1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1CK1A 1ENFA 2TSSA 3BVGA 2CHBD 3GP7A 4L6TB 1I4QA 1LT6D 1FNUA 1I4RA 1JWMD 1JWUD 1SXTA 2XRQD 3BVMA 1LTTD 2QILA 4BWGB 1TS2A 1D5MC 4RGTA 1B44D 1PTOC 1I4XA 1TS3A 1EU4A 1LTSD 1PRTB 1SBBB 4RGNA 1LTRD 1BCPC 1RF2D 1TS5A 1HQRD 2WV6D 1YN5A 1PTOD 1AW7A 1LT3D 5D3IB 3CHBD 3EFXD 1HA5A 5ELFA 1SJHD 4NZLB 1EEFD 4RHSA 1SJED 1TY0A 1SE3A 2R61A 3BZDB 2SEBD 1KLUD 1SE2A 3OWEB 4RGOS 3EA6A 4ZYSA 1JQYD 1RDPD 1S5ED 1PTOF 1JR0D 1CHPD 1I4HA 2QEJC 5ELCA 1CT1D 1DYQA 1PRTD 2XNAC 5ELEA 1F77A 1BCPF 1LO5D 2Z8LA 1D5XC 1BXTA 1ET6A 1PTOH 1RCVD 1PYWD 1S5CD 4RH6A 1UUPA 1HTLD 2RDGA 4RFBA 4TSSA 5FK9C 3BYTB 2O2LD 1PZKD 2G9HD 5I4DA 1YN4A 3W2DA 4OHJA 1V1OA 1D5ZC 1PRTF 1LTAD 1SE4A 2ICIA 1L0YB 3SEBA 1QILA 1PRTC 3DWPA 3MC0B 1JWSD 1D6EC 3MFGA 4RCOA 3R2TA 1LT5D 1B1ZA 2NTSA 4K6LA 1V1PA 1HXYD 5ELDA 1UNSA 1PZJD 2XN9C 3R8BA 1S5DD 2AQ2B 1M4VA 1LLRD 1V1PB 4L63B 1CHQD 1ET9A 4DXFA 1S5BD 1LTGD 1CQVA 1PTOB 3URYA 1FD7D 4RHRA 1BCPB 1FNVA 2NTTA 4RGMA 4DXGA 1TY2A 5ELBA 1XXGA 3R2IA 1TS4A 1LTBD 1SEBD 1S5FD 2RDHA 3BVZA 2IPKD 1I4GA 1KTKA 2AQ1B 5TSSA 2J4XA 3KLSX 1RD9D 4Z9CB 1KLGD 1FGBD 1DJRD 1FNWA 3DWQA 2AQ3B 1LTID 1MD2D 3TSSA 1L0XB 1LT4D 4C56C 3V05A 1YN3A 1XTCD 4O1NA 1I4PA 3DWAA 1EEID 1G8ZD 1EFID 2IJ0A 1EWCA 1GOZA 1AN8A 1BCPD 1PZID 1T5XD 3BYYB 5FKAC 2XRSD 1JCKB 1EU3A 3O13A 4UDUC 1ESFA 5D3DA 1STEA
chains in the Genus database with same CATH superfamily
3K7UC 1UD7A 1DM0B 4YWLA 2F0NA 1PA6A 3DM1A 3IG3A 2BS2B 2DNFA 3GP7A 4H13C 1RODA 4B3MQ 1SYCA 1JRPA 1HTPA 1SXTA 3HFZB 4DDID 5I2YA 3Q22A 2K01A 2J7QB 1HRJA 2VH2A 3RZFA 3UQBA 3N1XC 3HKZB 1F2LA 4RGTA 4XT1B 2NVXH 1TGZB 2JSOA 2MP1A 4FN2A 1CZPA 4MGYE 2KCNA 1IL2A 2KN5A 5E7NA 4AOFA 1TT2A 4ZUJA 1PTOD 1PLFA 2EYOA 3BDOA 2JA6B 3CHBD 5CV7A 3GO5A 3J7AF 3BWUD 5IE8A 4L2YA 4WQOB 4FJYA 2JU6X 5IGBA 1E6EB 5IYDH 2V3SA 2KJHB 5IYBG 4DDGD 3CF5A 1NR4A 5KHQA 5EE1A 2RPVA 2KDMA 3EQLC 2FUG1 1TY0A 1VQHA 2Z6KA 2D9UA 1XLOA 3OOCA 3SE0A 4MJSA 3RI7C 4B0EA 3D4DA 1Z7TA 1L1OA 2CCZA 2C7NB 3AXCA 4HPLB 3S24A 4MELA 1ICWA 4U68A 3VUXA 4YHHL 5C3EH 5C3WA 5LMNQ 5BR8Q 3LNNA 4HIDA 3Q3NC 1JR0D 3IT4B 4ANVA 4O2DA 1T9HA 4OELB 2KDIA 4JI7Q 3GB1A 4P1CC 4C4VB 3X3NA 1H9SA 4X66Q 4OIKA 3B2GA 1F2YA 3CCMA 1HHVA 2WLBA 2BE5D 1TIID 1H8CA 2D62A 3I4MG 3SFDB 4XQQA 1HTLD 2DYBA 4TSSA 4B9KA 3NRZA 5IP7H 2EYJA 2EY1A 3F2BA 5L95C 1C76A 2G9HD 4IKGA 1I35A 3ENEA 3I72A 2YV5A 2KHJA 3TRZA 4W9KA 1SNCA 1CKNA 2BYFA 5M9OA 1WJ6A 3OMCA 2A69D 4X3SA 3X3MA 1EYGA 4MM3A 1GUTA 1QILA 3OLMD 1BUIC 4RM8A 5IOCA 3KUZA 3ZDMC 3ULLA 2WXPA 1XCQL 1Q8KA 1GB1A 3NP8A 1LLRD 3Q6BA 2RQXA 1I94Q 3PS6A 3N52A 1SNMA 2BA1A 1QOBA 3S2HH 4XQJA 3S16B 1E9MA 3N30A 2WX1A 4B3SQ 1WJJA 4DR4L 3G4SA 3K0YA 3DBHB 4A3IH 4I6PA 2PI2E 2F0GA 1JJCB 4Y7NH 1KH0A 2D2QA 1E7PB 2JA5B 2F3WA 3HOUG 4GS3A 1SLJA 4BY7B 1CMXB 1GUGA 3KF6B 2OTLA 1N33Q 3PLVA 2QSDA 4GOCA 1KABA 3PSIA 4ZCKA 5G3LF 1QOAA 2JRIB 2ON8A 1XYIA 1KDCA 1T0QC 4F8MA 2E2HH 1B3AA 5T1IA 1YJIA 3MZ5A 3QG1A 4HKZE 3VYSA 3PTFC 5I6WA 1FGUA 2RVLA 1NBWA 3NVVA 1V86A 3QIJA 2RHSB 2WXQA 4BBRH 3B2FA 1EWCA 4UPAA 3GZNB 4ASWC 3CP0A 1PZID 3BYYB 4JOIC 5C44H 4KSLC 2LGYA 1X56A 3O13A 3MJ5A 2LXJA 2LY7A 4IM0A 1Q1EA 5IYDG 4DV0Q 1ZP0B 1FXTB 1WFYA 3HOXH 2H88B 3VR5A 3J7ZC 1TWHB 5LHY1 4YTPB 4L5TA 3GTLH 2IHFA 1TVXA 3KWLA 2QJLA 4WAFA 5C3EG 3MHZA 1B7YB 4RGNA 1YMHE 2V4LA 5J17A 1LTRD 4E6IA 1K3RA 3L7ZC 5C4ZA 3F2CA 4AQYL 1N62A 1X1MA 1YN5A 2UWQA 4A3FB 1K28A 3IFWB 4HMJA 2FMMA 3C1FA 5ELFA 4HSVA 3VRAB 4R4IA 4AYBB 2IY0B 2PZUA 1I50B 1KRTA 1L2FA 1PV4A 1F9JA 1QZEA 1VZ6A 4JGHB 3TBLD 2ZJQA 2FCMA 2J7ZA 1AFPA 5I9OA 4LNKA 4LDTB 5IP7G 2R61A 5M5YB 1WRDB 4DHJD 3EROA 3VR9B 2NPTB 2JXTA 4RGOS 3U9SA 1AZPA 2GVBA 3A5ZB 4PZ8A 4DR2Q 3LWUA 1XMQL 5HI1A 3K5OA 4ODGA 1OXSC 2MFIA 2ES2A 4KIKB 2KMCA 3QCAA 2JYTA 2JYEA 5ELEA 2UUBL 2EY2A 4O42A 4DAVA 1SFOH 5C5LA 1E8XA 1I3QH 2DHZA 2GB1A 2R2OA 1D5XC 1F2MA 4XGAB 4G7ZC 1C1YB 4R3DA 1VQIA 3WALA 4KK7A 4WJ3M 5FO7B 1R4PB 1IBML 2R93B 4OWTB 3FP9A 5LNK1 4QIWB 3K8AA 4ZK9B 1JE4A 2N9PC 5IOIA 1GUSA 2KHSA 3NVWA 2DZKA 2F0HA 4A3IG 4IUVA 3GV3A 5AZGA 1V1OA 1PRTF 3WIMA 4DKAC 3ZKJC 2ZTEA 1GUAB 4HJ7A 1KXLA 4RNAA 5C4JH 1VQGA 2ZT9C 3R2TA 2JXXA 3S1QB 4YSYB 4HK2A 1GXDC 2MBOA 1X55A 1ZXTA 3PO3H 1UBQA 2KDFB 4PS3A 3VH3B 4JC0A 2UU7A 3S17H 3S2AA 1MSGA 2AX5A 3VQIA 2BGFA 3IAS1 3DM3A 1YJWA 4DUZL 1UZXB 2WWZA 4GKJL 1WR6E 1MSHA 4BBRG 3HOWB 3M63B 4HPMB 2Z0SA 2RCFA 1TWAH 3OSOA 2YEPF 1E3PA 1MBYA 1VD2A 4LUZA 5IP4D 3E6ZX 4MN3A 4J6IA 2MP2A 5DNFA 3K5MA 5C44G 4FYDA 2HHHL 1BR9A 2JZ3B 1V8QA 2GRIA 5EKIA 2BWFA 3OMGA 3I90A 1VQCA 2Z6BA 3F8TA 1AP0A 2BQQA 1STNA 1X3QA 3RD2A 2B2TC 2WP8J 2LUMA 2NUCA 2KKCA 2A5HA 2WXJA 4ZRJA 3W1SC 3VR6A 3CQZH 2KVMA 3E0JA 2OT2A 2K8CA 5BMGA 1EEID 3M85A 1WJ4A 2INNE 4XDDA 1P98A 1IHZA 2PQAB 3RNGC 2OTJA 4BOZB 3QIAA 2UXDL 2KCTA 2W3RA 1D4BA 4IPDA 2HD3A 4B3RQ 3P63A 4HPPA 2ZTCA 2B2UA 3QX1A 2LMCB 2RD0A 2BPSA 2F0LA 1P7EA 3U4ZA 4TVAB 1FR3A 1C0AA 1UE5A 2RPQA 4BZAA 1K50A 1JWMD 4M8AA 3TEXA 1HUMA 3X23A 4HR7B 2CVRA 1JOKA 2EY5A 1IUEA 3MXUA 3E3XA 3OTOQ 4F7ZA 1WMHB 4GDLA 5HFYA 4C3HB 3DBHI 3L13A 