1IGCA

Igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
58
structure length
58
Chain Sequence
b'AVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGG1-KAPPA MOPC21 FAB (LIGHT CHAIN)
publication title The third IgG-binding domain from streptococcal protein G. An analysis by X-ray crystallography of the structure alone and in a complex with Fab.
pubmed doi rcsb
source organism Mus musculus
molecule tags Complex (antibody/binding protein)
total genus 15
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 1994-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01378 IgG_binding_B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.10 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1igcA00
1KH0A 3UI3A 1GB4A 2IGHA 3GB1A 2IGDA 3MP9A 4HKZE 4OZBA 2GB1A 2JSVX 1FD6A 1XCQL 2JZPA 5JXVA 2KWDA 1K50A 2KN4A 5BMGA 3FILB 5BMHA 1EM7A 1C9FA 1FCLA 1FCCC 1IGCA 1PGBA 2JWUA 1IGDA 4IKGA 1IBXA 1HEZE 1K51A 1MHXA 2EELA 2I38A 4WH4A 1PGAA 2PLPA 1HZ6A 2J52A 2OEDA 1UWXA 2N9KA 2RPVA 4KGSA 2J53A 1JMLA 4KGRA 2QMTA 2KDMA 1GB1A 1YMHE 4IOIE 5HHDG 1ZXHA 2K0PA 4KGTA 4HJGE 2LHEA 2ZW1A 1P7EA 1K53A 4OZAA 2PTLA 1XCTL 1YNTE 1HZ5A 2LUMA 2RMMA 4GLSC 1MHHE 1D4BA 1PGXA 3FILA 4D2KA 2ON8A 5BMIA 1K52A 1MVKA 2IGGA 1Q10A 2QSDA 2ZW0A 2GI9A 2PW9A 2ONQA 5HG2A 2N9LA 2LHDA 1IBXB 4MACA 1MPEA 2NMQA 2KACA 5HFYA 1F2RI 2JXTA 2I2YA 3V3XA 1MI0A 2KQ4X 1QKZA 1F2RC 1XF5L 1P7FA 2JU6X 5HI1A 4OZCA 2N7JA 2LGIA
chains in the Genus database with same CATH superfamily
5IP4D 1T0QC 2N9PC 1BT0A 2KFKB 4KIKA 3RNEC 3P4RB 2DLBA 3PZ8A 5AUIA 2FIDA 2GBMA 2LGDA 4MH8A 3QWZB 1FCCC 5H92C 1UWMA 4YWGG 1D3ZA 3ZRFA 2MJDA 2BB6A 3V61A 2KT7A 1MHXA 4MSMB 4P6VF 2D10A 2AWTA 2QJLA 3P4QB 4OVZA 2ICIA 3AE1B 1JROA 4MH0E 2GBKA 1HZ6A 1FNWA 1KJTA 4M0WB 3H1UA 1IUEA 2WXQA 5KHOA 2KNBA 2DAJA 3PZ7A 5FK9C 1ZPSA 1F0ZA 4GB9A 1ZGUB 4KGTA 4BKSA 1KTKA 2JQRB 5AZHA 4DBGA 4BKGA 3GP7A 1WYWB 3NOBA 5J18A 2J0JA 2ZNVB 2BYVE 4IWPA 2Z0EB 4GLSC 2IO2B 3BWUD 4JE3B 4RH6A 2KOXA 1QQRA 1WZ0A 2FCNA 1V97A 2Y5BB 5AZGA 2YVCA 2D2QA 4LNFA 4ICUA 4US8A 2HDEA 2BBCA 1SE2A 2WHIA 3MC8A 1OEYA 2KLCA 3HHMA 2M56B 4NJ7A 5EE1A 1T5XD 5EE0A 5BYRA 3WALA 3QARA 2AEHA 4AWJA 2ZVOA 4OW0A 4WJPA 1PFDA 3UIOB 4CHKA 2KMAA 1J7CA 2M0XA 4EZJA 4G0NB 1H4RA 2HJ1A 1JRUA 4HKQA 4YT0B 3LXFA 4F7ZA 1OQYA 1NVID 3ZDTA 2KC2A 2D07B 2WXOA 4FA6A 3SU8X 2V9HA 2MSED 2WLBA 1IGDA 2O6VB 4A20A 4PS3A 1I42A 2OOBB 2YEPF 3RNFC 4P1CC 2FBWB 1NDDA 2D3AA 2WXIA 2LWPA 3ZW3A 2N7EA 3PT2B 1GC7A 5CTRC 4A3PA 3HIZA 1GB1A 2BKRB 3KWVA 3GE8C 2KQ7A 1WSPA 2O6VD 3R7QA 1JW9D 2PKOA 1BXTA 2KVRA 4K1RB 4KX6B 4N58A 5C1ZA 3RD2A 2L3ZA 3VTVA 1F52A 3VUYA 3RNBC 4DK5A 3AEAB 4B9KA 3VTUA 2PW9A 1RAXA 4GIVA 3NVZA 1MPEA 3QC8B 5IO9A 3N1XC 1Q5WB 1TKEA 1LQBA 4ZRJA 3VRBB 1F2RI 2XK5B 3Q2AC 1QKZA 1YJJA 3RPFC 1WF9A 1I4GA 2CHXA 2JU6X 5L95C 2EMTA 5T8IA 1I7HA 5FKAC 3N30A 4ZRQA 1T0SC 1GNUA 2MWSB 4O1NA 2GBRA 3RNAC 4PS7A 1YD8U 1YN3A 4REZA 1L0YB 3Q3JA 2QIEB 4TQ1A 2R2QA 4M01A 2EKEC 5JXVA 5E6PA 1WMHA 3L54A 1ENFA 2KN5A 2EKIA 1JALA 3TEXA 2W9NA 5J2RA 3LB8C 2CS4A 5TR5A 4ZHOA 2EELA 1KOTA 4DXGA 1ZW7A 1NYRA 2PLPA 4ANXA 1C1YB 2OEDA 3PRMB 1V5OA 2INDC 2RPVA 3PGEA 2L0TA 1V1PA 3BVGA 1XEEA 4XE0A 2LASA 2X8XX 3SFEB 1VZ6A 2IYDB 3IAM1 3Q3MC 1WFYA 3AE5B 4CQNA 1UGMA 1XCTL 5JZEB 3WIMA 1ET6A 4K7SA 4KIKB 3CIRB 4JGHB 3PHWB 2DAFA 4KKIA 4EZKA 4I6LB 4IM3A 3Q8BA 3NVWA 2QSDA 3MC9A 4YTPB 1DOIA 3N32A 5HG2A 2LHDA 3OG5A 1XLQA 4XWWA 4MACA 2IY0B 1KM7A 3B0AA 2NBVB 4LDTB 1SGHA 4DHZB 3TEZA 2IJ0A 1I4HA 4L23A 3T3NA 2NTSA 3AE3B 3PV1A 2AQ3B 4TKNA 3BK1A 4HDOA 4OHJA 5HI1A 4ITKA 1JRPA 4JWUC 4W9KA 2KK8A 2LGIA 2L76A 2PPHA 2XNAC 2G1EA 5J17A 1I4QA 4ASWC 3UINB 2GB1A 2QILA 3P4PB 2PE9A 4WQMA 2KWDA 3C19A 2JX5A 4TUUA 3U2SC 1TS5A 2GMIC 1YN5A 1I4XA 2HD5B 3A1QB 3D32A 1HTOA 2IZVB 3M62B 2DZIA 1LM8B 4HEA1 1DYQA 5JHBA 2IBIB 4EUTA 2JRHA 4IC7B 2DNFA 1K51A 2JXXA 3VAWA 3IG3A 3VUWA 4E3CA 1AW7A 3UQBA 1UWXA 4XX5A 3FAHA 2KJRA 4BZAA 3A4SC 4RFBA 4YTMB 2BWFA 4GDKB 3W1SA 4FJVB 2VH2A 2M19A 4HROA 2H89B 2WDRB 4GGQA 2ZEQA 2MBBB 1R4NI 2MLBA 1FRRA 3VFKA 1T3QA 3AV8A 3QAQA 3GOEA 1EF1A 2K22A 2J0KA 2NBUA 2ZCCA 4NNJB 4G11A 1WIAA 3RN9C 2JRIB 1HQRD 2DYMA 2PE6B 5BMIA 2BVCA 1YQ4B 1XXGA 1NBFC 3ZVVA 2IGGA 4BFRA 3V05A 2KWCA 1FNUA 2RDGA 3EFUA 3JVZX 3NZUA 3PREA 3UGBB 2BW2A 2BTEA 2V4IB 1PYWD 4WWOA 2NMQA 1E6EB 5HFYA 4NJ6A 3NVVA 4BAXA 4FLHA 2KC1A 2PVGC 3HVZA 3AH7A 1WR6E 5DPRA 1L6UA 3DVNU 1HTQA 1V8CA 4JWSC 4HXDA 2WXKA 1RRBA 2BKFA 2L83A 3DWGC 2FCQA 4WJNA 2QC8A 2BB5A 1VJKA 1QT9A 1C4CA 1WGGA 4XDCA 2RPQA 4H2AA 4LNIA 2FE8A 4W9IA 4OZBA 2D3GA 3RCZA 2W82A 1XLNA 2NVUI 5BMHA 2B3AA 1WJNA 1RYJA 3JYUA 1N5XA 4IDIA 4FN2A 4RMAA 3KUZA 3RULA 1GG3A 3TEYA 3N9YC 1GAQB 4E74A 2K6QA 4RGOS 2K25A 2GRIA 4FULA 4F8CB 3AEDB 4MM3A 3CSTA 1SSNA 2HJ8A 4LNKA 4AOFA 2LJ5A 2J7QB 1GC6A 4GMVA 2MBOA 4FHKA 5GMVA 4ZDVA 3Q8EA 4FJYA 2WXLA 3PS6A 2Y5CA 2M8SA 2V3SA 1C77A 4DWFA 2MCNB 2JUOA 1SB3C 2WU5B 3PLUA 1WMHB 3PZDA 2WXPA 3ZIMA 4J6IA 1RLFA 3M3JA 2KO3A 1J0GA 3AE7B 4YSXB 3HUIA 2E6XA 2WDVB 1WM2A 5EDSA 4FJZA 2EMSA 4JPSA 1TKGA 1TS2A 4K7WA 4WIPA 1EWYC 4HPLB 4ZRIA 1V49A 2GBNA 5AZFA 4PYZA 1V1PB 4XYCA 3RNCC 1TY0A 5DPWA 2JT4B 2SEBD 5BO4B 2LVPA 2KTRA 3AE9B 2JVCA 4JQWC 3M95A 2MRPA 3HM3A 3UI3A 3AB5A 1B9RA 2X38A 4KKJA 5G5GA 3H7PA 1T0YA 1Y56A 1FXIA 5DCNA 2RDHA 2RSUA 4RGNA 1N62A 1XCQL 4KSLC 