1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1EEFD 1G8ZD 1HQRD 1FNVA 1RDPD 1EEID 1UNSA 2RDHA 3R8BA 1EU4A 1JR0D 1PTOD 3R2TA 1KTKA 1ET6A 1L0YB 1GOZA 4RGMA 1PTOB 2AQ1B 1RCVD 1LTRD 1PRTD 4BWGB 2XN9C 3BVGA 1EWCA 2AQ2B 1JCKB 1PRTB 1LTID 2WV6D 1CT1D 1FGBD 1I4RA 4DXFA 3GP7A 4TSSA 1CHPD 4DXGA 1L0XB 1EFID 2XRSD 1AN8A 1D6EC 1TS3A 1YN5A 1LT4D 2G9HD 1ET9A 1LT6D 3BYYB 3DWQA 1UUPA 1S5BD 1AW7A 4O1NA 1STEA 2ICIA 1KLUD 2CHBD 1BXTA 1TY2A 4RHRA 4RGTA 1TS4A 1I4PA 4C56C 3O13A 1KLGD 5ELDA 5TSSA 1PTOF 4NZLB 2Z8LA 2NTTA 3KLSX 1BCPC 3CHBD 1PZJD 4OHJA 1LLRD 1DJRD 1ESFA 1PRTF 1CQVA 2XRQD 1FNWA 3MC0B 1V1PA 5ELEA 4L63B 1LTSD 1LO5D 1QILA 1CK1A 1I4GA 3BYTB 1FNUA 1XTCD 2RDGA 1LTTD 5ELCA 1T5XD 1XXGA 1TY0A 2QEJC 3SEBA 4RHSA 2R61A 5I4DA 3R2IA 1SE3A 4RFBA 1JWMD 4RCOA 1LTGD 1ENFA 1S5ED 1PZID 1HTLD 4Z9CB 1SJED 2SEBD 1LT5D 3V05A 3URYA 2TSSA 3MFGA 1JQYD 1DYQA 2IPKD 4L6TB 1MD2D 1V1PB 1BCPD 3BZDB 1SE2A 2IJ0A 2NTSA 1D5MC 1TS2A 5ELFA 1F77A 1I4QA 1S5CD 1BCPB 1SEBD 3W2DA 1B44D 5D3DA 1JWSD 1M4VA 1D5ZC 1HXYD 4K6LA 2AQ3B 3OWEB 1SE4A 1I4XA 1PTOC 5FKAC 4ZYSA 1YN3A 1YN4A 1LTBD 3EA6A 3TSSA 1RD9D 1PRTC 1LTAD 1D5XC 5ELBA 2XNAC 1PTOH 3DWPA 3EFXD 4RGNA 1S5FD 1SBBB 1TS5A 3BVMA 3DWAA 1HA5A 2O2LD 5D3IB 1RF2D 1V1OA 3BVZA 1EU3A 1SJHD 1LT3D 1S5DD 1B1ZA 1I4HA 1PZKD 4RGOS 1PYWD 1BCPF 1JWUD 4UDUC 2QILA 4RH6A 2J4XA 5FK9C 1SXTA 1FD7D 1CHQD
chains in the Genus database with same CATH superfamily
2QIEB 1Q81C 4K7WA 4GNXA 4HPMB 4LNQA 3KFUA 2KHJA 1MI2A 4ARCA 2K22A 1HNZL 4DR6L 1QQRA 3HK0A 1IL2A 2EELA 2EYLA 3L9AX 2AEHA 3KUDB 3KYHC 3PHWB 2BE5D 3NP8A 4H2AA 1PXUA 2KT7A 4F8MA 3ZJUA 5HY6A 3J7AV 1FL0A 2KFJA 5G3LF 4R8IA 1VQKA 1R4NB 1RKNA 5FJ8H 2K7VA 1R4MB 3N52A 3SK5A 3KBGA 4OX9Q 1LQBA 1Y1VG 4IUUA 3PUVA 2OCEA 3AU5A 1E10A 2Z9HA 3T51B 1LT6D 3VA7A 4R4IA 1YHBA 1E3PA 2I1JA 3GE8C 4ASWC 2DUDA 2MW5A 3PQIA 1MBYA 2BWFA 4KKIA 1B9NA 4X66Q 3K80C 2RPVA 4C56C 2CW0C 2RCNA 2WXMA 2A68C 2W9NA 3Q8DA 2WX0A 4XYCA 2K6QA 5DEHA 2I5MX 3SHQA 1F2RC 4ITKA 4CKCA 4MT5A 3H8HA 2VY3A 1ASYA 5FR3A 3TEZA 1ZGUB 3VRAB 1W6JA 2WLBA 2NPTB 2LMCA 3HOZH 3GTKH 1EIYB 3SGIA 4JBKA 3STBD 1TXYA 2K32A 3T1HQ 1F9JA 4A3PA 4XDDA 2WIIB 3W1BA 3D8GA 2V0GA 4FXCA 2JA9A 3K58A 1HE8A 1A6XA 3P1MA 2LHEA 4A3GH 2KUMA 4HCPB 4N58A 4ANWA 2K25A 2E76C 4J1MA 2GB1A 2CHXA 1EIGA 4TRDA 3HGBA 3RLFA 3SVMA 1UWMA 3IT4B 2M1MA 1OXSC 3B0AA 1GJZA 5IOCA 2KHIA 4ODGA 2RMMA 3VTVA 3J80E 1MI0A 5IT9E 3A9JB 1V5TA 4MZ9A 2JYTA 3K9PB 4C4VA 2VB3X 3U30A 1ZE3D 1RFKA 1TWCH 4HJKA 4HWIB 3OAWA 2K03A 3MXNB 3Q8FA 1WJJA 3AFQA 4ILWA 3HOZB 4KHZA 3GTKB 3PLUA 5EAYA 1DONA 4J3OD 2JA5H 4S17A 3Q23A 2LI5A 2Y0SB 3DQVA 4WWPA 5DPRA 2KDEB 4G7OC 3W1GA 4A3GB 1XLQA 2E74C 2N7EA 3KQ4A 1PTOH 3DWPA 3A7LA 1SE9A 1LYLA 1SNDA 1DGJA 2E3TA 3L3OC 1PH6A 1J5EL 3ABVB 5E1FA 5E6OA 1EWIA 4TKNA 1F0ZA 2Q2HA 2BDOA 2NZHA 4L8JA 4PS7A 3T3OA 4G7HC 1SDFA 5LMUL 4GLXA 4IOIE 3SU8X 1EY6A 1HA5A 1EFWA 1KHIA 1STHA 1L1OA 4L5QA 3T16A 4IFDH 2KWVB 5LL6S 4DR4L 3DEOA 5CBEE 3WA0A 3T1YL 1SJHD 4AYBE 4WH4A 2NB0A 2L52A 1NR4A 5HI1A 3Q3OC 1TWCB 4IUMB 1JWUD 4AIMA 1NBWA 1F2LA 1U9RA 1JOOA 4JV5L 1A63A 2WNMA 2J53A 3GTGB 4RF1A 2CKZB 2DYMA 1RDPD 2QGQA 5FLXE 2MP2A 2OXPA 1Q3LA 1GD7A 2Z6BA 3CC4A 1JR0D 4IKGA 2IX0A 1ENCA 3E9IA 2IHFA 4ZUIA 3J7AF 1AP0A 1HA6A 2M19A 2ZZPB 1CFMA 1PTOB 3NVVA 4JPSA 4QIWB 1V9JA 2WXFA 2Z1CA 4M02A 2KECA 3HOUH 1IW7C 1I4RA 5JAVA 4PMCA 3ZJVA 2KOLA 1EQVA 4RCNA 1HCZA 4PMBA 2EXDA 4P2CB 1NVID 1Q12A 1AN8A 2E75C 4HAEA 3HVDA 5AJ3L 4LF9L 5LMNQ 2W3RA 4YWGG 1RWSA 5K36G 3U4ZA 2ZXPA 5IIFA 4MGKE 4WQOB 3N3KB 2V1CC 4JOIC 4A93H 3U52E 3V96A 4EZLA 3A4SC 2HIVA 3FILA 3KLRA 4HJ5A 5BMHA 4XDXA 4IW0A 3AE1B 2NTTA 5NUCA 2EKEC 1L2FA 1V43A 2KDFB 3CAMA 2KENA 3EFUA 3FVQA 4LJOB 1VQPA 2YTXA 2WB1G 4RG1A 2DZIA 4LFBQ 1UGJA 4W9IA 3J7YW 4OIKA 3HOUB 1CA5A 1WGDA 2WXQA 4WAAA 1PGXA 3S1QH 3MHSD 4A3JG 1EO6A 3ONSA 4O0AA 4HEA1 2A6EC 4XWTA 2BA1A 4Q5VA 4DQOC 1ML0D 2L12A 2G1EA 5M5XH 2FIDA 4K5WA 3QWZB 4GN4B 1S5ED 4LUOA 2Z4IA 4O42A 5IYBG 3W3AA 4OWWB 4A93B 5D6JB 2F52A 3S17B 1MHHE 3M62B 5HHDG 2H5XA 1EIFA 3RR5A 2L55A 2FMMA 1FFVA 2IGHA 5GAEC 1BVSA 5JH5C 4JK1C 2JSOA 4W9KA 1U4LA 3N30A 5EBCA 1TVXA 3RNEC 1GG3A 1O80A 5C0XJ 3MHZA 1IL8A 2IJ0A 1VQHA 3TUOA 4PK1A 2F0KA 2MGSA 5EJWA 4B9WA 3RNBC 2O5IC 1C48A 2NBFA 1RTOA 5I9OA 4RWSC 4XQNA 4OXPA 3MZ5A 1EY8A 3S1QB 1PTOC 1QCBD 1YN4A 2WAQG 2BKFA 1OXUA 2H89B 3TBIB 3U9OA 3A33B 3I91A 3KLSA 2KN5A 4HROA 3VYTA 1I7HA 2KNBA 3EFXD 4GIVA 4OVZA 2MBOA 5MPOA 5J2RA 1JB3A 2B8FA 1Y1WG 2BH2A 1EYAA 2V3SA 3RNFC 4ZHOA 1S5FD 2ACZB 4RKLA 1J8IA 4AQ7A 5BN4A 1BO0A 4GKKL 3CF5A 1I94Q 1VMPA 3WDNA 1WIAA 1WRDB 4ZAIA 5KNDA 2A19A 3OTOL 3DOWA 4TQ0A 3JAMi 3HRDD 1IPGA 4OVUA 1FEHA 1PH4A 2RPQA 2BB6A 4LJPB 1I4HA 2WU5B 1GUSA 2PQAA 3H15A 4GOPB 1B7YB 3CMMB 3RI7C 1HTQA 4A3BH 4TMAB 3I4MG 2K8HA 2UUCL 4YCWA 1IBML 1QOBA 4BOSC 3E5SA 1G6JA 3K5OA 3BJUA 1C8CA 1NCVA 2DY7A 1N63A 4NAWA 3R7QA 1A70A 3DBRI 2L3ZA 1PH8A 1VQCA 2PMZE 5GMVA 1EU4A 2WB1E 4P74A 1WGYA 1J6QA 4A3LH 1X56A 5J1ZA 3TS0A 3C2PA 1EZ8A 4ARIA 2EJFC 3UE0A 3FEWX 4JI3L 2E2DC 4GLAC 1EY5A 4B9XA 3TL5A 3U58A 2FINB 1PRTB 