1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1TY2A 1RCVD 1TS3A 4TSSA 1F77A 1S5FD 1LTRD 2QEJC 1CQVA 1G8ZD 3V05A 1FNVA 4K6LA 1V1PA 4RHRA 3W2DA 2XRQD 1ET9A 1TS4A 4RGOS 1EEFD 1HXYD 2SEBD 2Z8LA 1I4XA 3R2IA 1ESFA 2QILA 4OHJA 2RDHA 1LO5D 5ELEA 1T5XD 3OWEB 1B1ZA 2XNAC 1HTLD 3O13A 1ENFA 1CHQD 1BXTA 1JQYD 3CHBD 4RGNA 1PYWD 1ET6A 1EU4A 1SE3A 1V1PB 1FGBD 4RH6A 1D5XC 1TS2A 5ELFA 1I4PA 1DYQA 1PRTD 1RDPD 5D3IB 1LT5D 1I4RA 1S5CD 1DJRD 1I4GA 1SEBD 2ICIA 3KLSX 1LTAD 1AN8A 1LLRD 3DWPA 1D5MC 1PRTB 4BWGB 1SJED 5D3DA 1FNUA 1SE4A 1STEA 3SEBA 1I4QA 1PZKD 1LTBD 2WV6D 3GP7A 1JWSD 1L0YB 1YN3A 1L0XB 1RF2D 1MD2D 5ELDA 1LTTD 1RD9D 1LTID 1EEID 1BCPC 5I4DA 1S5ED 1PZJD 3BZDB 1PRTC 5ELCA 2RDGA 1JWMD 3EFXD 1EWCA 2AQ1B 1PTOC 1SBBB 3BYYB 1LT6D 1CT1D 4RGTA 1LT4D 2R61A 4DXFA 1EU3A 3EA6A 4UDUC 4RCOA 3BVZA 1LTSD 1PTOH 2IPKD 2NTTA 2AQ2B 2XN9C 1SE2A 1I4HA 3R8BA 3R2TA 4O1NA 1QILA 1EFID 2XRSD 1XXGA 2CHBD 3MC0B 1BCPB 1S5DD 5TSSA 1FD7D 4RGMA 1V1OA 2IJ0A 1TY0A 1GOZA 2AQ3B 4L6TB 1HA5A 1SXTA 2J4XA 1PTOD 3BVGA 1KTKA 1JR0D 3BVMA 5FKAC 1PTOF 1YN4A 1D6EC 5FK9C 1CHPD 1PZID 1SJHD 2NTSA 1M4VA 1HQRD 1PRTF 1TS5A 1BCPD 1JCKB 2O2LD 4RHSA 4C56C 4ZYSA 3TSSA 1FNWA 1UUPA 3DWAA 1PTOB 1CK1A 1XTCD 1KLGD 1KLUD 4L63B 5ELBA 3BYTB 4NZLB 4RFBA 1LTGD 1BCPF 1AW7A 1JWUD 1B44D 4Z9CB 3URYA 1D5ZC 1LT3D 4DXGA 2G9HD 1UNSA 3DWQA 2TSSA 3MFGA 1S5BD 1YN5A
chains in the Genus database with same CATH superfamily
3QWNA 3JW0X 2L9HA 2CU3A 5IWAQ 2V1CC 1CA5A 3Q8CA 2CHXA 3T1YQ 1TR5A 3H3VI 2A8VA 3RMHA 1VZ7A 2QKIC 3ZLZA 2RVLA 4ZOHC 3FDTA 1NYRA 1V1PA 3BDLA 1EF5A 1WE6A 1VQEA 3NBIA 1D7QA 1SYFA 2RA4A 5KYIA 2DZKA 4FJYA 4JQWC 2E2HB 4FA6A 5IP7G 3ZNHB 1Q8KA 4DK5A 1AARA 1AZPA 2QILA 2I1KA 5CHWA 3T3NA 5IOCA 4N8X1 4CHTB 4ZUJA 2JA7G 4ZK9B 2AYOB 2I07B 5DPTA 3MEFA 3I72A 3NENA 3OW7A 3HOWG 3EFUA 1H9KA 1EU4A 3MVVA 4HMIA 4BBSB 1TQOA 1TBEA 2O6VA 2PVGC 1YHAA 1HA6A 1IHZA 1X32A 5J18A 1QKZA 3APCA 2K22A 2MEKA 1PRTD 5FO8B 3M3YH 3RCZA 3E56A 4EGVA 3I63C 1S5CD 1AFPA 3A8KE 1E7UA 1DJRD 2E5LQ 3PZ7A 4REZA 3VH3B 4B3TL 1LTAD 3W3AA 1CSQA 4KN4C 4UP8A 4YY3L 4G7ZC 2AL6A 2BT6A 1LLRD 2DBYA 4RM8A 4ZYNA 4B6WA 3GTGB 3L3OC 4KHVA 3BDOA 2FIDA 3Q0AA 4BWGB 3VVWB 1OQYA 2MP2A 4E3CA 3CMAA 4YSXB 1N62A 2WS3B 3PT2B 1C79A 1B9MA 3KLRA 4RM9A 4A3KG 3DVNV 1YN3A 2X38A 2HHHL 2JE6I 4P75A 5LHY1 1RD9D 2ZXRA 4DBGA 1C1YB 3TEYA 1CZGA 2WB1G 2D11A 2K3UA 5G5GA 2ENBA 4A3PA 3BZDB 2RD0A 3RNEC 3K5LA 3RNCC 1SMXA 2OT2A 2R7ZH 3B2GA 3QCAA 3KUZA 2KHWB 1QVFA 2IT1A 5GADC 1TKYA 4DAVA 4A3JB 1F9SA 2B76B 2V3SA 4JI7L 3VYUA 3JC66 3OG5A 3VR9B 5KHQA 5E4WC 2K5HA 4BY7H 4GGQA 5KNDA 1IYUA 1MSGA 2Y0SG 2N1VA 1C4PA 1GHJA 4A93H 1WYWB 3B9JA 1YZ6A 1D4BA 1NENB 2AWTA 3PO0A 1MIUA 1A2UA 5HGQA 2CH4W 1GUGA 3T13A 1VJKA 3D4WA 3GTPH 4FBJB 1AH9A 5DAUA 1WR6E 3IXSA 1V49A 5JH5C 4OVUA 1E8YA 1U4LA 1M1KC 1P8LA 3HKZE 3PREA 1N36Q 3F2DA 1K8GA 1SJHD 1PRTF 3IVFA 4C56C 5I2YA 1CFMA 2BE5D 2NVXB 2RCFA 1L6VA 1UUPA 1H9RA 3DWAA 3DBLB 4JI6L 5C0XG 2JXXA 2Z4HA 4JI5L 2O6VD 2WQYB 1NMGA 1TKWB 1VQOA 3HHMA 1GXDC 5AEKB 1K3RA 2ZTDA 4UP9A 2MSED 3S1NB 2EQSA 1F1HA 1PGBA 1OXVA 1NI2A 3CAMA 2M0XA 5FLXc 2K50A 2F1MA 4DV2Q 3V62A 5BMIA 1V9JA 3AV8A 1IYFA 2QA4A 3VRBB 3N20C 2JRHA 2ZVNA 1G8ZD 1EIFA 2MJEA 2SNSA 2GI9A 1HNXL 1N9WA 4RHRA 4C3IH 2GA4B 1TS4A 2LXJA 4I65A 4GZYC 3OLMD 4A8XC 5DM73 5K5PA 5IGCA 1L1OC 3PIOA 3KWVA 5D2MB 3KUPA 3LX0A 3M4YA 4JBMA 1YNJD 4LDTD 4XYQA 2YTVA 1KC8C 1LO5D 4IKGA 4ZDVA 5C44G 2UYZB 4ANVA 3O13A 1TT2A 2K01A 3T1HL 4NXMQ 4LF9L 2BDOA 4RH6A 4LF7Q 1ZDVA 1DXMA 2L55A 1UZXB 1BKBA 1NUCA 5FLMH 1XMOQ 3STBC 4X66Q 2LI5A 4WAFA 3HS0C 4ABNA 4BAXA 2UUCQ 2O4XA 3KLSX 2KZRA 1AN8A 4ZLTF 3A33B 4G7HC 2CKHB 1VQPA 4AUQC 3A54A 2VUMB 3FP9A 1P7FA 3MXPA 4OELB 1RODA 1V2YA 4K2LA 3U30A 1WXSA 2CFMA 4NPSA 4NAWA 4DWFA 5I9PA 3FC4A 3A74A 2M4NA 3CCJA 2QJLA 2K9XA 1UWVA 1SLJA 1Y1WB 1V8CA 4S3SA 3J80c 3AEBB 2JN4A 4OO1I 4BVUC 4W9HA 3VA5A 4GKJQ 5M3FB 2LS01 3HKSA 3Q3OC 1PRTC 4P73A 2KQ4X 1IL2A 4DR6Q 5CHFA 2N7DA 1R9TH 1DOYA 1KH0A 5J17A 1HCZA 1MJEA 4L23A 1LTLA 4BZAA 1HNZL 3CPWA 1V43A 4HIKA 1M94A 2CHZA 4L1BA 5EPLA 3SE0A 3S14H 4LNFA 1O78A 3E0JA 2L1AA 1FYCA 1I4HA 3PUVA 4EQOA 3HOUG 3N52A 2RQXA 1K8RB 1K9MC 3VR2A 3MHSD 2OOBB 1VDVA 3IFDA 3I73A 1XPUA 4R4QA 3V96A 1TY0A 2CH4A 2WXIA 3MC9A 1CKMA 2K32A 1C7YA 1VQLA 1A70A 1QZGA 3MHBA 1TU2B 1II3A 3GTJH 4P1CC 1L1OA 4DDID 4B0EA 4DK0A 4YHHL 2NPTA 5E4XA 3G6EA 5I6WA 5D65A 1T6BX 2MBBB 2G1EA 4ITKA 3GOEA 1YBYA 1KLGD 1KLUD 1WTXA 3BYTB 1A3VA 2Q2IA 3I90A 4Q0FA 1ZKOA 3J7ZC 2HDLA 3SDLC 5GROA 3TMEA 4GNXA 1NSNS 4WURA 4US8A 3A8JE 5DNFA 2C35B 1LT3D 5IGFA 3OTOL 4HJ9A 1KQSA 1I94Q 1PXUA 1E8XA 3AFQA 1ZKHA 2LFIA 4LF5Q 2HE7A 4ICUA 2K28A 2RSOA 3K7UC 5KNBA 4Y7NH 2UUBQ 3UQAA 1S5FD 4POGA 2JZPA 4TVAB 2QEJC 4JOIC 2KCCA 3RD4A 2KTRB 4LDTB 1J8CA 1HRJA 3Q8DA 3L9AX 1Z5SB 3A9JA 2LGDA 3NXWA 2B2VA 3U4ZA 4C1NI 1HXYD 5HHDG 2WFWA 2BF8B 5JAVA 3PHXB 5H92C 3ZKJC 3OJ3A 4LF8L 4W9LA 3NHEB 2BKFA 1QCBD 5CORA 2RDHA 1PGXA 2DAFA 4C00A 4YY3Q 3ZO5B 2B3GA 2WGSA 1A3UA 2BYFA 2UUAL 1ENFA 4LMQD 5IWAL 1A63A 4JVZA 1C8CA 2NVQH 4O42A 4A3CG 1SNMA 4H7BA 5M3MH 