1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1D5MC 1BCPF 2NTTA 4RGNA 4RHSA 1I4QA 1LTID 1PZJD 1RCVD 1S5BD 4K6LA 3W2DA 3TSSA 2XRSD 1PTOF 4RH6A 1RDPD 1DJRD 1JQYD 1TS3A 2R61A 3URYA 1TS5A 1SEBD 2QILA 1PRTF 5ELDA 1DYQA 1FGBD 1BCPC 3DWAA 4L63B 2XN9C 1LTSD 1SJHD 1B1ZA 1I4GA 1FNUA 1ESFA 1KTKA 1LTGD 1S5ED 1D5XC 4ZYSA 1LTBD 1PTOD 1AN8A 1ET6A 1S5DD 2IPKD 3DWQA 4Z9CB 4RFBA 1LTAD 3V05A 1SXTA 1I4XA 1PRTD 1HQRD 1TS2A 2RDHA 1LTRD 1STEA 1G8ZD 1EWCA 4RGOS 2CHBD 1EEFD 1QILA 3EA6A 5ELBA 1LT3D 1SE2A 1LLRD 3DWPA 4BWGB 1GOZA 1F77A 1M4VA 2AQ2B 3BYTB 1PTOB 1BCPD 1XTCD 4C56C 3BVMA 5D3DA 1TS4A 1PRTB 1PYWD 1I4RA 3O13A 1EU3A 1SE4A 2QEJC 1TY2A 3GP7A 2O2LD 3CHBD 1EFID 1YN5A 1CHPD 5I4DA 2NTSA 1LT6D 2WV6D 1HXYD 1EU4A 1ENFA 1AW7A 4UDUC 4DXFA 1D5ZC 1PTOH 1CT1D 3BVGA 1FNWA 5ELFA 1I4HA 1PZID 3OWEB 2AQ3B 1FD7D 1PTOC 1TY0A 2TSSA 1HTLD 1B44D 1MD2D 2XNAC 4OHJA 4RGMA 1JWMD 1YN3A 1PRTC 5TSSA 5ELCA 1D6EC 1UNSA 1L0XB 2ICIA 3SEBA 1JWSD 1CHQD 2Z8LA 4TSSA 3R8BA 4L6TB 4DXGA 1LT4D 2J4XA 1S5CD 1BCPB 1CQVA 1KLUD 1LO5D 4O1NA 1SJED 3MFGA 3BZDB 4RHRA 1SBBB 2SEBD 1UUPA 1JCKB 1RF2D 3R2IA 1T5XD 3MC0B 2XRQD 4NZLB 1CK1A 1ET9A 1BXTA 1RD9D 1JR0D 1V1PB 1EEID 5FKAC 1SE3A 2IJ0A 1V1OA 3EFXD 3KLSX 3BYYB 4RCOA 5D3IB 1L0YB 1LTTD 2G9HD 1FNVA 3R2TA 1HA5A 1V1PA 1KLGD 5ELEA 1PZKD 1I4PA 3BVZA 1JWUD 1S5FD 1XXGA 2RDGA 2AQ1B 4RGTA 5FK9C 1LT5D 1YN4A
chains in the Genus database with same CATH superfamily
3K58A 3RNFC 2GBJA 1N5WA 2F0VA 4TQ1A 1TWAH 3VA5A 4F1SA 4JC0A 1H9RA 2EIFA 3RR5A 2BYVE 3SDLC 1BUVT 1VQHA 3OIQA 2E2HH 1TWHB 2WB1B 4ZRZA 4BBSG 1QOBA 2IDYA 1UAPA 4A3KG 3ULPA 3PO3B 3QA8A 3QIAA 4KD3A 3JSVB 3URYA 2KC1A 4DR7Q 1YJJA 2EYLA 3L10B 1MSGA 3WOEA 2BE5C 1J7BA 4JE3B 2HT1A 1N62A 4NQLB 3G6EA 4C3IG 4A3FB 2WXQA 4A3BB 2L52A 