1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
3URYA 4Z9CB 1LT5D 4RCOA 1PTOB 4RGNA 4RHRA 1V1PA 1M4VA 1KLUD 1PTOH 1KLGD 1S5ED 1TY2A 1ET9A 1ESFA 1LTGD 3R2TA 1L0XB 2NTTA 2XRSD 2QILA 1JWMD 1UNSA 4O1NA 1CQVA 1DYQA 1V1OA 1CT1D 1EEID 2XRQD 3SEBA 1DJRD 1D5XC 1HQRD 5FKAC 1HXYD 5FK9C 1PTOD 3DWAA 4RFBA 1FGBD 3MFGA 5ELCA 1AW7A 1L0YB 1PTOF 1EU4A 4NZLB 2RDHA 1JWUD 1RCVD 1RDPD 1S5CD 3OWEB 1UUPA 1JCKB 4DXFA 1HA5A 1KTKA 1S5BD 3BZDB 1PRTC 3MC0B 1LT4D 2G9HD 1YN3A 1ENFA 1I4QA 1EWCA 3TSSA 4ZYSA 3BVZA 1BCPD 2IJ0A 4RHSA 1TS4A 1BCPF 3GP7A 1D5MC 2CHBD 1RF2D 2Z8LA 4L6TB 1PYWD 3EFXD 1FNVA 1QILA 1SEBD 2NTSA 1SE4A 2WV6D 3BYTB 2J4XA 5D3DA 1BXTA 3DWPA 1XXGA 5ELDA 1FNWA 1CK1A 1YN4A 1D6EC 1LLRD 1GOZA 1I4HA 1F77A 1S5DD 5ELFA 3W2DA 1PRTB 1I4XA 1SJHD 1SXTA 2XNAC 1G8ZD 1PTOC 4L63B 1STEA 4K6LA 2O2LD 1TS2A 1FNUA 1LO5D 1LTID 2AQ3B 1EEFD 4BWGB 1SE3A 1RD9D 3BVGA 1D5ZC 3R8BA 3R2IA 2RDGA 1LTAD 4RGOS 3EA6A 1CHPD 1JR0D 1BCPC 1PRTD 4C56C 1LTBD 1PZJD 2IPKD 3O13A 4OHJA 1JWSD 1EU3A 1B44D 1TS3A 3KLSX 1TS5A 1EFID 2R61A 1ET6A 1YN5A 3BYYB 1JQYD 1B1ZA 2QEJC 2SEBD 4UDUC 5D3IB 4DXGA 1LTTD 3DWQA 1XTCD 1PZID 1SJED 2XN9C 1V1PB 1HTLD 5ELBA 5ELEA 1SBBB 1T5XD 2AQ1B 1MD2D 4RGTA 1FD7D 1I4GA 1LT6D 1PZKD 1I4PA 2ICIA 1BCPB 2AQ2B 1I4RA 5I4DA 1SE2A 3CHBD 1S5FD 4TSSA 4RGMA 1LTSD 1TY0A 1AN8A 1CHQD 1LTRD 1PRTF 3V05A 2TSSA 4RH6A 5TSSA 3BVMA 1LT3D
chains in the Genus database with same CATH superfamily
4NDXA 1SNPA 3CRLC 3CSTA 2JQRB 3K0XA 4LUVA 4DR2L 1NE3A 5J1ZA 4QQBX 3CCVA 4NQKE 2LMCB 2EMTA 3RLFA 2KWDA 2ASBA 3E5SA 2Q2UA 3C8YA 1HNXQ 3LGJA 2XRSD 3K58A 1Y1WG 1NUCA 2XWBB 5FLXL 3PPAA 1CT1D 1WR1A 4IPGA 3S15H 3K7AB 3IL8A 3OIQA 4DNIA 3EJIA 4NNJB 1Y56A 1XF5L 1N6ZA 1UH6A 5J2RA 4NB3A 1SDFA 3AH7A 3HK0A 3KQ4A 1FGBD 3VR6A 3K81C 1G6JA 3DHQA 1SNOA 3J80L 2J53A 3AEBB 3IAM1 1E8WA 2MWSB 2SOBA 2BW2A 2LGIA 2MRPA 4C3HG 3Q69A 4LJPB 1PFMA 1RRBA 3QCAA 2NVQH 1FR3A 4LF8Q 1HRJA 3FILA 3P42A 3D6WA 1HHVA 1GB1A 3TZDA 4XQJA 2IJ0A 3ZRFA 1ZGUB 3IG3A 3HOUG 1FM0D 1I7HA 3CMEA 5IOIA 2V1YA 4K0KL 2QGQA 1P7EA 1FNVA 2WYQA 4GOPA 3AEDB 3AMZA 2LJ5A 3RNCC 2J42A 1N32Q 4CDCC 2H5XA 5BN5A 1EOVA 1QJOA 1R4QB 1MVKA 4JWUC 1T5EA 1A8VA 2NVYB 4M0WA 1V8CA 1ZDXA 1M94A 4A3GB 5E3FA 1HE8A 4C3JH 4WORA 3PF5A 4A6QA 2A1AA 3A1QA 4QL5A 5IP4D 2F4VL 4KN4C 2UU9Q 2CJNA 3HIZA 2MHJA 1HZCA 3RNBC 5C5LA 2DAFA 2O2LD 4R4CA 2ZT9C 4IFDI 1T3QA 3AU4A 2NZOA 3JAML 2AQ3B 2WXOA 3ZIMA 2XK5A 3R8BA 2CH4A 4DV3Q 4YTPB 1IBXB 2FCSA 1NTGA 3D4WA 2RSNA 3J81i 2WXJA 4N9F4 2D62A 1YJ9A 4CGYB 1SE9A 1VR9A 4FHJA 1Y1WB 2VUMH 3A9KA 1LTBD 1B8AA 4IW0A 2L52A 4IPDA 1V5TA 2R7FA 2Z6KA 2R7DA 1BOSA 4IUQA 1JALA 1P0RA 2AEHA 4FO2A 2E5LQ 4A3DG 5D6JB 2R61A 2UUAQ 2LKVA 2GOWA 4LF7Q 4C1NI 4IFDG 3C19A 1TT2A 4HEA1 2HJ1A 1DD2A 1LTTD 1XTCD 4ZRKA 1HPCA 1BVSA 1QUQA 4IUNA 1SNCA 5DM73 1XPUA 2WXQA 3X23A 1VQOA 4ZUJA 3T3NA 1UEBA 3F2DA 4JOIC 2KJ6A 4CKEA 4C3HB 1RHPA 2NN6H 1K8AC 5I6WA 2D07B 2KLGA 2RKSA 3KWLA 4ARCA 2INDC 3Q8DA 2WKCA 4JC0A 1HUNA 1K9MC 1CTMA 2WB1G 5EE0A 1BCPB 1TWFB 2XVSA 1DOXA 1SMYD 3HOUB 5C4JB 1AE3A 1H8CA 4KJNA 2KQ4X 2KTRB 1CHQD 3OTOL 3L3OC 2M4NA 1MSHA 1KF6B 1OGWA 4A3OA 1X9NA 2WU5B 5JVH3 4JI4Q 1LT3D 1SR3A 2I5HA 4MNOA 4HCPB 1ZKHA 2IWHA 4BKGA 3S17B 4ANUA 2IL8A 3EQLC 2ZTEA 3CW2C 1LYLA 4TV3A 5M3MG 3I4MH 4LF5Q 2H88B 4WJQA 2KVZA 2A6EC 1ZW7A 1CQVA 2FMMA 1SRUA 1STGA 5HURA 1GM5A 4KHPQ 2J0MA 2K6DB 3JW0X 4W9FA 3S16B 3W1SA 2A69C 1N60A 5K36H 3HOWB 4MEMA 1WTPA 1HXYD 3OYYA 4B3RL 4HK2A 1WFQA 2UUBQ 2VZKD 1AW7A 1FCLA 1EU4A 1SROA 4G7HC 3RZDB 3G48A 2K05A 1E2WA 2ACZB 4P16A 3Q3OC 4NAWA 1S5CD 5K5PA 4NKLA 2L05A 1VQDA 2E2JH 1EQVA 3MC0B 2JA8G 2YLMA 2PPHA 4A3DB 1S3SG 3BVZA 3OJ3A 3KLSA 4DHZE 4JI5L 1I35A 4K8IA 3NSWA 1PYSB 2W55A 1TYGB 1YX6B 3HRZC 5C0XJ 3EFXD 3CPWA 1OXUA 4A3JH 1SEBD 3Q3JA 1PFDA 4EFOA 2K75A 1BXTA 3QOJA 4MJSA 4GN5A 2PW9A 1WTOA 3IRBA 1ZXTA 2WB1B 2X69A 1R9TB 1MJEA 4KZ0A 3NZUA 2N1WA 3EBEA 2IGDA 3X3MA 2L5TA 4WAAA 3WAMA 1XYIA 1TGZB 2MP2A 1SJHD 1KLVA 1QOHA 2Q5WD 4XXEA 5CMDA 4GLXA 2WP8J 3UDXA 3T8MA 1QZHA 1D8LA 5E6JA 3C1FA 3K5MA 1XLOA 1MBYA 5IGEA 3C2PA 5I2YA 4OVUA 1J5EQ 3J7A5 5M3MB 4L5SA 4ZLTF 2NPTA 1IW7C 1KD1C 1FFUA 2M17A 3J7YW 2M56B 2VQEL 2NVXB 3HRDD 4DU9A 1Z5SB 4HCEA 4POGA 3NPPA 4OWTB 2DYMA 3CMMB 3TMPB 1T0YA 1K8GA 1JQYD 1K73C 1ILQA 3MHBA 1ICFB 4OX9Q 3Q8CA 2PYKA 2LHDA 3HFZB 3TMEA 2ZXRA 1NYRA 3MA2B 2OTJA 2F0JA 4RCNA 1B3AA 2KN5A 4AH6A 3NVWA 2JVCA 1VQMA 1EY7A 3EGRA 3DQVA 2FXQA 4DAVA 5HG2A 3DMUA 4F7XA 2JA8B 2AQ1B 2QMTA 4IZ8A 2CVRA 1IYFA 2KACA 4ZAIA 2RPQA 4HR7B 2ZJQA 3JYUA 1EQRA 4Q5VA 4LJZC 1FXIA 3H7PA 4L2YA 4MGIE 4C3IG 1Q7YC 2Y5CA 1S5FD 3I55A 1R4NI 1RYJA 5FLMG 3BDCA 1AN8A 5KIXA 2KQSA 2N88A 4RG1A 2JA7H 4DUZQ 5C6AA 4PMWA 1JORA 3K5NA 1UE1A 3PGZA 3OOCA 5DPSA 3V2TA 4PV1C 3G6EA 3ICEA 1BKBA 3GE3C 1H9SA 2RD0A 1WVLA 1EUVB 4KK7A 2UXCL 3DHGC 3UDFA 4HJ7A 1HNZL 1FRDA 2WXIA 3VQIA 2WDQB 2KFJA 4XDCA 2VZKB 1KLGD 2M0XA 3VHTC 4WAFA 5C5MA 2F52A 2KKCA 1TWHB 2JZPA 1F0ZA 4BBNC 2R7ZH 4E74A 4OWWB 1DM0B 4WH4A 2JUOA 3D4RA 3H94A 1XNRQ 3SK5A 3BDOA 4EE2A 1HQRD 1HZAA 4DK3C 1E90A 1D3ZA 2IYDB 4QJFA 3GTPB 4WWNA 1F9SA 