4OELB 2ZNVC 4YSXB 3A7AB 3L2PA 3J81L 4L5RC 1V81A 3QQ8B 1VQNA 4MM3A 2KCTA 1C78A 4P1BC 1WF9A 3F2DA 3MP9A 1JORA 2RGFA 1SNPA 2F0DA 3RMKC 2F3WA 3V61A 3LXFA 5CHVC 3KH0A 2XGTA 4A3BB 2JN4A 1C76A 1AYFA 4K3BA 3J80L 5IT9L 2FUHB 2KCCA 3SK4A 2UXBQ 3DVNV 3AECB 1KLUD 4GNXB 2EY2A 3NQTA 2F0TA 1TY2A 1VQBA 4K14A 4CDDC 5ELDA 1PH1A 3OSOA 1UEBA 2VL6A 4H02A 2LKVA 4KKUA 4G57A 2MNAA 5C3WA 2I46A 4DUZL 1N6ZA 4KJNA 2WWZA 4EE2A 2WDTB 1XLOA 5EE9A 4HIMA 5C0XG 1K73C 1YOVB 2MUYA 3I9V1 3DUZA 3FKIB 5JEAJ 2QC8A 5F2DA 1NE3A 1QVCA 4OO1I 2C5CA 5ELCA 4LFAL 4CDFC 1T5XD 1L0VB 2QEJC 2REXA 3M3JA 4DAVA 2F0NA 3HOVB 3Q24A 1HNZQ 4DR6Q 3M4YA 2AWTA 5HG2A 2F0GA 5JPMC 4QUCA 1GC6A 2MBHA 3A8JE 1L7YA 3QK0A 3IBEA 2W82A 3M7GA 3HOWB 3UDGA 4DR1L 2BS3B 5FOBB 1OXVA 1WCMB 3UDFA 3VDYA 1PUTA 1RFAA 3RPFC 1KQSA 4B08A 1B3QA 3FPPA 4YCUA 5JXVA 4XQQA 4GOPC 1J7BA 1JT8A 3BG3A 4PZ6A 2V1YA 3NJTA 1BBXC 2CW0D 5DAUA 1DYQA 1KRSA 1T6BX 2A68D 4WJWA 2W3SA 4DAYA 2NTSA 5GAGC 1F77A 2LMCB 2MPMA 1TT2A 2RSOA 3PMFA 3RZOH 1MJEA 3AV8A 4REZA 4BVUC 2ZXRA 2MRPA 1HXYD 4ZYSA 4A3DG 1C4AA 1SE4A 4JLCA 4APVA 3DBHI 1A0IA 1AZQA 3TP6A 1YJ9A 5AEKB 1PRTC 1D5XC 4AP4C 1NDDA 1IYVA 3PO3H 3E9HA 4I6PA 2L0FA 2KDMA 1D1KA 3I2ZA 1XPRA 2PTLA 4DK1A 4LF8L 5JPNC 2D07B 4QAYA 4JWUC 2JXMB 1KAAA 2D3AA 2NBWB 3FAHA 3CCUA 3ZKJC 1YNTE 3HG9A 2LFIA 1V1OA 1M94A 4G11A 2ICEC 3NTIA 2R6GA 2B3GA 3B08A 1LT3D 2D3GA 3TCAA 3GOEA 4C4VB 2PYKA 4JBWA 3WOFA 1H9SB 4JI7Q 4NB3A 1TJEA 1GO3E 1CKNA 1YIJA 4B3TL 3QX1A 3RZOB 1PFMA 4DV3L 2L00B 2XVSA 4DR3L 1N9WA 1JJCB 4M1UB 1FNVA 2QKIC 5A35A 1AEXA 1NR2A 1DOKA 3S1RH 2OF1A 2J0JA 3BZKA 3CPFA 3QG1A 4UY8C 4LF4L 2KWUB 3PO3B 1JICA 1N33L 3TEXA 2AX5A 2C9OA 2MCNB 1V8CA 4KGRA 1EWCA 2AQ2B 1JCKB 2WDRB 2B76B 2FFKB 5JJZA 1VDVA 4ZK9B 1QT9A 2GN5A 1QLBB 3VUWA 4KDIC 4S3SA 4MGZE 1F1HA 1LACA 3G6JB 2ZTEA 4F88A 3AE7B 1FXAA 5JEAG 3A55A 4W9FA 1F9RA 2AL6A 2D0PA 2DN8A 4ZRZA 1XPUA 4HPLB 2NVXH 1S5BD 1SSOA 3JSVB 2L1BA 2CWPA 3E0JA 4IUNA 3AEBB 3EQLC 3HM3A 1K8MA 1J5EQ 1FXIA 4CHTB 3H3VI 4JE3B 1UE6A 4Y7NB 3LGJA 2MP2B 4KMUC 4MGIE 3PVLA 2V3NA 1TS4A 1V9PA 5LMUQ 2FCSA 3EROA 3DDCB 4E71A 3KLWA 1HZBA 3NTKA 4JPBW 4DR4Q 1STBA 2N3SA 3T1YQ 1ACCA 4QB4A 4IWQA 4KKSA 3I7FA 4YHHL 1WTRA 4WURA 4JI1L 4IFDJ 2IBIB 1EOVA 1E9MA 2PE6B 3FC4A 5I6YA 1KDCA 1EOTA 5FJ8G 3IAYA 2OEDA 5IE8A 2K01A 2WXOA 4JV5Q 4YCVA 1I4GA 1OEYA 2BVCA 3V6EB 1IW7D 4FXKC 5E4WC 1UBQA 4YTPB 5HURA 4FA6A 4YWKA 3SEBA 2R92H 5EPJA 2N1VA 1SMXA 2YEPF 2YEPB 3VUYA 2ZT9C 2NVXB 1ENFA 3PRZA 2KHWB 3ZO5B 4YSZB 3ZNHB 5IYBH 4PYUA 4DFAA 1I5FA 1SJED 1QNUA 2HDEA 4NPSA 2X69A 1IGCA 3L4PA 3JAME 2JY6A 2W54A 1S40A 3V3XA 4JOIA 4KV6A 3K5NA 2QCZA 3BDCA 5AJ3Q 4L6TB 4FP5D 3SE0A 5IO9A 3NSWA 4LF9Q 2JQRB 1SE2A 5ELFA 2BYTA 4BBRH 5C4HA 3TRZA 1S5CD 3HOZG 2E2JB 4JQWC 3LDZE 4IM2A 4IG7B 1D5ZC 1C3TA 3Q3FA 4HRSA 3KUPA 5C5MA 4XQJA 3M7NA 4OL7A 4A90A 2MP1A 3TSSA 5IY0A 1QG7A 4A3GG 3UGBB 4KZCA 1RD9D 2R92B 4M8AA 5ELBA 3WAOA 2LUMA 2A6ED 3VH3B 1GUAB 1CMXB 3P4RB 1W6KA 3CCVA 5LHY1 1AARA 1S3OA 2BWES 2CJOA 1QVGA 3NEMA 1SSNA 1TGZB 5D3IB 4DU9A 3BK2A 2N1WA 5C23A 2L11A 4B6WA 4WIPA 2CHZA 3M95A 2DENB 1LM0A 4C3IH 4W9LA 3DLLA 4UDUC 4A3MH 4JI0L 4GZYC 2MBQA 2C7HA 4CGYB 4BBRB 1XO3A 3I4MH 5D65A 1HNXL 2HD5B 4KD4A 3TMEA 1UE7A 4FBJB 1TYGB 4NJ7A 2V4LA 5C44H 2OTLA 1PTOD 1KIXA 2Q5WD 3U4EG 2J7QB 3F1ZA 1YJNA 3T56B 2PZWA 2Q2TA 1VQ7A 1EF1A 5FR6A 4BOZB 3PZ8A 4QL5A 3MC8A 3A8KE 3IXSA 3D4RA 4FO2A 1MVKA 2DWQA 4DXFA 5DNFA 1KD1C 4DR5L 4IFDG 1D1IA 3GTJH 4P16A 3PTFC 4I65A 1LTLA 4C3IB 2BF8B 3VUXA 1XCQL 3I63C 2G9HD 1QF6A 3APCA 2GMIC 4N6EB 3K8AA 4DV7L 3I3TB 4K1RB 1X6OA 4O1NA 2M4NA 4NAWB 3AYHB 3RD4A 1P16A 2MQHA 4RMFA 4RHRA 3B9JA 1KDAA 4GKKQ 2KC2A 5C44B 3G71A 2MHVA 3C1FA 3HOXH 5IN7A 4XGAB 1TWGH 3OTOQ 3AEGB 4KZ0A 3RUIB 3MC0B 5KEEA 2Y0SE 4MTKA 3HOUG 5C3EH 3R7RA 3RLOA 3UDXA 1TKWB 3PRMB 4MACA 2UUCQ 2IW3A 4MM3B 1IBMQ 1XF5L 1FCLA 3RCZA 1MSGA 3GTJB 3NRZA 3MA2B 3IFDA 1XMQL 2EMSA 3BK1A 2B2YC 4DK3C 3CCMA 4RFBA 3X3NA 1BT0A 2O2VA 2C7NB 1JWMD 2B2VC 2D3BA 2XEWA 3DXJC 3ZQ4A 2BTEA 1WGHA 1BR9A 4JI5L 1AH9A 5CTRC 4Z9CB 4JI3Q 2Z0SA 4A93G 3RULA 4AS1A 5I2YA 3A74A 1WFYA 1GKHA 4QUFA 3HOXB 1UZXB 2N7DA 3S15H 2OQ0A 2RKSA 4CBVA 1TWGB 4R1JA 3DHQA 2KANA 4N9F4 3N20C 3U8ZA 1UE5A 1SIJA 1B3AA 2UU7A 3IVFA 5G2NA 3PF4A 5C3EB 3KW5B 2KMAA 3KUZA 2JXTA 1NNXA 2IY0B 4ZRKA 1FGUA 1CZPA 2JZPA 5EE1A 1Y8OB 2A74C 3CP0A 2NCNA 4A3IH 5M3MH 1K50A 1E0BA 3W5OA 1E8YA 4AOFA 3OIPA 3TREA 3D0FA 5M3FH 2B2UA 1GUWA 1BF4A 2KJHB 2YLMA 3D6CA 1ZEQX 4FXGC 4UAIA 3AE8B 2VRRB 3TS2A 1XWEA 4MGYE 2K5WA 3HOYH 4DUZQ 1DD2A 3PF5A 2IO3B 1XX8A 4HK2A 4LMQD 3LJ3A 3ZRFA 2KWDA 3WANA 4UHVA 4A3FH 3AB9A 1TZOA 4EX5A 1I3QH 2J0MA 3S15B 3P63A 1SFOH 1SGHA 2AYOB 4LFAQ 2FAZA 1WY8A 2HUGA 1OO9B 2K05A 5CGKA 3K57A 1FVIA 5HKHA 2PVGC 5EPKA 4DHZE 4A3IB 5M3MB 3B6YA 2IHEA 4BKSA 3NE5B 4DR1Q 1UEAB 2JP1A 2INDC 2AWNA 1IP9A 1UNSA 3IG3A 4LF6L 5BYRA 4EKUA 5M3FB 4N8X1 5J39A 2IDYA 2RDBC 1VQMA 4NKLA 2KA7A 2E5LL 3KYDD 1FRDA 2N9LA 1PRTD 1X55A 3I8ZA 1VQ8A 3HOYB 1ZXTA 3GD7A 1P3QU 1PQSA 2LWPA 3L0WB 4US9A 4F8CB 4A8XC 2JZZA 4KV2A 1T0YA 4S0RA 3DBLI 1NI2A 4J15A 3ULLA 3I5JC 