3ZUNA 2KTRA 3IVFA 3KYHC 3PIPA 4DR6L 3KW5B 3N3KB 1HNZQ 4F88A 1LT3D 3E56A 1XPRA 3LX0A 1VQDA 4M01A 1ZYRC 2EYFA 2RKSA 1RJTA 1YJ1A 4NPSA 1WH3A 2K4KA 4XZ4A 4MTKA 3UF8A 4I6NB 1F1HA 5J2RA 2LGSA 4HJ9A 4NXML 2EYMA 1JMCA 2F0JA 5CHFA 1SE2A 1S3OA 2I2YA 3F2DA 4J3OD 3IAM1 4BKSA 2KT7A 2D3BA 4K5WA 4BY1H 4X3KA 4BKSD 3FILB 3GZNI 4AJWA 1PTOF 4GNXA 3H0GH 3QK0A 4C7YA 3OJ3A 3VHTC 4YTMB 5JXVA 2N1WA 1YHQA 3PO3G 3G7LA 2V9HA 5T8IA 2OF1A 1PYWD 1VDVA 4FF4A 4DR5L 3DVGX 2C9OA 2K5WA 4US8A 1D1IA 2F0KA 3M4OH 2YTVA 4RG1A 2K5NA 4FHKA 1DD2A 5A2QE 2H4OA 4M0WA 2LHDA 1K0RA 3JW0X 1EIGA 3WAOA 1CZGA 1SE4A 2AKWB 4W9HA 4IOIE 4XYCA 1S1QB 1LUZA 1QVCA 2RR9A 3ZNGC 1Q12A 4DV7L 3AULA 4GKKQ 2KQ4X 4DNRB 2PKOA 2Q8TA 3W1GA 3N1ZC 4B9XA 3PV0A 1ET9A 3V62A 2VQFL 4DV5Q 1CQVA 2KHIA 5EE0A 2BA0A 3RZDB 1EIFA 2KBNA 2LGXA 3NBHA 2ACZB 3PCOB 2ZCCA 1RLFA 2K1BA 4I65A 4GGQA 1P8LA 4K5XA 3W9CB 3R66C 2VS1A 5EGTA 4LJOB 1ONLA 1A3UA 2WIIB 1WXQA 1K51A 4KMUC 1MJEA 2R92H 1YX5B 1ZKOA 4CQNA 1FNWA 4OO1I 2BWES 3I4NH 2KHWB 4YY3Q 4NB3A 1WM3A 3P2BA 4R8IA 3ZNID 2KDBA 3CW2C 2UUAL 2PVOD 2PE9A 4FHJA 3NENA 2ZCBA 1NY4A 4YXDB 2ZXRA 5AZFA 2RSNA 5HG2A 3AE7B 3L9AX 3TQYA 1VQ4A 3TS2A 4A3GB 3GS2A 1UAPA 5EKKA 3HGBA 1UH6A 2UU9Q 4K0KL 4JI8L 5DM73 4HIOA 3K6OA 4JI6L 1T5XD 4N59A 2WAQB 1ENAA 4QGUA 2M9VA 4M00A 3D31A 5D3DA 2EPBA 4JWSC 2Y0SB 5C5MA 3AMZA 3VUYA 4YSZB 3QQ8B 3FRPB 4A3KH 4JI5Q 4A3BH 1FMAD 1TJEA 2AL6A 4LF8L 4ZUIA 2EMSA 3BK2A 5J22A 4DA2A 2IY1B 2ZTDA 3MTNB 1NVID 3C19A 4RF0A 3ZTDA 3TEWA 3C0RB 1WX9A 1AZQA 1HZBA 4BY1G 2KX0A 4IWOA 1HZ5A 4XIGS 1QLBB 3D4WA 3KBGA 1P9DU 2CH4W 1TWFB 3H0GG 1SMXA 3D6CA 2WV6D 4NJ6A 4IUUA 3ABVB 2NN6I 1AW7A 1N36Q 2H5XA 4IJHA 1Q7YC 2NBFA 2O2VA 1E24A 4E3CA 2MH7A 4IZ8A 2LKVA 3A9JB 1XTDA 1VQ8A 4A3MH 4F7XA 4W9EA 1TZOA 3Q8DA 3L4PA 3Q23A 1PH9A 1TWGB 1T3QA 2JN4A 1JQYD 1KC8C 4G7OC 3U58A 1HFNA 3TEHB 3T1YL 5KRUA 1U4LA 4XTCS 4OW0A 1CFMA 5EDSA 2QEJC 1CT1D 2WU5B 4JI0L 1F77A 1UEAB 2ZM6Q 3B9JA 4A90A 3BDCA 1BXTA 2BW2A 4YWMA 3IAYA 1WXMA 1KAAA 1RCVD 4KSKC 1S40A 3OPOA 2C35B 1GG3A 3H7SA 1PZKD 1ASZA 2L5TA 2A4ZA 1ML0D 2IT1A 2V1CC 2B2YC 1C7YA 2Y5CA 1YX6B 1ESRA 2DWQA 3AV8A 3U7ZA 2JEAI 1VF7A 1HR0W 5IYCH 3ZXVA 2JXMB 3PZ8A 4ITKA 3FAHA 1Q3LA 2E5LQ 1XQQA 2KOXA 2JE6I 1LQBA 2R92G 4C4VA 5KNCA 2F0EA 5LL6X 5ELDA 1HXYD 3SU8X 3QWNA 4TQUS 3I4NG 3I57A 5IO9A 4G7HC 3WAMA 1DOIA 4DHZE 2HTME 3AM9A 1R4QB 2IO2B 4N8X1 3EVQA 1HTOA 2EKEC 3OYYA 1DOMA 1SNOA 4UAIA 2F4VL 1N63A 5E6PA 4LF6Q 1HTQA 1C77A 2B8GA 3CPWA 1TY2A 3ULPA 4MGKE 5E6JA 3UGBB 4HRSA 2KENA 2E2JB 1WCMB 3M3YH 2N78A 1TZ1A 2F0FA 2KZRA 2MP2B 4KN4C 1I7HA 4BBNC 1N6ZA 4GMVA 4A3BG 4A3KG 3ICEA 4ARCA 1V9PA 2UXCQ 2GBJA 4GLVB 2QIEB 2KVZA 5EE3A 4XYOA 4DV4L 4LFBL 2R2QA 3PMFA 1G8ZD 2QDLA 4IM3A 3AE2B 3ML9A 1AN8A 1JJGA 2XVSA 4KKJA 3RUIB 2JA6H 4A76A 1T0YA 3ZQ4A 4K8IA 1QB5D 2V3NA 2EELA 1TYGB 1U4RA 1LM0A 2L9HA 2VXWA 3KF6A 3GTOB 4HXDA 2INPE 1EQQA 4JI2Q 3RUZA 4A3MG 1KQSA 3JSVB 3WDNA 2FAZA 1I4QA 1I4RA 1JWUD 1L0WA 4A3LH 2A6ED 3DHQA 4BWGB 4HJ5A 4ABNA 5CBAE 1R7SA 3Q8EA 2K50A 3E0EA 1HZCA 1C4CA 2MJEA 4MSMB 4P71A 2WDQB 3RNFC 2QCPX 4PZ7A 3C8YA 4CGYB 4JVZA 4LF5L 5K5PA 2ASQA 5IA7A 2GLSA 2A6HC 3APDA 4CO7A 3Q24A 1CJEA 4B95A 1WYWB 4M8NA 5EJWA 3RN9C 1IW7C 4LLGM 4OWWB 4M8MA 3ZDTA 4F8CB 5JHBA 3VH4B 2I5MX 2LSSA 2KWDA 3I3TB 3RULA 2WXIA 2SEBD 3BZKA 1EFWA 3S1NB 1FYCA 3NE5B 2MBQA 1LXDA 5J1ZA 2GBMA 3N9YC 3UDXA 1Q90A 4DUYL 4BBSG 5IYCG 2CHXA 3PF4A 4C3JB 3H6MA 3Q3FA 1A62A 1ZW7A 1WGDA 5AJ3L 5C0XI 5G5HA 1BCPF 4GNXB 1GM5A 1GC6A 1FRDA 1K83B 1K53A 4LNNA 1O80A 1NEKB 2H89B 3LJ3A 2JJQA 3S9WA 3IL8A 4WJQA 1ACCA 3S16H 3G6JB 1RL2A 4KD3A 2D11A 3CRKC 4YTNB 1AE3A 1F9SA 1N9WA 4LDTD 4LNIA 2NPTA 4EUTA 2JA5H 5D6JB 5G55A 1BKBA 2WYQA 2KLCA 4G50A 4BY7H 4IURA 3O65B 5A2QL 2Q8IB 2D5GA 4MDKE 1FCCC 4KIKA 4K6LA 1X32A 1V1PA 1FCLA 1WF9A 2IZVB 4MIUA 3L0WB 2I1KA 2KTFA 3I4LA 1LTGD 3HKZG 4HDOA 2GBKA 4BKTA 2KQ7A 4HCNB 1FNVA 2CW0C 4IUTA 3CCJA 1NBFC 4GLXA 3G6EA 3UIPB 4RKBA 1O7ZA 2GA4B 3DLLA 1CSQA 2WINB 2NYZD 3RLNA 4X64L 2JA6G 4JLCA 1FO4A 2CU1A 2L3ZA 1AWDA 4JOIA 1CTMA 1JOOA 2IPKD 4KX6B 1WM2A 1HEZE 4QCLA 4HCEA 1WTXA 2WB1E 1V43A 3MXNB 4DV3Q 1XLQA 2PJHA 4V190 2BF8B 2V0GA 1OQRA 1EF1A 1LTID 5D14A 1PQSA 1XLNA 1TWHH 2Z4IA 4C56C 4IM2A 4DQOC 4A3LG 4GDKB 5CV5A 5IWAQ 2IHEA 2NVYB 3SHLA 4A3EB 2MA9B 4A8XC 3C46A 4GLAC 4LWCA 3HUIA 2AWNA 4OVVA 2LJIA 1B4OA 2EIFA 1GOZA 3ZYYX 1G2TA 1DXMA 1MHHE 2M19A 3HVDA 1WTQA 4A3FH 1J5EL 3IT6B 4HCPB 2O5IC 3VR2A 4EZKA 5FKAC 3EGRA 5LMUL 2L52A 1I50H 4C2MB 2FE8A 4ANUA 1ENFA 3HZXA 4B3TQ 1F9QA 4BBSB 1JWBD 2JX5A 3QWZB 2CQOA 5M5YH 1YNTE 1ZGUB 3G71A 1KD1C 1RAXA 1LTLA 3PO0A 3D32A 4ULLA 4XWWA 2PMZE 1GHKA 2IGGA 2NZOA 2W55A 1MFWA 1WYGA 3AU5A 2N7DA 2BDOA 2WXRA 4N9PA 2WFWA 4JG2A 2ZVOA 1TS5A 3I7FA 4LF9L 2PQAA 1PFNA 4FXKC 4ILWA 2BH2A 5D3IB 3ITPA 1A2UA 1EYCA 3M7GA 4IPCA 5EQ0A 5DLQE 2XGTA 1IXRA 5IIFA 4OO1H 3NWSA 2FIDA 2KEDA 4WJPA 2G4SA 1VZ7A 2F0UA 5FLXE 2DZMA 3U8ZA 2DAJA 3KVFB 2R93H 3HOUH 4MNOA 3K0XA 3M3JA 5CYUA 2LMCA 2KUMA 1MIUA 2QMTA 1HQMC 3BZDB 2BDNA 4WQMA 5I2XA 3AE1B 1IBLL 2HT1A 3KWVA 4X65L 3G48A 4L5QA 3UDIA 2UUCQ 4JV5Q 4ALPA 