2K3UA 1OEYJ 1P98A 1P3QU 3MJ5A 2NPTA 3DQVA 1YOVB 1PDXA 2IO0B 2H88B 3DVGX 2RGFA 2KVZA 1ROEA 3QA8A 1LGRA 2GLSA 4NQKE 4MT5A 2ZJDA 3IVFA 2BS2B 2AL6A 2KDMA 1V2YA 3NY5A 3ALBA 1NI2A 1ZXHA 1S3SG 2KXJA 1H8CA 2K8HA 1ZOYB 2PVOD 2BQQA 1KLUD 1P7EA 2MQJA 2NTTA 4NZLB 3TUOA 2WX1A 5DPTA 1ZP0B 2Z8LA 1JWMD 4GOCA 4S17A 1YX6B 3X0WA 1FFVA 4LCDE 3WA0A 3ZO5B 5C3JB 2IO3B 2WXJA 1GJZA 4ACFA 4NAWA 4IM2A 2L0FA 1NEKB 2LI5A 2N9LA 1DOXA 1XT9B 2WXHA 3ZGZA 1ESFA 1YJIA 3DHIC 3PO0A 1E0ZA 2A4ZA 2M17A 2BYTA 2DBYA 2KX0A 2QEJC 5BYQA 3ZNID 2REXA 3BIID 2LRUA 3VR9B 3VHTC 4X57B 3ZYYX 3V62A 3RZWC 3ZNZB 4USAA 2ZVNA 3L17A 3BY4B 4B95A 1F1HA 4DHZE 1OTRB 2C9WB 2LXAA 3BK2A 3HM6X 3RI7C 1KF6B 3WAOA 3RNGC 3VTWA 3KVFB 1LXDA 1AYFA 1CK1A 2JY6A 1IGCA 1WX8A 3EC8A 3JSVA 4IKGA 3VR8B 1SF0A 2KDEB 2C7NB 1RM6C 2VZKB 4MJSA 2C7MB 2N9EB 5BYSA 4P1BC 2W3SA 4RNAA 1D5MC 4HVBA 3VDZA 1V9JA 1N61A 3QK0A 2N4FA 4MGYE 4KGSA 2WNMA 1E8ZA 1V86A 1JWAD 4GDLA 2KKCA 1OQRA 2FUG1 2JF5A 4URKA 5E6JA 3W2DA 3ZRCA 2CR5A 2PMVA 3H6NA 3ETRA 4KDLB 4QAYA 1V80A 2PTLA 5L83A 3I57A 2RR9A 2N1VA 3Q8AA 1JWUD 3TBLD 2K1FA 4B0MA 1D5ZC 3EFCA 2M1MA 1Q1OA 1FIQA 3E56A 1SE9A 1VD2A 1WXQA 4WAFA 5IOIA 3VQIA 1JWSD 2UWQA 4P7IA 1TYGB 2ONQA 3N20C 4XDDA 3PSEB 2RDBC 3WAMA 4BVUC 4XC2A 3KUCB 1OFFA 3IFWB 1K8RB 5D7GA 3MC0B 2KFJA 4C7YA 3L10B 1J19A 3CMMB 3J9CA 1UH6A 3W1YA 2K5PA 4HJKA 2MW5A 4ANUA 3KWLA 1CJEA 4C56C 2KANA 3Q69A 3MP9A 3QCAA 2WDQB 4ICVA 5IA7A 4RM9A 2KJHB 1MJDA 1WGYA 3FKYA 1E7UA 1WM3A 3IAS1 4WWNA 3IXSA 1QLBB 2RD0A 4DQOC 3IT4B 3ENEA 2AQ1B 2AQ2B 3EUB2 3N3KB 3NS1A 3OAWA 1LO5D 5LXIB 1E9MA 4AJWA 4FHJA 3WCQA 3Q14C 3L08A 3DDCB 4LNOA 1ZXIA 4PS8A 1I35A 3UF8A 2HE7A 3TJPA 2DZJA 4F1SA 2KTRB 1HE8A 3AEGB 5D94A 1TKYA 2M4NA 3U52E 4W9FA 3SFDB 3H7PB 4YSZB 3AEBB 1VRAB 4E71A 1J8CA 1I4PA 1WJUA 4RF0A 5HKHA 2BWES 3N1YC 2ON8A 2WXGA 2J42A 3EGRA 3NJTA 3AE8B 2KHWB 4M8MA 1X1MA 3R2IA 1KRHA 2KDIA 4C80A 2ZPNA 1BMLC 1ZDXA 3H9DA 3DHHC 4P16A 3ML9A 5JH5C 3V3XA 2BF8B 2WXNA 1WY8A 2KDFB 1XF5L 5AUKA 3AE4B 2KLGA 2WXMA 3ZDMC 2NS5A 4WJQA 3P63A 2INPE 1VDVA 1AARA 4XGAB 1C4PA 3SR6A 4JL9A 1FD6A 3V6CB 2LEKA 2LGYA 3V6EB 1WJ6A 3DBSA 3H8HA 3GZNB 4MEMA 3HK0A 1QOFA 4A6QA 4IWOA 3EA6A 1WGRA 2B76B 4FBJB 2MJEA 3W5UB 1WE7A 1R4MB 2INCC 1AN8A 1YN4A 2V3NA 5LXHA 3ZLZA 2KD0A 1WWTA 3Q8CA 4LDTD 3QIJA 1CZPA 4LTUA 4RM8A 5G5HA 1WX9A 2FUHB 3O65B 1YMHE 2DYOA 3SD5A 2R2OA 2JYTA 2ZNVC 1OQQA 3AEEB 2PJHA 3AM9A 4W9EA 1K53A 4BKSD 1KFYB 2CJOA 1HZ5A 1FO4A 4R3DA 4HPPA 4M0WA 5C2TB 4ANWA 3ZJUA 4C00A 4A3OA 3AMZA 4M02A 3M63B 2KX3A 2UYZB 2MBQA 4K3BA 4G50A 4BOSC 1Q10A 1TY2A 1YIWA 4JLCA 1WGHA 4AQ7A 3IT6B 2KTFA 2BT6A 1V5TA 2CHZA 4ARCA 3R7RA 4MJSB 1FM0D 3TEWA 4MGIE 2K8BA 4YL8A 4DXAB 1UZXB 1QOBA 5D2MB 3HRDD 4L1BA 1EF5A 2FAZA 4W9LA 4MGZE 2WP9B 1C3TA 3DBLB 5JHAA 4LNNA 4GDLB 2LVOA 3PRZA 2GOWA 5CHFA 3MFGA 1ZKHA 1A5RA 3OJ4B 2LUEA 4FADA 4HKZE 3V60A 2JSVX 3U30A 1DOYA 4DDGD 2KZRA 4PK1A 4ZOHC 4PYUA 1ZE3D 2R61A 2I1JA 3B1LX 1WRIA 3PLVA 2IPKD 3TSSA 2LD9A 4KV2A 3DBRI 1IBXA 2JZ3B 1HEZE 3AEFB 3QHTA 1J7BA 1U4AA 1AWDA 2TSSA 2LXCA 1QZEA 3I5JC 3C0RB 1E90A 2GBJA 3E9SA 1R7SA 4MELA 1JMLA 2G9HD 2K39A 2WU2B 4DXFA 3L16A 4OVUA 3SEBA 3WAPA 1YQ3B 2JPHA 4ZRKA 3H7SA 1TTNA 2ZW1A 4GU2A 3R8BA 1Y8RC 4DHJB 3FILA 5KHQA 1A70A 5IAAC 3ZKJC 4XZ4A 1MG8A 2FIFA 4D2KA 3QJZA 2SAKA 4EEWA 2L52A 3I9V1 4BKTA 4CYEA 1NENB 3NUHB 3SDLC 2BGFA 3ZUNA 1ET9A 4TMAB 3L13A 3BYYB 1T6BX 3AN1A 3ZNHB 2L8JA 2YEPB 2DHZA 4DHJD 3EECA 1T0RC 1N63A 1HA5A 1L4DB 3ZNGC 2N7JA 2LJIA 1KH0A 1E7PB 3AU5A 1WR1A 4EOYA 3DBHI 2M0AA 1IYFA 1WXSA 2WX0A 4NY0A 1QOAA 4I6NB 1SBBB 2KN4A 4MSQB 1UUPA 4W9DA 1WGDA 3B2FA 1FMAD 5G55A 3P1MA 2LRWA 3OJ3A 3PTFC 1CMXB 4ZHPA 4HWIB 2O2VA 4HLEA 1WGKA 2A5UA 1GPXA 2LZ6A 2ZPYA 4II3B 2KYWA 1E8YA 4PT5A 5D3DA 1N5WA 1UF0A 2YLMA 4IOIE 5EE9A 3FC4A 2ACZB 2Y5PA 2UU7A 2LVQA 4EFOA 1UGJA 1VZ8A 2KMMA 2RMMA 1KLGD 3ZTCA 1K52A 4N6EB 1MVKA 1SEBD 4XWTA 2L05A 2I1KA 1TIFA 4AP4C 2D3BA 4WJOA 3CSFA 3U7DA 3BYTB 3ZQ4A 4MGKE 2QHOA 5FR3A 2JXTA 2I2YA 2KWVB 2E3TA 2KQ4X 2KMCA 1P7FA 1XD3B 3NG0A 1SE4A 3PRPB 4AUQC 1P0RA 2G4SA 1VZ7A 2MP2A 1GB4A 3GB1A 1WZ3A 4UDUC 2ZZPB 1XLOA 2OJWA 3L4PA 2N1WA 4GN1A 4B0EA 3NRZA 3P42A 3KYDD 1TS4A 2K9XA 2DWQA 5GXGB 1NYQA 1V6EA 3LYYA 4HDQA 2WYQA 4ARIA 3B2GA 1B1ZA 3VVWB 1DGJA 2MH7A 1WJ4A 1PGAA 3APCA 3JW0X 2PEAA 2J52A 2QDFA 3A1QA 1QILA 2QMTA 4IWQA 3VRAB 3DVGY 2LFIA 2KJ6A 1VCBA 4G3XB 3AE2B 2G45B 3BINA 4HK2A 4YXDB 4US9A 3DOWA 1SIFA 5G2NA 4JX1C 3CWIA 1MHHE 3R2TA 1TJEA 4GDKA 4WAAA 4BOZB 3RUIB 3DPDA 5FR6A 3DVNV 1YJ1A 4AJYB 2WGSA 3R66C 1IBXB 3TIXA 5MPOA 4A90A 2KACA 2VZKD 3U8ZA 3VH4B 2CHWA 2WS3B 4K81A 3N1ZC 3A9KA 5CHVC 4HCPB 2C7HA 2DYBA 4OZCA 3T3OA 1C76A 2WWZA 1EU4A 4ANVA 2KWUB 4W9JA 3T9LA 1ZDVA 1PUTA 3GE3C 3IHPC 1STEA 1K50A 5BMGA 3FILB 1EM7A 2MJ3A 2IO1B 2C60A 3L0WB 4MM3B 4FXCA 5IN7A 1L0VB 3ZTDA 3C8YA 1WH3A 3ZXVA 1TT5B 1UBIA 3VUXA 1YQBA 3RT3B 4II2B 4GXBA 3BVMA 3I63C 2BPSA 4AS1A 3URYA 4B6WA 5LNK1 1Z5SB 2D5GA 2BS4B 4I6PA 4NQLB 3PHXB 2OJRA 4C7ZA 1WXAA 2K0PA 4TQ0A 4IM0A 3Q3OC 3NZ3A 1D5XC 2KQSA 4EE2A 4YTNB 1HXYD 1M4VA 4DDID 3AULA 5I4DA 3OWEB 1ISNA 3AI5A 1D4BA 1UD7A 3RFZB 2W54A 3AECB 4LJPB 1TGZB 1F77A 3O13A 4K7UA 2G3QB 1UBQA 1SE3A 2XN9C 4TV3A 1F9JA 1MFWA 5CHWA 3APDA 4L2YA 2N7DA 1L2NA 2O2VB 2N9XA 2BYEA 2AL3A 4ZRPA 4KZCA 1J7AA 1E7VA 4WWMA 1P9DU 3AE6B 4C4VA 2L1AA 4JIOU 4WURA 3IBEA 4RGTA 4W9HA 2W55A 