1T3QA 1HR0W 3OJ4B 4A3FB 1EYGA 3R3OA 4M8NA 1QKZA 4C7ZA 1I3QB 1U4AA 1SFOB 2JUOA 2B2WC 2J0KA 3P4PB 5BMIA 4B3ML 4LCDE 3JAML 4A3BG 1CKNB 4HIKA 1UUPA 1AW7A 2VH1A 1AE3A 1V5OA 2Y3AA 1MG8A 4LF8Q 1GB1A 3FMCA 3PGZA 4FN2A 3UIPB 3MFYA 4RGTA 1DM0B 4A3LG 1VZ8A 3L7ZC 2VQEL 5KYIA 1RHPA 1Q86C 2GBMA 1H9KA 3NWTA 5J22A 4NAMA 4GKJL 1H9MA 4A76A 1B53A 4OHJA 1OXXK 1DCZA 3ER0A 1WOCA 5M5WH 1JE4A 3U9SA 4ANVA 1XYIA 1CJEA 1P8LA 3SDZA 1QJOA 4B3TQ 2LZ6A 4II3B 1WX7A 2NVQH 1WJ6A 1I6VC 3CIRB 4DR3Q 3NQIA 2E2IH 1EUVB 2JVCA 2NS5A 3G48A 4BBSH 1STNA 3UF8A 1ILQA 2VUMH 3UINB 2F0PA 5KRUA 5DPSA 2K39A 1U5KA 4WWOA 4R4TA 4LF4Q 1WTHA 1IUEA 1FRRA 5EKLA 4AYBG 1N33Q 1QE6A 1GNUA 2HDMA 1PFDA 2WHIA 2X8XX 1VQ9A 1WMHA 4ICUA 2ATWA 4U673 1N32L 2VQFL 1M1KC 2G4DB 3HIZA 1J19A 1QB5D 1VZ6A 2GBRA 1TIFA 4M01A 4M00A 2A69C 3X23A 4OWXB 2ALYB 4KTAA 1SMYC 1EZ6A 3CCRA 5LNK1 2B8GA 2UUAL 4I6NB 4CJ0B 4X3UA 1EYDA 5M5WB 2MSED 1MSHA 1C0AA 5GAHC 3B2GA 4IWPA 1BUIC 1BCPB 1BQQT 1Q90A 2K04A 3W2DA 4BY7H 4E74A 2EPBA 5JOBA 1JWSD 4V190 2XSCA 2NVQB 2INPE 1HJPA 1J9OA 2E2IB 1K51A 1TTNA 1SYBA 4BBSB 2KO3A 2EZVA 2VUMB 3J81E 4KN4C 1KDBA 4R8NA 1CUKA 2YV5A 4DV0L 2F3IA 4QY7A 1Q7YC 2JA7H 3VQIA 4FHKA 4JI8L 1HFGA 2QW7A 1X32A 4POFA 2DYBA 1PYBA 3NG0A 3CMEA 3UI3A 4YHHQ 4KDLB 3BS1A 3QIAA 4JI1Q 3ND8A 3PIOA 4MTNA 2WINB 3AMUA 1HHVA 4GSWA 3Q8CA 2HHHL 3ZVVA 1MJDA 2HQLA 4JYAL 1C1YB 3ZTDA 3RD2A 2MJEA 1IBKL 3CCJA 4A3KB 1K8RB 3T3NA 1YJ1A 1PYWD 1H9SA 1Q1BA 2KX3A 4JVZA 2M00A 4RH6A 3MXUA 4BY7B 2GLSA 3GTGH 4K3CA 4LNKA 2CQAA 3EN2A 4ME5A 5M9OA 2N9XA 2OJWA 4V0BA 3KWVA 4DAPA 4PS3A 2MFIA 1E7UA 3R2TA 2K28A 4OONA 2UWQA 3PO3G 3HS0C 2FUG1 3ZGZA 2JA7B 5LXIB 4FNFA 1N61A 4IUPA 3FPUB 4KY5A 5GADC 1PGAA 3OYYA 4B0EA 2WV6D 5IKCM 1WSPA 1DOMA 1ENAA 1VF7A 4TSSA 2W55A 1RL2A 1KH0A 3RN9C 1FMAD 2QDFA 2C35B 1H8CA 1G6ZA 2KBNA 2WXPA 2LVPA 2LVQA 3AE9B 4X57B 5IWAL 1WJUA 5BMGA 3TEWA 2ON8A 3JSVA 2Q8TA 2KCMA 3GV6A 1GB4A 4C3HB 1PDXA 1DZ1A 4DDID 3L13A 3HP3A 2LXKA 3MXGA 2H88B 1NSNS 2FCMA 3DBRB 5C2TB 2WDVB 1KLGD 4N59A 4ZUJA 1PTOF 1Q10A 2LASA 2Z8LA 2ENBA 3TQYA 1MHXA 5C1ZA 4YXDB 3BZCA 3LX0A 1BCPC 1AFPA 3RZWC 4DK5A 2QCPX 4HXDA 2ONQA 1SNMA 1YNJC 3M4PA 1V1PA 1UD7A 4NY0A 2GA4B 3F2UA 1TU2B 2K52A 3NTHA 4JI0Q 4L63B 2BBCA 2GOWA 3MJ5A 2K33A 3P4SB 1HNXQ 3I57A 2A8VA 4OO1H 4HTHA 1XXGA 1XD3B 1PFSA 1TY0A 3EBEA 2R61A 3QAQA 1S72A 2Q8RE 4K7SA 3TBLD 4R3DA 1U0LA 4XT1B 3TZDA 4FXDA 3DCGA 1PZID 2L5TA 5JJLA 3MTNB 3S17H 1SROA 2KEDA 3H7SA 2L83A 3CRLC 3FRPB 5KGUA 1QZHA 2MJ8A 2PW5A 2RF4A 3K9OB 2C5LC 1R4MI 4DHZB 1X3GA 2HQEA 5C5LA 2LVOA 2DNCA 4IO9A 3W1SA 5EBDA 3K5LA 4B95A 4D2KA 5E3FA 4C3JH 4NPNA 3K7AH 5JVG3 2BW2A 2MLBA 4MSMB 1Q1EA 4MEMA 4DV7Q 4IM0A 2ZNVB 4ABNA 2GRIA 4BBNC 5FKAC 1CTMA 1YI2A 1V97A 2CWAA 3C1EA 3QOLA 2MEKA 2NVUI 2BYEA 2R92G 2OHFA 1ZXHA 2O2VB 3T4AC 1JWBD 4L2YA 4XT3B 4LF7Q 4QMGA 4Q2JA 4DR7L 4H44C 4B3RL 2B2YA 2CFMA 4IUTA 3UIOB 2B2VA 1TT5B 4TVAB 1NBFC 1MJCA 3K81C 2PNRC 3ZDTA 3VR5A 3IAM1 3BY4B 4DDGD 2BYVE 5CV6A 3LYYA 4DHJD 2N78A 1XMQQ 1H9JA 2F0HA 1PH7A 1N34L 1WYWB 2V3PA 2VNUD 4C3JB 4BBRG 2ZVOA 1P0RA 2PNHA 3K7AB 3EFCA 4JI6Q 5IP9H 3Q8BA 3Q8AA 4JI5Q 3RN2A 2QDBA 4HR7B 1KFYB 4WQMA 1HQRD 3NHHA 4JBMA 4LF5L 1D3ZA 2R2QA 1UELA 2EKIA 2UUBL 2BGFA 3A1QA 3DBHB 2G45B 1F2ZA 3KJPA 4GDLA 4EZKA 2NVYH 3MHBA 2NWGA 1NMFA 2SOBA 1Y8RC 1TZ1A 4ZRJA 1YJWA 4H0LC 2NMQA 1LABA 3ITPA 3SXHA 4A3CH 4DF7A 3S1MB 4YY3L 1PA6A 3QCAA 1QOGA 2QMTA 4AWJA 1CT1D 4G0NB 1X9NA 3TP5A 2K5DA 4LNNA 4DXGA 3R66C 4K8IA 4LW1A 5K5PA 2DAJA 2KXJA 1TS3A 3I3CA 4C3IG 1M90C 3AE5B 3U2SC 4FADA 3ZJTA 4WJ4A 4A3MG 1CI3M 3EVQA 4IJLA 1HPCA 2HDLA 2B39A 5CORA 1FPYA 2M0XA 1E0ZA 2C7MB 1Q46A 4KI0A 5H1SE 2KVZA 4OZBA 4P6VF 1DOXA 2GVBA 3H09A 3H3VH 4TQ1A 2EDGA 1JRPA 4NJCA 1BXTA 3H6MA 3NBHA 5C44G 4K7UA 3HKZB 2NVYB 2KVRA 2Z6KA 2N49A 3J80c 5IT9c 5IP4D 2B63H 2N7JA 1IBLL 2UU9L 4IC7B 5G5HA 2DHZA 5IP7H 1B50A 1PRTF 1K8AC 1CSQA 1K8GA 1JQ4A 3ULPA 3U50C 2UXDL 3I70A 1FJGL 2K3UA 3NVWA 4DBGA 3SFEB 4ME3A 2FXQA 1IGDA 2MJDA 3FKIH 1F9SA 4L5TA 3ZRCA 5D7GA 2JK8A 1FNUA 2PI2A 4X3KA 1Q0WB 5AZFA 1RJTA 3WCQA 3CXCA 4A9AA 4KN7C 4DA2A 1A2UA 3HOVH 1QZGA 4LF6Q 1GC7A 1YBYA 4EQPA 3AU4A 3PSIA 3KVFB 2JEAI 3NHEB 4L1BA 5J18A 2KD0A 2E5LQ 1TKGA 1E22A 2B2WA 2K50A 3TDQA 2D0OA 3HOWH 1NEKB 3R3MA 1HNWL 1U4PA 4ZRQA 4CKBA 3X3MA 3T13A 1WCMH 1EQQA 4X65L 1YD8U 4LFCL 4B9KA 4AJWA 4FJZA 2VXWA 3H0GH 4E6IA 1P1AA 3URYA 3DPDA 3HOXG 2AUKA 2B63B 4IFDI 4GS3A 4CYEA 2INCC 1MHWC 1SYGA 1UAPA 3EHVA 1VMCA 1MD2D 3GE3C 5C3EG 2KX0A 1BKBA 4DUYL 2B2UC 1Q1OA 4W9CA 5C4XB 1B44D 3MXPA 5D3DA 5I9PA 2MX2A 1YQ4B 2QF7A 1KLVA 2UXCL 4ZKBB 5CHWA 5FLXc 2L32A 4HSVA 3EA6A 3CD6A 1PYSB 1H4RA 4YL8A 3HUIA 4RMAA 3NXWA 2VQEQ 1MPEA 4RM8A 4R4QA 1ZKOA 3AE2B 4GKJQ 4HVBA 1WMHB 3MEHA 1ZKHA 4F1SA 3ERSX 3RT3B 1QVFA 3I4LA 4RA8A 4FF2A 4L23A 1NY4A 3IRBA 3H0GB 4FJVB 4NW2A 2WXHA 3ZW3A 1UE1A 3EJIA 1WFQA 1Q82C 2ZW1A 1SN8A 2A69D 4IOCA 2A5UA 4C1NI 3N6RA 5M5YH 3GO5A 1OEYJ 4A3EH 3GTLH 1SMYD 2JYEA 2J4XA 1R9TH 3ZYYX 4A3IG 5M3MG 5IYDH 1CHQD 5IGEA 1N32Q 4QQBX 5M3FG 3F8TA 2LHDA 2KLGA 4KHPL 1ICFB 1BBWA 1GXDC 4IPDA 1JJGA 1YVCA 2F0WA 4X3TA 