2GLSA 3KF6B 1FEHA 2G45B 4B3SQ 3L0WB 3TZDA 2KACA 4BKGA 5IGEA 3A56A 3HKZG 4P7IA 3CRKC 2LHDA 2B2UA 2ZT9C 2NZHA 1I4GA 2J0MA 1L7YA 2PPBC 3KLWA 5DEHA 5C0XJ 3IAYA 2PLPA 3P2BA 1D5MC 3ITPA 4XQNA 4KDLB 3AE2B 2KMMA 3QJZA 2LASA 4URKA 5HG2A 1HZAA 3ERSX 5G3LD 3MJWA 5E7NA 4KMUC 5D7GA 1JWSD 1FMAD 4MNOA 1VR9A 4P71A 4DFAA 2J52A 4GLSC 4HEA1 4OWXB 1LTTD 2F4IA 3AE6B 4KY5A 2O2VA 4A3KH 3IFWB 1UE6A 1YQBA 2B2WC 1SYCA 4JI3L 4QIWE 4QF4A 2HTHA 2KKCA 1EQRA 1TGZB 2JA5H 4HPMB 4M1UB 1JJCB 4CO7A 4OEMB 4CJ2C 2IGHA 2R61A 3FKIB 3KJPA 1BNZA 3QWZB 5A2QE 4MTNA 1ZE3D 4LJOB 1PV4A 3OMGA 1WR1A 4MSMB 3CC2A 5KRUA 2IO1B 1J7CA 1F9JA 1GUWA 3L17A 2VH1A 2FHTA 2NWGA 1STYA 3F2BA 1B50A 4YTMB 4FULA 2D62A 2W3SA 3NZSA 2A69C 1E1OA 3K57A 4RGMA 4DV6L 4G50A 4MEMA 2F0VA 3BVGA 1SNDA 4JBJA 1HE8A 3BWUD 3HOZG 4S17A 3VYRA 3UDXA 1GAQB 3WOEA 2E76C 1GD7A 2KWVB 1E2ZA 3NJTA 5IKCM 1B7YB 3NELA 1T0QC 1FO4A 3T56B 1KXLA 1EZ8A 4RMAA 3K80C 2J0TD 2Q8IB 4NZLB 1NVID 2JA8H 1DCZA 3FRPB 3TS2A 1K8OA 4DR5Q 3Q8EA 1V5OA 3CSFA 4E71A 1FIQA 3EBEA 2PMZB 2ZXOA 3PF5A 1KLVA 1S1QB 2JSOA 1FXTB 1WGGA 2Z9HA 1WTVA 3W1BA 2TSSA 1JB7A 1JB3A 2PQAA 2R93H 3R3MA 4BXXG 2RGFA 4BOSC 1JMCA 2RSNA 3T4AC 2JWZA 4HLEA 5FJ8G 2RKSA 3PQIA 3DBHI 4FXGC 2R92B 3P1MA 3RNGC 2V0GA 1VS0A 3SK8A 2QHOA 4A20A 2C9OA 1I3QH 2IW3A 3I4LA 4FF2A 1LQBA 5DLQE 1KJTA 1EY9A 1ET9A 4B3SL 1ZW7A 1L2NA 2A73B 3VUYA 2EYMA 1A3TA 1N61A 4OHJA 5M5YH 3GTQH 1YNXA 1HZ5A 3J80L 1CTMA 4MT5A 3TEXA 1VCIA 2KQ3A 4IWOA 4EFOA 1UAPA 1W2BA 3HOXB 5MPOA 3ND9A 1RIPA 4HMJA 4I7AA 1TZOA 3MJ5A 4K7WA 4M0WB 3QJYA 4JI4L 1ZOYB 1VQ7A 1Z9FA 5G5HA 2A6EC 2Z0SA 1GPXA 5HFYA 3WCQA 2PQAB 1O7LA 4YWKA 1TWGB 2YTXA 2BS2B 1DYQA 3F2CA 3MXGA 5CR3A 3C19A 4C3HB 3RNFC 1QB5D 2B2WA 2ZM6Q 2MRPA 4AYBG 1CZWA 2B63G 2VB3X 3DWPA 3DHQA 2FFKB 2GMIC 3ONAB 3IL8A 5JJLA 4KGRA 2MO1A 1F9RA 3ML8A 1H4RA 1CSPA 4GKKQ 2L11A 1V8QA 1VMCA 3MFYA 3VR3A 3GE3C 5JZEB 1EIGA 4HPLB 4DV1Q 3ZRFA 4NAMA 3P4PB 3PSIA 4RF1A 1ROEA 1CM9A 2DNCA 3NBHB 2F0FA 5EE1A 4N6EB 4DUYL 4PZ6A 1XMOL 2KNBA 3ALBA 5C3EB 3IRBA 4HXDA 4M0WA 2EIFA 3NVYA 4K6DA 5I4DA 5AZGA 5KYLA 1L4DB 4EOYA 2F3WA 3NK9A 1EUVB 3PO2H 2ID0A 3CMEA 3EROA 2I1JA 1E6EB 1EOVA 2XSCA 1RAXA 1WGDA 2MA9B 3S16B 4YTNB 3OIPA 3EA6A 3C46A 2GBRA 3DBLI 4IQZA 3HG9A 1KHIA 4GSWA 3OWFA 2WP8J 4JBKA 1GJZA 3R2TA 4QJFA 1C4QA 5FLXL 4JI2Q 1L0VB 5IP4D 3DMUA 1Y8NB 2BOSA 2MGSA 4DV3L 1N32L 4NKLA 2N1WA 1G6ZA 1RRBA 2WDRB 4GIVA 2CHBD 5BR8L 1ASZA 3S1QB 1L2FA 4DUZL 1IBKL 3RZOB 4LFCQ 1MKHA 4DR4L 2DAJA 4XWTA 1SB3C 2KHSA 2J4XA 3DPDA 3OIQA 1WY8A 5C23A 1VQMA 2R7DA 1ASYA 1YN4A 5FK9C 2RR9A 1PZID 3AE3B 3PHWB 4OW0A 1QE6A 1SNCA 2NMQA 4KKUA 2EY6A 4GOPC 4V190 2K6QA 2LGIA 2LJ5A 3I8ZA 2UXDQ 2L05A 2R93B 2UUBL 3AEAB 2F0QA 2OF1A 3D0FA 1WGRA 1TWFB 1XTCD 4YTPB 3NOBA 2YVCA 2B2TC 1U4MA 1QOFA 1UEBA 3SR1A 4WIPA 1BCPF 3W1GA 2BA1A 3TJPA 2EXZA 1EWIA 1H9SA 1VQIA 1C9FA 2YU9H 5IYCH 3UIOB 1XPRA 3DM1A 1UWMA 3R93A 1YIWA 2LGSA 2N49A 5JEAG 1ZGUB 3TZUA 1UNSA 1BT0A 4XE0A 4YSYB 3JVZX 3MFGA 1L6UA 4K7UA 4FDBA 2BYEA 2UUAQ 1WFQA 3HOWH 4OL7A 3C3LA 4OX9Q 2QW7A 1VRAB 5JJZA 2EMTA 3ETRA 5DPWA 3GTMB 2H89B 2F0NA 2KUMA 1R4NI 2EXDA 3IT4B 2CQOA 4K6LA 5GQOA 2A1AA 3W2DA 4Q5VA 1E22A 3FPPA 4QMGA 4A3FH 2JVCA 2WXHA 3P42A 1Y69U 2WXGA 4IUTA 3VAWA 4A3DB 3NRZA 2CWAA 1ESFA 4CDFC 1QOBA 2LVPA 2LRWA 1MSHA 1MJDA 2NVQB 2ZM6L 5ELEA 4A3LG 1XLPA 2LSSA 3TP8A 2BVCA 3UDFA 3S1MH 2KC2A 3C8YA 3NQIA 4R4OA 4M8MA 5D6JB 4AH6A 1N5XA 5HURA 4X65L 2I2YA 2BE5C 2DGYA 1HH2P 1VDZA 2V4IB 5IYDH 1PYWD 1Z6HA 2ZNVB 3OHXC 4B9WA 2I5MX 5EAYA 3DDCB 2KC1A 1QVGA 3HUIA 2G4DB 1P16A 1R7SA 3RZDH 4DUYQ 3AEDB 3PV1A 2E6XA 1GUTA 2F0JA 2KCNA 4DK1A 1B2TA 1I4RA 1FPYA 2KLGA 5JHBA 4IUMB 2PO4A 2ICIA 2R93G 3MAQA 1AE2A 4EZLA 2W9NA 2F0PA 5JVH3 4NXNQ 1I7HA 3BS1A 4I6PA 1GB4A 1BO0A 4LF5L 2PCFB 2HJ1A 4C3IG 2WV6D 3KYHC 1SYEA 5EKLA 1PH6A 1VQJA 5AJ3L 2N3SA 4QCLA 4K14A 5CGKA 3VFKA 3TP6A 4AIMA 3QHTA 2LXCA 3A5ZB 1IBLL 4OVZA 1VQ4A 1S5ED 4DAPA 1EL0A 1EM7A 2F4VQ 1B70B 1WZ3A 2DHZA 2C7MB 3EFXD 2PJHA 4GS3A 2XTIA 1A5RA 2F0UA 1IBXA 3OMCA 3PIO3 1A6XA 2K5PA 4YWMA 5BYQA 4MSQB 3A1QA 3KYCD 5FOBB 1D3ZA 3KBXA 4W9JA 5CMDA 2C9WB 2K8HA 3L08A 1LTSD 4Y52H 4KGTA 2XN9C 3Q8FA 4A3JH 1MGSA 2PI2E 3QARA 1ONLA 3EFCA 1Y1VB 1X3PA 1EY8A 1QILA 5CYUA 1YITA 4JWSC 2DJFC 2WWZA 2FE8A 2A74C 4JI3Q 4MACA 2N88A 1SIJA 4DHZB 3PTFC 4DK3C 3EIVA 4ZKCB 3OPOA 4LNQA 1QZHA 3FPUB 5JVG3 2L32A 3CRLC 1CKNA 2PYKA 4IC7B 1YJWA 4GDKB 5IN7A 1ICWA 5E3FA 5TR5A 2FCSA 1PFBA 2JA6H 5IYBG 3NVVA 1BBXC 4A3BH 3HIZA 4YWGG 1EIYB 4IM3A 1ILPA 3ZDTA 3G71A 1Q46A 1RWSA 2Z6KA 2B63B 4G7OC 1X3QA 1SAPA 4C3HG 4JK1C 1ZXHA 1E7VA 4ARIA 4APVA 3A1QB 4DXAB 4EQNA 1NEKB 3R7QA 2MO0A 3HOYB 2IX1A 1Y1VG 2NVXH 4X3UA 1NR2A 1OTRB 1TXYA 4MN3A 4Z9CB 3CD6A 1XTDA 5JOBA 3LWUA 2Y3AA 3I3TB 3KYDD 4IG7B 4ANXA 1HNWL 1WTRA 1BBUA 4QUCA 4CDDC 4A3LH 4NDXA 1KFYB 1MJCA 2J7ZA 1OEYJ 4FP5D 2WP9B 3HOXG 1YD8U 3AEEB 3MTNB 3KF6A 4GLVB 1BMLC 4IFDJ 1RCVD 5C3WA 1WM3A 4KD3A 1F77A 4ZUIA 2L7RA 1E10A 1YJJA 3HOZH 3VR4A 3H0GG 3GDEA 1E2VA 1C78A 4K0KQ 2GB1A 2K8BA 3VTUA 2JA8B 1IP9A 4NJ6A 2RPVA 4MJSB 2KANA 4B3TQ 3LNNA 1T5XD 1QOAA 1K52A 1B1ZA 