1IGCA

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Complex (antibody/binding protein)
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igcA00
1XCTL 2JWUA 4IKGA 2J52A 1GB4A 2EELA 1MHHE 1IGCA 2JU6X 1FD6A 1XCQL 1KH0A 2IGGA 4D2KA 1K52A 2N9KA 5HI1A 2I2YA 2OEDA 2N7JA 2LHDA 1QKZA 1PGXA 5BMHA 2GB1A 2J53A 1UWXA 2I38A 4MACA 1XF5L 2QSDA 2JSVX 2LHEA 4IOIE 4HJGE 1YNTE 4OZCA 1F2RI 2PTLA 4KGTA 2ON8A 1F2RC 3GB1A 1IBXB 3FILB 1PGBA 1MI0A 5BMIA 1ZXHA 1IGDA 1MHXA 1IBXA 2IGDA 4KGSA 3MP9A 2JXTA 4KGRA 2IGHA 2PLPA 3UI3A 1GB1A 2KDMA 5HG2A 2K0PA 1YMHE 4WH4A 2PW9A 4OZAA 1D4BA 1Q10A 1JMLA 1C9FA 2ONQA 3V3XA 4GLSC 2KN4A 2LUMA 2QMTA 2LGIA 2ZW1A 1K51A 1EM7A 5HHDG 5HFYA 1HEZE 3FILA 2RMMA 1FCLA 1P7EA 2JZPA 1K50A 1K53A 2KWDA 2ZW0A 2GI9A 2KACA 1HZ5A 5BMGA 1FCCC 1P7FA 2NMQA 2RPVA 2KQ4X 1MPEA 1MVKA 2N9LA 5JXVA 1PGAA 1HZ6A 4HKZE 4OZBA
chains in the Genus database with same CATH superfamily
2MBOA 2E6XA 2KDFB 3C0RB 1ZDVA 3UQAA 4ZRKA 4KV2A 2OHFA 3K9PB 2L8JA 2JVCA 4JE3B 2KZRA 3ALBA 1RRBA 1LO5D 1WSPA 5TSSA 1WGDA 3R8BA 3ZXRA 2HTME 1AYFA 1UNSA 1YOVB 2FAZA 4EOYA 3OWEB 1ESFA 3GB1A 5G55A 2XBBC 3JVZX 3PZ7A 2AWTA 4B0EA 1J19A 3Q8CA 1RM6C 3AN1A 4L1BA 2V4LA 1C77A 4MJSB 2IGDA 4B0MA 1JROA 3D32A 1V80A 4HRSA 2WXNA 1XEEA 2M4NA 4N6EB 2X38A 2DZJA 1Q10A 4MM3B 4FULA 2K1FA 1TJEA 5C2TB 4GMVA 4DDID 1WR6E 3N9YC 3R7QA 3ABVB 1IYFA 1FNWA 5LLIA 2CS4A 1V5TA 2WLBA 3AE3B 1SEBD 3GE3C 5I4DA 2KWDA 2KJRA 2GBNA 2GBKA 5DCNA 2WDTB 4OVZA 2RD0A 4TKNA 4WAAA 1SJED 2UWQA 3O65B 1WR1A 2JZ3B 3W5VB 1WX8A 3ZNID 1MG4A 4RM9A 4RH6A 3PRZA 2MQJA 3OJ3A 2KO3A 1SE2A 4GN1A 1FM0D 4TUUA 2JWZA 3TJPA 4ARIA 2WXIA 3CIRB 1E90A 3UIOB 1FFUA 4M8NA 4MGZE 1QZEA 1N61A 3VUXA 2D3AA 3RNBC 1VDVA 4FHKA 1PGBA 1DOIA 3RD2A 5MPOA 3KWLA 2K9XA 4II3B 3VUYA 3NVWA 1ZP0B 1XLOA 4XYCA 1M4VA 3DCGA 3SU8X 4RGNA 2IGHA 4HPMB 3APCA 2Z59B 1SE9A 4A55A 3LJ3A 2CJNA 3QA8A 2Y3AA 1CMXB 2D3GA 2XNAC 2PEAA 4MGKE 3ZRCA 3PRPB 4FXCA 4K3BA 5CTRC 4GLSC 2KN4A 2PIAA 1C4AA 2INDC 2JYEA 2JT4B 3DQVA 3Q3JA 2JPHA 2WP9B 1NEKB 2BS2B 4CHKA 1AWDA 2BKRB 4KVGB 3UQBA 4FADA 2KDBA 3MHSD 4HLEA 3NY5A 1SSNA 1OFFA 1NDDA 2KDEB 1F9JA 3C8YA 1XLPA 1ACCA 4KDLB 1LQBA 2ACZB 3WAOA 3PHWB 3AEBB 1XLNA 4NPNA 4RM8A 1WGGA 2KQ7A 5BO4B 3A33B 1STEA 1SE4A 2KD0A 1WM3A 4JLCA 4DXFA 2J0KA 3QARA 4ZHPA 2ASQA 2VH1A 5AZFA 4G11A 4HCNB 2L83A 4MSQB 1NBFC 3SFEB 4IOIE 3BIID 3Q6BA 1SJHD 3P1MA 4YWGG 2ZZPB 4KIKB 1AW7A 3NZSA 5TR5A 1A5RA 1C78A 5J18A 3RNCC 1KJTA 5AZGA 1L0YB 3BK1A 4A8XC 1S3SG 2BGFA 2K8HA 4IM3A 4E74A 1FRDA 3UI3A 2KC2A 3EFCA 1XO3A 1NENB 4OW0A 1B1ZA 3GE8C 2IPKD 4TSSA 2N1WA 1KOTA 3VRBB 3HM6X 2BF8B 1RWSA 2QMTA 3WAPA 1WI0A 3NG0A 1RFAA 3RT3B 3RULA 2MW5A 4ZRPA 5DPSA 4BKGA 3PRMB 1TTNA 2IO2B 1K50A 5EE9A 2WU5B 2KWVB 3JYUA 4ANVA 2QJLA 2Z8LA 3Q8AA 4A90A 1PDXA 2O2VB 2KVZA 2AEHA 1TY0A 3T9LA 4BKSD 3A9JB 3EGRA 4MM3A 2BQQA 1NI2A 4HKZE 4OHJA 1L6UA 5C23A 5E6NA 3T3NA 2AX5A 1BMLC 2J42A 2WX0A 3IVFA 1VZ8A 1UWXA 5E6PA 4P1CC 2BW2A 4FJZA 1YQBA 1YNTE 1F2RI 1QILA 1H4RA 3MHZA 4J6IA 1E0ZA 3PLVA 1LM8B 3AE2B 2IY1B 4JGHB 1KLGD 2KLGA 2KK8A 4XWWA 1C76A 4JX1C 4YTMB 2G3QB 3TSSA 1FNUA 3SHQA 3URYA 2PE6B 2ZW1A 5HHDG 2RR9A 2GBRA 2YEPB 1TZ1A 1L7YA 4WWOA 3VTWA 3VVWB 4NZLB 3PZDA 1K53A 3FC4A 4M8MA 4KKIA 3DHGC 3GZNI 1J7BA 5EE1A 2KACA 2EMSA 2LVQA 3PPAA 1P7FA 2KQ4X 1J8CA 3HRDD 3HUIA 3A4RA 3N30A 3P63A 2IO0B 4W9CA 4AOFA 5JHBA 4DHJD 3VXWA 1OQRA 4DXGA 3R2TA 4R3DA 1RLFA 1JWMD 1F77A 1ZKHA 2WXJA 1C4PA 2LASA 1UZXB 3RNGC 3AU5A 4DXAB 4HK2A 4ITKA 2WS3B 1WYWB 2I2YA 1EUVB 2MSED 3SDLC 3KUCB 1GAQB 4PS8A 3TEWA 1TS5A 4NQLB 1OQYA 2JRIB 1YN3A 2OJWA 3VTVA 4EFOA 1EWYC 1VCBA 2INNE 3J9CA 4ZRJA 3TEZA 3E56A 4IM0A 4L2YA 3CSFA 3W5UB 4BZAA 2A5UA 3PO0A 1LXDA 5IOIA 4IDIA 3V62A 3A4SC 1V2YA 5IAAC 1MI0A 1OGWA 2HJ1A 4KSKC 3H7PB 2PVOD 5BYSA 2C9WB 3QC8B 1TY2A 1VRAB 5JHAA 2JXTA 1YIWA 1TKYA 2KNBA 2W82A 2ZEQA 5D7GA 1GB1A 1YN5A 5EDSA 2QIEB 3MTNB 4W9DA 2WQYB 1J7CA 3I57A 2BBCA 3P4PB 1EWCA 1UBIA 2RDBC 1HA5A 2FBWB 3VRAB 3V05A 4AJWA 4JWSC 3BINA 2CHWA 1OTRB 1Q5WB 3WCQA 2BT6A 3CMMB 3NUHB 4PS7A 5HFYA 1E8ZA 3KH0A 1XQQA 4LNFA 4W9HA 2HTHA 2SEBD 1V5OA 2JY6A 4BKTA 3V61A 2DENB 2MBHA 1I4QA 3WALA 2RPVA 5AZHA 2C7HA 4OVVA 1Z5SB 1MVKA 4ARCA 1R4NI 3ENEA 2NBUA 4WWNA 3KYCD 1V1OA 1WZ0A 3QAQA 1CJEA 3ECIA 3CWIA 1JRPA 2DNFA 4OVUA 3HHMA 1WRIA 2G1EA 1FIQA 1JWBD 2K8CA 4C7YA 2FNJB 3UIPB 2MRPA 1PGXA 2ZNVC 3TIXA 4P1BC 4FLHA 2PVGC 3Q8FA 3V60A 3PHXB 2A4ZA 5AUIA 3A9JA 4REZA 3AU4A 2NTSA 2C7NB 4USAA 3A9KB 4LCDE 4HWIB 2V9HA 3VQIA 3ZUNA 2DX5B 1J0GA 4EZJA 1KFYB 1IBXA 3VTUA 2E3TA 2QEJC 3DBHB 1HTQA 2IO1B 2MA9B 1C3TA 2N9XA 4BKSA 2LRUA 2DZKA 3RCZA 1JMLA 3KVFB 3IFWB 2M8SA 3P2BA 3EUB2 1KLUD 2M56B 3H6NA 4FA6A 1CQVA 1R7SA 4ASWC 3CSTA 4RMAA 3H9DA 3PREA 4I6NB 3WIMA 1HXYD 1EO6A 5BMGA 1E7UA 2D3BA 3WA0A 1HTOA 2AQ2B 1TKEA 3MC0B 5EE3A 1I35A 4E71A 3OAWA 1LGRA 1C79A 3KYDD 1ZOYB 2MJDA 3OLMD 3QWZB 4BBNF 4AUQC 1E7VA 3W9CB 3ZNHB 1FD6A 1GG3A 1WGYA 2OEDA 1QOBA 3AI5A 5DPTA 1VLBA 1I4HA 4YL8A 2K5PA 4NAWA 4KKJA 2GB1A 4A6QA 4CQNA 2N1VA 4YTNB 4NJ7A 1TBEA 1P1AA 3L16A 3AE9B 3EECA 5KHQA 1SF0A 4YSYB 1UH6A 2R2QA 1FEHA 3R3MA 3DHIC 3GOEA 4WJOA 3MFGA 3N32A 4IC7B 2D10A 1YN4A 4F1SA 4B6WA 1K8RB 3ZXVA 3SFDB 3BK2A 2L52A 2Z0DB 3DVGY 1L0VB 3U7DA 3T8MA 1DOXA 4C56C 1D6EC 4JL9A 4ZRIA 3B2FA 2C60A 