4J8QA 2JA6H 4WORA 2CR5A 3WAMA 1RCVD 3HOYG 1B8AA 1KM7A 3AEAB 2UUAQ 1KJTA 2KACA 1K0SA 1WXAA 1E7ZA 2BH8A 4EGVA 1E7PB 2KCNA 3EGRA 2Z4HA 4A3FG 4XDCA 5CC4A 3VDZA 1CKMA 1E1TA 4CJ2C 4ZRPA 4BKTA 4DV4L 4HIOA 4DWFA 2IX3A 2ZM6L 4KY7A 5M5YB 4A3EB 3F2CA 3PUXA 1ET9A 3GTLB 3H3VC 1WRIA 2CKHB 3BYYB 1QOFA 2JT4B 1KABA 4DV0Q 4KIKA 4N9PA 1R9TB 2RBMA 2J52A 1HZ9A 4DNRB 3O65B 1ILPA 4JI8Q 4TQUS 3RN5A 2ICIA 4R4OA 4Y7NH 3W9CB 2O6VB 4YSYB 2KK8A 1ZDVA 3Q22A 4EZJA 1HEZE 2R7ZH 3VXWA 3AU7A 2HHHQ 2N4FA 2F0UA 2MWSB 3KOJA 2AWOA 1XJVA 4JYAQ 2JQOA 4HMJA 2JA6B 1X3QA 1WR6E 2MBBB 1IBKQ 1CQVA 2WXJA 4XX5A 3C8YA 4ULLA 2DJGC 4WRDA 1L4ZB 1SR3A 3U7DA 1E5WA 2PKOA 3MAQA 2SNSA 1LTTD 5AZHA 4II2B 1J0GA 2NR2A 4IJHA 3AEEB 5GXGB 4EQ5A 1VDZA 2RQXA 2A1AA 1F9QA 5IYCH 1HR0L 4WJNA 1E2ZA 2WXRA 1VQAA 4YT0B 1OGWA 4KY6A 2DZJA 1V86A 3C3LA 2M56B 2K0PA 2D3CA 4RF0A 2I38A 2R7ZB 1Y56A 3NWSA 1G51A 1Z6HA 2CU1A 1RTNA 1KNEA 1SYFA 2PEAA 1CKOA 1TQOA 4DN4M 4KHVA 4BZAA 3GB1A 1V1PB 4FF3A 2KMMA 4FVMA 1NI3A 1E1OA 1V49A 4MJSA 1BCPD 2E2JH 2ZJPA 5IWAQ 4WJPA 4YWLA 1YNJD 1XT9B 1XEEA 2EJMA 2OWOA 1GHJA 4BBSG 4LUZA 5BN3A 2VUMG 1V6EA 2J7ZA 4DV1L 2RDFA 3IL8A 2EOTA 4YWMA 4KKTA 1WZ0A 1HTPA 2BB5A 5EE3A 2FE8A 3DHGC 4O2DA 2PE9A 2D2CC 1YIWA 2HTME 2EQSA 1UBIA 4OEMB 1YHAA 1XPOA 3ZNGC 3D32A 1TS5A 3OMGA 2WX1A 3GZNB 2KKCA 2HJ1A 3LB8C 4C00A 4ZCKA 2VZAA 3OG5A 2AMCB 5EDSA 2C60A 4UPAA 2JWUA 1FD6A 3NENA 2PVOD 2QILA 1TWHB 4IUVA 4BY7G 2ASQA 5FK9C 3ZDMC 4CHKA 3NS1A 4LNIA 2AHOB 1GJXA 3KF8A 3GTPH 3S1NB 2KDBA 1GPXA 2Y0SG 2WKCA 2RA4A 1GUTA 3CC7A 4W9HA 4M0WA 5DCNA 2LGDA 3KK7A 3JYUA 4W9EA 4K2LA 2KYWA 1WH3A 3OJ3A 4F7ZA 1G2SA 2JA7G 3P42A 1UF0A 2F4VL 1OTRB 2HJ8A 3BIID 4LDTD 2VZKD 3Q6SA 5BYSA 5E4XA 4JGHB 5AZGA 3I73A 4ID6A 2JWZA 4HN7A 4PT5A 1FGBD 3Q0AA 2B3AA 2DZMA 4JX1C 5FO7B 1STGA 3CC2A 1BOSA 5CV7A 4X64L 3M4OH 4DHJB 1YN5A 2RSUA 3P4QB 1WX9A 3VAWA 2EIFA 2M8SA 4N9TA 2NN6H 2DX5B 1T5EA 2ZXOA 4C3HG 2OQKA 3GTPB 4DR7Q 1BUVT 3OW7A 4B3RQ 1STEA 2IGGA 3C19A 5FO8B 3A1QB 1Z9FA 2BOSA 3NUCA 3MWYW 2JA8H 4HJ7A 4GDLB 2F0EA 1GAQB 3O13A 2BQQA 2FCNA 5TSSA 3Q6BA 4DK6C 2HCIA 3KLSX 1V8QA 3I55A 4OWTB 3PUYA 1SE8A 3ML8A 4Y52H 2XRQD 2IY1B 1WTQA 1R4PB 1KRHA 1E90A 3AEDB 1N34Q 1P7EA 4HJAA 2LY7A 3S16H 3DBLB 1PFNA 1IBXA 2PQEA 3OPOA 4UP7A 4QCLA 2WS3B 3M4OB 4LF5Q 4PMWA 2KMCA 2ZPNA 1SNCA 2UUBQ 1C9OA 2Z0EB 2NZOA 1JJ2A 3PPAA 4K8JA 5L37A 4OGQC 4HCEA 3I4NH 4N8FA 3P1HA 3AE6B 1VCIA 2H4OA 1IKLA 4YY3Q 2WXNA 3NBHB 4GN5A 2G3QB 2JA8B 2KJ6A 3W1SC 2GBKA 5BO4B 4KD3A 3I72A 3PUWA 1K3BC 4B3SL 2N88A 2TSSA 4AH6A 3MFGA 3N1XC 4ICVA 2XTIA 4JCVE 1LUZA 2RVLA 1RYJA 5L83A 1L4DB 3S2HH 2KTRA 1WD1A 2CCZA 3S16B 1S1QB 4FF1A 4H13C 1GVPA 3IFWB 1B2TA 1ZXIA 4LTUA 4OO1G 2MA9B 5GROA 1C7YA 1I4XA 1MIUA 3I56A 1OFFA 1VQLA 1WXSA 2CHWA 4KVGB 1WTWA 5D2MB 1WGKA 2LGYA 1QOHA 1WM2A 3PV1A 5IGBA 1G2TA 5G5GA 2I1KA 2XNAC 1U4MA 1IBLQ 2UU9Q 3I4NB 2LGSA 3PIO3 4HLEA 2JZ3B 4EUTA 4URKA 3D3RA 3D4WA 1WR1A 3CSFA 2D5DA 5AUKA 1G291 4BXXH 1X3FA 5CBAE 2UXDQ 3UE1A 1FJGQ 4DNIA 2BA0A 4GXBA 4DPGA 5IGFA 4K0KL 1YNNC 2NZ1D 4C1NK 2PO4A 4C3JG 3S2HB 3DHIC 4RGOS 3SDLC 1IYFA 1K52A 2XWBB 1EM7A 1B9MA 4R4CA 3NZSA 4I7AA 3GTOH 1HNWQ 4X65Q 2F0LA 4EVOA 3GQBA 4LFCQ 1N5XA 3LWEA 3VRBB 1L0YB 2NUCA 3E3XA 2Y5BB 2LSSA 4BS9A 4BWGB 4P71A 1EIHA 2DYOA 1YNXA 2Q2UA 3N32A 4WFN3 2AL3A 3Q3NC 4RKBA 4A20A 4DUYQ 3KDFB 3RFZB 3E6ZX 1I94L 2A6HC 4J6HA 2YVCA 1EY9A 2UXCQ 4HCSA 3QHTA 2NBVB 4NQKE 3S2AA 5FLMH 4HKQA 1LFDA 2JRIB 4MELA 3LNNA 1WZ3A 5IP9G 1BNZA 3Q8EA 2F0QA 1Q8IA 4BKSD 4OVVA 2Z6KC 3EIVA 4DR2L 3GTOB 4ALPA 4DV5L 4HIDA 3M3YB 5L95C 5CV4A 2K5NA 1OXTA 2KLCA 3VYSA 2EY1A 3PIPA 2JX5A 3JAMc 1Q5WB 5JZEB 3HKSA 1RLFA 2VH2A 3RNGC 3A0JA 3DVNU 1AZPA 2X38A 3PT2B 1PH5A 4U68A 4A3CG 3TJPA 3QJYA 2JYOA 3CU7A 2FNJB 5C4JH 3AN1A 3AQQA 4QF4A 5C3XA 2WXKA 3QIJA 3A5UA 1CK1A 4LAAA 3L08A 3U7ZA 2Z59B 5FO9B 1A3TA 3ND9A 1VQOA 4LUVA 3ZJYC 2BS4B 2WGSA 4PQXA 4DNTB 3A54A 4OZCA 1SE3A 4IPHA 4KHPQ 4C80A 4KIKB 2KN4A 5H8YE 3DEPA 3CPWA 1V80A 1PHJA 3EUB2 4GLVB 4CDCC 4HPPA 3I90A 3ZTCA 5E6NA 1WYGA 2N8NA 3FP9A 3DVGY 2LGXA 2IO0B 2B2TC 1HZCA 3RLNA 1VQJA 2B63G 1L6VA 3ZNZB 1T0SC 4BFRA 3TEYA 5IP7G 3ICEA 3APDA 4DV4Q 1ROEA 2CS4A 2FCQA 2FBWB 2ZM6Q 2X6GA 5A2QE 5C4JB 4HKZE 1K3RA 1TS2A 3FKIG 4KGSA 1SEBD 2F3VA 4DV3Q 2ZTCA 2F0JA 2BT6A 1HUNA 4GLSC 3HOVG 1YITA 1CM9A 2Q2IA 1T0RC 2HE7A 3HOWG 2HD3A 1VR9A 1WCMG 2F4IA 1TIID 1XCTL 3ETRA 2CQOA 1PGBA 3H0GG 2QJLA 1NJIC 2K5VA 5I6WA 2LD9A 3T9LA 4US8A 3SK8A 1W2BA 4A3KH 1ISNA 2EE1A 2DNFA 1J7CA 1E7VA 3SK6A 4MJSB 1YQ3B 2JE6I 1WTOA 1KL9A 2WKDA 2OJRA 1S4ZA 2LXCA 1BCPF 5JHBA 4WWNA 1LXDA 3AH7A 3V60A 3HKZE 4KSLC 2KQ3A 3H91A 1HR0Q 1H95A 1ZW7A 3K6OA 2K1BA 3TN2A 1YHQA 3B1LX 1SB3C 3K5MA 4MH0E 3QA8A 4EFOA 2RR9A 3UI2A 1F2YA 4CQNA 3H7PA 5CV5A 2WQYB 1GOZA 4BY1H 1XNRL 2OTJA 3L10B 5IAAC 5IGDA 1TBEA 2K8CA 4MN3A 3GTQH 3TEHB 1SIFA 4ZHPA 4GN3B 4IPGA 2PPHA 5ISRA 3PRPB 2EYJA 1IZ6A 5C0XI 2XRSD 4JC0A 4IDIA 1IXRA 4LNOA 1LGRA 2I5HA 2D9UA 3U4VA 1FFUA 1Y14B 4A3EG 2RD0A 4USAA 4DV1Q 1WI0A 4QGUA 4JI7L 3Q69A 4AUQC 3W5VB 5HGTA 2BS2B 3MJWA 5IYDG 1MFWA 5CYUA 3VR2A 4C3HH 3KF8B 3RZDH 