2OTLA 2XNAC 1Q8IA 5IYCG 3RFZB 2V3NA 2EYOA 2PNHA 3P4SB 1Q86C 1ET6A 4A3MH 1V5TA 1XYIA 2ZPNA 4JE3B 5BMGA 3NUCA 1Z7TA 2EJMA 1EYCA 5JPNC 2JA5G 4JGHB 1FXAA 4G11A 1LM0A 4WJOA 1G91A 3I55A 1SEBD 4XYCA 3QA8A 4R4TA 3CC4A 2A4ZA 3ZDMC 2WAQG 4DV5L 3E9HA 3C2PA 1UBQA 2W82A 2KDEB 4U68A 1CJEA 5LXIB 1HZCA 3BDCA 3DEOA 1SE4A 3D31A 3VQIA 3UGBB 1M8AA 4LUZA 4JI4Q 1C76A 3P7JA 2BA0A 2X8XX 4IWQA 4AQYL 2KOLA 3Q22A 4HCPB 4B3MQ 1EY0A 2YTYA 2KDMA 4W9EA 1MG8A 3ZUNA 1JW9D 3BIID 1BUVT 4H02A 1GB1A 1WJJA 2B3AA 2Q2HA 4IUPA 4HCNB 2FMCA 1R4PB 3AFPA 3UIPB 2DWQA 5HY6A 3Q3NC 2D5GA 4DUZQ 1PTOC 1IBKQ 3TIXA 3ND8A 4C3HH 4HJ8A 1ACCA 2IY1B 3NWSA 1LYLA 1OXXK 1RTNA 3FKIG 3V61A 4M00A 3CKIB 5M3MG 3QR8A 3PUWA 4JI1Q 3PO2G 2KBNA 3B6YA 5JJKA 2BKRB 5IYBH 4DR3L 2I38A 3A55A 4DA2A 5IODA 1SE2A 4TRDA 4UY8C 1VQAA 4UHVA 4A3BB 1WX7A 3LJ3A 3RI7C 1K53A 4O1NA 1KABA 2AHOB 4KJNA 3G7LA 4K5WA 5IP9G 1X1MA 4AQ7A 3MXUA 2MBHA 3P75A 5K36H 4MM3B 3OAWA 4QY7A 1WXMA 4P2CB 3Q3FA 2XWBB 1J7BA 1HNWQ 2JXMB 1SNPA 2K1FA 2EVBA 4N8FA 2IBIB 1H8CA 4QIWB 1JE4A 2NVYB 4GKKL 1FCCC 5GXGB 3ECIA 5A35A 4OX9L 2D9UA 4ICVA 2GRIA 4C4VA 1FNWA 2JZ3B 2ZCBA 1PTOB 1JALA 4KVGB 4IOAA 3H7SA 3HKZB 4L63B 3SK5A 2IGDA 2Y5PA 4CYEA 3CIRB 1KRHA 4X3TA 2HHHQ 1XNQL 2B8FA 1TWHH 1XLNA 1P7EA 2WYQA 2DZMA 1ZPSA 3GV6A 1CA6A 3I9V1 5J3BA 4BBNF 4Y7NB 3NS1A 1CQFA 2B2UC 1WD0A 1YN5A 1TY2A 1XCTL 2INCC 3AE7B 1EO6A 1SSNA 1FCLA 4GLAC 1TJEA 4HR7B 3V05A 1U5KA 2KD0A 1YI2A 4WWMA 1EWHA 4N9F4 4KIKA 3J80i 3U9SA 4A3GB 3PO3H 4PMWA 4DNRB 3TBLD 2KWUB 4HPPA 4DV3Q 1VZ8A 2R7FA 4CJ1B 4QL5A 4NY0A 3QK0A 4JC0A 2KCTA 2LFNA 4MHEA 5BR8Q 4A3BG 4RNAA 4IPCA 3NVZA 1LACA 2L1BA 1JE5A 3HOUH 2A6HC 4KV2A 5T1GA 4XQQA 3GV3A 1N33Q 3PO2B 3N1ZC 4PK1A 2WIIB 4RKBA 2PNRC 1WJ6A 1KF6B 4HN7A 3DCGA 5C5MA 4OGQC 2K75A 3DBSA 5CV7A 1A15A 5AJ3Q 2F0TA 1FFVA 1FM0D 5ELFA 5C2TB 3H9DA 2HQEA 5CBAE 2KVRA 3DBRI 2A6ED 3GTMH 3Q69A 4ANWA 2WKDA 2OEOA 4ZHPA 1SMYC 2Z59B 3G48A 5EE0A 2WU5B 3HK0A 3I57A 4L2YA 2FCMA 3HRZC 3FEWX 3AU5A 5CC4A 1PDQA 5E1FA 1WRDB 4KIKB 1VQBA 1YX5B 2M19A 2DLBA 4X65Q 1UH6A 1XNRQ 5FLXE 3AECB 4K8IA 1HNZQ 1I6HH 2MBOA 1S3SG 1RJTA 3WANA 4IOIE 1SSOA 4I6NB 1RYJA 3U4VA 2AUKA 1TKGA 1MD2D 4ODGA 3TREA 4LF6Q 1EEID 2F0SA 1UGMA 1UGJA 2WLBA 3I4MG 3VUWA 3S1RB 4DV7Q 1JOKA 2B2VC 3KW5B 3NS8A 1B4OA 3NSWA 1Q90A 1ZYRD 1L0WA 3AMUA 3S15H 1G6PA 4F1SA 2EDGA 5EDSA 2K8CA 3VDZA 5IT9E 2WX0A 3LB8C 2KN4A 1K8MA 1YJ9A 2MW5A 1CUKA 1ENAA 3N6RA 3PMFA 2EYHA 4JL9A 1K28A 1TWCB 3R8BA 2FXQA 2NN6G 3EN2A 3VR6A 4DR2L 1C4CA 3F8TA 3ZIMA 2A68C 3EGRA 1QOGA 5M3FG 3I4MB 3C0RB 2WB1B 4LF7L 2E8GA 1Y8OB 1E5WA 1FD7D 1KDCA 3D8GA 2ICEC 3M4PA 2AEHA 3N9YC 3Q14C 4HDOA 4BKSA 4GOPA 2KJHB 1HA5A 2NN6I 3CF6E 3U7DA 4KLKA 1KTKA 3K5OA 4YWLA 3PO3B 1DONA 2BS3B 1YJIA 1Y8RC 2JT4B 2QGQA 3K8AA 3UF8A 2R2OA 1TS5A 3VYSA 4IFDI 3W5UB 4RHSA 2ZZPB 4IDIA 5M3FH 3S1MB 4II2B 3V3XA 1PH8A 1MHWC 2L5TA 5FO9B 2NN6H 3ZYYX 3ZTCA 2L0FA 4KJOA 5BYRA 5ELBA 2WDTB 3QAQA 2WX1A 3J80E 1QJOA 3ZXRA 2N9PC 3S2DB 2GBMA 2LXKA 4IFDH 4KD4A 3HOYG 3D32A 1IXRA 1ZXIA 3E5SA 1VQNA 3BZCA 5EKKA 4ZCKA 3RNUA 2F4VL 4FNFA 4C2MH 1D2BA 4GNXC 2ZJQA 1JOQA 1J19A 1EF1A 1K50A 4DPGA 1YQ3B 2WXFA 3MTSA 1PQSA 2H4OA 2F0OA 3A9KB 5EE3A 1YX6B 3AU4A 4DAYA 2M1MA 4EE2A 3VR8B 4ARCA 1A2TA 1OTCA 3X0WA 4LFBQ 4WJ3M 4A3EH 1EQTA 1K83B 1CKOA 4KKSA 1WM2A 2HCCA 2N9EB 5G2NA 1DM0B 3HOYH 2RDBC 1H9JA 4BKTA 2KEDA 3ONSA 3EECA 1QNKA 5L37A 1SFOH 2LMCA 4DV5Q 2QMTA 4KKTA 2HIXA 3KBGA 1PA6A 5G55A 4RG1A 4IO9A 1CHQD 3U8ZA 3KDFA 4A55A 4YSZB 2K05A 2M8SA 4ZRJA 2VB2X 5I9OA 2EPBA 2IWHA 3K6OA 2HD3A 2E2JB 1E24A 1MHXA 1I50H 1VQFA 4IJLA 1KM7A 2PKOA 1G291 3PVLA 3QX1A 2Q8RE 2QSDA 3W1SC 2JK8A 3AU7A 2INNE 3LDZE 3HVZA 3R66C 4WWNA 1R9TB 4JI5Q 1TT5B 4ZHOA 1BF4A 4WJ4A 3S16H 2DX5B 2Y5CA 1IGCA 1MVKA 1HFGA 2H5XA 3PS6A 3LXFA 1I94L 1FR3A 1OXSC 4IPHA 1G51A 4B9XA 3PO3G 1V97A 4G4KA 4N58A 4LW1A 3GP7A 2A19A 3NE5B 4OIKA 4IUUA 3SVMA 3L0OA 4NMZA 2Q8TA 2L83A 4JPBW 4XDXA 3CQZH 4KN7C 3RUZA 1J7AA 1YHBA 2VH2A 2CW0C 1BCPC 2Y0SB 1CZPA 1HNXQ 2VQFQ 1J9OA 3HM6X 1PZJD 3L10B 1W6KA 3GS2A 3BG3A 2JEAI 2CW0D 4BOZB 4RWSC 4HKQA 3JAME 1E7ZA 1WWTA 2ONQA 4DV2L 3PIPA 2E3TA 1E8ZA 5CHVC 1U4RA 1H9SB 3N1XC 3BVZA 2ACZB 5IGGA 3ZQ4A 1I42A 2F0DA 3PUYA 1WXAA 1XCQL 4IURA 1UE5A 1FL0A 2OHFA 4C1NK 2DN8A 1VQ8A 2K5QA 2JA7H 2M0AA 4OWWB 4NNJB 4QAYA 1EFID 1ZXTA 1OQQA 2M17A 3MC0B 1QZEA 2VZKB 1S5DD 1SE9A 4HIMA 4X66L 3RPFC 3IAS1 4LNOA 3TRZA 2O2VB 2J0JA 2RPQA 2WB1E 2EYLA 5FKAC 3H09A 2JXTA 3CMMB 1EIHA 2ATWA 4DR3Q 1WGHA 4ZYSA 3TSSA 3BJUA 1WCMG 4K5XA 2L0TA 4HK2A 4PS3A 3I70A 5EQ0A 3FAHA 4L5RC 2F3VA 1EY7A 2K52A 1KRTA 2OCEA 3CCEA 2VQEL 4IN3A 2QDFA 4RFBA 5EPJA 2UUCL 2JA5B 4XTCS 3TP7A 2JYEA 2JRIB 1IL8A 3URYA 2WNMA 1Y56A 4BXXH 3NTHA 1XMQQ 2LGYA 1WJUA 1ZDXA 4A4IA 2DY7A 1KAAA 2MH7A 1T5EA 1HFNA 2C7NB 2PMZE 3QC8B 4GU2A 4RA8A 2SDFA 5C5LA 4KDIC 3ZJUA 3S2DH 2Q2UA 1DOIA 1BBWA 2X69A 2JA8G 4WWOA 1Y14B 3VTWA 4H0LC 3L13A 4B9KA 2B2YA 4PZ8A 4RGOS 4RMFA 1IPGA 4PMBA 1Y1WG 3V6CB 3KWLA 2VRRB 2F03A 2HTME 4OONA 4P1BC 5JHAA 1V9PA 1B53A 4DAMA 4KZ0A 3NP8A 2JQRB 3K0YA 4K3BA 1DOXA 2HD5B 1IW7D 4F8MA 2D07B 3W5OA 2EMSA 