1IGCA

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
b'AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
molecule tags Complex (antibody/binding protein)
source organism Mus musculus
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igcA00
1PGBA 5BMIA 2IGHA 2KDMA 2K0PA 1HEZE 2PTLA 1P7FA 4OZCA 4GLSC 1QKZA 1JMLA 2KQ4X 1MI0A 2IGGA 3FILB 1F2RC 1D4BA 5HFYA 2LHEA 4OZAA 2RMMA 1IBXA 1HZ6A 1UWXA 1K50A 2QSDA 2N9KA 1YNTE 2RPVA 5HHDG 4HKZE 2N7JA 1FCCC 1MHXA 2ZW0A 4HJGE 2PLPA 2KACA 1XF5L 2QMTA 2J53A 2JZPA 2ONQA 3MP9A 4OZBA 2I2YA 4KGRA 1XCTL 1IBXB 2ON8A 2IGDA 4MACA 2GB1A 1HZ5A 3V3XA 1PGXA 2JSVX 1YMHE 2JWUA 2N9LA 3UI3A 2KWDA 1PGAA 1XCQL 2EELA 1F2RI 3GB1A 4D2KA 2PW9A 2NMQA 1MHHE 1P7EA 2LUMA 2JU6X 1C9FA 2GI9A 5BMGA 2JXTA 1ZXHA 5BMHA 2I38A 2KN4A 1GB1A 1K53A 1FD6A 2LGIA 1FCLA 1K51A 2LHDA 1KH0A 1IGCA 5HG2A 5HI1A 1Q10A 4KGSA 4IKGA 4KGTA 4IOIE 1MPEA 2ZW1A 4WH4A 5JXVA 2OEDA 1GB4A 1IGDA 1MVKA 3FILA 2J52A 1K52A 1EM7A
chains in the Genus database with same CATH superfamily
3UQAA 2IGHA 2PE6B 1PQSA 4L2YA 4A6QA 1J7AA 3U7ZA 4LCDE 4M8NA 4FXCA 5HFYA 2W82A 1C79A 2L1AA 1Q0WB 1HZ6A 3PO0A 1XLQA 2FCMA 1FNWA 4JWUC 2KQ7A 2V4LA 1YX5B 4I6NB 2LD9A 4P1CC 3RNCC 4MH0E 5IKCM 5IOIA 1TS2A 4YSZB 5LNK1 4LNIA 1WZ3A 1RRBA 4ZHPA 2QCZA 1RWSA 3NVYA 2XNAC 1OGWA 4B0MA 1WX8A 3MP9A 2EKEC 3Q8CA 3VRAB 3PZDA 1XCTL 1CJEA 4LNKA 2GB1A 3DCGA 2FIDA 1JROA 4G11A 4US9A 1XEEA 4OVZA 1EWYC 3UI3A 3BVMA 2KMMA 4LJPB 2G3QB 1RAXA 2L05A 4WWOA 5CHWA 4DQOC 2K6QA 1D5MC 1WJ4A 3IT6B 1E8XA 2NMQA 3ZXVA 4MM3A 3DBHI 3L10B 3ZDTA 1ROEA 3VUXA 5DCNA 4B9KA 2BTEA 2JXTA 3H7SA 2I1KA 4K7UA 3UGBB 1QOAA 1ET6A 1KFYB 2RPQA 4F7ZA 4REZA 3BK1A 3W9CB 1J7CA 1WX9A 4GN1A 1S3SG 3CSTA 2DWQA 4ZRPA 4HPLB 1TS4A 4YTNB 5LLIA 1ESFA 1GG3A 3A1QA 1V49A 1I42A 1Y8RC 4NJ6A 4W9GA 2E6XA 4II2B 1TY2A 5L83A 4DXFA 2LVQA 3UQBA 5C2TB 2V0GA 4PYUA 1WY8A 3ALBA 3SR6A 3A4RA 5CTRC 3ZJVA 2IYDB 5HKHA 1HE8A 1K50A 4RGMA 1F52A 1WGKA 2KVRA 1R4NB 3RZFA 1JCKB 1HXYD 1E7VA 1AW7A 3RZWC 2HE7A 2QJLA 2JZZA 1JWUD 3NS8A 3QC8B 4GDLB 3NHEB 4A3PA 3RFZB 3ZTCA 2GRIA 3DBLI 2VRRB 1NENB 1VR9A 3GZNI 1T0SC 2LRWA 1XCQL 3BVZA 1D6EC 3ETRA 2J7QB 5IN7A 2KWVB 2FIFA 3AM9A 3N30A 4IC7B 4ANWA 1WXQA 1E7PB 1TJEA 3W1SC 2FE8A 2JX5A 2JQRB 3DDCB 2D2QA 5C1ZA 1C9FA 1T0RC 4YSYB 3RN9C 4FULA 4MELA 3IFWB 3DHGC 1XLOA 3AXCA 1K8RB 2JXXA 4LK0M 4LNNA 1V5TA 1WXMA 4M00A 3TEWA 4BVUC 4JIOU 4JWSC 4WQMA 2PKOA 2ZVNA 4XZ4A 3AEFB 1E9MA 2FNJB 3DBLB 2OHFA 2WXLA 4DHZB 3VQIA 2G4SA 4PS8A 4ZRKA 1JWBD 3ENEA 3E56A 4GSWA 2V9HA 3P1MA 3B08A 4KZCA 2KJ6A 2K5PA 4RM8A 4WWMA 1L4DB 4HCPB 2DHZA 1UBIA 3TL5A 2N9PC 1WE7A 3Q8FA 2KC2A 4CHKA 4BOSC 2N7JA 2LXAA 2C5LC 4MT5A 2I1JA 2L0FA 1UBQA 1J7BA 1UUPA 1ZDVA 1GC6A 4RGTA 5D7GA 2ONQA 4B6WA 2FUG1 4BKTA 4HEA1 3C19A 2V3PA 2GMIC 3SHQA 3U52E 4W9IA 2O6VA 1WGDA 2MBOA 3V3XA 2JSVX 2K9XA 1WYGA 2JWUA 4PYZA 2J42A 1YN4A 3AULA 4MSQB 1ZOYB 1L0XB 4NJCA 3EC8A 1D5ZC 3AB5A 3N3KB 2PMVA 4FA6A 3IVFA 3A4SC 3ECIA 3Q3JA 2KJRA 4LJOB 1R7SA 2AYOB 4MSMB 2WX1A 2MH7A 4A55A 3L16A 2KK8A 3JW0X 2L3ZA 2RGFA 2BVCA 3ML9A 3QCAA 2Z0DB 3EA6A 3UF8A 1OQQA 2N7DA 1J8CA 2IJ0A 4KGSA 3MHZA 1HQRD 3HK0A 2WLBA 4IG7B 3EFCA 4ZRIA 3KUCB 2PVGC 3KYDD 4BOZB 1MVKA 2UU7A 1Z2MA 4HLEA 1ZW7A 2A5UA 3VUYA 3R8BA 1OTRB 1WR1A 4GDKB 4M8MA 3D32A 2MA9B 3FILB 1OFFA 3AU5A 2QSDA 2IY0B 1V81A 4A8XC 4DDID 3IAM1 3MJWA 1C4CA 2RPVA 3AE5B 3N1XC 5H8YE 3X23A 4NY0A 2D10A 1XLNA 2AL6A 4XGAB 3HHMA 4JGHB 2WXFA 3URYA 3PGEA 1DOXA 3EFUA 3JSVA 1HZ5A 2SEBD 1KLUD 1WWTA 1TT5B 1FO4A 3U8ZA 2MBQA 3CIRB 3PRMB 1RM6C 3NS1A 4LLGM 1STEA 3BYTB 3AECB 1GNUA 2JF5A 1TBEA 4P6VF 3N20C 4ICVA 2CJNA 1NBFC 2WQYB 1FM0D 1N62A 2J4XA 2QC8A 2JU6X 2PEAA 5AUIA 4FADA 2KDBA 3HUIA 5LXIB 3AE1B 4I6LB 2C9WB 2KLCA 3CSFA 3BIID 4E3CA 1KH0A 5EE1A 3EHVA 3I63C 4HDOA 1LM8B 3RULA 2PIAA 4RGOS 1I7HA 3AN1A 2Y5BB 4YTMB 3AEEB 1VDVA 2N9EB 3ML8A 2JY6A 2ICIA 3QAQA 3V05A 2JT4B 4AOFA 2B76B 4MJSA 2ZCCA 2LXCA 2J0JA 4IDIA 4HROA 2WXGA 3CF6E 4NNJB 3IXSA 2UWQA 3TUOA 3AE2B 2AQ2B 1MG4A 3R2IA 2M4NA 1VCBA 2KWUB 1I4QA 4KVGB 4KKJA 4I6PA 2FCQA 3LB8C 1JALA 1MJDA 2ZPYA 4BKGA 4YSXB 2DLBA 1GPXA 3LYYA 2LMCA 3ZNZB 3AI5A 4GDLA 1SE4A 2DZMA 1LO5D 4HKZE 1SF0A 3P4PB 1VJKA 3ABVB 1TS3A 4KSLC 2KT7A 4B95A 2XEWA 4S17A 2FUHB 3KLSX 3QK0A 3RD2A 4C7YA 3MTNB 4FHKA 3PT2B 2HTHA 2KWCA 1Z5SB 1ZKHA 2PJHA 2VH1A 3PV1A 2FCNA 4M01A 4FJVB 1V80A 3PLVA 2NCNA 4GB9A 2DNFA 3VUWA 1KJTA 5AZGA 3AE3B 2IO0B 1QZEA 4ZHOA 3T3OA 3P63A 4IW0A 1JQ4A 3JSVB 1T0QC 1H8CA 3CWIA 2KNBA 2KANA 3P4SB 1UH6A 2WS3B 2RDGA 4OVUA 4BFRA 2X8XX 2EMSA 2L76A 3H8HA 3VFKA 5I4DA 4FJZA 3ZYYX 4JQWC 2BYEA 5E6NA 2D3BA 2INPE 4EZJA 1NI2A 1XT9B 5AUKA 4KIKA 1P9DU 3V6CB 1MFWA 2XK5A 3CMMB 2MBEA 3R3MA 4XC2A 3HM6X 1VZ8A 4YWGG 4RM9A 3UIPB 3VR8B 5BO4B 4WJQA 3U7DA 3OJ4B 2NR2A 1YJIA 1WF9A 4HDQA 3K9PB 2JRIB 3NJTA 1WJNA 2GOWA 3AEDB 2MBBB 3Q3FA 2WXOA 1YNTE 2RDBC 5EE9A 3PRPB 2QIEB 4DXAB 3PPAA 1F1HA 4HJGE 2NS5A 2OJWA 2WXRA 3DVGX 3E9SA 3RNBC 1E5WA 4X57B 1TIFA 1WGGA 1YJ1A 2MRPA 3B9JA 4F1SA 3DWGC 4OZBA 4AWJA 2WNMA 2G1EA 3GZNB 4ZRQA 2MP2A 1XO3A 2BQQA 1FIQA 1HTOA 1TGZB 5J18A 1FMAD 2BT6A 3ZW3A 2JVCA 1EF5A 1H4RA 2L32A 3A9KB 2AL3A 1V2YA 3QJZA 2D3AA 5G5GA 3J9CA 3BK2A 4M0WB 1IP9A 1B1ZA 2WDVB 5JH5C 1I4XA 1UNSA 1OQRA 1AYFA 1K51A 2LHDA 2K8HA 2GBJA 3KUZA 3RNFC 3T9LA 1I4PA 