2IDYA 1K51A 4JQWC 5IO9A 4HDOA 1N5XA 2KX3A 3ZNZB 4IG7B 4JWUC 1FCLA 3NS1A 4GDLB 3H7PA 2MWSB 1S1QB 3P4SB 4HPPA 3L4PA 3UINB 3DBSA 1ZGUB 1FO4A 1FCCC 2RGFA 3M95A 4DBGA 2GOWA 4F7ZA 3DBRI 3GS2A 3U2SC 2WGSA 2JRHA 2L7RA 2B3AA 4XC2A 2BPSA 2WXGA 2KFKA 2B76B 2KC1A 1I4PA 3VFKA 3GZNB 1MHHE 1V86A 4LTUA 4HDQA 3HVDA 4D2KA 3ZDTA 2AYOB 1P3QU 1PYWD 4YSZB 2KLCA 1YJJA 2K3UA 1JWUD 4K3CA 4XE0A 3PGEA 3SD5A 1JWAD 2DZIA 2H89B 1QOFA 3ML9A 3RNEC 4FJYA 3RFZB 2GBJA 2KVRA 4W9IA 3RZWC 5FKAC 4CO7A 4W9KA 2KFJA 1NVID 1JRUA 4XX5A 1ZPSA 4MH0E 2FCMA 1I4RA 2L1AA 5FK9C 4RGTA 2J4XA 4CYEA 4WIPA 3IT6B 3L10B 4S17A 4YSXB 1ZXHA 1FMAD 2N4FA 4K81A 1CZPA 3AXCA 2WXQA 2AQ3B 4KGSA 5E6JA 3A1QB 4BVUC 2KWUB 1L4ZB 3IBEA 2KJHB 5LNK1 2LJ5A 2BWFA 2WXMA 1DGJA 3ZVVA 2K6DB 4HPLB 3M62B 1E10A 4UDUC 1HQRD 2J0JA 3Q8EA 1E8YA 2NCNA 2LGXA 3L17A 2V1YA 2K39A 4IW0A 2ONQA 2ZNVB 2LWPA 2LGDA 3I5JC 3NRZA 1N6ZA 2V4IB 1BXTA 5J17A 3AE5B 1WE7A 3A9KA 2FIDA 3DVNU 2BYTA 1P7EA 3P4QB 4TQ0A 5C1ZA 2GLSA 4WJQA 2L0FA 4N58A 2D07B 3H7SA 3NVYA 2GI9A 1D3ZA 1G6JA 2ZPYA 3UF8A 4W9JA 2L0TA 2KTFA 2L05A 4J3OD 2JQRB 3MC8A 3S2AA 3ML8A 2OJRA 4M02A 5LXIB 4G50A 2M17A 4MEMA 4KX6B 1T0RC 4ANXA 4W9GA 3JW0X 3ZTCA 4C7ZA 3AE4B 2Q5WD 2LUEA 3Q14C 2YVCA 2AL6A 3SEBA 2N7JA 2LHDA 3AE1B 3DPDA 3BVMA 3R7RA 2JYTA 1R4NB 1QOGA 2QCZA 1PQSA 4HROA 2TSSA 5CHFA 1WE6A 2I38A 3TMPB 4P16A 3BZDB 3VAWA 2IY0B 1J7AA 3I3TB 4LK0M 4A3OA 5D2MB 2JX5A 1OEYJ 1IBXB 3AE8B 2N7EA 2UU7A 4M0WA 1SXTA 4K7WA 4BBNC 4DK5A 2D3CA 1UGJA 3SR6A 4DWFA 4RNAA 4IWQA 3HVZA 3QHTA 1PUTA 3DBLI 3CF6E 3NZ3A 1YD8U 2Z0EB 2FCNA 2PW9A 4OZAA 3ZJTA 1GOZA 2Y5PA 3R2IA 5D6JB 1TS2A 2LGIA 2WX1A 1JQ4A 4NY0A 4AJYB 4MH8A 2H88B 2PPHA 5JZEB 2KYWA 3VH3B 4BOSC 4ZYNA 1RFKA 4NJ6A 4B95A 4A9AA 4DHZE 1HZ5A 2R2OA 2FIFA 3BY4B 5DPRA 1VZ7A 2LVPA 1MPEA 1FPYA 5EE0A 5FR3A 2W3RA 4X57B 1HE8A 4YXDB 1TKGA 1ET6A 3BYYB 3RUIB 1V1PA 4XDDA 3W1SA 2KT7A 1GNUA 4OZBA 1WXAA 2FCSA 2LZ6A 4ZRQA 3IXSA 4NAWB 1K52A 2N9KA 4MGYE 2BYEA 4K7SA 2BTEA 3PV1A 4GDLA 4GOCA 1VD2A 4W9FA 3ZJUA 1YJ1A 2WNMA 4YTPB 1V8CA 1JCKB 2LGSA 2GMIC 1WH3A 4IM2A 2QDFA 2V0GA 3AM9A 3ZIMA 1N62A 1Y56A 1BT0A 3NVZA 3WAMA 3ZW3A 1D5ZC 1F2RC 5DPWA 2DWQA 3MJ5A 5IKCM 4YT0B 2KHWB 2L00B 3ZJVA 2IYDB 4KSLC 3RZFA 4ICVA 1H8CA 1IGDA 3L13A 3W1SC 3T3OA 1D5XC 1WM2A 3IHPC 2D11A 4PT5A 1EU3A 2VRRB 3BYTB 2J0MA 1MFWA 3HM3A 3PLUA 1ROEA 1D4BA 4EEWA 1WF9A 2KN5A 2WU2B 2KDIA 4W9LA 1ZE3D 3QIJA 2K22A 3QCAA 4FN2A 3C19A 4I6PA 2MJ3A 4WJPA 1KRHA 2CJOA 1Y8RC 3A1QA 2ZVNA 1WMHA 2JZZA 3L0WB 5J2RA 4GGQA 2KFKB 4XGAB 2BKFA 1XXGA 2KMAA 3ZQ4A 2R61A 1E8WA 2XK5A 5IN7A 1B9RA 1KF6B 3AEAB 3AEFB 3AMZA 4LNNA 1WJUA 4US9A 3UGBB 2IGGA 4PYZA 1NI3A 2HE7A 1V49A 2KTRB 2O6VD 3DBRB 2KOXA 1QKZA 2NTTA 3IG3A 2RDHA 4N9F4 1WJ6A 2PE9A 3NOBA 5BMHA 2J53A 4HVBA 2K8BA 3QJZA 1UUPA 1GPXA 4MACA 1P98A 1WXSA 2LHEA 4F8CB 4ZYSA 4II2B 1RYJA 4KGTA 2EKEC 3Q3MC 1MG8A 2CR5A 1UELA 4TMAB 4GSWA 2BYVE 4PYUA 2O6VB 2BB6A 1SGHA 2FE8A 1WGKA 1FXTB 3FKYA 4RF0A 5LXHA 2BYFA 3AEDB 1V97A 1Z2MA 2PLPA 5GMVA 2MJEA 3JSVB 4M01A 3AE7B 3N1YC 1YMHE 4US8A 2PMVA 5E6OA 3RNFC 1C9FA 2NBVB 4JIOU 1UF0A 2M1MA 3BWUD 3RYTA 3EHVA 3EA6A 3V6CB 2NS5A 2CU1A 5BYRA 1L4DB 3ZLZA 3K9OB 2KMMA 2NBWB 3M63B 1WY8A 4TV3A 2J7QB 3H1UA 2ZW0A 2HD5B 1ISNA 1L5PA 1ZXIA 4RGMA 4IWPA 3DDCB 2NMQA 3PS6A 1YQ4B 5FR6A 4URKA 4KZ0A 2IBIB 2WHIA 1V6EA 4HCPB 4C80A 2BWES 1ET9A 1WWTA 4IKGA 1YJIA 5KHOA 1Q0WB 5H8YE 3L54A 1LFDA 2DHZA 2D5GA 4ACFA 4L23A 3B2GA 1FRRA 1EF1A 1L6VA 3NJTA 3MJWA 4GU2A 1WXQA 2IO3B 2JUOA 2RSUA 2KMCA 2Y5CA 3U30A 1V9JA 1UD7A 4OZCA 1P9DU 4M0WB 2BB5A 2PTLA 1WGRA 3DVGX 2ON8A 4C4VA 2KQSA 2ZVOA 4MSMB 2NPTB 1VJKA 4ANWA 2VH2A 1NYRA 5CX3A 3U7ZA 3NS8A 1KM7A 2OOBB 1QT9A 1F52A 1F1HA 1I42A 3N1ZC 5G5HA 4GB9A 5HG2A 2KKCA 3ZGZA 2I1KA 2MHJA 2AL3A 4KZCA 3W2DA 1SIFA 2EKIA 4GDKA 2ZJDA 3LXFA 2NR2A 1QLBB 1GUAB 3VUWA 2XN9C 2NVUI 1PFDA 2INCC 1HEZE 1FFVA 3FAHA 1ZW7A 3TBLD 2BS4B 3DBLB 3PT2B 5AUKA 1RAXA 5H92C 4WWPA 1DOYA 2DZMA 2QC8A 2LJIA 2DYMA 3L08A 3V6EB 3I9V1 1V1PB 3KLSX 4AQ7A 3X23A 1ZUD2 3QK0A 1FXIA 3VR9B 4PK1A 1T0QC 4GXBA 1PGAA 2PKOA 1XCTL 2MX2A 1L2NA 2J52A 4ZHOA 2JU6X 1F0ZA 1TYGB 5G5GA 2LXAA 1D5MC 2KX0A 1UGMA 3KQ4A 2PJHA 4O1NA 2G45B 4C00A 3RPFC 4XZ4A 3H8HA 1R4MI 2V3SA 1T3QA 1T0YA 2G4DB 2QSDA 2JSVX 1IPGA 1SB3C 4WURA 2HJ8A 3OG5A 2JXXA 3PSEB 2DLBA 2FUG1 4MT5A 3KUDB 2RPQA 2V3PA 2WDRB 5AEKB 4N59A 2L32A 2MP2B 3TUOA 2LI5A 1MHXA 1XD3B 2CHZA 2KTRA 2WXLA 3Q3FA 4NAMA 3TEXA 4WQMA 4LNKA 3TCAA 3APFA 3AULA 4LLGM 3ZTDA 1M94A 3PVLA 4G0NB 2KANA 3P4RB 1X1MA 2IZVB 1TIFA 4P6VF 2LFIA 3B1LX 2KXJA 2REXA 4RF1A 2O6VA 1N5WA 3AH7A 2WXHA 1WMHB 2BVCA 4DDGD 4Q2JA 1TGZB 2G4SA 1E5WA 3U4EG 4NNJB 3DOWA 4I6LB 1WYGA 2ICIA 1DYQA 3JSVA 2FUHB 2XK5B 2X8XX 1L0XB 3APDA 4ZDVA 2L3ZA 3ZRFA 2N7DA 2WXKA 2GBMA 4TQ1A 1HZ6A 3N20C 2C5LC 3DBHI 2JWUA 5CHVC 2EELA 4H2AA 4MGIE 3VHTC 3ONSA 3QQ8B 1XCQL 5T8IA 1KH0A 5C3JB 4EUTA 2LVOA 2XEWA 2G9HD 2WDVB 1ENFA 1FXAA 4G3XB 4KDIC 2N9EB 3M3JA 2N9PC 2CHXA 4AS1A 1XF5L 1JW9D 2MCNB 2MBEA 2QILA 2ZCCA 1I4GA 1WJ4A 3VH4B 3IAM1 1N60A 3FILB 2M0XA 2VZKD 2KWCA 1KTKA 2HDEA 1NYQA 1XLQA 3DHHC 1E7PB 2DBYA 5D94A 3I63C 4QAYA 1WXVA 3MP9A 3DWMA 5L83A 1T6BX 2W9NA 3LYYA 2K0PA 1N63A 4MJSA 1WFYA 4WH4A 4M00A 2DAJA 4E3CA 2M0AA 5L95C 3QX1A 3Q3NC 4XDCA 5G2NA 2LUMA 2VZKB 4K1RB 2NPTA 4HJKA 