA 1VZ7A 4WURA 1K53A 1QKZA 2JU6X 5D3DA 1C4PA 2WDQB 2KN4A 1SEBD 4KKJA 2GI9A 4ZRPA 4OZAA 4RGNA 2IPKD 1YJIA 4KKIA 1EWYC 3BVGA 1I4RA 4EE2A 4L23A 3NVWA 1FCLA 2PVGC 4MACA 4O1NA 1F2RC 2K3UA 2IJ0A 3B2FA 2PTLA 1NENB 1MHHE 3BIID 2LGIA 1ZDVA 4KX6B 3MP9A 4IDIA 2G1EA 3BVZA 3FAHA 1N62A 3R2TA 2W55A 2FUG1 1TS4A 5HI1A 1ET6A 2PKOA 3R2IA 1FFVA 5G5GA 3FILB 2JZPA 5T8IA 4XDCA 2BTEA 2ZW0A 3KLSX 3RPFC 2CJNA 3ZJUA 3NVYA 4RGTA 4HKQA 1V8CA 3ZQ4A 1CZPA 4ZYSA 5D3IB 1P7FA 1R7SA 3IT6B 3W9CB 1Q10A 3EUB2 2W3SA 1GPXA 1DYQA 1TS2A 2BB5A 1EWCA 2PW9A 3RFZB 1N61A 3HVZA 4JX1C 1DOYA 1E7PB 1L4ZB 5C2TB 3Q8AA 4AQ7A 4NJCA 3NRZA 2X38A 1JWAD 1JROA 1PGBA 5FKAC 1FXIA 1L6UA 5EE0A 1L0VB 1NI3A 4XWTA 1ZE3D 4LLGM 1QOAA 2I38A 2IDYA 4C80A 1K50A 2ONQA 2HDEA 4FXCA 1QILA 1TKGA 2W3RA 2VZKD 3URYA 2Q5WD 1TY2A 1VDVA 2WU2B 5HG2A 3P63A 2R61A 1JWMD 3NS1A 2V4IB 1D4BA 1MHXA 3FC4A 3AEEB 1N63A 2W54A 3TEWA 2MJDA 4N58A 3E9SA 2RDGA 1I4HA 2MH7A 4RF1A 1T5XD 1BMLC 1KFYB 1PFDA 2KQ4X 4RNAA 2L1AA 2WDRB 4L2YA 3B9JA 3AE2B 2G9HD 3AEBB 2WXOA 3P1MA 1FNWA 2WXNA 2FE8A 4A9AA 3KQ4A 1UUPA 1JALA 1E10A 3T3OA 1OQRA 1LO5D 1RWSA 2JYEA 5C3JB 2OEDA 2JX5A 3AH7A 1Y56A 1KF6B 2KAJA 2WDVB 5H92C 2VZKB 3C8YA 1SJHD 2LHEA 3P4RB 3OWEB 2V3NA 1JWUD 1ROEA 2EKIA 1CQVA 2EELA 2NTSA 4MM3B 4RGMA 1QLBB 3GP7A 3VR9B 1E6EB 3PZ8A 2FBWB 3MC0B 1ZDXA 1QOFA 2WQYB 1IBXA 1ACCA 3W5UB 1VJKA 1VR9A 1TY0A 3DWMA 1UNSA 1VLBA 1JCKB 4ZHOA 1F0ZA 3SEBA 2YEPF 3MHZA 4OVZA 1IBXB 3BK2A 2OHFA 3BYYB 3TEYA 4OW0A 1IUEA 1L0XB 2JYTA 4YSZB 1TJEA 2ON8A 1ZXHA 2WXMA 4AS1A 3P4QB 2DWQA 1GB1A 2K5PA 2PVOD 3ETRA 3AE8B 3U52E 1YJJA 1FNUA 1J7BA 1J7AA 3TSSA 4NAWB 1MI0A 2IGDA 4OZBA 2N0SB 3AEFB 2QIEB 2INPE 1N5XA 1P7EA 1RFKA 4ARCA 1YNTE 2N7JA 1FD6A 1VZ8A 5BYRA 2BW2A 3GB1A 4GLSC 2MJEA 5BYQA 1D5XC 1ZPSA 1L0YB 3W2DA 1KLUD 2QEJC 1YQ4B 2BT6A 3FILA 2JXTA 3TUOA 1XCTL 1XLQA 3AEGB 3AECB 4KGTA 1KRHA 2WP9B 4ARIA 3VQIA 2AQ3B 2LMCA 4ZOHC 1PDXA 2J42A 2SEBD 3AEDB 3AN1A 4A55A 1ESFA 1UWMA 5JXVA 1ET9A 1HZ5A 3Q8FA 2PIAA 3MJ5A 1NEKB 3NVVA 1TKYA 4DXGA 1FIQA 4YTMB 5EE9A 1AWDA 1XEEA 1I4XA 2WXRA 1YMHE 2XNAC 1WRIA 3ZGZA 3BWUD 1SE4A 4TMAB 2MJ3A 2J52A 1YN5A 1T6BX 4MH8A 4US9A 2D5GA 2WXIA 4M0WA 4OZCA 3AE5B 3AE1B 5HFYA 2NTTA 1L5PA 2ACZB 1I4QA 3ABVB 2DLBA 3HRDD 3IAS1 4C7YA 4TQ0A 4N6EB 2M19A 1T3QA 1PUTA 2YEPB 4J3OD 5AUKA 5BMGA 1I4PA 1STEA 3HUIA 4JWSC 4MT5A 4N59A 1JW9D 5MPOA 1OQQA 2Y3AA 1SBBB 1HQRD 3AE9B 5FR3A 4Q2JA 2BB6A 2MEKA 1VZ6A 2SAKA 1SIJA 2JWUA 1NYRA 1EM7A 2DYOA 3DWGC 1J7CA 3VR8B 2AQ1B 2WXJA 1C78A 2IGHA 3AE6B 3AM9A 2DBYA 2LFIA 3TEZA 5EE3A 3ZJTA 3IAM1 1XO3A 3AMZA 1ZUD2 2E6XA 4YSXB 3PZ7A 1QOBA 1HXYD 3AEAB 2PMVA 4JE3B 2BYTA 3LYYA 2PLPA 3Q8EA 3UI3A 1V97A 3IXSA 1C9FA 1XF5L 4IKGA 4PT5A 5HHDG 1L4DB 2LEKA 2N9KA 1PGAA 4NAMA 2J4XA 5BMHA 2JQRB 4CQNA 2WXQA 1A70A 3KWVA 4XWWA 1GB4A 1B9RA 2KDMA 3NUHB 3VRAB 4A8XC 1GAQB 4HROA 3H8HA 2M56B 5BYSA 1WGKA 2WNMA 1I7HA 2Z8LA 4A90A 1JQ4A 4WH4A 2J53A 3AE3B 4USAA 2Y5CA 3AB5A 2ICIA 1FXAA 3IT4B 1FM0D 2BS4B 1TS5A 4UDUC 1AN8A 3I9V1 1DOIA 2BS2B 1FRRA 4R3DA 4RH6A 4DXFA 1FNVA 1NVID 2BBCA 4ITKA 3V3XA 4H2AA 1F77A 4P6VF 3CWIA 3E56A 1SB3C 1C77A 2QSDA 3Q69A 1ENFA 4XDDA 4RGOS 5H8YE 3AV8A 5GXGB 2CJOA 2IGGA 1FMAD 4ZHPA 2WU5B 4LK0M 3P4PB 1SE3A 5E6JA 1K51A 4LTUA 1L6VA 4IOIE 3BZDB 1DOXA 2H89B 1TZOA 1C79A 2L32A 3R8BA 4KGRA 1FCCC 4KGSA 5TSSA 2KMMA 4B0MA 1WSPA 4YTNB 4A6QA 1SJED 3ZJVA 1K52A 3VRBB 4TSSA 1QQRA 2L83A 3P4SB 2ZW1A 3J9CA 1DGJA 4OHJA 5D7GA 2WXGA 1SSNA 2QJLA 4XE0A 3L4PA 2L52A 1KLGD 3U4EG 1E9MA 2WXKA 1JRPA 2E3TA 2WXPA 5AUIA 3U7ZA 2AX5A 1WXQA 3GS2A 4HKZE 2XN9C 1HZ6A 3W5VB 3O13A 3KWLA 3LXFA 1YQ3B 3BYTB 1IGCA 2RPVA 1V1PA 4C7ZA 1IGDA 1ZP0B 4YSYB 