1S4ZA 2BKFA 2JA5G 4Q2JA 5IGEA 2QW7A 4BY7G 1WMHA 1STHA 2FHTA 2B2WC 1G6ZA 1VF5C 2Q8RE 3BY4B 3S1QH 2M00A 2Z8LA 1JB7A 4PS7A 4EQ5A 2JWUA 3L0OA 2M1MA 4B3ML 3DMUA 2Y5PA 4GN3B 4JBJA 4KZCA 1U4MA 2VB3X 2K3UA 4PK1A 1UUPA 2AUKA 3P4SB 3Q3OC 1WE6A 1L6VA 5LL6S 5FK9C 3J81j 5C3JB 3HOWH 1WXAA 1F0ZA 2L7RA 4N9F4 2XK5B 3PV1A 1C79A 1HZAA 1F2ZA 3PUZA 2IX3A 1SMYC 2NN6H 3AE9B 3KUCB 3FILA 1ZUD2 1PYSB 2YLMA 3I55A 4MT5A 3OAWA 3BJUA 5IT9E 5JPNC 1M4VA 4YCUA 3NUHB 1CSPA 2B2TA 1J9OA 3W1SA 3DDCB 2KQSA 5C23A 2B3AA 3Q2AC 2ZVNA 2AL3A 3P20A 1JB3A 1SN8A 2J0JA 5LMNL 2NTTA 1CI3M 5BR8L 2O6VB 3MC9A 3DEOA 4IQZA 4YWKA 1WGYA 2I38A 1N8RC 2PZWA 2L12A 4A3FG 4X66L 1DZ1A 3DHGC 2PW9A 1VDZA 3OIQA 4AYBG 5CTRC 1XLPA 3QR8A 3RR5A 3T13A 1DJRD 3E9HA 3AN1A 2F52A 5GXGB 4US9A 2JEBI 2KANA 2FNJB 3PLUA 1FXIA 1EUJA 2EJMA 2K05A 3ER0A 1IGCA 1VMPA 3L16A 2KMAA 2CH4A 2LXKA 4C3HH 4WFN3 2E2IB 1DGSA 2IJ0A 4GB9A 3J81i 2VH1A 4CJ1B 2LD9A 3FKIB 1ZE3D 2K22A 4WJWA 1R4NB 1Z2MA 3NUCA 4P7IA 3WCQA 1XX8A 2IDYA 4OO1G 1NAPA 1C4PA 4AJYB 1ZYRD 4KZ0A 1MHXA 2K5PA 3H7PB 3V6CB 3HOVB 2D07B 1JROA 2R93G 4AS1A 4UP7A 1VQPA 2CHBD 4KHPQ 1X3EA 2C60A 2V4DA 4I7AA 1TT5B 1YNNC 3BYTB 2N7EA 5CHWA 5AZHA 1B8AA 3HOZB 1YBYA 4R1JA 1TS2A 2HDEA 2E2DC 2K1FA 1B44D 1SYBA 4HJGE 1LTSD 5C4XB 3T1HL 2WACA 1N33L 1RF2D 2OEDA 3RLFA 2JQRB 2M0AA 3AECB 1IYVA 2AWTA 1OGWA 3RT3B 4FJVB 1GC7A 2G45B 2IO0B 1VLBA 4XYQA 2I0QA 1TU2B 2B63B 2BH8A 3TDQA 1C78A 2FXQA 4NZLB 1T0SC 2VW9A 5EBDA 3BIID 3H91A 1DGJA 1H4RA 1IL8A 4IPHA 3HOWG 4K3CA 1JALA 4IW0A 2NS5A 4IO9A 1IBKL 1QOHA 4P74A 1Z5SB 1EQTA 4RWSC 5IAAC 4XDXA 4F87A 2VZKD 2NN6G 1STYA 3T9LA 3CF6E 4HSPA 2R3ZA 4C3IB 4DV0L 2BB6A 2A1AA 2L32A 3U30A 4K5VA 4NAWB 4GN5A 2HCCA 4LUVA 2JUOA 3ZW3A 2HTHA 1C8CA 4R4TA 4CDDC 2X8XX 1OXTA 3RZDH 3UQAA 3A9JA 1NENB 3LGJA 4LF4Q 5E4WC 2JT4B 2D0PA 2M2LA 3SDLC 1DOXA 1A3VA 3FKYA 4AQYQ 3Q3JA 2CJOA 5FR3A 2N8NA 3NOBA 3T3OA 2ICIA 3VR4A 3SEBA 2G4DB 1QZGA 2NVQB 4FNFA 2NBVB 1KOTA 5JJKA 2XWJB 4IALA 3AE3B 3IFTA 2PIAA 4KTAA 1CA5A 3P4RB 1V1PB 3PSEB 1WR1A 1WSPA 3VA5A 4WJNA 3URYA 4HJKA 4WWOA 4A3GH 4DR2L 1AARA 3A1QB 1XMQQ 4K81A 4DAPA 4AUQC 4C3HG 4QY7A 1J6QA 3BDLA 3H9DA 5C4HA 3E9SA 3R3OA 4D2KA 2EJFC 1OQYA 4DHZB 3MWYW 5C0XH 4DN4M 2D5DA 3ZRFA 4R4CA 2WXOA 4P72A 3QJYA 3GQBA 1SSOA 5CBEE 1NI2A 2CHWA 2EYHA 3SXHA 1G51A 1IBMQ 1QOGA 5JZEB 2MO0A 1SE9A 1A3TA 4OWXB 1F52A 1Q5WB 1P3QU 4EEWA 5IKCM 3MC8A 4FVMA 3B08A 3UDFA 4DV6Q 4O1NA 3H09A 3RCZA 3I9V1 4NMZA 3AEFB 3TREA 3RNEC 4K1RB 4EZLA 1D3ZA 3P1MA 4E71A 1J7BA 1HUNA 3OW7A 1TWFH 2RHQB 4P2CB 2PYKA 4DR3Q 2BTEA 2LFNA 2KXJA 1W6JA 2QCZA 3MAQA 2VRRB 2IL8A 2KFKB 4WURA 3H1UA 4JK1C 5ISRA 4IWQA 3C1EA 4ZYNA 2N7JA 2JQOA 5FR6A 1L5PA 3OIPA 5BMHA 4DUZQ 3HHMA 3NHHA 1N34L 2XRQD 2PI2A 5D65A 4GKJQ 1PUTA 1TWGH 2KQ3A 2SNSA 2LXCA 2WXGA 5D94A 1NCVA 3K7AB 1UBIA 1PTOC 3HM6X 2K75A 4KHZA 1VRAB 1WRIA 2QDBA 4A6QA 5FLXc 2HHHQ 3M4QA 4OGQC 3ONAB 1UWMA 3U4EG 4OL7A 3WOFA 4ME5A 4A3DB 2SDFA 2RSOA 1VQMA 3F2UA 4DV2Q 3PF5A 5LMNW 3Q8AA 3L3OC 1EWIA 2F0WA 1GJZA 4A3JB 2K14A 5FLXL 1PFBA 2ASBA 1M94A 5JHAA 1UWVA 2INDC 3PIP3 5JAVA 3JSVA 1HR0L 5JVG3 2LZ6A 3OWEB 1VQBA 2K8BA 3PREA 4JPBW 3J81E 2KJRA 1X3GA 2XEWA 2RBMA 1XPUA 2EVBA 1CHPD 2MGSA 1S72A 4B3RL 1B9RA 4FADA 1ZXHA 1R4NI 3I5JC 4OVUA 1B53A 3Q8FA 3TMPB 2TMPA 1YHBA 1E0ZA 4WJOA 3TEYA 3CCRA 3STBC 2I46A 4MZ9A 3E9IA 2BYVE 3U9OA 4TRDA 2K0PA 3RD4A 5M5WB 1S5CD 3DQVA 2R7FA 3D8GA 4RFBA 4UP9A 4A3GG 4DBGA 3PUXA 2A69C 2O2LD 2K52A 5KEEA 5J3BA 1QCBD 4DR6Q 1ILPA 1Y14B 1B9MA 1WCMH 1X65A 1LTAD 2E2JH 2WAQG 5C0XG 1L0YB 2KWCA 2N9XA 4HEA1 3I91A 5IT9c 2VUMB 4C7ZA 2Y0SG 1Q10A 2LEKA 1BUVT 1SYFA 1YJJA 2Q5WD 1PZJD 3DBLB 4L63B 1BBUA 1QWYA 1KDBA 4NXMQ 1V5OA 2NCNA 2R7ZB 1PTOB 4XDCA 3B6YA 5IT9L 2K33A 5T1GA 1N32L 2HIVA 2VB2X 1XNRQ 1JJ2A 2IY5B 1QJOA 3MEHA 3MJWA 1SNPA 5AFWA 1R4MB 4KDLB 3HKSA 1DOKA 1TS4A 1TQOA 1QVGA 3BVZA 3VTUA 3R7QA 5IGFA 3D4RA 1C48A 3KLSX 4CDCC 3GTOH 2JA7B 4N58A 1TKGA 4DR5Q 3AFQA 2C5CA 2KOLA 5JEAH 4MTNA 1K8MA 2F0QA 1PH4A 1QVFA 1V9JA 5E1FA 4PZ6A 1BDOA 3PHXB 1Z9FA 2MQHA 1WX8A 4ZAIA 2KK8A 2N0SB 3QOLA 2XSCA 2WB1B 5EKLA 1Q86C 4KGRA 4ZHOA 2RA4A 1CZWA 1DCZA 1Q0WB 3MEFA 3RNAC 4R8NA 3JAMi 3A55A 1PH6A 3F1ZA 4USAA 2EY6A 4K14A 1B9NA 2B2VC 4CJ0B 5IP9G 1MVKA 2XRSD 5HGTA 2A6HD 2KWUB 3HK0A 4JL9A 3HOXB 3B1LX 4N9TA 2DYMA 3Q14C 1EZ8A 2W9NA 3HG9A 2NWGA 2BBCA 4DNIA 2MCNB 1WTHA 2UYZB 2AHOB 2KCCA 3MXNA 5DPWA 1XT9B 1LT6D 3A4SC 1UE1A 3BVMA 3S1NH 3S1MB 2KC1A 5HY6A 5BN3A 2PVGC 1FL0A 1PVOA 3PQIA 2OQKA 4GDKA 3VYUA 3L2PA 2X69A 4LW1A 3HOYB 2L00B 2LVPA 4C3JH 4DV1L 4LF7L 1K8OA 2EOTA 2UXBQ 1WXVA 2M4NA 2MRPA 2B3GA 1WTWA 3NZ3A 4MH0E 4CBVA 3I63C 1K83H 1SYEA 3A5UA 2PMZB 2DLBA 4YY3L 2MO1A 2WDRB 5C0XJ 3AE5B 1N61A 1EEFD 3SR1A 1JMLA 3AE6B 5DPRA 1RKNA 2K5VA 1ZXIA 3CRLC 1D7QA 1MGSA 3AEGB 3NTHA 4DK6C 1I5FA 2CWAA 3A74A 3CCUA 2UU9L 2AEHA 4O0AA 3W1BA 2F0TA 4K0KQ 4ZYSA 2Y3AA 1GAQB 4ICVA 4C1NK 1WCMG 4HN7A 4JI6Q 4YSXB 1STBA 1XCTL 3SK6A 2KMMA 3A8KE 4PQXA 2K6DB 3E5SA 3VA7A 1Y8RC 3ERQA 1E8WA 3QO2A 1E2WA 2DJFC 5KNBA 2BYTA 2L55A 3VDYA 1IPGA 3AE4B 4LF8Q 2PMVA 3QARA 2V4IB 3GDEA 3RNCC 4M02A 4P16A 