4AWJA 2JZPA 2I1JA 4EZLA 3MC9A 1SBBB 4ZOHC 3E9SA 3NZUA 2LRWA 2EMTA 1WRDB 2WXFA 3AE6B 3AEGB 3Q8BA 2DYBA 3Q2AC 2W54A 2N9LA 2WDQB 1QQRA 2LXCA 4W9EA 1TZOA 4BFRA 4MDKE 1EU4A 4FHJA 3RNAC 3IAS1 3HK0A 1T5XD 3RMKC 3Q3OC 3WANA 4BOZB 3AECB 4DQOC 4FBJB 5HI1A 1EF5A 2SAKA 1AN8A 3B08A 1P0RA 2CKHB 4ICUA 4RCOA 1TS3A 4C4VB 4BAXA 5CHWA 2WXOA 1AARA 3OJ4B 1MJDA 3X0WA 4HJGE 4AP4C 1KLVA 4WAFA 1ZDXA 3ETRA 3AV8A 4WJNA 4XWTA 4LNOA 3EC8A 4IWOA 3P42A 1WGHA 2MBBB 3KW5B 2MBQA 5BMIA 3EFUA 3DWGC 3RN9C 1T0SC 1WZ3A 1WX7A 3DVNV 3ZNGC 1OEYA 1SE3A 4B9KA 2ZPNA 2RDGA 4A3PA 4EZKA 2V3NA 5D3DA 2WXPA 1U4AA 4GDKB 4LNIA 4PS3A 5IP4D 3ZYYX 3AB5A 1QOAA 3NVVA 1JWSD 4RGOS 4LDTD 3GP7A 2W3SA 1SIJA 2MLBA 2LGYA 5D3IB 4NJCA 3U52E 3V3XA 3W1YA 5JH5C 2AQ1B 3B0AA 1EM7A 1FNVA 1V81A 2C7MB 2JF5A 1CK1A 3HIZA 3ZKJC 5IA7A 2MP2A 2KAJA 4EE2A 2D2QA 4DHZB 2MH7A 4LDTB 3TL5A 1I4XA 1OQQA 1TT5B 3N1XC 2K6QA 2YLMA 3ZDMC 2YEPF 4P7IA 3B9JA 2MEKA 2KJ6A 4DHJB 1E8XA 5JXVA 2Y5BB 4LJPB 1E9MA 1GB4A 3U8ZA 1IGCA 3IT4B 1YX5B 1TS4A 3PTFC 1GJZA 4HEA1 3KUZA 4S0RA 4JPSA 4GIVA 2CU3A 3LDZE 2K25A 2L76A 1GC6A 1C4CA 2QHOA 1YX6B 4K7UA 1E6EB 2LMCA 3N3KB 2GRIA 5GXGB 4ANUA 2N0SB 3BVGA 4WQOB 3Q69A 1JALA 2INPE 1C1YB 1R4MB 4KIKA 1UBQA 1WX9A 1WJNA 1VR9A 4KGRA 2WXRA 2LD9A 2KDMA 2BS3B 1WIAA 3BVZA 4FJVB 3VDZA 1YQ3B 5BYQA 2W55A 2ZCBA 1VZ6A 4MELA 1I7HA 1WXMA 2WWZA 1BUIC 3NHEB 4A20A 3FILA 2RMMA 2DAFA 4LJOB 4WWMA 3AEEB 2WYQA 3O13A 2UYZB 3VR8B 3KWVA 4NQKE 3R66C 1QF6A 2LEKA 1Q1OA 4EKUA 3PZ8A 2DYOA 3TEYA 4RFBA 4IUMB 3LB8C 1XT9B 1UWMA 2FCQA 2M19A 3RI7C 2IJ0A 1GC7A 5HKHA 1IUEA 4HXDA 3ZO5B 4HKQA 1A70A 1IP9A 2O2VA
chains in the Genus database with same CATH topology
2PKOA 1XCTL 2WXJA 1C4PA 4C7ZA 2E6XA 2J52A 3AE4B 4ZHOA 2Q5WD 2JU6X 1ZDVA 1F0ZA 4ITKA 1TYGB 2WS3B 5G5GA 2I2YA 3SEBA 2N7JA 2OHFA 1D5MC 2LHDA 3KQ4A 3AE1B 4JE3B 1GAQB 3BVMA 1LO5D 3TEWA 2JYTA 1WSPA 4O1NA 1TS5A 3RPFC 1QOGA 4HROA 5TSSA 2TSSA 3H8HA 1YN3A 3R8BA 1T3QA 2I38A 2HTME 1AYFA 1EWYC 2QSDA 2JSVX 4P16A 1UNSA 3BZDB 1SB3C 2INNE 3J9CA 4WURA 3TEZA 3E56A 4L2YA 3W5UB 1J7AA 3OWEB 1ESFA 2DLBA 2FUG1 3GB1A 3PO0A 4LK0M 4MT5A 4IDIA 2JX5A 1IBXB 2V3PA 3AE8B 3PZ7A 2WDRB 4M0WA 1MI0A 4B0EA 1SXTA 4N59A 2L32A 3TUOA 2PVOD 3Q8CA 5BYSA 1RM6C 3AN1A 4L1BA 1MHXA 1TY2A 1C77A 1UGJA 1VRAB 2IGDA 3SR6A 2JXTA 1TKYA 2WXLA 2W82A 1JROA 4RNAA 4B0MA 3HVZA 5D7GA 4NAMA 3TEXA 1GB1A 4WQMA 1YN5A 2QIEB 1PUTA 2WXNA 4HRSA 1XEEA 3NZ3A 4N6EB 2X38A 2WQYB 2PW9A 1J7CA 3I57A 2BBCA 3P4PB 4LLGM 4OZAA 1Q10A 3ZJTA 1EWCA 4MM3B 1GOZA 3P4RB 2Y5PA 1HA5A 2FBWB 3R2IA 3VRAB 3V05A 4P6VF 1TS2A 2LGIA 4JWSC 1JQ4A 1TJEA 2LFIA 3WCQA 2BT6A 5C2TB 3NUHB 4MH8A 2H88B 4RF1A 5HFYA 3N9YC 3ABVB 1FNWA 1N5WA 3AH7A 2WXHA 2WLBA 2SEBD 3AE3B 4Q2JA 1SEBD 1RFKA 5I4DA 2KWDA 3U4EG 4A9AA 1WYGA 1HZ5A 2ICIA 1DYQA 1I4QA 4OVZA 2RPVA 1L0XB 1SJED 1VZ7A 1MPEA 5EE0A 5FR3A 2W3RA 4YXDB 1TKGA 1ET6A 3BYYB 1MVKA 4ARCA 3W5VB 1V1PA 4XDDA 2WXKA 4TQ1A 3W1SA 1HZ6A 4OZBA 2JWUA 2EELA 1V1OA 4H2AA 1CJEA 3CWIA 4RH6A 1JRPA 1XCQL 5T8IA 1KH0A 4ZRQA 3IXSA 4NAWB 5C3JB 1K52A 2N9KA 1SE2A 1WRIA 2G1EA 2BTEA 1FIQA 1JWBD 2G9HD 2WDVB 1FM0D 4C7YA 1ENFA 1FXAA 3ZJUA 1PGXA 2WNMA 4YTPB 1V8CA 1JCKB 4AS1A 1XF5L 2V0GA 1JW9D 3AM9A 4ARIA 1N62A 1Y56A 2WXIA 3CIRB 2PVGC 1FFUA 3Q8FA 3NVZA 5AUIA 2QILA 1D5ZC 4REZA 1I4GA 2NTSA 1F2RC 1N61A 2DWQA 3MJ5A 4USAA 3IAM1 1VDVA 1N60A 3FILB 1PGBA 1DOIA 4YT0B 5MPOA 3VQIA 3KWLA 2VZKD 2K9XA 1KTKA 2HDEA 3ZJVA 1NYQA 1XLQA 1E7PB 2DBYA 1IGDA 3NVWA 1KFYB 1ZP0B 1IBXA 1XLOA 3T3OA 1D5XC 3MP9A 1M4VA 3DWMA 2E3TA 4RGNA 2IGHA 2QEJC 1T6BX 4PT5A 3LYYA 1EU3A 3BYTB 4A55A 2CJNA 2K0PA 1N63A 2Y3AA 4WH4A 2M0AA 2XNAC 1ROEA 1D4BA 1JMLA 4FXCA 4XDCA 4GLSC 2KN4A 2PIAA 1C4AA 2LUMA 2JYEA 2VZKB 2WU2B 3EUB2 1KLUD 1ZE3D 2M56B 2WP9B 1NEKB 2K22A 2BS2B 1AWDA 2MJ3A 1CQVA 1R7SA 2JZPA 1SBBB 1KRHA 2CJOA 1SSNA 4ZOHC 3E9SA 1OFFA 1HXYD 5BMGA 3C8YA 2WXFA 1XLPA 2AQ2B 1TKEA 3AE6B 1ACCA 3AEGB 3Q8BA 3MC0B 2W54A 5EE3A 1XXGA 3ZQ4A 2R61A 2N9LA 1C79A 2ACZB 1ZOYB 2WDQB 1QQRA 2MJDA 3AEBB 1XLNA 1TZOA 1B9RA 1EU4A 1KF6B 3AEAB 1STEA 3AEFB 1SE4A 3AMZA 3IAS1 4US9A 1T5XD 3W9CB 1FD6A 2IGGA 3AECB 1NI3A 4DQOC 5HI1A 2OEDA 4DXFA 1QOBA 2SAKA 1AN8A 1VLBA 1I4HA 1QKZA 4ZHPA 2K5PA 2NTTA 4KKJA 2RDHA 5BMHA 2GB1A 4A6QA 4RCOA 2J53A 4CQNA 2L83A 1TS3A 1UUPA 1GPXA 4MACA 4YTNB 3SFEB 2LHEA 2WXOA 3AE9B 4IOIE 4ZYSA 4HJGE 3BIID 1SF0A 1RYJA 4KGTA 4YSYB 4WAFA 1ZDXA 3ETRA 3AV8A 4XWTA 1SJHD 1FEHA 3P1MA 3P42A 4YWGG 4TMAB 1AW7A 1C78A 2BB6A 2FE8A 5BMIA 3MFGA 3DWGC 1WGKA 4RF0A 1YN4A 1L0YB 1SE3A 3SFDB 3AEDB 1V97A 3BK1A 4A8XC 2RDGA 3BK2A 2PLPA 2MJEA 1FRDA 2V3NA 3UI3A 5D3DA 2WXPA 4GDKB 2L52A 3AE7B 1XO3A 1NENB 1YMHE 4OW0A 1B1ZA 3ZYYX 3AB5A 1L0VB 2IPKD 1QOAA 3NVVA 1JWSD 4TSSA 4US8A 2PMVA 4RGOS 3GP7A 1DOXA 2W3SA 4C56C 1SIJA 3VRBB 1D6EC 1C9FA 5D3IB 4NJCA 3U52E 3V3XA 3B2FA 1RWSA 2QMTA 3BWUD 2AQ1B 2IDYA 1K51A 1EM7A 1FNVA 1N5XA 3EA6A 4ZRPA 4JWUC 1CK1A 1FCLA 3NS1A 5BYRA 1L4DB 2KMMA 4GDLB 1K50A 5EE9A 2KAJA 3P4SB 4EE2A 2WU5B 2MH7A 3L4PA 2ZW0A 1I4XA 1OQQA 1L5PA 1ZXIA 4RGMA 2QJLA 1FO4A 2Z8LA 1FCCC 2YEPF 3Q8AA 4A90A 3B9JA 1PDXA 2NMQA 1TY0A 2MEKA 3GS2A 1YQ4B 3U2SC 3EGRA 5JXVA 2WXGA 4HKZE 2B76B 4OHJA 4C80A 1L6UA 1E9MA 1ET9A 1I4PA 1WWTA 4IKGA 1GB4A 1MHHE 1IGCA 3IT4B 1YJIA 1TS4A 4LTUA 3T3NA 2AX5A 3HVDA 4D2KA 1BMLC 