1DOXA 3S1MB 2IO3B 2WXMA 3N32A 4QJFA 1QVCA 2CHXA 5I9OA 1T9HA 1XNQL 3TIXA 1XF5L 1U0LA 2FFKB 4DQOC 4K0KQ 1PFSA 1F2MA 2EVBA 3GE8C 2ZM6L 2DAFA 4KMUC 2NVXH 2PYKA 2QCPX 2RA4A 4ULLA 2NPTB 3VR9B 1T0YA 1EWCA 2VL6A 2D10A 1J0GA 2KWVB 2BWFA 2JA7B 2KFKA 3PMFA 4A3EH 2DBYA 3DVGY 1Y14B 2WDTB 2C9WB 2WB1E 1SMYD 1WR6E 1BT0A 2KKCA 1J6QA 4YCUA 3VA7A 1YBYA 3K5LA 3BDCA 2X6LA 5KEEA 4R4CA 1QB5D 2BF8B 4RMAA 1Z2MA 1FEHA 2R6GA 2DZMA 4P16A 4PZ7A 1FYCA 4GKKL 5FR3A 1C4PA 5GAEC 2EJGC 1D1IA 4IPCA 2WV6D 4YWLA 2HCIA 2ZVOA 1TWFH 1SLJA 4DV2L 3KYCD 3IFTA 4ODGA 1KJTA 1ICFB 2Z0SA 1BQQT 4HMIA 4OONA 2ZM6Q 3GTGB 3OWFA 3PRMB 5H92C 4KHZA 1Y8NB 3NSWA 1SF0A 3UI2A 1V6EA 2V9HA 4XGAB 4QMGA 1O78A 2N9XA 4IN3A 5HI1A 2WINB 4WWOA 1E22A 3QK0A 1YNJC 3UDIA 2INDC 4EFOA 4JI2L 3PLVA 5G55A 3J81c 2FIFA 2Z6KC 1P1AA 1WTHA 1PFBA 4IOCA 1E7VA 4R9WA 2A68C 1KRSA 4BXXH 3A8JE 2J0MA 1KLUD 2UUBQ 2IY1B 2K7VA 4KY6A 4H13C 2KO3A 5J17A 3C2PA 1GUGA 1X65A 3Q8CA 1WJUA 2UXBQ 2OWOA 3KQ4A 1UELA 3K9PB 3H7PB 4GU2A 1Z7TA 1TZOA 2K1FA 2XWBB 4A3IH 3VR2A 2WXOA 1KLVA 3L3OC 5FKAC 1B3QA 2RBMA 1PUTA 1MJDA 3BYYB 4HIKA 4DR4L 1X1MA 2EY5A 4KZ0A 2IX0A 2HIVA 4JI4Q 1ILQA 4PNYA 1A70A 3IAM1 3SU8X 4ABNA 3FILA 1PZKD 1I4PA 3HKZG 4MIUA 1ZP0B 2NN6I 4MELA 1WWTA 3EBEA 4JOIC 4OL7A 4P1CC 3PO2H 1SNMA 2QW7A 3I70A 3MTSA 1LT5D 1STAA 4GNXB 2HHHL 4LK1C 4A3BH 2N7DA 3I8ZA 3AEDB 1IBML 1WCMB 3CW2C 3KF8B 1N36Q 4JYAQ 3LX0A 3AB5A 4LF7L 4ZHOA 2ZJDA 5FO9B 4NXNQ 2BS3B 4LK0M 1RCVD 3PUXA 1TWCB 1RWSA 3TSSA 5C4HA 2JZZA 2QC8A 4HVBA 1Y1WB 1X55A 3AE4B 1E7PB 2KCNA 1M94A 2W9NA 3SD5A 4D2KA 1V86A 1E90A 1C77A 5T8IA 2B2TC 2CKHB 2VUMG 1QNUA 2IYDB 3AEFB 1X54A 1GD7A 3PZ8A 4A3OA 4FO2A 2KNBA 3E0JA 4RM9A 4BY7G 4GLAC 3DVGX 2E3TA 2YTYA 3BK1A 2ZNVB 1K8RB 2MNAA 5LHY1 3T1YL 2Y3AA 1QQRA 3H3VC 3LYYA 