2KWVB 2RDGA 3AU7A 4LJPB 3ND8A 2WXFA 1VQNA 3HS0C 2OCEA 1PGAA 2CW0D 3CMAA 3IKJA 3UE0A 2LUEA 1UE7A 3PPAA 2LVOA 1Z47A 4XWTA 1YNJD 2MPMA 1WI0A 4PMCA 2DN8A 1WZ0A 1P16A 2RGFA 1HA6A 3I8ZA 3L17A 3CAMA 5JEAG 1S5BD 4IUPA 3SGIA 2NVYH 5GQOA 4A3EH 1OEYJ 3V3XA 1XNQL 1GVPA 2ZPNA 3CIRB 2N4FA 1JOQA 1FD7D 3KH0A 1I42A 3T1YQ 3W5OA 4DGZA 2L1BA 2K04A 2XK5A 2ZM6L 1NUCA 4A9AA 2AQ1B 2EKIA 5TSSA 4C2MH 4XQNA 5BMIA 1BF4A 3TEZA 4BBSH 2MLBA 2WXMA 1SIJA 1TR5A 2YU9B 4FULA 1HPCA 2NB0A 1GO3E 1BBXC 1LT4D 4L8JA 3VYTA 4CHKA 4FP5D 3LDZE 4E74A 3P75A 2K5DA 1Z6HA 3J80i 3QB3A 2C7MB 2ZXOA 4C3JG 5GROA 5KNDA 5EPLA 4OX9L 3KFUA 2E5LL 4A93B 2O6VA 2O6VD 2QHOA 3FPUB 1VQOA 2EQSA 4JI3Q 3T53B 4JI4Q 4WAAA 1HNWL 3IHPC 4W9IA 3ZJVA 1CK1A 2SOBA 1Q1OA 3P4PB 3DBLI 4FF2A 3CCVA 1XMOL 2V1YA 2WHIA 4HAEA 3GTJB 2LGDA 4YCWA 2CS4A 2MSED 4DR7L 2ALYB 4MHEA 4PMBA 4LF6L 2QILA 2X38A 1MJCA 1EIYB 1ZEQX 1U9RA 1L4ZB 2Q2IA 4R4OA 1EY0A 4HROA 4RF1A 4NJCA 1R4MI 1BCPC 3OHXC 4X62Q 2G1EA 2L83A 4I7ZC 4EQNA 2DZJA 4FO2A 4MH8A 2PNHA 2JSVX 4W9CA 5GAGC 2UXCL 2D2CC 3C3LA 2QC8A 2Z0EB 1RHPA 2PTLA 3K80C 1PXUA 2VQEQ 4ARIA 1BMLC 3DVNV 4MEMA 3H7PA 3KQ4A 3J81c 3EIVA 3KUDB 4LFCQ 4NQKE 3HIZA 4DV4Q 2OEOA 5JJZA 4LFBQ 3EFCA 4TKNA 1TKWB 4IUQA 5JEAJ 4JYAQ 1JW9D 1CQFA 4FXGC 3MXGA 2ZXPA 4NY0A 3AE8B 3JAME 4DWFA 1C3TA 2N9LA 1SMYD 4IJLA 3ZJTA 1FRRA 3PVLA 4ZHPA 3SFEB 3A8IE 3J81L 5G3LD 2LXAA 3LWEA 1B70B 3HRDD 2ZW1A 1PDQA 1V49A 4LFAL 2A19A 2MBHA 5KGUA 3ZVVA 3GTPB 2L76A 4ZKBB 3CC7A 2WX0A 1XEEA 5GAEC 4A3EG 4Y52H 1EY6A 2ZW0A 4NXNQ 4QL5A 1CKOA 3HVZA 4WWPA 1N5XA 2KEEA 4K2KA 5I4DA 3A33B 1LFDA 1YN4A 1ZDXA 4YCVA 1SF0A 5E4XA 3K59A 4KY5A 4HIKA 4LF5Q 3PO2B 4YL8A 4QMGA 2JZPA 4GN4B 3DWPA 4LNFA 1S3SG 5M3FB 2WGSA 5IN7A 3L54A 5EPKA 4II2B 2NTSA 1K73C 4OVZA 5KHOA 4UHVA 4CDFC 3PZ7A 1YITA 3R8BA 2H1EA 3KOJA 2E8GA 4DXFA 1SRUA 1VZ8A 3DBRB 3DHHC 4HCSA 4NAWA 1OXXK 2LASA 1U5KA 1JT8A 3BU2A 2Q2TA 2INCC 5FO9B 2E2IH 1IKLA 1BCPB 1MJDA 3AU4A 2FMCA 3GTKB 2JWZA 2DJGC 2JPHA 3GTGB 1Q82C 1EYDA 3FKIH 1EQVA 1SE8A 2YTYA 5AJ3Q 5M5XB 4NKLA 4PMWA 1T5EA 3NVZA 2RDHA 2MW5A 4DXAB 3S2DB 1I4GA 1O78A 1P7FA 1A0IA 1E8ZA 1VR9A 2QGQA 3HOVH 2JA8B 2KLGA 3IBEA 4QAYA 3TCAA 4GXBA 1V97A 2WP9B 2AUJD 2KJ6A 5CV8A 4HMIA 3UDGA 5DM63 2E6XA 4LK1C 1PH3A 3HOZH 1QQRA 4DR1Q 3ETRA 2O4XA 4KY7A 1XTCD 3L08A 5DPSA 4NPNA 5EAYA 5C4XH 2OHFA 2YVCA 3V61A 2QDFA 3A1QA 2GBNA 1GHJA 4HJ8A 1RTNA 1EOVA 3J7AV 1Y1VB 2L0TA 3W1YA 1JCKB 1EU3A 4X3UA 2KCMA 5C3XA 2R7DA 3RNUA 2B63H 2B76B 2DBYA 5H8YE 4C00A 4FF1A 1PH2A 2BB5A 5J18A 3S1RB 1WGRA 2N3SA 1LM8B 4L6TB 3TBIB 4HLEA 4EGVA 1NNXA 1GD7A 3MFYA 4AIMA 2DYOA 1G2SA 1ASYA 1VCBA 1I4XA 4KGTA 1WXSA 1EU4A 3V96A 1PDXA 1O7LA 4X64Q 2K9XA 3ZTCA 5C1ZA 5C6AA 3GV6A 3I3CA 4TQ1A 2FIFA 3NVYA 1FIQA 4C3IH 4ZDVA 4DPGA 1YNXA 1E8YA 2J53A 2F1MA 3FEWX 2L4NA 4DV3L 4K7WA 3EFXD 1GJXA 2BVCA 4A3CH 1MG4A 1WJNA 2KFKA 1QNUA 4POFA 1RM6C 4GOPC 2PW7A 4LMQD 4M1UB 5IWAL 3TN2A 2WQYB 4EOYA 3GTMB 4JX1C 1SR3A 2A68C 3HM3A 3PRPB 1HNXQ 2K39A 3R7RA 5KYIA 2K8HA 4K7SA 3M95A 3J80E 1E5WA 1E90A 4I6LB 2GMIC 2L0FA 3PIOA 1FEHA 1I6HB 3UINB 1J5EQ 2YYZA 2PNRC 3EECA 4W9JA 1YZ6A 3PGEA 2NVQH 3NELA 2Z9HA 3RN5A 2JRHA 1EOTA 5ELCA 5HKHA 5EPJA 2D3GA 4JI1L 4B3TL 3RMHA 1MKHA 1FJGQ 1ET6A 3VUWA 3PUWA 2ATWA 2K5HA 4UP8A 4JPSA 2NZ1D 1CUKA 1YHAA 3TP8A 3EFUA 1FM0D 3FKIG 1KL9A 3CD6A 3P42A 4DAMA 3SK5A 5AEKB 2QKIC 3BK1A 4K7UA 3VFKA 1B3QA 4Q5VA 1GUWA 4G3XB 3MC0B 4RCNA 3M4PA 3KJOA 3HOVG 3M7NA 1O7IA 3KK7A 1TBEA 1VQ6A 1EM7A 1J0GA 3CCSA 1VQ7A 2JYOA 4DK5A 4FDBA 3HOZG 4PV1C 3MA2B 1NJIC 1PGXA 5BO4B 5CR3A 1PH7A 1BBWA 5C4XG 2RCNA 5J39A 4RGMA 2IYDB 4BVUC 1YD8U 5CC4A 4GLSC 2ID0A 3ONSA 5DEHA 4PT5A 2K6AA 3MVVA 4OZCA 2QEXA 4BA1I 2BKRB 1KTKA 2CFMA 2OQ0A 3M4YA 4GOPB 2B63G 3TUOA 1W3SA 1KLGD 1FGBD 4IOAA 1YJNA 3T4AC 3DWQA 2EZVA 3HP3A 2WXHA 5EE9A 2HJ1A 3ZXRA 1L0XB 1LACA 1YN3A 5M3MB 1Y56A 3QHTA 2L0CA 3K7AH 3AQQA 3NWTA 1I4PA 1E7ZA 1X6OA 2XWBB 3NK9A 2RF4A 1Y1WB 4ZLTF 1LV9A 2CKHB 1IBXB 1NMGA 1C4QA 3H6NA 4C3IG 4YHHQ 4ZRZA 4A3DH 2PQEA 1UWXA 1UELA 2J0KA 1NR2A 4FF3A 4JI7L 1ESFA 4A3CG 3KLWA 1E1TA 2ICEC 2A6EC 3NSWA 2MHVA 3BVGA 4DK1A 2NVTB 3DBRI 1X3PA 4A3JH 2FFKB 2B8FA 4JBWA 4PNYA 2F4IA 5NUCA 4BKGA 2L11A 1EZ6A 4QUFA 1PFDA 4KKSA 4AQ7A 1SNDA 2NMQA 1N5WA 1SYDA 2HJ8A 3TMEA 1PFSA 1HQRD 1VQ5A 3EUB2 3W5VB 1ICFB 3DUZA 1E1OA 1RFKA 2NVUI 2QA4A 1D1KA 4POGA 4EZJA 2PO4A 2MJDA 2HQEA 3KDFB 3STBD 4P75A 3I56A 3L10B 4WIPA 2JA9A 5M5WH 2D3AA 3QA8A 2WKCA 1DOYA 1YIJA 1SB3C 2LHEA 4RMAA 1AE2A 4P73A 3JAMc 4A75A 3KLSA 1I94L 1E2ZA 1SAPA 3U7DA 4CKEA 4QUCA 2MBBB 4YWGG 3D3RA 4L5SA 3CC2A 3GTQB 4B0MA 4IFDJ 3TL5A 4BOSC 4B3SL 2VL6A 2VUMH 4OZAA 1DOLA 4DR4Q 3CWIA 1OFFA 3JAML 1EF5A 4WWNA 3DPDA 1TKEA 2EYPA 3H3VC 2D3CA 3WA0A 2BOSA 4KJOA 1E10A 4KHPL 2R7ZH 2DENB 2GN5A 1OTRB 1PTOH 3IXSA 4DNTB 1J8CA 4W9DA 1WGHA 1KRSA 2B29A 3FPPA 1C4AA 5BN5A 2OJRA 1HE8A 3A9KB 3NZUA 4R4QA 3T1HQ 4A20A 3P4QB 2KC2A 2K5QA 2W82A 4KV2A 1A2TA 2OXPA 3LB8C 3BG3A 1KJTA 4XC2A 3PRMB 5E6OA 2KX3A 2G3QB 1L6UA 1ZDVA 3H8HA 1PRTC 2QF7A 3DWMA 5H1SE 2XTIA 5I9PA 1B1ZA 2JA7H 2FCSA 2CKZB 4ZQ3A 2DNEA 2L15A 3AB5A 1BOSA 