1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
b'ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1LTGD 4L63B 1I4HA 3BZDB 1I4GA 4L6TB 1YN4A 1HQRD 3DWPA 1BCPB 1EU4A 2XRSD 1BCPD 3KLSX 1I4PA 5ELEA 1BXTA 1M4VA 1PTOB 1RF2D 2XRQD 1FGBD 1MD2D 1XXGA 1PTOD 1PZKD 1TS4A 3MC0B 2G9HD 1S5CD 1V1OA 1LTID 1ENFA 1GOZA 4TSSA 1XTCD 1CQVA 1ESFA 1RD9D 3R2TA 1LT4D 1PRTB 1HTLD 5FKAC 1T5XD 2RDGA 5TSSA 1HA5A 1PRTD 4RGMA 3TSSA 2NTSA 2IJ0A 1SE3A 1EEFD 1KTKA 1STEA 1AN8A 1B1ZA 2O2LD 4RCOA 1S5BD 1V1PB 5ELDA 1CHQD 1S5DD 1ET9A 1D5XC 4Z9CB 1YN5A 1SE4A 1SJED 1RCVD 1RDPD 1G8ZD 2AQ1B 2RDHA 1PZID 1BCPF 3MFGA 4C56C 1SXTA 1V1PA 5ELFA 1FNVA 1HXYD 3BVGA 1EEID 1S5ED 2J4XA 1PTOH 5FK9C 4RGOS 1PTOF 4RGNA 1FNUA 1I4XA 1CHPD 5ELBA 3R2IA 1TY0A 1ET6A 1BCPC 4DXFA 1L0YB 1LT3D 2CHBD 2SEBD 2ICIA 1LLRD 1L0XB 1D5ZC 1QILA 1JWUD 1PRTF 3CHBD 1LTRD 1EU3A 4DXGA 1PYWD 4K6LA 1PTOC 4BWGB 1S5FD 1PZJD 2IPKD 1YN3A 1JWSD 1UUPA 4ZYSA 1LO5D 2XN9C 4RGTA 1D6EC 1B44D 1KLUD 1LTBD 1UNSA 3DWQA 4UDUC 5I4DA 1SEBD 5D3IB 2NTTA 1SE2A 1KLGD 4NZLB 5D3DA 1AW7A 2QEJC 4RH6A 1CT1D 3O13A 1LT6D 4OHJA 1SBBB 3GP7A 1LT5D 1TS3A 1SJHD 1LTTD 1LTSD 1JR0D 3EA6A 2TSSA 1FD7D 3BYYB 1JQYD 2R61A 1JWMD 3W2DA 4RHRA 1TS5A 1LTAD 5ELCA 3OWEB 1TY2A 3BYTB 2Z8LA 1FNWA 2XNAC 4RFBA 1EWCA 3URYA 3V05A 1DJRD 1F77A 2QILA 3BVMA 4O1NA 3SEBA 4RHSA 1PRTC 1TS2A 1JCKB 1DYQA 3DWAA 2AQ3B 1CK1A 2WV6D 3EFXD 1D5MC 3BVZA 1EFID 1I4QA 2AQ2B 3R8BA 1I4RA
chains in the Genus database with same CATH superfamily
3PIPA 2MH7A 3GTLH 3R7QA 4UY8C 2F0EA 2BOSA 4S0RA 3ZDTA 3KLSX 2OTJA 4AYBG 1QVGA 2RBMA 2KKCA 3D6WA 2D3GA 5C0XI 1KL9A 1BXTA 2H4OA 4TMAB 2F3IA 5HGQA 4DV4L 2EKIA 1BNZA 3TP6A 2K52A 2KWUB 2QSDA 4ZRJA 2Y0SB 4YCWA 4G7HC 3ZRFA 3Q8EA 1KDCA 4A3GH 4A3DB 1PH3A 3NZ3A 2JWZA 5IP7H 5LNK1 1VF5C 3G4SA 5JVG3 3P4PB 3Q8BA 4ZHOA 4P74A 3A7AB 1EWHA 2ZJRA 1SE9A 2FMCA 2AL6A 3MHZA 3MTSA 1IBKQ 1HFGA 1X65A 3CMEA 4BY1H 3T9LA 4OO1I 1LGRA 2QEXA 1IBML 1ESRA 3J81E 2N4FA 5CV8A 1YOVB 2CR5A 4IM0A 2WS3B 4GDLB 1F9QA 3L54A 3HOVB 4ZRQA 4A3IH 1WZ3A 3RPFC 2M4NA 1ET9A 3S16B 3TDQA 3FPUB 3U7ZA 1BDOA 1Y69U 1HUMA 1KC8C 2K5WA 3I56A 3NG0A 5JEAJ 4MTKA 1RDPD 3JW0X 3CIRB 1IL8A 1G8ZD 3T56B 3APDA 2FJ2A 3QB3A 2PPBC 3LB8C 4MH8A 5D94A 3RULA 4BOZB 3ER0A 4YCVA 3APCA 2F0GA 1Z47A 3H0GG 5HI1A 1U4LA 2MBOA 4RCNA 2VQFL 1L6UA 3K9PB 1KABA 2XWJB 1QQRA 2FCNA 3N30A 4DDID 1TY0A 4K8IA 1ET6A 4XIGS 2K1BA 1F1HA 3PV0A 1R9TB 2K0PA 3LDZE 1C4QA 3RLOA 1PTOC 3ND9A 3AU4A 2JA8B 1FR3A 5BN3A 1EL0A 2BBCA 2A6HD 1OXTA 1XNRL 1JORA 4ARCA 2D0OA 2GOWA 4TQ0A 3HK0A 2R7FA 4US8A 1XLQA 4GDLA 3PT2B 4RM9A 1KLUD 1Y1VB 1UNSA 4JI7L 4BKSD 1WXVA 3CCJA 4A3LH 1MSHA 2LHEA 1SE2A 4JVZA 1SMYD 2LXKA 4RH6A 4A3PA 3PUWA 3BU2A 1X9NA 2GBKA 4JOIC 3S1MB 3OW7A 4KLKA 3HOYH 1YJWA 4JI1L 1S4ZA 3ULPA 3HOZH 3AEBB 2H1EA 2PKOA 3SK8A 5BR8L 3R66C 1NR4A 1OXXK 1TWGB 3Q24A 2CHZA 1TS5A 1MJEA 1NUCA 3K7UC 5EQ0A 3I4NB 1CA5A 3KLRA 4GXBA 3E56A 2DAFA 3I9V1 3NOBA 3HKZG 4BA2I 4KGRA 4J1MA 1EWYC 1VRAB 2E2HH 4HDQA 1E24A 1E5WA 3VAWA 2PZWA 4FHJA 2B2TA 4RA8A 3V6EB 2PE6B 5LXHA 2NUCA 4H0LC 2AUKA 5IO9A 4H7BA 2EY6A 1FM0D 3AFPA 4DK0A 3MHSD 2O6VD 3EN2A 4L5QA 1G6PA 4HJGE 3J7AF 3L4PA 4DV1L 2MO0A 3DHIC 1EFID 4BKSA 4A3KG 1I7HA 4GOPC 4IW0A 2KCMA 1XLPA 4KHZA 2NVXB 1WX7A 4W9IA 4BOSC 3TZUA 2B2VA 2JQRB 2NPTB 1N9WA 4C3JH 2EMTA 1QOAA 3N1XC 4LFCQ 2A68C 3S14B 2V1YA 3DBRB 4KKIA 1KD1C 4B3SQ 1TWCH 2LY7A 4A75A 1C4CA 2D3BA 3K7AB 1V1QA 3E3XA 1IBXA 1EYCA 1WXSA 1JRUA 1A3TA 1LTLA 3IAYA 2XIWA 5EBDA 3DM1A 1DGJA 4G50A 4M0WB 2KDFB 1HR0W 5M5YB 3R2TA 1WM2A 2UUAQ 4NAWB 5C4JB 3VQIA 2L1BA 3FDTA 3KFUA 3QA8A 2DJGC 1WGGA 2K9XA 1N32L 1KOTA 2V1CC 4AS1A 1EEFD 1DM0B 3G6EA 1NBWA 1X1MA 3I90A 1ASZA 4K7UA 2M0XA 2NN6G 3HOUH 5C3EB 2O6VA 1TTNA 1Y8NB 2EXDA 1SNOA 1FJGQ 1V86A 1LM8B 3DBLI 3JC66 2FUHB 1ENAA 1L1OC 3ZNGC 1UEAB 1HZ5A 3ABVB 1WE7A 3B2GA 3ZNHB 4YSYB 2NPTA 4DR2L 5DPTA 2VL6A 5KRUA 2B3GA 4DUYQ 3ZO5B 1VQKA 4YL8A 2WU2B 5C4XH 5AZGA 5FK9C 2EELA 4RGNA 1IBLL 1JWAD 2B2UA 3E9SA 1WCMB 1EF5A 3QK0A 2MSED 1QB5D 1Y8OB 1RIPA 4BA1I 4QF4A 2Z6KA 1X32A 1YJNA 4HJAA 3A1QB 1JWUD 4Y7NB 2LGYA 1VQEA 4C3IH 1H9MA 2YEPB 1KF6B 1MI0A 3P2BA 4RMAA 2KQ7A 5NUCA 4DR5L 3CQZH 3H91A 1STYA 5EPLA 3NP8A 4L5TA 1HA6A 1YMHE 2D5DA 1GUSA 2JRIB 4ZLTF 1VQLA 1FRDA 3SDLC 3KOJA 4RGTA 1EY8A 4Q2JA 3K7AH 4OXPA 4UDUC 4GN1A 2W9NA 2NTTA 2AMCB 3NSWA 2DLBA 2HQEA 5EKLA 4C3HB 4K5XA 3E0EA 1YNND 3HOXH 2Y3AA 4RKLA 3B08A 4HIMA 2FIDA 2KAJA 2JA6H 1SDFA 2WINB 5FR6A 4DR1Q 5EE9A 3QAQA 2VUMB 5GMVA 4LF6L 2K14A 1E3PA 3TMPB 1MHWC 1LTAD 1EZ6A 3JAME 5C44B 5M3MH 3S2DH 3S1QH 3NEMA 1R4QB 3K8AA 5M5WB 1KLVA 1JE5A 3GQBA 1EWCA 3NVWA 5BO4B 3P63A 1X3FA 3FRPB 4DV6Q 2F4IA 3RNGC 4HJ5A 3SK5A 1LFDA 2F0NA 2JZ3B 4TRDA 3PO3H 4DU9A 2YTVA 1WX8A 2QCZA 1N62A 4KKJA 4PG3A 1CSQA 4DV0Q 2CW0C 1PQSA 2FFKB 3MXUA 2JXXA 2HHHQ 1E6EB 1VQAA 3LWEA 4WH4A 1EYDA 5JOBA 3DPDA 4JV5L 3OTOL 4P72A 1HNXL 1I6HB 1VZ7A 1ZKHA 3SK6A 1LM0A 2A69D 1STGA 1W3SA 3U4ZA 1YX6B 4B3RL 3PREA 4A9AA 4BXXG 1ROEA 4E6IA 4BBSH 3T1HQ 4DUZQ 2Q8TA 1GJZA 2I5MX 1Y1WB 2RHSB 1SF0A 4Y7NH 2E5LL 2K5VA 1MGSA 2L9HA 2M9VA 4HPLB 4LJZC 4G57A 