2EKIA 4MEMA 2N8NA 2JT4B 2KA7A 4BBSH 1SDFA 1QILA 5ELBA 2IHFA 1GUWA 3STBD 3KWLA 2A1AA 4BWGB 2KC2A 2KAJA 4A3JH 1YD8U 5DM63 3NBHA 4JL9A 4K2KA 2X69A 2CU3A 2B2UC 4GDLA 1PV4A 4DKAC 2ZJRA 3TJPA 1B9RA 4PMCA 3H3VI 4LFBL 2B2UA 2LHDA 3N20C 3WOFA 3H9DA 4P6VF 5HKHA 1PRTB 5LMUQ 4WAFA 3T56B 4QY7A 3PO2B 2RVLA 5C3EH 2KWDA 2MQHA 3M4OB 1F9PA 1MKHA 4WWMA 2L1BA 1GHKA 5KNBA 2HJ1A 2KEEA 1VCIA 1GUSA 2INCC 3DBLB 4AOFA 4FJZA 2JQOA 3WAOA 3M3YB 3K7UC 2MBQA 4ACFA 1VQ5A 1WD1A 1BUIC 2JA6G 2EELA 2NS5A 1F0ZA 2IZVB 1E2WA 1QJOA 2E75C 2F0EA 3T1YQ 1ZPSA 2B29A 3ONAB 5IGCA 5CBAE 1EWYC 4DAYA 4A3LH 3DHQA 4B0EA 5TSSA 3KK7A 3HOVG 4WRDA 2QA4A 2JA8H 3ONSA 3WDNA 2SAKA 4N8X1 4X3TA 3OJ4B 3S2DB 3NHHA 5AZFA 1MJCA 3A5ZB 3STBC 5C3XA 5M3MG 3AEGB 2QDLA 4LMQD 1PGAA 4EGVA 4R8IA 2EXDA 4HR7B 5C4XB 1N34L 1WMHB 1YJNA 1HTPA 4NJCA 2NBVB 1A2TA 4V0BA 1T5XD 4NXNL 2KDBA 4UP7A 2ZW0A 3FILB 3B1LX 2A6EC 2M1MA 3RFZB 1SE3A 3SDZA 1Q7YC 4FBJB 1C4QA 3KUCB 2E8GA 4LNKA 4M8MA 5A2QE 1N9WA 1MJEA 4I7AA 1KRHA 1NBWA 4YSZB 3I72A 3VYTA 4HJKA 3APFA 4BKSA 2WAQB 1JWUD 4A3CH 1SNQA 5JEAJ 5C0XH 2UU9L 3RD4A 2RSUA 2WDRB 2MBHA 3H7SA 1EQVA 1LXDA 2F3WA 3VTUA 2PVGC 1JOOA 4G57A 4L5SA 1B70B 3PF5A 1C3TA 3IXSA 1IYUA 1Q10A 1BCPF 2NTTA 4S0RA 5IKCM 5EQ0A 4M0WA 3KBXA 1NENB 4URKA 2JA7H 4TVAB 4GKJL 4KSLC 3I4MG 2J42A 2E2IB 3OIPA 1XMOL 4HEA1 4JI1L 3R66C 3I2ZA 3IT4B 4DU9A 1HR0W 2EJMA 1CI3M 1XQQA 2N9LA 5EBCA 1SB3C 1NYQA 1STBA 2JZPA 1SJHD 5CYUA 1VQOA 4C3JG 2KJXA 1BBXC 1L6UA 4EZKA 3U4VA 1D5XC 4US9A 3SR1A 1AN8A 1VQBA 2NB0A 2VB2X 2LRUA 2IPKD 4CJ2C 1F1HA 2BS2B 1W6KA 1WZ3A 2HCCA 2K6AA 2YTXA 3RZOH 1QE6A 2K28A 4X62L 2ASQA 3ZVVA 4C3IH 1I3QH 1J7AA 5AFWA 4X66L 4XYOA 3EN2A 2PEAA 2J0KA 1SYEA 3VQIA 5EKIA 4A6QA 5FLXc 2EY2A 4DNRB 1MI0A 2Y5CA 2JYOA 2RCNA 4RG1A 2R92G 2PCFB 4EX5A 