3B2GA 3PZ7A 2YEPF 3DPDA 1QOFA 3VDZA 3HIZA 1V8CA 4W9HA 1IGDA 3WAPA 2JYEA 2DX5B 1VZ6A 1SE2A 1SIJA 2KFKB 4Q2JA 1QKZA 3T8MA 4WIPA 1NI3A 3NVVA 3LDZE 4G0NB 2C60A 1FRRA 1NVID 3W2DA 2O6VB 3DQVA 4TQ0A 2PE9A 2RMMA 1M94A 5JHAA 3TJPA 2N9KA 4EZKA 4ZRJA 4DWFA 3APCA 2NPTA 2AX5A 2M56B 3QX1A 4ICUA 1MHXA 2KMAA 4KZ0A 2GBMA 2J53A 1DGJA 4WAFA 2JPHA 4P7IA 4DHJB 1FEHA 3UINB 4EKUA 2DENB 3DHIC 3PRZA 3HVZA 3QIJA 3RMKC 4TKNA 2AQ1B 4RCOA 4K1RB 2CU1A 4DDGD 2KTRA 1C4PA 1V5OA 1N60A 2LZ6A 1T5XD 1G6JA 4MJSB 1UGMA 3TEZA 1TYGB 2MQJA 1I4HA 5CHFA 1WJ6A 5JZEB 4BBNC 1IPGA 3IT4B 2L83A 2WXNA 4S0RA 4L23A 2INCC 1SBBB 4MEMA 3B0AA 2V4IB 5IAAC 1YD8U 2KZRA 2L0TA 2FAZA 1EU3A 3MC0B 3ZXRA 2LGXA 4W9CA 1NYRA 3WAMA 1YQ3B 3BYYB 2ZW1A 3L54A 4DK5A 2WGSA 2LGYA 4EZLA 1WMHA 2CR5A 1ZXIA 3WA0A 2CS4A 3PHWB 1F0ZA 3DBRI 2DBYA 5FR6A 1MG8A 3BZDB 1SIFA 2REXA 3GE3C 4C80A 2JUOA 3Q3MC 4DXGA 2LGSA 2MCNB 1MI0A 3FKYA 4XX5A 4ASWC 1V97A 4IWPA 1Q5WB 3PZ8A 2AQ3B 3HM3A 3U4EG 1OEYJ 2K1FA 1UELA 4TV3A 3N9YC 1V9JA 3P2BA 2KHWB 1OQYA 4FLHA 3Q8AA 3DBHB 2MBHA 3MHSD 4URKA 3K9OB 2IDYA 3Q6BA 4AP4C 2NPTB 5D3DA 4MACA 1CZPA 1QQRA 2WXQA 3RPFC 2ZVOA 1TKEA 1PGXA 3H9DA 2AEHA 2PVOD 2M19A 2WXIA 2O2VA 2ZJDA 2W3SA 4OW0A 2G9HD 1TKYA 4E74A 4EOYA 2Q5WD 4R3DA 5H92C 4K7SA 2WU5B 3VXWA 4HCNB 2GI9A 1LFDA 4C00A 2LASA 5BMHA 1C4AA 4NQLB 2I38A 1IYFA 3VHTC 3ZNID 2D11A 1F9JA 3APFA 2QEJC 1KTKA 4ARCA 1P0RA 2MEKA 4ZYNA 2KTRB 2MJDA 2MLBA 2JYTA 3RNEC 1GAQB 2G4DB 2BS2B 2KTFA 1K52A 4UDUC 4H2AA 1E10A 3RNAC 4ZDVA 1ENFA 4US8A 4NJ7A 2X38A 1JMLA 1CK1A 3ZIMA 5C23A 2KJHB 2Z59B 1E8ZA 3KWVA 2Y5PA 3R2TA 2LHEA 3IBEA 2IO3B 2GLSA 4KV2A 1GUAB 2MSED 1IBXA 3KQ4A 3M3JA 1AARA 5IA7A 1SEBD 4G3XB 1JWAD 2IPKD 1FCCC 3I57A 2XN9C 4MGIE 2MW5A 1XQQA 1N6ZA 2K22A 4C4VA 1T0YA 2DYOA 4EE2A 4L1BA 2I2YA 3VRBB 1IBXB 2O6VD 3NRZA 1KF6B 4RNAA 2DAJA 4N58A 5JHBA 1LGRA 1WM2A 3ZKJC 2DZJA 1E6EB 4MH8A 2BYVE 3NZUA 4EUTA 3I3TB 2LI5A 5LXHA 2WDRB 2HJ1A 3DVNU 4C7ZA 1F77A 4E71A 1P7EA 2NBUA 2XK5B 3AU4A 4KIKB 3DBSA 1BXTA 4A90A 2ZCBA 1L2NA 1V6EA 1FD6A 1GOZA 3AE8B 4HPPA 1D5XC 1WGHA 4OHJA 1SSNA 3MC9A 4W9EA 3TEYA 1X1MA 1RLFA 1XXGA 2MHJA 3TSSA 4IOIE 4KDIC 5JXVA 1R4MI 2NBWB 4CYEA 2WHIA 2BWFA 3NUHB 2J52A 1S1QB 3ZUNA 2UYZB 3W5VB 1C1YB 2BB5A 4J6IA 2EKIA 3AH7A 2LUEA 2L8JA 4N9F4 2N0SB 2YEPB 1HTQA 3SFEB 3JVZX 3AMZA 1C3TA 1L7YA 4MM3B 1YIWA 2XBBC 4ACFA 4LNFA 4AJYB 2ZW0A 3P4RB 2FBWB 1VLBA 1ZP0B 2DZIA 4WURA 1E0ZA 1CMXB 2JRHA 3RCZA 1BUIC 3Q8EA 1ZUD2 2KFJA 3ZO5B 2KLGA 3H1UA 5D94A 3RNGC 4XDCA 5BYQA 1UZXB 2BYFA 4ZYSA 1YMHE 3TMPB 2RSUA 4K81A 5L95C 3W5UB 1FPYA 2KN5A 3GB1A 5TR5A 2WP9B 3EECA 4RF0A 4C56C 4NAWB 4M02A 2JWZA 1WGRA 2L00B 3I5JC 2CHZA 3ZVVA 3NG0A 2N1WA 3NVWA 1UD7A 3RT3B 2CKHB 1I4RA 1JRUA 4BBNF 4N6EB 2KVZA 4HRSA 1QT9A 1L5PA 2EMTA 5HG2A 1SJED 5HI1A 1WGYA 3AE4B 3TCAA 4YT0B 3L13A 3NZ3A 1FXAA 4BAXA 1E7UA 4DHZE 4YTPB 4LNOA 1GB4A 3L4PA 1UWMA 2DZKA 2DYMA 1WRIA 2CU3A 2K0PA 1QOBA 2LGDA 4OZCA 2YLMA 3GE8C 3SU8X 3N1ZC 3VTWA 3RYTA 2W9NA 1XD3B 3GS2A 4XE0A 3VAWA 1F2RC 1PYWD 4FJYA 2KDEB 4QAYA 3MFGA 4XWWA 1VZ7A 3N1YC 1SE3A 5CHVC 3Q8BA 4IM3A 3BWUD 1JWMD 4HXDA 4G50A 2PLPA 4A3OA 4JL9A 2K8BA 1YN3A 3C8YA 3WIMA 5E6JA 4RMAA 3PS6A 3FC4A 2BPSA 4IUMB 2KC1A 1KRHA 1NYQA 2N1VA 3ZNHB 4HKQA 2WDTB 2J0KA 4GXBA 3KYCD 2GBKA 2N9LA 1R4MB 3L17A 2K8CA 3BY4B 1NEKB 3SEBA 1PGAA 2H89B 3Q14C 4D2KA 3ZJTA 1L0YB 3PVLA 1P1AA 1WIAA 2MX2A 3BINA 1FFVA 2GBNA 1WJUA 1EO6A 3KWLA 1V1OA 1YN5A 4M0WA 1QF6A 2M0AA 2W3RA 1Y56A 2KN4A 3Q2AC 3V60A 4PS7A 1L4ZB 2ASQA 1E8YA 2C7HA 1YQBA 4NAWA 1V1PB 2BKFA 2ACZB 2R2QA 1E90A 4WQOB 1WMHB 1OEYA 4W9LA 2PPHA 3A33B 2K25A 1EM7A 1PGBA 5BMIA 4GU2A 4MGYE 1HEZE 2KX3A 1L6UA 4KX6B 4ANXA 5G5HA 2D3GA 1WH3A 1KOTA 4BKSA 4C4VB 3TIXA 4W9DA 3P42A 1UGJA 1EU4A 1N63A 2ZNVC 2FCSA 3GOEA 2R61A 4HK2A 4EEWA 2L7RA 3NVZA 3BVGA 2NBVB 4ANUA 3OWEB 3X0WA 3I9V1 5MPOA 3KW5B 2M17A 2K39A 3SDLC 5IO9A 1B9RA 3L0WB 2N9XA 2M1MA 2NTTA 2MP2B 3AEGB 1ZGUB 1WXAA 1P3QU 3H7PA 1ACCA 3H7PB 4WJOA 5E6OA 2IGDA 1WXSA 4KKIA 1WFYA 4JPSA 4N59A 1WRDB 4TMAB 2BS4B 3PREA 2QILA 3A9JB 4FHJA 2N4FA 1JRPA 2LEKA 3AEAB 2IBIB 4NQKE 4RH6A 3RI7C 3H6NA 3OJ3A 2BKRB 2BS3B 2KX0A 4K7WA 2LJIA 1HA5A 1YX6B 1QOGA 1SE9A 5J17A 1GB1A 4HWIB 2V1YA 4A9AA 4JLCA 2LVPA 1AN8A 3NOBA 5C3JB 4PK1A 3Q3NC 1ET9A 3A1QB 1RFKA 4WH4A 2RDHA 5E6PA 2VH2A 2IO1B 5FKAC 4XYCA 2KMCA 3PSEB 4ARIA 1WSPA 4P16A 3PTFC 1TY0A 1P7FA 4AJWA 4GLSC 4IWOA 1E8WA 1WM3A 2KQ4X 2TSSA 5DPTA 3ZLZA 4II3B 1WR6E 3QARA 2IGGA 1PUTA 1JWSD 1FNVA 4YXDB 1SB3C 2NTSA 3IG3A 2B3AA 3ZQ4A 1WYWB 5HHDG 4GMVA 1YOVB 5KHQA 3W1YA 4KDLB 2H88B 4LDTD 5DPSA 2KACA 1I4GA 2WYQA 3Q3OC 2QDFA 3DOWA 2KDIA 5EDSA 3WAOA 1T6BX 3V6EB 2WXHA 3ZDMC 2HD5B 4RF1A 1WE6A 4AUQC 2D3CA 5DPWA 3OLMD 1YQ4B 1I35A 2LRUA 5DPRA 1FXIA 1XLPA 4XWTA 3MC8A 1FNUA 3O13A 2MWSB 4AQ7A 1UF0A 2KD0A 5BYRA 2LFIA 3ZRCA 4P1BC 2Z8LA 3ZRFA 1V86A 2G45B 2GBRA 2LGIA 4GOCA 1EWCA 3ZJUA 2WXJA 5D2MB 1BT0A 1IGCA 1Q10A 1BMLC 2ZEQA 2A4ZA 4CO7A 2Y3AA 2WXPA 2BYTA 3NY5A 4MDKE 1P98A 2D07B 3NZSA 5EE0A 3KUDB 3L08A 4WWNA 3WALA 3ZGZA 3ZNGC 3VH4B 1J19A 3EGRA 5AZFA 4NPNA 2M0XA 5CX3A 4NAMA 5G2NA 1L6VA 4DBGA 2RR9A 3VTVA 4AS1A 2K3UA 4JE3B 4TUUA 1SGHA 4BKSD 1U4AA 1KM7A 3GP7A 1FRDA 1GC7A 2Y5CA 3S2AA 2J0MA 3PHXB 3DVGY 3WCQA 1A70A 4LDTB 1N61A 3VH3B 3U2SC 3SFDB 3TEXA 2KFKA 3R7RA 4WJPA 1N5WA 2MJ3A 