2QCZA 3RMKC 3A9JA 5EE3A 1UELA 1Q0WB 2BYFA 4M8NA 2NPTB 2Z0DB 1QOGA 5D6JB 1IPGA 1ACCA 2N0SB 3CF6E 5E6NA 1C9FA 1QF6A 5AEKB 3X23A 2FNJB 2MBEA 1L6VA 1PGBA 2NBWB 2JWUA 2V0GA 1FFUA 1RFKA 3KQ4A 3Q8FA 2I38A 5H8YE 1WX7A 4WH4A 1S1QB 3QQ8B 3UIPB 2PIAA 2N9KA 3AXCA 2WXFA 3I3TB 1C78A 3W5VB 1IP9A 1WE6A 5HHDG 5D3IB 3RZFA 3UQAA 4KDIC 4RF1A 1XLPA 5DPSA 4NAWB 1VR9A 2KFKA 2MP2B 4Q2JA 3APFA 1L7YA 1E5WA 1WYGA 1PGXA 2CU1A 4ZYNA 1V81A 3Q6BA 3ZJTA 1FRDA 4IUMB 2GI9A 1XO3A 3R3MA 1FEHA 3DHGC 3B9JA 3VH3B 1MG4A 3GZNI 3AU4A 4K3CA 3ABVB 4ZYSA 3K9OB 2C5LC 3W1SC 4EZLA 2LGXA 1R4NB 1E10A 3PPAA 1SJHD 3A4RA 1G6JA 4HRSA 1R4MI 4HCNB 4WQOB 2MA9B 3TMPB 2DZMA 2HTME 3ZJVA 3MJWA 4S0RA 1L0XB 2DX5B 3JSVB 3NVYA 4NJCA 3P2BA 4KSKC 2INNE 1EUVB 3BZDB 2IGHA 4J3OD 2IGDA 3BVZA 2WQYB 1SIJA 2K8CA 2JZPA 2MBHA 3S2AA 1WXMA 1ZUD2 4LJOB 5E6OA 2JYEA 1FCLA 1WI0A 3DCGA 3W9CB 3VXWA 3PVLA 2FCSA 1TZ1A 2D11A 3DWMA 3MHSD 4BBNF 3DBRB 2CKHB 4W9CA 4KVGB 1C4AA 4KGRA 2MX2A 2AYOB 2NCNA 3A9KB 3NZSA 1SJED 3KUDB 1SXTA 4TSSA 1EO6A 4HJGE 3K9PB 3ML8A 3LJ3A 4OZAA 1I4RA 3DBLI 4RGMA 1YNTE 2WDTB 4W9GA 2LUMA 4EKUA 1GUAB 2V1YA 2KDBA 1FPYA 4GSWA 2AX5A 2LMCA 2JZZA 2W3RA 5CX3A 3TCAA 1P1AA 2IY1B 2J0MA 1LFDA 1PQSA 2O6VA 3KH0A 4A9AA 3A33B 3EHVA 1KLVA 4A8XC 2OHFA 1TS3A 2FCMA 1E8XA 1UNSA 2K6DB 4HPMB 3QX1A 4N9F4 1YX5B 1FXAA 1RWSA 2D3CA 1TZOA 2L00B 4M00A 3HVDA 2VH1A 4RCOA 1D6EC 4BBNC 4NPNA 2L7RA 3NHEB 1F2RC 3KYCD 4CO7A 3NS8A 1OGWA 1FNVA 5C23A 4LLGM 2JWZA 4MDKE 5LLIA 1V1OA 2DZKA 4A55A 4IW0A 2J4XA 3Q3FA 1EU3A 3B08A 1CQVA 4OVVA 3LDZE 1FXTB 3DBHB 3WANA 1RFAA 2HTHA 3ECIA 4LK0M 1E8WA 1TBEA 2KAJA 4WWPA 2BS3B 5IKCM 2LGSA 2L32A 2XK5A 3P4SB 1N6ZA 2ZCBA 2J53A 4N59A 4C4VB 2Q5WD 2XEWA 2Y3AA 1WRDB 2LHEA 3KW5B 1JWBD 3A9JB 4KZ0A 3T8MA 1M94A 2ASQA 2XBBC 2CU3A 1BUIC 1NI3A 1XQQA 2WXRA 3MTNB 3Q3NC 3ZXRA 2IDYA 2ZW0A 3U4EG 4YSYB 1EWCA 1L5PA 1VLBA 3GS2A 3ONSA 4NAMA 2Z59B 1WXVA 2DENB 2MEKA 3MHZA 3U7ZA 2NR2A 1GOZA 1MI0A 1JCKB 3SHQA 4IG7B 3KLSX 2V3PA 2VRRB 2G4DB 3OLMD 2V4LA 1N60A 3RYTA 3TL5A 1Z2MA 2CJNA 1L4ZB 2MHJA 5TSSA 1JQ4A 1C79A
chains in the Genus database with same CATH topology
1C4CA 1VDVA 4XDCA 4H2AA 2FE8A 1C4PA 3P4RB 2DLBA 4OZBA 3SR6A 1ZDVA 1PUTA 3PZ8A 5AUIA 1FD6A 2W82A 1STEA 2LEKA 1XLNA 1K50A 5BMGA 3FILB 5BMHA 1EM7A 2MJ3A 4MH8A 1RYJA 3H8HA 4MM3B 1FCCC 5H92C 4FXCA 1N5XA 4IDIA 1QOFA 1UWMA 4A6QA 1L0VB 4YWGG 3EA6A 3C8YA 3TEYA 2B76B 3N9YC 2MJDA 1GAQB 2BB6A 2MJEA 3W5UB 1MHXA 4P6VF 4RGOS 2QJLA 3P4QB 4OVZA 2ICIA 3AE1B 1JROA 1AN8A 3BVMA 1YN4A 2V3NA 2GRIA 1HZ6A 1FNWA 4AS1A 1WWTA 3AEDB 3Q8CA 1IUEA 3URYA 5LNK1 1CZPA 2D5GA 4LTUA 2WXQA 1SSNA 5G5HA 2BS4B 3PZ7A 1YMHE 2DYOA 5FK9C 1ZPSA 4C7ZA 1F0ZA 2JYTA 2K0PA 1OQQA 3AEEB 4KGTA 4TQ0A 1KTKA 3NZ3A 3Q8EA 2JQRB 1D5XC 2WXLA 3AM9A 1K53A 3GP7A 4EE2A 1KFYB 2CJOA 2Y5CA 1HXYD 1HZ5A 4YTNB 4R3DA 1M4VA 1FO4A 4GLSC 1C77A 4M0WA 5I4DA 3OWEB 1D4BA 5C2TB 3BWUD 3RFZB 2W54A 1SB3C 3ZJUA 2WU5B 4JE3B 4RH6A 3AECB 3AMZA 1QQRA 3O13A 1F77A 1V97A 2WXPA 1Q10A 1TY2A 1SE3A 4US8A 2XN9C 4AQ7A 2HDEA 3IT6B 2BBCA 2BT6A 1SE2A 3AE7B 4L2YA 4YSXB 4ARCA 3HUIA 2E6XA 2WDVB 1FM0D 3TEWA 2M56B 4ZRPA 5EE1A 1QOBA 1T5XD 5EE0A 4JPSA 5BYRA 1TKGA 3HRDD 1TS2A 4L1BA 1J7AA 4WIPA 1EWYC 4WWMA 4OW0A 3AE6B 2WP9B 1PFDA 1J7CA 1V1PB 2L1AA 4WURA 1TY0A 4GDLB 4RGTA 2SEBD 2W55A 3AE9B 3MFGA 5EE3A 3UI3A 4HKQA 3AB5A 4YT0B 2X38A 3LXFA 4KKJA 1B9RA 5G5GA 1Y56A 1FXIA 1NVID 4HKZE 2RDHA 1QOGA 2JSVX 4RGNA 1N62A 1XCQL 1DOYA 2K3UA 1ACCA 2WXOA 2N0SB 4ZOHC 1C9FA 1QF6A 1ZE3D 2WLBA 2R61A 1WRIA 1L6VA 1PGBA 2IPKD 2JWUA 1IGDA 2V0GA 3TSSA 1FFUA 1IBXA 3MJ5A 1PDXA 1HEZE 2YEPF 2H88B 3AEFB 1RFKA 3KQ4A 1J7BA 3Q8FA 2FBWB 1AWDA 1ROEA 2I38A 2TSSA 5H8YE 4WH4A 2WXIA 4MT5A 2PIAA 2N9KA 3E9SA 2BS2B 1R7SA 1JMLA 2G9HD 2WXFA 2KDMA 2WU2B 1C78A 4DXFA 3W5VB 1GB1A 3SEBA 1YQ3B 5D3IB 3KWVA 5HHDG 1ZXHA 4RF1A 1XLPA 4NAWB 1VR9A 1WSPA 1ZOYB 2PVOD 2ZW1A 1KLUD 4Q2JA 1P7EA 2NTTA 1JW9D 4NZLB 3TUOA 2PKOA 3R8BA 1BXTA 1ZP0B 1WYGA 1PGXA 2Z8LA 3FILA 1A70A 1JWMD 4KX6B 4N58A 4D2KA 1FFVA 3ZJTA 5C3JB 2SAKA 2WXJA 1FRDA 3AEAB 2L52A 2GI9A 2PW9A 3I9V1 1NEKB 1NENB 1XO3A 3NUHB 1FEHA 3NVZA 2N9LA 1DOXA 1ET9A 2WXHA 3B9JA 1MPEA 4TMAB 3ZGZA 1ESFA 3BYYB 1T6BX 3AN1A 3ABVB 4ZYSA 1YJIA 1TKEA 3VRBB 1F2RI 2YEPB 3PO0A 1E0ZA 1E10A 1SJHD 1QKZA 1YJJA 2BYTA 3RPFC 2DBYA 4HRSA 1I4GA 2QEJC 1N63A 5BYQA 2JU6X 3BIID 5T8IA 1HA5A 1I7HA 1L4DB 5FKAC 3VR9B 4ZRQA 2HTME 3ZJVA 3ZYYX 1L0XB 2N7JA 2LJIA 1KH0A 3NVYA 4NJCA 4O1NA 2INNE 3BZDB 4USAA 2IGHA 1E7PB 4J3OD 2IGDA 1YN3A 3BVZA 4REZA 1L0YB 2WQYB 2M0AA 1SIJA 2QIEB 4TQ1A 1QOAA 3BK2A 1KF6B 1SBBB 2JZPA 5JXVA 2KN4A 1ZUD2 1UUPA 2JYEA 3B2FA 1ENFA 1FMAD 1FCLA 1AYFA 1CK1A 1IGCA 3P1MA 2EKIA 1JALA 3TEXA 3W9CB 4IKGA 3VR8B 4ZHPA 3LB8C 1SF0A 4ZHOA 1RM6C 2EELA 2VZKB 1WGKA 4DXGA 1GPXA 3DWMA 5BYSA 1NYRA 2PLPA 2W3SA 4RNAA 2OEDA 1D5MC 1N61A 2RPVA 4KGSA 1C4AA 2WNMA 4KGRA 4PT5A 1V1PA 5D3DA 1JWAD 1N5WA 1OQRA 3BVGA 1XEEA 4XE0A 3SFEB 1SJED 1VZ6A 4IOIE 3IAM1 5EE9A 2FUG1 3FC4A 1SXTA 4TSSA 4HJGE 2ACZB 5E6JA 2Y5PA 3AE5B 3W2DA 4CQNA 2PMVA 3ETRA 1UGJA 4OZAA 1I4RA 2PTLA 1XCTL 4RGMA 1VZ8A 1YNTE 2KMMA 3I57A 1ET6A 1JWUD 2LUMA 1KLGD 2RMMA 3Q8AA 4B0MA 3CIRB 1D5ZC 1VJKA 4KKIA 2AX5A 2LMCA 1FIQA 1K52A 2W3RA 3E56A 1WXQA 4WAFA 4N6EB 3VQIA 3Q8BA 1MVKA 3NVWA 1SEBD 2QSDA 4XWTA 1JWSD 4YTPB 4A9AA 1TYGB 2ONQA 4XDDA 1DOIA 5HG2A 4A8XC 2OHFA 1TS3A 2LHDA 1XLQA 