5IGDA 1FJGQ 2CHZA 2YU9H 2CJNA 4W9IA 3N3KB 2CU1A 2HDEA 1PYWD 2LRWA 4YY3Q 1YNND 1EY0A 3J80L 3AEAB 3T51B 1IBMQ 2NBFA 2WXRA 2D0OA 4CKBA 1JRUA 2F52A 2CH4W 2WXNA 5IOCA 2WFWA 1LT6D 2K6DB 1ENFA 4NP5A 5C1ZA 1HEZE 4GOCA 3PUVA 4FN2A 2XVSA 4JI7Q 4RKBA 2JRHA 1OO9B 1YIJA 3R7QA 4L8JA 5DCNA 4K5VA 1GUNA 3M4YA 4FXKC 2N4FA 2JJQA 1B44D 3UIOB 5C3JB 1QWYA 3TUOA 1SYDA 1A8VA 3DUZA 3W1BA 1WXAA 2AUJD 3TMEA 1QKZA 1FMAD 3N1ZC 4BKGA 4ZHPA 4Y7NB 4FXCA 3RN2A 2N49A 4XDXA 1TTNA 5HHDG 3V96A 2K6QA 3PSEB 2AKWB 2FUHB 5EE9A 2K33A 4M0WB 5G5HA 2YYZA 1SJED 2FHTA 1KIXA 3RZWC 1XNRL 4JI8L 3HOXH 2OTJA 2Y5BB 3CCVA 1OEYJ 2A8VA 3P4RB 4A3KH 1RAXA 3MC0B 2PZTA 3AEBB 1NNXA 4R4IA 3E5SA 4FXGC 3BZKA 4CKEA 3GDEA 4A3GB 3F2UA 3S1QB 2L32A 2GA4B 2KN4A 1TWAB 2NWGA 4I65A 4PS8A 3SVMA 4IPDA 1BVSA 2MBEA 2B2VC 4ME3A 3DBHI 2MJ8A 5HGQA 1WJJA 1OQQA 1VD2A 3RPFC 1UGMA 4RAUC 1CJEA 1A62A 1M8AA 1PXUA 1P7EA 5M5WB 5E7NA 4B3RL 1CSPA 2BKRB 2V4LA 4M8NA 4A8XC 2MFIA 1E8ZA 1D5MC 2PO4A 3Q6SA 5JEAG 4QAYA 2EE1A 2C5CA 2D5DA 5M5YB 2KQ3A 5LMNQ 4KKTA 4N9F4 1K8MA 1ENCA 4IUUA 3PO3G 3DCGA 3HVZA 1EQRA 3W1GA 5J22A 2VH1A 2WU5B 4AQ7A 1PTOF 1RTOA 4MJSB 5FJ8G 1DJRD 3M9BA 2KDMA 1SEBD 3AE1B 3RNCC 1Q90A 2VB3X 1WTVA 2PI2E 1IBLL 1D4BA 3PZDA 3GO5A 1RHPA 3SFEB 3DWAA 3NHEB 3PO2G 1X3FA 1WM2A 2KFJA 5C4XH 2LJIA 4I6NB 4Y52H 4APVA 5E3FA 4HJ7A 5IP7G 1UEBA 4OZBA 3KUPA 2K0PA 1KTKA 2KVZA 2LUEA 3PLUA 3ZXVA 2PQAB 3B2GA 3L13A 1ONLA 1S5DD 4HXDA 2BQQA 1LM0A 3UINB 4J8QA 2JF5A 1L2FA 4KK7A 4IM2A 4XX5A 4N6EB 1E8YA 1WFQA 3IG3A 1VR9A 4BBNC 1WSPA 2K01A 5D7GA 3SE0A 2LZ6A 1VLBA 4MDKE 4US8A 3L9AX 1V5TA 4HJAA 4IWQA 2E76C 4S17A 4LF5L 1HNWQ 1IYJB 4CDDC 5KHOA 3CMMB 4NY0A 1STHA 2QCZA 3HM3A 3FEWX 1ZKOA 4XYQA 2M2LA 1VZ6A 4HPMB 1SYCA 2J7ZA 2WHIA 1XLOA 2EYJA 5BN3A 2WXPA 4ICUA 1EU3A 