1C7YA 1N5XA 1Q46A 1MJCA 3VYTA 2Y3AA 5IWAQ 1QOGA 1PYBA 2WGSA 5C44H 4LFBQ 2N7DA 1JRPA 1KRTA 4JGHB 1TU2B 3NTIA 3RMKC 4A55A 4JI6L 3T9LA 2FIFA 2QDFA 2LFNA 4M00A 3MXGA 4YIJA 5LHY1 2F0DA 4JL9A 1K8OA 1MIUA 1VQCA 4YHHL 1XNQL 1WGGA 2LWPA 4J8QA 5EPKA 1HR0L 2E2HH 4URKA 4XE0A 1QNUA 3W1YA 4KLKA 1SE4A 2RGFA 2WV6D 1YIWA 2YEPB 3AEEB 3X0WA 2QDBA 4UP7A 1XXGA 2ZCCA 4JI8Q 2ENBA 3GTGB 2IHEA 3PUZA 3I9V1 4DR4L 2HIXA 2FCQA 3S14H 1OFFA 1LLRD 2KJRA 4KKSA 4I65A 3A54A 1F77A 4C3IB 5JHAA 4FVMA 1V97A 2KOXA 2LXAA 1E1TA 1OO9B 1HTQA 2VB3X 2AKWB 3S2HB 3UINB 3L2PA 3H6NA 3J7AF 3GTOB 4JI1L 3V6EB 4IJHA 1SF0A 4R4TA 3K7UC 4YWMA 4XIGS 4JI7Q 2IZVB 2CKZB 1QVGA 3ND9A 4IO9A 4C3JG 2KCMA 3KF6A 3PRMB 2EJGC 2D5GA 1SGHA 3FVQA 1WM2A 1F2RC 5G55A 4DR2Q 3K59A 4C56C 1LUZA 3MTSA 2IPKD 3LXFA 2GVBA 4AQ7A 2I1KA 1B44D 2QSDA 1C8CA 1YMHE 3ZO5B 3I7FA 3CCMA 2RPVA 1GHKA 4B9XA 1R4PB 1E9MA 1H9KA 1ASZA 4ZCKA 4KIKB 5E4WC 4HRSA 3PIOA 4FF1A 1I3QH 5D3IB 2NN6I 2K01A 4CDDC 2BOSA 2BH2A 4HMIA 4CDEC 3GTJH 2BPSA 2L32A 2PQEA 3I4OA 1SJED 5GAGC 1EO6A 3FPPA 3JAMc 2VUMG 4GDLB 2KO3A 4FBJB 4W9JA 1PHJA 2EZVA 1T5XD 3PVLA 1WXMA 1X3EA 4UY8C 3S15B 2EQSA 4HPLB 2JYOA 1HZ6A 2OEDA 5IGCA 2RMMA 1NEKB 1ZKOA 4LF8L 4FADA 4GOPB 1B7YB 4UPAA 4TUUA 2L76A 1WSPA 3MXPA 2I5MX 1XMQQ 2CHXA 1EQTA 3VA7A 3S1QH 4DR3L 2Y5PA 2E8GA 3HG9A 4G57A 2NN6G 1YZ6A 1XEEA 4NJ7A 2NVQB 3W5OA 4KKIA 3A4SC 1WJJA 3KYCD 2PO4A 4P7IA 1C48A 5LNK1 4DAPA 1NJIC 2IT1A 3HKZG 4K0KQ 4JLCA 1VDZA 2MFIA 1TT5B 1C4CA 4NJCA 4H02A 1ESFA 3ZTDA 2DYOA 1TKEA 2R2QA 3I3TB 3OSOA 2UU9L 5KEEA 3RLOA 5L95C 5FKAC 5JJZA 2KDBA 2AMCB 5FJ8H 4WWOA 4PS3A 2F3IA 4C3JB 2ON8A 1ICWA 4RFBA 1QOFA 3AE6B 1HZ5A 1L0YB 4DNRB 3I4MG 5JJKA 1WGHA 2V3SA 5HI1A 3J7AV 4KVGB 1GO3E 1S5BD 2E75C 2ZM6L 3C0RB 3APFA 5K36G 1YD8U 5BMGA 4KY7A 3DDCB 3CWIA 5KHOA 3KW5B 2C5LC 5IP9H 4ID6A 4BA2I 5IN7A 1HTOA 2DX5B 2VUMB 5C23A 1E7PB 4DK1A 2K22A 4K5XA 4FF4A 1H9MA 3IXSA 2HTHA 2F4IA 5BMHA 2N3SA 3M4PA 2WXNA 3VR5A 2BB6A 1NI2A 3PZ7A 1STYA 2RA4A 5D65A 3A7LA 4GU2A 2MJEA 4REZA 1VQAA 1PUTA 2KDFB 1A0IA 3BJUA 4A3JG 2BCOA 1G8ZD 3PS6A 1PTOC 4JPBW 2B63H 2R3ZA 3I70A 2PJHA 1CZGA 5AZHA 4DBGA 1X32A 3DWMA 1SE8A 3V60A 1OXTA 1XCTL 2WDRB 3VA5A 1MSGA 3HKZB 1DOYA 2KENA 3OTOQ 4HJ9A 1AFPA 1O7IA 2OJWA 2LXJA 4TQ0A 3E6ZX 3TRZA 1L1OA 1TIID 2EKEC 3UQBA 3BY4B 4K3CA 1JR0D 2LXKA 3T1HQ 2A73B 5IT9E 3UE0A 2B39A 2F0MA 4LF5L 1UBQA 1WE7A 3MJWA 2CQAA 1TS5A 3SXHA 2I07B 3ALBA 3TBIB 4KHPL 4CJ2C 1AZQA 2QKIC 2RF4A 3FKIH 4IJLA 3RUIB 3MXNA 3IT4B 5IGFA 4ZRZA 2EXDA 3I4MB 2QHOA 2WAQG 4P71A 1YX5B 3AE4B 4A3KH 1PZID 4BKTA 3ZJVA 2UUBL 5LL6S 3GTMH 2JXXA 4IOAA 2HQLA 3PO2H 3NHEB 2UYZB 3T51B 3NWTA 4ICUA 3VVWB 3CHBD 4A90A 2O2VA 4TQUS 1T9HA 1S1QB 3BWUD 2EJMA 1TY0A 2KDMA 1LTRD 4ZRIA 4LDTB 2K5QA 2HD3A 1IHZA 3ZVVA 2LD9A 2B2UA 4DV5L 1IBLL 3GTKH 4PK1A 2KDIA 3VUYA 1CUKA 1GJZA 4W9GA 3O65B 1FVIA 3E9IA 3MAQA 4GLSC 3CCEA 1EIHA 3PMFA 1AARA 2OJRA 5DLQE 1J7BA 2KN4A 1X3GA 1GUWA 4A3JB 2RHQB 1UZXB 4ZUIA 2JA7G 1UNSA 3Q2AC 4XYQA 2NZHA 3NUCA 3LX0A 1GHJA 2R92H 5JPMC 4JE3B 5BO4B 1V5OA 1PGAA 4XTCS 5IE8A 3AEGB 1NNXA 1RIPA 2Z59B 5FK9C 4CKBA 4IPCA 1TZOA 2A68D 3K5LA 3RZOH 4X3KA 1G6ZA 4F8CB 3BINA 5ELCA 3KFUA 3KYDD 3HVDA 1BR9A 5HGQA 4HIDA 1J5EL 2KK8A 1HEZE 5HKHA 4FJVB 4L5TA 2N49A 2Z6KC 3T13A 2R7ZG 2IBIB 4JI3L 2CS4A 1L2FA 1MG4A 2RBMA 4MTKA 1JRUA 1PRTC 3U58A 4N9TA 2LHEA 1EWCA 1E8YA 3AI5A 2WP9B 2LI5A 4LK1C 4IALA 1ONLA 1F52A 4HCSA 2VQEQ 2MPMA 3D31A 4KX6B 3GP7A 2WAQB 3K9PB 1RF2D 3RN2A 1BBXC 1PYWD 4DPGA 1BT0A 4UP9A 3NY5A 4OX9L 4YWGG 1UELA 4AJWA 1B3QA 1DGSA 1JE4A 5C44G 3W5UB 4C7YA 2FBWB 4DDID 3UQAA 2OTLA 3DWPA 3KDFA 3P1HA 3WOFA 4TVAB 3KWVA 1J0GA 1VQEA 1Q8KA 2B2YC 1JT8A 2LJIA 1O7YA 5CGKA 4NXML 4LK0M 2EPBA 1PVOA 1C1YB 2A6ED 4ALPA 1Q1OA 1FRRA 1PV4A 3NS8A 1EZ8A 2KCNA 3F2BA 5HFYA 2MO0A 4F87A 1G2TA 1AE2A 5G2NA 1IZ6A 3V62A 3TEZA 3GV3A 3PIPA 3OG5A 3CRKC 5GAEC 4OONA 1WTWA 4WJ4A 2NYZD 3N32A 3U4EG 2YU9H 3CU7A 5KHQA 1NY4A 2EJFC 2KJXA 4LWCA 3TP8A 2F0TA 2UXCQ 2F3WA 2JA7B 3HEJA 1LABA 1HNZQ 3BU2A 3P75A 1WTHA 1VQFA 3W1SC 4GKKQ 1TWGH 2ZZPB 5FR6A 3ZKJC 1G51A 1HUMA 3VDZA 2KFKA 2M2LA 3STBC 2LY7A 4WJOA 5AZFA 3PHXB 3TUOA 1WX9A 1LACA 1L4DB 1KL9A 4WQOB 3I90A 1XNRL 1NI3A 1YEZA 2AHOB 3S1NH 1UF0A 3CP0A 4DXGA 3QA8A 3DWQA 3VH3B 4FNFA 1LQBA 1KOTA 2WB1E 1CKOA 2R7ZB 2WX0A 3MFYA 3EUB2 3NG0A 4GMVA 5IWAL 1WXSA 1PH2A 1FCCC 3TEYA 3GE8C 4LFBL 5CX3A 3KF8A 1P9DU 1E10A 1QZGA 3TDQA 3PTFC 2PE9A 4EQPA 3Q8BA 5EDSA 2KLCA 4GSWA 1NR4A 3RZFA 2ASQA 3J80E 3FEWX 4XX5A 4F1SA 2QCZA 2WACA 1PQSA 1FIQA 5C44B 2IY5B 4JBJA 3FRPB 1KDAA 5TSSA 4NXNL 1GD7A 1WTRA 2PI2E 3MC8A 4FJYA 4BOZB 1XNQQ 1PXUA 4A3CH 5AFWA 1AWDA 4A3IH 1HR0Q 1I50H 2JA5H 1FEHA 1WTVA 4WWPA 1YHBA 1PTOH 4XZ4A 3NVZA 4JPSA 2GB1A 4C7ZA 4WJPA 1BF4A 2D3CA 3L17A 4RM8A 4CJ0B 4M8NA 2LZ6A 4ZHPA 2D9UA 3F1ZA 3K0YA 1JOQA 1UD7A 4C1NK 2VH1A 3RNAC 4FXCA 4YXDB 1A2TA 4TRDA 2VXWA 3MC9A 1X6OA 2H4OA 2W3SA 1N61A 4B0MA 4W9KA 3S14B 2CR5A 1HZBA 4B08A 1K51A 3NS1A 3D0FA 1ZE3D 5J17A 2ES2A 3N52A 2AWTA 3EFUA 3NUHB 4LFCL 1OEYA 4LF9L 2F0PA 4JBKA 1JCKB 4FLHA 3NZSA 1PH7A 3AM9A 2RDBC 1MHHE 3MZ5A 4YSXB 5FJ8G 