2J42A 4HEA1 5H8YE 1PYWD 2D5GA 4YSZB 1YJJA 2K3UA 4L23A 3B2GA 1JWUD 1FRRA 4XE0A 4JPSA 1L6VA 1JWAD 2H89B 1QOFA 3RFZB 1WXQA 1VZ8A 2Y5CA 2CU3A 1UWXA 5FKAC 2BW2A 1C4CA 1NVID 1YNTE 4OZCA 1F2RI 1QILA 2BB5A 2PTLA 1ZPSA 1E6EB 2LMCA 2ON8A 3MHZA 1I4RA 2GRIA 5GXGB 2N0SB 3BVGA 2L1AA 5FK9C 4RGTA 2J4XA 1E0ZA 1VJKA 3Q69A 4WIPA 3IT6B 1JALA 1NYRA 4YSXB 1ZXHA 2INPE 3AE2B 1FMAD 1CZPA 3U7ZA 2WXQA 2AQ3B 4KGSA 5E6JA 1L4ZB 1VR9A 1QT9A 4KGRA 5LNK1 1KLGD 2WXRA 5G5HA 2WXMA 1DGJA 2KDMA 1E10A 5HG2A 2BS3B 4UDUC 3ZGZA 3BVZA 1HQRD 3Q8EA 1YQ3B 4XWWA 5BYQA 3W2DA 1C76A 2W55A 2EKIA 4JX1C 4YTMB 2ONQA 3LXFA 3TSSA 1FNUA 1VZ6A 3URYA 1I7HA 2ZW1A 1QLBB 5HHDG 2XN9C 3NRZA 1BUIC 2V4IB 2YEPB 1PFDA 1HEZE 1BXTA 1FFVA 3AE5B 3FAHA 3FILA 2RMMA 2BS4B 2BYTA 1P7EA 4WWMA 4NZLB 3AEEB 3O13A 3VR8B 3P4QB 5AUKA 1K53A 5H92C 3FC4A 3KWVA 4TQ0A 4KKIA 1DOYA 4N58A 1J7BA 3NVYA 5EE1A 2GI9A 1QF6A 2LJIA 2LEKA 2KACA 2DYMA 3PZ8A 3I9V1 2DYOA 1V1PB 3KLSX 3TEYA 4J3OD 4AQ7A 2JQRB 1P7FA 4RFBA 2KQ4X 3LB8C 1ZUD2 1UWMA 2M19A 3HRDD 1FXIA 2IJ0A 3HUIA 3P63A 3VR9B 4KX6B 1IUEA 4HKQA 1OQRA 4DXGA 1A70A 3R2TA 4R3DA 1JWMD 1F77A 1PGAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCT L;  2JWU A;  4IKG A;  2J52 A;  1GB4 A;  2EEL A;  1MHH E;  1IGC A;  2JU6 X;  1FD6 A;  1XCQ L;  1KH0 A;  2IGG A;  4D2K A;  1K52 A;  2N9K A;  5HI1 A;  2I2Y A;  2OED A;  2N7J A;  2LHD A;  1QKZ A;  1PGX A;  5BMH A;  2GB1 A;  2J53 A;  1UWX A;  2I38 A;  4MAC A;  1XF5 L;  2QSD A;  2JSV X;  2LHE A;  4IOI E;  4HJG E;  1YNT E;  4OZC A;  1F2R I;  2PTL A;  4KGT A;  2ON8 A;  1F2R C;  3GB1 A;  1IBX B;  3FIL B;  1PGB A;  1MI0 A;  5BMI A;  1ZXH A;  1IGD A;  1MHX A;  1IBX A;  2IGD A;  4KGS A;  3MP9 A;  2JXT A;  4KGR A;  2IGH A;  2PLP A;  3UI3 A;  1GB1 A;  2KDM A;  5HG2 A;  2K0P A;  1YMH E;  4WH4 A;  2PW9 A;  4OZA A;  1D4B A;  1Q10 A;  1JML A;  1C9F A;  2ONQ A;  3V3X A;  4GLS C;  2KN4 A;  2LUM A;  2QMT A;  2LGI A;  2ZW1 A;  1K51 A;  1EM7 A;  5HHD G;  5HFY A;  1HEZ E;  3FIL A;  2RMM A;  1FCL A;  1P7E A;  2JZP A;  1K50 A;  1K53 A;  2KWD A;  2ZW0 A;  2GI9 A;  2KAC A;  1HZ5 A;  5BMG A;  1FCC C;  1P7F A;  2NMQ A;  2RPV A;  2KQ4 X;  1MPE A;  1MVK A;  2N9L A;  5JXV A;  1PGA A;  1HZ6 A;  4HKZ E;  4OZB A; 
#chains in the Genus database with same CATH topology
 2MBO A;  2E6X A;  2KDF B;  3C0R B;  1ZDV A;  3UQA A;  4ZRK A;  4KV2 A;  2OHF A;  3K9P B;  2L8J A;  2JVC A;  4JE3 B;  2KZR A;  3ALB A;  1RRB A;  1LO5 D;  1WSP A;  5TSS A;  1WGD A;  3R8B A;  3ZXR A;  2HTM E;  1AYF A;  1UNS A;  1YOV B;  2FAZ A;  4EOY A;  3OWE B;  1ESF A;  3GB1 A;  5G55 A;  2XBB C;  3JVZ X;  3PZ7 A;  2AWT A;  4B0E A;  1J19 A;  3Q8C A;  1RM6 C;  3AN1 A;  4L1B A;  2V4L A;  1C77 A;  4MJS B;  2IGD A;  4B0M A;  1JRO A;  3D32 A;  1V80 A;  4HRS A;  2WXN A;  1XEE A;  2M4N A;  4N6E B;  2X38 A;  2DZJ A;  1Q10 A;  4MM3 B;  4FUL A;  2K1F A;  1TJE A;  5C2T B;  4GMV A;  4DDI D;  1WR6 E;  3N9Y C;  3R7Q A;  3ABV B;  1IYF A;  1FNW A;  5LLI A;  2CS4 A;  1V5T A;  2WLB A;  3AE3 B;  1SEB D;  3GE3 C;  5I4D A;  2KWD A;  2KJR A;  2GBN A;  2GBK A;  5DCN A;  2WDT B;  4OVZ A;  2RD0 A;  4TKN A;  4WAA A;  1SJE D;  2UWQ A;  3O65 B;  1WR1 A;  2JZ3 B;  3W5V B;  1WX8 A;  3ZNI D;  1MG4 A;  4RM9 A;  4RH6 A;  3PRZ A;  2MQJ A;  3OJ3 A;  2KO3 A;  1SE2 A;  4GN1 A;  1FM0 D;  4TUU A;  2JWZ A;  3TJP A;  4ARI A;  2WXI A;  3CIR B;  1E90 A;  3UIO B;  1FFU A;  4M8N A;  4MGZ E;  1QZE A;  1N61 A;  3VUX A;  2D3A A;  3RNB C;  1VDV A;  4FHK A;  1PGB A;  1DOI A;  3RD2 A;  5MPO A;  3KWL A;  2K9X A;  4II3 B;  3VUY A;  3NVW A;  1ZP0 B;  1XLO A;  4XYC A;  1M4V A;  3DCG A;  3SU8 X;  4RGN A;  2IGH A;  4HPM B;  3APC A;  2Z59 B;  1SE9 A;  4A55 A;  3LJ3 A;  2CJN A;  3QA8 A;  2Y3A A;  1CMX B;  2D3G A;  2XNA C;  2PEA A;  4MGK E;  3ZRC A;  3PRP B;  4FXC A;  4K3B A;  5CTR C;  4GLS C;  2KN4 A;  2PIA A;  1C4A A;  2IND C;  2JYE A;  2JT4 B;  3DQV A;  3Q3J A;  2JPH A;  2WP9 B;  1NEK B;  2BS2 B;  4CHK A;  1AWD A;  2BKR B;  4KVG B;  3UQB A;  4FAD A;  2KDB A;  3MHS D;  4HLE A;  3NY5 A;  1SSN A;  1OFF A;  1NDD A;  2KDE B;  1F9J A;  3C8Y A;  1XLP A;  1ACC A;  4KDL B;  1LQB A;  2ACZ B;  3WAO A;  3PHW B;  3AEB B;  1XLN A;  4NPN A;  4RM8 A;  1WGG A;  2KQ7 A;  5BO4 B;  3A33 B;  1STE A;  1SE4 A;  2KD0 A;  1WM3 A;  4JLC A;  4DXF A;  2J0K A;  3QAR A;  4ZHP A;  2ASQ A;  2VH1 A;  5AZF A;  4G11 A;  4HCN B;  2L83 A;  4MSQ B;  1NBF C;  3SFE B;  4IOI E;  3BII D;  3Q6B A;  1SJH D;  3P1M A;  4YWG G;  2ZZP B;  4KIK B;  1AW7 A;  3NZS A;  5TR5 A;  1A5R A;  1C78 A;  5J18 A;  3RNC C;  1KJT A;  5AZG A;  1L0Y B;  3BK1 A;  4A8X C;  1S3S G;  2BGF A;  2K8H A;  4IM3 A;  4E74 A;  1FRD A;  3UI3 A;  2KC2 A;  3EFC A;  1XO3 A;  1NEN B;  4OW0 A;  1B1Z A;  3GE8 C;  2IPK D;  4TSS A;  2N1W A;  1KOT A;  3VRB B;  3HM6 X;  2BF8 B;  1RWS A;  2QMT A;  3WAP A;  1WI0 A;  3NG0 A;  1RFA A;  3RT3 B;  3RUL A;  2MW5 A;  4ZRP A;  5DPS A;  4BKG A;  3PRM B;  1TTN A;  2IO2 B;  1K50 A;  5EE9 A;  2WU5 B;  2KWV B;  3JYU A;  4ANV A;  2QJL A;  2Z8L A;  3Q8A A;  4A90 A;  1PDX A;  2O2V B;  2KVZ A;  2AEH A;  1TY0 A;  3T9L A;  4BKS D;  3A9J B;  3EGR A;  4MM3 A;  2BQQ A;  1NI2 A;  4HKZ E;  4OHJ A;  1L6U A;  5C23 A;  5E6N A;  3T3N A;  2AX5 A;  