4JPSA 4D2KA 1V1PB 1XCQL 5G5HA 2WS3B 2RDHA 1B1ZA 2WXHA 3B2GA 1AYFA 2KACA 3Q8BA 1PYWD 4WIPA 1TS3A 1MPEA 1C4AA 3P42A 3AE4B 1XLPA 2KWDA 1QOGA 5BMIA 4ZRQA 2H88B 5LNK1 1FRDA 1SE2A 2V0GA 3EA6A 4RCOA 2K22A 3I57A 4WQMA 4WWMA 3N9YC 2WXLA 1EU3A 2I2YA 3BVMA 3EGRA 1D5MC 1D6EC 3AE7B 3BK1A 1HEZE 1KH0A 4REZA 2WXFA 4C56C 1KTKA 2LJIA 1MVKA 3SR6A 4YXDB 1WYGA 3SFEB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2J53 A;  1P7E A;  1YNT E;  2N7J A;  1FD6 A;  1P7F A;  1PGX A;  3GB1 A;  4GLS C;  1Q10 A;  2PW9 A;  3V3X A;  3FIL A;  2JXT A;  1XCT L;  4KGT A;  2GB1 A;  1PGB A;  2N9L A;  2QSD A;  5JXV A;  1UWX A;  1HZ5 A;  1F2R I;  4HJG E;  2IGG A;  2K0P A;  1K51 A;  2I38 A;  2JSV X;  1YMH E;  1K50 A;  2ONQ A;  4IOI E;  4KGR A;  2J52 A;  1FCC C;  4KGS A;  5HG2 A;  4OZC A;  5HFY A;  1K52 A;  2NMQ A;  1D4B A;  1MHX A;  2QMT A;  2RMM A;  2ZW1 A;  2LHD A;  5BMG A;  2KQ4 X;  1JML A;  4HKZ E;  1HZ6 A;  2JWU A;  1IGC A;  2RPV A;  1EM7 A;  2LUM A;  2OED A;  1IGD A;  2IGH A;  2LHE A;  1K53 A;  1QKZ A;  2JU6 X;  4D2K A;  1XCQ L;  2KN4 A;  2EEL A;  2GI9 A;  2KAC A;  2PLP A;  4OZA A;  3UI3 A;  1IBX A;  1C9F A;  1MPE A;  1XF5 L;  4IKG A;  1FCL A;  2KWD A;  5BMI A;  5HHD G;  4MAC A;  2N9K A;  1PGA A;  1IBX B;  1F2R C;  5BMH A;  2PTL A;  1MHH E;  1GB4 A;  2LGI A;  2I2Y A;  2KDM A;  2ON8 A;  1ZXH A;  3MP9 A;  1GB1 A;  1HEZ E;  1KH0 A;  5HI1 A;  3FIL B;  2JZP A;  1MI0 A;  1MVK A;  2IGD A;  4OZB A;  4WH4 A;  2ZW0 A; 
#chains in the Genus database with same CATH topology
 1NDD A;  1ZOY B;  3DPD A;  3PT2 B;  2BPS A;  3LB8 C;  2GOW A;  1PGX A;  2R2Q A;  4RF0 A;  1LM8 B;  4HLE A;  3V6E B;  1JWB D;  2IY0 B;  3QC8 B;  5IKC M;  1P3Q U;  2B76 B;  1XLN A;  2CU3 A;  1HA5 A;  2GRI A;  5DPT A;  4US8 A;  2Y5P A;  1NBF C;  1VRA B;  4GDL B;  1CJE A;  3ZKJ C;  2JSV X;  4XC2 A;  4YWG G;  3PTF C;  2LZ6 A;  4L1B A;  1SF0 A;  2NMQ A;  4W9L A;  3RNG C;  4HRS A;  4JWU C;  4DQO C;  1AW7 A;  3H6N A;  3A1Q A;  5IOI A;  2AQ2 B;  3AI5 A;  3HVD A;  1TT5 B;  3U2S C;  1V1O A;  1CK1 A;  1WY8 A;  3MFG A;  3V05 A;  1OFF A;  2OOB B;  1N5W A;  2LUM A;  1EU4 A;  1EO6 A;  3A4S C;  5I4D A;  1K53 A;  1QKZ A;  2JU6 X;  2ZVO A;  3AXC A;  5JHB A;  3ALB A;  4KKJ A;  2GI9 A;  3NJT A;  2J0J A;  1WGG A;  4RGN A;  3VHT C;  1FCL A;  3RUI B;  3B2F A;  4BVU C;  1MHH E;  3BII D;  4M00 A;  4ZYN A;  1BT0 A;  4AOF A;  2INC C;  4MEM A;  4XYC A;  2CHW A;  3MP9 A;  3BVZ A;  3FAH A;  3R2T A;  1L7Y A;  2ZW0 A;  2CJN A;  3NVY A;  2QCZ A;  2N7D A;  5D3I B;  3PLV A;  1E7U A;  1Q10 A;  4G0N B;  2W3S A;  4C4V B;  3HVZ A;  5E6O A;  1L4Z B;  5J2R A;  3Q8A A;  4ZRJ A;  2X38 A;  5JH5 C;  1JWA D;  4JQW C;  5EE0 A;  3PRM B;  1NI3 A;  2DHZ A;  1ZE3 D;  1QIL A;  1GG3 A;  2VZK D;  4FLH A;  1VDV A;  1YQB A;  4HPL B;  5HG2 A;  2NBU A;  2R61 A;  3QIJ A;  2V4I B;  2KN5 A;  3S2A A;  2KDB A;  2KVZ A;  1VD2 A;  2A4Z A;  2MH7 A;  2LGS A;  1T5X D;  1BML C;  1LFD A;  1PFD A;  2KQ4 X;  3RNC C;  2WDR B;  3Q6B A;  3AE2 B;  3AEB B;  3P1M A;  4HK2 A;  2V1Y A;  4GDK A;  4HCN B;  4EZK A;  3T3O A;  1OQR A;  3RNA C;  1RWS A;  2JX5 A;  2EMT A;  1G6J A;  2NS5 A;  5H92 C;  3C8Y A;  1SJH D;  2M0X A;  3P4R B;  3DOW A;  2FCS A;  3OWE B;  4IC7 B;  2EKI A;  3EFU A;  2EEL A;  2JZZ A;  4RGM A;  3PZ8 A;  2CU1 A;  2FBW B;  3UIO B;  1ZDX A;  1QOF A;  2GMI C;  3HM6 X;  3PGE A;  3X0W A;  4CHK A;  1TY0 A;  3DWM A;  1MG8 A;  1UNS A;  2KJ6 A;  2DAJ A;  3PVL A;  5KHO A;  1F0Z A;  2QC8 A;  3SEB A;  1IBX B;  2Z59 B;  4LDT B;  3BYY B;  3TEY A;  3KYC D;  1A5R A;  2XK5 B;  1ZXH A;  4NAW A;  3QQ8 B;  3ETR A;  3AE8 B;  