4XWWA 1UNSA 4MACA 3BYTB 3ZQ4A 1OFFA 1FXAA 1RWSA 1TZOA 3HVDA 4RCOA 5FR3A 1D6EC 5D7GA 2JXTA 2I2YA 3TEZA 2IJ0A 2E3TA 1I4HA 2KQ4X 3MC0B 4C7YA 4L23A 3T3NA 1F2RC 2NTSA 3AE3B 1P7FA 2AQ3B 1SE4A 3J9CA 3BK1A 4OHJA 5HI1A 2K5PA 4ITKA 1FNVA 4LLGM 1JRPA 4JWUC 1VZ7A 2LGIA 3KWLA 1CJEA 2XNAC 1GB4A 1V1OA 2G1EA 4C56C 4A55A 1I4QA 3GB1A 4UDUC 3Q69A 1XLOA 3L4PA 3MP9A 2WDQB 4B0EA 2J4XA 2GB1A 2QILA 3NRZA 3P4PB 4WQMA 1EU3A 2KWDA 3P42A 1TS4A 1CQVA 2K9XA 2JX5A 3U2SC 1TS5A 1YN5A 1I4XA 2DWQA 3IAS1 5GXGB 3IXSA 1NYQA 1QLBB 3LYYA 4DQOC 3IT4B 4ARIA 2AQ1B 3B2GA 4HEA1 1DYQA 2AQ2B 4LK0M 1B1ZA 3EUB2 1K51A 1DGJA 2KAJA 2MH7A 3NS1A 1LO5D 1E9MA 2BS3B 1PGAA 2L32A 3P4SB 3WCQA 2J52A 1AW7A 1UWXA 3FAHA 1QILA 2J53A 1ZXIA 4RFBA 4YTMB 4GDKB 2QMTA 4N59A 3VRAB 3W1SA 2M19A 4HROA 2H89B 2WDRB 2Q5WD 2LFIA 2Y3AA 3AE2B 4YXDB 1FRRA 2LHEA 1T3QA 3AV8A 4US9A 3AEGB 1JWBD 1TKYA 2K22A 3U52E 3SFDB 4JX1C 3CWIA 1MHHE 3R2TA 4YSZB 3AEBB 1VRAB 1HQRD 2CU3A 2DYMA 1I4PA 1TJEA 4RF0A 1BUIC 1NI3A 2ON8A 5BMIA 1YQ4B 1XXGA 2WXRA 2WXGA 2J42A 2IGGA 3EGRA 2IDYA 2ZW0A 3AE8B 3V05A 3U4EG 1FNUA 2RDGA 4YSYB 1EWCA 1L5PA 1VLBA 2BW2A 3R2IA 2BTEA 2V4IB 1IBXB 3GS2A 1PYWD 4NAMA 5MPOA 2NMQA 4A90A 1KRHA 2KACA 1E6EB 2VZKD 4C80A 5HFYA 1BMLC 1ZDXA 3NVVA 2MEKA 2WS3B 4P16A 2PVGC 3MHZA 3U7ZA 3V3XA 3HVZA 3AH7A 1GOZA 1MI0A 2WXNA 1JCKB 3KLSX 1L6UA 1XF5L 2V3PA 1V8CA 4JWSC 5AUKA 3AE4B 2WXKA 1N60A 2WXMA 4OZCA 3T3OA 1C76A 3P63A 2CJNA 1L4ZB 2L83A 3DWGC 1EU4A 5TSSA 1JQ4A 2INPE 1C79A 2BB5A 1QT9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KH0 A;  3UI3 A;  1GB4 A;  2IGH A;  3GB1 A;  2IGD A;  3MP9 A;  4HKZ E;  4OZB A;  2GB1 A;  2JSV X;  1FD6 A;  1XCQ L;  2JZP A;  5JXV A;  2KWD A;  1K50 A;  2KN4 A;  5BMG A;  3FIL B;  5BMH A;  1EM7 A;  1C9F A;  1FCL A;  1FCC C;  1IGC A;  1PGB A;  2JWU A;  1IGD A;  4IKG A;  1IBX A;  1HEZ E;  1K51 A;  1MHX A;  2EEL A;  2I38 A;  4WH4 A;  1PGA A;  2PLP A;  1HZ6 A;  2J52 A;  2OED A;  1UWX A;  2N9K A;  2RPV A;  4KGS A;  2J53 A;  1JML A;  4KGR A;  2QMT A;  2KDM A;  1GB1 A;  1YMH E;  4IOI E;  5HHD G;  1ZXH A;  2K0P A;  4KGT A;  4HJG E;  2LHE A;  2ZW1 A;  1P7E A;  1K53 A;  4OZA A;  2PTL A;  1XCT L;  1YNT E;  1HZ5 A;  2LUM A;  2RMM A;  4GLS C;  1MHH E;  1D4B A;  1PGX A;  3FIL A;  4D2K A;  2ON8 A;  5BMI A;  1K52 A;  1MVK A;  2IGG A;  1Q10 A;  2QSD A;  2ZW0 A;  2GI9 A;  2PW9 A;  2ONQ A;  5HG2 A;  2N9L A;  2LHD A;  1IBX B;  4MAC A;  1MPE A;  2NMQ A;  2KAC A;  5HFY A;  1F2R I;  2JXT A;  2I2Y A;  3V3X A;  1MI0 A;  2KQ4 X;  1QKZ A;  1F2R C;  1XF5 L;  1P7F A;  2JU6 X;  5HI1 A;  4OZC A;  2N7J A;  2LGI A; 
#chains in the Genus database with same CATH topology
 5IP4 D;  1T0Q C;  2N9P C;  1BT0 A;  2KFK B;  4KIK A;  3RNE C;  3P4R B;  2DLB A;  3PZ8 A;  5AUI A;  2FID A;  2GBM A;  2LGD A;  4MH8 A;  3QWZ B;  1FCC C;  5H92 C;  1UWM A;  4YWG G;  1D3Z A;  3ZRF A;  2MJD A;  2BB6 A;  3V61 A;  2KT7 A;  1MHX A;  4MSM B;  4P6V F;  2D10 A;  2AWT A;  2QJL A;  3P4Q B;  4OVZ A;  2ICI A;  3AE1 B;  1JRO A;  4MH0 E;  2GBK A;  1HZ6 A;  1FNW A;  1KJT A;  4M0W B;  3H1U A;  1IUE A;  2WXQ A;  5KHO A;  2KNB A;  2DAJ A;  3PZ7 A;  5FK9 C;  1ZPS A;  1F0Z A;  4GB9 A;  1ZGU B;  4KGT A;  4BKS A;  1KTK A;  2JQR B;  5AZH A;  4DBG A;  4BKG A;  3GP7 A;  1WYW B;  3NOB A;  5J18 A;  2J0J A;  2ZNV B;  2BYV E;  4IWP A;  2Z0E B;  4GLS C;  2IO2 B;  3BWU D;  4JE3 B;  4RH6 A;  2KOX A;  1QQR A;  1WZ0 A;  2FCN A;  1V97 A;  2Y5B B;  5AZG A;  2YVC A;  2D2Q A;  4LNF A;  4ICU A;  4US8 A;  2HDE A;  2BBC A;  1SE2 A;  2WHI A;  3MC8 A;  1OEY A;  2KLC A;  3HHM A;  2M56 B;  4NJ7 A;  5EE1 A;  1T5X D;  5EE0 A;  5BYR A;  3WAL A;  3QAR A;  2AEH A;  4AWJ A;  2ZVO A;  4OW0 A;  4WJP A;  1PFD A;  3UIO B;  4CHK A;  2KMA A;  1J7C A;  2M0X A;  4EZJ A;  4G0N B;  1H4R A;  2HJ1 A;  1JRU A;  4HKQ A;  4YT0 B;  3LXF A;  4F7Z A;  1OQY A;  1NVI D;  3ZDT A;  2KC2 A;  2D07 B;  2WXO A;  4FA6 A;  3SU8 X;  2V9H A;  2MSE D;  2WLB A;  1IGD A;  2O6V B;  4A20 A;  4PS3 A;  1I42 A;  2OOB B;  2YEP F;  3RNF C;  4P1C C;  2FBW B;  1NDD A;  2D3A A;  2WXI A;  2LWP A;  3ZW3 A;  2N7E A;  3PT2 B;  1GC7 A;  5CTR C;  4A3P A;  3HIZ A;  1GB1 A;  2BKR B;  3KWV A;  3GE8 C;  2KQ7 A;  1WSP A;  2O6V D;  3R7Q A;  1JW9 D;  2PKO A;  1BXT A;  2KVR A;  4K1R B;  4KX6 B;  4N58 A;  5C1Z A;  3RD2 A;  2L3Z A;  3VTV A;  1F52 A;  3VUY A;  3RNB C;  4DK5 A;  3AEA B;  4B9K A;  3VTU A;  2PW9 A;  1RAX A;  4GIV A;  3NVZ A;  1MPE A;  3QC8 B;  5IO9 A;  3N1X C;  1Q5W B;  1TKE A;  1LQB A;  4ZRJ A;  3VRB B;  1F2R I;  2XK5 B;  3Q2A C;  1QKZ A;  1YJJ A;  3RPF C;  1WF9 A;  1I4G A;  2CHX A;  2JU6 X;  5L95 C;  2EMT A;  5T8I A;  1I7H A;  5FKA C;  3N30 A;  4ZRQ A;  1T0S C;  1GNU A;  2MWS B;  4O1N A;  2GBR A;  3RNA C;  4PS7 A;  1YD8 U;  1YN3 A;  4REZ A;  1L0Y B;  3Q3J A;  2QIE B;  4TQ1 A;  2R2Q A;  4M01 A;  2EKE C;  5JXV A;  5E6P A;  1WMH A;  3L54 A;  1ENF A;  2KN5 A;  2EKI A;  1JAL A;  3TEX A;  2W9N A;  5J2R A;  3LB8 C;  2CS4 A;  5TR5 A;  4ZHO A;  2EEL A;  1KOT A;  4DXG A;  1ZW7 A;  1NYR A;  2PLP A;  4ANX A;  1C1Y B;  2OED A;  3PRM B;  1V5O A;  2IND C;  2RPV A;  3PGE A;  2L0T A;  1V1P A;  3BVG A;  1XEE A;  4XE0 A;  2LAS A;  2X8X X;  3SFE B;  1VZ6 A;  2IYD B;  3IAM 1;  3Q3M C;  1WFY A;  3AE5 B;  4CQN A;  1UGM A;  1XCT L;  5JZE B;  3WIM A;  