2Z0EB 5BYSA 2N7EA 3EUB2 5GMVA 3AE7B 1WXVA 4MGZE 2PW9A 3WANA 3MJ5A 3APDA 1TS5A 4W9FA 2WU2B 1YJJA 1TZ1A 5BMGA 3DHHC 3DWMA 1D3ZA 2KXJA 2ZZPB 4FBJB 2CHXA 4PS3A 4WWPA 1LXDA 4JX1C 3VVWB 1EF1A 4HJKA 2OJRA 2HDEA 4F8CB 3M95A 4KGTA 3OAWA 4IWQA 5AEKB 2WX0A 4J3OD 4ZOHC 1WI0A 4HPMB 2OEDA 5J2RA 3FILA 3RUIB 2KQSA 1NDDA 3B2FA 1TKGA 2M8SA 1WX7A 2PTLA 2SAKA 5AZHA 1T3QA 1CQVA 1D4BA 4O1NA 1DOYA 3QHTA 2V3SA 1GJZA 2DAFA 2MJEA 5FK9C 1UWXA 2W55A 3R7QA 4ANVA 2CJOA 2IY1B 3T3NA 2WWZA 1N5XA 4GGQA 2HJ8A 2CHWA 3QA8A 2QMTA 2BB6A 2QHOA 1ZE3D 4GDKA 1QLBB 4KGRA 3VTUA 2INNE 2ON8A 2INDC 1Q1OA 3VR9B 3LXFA 1PDXA 3HVDA 4RFBA 2C7MB 2D5GA 1ZDXA 1R4NI 1ZPSA 1VRAB 3KVFB 3A9KA 4XDDA 1F2RI 3ZTDA 3ONSA 1C77A 5IP4D 2VZKB 1MHHE 4PT5A 2LUMA 2NVUI 2VZKD 2E3TA 2JZ3B 3DVNV 3LJ3A 3M63B 1VD2A 1C76A 1ZXHA 3V62A 1FXTB 1PFDA 4LTUA 1K53A 4FN2A 5G55A 3V61A 3AEBB 4A20A 2BW2A 3DBRB 5EE3A 3QQ8B 3FAHA 2KYWA 4USAA 5TSSA 3AE9B 3P4QB 1MPEA 3IHPC 3R66C 2KDMA 2YVCA 3SD5A 4NZLB 2ZNVB 4GIVA 3OG5A 5D3IB 3UIOB 2KOXA 1DYQA 2K6DB 2L52A 4RGNA 3IAS1 4DHJD 2IO2B 1WZ0A 1DOIA 1QILA 4OZAA 3N32A 2WDQB 1RYJA 3O65B 4HVBA 2IZVB 3AV8A 4WJNA 3HRDD 2OOBB 2AWTA 2BBCA 4K3BA 1RFAA 2HTME 2O2VB 1KLGD 3C0RB 4K3CA 4KSKC 1SJHD 2BF8B 4MGKE 2KKCA 4YL8A 3M62B 1XF5L 5FR3A 2V3NA 2JZPA 5D6JB 3B1LX 2LJ5A 1EUVB 3PLUA 2LWPA 1KLVA 1TZOA 4EFOA 2R2OA 3JYUA 2KAJA 4B0EA 4IM2A 2KWDA 3A9JA 3AE6B 1FFUA 1J0GA 1IUEA 2EELA 2BWES 1AWDA 3TBLD 1C78A 1A5RA 4TSSA 4W9JA 5GXGB 2LVOA 5T8IA 4BZAA 2KDFB 1LQBA 3W1SA 2WXKA 1ISNA 2BGFA 1L0VB 3Q69A 4WAAA 5KHOA 1FCLA 2KO3A 1V1PA 4TQ1A 4IM0A 2RD0A 4W9KA 4CQNA 3QWZB 4IKGA 1JW9D 3U30A 2ZPNA 2WXMA 2C7NB 2W54A 1M4VA 4OVVA 1SXTA 4ITKA 1TTNA 2DYBA 3KH0A
chains in the Genus database with same CATH topology
4H2AA 1E10A 2WXGA 2IGHA 4ARIA 1WSPA 3IXSA 4P16A 4L2YA 1ENFA 4A6QA 1TY0A 3TUOA 1P7FA 4US8A 4GLSC 3AE2B 1J7AA 2AQ2B 3R2IA 2X38A 3U7ZA 1JMLA 1CK1A 1I4QA 2KQ4X 2TSSA 4KKJA 2IGGA 3LB8C 1PUTA 1JALA 3KWVA 2Y5PA 1JWSD 3R2TA 2LHEA 4FXCA 5HFYA 2W82A 1C79A 1FNVA 2L1AA 4YSXB 1IBXA 2DLBA 4YXDB 1HZ6A 3KQ4A 2LMCA 1SB3C 1XLQA 2NTSA 3LYYA 3PO0A 1FNWA 4JWUC 1SE4A 1SEBD 3ZQ4A 5HHDG 1LO5D 4HKZE 1SF0A 1JWAD 2IPKD 3P4PB 1FCCC 3I57A 1VJKA 2XN9C 3ABVB 1TS3A 2H88B 1TS2A 4YSZB 5LNK1 2KACA 1I4GA 4ZHPA 1RWSA 3NVYA 2XNAC 4B0MA 2K22A 3KLSX 2DYOA 3MP9A 4EE2A 4L1BA 3Q8CA 3VRAB 2I2YA 3VRBB 1XCTL 1IBXB 3NRZA 1KF6B 1T6BX 4RNAA 4C7YA 1CJEA 2WXHA 2GB1A 1JROA 4N58A 4US9A 1XEEA 4RF1A 4OVZA 1EWYC 3UI3A 1E6EB 4MH8A 3BVMA 2KMMA 1YQ4B 4DQOC 1FXIA 1XLPA 1D5MC 4XWTA 3IT6B 2WDRB 2NMQA 4C7ZA 1F77A 3AE3B 1FNUA 4ZHOA 3T3OA 3P63A 1P7EA 3O13A 1ROEA 1JQ4A 4AQ7A 2BTEA 3CWIA 3P4SB 5BYRA 2LFIA 2WS3B 1BXTA 2JXTA 4A90A 2Z8LA 2RDGA 1FD6A 1GOZA 1QOAA 2LGIA 3AE8B 1EWCA 1ET6A 3ZJUA 2WXJA 1D5XC 3H8HA 4OHJA 1KFYB 1SSNA 1IGCA 5I4DA 3TEYA 3ZYYX 1Q10A 1BMLC 1XXGA 4REZA 3TSSA 4IOIE 2Y3AA 2INPE 3BK1A 3W9CB 1J7CA 5JXVA 2WXPA 5AUKA 2BYTA 3NUHB 5EE0A 2DWQA 2J52A 4ZRPA 1TS4A 4YTNB 1ESFA 3W5VB 3ZGZA 1VZ8A 4YWGG 2BB5A 2E6XA 1TY2A 2EKIA 3VR8B 3AH7A 4DXFA 3EGRA 5C2TB 2V0GA 2N0SB 2YEPB 3SFEB 3SR6A 1YJIA 4NAMA 3ZJVA 3AMZA 1L6VA 3AEDB 1K50A 2WXOA 4AS1A 4RGMA 2K3UA 4JE3B 1YNTE 4MM3B 5EE9A 3GP7A 1WGKA 1FRDA 2QIEB 2Y5CA 2ZW0A 4HJGE 3P4RB 1JCKB 2FBWB 2WXRA 3E9SA 1HXYD 1VLBA 1ZP0B 1AW7A 3WCQA 4WURA 1A70A 1E0ZA 2QJLA 1N61A 3B9JA 1BUIC 1JWUD 1ZUD2 3Q8EA 3SFDB 3U2SC 4GDLB 3DWGC 4OZBA 3TEXA 3RFZB 4XDCA 5BYQA 2GRIA 2WNMA 2G1EA 1N5WA 1NENB 2MJ3A 1YMHE 4ZRQA 1VR9A 4ZYSA 5BYSA 1XO3A 3EUB2 1XCQL 1FIQA 3BVZA 1D6EC 3W5UB 3ETRA 3AE7B 3GB1A 2WP9B 1FMAD 2PW9A 3AM9A 2BT6A 3MJ5A 4RF0A 1TS5A 2WU2B 1YJJA 1WXQA 4C56C 4NAWB 1E7PB 1TJEA 2L32A 2FE8A 2JX5A 2JQRB 1C9FA 3NVWA 5BMGA 4YSYB 1I4RA 3DWMA 5G5GA 4N6EB 3J9CA 3BK2A 1B1ZA 2WDVB 4HRSA 1I4XA 1OQRA 1QT9A 1AYFA 1UNSA 1XLOA 1K51A 1L5PA 2LHDA 4JX1C 4LK0M 1I4PA 3B2GA 5HG2A 1SJED 2HDEA 5HI1A 3AE4B 4KGTA 3PZ7A 4YT0B 3NZ3A 1FXAA 2YEPF 4J3OD 1QOFA 4ZOHC 4JWSC 4WQMA 2OEDA 4YTPB 2PKOA 1V8CA 1GB4A 3L4PA 1IGDA 3AEFB 1E9MA 1UWMA 3FILA 2OHFA 2DYMA 2WXLA 2JYEA 3B2FA 3VQIA 1TKGA 1WRIA 2CU3A 2K0PA 1VZ6A 1QOBA 1SE2A 2PTLA 1SIJA 4OZCA 2SAKA 1JWBD 3E56A 4Q2JA 1QKZA 1T3QA 1CQVA 3GS2A 3P1MA 4XE0A 4WIPA 1NI3A 3NVVA 2K5PA 1F2RC 4WWMA 1D4BA 1L4DB 1FRRA 1PYWD 4O1NA 1NVID 3W2DA 1DOYA 4TQ0A 3MFGA 2RMMA 4XWWA 1VZ7A 2MJEA 1SE3A 5FK9C 1UWXA 3Q8BA 3BWUD 3Q8FA 2W55A 2N9KA 1JWMD 2N7JA 2CJOA 2AX5A 2M56B 3T3NA 1MHXA 4MT5A 2PLPA 1N5XA 1J7BA 1YN3A 2QMTA 3C8YA 1UUPA 1ZDVA 2J53A 1DGJA 2BB6A 4WAFA 4RGTA 5D7GA 2ONQA 1ZE3D 5E6JA 1FEHA 2FUG1 1QLBB 3FC4A 4HEA1 4KGRA 2V3PA 3U52E 3HVZA 2INNE 2ON8A 3VR9B 3LXFA 3V3XA 1PDXA 3HVDA 1KRHA 1NYQA 4RFBA 4HKQA 2JSVX 2K9XA 2D5GA 2N9LA 1WYGA 2JWUA 2J42A 1YN4A 1ZDXA 1ZOYB 2AQ1B 1NEKB 4RCOA 3SEBA 1L0XB 1PGAA 1ZPSA 1VRAB 4NJCA 2H89B 4XDDA 1D5ZC 1F2RI 3AB5A 1C4PA 4D2KA 2PMVA 3ZJTA 1L0YB 1C77A 1N60A 1T5XD 1FFVA 2VZKB 1R7SA 1MHHE 4PT5A 2LUMA 3TEZA 1TYGB 3KWLA 1V1OA 2VZKD 1YN5A 2E3TA 1I4HA 4M0WA 3IT4B 2MH7A 1C76A 1ZXHA 2L83A 4A55A 1QF6A 2M0AA 2W3RA 2WXNA 1Y56A 2KN4A 1PFDA 4LTUA 1K53A 4L23A 1L4ZB 1SBBB 3AEBB 3EA6A 2BW2A 2V4IB 1OQQA 5EE3A 3FAHA 2IJ0A 1V1PB 4KGSA 3MHZA 1EU3A 2ACZB 3MC0B 1HQRD 2WLBA 1NYRA 4USAA 5TSSA 1YQ3B 3BYYB 2ZW1A 2PVGC 1ZXIA 3AE9B 1MVKA 3P4QB 1MPEA 1EM7A 3R8BA 1PGBA 5BMIA 1F0ZA 2DBYA 2KDMA 1HEZE 