4GMVA 4R4TA 4J8QA 1TIID 4ARIA 1V5TA 1A5RA 2CS4A 1GKHA 4A3CG 1K8MA 2MNAA 2UUCL 3Q3NC 4OWWB 1KQSA 4KV6A 2YLMA 3GTPB 1WJ4A 4BBRG 2N7EA 4EZLA 2IJ0A 4N8X1 2BT6A 1UWXA 5C0XJ 1XWEA 4HMIA 1P7FA 3J7ZC 4YCUA 3HOVG 4P16A 3U58A 1FGUA 2VY3A 1TWHH 3HM6X 1SNQA 4WWOA 1KH0A 1WGDA 2D07B 1YX5B 4LWCA 2I0QA 2DAJA 1V1PA 1SYCA 4OEMB 1EEID 2LUEA 4DKAC 2P5ZX 3BDLA 4FHKA 3M4QA 1V80A 3DBHI 4M00A 4WURA 5AFWA 4IFDI 2D10A 1E0ZA 1PTOF 1YITA 2DHZA 2J7QB 4IOAA 2M8SA 3V96A 4XXEA 2D2CC 1K51A 1HE8A 1RTOA 3CCLA 1DOXA 1KAWA 3DHHC 1QILA 5L37A 2PIAA 3GTJH 3ZQ4A 1V49A 2N9XA 2EYHA 4AWJA 3I73A 4NPNA 4GOCA 2UU7A 3RNEC 1T0QC 5KNBA 2F0SA 1A2TA 2VRRB 4P1BC 4URKA 1SR3A 3FAHA 2XSCA 4GKKL 1W6JA 3CCQA 1G51A 1O7IA 2KC1A 1SFOB 4R4QA 2E2IB 2LGIA 4K81A 5JPNC 4TUUA 2R92H 1E8YA 4XC2A 1SRUA 1MIUA 1WTPA 1I35A 1VMPA 2JP1A 1P9DU 2ACZB 3AE4B 4K6DA 4ZRZA 3HRZC 4KZ0A 4IUQA 2E75C 1TZ1A 2K8BA 4W9KA 1AZQA 4LF5L 1IYUA 2L00B 3MC8A 3PRZA 1B3QA 3KLWA 3RT3B 2UXDL 4NY0A 4EQOA 1R4MI 1GHJA 2K6AA 1OXUA 2KANA 3LWUA 1A3UA 3T13A 2JRHA 3EUB2 1Q12A 3U30A 1GAQB 2K05A 4M8NA 5G5HA 4K0KL 1MBYA 3ONSA 1BKBA 4RAUC 2B39A 3ETRA 4NJ7A 3DEOA 1O7LA 1VQ9A 4GIVA 3VHTC 3ZIMA 4A3EB 4ZAIA 4FF2A 5HHDG 3J7A5 3FKIB 3WALA 2D5GA 3KJOA 2IX0A 2ZNVC 1XO3A 5DAUA 4MJSA 2OTLA 2DNEA 2V9HA 3ECIA 1JT8A 2NVQB 4QY7A 4A3FB 5DPWA 2DYMA 2L76A 1E1OA 3KDFB 5EJWA 2KCTA 3DVGX 5EE1A 1HEZE 4MSQB 1J7BA 3UINB 3SK4A 2CH4A 2PZUA 1E10A 1QVCA 4ZUIA 3KYHC 3K58A 4JBMA 4FYDA 1GUWA 1N33Q 1MHXA 2R7ZB 2DZIA 2JXTA 1DZ1A 1HFNA 1D2BA 1HR0L 4RWSC 1T0YA 1V8CA 1WR6E 5IAAC 1RF2D 4WFN3 1UBQA 1PZKD 1JJCB 5K5PA 3AEFB 3M63B 2JX5A 3ZJVA 2L83A 3EIVA 3ZKJC 4BBNF 4P71A 3AFQA 1WTOA 1SIJA 2GI9A 2IDYA 5DNFA 2BB5A 2HTHA 4IWOA 4RGMA 2WP9B 5GROA 4BFRA 5ELOA 1FCLA 2K5DA 2WDVB 3ERQA 1CKNB 1KTKA 1U4PA 3ZGZA 1VZ8A 5JJLA 3RLNA 3QIJA 5KNDA 3R3MA 2CQAA 3DHQA 5FLXc 1D5XC 1C79A 1PGXA 1FIQA 1AH9A 1D1KA 3WWVA 1L4DB 1WJNA 2Y5CA 2ZCBA 3KDFA 2PNRC 3IRBA 3C0RB 2A68D 2JK8A 4JOIA 4R8NA 4DR7Q 2K5PA 3AM9A 1PH4A 4X62Q 1E0BA 2F4VL 3U9OA 4P7IA 4JPBW 3M7GA 1PTOH 4DHZE 1JRPA 1F2RC 3NPPA 2ZT9C 2A6ED 3H6MA 5C4ZA 4DFAA 3ENEA 2RHQB 1KDBA 3OJ4B 2K6DB 3A8IE 1WCMG 2EZVA 2HJ8A 3M3YH 1M8AA 5LLIA 2MBBB 3QQ8B 4O2DA 3VXWA 1EQQA 4QUCA 2C35B 3IT6B 1EU3A 1SNMA 3NBHB 2KHJA 1DGSA 4V0BA 4H44C 2M2LA 5FLMG 4KV2A 1ZDVA 4GN5A 2RCFA 3HGBA 4AQYQ 1B50A 3OIPA 1M1KC 3HKSA 3KF8A 4PQXA 1Q46A 1X3PA 3H9DA 1EO6A 2R7ZH 4A3JB 4GOPA 4A3MG 1YZ6A 3TP5A 1C7YA 1E8WA 1YNTE 3L2PA 1NI3A 2A5UA 2Y0SE 2DY8A 2F52A 1STBA 1E22A 3P4SB 4N6EB 3WAPA 4OHJA 5EGTA 1QUQB 1RTNA 3IL8A 4F87A 1SNPA 3DBRI 4RG1A 1WIAA 1TS3A 3H3VC 4C4VB 3K5LA 4NKLA 3EA6A 3EHVA 5CHWA 1V43A 3PUXA 3M4YA 2KQSA 1J9OA 5CR3A 2JA5H 4JWSC 4B6WA 3EC8A 2KN4A 2QF7A 5M3FB 4XDCA 2RGFA 2KMCA 2MCNB 4ID6A 2K5NA 5J22A 1PGBA 1RLFA 5JXVA 3BVMA 5FJ8G 4MGKE 4A3BG 1IP9A 2Z9HA 4DV4Q 4ZYNA 4HIOA 1VQFA 5IOIA 4K2LA 3B6YA 5CBAE 4JI8Q 3VA7A 4PMBA 4KSLC 4GNXC 3ITPA 1XCQL 3NENA 3ONAB 1L1OA 1R4NB 3RCZA 3C2PA 2AX5A 2GRIA 3MP9A 3NY5A 3VTWA 1L0VB 3K6OA 2K5QA 3GTQB 1HQRD 4NXNQ 1IBMQ 3E0JA 1O78A 3AU5A 1J6QA 4G11A 4LFAQ 3VA5A 4BKTA 4DR3L 1R4PB 2KN5A 1QUQA 4KHPQ 2QDLA 2DYOA 5AJ3Q 4R4IA 1Y1WG 1P7EA 4CKEA 1WRDB 3J7AV 1QVFA 4J15A 1FXAA 3STBC 2HJ1A 2N9PC 3S2HH 4AJYB 4DV7Q 3S9WA 2DZMA 1YHQA 3CSTA 5E6PA 1DOIA 3TCAA 1CA6A 1KFYB 4W9LA 2KFJA 2K33A 3M4OB 2B76B 1XTCD 2BB6A 5FKAC 1DXMA 1GG3A 1PDQA 1SLJA 2EYLA 2MX2A 3GO5A 2ZTDA 5AZFA 5HURA 4F8MA 1NVID 1L6VA 1WZ0A 4ZCKA 3RN9C 4HCEA 1TT5B 2CW0D 1FCCC 1FRRA 3SE0A 2O5IC 1OQQA 1WE6A 1Q8IA 2O2LD 2Q2TA 2J52A 1JMCA 2PLPA 1QOFA 2WXJA 2A1AA 3DVGY 1QNUA 2AQ1B 1IYJB 4LMQD 2CWPA 3MFGA 5LMUL 1XNRQ 4DR6L 3VH3B 3PSIA 4XYOA 1JROA 3DQVA 4GDKA 2ZM6Q 4LUVA 3GE3C 3A8JE 4J6IA 2F0LA 4UPAA 3T1YQ 3NZSA 3P7JA 1FNUA 3H0GH 3ML8A 3J81i 2JA7G 3K59A 1H9SB 4PMCA 3TEHB 5F2DA 3AMZA 3NJTA 3T3OA 1L0YB 4X6AH 2R93G 3HVZA 5J3BA 3ZVVA 4F7ZA 2FCMA 1GUGA 2VS1A 4DNIA 5G3LF 2F3VA 5JAVA 5BR8Q 4P73A 3AMUA 4IUVA 4JWUC 2KQ3A 1EY7A 1BVSA 2M19A 4IC7B 4DV3L 4IFDJ 1JWSD 4GSWA 2RD0A 5K36G 1SSOA 2ZPNA 1RM6C 3IKJA 3Q8DA 4AP4C 2L4NA 2KCCA 4US9A 2ZXOA 2CJNA 3VYRA 3MC9A 1G2TA 4PK1A 3UDFA 2B63B 2N1VA 3AE6B 1ILQA 2XK5B 1IGDA 1Y14B 1LT6D 2XVSA 3VR2A 3J80L 1ZOYB 2ZW0A 4EUTA 1KNEA 1LUZA 3L3OC 3GTLB 1YQ4B 2C7HA 2PYKA 3M4OH 5EPJA 1ACCA 3W5OA 5EE3A 3BYYB 4A4IA 3LX0A 4DV1Q 3PF5A 1ZKOA 4RHRA 1RFAA 1IHZA 3VRAB 4R4CA 2K1FA 5AUIA 1BBUA 1FEHA 2BCOA 4RMFA 4A3GB 4OO1G 1WFQA 4LNFA 1Z6HA 4DAMA 3A0JA 2F03A 2NBFA 3CC2A 1L5PA 1ZP0B 5FO9B 4U673 1H8CA 2HDLA 1S72A 3GZNB 5GAHC 5CV9A 4BY1B 4NNJB 5D65A 1EY9A 2KDEB 4IOCA 1MFWA 1B4OA 3T4AC 4F88A 1SYDA 4A3IB 4B9XA 1GB4A 3DM3A 2EMSA 4FXGC 4A3KH 1XEEA 4IALA 1N32Q 4NW2A 2WXQA 2Q2UA 4LF4L 3PCOB 2YTYA 1YQ3B 1WD0A 3SDZA 4JK1C 2KZRA 4ANVA 4DHZB 2D3CA 3ZJYC 2KENA 3MC0B 2RVLA 1B8AA 1I5FA 2BKFA 1ICFB 2CH4W 3UF8A 1SYFA 2BYFA 4DR2Q 2M1MA 2CFMA 1SAPA 4FADA 2G5DA 2EJGC 4LNOA 3G6JB 4UAIA 1TQOA 1HA5A 1E2WA 4S17A 1IBLQ 2HIXA 3FILA 4B3TQ 1KAAA 4NXML 5E4XA 2KDBA 3VR5A 1AN8A 4MHEA 2E3TA 3VYTA 5M5XH 1B70B 1GVPA 2KOXA 3S24A 1B3AA 2L52A 2VNUD 1L7YA 4LUOA 2NN6H 1JB3A 3C19A 5COYA 1SB3C 4YTPB 1GPXA 