2XN9C 3EHVA 1S5DD 1WY8A 3CMEA 4WJ4A 2E76C 4LNQA 1CKMA 3RYTA 3PGZA 3EBEA 4OXPA 4JWUC 2PLPA 2ZJDA 2KYWA 4PYZA 1IBKQ 4X6AH 2WNMA 1J8IA 2F0PA 3I4OA 2MJ8A 1KDAA 2Z4HA 4LJZC 3AEVA 1YQBA 1K8GA 2LWPA 1RRBA 3U52E 4DAYB 3Q8BA 3AEEB 4G0NB 2B2VA 2FCNA 2FINB 1WD0A 4A3DG 1QF6A 3RZOB 4HDQA 5FLMH 2MBEA 1T6BX 1G91A 3S14B 2MEKA 2ZJPA 4LF4L 4EQOA 4A3JG 3RZWC 2K28A 4ME3A 3S15B 3NHEB 1Y8NB 5GADC 3S1MH 2KN4A 4MACA 3I4MB 4Q0FA 2KECA 4NDXA 3SR6A 4BS9A 3KF8A 3A4RA 3HOYH 1P1AA 3DEPA 1XJVA 2FJ2A 2PPBC 2RDFA 1X9NA 1NDDA 2MJ3A 2J52A 1WX7A 1OEYA 4JBKA 1TWCB 3NQIA 3AFPA 4JIOU 5MPOA 3CKIB 2UUBQ 1KFYB 2A8VA 3EJIA 3WANA 5JJIA 1K8AC 3P7JA 2E74C 2GVAA 2IX0A 3D6WA 3R3MA 3CPFA 2CR5A 2KVRA 2LRUA 4GZYC 1G6JA 4REZA 2PZTA 1LTTD 4H0LC 3TP6A 1E22A 1ILQA 1D5MC 2KA7A 2IGHA 2Q2UA 2NR2A 3MP9A 1PRTB 4URKA 4CKCA 2VUMG 1DONA 3T16A 1UGJA 3Q0AA 1EY5A 4JCVE 4ZRQA 1SROA 5IGCA 1AYFA 2ZPYA 4APVA 1I6VC 1WOCA 4DF7A 1R9TB 1GNUA 2BS4B 3UE1A 3HOUB 2PEAA 5LXHA 2EMTA 3JYUA 1JORA 1YEZA 3J80c 2R7ZG 5H92C 2Z59B 4IUMB 4DV6L 4L5RC 1STAA 4RHSA 3VR3A 4CKBA 4ICUA 4KV6A 2B39A 2HIXA 1B2TA 2K7VA 4ZRIA 1Y69U 4S3SA 1KAWA 2YEPB 1V5TA 4DR3L 3CSFA 4KI0A 4G11A 2NVXB 1C9FA 5BYRA 3J80L 2L1AA 4ZOHC 2WXKA 1Q1BA 3MHBA 2XNAC 3MHSD 4W9GA 4K8JA 2JA7G 4QJFA 3TP5A 2I5LX 5EBCA 4W9FA 3PHWB 1N34Q 1ZPSA 1O7YA 1QUQB 3CCQA 5IP9H 2WU2B 1U0LA 4EE2A 3VTWA 2Z6KC 2REXA 2KD0A 2CQAA 1E7UA 2WB1G 3AMUA 1G291 2LVQA 4IDIA 4NJ7A 2GBRA 2JK8A 1L1OC 5CV9A 2JF5A 1HH2P 1UGMA 1MPEA 5HGQA 1FFVA 3J7YW 3AEBB 4JQWC 3T8MA 5C3EB 3U2SC 1P0RA 2JY6A 4IG7B 3ALBA 1OXVA 3HOXG 1JWSD 2Z0DB 2B2YA 5FLMG 2UXDQ 4DV2L 3N1YC 1Q46A 1EL0A 3W3AA 1UNSA 2EXDA 3NTKA 2YU9H 1BNZA 4IOCA 2L05A 2BE5C 2PE6B 3PUVA 4YT0B 2C9WB 4A55A 2DZIA 3ECIA 4NAMA 3KYDD 4TQ0A 4ANXA 1QOFA 1HR0Q 4GSWA 2BYEA 2P5ZX 5KIXA 1K0SA 3RPFC 3VAWA 3T56B 1JQ4A 2IW3A 1V8CA 1KLVA 3HOYG 1FPYA 4RHRA 4K3BA 2JP1A 4FXDA 1A6XA 4DXGA 4A93H 2MUYA 3A56A 5ELBA 4DK0A 3OTOL 1F2RC 1TTNA 5BN4A 4TV3A 3K81C 1OTCA 1SEBD 1TXYA 1S5FD 2A5UA 4IFDI 2VY3A 5C2TB 3GE8C 3H94A 3ZLZA 3SDZA 1HNZL 2FBWB 4XE0A 4RKLA 4EX5A 1W2BA 2GOWA 1V80A 4G57A 3GTJH 5JVH3 2M17A 3TZDA 2AYOB 2OJWA 4J6HA 4N8FA 1II3A 5COYA 2LFIA 3V60A 3KJPA 3DVNU 4ZKCB 2ZEQA 1FXAA 1UE6A 3VXWA 2DNCA 4YIJA 2M8SA 1UEBA 2K03A 4XXEA 3S2HB 5LLIA 1EY7A 2WXLA 3I70A 2I1JA 3TIXA 3H15A 1BCPD 1JICA 3BZCA 4C1NI 4A3IB 1QG7A 3VYRA 4Y7NB 2LRWA 2N9KA 4JW0A 4UDUC 3ZNZB 3HKZE 4IUNA 4GN1A 5KYLA 4MJSB 1YJ9A 1FFUA 2CHZA 3K9PB 1UF0A 1N32Q 2L8JA 2E3TA 1L1OB 1XNRL 2E2HB 2K6QA 4OONA 3AI5A 3OWFA 2DX5B 3FVQA 1CA6A 1PYBA 4TMAB 5CX3A 4CHTB 1TS3A 3TS0A 4FJZA 4F1SA 4BBRB 2KO3A 1OXUA 1H9SB 3EN2A 1MHWC 4OEMB 5JJLA 1VQ9A 5C44B 1SJHD 2XIWA 1XWEA 4J15A 3GTPH 2EJGC 3RNBC 4DV7Q 4CDEC 4GKKL 4WORA 2F0DA 4LCDE 1U4AA 4TUUA 3ZJYC 1WTOA 2N49A 4H7BA 2VQFQ 1MI0A 3EC8A 4DV5L 1CKNB 2A73B 1KLUD 2DY8A 1IW7D 3VRBB 4MM3B 3GTLB 3VVWB 3WWVA 3PO2H 3DWGC 3NS8A 5BYSA 3CXCA 1IP9A 5IY0A 1A15A 2I5HA 2Y5BB 3H3VI 5M3FH 3HRZC 5K36H 5CV6A 1QZHA 1NSNS 3FMCA 1KHIA 4H44C 3RLOA 2MNAA 1KNAA 3PRZA 3GD7A 4KHVA 3Q3MC 2HDMA 5IGDA 3ZJUA 1HZ6A 5FJ8H 1VMCA 4AP4C 2UUAQ 1HJPA 2IBIB 3GTKH 3GTGH 1YVCA 4A93G 1NTGA 4DV1Q 2X6LA 4LF7Q 2IWHA 4AWJA 2UXBL 1PGBA 2NZHA 5I6YA 5TR5A 5M5XH 3NPPA 3CCEA 4LAAA 1VQKA 5G5GA 1NE3A 3N32A 3IRBA 3T3NA 4LK0M 3S2DH 4DFAA 4OZBA 4JI8Q 3HEJA 1RIPA 2JA8H 4RCOA 1EWYC 1LT5D 1D8LA 4MGZE 3ERSX 4HTHA 1SFOB 2V3PA 1I3QB 2NBWB 1M90C 4A4IA 2YTXA 2N9EB 2K25A 1CHQD 1VCIA 2IX1A 2A74C 5AUIA 4JI5L 1PHJA 1GKHA 1KNEA 1IYFA 1YQ3B 1T0RC 1WTRA 3DHIC 3SD5A 5A35A 1YQ4B 2O5JC 1WE7A 4S17A 3DXJC 4BFRA 2CWPA 2BS3B 2KAJA 1Y1VH 1J7AA 4QB4A 5DAUA 4X3TA 2NBUA 3NZSA 2G5DA 2RMMA 5C4JB 4HIMA 4G4KA 5CMDA 1N36L 1WVLA 2WS3B 2PPHA 3S1RH 3WAPA 2VZKB 4XT3B 5CORA 1XD3B 3OG5A 3TZUA 3PO3B 4KGSA 2WKDA 3TSSA 1AH9A 3S17B 3NQTA 2JVCA 3QJZA 2EDGA 4JE3B 3RMKC 2LJ5A 3LYYA 2W54A 3ND9A 1NYRA 4PS8A 4W9LA 3TJPA 4CYEA 1LGRA 1EFID 3KF8B 2RDBC 3PZDA 3VR8B 5F2DA 1IYUA 2EYLA 1TWAB 1BT0A 4ZRPA 4EKUA 3N6RA 4P1BC 2F0MA 1STGA 1SSNA 3I2ZA 1X54A 3Q8CA 5DCNA 5AUKA 3X0WA 3APFA 4N6EB 3JC66 4FBJB 4JI0Q 2D10A 1H95A 5G2NA 4GOPA 2TSSA 3BS1A 2AMCB 3GTMH 4KJNA 1WI5A 5CGKA 1WFQA 1XNQQ 1LABA 3CSTA 2GI9A 3J9CA 4DHJB 2A68D 1FNUA 4LNOA 4FXCA 3MXPA 4LUOA 1E2VA 4B08A 3CQZB 1GUNA 4AYBE 1I6HH 1L0VB 1XF5L 3PO2G 2KDEB 2OOBB 3NJTA 1WWTA 1SBBB 1WGGA 1QKZA 4RA8A 3U50C 5M3FG 4KY6A 5K36G 4GIVA 1IBXA 2LS01 4NP5A 2KFJA 3NXWA 2LGIA 2M56B 5FOBB 3K58A 4BA2I 1J19A 3ML8A 1WTVA 1GB4A 2AWOA 2B2UC 4PYUA 2IO3B 3SVMA 1CM9A 3NEMA 4LTUA 2ZNVC 1WIAA 4KDIC 2IGDA 2MHJA 1WD1A 5FJ8G 3D0FA 1V6EA 3QAQA 2F0OA 4QF4A 2WDTB 2CU3A 3NS1A 1K52A 3A54A 3N20C 3NY5A 1SNQA 4OX9Q 2BT6A 3AEAB 2X6GA 1JC7A 3FDTA 4NW2A 1KIXA 2HD5B 3GE3C 1RDPD 2F4VQ 1VQAA 5LXIB 1S5ED 4JI3L 4JI4L 4A3OA 1C9OA 2G9DA 4B6WA 1Q81C 1HNWQ 1K8RB 4QIWE 1DYQA 3C2PA 1A70A 2JA8G 4ANWA 2KJXA 3KBXA 2J42A 2RSUA 4HKQA 3ZIMA 2KNBA 5CHVC 1GPXA 3UI3A 1XMOQ 2B2WA 3Q6SA 4KN7C 3VDZA 2HCIA 4II3B 1G6PA 1U4PA 1EY8A 2XBBC 4DR7Q 1TKYA 1QE6A 4PG3A 3KDFA 4EQPA 4RH6A 1PFMA 4J1MA 3AEDB 1ROEA 2JZZA 1JRUA 4BXXH 4IWPA 4MGIE 4X62L 5D7GA 4OHJA 4BY1B 