2BE5C 5GAHC 1BCPD 3SDZA 5C0XG 4L5QA 3A8IE 3GS2A 3L10B 3IFDA 4CJ1B 4AOFA 1IYUA 3PZDA 4HN7A 1QOBA 3QG1A 1W3SA 3UE1A 4G7OC 2K4KA 1IL2A 2LVPA 5DPRA 1XLPA 2OF1A 1XCQL 3FKYA 3WAPA 4G7ZC 4DAYB 4M0WB 2PMZB 2ALYB 4POFA 2NMQA 2MBBB 2GBRA 3N3KB 2GBNA 1I3QB 1S5DD 2C7NB 5CV9A 3GTJB 2L15A 5IP9G 5EBCA 4LF4Q 1PMRA 3M85A 2MQHA 3B9JA 4K6LA 1P1AA 3M4YA 4LNOA 3F8TA 3RYTA 1VQHA 3VUXA 1AZPA 5BMIA 5IGDA 4FYDA 1J9OA 2B2TA 2A6HD 3D3RA 4DF7A 1XMQL 4APVA 4KDLB 2PW7A 2PZTA 4BFRA 1X55A 4LNKA 1FGUA 3A56A 1BMLC 2KWUB 4DR3Q 1XO3A 1IPGA 4X64Q 3H09A 4Q2JA 4MN3A 5JAVA 3NBIA 2KEEA 5C3EH 4KGRA 4NMZA 2FJ2A 3S1QB 3ZXRA 2B63G 1VQBA 2VL6A 4G4KA 3GZNI 3PO3G 4IC7B 3G6JB 1SNQA 3UI2A 2NVUI 2WS3B 5D14A 5AJ3L 4X66L 1WGRA 1HQMC 3J81c 2KHWB 1TTNA 3K9OB 4CO7A 1KJTA 1YJWA 1VQJA 1LGRA 3BZCA 1EY5A 1YN5A 1VCBA 2W82A 1QT9A 4DR7L 4DAMA 1TWAH 2ATWA 5JJLA 4A3LH 1N5WA 4HSVA 4K2LA 1WRDB 2JRHA 1M8AA 3L16A 3P4QB 4OVVA 2LGYA 1DCZA 4N8FA 3J9CA 3KYHC 4MH0E 4X3SA 3AXCA 4YT0B 3HOZH 4RGTA 3HOWG 2HT1A 1BDOA 4MM3B 1L7YA 2HCIA 3AECB 3FKIG 2K04A 4IUPA 1I4RA 2AL6A 1DONA 1ZUD2 2ZM6Q 4HVBA 1YHAA 3QIAA 1CJEA 1V8QA 4A3KG 4QMGA 3PIP3 1VDVA 5BYSA 2B76B 1N33L 2K5VA 3Q8FA 3CC2A 1VMPA 3URYA 3ML9A 1NAPA 3PO2G 2BTEA 4RHRA 1V1PA 3AB9A 3DPDA 1KLUD 4LCDE 1K53A 4OW0A 1SB3C 4J15A 3C3LA 2FIDA 2A19A 4NPSA 4PS7A 3CCLA 1LM0A 1JWMD 2PW5A 3UI3A 4O1NA 2EYPA 3L0OA 3NENA 1F2RI 4IM0A 1V43A 3B2FA 3OLMD 2ZW0A 3IBEA 4HIMA 3CCUA 1EF1A 1TVXA 2UXDL 5J3BA 1VZ7A 1KHIA 1WI0A 4L1BA 2B2YA 4PZ6A 3ML8A 5AUKA 3DWAA 4QY7A 5EQ0A 2J0TD 2O6VB 4BKSD 4KHVA 1G6PA 2ZVNA 4HIOA 4WURA 1GNUA 3QC8B 1PH8A 4R4IA 3CCQA 2B63B 3H6MA 3VXWA 2KHJA 1UUPA 3PO3B 4PYZA 3G4SA 3MJ5A 2J0KA 3T1HL 2R92G 2VQFL 4HKZE 1ENFA 4BXXH 5M5YH 4EZJA 2WWZA 5F2DA 2GN5A 1WZ0A 2N4FA 3HUIA 1KQSA 1YHQA 3SDLC 2PTLA 4L6TB 2X8XX 2CHBD 2JP1A 3AE5B 2JRIB 4DHJD 3PO0A 3MP9A 4ODGA 4BOSC 1GUOA 3H8HA 3ZRCA 1CKMA 2KHSA 5KRUA 4X62L 4IURA 3ND8A 3R3OA 3P4PB 3PHWB 2J4XA 5IO9A 3HVZA 1FFVA 4NW2A 4C4VB 1XX8A 1Y8OB 3P4SB 3HOYH 2WU2B 5LMNQ 5ELDA 3SK4A 2LASA 1JQ4A 1SNMA 1Y1VH 3A55A 3F2CA 3BDLA 3FKIB 1WTQA 3AULA 3GZNB 1X54A 1UWXA 2A8VA 1Z6HA 4K3BA 1X65A 2WHIA 4ZDVA 3Q3MC 1C4QA 5G5HA 1V9JA 1N8RC 4A3KB 4NAMA 4A4IA 1E6EB 4E71A 4RMAA 1ENCA 3D32A 4XYOA 3GTMB 1YVCA 1FNUA 2WDTB 4KD3A 5GMVA 3PO2B 3I63C 2DNCA 3DEPA 3N6RA 2E74C 4W9DA 3GTLH 2GMIC 2LUEA 3UIPB 3RT3B 1I5FA 3I8ZA 2F1MA 3GO5A 4DV5Q 1IBLQ 1WE6A 2L1AA 3VRAB 1P3QU 2WXLA 1NCVA 5IYDH 4GNXA 3GTKB 3CKIB 1E1OA 1DOLA 3MEHA 5LXHA 3H9DA 4R4QA 3AEAB 1Z2MA 4CKCA 4DK6C 4BY7H 5GROA 2QEJC 2EELA 2B29A 2JSOA 4IUVA 4KJOA 1QG7A 5CV4A 3A5ZB 4IOCA 3W5VB 3S9WA 1WX8A 5HY6A 2ID0A 1HTLD 2BKFA 4YTMB 4JI2Q 1RLFA 2BYTA 1SBBB 2R92B 3U30A 1J8IA 1I4GA 1H95A 2C7HA 2L12A 1TKYA 3N1XC 1RODA 4M8AA 3RZOB 1I94L 2QW7A 4JI3Q 4TSSA 4XT3B 3NZ3A 4H2AA 1OXSC 5C3XA 1T0QC 2MBHA 3J7ZC 2RCNA 2AL3A 3FMCA 3L54A 3HKZE 1VQ8A 1JWAD 4DV7L 5CHFA 1JICA 5IP7H 2K5NA 3G71A 4DV0L 4YCVA 4TKNA 2DYBA 4LAAA 4B9WA 5CV7A 3H3VI 1P7FA 3RN9C 1K8RB 2Q2HA 4YSZB 1YNNC 4DUYL 4A3PA 4GOCA 1L0VB 1T6BX 2AX5A 1EIYB 1F9PA 1H9JA 1WD0A 3R2TA 2PQAA 4WRDA 3QOLA 1DZ1A 1FYCA 1WM3A 4IG7B 4NXMQ 4USAA 2JF5A 2JSVX 4XYCA 3I4NH 4XQQA 4FF3A 4A3CG 2KX0A 4A3IG 2JA5G 3IHPC 2N8NA 1L1OC 1KIXA 1U5KA 2WXGA 3FC4A 2MBEA 4DHJB 2I2YA 4O0AA 2C9OA 1FD6A 2X6GA 2HDEA 3Q24A 4HCNB 2KFKB 4A3FH 3I91A 1Q0WB 1L6UA 4JK1C 1EF5A 2WXFA 2MP1A 4KGSA 4HAEA 1WX7A 2MJ8A 3EN2A 1LT4D 2ZTCA 1QOAA 3EECA 2F0GA 2KQ3A 3TSSA 4GKKL 5GXGB 2MA9B 2YU9B 2F0UA 3OPOA 1MFWA 3JC66 3BK2A 5JEAJ 2JWZA 3OMCA 2KX3A 4DXAB 3DHHC 4GLAC 2VH2A 2FMCA 2MX2A 3VYSA 3NJTA 1ACCA 2AUKA 1YIJA 3JSVA 4HSPA 1QLBB 1TWGB 3KJOA 1SIJA 2NZ1D 2TMPA 3M63B 4KN7C 1XWEA 1Q86C 2K6AA 4PS8A 2JYTA 1AEXA 2F0NA 1WYGA 3S1NB 2CHWA 4GXBA 1EY9A 4HXDA 1UWMA 3A8JE 3ZDTA 2F0LA 2R2OA 3ZYYX 1C0AA 3AE1B 1RFKA 3QQ8B 4GDKA 2B2UC 2KOLA 3BIID 2F0KA 1J7AA 1WMHA 1WYWB 2EY6A 2D5DA 2OXPA 4HPMB 1YOVB 2EYLA 4LJOB 1LO5D 3C1EA 5C3JB 3AE3B 2MSED 2CKHB 4BZAA 3BVGA 3VDYA 1C76A 2JK8A 3VAWA 1G291 1LTAD 4W9IA 3GB1A 3A74A 3M4QA 2RVLA 4NXNQ 1UGMA 1V2YA 2K6QA 2JXMB 3U9SA 2CQOA 4R8IA 3SD5A 1PRTD 3AFQA 1XLNA 2RSOA 4B3ML 2YYZA 2LFIA 1B9RA 1O78A 2JT4B 2AUJD 3E0EA 2XTIA 1TS3A 2WAQE 3SHLA 2GBJA 1WWTA 1EFID 2EY2A 4A3IB 2JA5B 1I50B 5GQOA 3A9JB 3BYYB 3DWGC 3AE7B 2IO1B 1CKNA 1KAWA 4EX5A 1WR6E 3B2GA 2HHHQ 5C3EG 4V0BA 3K6OA 2CW0D 2N9EB 1NSNS 2BT6A 4DFAA 4ILWA 5T8IA 1QCBD 5ELBA 5BN4A 1VQPA 4ZYNA 2GRIA 2XSCA 3PGEA 3PLUA 3EC8A 3GQBA 2K8HA 4LFCQ 3NBHA 4LF9Q 5A2QE 2QA4A 1PLFA 1Z7TA 4GIVA 4FN2A 2SDFA 4DKAC 4A3LG 1EM7A 1KFYB 3VTWA 5DCNA 3CD6A 2PMVA 2JX5A 1YJNA 1R4NB 2F03A 3M95A 2RCFA 4NQLB 1KDCA 1XPOA 2PZWA 4JYAQ 3HOZG 5C4HA 1HFNA 2MW5A 2EOTA 1Y8RC 3ETRA 1EYGA 3B6YA 2H1EA 3PF4A 1PH1A 1PDXA 4LLGM 1WD1A 4NY0A 3DM3A 4UAIA 1ET9A 1QZEA 4PQXA 1TZ1A 3CCSA 2I0QA 3FILB 1J6QA 3EIVA 4EOYA 3AE8B 2V4IB 2YV5A 4LF4L 4JX1C 1U4AA 4K7UA 3EVQA 4M8MA 1HH2P 1AYFA 3J80i 4OZCA 4B6WA 1A3VA 1J8CA 4FP5D 1F9JA 1TBEA 1EYCA 2E76C 3BK1A 4BAXA 2K9XA 1S4ZA 2DZMA 5CV5A 2WKDA 1VQGA 3H7SA 4PT5A 5CR3A 3TP5A 5AEKB 1X3FA 3N30A 3KVFB 2QJLA 2ICEC 4QCLA 4KV6A 