3PO2H 2O6VD 3IHPC 2L1AA 3PUZA 4M0WB 3WALA 2O6VA 1D8LA 1KRTA 5HGQA 2WXIA 3S2DH 4MDKE 1PH3A 4TV3A 1I4PA 1QWYA 4BBNF 5E6PA 2PJHA 4BKGA 1X54A 3UDIA 1X3EA 3P7JA 1O7LA 4BY1B 2JA6G 1VQ4A 2ZVNA 4IUQA 1LLRD 3AEVA 4LDTB 4LNFA 3NUHB 2VZKB 1M8AA 4PZ8A 3KYCD 5LMNW 3GTQB 1RRBA 4YTMB 4FJYA 4XTCS 1F2RI 1LV9A 1VQIA 4TKOB 2YYZA 2IGDA 1HFNA 2K5QA 2F0SA 1K83H 2RDGA 1A2TA 1X65A 2LEKA 2PZUA 3IFTA 1JWAD 4MHEA 2F0OA 1AE2A 1NUCA 1UWVA 2R93H 3AMZA 4RCOA 4ANUA 2G5DA 2NBUA 3PO2B 2F4VQ 1GUOA 3RZDB 4HCNB 2A73B 2SEBD 3S2DB 2R7ZG 2WP8J 4X62L 1XLPA 2QHOA 2JEBI 2KFKA 1JMCA 1QOAA 2KTFA 3AM9A 3M85A 2PIAA 4K5VA 5EE0A 2B29A 2CH4W 2AUJD 1Z7TA 4X64Q 4ZQ3A 5E7NA 2OEOA 3MVVA 3VR4A 3BZDB 5G55A 3WIMA 4PNYA 2KC1A 3Q14C 3SR1A 1A3VA 1DOLA 2KVMA 1IBXB 3KBXA 1K9MC 3CCLA 3OWEB 2D5GA 1K83B 1R7SA 2JA5B 4P75A 3KF6A 5KNBA 1JE5A 4GOCA 2R93B 5IYCG 4P72A 5JJKA 3V62A 1VQEA 2D2QA 3BDOA 2GVAA 5AFWA 4NXNL 1HZ5A 2ZJDA 3AULA 4IM3A 5H92C 3N1YC 3CCEA 1R4NI 4DR5Q 3CCSA 5TR5A 3RYTA 3NVZA 2YTYA 3G6EA 2EY6A 1ESRA 2MO0A 3AI5A 4JW0A 1F2MA 1OQQA 2CVRA 5DPWA 2MQJA 1SLJA 2BKRB 2KTRB 1L2NA 3PZ7A 2E2HH 4G4KA 1T9HA 4OIJA 4IOAA 1SXTA 2VW9A 1FD7D 4NNJB 2QSDA 2JXXA 1VS0A 3JC66 3UQBA 1KF6B 4ZYNA 1CSPA 5T8IA 4B0MA 3HM6X 2EY5A 3R8BA 2MO1A 2K6AA 1ET6A 1EY7A 1NAPA 2SDFA 2XIWA 4B3SQ 5BYQA 3ZXRA 3PCOB 2BYFA 3AEFB 4GDKA 2KJRA 3T8MA 3S1MH 2K4KA 1O78A 2L9HA 3BVGA 4EOYA 2GBNA 4NMZA 5JJIA 1LTID 4FHJA 1C4CA 3CQZH 4LLGM 4NXML 3RUZA 1ZYRC 1I35A 4CO7A 2WXGA 2F0IA 1UWXA 3RNUA 4L5SA 1YNND 2V9HA 1A5RA 2E2HB 3PREA 3DWQA 5CHFA 1KC8C 2KHSA 1E8ZA 1N5WA 2HT1A 1WXMA 4DXAB 2K1FA 2DJFC 5EQ0A 4P73A 2CHBD 1CZWA 1XNQL 4W9DA 3W5UB 5A2QL 2EXZA 1WYDA 4BA1I 4P7IA 2N9KA 4AQYL 2HCCA 5ELOA 4NZLB 4K0KQ 4NQLB 4WJ3M 1SYCA 3CHBD 1DOYA 3QOJA 3H1UA 1OQRA 5J3BA 1FNWA 3H94A 4DKAC 2ASBA 1LTSD 1MGSA 2EJGC 3CQZB 1PH9A 2M17A 3VVWB 3TZUA 3VYRA 2L7RA 2O4XA 1WJ4A 3D4DA 4G7ZC 2A6HD 3J81c 1Q8KA 3P20A 4ACFA 2ZJQA 2BDNA 4PZ7A 1TWFH 2KEEA 2NN6G 1EL0A 2HIXA 3C0RB 4GGQA 5M5XB 1ZOYB 1PLFA 1FIQA 3K7UC 4I6LB 3G7LA 2ES2A 2JA8G 3S14H 5JHAA 4I7ZC 1VZ7A 4C7YA 4A75A 3V05A 4A4IA 2ID0A 2L0CA 5JVH3 1E6EB 3TIXA 3K59A 2LRUA 1YX6B 3PLVA 1CQFA 1K28A 3QARA 3QC8B 4JI4L 1U4RA 3H9DA 1II3A 2K5PA 5C4XH 3KUCB 1EYCA 2ZTDA 1EY4A 4DR2Q 5BR8L 2CH4A 2AQ3B 4DV5Q 5KYLA 1EF5A 3QJZA 1TKEA 3ERQA 1XLNA 1TWFB 1P9DU 1PFBA 2K6DB 1K8OA 3I4NG 2IO1B 1K0RA 2K8BA 3ZUNA 2XBBC 1WWTA 5LL6X 2IO2B 3J7A5 1YEZA 1GUNA 4DV2L 3S14B 1TR5A 1EWHA 4R9WA 1X3PA 3Q2AC 4EQNA 1FCCC 2Y5CA 3E56A 1JW9D 4HJGE 3AXCA 1ICWA 3A56A 1RF2D 4K2KA 3PZDA 2EVBA 3DBSA 5KHOA 1Y1VH 1S5DD 4B3MQ 2B2TA 2JF5A 3PO0A 3OMCA 1B1ZA 4DV6L 3AE3B 2V4DA 2UYZB 2INNE 4RNAA 3RZFA 2Q8IB 5EKKA 3AE4B 1GM5A 3NY5A 1DJRD 3S24A 1EEFD 3Q3JA 3OW2A 2G4SA 1QUQA 4AJYB 1EEID 5DLQE 2RDHA 3J7ZC 2KDIA 3WAPA 3DVGX 1CZGA 3SR6A 1L6UA 4K6DA 1H9RA 1KTKA 4LJZC 1RIPA 3D6WA 1E8WA 1TWAH 1E2VA 3VFKA 3HHMA 1NENB 5IGCA 5IGGA 4BXXG 1D7QA 3NOBA 2L76A 3P75A 4ZDVA 2WAQE 1XMOL 3KDFA 4HSPA 4EQOA 2RHQB 3HZXA 3A9KA 3M4QA 2L8JA 2JRHA 2XK5A 1Y1VB 1LT4D 2CJNA 4GN1A 2PMVA 4JI2L 5DM63 1ZDXA 4XIGS 5LXHA 1UGMA 1KAWA 3V2TA 5COYA 2VS1A 4AYBB 4DK0A 3FKYA 3NZUA 2VQFQ 4FDBA 1FXTB 3ML9A 2WACA 4H7BA 4X6AH 4NDXA 2KQ7A 3NELA 3H7PB 1IKMA 1YMHE 1MG4A 1N36L 1TWAB 4IALA 1RODA 2PI2E 2R7FA 3E9SA 3QB3A 2F0MA 1HH2P 5FLXL 4K81A 1A3UA 3A4RA 4XZ4A 3IT6B 3ZLZA 2PW7A 3PSEB 1VF5C 2BCOA 4XXEA 3BYTB 2KAJA 4NJ6A 5GQOA 1YZ6A 3HRZC 3KWLA 3VTUA 1J7AA 1N8RC 5I4DA 1EQTA 1SYEA 2XWJB 5FLMG 5HFYA 5DM73 1AWDA 3A5ZB 2D62A 2IWHA 1LTGD 3EECA 5LLIA 3OOCA 1WXVA 1XNRQ 1Z47A 3GDEA 1F9PA 1WM3A 3SFDB 1EWYC 1LT5D 1R4QB 1D2BA 5I2XA 1Y8NB 1PVOA 2WYQA 2KQ4X 3NK9A 1JQYD 2IPKD 2I5LX 2RSNA 1I6HH 1XTDA 3DM1A 2CU3A 2DGYA 4IQZA 1HRJA 4JBJA 4GNXC 1SNOA 3P2BA 1KOTA 2H1EA 2LXJA 2PLPA 4J6IA 1M4VA 4KLKA 1G6PA 4OX9L 2I0QA 2DY8A 3ULJA 1DGSA 4WAFA 2IL8A 1VD2A 1ZP0B 2WP9B 2BE5C 1L5PA 2D11A 4C2MH 4HJ9A 2F0VA 3QO2A 1VLBA 3ONAB 2F0FA 2L4NA 4IN3A 5EKIA 2N55A 2QA4A 4X66L 5G3LD 4G3XB 2KFKB 2NVTH 2O2LD 3MEFA 1L1OB 1IYUA 5IODA 1C4PA 1UH6A 2WDQB 3TP8A 2N9EB 3ENEA 4GB9A 1I6HB 2BPSA 2I07B 2PCFB 2KQSA 1RAXA 2E8GA 3AFPA 1TWHH 2J0TD 3A8IE 2VB2X 4FF4A 1KXLA 2DZKA 3ALBA 3H6NA 1ASZA 5K36H 3S1NH 1WTPA 3IKJA 5ELEA 2ZCCA 2EYPA 3T1HL 2HTHA 5IA7A 1EUJA 3K0XA 4WWMA 1OTCA 2R3ZA 3KF6B 4CJ1B 4X62Q 3I4OA 3S1RB 5CR3A 3PHXB 4C2MB 2K5HA 1HZAA 4ZRIA 1FM0D 1WGGA 1VJKA 2DNEA 1Y69U 2XN9C 3Q3MC 4JL9A 2N0SB 1FR3A 2PZTA 3EC8A 4XWWA 3HFZB 3STBC 3SHLA 3D31A 5T1GA 2LJIA 2IYDB 4JG2A 3GP7A 3V6CB 2NVTB 2NPTA 1P98A 1L0XB 4XC2A 1EFID 2SNMA 4KKJA 1D6EC 4A3KG 4A3JH 3M9BA 1VQDA 1B70B 4IPCA 4KK7A 1WJNA 3FHWA 1IYJB 1IHZA 2X6LA 4XYQA 4ZLTF 1BMLC 4HDQA 4RM9A 4A6QA 4F87A 2FHTA 1J8CA 1EY0A 4UP9A 2YU9H 1WVLA 4IWOA 3DM3A 3PIP3 3OLMD 2FIFA 4NXNQ 4ZOHC 2RHSB 3L54A 3WWVA 3WOEA 2FMCA 1RM6C 1KNAA 3FILB 1NYQA 2E6XA 2M0AA 4WJOA 3NPPA 4BY1G 1GHKA 4F7XA 1E2WA 2O5JC 1C9FA 1WI5A 4GDKB 1V2YA 3JW0X 1PZJD 4DAMA 3A9JA 1GUGA 5E6JA 4ANXA 1DOIA 2LUEA 1Z2MA 4K5XA 4YIJA 1VCBA 2PMZB 3LWUA 5D14A 1JALA 2WB1B 4G50A 3CF6E 3ZXVA 1SRUA 3R93A 1O7ZA 2P5ZX 1YJJA 1QILA 3MXNA 3OWFA 1QNKA 4OW0A 