3KLSA 2RHSB 3RZFA 1GUOA 1PYSB 3K59A 4JWUC 1E0ZA 1K0SA 3J81L 2IGGA 1SDFA 4J6HA 2LVQA 2D3BA 2D3GA 4JBWA 5C0XH 2N8NA 4NJCA 4OZAA 3SFEB 3DHHC 3T8MA 3TEZA 4WQMA 1T0YA 2MHJA 1SFOB 2A69D 1C4AA 3EUB2 3B1LX 2MHVA 3P4RB 1ZEQX 3H94A 1WX8A 1QQRA 1GHKA 4C7YA 2CKZB 4FXKC 3VHTC 1I50B 2UWQA 5C4JH 1Q7YC 5HKHA 1I3QB 4KHPL 4GOCA 1F52A 3E0EA 3H0GH 2F0WA 2F0HA 2KVZA 2LWPA 4DKAC 2FBWB 2FJ2A 1N34L 3M4QA 4AYBB 3S9WA 3UDGA 1TYGB 2WXLA 3WAMA 1RF2D 3ZNGC 2Z4IA 3GTQB 2PZTA 5EBDA 3CSTA 4K2KA 2AWOA 1VLBA 3P63A 1DGSA 1OXUA 2Q5WD 5ELCA 1W3SA 1SIFA 3I4OA 4GN3B 2XWJB 5KHOA 3K7AB 2HUGA 2IX3A 1TKEA 4R3DA 4DXFA 1TWHB 3NTKA 2W54A 2DZJA 2FAZA 3EJIA 1QF6A 4DN4M 1F2RC 1N33L 2VZKD 2IPKD 3SD5A 1F2MA 2PIAA 4M02A 4TQ1A 2KMAA 3K0XA 5J22A 1EQQA 3I5JC 2EYPA 5A2QL 3W1SA 4GLXA 4DV7L 1WI5A 3QO2A 2KX0A 1SMYD 3D6CA 2EE1A 1EZ6A 1WIAA 2K7VA 1OO9B 2FINB 4O2DA 2PI2A 2E2HH 1EYAA 1JR0D 2CU1A 2N0SB 1JJ2A 3AI5A 1PTOF 4IW0A 2DJGC 2KJRA 3AE5B 5E6PA 4EUTA 4LFAL 1W6JA 3AM9A 3IG3A 1WTHA 3A7LA 4K1RB 1WYGA 4QGUA 4DV1L 4LTUA 3W9CB 4F88A 4BBRG 3A7AB 2KECA 2V4DA 1F0ZA 1EOTA 3FVQA 2FUHB 3MP9A 2WXPA 3GZNB 2J7QB 4AWJA 4B95A 1D5ZC 3K9PB 1J0GA 2L00B 1V86A 4A3IG 3RZWC 2BB6A 3TQYA 1YEZA 2W3RA 4IM0A 4HAEA 3F2UA 3W1YA 3DUZA 4HKZE 2LZ6A 1TS3A 3C1EA 3OOCA 4TSSA 5HI1A 1Q1EA 3BU2A 1K83H 2JA6B 3GTGH 1MFWA 2KWDA 2WHIA 3DBRB 3RN5A 1WYDA 4GN5A 3CCRA 1LM8B 2KT7A 4JYAL 2PEAA 1I6HB 3I4NH 5CV4A 2WXQA 1KRSA 2LXAA 4KZCA 5LMNQ 4GDKA 2IZVB 5FLMG 2CHWA 4NAWB 3QB3A 1N8RC 4HIDA 2PPHA 5C4ZA 2ZJPA 3TDQA 1D8LA 4GN4B 1IBXB 1XPOA 4FVMA 4J1MA 4DV4L 1HR0W 5AFWA 1UWXA 4HSVA 1F9QA 4HVBA 5J39A 1NBWA 5I6YA 1SE8A 3I2ZA 2DNEA 2C5CA 1QG7A 4A9AA 1VQCA 1O7YA 1D5XC 3KOJA 4HEDA 4YIJA 3GTLB 3DVNU 3Q3JA 4HROA 1VD2A 1V81A 5IYDG 4YL8A 5JJIA 1WCMH 5D3IB 3CXCA 1MHHE 1R4NB 1TWCH 5LXHA 3SK6A 2Y5BB 4WWPA 1IBML 5IT9L 2W55A 3ZXVA 1F2RI 3X3MA 1VQ6A 3HOWB 3DQVA 2G9DA 4RF0A 4HTHA 2N9KA 2Z6BA 1UEAB 3TP5A 2NCNA 3PSEB 1NCVA 3K81C 2RMMA 3HZXA 3APFA 2L12A 4ME3A 2ZXPA 3HP3A 2OQKA 2OJWA 3VXWA 1L0YB 5LL6S 3ZGZA 3KQ4A 1Z2MA 1J5EL 1LTID 3E9IA 4G3XB 2F0EA 3IT6B 1PH9A 1L1OB 3P4QB 3A4RA 3WAOA 3V2TA 2KDBA 4XT1B 4BBRH 1SBBB 3JAMc 4R8IA 3BYYB 1JICA 3AMZA 4RGTA 1PFDA 1L4ZB 4B3RL 1X54A 3S1NH 3T1YL 4RCOA 2K14A 1PTOH 4NB3A 2HT1A 1V6EA 2UU7A 5BYSA 2JPHA 2MP2B 2PMVA 4OIJA 2JY6A 3H6NA 2KHJA 2OEDA 2NVTB 5C6AA 4ACFA 1SNOA 4ZRZA 1GUNA 1LABA 1KIXA 2UU9Q 1S4ZA 1GG3A 4YCUA 4IPDA 2WU2B 5IIFA 1PH7A 5IA7A 2Z0DB 3S17B 4FO2A 1V1OA 3FKIH 1P98A 4C80A 4DU9A 4C3IB 3PF4A 1Y8PB 4PG3A 4MJSA 3RZOH 3S1QH 1E2WA 5L83A 4BY7B 2RBMA 1M4VA 2KQSA 4DHZE 2MJ8A 2LKVA 4MDKE 3CCUA 2MPMA 5CV9A 3LGJA 1N5WA 1K0RA 2E5LL 2E2JH 2J53A 1K3BC 1SYDA 2LRUA 1JQ4A 1HHVA 2MUYA 5LMNL 3H15A 4M01A 1X3GA 3KDFB 2AX5A 1WCMB 3PZDA 1STHA 3D6WA 1QOHA 3KH0A 4EEWA 1DGJA 1S5BD 1OQRA 3FILB 4L8JA 5HGTA 1JRUA 2QEXA 3CCQA 5CX3A 4R9WA 4DR7Q 4A3EG 5E6JA 1EY4A 4A3DG 1YOVB 2K0PA 2KFKB 1B3QA 3H7PA 1IKLA 1LUZA 4JI8L 1J8IA 5LNK1 4UP7A 1IKMA 3AE9B 1J6QA 1MI2A 4POFA 1A62A 4XQJA 1T3QA 3LWEA 4L5QA 4JOIA 2JJQA 4GOPB 5LLIA 2R92G 2KTFA 2A5UA 3WWVA 3RULA 2C60A 2CS4A 3TCAA 4YCWA 2WXNA 1VF7A 1AYFA 4FHJA 2VL6A 1HR0L 4KHPQ 1U4PA 3HGBA 3M3YB 3MZ5A 3NBHA 3CCSA 1V1PB 1NBFC 2GBKA 2IYDB 2XBBC 2EELA 4H13C 4XDDA 3B0AA 1GJXA 2I0QA 1XWEA 4L5SA 3Q6SA 2XVSA 5KIXA 3PGZA 2LD9A 4AOFA 5JPMC 4WRDA 3RZDB 4IUNA 3SDZA 1WF9A 1Q0WB 2LY7A 1S40A 3CU7A 2INPE 2MBEA 4JV5Q 3RN9C 4X64Q 3S2HH 1SJED 5DPSA 1YIJA 3HRDD 3HOZB 4B3RQ 1X3EA 3JSVA 3BINA 2BCOA 1EYDA 1Y1VH 4C3JH 2VUMG 2NVUI 3WALA 5BN3A 2B39A 5ELDA 5C4HA 2FIFA 4YCVA 5H1SE 3JAML 1S3OA 5EGTA 2ES2A 2UXBL 4OZBA 3V60A 5C4XB 4P74A 2JA6G 3BK2A 4KSLC 4I7ZC 4L5TA 1K51A 3RT3B 1E7PB 2YYZA 1G6JA 1LT4D 4WJPA 2WKCA 3NEMA 4H44C 4UDUC 4A3IB 1WJNA 5F2DA 1UD7A 2BGFA 1MI0A 3AQQA 4ZRIA 1HEZE 1GUSA 4EX5A 1WJ4A 3RN2A 3VRAB 3UDIA 4GDLA 3UQBA 4XT3B 1SYBA 5C3EG 3A9KA 3ABVB 2C7HA 2RF4A 4ID6A 4FN2A 4R4IA 1GO3E 3CCMA 4E74A 4HJ7A 4I6LB 1X55A 4M8NA 2DYBA 4USAA 3FMCA 2K6DB 4NXML 3NWTA 4HWIB 4XIGS 5ISRA 1IYVA 3U50C 1PYBA 2OXPA 1NNXA 2MBQA 4MTKA 4TQUS 1FJGL 2A6HD 2ZCCA 2ZPYA 3PLVA 3PRZA 1PMRA 4DR7L 3AE8B 2N7EA 1CK1A 2EZVA 4K3CA 4B3ML 2NS5A 4NP5A 2OJRA 1YHQA 1JWUD 2EY5A 3AE1B 3CCVA 4KK7A 3NG0A 4S0RA 1E0BA 5BN4A 1AEXA 1FGUA 4GMVA 4IWPA 2X6LA 1VMPA 2O5JC 4KY7A 4J3OD 4LJPB 4XDCA 2K5WA 3CC7A 2KEEA 2N55A 3AB9A 3VYTA 1WTPA 3BZKA 4DR6L 1WZ0A 1WMHB 2KO3A 2HCIA 5AZFA 4NJ7A 3TMPB 2K5NA 3Q24A 5FO7B 2G5DA 1IYJB 4H2AA 2KDFB 3NY5A 4K7SA 4NPNA 3UI2A 3U58A 4JI1L 1WSPA 4II3B 1EUJA 1YJNA 4BA2I 3PUXA 3U7ZA 3HFZB 1HZBA 4P16A 5EKIA 1YVCA 2EJGC 2R3ZA 1FNVA 1SRUA 4CKCA 3J7AF 2I5HA 2YU9B 2K25A 2LUMA 5IY0A 3J9CA 2JU6X 3KJOA 1EEFD 2UXCQ 1WGKA 3CW2C 3ZW3A 4K8JA 4KKJA 1QUQB 2RCNA 1BDOA 3I4NG 4GN1A 1N63A 2NVYH 1PH2A 3PV0A 2NYZD 3OWEB 4TKNA 3CWIA 1FD6A 1NE3A 3MXNB 5C4XH 1HTLD 1NYQA 2JUOA 5IOIA 1RLFA 4A3JG 1HJPA 3E9SA 4LAAA 2PW9A 3A4SC 1WI0A 2MX2A 1B3AA 4A3IH 1U4AA 2KFKA 1A8VA 4A3MB 3PUZA 4X3KA 4RAUC 4WH4A 3J81c 2I5LX 5CV5A 3KVFB 2N9XA 4PMCA 4V0BA 3ZJYC 2XGTA 4OXPA 3SHQA 4UPAA 3KUDB 2ZTEA 3TL5A 1SR3A 4UAIA 4A3FB 2MJDA 1VF5C 1I4QA 4XXEA 