1ET6 A;  4K7S A;  4KIK B;  3CIR B;  4JGH B;  3PHW B;  2DAF A;  4KKI A;  4EZK A;  4I6L B;  4IM3 A;  3Q8B A;  3NVW A;  2QSD A;  3MC9 A;  4YTP B;  1DOI A;  3N32 A;  5HG2 A;  2LHD A;  3OG5 A;  1XLQ A;  4XWW A;  4MAC A;  2IY0 B;  1KM7 A;  3B0A A;  2NBV B;  4LDT B;  1SGH A;  4DHZ B;  3TEZ A;  2IJ0 A;  1I4H A;  4L23 A;  3T3N A;  2NTS A;  3AE3 B;  3PV1 A;  2AQ3 B;  4TKN A;  3BK1 A;  4HDO A;  4OHJ A;  5HI1 A;  4ITK A;  1JRP A;  4JWU C;  4W9K A;  2KK8 A;  2LGI A;  2L76 A;  2PPH A;  2XNA C;  2G1E A;  5J17 A;  1I4Q A;  4ASW C;  3UIN B;  2GB1 A;  2QIL A;  3P4P B;  2PE9 A;  4WQM A;  2KWD A;  3C19 A;  2JX5 A;  4TUU A;  3U2S C;  1TS5 A;  2GMI C;  1YN5 A;  1I4X A;  2HD5 B;  3A1Q B;  3D32 A;  1HTO A;  2IZV B;  3M62 B;  2DZI A;  1LM8 B;  4HEA 1;  1DYQ A;  5JHB A;  2IBI B;  4EUT A;  2JRH A;  4IC7 B;  2DNF A;  1K51 A;  2JXX A;  3VAW A;  3IG3 A;  3VUW A;  4E3C A;  1AW7 A;  3UQB A;  1UWX A;  4XX5 A;  3FAH A;  2KJR A;  4BZA A;  3A4S C;  4RFB A;  4YTM B;  2BWF A;  4GDK B;  3W1S A;  4FJV B;  2VH2 A;  2M19 A;  4HRO A;  2H89 B;  2WDR B;  4GGQ A;  2ZEQ A;  2MBB B;  1R4N I;  2MLB A;  1FRR A;  3VFK A;  1T3Q A;  3AV8 A;  3QAQ A;  3GOE A;  1EF1 A;  2K22 A;  2J0K A;  2NBU A;  2ZCC A;  4NNJ B;  4G11 A;  1WIA A;  3RN9 C;  2JRI B;  1HQR D;  2DYM A;  2PE6 B;  5BMI A;  2BVC A;  1YQ4 B;  1XXG A;  1NBF C;  3ZVV A;  2IGG A;  4BFR A;  3V05 A;  2KWC A;  1FNU A;  2RDG A;  3EFU A;  3JVZ X;  3NZU A;  3PRE A;  3UGB B;  2BW2 A;  2BTE A;  2V4I B;  1PYW D;  4WWO A;  2NMQ A;  1E6E B;  5HFY A;  4NJ6 A;  3NVV A;  4BAX A;  4FLH A;  2KC1 A;  2PVG C;  3HVZ A;  3AH7 A;  1WR6 E;  5DPR A;  1L6U A;  3DVN U;  1HTQ A;  1V8C A;  4JWS C;  4HXD A;  2WXK A;  1RRB A;  2BKF A;  2L83 A;  3DWG C;  2FCQ A;  4WJN A;  2QC8 A;  2BB5 A;  1VJK A;  1QT9 A;  1C4C A;  1WGG A;  4XDC A;  2RPQ A;  4H2A A;  4LNI A;  2FE8 A;  4W9I A;  4OZB A;  2D3G A;  3RCZ A;  2W82 A;  1XLN A;  2NVU I;  5BMH A;  2B3A A;  1WJN A;  1RYJ A;  3JYU A;  1N5X A;  4IDI A;  4FN2 A;  4RMA A;  3KUZ A;  3RUL A;  1GG3 A;  3TEY A;  3N9Y C;  1GAQ B;  4E74 A;  2K6Q A;  4RGO S;  2K25 A;  2GRI A;  4FUL A;  4F8C B;  3AED B;  4MM3 A;  3CST A;  1SSN A;  2HJ8 A;  4LNK A;  4AOF A;  2LJ5 A;  2J7Q B;  1GC6 A;  4GMV A;  2MBO A;  4FHK A;  5GMV A;  4ZDV A;  3Q8E A;  4FJY A;  2WXL A;  3PS6 A;  2Y5C A;  2M8S A;  2V3S A;  1C77 A;  4DWF A;  2MCN B;  2JUO A;  1SB3 C;  2WU5 B;  3PLU A;  1WMH B;  3PZD A;  2WXP A;  3ZIM A;  4J6I A;  1RLF A;  3M3J A;  2KO3 A;  1J0G A;  3AE7 B;  4YSX B;  3HUI A;  2E6X A;  2WDV B;  1WM2 A;  5EDS A;  4FJZ A;  2EMS A;  4JPS A;  1TKG A;  1TS2 A;  4K7W A;  4WIP A;  1EWY C;  4HPL B;  4ZRI A;  1V49 A;  2GBN A;  5AZF A;  4PYZ A;  1V1P B;  4XYC A;  3RNC C;  1TY0 A;  5DPW A;  2JT4 B;  2SEB D;  5BO4 B;  2LVP A;  2KTR A;  3AE9 B;  2JVC A;  4JQW C;  3M95 A;  2MRP A;  3HM3 A;  3UI3 A;  3AB5 A;  1B9R A;  2X38 A;  4KKJ A;  5G5G A;  3H7P A;  1T0Y A;  1Y56 A;  1FXI A;  5DCN A;  2RDH A;  2RSU A;  4RGN A;  1N62 A;  1XCQ L;  4KSL C;  2K3U A;  1OEY J;  1P98 A;  1P3Q U;  3MJ5 A;  2NPT A;  3DQV A;  1YOV B;  1PDX A;  2IO0 B;  2H88 B;  3DVG X;  2RGF A;  2KVZ A;  1ROE A;  3QA8 A;  1LGR A;  2GLS A;  4NQK E;  4MT5 A;  2ZJD A;  3IVF A;  2BS2 B;  2AL6 A;  2KDM A;  1V2Y A;  3NY5 A;  3ALB A;  1NI2 A;  1ZXH A;  1S3S G;  2KXJ A;  1H8C A;  2K8H A;  1ZOY B;  2PVO D;  2BQQ A;  1KLU D;  1P7E A;  2MQJ A;  2NTT A;  4NZL B;  3TUO A;  2WX1 A;  5DPT A;  1ZP0 B;  2Z8L A;  1JWM D;  4GOC A;  4S17 A;  1YX6 B;  3X0W A;  1FFV A;  4LCD E;  3WA0 A;  3ZO5 B;  5C3J B;  2IO3 B;  2WXJ A;  1GJZ A;  4ACF A;  4NAW A;  4IM2 A;  2L0F A;  1NEK B;  2LI5 A;  2N9L A;  1DOX A;  1XT9 B;  2WXH A;  3ZGZ A;  1ESF A;  1YJI A;  3DHI C;  3PO0 A;  1E0Z A;  2A4Z A;  2M17 A;  2BYT A;  2DBY A;  2KX0 A;  2QEJ C;  5BYQ A;  3ZNI D;  2REX A;  3BII D;  2LRU A;  3VR9 B;  3VHT C;  4X57 B;  3ZYY X;  3V62 A;  3RZW C;  3ZNZ B;  4USA A;  2ZVN A;  3L17 A;  3BY4 B;  4B95 A;  1F1H A;  4DHZ E;  1OTR B;  2C9W B;  2LXA A;  3BK2 A;  3HM6 X;  3RI7 C;  1KF6 B;  3WAO A;  3RNG C;  3VTW A;  3KVF B;  1LXD A;  1AYF A;  1CK1 A;  2JY6 A;  1IGC A;  1WX8 A;  3EC8 A;  3JSV A;  4IKG A;  3VR8 B;  1SF0 A;  2KDE B;  2C7N B;  1RM6 C;  2VZK B;  4MJS A;  2C7M B;  2N9E B;  5BYS A;  4P1B C;  2W3S A;  4RNA A;  1D5M C;  4HVB A;  3VDZ A;  1V9J A;  1N61 A;  3QK0 A;  2N4F A;  4MGY E;  4KGS A;  2WNM A;  1E8Z A;  1V86 A;  1JWA D;  4GDL A;  2KKC A;  1OQR A;  2FUG 1;  2JF5 A;  4URK A;  5E6J A;  3W2D A;  3ZRC A;  2CR5 A;  2PMV A;  3H6N A;  3ETR A;  4KDL B;  4QAY A;  1V80 A;  2PTL A;  5L83 A;  3I57 A;  2RR9 A;  2N1V A;  3Q8A A;  1JWU D;  3TBL D;  2K1F A;  4B0M A;  1D5Z C;  3EFC A;  2M1M A;  1Q1O A;  1FIQ A;  3E56 A;  1SE9 A;  1VD2 A;  1WXQ A;  4WAF A;  5IOI A;  3VQI A;  1JWS D;  2UWQ A;  4P7I A;  1TYG B;  2ONQ A;  3N20 C;  4XDD A;  3PSE B;  2RDB C;  3WAM A;  4BVU C;  4XC2 A;  3KUC B;  1OFF A;  3IFW B;  1K8R B;  5D7G A;  3MC0 B;  2KFJ A;  4C7Y A;  3L10 B;  1J19 A;  3CMM B;  3J9C A;  1UH6 A;  3W1Y A;  2K5P A;  4HJK A;  2MW5 A;  4ANU A;  3KWL A;  1CJE A;  4C56 C;  2KAN A;  3Q69 A;  3MP9 A;  3QCA A;  2WDQ B;  4ICV A;  5IA7 A;  4RM9 A;  2KJH B;  1MJD A;  1WGY A;  3FKY A;  1E7U A;  1WM3 A;  3IAS 1;  4WWN A;  3IXS A;  1QLB B;  2RD0 A;  4DQO C;  3IT4 