4YHHL 2KWCA 2BS2B 4FXCA 1ZE3D 4DR5Q 2ZCCA 1VQDA 2OEOA 4FBJB 5ELNA 2A8VA 4ZQ3A 3SFEB 3CC4A 2H88B 3TS0A 1H95A 3KLSA 3RZFA 1NY4A 2QDFA 3HOYB 3DVNU 3JAMc 2WAQE 4W9EA 3HOZB 5IGDA 3PGEA 4OGQC 4LF9L 3AB5A 2LGXA 4JI6Q 3DBSA 3AEEB 2L05A 3WAMA 2O4XA 2SEBD 3GV6A 3RUZA 1HNZQ 1VJKA 1FD6A 4B08A 2WB1B 1DOYA 2N7JA 5AUKA 4J6HA 1TWFH 3PTFC 4IPCA 3S17H 4N59A 4KI0A 2WIIB 4CYEA 2E2HB 2LEKA 3RUIB 1YIWA 5JVH3 1PH2A 2W82A 3L0WB 1IXRA 3IAM1 3PIO3 1LO5D 1UF0A 3KF6A 3CU7A 4XT3B 2L11A 4JYAL 1NYQA 3CCVA 1FYCA 2LHDA 4NZLB 3K5NA 4JGHB 4MH0E 1J8CA 3OMGA 1EYAA 1N8RC 1Q1BA 2HDMA 2VQEQ 4B3MQ 1UGJA 3NTKA 5I6WA 1C4PA 1SBBB 3GP7A 4C3JB 2CJOA 1VQ4A 3ZW3A 1TWCB 4LDTB 1HHVA 3QOLA 4LDTD 4JV5Q 1DCZA 1JWMD 3OTOQ 1AFPA 2GVBA 4ZUJA 5CORA 2KFKB 4EOYA 2WXGA 3AEGB 4HLEA 4B3RQ 1EIYB 2PCFB 4U68A 4I7AA 1GD7A 3N1YC 3URYA 3V05A 4A93G 2DWQA 1DOKA 4R9WA 1XQQA 1DJRD 2JY6A 1C76A 1Z2MA 2E5LQ 3DVNV 1TKGA 5LL6X 3OOCA 2IGDA 4XZ4A 2Z4IA 1OEYA 1WM3A 1WGKA 4PZ8A 5HGTA 3RD2A 3ZJTA 4JI4L 3HOUB 2E6XA 1UWMA 2UUCQ 3I4MG 1HUNA 1XYIA 2DNCA 2D2QA 1IBXB 1Q90A 4L63B 5FLXL 1E1TA 4X65L 4L6TB 2KLCA 4AQ7A 3D3RA 4NDXA 1SNDA 3U9SA 1JJ2A 2F0QA 4BXXH 2BKRB 5A2QL 2BGFA 2WXOA 3IVFA 2KHSA 1VQJA 1MVKA 1L4ZB 1E7VA 1V2YA 4JLCA 5C4XB 3W5UB 4F8CB 1QLBB 4X57B 3VDZA 4LF7Q 2UU9L 2BS4B 2BYEA 2BYVE 1S5CD 1A2UA 1K9MC 1EF1A 2KFKA 4HKQA 2MO1A 1OGWA 2A73B 4QQBX 4CDFC 2O6VB 4A3CH 2WXHA 1HTLD 1J5EQ 3RN2A 1VDZA 1AYFA 1ONLA 4HWIB 4C3IB 4AOFA 2MA9B 1WYDA 4PV1C 3VR9B 3BZKA 1QOHA 4HRSA 4BBRH 3CQZB 3BDCA 2GB1A 3A5ZB 4X3KA 1NEKB 1ZXIA 1NI2A 2J0JA 2L32A 3HFZB 2K04A 1ISNA 5CV7A 2K28A 1HTOA 2JXMB 1YN5A 1SE4A 5DPSA 3FC4A 3ZDMC 1YEZA 4GLXA 4HIDA 3PO2G 2MJ3A 1SXTA 1HXYD 1V8QA 3HOXB 3S1RH 3AU7A 4QAYA 2ICEC 1E8XA 4LAAA 3OAWA 4JI0L 4FF4A 4HXDA 4MM3A 2JA6B 4GZYC 1PFMA 3UE1A 3I4LA 4GKKQ 5LMNW 1I4XA 3JSVB 1CHPD 2RPQA 4H13C 2F0KA 2F0IA 1A63A 4DA2A 1N61A 4W9FA 3WOEA 1UEBA 3VRBB 3X0WA 3NELA 3TZDA 5M3MB 3S1QB 3S2DB 3LXFA 5FOBB 1VQBA 4LF5Q 3RR5A 3OPOA 4BBNC 3RMHA 3NTHA 3TN2A 4P1CC 3J81L 2Y5PA 3RMKC 1ZEQX 3H3VH 3PO3B 2YEPF 1AP0A 3L13A 2BF8B 4YY3Q 1CKOA 3UDXA 4GNXA 2XN9C 1DD2A 3N1ZC 4OWTB 4Q0FA 5CGKA 3DWQA 4LF8Q 3HOWB 1Q7YC 4K0KQ 2IO1B 1BT0A 4DR4L 2JVCA 3WAOA 5KNCA 1TXYA 1NAPA 2GVAA 3OYYA 4HEDA 2B63G 3KH0A 4WJ3M 4PYUA 3D0FA 4CJ1B 2QDBA 1PVOA 3E9IA 2LJ5A 2BPSA 2G1EA 3RNCC 2CHWA 3AULA 4BBSB 1LTTD 2PVOD 3TUOA 3V2TA 3A9KA 4L1BA 2VB3X 1B9NA 5JEAH 1KXLA 3KUCB 4W9DA 4XX5A 3MZ5A 5IKCM 2NVTB 2L7RA 2PNHA 3OWEB 2PW9A 4DV5L 1CZWA 1OFFA 3JSVA 4DBGA 3GTMH 2DUDA 4FDBA 5EPKA 4HPPA 3PV1A 5E6NA 1F2LA 5IIFA 1EOVA 1Q1EA 2F0HA 4W9CA 1IZ6A 1CM9A 2K50A 5ISRA 1HR0Q 1TKEA 4IG7B 1UE5A 1N36L 4RHSA 4X64L 4KJOA 4LFBL 5EDSA 4JIOU 1RFKA 2N1WA 3IAS1 3SD5A 5T8IA 3DWAA 3KVFB 2HCCA 2EVBA 3EFXD 5KYIA 4OVUA 3PHXB 1WSPA 1K0SA 4M02A 3BVZA 2PQAA 2ZJQA 4A3IG 3OJ3A 1TWHB 3BZDB 1GUNA 4IFDG 2AWTA 2KVRA 2W3RA 2WP8J 1TIFA 3I72A 2INDC 2ATWA 3IG3A 4HDOA 4ME5A 4G7ZC 2CU3A 1I4PA 1SNCA 2KVMA 4KGSA 3UQAA 1KRTA 3T16A 1U4RA 1AE3A 4UP7A 4FXDA 1EIGA 3DCGA 4JI5L 2WAQB 1B9RA 2BE5C 3PLVA 3F1ZA 1IBKL 1V1OA 4BY7G 1HZ6A 2LD9A 4USAA 1HNWL 4TSSA 2F4VQ 2WWZA 3UDIA 3NVZA 4C7ZA 1OXSC 3O65B 4LK0M 3HOWH 5GAEC 2MHJA 5IP4D 1PLFA 4ICVA 4N9PA 3GTJB 1BQQT 5TR5A 1VQMA 3SHLA 2WHIA 3I5JC 2KWDA 2PMZB 4CKCA 5BMHA 1V1PB 1CHQD 1S5DD 1E7PB 1CKMA 1ZYRC 3D4WA 4E3CA 2JEAI 4HCPB 1OO9B 4HR7B 2SOBA 1XTDA 2KBNA 1BR9A 4OL7A 2WU5B 1IUEA 2NVTH 3EVQA 1S3SG 1I6VC 5ELFA 5IGCA 3T8MA 4PNYA 2R92B 1BBWA 5JJKA 2Y0SG 1E2ZA 3K5MA 4EZJA 4A3DG 3HOYG 4RGOS 2YVCA 4GN4B 2JSOA 1I50B 1E7ZA 2RSUA 3VTVA 1RYJA 2DZKA 1UE6A 5IT9L 4KJNA 5KYLA 2ASQA 1BCPC 3GTGH 3V60A 4HIKA 1K8OA 1K8RB 1IW7C 1LLRD 5IYCG 2PW7A 1PRTF 4AJWA 4I7ZC 2UXBL 1YNJD 4WJ4A 1C77A 2G4DB 2Z59B 3AEVA 4A20A 3D32A 2Z1CA 4GU2A 1XD3B 1FFUA 5FLMH 3GZNI 4KK7A 3AECB 2K3UA 2NWGA 4O42A 4HPMB 4HJ8A 3P75A 5E7NA 1P8LA 4KIKA 1SEBD 1AARA 4EGVA 5BN4A 2NYZD 2INCC 3AI5A 4LW1A 4R3DA 2B8FA 2QEJC 2B3AA 4A3MH 2KO3A 1K52A 3PRMB 2O2VA 5C1ZA 3TEWA 1YHAA 4K8JA 1WYWB 3D31A 3FHWA 4FVMA 3SGIA 1WTXA 4GLAC 2W54A 1JOQA 1XLOA 4Q5VA 3IFWB 3CCSA 3AH7A 5IP9G 1EYGA 1Q10A 2LXCA 1PFBA 4F7XA 2HIVA 4WWNA 3TP7A 3BG3A 1CMXB 4IUNA 2HE7A 2IT1A 4EE2A 5HFYA 4C1NK 3PPAA 3C8YA 2JA8G 4MJSB 4H2AA 2J53A 3N20C 2IY0B 3MWYW 4JI3L 2LS01 1U0LA 2F1MA 4RF0A 2QILA 2LXJA 3I2ZA 3ZRCA 1IGCA 2E76C 5FJ8H 2B8GA 2DX5B 1Y1VG 4A3BH 2DJFC 1RJTA 2MEKA 1V97A 3HRDD 2DN8A 2F0WA 2IHEA 2FMMA 1A3VA 3QG1A 2MHVA 1VQGA 4LFCL 1N60A 2WXIA 1ASYA 4CHTB 2E2JH 1I50H 3MAQA 3BIID 2CQOA 4YWMA 3FMCA 4IZ8A 1N34L 2BWES 3OW2A 2QW7A 4HCSA 1F2MA 2C9OA 3I4NG 4MELA 2NZOA 3W1BA 3ZJUA 2IO0B 1LABA 2E74C 1PTOB 2R2QA 1MD2D 4DNTB 4HVBA 1X3EA 1PTOD 1C0AA 1ZPSA 1HTQA 2OQKA 4ZRKA 4JW0A 3U7DA 4AUQC 1J19A 4DAVA 4S3SA 1GOZA 2QCPX 3Q3OC 5L95C 4DR6Q 4ITKA 3Q14C 3M3YB 4XQQA 3CCRA 1LT4D 1SYBA 5IWAQ 1MPEA 5AZHA 2ES2A 2DENB 3AE7B 3BWUD 5EE0A 2IWHA 1TKYA 4KD3A 3TSSA 4NB3A 2MJEA 3DHGC 4CKBA 3NZUA 4WWPA 2OQ0A 5T1IA 2YU9H 3R7RA 3PO0A 1H4RA 2X6LA 2N0SB 1XNQQ 4RM8A 1K3BC 1MKHA 4KY7A 1EFWA 1WOCA 3T53B 4E74A 4KVGB 1SMXA 4ICUA 2F0PA 5LMNL 3NS8A 1PZID 3NUCA 3KJPA 3ML9A 1A70A 