5JOBA 2QEJC 4IM3A 1FRRA 4HSVA 3W5OA 2E2JH 4BKSD 3F1ZA 4CHTB 2V4DA 2IWHA 1UBQA 2XSCA 1CHPD 2JZ3B 4A3CG 5KNDA 1I94Q 4X57B 4F7ZA 3VHTC 1P98A 5LNK1 1CFMA 2UU9Q 2OJRA 3KWVA 2Q8IB 4OX9L 1E2VA 1KM7A 2LVOA 1H9SB 3HHMA 2YV5A 2LMCA 2YTVA 3D31A 3OWEB 2JU6X 1U4AA 1VF7A 3GTGH 3W1SA 5IP9H 1IBKQ 1XYIA 4LF9Q 1TY0A 3GTJB 3NY5A 3K7AH 1HZAA 5IGBA 4ZCKA 5ELCA 2I1JA 1HR0L 1KXLA 5AUIA 3VH4B 4IUMB 2J53A 5JEAH 2BKFA 1CHQD 2EJFC 2Y0SE 3GD7A 3IKJA 3PV0A 3R8BA 4C3JH 4F88A 1S72A 2AWTA 3KDFA 3AM9A 2F3VA 4YWMA 4YT0B 1EYDA 1BCPB 3NELA 4R4QA 3IAS1 5M3FH 4DR1L 3DVNU 2A6HD 4GSWA 4LJPB 1ASZA 3CAMA 4DV5Q 3VFKA 1J7CA 4W9DA 2MP2A 1IW7C 1CK1A 1K28A 2MPMA 2I46A 5JJKA 3TCAA 1YJIA 2CS4A 1ACCA 4DF7A 5HGTA 1FFUA 5AUKA 1L0YB 5AZGA 1G6JA 2MHJA 3DM3A 4MM3A 2DUDA 3RZOB 1DOIA 2ZJPA 2BPSA 3I73A 3Q8EA 4JGHB 4WIPA 1V9PA 3KFUA 4MHEA 1O7YA 5HFYA 4HSPA 2KVMA 4OX9Q 2UU7A 3PS6A 3VR4A 4UAIA 2AQ1B 3KLRA 3OSOA 5BR8L 1FRDA 1CQFA 5CMDA 4XQQA 5IP4D 3NZSA 3J80i 4MN3A 3GS2A 4KV2A 4FADA 4IDIA 4E74A 2LHEA 5IYCG 1H95A 2WYQA 2C7MB 1WD0A 2PPHA 2WP9B 3P4QB 1DOYA 1PZJD 1LTID 1MPEA 5FLMH 2LD9A 3N1XC 1HTQA 2NVYB 1FJGL 1PGBA 3SFDB 3H94A 2F0HA 2OJWA 3FC4A 1E7ZA 3I3CA 2FCSA 2JYTA 1XPUA 1K8AC 2C5LC 3GTLH 2M00A 4H2AA 3NVVA 4DUZL 1RFKA 2IX3A 1BCPC 4RMFA 4IFDH 2QSDA 2I2YA 4CQNA 4KKUA 2DZIA 3ZNHB 2LY7A 4YSXB 1WGHA 3CIRB 2K5NA 2QGQA 1UD7A 4RCNA 2A5HA 1EQTA 3TQYA 3C46A 3TMPB 1KC8C 1HPCA 2G4DB 1TKWB 1PH5A 3SHLA 3U4ZA 1AEXA 2NN6H 2KZRA 4W9FA 4ITKA 5FJ8H 3EQLC 3P4SB 4QB4A 1Y1WH 3HGBA 2N7JA 3QAQA 1LABA 3IAYA 1Z47A 1HHVA 4QIWB 3OPOA 4RGOS 4XYCA 1Y1WG 1Y1VH 1Z6HA 1GUOA 3T16A 2KMMA 4TUUA 5J2RA 1F77A 4DR7L 3A8KE 3AI5A 2AQ2B 4FLHA 3KLWA 2D3GA 4K6DA 1IPGA 1YOVB 4C3HG 4IM0A 3PIO3 2QF7A 1GVPA 1E3PA 3A9KA 3A9JA 4ZOHC 2D2QA 3MEHA 3NWSA 3GTMB 2SNSA 