B;  3ENE A;  2AQ1 B;  2AQ2 B;  3EUB 2;  3N3K B;  3NS1 A;  3OAW A;  1LO5 D;  5LXI B;  1E9M A;  4AJW A;  4FHJ A;  3WCQ A;  3Q14 C;  3L08 A;  3DDC B;  4LNO A;  1ZXI A;  4PS8 A;  1I35 A;  3UF8 A;  2HE7 A;  3TJP A;  2DZJ A;  4F1S A;  2KTR B;  1HE8 A;  3AEG B;  5D94 A;  1TKY A;  2M4N A;  3U52 E;  4W9F A;  3SFD B;  3H7P B;  4YSZ B;  3AEB B;  1VRA B;  4E71 A;  1J8C A;  1I4P A;  1WJU A;  4RF0 A;  5HKH A;  2BWE S;  3N1Y C;  2ON8 A;  2WXG A;  2J42 A;  3EGR A;  3NJT A;  3AE8 B;  2KHW B;  4M8M A;  1X1M A;  3R2I A;  1KRH A;  2KDI A;  4C80 A;  2ZPN A;  1BML C;  1ZDX A;  3H9D A;  3DHH C;  4P16 A;  3ML9 A;  5JH5 C;  3V3X A;  2BF8 B;  2WXN A;  1WY8 A;  2KDF B;  1XF5 L;  5AUK A;  3AE4 B;  2KLG A;  2WXM A;  3ZDM C;  2NS5 A;  4WJQ A;  3P63 A;  2INP E;  1VDV A;  1AAR A;  4XGA B;  1C4P A;  3SR6 A;  4JL9 A;  1FD6 A;  3V6C B;  2LEK A;  2LGY A;  3V6E B;  1WJ6 A;  3DBS A;  3H8H A;  3GZN B;  4MEM A;  3HK0 A;  1QOF A;  4A6Q A;  4IWO A;  3EA6 A;  1WGR A;  2B76 B;  4FBJ B;  2MJE A;  3W5U B;  1WE7 A;  1R4M B;  2INC C;  1AN8 A;  1YN4 A;  2V3N A;  5LXH A;  3ZLZ A;  2KD0 A;  1WWT A;  3Q8C A;  4LDT D;  3QIJ A;  1CZP A;  4LTU A;  4RM8 A;  5G5H A;  1WX9 A;  2FUH B;  3O65 B;  1YMH E;  2DYO A;  3SD5 A;  2R2O A;  2JYT A;  2ZNV C;  1OQQ A;  3AEE B;  2PJH A;  3AM9 A;  4W9E A;  1K53 A;  4BKS D;  1KFY B;  2CJO A;  1HZ5 A;  1FO4 A;  4R3D A;  4HPP A;  4M0W A;  5C2T B;  4ANW A;  3ZJU A;  4C00 A;  4A3O A;  3AMZ A;  4M02 A;  3M63 B;  2KX3 A;  2UYZ B;  2MBQ A;  4K3B A;  4G50 A;  4BOS C;  1Q10 A;  1TY2 A;  1YIW A;  4JLC A;  1WGH A;  4AQ7 A;  3IT6 B;  2KTF A;  2BT6 A;  1V5T A;  2CHZ A;  4ARC A;  3R7R A;  4MJS B;  1FM0 D;  3TEW A;  4MGI E;  2K8B A;  4YL8 A;  4DXA B;  1UZX B;  1QOB A;  5D2M B;  3HRD D;  4L1B A;  1EF5 A;  2FAZ A;  4W9L A;  4MGZ E;  2WP9 B;  1C3T A;  3DBL B;  5JHA A;  4LNN A;  4GDL B;  2LVO A;  3PRZ A;  2GOW A;  5CHF A;  3MFG A;  1ZKH A;  1A5R A;  3OJ4 B;  2LUE A;  4FAD A;  4HKZ E;  3V60 A;  2JSV X;  3U30 A;  1DOY A;  4DDG D;  2KZR A;  4PK1 A;  4ZOH C;  4PYU A;  1ZE3 D;  2R61 A;  2I1J A;  3B1L X;  1WRI A;  3PLV A;  2IPK D;  3TSS A;  2LD9 A;  4KV2 A;  3DBR I;  1IBX A;  2JZ3 B;  1HEZ E;  3AEF B;  3QHT A;  1J7B A;  1U4A A;  1AWD A;  2TSS A;  2LXC A;  1QZE A;  3I5J C;  3C0R B;  1E90 A;  2GBJ A;  3E9S A;  1R7S A;  4MEL A;  1JML A;  2G9H D;  2K39 A;  2WU2 B;  4DXF A;  3L16 A;  4OVU A;  3SEB A;  3WAP A;  1YQ3 B;  2JPH A;  4ZRK A;  3H7S A;  1TTN A;  2ZW1 A;  4GU2 A;  3R8B A;  1Y8R C;  4DHJ B;  3FIL A;  5KHQ A;  1A70 A;  5IAA C;  3ZKJ C;  4XZ4 A;  1MG8 A;  2FIF A;  4D2K A;  3QJZ A;  2SAK A;  4EEW A;  2L52 A;  3I9V 1;  4BKT A;  4CYE A;  1NEN B;  3NUH B;  3SDL C;  2BGF A;  3ZUN A;  1ET9 A;  4TMA B;  3L13 A;  3BYY B;  1T6B X;  3AN1 A;  3ZNH B;  2L8J A;  2YEP B;  2DHZ A;  4DHJ D;  3EEC A;  1T0R C;  1N63 A;  1HA5 A;  1L4D B;  3ZNG C;  2N7J A;  2LJI A;  1KH0 A;  1E7P B;  3AU5 A;  1WR1 A;  4EOY A;  3DBH I;  2M0A A;  1IYF A;  1WXS A;  2WX0 A;  4NY0 A;  1QOA A;  4I6N B;  1SBB B;  2KN4 A;  4MSQ B;  1UUP A;  4W9D A;  1WGD A;  3B2F A;  1FMA D;  5G55 A;  3P1M A;  2LRW A;  3OJ3 A;  3PTF C;  1CMX B;  4ZHP A;  4HWI B;  2O2V A;  4HLE A;  1WGK A;  2A5U A;  1GPX A;  2LZ6 A;  2ZPY A;  4II3 B;  2KYW A;  1E8Y A;  4PT5 A;  5D3D A;  1N5W A;  1UF0 A;  2YLM A;  4IOI E;  5EE9 A;  3FC4 A;  2ACZ B;  2Y5P A;  2UU7 A;  2LVQ A;  4EFO A;  1UGJ A;  1VZ8 A;  2KMM A;  2RMM A;  1KLG D;  3ZTC A;  1K52 A;  4N6E B;  1MVK A;  1SEB D;  4XWT A;  2L05 A;  2I1K A;  1TIF A;  4AP4 C;  2D3B A;  4WJO A;  3CSF A;  3U7D A;  3BYT B;  3ZQ4 A;  4MGK E;  2QHO A;  5FR3 A;  2JXT A;  2I2Y A;  2KWV B;  2E3T A;  2KQ4 X;  2KMC A;  1P7F A;  1XD3 B;  3NG0 A;  1SE4 A;  3PRP B;  4AUQ C;  1P0R A;  2G4S A;  1VZ7 A;  2MP2 A;  1GB4 A;  3GB1 A;  1WZ3 A;  4UDU C;  2ZZP B;  1XLO A;  2OJW A;  3L4P A;  2N1W A;  4GN1 A;  4B0E A;  3NRZ A;  3P42 A;  3KYD D;  1TS4 A;  2K9X A;  2DWQ A;  5GXG B;  1NYQ A;  1V6E A;  3LYY A;  4HDQ A;  2WYQ A;  4ARI A;  3B2G A;  1B1Z A;  3VVW B;  1DGJ A;  2MH7 A;  1WJ4 A;  1PGA A;  3APC A;  3JW0 X;  2PEA A;  2J52 A;  2QDF A;  3A1Q A;  1QIL A;  2QMT A;  4IWQ A;  3VRA B;  3DVG Y;  2LFI A;  2KJ6 A;  1VCB A;  4G3X B;  3AE2 B;  2G45 B;  3BIN A;  4HK2 A;  4YXD B;  4US9 A;  3DOW A;  1SIF A;  5G2N A;  4JX1 C;  3CWI A;  1MHH E;  3R2T A;  1TJE A;  4GDK A;  4WAA A;  4BOZ B;  3RUI B;  3DPD A;  5FR6 A;  3DVN V;  1YJ1 A;  4AJY B;  2WGS A;  3R66 C;  1IBX B;  3TIX A;  5MPO A;  4A90 A;  2KAC A;  2VZK D;  3U8Z A;  3VH4 B;  2CHW A;  2WS3 B;  4K81 A;  3N1Z C;  3A9K A;  5CHV C;  4HCP B;  2C7H A;  2DYB A;  4OZC A;  3T3O A;  1C76 A;  2WWZ A;  1EU4 A;  4ANV A;  2KWU B;  4W9J A;  3T9L A;  1ZDV A;  1PUT A;  3GE3 C;  3IHP C;  1STE A;  1K50 A;  5BMG A;  3FIL B;  1EM7 A;  2MJ3 A;  2IO1 B;  2C60 A;  3L0W B;  4MM3 B;  4FXC A;  5IN7 A;  1L0V B;  3ZTD A;  3C8Y A;  1WH3 A;  3ZXV A;  1TT5 B;  1UBI A;  3VUX A;  1YQB A;  3RT3 B;  4II2 B;  4GXB A;  3BVM A;  3I63 C;  2BPS A;  4AS1 A;  3URY A;  4B6W A;  5LNK 1;  1Z5S B;  2D5G A;  2BS4 B;  4I6P A;  4NQL B;  3PHX B;  2OJR A;  4C7Z A;  1WXA A;  2K0P A;  4TQ0 A;  4IM0 A;  3Q3O C;  3NZ3 A;  1D5X C;  2KQS A;  4EE2 A;  4YTN B;  1HXY D;  1M4V A;  4DDI D;  3AUL A;  5I4D A;  3OWE B;  1ISN A;  3AI5 A;  1D4B A;  1UD7 