4KJOA 5ELNA 4FLHA 4MH8A 4A3JB 3M63B 1E24A 2KJXA 1BBUA 3HEJA 4RHSA 3CCQA 2AKWB 2LXAA 1ZYRD 3CWIA 3CKIB 1ZUD2 3PO2G 4CKEA 2YU9B 3C46A 1HTLD 3ECIA 2JJQA 2PPBC 5T1IA 5KHQA 1L1OC 3F2BA 1Y1WH 1B9RA 3VA5A 3GTMH 3VTWA 1YQBA 2EMTA 4NXMQ 1Y8PB 2MJ3A 1VQ5A 2J42A 2TMPA 4DGZA 2L15A 3DHHC 1D4BA 4JWSC 3PGEA 4FULA 2GBJA 1HZ6A 1YX5B 3DWMA 4KX6B 2DBYA 4YTNB 1PH2A 1WXQA 1D5MC 3FDTA 3CMAA 1I4QA 5CV8A 2LRWA 1HTOA 5C3JB 1WGRA 1JOKA 3T53B 5C6AA 3BDLA 4K6LA 1WE7A 1YN3A 3J81j 3BINA 2JA5G 1XNQQ 1VQGA 3SD5A 4HMIA 2WAQB 3VYUA 5LMNL 2R93G 4AQYQ 1LTAD 1SAPA 1PV4A 1I50H 4QJFA 1JB7A 1FO4A 1E8XA 4RGNA 4BAXA 3J81i 2V4IB 1Y1WB 3X0WA 2ZPYA 1STAA 4PG3A 3GTMB 1Z5SB 2JPHA 4LK0M 3RNCC 3CRKC 3BVMA 2OOBB 3MTSA 3W1YA 1P7FA 3VH4B 1SF0A 2LGIA 2JU6X 1PMRA 1HQMC 1NMGA 2QEXA 3MC9A 3J80i 4LFBL 4POGA 2PQAB 4A3MB 1VQFA 3VR6A 1JROA 5DPTA 3I4MB 5IOIA 1G8ZD 3QWNA 2K9XA 3TMPB 2A4ZA 2IT1A 3QR8A 5CMDA 2SAKA 4WJQA 5C4ZA 1N62A 2M9VA 4RGMA 3S9WA 2IX1A 1C79A 3CSTA 1I50B 1OQYA 2WU2B 3AB5A 2I2YA 1ONLA 4CDEC 4LF7L 2AQ1B 1LTRD 2R7DA 4P1CC 5CV9A 4JI4Q 3K0YA 1FYCA 4PV1C 2N9PC 4GMVA 4GU2A 2EYHA 2A5HA 2EYOA 2L0TA 2LJ5A 2D10A 1CHPD 1B4OA 5C0XH 5KNCA 1W3SA 3NBIA 3GV3A 5BR8Q 1WE6A 2G9DA 4HEDA 2M2LA 1XQQA 2WFWA 3BWUD 2ZEQA 4W9JA 5D94A 1X1MA 4JI6L 4HJ8A 4E3CA 2F1MA 1PDQA 2LFNA 2FJ2A 3M3YH 1F52A 4DV2Q 1QUQB 3PV0A 3G4SA 3VR9B 1DXMA 1LM8B 1WTXA 3GZNI 1G91A 1JRUA 3RNAC 4NP5A 1TKYA 2JSVX 1ESFA 1WTVA 1V1QA 4DV6Q 4IURA 3E0EA 3ZIMA 1WD0A 1JMLA 2F03A 1LO5D 1JOQA 4PYZA 3N1ZC 2EYFA 3A9KB 4Q0FA 3NS8A 4A3OA 2C9WB 2MBEA 1XTCD 1YJIA 2XK5B 4A3DH 1HUMA 1EQRA 4QIWE 3CW2C 4UP8A 2OT2A 2QDLA 3R2IA 1NYRA 2ZCBA 4BA2I 1A15A 3VR3A 1N60A 1K53A 3HVZA 1S3SG 3N9YC 4JIOU 5EPLA 4OZAA 5EGTA 4HDOA 1VQ6A 3IAS1 4RAUC 4LK1C 2K14A 4KGTA 4FYDA 1VRAB 3TP7A 3HKZG 2PW9A 3NVYA 1BDOA 1XMOQ 4X3SA 2KOXA 2MHJA 4PS8A 5J17A 5KIXA 2WXLA 3APFA 1I42A 5BN5A 4M8MA 3VR8B 2IY5B 2GI9A 3L16A 3ZNID 4DAYB 4GOPA 1QZEA 1JC7A 4JI2Q 1O7IA 3KJOA 2ZJRA 3DWGC 1A62A 4MSQB 4TUUA 4W9GA 1SNQA 1ZPSA 1CA6A 2LS01 4KSKC 4A3DB 1LTBD 2YTVA 4MIUA 3JVZX 3NZ3A 1N36Q 2DLBA 3L17A 1A8VA 2EYMA 1L0WA 4ZKCB 2UXBL 2RCFA 3BU2A 3PS6A 1SYDA 2MH7A 3OIQA 3GS2A 1NTGA 5AUIA 2L05A 1SBBB 2ZW0A 3DWAA 2R2OA 3RMHA 3UQAA 2Z0DB 5CX3A 1STYA 2KWCA 4MNOA 3BVZA 1C77A 1EU3A 1MKHA 2DAFA 2Y5PA 4XE0A 5JEAH 2KZRA 1C4QA 4EEWA 1PZKD 4LWCA 3OHXC 2IZVB 4A55A 5C4XG 2NYZD 3VHTC 4IZ8A 2NN6I 4XYOA 3J9CA 3L0OA 3B2FA 1O7YA 1T0QC 2K75A 3DMUA 1WX8A
chains in the Genus database with same CATH topology
2QIEB 1MI2A 4ARCA 2K22A 1QQRA 2EELA 2EYLA 3L9AX 4H2AA 2BE5D 3NP8A 1PXUA 4F8MA 3ZJUA 3J7AV 5G3LF 4R8IA 1RKNA 2K7VA 3N52A 3SK5A 3KBGA 4IUUA 3PUVA 1E10A 3T51B 1LT6D 3VA7A 4KKIA 1MBYA 1B9NA 2RPVA 4C56C 2CW0C 2WXMA 2A68C 5DEHA 1F2RC 4ITKA 4CKCA 4MT5A 3H8HA 5FR3A 3TEZA 3VRAB 1W6JA 2WLBA 2LMCA 2K32A 4XDDA 2WIIB 2V0GA 3D8GA 4FXCA 3K58A 1A6XA 3P1MA 2LHEA 4N58A 2KUMA 2E76C 4J1MA 2GB1A 3IT4B 1EIGA 4TRDA 3HGBA 3RLFA 3SVMA 1UWMA 1OXSC 5IOCA 4ODGA 2RMMA 3J80E 1MI0A 5IT9E 2JYTA 2VB3X 1ZE3D 1RFKA 2K03A 3Q8FA 4ILWA 3HOZB 4KHZA 3GTKB 1DONA 4J3OD 3Q23A 2Y0SB 4G7OC 4A3GB 1XLQA 2E74C 3KQ4A 1PTOH 3DWPA 3A7LA 1SNDA 1DGJA 2E3TA 3L3OC 3ABVB 5E1FA 1F0ZA 2BDOA 4L8JA 3T3OA 4G7HC 1SDFA 4IOIE 1EY6A 1HA5A 3T16A 1STHA 4IFDH 5LL6S 3DEOA 5CBEE 1SJHD 4WH4A 2NB0A 2L52A 1NR4A 5HI1A 1TWCB 1JWUD 1F2LA 1U9RA 1JOOA 2WNMA 2J53A 3GTGB 4RF1A 2DYMA 1RDPD 5FLXE 2OXPA 1Q3LA 4IKGA 1JR0D 2IX0A 1ENCA 4ZUIA 1AP0A 3J7AF 2M19A 1HA6A 4JPSA 3NVVA 1CFMA 1PTOB 4QIWB 2WXFA 2Z1CA 2KECA 1IW7C 1I4RA 5JAVA 4PMCA 3ZJVA 2KOLA 1EQVA 4RCNA 1HCZA 4PMBA 1NVID 4P2CB 1Q12A 1AN8A 2E75C 4HAEA 3HVDA 2W3RA 4YWGG 1RWSA 5K36G 2ZXPA 5IIFA 3U52E 3V96A 3FILA 3KLRA 5BMHA 4XDXA 3AE1B 2NTTA 5NUCA 1V43A 3FVQA 1UGJA 3J7YW 4OIKA 3HOUB 1CA5A 2WXQA 1PGXA 4HEA1 2A6EC 4XWTA 2BA1A 4Q5VA 4DQOC 1ML0D 2L12A 2G1EA 4K5WA 1S5ED 2Z4IA 4O42A 3W3AA 4A93B 3S17B 1MHHE 5HHDG 1FFVA 2L55A 2FMMA 2IGHA 4JK1C 2JSOA 1U4LA 5EBCA 1TVXA 1O80A 5C0XJ 3MHZA 1IL8A 2IJ0A 3TUOA 2F0KA 2MGSA 5EJWA 4B9WA 2O5IC 1C48A 2NBFA 1RTOA 5I9OA 4RWSC 4XQNA 3MZ5A 1EY8A 3S1QB 1PTOC 1QCBD 1YN4A 1OXUA 2H89B 3TBIB 3U9OA 3I91A 3KLSA 4HROA 3VYTA 1I7HA 4OVZA 3EFXD 5MPOA 1JB3A 2B8FA 1EYAA 4ZHOA 1S5FD 2ACZB 4RKLA 1J8IA 4AQ7A 5BN4A 1BO0A 1VMPA 3WDNA 4ZAIA 5KNDA 4TQ0A 3HRDD 1FEHA 2BB6A 1I4HA 2WU5B 1GUSA 4TMAB 1QOBA 3E5SA 3K5OA 1C8CA 1NCVA 2DY7A 1N63A 1A70A 1EU4A 5J1ZA 3C2PA 1EZ8A 4ARIA 2EJFC 3FEWX 2E2DC 1EY5A 4B9XA 2FINB 1PRTB 4YSXB 3A7AB 3J81L 1C78A 3MP9A 1JORA 1SNPA 2F0DA 2F3WA 3LXFA 4A3BB 1C76A 1AYFA 3J80L 5IT9L 2KCCA 3SK4A 3AECB 1KLUD 2EY2A 3NQTA 2F0TA 1TY2A 4K14A 5ELDA 3OSOA 2LKVA 4KKUA 4G57A 5C3WA 2I46A 4KJNA 4EE2A 1XLOA 5EE9A 5C0XG 3I9V1 2MUYA 3DUZA 3FKIB 5JEAJ 5F2DA 4OO1I 2C5CA 5ELCA 1L0VB 1T5XD 2QEJC 4DAVA 2F0NA 3HOVB 3Q24A 3M4YA 5HG2A 2F0GA 5JPMC 4QUCA 3A8JE 2W82A 3M7GA 3HOWB 2BS3B 5FOBB 1OXVA 1WCMB 1PUTA 3RPFC 4B08A 3FPPA 5JXVA 4XQQA 1J7BA 3BG3A 1BBXC 2CW0D 5DAUA 1DYQA 1T6BX 2A68D 4WJWA 2W3SA 4DAYA 2NTSA 1F77A 2LMCB 2MPMA 1TT2A 2RSOA 3PMFA 3AV8A 4REZA 5BYRA 2ZXRA 1HXYD 4ZYSA 1C4AA 1SE4A 1AZQA 3TP6A 