3HOWB 2K14A 2WKCA 3LDZE 2D9UA 3Q8AA 1C7YA 2QEXA 3GB1A 3VYSA 1Q82C 1WTQA 2IY5B 1Y8RC 2K25A 2KMAA 2L7RA 4KGRA 5BMIA 1UEAB 1EF5A 2P5ZX 2Y5PA 1RKNA 2K50A 3Q3FA 4PS3A 3K0XA 4W9CA 3VXWA 3D4DA 4N59A 3CQZH 1TIFA 1PTOC 3VVWB 5C0XJ 2IO2B 4HPPA 4ZUIA 5E6OA 1FVIA 1MIUA 3HOXG 1SMXA 4GLXA 1JWMD 1V97A 2IGHA 2B2WA 2OXPA 3HRZC 5IT9c 4B3ML 1E1TA 2E74C 1TZ1A 1D6EC 5IYDG 3CSTA 4BY7H 2BB5A 3EUB2 5J1ZA 2F0NA 3Q3MC 1CTMA 3MXNA 1BDOA 1Q1BA 2Z8LA 2OT2A 3D4RA 3I90A 4L6TB 3OMCA 2KYWA 5C3EB 3J7AF 3VRAB 2J4XA 2KDIA 4B95A 4ZK9B 1UH6A 1J19A 2LXKA 1SGHA 3ND8A 3MFGA 3MZ5A 2MP2B 5JXVA 3TP5A 2ZXRA 1YJWA 3OTOL 1KD1C 3LB8C 3J81j 5CGKA 2JWZA 4JI2Q 1XPRA 2NBUA 1TXYA 3UDXA 3A8IE 1E8XA 3DEOA 4L1BA 3AU7A 5K5PA 1V1PB 2GBNA 5IA7A 1QT9A 2UUAQ 3VDYA 1I3QB 1LTTD 4W9LA 2CW0C 3QO2A 4AYBG 3N9YC 2L9HA 3DVNV 3ZYYX 2PE9A 1NTGA 2INNE 1CMXB 4FJVB 5IY0A 3PF4A 2BDNA 1TVXA 3FAHA 1WMHA 3RD2A 3F2DA 2TMPA 3K5NA 3H09A 1YX5B 2FUG1 2LMCB 2A73B 1C9OA 1Q5WB 3I4MB 1B4OA 3K81C 4X65Q 1IKMA 3GQBA 3GV6A 4RHSA 3Q22A 4QQBX 2L83A 1RIPA 3UIPB 3HOUB 3NVZA 4IZ8A 3ZJTA 5AJ3Q 2DN8A 3KUDB 4JG2A 4JI3Q 4LDTB 4MSQB 1N34Q 4JQWC 1N8RC 3S16H 2V0GA 4A3KB 2V3NA 1ZXIA 4A3MB 1AE2A 3NUHB 1DYQA 1U4RA 1WCMH 4AQYL 1G2TA 3ZLZA 2JA5B 2XN9C 4ZAIA 3HOVB 2O2VA 3C8YA 2PNHA 2XK5A 4DV3L 2DY7A 4A9AA 5G3LF 1JMCA 1FNUA 2E5LQ 1QZGA 3W1SC 4AS1A 3NZ3A 3P1HA 2K39A 2L8JA 3ZDMC 1XD3B 4I6LB 1S1QB 4DN4M 3KF6B 4NB3A 4A3MH 1EIFA 1TKGA 1CUKA 5G5GA 3M4QA 4JI7L 3KF6A 3TP8A 2WAQE 2JA8G 1L7YA 2NBWB 3ENEA 4AJWA 2CHBD 3M62B 4A3LG 1LT3D 3MWYW 3NS8A 3DWPA 3PIPA 1ZDXA 2EYFA 2FMMA 4AH6A 3RLOA 1BCPD 1YIWA 4C56C 1DCZA 1GM5A 4P73A 1ZKHA 1W6JA 1XT9B 1SNPA 3S2HB 2F0PA 1CA5A 1L0VB 1WE7A 1P0RA 3FPPA 3Q8DA 4DR2L 2DENB 3GZNB 2KK8A 2DY8A 4MJSA 2KDEB 1WF9A 1EY6A 4XT1B 4ANXA 4EQNA 