1XO3A 1D5ZC 1Y1VG 2F0IA 2DAFA 2IO1B 3PT2B 2VNUD 1PH8A 3T51B 4GNXC 1H9MA 3A0JA 4QQBX 1IYJB 4JBMA 1SGHA 1H9KA 1D6EC 3H0GB 2VQEL 3SK4A 5D2MB 1N60A 2K32A 2PCFB 1HFGA 4LFCL 2AQ2B 3V2TA 5HURA 4RMFA 2HQLA 5M3MH 1Q8IA 1LYLA 4OIJA 1L2NA 4JYAL 4JI2L 4S0RA 2ZJRA 3JVZX 2F3VA 4IN3A 1JWAD 3AB9A 1B50A 3CC4A 1F2RI 1NYQA 1YIWA 1W6KA 1Y1WH 1EY9A 3M4OB 5L83A 3ZGZA 4H02A 2C7HA 3A9KA 4A3PA 3R2IA 2VZAA 1JE5A 4RM9A 1AEXA 3RN2A 3DOWA 2J0TD 4EVOA 4LFAQ 3IFDA 2J4XA 1PMRA 1RD9D 2BCOA 4Z9CB 5GAHC 1ZKHA 1VQEA 2MWSB 2NVTH 2ZNVB 1M8AA 1EIHA 3DBSA 3FC4A 3KYCD 2AQ3B 1MD2D 4HEDA 5CV4A 4NXNL 4HJAA 2E75C 1RFAA 1RYJA 4HVBA 2F0SA 4C80A 1IKMA 1FVIA 2Z1CA 1SIFA 2LI5A 2F0VA 4GDLB 5BYQA 1EWHA 2DGYA 1QNKA 4R9WA 5IODA 2KTRB 1TIFA 2WXNA 1ZOYB 2J0MA 4IC7B 3V6EB 1X3FA 4K2LA 2ONQA 1A8VA 3TP7A 3K5LA 3APCA 4NNJB 4DUYQ 1M1KC 1Y8OB 2M0XA 3P1HA 4DAYA 1YI2A 1MG8A 3K57A 3LXFA 2SAKA 2R92B 1A5RA 4KKUA 4KLKA 3K9OB 2DUDA 3OJ4B 4WH4A 3I4NB 2F3IA 4U673 1K9MC 4BBNF 1BQQT 1H9RA 2PW5A 1GUOA 1EY4A 3B0AA 2F03A 3GTQH 1EUVB 4L23A 2HDLA 3W5UB 1YNND 4IFDH 4RAUC 2EXZA 1WZ3A 4P6VF 5JH5C 1V2YA 1V1QA 4KKIA 3VTVA 1VJKA 3QC8B 1D2BA 1XPOA 1BO0A 1HA5A 3NTIA 1F9RA 1K3BC 2HUGA 1KF6B 1NI3A 5DPTA 2WDVB 4ZRKA 1IZ6A 4DR1L 4HWIB 2D0OA 3PUYA 2ZZPB 4A3BB 1SJED 4A3KB 1YOVB 4GU2A 1SE3A 5GMVA 3QOJA 4BXXG 1WGKA 3DCGA 4M0WB 3SHQA 1FD6A 3EA6A 1OO9B 2FCQA 3K5NA 1VQJA 3Q69A 5FO8B 2SNMA 1IGDA 3ZNHB 1WYDA 1I4HA 3J7A5 4BAXA 4KD4A 5L37A 2CJNA 1PRTD 3UIOB 1LO5D 3M62B 2ENBA 4WWMA 3RFZB 5ELOA 1EYAA 1L4DB 1OQQA 3A8JE 5IYBH 1E7VA 4ID6A 5M3MG 3PIO3 3NBHB 3CU7A 4NQLB 1WTPA 1VQFA 4A3MB 1ISNA 3U4VA 4AH6A 1Y1WG 1KM7A 4H2AA 4KKTA 5E6NA 1YNJC 3OW2A 3W2DA 4V0BA 1PH1A 3CCLA 1L7YA 4FLHA 1QT9A 4FA6A 4J8QA 1KRHA 3RZOH 3NG0A 1ENCA 2HE7A 3AYHB 3MFGA 3S14H 1V81A 4B9WA 2N88A 3ZO5B 1BVSA 2MX2A 3ZRCA 5LMUQ 2N1VA 4EFOA 4UY8C 4DK3C 3S15H 3KUPA 1HNXL 4L1BA 5JOBA 4KVGB 3KLRA 3I4MH 4X57B 4MSQB 1VQLA 3UI2A 1MI2A 1WJUA 2W3SA 3AH7A 3DVGY 5JPMC 2MQJA 1QUQA 4ACFA 5ELNA 3SK8A 2OWOA 2C5LC 1PH5A 1NMFA 1XXGA 1VS0A 1TWCH 1Y8PB 3ULJA 3H3VH 4IPGA 1A63A 3CMMB 4XX5A 1LTBD 2N55A 4JI1Q 4CJ2C 3MTSA 1RWSA 1HCZA 1FJGL 4LF9Q 1E0BA 3WOEA 2FUHB 3A7LA 3R93A 2DY7A 3GOEA 5HHDG 2EE1A 1F9PA 3FHWA 1J7CA 2KACA 3V05A 1EQRA 3M9BA 2Q2HA 2WAQE 3NBIA 3I73A 3DWAA 4K6DA 1EO6A 1SDFA 2Y0SE 1RTOA 2I07B 1H9JA 1SYGA 5IGGA 4WRDA 1IBLQ 2UUCL 4JV5L 2R6GA 4X65Q 4IFDG 3BINA 1R9TH 5E3FA 2O2VB 4DU9A 3M3YB 4TKOB 3A7AB 1HZ9A 1STEA
chains in the Genus database with same CATH topology
1DM0B 2F0NA 3DM1A 2BS2B 3GP7A 4H13C 1RODA 1SYCA 1JRPA 1HTPA 1SXTA 5I2YA 3Q22A 2K01A 1HRJA 3HKZB 1F2LA 4RGTA 4XT1B 2JSOA 2MP1A 1CZPA 2KCNA 1TT2A 4ZUJA 1PTOD 1PLFA 2EYOA 3BDOA 2JA6B 3CHBD 5CV7A 3GO5A 3J7AF 3BWUD 4L2YA 5IGBA 1E6EB 1NR4A 5EE1A 2RPVA 2KDMA 3EQLC 2FUG1 1TY0A 1XLOA 2D9UA 3OOCA 3SE0A 4B0EA 3D4DA 1Z7TA 1ICWA 4U68A 5C3WA 3LNNA 1JR0D 3IT4B 3GB1A 3X3NA 1H9SA 4OIKA 3B2GA 1F2YA 1HHVA 2WLBA 2BE5D 1TIID 2D62A 3SFDB 4XQQA 1HTLD 4TSSA 3NRZA 2EYJA 2EY1A 1C76A 2G9HD 4IKGA 3I72A 1SNCA 5M9OA 3OMCA 2A69D 4X3SA 3X3MA 1GUTA 1QILA 1BUIC 5IOCA 2WXPA 1XCQL 1GB1A 3NP8A 1LLRD 2RQXA 3N52A 1SNMA 2BA1A 1QOBA 4XQJA 3S16B 1E9MA 3K0YA 1KH0A 2F0GA 1E7PB 2JA5B 2F3WA 4BY7B 1GUGA 2QSDA 1KABA 5G3LF 1QOAA 2ON8A 1XYIA 1KDCA 4F8MA 1B3AA 5T1IA 1YJIA 3MZ5A 3QG1A 4HKZE 3VYSA 5I6WA 2RVLA 3NVVA 2WXQA 3B2FA 1EWCA 1PZID 3BYYB 3O13A 3MJ5A 2LY7A 1Q1EA 1ZP0B 2H88B 3VR5A 1TWHB 5LHY1 4YTPB 1TVXA 3KWLA 2QJLA 4WAFA 3MHZA 4RGNA 1YMHE 1LTRD 4E6IA 5C4ZA 3L7ZC 1N62A 1YN5A 4A3FB 4HMJA 5ELFA 2FMMA 3C1FA 4HSVA 3VRAB 4AYBB 2PZUA 1I50B 1VZ6A 2J7ZA 1AFPA 5I9OA 2R61A 5M5YB 3EROA 3VR9B 2JXTA 4RGOS 3U9SA 1AZPA 3LWUA 5HI1A 3K5OA 4ODGA 1OXSC 2JYTA 2JYEA 5ELEA 2EY2A 4O42A 4DAVA 5C5LA 2GB1A 1D5XC 1F2MA 4G7ZC 4R3DA 4KK7A 5FO7B 1R4PB 2R93B 5LNK1 4QIWB 4ZK9B 1JE4A 1STEA 1GUSA 2KHSA 2F0HA 4IUVA 3GV3A 1V1OA 1PRTF 4RNAA 2ZT9C 3R2TA 3S1QB 4YSYB 1GXDC 1ZXTA 1MSGA 2AX5A 3VQIA 3IAS1 1MSHA 3HOWB 2YEPF 3OSOA 1MBYA 3E6ZX 4MN3A 5DNFA 3K5MA 4FYDA 1BR9A 1V8QA 2GRIA 5EKIA 3OMGA 3I90A 1AP0A 1STNA 1X3QA 2B2TC 2WP8J 2LUMA 2NUCA 2A5HA 2WXJA 3VR6A 2KVMA 3E0JA 2OT2A 5BMGA 1EEID 3M85A 4XDDA 2INNE 1IHZA 3QIAA 2W3RA 1D4BA 3P63A 2B2UA 2LMCB 2F0LA 1P7EA 1FR3A 1K50A 1JWMD 4M8AA 3TEXA 1HUMA 4HR7B 2CVRA 1JOKA 2EY5A 1IUEA 3MXUA 5HFYA 4C3HB 4F88A 1LT3D 3E56A 3LX0A 1ZYRC 2EYFA 2RKSA 1RJTA 2EYMA 2I2YA 2F0JA 1SE2A 4J3OD 3IAM1 4K5WA 4X3KA 3FILB 1PTOF 4C7YA 4YTMB 5JXVA 3G7LA 5T8IA 2OF1A 1PYWD 1VDVA 4FF4A 2C9OA 2K5WA 4US8A 1D1IA 2F0KA 1DD2A 5A2QE 2H4OA 4M0WA 2LHDA 1EIGA 1CZGA 1SE4A 4IOIE 1Q12A 2KQ4X 4DNRB 2PKOA 2Q8TA 4B9XA 3PV0A 1ET9A 1CQVA 5EE0A 2BA0A 3RZDB 3NBHA 2ACZB 2K1BA 4I65A 4K5XA 3W9CB 5EGTA 1ONLA 1A3UA 2WIIB 1WXQA 1K51A 4KMUC 1ZKOA 4CQNA 1FNWA 4OO1I 4R8IA 2PVOD 4YXDB 2ZXRA 2RSNA 5HG2A 3AE7B 3L9AX 3GS2A 4A3GB 1UAPA 5EKKA 3HGBA 5DM73 3K6OA 1T5XD 4N59A 2WAQB 1ENAA 2M9VA 3D31A 5D3DA 2EPBA 4JWSC 2Y0SB 5C5MA 3AMZA 4YSZB 3FRPB 1FMAD 1TJEA 4ZUIA 3BK2A 5J22A 4DA2A 1NVID 4RF0A 3TEWA 1AZQA 1HZ5A 4XIGS 1QLBB 3D4WA 3KBGA 1TWFB 3D6CA 2WV6D 4IUUA 3ABVB 2NN6I 1AW7A 2NBFA 