4MJS A;  4W9F A;  4DXA B;  1E8Y A;  2RR9 A;  4FJV B;  3APC A;  4OZB A;  4AWJ A;  2QIE B;  2INP E;  4PYU A;  2KNB A;  1P7E A;  5BYR A;  4W9I A;  3MJW A;  4NJ7 A;  2MA9 B;  1ZGU B;  2QEJ C;  3K9O B;  4CO7 A;  1XLQ A;  3AEC B;  3TJP A;  4KGT A;  4ARI A;  1UWM A;  1ET9 A;  1HZ5 A;  1NEK B;  3NVV A;  1XEE A;  3HM3 A;  1YMH E;  1J0G A;  2XNA C;  5IO9 A;  4EZJ A;  1KOT A;  3A33 B;  4MGY E;  2MP2 B;  3MC9 A;  4MH8 A;  2LRU A;  2D5G A;  1LQB A;  3AE5 B;  3ZRC A;  2FNJ B;  2NTT A;  5J18 A;  2C7N B;  3Q3J A;  2M19 A;  5CHV C;  3W1S C;  1WM2 A;  2BKR B;  5MPO A;  4EOY A;  2Z0E B;  2REX A;  3EFC A;  4F8C B;  4Q2J A;  2YLM A;  3CMM B;  4KZC A;  3L13 A;  1EM7 A;  3PLU A;  3CST A;  3CSF A;  1MFW A;  2G4D B;  5DPR A;  2IGH A;  3TEZ A;  3AMZ A;  4KIK A;  4ZDV A;  1ZUD 2;  2ZPY A;  2DZK A;  2LGD A;  1X1M A;  3JYU A;  3Q8E A;  4QAY A;  4GN1 A;  3UI3 A;  3IXS A;  1C9F A;  2M17 A;  4IKG A;  2GBR A;  3UGB B;  1EF1 A;  4HWI B;  2PEA A;  4HDO A;  2Z0D B;  2WXQ A;  3KWV A;  1GB4 A;  1PQS A;  3OJ3 A;  3BIN A;  3VRA B;  3QHT A;  1GAQ B;  2VH1 A;  2M56 B;  2LVP A;  1WGK A;  2WGS A;  3PZD A;  1XT9 B;  1GNU A;  3RI7 C;  3GE3 C;  3AE3 B;  3RT3 B;  4W9E A;  3AB5 A;  1P98 A;  2ZNV C;  2BS4 B;  1TS5 A;  3TMP B;  4UDU C;  4W9D A;  3I9V 1;  2BS2 B;  4IM3 A;  4WWO A;  4DXF A;  1NVI D;  2BBC A;  3V3X A;  4IUM B;  4P6V F;  3ZRF A;  1C1Y B;  1WJ6 A;  3DVN V;  4IG7 B;  5CTR C;  5H8Y E;  1HTO A;  2CJO A;  2KAN A;  3C0R B;  3VXW A;  1WH3 A;  4IOI E;  3BZD B;  1DOX A;  4PS7 A;  1KM7 A;  2H89 B;  4A20 A;  1E90 A;  3DBL I;  1WSP A;  4FUL A;  3PRE A;  1IYF A;  3VRB B;  2L83 A;  3P4S B;  3WAO A;  5D6J B;  2I1K A;  4OHJ A;  4II2 B;  5D7G A;  1YX5 B;  2QJL A;  2ASQ A;  2O6V D;  3L4P A;  2L52 A;  1KLG D;  1OQY A;  1WX8 A;  3U4E G;  3L0W B;  4IM0 A;  3DBL B;  1MG4 A;  1SE9 A;  3UIP B;  2KZR A;  2GLS A;  4WJN A;  4MEL A;  4YSY B;  2AEH A;  3OLM D;  4D2K A;  1XCQ L;  2D3A A;  3PSE B;  2JRI B;  2RDH A;  2FIF A;  2WXH A;  2KAC A;  2LXC A;  5AZG A;  2O6V A;  3SU8 X;  1PYW D;  4ANU A;  4WIP A;  3ZNH B;  1TS3 A;  2L8J A;  3NY5 A;  2ZPN A;  2NBW B;  4WWM A;  4K3B A;  3BVM A;  1ZKH A;  3EGR A;  3PRP B;  3AE7 B;  3KUC B;  3BK1 A;  3ML8 A;  3NOB A;  1R4M I;  2WXF A;  5JHA A;  4LNK A;  2LJI A;  3SFE B;  3I63 C;  2UWQ A;  1YN3 A;  2NPT B;  4B0E A;  2BQQ A;  4W9G A;  2CKH B;  3PO0 A;  3NVZ A;  2K9X A;  2LWP A;  3OG5 A;  1R4M B;  3DHH C;  5EE1 A;  3NZ3 A;  2GB1 A;  2N9L A;  3CIR B;  3IBE A;  1E8X A;  4K7W A;  1RLF A;  2BF8 B;  4DK5 A;  3N1Z C;  2QHO A;  2BYV E;  1NYQ A;  1JWS D;  4P1B C;  1I4G A;  3O65 B;  4DHZ E;  2J7Q B;  2KC1 A;  2L00 B;  1C4C A;  2LHD A;  1T0Q C;  1TKE A;  3DHI C;  1C3T A;  3Q8C A;  1JML A;  1RYJ A;  3W1S A;  3T3N A;  2IBI B;  4P1C C;  4RM8 A;  3ML9 A;  1KLV A;  1TYG B;  1ZW7 A;  1VZ7 A;  3QJZ A;  4EKU A;  1C4P A;  4M02 A;  2KN4 A;  2MW5 A;  3U8Z A;  3DQV A;  4NY0 A;  3Q3M C;  4OZA A;  3PRZ A;  2BVC A;  1YJI A;  4KKI A;  4EE2 A;  2KYW A;  3NVW A;  2KDE B;  1MJD A;  4MAC A;  2NR2 A;  4BKS D;  1Z5S B;  1F2R C;  2IJ0 A;  1YJ1 A;  2BWF A;  3K9P B;  1GJZ A;  4EEW A;  2K8H A;  1N62 A;  2MBE A;  5HI1 A;  1ET6 A;  2JZP A;  5T8I A;  4XDC A;  2MSE D;  2OJW A;  4HXD A;  2BTE A;  3RN9 C;  1V9J A;  1WIA A;  3ZQ4 A;  1CZP A;  1WZ3 A;  2DZM A;  4BKS A;  4ZYS A;  1DYQ A;  1WXM A;  2KWU B;  1R4N B;  3UQB A;  1DOY A;  1E7P B;  2JZ3 B;  2DNF A;  5C2T B;  4NJC A;  3LJ3 A;  3L10 B;  4K1R B;  5FKA C;  2VH2 A;  1FXI A;  1L6U A;  3I3T B;  4K81 A;  5TR5 A;  3ZDM C;  4XGA B;  2JVC A;  4FHK A;  4LLG M;  1Q5W B;  2IDY A;  2ONQ A;  2HDE A;  