3BZDB 4NZLB 1L6UA 4KX6B 5G5HA 5D3IB 4GDKB 4C80A 4DXGA 1DYQA 1GPXA 1MI0A 2L52A 3FILB 3P42A 4RGNA 1OFFA 3IAS1 1UGJA 1V97A 1EU4A 1N63A 1DOIA 1QILA 4OZAA 2R61A 3PZ8A 2AQ3B 2WDQB 2QSDA 3BVGA 3NVZA 3U4EG 1RYJA 3OWEB 4A8XC 3IAM1 3I9V1 5MPOA 1C4CA 2RPVA 3AE5B 3AV8A 3N9YC 3HRDD 3TEWA 2BBCA 2HTME 5H8YE 1KLGD 1B9RA 1XLNA 3Q8AA 1SJHD 2NTTA 1XF5L 2IDYA 5FR3A 3AEGB 2WXFA 3URYA 2V3NA 2JZPA 1DOXA 1ACCA 5D3DA 2IGDA 4MACA 4KKIA 1CZPA 1HZ5A 1QQRA 2SEBD 2WXQA 3RPFC 1TZOA 1TKEA 1PGXA 1KLUD 1WWTA 4JPSA 1FO4A 2PVOD 4N59A 2KAJA 4B0EA 4TMAB 2BS4B 2KWDA 3CIRB 1RM6C 3AE6B 1FFUA 2QILA 3NS1A 4LLGM 2M19A 1STEA 3BYTB 2WXIA 3AECB 1IUEA 2EELA 1AWDA 1JRPA 2LEKA 2W3SA 3AEAB 4OW0A 4P6VF 1C78A 1TKYA 2G9HD 2CJNA 2Q5WD 4RH6A 4TSSA 2BS3B 5GXGB 2WQYB 1FM0D 1N62A 5T8IA 2LJIA 2J4XA 1HA5A 4R3DA 5H92C 1QOGA 2JU6X 2WU5B 2GI9A 5AUIA 3W1SA 2WXKA 5BMHA 3HUIA 1C4AA 2I38A 1L0VB 3Q69A 1GB1A 3AE1B 1FCLA 1V1PA 4A9AA 4TQ1A 3BIID 1KH0A 1AN8A 2QEJC 5C3JB 4CQNA 1KTKA 5EE1A 1ET9A 4IKGA 4ARCA 1RFKA 2MEKA 2PIAA 1JW9D 1I7HA 3AN1A 4RGOS 4YTMB 1VDVA 2MJDA 3AEEB 2WXMA 2JYTA 4WH4A 2W54A 1GAQB 1M4VA 2ICIA 2RDHA 3V05A 5FKAC 2B76B 1SXTA 2BS2B 4ITKA 1K52A 4IDIA 4HROA 4UDUC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PGB A;  5BMI A;  2IGH A;  2KDM A;  2K0P A;  1HEZ E;  2PTL A;  1P7F A;  4OZC A;  4GLS C;  1QKZ A;  1JML A;  2KQ4 X;  1MI0 A;  2IGG A;  3FIL B;  1F2R C;  1D4B A;  5HFY A;  2LHE A;  4OZA A;  2RMM A;  1IBX A;  1HZ6 A;  1UWX A;  1K50 A;  2QSD A;  2N9K A;  1YNT E;  2RPV A;  5HHD G;  4HKZ E;  2N7J A;  1FCC C;  1MHX A;  2ZW0 A;  4HJG E;  2PLP A;  2KAC A;  1XF5 L;  2QMT A;  2J53 A;  2JZP A;  2ONQ A;  3MP9 A;  4OZB A;  2I2Y A;  4KGR A;  1XCT L;  1IBX B;  2ON8 A;  2IGD A;  4MAC A;  2GB1 A;  1HZ5 A;  3V3X A;  1PGX A;  2JSV X;  1YMH E;  2JWU A;  2N9L A;  3UI3 A;  2KWD A;  1PGA A;  1XCQ L;  2EEL A;  1F2R I;  3GB1 A;  4D2K A;  2PW9 A;  2NMQ A;  1MHH E;  1P7E A;  2LUM A;  2JU6 X;  1C9F A;  2GI9 A;  5BMG A;  2JXT A;  1ZXH A;  5BMH A;  2I38 A;  2KN4 A;  1GB1 A;  1K53 A;  1FD6 A;  2LGI A;  1FCL A;  1K51 A;  2LHD A;  1KH0 A;  1IGC A;  5HG2 A;  5HI1 A;  1Q10 A;  4KGS A;  4IKG A;  4KGT A;  4IOI E;  1MPE A;  2ZW1 A;  4WH4 A;  5JXV A;  2OED A;  1GB4 A;  1IGD A;  1MVK A;  3FIL A;  2J52 A;  1K52 A;  1EM7 A; 
#chains in the Genus database with same CATH topology
 3UQA A;  2IGH A;  2PE6 B;  1PQS A;  4L2Y A;  4A6Q A;  1J7A A;  3U7Z A;  4LCD E;  4M8N A;  4FXC A;  5HFY A;  2W82 A;  1C79 A;  2L1A A;  1Q0W B;  1HZ6 A;  3PO0 A;  1XLQ A;  2FCM A;  1FNW A;  4JWU C;  2KQ7 A;  2V4L A;  1YX5 B;  4I6N B;  2LD9 A;  4P1C C;  3RNC C;  4MH0 E;  5IKC M;  5IOI A;  1TS2 A;  4YSZ B;  5LNK 1;  4LNI A;  1WZ3 A;  1RRB A;  4ZHP A;  2QCZ A;  1RWS A;  3NVY A;  2XNA C;  1OGW A;  4B0M A;  1WX8 A;  3MP9 A;  2EKE C;  3Q8C A;  3VRA B;  3PZD A;  1XCT L;  1CJE A;  4LNK A;  2GB1 A;  3DCG A;  2FID A;  1JRO A;  4G11 A;  4US9 A;  1XEE A;  4OVZ A;  1EWY C;  3UI3 A;  3BVM A;  2KMM A;  4LJP B;  2G3Q B;  1RAX A;  2L05 A;  4WWO A;  5CHW A;  4DQO C;  2K6Q A;  1D5M C;  1WJ4 A;  3IT6 B;  1E8X A;  2NMQ A;  3ZXV A;  4MM3 A;  3DBH I;  3L10 B;  3ZDT A;  1ROE A;  3VUX A;  5DCN A;  4B9K A;  2BTE A;  2JXT A;  3H7S A;  2I1K A;  4K7U A;  3UGB B;  1QOA A;  1ET6 A;  1KFY B;  2RPQ A;  4F7Z A;  4REZ A;  3BK1 A;  3W9C B;  1J7C A;  1WX9 A;  4GN1 A;  1S3S G;  3CST A;  2DWQ A;  4ZRP A;  4HPL B;  1TS4 A;  4YTN B;  5LLI A;  1ESF A;  1GG3 A;  3A1Q A;  1V49 A;  1I42 A;  1Y8R C;  4NJ6 A;  4W9G A;  2E6X A;  4II2 B;  1TY2 A;  5L83 A;  4DXF A;  2LVQ A;  3UQB A;  5C2T B;  2V0G A;  4PYU A;  1WY8 A;  3ALB A;  3SR6 A;  3A4R A;  5CTR C;  3ZJV A;  2IYD B;  5HKH A;  1HE8 A;  1K50 A;  4RGM A;  1F52 A;  1WGK A;  2KVR A;  1R4N B;  3RZF A;  1JCK B;  1HXY D;  1E7V A;  1AW7 A;  3RZW C;  2HE7 A;  2QJL A;  2JZZ A;  1JWU D;  3NS8 A;  3QC8 B;  4GDL B;  3NHE B;  4A3P A;  3RFZ B;  3ZTC A;  2GRI A;  3DBL I;  2VRR B;  1NEN B;  1VR9 A;  3GZN I;  1T0S C;  2LRW A;  1XCQ L;  3BVZ A;  1D6E C;  3ETR A;  2J7Q B;  5IN7 A;  2KWV B;  2FIF A;  3AM9 A;  3N30 A;  4IC7 B;  4ANW A;  1WXQ A;  1E7P B;  1TJE A;  3W1S C;  2FE8 A;  2JX5 A;  2JQR B;  3DDC B;  2D2Q A;  5C1Z A;  1C9F A;  1T0R C;  4YSY B;  3RN9 C;  4FUL A;  4MEL A;  3IFW B;  3DHG C;  1XLO A;  3AXC A;  1K8R B;  2JXX A;  4LK0 M;  4LNN A;  1V5T A;  1WXM A;  4M00 A;  3TEW A;  4BVU C;  4JIO U;  4JWS C;  4WQM A;  2PKO A;  2ZVN A;  4XZ4 A;  3AEF B;  1E9M A;  2FNJ B;  3DBL B;  2OHF A;  2WXL A;  4DHZ B;  3VQI A;  2G4S A;  4PS8 A;  4ZRK A;  1JWB D;  3ENE A;  3E56 A;  4GSW A;  2V9H A;  3P1M A;  3B08 A;  4KZC A;  2KJ6 A;  2K5P A;  4RM8 A;  4WWM A;  1L4D B;  4HCP B;  2DHZ A;  1UBI A;  3TL5 A;  2N9P C;  1WE7 A;  3Q8F A;  2KC2 A;  4CHK A;  4BOS C;  2N7J A;  2LXA A;  2C5L C;  4MT5 A;  2I1J A;  2L0F A;  1UBQ A;  1J7B A;  1UUP A;  1ZDV A;  1GC6 A;  4RGT A;  5D7G A;  2ONQ A;  4B6W A;  2FUG 1;  4BKT A;  4HEA 1;  3C19 A;  2V3P A;  2GMI C;  3SHQ A;  3U52 E;  4W9I A;  2O6V A;  1WGD A;  2MBO A;  3V3X A;  2JSV X;  2K9X A;  1WYG A;  2JWU A;  4PYZ A;  2J42 A;  1YN4 A;  3AUL A;  4MSQ B;  1ZOY B;  1L0X B;  4NJC A;  3EC8 A;  1D5Z C;  3AB5 A;  3N3K B;  2PMV A;  4FA6 A;  3IVF A;  3A4S C;  3ECI A;  3Q3J A;  2KJR