2MH7A 4IZ8A 2LKVA 4F7XA 1TZOA 3L4PA 3Q23A 1TWGB 1T3QA 1JQYD 4G7OC 1HFNA 5KRUA 1U4LA 4XTCS 4OW0A 1CFMA 2QEJC 1CT1D 2WU5B 1F77A 1UEAB 3B9JA 4A90A 3BDCA 1BXTA 2BW2A 3IAYA 1KAAA 1RCVD 3OPOA 1PZKD 2L5TA 1ML0D 2IT1A 2Y5CA 2B2YC 3U7ZA 1ESRA 2DWQA 3AV8A 2JEAI 1VF7A 2JXMB 3PZ8A 4ITKA 3FAHA 1Q3LA 2JE6I 5KNCA 2F0EA 5LL6X 5ELDA 1HXYD 3QWNA 4TQUS 3I57A 4G7HC 1DOIA 2HTME 3AM9A 1R4QB 3EVQA 1DOMA 1SNOA 4UAIA 1N63A 1C77A 2B8GA 1TY2A 5E6JA 4HRSA 2E2JB 1WCMB 2F0FA 4KN4C 1I7HA 4ARCA 2QIEB 5EE3A 4XYOA 3PMFA 1G8ZD 3AE2B 1AN8A 2XVSA 4KKJA 3ZQ4A 4K8IA 1QB5D 2V3NA 2EELA 1TYGB 1U4RA 2L9HA 2VXWA 3GTOB 2INPE 3RUZA 3WDNA 1I4QA 1I4RA 1JWUD 2A6ED 3DHQA 4BWGB 4ABNA 5CBAE 1R7SA 3Q8EA 1C4CA 2MJEA 2WDQB 2QCPX 3C8YA 4CGYB 5K5PA 2A6HC 3Q24A 1CJEA 5EJWA 1IW7C 4LLGM 2KWDA 2WXIA 2SEBD 3S1NB 1FYCA 3NE5B 5J1ZA 3N9YC 1Q90A 4C3JB 3H6MA 5C0XI 5G5HA 1BCPF 1FRDA 1K83B 1K53A 1O80A 1NEKB 2H89B 3S9WA 3IL8A 1ACCA 3G6JB 4KD3A 3CRKC 4YTNB 1F9SA 4IURA 5A2QL 2Q8IB 2D5GA 1FCCC 4K6LA 1X32A 1V1PA 1FCLA 4MIUA 3I4LA 1LTGD 1FNVA 2CW0C 4IUTA 4RKBA 1O7ZA 2GA4B 2WINB 2NYZD 1FO4A 1AWDA 4KX6B 1CTMA 1JOOA 2IPKD 1HEZE 4QCLA 4HCEA 1WTXA 1V43A 1XLQA 4V190 2V0GA 1OQRA 1LTID 5D14A 1XLNA 2Z4IA 4C56C 4DQOC 4GDKB 5CV5A 4A8XC 2NVYB 3SHLA 4A3EB 3C46A 3HUIA 2AWNA 2LJIA 1B4OA 1GOZA 3ZYYX 1G2TA 1DXMA 1MHHE 2M19A 3HVDA 1WTQA 3IT6B 4MACA 2O5IC 3VR2A 5FKAC 3EGRA 2L52A 4C2MB 2FE8A 1ENFA 3HZXA 2JX5A 1F9QA 4BBSB 1JWBD 1YNTE 3PO0A 4ULLA 4XWWA 1GHKA 2IGGA 2W55A 1WYGA 2WXRA 2BDOA 4N9PA 1TS5A 1PFNA 4FXKC 4ILWA 5D3IB 3ITPA 1A2UA 1EYCA 3M7GA 5EQ0A 5IIFA 3NVWA 4OO1H 3NWSA 2KEDA 1VZ7A 2F0UA 5FLXE 5CYUA 2LMCA 2KUMA 2QMTA 1HQMC 3BZDB 2BDNA 4WQMA 5I2XA 3AE1B 3KWVA 1S4ZA 4Q2JA 5IGEA 1STHA 2FHTA 2B2WC 1G6ZA 1VF5C 2Q8RE 2M00A 2Z8LA 2JWUA 3DMUA 2Y5PA 1U4MA 2VB3X 2K3UA 1UUPA 2AUKA 3P4SB 1L6VA 5LL6S 5FK9C 5C3JB 1F0ZA 1C79A 3PUZA 1F2ZA 2IX3A 1SMYC 2NN6H 3AE9B 3FILA 1ZUD2 4MT5A 5IT9E 5JPNC 1M4VA 3NUHB 2B2TA 1J9OA 3W1SA 3P20A 1JB3A 2NTTA 1CI3M 3DEOA 4IQZA 2I38A 2PZWA 2L12A 1DZ1A 2PW9A 1VDZA 3OIQA 1XLPA 3T13A 1DJRD 3AN1A 5GXGB 4US9A 2JEBI 1FXIA 2EJMA 2K05A 1IGCA 1VMPA 2E2IB 4WFN3 2IJ0A 4CJ1B 3FKIB 1ZE3D 2K22A 4WJWA 3NUCA 3WCQA 1XX8A 2IDYA 4OO1G 1NAPA 1C4PA 1ZYRD 1MHXA 2K5PA 3HOVB 1JROA 4AS1A 2CHBD 2V4DA 1YNNC 3BYTB 3HOZB 1TS2A 2HDEA 2E2DC 1B44D 1SYBA 4HJGE 1LTSD 5C4XB 2WACA 1RF2D 2OEDA 3RLFA 2JQRB 2M0AA 3AECB 1IYVA 1VLBA 4XYQA 1C78A 1TU2B 2B63B 3TDQA 4NZLB 5EBDA 3BIID 3H91A 1DGJA 1IL8A 1JALA 1QOHA 1EQTA 4RWSC 4XDXA 4F87A 2VZKD 2NN6G 1STYA 4HSPA 2R3ZA 4C3IB 2BB6A 2L32A 4K5VA 4NAWB 2HCCA 1C8CA 1OXTA 1NENB 5E4WC 2M2LA 1DOXA 1A3VA 2CJOA 5FR3A 3T3OA 2ICIA 3VR4A 3SEBA 2NVQB 4FNFA 2XWJB 4IALA 3AE3B 3IFTA 2PIAA 4KTAA 1CA5A 3P4RB 1V1PB 1WSPA 3VA5A 3URYA 4DAPA 4C3HG 3BDLA 5C4HA 3E9SA 3R3OA 4D2KA 2EJFC 3MWYW 5C0XH 4DN4M 2D5DA 2WXOA 5CBEE 3GQBA 1SSOA 3QJYA 2EYHA 3SXHA 1QOGA 1A3TA 4FVMA 4O1NA 3H09A 3I9V1 4NMZA 3AEFB 3P1MA 1J7BA 1HUNA 3OW7A 4P2CB 2PYKA 2BTEA 2LFNA 1W6JA 3MAQA 2IL8A 4WURA 4JK1C 5ISRA 3C1EA 2N7JA 1L5PA 3OIPA 5BMHA 3NHHA 2XRQD 1PUTA 5D65A 2KQ3A 2SNSA 2WXGA 1NCVA 3K7AB 1PTOC 4KHZA 1VRAB 1WRIA 2QDBA 4A6QA 4OGQC 3ONAB 1UWMA 3U4EG 4OL7A 3WOFA 4ME5A 4A3DB 2SDFA 2RSOA 3F2UA 3Q8AA 3L3OC 2F0WA 4A3JB 5FLXL 1PFBA 3PIP3 5JAVA 5JVG3 3OWEB 3J81E 2RBMA 2EVBA 1CHPD 2MGSA 1B9RA 1ZXHA 1B53A 3Q8FA 2TMPA 1E0ZA 3TEYA 2I46A 2K0PA 3U9OA 4TRDA 3RD4A 5M5WB 1S5CD 3D8GA 4RFBA 3PUXA 2A69C 2O2LD 5KEEA 1QCBD 1ILPA 1B9MA 1LTAD 5C0XG 4HEA1 1L0YB 3I91A 2VUMB 4C7ZA 1Q10A 2LEKA 1BUVT 1SYFA 1YJJA 2Q5WD 1PZJD 4L63B 1QWYA 1KDBA 2R7ZB 1PTOB 4XDCA 5IT9L 2K33A 5T1GA 2VB2X 1QJOA 3MEHA 1SNPA 5AFWA 1DOKA 1TS4A 1TQOA 3BVZA 5IGFA 3D4RA 1C48A 3KLSX 2JA7B 4N58A 1TKGA 2C5CA 2KOLA 5JEAH 1K8MA 2F0QA 5E1FA 1BDOA 2N0SB 4ZAIA 4ZHOA 3QOLA 2XSCA 2WB1B 5EKLA 4KGRA 2RA4A 1CZWA 1DCZA 4R8NA 3A55A 4USAA 2EY6A 4K14A 1B9NA 2B2VC 4CJ0B 1MVKA 2XRSD 5HGTA 2A6HD 3HOXB 4N9TA 2DYMA 1EZ8A 3HG9A 2NWGA 2BBCA 2KCCA 3MXNA 1LT6D 3BVMA 3S1MB 5BN3A 2PVGC 3VYUA 2X69A 3HOYB 1K8OA 2EOTA 1WTWA 3NZ3A 4CBVA 1SYEA 2PMZB 2DLBA 2WDRB 3AE5B 5C0XJ 1N61A 1EEFD 3SR1A 1JMLA 3AE6B 1RKNA 1ZXIA 3CRLC 1MGSA 3AEGB 3NTHA 2F0TA 4ZYSA 2Y3AA 1GAQB 4C1NK 4HN7A 4YSXB 1STBA 1XCTL 3SK6A 2KMMA 3A8KE 4PQXA 3E5SA 3VA7A 3ERQA 3QO2A 1E2WA 5KNBA 2BYTA 2L55A 3AE4B 2PMVA 2V4IB 4P16A 2RDGA 3AU7A 3ND8A 2WXFA 3HS0C 1PGAA 2CW0D 3IKJA 1Z47A 4XWTA 1YNJD 2MPMA 4PMCA 2DN8A 1HA6A 3I8ZA 5JEAG 1S5BD 4IUPA 3V3XA 3CIRB 1JOQA 1FD7D 4DGZA 2L1BA 2K04A 1NUCA 4A9AA 2AQ1B 2EKIA 5TSSA 4XQNA 5BMIA 1BF4A 3TEZA 2WXMA 1SIJA 1TR5A 2YU9B 1HPCA 2NB0A 1BBXC 1LT4D 4L8JA 3VYTA 4FP5D 3P75A 2K5DA 1Z6HA 3QB3A 2ZXOA 4C3JG 5KNDA 4A93B 5EPLA 3FPUB 3T53B 3ZJVA 1CK1A 2SOBA 3P4PB 4FF2A 4HAEA 3GTJB 2X38A 4MHEA 4PMBA 2QILA 1ZEQX 1U9RA 1L4ZB 4HROA 1EY0A 4RF1A 4NJCA 1BCPC 3OHXC 2G1EA 2L83A 4I7ZC 4EQNA 4FO2A 4MH8A 2JSVX 2D2CC 3C3LA 1RHPA 2PTLA 4ARIA 1PXUA 1BMLC 3KQ4A 2OEOA 5JJZA 1TKWB 4IUQA 5JEAJ 1JW9D 1CQFA 4FXGC 3MXGA 2ZXPA 3AE8B 3JAME 2N9LA 1SMYD 3ZJTA 1FRRA 4ZHPA 3SFEB 3A8IE 3J81L 5G3LD 3LWEA 3HRDD 2ZW1A 1PDQA 5KGUA 3GTPB 