1JWUD 5EKLA 1U9RA 2Y0SG 3KUPA 4LUZA 4X64L 2C60A 3VRBB 3M3JA 3VUWA 2LMCA 2IX1A 1WYDA 4GLVB 4LMQD 3E9HA 4II2B 4K6DA 2EIFA 3R93A 3A1QB 2REXA 2JU6X 4XDDA 4ZYSA 1YQ3B 5HHDG 4K14A 2BDNA 2OEOA 3ERQA 2K8BA 1K3RA 3QJZA 4JVZA 3TZUA 3DBLI 4ZRQA 1L4ZB 4IWOA 1BCPF 5AJ3Q 5C3EB 4X66Q 5CHVC 3RZWC 4L8JA 2XK5B 4LDTD 2LRUA 4OVZA 3RUZA 4DNTB 2L83A 1MHXA 3NOBA 4DR7Q 2N9PC 2K14A 1IBML 3CQZH 1DOMA 4G0NB 1EZ6A 4BXXG 2VY3A 1U4RA 4R8NA 2KCTA 3A9KB 4WQMA 1CK1A 1TWAB 3JAMi 1OEYJ 2IDYA 4MACA 4MELA 4N6EB 5H8YE 1H4RA 2W3RA 3LJ3A 1PRTB 4JG2A 1IYVA 1PH6A 2L0FA 1GC6A 5BYRA 2EKIA 2G1EA 2F0HA 3L13A 3HOZB 1XD3B 1T0RC 1Q90A 1TQOA 3Q3NC 3HOYG 2MQJA 2NVTH 3AYHB 1QUQB 4BA1I 2MEKA 4N58A 3K57A 4IDIA 3TCAA 1SYBA 2P5ZX 2G45B 4ME5A 1SNDA 1N33Q 4HLEA 4DA2A 4WFN3 3EROA 4IWQA 4LNNA 4OHJA 2MJDA 4YWKA 2ZCBA 4KKTA 5EPJA 1CFMA 1YI2A 3J81L 1ASYA 2J52A 3L4PA 2BYEA 1VS0A 2KVRA 1IGCA 2M19A 2ZPYA 2IW3A 1B70B 5IOCA 3W1BA 1EWHA 2Z0SA 1EWIA 1N34Q 4II3B 3JVZX 2PMZE 2ZXPA 4K2KA 5IYDG 1V80A 3MVVA 1VD2A 2Y0SB 2UXDQ 3WALA 3OWFA 2V9HA 3H3VC 1IBXA 1T0SC 3HZXA 3IFWB 2KHIA 2HUGA 1FMAD 5KYLA 4MSMB 1CQFA 1FD7D 2K5HA 3TP7A 3DVNU 2J7ZA 1UAPA 4BY7G 4MGKE 4CYEA 2AQ2B 2KA7A 4JBWA 3AMUA 2B2VA 4HMJA 2VQFQ 2N7EA 2V3NA 3Q0AA 2FE8A 4U673 4M02A 4N59A 5CV8A 2TSSA 1MGSA 3U2SC 5EGTA 3KUZA 5M5YB 5KYIA 4ITKA 3SR6A 2CFMA 4NAWB 3T3OA 1JWBD 3EHVA 4X62Q 2F0OA 2NUCA 1E2ZA 5LMNL 3SK6A 5J18A 3FPUB 3QHTA 3NQIA 1VCIA 4FDBA 1FO4A 5LXIB 3CF5A 3SFEB 1DYQA 2B2TC 5IP7G 5KNDA 3DBLB 5EKKA 1EY6A 3HOYB 1EY0A 1Y69U 4B95A 2KTRA 5EE3A 5AUIA 3H91A 5JEAH 4WJWA 3KBXA 4DR6L 3PQIA 4F88A 4ANWA 3MFGA 1UE5A 3RD4A 3QJYA 3DUZA 2BS4B 4DV2L 4MJSB 4KMUC 2GVAA 3T56B 4NZLB 2E2JB 1YNTE 2K5PA 3RZDH 1HFGA 2O5JC 4EUTA 2UWQA 1F2LA 2VZAA 3I4NG 2MP2B 2RQXA 2ZVOA 2CWAA 2LGXA 3NELA 1FPYA 3GTLB 4JW0A 4G50A 3RNFC 4DWFA 2DZIA 4W9LA 5E6PA 2KC1A 3PRPB 2Z8LA 1IYJB 1V9PA 2B8GA 2JEBI 4A3FG 4XGAB 3MXUA 4KSKC 2K7VA 1E8ZA 4RF1A 1TKWB 1A70A 2K33A 1P16A 1EL0A 3TP6A 2PNHA 1E5WA 4RA8A 2F0FA 4JI2L 1OXVA 1PH3A 4BY7B 2NPTB 4A8XC 3KLRA 1YN4A 2FNJB 2ZNVC 1PFSA 2E3TA 4M1UB 2J0JA 3TS0A 1ZP0B 2A5HA 2C9WB 2D2QA 2XEWA 3ZDMC 1SXTA 2KDEB 5KNCA 4YWLA 2G3QB 1STEA 2BS2B 2YTYA 1I94Q 1YJIA 2BA1A 3ZNID 4B3TQ 4G3XB 1M90C 2WXPA 3L7ZC 3CXCA 1EQQA 2DUDA 1STHA 4DV7Q 4YL8A 1VQ5A 1HCZA 5L37A 3HOXH 2BQQA 5LMUL 4DV0Q 3UDGA 1PA6A 1K8MA 1WJ4A 4X6AH 1SSNA 2LVOA 4AJYB 3KOJA 3CC4A 2V3PA 3H7PB 3NTKA 1PZJD 1HNWQ 4R3DA 3SFDB 1E2VA 1JWSD 5IT9L 1EU3A 3BG3A 4DUYQ 3A5UA 1NMFA 3ZUNA 2OHFA 3FDTA 3I73A 3QAQA 1M1KC 4OZBA 1H9SB 3M3YH 2BWFA 2A69D 1DOKA 3AV8A 1UE6A 2XN9C 1XPRA 4S17A 1Y8NB 1WJNA 4DV6L 4CDFC 2PVGC 2R93H 2L7RA 4H0LC 3I4NB 1J7CA 1LT6D 2YEPF 2QIEB 5G3LD 4IWPA 1YJJA 1A5RA 2V0GA 4QF4A 3PT2B 5CORA 1Q5WB 4HTHA 2PE6B 1SE2A 3P1MA 4EQNA 1PFNA 3J81j 4PG3A 2WQYB 1C9OA 4A3FB 5EKIA 1ZYRC 2DENB 2NS5A 4IQZA 3QB3A 2DNEA 2NBFA 3BVMA 3RNGC 2V4LA 1BBWA 2LRWA 3DXJC 4BKSA 2D0OA 5ELNA 3WA0A 2N1VA 4CBVA 5DPTA 5AZGA 5FLXE 3NK9A 1YBYA 1L0XB 2OT2A 4R1JA 3TEXA 1E24A 3MTNB 2SNSA 2D3GA 1VQLA 3A0JA 4Y7NH 2I1JA 2KMMA 2KXJA 3S1RH 2K0PA 1OQQA 4HKQA 2KMCA 1Q12A 1SYCA 4DV1Q 4GGQA 1KC8C 3UDIA 2F0EA 5CBEE 4S0RA 1XTDA 2L4NA 5H1SE 4TMAB 1VF7A 3ZGZA 3U4ZA 1AP0A 2NB0A 2N78A 3CAMA 2MO1A 4GNXC 3Q14C 1OQRA 2MCNB 1EY8A 4C2MH 2UU7A 3FAHA 5DNFA 4X65L 1GUGA 1JJCB 1E7VA 2NBWB 1CKNB 4P6VF 3RFZB 4XWWA 5TR5A 1VQIA 3VFKA 2YVCA 2D2CC 1Q10A 1WZ3A 4ACFA 1IW7D 4XC2A 1S40A 4B3MQ 4E3CA 2EVBA 2E2HB 3H3VH 3QIJA 4FF2A 1H9RA 3VYUA 2CH4W 1D5MC 4LNIA 3UIOB 4HJ8A 2N9KA 1IXRA 1EY4A 1YNXA 2ZJRA 2M1MA 1QILA 3RR5A 4JIOU 2DJFC 3X3NA 2HHHL 2L0TA 4ULLA 1JW9D 3KF6B 5C4XH 1Z9FA 3TREA 2EYMA 3NRZA 4A75A 4CQNA 2PEAA 3Q8AA 4TKOB 4X3TA 2N7JA 4EQ5A 1FJGQ 3ZW3A 1N36L 4K7SA 2HQEA 4I7ZC 1I4XA 4K8JA 1ESRA 1PH4A 2ZXOA 3JAME 5D2MB 2F3VA 3NHHA 3KUCB 3N1ZC 2UXBL 3VH4B 2E6XA 3Q6SA 2I46A 2HDLA 1NR2A 1II3A 3NEMA 3ENEA 4MGYE 3WAOA 4AP4C 3NP8A 3ERSX 1YITA 4JYAL 1E7UA 2IO3B 3ZNHB 1RTOA 4H44C 2RDGA 4ARIA 2H89B 1E7ZA 2O6VD 4RGOS 4IKGA 1SYFA 3EA6A 4PNYA 3VTVA 5EE1A 1MI2A 2BF8B 3WOEA 1IKMA 2OOBB 2KTFA 1LFDA 3ZLZA 1KNAA 1U4MA 3ZJUA 2ZPNA 3ECIA 2BVCA 4XT1B 3CF6E 3SVMA 1UWVA 3F2UA 4W9CA 5D7GA 3VR2A 3LNNA 1NYQA 4J6IA 2RDFA 1J19A 3U50C 2KMAA 1XLQA 5CHWA 3U4VA 4QGUA 3B1LX 2BBCA 2W54A 2IO2B 4GKJQ 4FXGC 4KI0A 4BBRH 4DR5L 2A5UA 1KABA 1VQ7A 5EE9A 1XMOQ 3IKJA 4IPHA 2WXMA 3DM1A 5DAUA 2R6GA 5I4DA 2EYHA 4HJAA 3PSEB 4F7ZA 4B3SL 1CI3M 2AWNA 4AIMA 3C46A 4AUQC 2JA6H 4KKJA 2VW9A 4PMBA 5BR8Q 3VTUA 3S1MH 1HR0W 1I6HH 2C5CA 4KIKA 4HJKA 5M5XH 4IUTA 4P75A 5A35A 4QIWB 1BNZA 5I6YA 4JBMA 1PGXA 5LL6X 3HP3A 2X38A 1SYEA 3ZXVA 1B50A 4GDLA 3AU7A 3HOVH 2G5DA 2JA9A 1IBMQ 4ZQ3A 2NR2A 3UF8A 2KWCA 3GOEA 3P20A 1JMCA 1W6JA 2QILA 5C4ZA 2IO0B 3ONAB 2INPE 2RR9A 1DXMA 2BA0A 1V1OA 4O42A 3CQZB 4ASWC 4P72A 3ZJTA 1CZWA 1GUNA 2B3GA 4EVOA 2DJGC 3AQQA 3RCZA 3KLWA 1KNEA 1JMLA 1RFAA 1X3PA 3DVGX 1WIAA 3TJPA 1EYDA 3SU8X 4AWJA 2Y5BB 3PREA 3LDZE 2NVTB 1ILPA 5G5GA 4A3MH 2LGDA 1CSQA 1O80A 3IAYA 2DBYA 5JEAG 4J6HA 1OTCA 1ZXIA 3T1YL 1WCMH 4DN4M 4BY1H 1P98A 5IYCH 2OWOA 1TS4A 2I38A 2ZJPA 1ENAA 4P2CB 2ONQA 4IOIE 