1PRTC 1D5XC 1IYVA 2KDMA 1D1KA 2PTLA 4DK1A 5JPNC 4JWUC 2JXMB 1KAAA 3FAHA 1YNTE 3HG9A 2LFIA 1V1OA 2ICEC 3NTIA 2R6GA 1LT3D 2PYKA 4JBWA 3WOFA 1H9SB 1TJEA 3RZOB 1PFMA 2XVSA 4M1UB 1FNVA 2QKIC 5A35A 1AEXA 1NR2A 1DOKA 2OF1A 3QG1A 3PO3B 1JICA 3TEXA 2AX5A 2C9OA 1V8CA 4KGRA 1EWCA 2AQ2B 1JCKB 2WDRB 2B76B 2FFKB 5JJZA 1VDVA 4ZK9B 1QT9A 1QLBB 4S3SA 1LACA 3G6JB 3AE7B 4F88A 1FXAA 5JEAG 3A55A 1F9RA 2DN8A 4ZRZA 1S5BD 1SSOA 2L1BA 4IUNA 3E0JA 3AEBB 3EQLC 1K8MA 1FXIA 4CHTB 4JE3B 4Y7NB 4KMUC 2V3NA 1TS4A 3EROA 3NTKA 1STBA 1ACCA 4QB4A 4KKSA 1WTRA 4WURA 4IFDJ 1E9MA 3FC4A 5I6YA 1KDCA 1EOTA 3IAYA 2OEDA 2WXOA 2K01A 1I4GA 1IW7D 4FXKC 5E4WC 4YTPB 5HURA 3SEBA 2YEPF 5EPJA 2YEPB 2ZT9C 2NVXB 1ENFA 4YSZB 4DFAA 1SJED 1QNUA 2HDEA 2X69A 1IGCA 3L4PA 3JAME 2W54A 3V3XA 4KV6A 3K5NA 3BDCA 4L6TB 4FP5D 3SE0A 3NSWA 2JQRB 1SE2A 5ELFA 2BYTA 5C4HA 1S5CD 2E2JB 1D5ZC 4HRSA 3KUPA 5C5MA 4XQJA 3M7NA 4OL7A 4A90A 2MP1A 3TSSA 1QG7A 1RD9D 2R92B 4M8AA 5ELBA 2LUMA 2A6ED 3P4RB 1W6KA 5LHY1 2CJOA 1SSNA 5D3IB 4DU9A 2L11A 4WIPA 4UDUC 4GZYC 4CGYB 4BBRB 1XO3A 5D65A 4KD4A 3TMEA 1TYGB 1PTOD 2Q5WD 3U4EG 3T56B 2PZWA 3PZ8A 3A8KE 3IXSA 3D4RA 4FO2A 1MVKA 2DWQA 4DXFA 5DNFA 4IFDG 1D1IA 4P16A 4I65A 4C3IB 1XCQL 2G9HD 1QF6A 4N6EB 4O1NA 4NAWB 3RD4A 4RHRA 3B9JA 1KDAA 5C44B 2MHVA 3C1FA 3AEGB 3MC0B 5KEEA 1TKWB 4MACA 2IW3A 4MM3B 1FCLA 1XF5L 1MSGA 3GTJB 3NRZA 3MA2B 3IFDA 3BK1A 2B2YC 4RFBA 3X3NA 3ZQ4A 1JWMD 2B2VC 2BTEA 3DXJC 1BR9A 4Z9CB 4AS1A 5I2YA 4QUFA 3HOXB 2RKSA 4CBVA 1TWGB 3DHQA 1SIJA 1B3AA 5C3EB 2JXTA 1CZPA 2JZPA 5EE1A 1Y8OB 2A74C 1K50A 1E0BA 3OIPA 2B2UA 1GUWA 1BF4A 3D6CA 1ZEQX 4FXGC 4UAIA 3AE8B 1XWEA 2K5WA 1DD2A 1XX8A 4LMQD 2KWDA 3AB9A 1TZOA 3S15B 3P63A 2HUGA 1OO9B 2K05A 5CGKA 3K57A 2PVGC 5EPKA 4A3IB 5M3MB 3NE5B 1UEAB 2JP1A 2AWNA 1UNSA 5M3FB 2IDYA 5J39A 4NKLA 2KA7A 1FRDA 2N9LA 1PRTD 3I8ZA 3HOYB 1ZXTA 3GD7A 4US9A 4A8XC 1T3QA 4A3FB 3R3OA 4C7ZA 1QKZA 1I3QB 1SFOB 2B2WC 3P4PB 5BMIA 3JAML 1UUPA 1AW7A 2Y3AA 1GB1A 3FMCA 3MFYA 4RGTA 1DM0B 1VZ8A 3L7ZC 5KYIA 1RHPA 1H9KA 3NWTA 5J22A 4NAMA 1H9MA 1B53A 4OHJA 1OXXK 1DCZA 1JE4A 3U9SA 1XYIA 1CJEA 3SDZA 1QJOA 3CIRB 1I6VC 3NQIA 1STNA 1ILQA 2F0PA 5KRUA 1IUEA 1FRRA 5EKLA 1QE6A 2HDMA 1PFDA 4U673 1VZ6A 1QB5D 2A69C 4KTAA 1SMYC 1EZ6A 5LNK1 2B8GA 4CJ0B 4X3UA 1EYDA 5M5WB 1MSHA 3B2GA 1BUIC 1BCPB 1BQQT 1Q90A 2K04A 3W2DA 2EPBA 5JOBA 1JWSD 4V190 2XSCA 2NVQB 2INPE 1J9OA 2E2IB 1K51A 1SYBA 4BBSB 2EZVA 2VUMB 3J81E 4KN4C 1KDBA 4R8NA 3VQIA 1HFGA 1X32A 3UI3A 3BS1A 3QIAA 3ND8A 3AMUA 2WINB 1HHVA 3Q8CA 2MJEA 4A3KB 3T3NA 3DMUA 1PYWD 1H9SA 1Q1BA 2M00A 4RH6A 3MXUA 4BY7B 2CQAA 4ME5A 5M9OA 4V0BA 3KWVA 4DAPA 3R2TA 2K28A 3HS0C 2FUG1 3ZGZA 2JA7B 4FNFA 1N61A 4IUPA 3FPUB 4KY5A 1PGAA 4B0EA 2WV6D 1WSPA 1DOMA 1ENAA 1VF7A 4TSSA 2W55A 1KH0A 1FMAD 1G6ZA 2WXPA 3AE9B 3TEWA 5BMGA 2ON8A 2Q8TA 3GV6A 1GB4A 4C3HB 1PDXA 1DZ1A 3HP3A 3MXGA 2H88B 1NSNS 5C2TB 2WDVB 1KLGD 4N59A 4ZUJA 1PTOF 1Q10A 2Z8LA 2ENBA 1MHXA 4YXDB 3LX0A 1BCPC 1AFPA 2QCPX 2ONQA 1SNMA 1YNJC 1V1PA 2GA4B 3F2UA 1TU2B 3NTHA 4L63B 2BBCA 3MJ5A 2K33A 3P4SB 3I57A 4OO1H 4HTHA 1XXGA 1TY0A 2R61A 2Q8RE 4R3DA 4XT1B 3TZDA 4FXDA 1PZID 2L5TA 2KEDA 2L83A 3CRLC 3FRPB 5KGUA 2MJ8A 2PW5A 2HQEA 5C5LA 2DNCA 3W1SA 5EBDA 3K5LA 4D2KA 5E3FA 5JVG3 2BW2A 1Q1EA 4ABNA 2GRIA 5FKAC 1CTMA 1V97A 2MEKA 3C1EA 3QOLA 2OHFA 1ZXHA 3T4AC 1JWBD 4L2YA 4XT3B 4QMGA 4Q2JA 4H44C 2B2YA 4IUTA 2B2VA 2PNRC 3VR5A 3IAM1 5CV6A 3LYYA 1H9JA 2F0HA 2V3PA 2VNUD 4C3JB 3K7AB 3Q8BA 3Q8AA 2QDBA 4HR7B 1KFYB 4WQMA 1HQRD 3NHHA 2EKIA 1F2ZA 3MHBA 2NWGA 2SOBA 4H0LC 2NMQA 1LABA 3ITPA 3SXHA 4DF7A 3S1MB 1QOGA 2QMTA 1CT1D 3TP5A 2K5DA 4DXGA 4K8IA 5K5PA 1TS3A 3I3CA 4C3IG 3AE5B 3U2SC 3ZJTA 1CI3M 3EVQA 1HPCA 2HDLA 2B39A 5CORA 1E0ZA 4KI0A 4OZBA 4P6VF 1DOXA 3H09A 4TQ1A 2EDGA 1JRPA 4NJCA 1BXTA 3H6MA 3NBHA 3HKZB 2NVYB 2N7JA 5G5HA 1B50A 1PRTF 1JQ4A 3I70A 2K3UA 3NVWA 3SFEB 1IGDA 2MJDA 1F9SA 5D7GA 4X3KA 1FNUA 1RJTA 3WCQA 4KN7C 4DA2A 1A2UA 4L1BA 4EQPA 2JEAI 1TKGA 2B2WA 3TDQA 1NEKB 1U4PA 4ZRQA 4CKBA 3X3MA 3T13A 2VXWA 4E6IA 3URYA 2AUKA 2B63B 4IFDI 1SYGA 1UAPA 1VMCA 1MD2D 2B2UC 5C4XB 1B44D 3MXPA 5D3DA 5I9PA 1YQ4B 2QF7A 4ZKBB 2L32A 4HSVA 3EA6A 3HUIA 3NXWA 1MPEA 1ZKOA 3AE2B 3MEHA 3I4LA 4RA8A 4FF2A 4L23A 3H0GB 4NW2A 2WXHA 3EJIA 2ZW1A 2A69D 4C1NI 3N6RA 3GO5A 1SMYD 2JYEA 2J4XA 3ZYYX 1CHQD 5IGEA 2LHDA 1GXDC 4X3TA 2F0WA 4J8QA 4WORA 1RCVD 3AEAB 2KACA 4EGVA 1E7PB 2KCNA 3EGRA 2Z4HA 4XDCA 5CC4A 4ZRPA 4CJ2C 2IX3A 5M5YB 4KY7A 4A3EB 3PUXA 1ET9A 3GTLB 3H3VC 1WRIA 3BK2A 3BYYB 1QOFA 1KABA 4N9PA 1R9TB 2RBMA 2J52A 4DNRB 1ILPA 4TQUS 3W9CB 2ICIA 4YSYB 1ZDVA 3Q22A 1HEZE 3AU7A 2F0UA 2AWOA 4HMJA 2JA6B 1X3QA 1CQVA 2WXJA 3C8YA 4ULLA 4WRDA 1L4ZB 2PKOA 3MAQA 2SNSA 1LTTD 3AEEB 5GXGB 1VDZA 2RQXA 1F9QA 1E2ZA 2WXRA 4YT0B 4KY6A 3C3LA 2M56B 2K0PA 4RF0A 2I38A 2R7ZB 1Y56A 3NWSA 1Z6HA 1RTNA 1KNEA 1SYFA 4DN4M 1TQOA 4KHVA 3GB1A 1V1PB 4FF3A 2KMMA 4FVMA 1NI3A 1BCPD 1YNJD 1XEEA 2EJMA 1GHJA 5BN3A 2J7ZA 2RDFA 3IL8A 2EOTA 2BB5A 4KKTA 1HTPA 5EE3A 2FE8A 2D2CC 2HTME 1TS5A 3OMGA 3LB8C 2JWUA 1FD6A 2PVOD 2QILA 1TWHB 4IUVA 5FK9C 3NS1A 