1BML C;  2J42 A;  2WX0 A;  3IVF A;  1VZ8 A;  1UWX A;  5E6P A;  4P1C C;  2BW2 A;  4FJZ A;  1YQB A;  1YNT E;  1F2R I;  1QIL A;  1H4R A;  3MHZ A;  4J6I A;  1E0Z A;  3PLV A;  1LM8 B;  3AE2 B;  2IY1 B;  4JGH B;  1KLG D;  2KLG A;  2KK8 A;  4XWW A;  1C76 A;  4JX1 C;  4YTM B;  2G3Q B;  3TSS A;  1FNU A;  3SHQ A;  3URY A;  2PE6 B;  2ZW1 A;  5HHD G;  2RR9 A;  2GBR A;  2YEP B;  1TZ1 A;  1L7Y A;  4WWO A;  3VTW A;  3VVW B;  4NZL B;  3PZD A;  1K53 A;  3FC4 A;  4M8M A;  4KKI A;  3DHG C;  3GZN I;  1J7B A;  5EE1 A;  2KAC A;  2EMS A;  2LVQ A;  3PPA A;  1P7F A;  2KQ4 X;  1J8C A;  3HRD D;  3HUI A;  3A4R A;  3N30 A;  3P63 A;  2IO0 B;  4W9C A;  4AOF A;  5JHB A;  4DHJ D;  3VXW A;  1OQR A;  4DXG A;  3R2T A;  4R3D A;  1RLF A;  1JWM D;  1F77 A;  1ZKH A;  2WXJ A;  1C4P A;  2LAS A;  1UZX B;  3RNG C;  3AU5 A;  4DXA B;  4HK2 A;  4ITK A;  2WS3 B;  1WYW B;  2I2Y A;  1EUV B;  2MSE D;  3SDL C;  3KUC B;  1GAQ B;  4PS8 A;  3TEW A;  1TS5 A;  4NQL B;  1OQY A;  2JRI B;  1YN3 A;  2OJW A;  3VTV A;  4EFO A;  1EWY C;  1VCB A;  2INN E;  3J9C A;  4ZRJ A;  3TEZ A;  3E56 A;  4IM0 A;  4L2Y A;  3CSF A;  3W5U B;  4BZA A;  2A5U A;  3PO0 A;  1LXD A;  5IOI A;  4IDI A;  3V62 A;  3A4S C;  1V2Y A;  5IAA C;  1MI0 A;  1OGW A;  2HJ1 A;  4KSK C;  3H7P B;  2PVO D;  5BYS A;  2C9W B;  3QC8 B;  1TY2 A;  1VRA B;  5JHA A;  2JXT A;  1YIW A;  1TKY A;  2KNB A;  2W82 A;  2ZEQ A;  5D7G A;  1GB1 A;  1YN5 A;  5EDS A;  2QIE B;  3MTN B;  4W9D A;  2WQY B;  1J7C A;  3I57 A;  2BBC A;  3P4P B;  1EWC A;  1UBI A;  2RDB C;  1HA5 A;  2FBW B;  3VRA B;  3V05 A;  4AJW A;  4JWS C;  3BIN A;  2CHW A;  1OTR B;  1Q5W B;  3WCQ A;  2BT6 A;  3CMM B;  3NUH B;  4PS7 A;  5HFY A;  1E8Z A;  3KH0 A;  1XQQ A;  4LNF A;  4W9H A;  2HTH A;  2SEB D;  1V5O A;  2JY6 A;  4BKT A;  3V61 A;  2DEN B;  2MBH A;  1I4Q A;  3WAL A;  2RPV A;  5AZH A;  2C7H A;  4OVV A;  1Z5S B;  1MVK A;  4ARC A;  1R4N I;  3ENE A;  2NBU A;  4WWN A;  3KYC D;  1V1O A;  1WZ0 A;  3QAQ A;  1CJE A;  3ECI A;  3CWI A;  1JRP A;  2DNF A;  4OVU A;  3HHM A;  1WRI A;  2G1E A;  1FIQ A;  1JWB D;  2K8C A;  4C7Y A;  2FNJ B;  3UIP B;  2MRP A;  1PGX A;  2ZNV C;  3TIX A;  4P1B C;  4FLH A;  2PVG C;  3Q8F A;  3V60 A;  3PHX B;  2A4Z A;  5AUI A;  3A9J A;  4REZ A;  3AU4 A;  2NTS A;  2C7N B;  4USA A;  3A9K B;  4LCD E;  4HWI B;  2V9H A;  3VQI A;  3ZUN A;  2DX5 B;  1J0G A;  4EZJ A;  1KFY B;  1IBX A;  3VTU A;  2E3T A;  2QEJ C;  3DBH B;  1HTQ A;  2IO1 B;  2MA9 B;  1C3T A;  2N9X A;  4BKS A;  2LRU A;  2DZK A;  3RCZ A;  1JML A;  3KVF B;  3IFW B;  2M8S A;  3P2B A;  3EUB 2;  1KLU D;  2M56 B;  3H6N A;  4FA6 A;  1CQV A;  1R7S A;  4ASW C;  3CST A;  4RMA A;  3H9D A;  3PRE A;  4I6N B;  3WIM A;  1HXY D;  1EO6 A;  5BMG A;  1E7U A;  2D3B A;  3WA0 A;  1HTO A;  2AQ2 B;  1TKE A;  3MC0 B;  5EE3 A;  1I35 A;  4E71 A;  3OAW A;  1LGR A;  1C79 A;  3KYD D;  1ZOY B;  2MJD A;  3OLM D;  3QWZ B;  4BBN F;  4AUQ C;  1E7V A;  3W9C B;  3ZNH B;  1FD6 A;  1GG3 A;  1WGY A;  2OED A;  1QOB A;  3AI5 A;  5DPT A;  1VLB A;  1I4H A;  4YL8 A;  2K5P A;  4NAW A;  4KKJ A;  2GB1 A;  4A6Q A;  4CQN A;  2N1V A;  4YTN B;  4NJ7 A;  1TBE A;  1P1A A;  3L16 A;  3AE9 B;  3EEC A;  5KHQ A;  1SF0 A;  4YSY B;  1UH6 A;  2R2Q A;  1FEH A;  3R3M A;  3DHI C;  3GOE A;  4WJO A;  3MFG A;  3N32 A;  4IC7 B;  2D10 A;  1YN4 A;  4F1S A;  4B6W A;  1K8R B;  3ZXV A;  3SFD B;  3BK2 A;  2L52 A;  2Z0D B;  3DVG Y;  1L0V B;  3U7D A;  3T8M A;  1DOX A;  4C56 C;  1D6E C;  4JL9 A;  4ZRI A;  3B2F A;  2C60 A;  2IDY A;  1K51 A;  4JQW C;  5IO9 A;  4HDO A;  1N5X A;  2KX3 A;  3ZNZ B;  4IG7 B;  4JWU C;  1FCL A;  3NS1 A;  4GDL B;  3H7P A;  2MWS B;  1S1Q B;  3P4S B;  4HPP A;  3L4P A;  3UIN B;  3DBS A;  1ZGU B;  1FO4 A;  1FCC C;  2RGF A;  3M95 A;  4DBG A;  2GOW A;  4F7Z A;  3DBR I;  3GS2 A;  3U2S C;  2WGS A;  2JRH A;  2L7R A;  2B3A A;  4XC2 A;  2BPS A;  2WXG A;  2KFK A;  2B76 B;  2KC1 A;  1I4P A;  3VFK A;  3GZN B;  1MHH E;  1V86 A;  4LTU A;  4HDQ A;  3HVD A;  4D2K A;  3ZDT A;  2AYO B;  1P3Q U;  1PYW D;  4YSZ B;  2KLC A;  1YJJ A;  2K3U A;  1JWU D;  4K3C A;  4XE0 A;  3PGE A;  3SD5 A;  1JWA D;  2DZI A;  2H89 B;  1QOF A;  3ML9 A;  3RNE C;  4FJY A;  3RFZ B;  2GBJ A;  2KVR A;  4W9I A;  3RZW C;  5FKA C;  4CO7 A;  4W9K A;  2KFJ A;  1NVI D;  1JRU A;  4XX5 A;  1ZPS A;  4MH0 E;  2FCM A;  1I4R A;  2L1A A;  5FK9 C;  4RGT A;  2J4X A;  4CYE A;  4WIP A;  3IT6 B;  3L10 B;  4S17 A;  4YSX B;  1ZXH A;  1FMA D;  2N4F A;  4K81 A;  1CZP A;  3AXC A;  2WXQ A;  2AQ3 B;  4KGS A;  5E6J A;  3A1Q B;  4BVU C;  2KWU B;  1L4Z B;  3IBE A;  2KJH B;  5LNK 1;  2LJ5 A;  2BWF A;  2WXM A;  1DGJ A;  3ZVV A;  2K6D B;  4HPL B;  3M62 B;  1E10 A;  4UDU C;  1HQR D;  2J0J A;  3Q8E A;  1E8Y A;  2NCN A;  2LGX A;  3L17 A;  2V1Y A;  2K39 A;  4IW0 A;  2ONQ A;  2ZNV B;  2LWP A;  2LGD A;  3I5J C;  3NRZ A;  1N6Z A;  2V4I B;  1BXT A;  5J17 A;  3AE5 B;  1WE7 A;  3A9K A;  2FID A;  3DVN U;  2BYT A;  1P7E A;  3P4Q B;  4TQ0 A;  5C1Z A;  2GLS A;  4WJQ A;  2L0F A;  4N58 A;  2D07 B;  3H7S A;  3NVY A;  2GI9 A;  1D3Z A;  1G6J A;  2ZPY A;  3UF8 A;  4W9J A;  2L0T A;  2KTF A;  2L05 A;  4J3O D;  2JQR B;  3MC8 A;  3S2A A;  3ML8 A;  2OJR A;  4M02 A;  5LXI B;  4G50 A;  2M17 A;  