A;  3RFZ B;  2W54 A;  3AEC B;  4LJP B;  1TGZ B;  1F77 A;  3O13 A;  4K7U A;  2G3Q B;  1UBQ A;  1SE3 A;  2XN9 C;  4TV3 A;  1F9J A;  1MFW A;  5CHW A;  3APD A;  4L2Y A;  2N7D A;  1L2N A;  2O2V B;  2N9X A;  2BYE A;  2AL3 A;  4ZRP A;  4KZC A;  1J7A A;  1E7V A;  4WWM A;  1P9D U;  3AE6 B;  4C4V A;  2L1A A;  4JIO U;  4WUR A;  3IBE A;  4RGT A;  4W9H A;  2W55 A;  2QCZ A;  3RMK C;  3A9J A;  5EE3 A;  1UEL A;  1Q0W B;  2BYF A;  4M8N A;  2NPT B;  2Z0D B;  1QOG A;  5D6J B;  1IPG A;  1ACC A;  2N0S B;  3CF6 E;  5E6N A;  1C9F A;  1QF6 A;  5AEK B;  3X23 A;  2FNJ B;  2MBE A;  1L6V A;  1PGB A;  2NBW B;  2JWU A;  2V0G A;  1FFU A;  1RFK A;  3KQ4 A;  3Q8F A;  2I38 A;  5H8Y E;  1WX7 A;  4WH4 A;  1S1Q B;  3QQ8 B;  3UIP B;  2PIA A;  2N9K A;  3AXC A;  2WXF A;  3I3T B;  1C78 A;  3W5V B;  1IP9 A;  1WE6 A;  5HHD G;  5D3I B;  3RZF A;  3UQA A;  4KDI C;  4RF1 A;  1XLP A;  5DPS A;  4NAW B;  1VR9 A;  2KFK A;  2MP2 B;  4Q2J A;  3APF A;  1L7Y A;  1E5W A;  1WYG A;  1PGX A;  2CU1 A;  4ZYN A;  1V81 A;  3Q6B A;  3ZJT A;  1FRD A;  4IUM B;  2GI9 A;  1XO3 A;  3R3M A;  1FEH A;  3DHG C;  3B9J A;  3VH3 B;  1MG4 A;  3GZN I;  3AU4 A;  4K3C A;  3ABV B;  4ZYS A;  3K9O B;  2C5L C;  3W1S C;  4EZL A;  2LGX A;  1R4N B;  1E10 A;  3PPA A;  1SJH D;  3A4R A;  1G6J A;  4HRS A;  1R4M I;  4HCN B;  4WQO B;  2MA9 B;  3TMP B;  2DZM A;  2HTM E;  3ZJV A;  3MJW A;  4S0R A;  1L0X B;  2DX5 B;  3JSV B;  3NVY A;  4NJC A;  3P2B A;  4KSK C;  2INN E;  1EUV B;  3BZD B;  2IGH A;  4J3O D;  2IGD A;  3BVZ A;  2WQY B;  1SIJ A;  2K8C A;  2JZP A;  2MBH A;  3S2A A;  1WXM A;  1ZUD 2;  4LJO B;  5E6O A;  2JYE A;  1FCL A;  1WI0 A;  3DCG A;  3W9C B;  3VXW A;  3PVL A;  2FCS A;  1TZ1 A;  2D11 A;  3DWM A;  3MHS D;  4BBN F;  3DBR B;  2CKH B;  4W9C A;  4KVG B;  1C4A A;  4KGR A;  2MX2 A;  2AYO B;  2NCN A;  3A9K B;  3NZS A;  1SJE D;  3KUD B;  1SXT A;  4TSS A;  1EO6 A;  4HJG E;  3K9P B;  3ML8 A;  3LJ3 A;  4OZA A;  1I4R A;  3DBL I;  4RGM A;  1YNT E;  2WDT B;  4W9G A;  2LUM A;  4EKU A;  1GUA B;  2V1Y A;  2KDB A;  1FPY A;  4GSW A;  2AX5 A;  2LMC A;  2JZZ A;  2W3R A;  5CX3 A;  3TCA A;  1P1A A;  2IY1 B;  2J0M A;  1LFD A;  1PQS A;  2O6V A;  3KH0 A;  4A9A A;  3A33 B;  3EHV A;  1KLV A;  4A8X C;  2OHF A;  1TS3 A;  2FCM A;  1E8X A;  1UNS A;  2K6D B;  4HPM B;  3QX1 A;  4N9F 4;  1YX5 B;  1FXA A;  1RWS A;  2D3C A;  1TZO A;  2L00 B;  4M00 A;  3HVD A;  2VH1 A;  4RCO A;  1D6E C;  4BBN C;  4NPN A;  2L7R A;  3NHE B;  1F2R C;  3KYC D;  4CO7 A;  3NS8 A;  1OGW A;  1FNV A;  5C23 A;  4LLG M;  2JWZ A;  4MDK E;  5LLI A;  1V1O A;  2DZK A;  4A55 A;  4IW0 A;  2J4X A;  3Q3F A;  1EU3 A;  3B08 A;  1CQV A;  4OVV A;  3LDZ E;  1FXT B;  3DBH B;  3WAN A;  1RFA A;  2HTH A;  3ECI A;  4LK0 M;  1E8W A;  1TBE A;  2KAJ A;  4WWP A;  2BS3 B;  5IKC M;  2LGS A;  2L32 A;  2XK5 A;  3P4S B;  1N6Z A;  2ZCB A;  2J53 A;  4N59 A;  4C4V B;  2Q5W D;  2XEW A;  2Y3A A;  1WRD B;  2LHE A;  3KW5 B;  1JWB D;  3A9J B;  4KZ0 A;  3T8M A;  1M94 A;  2ASQ A;  2XBB C;  2CU3 A;  1BUI C;  1NI3 A;  1XQQ A;  2WXR A;  3MTN B;  3Q3N C;  3ZXR A;  2IDY A;  2ZW0 A;  3U4E G;  4YSY B;  1EWC A;  1L5P A;  1VLB A;  3GS2 A;  3ONS A;  4NAM A;  2Z59 B;  1WXV A;  2DEN B;  2MEK A;  3MHZ A;  3U7Z A;  2NR2 A;  1GOZ A;  1MI0 A;  1JCK B;  3SHQ A;  4IG7 B;  3KLS X;  2V3P A;  2VRR B;  2G4D B;  3OLM D;  2V4L A;  1N60 A;  3RYT A;  3TL5 A;  1Z2M A;  2CJN A;  1L4Z B;  2MHJ A;  5TSS A;  1JQ4 A;  1C79 A; 
#chains in the Genus database with same CATH homology
 1C4C A;  1VDV A;  4XDC A;  4H2A A;  2FE8 A;  1C4P A;  3P4R B;  2DLB A;  4OZB A;  3SR6 A;  1ZDV A;  1PUT A;  3PZ8 A;  5AUI A;  1FD6 A;  2W82 A;  1STE A;  2LEK A;  1XLN A;  1K50 A;  5BMG A;  3FIL B;  5BMH A;  1EM7 A;  2MJ3 A;  4MH8 A;  1RYJ A;  3H8H A;  4MM3 B;  1FCC C;  5H92 C;  4FXC A;  1N5X A;  4IDI A;  1QOF A;  1UWM A;  4A6Q A;  1L0V B;  4YWG G;  3EA6 A;  3C8Y A;  3TEY A;  2B76 B;  3N9Y C;  2MJD A;  1GAQ B;  2BB6 A;  2MJE A;  3W5U B;  1MHX A;  4P6V F;  4RGO S;  2QJL A;  3P4Q B;  4OVZ A;  2ICI A;  3AE1 B;  1JRO A;  1AN8 A;  3BVM A;  1YN4 A;  2V3N A;  2GRI A;  1HZ6 A;  1FNW A;  4AS1 A;  1WWT A;  3AED B;  3Q8C A;  1IUE A;  3URY A;  5LNK 1;  1CZP A;  2D5G A;  4LTU A;  2WXQ A;  1SSN A;  5G5H A;  2BS4 B;  3PZ7 A;  1YMH E;  2DYO A;  5FK9 C;  1ZPS A;  4C7Z A;  1F0Z A;  2JYT A;  2K0P A;  1OQQ A;  3AEE B;  4KGT A;  4TQ0 A;  1KTK A;  3NZ3 A;  3Q8E A;  2JQR B;  1D5X C;  2WXL A;  3AM9 A;  1K53 A;  3GP7 A;  4EE2 A;  1KFY B;  2CJO A;  2Y5C A;  1HXY D;  1HZ5 A;  4YTN B;  4R3D A;  1M4V A;  1FO4 A;  4GLS C;  1C77 A;  4M0W A;  5I4D A;  3OWE B;  1D4B A;  5C2T B;  3BWU D;  3RFZ B;  2W54 A;  1SB3 C;  3ZJU A;  2WU5 B;  4JE3 B;  4RH6 A;  3AEC B;  3AMZ A;  1QQR A;  3O13 A;  1F77 A;  1V97 A;  2WXP A;  1Q10 A;  1TY2 A;  1SE3 A;  4US8 A;  2XN9 C;  4AQ7 A;  2HDE A;  3IT6 B;  2BBC A;  2BT6 A;  1SE2 A;  3AE7 B;  4L2Y A;  4YSX B;  4ARC A;  3HUI A;  2E6X A;  2WDV B;  1FM0 D;  3TEW A;  2M56 B;  4ZRP A;  5EE1 A;  1QOB A;  1T5X D;  5EE0 A;  4JPS A;  5BYR A;  1TKG A;  3HRD D;  1TS2 A;  4L1B A;  1J7A A;  4WIP A;  1EWY C;  4WWM A;  4OW0 A;  3AE6 B;  2WP9 B;  1PFD A;  1J7C A;  1V1P B;  2L1A A;  4WUR A;  1TY0 A;  4GDL B;  4RGT A;  2SEB D;  2W55 A;  3AE9 B;  3MFG A;  5EE3 A;  3UI3 A;  4HKQ A;  