1GJXA 1GPXA 3KF8A 3S1NB 2WKCA 2RA4A 1GUTA 4M0WA 3KK7A 4K2LA 1G2SA 3P42A 3BIID 2VZKD 3Q6SA 5BYSA 5E4XA 3I73A 4ID6A 4HN7A 4PT5A 1FGBD 3Q0AA 4JX1C 5FO7B 1STGA 1BOSA 5CV7A 1YN5A 3P4QB 4N9TA 2NN6H 1T5EA 2ZXOA 4C3HG 3GTPB 1BUVT 3OW7A 1STEA 2IGGA 5FO8B 2BOSA 3NUCA 3MWYW 4GDLB 2F0EA 1GAQB 3O13A 5TSSA 2HCIA 3KLSX 1V8QA 3PUYA 2XRQD 1WTQA 1R4PB 1KRHA 3AEDB 1P7EA 2LY7A 1PFNA 1IBXA 2PQEA 3OPOA 4QCLA 2WS3B 3M4OB 4PMWA 1SNCA 4K8JA 4OGQC 4HCEA 3P1HA 3AE6B 1VCIA 2H4OA 1IKLA 2WXNA 2JA8B 4KD3A 3I72A 3PUWA 2N88A 2TSSA 3MFGA 1RYJA 2RVLA 1L4DB 1WD1A 3S16B 4FF1A 4H13C 1B2TA 1ZXIA 4LTUA 4OO1G 1I4XA 1OFFA 1WTWA 1WGKA 1QOHA 5IGBA 1G2TA 5G5GA 2XNAC 1U4MA 3I4NB 3PIO3 3D3RA 3D4WA 2D5DA 5AUKA 1G291 5CBAE 2BA0A 5IGFA 1YNNC 2NZ1D 4C1NK 2PO4A 4C3JG 3S2HB 4RGOS 1K52A 2XWBB 1EM7A 1B9MA 2F0LA 4EVOA 3GQBA 1N5XA 3LWEA 3VRBB 1L0YB 2NUCA 4BS9A 4BWGB 1EIHA 2DYOA 4WFN3 4RKBA 3RFZB 3E6ZX 2A6HC 4J6HA 1EY9A 4HCSA 4HKQA 3LNNA 1BNZA 3Q8EA 2F0QA 1Q8IA 3GTOB 3M3YB 5CV4A 1OXTA 3VYSA 2EY1A 2JX5A 1AZPA 2X38A 4U68A 3QJYA 2JYOA 3CU7A 3AN1A 4QF4A 5C3XA 2WXKA 1CK1A 4LAAA 3U7ZA 5FO9B 1A3TA 3ND9A 2BS4B 4PQXA 4DNTB 3A54A 4OZCA 1SE3A 4C80A 2KN4A 5H8YE 3DEPA 3EUB2 3I90A 1WYGA 2B2TC 1L6VA 3TEYA 1ROEA 2FBWB 2X6GA 5A2QE 5C4JB 4HKZE 1TS2A 4KGSA 1SEBD 2F3VA 2F0JA 2BT6A 1HUNA 4GLSC 1CM9A 1VR9A 2F4IA 1TIID 1XCTL 3ETRA 1PGBA 2QJLA 5I6WA 4US8A 3SK8A 2EE1A 1J7CA 3SK6A 1YQ3B 2JE6I 1WTOA 2WKDA 1S4ZA 1BCPF 3AH7A 2KQ3A 3H91A 3K6OA 2K1BA 3TN2A 1SB3C 3K5MA 3UI2A 1F2YA 4CQNA 5CV5A 2WQYB 1GOZA 5IGDA 4MN3A 4ZHPA 5ISRA 2EYJA 5C0XI 2XRSD 4IDIA 2D9UA 1FFUA 4USAA 3Q69A 3W5VB 5HGTA 2BS2B 5CYUA 3VR2A 2L1AA 3PUZA 2WXIA 1I4PA 1QWYA 3P7JA 1O7LA 4BY1B 4IUQA 1LLRD 3NUHB 2VZKB 1M8AA 3GTQB 4YTMB 4XTCS 1F2RI 1LV9A 4TKOB 2YYZA 2IGDA 1HFNA 2K5QA 2F0SA 2RDGA 1A2TA 2LEKA 2PZUA 3IFTA 1JWAD 4MHEA 2F0OA 1NUCA 3AMZA 4RCOA 3PO2B 1GUOA 3RZDB 2A73B 2SEBD 3S2DB 1XLPA 2WP8J 2JEBI 1QOAA 3AM9A 3M85A 2PIAA 4K5VA 5EE0A 2AUJD 1Z7TA 4ZQ3A 2OEOA 3MVVA 3VR4A 3BZDB 4PNYA 1IBXB 3SR1A 1A3VA 1DOLA 2KVMA 3KBXA 3OWEB 2D5GA 1K83B 1R7SA 2JA5B 5KNBA 2R93B 3BDOA 5AFWA 1HZ5A 5H92C 3NVZA 2EY6A 1ESRA 1F2MA 1OQQA 2CVRA 3PZ7A 4G4KA 4OIJA 1SXTA 1FD7D 2QSDA 1KF6B 5T8IA 4B0MA 2EY5A 3R8BA 2K6AA 1ET6A 1EY7A 1NAPA 2SDFA 2XIWA 5BYQA 3AEFB 2L9HA 1O78A 3BVGA 4NMZA 1LTID 1C4CA 4LLGM 3RUZA 1ZYRC 2WXGA 2F0IA 1UWXA 1YNND 2E2HB 3DWQA 2KHSA 1N5WA 5EQ0A 2CHBD 1CZWA 3W5UB 5A2QL 2EXZA 4BA1I 2N9KA 2HCCA 4NZLB 1SYCA 3CHBD 1DOYA 3QOJA 1OQRA 1FNWA 3H94A 1LTSD 1MGSA 2EJGC 3CQZB 3VYRA 2O4XA 3D4DA 4G7ZC 2A6HD 3P20A 2BDNA 2KEEA 2NN6G 1EL0A 5M5XB 1ZOYB 1PLFA 1FIQA 3G7LA 4I7ZC 1VZ7A 4C7YA 3V05A 2ID0A 2L0CA 5JVH3 1E6EB 3K59A 1CQFA 1U4RA 1II3A 2K5PA 1EYCA 1EY4A 2AQ3B 5KYLA 1TKEA 3ERQA 1XLNA 1TWFB 1PFBA 1K8OA 1WWTA 5LL6X 1GUNA 3S14B 1TR5A 1EWHA 4R9WA 1X3PA 4EQNA 1FCCC 2Y5CA 3E56A 1JW9D 4HJGE 1ICWA 3A56A 1RF2D 4K2KA 2EVBA 1S5DD 3PO0A 2B2TA 3OMCA 1B1ZA 3AE3B 2V4DA 2INNE 4RNAA 2Q8IB 5EKKA 3AE4B 1DJRD 1EEFD 1EEID 2RDHA 1CZGA 3SR6A 1L6UA 4K6DA 1H9RA 1KTKA 4LJZC 3D6WA 1E2VA 1NENB 5IGCA 5IGGA 3P75A 4HSPA 4EQOA 3HZXA 1Y1VB 1LT4D 2CJNA 2PMVA 5DM63 1ZDXA 4XIGS 3V2TA 5COYA 4AYBB 4DK0A 2WACA 4H7BA 4NDXA 1IKMA 1YMHE 1TWAB 4IALA 1RODA 3E9SA 3QB3A 2F0MA 5FLXL 1A3UA 3IT6B 2PW7A 1VF5C 2BCOA 4XXEA 3BYTB 2KAJA 3KWLA 3HRZC 1J7AA 5I4DA 1EQTA 1SYEA 2XWJB 5HFYA 5DM73 1AWDA 2D62A 2IWHA 1LTGD 3OOCA 1Z47A 1F9PA 3SFDB 1EWYC 1LT5D 1R4QB 1D2BA 5I2XA 1Y8NB 2KQ4X 3NK9A 1JQYD 2IPKD 2RSNA 3DM1A 2CU3A 4IQZA 1HRJA 1SNOA 2H1EA 2PLPA 1M4VA 2DY8A 4WAFA 2IL8A 1ZP0B 2WP9B 2BE5C 1L5PA 2F0VA 3QO2A 1VLBA 3ONAB 2F0FA 2L4NA 4IN3A 5EKIA 2N55A 5G3LD 2O2LD 1IYUA 5IODA 1C4PA 2WDQB 3TP8A 1I6HB 2I07B 2PCFB 4FF4A 3A8IE 2J0TD 2VB2X 5K36H 1WTPA 3IKJA 5ELEA 2EYPA 4WWMA 2R3ZA 4CJ1B 3S1RB 5CR3A 4C2MB 1FM0D 1VJKA 2DNEA 1Y69U 2XN9C 2N0SB 1FR3A 2PZTA 4XWWA 3SHLA 3D31A 5T1GA 2LJIA 3GP7A 2NVTB 1L0XB 1EFID 2SNMA 4KKJA 1D6EC 4KK7A 1IHZA 2X6LA 4XYQA 4ZLTF 1BMLC 4A6QA 4F87A 2FHTA 1EY0A 1WVLA 3PIP3 4ZOHC 3WOEA 2FMCA 1RM6C 1KNAA 3FILB 1NYQA 2E6XA 2M0AA 3NPPA 1GHKA 1C9FA 4F7XA 1E2WA 2O5JC 4GDKB 5E6JA 1PZJD 1GUGA 1DOIA 4K5XA 4YIJA 2PMZB 3LWUA 5D14A 1JALA 2WB1B 3R93A 1YJJA 1O7ZA 1QILA 3MXNA 3OWFA 1QNKA 4OW0A 4KJOA 4MH8A 4A3JB 2KJXA 3HEJA 4RHSA 1ZYRD 3CWIA 3CKIB 1ZUD2 4CKEA 2YU9B 3C46A 1HTLD 2PPBC 5T1IA 1B9RA 3VA5A 1Y8PB 2MJ3A 1D4BA 2J42A 2TMPA 4DGZA 4JWSC 1HZ6A 3DWMA 4KX6B 2DBYA 4YTNB 1WXQA 1D5MC 3FDTA 1I4QA 5CV8A 5C3JB 1JOKA 3T53B 5C6AA 3BDLA 4K6LA 1YN3A 4HMIA 2WAQB 3VYUA 1LTAD 1SAPA 1FO4A 4RGNA 2V4IB 1Y1WB 1STAA 3GTMB 4LK0M 3CRKC 3BVMA 3MTSA 1P7FA 1SF0A 2LGIA 2JU6X 1PMRA 1HQMC 4A3MB 3VR6A 1JROA 3I4MB 1G8ZD 3QWNA 2K9XA 2IT1A 5CMDA 2SAKA 5C4ZA 1N62A 2M9VA 4RGMA 3S9WA 2IX1A 1C79A 1I50B 3AB5A 2WU2B 2I2YA 1ONLA 2AQ1B 1LTRD 5CV9A 3K0YA 1FYCA 4PV1C 2EYHA 2A5HA 2EYOA 1CHPD 1B4OA 5C0XH 5KNCA 3NBIA 3GV3A 2G9DA 4HEDA 2M2LA 3BWUD 2F1MA 1PDQA 2LFNA 2FJ2A 3PV0A 3VR9B 1DXMA 1WTXA 1G91A 4NP5A 1TKYA 2JSVX 1ESFA 1WTVA 4IURA 1WD0A 1JMLA 2F03A 1LO5D 1JOQA 2EYFA 4Q0FA 1XTCD 1YJIA 1HUMA 2OT2A 3R2IA 1NYRA 4BA2I 1A15A 3VR3A <