1J8IA 1STHA 2REXA 1VQCA 1J0GA 4DV3Q 4W9HA 1UE7A 1SROA 3K0YA 2M56B 2N9EB 1ENCA 3KW5B 1MHHE 1QWYA 3AN1A 1Q81C 1J7AA 5H8YE 2WXMA 4OZCA 3QJYA 2AKWB 2MP1A 5BN5A 3TEZA 2LSSA 1F2YA 2ZXPA 2JA7H 2JA5B 2CHBD 1VD2A 1F2ZA 3L17A 2G9DA 3KF8B 2R93H 4KMUC 5KIXA 1C8CA 4GOPB 5C3EG 2DZJA 2OOBB 4K7WA 4BWGB 5KEEA 1JE4A 3L9AX 4KSKC 4LNIA 3KWLA 1UUPA 2RF4A 1BOSA 2M0AA 2VW9A 4ODGA 1W2BA 4OVVA 2IHFA 2AWOA 3A54A 1Q82C 2I07B 2IW3A 2W55A 3QC8B 3P4RB 4P2CB 3BZCA 3TIXA 1CZPA 3SU8X 2WXFA 1AW7A 2HQLA 2K01A 4DR1L 1JW9D 1WXQA 2C5LC 3GD7A 4GS3A 4NP5A 3Q8CA 1P98A 3O13A 3OSOA 2RPVA 2IY5B 5C0XH 1F9PA 4HTHA 4JBWA 1EM7A 2WXKA 3T51B 2I1KA 2RDFA 3OLMD 3G48A 2UWQA 4TQUS 3ZNID 4FULA 1CTMA 2IZVB 2KEEA 3RNBC 4AYBB 2F0DA 4LNQA 4YSZB 1IYVA 1HJPA 2EE1A 3BS1A 1FNWA 3JVZX 1Q8KA 4LF4Q 3S2HB 1B7YB 3PRPB 2MW5A 5GADC 4OO1H 4NQKE 3W3AA 1KHIA 1UZXB 1L1OB 3SEBA 1B9MA 3S1NH 1HZAA 2LUMA 3APFA 1HPCA 4OELB 2GN5A 3RZOH 2WV6D 1XMQQ 3LYYA 4XDXA 4IM3A 4C3HG 4ZKCB 4FJYA 1G2SA 2LASA 1UD7A 3A56A 3T1HL 1ML0D 1UAPA 1ZXHA 1PH9A 2JZPA 3I3TB 3HP3A 3PSEB 2LXAA 4OONA 3CKIB 4NXMQ 1OXVA 2VUMG 4DHJB 3TREA 3GTKH 4DHJD 3NHHA 2WB1E 4H02A 3ULJA 2SAKA 1G6ZA 2OT2A 5C44G 3A4RA 3RI7C 4B0EA 1SMYC 1GC7A 3TBIB 4XYCA 3I4OA 4WORA 3J80E 4MSMB 3BK2A 1F0ZA 5MPOA 1AEXA 2D0PA 3H0GB 4YWLA 4N9F4 2PVGC 4XT1B 4C1NI 2UYZB 1ESFA 1RD9D 1JC7A 4KZCA 1XCTL 4LCDE 3FP9A 3EROA 5I6YA 2V3SA 1VCIA 3MVVA 4PS8A 4APVA 3SR1A 4MN3A 3P1MA 5J18A 3WDNA 2R3ZA 2I46A 2NB0A 4LF9Q 4RCOA 1VR9A 2I2YA 4PS7A 4GDKB 2I5LX 1G91A 4KKSA 1D7QA 3A5UA 3CSFA 2ZJPA 1PMRA 1QKZA 2Y5BB 1WMHB 1BCPF 3I8ZA 2LRWA 3SFDB 3NWTA 3FPPA 2KVZA 1XX8A 2HUGA 2JZZA 4IQZA 3ICEA 4GLSC 3NQTA 5C3WA 2MWSB 1X54A 3QHTA 1YJ9A 2GLSA 1HH2P 2BE5D 2A74C 2LZ6A 4CJ0B 4DXFA 3Q22A 1VQ5A 2UXCL 1EWIA 1YHBA 2VQFQ 4HJKA 2ZZPB 1PFSA 1WH3A 2KCNA 3W1YA 2FBWB 4ANXA 4JC0A 2BH2A 3RN5A 3HKZB 4IO9A 2NBVB 4NJCA 5CHFA 2D62A 2HCIA 1RHPA 2V3NA 1PZJD 3TP8A 4KD4A 4I65A 3AE1B 1FXTB 3TQYA 4K2KA 1XPRA 3GTOH 3IXSA 2K5HA 3P1HA 1ZYRD 2KJHB 2NR2A 3RLFA 1U4AA 5DPRA 3R3OA 2B29A 2HD3A 4UP9A 3CCMA 5D3DA 1V9JA 2KUMA 3L7ZC 2AEHA 2ZPYA 5I9OA 4JI7Q 2NVUI 2EYJA 4A3KB 1K83H 1WTVA 1WMHA 2L12A 5C3JB 3N6RA 3B9JA 2EXZA 4JI4Q 4R4OA 4NJ6A 4B0MA 2WKDA 3CRKC 4ZRPA 2JYOA 4JI1Q 3RZDH 1FFVA 3GB1A 3VR6A 1G291 4FF1A 1NE3A 3H15A 4X65Q 2XNAC 4RFBA 2XBBC 4WJOA 1C9OA 2KT7A 3U8ZA 1EQTA 5D2MB 4JBKA 1KM7A 3ZYYX 1Y8PB 2KWVB 2QGQA 4DK3C 2BDNA 3PUVA 4A93H 4RKBA 4ZRIA 5JJZA 2WDTB 2I5HA 4FJVB 1WTRA 1GUAB 1JCKB 1YJJA 2UU9Q 1DOLA 5DM73 3S15H 5M5XB 4MGZE 1VCBA 3WANA 1N33L 4IWQA 5D7GA 3I4MH 3H6NA 2CVRA 1WJJA 3HIZA 3JYUA 5AEKB 1HTPA 1X6OA 3Q3MC 5KHQA 3MFYA 1NNXA 3K0XA 3K57A 1XPOA 4PZ7A 4CDEC 2B2YC 2PMVA 3Q3FA 2GBJA 2J7ZA 4UHVA 4ACFA 5I2YA 1M4VA 3CCEA 1I94L 1MG4A 1XXGA 4BZAA 3D6CA 2N78A 4KY5A 3LGJA 4IJHA 2UUBL 3IHPC 5IGGA 3FILB 3DUZA 2KXJA 5IGFA 2RR9A 4A3EG 1NDDA 4G3XB 1J7CA 2INPE 3FKIG 1XJVA 3NE5B 4II3B 4HKZE 2OCEA 3E6ZX 4IUMB 4BAXA 4JI0Q 1PYSB 4ZKBB 1JOKA 1S1QB 3AE3B 1OTCA 4C00A 4IN3A 1II3A 1TWFB 1TU2B 1QJOA 5G3LD 3NXWA 3S17B 4Y52H 1QT9A 2L0TA 2WDRB 4NQLB 4A3FG 4HSVA 3PMFA 2V4DA 5J17A 2EDGA 3K5OA 5KGUA 4NAMA 1S5BD 2OXPA 1WGRA 1XF5L 5IOCA 1SYGA 3H7SA 4X62L 1Q1OA 2Q5WD 5GQOA 3MXGA 3TEXA 3MJWA 2R7DA 4CBVA 4A8XC 4DWFA 4EEWA 2CU1A 1EOTA 1VQHA 2BWFA 2TMPA 4X3TA 2R7ZG 2LKVA 4LLGM 1JOOA 3AYHB 1LYLA 3BINA 1TGZB 1P3QU 4IPGA 2HD5B 3QCAA 4TQ1A 3OG5A 4PYZA 3PO2H 2J4XA 2JEBI 2KDIA 1TVXA 4HMJA 4ANWA 3ULLA 2LVOA 2X8XX 2OF1A 3PIP3 3V62A 4YSXB 3RD4A 2A69C 4MIUA 5C6AA 2F0UA 3ND8A 2VXWA 5ELBA 3ZLZA 1UWVA 1TT2A 2ZNVB 2GMIC 4XQJA 5A2QE 4K3BA 3PZ8A 3CC7A 3NHEB 4JBJA 4ULLA 1D5ZC 4L2YA 4OX9L 2EPBA 3FEWX 2FHTA 1LTRD 3KF6B 4QL5A 3UE0A 4AQYL 1NJIC 1BF4A 2J42A 1Z7TA 3BY4B 4LNNA 3VUWA 3UI2A 1SSNA 2VZKB 3KUPA 2R6GA 2VZKD 2ASBA 4L8JA 3PVLA 3AE9B 4KN7C 2QMTA 3RNFC 5HY6A 3VR8B 4BKGA 1TZOA 4DPGA 5D6JB 1JB7A 5I4DA 3VUXA 3IFTA 2RA4A 1C1YB 4E71A 2K6QA 5IYDG 1KLGD 4HK2A 2H5XA 3BK1A 1E9MA 5BMIA 4IM2A 2PI2A 1TR5A 2PTLA 3GE8C 1N36Q 2LI5A 4X64Q 3VFKA 4LFBQ 3ZNZB 4IUPA 3PQIA 5E4WC 5IN7A 3HG9A 1XT9B 4M8AA 1WTHA 1C78A 2RSOA 2J0TD 2NMQA 3W2DA 2VH1A 4RF1A 5G5GA 1XLNA 4IWPA 1WX9A 2Z8LA 1TWAH 1N5WA 4DGZA 2PMZE 2HTME 1R4MB 3M9BA 4LF6Q 4EKUA 3NRZA 4HEA1 3ZXRA 2JQOA 1F77A 4CJ2C 3UDGA 3IT4B 4JL9A 3H1UA 4JI8L 1T3QA 1PRTC 4A3JG 2AWNA 4JI5Q 2JWUA 4KDIC 4YT0B 3BJUA 2WXLA 3PF4A 2L8JA 5E6JA 4BBRB 2K8CA 4IDIA 5JH5C 2MP2B 1PHJA 4HCNB 4JE3B 1PH5A 4PZ6A 1HNWQ 4FF3A 4NXNL 2WQYB 4WJPA 2NZHA 4LFAL 4K3CA 4JI2L 1EUVB 4WAFA 4YTMB 4KHPL 1IKLA 2K22A 5AJ3L 1I4HA 3PLUA 3J7YW 2BYTA 5LHY1 4V190 1RL2A 1EU4A 2NVYH 1HNXQ 4GKJL 4IFDH 1BMLC 1V81A 3TL5A 5EBCA 4DV7L 3QR8A 4QIWE 3S1RB 1CSPA 2QHOA 5EKIA 5M3FG 1FGBD 2JJQA 2K75A 2JF5A 3AV8A 4WIPA 1TS4A 2N9KA 3H8HA 3V6CB 2MBEA 3VTUA 2MBHA 1XMOL 1UBIA 4BY7H 2G45B 2IYDB 2SNSA 3PIOA 3S2AA 4HJ7A 1T5XD 2PEAA 1QF6A 3MA2B 1O7ZA 2JT4B 1YI2A 2FUG1 3NUHB 5C2TB 3RYTA 4JCVE 4I6NB 1PH7A 1STNA 1DONA 2DGYA 1D1IA 2ID0A 2KTRB 2L1AA 2LVPA 3A4SC 3EECA 3GOEA 4K1RB 3JAMi 1VLBA 1EY4A 2ZXRA 3J81j 2MP2A 5T1GA 4CDDC 4I6LB 4MM3B 1IPGA 3VVWB 4A55A 2JYEA 2UXBQ 1QZEA 1SJED 