A;  4LJO B;  1R7S A;  2AYO B;  4MSM B;  2WX1 A;  2MH7 A;  4A55 A;  3L16 A;  2KK8 A;  3JW0 X;  2L3Z A;  2RGF A;  2BVC A;  3ML9 A;  3QCA A;  2Z0D B;  3EA6 A;  3UF8 A;  1OQQ A;  2N7D A;  1J8C A;  2IJ0 A;  4KGS A;  3MHZ A;  1HQR D;  3HK0 A;  2WLB A;  4IG7 B;  3EFC A;  4ZRI A;  3KUC B;  2PVG C;  3KYD D;  4BOZ B;  1MVK A;  2UU7 A;  1Z2M A;  4HLE A;  1ZW7 A;  2A5U A;  3VUY A;  3R8B A;  1OTR B;  1WR1 A;  4GDK B;  4M8M A;  3D32 A;  2MA9 B;  3FIL B;  1OFF A;  3AU5 A;  2QSD A;  2IY0 B;  1V81 A;  4A8X C;  4DDI D;  3IAM 1;  3MJW A;  1C4C A;  2RPV A;  3AE5 B;  3N1X C;  5H8Y E;  3X23 A;  4NY0 A;  2D10 A;  1XLN A;  2AL6 A;  4XGA B;  3HHM A;  4JGH B;  2WXF A;  3URY A;  3PGE A;  1DOX A;  3EFU A;  3JSV A;  1HZ5 A;  2SEB D;  1KLU D;  1WWT A;  1TT5 B;  1FO4 A;  3U8Z A;  2MBQ A;  3CIR B;  3PRM B;  1RM6 C;  3NS1 A;  4LLG M;  1STE A;  3BYT B;  3AEC B;  1GNU A;  2JF5 A;  1TBE A;  4P6V F;  3N20 C;  4ICV A;  2CJN A;  1NBF C;  2WQY B;  1FM0 D;  1N62 A;  2J4X A;  2QC8 A;  2JU6 X;  2PEA A;  5AUI A;  4FAD A;  2KDB A;  3HUI A;  5LXI B;  3AE1 B;  4I6L B;  2C9W B;  2KLC A;  3CSF A;  3BII D;  4E3C A;  1KH0 A;  5EE1 A;  3EHV A;  3I63 C;  4HDO A;  1LM8 B;  3RUL A;  2PIA A;  4RGO S;  1I7H A;  3AN1 A;  2Y5B B;  4YTM B;  3AEE B;  1VDV A;  2N9E B;  3ML8 A;  2JY6 A;  2ICI A;  3QAQ A;  3V05 A;  2JT4 B;  4AOF A;  2B76 B;  4MJS A;  2ZCC A;  2LXC A;  2J0J A;  4IDI A;  4HRO A;  2WXG A;  3CF6 E;  4NNJ B;  3IXS A;  2UWQ A;  3TUO A;  3AE2 B;  2AQ2 B;  1MG4 A;  3R2I A;  2M4N A;  1VCB A;  2KWU B;  1I4Q A;  4KVG B;  4KKJ A;  4I6P A;  2FCQ A;  3LB8 C;  1JAL A;  1MJD A;  2ZPY A;  4BKG A;  4YSX B;  2DLB A;  1GPX A;  3LYY A;  2LMC A;  3ZNZ B;  3AI5 A;  4GDL A;  1SE4 A;  2DZM A;  1LO5 D;  4HKZ E;  1SF0 A;  3P4P B;  1VJK A;  3ABV B;  1TS3 A;  4KSL C;  2KT7 A;  4B95 A;  2XEW A;  4S17 A;  2FUH B;  3KLS X;  3QK0 A;  3RD2 A;  4C7Y A;  3MTN B;  4FHK A;  3PT2 B;  2HTH A;  2KWC A;  1Z5S B;  1ZKH A;  2PJH A;  2VH1 A;  3PV1 A;  2FCN A;  4M01 A;  4FJV B;  1V80 A;  3PLV A;  2NCN A;  4GB9 A;  2DNF A;  3VUW A;  1KJT A;  5AZG A;  3AE3 B;  2IO0 B;  1QZE A;  4ZHO A;  3T3O A;  3P63 A;  4IW0 A;  1JQ4 A;  3JSV B;  1T0Q C;  1H8C A;  3CWI A;  2KNB A;  2KAN A;  3P4S B;  1UH6 A;  2WS3 B;  2RDG A;  4OVU A;  4BFR A;  2X8X X;  2EMS A;  2L76 A;  3H8H A;  3VFK A;  5I4D A;  4FJZ A;  3ZYY X;  4JQW C;  2BYE A;  5E6N A;  2D3B A;  2INP E;  4EZJ A;  1NI2 A;  1XT9 B;  5AUK A;  4KIK A;  1P9D U;  3V6C B;  1MFW A;  2XK5 A;  3CMM B;  2MBE A;  3R3M A;  4XC2 A;  3HM6 X;  1VZ8 A;  4YWG G;  4RM9 A;  3UIP B;  3VR8 B;  5BO4 B;  4WJQ A;  3U7D A;  3OJ4 B;  2NR2 A;  1YJI A;  1WF9 A;  4HDQ A;  3K9P B;  2JRI B;  3NJT A;  1WJN A;  2GOW A;  3AED B;  2MBB B;  3Q3F A;  2WXO A;  1YNT E;  2RDB C;  5EE9 A;  3PRP B;  2QIE B;  4DXA B;  3PPA A;  1F1H A;  4HJG E;  2NS5 A;  2OJW A;  2WXR A;  3DVG X;  3E9S A;  3RNB C;  1E5W A;  4X57 B;  1TIF A;  1WGG A;  1YJ1 A;  2MRP A;  3B9J A;  4F1S A;  3DWG C;  4OZB A;  4AWJ A;  2WNM A;  2G1E A;  3GZN B;  4ZRQ A;  2MP2 A;  1XO3 A;  2BQQ A;  1FIQ A;  1HTO A;  1TGZ B;  5J18 A;  1FMA D;  2BT6 A;  3ZW3 A;  2JVC A;  1EF5 A;  1H4R A;  2L32 A;  3A9K B;  2AL3 A;  1V2Y A;  3QJZ A;  2D3A A;  5G5G A;  3J9C A;  3BK2 A;  4M0W B;  1IP9 A;  1B1Z A;  2WDV B;  5JH5 C;  1I4X A;  1UNS A;  1OQR A;  1AYF A;  1K51 A;  2LHD A;  2K8H A;  2GBJ A;  3KUZ A;  3RNF C;  3T9L A;  1I4P A;  3B2G A;  3PZ7 A;  2YEP F;  3DPD A;  1QOF A;  3VDZ A;  3HIZ A;  1V8C A;  4W9H A;  1IGD A;  3WAP A;  2JYE A;  2DX5 B;  1VZ6 A;  1SE2 A;  1SIJ A;  2KFK B;  4Q2J A;  1QKZ A;  3T8M A;  4WIP A;  1NI3 A;  3NVV A;  3LDZ E;  4G0N B;  2C60 A;  1FRR A;  1NVI D;  3W2D A;  2O6V B;  3DQV A;  4TQ0 A;  2PE9 A;  2RMM A;  1M94 A;  5JHA A;  3TJP A;  2N9K A;  4EZK A;  4ZRJ A;  4DWF A;  3APC A;  2NPT A;  2AX5 A;  2M56 B;  3QX1 A;  4ICU A;  1MHX A;  2KMA A;  4KZ0 A;  2GBM A;  2J53 A;  1DGJ A;  4WAF A;  2JPH A;  4P7I A;  4DHJ B;  1FEH A;  3UIN B;  4EKU A;  2DEN B;  3DHI C;  3PRZ A;  3HVZ A;  3QIJ A;  3RMK C;  4TKN A;  2AQ1 B;  4RCO A;  4K1R B;  2CU1 A;  4DDG D;  2KTR A;  1C4P A;  1V5O A;  1N60 A;  2LZ6 A;  1T5X D;  1G6J A;  4MJS B;  1UGM A;  3TEZ A;  1TYG B;  2MQJ A;  1I4H A;  5CHF A;  1WJ6 A;  5JZE B;  4BBN C;  1IPG A;  3IT4 B;  2L83 A;  2WXN A;  4S0R A;  4L23 A;  2INC C;  1SBB B;  4MEM A;  3B0A A;  2V4I B;  5IAA C;  1YD8 U;  2KZR A;  2L0T A;  2FAZ A;  1EU3 A;  3MC0 B;  3ZXR A;  2LGX A;  4W9C A;  1NYR A;  3WAM A;  1YQ3 B;  3BYY B;  2ZW1 A;  3L54 A;  4DK5 A;  2WGS A;  2LGY A;  4EZL A;  1WMH A;  2CR5 A;  1ZXI A;  3WA0 A;  2CS4 A;  3PHW B;  1F0Z A;  3DBR I;  2DBY A;  5FR6 A;  1MG8 A;  3BZD B;  1SIF A;  2REX A;  3GE3 C;  4C80 A;  2JUO A;  3Q3M C;  4DXG A;  2LGS A;  2MCN B;  1MI0 A;  3FKY A;  4XX5 A;  4ASW C;  1V97 A;  4IWP A;  1Q5W B;  3PZ8 A;  2AQ3 B;  3HM3 A;  3U4E G;  1OEY J;  2K1F A;  1UEL A;  4TV3 A;  3N9Y C;  1V9J A;  3P2B A;  2KHW B;  1OQY A;  4FLH A;  3Q8A A;  3DBH B;  2MBH A;  3MHS D;  4URK A;  3K9O B;  2IDY A;  3Q6B A;  4AP4 C;  2NPT B;  5D3D A;  4MAC A;  1CZP A;  1QQR A;  2WXQ A;  3RPF C;  2ZVO A;  1TKE A;  1PGX A;  3H9D A;  2AEH A;  2PVO D;  2M19 A;  2WXI A;  2O2V A;  2ZJD A;  2W3S A;  4OW0 A;  2G9H D;  