2RSU A;  2KWC A;  1TKG A;  3URY A;  1J19 A;  5FR6 A;  2Q5W D;  4DDI D;  2MQJ A;  2WU2 B;  1TTN A;  3NS1 A;  1JWM D;  3VDZ A;  4ANV A;  3DCG A;  2MBO A;  2W54 A;  3ZVV A;  4LJP B;  1UEL A;  1I4H A;  1U4A A;  1UBQ A;  3MHS D;  1V5O A;  2UYZ B;  3B9J A;  2G9H D;  2WXN A;  3KQ4 A;  4IWQ A;  4LJO B;  3I5J C;  2OED A;  2AYO B;  2LAS A;  2KAJ A;  1F9J A;  4KDI C;  1IPG A;  4BFR A;  2V3N A;  1JWU D;  2KK8 A;  2KFK A;  2A5U A;  2BWE S;  4MM3 B;  2JF5 A;  3VR9 B;  2WQY B;  1IBX A;  4IWO A;  1VJK A;  1VLB A;  2BGF A;  3H7P B;  3Q3O C;  1JCK B;  3RNE C;  2YEP F;  4GXB A;  3GOE A;  4OW0 A;  2LGX A;  1I42 A;  4AS1 A;  3TCA A;  2DWQ A;  1GB1 A;  4MSM B;  2PVO D;  1YJJ A;  1FNU A;  2IYD B;  1J7B A;  3M3J A;  3TSS A;  3QCA A;  1Q0W B;  4J6I A;  5AEK B;  2RPQ A;  1MI0 A;  1WI0 A;  3FKY A;  2DZI A;  1YNT E;  1TIF A;  2BW2 A;  3GB1 A;  5BYQ A;  4K3C A;  1ZPS A;  1L0Y B;  3W2D A;  1KLU D;  3FIL A;  3TUO A;  5G2N A;  3VQI A;  2AQ3 B;  4ZOH C;  1PDX A;  2J42 A;  3AED B;  1ESF A;  1K8R B;  2BYE A;  2L7R A;  3WAN A;  4YTM B;  5EE9 A;  1AWD A;  2WWZ A;  2HD5 B;  1I4X A;  1E7V A;  1WRI A;  2BKF A;  3ZGZ A;  1UGM A;  2CHZ A;  3BWU D;  3KUD B;  4OZC A;  4M0W A;  5HFY A;  2IO3 B;  3PV1 A;  1J8C A;  1I4Q A;  3HRD D;  2DLB A;  2YEP B;  4J3O D;  5AUK A;  1FXT B;  4PYZ A;  3N30 A;  4MT5 A;  4N59 A;  3IHP C;  4G11 A;  1SBB B;  3AE9 B;  4JIO U;  3RNF C;  2MLB A;  2PE9 A;  4W9J A;  2JWU A;  1NYR A;  4IM2 A;  3HHM A;  3VR8 B;  2WXJ A;  1YIW A;  2KJR A;  3ZJT A;  4YSX B;  3RZW C;  2LGY A;  2EKE C;  2KLC A;  4FN2 A;  3A9K A;  2V3S A;  2PMV A;  3LYY A;  1NI2 A;  3V61 A;  2HTH A;  4PT5 A;  4A3P A;  2LEK A;  2N9K A;  1UF0 A;  4NAM A;  4AP4 C;  2K6D B;  2FCM A;  5BMH A;  2JQR B;  4LCD E;  1A70 A;  4XWW A;  4FBJ B;  1B9R A;  2DYB A;  3RZF A;  1T0Y A;  4HRO A;  2FCN A;  4EUT A;  4W9C A;  4S0R A;  2FCQ A;  3N1Y C;  4S17 A;  1XD3 B;  1I7H A;  1WXA A;  4BAX A;  5JZE B;  4WQO B;  3M62 B;  2KQ7 A;  1VCB A;  4HPP A;  4W9H A;  1UZX B;  5KHQ A;  5G55 A;  1FRR A;  2R2O A;  4ITK A;  1F77 A;  1OEY A;  3CWI A;  2D3C A;  1ENF A;  4XDD A;  3H1U A;  1N6Z A;  3A1Q B;  1S1Q B;  2KX3 A;  1WX7 A;  2WU5 B;  1OTR B;  2KOX A;  4DHJ D;  3Q3F A;  3VUW A;  3R8B A;  4M01 A;  3SDL C;  3ZTD A;  1FCC C;  4KGS A;  5TSS A;  4PK1 A;  3RCZ A;  1K52 A;  3IVF A;  3HIZ A;  1QQR A;  2KT7 A;  3J9C A;  2YVC A;  3L08 A;  1SSN A;  4E71 A;  4PS3 A;  1E9M A;  2WXP A;  5AUI A;  1WXQ A;  4HKZ E;  3QWZ B;  4X57 B;  1UH6 A;  5L83 A;  3Q14 C;  3VUY A;  1LGR A;  1YQ3 B;  1IGC A;  2RPV A;  4MGI E;  4C7Z A;  5IAA C;  1IGD A;  2GBJ A;  1ZP0 B;  2IY1 B;  1WX9 A;  3PPA A;  1B1Z A;  4BBN F;  4M8N A;  3WA0 A;  1P1A A;  4RM9 A;  1MPE A;  3P42 A;  3AE4 B;  1XLP A;  2G45 B;  5BMI A;  4WWN A;  3VH3 B;  2H88 B;  2V0G A;  3EA6 A;  3SHQ A;  4RCO A;  3ONS A;  2LJ5 A;  4WQM A;  3N9Y C;  2WXL A;  1EU3 A;  2KWV B;  2WDT B;  2CS4 A;  1D6E C;  2K8B A;  1KH0 A;  1KTK A;  4ACF A;  2LRW A;  1RFA A;  1GUA B;  4WAA A;  4KZ0 A;  2M0A A;  3KH0 A;  3B0A A;  1BXT A;  2C7H A;  2GBM A;  1FO4 A;  1WF9 A;  4RMA A;  1WE7 A;  2DYM A;  2HTM E;  1M4V A;  4YT0 B;  2WLB A;  3WAL A;  3C19 A;  3ZIM A;  1F2R I;  3L54 A;  4FJZ A;  4II3 B;  1KJT A;  4F1S A;  3NHE B;  4HEA 1;  2BS3 B;  4GDK B;  1QT9 A;  4YTP B;  4I6N B;  3ZYY X;  5FK9 C;  1ZXI A;  1RM6 C;  1AAR A;  2RMM A;  1E0Z A;  1BUI C;  5D94 A;  4B95 A;  4I6P A;  3SFD B;  2J0M A;  2K1F A;  3ZLZ A;  1XXG A;  4RFB A;  1SXT A;  2W82 A;  3RD2 A;  2TSS A;  1GOZ A;  1WWT A;  2WX1 A;  1WZ0 A;  2IO2 B;  2ZZP B;  2KTR A;  3A9J A;  1WGD A;  5E6N A;  3AU4 