2ZM6L 4QCLA 1M90C 1NCVA 2RSNA 3T1YL 3Q6SA 1R7SA 3F8TA 2MGSA 2X6GA 2FCQA 4KGTA 2WFWA 5J2RA 5DLQE 3BVGA 4FLHA 3IFDA 4UP8A 1GUOA 5IYBG 2LJIA 5G55A 1TKWB 1EY5A 4A3DH 4OIJA 1O7YA 2MFIA 1M94A 2N7DA 3PUZA 2WXRA 1VMCA 5H1SE 2LWPA 4EZKA 2GA4B 4P6VF 1LACA 3R2IA 1VQ6A 1N63A 1NMGA 2C7NB 2MJDA 4OZAA 2JSVX 1MSGA 4B9KA 3CHBD 3N9YC 3GTMB 1QNKA 2LFNA 4GNXB 4MZ9A 2SDFA 5IYCH 1U5KA 1WGYA 2RMMA 1G6JA 4PMWA 3AEDB 5C23A 3HOVH 3EBEA 1YN3A 4M8MA 3TBLD 3S16H 5CTRC 3AE2B 2KTRA 2JN4A 2H89B 2KHIA 3U52E 3PUYA 1D4BA 4JI3Q 1SYEA 4K5VA 2R2OA 2X38A 1CUKA 3A9KB 2KECA 1CT1D 1EY6A 3PZ7A 3STBD 1GNUA 2BS3B 3KQ4A 1U9RA 1LT5D 2RKSA 4N9TA 3RNUA 1T0RC 4G4KA 2LFIA 1EY0A 5JZEB 4L5RC 1JWBD 3C1EA 1GM5A 3BDOA 1JR0D 5CYUA 1FD7D 1UGMA 1YIJA 2D3AA 2IY1B 4K7SA 4OIKA 4KKTA 4OWXB 5IP9H 3W1SC 3Q6BA 1TY2A 1NR2A 2PO4A 1DOMA 3CPFA 4QUFA 1R9TH 1ZW7A 2BVCA 2AUJD 1VQNA 2PPHA 4PS3A 3WCQA 2UXDQ 5IA7A 1N34Q 2IO2B 3RZWC 1LQBA 2A6EC 2JA8H 2WXNA 1VF7A 1F9RA 5CX3A 2MPMA 5IT9E 2BTEA 3QIAA 2XGTA 2PQAB 2BH8A 4JQWC 1H9KA 2A4ZA 4GLVB 4X66L 3MEFA 1R4NI 1YVCA 3W5VB 1ICWA 2B2WC 1Y1VH 3DMUA 3M85A 4NPSA 5D14A 1D8LA 2FE8A 2L0FA 4LJPB 4YXDB 2IO3B 1WRIA 4OW0A 3S1MH 2GBNA 4DV2L 4BVUC 2WX1A 1RAXA 1CFMA 3I7FA 2LGDA 2Q2IA 1TWGH 2KMMA 2EQSA 1X3QA 1Z9FA 4AH6A 4DF7A 3U4VA 1C4AA 3I4NH 4A3GG 1F9JA 2HT1A 2N8NA 1K50A 2YV5A 5IP7G 2K32A 3KYCD 3KWVA 3NTIA 3C46A 1KRSA 3V3XA 1RKNA 2G9HD 5I9PA 3VR3A 5LMNQ 1SN8A 2WACA 3A55A 2KX3A 2ZTEA 1A6XA 4B3TL 1PYBA 3GTGB 1OTRB 4BY1G 4IPHA 1MG8A 1P1AA 1I42A 4YWKA 5J39A 2EJFC 2WNMA 3OHXC 3M4PA 2L55A 3I63C 4M0WA 1STEA 1V9PA 2N88A 3CMAA 4NAWA 1A8VA 3OMCA 1RWSA 3DXJC 2NVXH 4YWGG 1K73C 4ASWC 4DXAB 2EOTA 1RCVD 3S14H 4BS9A 3VYUA 5CHVC 2A5HA 3VYSA 4AYBE 2G4SA 2DYBA 4A3MB 1PV4A 2DNFA 2I38A 3V61A 4DK1A 3CW2C 1VS0A 4JI6L 4ALPA 2D11A 3EFCA 4HN7A 3X3NA 1HNZL 1NYRA 1S40A 4M01A 1JQ4A 5M5YH 1H9JA 1KNAA 3MHBA 1JJGA 3L16A 3ZXVA 5C4JH 3U2SC 2ICIA 3HHMA 3U50C 3I91A 4QMGA 2Q8IB 4DXGA 1IYFA 1PYWD 3E5SA 4KIKB 1T5EA 4CGYB 2N55A 1WVLA 1S5FD 4N58A 5C3EH 2KMAA 5H92C 1QG7A 5HG2A 5BYQA 1LV9A 2IPKD 2O2VB 3I55A 3A1QA 4DAPA 3AE8B 4A3BB 1WD1A 1VQ7A 3QWZB 3HUIA 4A3LG 3SVMA 1PGAA 2IX3A 2VQEL 4B3ML 4WWMA 1E2VA 4ZHPA 2NN6I 3NBIA 3F2BA 2CWAA 3HM3A 1HRJA 3WOFA 2MQJA 3LNNA 5C4HA 2E2JB 2RQXA 3LJ3A 3HOZG 3K81C 2B2YA 2C60A 5GAGC 3J80c 2BW2A 2K39A 2PQEA 1WYGA 3M62B 5L83A 4POFA 3DWGC 1WGHA 1WCMH 2TSSA 3CAMA 3KUZA 3Q0AA 2G3QB 1B53A 5BYRA 1EQRA 2F0OA 2C9WB 5FO8B 4QIWB 2WB1G 4TV3A 2NBWB 4IURA 2GBMA 2V0GA 3K9OB 2KLGA 2SNMA 3AQQA 2LVQA 3CWIA 1V6EA 1YD8U 4GB9A 2QKIC 5JHBA 4XWTA 2Z4HA 4YTNB 4O1NA 3Q8AA 3GV3A 4IPDA 1E90A 2HDEA 2Z6BA 4JPSA 2RDBC 2L3ZA 1DYQA 2AQ3B 3A8KE 3CP0A 2YU9B 4KY6A 3GS2A 1UE1A 4CQNA 2MBQA 4D2KA 4C3HH 1I4QA 4K14A 5E6OA 2PW5A 3KBXA 4C3JG 1FXIA 1EUJA 3NK9A 1LTGD 3ZTDA 1STAA 2KJRA 2W3SA 1VZ6A 3AEAB 1GHKA 2JPHA 3HVDA 2VUMH 1SE8A 3TJPA 4LF7L 2KD0A 2O5JC 1WTWA 3P42A 3F2CA 1HQMC 1AZPA 2ZTCA 3QARA 5C44H 4DR3Q 3HKZE 3VR4A 5M5WH 4EQ5A 3MXPA 3U4EG 1J5EL 1WR1A 1FVIA 1LTID 1ENFA 4WJWA 5IGEA 1KIXA 1WTQA 1CQVA 1Z5SB 3NWSA 2JA7B 4L5SA 1PRTB 4P75A 4XTCS 1SGHA 1Y56A 4A3OA 1PRTD 1HZCA 2R93B 1JALA 1K53A 4CHKA 3CF5A 4TKNA 3W9CB 3HOUG 2I1JA 1AE2A 2N49A 3N52A 4B3SL 2OJWA 2LMCB 2ZEQA 1FO4A 1B1ZA 1PFNA 4R1JA 2GBRA 2E8GA 4EVOA 2MRPA 4DQOC 1I6HH 4DK5A 2UXCQ 5J1ZA 2MJ8A 5G2NA 2DBYA 4FA6A 4X3SA 3J80i 1ZDXA 4EX5A 2CCZA 3C3LA 2ONQA 1MI2A 3RFZB 3CPWA 1Y1WH 1E8ZA 5C4XG 2UUAL 3A7LA 3JAML 2IX1A 2EY5A 4JG2A 3I3CA 2F3WA 1CI3M 1CJEA 2C7MB 3UQBA 1HCZA 1CQFA 5LMUQ 1EIHA 3L10B 1L2FA 1Q0WB 2AL3A 1F9SA 3WA0A 2BA0A 5JEAG 3P4QB 4C3IG 1L0XB 1T9HA 2L5TA 3GTPH 1WWTA 1FJGL 2JU6X 5JHAA 4WRDA 3I70A 5LL6S 2IL8A 4YY3L 2Z0EB 4DAYB 3A9JB 2Z0DB 4LF8L 2PZTA 3H09A 1WI0A 1PH1A 2JYTA 4DUYL 3S1NB 1L2NA 2EY1A 2LMCA 1L0WA 1B44D 1LTBD 3RZOB 4L23A 2JUOA 2K7VA 5D3IB 1F2RI 3A33B 1P16A 3HOXG 2OJRA 3ALBA 3DOWA 4B95A 1N6ZA 1I3QB 1K28A 3M7NA 2M17A 1A15A 4YIJA 3B0AA 2JA6G 2NCNA 3E9HA 1WF9A 4EQNA 4KX6B 5HKHA 5DCNA 1K0RA 3UIPB 1X3GA 3Q8FA 2A19A 1YNXA 3SXHA 3KBGA 3GTKB 3OWFA 4HAEA 3Q2AC 2JE6I 2V4LA 2ON8A 4ZOHC 5CV5A 5M3MG 1JICA 2EYFA 5FR3A 3F2UA 3K80C 5LXIB 4HJ9A 3BYTB 5CC4A 5A35A 3J9CA 2VZAA 1WJ6A 2MUYA 1SIFA 1LXDA 4M1UB 1QCBD 1K8AC 3CD6A 1V5OA 3PO3G 4TVAB 3CMMB 1ZUD2 2PI2E 1I94Q 5K36H 4DAYA 3A9JA 1TS2A 3HOWG 2J0MA 2UUBQ 3D8GA 1RODA 2FNJB 2K25A 2M00A 2V4IB 2Q8RE 3QJZA 3H3VI 2WLBA 2FXQA 1SFOH 2KNBA 2E2IH 4MACA 4CO7A 2EJMA 1WI5A 3R93A 1PDXA 3N32A 2KX0A 2ZVNA 2F0TA 2J0KA 3SR6A 1I4GA 4QGUA 1YN4A 4BBSG 1NENB 2XRSD 4MT5A 3I57A 5IY0A 2K03A 4DV6L 1PH8A 3DEPA 5ELEA 2FAZA 3DDCB 2XRQD 2MLBA 2D9UA 3Q69A 3EFUA 1Q3LA 2EY2A 3FVQA 1HZ9A 2Q2HA 3CXCA 5DEHA 4DV0L 1AWDA 2KTFA 3MTNB 4WAAA 2HHHL 4DNRB 3PS6A 5BMGA 2AHOB 2KC2A 1EIFA 4A3EH 1ZXTA 4W9GA 3CRLC 3D4DA 2RDGA 3FKIH 5TSSA 2L15A 2N9LA 3H94A 2CKZB 2NTSA 1UH6A 1SE3A 1I3QH 3F2DA 4HROA 2B2TC 2NVQH 2XTIA 2A6HC 4DUZL 1X55A 4A3FH 4FN2A 4ME3A 1MJCA 3AB9A 3GTOB 1P0RA 1TJEA 1WY8A 3SHQA 4IKGA 4OX9Q 4REZA 4WQMA 4A6QA 1C48A 1CKNA 2KQ4X 4F1SA 1K3RA 4HSPA 2ENBA 5EKKA 1EZ8A 3D4RA 1GUTA 2B2VC 4YHHQ 4LJOB 2WYQA 3T3NA 3VDYA 1S5ED 