1NBWA 2YTVA 2Z9HA 1N34L 2NTSA 1UGJA 2K8CA 2VRRB 1VQNA 2EMSA 5MPOA 1L1OB 1GVPA 4BVUC 3NXWA 4YY3L 1A2UA 3WDNA 4A3BH 3GDEA 2MGSA 4B0EA 3SE0A 2E2IH 1GOZA 4ZOHC 4DK5A 4LF6L 3A8KE 3W2DA 2EE1A 2CU1A 2UUCQ 2A68C 2IY0B 3GTQH 3MHZA 3MXNB 1ZOYB 4ANVA 4KKUA 1LTID 4K5WA 3ULJA 4YCUA 1K3BC 1SE3A 1TXYA 2IX0A 2XBBC 3SK8A 5H92C 4P1CC 3KK7A 2KJHB 1TWCH 4OGQC 1D1IA 1K50A 1FXTB 1W6KA 1ROEA 1HJPA 4UP8A 2PKOA 5CV6A 1B53A 1EIGA 3SGIA 2QF7A 1STBA 3ZTCA 1YNJC 1GC7A 4GB9A 1QVFA 4PZ8A 2O2VB 4AYBG 4MIUA 4MSQB 3P63A 1EFWA 3KLSX 1CZPA 2DY7A 2IGGA 3TEWA 5FR3A 1E3PA 1YQ4B 1JC7A 1N63A 3I56A 2NCNA 4H7BA 3HOXG 4US8A 1BQQT 3KBGA 2V4DA 3R7QA 1FL0A 3WWVA 2B8FA 4G11A 1VZ6A 5ISRA 2LUMA 2NBVB 4DR6Q 4DV4L 2L11A 5E7NA 1RAXA 4DV2Q 4MT5A 3BZKA 3VYRA 1SYGA 4MTNA 1QVCA 3TEHB 5I2XA 3DOWA 2GI9A 3CSFA 4A3EH 4MDKE 2JQOA 1VQKA 1VRAB 1IL8A 2IX3A 4JWSC 4QAYA 5IT9c 2Q2IA 2R93G 1JJ2A 5M3FH 1WOCA 5IA7A 2L0CA 4OWXB 2N55A 2FHTA 5IY0A 1L5PA 1RM6C 1YJ1A 4MH8A 4L5RC 2XWJB 1QNKA 2CU3A 4ME3A 1TY2A 1G91A 1C9FA 2K5WA 3W9CB 2K32A 2EXZA 1WFYA 4RKLA 1DOIA 1IBKQ 2PVOD 1Y14B 2GA4B 4FJZA 2Z6BA 4JCVE 1EEID 5C2TB 2LS01 2JN4A 3OJ4B 1MG8A 1MJDA 2W9NA 3B08A 4CHKA 1DJRD 2RHSB 4LNQA 2Y0SE 1U4PA 4U68A 2L8JA 1Q3LA 2WXHA 1PTOD 1TR5A 4B3TL 3I4LA 1W2BA 2N9XA 3QWZB 3KDFB 2EY5A 2DAJA 5I9PA 4OIJA 2NWGA 3HM6X 2MJ3A 1DGJA 3TIXA 1HA5A 4AYBB 1GUAB 4AQYQ 1ISNA 4KDIC 2G9HD 4EZLA 3SHQA 2B2WA 1VF5C 5LMUQ 1HNWL 2BWES 4I6PA 5M5WH 1WI5A 4A93H 4A9AA 5IYBH 4H13C 3HOXB 4LNFA 4XDXA 5M9OA 2KWVB 5LMNW 1MKHA 4R9WA 1EIFA 1F9QA 5ELOA 3KH0A 3BS1A 2KZRA 4PYUA 3QARA 4HIKA 2A4ZA 4DV6Q 4BBSH 3L9AX 1I4HA 4CHTB 2K52A 2B2VC 4PZ7A 3QO2A 3M3YB 2DZJA 1SLJA 3M4OH 2XNAC 4HJGE 4HROA 1C77A 3LWEA 3R66C 1OTRB 2R93B 4ZKCB 3ZJYC 1LV9A 1TS2A 5C4XG 2G4SA 1IUEA 3ONSA 4JV5L 4OL7A 5J22A 1A6XA 1FXAA 2SAKA 3IVFA 1WXVA 1HA6A 4LUOA 4JQWC 3S2AA 2LXCA 4MGZE 3U52E 1CHPD 1JOOA 3KF8B 3HGBA 3TN2A 1L0WA 3RULA 3S2DH 1BCPC 2HIVA 2CCZA 1JJGA 3PV0A 3B0AA 3AE9B 3O13A 4IM3A 3E9SA 4KTAA 2WINB 4ICVA 3RPFC 4EQOA 4NJ6A 4OIKA 2XIWA 2KD0A 2D0PA 3PUXA 4DV1L 2WXRA 4UDUC 2KNBA 4IFDJ 2JEAI 4GN1A 2VB2X 1K83H 1D4BA 3FP9A 3Q22A 3CCJA 3PSIA 2A74C 3GV6A 1WGKA 4Y7NB 4X57B 3S1RB 3A33B 2KEDA 3QK0A 4NPNA 1V81A 1MD2D 2LSSA 1F2ZA 2BH8A 1D1KA 1I4PA 1KM7A 3CC7A 1QB5D 2DY8A 3VR3A 1KRHA 2JPHA 3H0GH 5G3LF 3ULPA 3WIMA 5E6OA 4YSYB 1A3UA 2A6HC 3DVNV 4X65Q 2HDMA 2GBMA 4RF0A 2F0VA 2BB5A 3HKSA 3V05A 4C2MB 1WH3A 2J7QB 4BBRG 2EYFA 3IFTA 4RCOA 1PTOB 1UE7A 3LWUA 2N0SB 4RGNA 3RN5A 1JROA 2K3UA 2KCCA 2WFWA 2E2DC 3DHIC 1ZEQX 2DN8A 4QUCA 2JA6G 1FJGL 3UGBB 1CM9A 1JE5A 1GAQB 1GXDC 4EKUA 3RLNA 2L55A 3M62B 3PUYA 5FLXc 2F0SA 1NVID 2JWUA 5C4XB 4HEDA 4JI0L 2XRQD 5EAYA 1GJXA 1R4MI 2MBOA 1N36Q 1D5XC 1XT9B 2KYWA 2HE7A 1CMXB 1GUSA 3TS2A 1A3TA 2FINB 1NBFC 5FO7B 5IGGA 4KGTA 4LFAL 2UXBQ 3HOVG 2CWPA 3J80c 5JH5C 4DK0A 4KV2A 2PCFB 1GKHA 1SFOH 4DR1L 1QKZA 5T1GA 2IY1B 5EPLA 2HCCA 3OHXC 1KTKA 2L3ZA 3MEFA 4S3SA 1TJEA 4P74A 4JOIA 1YN3A 3ABVB 2KQ7A 3U7DA 1BBUA 1B9MA 2AWOA 3NVVA 4B9KA 1Y8PB 1F2YA 5JOBA 1RKNA 1ZYRD 4DDGD 3L0WB 4KSLC 2FCMA 4W9HA 5FO8B 3STBD 3AN1A 1STAA 1HZ9A 4RMFA 3PUVA 2QC8A 3TL5A 3LYYA 4KHZA 2PLPA 4R4OA 1UBIA 3J81E 2EY1A 3OIPA 5KNBA 4GKJL 1HNXL 2CJOA 4A3MG 3K7AH 4XWTA 4RAUC 2VNUD 5IKCM 3DBHI 1V49A 1FNWA 1P8LA 2N9LA 3PUWA 2ZTDA 5HGTA 1WCMG 4M01A 4BY1G 1XMOL 5IYCG 3D6CA 1CSPA 1N9WA 3I2ZA 5JXVA 3W3AA 4DR5Q 4ZKBB 3S24A 1WJ6A 4X3UA 1RJTA 1SMYC 2Z0DB 1NENB 4I6LB 1WXQA 5LLIA 3Q6BA 5BR8L 4BBRB 4OO1H 3I5JC 4KY6A 4I7AA 4B3SQ 1EEFD 1RL2A 3NWSA 5C1ZA 4BWGB 1X1MA 1ZXHA 3N9YC 4A3BG 3NVYA 3ZQ4A 3G7LA 4EGVA 2PZUA 3R2IA 5E6NA 3KJPA 1SMXA 5E4XA 1QWYA 4HDOA 2JA6B 4DAYA 4ZK9B 3V61A 3S1MB 4US9A 2G4DB 1I6HB 3I72A 2V1CC 2XGTA 5M5XB 1EYAA 1Q1EA 4QUFA 1TKGA 1EUJA 5J39A 2ZNVB 3IT6B 2NVYH 1N32L 4A3GH 5JZEB 2SEBD 3HOVB 3MWYW 2KT7A 3HHMA 1GPXA 4BBNF 3GD7A 3OW2A 3V96A 1V1PB 4FHKA 2KECA 2Q8RE 2BS3B 4EZKA 3M9BA 4J1MA 2LGSA 2M00A 3DEOA 3PRZA 2WXKA 2L1BA 2GBKA 2Z0EB 3P4RB 1Y1VG 2JE6I 1WGYA 2K50A 3PCOB 1GG3A 2YTXA 1LXDA 2FCNA 2F4VQ 1PDQA 2BGFA 1R4MB 2BKRB 5CC4A 5C0XH 4RGMA 1LTSD 3QWNA 5A2QL 1KH0A 1V6EA 4DV3L 2DNFA 1Z47A 4MZ9A 5EBDA 2BE5D 4DHZB 3A4RA 1Y1WH 3T1YQ 3DBRI 1IGDA 3U7ZA 1VJKA 1SAPA 4FXKC 2BYFA 4A3MB 4O2DA 4W9EA 3VR9B 1M4VA 1WCMB 2QCPX 4PMCA 4P73A 4BY1B 1S5ED 1XQQA 2D3AA 3Q23A 4C80A 4KZCA 4A3EG 2E5LL 2WDVB 4OZAA 1VQ6A 1LTGD 2C35B 2UUAL 1MI0A 3DBSA 2NTTA 4YY3Q 4LF7L 1SYDA 3NE5B 5IGBA 1E8XA 2WX1A 2INCC 4MM3A 4ABNA 5M3FG 4C3HH 2UUCL 4WJNA 4LF6Q 1N62A 3PLVA 1JOKA 4A3BB 4EEWA 2K03A 3WANA 2SNMA 2KANA 3Q8EA 2E2IB 2K28A 3R3MA 1VQ4A 1TWFH 2LVQA 3N1YC 4FXDA 3HOUH 5C4JH 1KDBA 2HD5B 2PNRC 3DBHB 3AEFB 5BYQA 1RDPD 3H1UA 3GTQB 2KC2A 2PIAA 1YQBA 1L6VA 1RWSA 4WWMA 1O7ZA 3PO3H 1SN8A 2AYOB 4HPPA 4A20A 2BYVE 2FUG1 2INNE 3EFCA 1TWCB 3S17H 4OELB 1EWYC 4RHSA 5I9OA 3AU5A 4QIWE 4JI4L 2PPBC 5CBAE 5CYUA 3L08A 2CHZA 2OCEA 1IP9A 3K5OA 3ITPA 1LM8B 1WXAA 3TQYA 4HWIB 1HTPA 1A63A 3BYTB 2RSUA 1Y1VB 1CA5A 3S16H 2FAZA 2O6VA 3CPFA 3D8GA 4GNXB 3HOWH 3Q3FA 1C3TA 2L00B 4ZRJA 2JYEA 1RTNA 4A93G 5IYBG 3VR8B 1Q82C 5ELFA 3H15A 1STNA 1SSOA 