A;  1WMH A;  3N32 A;  2UU7 A;  4HPM B;  1WJN A;  1YD8 U;  2O2V A;  2WDQ B;  3DDC B;  1SEB D;  2JXX A;  4MJS B;  4DBG A;  2IPK D;  1EWY C;  5IP4 D;  5HKH A;  2PVG C;  4TUU A;  3WAM A;  1TZ1 A;  3U30 A;  2K3U A;  2PPH A;  2PTL A;  4EZL A;  4KX6 B;  2G1E A;  4LNN A;  2PJH A;  3ZW3 A;  3R2I A;  5G5G A;  1WR6 E;  3DVG X;  2LVO A;  3KLS X;  3RPF C;  3PS6 A;  4RGT A;  1V8C A;  3JSV A;  5EDS A;  1R7S A;  3IT6 B;  3NZS A;  3W9C B;  3RNB C;  4FAD A;  1EWC A;  3RFZ B;  1JRU A;  1N61 A;  3T9L A;  2K25 A;  4BKG A;  4AQ7 A;  3NRZ A;  2NVU I;  3R66 C;  1JRO A;  2JWZ A;  4DDG D;  1L0V B;  4MSQ B;  4OVV A;  4XWT A;  3IG3 A;  3APD A;  4ANW A;  2I38 A;  4GGQ A;  2LUE A;  3V6C B;  4C80 A;  3CF6 E;  4FXC A;  4HDQ A;  2JY6 A;  1EF5 A;  1D4B A;  1MHX A;  2FUH B;  3R7R A;  3TEW A;  3PHW B;  3E9S A;  2RDG A;  4GDL A;  4KIK B;  4DHZ B;  3W1Y A;  1LXD A;  1KFY B;  4RNA A;  2L1A A;  4L2Y A;  1ISN A;  5CX3 A;  2DZJ A;  2ZVN A;  2FE8 A;  1JAL A;  1E10 A;  2JYE A;  4MDK E;  2DEN B;  3AH7 A;  1Y56 A;  1KF6 B;  4DWF A;  3V62 A;  3WAP A;  1Q1O A;  3TIX A;  3B08 A;  2AL6 A;  2NTS A;  1QLB B;  3GP7 A;  2NCN A;  3W5U B;  2LXA A;  2JRH A;  4M8M A;  3D32 A;  4A3O A;  4ZHO A;  3BK2 A;  2QDF A;  1WGR A;  1IUE A;  5LLI A;  3ZTC A;  4MGZ E;  1UD7 A;  1TJE A;  4YSZ B;  2ON8 A;  3QK0 A;  3QX1 A;  2CR5 A;  3U52 E;  2RD0 A;  3OJ4 B;  1J7A A;  4PS8 A;  2FAZ A;  3M95 A;  2N0S B;  5C1Z A;  2C7M B;  4ARC A;  1VZ8 A;  3N1X C;  4GLS C;  1E8W A;  3GE8 C;  3ZDT A;  3Q2A C;  2D10 A;  1YQ4 B;  2JXT A;  3ZXR A;  3ENE A;  3AEG B;  2EMS A;  3LDZ E;  2KMA A;  2SEB D;  3AN1 A;  2PIA A;  3MJ5 A;  1CMX B;  3GZN I;  1TKY A;  1FIQ A;  4C4V A;  2WXR A;  2B3A A;  2MJ3 A;  5AZH A;  1YN5 A;  2ZCC A;  1WM3 A;  3VFK A;  4NNJ B;  4US9 A;  4XX5 A;  2D11 A;  2WXI A;  1I35 A;  1D3Z A;  4HCP B;  1L5P A;  2ACZ B;  3ABV B;  3IAS 1;  4C7Y A;  4TQ0 A;  1M94 A;  2KKC A;  4NJ6 A;  1PUT A;  1STE A;  1JW9 D;  1OQQ A;  4EFO A;  5FR3 A;  1SGH A;  2O6V B;  2MEK A;  2N4F A;  1VZ6 A;  3VAW A;  2DYO A;  2MBQ A;  1C78 A;  2DBY A;  5C23 A;  5EE3 A;  3IAM 1;  1XO3 A;  2MCN B;  2E6X A;  4ZRI A;  2LVQ A;  2PE6 B;  1HXY D;  2W9N A;  2N9X A;  4GIV A;  3AUL A;  1EUV B;  1V97 A;  1YOV B;  4LDT D;  2D3G A;  4TV3 A;  1GC7 A;  1PGA A;  1S3S G;  2N1W A;  2J4X A;  3A4R A;  4KSK C;  2KDM A;  4A8X C;  5BYS A;  5GMV A;  1WGH A;  2N9P C;  2Z8L A;  4A90 A;  1JQ4 A;  4USA A;  5CHF A;  1WE6 A;  4AJW A;  3KYD D;  3QAR A;  3SD5 A;  2XK5 A;  1DOI A;  1V81 A;  4RH6 A;  2ZCB A;  1FNV A;  1TBE A;  4H2A A;  3VH4 B;  3TBL D;  3P2B A;  2FID A;  3E56 A;  1SB3 C;  2QSD A;  3Q69 A;  4RGO S;  3AV8 A;  5GXG B;  4ZHP A;  4LK0 M;  3P4P B;  1SE3 A;  5E6J A;  1K51 A;  4LTU A;  1Z2M A;  1WRD B;  3DBR I;  4MGK E;  1TZO A;  1C79 A;  2L32 A;  4B0M A;  3BY4 B;  4KSL C;  2C5L C;  2GBK A;  2AL3 A;  2KLG A;  2HJ1 A;  1JRP A;  2E3T A;  3DBR B;  3U7Z A;  2KJH B;  2AX5 A;  3GS2 A;  4JL9 A;  1HZ6 A;  3W5V B;  2MP2 A;  1FPY A;  1P9D U;  3DVN U;  3N3K B;  4JGH B;  1V1P B;  2RGF A;  4N9F 4;  4YL8 A;  5G5H A;  3EC8 A;  2WS3 B;  3B2G A;  3L17 A;  2KVR A;  5LXH A;  3JVZ X;  2KFJ A;  2AWT A;  4GU2 A;  4C00 A;  2KWD A;  4ZRQ A;  5LNK 1;  1FRD A;  1SE2 A;  2K22 A;  2BYF A;  5IN7 A;  2I2Y A;  4WWP A;  1D5M C;  1HEZ E;  4P7I A;  2G3Q B;  2ZEQ A;  4REZ A;  2ZNV B;  1MVK A;  1WYG A;  4ANX A;  2V3P A;  3APF A;  1C76 A;  3TL5 A;  1T0S C;  3DHG C;  3MTN B;  4WAF A;  1UGJ A;  1Y8R C;  2IND C;  4TQ1 A;  2IO0 B;  2LD9 A;  4AUQ C;  4P16 A;  2KMC A;  4GB9 A;  1XLO A;  3VUX A;  2JPH A;  3ZNZ B;  1UWX A;  2KC2 A;  4HJG E;  2QIL