1TKY A;  4E74 A;  4EOY A;  2Q5W D;  4R3D A;  5H92 C;  4K7S A;  2WU5 B;  3VXW A;  4HCN B;  2GI9 A;  1LFD A;  4C00 A;  2LAS A;  5BMH A;  1C4A A;  4NQL B;  2I38 A;  1IYF A;  3VHT C;  3ZNI D;  2D11 A;  1F9J A;  3APF A;  2QEJ C;  1KTK A;  4ARC A;  1P0R A;  2MEK A;  4ZYN A;  2KTR B;  2MJD A;  2MLB A;  2JYT A;  3RNE C;  1GAQ B;  2G4D B;  2BS2 B;  2KTF A;  1K52 A;  4UDU C;  4H2A A;  1E10 A;  3RNA C;  4ZDV A;  1ENF A;  4US8 A;  4NJ7 A;  2X38 A;  1JML A;  1CK1 A;  3ZIM A;  5C23 A;  2KJH B;  2Z59 B;  1E8Z A;  3KWV A;  2Y5P A;  3R2T A;  2LHE A;  3IBE A;  2IO3 B;  2GLS A;  4KV2 A;  1GUA B;  2MSE D;  1IBX A;  3KQ4 A;  3M3J A;  1AAR A;  5IA7 A;  1SEB D;  4G3X B;  1JWA D;  2IPK D;  1FCC C;  3I57 A;  2XN9 C;  4MGI E;  2MW5 A;  1XQQ A;  1N6Z A;  2K22 A;  4C4V A;  1T0Y A;  2DYO A;  4EE2 A;  4L1B A;  2I2Y A;  3VRB B;  1IBX B;  2O6V D;  3NRZ A;  1KF6 B;  4RNA A;  2DAJ A;  4N58 A;  5JHB A;  1LGR A;  1WM2 A;  3ZKJ C;  2DZJ A;  1E6E B;  4MH8 A;  2BYV E;  3NZU A;  4EUT A;  3I3T B;  2LI5 A;  5LXH A;  2WDR B;  2HJ1 A;  3DVN U;  4C7Z A;  1F77 A;  4E71 A;  1P7E A;  2NBU A;  2XK5 B;  3AU4 A;  4KIK B;  3DBS A;  1BXT A;  4A90 A;  2ZCB A;  1L2N A;  1V6E A;  1FD6 A;  1GOZ A;  3AE8 B;  4HPP A;  1D5X C;  1WGH A;  4OHJ A;  1SSN A;  3MC9 A;  4W9E A;  3TEY A;  1X1M A;  1RLF A;  1XXG A;  2MHJ A;  3TSS A;  4IOI E;  4KDI C;  5JXV A;  1R4M I;  2NBW B;  4CYE A;  2WHI A;  2BWF A;  3NUH B;  2J52 A;  1S1Q B;  3ZUN A;  2UYZ B;  3W5V B;  1C1Y B;  2BB5 A;  4J6I A;  2EKI A;  3AH7 A;  2LUE A;  2L8J A;  4N9F 4;  2N0S B;  2YEP B;  1HTQ A;  3SFE B;  3JVZ X;  3AMZ A;  1C3T A;  1L7Y A;  4MM3 B;  1YIW A;  2XBB C;  4ACF A;  4LNF A;  4AJY B;  2ZW0 A;  3P4R B;  2FBW B;  1VLB A;  1ZP0 B;  2DZI A;  4WUR A;  1E0Z A;  1CMX B;  2JRH A;  3RCZ A;  1BUI C;  3Q8E A;  1ZUD 2;  2KFJ A;  3ZO5 B;  2KLG A;  3H1U A;  5D94 A;  3RNG C;  4XDC A;  5BYQ A;  1UZX B;  2BYF A;  4ZYS A;  1YMH E;  3TMP B;  2RSU A;  4K81 A;  5L95 C;  3W5U B;  1FPY A;  2KN5 A;  3GB1 A;  5TR5 A;  2WP9 B;  3EEC A;  4RF0 A;  4C56 C;  4NAW B;  4M02 A;  2JWZ A;  1WGR A;  2L00 B;  3I5J C;  2CHZ A;  3ZVV A;  3NG0 A;  2N1W A;  3NVW A;  1UD7 A;  3RT3 B;  2CKH B;  1I4R A;  1JRU A;  4BBN F;  4N6E B;  2KVZ A;  4HRS A;  1QT9 A;  1L5P A;  2EMT A;  5HG2 A;  1SJE D;  5HI1 A;  1WGY A;  3AE4 B;  3TCA A;  4YT0 B;  3L13 A;  3NZ3 A;  1FXA A;  4BAX A;  1E7U A;  4DHZ E;  4YTP B;  4LNO A;  1GB4 A;  3L4P A;  1UWM A;  2DZK A;  2DYM A;  1WRI A;  2CU3 A;  2K0P A;  1QOB A;  2LGD A;  4OZC A;  2YLM A;  3GE8 C;  3SU8 X;  3N1Z C;  3VTW A;  3RYT A;  2W9N A;  1XD3 B;  3GS2 A;  4XE0 A;  3VAW A;  1F2R C;  1PYW D;  4FJY A;  2KDE B;  4QAY A;  3MFG A;  4XWW A;  1VZ7 A;  3N1Y C;  1SE3 A;  5CHV C;  3Q8B A;  4IM3 A;  3BWU D;  1JWM D;  4HXD A;  4G50 A;  2PLP A;  4A3O A;  4JL9 A;  2K8B A;  1YN3 A;  3C8Y A;  3WIM A;  5E6J A;  4RMA A;  3PS6 A;  3FC4 A;  2BPS A;  4IUM B;  2KC1 A;  1KRH A;  1NYQ A;  2N1V A;  3ZNH B;  4HKQ A;  2WDT B;  2J0K A;  4GXB A;  3KYC D;  2GBK A;  2N9L A;  1R4M B;  3L17 A;  2K8C A;  3BY4 B;  1NEK B;  3SEB A;  1PGA A;  2H89 B;  3Q14 C;  4D2K A;  3ZJT A;  1L0Y B;  3PVL A;  1P1A A;  1WIA A;  2MX2 A;  3BIN A;  1FFV A;  2GBN A;  1WJU A;  1EO6 A;  3KWL A;  1V1O A;  1YN5 A;  4M0W A;  1QF6 A;  2M0A A;  2W3R A;  1Y56 A;  2KN4 A;  3Q2A C;  3V60 A;  4PS7 A;  1L4Z B;  2ASQ A;  1E8Y A;  2C7H A;  1YQB A;  4NAW A;  1V1P B;  2BKF A;  2ACZ B;  2R2Q A;  1E90 A;  4WQO B;  1WMH B;  1OEY A;  4W9L A;  2PPH A;  3A33 B;  2K25 A;  1EM7 A;  1PGB A;  5BMI A;  4GU2 A;  4MGY E;  1HEZ E;  2KX3 A;  1L6U A;  4KX6 B;  4ANX A;  5G5H A;  2D3G A;  1WH3 A;  1KOT A;  4BKS A;  4C4V B;  3TIX A;  4W9D A;  3P42 A;  1UGJ A;  1EU4 A;  1N63 A;  2ZNV C;  2FCS A;  3GOE A;  2R61 A;  4HK2 A;  4EEW A;  2L7R A;  3NVZ A;  3BVG A;  2NBV B;  4ANU A;  3OWE B;  3X0W A;  3I9V 1;  5MPO A;  3KW5 B;  2M17 A;  2K39 A;  3SDL C;  5IO9 A;  1B9R A;  3L0W B;  2N9X A;  2M1M A;  2NTT A;  2MP2 B;  3AEG B;  1ZGU B;  1WXA A;  1P3Q U;  3H7P A;  1ACC A;  3H7P B;  4WJO A;  5E6O A;  2IGD A;  1WXS A;  4KKI A;  1WFY A;  4JPS A;  4N59 A;  1WRD B;  4TMA B;  2BS4 B;  3PRE A;  2QIL A;  3A9J B;  4FHJ A;  2N4F A;  1JRP A;  2LEK A;  3AEA B;  2IBI B;  4NQK E;  4RH6 A;  3RI7 C;  3H6N A;  3OJ3 A;  2BKR B;  2BS3 B;  2KX0 A;  4K7W A;  2LJI A;  1HA5 A;  1YX6 B;  1QOG A;  1SE9 A;  5J17 A;  1GB1 A;  4HWI B;  2V1Y A;  4A9A A;  4JLC A;  2LVP A;  1AN8 A;  3NOB A;  5C3J B;  4PK1 A;  3Q3N C;  1ET9 A;  3A1Q B;  1RFK A;  4WH4 A;  2RDH A;  5E6P A;  2VH2 A;  2IO1 B;  5FKA C;  4XYC A;  2KMC A;  3PSE B;  4ARI A;  1WSP A;  4P16 A;  3PTF C;  1TY0 A;  1P7F A;  4AJW A;  4GLS C;  4IWO A;  1E8W A;  1WM3 A;  2KQ4 X;  2TSS A;  5DPT A;  3ZLZ A;  4II3 B;  1WR6 E;  3QAR A;  2IGG A;  1PUT A;  1JWS D;  1FNV A;  4YXD B;  1SB3 C;  2NTS A;  3IG3 A;  2B3A A;  3ZQ4 A;  1WYW B;  5HHD G;  4GMV A;  1YOV B;  5KHQ A;  3W1Y A;  4KDL B;  2H88 B;  4LDT D;  5DPS A;  2KAC A;  1I4G A;  2WYQ A;  3Q3O C;  2QDF A;  3DOW A;  2KDI A;  5EDS A;  3WAO A;  1T6B X;  3V6E B;  2WXH A;  3ZDM C;  2HD5 B;  4RF1 A;  1WE6 A;  4AUQ C;  2D3C A;  5DPW A;  3OLM D;  1YQ4 B;  1I35 A;  2LRU A;  5DPR A;  1FXI A;  1XLP A;  4XWT A;  3MC8 A;  1FNU