4MEM A;  4KX6 B;  1T0R C;  4ANX A;  4W9G A;  3JW0 X;  3ZTC A;  4C7Z A;  3AE4 B;  2Q5W D;  2LUE A;  3Q14 C;  2YVC A;  2AL6 A;  3SEB A;  2N7J A;  2LHD A;  3AE1 B;  3DPD A;  3BVM A;  3R7R A;  2JYT A;  1R4N B;  1QOG A;  2QCZ A;  1PQS A;  4HRO A;  2TSS A;  5CHF A;  1WE6 A;  2I38 A;  3TMP B;  4P16 A;  3BZD B;  3VAW A;  2IY0 B;  1J7A A;  3I3T B;  4LK0 M;  4A3O A;  5D2M B;  2JX5 A;  1OEY J;  1IBX B;  3AE8 B;  2N7E A;  2UU7 A;  4M0W A;  1SXT A;  4K7W A;  4BBN C;  4DK5 A;  2D3C A;  1UGJ A;  3SR6 A;  4DWF A;  4RNA A;  4IWQ A;  3HVZ A;  3QHT A;  1PUT A;  3DBL I;  3CF6 E;  3NZ3 A;  1YD8 U;  2Z0E B;  2FCN A;  2PW9 A;  4OZA A;  3ZJT A;  1GOZ A;  2Y5P A;  3R2I A;  5D6J B;  1TS2 A;  2LGI A;  2WX1 A;  1JQ4 A;  4NY0 A;  4AJY B;  4MH8 A;  2H88 B;  2PPH A;  5JZE B;  2KYW A;  3VH3 B;  4BOS C;  4ZYN A;  1RFK A;  4NJ6 A;  4B95 A;  4A9A A;  4DHZ E;  1HZ5 A;  2R2O A;  2FIF A;  3BY4 B;  5DPR A;  1VZ7 A;  2LVP A;  1MPE A;  1FPY A;  5EE0 A;  5FR3 A;  2W3R A;  4X57 B;  1HE8 A;  4YXD B;  1TKG A;  1ET6 A;  3BYY B;  3RUI B;  1V1P A;  4XDD A;  3W1S A;  2KT7 A;  1GNU A;  4OZB A;  1WXA A;  2FCS A;  2LZ6 A;  4ZRQ A;  3IXS A;  4NAW B;  1K52 A;  2N9K A;  4MGY E;  2BYE A;  4K7S A;  2BTE A;  3PV1 A;  4GDL A;  4GOC A;  1VD2 A;  4W9F A;  3ZJU A;  1YJ1 A;  2WNM A;  4YTP B;  1V8C A;  1JCK B;  2LGS A;  2GMI C;  1WH3 A;  4IM2 A;  2QDF A;  2V0G A;  3AM9 A;  3ZIM A;  1N62 A;  1Y56 A;  1BT0 A;  3NVZ A;  3WAM A;  3ZW3 A;  1D5Z C;  1F2R C;  5DPW A;  2DWQ A;  3MJ5 A;  5IKC M;  4YT0 B;  2KHW B;  2L00 B;  3ZJV A;  2IYD B;  4KSL C;  3RZF A;  4ICV A;  1H8C A;  1IGD A;  3L13 A;  3W1S C;  3T3O A;  1D5X C;  1WM2 A;  3IHP C;  2D11 A;  4PT5 A;  1EU3 A;  2VRR B;  3BYT B;  2J0M A;  1MFW A;  3HM3 A;  3PLU A;  1ROE A;  1D4B A;  4EEW A;  1WF9 A;  2KN5 A;  2WU2 B;  2KDI A;  4W9L A;  1ZE3 D;  3QIJ A;  2K22 A;  3QCA A;  4FN2 A;  3C19 A;  4I6P A;  2MJ3 A;  4WJP A;  1KRH A;  2CJO A;  1Y8R C;  3A1Q A;  2ZVN A;  1WMH A;  2JZZ A;  3L0W B;  5J2R A;  4GGQ A;  2KFK B;  4XGA B;  2BKF A;  1XXG A;  2KMA A;  3ZQ4 A;  2R61 A;  1E8W A;  2XK5 A;  5IN7 A;  1B9R A;  1KF6 B;  3AEA B;  3AEF B;  3AMZ A;  4LNN A;  1WJU A;  4US9 A;  3UGB B;  2IGG A;  4PYZ A;  1NI3 A;  2HE7 A;  1V49 A;  2KTR B;  2O6V D;  3DBR B;  2KOX A;  1QKZ A;  2NTT A;  3IG3 A;  2RDH A;  4N9F 4;  1WJ6 A;  2PE9 A;  3NOB A;  5BMH A;  2J53 A;  4HVB A;  2K8B A;  3QJZ A;  1UUP A;  1GPX A;  4MAC A;  1P98 A;  1WXS A;  2LHE A;  4F8C B;  4ZYS A;  4II2 B;  1RYJ A;  4KGT A;  2EKE C;  3Q3M C;  1MG8 A;  2CR5 A;  1UEL A;  4TMA B;  4GSW A;  2BYV E;  4PYU A;  2O6V B;  2BB6 A;  1SGH A;  2FE8 A;  1WGK A;  1FXT B;  3FKY A;  4RF0 A;  5LXH A;  2BYF A;  3AED B;  1V97 A;  1Z2M A;  2PLP A;  5GMV A;  2MJE A;  3JSV B;  4M01 A;  3AE7 B;  3N1Y C;  1YMH E;  4US8 A;  2PMV A;  5E6O A;  3RNF C;  1C9F A;  2NBV B;  4JIO U;  1UF0 A;  2M1M A;  3BWU D;  3RYT A;  3EHV A;  3EA6 A;  3V6C B;  2NS5 A;  2CU1 A;  5BYR A;  1L4D B;  3ZLZ A;  3K9O B;  2KMM A;  2NBW B;  3M63 B;  1WY8 A;  4TV3 A;  2J7Q B;  3H1U A;  2ZW0 A;  2HD5 B;  1ISN A;  1L5P A;  1ZXI A;  4RGM A;  4IWP A;  3DDC B;  2NMQ A;  3PS6 A;  1YQ4 B;  5FR6 A;  4URK A;  4KZ0 A;  2IBI B;  2WHI A;  1V6E A;  4HCP B;  4C80 A;  2BWE S;  1ET9 A;  1WWT A;  4IKG A;  1YJI A;  5KHO A;  1Q0W B;  5H8Y E;  3L54 A;  1LFD A;  2DHZ A;  2D5G A;  4ACF A;  4L23 A;  3B2G A;  1FRR A;  1EF1 A;  1L6V A;  3NJT A;  3MJW A;  4GU2 A;  1WXQ A;  2IO3 B;  2JUO A;  2RSU A;  2KMC A;  2Y5C A;  3U30 A;  1V9J A;  1UD7 A;  4OZC A;  1P9D U;  4M0W B;  2BB5 A;  2PTL A;  1WGR A;  3DVG X;  2ON8 A;  4C4V A;  2KQS A;  2ZVO A;  4MSM B;  2NPT B;  1VJK A;  4ANW A;  2VH2 A;  1NYR A;  5CX3 A;  3U7Z A;  3NS8 A;  1KM7 A;  2OOB B;  1QT9 A;  1F52 A;  1F1H A;  1I42 A;  3N1Z C;  5G5H A;  4GB9 A;  5HG2 A;  2KKC A;  3ZGZ A;  2I1K A;  2MHJ A;  2AL3 A;  4KZC A;  3W2D A;  1SIF A;  2EKI A;  4GDK A;  2ZJD A;  3LXF A;  2NR2 A;  1QLB B;  1GUA B;  3VUW A;  2XN9 C;  2NVU I;  1PFD A;  2INC C;  1HEZ E;  1FFV A;  3FAH A;  1ZW7 A;  3TBL D;  2BS4 B;  3DBL B;  3PT2 B;  5AUK A;  1RAX A;  5H92 C;  4WWP A;  1DOY A;  2DZM A;  2QC8 A;  2LJI A;  2DYM A;  3L08 A;  3V6E B;  3I9V 1;  1V1P B;  3KLS X;  4AQ7 A;  3X23 A;  1ZUD 2;  3QK0 A;  1FXI A;  3VR9 B;  4PK1 A;  1T0Q C;  4GXB A;  1PGA A;  2PKO A;  1XCT L;  2MX2 A;  1L2N A;  2J52 A;  4ZHO A;  2JU6 X;  1F0Z A;  1TYG B;  5G5G A;  2LXA A;  1D5M C;  2KX0 A;  1UGM A;  3KQ4 A;  2PJH A;  4O1N A;  2G45 B;  4C00 A;  3RPF C;  4XZ4 A;  3H8H A;  1R4M I;  2V3S A;  1T3Q A;  1T0Y A;  2G4D B;  2QSD A;  2JSV X;  1IPG A;  1SB3 C;  4WUR A;  2HJ8 A;  3OG5 A;  2JXX A;  3PSE B;  2DLB A;  2FUG 1;  4MT5 A;  3KUD B;  2RPQ A;  2V3P A;  2WDR B;  5AEK B;  4N59 A;  2L32 A;  2MP2 B;  3TUO A;  2LI5 A;  1MHX A;  1XD3 B;  2CHZ A;  2KTR A;  2WXL A;  3Q3F A;  4NAM A;  3TEX A;  4WQM A;  4LNK A;  3TCA A;  3APF A;  3AUL A;  4LLG M;  3ZTD A;  1M94 A;  3PVL A;  4G0N B;  2KAN A;  3P4R B;  1X1M A;  2IZV B;  1TIF A;  4P6V F;  2LFI A;  3B1L X;  2KXJ A;  2REX A;  4RF1 A;  2O6V A;  1N5W A;  3AH7 A;  2WXH A;  1WMH B;  2BVC A;  4DDG D;  4Q2J A;  1TGZ B;  2G4S A;  1E5W A;  3U4E G;  4NNJ B;  3DOW A;  4I6L B;  1WYG A;  2ICI A;  1DYQ A;  