1KL9A 2KN5A 5CBEE 1L5PA 2H4OA 4GB9A 1IL2A 4DR6Q 2SDFA 1V9JA 4UDUC 4KDIC 1PTOH 1CT1D 1OXUA 1D1KA 4P71A 1KF6B 1PZID 4XDDA 2AQ3B 3CWIA 2MH7A 3AE2B 3R3OA 3CQZB 1PH3A 4J6HA 1SFOB 2H89B 1AZPA 1WVLA 2KANA 3BINA 1PMRA 4E6IA 5FLMG 2LGSA 2MCNB 5JHAA 2M17A 1F2ZA 1JORA 1AZQA 2V4IB 3G4SA 2Q5WD 1HFGA 1NDDA 4FDBA 1G6PA 4RA8A 3QWNA 3K9OB 4NW2A 4NAWB 1UBIA 3TEXA 2WU2B 4JW0A 4DUZQ 4RNAA 2YEPF 1K73C 1KAWA 3QIJA 4MGKE 5FLXL 3KH0A 3QJYA 4XZ4A 1I35A 4DPGA 4A4IA 2MSED 4EEWA 1HA6A 3C0RB 2A6HC 1EWIA 4YTNB 1UUPA 3TEZA 4IUPA 4M1UB 4PZ6A 1EY5A 1FIQA 2KEDA 4A3GG 3WAMA 2RHQB 3KJPA 1JR0D 1BNZA 4JYAL 1VQ4A 4ANWA 2K5VA 3EFXD 4EE2A 5LL6S 4XTCS 3ULJA 4ARCA 3MXUA 4ANUA 1WR1A 1UWVA 3R2TA 1FNVA 4QGUA 2R93H 1HA5A 1V1PA 1UZXB 5ELEA 2OCEA 3NS1A 1U5KA 1S5FD 1BR9A 1PDQA 1PH8A 4K3CA 1HZBA 1XMQL 1TYGB 2K03A 3J7ZC 3GTQB 4WJ3M 5EJWA 3SR6A 4AYBE 3VYRA 4FF1A 3KVFB 1GB1A 4ZQ3A 3AE3B 3CRLC 3HK0A 4LF4L 4DR5Q 4M00A 4N8FA 1S5BD 1II3A 3AE6B 4DA2A 2F4IA 1IUEA 1YQ4B 4IUVA 2A69D 2DJGC 1TGZB 4W9JA 2OQ0A 4L5RC 3HOUH 4JWSC 4DFAA 2BCOA 4HTHA 2ZZPB 2B2WC 4PMBA 4A3IG 1HNWL 1TWCH 2NZHA 2PZWA 4DR1Q 4HEDA 1TKYA 2CHWA 1SE9A 4ALPA 3SXHA 1VZ8A 2KACA 3N30A 4NQKE 4BS9A 5IODA 1TT2A 1WJNA 1ZOYB 1Q3LA 3NK9A 5IGEA 2LJ5A 5M9OA 3ZO5B 3PV1A 2N9EB 2ZPNA 1H8CA 1VRAB 3EGRA 3HOWG 2ICEC 1G91A 3ZKJC 1G51A 1K0RA 1NVID 4DHZB 2B3GA 1C48A 4DV6Q 3I63C 3L4PA 4CJ1B 2JA9A 2RDHA 4BKTA 2MO1A 1VQMA 2L0FA 3CXCA 4A76A 4ILWA 4ASWC 1ML0D 2ZTCA 1V5OA 2K75A 2K1BA 4FA6A 3A74A 3JC66 4Q5VA 5IYBG 3HKZE 1FXAA 4L23A 3VH3B 1ZXTA 3MTNB 4FJYA 4K81A 4YIJA 1BF4A 2WAQG 2KFKB 4KGSA 3RT3B 1PH1A 2IY0B 1EUJA 2HDMA 2LXJA 1NI3A 4JBWA 3OOCA 5D6JB 3CF6E 5DAUA 2KUMA 4BY1H 3VYUA 1SE4A 3G71A 2O2LD 1HQMC 3JVZX 3ZNID 3CHBD 3WAPA 4MGIE 1FD6A 2OQKA 4X3UA 3PTFC 5C4XG 1YNJD 