2NBUA 4DV4Q 1D2BA 2F0WA 1KAAA 4KD4A 3E56A 2DHZA 4HDQA 1LTLA 3QR8A 3APCA 1CA6A 1I42A 2VS1A 2O4XA 1F1HA 4HJ5A 5JJIA 2K1BA 4A3DH 4B3RQ 1RD9D 1D5ZC 1NMGA 4GS3A 3VR4A 5JVG3 4YTNB 4IFDH 4BBSG 4OEMB 3V6CB 2MNAA 5CTRC 4A3EB 4KY5A 1GUTA 4C4VA 2K25A 4NP5A 2EDGA 2GLSA 3NQTA 5EJWA 4GOPC 5M3FB 3W1GA 1IBKL 1O7LA 4JI5Q 2JXTA 1R9TH 5COYA 3DBRB 1F2MA 1S72A 1QE6A 3T53B 1WTXA 2DLBA 1U0LA 2FFKB 5FO9B 3DLLA 1K28A 2KAJA 3R7RA 3RD2A 2HJ8A 4FA6A 4UHVA 3RI7C 1PH5A 4RWSC 4RKBA 1K0RA 2D11A 1WRIA 2JJQA 4XQNA 3RNEC 3V3XA 2PQAB 1VLBA 2K5DA 2ICIA 2Z1CA 4AQYL 1WF9A 4DQOC 1A15A 3PIO3 1JB7A 3LB8C 3TBLD 3N20C 5BN3A 4ANXA 5M3MH 2M8SA 2KBNA 1KRSA 4K7WA 2BDOA 3WCQA 1WGDA 3OW7A 3APDA 4GZYC 2O5IC 2NVXH 1S3OA 3DVGY 4Z9CB 3HM3A 1LT5D 5C3WA 4QB4A 5M5WB 2K39A 2JZZA 4A93B 1OXXK 3H0GG 2D3BA 1QQRA 3PZ8A 4ZRPA 1E0ZA 1Q1BA 1YNJD 5DPWA 4K81A 2Q2TA 4V190 3CMAA 3IAS1 1R7SA 2PI2A 2D10A 2F0QA 2MUYA 3M7NA 5GADC 2JA8H 3SEBA 1EOTA 4N9PA 3OAWA 2JZ3B 2CW0C 3JSVB 4J3OD 4L23A 4IUMB 4BBSB 2C7MB 4P1BC 5IODA 2Z4IA 4FULA 2X6LA 3OMGA 1PTOF 1KXLA 3M4OB 1BUVT 4JV5Q 4WJ3M 2RDHA 1RCVD 4MHEA 4A76A 2OQKA 2FUHB 3OWEB 1K0SA 1TIFA 1B2TA 2OQ0A 4DXFA 1ML0D 5DM63 3BZDB 3ER0A 1VZ8A 3ULLA 4GDKB 1I4QA 3RMHA 2WLBA 2MLBA 1B4OA 4DUZL 5IAAC 3HS0C 1WMHB 4Y52H 2M0AA 2DZKA 4ZHOA 4K1RB 1X3QA 1Q81C 3I3CA 1XJVA 1C4PA 2I5LX 1VQ9A 3P2BA 3S2DB 3E3XA 4BS9A 2LEKA 3AE2B 1F9RA 1TWHH 3ZNZB 2Q8IB 4OXPA 3T16A 4DGZA 2ZEQA 1E22A 2QEXA 1ZPSA 5D3DA 3CIRB 3SR1A 2DGYA 3A7AB 3RNUA 3FHWA 4Q0FA 1WY8A 1C79A 2ZW1A 1D6EC 1AH9A 4LTUA 3GTPH 1PGBA 5T1IA 2L9HA 4OO1I 2JY6A 5JHBA 1K83B 2F0IA 1VMCA 2QDLA 1MPEA 4L63B 4AS1A 2IGHA 1PH9A 5E1FA 4RNAA 4N8X1 1SIFA 3ZNGC 3AFPA 1MHWC 5DEHA 1BO0A 4IM2A 2Q8TA 5D94A 3D4DA 2G9DA 1E0BA 2EYOA 3H0GB 4IN3A 2IHFA 4AYBE 3AB5A 5L83A 1L2NA 3DCGA 2M9VA 1D7QA 4I6NB 3NTHA 3K8AA 2WNMA 1IKLA 3NBHB 4JI6Q 5FOBB 3MHSD 3KUDB 4D2KA 4YCWA 1YNND 4OO1G 3AEVA 5NUCA 5KGUA 1ZDVA 2MH7A 3I57A 4E6IA 3GTGH 1ET6A 3M7GA 1Q8IA 4GN3B 4YHHQ 4RM9A 3U9OA 4K5VA 1K52A 3QX1A 1B1ZA 4C3IH 1BUIC 1UEAB 1V1QA 3E0JA 4JI8L 5FLMH 4JI0Q 4F8MA 2Z4HA 1OQYA 3K80C 4WIPA 3U8ZA 1QF6A 4IUUA 1A62A 1V86A 4TQ1A 2KUMA 3S2HH 5JPNC 2DWQA 4C00A 2MHVA 1C4AA 4GN4B 5ELEA 3GTOH 4DR4Q 2B2WC 4LFAQ 1WJUA 5C0XI 2HTME 1PZKD 2KVMA 1G2SA 3PV1A 1GB4A 5IIFA 1JB3A 4DR1Q 4A3GG 1NDDA 3T4AC 2ZJDA 1PFBA 2WIIB 1C78A 4JI7L 2B3AA 1I6VC 4JI1Q 2MBQA 1B9NA 1SFOB 2K1FA 3A9JA 3P7JA 1PRTF 3CCRA 4RH6A 1X56A 1U4LA 2EYJA 4LW1A
chains in the Genus database with same CATH topology
4NDXA 1SNPA 3CRLC 2JQRB 5J1ZA 2LMCB 3RLFA 2KWDA 3E5SA 3C8YA 2XRSD 3K58A 1NUCA 2XWBB 5FLXL 1CT1D 3K7AB 3IL8A 3OIQA 3EJIA 1Y56A 1XF5L 1SDFA 3AH7A 3KQ4A 1FGBD 3VR6A 3DHQA 1SNOA 3J80L 2J53A 3AEBB 3IAM1 2SOBA 2BW2A 2LGIA 4C3HG 3Q69A 1PFMA 1FR3A 1HRJA 3FILA 3P42A 3D6WA 1HHVA 1GB1A 3TZDA 4XQJA 2IJ0A 1FM0D 1I7HA 1P7EA 1FNVA 3AEDB 3AMZA 2J42A 5BN5A 1R4QB 1QJOA 1MVKA 4JWUC 1T5EA 2NVYB 4M0WA 1V8CA 1ZDXA 4A3GB 5E3FA 4WORA 4A6QA 4KN4C 2CJNA 5C5LA 2O2LD 4IFDI 2ZT9C 1T3QA 3JAML 2AQ3B 2WXOA 3R8BA 4YTPB 1IBXB 3D4WA 2RSNA 2WXJA 2D62A 4CGYB 1VR9A 1Y1WB 1LTBD 2L52A 1BOSA 4IUQA 1JALA 4FO2A 2R61A 2LKVA 4C1NI 4IFDG 1TT2A 4HEA1 1DD2A 1LTTD 1XTCD 1HPCA 4IUNA 2WXQA 1SNCA 5DM73 3T3NA 4ZUJA 4CKEA 4C3HB 1RHPA 2NN6H 5I6WA 2RKSA 3KWLA 4ARCA 2WKCA 1HUNA 1CTMA 5EE0A 1BCPB 1TWFB 2XVSA 1DOXA 1SMYD 3HOUB 5C4JB 4KJNA 2KQ4X 1CHQD 3L3OC 1MSHA 1KF6B 2WU5B 5JVH3 1LT3D 2IWHA 3S17B 2IL8A 3EQLC 2H88B 2A6EC 1CQVA 2FMMA 5HURA 1STGA 3S16B 3W1SA 2A69C 1N60A 5K36H 3HOWB 1WTPA 1HXYD 2VZKD 1AW7A 1FCLA 1EU4A 3RZDB 4G7HC 2K05A 1E2WA 2ACZB 4P16A 1S5CD 5K5PA 4NKLA 1EQVA 3MC0B 4A3DB 3BVZA 3KLSA 4K8IA 3NSWA 2W55A 1TYGB 3HRZC 5C0XJ 3EFXD 1OXUA 1SEBD 1PFDA 1BXTA 3QOJA 2PW9A 1WTOA 1ZXTA 2WB1B 2EYJA 2X69A 1R9TB 2IGDA 3X3MA 2L5TA 1XYIA 1SJHD 1QOHA 2Q5WD 4XXEA 5CMDA 2WP8J 5E6JA 3C1FA 3K5MA 1XLOA 1MBYA 5IGEA 3C2PA 5I2YA 5M3MB 4ZLTF 1IW7C 1FFUA 3J7YW 2M56B 2NVXB 3HRDD 4DU9A 4HCEA 3NPPA 2DYMA 1JQYD 1ILQA 3MHBA 3Q8CA 2PYKA 2LHDA 3TMEA 1NYRA 2ZXRA 3MA2B 2F0JA 4RCNA 1B3AA 3NVWA 1EY7A 3EGRA 4DAVA 5HG2A 3DMUA 4F7XA 2JA8B 2AQ1B 2QMTA 4IZ8A 2CVRA 2KACA 4ZAIA 4HR7B 4Q5VA 4LJZC 1FXIA 4L2YA 4C3IG 2Y5CA 1S5FD 1RYJA 3BDCA 1AN8A 5KIXA 2N88A 5C6AA 4PMWA 1JORA 3K5NA 3OOCA 3V2TA 4PV1C 1H9SA 1WVLA 4KK7A 1FRDA 2WXIA 3VQIA 2WDQB 4XDCA 2VZKB 1KLGD 4WAFA 5C5MA 1TWHB 2JZPA 1F0ZA 1DM0B 4WH4A 3D4RA 3H94A 3SK5A 3BDOA 4EE2A 1HQRD 3GTPB 1F9SA 1N5XA 3VYTA 2Y3AA 1QOGA 1JRPA 1TU2B 3NTIA 4A55A 2LFNA 3MXGA 4YIJA 5LHY1 2F0DA 1K8OA 4J8QA 5EPKA 4XE0A 1QNUA 1SE4A 2YEPB 2WV6D 3AEEB 2QDBA 1XXGA 3GTGB 2ENBA 3PUZA 3I9V1 1OFFA 1LLRD 4KKSA 4I65A 3A54A 1F77A 4C3IB 4FVMA 1V97A 1OO9B 2VB3X 3S2HB 3J7AF 3GTOB 1SF0A 4XIGS 3ND9A 4C3JG 2EJGC 2D5GA 3FVQA 1F2RC 3K59A 4C56C 3MTSA 2IPKD 3LXFA 4AQ7A 1B44D 2QSDA 1C8CA 1YMHE 2RPVA 1GHKA 4B9XA 1R4PB 1E9MA 1H9KA 5E4WC 4HRSA 4FF1A 5D3IB 2NN6I 2K01A 2BOSA 4HMIA 2L32A 2PQEA 1SJED 3FPPA 4GDLB 2EZVA 1T5XD 3S15B 2JYOA 1HZ6A 2OEDA 5IGCA 2RMMA 1NEKB 1ZKOA 1WSPA 3MXPA 1EQTA 3VA7A 2Y5PA 4G57A 3HG9A 2NN6G 1XEEA 2NVQB 4KKIA 2PO4A 5LNK1 1C48A 4DAPA 2IT1A 