A;  3UIN B;  1D5Z C;  2N7E A;  4NZL B;  1N60 A;  2K0P A;  4KVG B;  4JLC A;  4IWP A;  4G50 A;  1GC6 A;  1WJ4 A;  3U7D A;  3TEX A;  3HK0 A;  1FFU A;  4KDL B;  1RRB A;  5CHW A;  1YN4 A;  4I6L B;  5E6P A;  2QMT A;  1V5T A;  3NG0 A;  3WCQ A;  1E5W A;  1QF6 A;  3DBH I;  2KFK B;  1WFY A;  4K7U A;  1FEH A;  2INN E;  2L76 A;  4ICU A;  2M1M A;  4WUR A;  4HVB A;  5D3D A;  4K7S A;  2KDI A;  3DBH B;  3H9D A;  1F1H A;  4ZRP A;  3ZUN A;  2LI5 A;  4LNO A;  3ZO5 B;  2K6Q A;  2L3Z A;  3WIM A;  3BVG A;  1I4R A;  4L23 A;  4KV2 A;  2KQS A;  2KO3 A;  4O1N A;  1T0R C;  2C60 A;  1NEN B;  2LGI A;  2J0K A;  1ZDV A;  1TGZ B;  1V49 A;  4IDI A;  5AZF A;  2ZJD A;  2W55 A;  2FUG 1;  1TS4 A;  2PKO A;  1FFV A;  3FIL B;  1UBI A;  4WJO A;  4NQL B;  3ZJU A;  4HKQ A;  1P7F A;  1V6E A;  2RDB C;  3QAQ A;  3EUB 2;  2WYQ A;  1GPX A;  1TS2 A;  1E8Z A;  2BB5 A;  2PW9 A;  2G4S A;  2KX0 A;  4JX1 C;  4M0W B;  1PGB A;  5LXI B;  4ICV A;  2NPT A;  3PHX B;  3OAW A;  1QOA A;  3NZU A;  1K50 A;  2W3R A;  4ASW C;  2D2Q A;  1TY2 A;  4XZ4 A;  3P63 A;  1WYW B;  4MH0 E;  4IW0 A;  4WJP A;  3FC4 A;  3AEE B;  1N63 A;  3VTW A;  2MJD A;  2KXJ A;  4AJY B;  4N58 A;  4RF1 A;  4BOS C;  1HE8 A;  3A9K B;  2WXO A;  1FNW A;  4A9A A;  1UUP A;  4URK A;  2NBV B;  1LO5 D;  5C3J B;  2D3B A;  2WDV B;  2KDF B;  2VZK B;  2LHE A;  2CHX A;  1IP9 A;  4TKN A;  1ROE A;  3R7Q A;  1CQV A;  4GOC A;  3UQA A;  1E6E B;  3MC0 B;  2KD0 A;  1ACC A;  4CYE A;  1P0R A;  1VR9 A;  1WJU A;  3MHZ A;  3VTV A;  4OVZ A;  2IZV B;  2OHF A;  2VRR B;  1L0X B;  2JYT A;  2V4L A;  2WXM A;  3B1L X;  3P4Q B;  2K5P A;  2D07 B;  3UF8 A;  1H8C A;  3KVF B;  4NAW B;  2I1J A;  1V86 A;  2K8C A;  3ZNG C;  1WXS A;  2IGD A;  3AEF B;  4LNF A;  2KHW B;  5D2M B;  1N5X A;  1RFK A;  2N7J A;  1FD6 A;  2MJE A;  1D5X C;  2WHI A;  2MBH A;  2BT6 A;  1XCT L;  1KRH A;  2WP9 B;  2LMC A;  5JXV A;  4A55 A;  3Q8F A;  4FHJ A;  4DXG A;  5J17 A;  2X8X X;  2MX2 A;  4W9K A;  2M8S A;  3DBS A;  1SE4 A;  4TMA B;  3RMK C;  2J52 A;  4FJY A;  2L0F A;  1T6B X;  4DHJ B;  3AE1 B;  1WGY A;  4LNI A;  3R3M A;  4N6E B;  4FA6 A;  1SIF A;  1T3Q A;  3V60 A;  5BMG A;  1I4P A;  3HUI A;  4JWS C;  3QA8 A;  3AU5 A;  2Y3A A;  1HQR D;  4GMV A;  2BB6 A;  1OEY J;  2L0T A;  2SAK A;  1SIJ A;  4ZRK A;  4NPN A;  2HE7 A;  2V9H A;  3DWG C;  1J7C A;  2AQ1 B;  3Q3N C;  3AE6 B;  3AM9 A;  2LFI A;  2MRP A;  5IA7 A;  3PZ7 A;  1QOB A;  3NS8 A;  4BOZ B;  3AEA B;  2L05 A;  4JE3 B;  2BYT A;  2PLP A;  1XF5 L;  1WR1 A;  5HHD G;  1L4D B;  1WXV A;  3VVW B;  3M63 B;  4CQN A;  4WJQ A;  2XBB C;  3NUH B;  4MM3 A;  3H8H A;  2HJ8 A;  3IFW B;  3RYT A;  1OGW A;  2N9E B;  1L2N A;  2WNM A;  1V80 A;  5DCN A;  3H7P A;  3EEC A;  1V2Y A;  4WH4 A;  1YX6 B;  2J53 A;  4B9K A;  2IO1 B;  2WX0 A;  3X23 A;  2Y5C A;  2ICI A;  1FXA A;  2MWS B;  3IT4 B;  2K39 A;  1FM0 D;  5BO4 B;  1AN8 A;  2M4N A;  2N1V A;  4R3D A;  3RUL A;  2GBN A;  3MC8 A;  1C77 A;  5DPS A;  3VTU A;  4NQK E;  2IGG A;  2KTF A;  1FMA D;  4BKT A;  2MHJ A;  2C9W B;  1L6V A;  1RAX A;  4KGR A;  2KMM A;  4G3X B;  4B6W A;  4YTN B;  4A6Q A;  1SJE D;  3ZJV A;  1HTQ A;  2DX5 B;  2KTR B;  3A9J B;  1H4R A;  4TSS A;  2ZW1 A;  3T8M A;  4BBN C;  1DGJ A;  2WXG A;  3EHV A;  4XE0 A;  1WMH B;  2JUO A;  4HJK A;  4F7Z A;  2O2V B;  2WXK A;  5DPW A;  2XN9 C;  3O13 A;  3KWL A;  3LXF A;  2XEW A;  3BYT B;  1V1P A;  2OJR A;  4E74 A;  4JPS A;  1R4N I;  2Y5B B;  1AYF A;  1F52 A;  3Q8B A;  3ZXV A;  3GZN B;  3L16 A;  2MBB B;  1XQQ A;  4E3C A;  3DVG Y;  1C4A A;  3H7S A;  1QOG A;  2JT4 B;  3KUZ A;  3JSV B;  3I57 A;  3KW5 B;  3JW0 X;  2DAF A;  4OVU A;  3ZNI D;  3N20 C;  4BZA A;  4C56 C;  5L95 C;  1QZE A;  4YXD B;  3SR6 A;  3ECI A;  4GSW A; 