3JSV A;  2FUH B;  2XK5 B;  2X8X X;  1L0X B;  3APD A;  4ZDV A;  2L3Z A;  3ZRF A;  2N7D A;  2WXK A;  2GBM A;  4TQ1 A;  1HZ6 A;  3N20 C;  2C5L C;  3DBH I;  2JWU A;  5CHV C;  2EEL A;  4H2A A;  4MGI E;  3VHT C;  3ONS A;  3QQ8 B;  1XCQ L;  5T8I A;  1KH0 A;  5C3J B;  4EUT A;  2LVO A;  2XEW A;  2G9H D;  2WDV B;  1ENF A;  1FXA A;  4G3X B;  4KDI C;  2N9E B;  3M3J A;  2N9P C;  2CHX A;  4AS1 A;  1XF5 L;  1JW9 D;  2MCN B;  2MBE A;  2QIL A;  2ZCC A;  1I4G A;  1WJ4 A;  3VH4 B;  3IAM 1;  1N60 A;  3FIL B;  2M0X A;  2VZK D;  2KWC A;  1KTK A;  2HDE A;  1NYQ A;  1XLQ A;  3DHH C;  1E7P B;  2DBY A;  5D94 A;  3I63 C;  4QAY A;  1WXV A;  3MP9 A;  3DWM A;  5L83 A;  1T6B X;  2W9N A;  3LYY A;  2K0P A;  1N63 A;  4MJS A;  1WFY A;  4WH4 A;  4M00 A;  2DAJ A;  4E3C A;  2M0A A;  5L95 C;  3QX1 A;  3Q3N C;  4XDC A;  5G2N A;  2LUM A;  2VZK B;  4K1R B;  2NPT A;  4HJK A;  4AWJ A;  2JZP A;  2I1J A;  4EZL A;  3MC9 A;  1SBB B;  4ZOH C;  3E9S A;  3NZU A;  2LRW A;  2EMT A;  1WRD B;  2WXF A;  3AE6 B;  3AEG B;  3Q8B A;  2DYB A;  3Q2A C;  2W54 A;  2N9L A;  2WDQ B;  1QQR A;  2LXC A;  4W9E A;  1TZO A;  4BFR A;  4MDK E;  1EU4 A;  4FHJ A;  3RNA C;  3IAS 1;  3HK0 A;  1T5X D;  3RMK C;  3Q3O C;  3WAN A;  4BOZ B;  3AEC B;  4DQO C;  4FBJ B;  5HI1 A;  1EF5 A;  2SAK A;  1AN8 A;  3B08 A;  1P0R A;  2CKH B;  4ICU A;  4RCO A;  1TS3 A;  4C4V B;  4BAX A;  5CHW A;  2WXO A;  1AAR A;  3OJ4 B;  1MJD A;  3X0W A;  4HJG E;  4AP4 C;  1KLV A;  4WAF A;  1ZDX A;  3ETR A;  3AV8 A;  4WJN A;  4XWT A;  4LNO A;  3EC8 A;  4IWO A;  3P42 A;  1WGH A;  2MBB B;  3KW5 B;  2MBQ A;  5BMI A;  3EFU A;  3DWG C;  3RN9 C;  1T0S C;  1WZ3 A;  1WX7 A;  3DVN V;  3ZNG C;  1OEY A;  1SE3 A;  4B9K A;  2ZPN A;  2RDG A;  4A3P A;  4EZK A;  2V3N A;  5D3D A;  2WXP A;  1U4A A;  4GDK B;  4LNI A;  4PS3 A;  5IP4 D;  3ZYY X;  3AB5 A;  1QOA A;  3NVV A;  1JWS D;  4RGO S;  4LDT D;  3GP7 A;  2W3S A;  1SIJ A;  2MLB A;  2LGY A;  5D3I B;  4NJC A;  3U52 E;  3V3X A;  3W1Y A;  5JH5 C;  2AQ1 B;  3B0A A;  1EM7 A;  1FNV A;  1V81 A;  2C7M B;  2JF5 A;  1CK1 A;  3HIZ A;  3ZKJ C;  5IA7 A;  2MP2 A;  2KAJ A;  4EE2 A;  2D2Q A;  4DHZ B;  2MH7 A;  4LDT B;  3TL5 A;  1I4X A;  1OQQ A;  1TT5 B;  3N1X C;  2K6Q A;  2YLM A;  3ZDM C;  2YEP F;  4P7I A;  3B9J A;  2MEK A;  2KJ6 A;  4DHJ B;  1E8X A;  5JXV A;  2Y5B B;  4LJP B;  1E9M A;  1GB4 A;  3U8Z A;  1IGC A;  3IT4 B;  1YX5 B;  1TS4 A;  3PTF C;  1GJZ A;  4HEA 1;  3KUZ A;  4S0R A;  4JPS A;  4GIV A;  2CU3 A;  3LDZ E;  2K25 A;  2L76 A;  1GC6 A;  1C4C A;  2QHO A;  1YX6 B;  4K7U A;  1E6E B;  2LMC A;  3N3K B;  2GRI A;  5GXG B;  4ANU A;  2N0S B;  3BVG A;  4WQO B;  3Q69 A;  1JAL A;  2INP E;  1C1Y B;  1R4M B;  4KIK A;  1UBQ A;  1WX9 A;  1WJN A;  1VR9 A;  4KGR A;  2WXR A;  2LD9 A;  2KDM A;  2BS3 B;  1WIA A;  3BVZ A;  4FJV B;  3VDZ A;  1YQ3 B;  5BYQ A;  2W55 A;  2ZCB A;  1VZ6 A;  4MEL A;  1I7H A;  1WXM A;  2WWZ A;  1BUI C;  3NHE B;  4A20 A;  3FIL A;  2RMM A;  2DAF A;  4LJO B;  4WWM A;  3AEE B;  2WYQ A;  3O13 A;  2UYZ B;  3VR8 B;  3KWV A;  4NQK E;  3R66 C;  1QF6 A;  2LEK A;  1Q1O A;  4EKU A;  3PZ8 A;  2DYO A;  3TEY A;  4RFB A;  4IUM B;  3LB8 C;  1XT9 B;  1UWM A;  2FCQ A;  2M19 A;  3RI7 C;  2IJ0 A;  1GC7 A;  5HKH A;  1IUE A;  4HXD A;  3ZO5 B;  4HKQ A;  1A70 A;  1IP9 A;  2O2V A; 
#chains in the Genus database with same CATH homology
 2PKO A;  1XCT L;  2WXJ A;  1C4P A;  4C7Z A;  2E6X A;  2J52 A;  3AE4 B;  4ZHO A;  2Q5W D;  2JU6 X;  1ZDV A;  1F0Z A;  4ITK A;  1TYG B;  2WS3 B;  5G5G A;  2I2Y A;  3SEB A;  2N7J A;  2OHF A;  1D5M C;  2LHD A;  3KQ4 A;  3AE1 B;  4JE3 B;  1GAQ B;  3BVM A;  1LO5 D;  3TEW A;  2JYT A;  1WSP A;  4O1N A;  1TS5 A;  3RPF C;  1QOG A;  4HRO A;  5TSS A;  2TSS A;  3H8H A;  1YN3 A;  3R8B A;  1T3Q A;  2I38 A;  2HTM E;  1AYF A;  1EWY C;  2QSD A;  2JSV X;  4P16 A;  1UNS A;  3BZD B;  1SB3 C;  2INN E;  3J9C A;  4WUR A;  3TEZ A;  3E56 A;  4L2Y A;  3W5U B;  1J7A A;  3OWE B;  1ESF A;  2DLB A;  2FUG 1;  3GB1 A;  3PO0 A;  4LK0 M;  4MT5 A;  4IDI A;  2JX5 A;  1IBX B;  2V3P A;  3AE8 B;  3PZ7 A;  2WDR B;  4M0W A;  1MI0 A;  4B0E A;  1SXT A;  4N59 A;  2L32 A;  3TUO A;  2PVO D;  3Q8C A;  5BYS A;  1RM6 C;  3AN1 A;  4L1B A;  1MHX A;  1TY2 A;  1C77 A;  1UGJ A;  1VRA B;  2IGD A;  3SR6 A;  2JXT A;  1TKY A;  2WXL A;  2W82 A;  1JRO A;  4RNA A;  4B0M A;  3HVZ A;  5D7G A;  4NAM A;  3TEX A;  1GB1 A;  4WQM A;  1YN5 A;  2QIE B;  1PUT A;  2WXN A;  4HRS A;  1XEE A;  3NZ3 A;  4N6E B;  2X38 A;  2WQY B;  2PW9 A;  1J7C A;  3I57 A;  2BBC A;  3P4P B;  4LLG M;  4OZA A;  1Q10 A;  3ZJT A;  1EWC A;  4MM3 B;  1GOZ A;  3P4R B;  2Y5P A;  1HA5 A;  2FBW B;  3R2I A;  3VRA B;  3V05 A;  4P6V F;  1TS2 A;  2LGI A;  4JWS C;  1JQ4 A;  1TJE A;  2LFI A;  3WCQ A;  2BT6 A;  5C2T B;  3NUH B;  4MH8 A;  2H88 B;  4RF1 A;  5HFY A;  3N9Y C;  3ABV B;  1FNW A;  1N5W A;  3AH7 A;  2WXH A;  2WLB A;  2SEB D;  3AE3 B;  4Q2J A;  1SEB D;  1RFK A;  5I4D A;  2KWD A;  3U4E G;  4A9A A;  1WYG A;  1HZ5 A;  2ICI A;  1DYQ A;  1I4Q A;  4OVZ A;  2RPV A;  1L0X B;  1SJE D;  1VZ7 A;  1MPE A;  5EE0 A;  5FR3 A;  2W3R A;  4YXD B;  1TKG A;  1ET6 A;  3BYY B;  1MVK A;  4ARC A;  3W5V B;  1V1P A;  4XDD A;  2WXK A;  4TQ1 A;  3W1S A;  