1PZKD 4CBVA 2REXA 4HJGE 4WJQA 4LK1C 3FKYA 1PHJA 1NY4A 3HVDA 1RKNA 4JW0A 4JCVE 4A3DH 2MWSB 1T9HA 5H8YE 1EY5A 1E9MA 2OWOA 3SR6A 3GE8C 1T0RC 5LMUQ 4IFDG 1MPEA 2E2DC 4OWTB 2E74C 2UU9L 4RCNA 3HOUB 1KOTA 1V1QA 2F0MA 2EY2A 4WORA 1WXVA 1X6OA 1BQQT 4U673 1PFMA 1LT6D 1CT1D 4BBSG 1K73C 1PFSA 4OO1H 4MELA 3ZTDA 4B0MA 3T16A 3ZNID 3AULA 4MH8A 5CBEE 4ZRQA 4LNIA 3VH4B 4XC2A 1QVCA 1Q1BA 2AQ2B 2NTTA 1WH3A 4KY6A 3J7YW 2HDMA 1G2TA 1R4QB 3GB1A 4HCSA 4DQOC 2V4LA 4TKOB 3A5UA 5G3LF 3MC8A 2NPTB 2OTJA 3TBIB 4PS7A 3QQ8B 2NBUA 5COYA 2DNFA 4AYBE 4K81A 2XEWA 1KL9A 2K03A 3Q23A 1X9NA 4A3FG 2FCQA 2HDEA 4QQBX 4J8QA 2LEKA 4HIOA 4MH0E 2NTSA 2O2LD 2Z1CA 5M5YB 3PCOB 1XNRL 3AH7A 5AZHA 1H95A 1SGHA 2ON8A 3X23A 3EQLC 2KK8A 2L52A 5IGBA 2V3PA 3VTVA 4DK6C 1JWAD 1ENCA 3M4OB 1KD1C 1R4MB 2IO2B 2N9LA 1LTGD 1CMXB 2EJFC 4A3MG 1B44D 3FHWA 2WDQB 4G0NB 1BUIC 5GAEC 5DCNA 3BK1A 4DXGA 2WXRA 3A9JB 3DWQA 1Q82C 3NHHA 3CCLA 3S17H 4O0AA 1EWYC 3VA7A 4AQYQ 4CHKA 1B8AA 2R2QA 5IT9c 2WDVB 2PW7A 1YMHE 3GTJB 2L3ZA 4JI6Q 4LJZC 2WXJA 1O7ZA 3P1HA 4GKJL 2BQQA 3P20A 1MG4A 1VZ6A 2WXMA 4FYDA 4FHKA 4BS9A 5LL6X 4IJHA 3SGIA 4KKIA 1OXTA 4CDEC 2VS1A 2PZUA 2Z8LA 3H3VH 2HIVA 1ZP0B 3U52E 4E6IA 2HQLA 2KWCA 3RR5A 2GN5A 5C0XI 2LJIA 4XWWA 3RNAC 1BXTA 2M00A 5M3MB 4JV5L 2FCNA 2XIWA 1XX8A 2Y0SE 3H6MA 3STBD 1VQHA 1HUMA 4JI8Q 2DZIA 2KJ6A 1ML0D 4FLHA 4LK0M 1TS2A 1JWBD 4BBSH 1I4PA 3JSVB 1E8WA 4MGYE 1G2SA 1STAA 4C2MB 4DV6Q 2K4KA 2KQ7A 2ZTCA 3C1FA 2UXBQ 4HJ5A 2R6GA 4OVVA 4AJYB 1IZ6A 3NPPA 2GVBA 3ERQA 4IPGA 3RLNA 1XNQQ 2EKIA 4FXDA 1VQ5A 3K5MA 1PDXA 3OJ4B 2WXKA 3N32A 4BY1H 1RHPA 2XK5B 2JSVX 5C3JB 4LF9Q 3T3OA 1ESRA 4K5VA 2BS4B 5C4JB 3PZ8A 2X6GA 4DR5L 5LMNW 2L0CA 3GO5A 3R7RA 3QG1A 3M63B 4IM2A 4NQLB 3VR5A 2PW5A 2BW2A 2VNUD 1OEYA 2BH2A 2JF5A 2YEPF 2K5VA 4W9FA 3NZ3A 4PT5A 4DV0Q 3CPFA 5DPRA 3DEPA 1PFNA 2R7ZB 2GBJA 2K39A 3L4PA 4NQKE 3SK4A 3DVGY 1NTGA 4W9KA 5EPKA 4KHZA 5C3EH 4FF1A 4ZQ3A 3DWMA 5IAAC 4IUVA 4Q2JA 4TMAB 5C4XG 1LGRA 3MA2B 2QDBA 1ICFB 3OYYA 3EC8A 2B2TA 4DGZA 3KF8B 2VQEQ 3PPAA 3M3JA 4KGSA 4BY1G 3S2AA 3KFUA 3ICEA 2ASBA 1GOZA 3IKJA 2VY3A 4A3KB 5T8IA 2IX0A 4DDGD 5BN5A 1EQVA 3GTPB 4YT0B 3H7PB 1E1TA 2CVRA 1D1IA 2PQEA 2C5LC 4DR1L 4N9PA 5FJ8H 3M85A 2KA7A 3GTKH 2D2QA 4GDLB 3PRMB 1WOCA 1IW7C 1I6VC 1BR9A 3OSOA 2YLMA 3N3KB 4F7ZA 1WRIA 5CV8A 5JEAJ 3DBHB 1AW7A 4LUVA 3G4SA 5FR3A 3ER0A 5GMVA 1DD2A 2OQ0A 1YNTE 5J2RA 3W5VB 4JX1C 2VQFL 5EBCA 5NUCA 4WAAA 4D2KA 3NQTA 1HQMC 2R7ZG 4MGZE 4ZRPA 1F2ZA 2CWPA 2G4SA 1H9MA 1Q5WB 2ZNVC 5C44B 1NAPA 4LLGM 2ZW0A 2JA7B 1Q3LA 3UI3A 3I4NB 4PNYA 1STBA 2KOXA 3U4EG 5C1ZA 4HDQA 1K8AC 1NI3A 2JZZA 3B2FA 1UBIA 1HUNA 2EYJA 2KHIA 3NTIA 2NZ1D 4GXBA 5J1ZA 4FJZA 2J42A 2BDNA 1WX9A 2QF7A 1VQKA 4ANUA 4EQPA 1R4MI 1N32Q 1I4XA 2E2IB 3OTOQ 4A3EB 1C77A 4WQOB 5E6NA 1MBYA 3U9OA 1WMHA 1HZ9A 2F0KA 2KJXA 2K04A 2PE6B 4KSKC 1X65A 3J81E 2D0PA 3SU8X 3CHBD 2MFIA 2DENB 5D94A 2L8JA 1I35A 4DR2Q 1TWGH 4IALA 4W9IA 3CQZB 5K36G 1QWYA 2F0IA 3Q3MC 3ZJVA 3DVGX 3TEWA 3V6EB 1N34Q 1IGDA 3GQBA 1FJGQ 1Q12A 2B29A 4PZ7A 2LMCB 4LF4Q 2RSUA 4LFCL 1ZUD2 3GTLH 2M9VA 5LMUL 4HJAA 2RHQB 2L4NA 1SROA 4A93G 2O5IC 1GUAB 3H1UA 1VQGA 4DV0L 1VCBA 4BY7G 2SAKA 1STNA 1FNUA 1PH5A 1JT8A 5EE9A 2B8GA 2KDIA 4C3JG 2VUMH 2K33A 2WINB 3HOXH 1LTBD 1KNAA 3PRPB 3DLLA 3Q6BA 1Q10A 4KTAA 3RNBC 3QIJA 2AUJD 2JYOA 3QOLA 2BWFA 4AP4C 3UE1A 4A3GG 1XLOA 1F2YA 2EOTA 4IOCA 4BKSD 2QIEB 3K9OB 5FR6A 4AS1A 1C48A 5ELNA 4DNTB 1AZQA 4GB9A 4HJKA 4ILWA 1JC7A 4PV1C 1WE7A 3VUXA 2UXCL 1JWMD 1AWDA 1EWCA 2KAJA 2GBNA 4M8AA 3L7ZC 3WIMA 3AN1A 5JXVA 1EYGA 1XLQA 3N30A 1TVXA 1FRDA 2D5DA 2L76A 3APDA 3HM3A 4C7ZA 4F8CB 1EU3A 2F3IA 1FXIA 3J81i 2XK5A 4LFAQ 1VQDA 2KCMA 3O65B 4LFBL 4PQXA 3T51B 5GAGC 3ULLA 5DM63 2JX5A 2JA9A 3F1ZA 3GTKB 4PYZA 1GKHA 4CKEA 1O80A 2XRSD 4QB4A 2R92H 3HOVH 1PH4A 2K5DA 4N9TA 2IJ0A 3DOWA 2JYTA 5AUKA 1L5PA 2D10A 2GVAA 2AWNA 1CI3M 2L15A 3DXJC 3A8IE 2KYWA 1HQRD 4MGKE 3K58A 4DAYB 2IY0B 4US9A 3ZJTA 4EQ5A 1E90A 4BA1I 2FMMA 3E3XA 3S14B 1RFAA 5CTRC 1B9NA 1P3QU 1TZ1A 4JYAQ 3S24A 2QCZA 2B2YC 3SFDB 1SF0A 2D0OA 1TTNA 2GOWA 1S72A 5IP7H 4KV6A 1IBLQ 1AP0A 4LNNA 4PYUA 1U9RA 1HZ6A 2G9HD 3RUIB 2G3QB 3ULJA 3DHIC 3WOFA 3DM3A 1WTQA 2V1YA 1P9DU 5EJWA 2DUDA 1RM6C 2BB5A 2D3AA 4LUOA 5M5WH 1Q81C 4LCDE 3RLOA 3ZVVA 1LTRD 3Q2AC 1X3FA 1CQVA 4X62L 3N1YC 1F2LA 2DYMA 5D14A 3PIP3 4ZKBB 3G6JB 4CJ0B 3R2IA 4R4CA 1HTPA 2JP1A 3D3RA 1FVIA 5C44H 1HTOA 1KAWA 4DHJD 4CDCC 3L16A 3PLUA 2JEBI 4ULLA 3WDNA 1V80A 3I56A 4RGNA 3B08A 3T9LA 2WAQB 2MJ3A 3H8HA 1XO3A 2EYFA 4FADA 2ZEQA 4TQ0A 2LGXA 1FGBD 4RKLA 3GTOB 5I2XA 1Q1OA 2IDYA 4KI0A 2CR5A 1NMFA 1EY6A 1JMLA 1ISNA 1LT5D 4DR4Q 3BY4B 3WAPA 4P72A 4P6VF 3FILA 2MLBA 1C9OA 2RDFA 4ASWC 1TWAB 2FNJB 1F9PA 2PZWA 1WTOA 5KEEA 2ZVOA 4CGYB 1EFWA 1XF5L 2M56B 1N6ZA 2D3CA 2KTRA 4EZJA 5D3DA 4CKBA 1XMQL 2PTLA 1STEA 3Q8AA 2SOBA 4JG2A 4LWCA 1E3PA 2IHFA 2EY1A 1TIFA 4YXDB 2KVMA 1DOKA 1L0XB 4FXCA 2YV5A 5GAHC 2P5ZX 3H0GB 3RLFA 3AEFB 5ELOA 1SN8A 4ALPA 3RMKC 2TMPA 3AEVA 1LV9A 2Q2TA 3IAM1 2MQJA 3KUCB 3HOVG 3ML9A 4JI0Q 1TWFH 5IP9H 1P1AA 3M9BA 2F0LA 4WJNA 2AQ1B 3TN2A 4X3SA 3PGEA 