#chains in the Genus database with same CATH homology
 1ZOY B;  2V3P A;  1C76 A;  1YN3 A;  4WAF A;  4B0E A;  3LB8 C;  1UGJ A;  1PGX A;  4RF0 A;  4TQ1 A;  2M0A A;  3PO0 A;  3NVZ A;  4P16 A;  1JWB D;  2K9X A;  1BXT A;  1FO4 A;  5EE1 A;  2B76 B;  3NZ3 A;  1XLN A;  2CU3 A;  1XLO A;  2GB1 A;  2N9L A;  1HA5 A;  3CIR B;  2GRI A;  2DYM A;  2HTM E;  1M4V A;  4YT0 B;  1UWX A;  2WLB A;  4US8 A;  2Y5P A;  1F2R I;  4HJG E;  2QIL A;  1VRA B;  4GDL B;  1NYQ A;  1D5Z C;  1JWS D;  1CJE A;  4NZL B;  1N60 A;  2K0P A;  1I4G A;  2JSV X;  4YWG G;  4HEA 1;  4L1B A;  3TEX A;  1SF0 A;  2BS3 B;  4GDK B;  1QT9 A;  4YTP B;  1FFU A;  3ZYY X;  2NMQ A;  5FK9 C;  1YN4 A;  4HRS A;  1ZXI A;  1RM6 C;  2QMT A;  4JWU C;  4DQO C;  1AW7 A;  2RMM A;  1C4C A;  2LHD A;  1E0Z A;  1BUI C;  3WCQ A;  3SFD B;  1QF6 A;  1TKE A;  1XXG A;  4RFB A;  2AQ2 B;  3HVD A;  1SXT A;  1FEH A;  2W82 A;  3Q8C A;  3U2S C;  1JML A;  1RYJ A;  1V1O A;  2TSS A;  1GOZ A;  1WWT A;  3W1S A;  1CK1 A;  3MFG A;  3T3N A;  3V05 A;  1OFF A;  2INN E;  1N5W A;  2LUM A;  1TYG B;  1EU4 A;  5I4D A;  1VZ7 A;  4WUR A;  1K53 A;  1QKZ A;  2JU6 X;  5D3D A;  1C4P A;  2WDQ B;  2KN4 A;  1SEB D;  4KKJ A;  2GI9 A;  4ZRP A;  4OZA A;  4RGN A;  2IPK D;  1YJI A;  4KKI A;  1EWY C;  3BVG A;  1I4R A;  4EE2 A;  4L23 A;  3NVW A;  1FCL A;  2PVG C;  4MAC A;  4O1N A;  1F2R C;  2K3U A;  2IJ0 A;  3B2F A;  2PTL A;  1NEN B;  1MHH E;  3BII D;  2LGI A;  1ZDV A;  4KX6 B;  3MP9 A;  4IDI A;  2G1E A;  3BVZ A;  3FAH A;  1N62 A;  3R2T A;  2W55 A;  2FUG 1;  1TS4 A;  5HI1 A;  1ET6 A;  2PKO A;  3R2I A;  1FFV A;  5G5G A;  3FIL B;  2JZP A;  5T8I A;  4XDC A;  2BTE A;  2ZW0 A;  3KLS X;  3RPF C;  2CJN A;  3ZJU A;  3NVY A;  4RGT A;  4HKQ A;  1V8C A;  3ZQ4 A;  1CZP A;  4ZYS A;  5D3I B;  1P7F A;  1R7S A;  3IT6 B;  3W9C B;  1Q10 A;  3EUB 2;  2W3S A;  1GPX A;  1DYQ A;  1TS2 A;  2BB5 A;  1EWC A;  2PW9 A;  3RFZ B;  1N61 A;  3HVZ A;  4JX1 C;  1DOY A;  1E7P B;  1L4Z B;  5C2T B;  3Q8A A;  4AQ7 A;  4NJC A;  3NRZ A;  2X38 A;  1JWA D;  1JRO A;  1PGB A;  5FKA C;  1FXI A;  1L6U A;  5EE0 A;  1L0V B;  1NI3 A;  4XWT A;  1ZE3 D;  4LLG M;  1QOA A;  2I38 A;  2IDY A;  4C80 A;  1K50 A;  2ONQ A;  2HDE A;  4FXC A;  1QIL A;  1TKG A;  2W3R A;  2VZK D;  3URY A;  2Q5W D;  1TY2 A;  1VDV A;  2WU2 B;  5HG2 A;  3P63 A;  2R61 A;  1JWM D;  3NS1 A;  2V4I B;  1D4B A;  1MHX A;  3FC4 A;  3AEE B;  1N63 A;  2W54 A;  3TEW A;  2MJD A;  4N58 A;  3E9S A;  2RDG A;  1I4H A;  2MH7 A;  4RF1 A;  1T5X D;  1BML C;  1KFY B;  1PFD A;  2KQ4 X;  4RNA A;  2L1A A;  2WDR B;  4L2Y A;  3B9J A;  3AE2 B;  2G9H D;  3AEB B;  2WXO A;  3P1M A;  1FNW A;  2WXN A;  2FE8 A;  4A9A A;  3KQ4 A;  1UUP A;  1JAL A;  1E10 A;  3T3O A;  1OQR A;  1LO5 D;  1RWS A;  2JYE A;  5C3J B;  2OED A;  2JX5 A;  3AH7 A;  1Y56 A;  1KF6 B;  2KAJ A;  2WDV B;  5H92 C;  2VZK B;  3C8Y A;  1SJH D;  2LHE A;  3P4R B;  3OWE B;  2V3N A;  1JWU D;  1ROE A;  2EKI A;  1CQV A;  2EEL A;  2NTS A;  4MM3 B;  4RGM A;  1QLB B;  3GP7 A;  3VR9 B;  1E6E B;  3PZ8 A;  2FBW B;  3MC0 B;  1ZDX A;  1QOF A;  2WQY B;  1IBX A;  1ACC A;  3W5U B;  1VJK A;  1VR9 A;  1TY0 A;  3DWM A;  1UNS A;  1VLB A;  1JCK B;  4ZHO A;  1F0Z A;  3SEB A;  2YEP F;  3MHZ A;  4OVZ A;  1IBX B;  3BK2 A;  2OHF A;  3BYY B;  3TEY A;  4OW0 A;  1IUE A;  1L0X B;  2JYT A;  4YSZ B;  1TJE A;  2ON8 A;  1ZXH A;  2WXM A;  4AS1 A;  3P4Q B;  2DWQ A;  1GB1 A;  2K5P A;  2PVO D;  3ETR A;  3AE8 B;  3U52 E;  1YJJ A;  1FNU A;  1J7B A;  1J7A A;  3TSS A;  