1HZ6 A;  4OZB A;  2JWU A;  2EEL A;  1V1O A;  4H2A A;  1CJE A;  3CWI A;  4RH6 A;  1JRP A;  1XCQ L;  5T8I A;  1KH0 A;  4ZRQ A;  3IXS A;  4NAW B;  5C3J B;  1K52 A;  2N9K A;  1SE2 A;  1WRI A;  2G1E A;  2BTE A;  1FIQ A;  1JWB D;  2G9H D;  2WDV B;  1FM0 D;  4C7Y A;  1ENF A;  1FXA A;  3ZJU A;  1PGX A;  2WNM A;  4YTP B;  1V8C A;  1JCK B;  4AS1 A;  1XF5 L;  2V0G A;  1JW9 D;  3AM9 A;  4ARI A;  1N62 A;  1Y56 A;  2WXI A;  3CIR B;  2PVG C;  1FFU A;  3Q8F A;  3NVZ A;  5AUI A;  2QIL A;  1D5Z C;  4REZ A;  1I4G A;  2NTS A;  1F2R C;  1N61 A;  2DWQ A;  3MJ5 A;  4USA A;  3IAM 1;  1VDV A;  1N60 A;  3FIL B;  1PGB A;  1DOI A;  4YT0 B;  5MPO A;  3VQI A;  3KWL A;  2VZK D;  2K9X A;  1KTK A;  2HDE A;  3ZJV A;  1NYQ A;  1XLQ A;  1E7P B;  2DBY A;  1IGD A;  3NVW A;  1KFY B;  1ZP0 B;  1IBX A;  1XLO A;  3T3O A;  1D5X C;  3MP9 A;  1M4V A;  3DWM A;  2E3T A;  4RGN A;  2IGH A;  2QEJ C;  1T6B X;  4PT5 A;  3LYY A;  1EU3 A;  3BYT B;  4A55 A;  2CJN A;  2K0P A;  1N63 A;  2Y3A A;  4WH4 A;  2M0A A;  2XNA C;  1ROE A;  1D4B A;  1JML A;  4FXC A;  4XDC A;  4GLS C;  2KN4 A;  2PIA A;  1C4A A;  2LUM A;  2JYE A;  2VZK B;  2WU2 B;  3EUB 2;  1KLU D;  1ZE3 D;  2M56 B;  2WP9 B;  1NEK B;  2K22 A;  2BS2 B;  1AWD A;  2MJ3 A;  1CQV A;  1R7S A;  2JZP A;  1SBB B;  1KRH A;  2CJO A;  1SSN A;  4ZOH C;  3E9S A;  1OFF A;  1HXY D;  5BMG A;  3C8Y A;  2WXF A;  1XLP A;  2AQ2 B;  1TKE A;  3AE6 B;  1ACC A;  3AEG B;  3Q8B A;  3MC0 B;  2W54 A;  5EE3 A;  1XXG A;  3ZQ4 A;  2R61 A;  2N9L A;  1C79 A;  2ACZ B;  1ZOY B;  2WDQ B;  1QQR A;  2MJD A;  3AEB B;  1XLN A;  1TZO A;  1B9R A;  1EU4 A;  1KF6 B;  3AEA B;  1STE A;  3AEF B;  1SE4 A;  3AMZ A;  3IAS 1;  4US9 A;  1T5X D;  3W9C B;  1FD6 A;  2IGG A;  3AEC B;  1NI3 A;  4DQO C;  5HI1 A;  2OED A;  4DXF A;  1QOB A;  2SAK A;  1AN8 A;  1VLB A;  1I4H A;  1QKZ A;  4ZHP A;  2K5P A;  2NTT A;  4KKJ A;  2RDH A;  5BMH A;  2GB1 A;  4A6Q A;  4RCO A;  2J53 A;  4CQN A;  2L83 A;  1TS3 A;  1UUP A;  1GPX A;  4MAC A;  4YTN B;  3SFE B;  2LHE A;  2WXO A;  3AE9 B;  4IOI E;  4ZYS A;  4HJG E;  3BII D;  1SF0 A;  1RYJ A;  4KGT A;  4YSY B;  4WAF A;  1ZDX A;  3ETR A;  3AV8 A;  4XWT A;  1SJH D;  1FEH A;  3P1M A;  3P42 A;  4YWG G;  4TMA B;  1AW7 A;  1C78 A;  2BB6 A;  2FE8 A;  5BMI A;  3MFG A;  3DWG C;  1WGK A;  4RF0 A;  1YN4 A;  1L0Y B;  1SE3 A;  3SFD B;  3AED B;  1V97 A;  3BK1 A;  4A8X C;  2RDG A;  3BK2 A;  2PLP A;  2MJE A;  1FRD A;  2V3N A;  3UI3 A;  5D3D A;  2WXP A;  4GDK B;  2L52 A;  3AE7 B;  1XO3 A;  1NEN B;  1YMH E;  4OW0 A;  1B1Z A;  3ZYY X;  3AB5 A;  1L0V B;  2IPK D;  1QOA A;  3NVV A;  1JWS D;  4TSS A;  4US8 A;  2PMV A;  4RGO S;  3GP7 A;  1DOX A;  2W3S A;  4C56 C;  1SIJ A;  3VRB B;  1D6E C;  1C9F A;  5D3I B;  4NJC A;  3U52 E;  3V3X A;  3B2F A;  1RWS A;  2QMT A;  3BWU D;  2AQ1 B;  2IDY A;  1K51 A;  1EM7 A;  1FNV A;  1N5X A;  3EA6 A;  4ZRP A;  4JWU C;  1CK1 A;  1FCL A;  3NS1 A;  5BYR A;  1L4D B;  2KMM A;  4GDL B;  1K50 A;  5EE9 A;  2KAJ A;  3P4S B;  4EE2 A;  2WU5 B;  2MH7 A;  3L4P A;  2ZW0 A;  1I4X A;  1OQQ A;  1L5P A;  1ZXI A;  4RGM A;  2QJL A;  1FO4 A;  2Z8L A;  1FCC C;  2YEP F;  3Q8A A;  4A90 A;  3B9J A;  1PDX A;  2NMQ A;  1TY0 A;  2MEK A;  3GS2 A;  1YQ4 B;  3U2S C;  3EGR A;  5JXV A;  2WXG A;  4HKZ E;  2B76 B;  4OHJ A;  4C80 A;  1L6U A;  1E9M A;  1ET9 A;  1I4P A;  1WWT A;  4IKG A;  1GB4 A;  1MHH E;  1IGC A;  3IT4 B;  1YJI A;  1TS4 A;  4LTU A;  3T3N A;  2AX5 A;  3HVD A;  4D2K A;  1BML C;  2J42 A;  4HEA 1;  5H8Y E;  1PYW D;  2D5G A;  4YSZ B;  1YJJ A;  2K3U A;  4L23 A;  3B2G A;  1JWU D;  1FRR A;  4XE0 A;  4JPS A;  1L6V A;  1JWA D;  2H89 B;  1QOF A;  3RFZ B;  1WXQ A;  1VZ8 A;  2Y5C A;  2CU3 A;  1UWX A;  5FKA C;  2BW2 A;  1C4C A;  1NVI D;  1YNT E;  4OZC A;  1F2R I;  1QIL A;  2BB5 A;  2PTL A;  1ZPS A;  1E6E B;  2LMC A;  2ON8 A;  3MHZ A;  1I4R A;  2GRI A;  5GXG B;  2N0S B;  3BVG A;  2L1A A;  5FK9 C;  4RGT A;  2J4X A;  1E0Z A;  1VJK A;  3Q69 A;  4WIP A;  3IT6 B;  1JAL A;  1NYR A;  4YSX B;  1ZXH A;  2INP E;  3AE2 B;  1FMA D;  1CZP A;  3U7Z A;  2WXQ A;  2AQ3 B;  4KGS A;  5E6J A;  1L4Z B;  1VR9 A;  1QT9 A;  4KGR A;  5LNK 1;  1KLG D;  2WXR A;  5G5H A;  2WXM A;  1DGJ A;  2KDM A;  1E10 A;  5HG2 A;  2BS3 B;  4UDU C;  3ZGZ A;  3BVZ A;  1HQR D;  3Q8E A;  1YQ3 B;  4XWW A;  5BYQ A;  3W2D A;  1C76 A;  2W55 A;  2EKI A;  4JX1 C;  4YTM B;  2ONQ A;  3LXF A;  3TSS A;  1FNU A;  1VZ6 A;  3URY A;  1I7H A;  2ZW1 A;  1QLB B;  5HHD G;  2XN9 C;  3NRZ A;  1BUI C;  2V4I B;  2YEP B;  1PFD A;  1HEZ E;  1BXT A;  1FFV A;  3AE5 B;  3FAH A;  3FIL A;  2RMM A;  2BS4 B;  2BYT A;  1P7E A;  4WWM A;  4NZL B;  3AEE B;  3O13 A;  3VR8 B;  3P4Q B;  5AUK A;  1K53 A;  5H92 C;  3FC4 A;  3KWV A;  4TQ0 A;  4KKI A;  1DOY A;  4N58 A;  1J7B A;  3NVY A;  5EE1 A;  2GI9 A;  1QF6 A;  2LJI A;  2LEK A;  2KAC A;  2DYM A;  3PZ8 A;  3I9V 1;  2DYO A;  1V1P B;  3KLS X;  3TEY A;  4J3O D;  4AQ7 A;  2JQR B;  1P7F A;  4RFB A;  2KQ4 X;  3LB8 C;  1ZUD 2;  1UWM A;  2M19 A;  3HRD D;  1FXI A;  2IJ0 A;  3HUI A;  3P63 A;  3VR9 B;  4KX6 B;  1IUE A;  4HKQ A;  1OQR A;  4DXG A;  1A70 A;  3R2T A;  4R3D A;  1JWM D;  1F77 A;  1PGA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...