4IZ8A 1XJVA 3KF8A 4FF4A 2PVOD 4OZCA 2CJNA 2NB0A 3SHLA 2K6AA 3TEHB 1C3TA 1JRPA 2I46A 1A0IA 3S2HB 1NDDA 2VZAA 1BOSA 4J15A 5M5XH 2WXOA 4N59A 1UE1A 2WACA 3QIAA 4A75A 2BH8A 3SXHA 3RD2A 4EKUA 1JJGA 2LVOA 1JORA 3WA0A 2DY8A 1XXGA 4DNIA 5IE8A 1XT9B 4X6AH 5TSSA 2VXWA 4EZKA 2YEPB 2J0KA 3ZRCA 1YQ4B 3J7A5 2AQ3B 1NR4A 3DWGC 1SXTA 4A3GH 1PTOD 1DZ1A 1O7IA 4W9GA 3GZNI 4F7XA 1WD1A 2INDC 4ME5A 1IUEA 1D6EC 1CHPD 1PGAA 4W9DA 3RYTA 1BCPD 1JCKB 3UE0A 3DHGC 1RL2A 1QLBB 3J81j 1GC7A 1VQ9A 4JI2L 3H91A 4A76A 4OO1G 1KDBA 3MXNA 5T1IA 1JROA 2AL3A 2CJOA 3ENEA 3ULPA 3GD7A 2KXJA 3L54A 1M90C 4WFN3 4A3CH 3IFTA 2QC8A 1J5EQ 4W9CA 2BTEA 3D4DA 2WAQE 3KK7A 1CKNB 3CF5A 1TIID 1PLFA 4MM3A 2JWUA 4XYOA 2MP1A 5KNCA 3T53B 3HEJA 1HPCA 4JIOU 2K1BA 1PH1A 4DF7A 2ZJDA 1JOOA 5JEAH 3L2PA 4DR1Q 4J6IA 4JPSA 4MGIE 2E75C 1TWAH 3OW2A 2IO3B 3T1HQ 2UXDL 2NVTH 4XGAB 4ZRKA 2IO0B 1LXDA 2ZW1A 4XX5A 2BWES 1RFKA 2Z0EB 4AJWA 4B08A 2DYOA 3NVWA 4C4VB 4DHJB 2B63H 4BY1B 1D1KA 1B9RA 2XRQD 1YJ1A 3M95A 4KX6B 4HRSA 2QDLA 3GTOH 3X3NA 1I5FA 2SEBD 1XQQA 2LHEA 3NUHB 5CV6A 1STGA 3QOJA 2A68D 4G57A 4FF3A 1PH3A 2FUG1 2MNAA 3M62B 2JQOA 2KX3A 4WJWA 5KGUA 2ZJRA 1GC6A 2N7JA 1JQYD 2NBWB 2BYTA 1BVSA 3MWYW 1Y1WH 2KN5A 3AYHB 3MHZA 4A6QA 3S15B 4MIUA 1XD3B 1SE3A 1KDAA 1XEEA 2CQAA 4BBNC 2IL8A 1PUTA 1Z47A 1GVPA 3I3CA 2VW9A 4MZ9A 3R3OA 1UF0A 1RTOA 1RDPD 3EHVA 4QUFA 1WTWA 3AEGB 4BBRB 2ALYB 1QNUA 2QCPX 4EVOA 1FFUA 2IY5B 1SNQA 2D2CC 4R8NA 3H3VC 1QT9A 1WFYA 4XZ4A 4R1JA 4JI0L 1KNEA 1U0LA 2H88B 2LUEA 3MEHA 2N4FA 3E6ZX 4BFRA 3S1RH 2MCNB 4CQNA 2E2IH 1PRTB 3IBEA 3LYYA 4FJVB 4LNKA 2SNMA 2CCZA 1GNUA 1LFDA 3SEBA 4JLCA 2BYVE 2IHEA 1OFFA 2M2LA 3K7AH 1FRRA 3TUOA 1X56A 2BBCA 3M7NA 2ASQA 1ILQA 3UINB 4PS8A 2KLCA 1C0AA 1DOLA 2V9HA 5M5XB 2NR2A 4A90A 4TV3A 3I4MH 2RDGA 3AE4B 5BMHA 4A3OA 3TS0A 4NXNL 4HSPA 3CP0A 1HTQA 2N78A 1T0SC 3NZUA 2F0GA 3VDYA 3AXCA 2F52A 5IO9A 5AUIA 1NJIC 5M9OA 3EVQA 3I91A 3I7FA 4YHHQ 3M4OH 1YNND 1HR0Q 3HOVB 2AMCB 3JYUA 1UELA 4K0KL 2NBVB 2BPSA 5BO4B 4F87A 5IGDA 1BCPB 2HJ8A 4LF4L 2A5HA 3K5NA 4DV4Q 1OGWA 4GNXB 4IUQA 1QUQA 4L6TB 3U2SC 1N60A 1ZYRC 2Z6KC 4C3JB 3J7AV 3BVMA 4JI7Q 3IHPC 1SYGA 2KENA 1PVOA 4X64L 2H1EA 3D4RA 1WVLA 4A93B 4HCEA 3Q8BA 1AE3A 2NUCA 2NZOA 3JAMi 2PE9A 4X62Q 2KMCA 5L95C 1YNNC 2MQHA 1GM5A 1IBMQ 1YNJC 1P0RA 1WGYA 4NW2A 4LF6L 4X57B 4ZAIA 2EKEC 4TUUA 5E6OA 3A0JA 3M7GA 4LF8Q 3ZNZB 3AB5A 1UE7A 5C3XA 5M5WB 2KFJA 2O6VB 1N36L 1WXQA 2NBFA 1DOMA 2AKWB
chains in the Genus database with same CATH topology
3QWNA 2L9HA 2CU3A 1CA5A 3Q8CA 1TR5A 1VZ7A 3RMHA 2QKIC 2RVLA 4ZOHC 3FDTA 1NYRA 1V1PA 3BDLA 3NBIA 1SYFA 2RA4A 5KYIA 2E2HB 1AZPA 2QILA 3T3NA 5IOCA 4CHTB 4ZUJA 4ZK9B 2I07B 3I72A 3OW7A 1H9KA 1EU4A 3MVVA 4HMIA 4BBSB 1TQOA 2PVGC 1HA6A 1IHZA 1X32A 1QKZA 2K22A 2MEKA 1PRTD 5FO8B 3E56A 4EGVA 1S5CD 1AFPA 3A8KE 3PZ7A 1DJRD 4REZA 4JWSC 1LTAD 3W3AA 4KN4C 2BT6A 2DBYA 4G7ZC 1LLRD 3GTGB 3L3OC 4KHVA 3BDOA 3Q0AA 4BWGB 4YSXB 1N62A 2WS3B 1C79A 1B9MA 3KLRA 1YN3A 2X38A 2JE6I 5LHY1 1RD9D 2ZXRA 3TEYA 1CZGA 5G5GA 2K3UA 2ENBA 3BZDB 3K5LA 2OT2A 3B2GA 2IT1A 1TKYA 4DAVA 4A3JB 1F9SA 2B76B 3VYUA 3VR9B 5E4WC 5KNDA 1IYUA 1MSGA 1C4PA 1GHJA 3B9JA 1D4BA 1NENB 3PO0A 1A2UA 1GUGA 3T13A 1VJKA 3D4WA 5DAUA 3IXSA 1U4LA 1SJHD 1PRTF 4C56C 5I2YA 1CFMA 2BE5D 2NVXB 1L6VA 1UUPA 1H9RA 3DWAA 5C0XG 2Z4HA 2WQYB 1TKWB 1GXDC 3S1NB 1PGBA 1OXVA 2F1MA 5BMIA 3AV8A 3VRBB 1G8ZD 2MJEA 2SNSA 2GI9A 4RHRA 2GA4B 1TS4A 4I65A 4GZYC 4A8XC 5DM73 5K5PA 5IGCA 3KWVA 3KUPA 3LX0A 3M4YA 1YNJD 4XYQA 4IKGA 1LO5D 3O13A 1TT2A 2K01A 2BDOA 4RH6A 1ZDVA 1DXMA 2L55A 1NUCA 4WAFA 3HS0C 4ABNA 2O4XA 3KLSX 1AN8A 4ZLTF 4G7HC 3A54A 2VUMB 1P7FA 3MXPA 1RODA 4K2LA 5I9PA 3FC4A 2QJLA 2K9XA 1Y1WB 1V8CA 4S3SA 3AEBB 4OO1I 3VA5A 5M3FB 2LS01 1PRTC 2KQ4X 1DOYA 1KH0A 1HCZA 4L23A 1V43A 4L1BA 5EPLA 3SE0A 1O78A 3E0JA 2L1AA 1FYCA 1I4HA 3PUVA 4EQOA 3N52A 2RQXA 3VR2A 1VDVA 3IFDA 3I73A 3V96A 1TY0A 2WXIA 2K32A 1A70A 1TU2B 3MHBA 1II3A 4B0EA 4DK0A 5E4XA 5I6WA 5D65A 1T6BX 2G1EA 4ITKA 1KLGD 1KLUD 1WTXA 3BYTB 1A3VA 4Q0FA 3I90A 1ZKOA 2HDLA 3TMEA 1NSNS 4WURA 4US8A 3A8JE 5DNFA 1LT3D 5IGFA 1PXUA 2LFIA 2K28A 2RSOA 5KNBA 1S5FD 2JZPA 3RD4A 2QEJC 2KCCA 1HRJA 3L9AX 3NXWA 2B2VA 4C1NI 1HXYD 5HHDG 5H92C 5JAVA 1QCBD 5CORA 2RDHA 1PGXA 1A3UA 1ENFA 4LMQD 1C8CA 4O42A 1SNMA 4H7BA 1FEHA 3TZDA 2KACA 5IGEA 3A56A 3CRKC 2LHDA 2B2UA 2ZT9C 1I4GA 2PPBC 5DEHA 5C0XJ 3IAYA 2PLPA 1D5MC 3ITPA 4XQNA 3AE2B 2KMMA 5HG2A 5G3LD 4KMUC 5D7GA 1JWSD 1FMAD 1VR9A 4DFAA 4HEA1 2J52A 4GLSC 1LTTD 2F4IA 3AE6B 4KY5A 2B2WC 1SYCA 4QF4A 4M1UB 4CJ2C 2IGHA 2R61A 3FKIB 1BNZA 5A2QE 1ZE3D 3OMGA 5KRUA 1J7CA 1GUWA 2FHTA 2NWGA 1STYA 1B50A 4YTMB 2D62A 2W3SA 2A69C 3K57A 4RGMA 2F0VA 3BVGA 1SNDA 3BWUD 3VYRA 1GAQB 3WOEA 2E76C 1E2ZA 1FO4A 3T56B 1EZ8A 2J0TD 2Q8IB 4NZLB 1NVID 1DCZA 3FRPB 1K8OA 3Q8EA 1FIQA 2PMZB 2ZXOA 2JSOA 1WTVA 2TSSA 1JB3A 2RSNA 3T4AC 2RKSA 4FXGC 2R92B 3P1MA 2V0GA 3SK8A 2C9OA 2IW3A 3I4LA 4FF2A 1EY9A 1ET9A 2A73B 2EYMA 1A3TA 1N61A 4OHJA 3TEXA 1HZ5A 3J80L 1CTMA 4MT5A 1VCIA 2KQ3A 1UAPA 3HOXB 5MPOA 3ND9A 4HMJA 1TZOA 3MJ5A 3QJYA 1ZOYB 5G5HA 