3AB5 A;  4YT0 B;  2X38 A;  3LXF A;  4KKJ A;  1B9R A;  5G5G A;  1Y56 A;  1FXI A;  1NVI D;  4HKZ E;  2RDH A;  1QOG A;  2JSV X;  4RGN A;  1N62 A;  1XCQ L;  1DOY A;  2K3U A;  1ACC A;  2WXO A;  2N0S B;  4ZOH C;  1C9F A;  1QF6 A;  1ZE3 D;  2WLB A;  2R61 A;  1WRI A;  1L6V A;  1PGB A;  2IPK D;  2JWU A;  1IGD A;  2V0G A;  3TSS A;  1FFU A;  1IBX A;  3MJ5 A;  1PDX A;  1HEZ E;  2YEP F;  2H88 B;  3AEF B;  1RFK A;  3KQ4 A;  1J7B A;  3Q8F A;  2FBW B;  1AWD A;  1ROE A;  2I38 A;  2TSS A;  5H8Y E;  4WH4 A;  2WXI A;  4MT5 A;  2PIA A;  2N9K A;  3E9S A;  2BS2 B;  1R7S A;  1JML A;  2G9H D;  2WXF A;  2KDM A;  2WU2 B;  1C78 A;  4DXF A;  3W5V B;  1GB1 A;  3SEB A;  1YQ3 B;  5D3I B;  3KWV A;  5HHD G;  1ZXH A;  4RF1 A;  1XLP A;  4NAW B;  1VR9 A;  1WSP A;  1ZOY B;  2PVO D;  2ZW1 A;  1KLU D;  4Q2J A;  1P7E A;  2NTT A;  1JW9 D;  4NZL B;  3TUO A;  2PKO A;  3R8B A;  1BXT A;  1ZP0 B;  1WYG A;  1PGX A;  2Z8L A;  3FIL A;  1A70 A;  1JWM D;  4KX6 B;  4N58 A;  4D2K A;  1FFV A;  3ZJT A;  5C3J B;  2SAK A;  2WXJ A;  1FRD A;  3AEA B;  2L52 A;  2GI9 A;  2PW9 A;  3I9V 1;  1NEK B;  1NEN B;  1XO3 A;  3NUH B;  1FEH A;  3NVZ A;  2N9L A;  1DOX A;  1ET9 A;  2WXH A;  3B9J A;  1MPE A;  4TMA B;  3ZGZ A;  1ESF A;  3BYY B;  1T6B X;  3AN1 A;  3ABV B;  4ZYS A;  1YJI A;  1TKE A;  3VRB B;  1F2R I;  2YEP B;  3PO0 A;  1E0Z A;  1E10 A;  1SJH D;  1QKZ A;  1YJJ A;  2BYT A;  3RPF C;  2DBY A;  4HRS A;  1I4G A;  2QEJ C;  1N63 A;  5BYQ A;  2JU6 X;  3BII D;  5T8I A;  1HA5 A;  1I7H A;  1L4D B;  5FKA C;  3VR9 B;  4ZRQ A;  2HTM E;  3ZJV A;  3ZYY X;  1L0X B;  2N7J A;  2LJI A;  1KH0 A;  3NVY A;  4NJC A;  4O1N A;  2INN E;  3BZD B;  4USA A;  2IGH A;  1E7P B;  4J3O D;  2IGD A;  1YN3 A;  3BVZ A;  4REZ A;  1L0Y B;  2WQY B;  2M0A A;  1SIJ A;  2QIE B;  4TQ1 A;  1QOA A;  3BK2 A;  1KF6 B;  1SBB B;  2JZP A;  5JXV A;  2KN4 A;  1ZUD 2;  1UUP A;  2JYE A;  3B2F A;  1ENF A;  1FMA D;  1FCL A;  1AYF A;  1CK1 A;  1IGC A;  3P1M A;  2EKI A;  1JAL A;  3TEX A;  3W9C B;  4IKG A;  3VR8 B;  4ZHP A;  3LB8 C;  1SF0 A;  4ZHO A;  1RM6 C;  2EEL A;  2VZK B;  1WGK A;  4DXG A;  1GPX A;  3DWM A;  5BYS A;  1NYR A;  2PLP A;  2W3S A;  4RNA A;  2OED A;  1D5M C;  1N61 A;  2RPV A;  4KGS A;  1C4A A;  2WNM A;  4KGR A;  4PT5 A;  1V1P A;  5D3D A;  1JWA D;  1N5W A;  1OQR A;  3BVG A;  1XEE A;  4XE0 A;  3SFE B;  1SJE D;  1VZ6 A;  4IOI E;  3IAM 1;  5EE9 A;  2FUG 1;  3FC4 A;  1SXT A;  4TSS A;  4HJG E;  2ACZ B;  5E6J A;  2Y5P A;  3AE5 B;  3W2D A;  4CQN A;  2PMV A;  3ETR A;  1UGJ A;  4OZA A;  1I4R A;  2PTL A;  1XCT L;  4RGM A;  1VZ8 A;  1YNT E;  2KMM A;  3I57 A;  1ET6 A;  1JWU D;  2LUM A;  1KLG D;  2RMM A;  3Q8A A;  4B0M A;  3CIR B;  1D5Z C;  1VJK A;  4KKI A;  2AX5 A;  2LMC A;  1FIQ A;  1K52 A;  2W3R A;  3E56 A;  1WXQ A;  4WAF A;  4N6E B;  3VQI A;  3Q8B A;  1MVK A;  3NVW A;  1SEB D;  2QSD A;  4XWT A;  1JWS D;  4YTP B;  4A9A A;  1TYG B;  2ONQ A;  4XDD A;  1DOI A;  5HG2 A;  4A8X C;  2OHF A;  1TS3 A;  2LHD A;  1XLQ A;  4XWW A;  1UNS A;  4MAC A;  3BYT B;  3ZQ4 A;  1OFF A;  1FXA A;  1RWS A;  1TZO A;  3HVD A;  4RCO A;  5FR3 A;  1D6E C;  5D7G A;  2JXT A;  2I2Y A;  3TEZ A;  2IJ0 A;  2E3T A;  1I4H A;  2KQ4 X;  3MC0 B;  4C7Y A;  4L23 A;  3T3N A;  1F2R C;  2NTS A;  3AE3 B;  1P7F A;  2AQ3 B;  1SE4 A;  3J9C A;  3BK1 A;  4OHJ A;  5HI1 A;  2K5P A;  4ITK A;  1FNV A;  4LLG M;  1JRP A;  4JWU C;  1VZ7 A;  2LGI A;  3KWL A;  1CJE A;  2XNA C;  1GB4 A;  1V1O A;  2G1E A;  4C56 C;  4A55 A;  1I4Q A;  3GB1 A;  4UDU C;  3Q69 A;  1XLO A;  3L4P A;  3MP9 A;  2WDQ B;  4B0E A;  2J4X A;  2GB1 A;  2QIL A;  3NRZ A;  3P4P B;  4WQM A;  1EU3 A;  2KWD A;  3P42 A;  1TS4 A;  1CQV A;  2K9X A;  2JX5 A;  3U2S C;  1TS5 A;  1YN5 A;  1I4X A;  2DWQ A;  3IAS 1;  5GXG B;  3IXS A;  1NYQ A;  1QLB B;  3LYY A;  4DQO C;  3IT4 B;  4ARI A;  2AQ1 B;  3B2G A;  4HEA 1;  1DYQ A;  2AQ2 B;  4LK0 M;  1B1Z A;  3EUB 2;  1K51 A;  1DGJ A;  2KAJ A;  2MH7 A;  3NS1 A;  1LO5 D;  1E9M A;  2BS3 B;  1PGA A;  2L32 A;  3P4S B;  3WCQ A;  2J52 A;  1AW7 A;  1UWX A;  3FAH A;  1QIL A;  2J53 A;  1ZXI A;  4RFB A;  4YTM B;  4GDK B;  2QMT A;  4N59 A;  3VRA B;  3W1S A;  2M19 A;  4HRO A;  2H89 B;  2WDR B;  2Q5W D;  2LFI A;  2Y3A A;  3AE2 B;  4YXD B;  1FRR A;  2LHE A;  1T3Q A;  3AV8 A;  4US9 A;  3AEG B;  1JWB D;  1TKY A;  2K22 A;  3U52 E;  3SFD B;  4JX1 C;  3CWI A;  1MHH E;  3R2T A;  4YSZ B;  3AEB B;  1VRA B;  1HQR D;  2CU3 A;  2DYM A;  1I4P A;  1TJE A;  4RF0 A;  1BUI C;  1NI3 A;  2ON8 A;  5BMI A;  1YQ4 B;  1XXG A;  2WXR A;  2WXG A;  2J42 A;  2IGG A;  3EGR A;  2IDY A;  2ZW0 A;  3AE8 B;  3V05 A;  3U4E G;  1FNU A;  2RDG A;  4YSY B;  1EWC A;  1L5P A;  1VLB A;  2BW2 A;  3R2I A;  2BTE A;  2V4I B;  1IBX B;  3GS2 A;  1PYW D;  4NAM A;  5MPO A;  2NMQ A;  4A90 A;  1KRH A;  2KAC A;  1E6E B;  2VZK D;  4C80 A;  5HFY A;  1BML C;  1ZDX A;  3NVV A;  2MEK A;  2WS3 B;  4P16 A;  2PVG C;  3MHZ A;  3U7Z A;  3V3X A;  3HVZ A;  3AH7 A;  1GOZ A;  1MI0 A;  2WXN A;  1JCK B;  3KLS X;  1L6U A;  1XF5 L;  2V3P A;  1V8C A;  4JWS C;  5AUK A;  3AE4 B;  2WXK A;  1N60 A;  2WXM A;  4OZC A;  3T3O A;  1C76 A;  3P63 A;  2CJN A;  1L4Z B;  2L83 A;  3DWG C;  1EU4 A;  5TSS A;  1JQ4 A;  2INP E;  1C79 A;  2BB5 A;  1QT9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...