1VDZA 4NJCA 1C4CA 1ESFA 2DYOA 1TKEA 3OSOA 5KEEA 5FKAC 5JJZA 4C3JB 2ON8A 1ICWA 4RFBA 1QOFA 3AE6B 1HZ5A 1L0YB 4DNRB 5HI1A 3J7AV 1S5BD 2E75C 5K36G 5BMGA 4KY7A 3CWIA 4ID6A 4BA2I 2VUMB 1E7PB 4DK1A 2K22A 4K5XA 4FF4A 1H9MA 3IXSA 2F4IA 5BMHA 2WXNA 3VR5A 2BB6A 3PZ7A 1STYA 2RA4A 5D65A 3A7LA 2MJEA 4REZA 1PUTA 2BCOA 1G8ZD 1PTOC 2R3ZA 3I70A 1CZGA 1X32A 3DWMA 1OXTA 1XCTL 2WDRB 3VA5A 1MSGA 3HKZB 1DOYA 1AFPA 4TQ0A 3E6ZX 1TIID 1JR0D 5IT9E 2A73B 2B39A 2F0MA 2CQAA 1TS5A 3SXHA 2I07B 3TBIB 4CJ2C 1AZQA 2QKIC 3MXNA 3IT4B 5IGFA 4ZRZA 3I4MB 3AE4B 1PZID 3ZJVA 5LL6S 3T51B 3NWTA 3CHBD 4A90A 4TQUS 3BWUD 2EJMA 1TY0A 2KDMA 1LTRD 2K5QA 1IHZA 2B2UA 3MAQA 4GLSC 1EIHA 3PMFA 1J7BA 2KN4A 1GUWA 4A3JB 4ZUIA 1UNSA 4XYQA 3NUCA 3LX0A 1GHJA 4JE3B 5JPMC 1PGAA 4XTCS 3AEGB 5FK9C 4CKBA 1TZOA 2A68D 3K5LA 1G6ZA 4X3KA 5ELCA 3HVDA 1BR9A 1HEZE 3T13A 2RBMA 1PRTC 4N9TA 2LHEA 1EWCA 2WP9B 4LK1C 4IALA 1ONLA 4HCSA 2MPMA 3D31A 4KX6B 3GP7A 2WAQB 1RF2D 1BBXC 1PYWD 4YWGG 1JE4A 4C7YA 3W5UB 2FBWB 3DWPA 3P1HA 3WOFA 3KWVA 2B2YC 2LJIA 1O7YA 5CGKA 4LK0M 2EPBA 2A6ED 1FRRA 1EZ8A 2KCNA 5HFYA 4F87A 1G2TA 3TEZA 3GV3A 3CRKC 1WTWA 2NYZD 3U4EG 3CU7A 2EJFC 2KJXA 3TP8A 2F0TA 2JA7B 2F3WA 3HEJA 1LABA 3P75A 1HUMA 2M2LA 2LY7A 3TUOA 1LACA 1L4DB 3I90A 1NI3A 4DXGA 3DWQA 4FNFA 2R7ZB 3MFYA 3EUB2 3TEYA 1FCCC 3KF8A 1E10A 3TDQA 4EQPA 3Q8BA 1NR4A 3J80E 3FEWX 2WACA 1FIQA 5C44B 3FRPB 1KDAA 5TSSA 1WTRA 1PXUA 5AFWA 1AWDA 1FEHA 1WTVA 1PTOH 3NVZA 4JPSA 2GB1A 4C7ZA 1BF4A 4CJ0B 4ZHPA 2D9UA 3K0YA 1JOQA 4YXDB 4C1NK 4FXCA 1A2TA 4TRDA 2VXWA 2H4OA 2W3SA 1N61A 4B0MA 3S14B 4B08A 1K51A 3NS1A 1ZE3D 3N52A 3NUHB 2F0PA 1JCKB 3AM9A 1MHHE 3MZ5A 4YSXB 2BE5C 1BCPD 3SDZA 5C0XG 3A8IE 3GS2A 3IFDA 4CJ1B 1IYUA 4HN7A 1QOBA 3QG1A 4G7OC 1XLPA 2OF1A 1XCQL 4G7ZC 2PMZB 2NMQA 1I3QB 1S5DD 5CV9A 3GTJB 5EBCA 1PMRA 3M85A 3B9JA 4K6LA 3M4YA 5BMIA 1AZPA 5IGDA 4FYDA 1J9OA 2B2TA 2A6HD 3D3RA 4DF7A 2PW7A 2PZTA 1BMLC 3A56A 1XO3A 3H09A 4Q2JA 4MN3A 5JAVA 3NBIA 2KEEA 4KGRA 4NMZA 2FJ2A 3S1QB 4G4KA 3G6JB 1SNQA 3UI2A 2WS3B 5D14A 1HQMC 1YN5A 1EY5A 2W82A 1QT9A 1N5WA 3P4QB 4HSVA 4K2LA 1M8AA 1DCZA 3J9CA 4X3SA 4YT0B 4RGTA 1BDOA 4MM3B 2HCIA 3AECB 4IUPA 2K04A 1I4RA 1DONA 1ZUD2 3QIAA 1CJEA 1V8QA 4QMGA 3PIP3 1VDVA 5BYSA 2B76B 3Q8FA 1VMPA 3URYA 1NAPA 2BTEA 4RHRA 1V1PA 3AB9A 4OW0A 1KLUD 1K53A 1SB3C 3C3LA 1JWMD 2PW5A 3UI3A 4O1NA 2EYPA 1F2RI 1V43A 3B2FA 2ZW0A 1TVXA 4L1BA 1VZ7A 2B2YA 5AUKA 3DWAA 5EQ0A 2J0TD 4KHVA 4WURA 2B63B 3H6MA 1UUPA 3PO3B 3MJ5A 4HKZE 1ENFA 5F2DA 3HUIA 2PTLA 4L6TB 3AE5B 2CHBD 2JP1A 3PO0A 3MP9A 4ODGA 1GUOA 3H8HA 2KHSA 5KRUA 3P4PB 4IURA 3ND8A 3R3OA 2J4XA 3HVZA 1FFVA 4NW2A 1XX8A 1Y8OB 3P4SB 2WU2B 5ELDA 3SK4A 1JQ4A 1SNMA 3A55A 3BDLA 3FKIB 1WTQA 1UWXA 1Z6HA 1C4QA 5G5HA 4A3KB 4NAMA 1E6EB 1ENCA 4XYOA 3GTMB 1FNUA 4KD3A 3PO2B 2DNCA 3DEPA 3N6RA 2E74C 3I8ZA 2F1MA 3GO5A 2L1AA 3VRAB 2WXLA 1NCVA 3GTKB 3CKIB 1DOLA 3MEHA 3AEAB 4CKCA 2QEJC 2EELA 2JSOA 4IUVA 4KJOA 1QG7A 5CV4A 3W5VB 3S9WA 2ID0A 1HTLD 4YTMB 2BYTA 1SBBB 2R92B 1J8IA 1I4GA 2L12A 1TKYA 1RODA 4M8AA 3RZOB 3NZ3A 4TSSA 4XT3B 4H2AA 1OXSC 5C3XA 3FMCA 1JWAD 1JICA 4LAAA 4B9WA 5CV7A 1P7FA 4YSZB 1YNNC 1L0VB 1T6BX 2AX5A 1F9PA 1H9JA 1WD0A 3R2TA 4WRDA 3QOLA 1DZ1A 1FYCA 4USAA 2JSVX 4XQQA 4FF3A 3FC4A 2WXGA 2I2YA 1FD6A 2C9OA 2X6GA 2HDEA 3Q24A 3I91A 1L6UA 4JK1C 2WXFA 2MP1A 4KGSA 4HAEA 2MJ8A 1QOAA 1LT4D 2F0GA 2KQ3A 3TSSA 5GXGB 2YU9B 2F0UA 3OPOA 3BK2A 5JEAJ 3OMCA 2FMCA 3VYSA 1ACCA 2AUKA 4HSPA 1QLBB 1TWGB 1SIJA 2NZ1D 2TMPA 4KN7C 1XWEA 2K6AA 2JYTA 1AEXA 2F0NA 1WYGA 3S1NB 1EY9A 1UWMA 3A8JE 2F0LA 3ZYYX 3AE1B 1RFKA 2B2UC 2KOLA 3BIID 2F0KA 1J7AA 2EY6A 2D5DA 2OXPA 2EYLA 1LO5D 3C1EA 5C3JB 3AE3B 3BVGA 1C76A 1G291 1LTAD 3GB1A 2RVLA 2JXMB 3U9SA 4R8IA 1PRTD 1XLNA 2RSOA 2LFIA 2YYZA 1B9RA 1O78A 2AUJD 1TS3A 3SHLA 1WWTA 1EFID 2EY2A 4A3IB 2JA5B 1I50B 3BYYB 3DWGC 3AE7B 3B2GA 4V0BA 3K6OA 2CW0D 1NSNS 2BT6A 4DFAA 4ILWA 5T8IA 1QCBD 5ELBA 5BN4A 2GRIA 2XSCA 3GQBA 3NBHA 5A2QE 1PLFA 1Z7TA 2SDFA 1KFYB 1EM7A 2PMVA 2JX5A 2F03A 1KDCA 2PZWA 5C4HA 1HFNA 2EOTA 3ETRA 2H1EA 1PDXA 4LLGM 1WD1A 4UAIA 1ET9A 4PQXA 3FILB 3AE8B 2V4IB 4JX1C 4OZCA 3EVQA 1AYFA 1A3VA 4FP5D 1EYCA 2E76C 3BK1A 2K9XA 1S4ZA 5CV5A 2WKDA 4PT5A 5CR3A 3TP5A 2QJLA 2ICEC 4QCLA 4KV6A 1JWUD 5EKLA 1U9RA 3KUPA 3VRBB 2LMCA 2IX1A 4LMQD 4K6DA 3R93A 2JU6X 4XDDA 4ZYSA 1YQ3B 5HHDG 4K14A 2BDNA 2OEOA 3ERQA 4ZRQA 3TZUA 1L4ZB 1BCPF 5C3EB 4L8JA 4OVZA 3RUZA 4DNTB 2L83A 1MHXA 1DOMA 1EZ6A 1U4RA 4R8NA 4WQMA 1CK1A 1TWAB 2IDYA 4MACA 4N6EB 5H8YE 2W3RA 1PRTB 1IYVA 5BYRA 2EKIA 2G1EA 2F0HA 3HOZB 1Q90A 1TQOA 2MEKA 4BA1I 4N58A 3K57A 4IDIA 1SYBA 4ME5A 1SNDA 4DA2A 4WFN3 3EROA 4OHJA 2MJDA 4KKTA 5EPJA 1CFMA 3J81L 2J52A 3L4PA 2M19A 1IGCA 2IW3A 5IOCA 1EWHA 4K2KA 2ZXPA 3MVVA 2Y0SB 3OWFA 3H3VC 1IBXA 3HZXA 2HUGA 1FMAD 5KYLA 1CQFA 1FD7D 3TP7A 2J7ZA 1UAPA 2AQ2B 2KA7A 4JBWA 3AMUA 2B2VA 4HMJA 2V3NA 3Q0AA 2FE8A 4U673 4N59A 5CV8A 2TSSA 1MGSA 3U2SC 5EGTA 5M5YB 5KYIA 4ITKA 3SR6A 4NAWB 3T3OA 1JWBD 2F0OA 2NUCA 1E2ZA 3SK6A 3FPUB 3NQIA 1VCIA 1FO4A 3SFEB 1DYQA 2B2TC 5KNDA 5EKKA 1EY6A 3HOYB 1EY0A 1Y69U 