A;  3O13 A;  2MWS B;  4AQ7 A;  1UF0 A;  2KD0 A;  5BYR A;  2LFI A;  3ZRC A;  4P1B C;  2Z8L A;  3ZRF A;  1V86 A;  2G45 B;  2GBR A;  2LGI A;  4GOC A;  1EWC A;  3ZJU A;  2WXJ A;  5D2M B;  1BT0 A;  1IGC A;  1Q10 A;  1BML C;  2ZEQ A;  2A4Z A;  4CO7 A;  2Y3A A;  2WXP A;  2BYT A;  3NY5 A;  4MDK E;  1P98 A;  2D07 B;  3NZS A;  5EE0 A;  3KUD B;  3L08 A;  4WWN A;  3WAL A;  3ZGZ A;  3ZNG C;  3VH4 B;  1J19 A;  3EGR A;  5AZF A;  4NPN A;  2M0X A;  5CX3 A;  4NAM A;  5G2N A;  1L6V A;  4DBG A;  2RR9 A;  3VTV A;  4AS1 A;  2K3U A;  4JE3 B;  4TUU A;  1SGH A;  4BKS D;  1U4A A;  1KM7 A;  3GP7 A;  1FRD A;  1GC7 A;  2Y5C A;  3S2A A;  2J0M A;  3PHX B;  3DVG Y;  3WCQ A;  1A70 A;  4LDT B;  1N61 A;  3VH3 B;  3U2S C;  3SFD B;  3TEX A;  2KFK A;  3R7R A;  4WJP A;  1N5W A;  2MJ3 A;  2Z0E B;  5BYS A;  2N7E A;  3EUB 2;  5GMV A;  3AE7 B;  1WXV A;  4MGZ E;  2PW9 A;  3WAN A;  3MJ5 A;  3APD A;  1TS5 A;  4W9F A;  2WU2 B;  1YJJ A;  1TZ1 A;  5BMG A;  3DHH C;  3DWM A;  1D3Z A;  2KXJ A;  2ZZP B;  4FBJ B;  2CHX A;  4PS3 A;  4WWP A;  1LXD A;  4JX1 C;  3VVW B;  1EF1 A;  4HJK A;  2OJR A;  2HDE A;  4F8C B;  3M95 A;  4KGT A;  3OAW A;  4IWQ A;  5AEK B;  2WX0 A;  4J3O D;  4ZOH C;  1WI0 A;  4HPM B;  2OED A;  5J2R A;  3FIL A;  3RUI B;  2KQS A;  1NDD A;  3B2F A;  1TKG A;  2M8S A;  1WX7 A;  2PTL A;  2SAK A;  5AZH A;  1T3Q A;  1CQV A;  1D4B A;  4O1N A;  1DOY A;  3QHT A;  2V3S A;  1GJZ A;  2DAF A;  2MJE A;  5FK9 C;  1UWX A;  2W55 A;  3R7Q A;  4ANV A;  2CJO A;  2IY1 B;  3T3N A;  2WWZ A;  1N5X A;  4GGQ A;  2HJ8 A;  2CHW A;  3QA8 A;  2QMT A;  2BB6 A;  2QHO A;  1ZE3 D;  4GDK A;  1QLB B;  4KGR A;  3VTU A;  2INN E;  2ON8 A;  2IND C;  1Q1O A;  3VR9 B;  3LXF A;  1PDX A;  3HVD A;  4RFB A;  2C7M B;  2D5G A;  1ZDX A;  1R4N I;  1ZPS A;  1VRA B;  3KVF B;  3A9K A;  4XDD A;  1F2R I;  3ZTD A;  3ONS A;  1C77 A;  5IP4 D;  2VZK B;  1MHH E;  4PT5 A;  2LUM A;  2NVU I;  2VZK D;  2E3T A;  2JZ3 B;  3DVN V;  3LJ3 A;  3M63 B;  1VD2 A;  1C76 A;  1ZXH A;  3V62 A;  1FXT B;  1PFD A;  4LTU A;  1K53 A;  4FN2 A;  5G55 A;  3V61 A;  3AEB B;  4A20 A;  2BW2 A;  3DBR B;  5EE3 A;  3QQ8 B;  3FAH A;  2KYW A;  4USA A;  5TSS A;  3AE9 B;  3P4Q B;  1MPE A;  3IHP C;  3R66 C;  2KDM A;  2YVC A;  3SD5 A;  4NZL B;  2ZNV B;  4GIV A;  3OG5 A;  5D3I B;  3UIO B;  2KOX A;  1DYQ A;  2K6D B;  2L52 A;  4RGN A;  3IAS 1;  4DHJ D;  2IO2 B;  1WZ0 A;  1DOI A;  1QIL A;  4OZA A;  3N32 A;  2WDQ B;  1RYJ A;  3O65 B;  4HVB A;  2IZV B;  3AV8 A;  4WJN A;  3HRD D;  2OOB B;  2AWT A;  2BBC A;  4K3B A;  1RFA A;  2HTM E;  2O2V B;  1KLG D;  3C0R B;  4K3C A;  4KSK C;  1SJH D;  2BF8 B;  4MGK E;  2KKC A;  4YL8 A;  3M62 B;  1XF5 L;  5FR3 A;  2V3N A;  2JZP A;  5D6J B;  3B1L X;  2LJ5 A;  1EUV B;  3PLU A;  2LWP A;  1KLV A;  1TZO A;  4EFO A;  2R2O A;  3JYU A;  2KAJ A;  4B0E A;  4IM2 A;  2KWD A;  3A9J A;  3AE6 B;  1FFU A;  1J0G A;  1IUE A;  2EEL A;  2BWE S;  1AWD A;  3TBL D;  1C78 A;  1A5R A;  4TSS A;  4W9J A;  5GXG B;  2LVO A;  5T8I A;  4BZA A;  2KDF B;  1LQB A;  3W1S A;  2WXK A;  1ISN A;  2BGF A;  1L0V B;  3Q69 A;  4WAA A;  5KHO A;  1FCL A;  2KO3 A;  1V1P A;  4TQ1 A;  4IM0 A;  2RD0 A;  4W9K A;  4CQN A;  3QWZ B;  4IKG A;  1JW9 D;  3U30 A;  2ZPN A;  2WXM A;  2C7N B;  2W54 A;  1M4V A;  4OVV A;  1SXT A;  4ITK A;  1TTN A;  2DYB A;  3KH0 A; 
#chains in the Genus database with same CATH homology
 4H2A A;  1E10 A;  2WXG A;  2IGH A;  4ARI A;  1WSP A;  3IXS A;  4P16 A;  4L2Y A;  1ENF A;  4A6Q A;  1TY0 A;  3TUO A;  1P7F A;  4US8 A;  4GLS C;  3AE2 B;  1J7A A;  2AQ2 B;  3R2I A;  2X38 A;  3U7Z A;  1JML A;  1CK1 A;  1I4Q A;  2KQ4 X;  2TSS A;  4KKJ A;  2IGG A;  3LB8 C;  1PUT A;  1JAL A;  3KWV A;  2Y5P A;  1JWS D;  3R2T A;  2LHE A;  4FXC A;  5HFY A;  2W82 A;  1C79 A;  1FNV A;  2L1A A;  4YSX B;  1IBX A;  2DLB A;  4YXD B;  1HZ6 A;  3KQ4 A;  2LMC A;  1SB3 C;  1XLQ A;  2NTS A;  3LYY A;  3PO0 A;  1FNW A;  4JWU C;  1SE4 A;  1SEB D;  3ZQ4 A;  5HHD G;  1LO5 D;  4HKZ E;  1SF0 A;  1JWA D;  2IPK D;  3P4P B;  1FCC C;  3I57 A;  1VJK A;  2XN9 C;  3ABV B;  1TS3 A;  2H88 B;  1TS2 A;  4YSZ B;  5LNK 1;  2KAC A;  1I4G A;  4ZHP A;  1RWS A;  3NVY A;  2XNA C;  4B0M A;  2K22 A;  3KLS X;  2DYO A;  3MP9 A;  4EE2 A;  4L1B A;  3Q8C A;  3VRA B;  2I2Y A;  3VRB B;  1XCT L;  1IBX B;  3NRZ A;  1KF6 B;  1T6B X;  4RNA A;  4C7Y A;  1CJE A;  2WXH A;  2GB1 A;  1JRO A;  4N58 A;  4US9 A;  1XEE A;  4RF1 A;  4OVZ A;  1EWY C;  3UI3 A;  1E6E B;  4MH8 A;  3BVM A;  2KMM A;  1YQ4 B;  4DQO C;  1FXI A;  1XLP A;  1D5M C;  4XWT A;  3IT6 B;  2WDR B;  2NMQ A;  4C7Z A;  1F77 A;  3AE3 B;  1FNU A;  4ZHO A;  3T3O A;  3P63 A;  1P7E A;  3O13 A;  1ROE A;  1JQ4 A;  4AQ7 A;  2BTE A;  3CWI A;  3P4S B;  5BYR A;  2LFI A;  2WS3 B;  1BXT A;  2JXT A;  4A90 A;  2Z8L A;  2RDG A;  1FD6 A;  1GOZ A;  1QOA A;  2LGI A;  3AE8 B;  1EWC A;  1ET6 A;  3ZJU A;  2WXJ A;  1D5X C;  3H8H A;  4OHJ A;  1KFY B;  1SSN A;  1IGC A;  5I4D A;  3TEY A;  3ZYY X;  1Q10 A;  1BML C;  1XXG A;  4REZ A;  3TSS A;  4IOI E;  2Y3A A;  2INP E;  3BK1 A;  3W9C B;  1J7C A;  5JXV A;  2WXP A;  5AUK A;  2BYT A;  3NUH B;  5EE0 A;  2DWQ A;  2J52 A;  4ZRP A;  1TS4 A;  4YTN B;  1ESF A;  3W5V B;  3ZGZ A;  1VZ8 A;  4YWG G;  2BB5 