2A6EC 1GPXA 5HFYA 3WCQA 1O7LA 1TWGB 2BS2B 1DYQA 3MXGA 5CR3A 4C3HB 1QB5D 2B2WA 1CZWA 2VB3X 3DWPA 3DHQA 2FFKB 3ONAB 3IL8A 4KGRA 1F9RA 2L11A 1V8QA 1VMCA 3MFYA 3VR3A 1EIGA 4NAMA 3P4PB 4RF1A 1ROEA 1CM9A 2DNCA 2F0FA 5EE1A 4N6EB 5C3EB 4M0WA 3NVYA 4K6DA 5I4DA 5KYLA 1L4DB 2F3WA 3NK9A 2ID0A 3EROA 1E6EB 2XSCA 4YTNB 3S16B 3OIPA 3EA6A 3C46A 4IQZA 3HG9A 3OWFA 2WP8J 3R2TA 5FLXL 1C4QA 1L0VB 3DMUA 1Y8NB 2BOSA 2MGSA 4NKLA 1G6ZA 2WDRB 2CHBD 3S1QB 3RZOB 4XWTA 1SB3C 2KHSA 2J4XA 3OIQA 1YN4A 3AE3B 5FK9C 4OW0A 1PZID 1QE6A 1SNCA 2NMQA 4KKUA 2EY6A 4V190 2LGIA 3I8ZA 2R93B 3AEAB 2F0QA 2OF1A 1TWFB 1XTCD 4YTPB 2B2TC 1U4MA 1QOFA 3SR1A 4WIPA 1BCPF 2BA1A 2EXZA 1H9SA 1C9FA 3DM1A 1UWMA 3R93A 5JEAG 3TZUA 1UNSA 4XE0A 4YSYB 3MFGA 1L6UA 4OL7A 3C3LA 1VRAB 5JJZA 3ETRA 3GTMB 2H89B 2F0NA 2KUMA 3IT4B 4K6LA 3W2DA 3P42A 4Q5VA 3FPPA 4QMGA 2WXHA 1Y69U 2WXGA 4IUTA 4A3DB 3NRZA 1ESFA 1QOBA 1MSHA 1XLPA 2NVQB 5ELEA 3TP8A 3C8YA 3NQIA 1N5XA 5HURA 2I2YA 2BE5C 2V4IB 1VDZA 1PYWD 1Z6HA 3OHXC 4B9WA 3HUIA 1R7SA 3AEDB 2E6XA 1GUTA 2F0JA 2KCNA 4DK1A 1B2TA 1I4RA 2PO4A 2ICIA 3MAQA 2F0PA 5JVH3 1I7HA 3BS1A 1GB4A 1BO0A 2PCFB 4C3IG 2WV6D 1SYEA 5EKLA 4QCLA 4K14A 5CGKA 3TP6A 4OVZA 1S5ED 4DAPA 1EL0A 1EM7A 1IBXA 3EFXD 2F0UA 3OMCA 3PIO3 1A6XA 2K5PA 5BYQA 5FOBB 3KBXA 5CMDA 1LTSD 4KGTA 2XN9C 3Q8FA 1MGSA 1ONLA 1Y1VB 1X3PA 1EY8A 1QILA 5CYUA 2FE8A 2A74C 4MACA 2N88A 1SIJA 4ZKCB 3OPOA 3FPUB 5JVG3 2L32A 3CRLC 2PYKA 4GDKB 1ICWA 5E3FA 1PFBA 3NVVA 1BBXC 4YWGG 1ILPA 1RWSA 2B63B 4G7OC 1X3QA 1SAPA 4C3HG 4JK1C 1ZXHA 4ARIA 4EQNA 1NEKB 3HOYB 2IX1A 4X3UA 1NR2A 4MN3A 4Z9CB 5JOBA 3LWUA 2Y3AA 1WTRA 4QUCA 4NDXA 1KFYB 2J7ZA 2WP9B 3AEEB 4FP5D 1BMLC 4IFDJ 1RCVD 5C3WA 4KD3A 1F77A 4ZUIA 1E10A 1YJJA 3VR4A 1E2VA 1C78A 2GB1A 2JA8B 2RPVA 3LNNA 1T5XD 1QOAA 1K52A 1B1ZA 2XNAC 1Q8IA 3RFZB 2V3NA 2EYOA 3P4SB 1ET6A 1XYIA 4JE3B 5BMGA 3NUCA 1Z7TA 2EJMA 1EYCA 5JPNC 1FXAA 1G91A 1SEBD 3C2PA 2W82A 4U68A 1CJEA 3BDCA 3DEOA 1SE4A 3D31A 3VQIA 1M8AA 1C76A 2BA0A 3P7JA 2KOLA 3Q22A 1EY0A 2KDMA 1JW9D 3BIID 1BUVT 1GB1A 4IUPA 2FMCA 1R4PB 2DWQA 2D5GA 1PTOC 3ND8A 1ACCA 3NWSA 1OXXK 1RTNA 3CKIB 3PUWA 2I38A 3A55A 4DA2A 5IODA 1SE2A 4TRDA 4A3BB 1K53A 4O1NA 1KABA 4KJNA 3G7LA 4K5WA 4AQ7A 3MXUA 3P75A 5K36H 4MM3B 4P2CB 2XWBB 1J7BA 2JXMB 1SNPA 2EVBA 4QIWB 1JE4A 2NVYB 1FCCC 5GXGB 5A35A 2D9UA 2GRIA 1FNWA 1PTOB 1JALA 3HKZB 4L63B 3SK5A 2IGDA 2Y5PA 3CIRB 1KRHA 4X3TA 2B8FA 1XLNA 1P7EA 1ZPSA 3GV6A 1CA6A 3I9V1 4Y7NB 3NS1A 1CQFA 2B2UC 1WD0A 1YN5A 1TY2A 1XCTL 3AE7B 1SSNA 1FCLA 1TJEA 4HR7B 3V05A 4WWMA 1EWHA 3U9SA 4A3GB 4PMWA 4DNRB 1VZ8A 4CJ1B 4MHEA 2LFNA 4RNAA 3NVZA 1LACA 2L1BA 2A6HC 5T1GA 4XQQA 3GV3A 3PO2B 2WIIB 4RKBA 2PNRC 1KF6B 4HN7A 5C5MA 4OGQC 5CV7A 1A15A 2F0TA 1FFVA 1FM0D 5ELFA 5C2TB 2HQEA 5CBAE 3Q69A 2A6ED 2WKDA 2OEOA 4ZHPA 1SMYC 2WU5B 3I57A 4L2YA 3HRZC 3FEWX 5CC4A 1PDQA 5E1FA 2M19A 2DLBA 5FLXE 3AECB 4K8IA 1RJTA 4IOIE 1SSOA 1RYJA 2AUKA 1TKGA 1MD2D 4ODGA 1EEID 2F0SA 1UGJA 2WLBA 3S1RB 1JOKA 2B2VC 1B4OA 3NSWA 1Q90A 1ZYRD 3AMUA 2EDGA 5IT9E 3LB8C 2KN4A 1K8MA 1ENAA 3N6RA 3PMFA 2EYHA 3R8BA 1TWCB 2NN6G 3VR6A 1C4CA 2A68C 3EGRA 1QOGA 3I4MB 2WB1B 1Y8OB 1FD7D 1KDCA 3D8GA 2ICEC 3N9YC 1HA5A 2NN6I 1KTKA 3K5OA 3PO3B 1DONA 2BS3B 1YJIA 1TS5A 3VYSA 4IFDI 3W5UB 4RHSA 4IDIA 3S1MB 3V3XA 2L5TA 5FO9B 3ZYYX 2NN6H 4KJOA 5BYRA 5ELBA 3J80E 1QJOA 3S2DB 4IFDH 4KD4A 1ZXIA 3E5SA 5EKKA 1D2BA 4PT5A 4FNFA 1K50A 1JOQA 2WXFA 1YQ3B 3MTSA 2H4OA 2F0OA 5EE3A 4DAYA 4EE2A 3VR8B 4ARCA 1A2TA 1EQTA 1K83B 4KKSA 2HCCA 1DM0B 1H9JA 2KEDA 1QNKA 2LMCA 2QMTA 4KKTA 3KBGA 4A55A 1CHQD 4YSZB 2K05A 2VB2X 5I9OA 2EPBA 2IWHA 3K6OA 2E2JB 1MHXA 2PKOA 1G291 2Q8RE 2QSDA 3AU7A 2INNE 3HVZA 1R9TB 4ZHOA 1BF4A 2Y5CA 1IGCA 1MVKA 1HFGA 3LXFA 4B9XA 1FR3A 1OXSC 1V97A 4G4KA 4N58A 3GP7A 3NE5B 4OIKA 4IUUA 3SVMA 2Q8TA 4NMZA 2L83A 4XDXA 4KN7C 3RUZA 1J7AA 2CW0C 1BCPC 2Y0SB 1CZPA 1J9OA 1PZJD 1W6KA 3GS2A 3BG3A 2JEAI 2CW0D 4RWSC 4HKQA 3JAME 1WWTA 2ONQA 2E3TA 1U4RA 1H9SB 3BVZA 2ACZB 5IGGA 3ZQ4A 2F0DA 3PUYA 1XCQL 4IURA 2OHFA 4C1NK 2DN8A 2K5QA 2M0AA 1EFID 1ZXTA 1OQQA 3MC0B 2VZKB 1S5DD 3RPFC 3IAS1 2EYLA 5FKAC 3H09A 2JXTA 1EIHA 4ZYSA 3TSSA 4K5XA 3I70A 5EQ0A 3FAHA 2F3VA 1EY7A 4IN3A 4RFBA 5EPJA 2JA5B 4XTCS 3TP7A 2JYEA 1IL8A 3URYA 2WNMA 1Y56A 3NTHA 1ZDXA 2DY7A 1KAAA 2MH7A 1T5EA 1HFNA 4RA8A 2SDFA 5C5LA 3ZJUA 1DOIA 2X69A 4H0LC 2B2YA 4RGOS 4PMBA 3KWLA 2F03A 2HTME 1B53A 3NP8A 2JQRB 3K0YA 1DOXA 1IW7D 4F8MA 3KLSA 1GUOA 4JWUC 3K59A 1E0ZA 3J81L 2IGGA 1SDFA 4J6HA 4JBWA 5C0XH 4NJCA 4OZAA 3SFEB 3TEZA 4WQMA 1SFOB 2A69D 1C4AA 3EUB2 2MHVA 3P4RB 1ZEQX 3H94A 1QQRA 1GHKA 4C7YA 4FXKC 1I50B 1I3QB 2F0WA 2F0HA 2FBWB 2FJ2A 4AYBB 1TYGB 3S9WA 2WXLA 1RF2D 2Z4IA 3GTQB 2PZTA 5EBDA 4K2KA 2AWOA 1VLBA 3P63A 1OXUA 2Q5WD 5ELCA 2XWJB 3K7AB 2HUGA 2IX3A 1TKEA 4R3DA 4DXFA 1TWHB 3NTKA 2W54A 1QF6A 3EJIA 4DN4M 1F2RC 2VZKD 2IPKD 1F2MA 2PIAA 4TQ1A 5J22A 2EYPA 5A2QL 3W1SA 3QO2A 1SMYD 3D6CA 2EE1A 1EZ6A 2K7VA 1OO9B 2FINB 1EYAA 1JR0D 2N0SB 1PTOF 3AE5B 1W6JA 3AM9A 3A7LA 1WYGA 4LTUA 3W9CB 4F88A 3A7AB 2KECA 2V4DA 1F0ZA 1EOTA 3FVQA 3MP9A 2WXPA 1D5ZC 