3G71A 2WAQG 1PUTA 1K83B 1HZBA 4A76A 1GJXA 5IGBA 3W1SA 4ZK9B 4CDCC 3DLLA 1OQYA 2KOLA 2OWOA 2QIEB 4IUTA 1VQ8A 3RZDB 1LT3D 3UIOB 2RCNA 1A62A 2K8HA 5I2XA 3CF6E 3ERSX 2WGSA 4AIMA 1XPUA 4KTAA 1QZGA 4K6LA 3TS2A 4X3UA 3W1GA 1QOGA 2B2WA 1QE6A 2KEDA 4A93B 2FIFA 2WX0A 3J81c 4PT5A 4C7YA 1WJUA 3M3JA 4ZYSA 4ANUA 2F0JA 1GO3E 3ZTCA 4G0NB 1D6EC 3CCUA 3NBHA 2OHFA 1EQVA 3DBLB 4WJQA 2VB2X 3FKYA 4K5WA 2CKHB 2INNE 4QB4A 3S15B 2R92G 1GB1A 3NVYA 3MXNB 3KK7A 4DK6C 1Y8RC 5IYDH 4TKOB 4JYAQ 5JPMC 3I4MB 1QOBA 2ALYB 1FPYA 4KHVA 4FP5D 4N8FA 3G7LA 1FMAD 1MJDA 1SJHD 1YBYA 4EFOA 1WXAA 1LTSD 1FL0A 5FO7B 4KDLB 2EYPA 4JI2Q 3KYDD 1NTGA 2B2UC 1KRHA 3RNAC 2C5CA 3QWNA 1OQRA 2XEWA 4C4VA 3MJ5A 3L0OA 2EIFA 4GKJQ 3AXCA 2Z6KC 1U4MA 1PA6A 1CZGA 1W6KA 5C5LA 2X69A 1F52A 2LGSA 4KN4C 3B2FA 4ZDVA 1QZHA 4ILWA 4EQPA 2ZVOA 1D3ZA 2QA4A 1CK1A 3KUDB 4A3JH 1WXMA 2KACA 2BDOA 1XMOQ 1D5MC 3HEJA 3TEYA 5CV4A 3H7PB 1IKMA 2XWBB 3R8BA 2EKEC 1NBFC 4GGQA 1I4RA 4DDGD 4G7OC 2IGGA 2YTXA 3Q3JA 3MXNA 3DWPA 2N3SA 3C1FA 1BCPB 1VQOA 1WFYA 1KDAA 2MQHA 4JX1C 1BCPD 4IUUA 3TMEA 1B2TA 1IW7D 1ILPA 2KJXA 3PHWB 3PO2B 2KK8A 4XE0A 1C9FA 1GC6A 1PH6A 1C3TA 5M3FH 5DM63 5IWAL 4R8IA 3NVVA 4QJFA 4J3OD 2F0VA 1BUIC 5CV6A 2AYOB 3OIQA 2ZJDA 3NQIA 5CMDA 4NMZA 1YJIA 2IGHA 1XNQL 4W9JA 2KHWB 3HS0C 2KYWA 4FJZA 4GN3B 5E3FA 3X23A 4XGAB 2KDMA 3P20A 1O80A 3UGBB 4FNFA 2WKCA 1VDVA 5ELDA 3Q23A 2NBUA 2CHXA 4Z9CB 2PE9A 1N5XA 3GTQH 3H7PA 2NS5A 4II2B 4FXKC 1Q86C 2VH2A 5BYSA 2FINB 2RDHA 5M9OA 4C2MB 2JA9A 1VQPA 2NZ1D 3PGZA 4C56C 4MGIE 5E1FA 5IE8A 1FNVA 4XWWA 1YNNC 1TBEA 5GXGB 2EYMA 4KKUA 4ABNA 4XDDA 2FCSA 3EQLC 3IBEA 5C0XG 3HZXA 3QO2A 1T6BX 5IYBH 2QJLA 5C5MA 2K4KA 1K8GA 4LTUA 1UELA 2ZW1A 1PXUA 2DY7A 2BQQA 4O0AA 3X3MA 3AE5B 1GXDC 4OZBA 4XQNA 5IT9c 4MEMA 3NS1A 2KJ6A 4FO2A 4RNAA 1TWAB 1BO0A 3QX1A 2BA1A 2YYZA 3M95A 3GDEA 4XYQA 1E7UA 2QC8A 4DR7L 1H9SA 1S3OA 2F0MA 3TRZA 2KA7A 2V3PA 1RRBA 1YQBA 1BBXC 4C80A 2LRUA 3N3KB 4I6PA 2WDQB 5KHOA 1YJ1A 3DWMA 4OVZA 3WIMA 3UI3A 1BUVT 5IODA 1IL2A 4POGA 2E2DC 3VH4B 1OEYJ 3EGRA 4MGYE 2F0FA 5FLXE 2PJHA 1ZGUB 2EYOA 4X66Q 4LNKA 3L08A 4DR4Q 3DBHB 2NVYB 2Z0SA 3QOJA 2L0CA 1X56A 2JA5G 1Q5WB 1JQYD 2R61A 2XK5A 3EJIA 1PFDA 5ELCA 4LK1C 2IBIB 3B1LX 5C3XA 4A90A 4DV2Q 5CBEE 1NSNS 5JJIA 3PZDA 5EAYA 1T0SC 4DV5Q 2OEDA 4BY7B 2WXPA 4MNOA 1XMQL 4IOIE 4MDKE 1H9RA 3A74A 4C2MH 1NMFA 3VUYA 4MTNA 1A0IA 1KJTA 1JMLA 1TYGB 1YNJC 4WQOB 3ZUNA 3MEHA 4IJLA 2B63H 1VQIA 4LUZA 4DN4M 4B9WA 2AQ2B 4WJNA
chains in the Genus database with same CATH topology
2MH7A 2F0EA 2BOSA 3KLSX 2RBMA 3D6WA 5C0XI 1BXTA 2H4OA 4TMAB 2EKIA 2QSDA 3U2SC 1BNZA 3TP6A 2Y0SB 4G7HC 3Q8EA 1KDCA 4A3DB 3NZ3A 5LNK1 1VF5C 5JVG3 3P4PB 3Q8BA 4ZHOA 3A7AB 1EWHA 2FMCA 3MHZA 3MTSA 1HFGA 4OO1I 1ESRA 3J81E 5CV8A 2WS3B 4GDLB 1F9QA 4ZRQA 3HOVB 3RPFC 1ET9A 3S16B 3TDQA 3FPUB 3U7ZA 1BDOA 1Y69U 1HUMA 2K5WA 5JEAJ 1RDPD 3CIRB 1IL8A 1G8ZD 3T56B 2FJ2A 3QB3A 2PPBC 3LB8C 4MH8A 2F0GA 1Z47A 5HI1A 1U4LA 4RCNA 1L6UA 1KABA 2XWJB 1QQRA 1TY0A 4K8IA 1ET6A 4XIGS 2K1BA 3PV0A 1R9TB 2K0PA 1C4QA 1PTOC 3ND9A 2JA8B 1FR3A 5BN3A 1EL0A 2BBCA 2A6HD 1OXTA 4ARCA 1JORA 4TQ0A 4US8A 1XLQA 1KLUD 1Y1VB 1UNSA 1MSHA 2LHEA 1SE2A 1SMYD 4RH6A 3PUWA 3S1MB 3OW7A 1S4ZA 3AEBB 2H1EA 2PKOA 3SK8A 1NR4A 1OXXK 1TWGB 3Q24A 1TS5A 1NUCA 3I4NB 5EQ0A 1CA5A 3KLRA 3E56A 3I9V1 4BA2I 4KGRA 4J1MA 1EWYC 1VRAB 2PZWA 2B2TA 4RA8A 2NUCA 4H0LC 2AUKA 4H7BA 2EY6A 1FM0D 4DK0A 4HJGE 3J7AF 3L4PA 1EFID 1I7HA 1XLPA 4KHZA 2NVXB 3TZUA 2B2VA 2JQRB 1QOAA 4KKIA 2A68C 3S14B 1C4CA 2LY7A 3K7AB 1IBXA 1EYCA 1A3TA 3IAYA 2XIWA 5EBDA 3DM1A 1DGJA 5M5YB 3R2TA 4NAWB 5C4JB 3VQIA 2L1BA 3FDTA 2K9XA 4AS1A 1EEFD 1DM0B 3I90A 2NN6G 5C3EB 1Y8NB 1SNOA 1ENAA 1UEAB 1HZ5A 3ABVB 3B2GA 4YSYB 5KRUA 2WU2B 5FK9C 2EELA 4RGNA 1JWAD 2B2UA 3E9SA 1WCMB 1QB5D 1Y8OB 4BA1I 4QF4A 1X32A 1JWUD 4Y7NB 1H9MA 2YEPB 1KF6B 1MI0A 5NUCA 3H91A 1STYA 5EPLA 3NP8A 1HA6A 1YMHE 2D5DA 1GUSA 4ZLTF 1FRDA 4RGTA 1EY8A 4Q2JA 4UDUC 2NTTA 3NSWA 2DLBA 2HQEA 5EKLA 4C3HB 4K5XA 2Y3AA 1YNND 4RKLA 2KAJA 1SDFA 2WINB 5EE9A 2VUMB 1LTAD 1EZ6A 3JAME 5C44B 5M5WB 1R4QB 3GQBA 3NVWA 1EWCA 3P63A 3FRPB 2F4IA 3SK5A 2F0NA 4TRDA 4DU9A 1N62A 4KKJA 2CW0C 2FFKB 3MXUA 1E6EB 4WH4A 3LWEA 1EYDA 5JOBA 1I6HB 1VZ7A 3SK6A 2A69D 1STGA 4A9AA 1ROEA 4E6IA 2Q8TA 1Y1WB 1SF0A 1MGSA 2L9HA 2M9VA 4LJZC 4G57A 4J8QA 1TIID 4ARIA 1K8MA 4KV6A 3GTPB 2IJ0A 2BT6A 1UWXA 5C0XJ 1XWEA 4HMIA 1P7FA 4P16A 1SNQA 1KH0A 1V1PA 1SYCA 1EEID 3BDLA 4WURA 5AFWA 4IFDI 1E0ZA 1PTOF 3V96A 4XXEA 2D2CC 1K51A 1RTOA 1DOXA 1QILA 2PIAA 3ZQ4A 2EYHA 3I73A 5KNBA 2F0SA 1A2TA 3FAHA 2XSCA 1W6JA 1SFOB 2LGIA 2E2IB 5JPNC 1WTPA 1VMPA 2JP1A 2ACZB 3AE4B 5H92C 4K6DA 4ZRZA 3HRZC 4IUQA 2E75C 1AZQA 1IYUA 4EQOA 1GHJA 2K6AA 1OXUA 3LWUA 1A3UA 3T13A 3EUB2 1Q12A 1GAQB 2K05A 5G5HA 1MBYA 4RAUC 2B39A 3ETRA 3DEOA 1O7LA 4A3EB 4ZAIA 4FF2A 5HHDG 3FKIB 2D5GA 2IX0A 1XO3A 5DAUA 2DNEA 2NVQB 4A3FB 2DYMA 5EJWA 5EE1A 1HEZE 1J7BA 3SK4A 2PZUA 1E10A 4ZUIA 3K58A 1GUWA 4FYDA 1MHXA 2R7ZB 2JXTA 1DZ1A 1HFNA 1D2BA 4RWSC 1V8CA 1RF2D 4WFN3 1PZKD 5K5PA 3AEFB 2JX5A 3ZJVA 2L83A 2IDYA 1SIJA 1WTOA 2GI9A 