4NAW B;  1MI0 A;  2IGD A;  4OZB A;  2N0S B;  3AEF B;  2QIE B;  2INP E;  1N5X A;  1P7E A;  1RFK A;  4ARC A;  1YNT E;  2N7J A;  1FD6 A;  1VZ8 A;  5BYR A;  2BW2 A;  3GB1 A;  4GLS C;  2MJE A;  5BYQ A;  1D5X C;  1ZPS A;  1L0Y B;  3W2D A;  1KLU D;  2QEJ C;  1YQ4 B;  2BT6 A;  3FIL A;  2JXT A;  3TUO A;  1XCT L;  1XLQ A;  3AEG B;  3AEC B;  4KGT A;  1KRH A;  2WP9 B;  4ARI A;  3VQI A;  2AQ3 B;  2LMC A;  4ZOH C;  1PDX A;  2J42 A;  2SEB D;  3AED B;  3AN1 A;  4A55 A;  1ESF A;  1UWM A;  5JXV A;  1ET9 A;  1HZ5 A;  3Q8F A;  2PIA A;  3MJ5 A;  1NEK B;  3NVV A;  1TKY A;  4DXG A;  1FIQ A;  4YTM B;  5EE9 A;  1AWD A;  1XEE A;  1I4X A;  2WXR A;  1YMH E;  2XNA C;  1WRI A;  3ZGZ A;  3BWU D;  1SE4 A;  4TMA B;  2MJ3 A;  2J52 A;  1YN5 A;  1T6B X;  4MH8 A;  4US9 A;  2D5G A;  2WXI A;  4M0W A;  4OZC A;  3AE5 B;  3AE1 B;  5HFY A;  2NTT A;  1L5P A;  2ACZ B;  1I4Q A;  3ABV B;  2DLB A;  3HRD D;  3IAS 1;  4C7Y A;  4TQ0 A;  4N6E B;  2M19 A;  1T3Q A;  1PUT A;  2YEP B;  4J3O D;  5AUK A;  5BMG A;  1I4P A;  1STE A;  3HUI A;  4JWS C;  4MT5 A;  4N59 A;  1JW9 D;  5MPO A;  1OQQ A;  2Y3A A;  1SBB B;  1HQR D;  3AE9 B;  5FR3 A;  4Q2J A;  2BB6 A;  2MEK A;  1VZ6 A;  2SAK A;  1SIJ A;  2JWU A;  1NYR A;  1EM7 A;  2DYO A;  3DWG C;  1J7C A;  3VR8 B;  2AQ1 B;  2WXJ A;  1C78 A;  2IGH A;  3AE6 B;  3AM9 A;  2DBY A;  2LFI A;  3TEZ A;  5EE3 A;  3ZJT A;  3IAM 1;  1XO3 A;  3AMZ A;  1ZUD 2;  2E6X A;  4YSX B;  3PZ7 A;  1QOB A;  1HXY D;  3AEA B;  2PMV A;  4JE3 B;  2BYT A;  3LYY A;  2PLP A;  3Q8E A;  3UI3 A;  1V97 A;  3IXS A;  1C9F A;  1XF5 L;  4IKG A;  4PT5 A;  5HHD G;  1L4D B;  2LEK A;  2N9K A;  1PGA A;  4NAM A;  2J4X A;  5BMH A;  2JQR B;  4CQN A;  2WXQ A;  1A70 A;  3KWV A;  4XWW A;  1GB4 A;  1B9R A;  2KDM A;  3NUH B;  3VRA B;  4A8X C;  1GAQ B;  4HRO A;  3H8H A;  2M56 B;  5BYS A;  1WGK A;  2WNM A;  1I7H A;  2Z8L A;  4A90 A;  1JQ4 A;  4WH4 A;  2J53 A;  3AE3 B;  4USA A;  2Y5C A;  3AB5 A;  2ICI A;  1FXA A;  3IT4 B;  1FM0 D;  2BS4 B;  1TS5 A;  4UDU C;  1AN8 A;  3I9V 1;  1DOI A;  2BS2 B;  1FRR A;  4R3D A;  4RH6 A;  4DXF A;  1FNV A;  1NVI D;  2BBC A;  4ITK A;  3V3X A;  4H2A A;  1F77 A;  4P6V F;  3CWI A;  3E56 A;  1SB3 C;  1C77 A;  2QSD A;  3Q69 A;  1ENF A;  4XDD A;  4RGO S;  5H8Y E;  3AV8 A;  5GXG B;  2CJO A;  2IGG A;  1FMA D;  4ZHP A;  2WU5 B;  4LK0 M;  3P4P B;  1SE3 A;  5E6J A;  1K51 A;  4LTU A;  1L6V A;  4IOI E;  3BZD B;  1DOX A;  2H89 B;  1TZO A;  1C79 A;  2L32 A;  3R8B A;  4KGR A;  1FCC C;  4KGS A;  5TSS A;  2KMM A;  4B0M A;  1WSP A;  4YTN B;  4A6Q A;  1SJE D;  3ZJV A;  1K52 A;  3VRB B;  4TSS A;  1QQR A;  2L83 A;  3P4S B;  2ZW1 A;  3J9C A;  1DGJ A;  4OHJ A;  5D7G A;  2WXG A;  1SSN A;  2QJL A;  4XE0 A;  3L4P A;  2L52 A;  1KLG D;  3U4E G;  1E9M A;  2WXK A;  1JRP A;  2E3T A;  2WXP A;  5AUI A;  3U7Z A;  2AX5 A;  1WXQ A;  3GS2 A;  4HKZ E;  2XN9 C;  1HZ6 A;  3W5V B;  3O13 A;  3KWL A;  3LXF A;  1YQ3 B;  3BYT B;  1IGC A;  2RPV A;  1V1P A;  4C7Z A;  1IGD A;  1ZP0 B;  4YSY B;  4JPS A;  4D2K A;  1V1P B;  1XCQ L;  5G5H A;  2WS3 B;  2RDH A;  1B1Z A;  2WXH A;  3B2G A;  1AYF A;  2KAC A;  3Q8B A;  1PYW D;  4WIP A;  1TS3 A;  1MPE A;  1C4A A;  3P42 A;  3AE4 B;  1XLP A;  2KWD A;  1QOG A;  5BMI A;  4ZRQ A;  2H88 B;  5LNK 1;  1FRD A;  1SE2 A;  2V0G A;  3EA6 A;  4RCO A;  2K22 A;  3I57 A;  4WQM A;  4WWM A;  3N9Y C;  2WXL A;  1EU3 A;  2I2Y A;  3BVM A;  3EGR A;  1D5M C;  1D6E C;  3AE7 B;  3BK1 A;  1HEZ E;  1KH0 A;  4REZ A;  2WXF A;  4C56 C;  1KTK A;  2LJI A;  1MVK A;  3SR6 A;  4YXD B;  1WYG A;  3SFE B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...