2BB6A 2W3RA 4HAEA 3F2UA 3DUZA 4HKZE 1TS3A 3C1EA 3OOCA 4TSSA 5HI1A 1Q1EA 2JA6B 2KWDA 1I6HB 5CV4A 2WXQA 4NAWB 3QB3A 5C4ZA 3TDQA 1IBXB 4FVMA 4J1MA 5AFWA 1UWXA 4HSVA 1F9QA 5J39A 5I6YA 2DNEA 2C5CA 1QG7A 4A9AA 1O7YA 1D5XC 4HEDA 4YIJA 3GTLB 4HROA 5D3IB 1MHHE 3SK6A 5IT9L 2W55A 1F2RI 3X3MA 3HOWB 2G9DA 4RF0A 4HTHA 2N9KA 1UEAB 3TP5A 1NCVA 2RMMA 3HZXA 2L12A 2ZXPA 3HP3A 1L0YB 5LL6S 3ZGZA 3KQ4A 1LTID 2F0EA 3IT6B 3P4QB 3V2TA 4XT1B 1SBBB 4R8IA 3BYYB 1JICA 3AMZA 4RGTA 1PFDA 1L4ZB 4RCOA 1PTOH 5BYSA 2PMVA 4OIJA 2OEDA 2NVTB 5C6AA 4ZRZA 1SNOA 1GUNA 1LABA 2WU2B 5EE0A 1S4ZA 5IIFA 3S17B 4FO2A 1V1OA 4C80A 4DU9A 4C3IB 1Y8PB 1E2WA 4BY7B 2RBMA 1M4VA 2MJ8A 2LKVA 2MPMA 5CV9A 1N5WA 2J53A 1SYDA 1JQ4A 1HHVA 2MUYA 2AX5A 1WCMB 1STHA 3D6WA 1QOHA 1DGJA 1S5BD 1OQRA 3FILB 4L8JA 5HGTA 4R9WA 5E6JA 1EY4A 2K0PA 1IKLA 1J8IA 5LNK1 3AE9B 1IKMA 1MI2A 4XQJA 1T3QA 3LWEA 2WXNA 1VF7A 1AYFA 1U4PA 3HGBA 3M3YB 3MZ5A 3NBHA 1V1PB 2EELA 4H13C 4XDDA 1GJXA 1XWEA 2XVSA 3Q6SA 5KIXA 5JPMC 4WRDA 3RZDB 4IUNA 3SDZA 2LY7A 3CU7A 2INPE 1SJED 3HRDD 3HOZB 2BCOA 1EYDA 5BN3A 2B39A 5ELDA 5C4HA 3JAML 5EGTA 4OZBA 5C4XB 3BK2A 4I7ZC 1K51A 1E7PB 2YYZA 1LT4D 2WKCA 4H44C 4UDUC 4A3IB 5F2DA 1MI0A 1HEZE 1GUSA 3VRAB 4XT3B 1SYBA 3ABVB 4ID6A 4USAA 3FMCA 3NWTA 4XIGS 5ISRA 1IYVA 2OXPA 4TQUS 2A6HD 1PMRA 3AE8B 1CK1A 2EZVA 4NP5A 1JWUD 2EY5A 3AE1B 4KK7A 1E0BA 5BN4A 1AEXA 2X6LA 1VMPA 2O5JC 4KY7A 4J3OD 4XDCA 2K5WA 2KEEA 2N55A 3AB9A 3VYTA 1WTPA 2HCIA 3Q24A 5FO7B 4H2AA 3UI2A 1WSPA 4BA2I 3PUXA 3U7ZA 4P16A 5EKIA 2EJGC 2LUMA 2R3ZA 1FNVA 3J7AF 4CKCA 2YU9B 3J9CA 2JU6X 1EEFD 1WGKA 4K8JA 4KKJA 1BDOA 1N63A 3PV0A 2NYZD 3OWEB 3CWIA 1FD6A 1HTLD 1NYQA 3E9SA 4LAAA 2PW9A 1B3AA 4A3MB 3PUZA 4X3KA 4RAUC 4WH4A 5CV5A 4PMCA 4V0BA 4UAIA 4A3FB 2MJDA 1VF5C 1I4QA 4XXEA 1PZKD 4CBVA 4HJGE 4LK1C 3HVDA 1RKNA 5H8YE 1EY5A 1E9MA 3SR6A 4IFDG 1MPEA 2E2DC 3HOUB 2E74C 4RCNA 2F0MA 2EY2A 4WORA 1BQQT 4U673 1PFMA 1LT6D 1CT1D 4OO1H 4B0MA 3T16A 4MH8A 5CBEE 4ZRQA 2NTTA 1Q1BA 2AQ2B 4KY6A 3J7YW 2HDMA 1G2TA 1R4QB 3GB1A 4HCSA 4DQOC 4TKOB 5G3LF 3TBIB 5COYA 2K03A 3Q23A 2LEKA 2HDEA 4J8QA 2NTSA 2O2LD 2Z1CA 5M5YB 3AH7A 2ON8A 3EQLC 2L52A 5IGBA 2V3PA 1JWAD 1ENCA 3M4OB 2N9LA 1LTGD 2EJFC 1B44D 2WDQB 1BUIC 3BK1A 4DXGA 2WXRA 3DWQA 3NHHA 1EWYC 3VA7A 2WDVB 2PW7A 1YMHE 3GTJB 4LJZC 2WXJA 1O7ZA 3P1HA 3P20A 1VZ6A 2WXMA 4FYDA 4BS9A 5LL6X 4KKIA 1OXTA 2PZUA 2Z8LA 1ZP0B 3U52E 4E6IA 5C0XI 2LJIA 4XWWA 1BXTA 2M00A 5M3MB 2XIWA 1XX8A 3H6MA 1HUMA 4LK0M 1ML0D 1TS2A 1JWBD 1I4PA 1G2SA 1STAA 4C2MB 3C1FA 2R6GA 3NPPA 2EKIA 3ERQA 4FXDA 3K5MA 1PDXA 2WXKA 1RHPA 2JSVX 5C3JB 3T3OA 1ESRA 4K5VA 2BS4B 5C4JB 3PZ8A 2X6GA 2L0CA 3GO5A 3QG1A 3VR5A 2PW5A 2BW2A 2VNUD 2YEPF 3NZ3A 3DEPA 1PFNA 2R7ZB 3L4PA 3SK4A 5EPKA 4KHZA 4FF1A 4ZQ3A 3DWMA 4IUVA 4Q2JA 4TMAB 3MA2B 2QDBA 2B2TA 4DGZA 4KGSA 1GOZA 3IKJA 4A3KB 5T8IA 2IX0A 5BN5A 1EQVA 3GTPB 4YT0B 2CVRA 1D1IA 2PQEA 4N9PA 3M85A 2KA7A 4GDLB 1IW7C 1I6VC 1BR9A 3OSOA 1WRIA 5CV8A 5JEAJ 5FR3A 1AW7A 1DD2A 1YNTE 3W5VB 4JX1C 5EBCA 5NUCA 4D2KA 3NQTA 1HQMC 4ZRPA 1F2ZA 1H9MA 4LLGM 5C44B 1NAPA 2ZW0A 2JA7B 1Q3LA 3UI3A 3I4NB 4PNYA 1STBA 3U4EG 1NI3A 3B2FA 1HUNA 2EYJA 3NTIA 2NZ1D 5J1ZA 2J42A 2BDNA 2QF7A 4EQPA 1I4XA 2E2IB 1C77A 4A3EB 1MBYA 3U9OA 2F0KA 2KJXA 2K04A 3J81E 3CHBD 4IALA 3CQZB 5K36G 1QWYA 2F0IA 3ZJVA 3TEWA 1IGDA 3GQBA 1Q12A 2LMCB 1ZUD2 2M9VA 2L4NA 2O5IC 2SAKA 1STNA 1FNUA 5EE9A 2B8GA 4C3JG 2K33A 2WINB 1LTBD 1KNAA 1Q10A 4KTAA 2AUJD 2JYOA 3QOLA 1XLOA 1F2YA 2EOTA 2QIEB 4AS1A 1C48A 4DNTB 1AZQA 4ILWA 1JC7A 4PV1C 1JWMD 1AWDA 1EWCA 2KAJA 4M8AA 3L7ZC 3AN1A 5JXVA 1XLQA 1TVXA 1FRDA 2D5DA 4C7ZA 1EU3A 1FXIA 4PQXA 3T51B 5DM63 2JX5A 3GTKB 4CKEA 1O80A 2XRSD 4QB4A 2K5DA 4N9TA 2IJ0A 2JYTA 5AUKA 1L5PA 2AWNA 1CI3M 3DXJC 3A8IE 4US9A 1HQRD 3ZJTA 3K58A 4BA1I 2FMMA 3S14B 1B9NA 2B2YC 3SFDB 1SF0A 4KV6A 1AP0A 1U9RA 1HZ6A 2G9HD 3WOFA 1WTQA 5EJWA 1RM6C 2BB5A 1LTRD 1CQVA 1F2LA 2DYMA 5D14A 3PIP3 4ZKBB 3G6JB 4CJ0B 3R2IA 1HTPA 2JP1A 3D3RA 2JEBI 4ULLA 3WDNA 4RGNA 2WAQB 2MJ3A 3H8HA 1XO3A 2EYFA 4TQ0A 1FGBD 4RKLA 3GTOB 5I2XA 2IDYA 4KI0A 1EY6A 1JMLA 1LT5D 4P6VF 3FILA 2RDFA 1TWAB 1F9PA 2PZWA 1WTOA 5KEEA 4CGYB 1XF5L 2M56B 5D3DA 4CKBA 2PTLA 1STEA 3Q8AA 2SOBA 2EY1A 4YXDB 2KVMA 1DOKA 1L0XB 4FXCA 3AEFB 3H0GB 3RLFA 2TMPA 1LV9A 3IAM1 2F0LA 2AQ1B 3TN2A 4X3SA 4IZ8A 2PVOD 3KF8A 4FF4A 4OZCA 2CJNA 2NB0A 3SHLA 2K6AA 1JRPA 2I46A 3S2HB 1BOSA 2WXOA 4N59A 2WACA 3QIAA 3SXHA 1JORA 2DY8A 1XXGA 5TSSA 2VXWA 2YEPB 1YQ4B 2AQ3B 1NR4A 3DWGC 1SXTA 1PTOD 1DZ1A 4F7XA 1WD1A 4ME5A 1IUEA 1D6EC 1CHPD 1PGAA 1BCPD 1JCKB 1QLBB 4OO1G 3H91A 2CJOA 1KDBA 3MXNA 5T1IA 1JROA 3GD7A 4WFN3 3IFTA 2BTEA 3D4DA 3KK7A 1TIID 1PLFA 2JWUA 4XYOA 2MP1A 5KNCA 3T53B 3HEJA 1HPCA 2K1BA 4DF7A 1JOOA 5JEAH 4JPSA 2E75C 2ZW1A 1RFKA 4B08A 2DYOA 3NVWA 1B9RA 4BY1B 1D1KA 2XRQD 4KX6B 4HRSA 2LHEA 3X3NA 2SEBD 3NUHB 5CV6A 1STGA 3QOJA 2A68D 4G57A 4FF3A 2FUG1 4WJWA 5KGUA 2N7JA 1JQYD 2BYTA 3MWYW 3MHZA 4A6QA 3S15B 4MIUA 1SE3A 1KDAA 1XEEA 2CQAA 2IL8A 1PUTA 1Z47A 3I3CA 3R3OA 1RTOA 1RDPD 4QUFA 1WTWA 3AEGB 4BBRB 1QNUA 2QCPX 4EVOA 1FFUA 1QT9A 1SNQA