5DNFA 2BB5A 4RGMA 2WP9B 1FCLA 2K5DA 2WDVB 3ERQA 3ZGZA 1KTKA 1U4PA 1VZ8A 5KNDA 2CQAA 3DHQA 1C79A 1D5XC 1PGXA 1FIQA 2Y5CA 1D1KA 1L4DB 2PNRC 2A68D 4R8NA 2K5PA 3AM9A 1E0BA 3U9OA 3M7GA 1PTOH 1JRPA 1F2RC 3NPPA 2ZT9C 2A6ED 3H6MA 5C4ZA 4DFAA 1KDBA 3A8IE 2EZVA 1M8AA 4QUCA 3IT6B 1EU3A 1SNMA 4V0BA 4H44C 2M2LA 1ZDVA 3HGBA 1B50A 3OIPA 3KF8A 4PQXA 1X3PA 4A3JB 3TP5A 1YNTE 1NI3A 4N6EB 2DY8A 3P4SB 1STBA 4OHJA 5EGTA 1RTNA 3IL8A 4F87A 1SNPA 1TS3A 3H3VC 3K5LA 4NKLA 3EA6A 1V43A 3PUXA 3M4YA 1J9OA 5CR3A 4JWSC 2KN4A 2QF7A 5M3FB 4XDCA 4ID6A 5J22A 1PGBA 5JXVA 3BVMA 4K2LA 5CBAE 3VA7A 4PMBA 3ITPA 1XCQL 3ONAB 3C2PA 2AX5A 2GRIA 3MP9A 1L0VB 3K6OA 2K5QA 3GTQB 1HQRD 3E0JA 1O78A 3VA5A 1R4PB 2DYOA 1P7EA 4CKEA 3J7AV 1FXAA 3S9WA 1DOIA 1CA6A 1KFYB 2K33A 3M4OB 2B76B 1XTCD 2BB6A 5FKAC 1DXMA 1PDQA 2EYLA 3GO5A 5HURA 4F8MA 1NVID 1L6VA 4HCEA 2CW0D 1FCCC 1FRRA 3SE0A 2O5IC 1OQQA 1Q8IA 2O2LD 2J52A 2PLPA 1QOFA 2WXJA 1QNUA 2AQ1B 4LMQD 3MFGA 4XYOA 1JROA 3A8JE 2F0LA 3P7JA 1FNUA 3K59A 1H9SB 4PMCA 5F2DA 3AMZA 3T3OA 1L0YB 3HVZA 1GUGA 5G3LF 2F3VA 5JAVA 3AMUA 4IUVA 4JWUC 2KQ3A 1EY7A 2M19A 4IFDJ 1JWSD 5K36G 1SSOA 1RM6C 3IKJA 2L4NA 2KCCA 4US9A 2ZXOA 2CJNA 3VYRA 1G2TA 2B63B 3AE6B 1ILQA 1IGDA 2XVSA 1LT6D 3VR2A 3J80L 1ZOYB 2ZW0A 1KNEA 3L3OC 3GTLB 1YQ4B 2PYKA 5EPJA 1ACCA 5EE3A 3BYYB 3LX0A 1ZKOA 4RHRA 1IHZA 3VRAB 5AUIA 1FEHA 2BCOA 4A3GB 4OO1G 1Z6HA 2F03A 2NBFA 1L5PA 1ZP0B 5FO9B 4U673 2HDLA 5CV9A 4BY1B 5D65A 1EY9A 1B4OA 3T4AC 4F88A 1SYDA 4A3IB 4B9XA 1GB4A 4FXGC 1XEEA 4IALA 4NW2A 2WXQA 1YQ3B 1WD0A 3SDZA 4JK1C 3MC0B 2RVLA 1SYFA 1SAPA 2EJGC 3G6JB 4UAIA 1TQOA 1HA5A 1E2WA 3FILA 1KAAA 5E4XA 3VR5A 1AN8A 4MHEA 2E3TA 3VYTA 1B3AA 2L52A 2VNUD 2NN6H 1JB3A 5COYA 1SB3C 4YTPB 1GPXA 2BS2B 4FXCA 1ZE3D 2OEOA 4ZQ3A 3SFEB 2H88B 3KLSA 3HOYB 3HOZB 5IGDA 4OGQC 3AB5A 3AEEB 2O4XA 2SEBD 3GV6A 3RUZA 1VJKA 1FD6A 4B08A 2WB1B 1DOYA 2N7JA 5AUKA 4J6HA 4N59A 4KI0A 2WIIB 2E2HB 2LEKA 5JVH3 2W82A 3IAM1 3PIO3 1LO5D 3CU7A 4XT3B 2L11A 1NYQA 1FYCA 2LHDA 4NZLB 3K5NA 3OMGA 1EYAA 1Q1BA 2HDMA 1UGJA 3NTKA 5I6WA 1C4PA 1SBBB 3GP7A 4C3JB 2CJOA 1TWCB 1HHVA 3QOLA 1DCZA 1JWMD 1AFPA 4ZUJA 5CORA 2WXGA 3AEGB 2PCFB 4U68A 3URYA 3V05A 2DWQA 1DOKA 4R9WA 1DJRD 1C76A 1TKGA 5LL6X 3OOCA 2IGDA 2Z4IA 1WGKA 5HGTA 3ZJTA 3HOUB 2E6XA 1UWMA 1HUNA 1XYIA 2DNCA 1IBXB 1Q90A 4L63B 5FLXL 4AQ7A 4L6TB 3D3RA 4NDXA 1SNDA 3U9SA 2F0QA 5A2QL 2WXOA 2KHSA 1MVKA 1L4ZB 5C4XB 3W5UB 1QLBB 2BS4B 1S5CD 1A2UA 4HKQA 2A73B 2WXHA 1HTLD 1VDZA 1AYFA 1ONLA 4C3IB 3VR9B 4PV1C 1QOHA 4HRSA 3CQZB 3BDCA 2GB1A 1NEKB 4X3KA 1ZXIA 2L32A 2K04A 5CV7A 2K28A 2JXMB 1YN5A 1SE4A 3FC4A 2MJ3A 1SXTA 1HXYD 1V8QA 3HOXB 3AU7A 2ICEC 4LAAA 4FF4A 2JA6B 4GZYC 1PFMA 3I4LA 1I4XA 1CHPD 4H13C 2F0KA 2F0IA 4DA2A 1N61A 3WOEA 3VRBB 3TZDA 3S1QB 5M3MB 3S2DB 3LXFA 5FOBB 3OPOA 3RMHA 3NTHA 3TN2A 3J81L 2Y5PA 1ZEQX 3PO3B 2YEPF 1AP0A 2XN9C 1DD2A 4Q0FA 5CGKA 3DWQA 3HOWB 5KNCA 1NAPA 4HEDA 4CJ1B 2QDBA 2G1EA 4BBSB 1LTTD 2PVOD 3TUOA 3V2TA 4L1BA 2VB3X 1B9NA 5JEAH 3MZ5A 2NVTB 2PW9A 3OWEB 1CZWA 1OFFA 5EPKA 1F2LA 5IIFA 1Q1EA 2F0HA 1CM9A 5ISRA 1TKEA 4RHSA 4KJOA 1RFKA 3IAS1 5T8IA 3DWAA 2HCCA 2EVBA 3EFXD 5KYIA 1WSPA 3BVZA 1TWHB 3BZDB 1GUNA 4IFDG 2W3RA 2WP8J 3I72A 4ME5A 4G7ZC 2CU3A 1I4PA 1SNCA 2KVMA 4KGSA 3T16A 1U4RA 4FXDA 1EIGA 2WAQB 1B9RA 2BE5C 4USAA 1V1OA 1HZ6A 4TSSA 3NVZA 4C7ZA 1OXSC 4LK0M 1PLFA 4N9PA 3GTJB 1BQQT 3SHLA 2KWDA 2PMZB 4CKCA 5BMHA 1V1PB 1CHQD 1S5DD 1E7PB 1ZYRC 3D4WA 2JEAI 1OO9B 4HR7B 2SOBA 1BR9A 4OL7A 2WU5B 1IUEA 3EVQA 1I6VC 5ELFA 5IGCA 4PNYA 2R92B 1E2ZA 3K5MA 4RGOS 2JSOA 1I50B 1RYJA 5IT9L 4KJNA 5KYLA 1BCPC 1K8OA 1IW7C 1LLRD 2PW7A 1PRTF 4I7ZC 1YNJD 1C77A 2Z1CA 1FFUA 4KK7A 3AECB 2K3UA 2NWGA 4O42A 3P75A 1SEBD 4EGVA 5BN4A 2NYZD 4R3DA 2B8FA 2QEJC 1K52A 3TEWA 4K8JA 3D31A 4FVMA 1WTXA 2W54A 1JOQA 1XLOA 4Q5VA 3AH7A 1Q10A 4F7XA 1PFBA 3TP7A 3BG3A 4IUNA 2IT1A 4EE2A 5HFYA 4C1NK 3C8YA 4H2AA 2J53A 3MWYW 2LS01 2F1MA 4RF0A 2QILA 1IGCA 2E76C 2B8GA 1RJTA 2MEKA 1V97A 3HRDD 2DN8A 2F0WA 2FMMA 1A3VA 3QG1A 2MHVA 1N60A 2WXIA 4CHTB 3MAQA 3BIID 3FMCA 4IZ8A 4HCSA 1F2MA 2C9OA 3ZJUA 1LABA 2E74C 1PTOB 1MD2D 4DNTB 1PTOD 1ZPSA 4DAVA 4S3SA 1GOZA 2QCPX 4ITKA 3M3YB 4XQQA 1LT4D 1SYBA 1MPEA 3BWUD 3AE7B 5EE0A 2IWHA 1TKYA 4KD3A 3TSSA 2MJEA 4CKBA 5T1IA 3PO0A 2N0SB 2X6LA 4KY7A 3T53B 2F0PA 1PZID 3NUCA 1A70A 1J8IA 1STHA 3K0YA 2M56B 1ENCA 1MHHE 1QWYA 3AN1A 1J7AA 5H8YE 2WXMA 4OZCA 3QJYA 2MP1A 5BN5A 3TEZA 2ZXPA 1F2YA 2JA5B 2CHBD 1F2ZA 2G9DA 4KMUC 5KIXA 1C8CA 4BWGB 5KEEA 1JE4A 3L9AX 3KWLA 1UUPA 1BOSA 2M0AA 4ODGA 3A54A 2AWOA 2I07B 2IW3A 2W55A 3P4RB 4P2CB 1CZPA 2WXFA 1AW7A 2K01A 1JW9D 1WXQA 3GD7A 3Q8CA 4NP5A 3O13A 3OSOA 2RPVA 5C0XH 1F9PA 4HTHA 4JBWA 1EM7A 2WXKA 3T51B 2RDFA 4TQUS 1CTMA 2KEEA 4AYBB 2F0DA 4YSZB 1IYVA 2EE1A 3BS1A 1FNWA 3S2HB 4OO1H 3W3AA 3SEBA 1B9MA 2LUMA 1HPCA 2WV6D 3LYYA 4XDXA 4C3HG 4ZKCB 1G2SA 3A56A 1ML0D 1UAPA 1ZXHA 2JZPA 3HP3A 3CKIB 1OXVA 3NHHA 2SAKA 1G6ZA 2OT2A 4B0EA 1SMYC 3TBIB 4WORA 3J80E 3BK2A 1F0ZA 5MPOA 1AEXA 3H0GB 2PVGC 4XT1B 4C1NI 1ESFA 1RD9D 1JC7A 1XCTL 3EROA 5I6YA 1VCIA 3MVVA 3SR1A 4MN3A 3P1MA 3WDNA 