4ZKBB 1XEEA 1EY6A 2ZW0A 3HVZA 1N5XA 2KEEA 4K2KA 5I4DA 1YN4A 1ZDXA 1SF0A 5E4XA 3K59A 4KY5A 3PO2B 4QMGA 2JZPA 3DWPA 5M3FB 5EPKA 4OVZA 2NTSA 3PZ7A 3R8BA 2H1EA 4DXFA 1VZ8A 4HCSA 1OXXK 5FO9B 1IKLA 1BCPB 2FMCA 3GTKB 3GTGB 1EYDA 1EQVA 5M5XB 4NKLA 4PMWA 1T5EA 3NVZA 2RDHA 3S2DB 1I4GA 1O78A 1P7FA 1VR9A 2JA8B 1V97A 2WP9B 2AUJD 5CV8A 4HMIA 2E6XA 5DM63 4LK1C 1QQRA 3ETRA 2O4XA 4KY7A 1XTCD 2OHFA 1GHJA 1RTNA 3J7AV 1Y1VB 1JCKB 1EU3A 4X3UA 5C3XA 2B76B 2DBYA 2JU6X 5H8YE 4FF1A 2BB5A 3S1RB 4L6TB 3TBIB 4EGVA 3MFYA 2DYOA 1G2SA 1I4XA 4KGTA 1EU4A 3V96A 1PDXA 1O7LA 2K9XA 5C6AA 3GV6A 3I3CA 4TQ1A 3NVYA 1FIQA 2J53A 2F1MA 3FEWX 2L4NA 3EFXD 1GJXA 1QNUA 1RM6C 2PW7A 4LMQD 4M1UB 2WQYB 3TN2A 3GTMB 4JX1C 2A68C 5KYIA 3J80E 1FEHA 1I6HB 2YYZA 2PNRC 1EOTA 5ELCA 5EPJA 3RMHA 1ET6A 3PUWA 4JPSA 2NZ1D 1FM0D 3P42A 3SK5A 2QKIC 3BK1A 4Q5VA 1GUWA 3MC0B 4RCNA 3M7NA 3KK7A 1EM7A 2JYOA 4PV1C 3MA2B 1PGXA 5CR3A 5J39A 4RGMA 5CC4A 4GLSC 2ID0A 5DEHA 4PT5A 2K6AA 3MVVA 4OZCA 4BA1I 1KTKA 3M4YA 3TUOA 1KLGD 1FGBD 3T4AC 3DWQA 2EZVA 3HP3A 2WXHA 5EE9A 1L0XB 1LACA 1YN3A 5M3MB 1Y56A 2L0CA 3NWTA 1I4PA 2XWBB 3NK9A 1Y1WB 4ZLTF 1LV9A 1IBXB 1C4QA 4C3IG 4ZRZA 1UWXA 2PQEA 1NR2A 4FF3A 1ESFA 2ICEC 2A6EC 3NSWA 2MHVA 3BVGA 4DK1A 2NVTB 1X3PA 2FFKB 2B8FA 4JBWA 4PNYA 2F4IA 5NUCA 2L11A 1EZ6A 4QUFA 1PFDA 4KKSA 4AQ7A 1SNDA 2NMQA 1N5WA 1SYDA 3TMEA 1HQRD 3EUB2 3W5VB 3DUZA 1RFKA 1D1KA 2PO4A 2MJDA 2HQEA 4WIPA 2WKCA 1DOYA 1SB3C 2LHEA 3KLSA 1E2ZA 1SAPA 4CKEA 4QUCA 4YWGG 3D3RA 3GTQB 4B0MA 4IFDJ 4OZAA 1DOLA 3CWIA 1OFFA 3JAML 1TKEA 2EYPA 3H3VC 2BOSA 4KJOA 1E10A 3IXSA 1PTOH 4DNTB 3FPPA 1C4AA 5BN5A 3P4QB 2K5QA 2W82A 1A2TA 2OXPA 3LB8C 3BG3A 1L6UA 1ZDVA 3H8HA 1PRTC 2QF7A 3DWMA 5I9PA 1B1ZA 4ZQ3A 2DNEA 3AB5A 1BOSA 2XN9C 1S5DD 2E76C 4JWUC 2PLPA 2WNMA 1J8IA 2F0PA 2MJ8A 1KDAA 2Z4HA 4LJZC 3U52E 3Q8BA 3AEEB 2B2VA 1QF6A 2FINB 1WD0A 3RZOB 1T6BX 1G91A 3S14B 2MEKA 4EQOA 2K28A 3S15B 1Y8NB 2KN4A 3I4MB 4Q0FA 2KECA 4NDXA 3SR6A 4BS9A 3KF8A 3DEPA 2FJ2A 2PPBC 2RDFA 2MJ3A 2J52A 1TWCB 3NQIA 5MPOA 3CKIB 1KFYB 3EJIA 3P7JA 2E74C 2IX0A 3D6WA 4GZYC 4REZA 2PZTA 1LTTD 4H0LC 3TP6A 1ILQA 1D5MC 2KA7A 2IGHA 3MP9A 1PRTB 4CKCA 1DONA 3T16A 1UGJA 3Q0AA 1EY5A 4ZRQA 5IGCA 1AYFA 1I6VC 1R9TB 4DF7A 2BS4B 3HOUB 1JORA 5H92C 1STAA 4RHSA 3VR3A 4CKBA 4KV6A 2B39A 1B2TA 2K7VA 1Y69U 4S3SA 2YEPB 4KI0A 2NVXB 1C9FA 5BYRA 3J80L 2L1AA 4ZOHC 2WXKA 1Q1BA 3MHBA 2XNAC 4K8JA 3TP5A 5EBCA 1ZPSA 1O7YA 2WU2B 4EE2A 2CQAA 3AMUA 1G291 4IDIA 5CV9A 3AEBB 1MPEA 1FFVA 3J7YW 5C3EB 3U2SC 1OXVA 1JWSD 2B2YA 1EL0A 3W3AA 1UNSA 3NTKA 1BNZA 4YT0B 2BE5C 3PUVA 4A55A 4NAMA 4TQ0A 1QOFA 3RPFC 5KIXA 1JQ4A 3T56B 2IW3A 1V8CA 4RHRA 2JP1A 4FXDA 1A6XA 4DXGA 2MUYA 4DK0A 3A56A 5ELBA 1F2RC 5BN4A 1SEBD 1S5FD 4IFDI 5C2TB 3H94A 3SDZA 2FBWB 4XE0A 4RKLA 4G57A 5JVH3 3TZDA 4J6HA 1II3A 5COYA 2LFIA 4ZKCB 1FXAA 2DNCA 4YIJA 2K03A 4XXEA 3S2HB 1EY7A 2WXLA 3I70A 1BCPD 1JICA 4C1NI 4A3IB 1QG7A 3VYRA 4Y7NB 2N9KA 4UDUC 4IUNA 5KYLA 1FFUA 2E3TA 2E2HB 3OWFA 3FVQA 1CA6A 4TMAB 4CHTB 1TS3A 4BBRB 1OXUA 1H9SB 5C44B 1SJHD 2XIWA 1XWEA 2EJGC 4WORA 2F0DA 1WTOA 4H7BA 1MI0A 2A73B 1KLUD 2DY8A 1IW7D 3VRBB 4MM3B 3GTLB 3DWGC 5BYSA 1A15A 3HRZC 5K36H 5CV6A 1NSNS 3FMCA 4H44C 1KNAA 3GD7A 4KHVA 2HDMA 5IGDA 3ZJUA 1HZ6A 1VMCA 2X6LA 2IWHA 1PGBA 5I6YA 3NPPA 4LAAA 5G5GA 3T3NA 4LK0M 4DFAA 4OZBA 3HEJA 4RCOA 1EWYC 1LT5D 2V3PA 4HTHA 1SFOB 1I3QB 1CHQD 1VCIA 2IX1A 2A74C 5AUIA 1KNEA 1YQ3B 1WTRA 5A35A 1YQ4B 2O5JC 3DXJC 2BS3B 2KAJA 1J7AA 4QB4A 5DAUA 4X3TA 2RMMA 5C4JB 4G4KA 5CMDA 2WS3B 1WVLA 2VZKB 4XT3B 5CORA 4KGSA 3TZUA 3PO3B 2WKDA 3TSSA 3S17B 3NQTA 2EDGA 4JE3B 3LYYA 2W54A 3ND9A 1NYRA 1EFID 5F2DA 1IYUA 2EYLA 1TWAB 4ZRPA 3N6RA 2F0MA 1STGA 1SSNA 3Q8CA 5AUKA 4N6EB 2TSSA 3BS1A 4KJNA 5CGKA 1LABA 3J9CA 2GI9A 2A68D 1FNUA 4FXCA 3MXPA 4B08A 1E2VA 3VR8B 3CQZB 1GUNA 1XF5L 1L0VB 1WWTA 1SBBB 1QKZA 4RA8A 4KY6A 5K36G 1IBXA 2LS01 4NP5A 3NXWA 2LGIA 2M56B 5FOBB 3K58A 4BA2I 1WTVA 2AWOA 2B2UC 3SVMA 1CM9A 4LTUA 2IGDA 1WD1A 2F0OA 4QF4A 2CU3A 3NS1A 1K52A 3A54A 1SNQA 2BT6A 3AEAB 2X6GA 1JC7A 3FDTA 4NW2A 1RDPD 1S5ED 2G9DA 1GB4A 1A70A 1DYQA 3C2PA 2KJXA 3KBXA 2J42A 4HKQA 1GPXA 3UI3A 2B2WA 3Q6SA 4KN7C 2HCIA 1U4PA 1EY8A 1TKYA 1QE6A 4EQPA 4RH6A 1PFMA 4J1MA 3AEDB 1ROEA 5D7GA 4OHJA 4BY1B 1XO3A 1D5ZC 2F0IA 2VNUD 3T51B 1H9MA 1H9KA 1D6EC 3H0GB 3SK4A 1N60A 2K32A 2PCFB 1HFGA 3V2TA 2AQ2B 5HURA 1Q8IA 4OIJA 2F3VA 4IN3A 1JWAD 3AB9A 1B50A 1F2RI 1NYQA 3ZGZA 1W6KA 3M4OB 1EY9A 3R2IA 1AEXA 2J0TD 4EVOA 3IFDA 2J4XA 1PMRA 1RD9D 2BCOA 4Z9CB 3FC4A 1M8AA 1EIHA 2AQ3B 1MD2D 4HEDA 5CV4A 2E75C 1RYJA 2F0SA 4C80A 1IKMA 2Z1CA 5BYQA 2F0VA 4GDLB 1EWHA 1QNKA 4R9WA 5IODA 2WXNA 1ZOYB 4K2LA 2ONQA 3TP7A 3K5LA 1Y8OB 3P1HA 4DAYA 3K57A 3LXFA 2SAKA 2R92B 4KKUA 4WH4A 3I4NB 4U673 1BQQT 1H9RA 2PW5A 1GUOA 1EY4A 2F03A 4L23A 2HDLA 3W5UB 1YNND 4IFDH 4RAUC 2EXZA 4P6VF 4KKIA 1VJKA 1D2BA 1BO0A 1HA5A 3NTIA 1F9RA 2HUGA 1KF6B 1NI3A 2WDVB 3PUYA 4A3BB 1SJED 4A3KB 1SE3A 3QOJA 1WGKA 1FD6A 3EA6A 1OO9B 3K5NA 3Q69A 5FO8B 2SNMA 1IGDA 1I4HA 4KD4A 2CJNA 1PRTD 1LO5D 2ENBA 4WWMA 3RFZB 1EYAA 1L4DB 1OQQA 3A8JE <