A;  2E6X A;  1TY2 A;  2EKI A;  3VR8 B;  3AH7 A;  4DXF A;  3EGR A;  5C2T B;  2V0G A;  2N0S B;  2YEP B;  3SFE B;  3SR6 A;  1YJI A;  4NAM A;  3ZJV A;  3AMZ A;  1L6V A;  3AED B;  1K50 A;  2WXO A;  4AS1 A;  4RGM A;  2K3U A;  4JE3 B;  1YNT E;  4MM3 B;  5EE9 A;  3GP7 A;  1WGK A;  1FRD A;  2QIE B;  2Y5C A;  2ZW0 A;  4HJG E;  3P4R B;  1JCK B;  2FBW B;  2WXR A;  3E9S A;  1HXY D;  1VLB A;  1ZP0 B;  1AW7 A;  3WCQ A;  4WUR A;  1A70 A;  1E0Z A;  2QJL A;  1N61 A;  3B9J A;  1BUI C;  1JWU D;  1ZUD 2;  3Q8E A;  3SFD B;  3U2S C;  4GDL B;  3DWG C;  4OZB A;  3TEX A;  3RFZ B;  4XDC A;  5BYQ A;  2GRI A;  2WNM A;  2G1E A;  1N5W A;  1NEN B;  2MJ3 A;  1YMH E;  4ZRQ A;  1VR9 A;  4ZYS A;  5BYS A;  1XO3 A;  3EUB 2;  1XCQ L;  1FIQ A;  3BVZ A;  1D6E C;  3W5U B;  3ETR A;  3AE7 B;  3GB1 A;  2WP9 B;  1FMA D;  2PW9 A;  3AM9 A;  2BT6 A;  3MJ5 A;  4RF0 A;  1TS5 A;  2WU2 B;  1YJJ A;  1WXQ A;  4C56 C;  4NAW B;  1E7P B;  1TJE A;  2L32 A;  2FE8 A;  2JX5 A;  2JQR B;  1C9F A;  3NVW A;  5BMG A;  4YSY B;  1I4R A;  3DWM A;  5G5G A;  4N6E B;  3J9C A;  3BK2 A;  1B1Z A;  2WDV B;  4HRS A;  1I4X A;  1OQR A;  1QT9 A;  1AYF A;  1UNS A;  1XLO A;  1K51 A;  1L5P A;  2LHD A;  4JX1 C;  4LK0 M;  1I4P A;  3B2G A;  5HG2 A;  1SJE D;  2HDE A;  5HI1 A;  3AE4 B;  4KGT A;  3PZ7 A;  4YT0 B;  3NZ3 A;  1FXA A;  2YEP F;  4J3O D;  1QOF A;  4ZOH C;  4JWS C;  4WQM A;  2OED A;  4YTP B;  2PKO A;  1V8C A;  1GB4 A;  3L4P A;  1IGD A;  3AEF B;  1E9M A;  1UWM A;  3FIL A;  2OHF A;  2DYM A;  2WXL A;  2JYE A;  3B2F A;  3VQI A;  1TKG A;  1WRI A;  2CU3 A;  2K0P A;  1VZ6 A;  1QOB A;  1SE2 A;  2PTL A;  1SIJ A;  4OZC A;  2SAK A;  1JWB D;  3E56 A;  4Q2J A;  1QKZ A;  1T3Q A;  1CQV A;  3GS2 A;  3P1M A;  4XE0 A;  4WIP A;  1NI3 A;  3NVV A;  2K5P A;  1F2R C;  4WWM A;  1D4B A;  1L4D B;  1FRR A;  1PYW D;  4O1N A;  1NVI D;  3W2D A;  1DOY A;  4TQ0 A;  3MFG A;  2RMM A;  4XWW A;  1VZ7 A;  2MJE A;  1SE3 A;  5FK9 C;  1UWX A;  3Q8B A;  3BWU D;  3Q8F A;  2W55 A;  2N9K A;  1JWM D;  2N7J A;  2CJO A;  2AX5 A;  2M56 B;  3T3N A;  1MHX A;  4MT5 A;  2PLP A;  1N5X A;  1J7B A;  1YN3 A;  2QMT A;  3C8Y A;  1UUP A;  1ZDV A;  2J53 A;  1DGJ A;  2BB6 A;  4WAF A;  4RGT A;  5D7G A;  2ONQ A;  1ZE3 D;  5E6J A;  1FEH A;  2FUG 1;  1QLB B;  3FC4 A;  4HEA 1;  4KGR A;  2V3P A;  3U52 E;  3HVZ A;  2INN E;  2ON8 A;  3VR9 B;  3LXF A;  3V3X A;  1PDX A;  3HVD A;  1KRH A;  1NYQ A;  4RFB A;  4HKQ A;  2JSV X;  2K9X A;  2D5G A;  2N9L A;  1WYG A;  2JWU A;  2J42 A;  1YN4 A;  1ZDX A;  1ZOY B;  2AQ1 B;  1NEK B;  4RCO A;  3SEB A;  1L0X B;  1PGA A;  1ZPS A;  1VRA B;  4NJC A;  2H89 B;  4XDD A;  1D5Z C;  1F2R I;  3AB5 A;  1C4P A;  4D2K A;  2PMV A;  3ZJT A;  1L0Y B;  1C77 A;  1N60 A;  1T5X D;  1FFV A;  2VZK B;  1R7S A;  1MHH E;  4PT5 A;  2LUM A;  3TEZ A;  1TYG B;  3KWL A;  1V1O A;  2VZK D;  1YN5 A;  2E3T A;  1I4H A;  4M0W A;  3IT4 B;  2MH7 A;  1C76 A;  1ZXH A;  2L83 A;  4A55 A;  1QF6 A;  2M0A A;  2W3R A;  2WXN A;  1Y56 A;  2KN4 A;  1PFD A;  4LTU A;  1K53 A;  4L23 A;  1L4Z B;  1SBB B;  3AEB B;  3EA6 A;  2BW2 A;  2V4I B;  1OQQ A;  5EE3 A;  3FAH A;  2IJ0 A;  1V1P B;  4KGS A;  3MHZ A;  1EU3 A;  2ACZ B;  3MC0 B;  1HQR D;  2WLB A;  1NYR A;  4USA A;  5TSS A;  1YQ3 B;  3BYY B;  2ZW1 A;  2PVG C;  1ZXI A;  3AE9 B;  1MVK A;  3P4Q B;  1MPE A;  1EM7 A;  3R8B A;  1PGB A;  5BMI A;  1F0Z A;  2DBY A;  2KDM A;  1HEZ E;  3BZD B;  4NZL B;  1L6U A;  4KX6 B;  5G5H A;  5D3I B;  4GDK B;  4C80 A;  4DXG A;  1DYQ A;  1GPX A;  1MI0 A;  2L52 A;  3FIL B;  3P42 A;  4RGN A;  1OFF A;  3IAS 1;  1UGJ A;  1V97 A;  1EU4 A;  1N63 A;  1DOI A;  1QIL A;  4OZA A;  2R61 A;  3PZ8 A;  2AQ3 B;  2WDQ B;  2QSD A;  3BVG A;  3NVZ A;  3U4E G;  1RYJ A;  3OWE B;  4A8X C;  3IAM 1;  3I9V 1;  5MPO A;  1C4C A;  2RPV A;  3AE5 B;  3AV8 A;  3N9Y C;  3HRD D;  3TEW A;  2BBC A;  2HTM E;  5H8Y E;  1KLG D;  1B9R A;  1XLN A;  3Q8A A;  1SJH D;  2NTT A;  1XF5 L;  2IDY A;  5FR3 A;  3AEG B;  2WXF A;  3URY A;  2V3N A;  2JZP A;  1DOX A;  1ACC A;  5D3D A;  2IGD A;  4MAC A;  4KKI A;  1CZP A;  1HZ5 A;  1QQR A;  2SEB D;  2WXQ A;  3RPF C;  1TZO A;  1TKE A;  1PGX A;  1KLU D;  1WWT A;  4JPS A;  1FO4 A;  2PVO D;  4N59 A;  2KAJ A;  4B0E A;  4TMA B;  2BS4 B;  2KWD A;  3CIR B;  1RM6 C;  3AE6 B;  1FFU A;  2QIL A;  3NS1 A;  4LLG M;  2M19 A;  1STE A;  3BYT B;  2WXI A;  3AEC B;  1IUE A;  2EEL A;  1AWD A;  1JRP A;  2LEK A;  2W3S A;  3AEA B;  4OW0 A;  4P6V F;  1C78 A;  1TKY A;  2G9H D;  2CJN A;  2Q5W D;  4RH6 A;  4TSS A;  2BS3 B;  5GXG B;  2WQY B;  1FM0 D;  1N62 A;  5T8I A;  2LJI A;  2J4X A;  1HA5 A;  4R3D A;  5H92 C;  1QOG A;  2JU6 X;  2WU5 B;  2GI9 A;  5AUI A;  3W1S A;  2WXK A;  5BMH A;  3HUI A;  1C4A A;  2I38 A;  1L0V B;  3Q69 A;  1GB1 A;  3AE1 B;  1FCL A;  1V1P A;  4A9A A;  4TQ1 A;  3BII D;  1KH0 A;  1AN8 A;  2QEJ C;  5C3J B;  4CQN A;  1KTK A;  5EE1 A;  1ET9 A;  4IKG A;  4ARC A;  1RFK A;  2MEK A;  2PIA A;  1JW9 D;  1I7H A;  3AN1 A;  4RGO S;  4YTM B;  1VDV A;  2MJD A;  3AEE B;  2WXM A;  2JYT A;  4WH4 A;  2W54 A;  1GAQ B;  1M4V A;  2ICI A;  2RDH A;  3V05 A;  5FKA C;  2B76 B;  1SXT A;  2BS2 B;  4ITK A;  1K52 A;  4IDI A;  4HRO A;  4UDU C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...