2R3ZA 2I46A 2NB0A 1VR9A 4RCOA 2I2YA 4GDKB 1G91A 4KKSA 1PMRA 1QKZA 1BCPF 3I8ZA 3SFDB 3NWTA 3FPPA 1XX8A 2HUGA 4IQZA 4GLSC 3NQTA 5C3WA 2BE5D 2A74C 4CJ0B 4DXFA 3Q22A 2KCNA 2FBWB 4NJCA 3HKZB 2D62A 2HCIA 1RHPA 2V3NA 1PZJD 3TP8A 4KD4A 4I65A 3AE1B 4K2KA 3IXSA 3P1HA 1ZYRD 3RLFA 3R3OA 5D3DA 2KUMA 3L7ZC 5I9OA 2EYJA 4A3KB 1WTVA 5C3JB 2L12A 3N6RA 3B9JA 2EXZA 4B0MA 2WKDA 3CRKC 4ZRPA 2JYOA 1FFVA 3GB1A 3VR6A 1G291 4FF1A 2XNAC 4RFBA 1EQTA 3ZYYX 1Y8PB 2BDNA 3PUVA 4RKBA 5JJZA 1WTRA 1JCKB 1YJJA 1DOLA 5DM73 5M5XB 5D7GA 2CVRA 1HTPA 3MFYA 3K57A 2B2YC 2PMVA 2J7ZA 5I2YA 1M4VA 1XXGA 3D6CA 4KY5A 5IGGA 3FILB 3DUZA 5IGFA 1J7CA 2INPE 3NE5B 4HKZE 3E6ZX 4ZKBB 1JOKA 3AE3B 4IN3A 1II3A 1TWFB 1TU2B 1QJOA 5G3LD 3NXWA 3S17B 1QT9A 2WDRB 4HSVA 3PMFA 2V4DA 2EDGA 3K5OA 5KGUA 4NAMA 1S5BD 2OXPA 1XF5L 5IOCA 1SYGA 3TEXA 2Q5WD 3MXGA 4A8XC 4CBVA 1EOTA 2TMPA 4X3TA 4LLGM 2LKVA 1JOOA 4TQ1A 2J4XA 2JEBI 1TVXA 4HMJA 2OF1A 3PIP3 4YSXB 3RD4A 2A69C 4MIUA 5C6AA 2F0UA 3ND8A 2VXWA 5ELBA 1TT2A 4XQJA 5A2QE 3PZ8A 4L2YA 4ULLA 1D5ZC 2EPBA 3FEWX 2FHTA 1LTRD 1BF4A 2J42A 1Z7TA 3UI2A 1SSNA 2VZKB 3KUPA 2R6GA 2VZKD 4L8JA 3AE9B 4KN7C 2QMTA 3VR8B 1TZOA 5I4DA 3IFTA 2RA4A 1KLGD 3BK1A 1E9MA 5BMIA 1TR5A 2PTLA 4IUPA 5E4WC 3HG9A 4M8AA 1C78A 2RSOA 2J0TD 2NMQA 3W2DA 4RF1A 5G5GA 1XLNA 2Z8LA 1N5WA 4DGZA 2HTME 3NRZA 4HEA1 1F77A 4CJ2C 3IT4B 1T3QA 1PRTC 2JWUA 2AWNA 4YT0B 2WXLA 5E6JA 4BBRB 4IDIA 4JE3B 4FF3A 2WQYB 4WAFA 4YTMB 1IKLA 2K22A 1I4HA 3J7YW 2BYTA 5LHY1 4V190 1EU4A 1BMLC 4IFDH 5EBCA 3S1RB 5EKIA 1FGBD 3AV8A 4WIPA 1TS4A 2N9KA 3H8HA 2SNSA 1T5XD 1QF6A 3MA2B 1O7ZA 3NUHB 2FUG1 5C2TB 1STNA 1DONA 1D1IA 2ID0A 2L1AA 1VLBA 1EY4A 2ZXRA 5T1GA 4MM3B 4A55A 2JYEA 1SJED 4QCLA 1NCVA 2RSNA 3Q6SA 1R7SA 2MGSA 2X6GA 4KGTA 3BVGA 3IFDA 1GUOA 2LJIA 1TKWB 1EY5A 4OIJA 1O7YA 2WXRA 3PUZA 1VMCA 2GA4B 4P6VF 1LACA 3R2IA 1N63A 2MJDA 4OZAA 2JSVX 1MSGA 3CHBD 3N9YC 3GTMB 1QNKA 2LFNA 2SDFA 2RMMA 4PMWA 3AEDB 1YN3A 3AE2B 2H89B 3U52E 1D4BA 3PUYA 1SYEA 4K5VA 2X38A 2KECA 1CT1D 1EY6A 3PZ7A 2BS3B 3KQ4A 1U9RA 1LT5D 2RKSA 4N9TA 4G4KA 2LFIA 1EY0A 1JWBD 3C1EA 3BDOA 1JR0D 5CYUA 1FD7D 4OIKA 4KKTA 1TY2A 1NR2A 2PO4A 1DOMA 4QUFA 2AUJD 3WCQA 2A6EC 2WXNA 1VF7A 1F9RA 2MPMA 5IT9E 2BTEA 3QIAA 1H9KA 3W5VB 1ICWA 2B2WC 3DMUA 3M85A 5D14A 2FE8A 4YXDB 1WRIA 4OW0A 1CFMA 2KMMA 1X3QA 4DF7A 1C4AA 3KWVA 1K50A 2K32A 3NTIA 3C46A 3V3XA 1RKNA 2G9HD 5I9PA 3VR3A 3A55A 2WACA 1A6XA 3GTGB 5J39A 2EJFC 2WNMA 3OHXC 4M0WA 2L55A 1STEA 2N88A 3OMCA 1RWSA 3DXJC 4YWGG 2EOTA 1RCVD 4BS9A 3VYUA 2A5HA 3VYSA 4A3MB 2I38A 4DK1A 4HN7A 3X3NA 1NYRA 1JQ4A 1H9JA 1KNAA 3MHBA 2ICIA 3I91A 4QMGA 2Q8IB 4DXGA 1PYWD 3E5SA 1T5EA 4CGYB 2N55A 1WVLA 1S5FD 4N58A 1QG7A 5HG2A 5BYQA 1LV9A 2IPKD 3AE8B 4DAPA 4A3BB 1WD1A 3HUIA 1PGAA 3SVMA 2IX3A 4WWMA 1E2VA 4ZHPA 2NN6I 3NBIA 1HRJA 3WOFA 3LNNA 5C4HA 2E2JB 2RQXA 2B2YA 2BW2A 2PQEA 1WYGA 3DWGC 2TSSA 3Q0AA 1B53A 5BYRA 2F0OA 5FO8B 4QIWB 4IURA 2V0GA 2SNMA 3CWIA 2QKIC 4XWTA 2Z4HA 4YTNB 4O1NA 3Q8AA 3GV3A 2HDEA 4JPSA 1DYQA 2AQ3B 3A8KE 2YU9B 4KY6A 3GS2A 4CQNA 4D2KA 1I4QA 4K14A 2PW5A 3KBXA 4C3JG 1FXIA 3NK9A 1LTGD 1STAA 2W3SA 1VZ6A 3AEAB 1GHKA 3HVDA 2O5JC 1WTWA 3P42A 1HQMC 1AZPA 3VR4A 3U4EG 3MXPA 1LTID 4WJWA 1ENFA 5IGEA 1WTQA 1CQVA 3NWSA 2JA7B 1PRTB 4XTCS 1Y56A 1PRTD 2R93B 1JALA 1K53A 3W9CB 3N52A 2LMCB 1FO4A 1B1ZA 1PFNA 4EVOA 4DQOC 5J1ZA 2MJ8A 2DBYA 4X3SA 1ZDXA 3C3LA 2ONQA 1MI2A 3RFZB 2IX1A 3A7LA 3JAML 2EY5A 3I3CA 2F3WA 1CI3M 1CJEA 1HCZA 1CQFA 1EIHA 1F9SA 2BA0A 5JEAG 3P4QB 4C3IG 1L0XB 2L5TA 1WWTA 2JU6X 4WRDA 3I70A 5LL6S 2IL8A 2PZTA 3H09A 2JYTA 3S1NB 2EY1A 2LMCA 1B44D 1LTBD 3RZOB 4L23A 2K7VA 5D3IB 1F2RI 1I3QB 3M7NA 1A15A 4YIJA 4KX6B 4EQNA 3Q8FA 3SXHA 3KBGA 3GTKB 3OWFA 4HAEA 2JE6I 2ON8A 4ZOHC 5CV5A 1JICA 2EYFA 5FR3A 3F2UA 3BYTB 5CC4A 5A35A 3J9CA 2MUYA 4M1UB 1QCBD 1ZUD2 5K36H 4DAYA 1TS2A 3D8GA 1RODA 2V4IB 2M00A 2Q8RE 2WLBA 4MACA 2EJMA 3R93A 1PDXA 2F0TA 3SR6A 1I4GA 1YN4A 1NENB 2XRSD 4MT5A 3I57A 2K03A 3DEPA 5ELEA 2XRQD 2D9UA 3Q69A 1Q3LA 2EY2A 3FVQA 1AWDA 5DEHA 5BMGA 4DNRB 1ZXTA 3CRLC 3D4DA 2RDGA 5TSSA 2N9LA 3H94A 2NTSA 1SE3A 4HROA 2B2TC 2A6HC 3AB9A 3GTOB 1TJEA 4IKGA 4REZA 4WQMA 4A6QA 1C48A 2KQ4X 4HSPA 2ENBA 5EKKA 1EZ8A 3D4RA 1GUTA 2B2VC 3T3NA 1S5ED 1PUTA 1K83B 1GJXA 5IGBA 3W1SA 4ZK9B 2KOLA 2QIEB 4IUTA 3RZDB 1LT3D 5I2XA 4KTAA 4K6LA 4X3UA 1QOGA 2B2WA 1QE6A 2KEDA 4A93B 4PT5A 4C7YA 4ZYSA 2F0JA 1D6EC 3NBHA 2OHFA 1EQVA 2VB2X 4K5WA 2INNE 1GB1A 4QB4A 3S15B 3NVYA 3KK7A 4TKOB 5JPMC 3I4MB 1QOBA 4KHVA 4FP5D 3G7LA 1FMAD 1SJHD 1LTSD 5FO7B 2EYPA 2B2UC 1KRHA 2C5CA 3QWNA 1OQRA 3MJ5A 1U4MA 1CZGA 1W6KA 5C5LA 2X69A 4KN4C 3B2FA 4ILWA 4EQPA 1CK1A 2KACA 2BDOA 1D5MC 3HEJA 3TEYA 5CV4A 1IKMA 2XWBB 3R8BA 1I4RA 4G7OC 2IGGA 3MXNA 3DWPA 3C1FA 1BCPB 1KDAA 4JX1C 1BCPD 4IUUA 3TMEA 1B2TA 1IW7D 1ILPA 2KJXA 3PO2B 4XE0A 1C9FA 5DM63 4R8IA 3NVVA 4J3OD 2F0VA 1BUIC 5CV6A 3OIQA 3NQIA 5CMDA 4NMZA 1YJIA 2IGHA 3HS0C 5E3FA 2KDMA 3P20A 1O80A 4FNFA 2WKCA 1VDVA 5ELDA 3Q23A 4Z9CB 1N5XA 4FXKC 5BYSA 2FINB 2RDHA 5M9OA 4C2MB 4C56C 2NZ1D 5E1FA 1FNVA 4XWWA 1YNNC 5GXGB 2EYMA 4KKUA 4ABNA 4XDDA 3EQLC