5AUIA 5EE3A 3H91A 5JEAH 4WJWA 3KBXA 4F88A 3MFGA 3RD4A 2BS4B 3QJYA 3DUZA 4KMUC 3T56B 4NZLB 2E2JB 1YNTE 2K5PA 1HFGA 2O5JC 1F2LA 2RQXA 3GTLB 2Z8LA 2B8GA 2JEBI 3MXUA 2K7VA 4RF1A 1TKWB 1A70A 2K33A 1EL0A 3TP6A 4RA8A 2F0FA 4BY7B 1OXVA 4A8XC 3KLRA 1YN4A 2E3TA 4M1UB 1ZP0B 2A5HA 1SXTA 5KNCA 1STEA 2BS2B 1YJIA 2BA1A 2WXPA 3L7ZC 1STHA 1HCZA 1K8MA 1SSNA 2V3PA 3NTKA 1PZJD 3SFDB 4R3DA 1E2VA 1JWSD 5IT9L 1EU3A 3BG3A 2OHFA 3FDTA 3I73A 4OZBA 1H9SB 2A69D 1DOKA 3AV8A 2XN9C 1Y8NB 2PVGC 4H0LC 3I4NB 1J7CA 1LT6D 2YEPF 2QIEB 5G3LD 1YJJA 2V0GA 4QF4A 5CORA 4HTHA 1SE2A 3P1MA 4EQNA 1PFNA 2WQYB 4A3FB 5EKIA 1ZYRC 4IQZA 3QB3A 2DNEA 2NBFA 3BVMA 3DXJC 4CBVA 5FLXE 3NK9A 2OT2A 1L0XB 3TEXA 2SNSA 2KMMA 2K0PA 1OQQA 4HKQA 1Q12A 1SYCA 2F0EA 5CBEE 2L4NA 4TMAB 1VF7A 3ZGZA 1AP0A 2NB0A 1OQRA 1EY8A 3FAHA 5DNFA 1GUGA 4P6VF 3RFZB 4XWWA 2D2CC 1Q10A 1IW7D 2EVBA 2E2HB 4FF2A 1H9RA 3VYUA 1D5MC 2N9KA 1EY4A 1QILA 3X3NA 4ULLA 1JW9D 3NRZA 2EYMA 4CQNA 3Q8AA 4TKOB 2N7JA 2HQEA 4I7ZC 1I4XA 4K8JA 1ESRA 2ZXOA 3JAME 2F3VA 3NHHA 2E6XA 3Q6SA 2I46A 2HDLA 1NR2A 1II3A 3NP8A 1RTOA 4H44C 2RDGA 4ARIA 2H89B 4IKGA 4RGOS 1SYFA 3EA6A 4PNYA 5EE1A 1MI2A 3WOEA 1IKMA 1KNAA 1U4MA 3ZJUA 4XT1B 3SVMA 3F2UA 5D7GA 3VR2A 3LNNA 1NYQA 2RDFA 1XLQA 2BBCA 2W54A 4FXGC 4KI0A 1KABA 5EE9A 3IKJA 2WXMA 3DM1A 5DAUA 2R6GA 5I4DA 2EYHA 1CI3M 2AWNA 3C46A 4KKJA 4PMBA 2C5CA 4IUTA 5A35A 4QIWB 1BNZA 5I6YA 1PGXA 5LL6X 3HP3A 2X38A 1SYEA 1B50A 3AU7A 4ZQ3A 3P20A 1W6JA 2QILA 5C4ZA 3ONAB 2INPE 1DXMA 2BA0A 1V1OA 4O42A 3CQZB 3ZJTA 1CZWA 1GUNA 4EVOA 1KNEA 1JMLA 1X3PA 1EYDA 2NVTB 1ILPA 5G5GA 1O80A 3IAYA 2DBYA 5JEAG 4J6HA 1ZXIA 4DN4M 1TS4A 2I38A 1ENAA 4P2CB 2ONQA 4IOIE 1UGJA 2NTSA 5MPOA 3NXWA 1A2UA 3WDNA 2MGSA 4B0EA 3SE0A 1GOZA 4ZOHC 3A8KE 3W2DA 2EE1A 2A68C 3MHZA 1ZOYB 4KKUA 1LTID 4K5WA 1SE3A 2IX0A 3SK8A 5H92C 3KK7A 4OGQC 1K50A 1D1IA 1W6KA 1ROEA 2PKOA 5CV6A 1B53A 1EIGA 2QF7A 1STBA 1YNJC 4MIUA 3P63A 2IGGA 3KLSX 1CZPA 2DY7A 3TEWA 5FR3A 1YQ4B 1JC7A 1N63A 4H7BA 4US8A 1BQQT 3KBGA 2V4DA 2B8FA 1VZ6A 5ISRA 2LUMA 2L11A 4MT5A 3VYRA 1SYGA 5I2XA 2GI9A 1VRAB 1IL8A 2IX3A 4JWSC 2L0CA 1L5PA 2N55A 2FHTA 1RM6C 4MH8A 2XWJB 1QNKA 2CU3A 1TY2A 1G91A 1C9FA 2K5WA 3W9CB 2K32A 2EXZA 4RKLA 1DOIA 2PVOD 2GA4B 1EEID 5C2TB 2LS01 1DJRD 1U4PA 4U68A 2WXHA 1Q3LA 1PTOD 1TR5A 3I4LA 2EY5A 5I9PA 4OIJA 2NWGA 2MJ3A 1DGJA 1HA5A 4AYBB 2G9HD 2B2WA 1VF5C 4A9AA 3HOXB 4H13C 4XDXA 5M9OA 4R9WA 1F9QA 3BS1A 3L9AX 1I4HA 4CHTB 2B2VC 3M3YB 3QO2A 2XNAC 4HJGE 4HROA 1C77A 3LWEA 2R93B 4ZKCB 1LV9A 1TS2A 1IUEA 4OL7A 5J22A 1A6XA 1FXAA 2SAKA 1HA6A 3U52E 1CHPD 1JOOA 3HGBA 3TN2A 1BCPC 3PV0A 3AE9B 3O13A 3E9SA 4KTAA 2WINB 3RPFC 4EQOA 4OIKA 2XIWA 3PUXA 2WXRA 4UDUC 4IFDJ 2JEAI 2VB2X 1D4BA 3Q22A 2A74C 3GV6A 1WGKA 4Y7NB 3S1RB 2KEDA 1MD2D 1F2ZA 1D1KA 1I4PA 1QB5D 2DY8A 3VR3A 1KRHA 5G3LF 4YSYB 1A3UA 2A6HC 2HDMA 4RF0A 2F0VA 2BB5A 3V05A 4C2MB 2EYFA 3IFTA 4RCOA 1PTOB 3LWUA 2N0SB 4RGNA 1JROA 2K3UA 2KCCA 2E2DC 1ZEQX 2DN8A 4QUCA 1CM9A 1GAQB 1GXDC 2L55A 3PUYA 2F0SA 1NVID 2JWUA 5C4XB 4HEDA 2XRQD 1GJXA 1D5XC 1GUSA 1A3TA 2FINB 4KGTA 5FO7B 5IGGA 4DK0A 2PCFB 1QKZA 5T1GA 5EPLA 2HCCA 3OHXC 1KTKA 4S3SA 1TJEA 1YN3A 3ABVB 1B9MA 2AWOA 3NVVA 1Y8PB 1F2YA 5JOBA 1RKNA 1ZYRD 5FO8B 3AN1A 1STAA 3PUVA 3LYYA 4KHZA 2PLPA 3J81E 2EY1A 3OIPA 5KNBA 2CJOA 4XWTA 4RAUC 2VNUD 1FNWA 2N9LA 3PUWA 5HGTA 3D6CA 5JXVA 3W3AA 4ZKBB 4X3UA 1RJTA 1SMYC 1NENB 1WXQA 4BBRB 4OO1H 4KY6A 1EEFD 3NWSA 4BWGB 1ZXHA 3N9YC 3NVYA 3ZQ4A 3G7LA 4EGVA 2PZUA 3R2IA 5E4XA 1QWYA 2JA6B 4DAYA 4ZK9B 3S1MB 4US9A 1I6HB 3I72A 5M5XB 1EYAA 1Q1EA 4QUFA 1TKGA 5J39A 3IT6B 2SEBD 3HOVB 3MWYW 1GPXA 3GD7A 3V96A 1V1PB 2KECA 2Q8RE 2BS3B 4J1MA 2M00A 3DEOA 2WXKA 2L1BA 3P4RB 2JE6I 1PDQA 5CC4A 5C0XH 4RGMA 1LTSD 3QWNA 5A2QL 1KH0A 1Z47A 5EBDA 2BE5D 1IGDA 3U7ZA 1VJKA 1SAPA 4FXKC 4A3MB 3VR9B 1M4VA 1WCMB 2QCPX 4PMCA 4BY1B 4C80A 1S5ED 3Q23A 2WDVB 4OZAA 1LTGD 1MI0A 2NTTA 1SYDA 3NE5B 5IGBA 4ABNA 1N62A 1JOKA 4A3BB 2K03A 2SNMA 3Q8EA 2E2IB 2K28A 4FXDA 1KDBA 2PNRC 3AEFB 5BYQA 1RDPD 3GTQB 2PIAA 1L6VA 1RWSA 4WWMA 1O7ZA 2FUG1 2INNE 1TWCB 1EWYC 4RHSA 5I9OA 2PPBC 5CBAE 5CYUA 3K5OA 3ITPA 1HTPA 3BYTB 1Y1VB 1CA5A 3D8GA 2JYEA 1RTNA 3VR8B 5ELFA 1STNA 1SSOA 1D2BA 2F0WA 1KAAA 4KD4A 3E56A 1CA6A 2O4XA 2K1BA 1RD9D 1D5ZC 3VR4A 5JVG3 4YTNB 4IFDH 4A3EB 4KY5A 1GUTA 4NP5A 2EDGA 3NQTA 5EJWA 5M3FB 1O7LA 2JXTA 5COYA 1F2MA 1QE6A 3T53B 1WTXA 2DLBA 2FFKB 5FO9B 2KAJA 4RWSC 4RKBA 1WRIA 4XQNA 3V3XA 1VLBA 2K5DA 2ICIA 2Z1CA 4DQOC 1A15A 3PIO3 3LB8C 5BN3A 2BDOA 3WCQA 3OW7A 4GZYC 2O5IC 4Z9CB 1LT5D 5C3WA 4QB4A 5M5WB 4A93B 1OXXK 3PZ8A 1QQRA 4ZRPA 1E0ZA 1Q1BA 1YNJD 4V190 3IAS1 1R7SA 2F0QA 2MUYA 3M7NA 3SEBA 1EOTA 4N9PA 2CW0C 4J3OD 4L23A 4BBSB 5IODA 2Z4IA 2X6LA 3OMGA 1PTOF 3M4OB 1BUVT 2RDHA 1RCVD 4MHEA 3OWEB 1B2TA 4DXFA 1ML0D 5DM63 3BZDB 1VZ8A 4GDKB 1I4QA 3RMHA 2WLBA 1B4OA 3HS0C 2M0AA 4ZHOA 1X3QA 1C4PA 3I3CA 3S2DB 4BS9A 2LEKA 3AE2B 1F9RA 2Q8IB 3T16A 4DGZA 1ZPSA 5D3DA 3CIRB 3SR1A 3A7AB 4Q0FA 2ZW1A 1C79A 4LTUA 1D6EC 1PGBA 5T1IA 2L9HA 4OO1I 1K83B 2F0IA 1VMCA 1MPEA 4L63B 4AS1A 2IGHA 5E1FA 4RNAA 5DEHA 1BO0A