1EM7A 3E9SA 4W9EA 5IO9A 1AW7A 4CO7A 3NZUA 1HFNA 2Y0SG 3HIZA 4F8CB 4K14A 1FNWA 4F7XA 3GTJH 1Y56A 2N3SA 2TSSA 3ZTDA 4OHJA 4A93B 4J6IA 4FNFA 1EYGA 2F0SA 3OHXC 2BWES 3AB9A 5C0XI 1TJEA 3RI7C 4C4VB 4MTKA 1D3ZA 2ACZB 1WTRA 3JSVA 2CVRA 4WJ4A 1BMLC 2QHOA 1XNRQ 2E2JB 1WI0A 3A33B 3FKYA 1E2ZA 4DXGA 2WGSA 1JQ4A 1MGSA 2ZTDA 1FCLA 4B9XA 2KDFB 3UE1A 5I6YA 1QZHA 1Q86C 3JW0X 1Q8IA 1YEZA 1Z9FA 5LL6X 1NMFA 4ZDVA 1KDCA 2MGSA 3G6JB 2SEBD 1CSQA 3CMAA 4DV1Q 1CA6A 3R2IA 2VNUD 2K8BA 3QJZA 4LF4Q 3I56A 4X65L 5E6NA 1LV9A 2IJ0A 3T4AC 3RUZA 5JVG3 1I42A 2ZW1A 4HLEA 3CC2A 2HHHQ 1JMLA 4JI6L 2KHIA 3MHBA 4NAWA 2AMCB 2MBOA 4OZAA 2CW0D 1JE5A 3LNNA 3ER0A 4HPLB 1PH9A 3TEHB 5M3MH 3BVZA 2PNRC 3CC7A 4K7SA 2RDGA 1EOVA 5GADC 1FGUA 4JI5L 3AFQA 1K51A 5EKLA 1EQQA 3MXGA 4RF0A 2W3RA 3ICEA 4A3GH 2BE5D 2B2YC 2N1WA 3D6CA 3D4WA 2EXZA 2Z0DB 4ZKBB 3PO3H 1R4QB 2IT1A 3TP7A 2F0DA 2IBIB 2GVBA 1GG3A 2MJ3A 3ETRA 1PRTF 1P9DU 3CCQA 2F03A 2INPE 3I7FA 3U9OA 2MWSB 4R3DA 4FVMA 3NQIA 4L63B 5I2YA 3RN5A 5CV7A 2DAJA 1N32Q 3I4OA 4M02A 4IJLA 4B6WA 3TREA 2B2VA 1B2TA 2G4SA 4G7OC 1H4RA 1JWAD 1PTOD 5HG2A 1ET6A 1Q81C 2WWZA 4C80A 4LW1A 1IYFA 2F0UA 1IBXA 2JSOA 3DPDA 1Z5SB 2BS4B 2KECA 4YTMB 1HQRD 5IWAL 1A3VA 4WJNA 2ZNVC 3EC8A 4E71A 4DNIA 3NRZA 3KYHC 3A4SC 2RDFA 3A0JA 4NXMQ 3DHHC 3PREA 4R8NA 2MJEA 4ZKCB 2B3AA 1TBEA 2NZOA 4CDCC 4GKKQ 1RL2A 1K8OA 3VR6A 4IG7B 2JEBI 2NN6G 2V3PA 3BYTB 2IO1B 4ME5A 4UPAA 1TWFB 2XK5B 4JPSA 4II3B 2DX5B 2YVCA 2CH4A 4NKLA 1E6EB 4GDKB 1QZEA 5LMNL 1F2RC 3Q0AA 3KYDD 3MP9A 1R4NB 2I5MX 2KXJA 5M3FG 2DNFA 1H9JA 1X56A 3K5OA 4C2MB 1J9OA 2A4ZA 2XGTA 2ZCBA 1V8QA 1A5RA 3IRBA 4OIJA 3H91A 1A15A 3NTHA 1QCBD 1J8IA 4CKCA 4HCEA 1LUZA 2M9VA 4WH4A 3FDTA 4LWCA 3IBEA 3U58A 2EYMA 4EOYA 2O6VA 2R2QA 3VAWA 4DBGA 3H6MA 4CJ0B 1FXTB 2NUCA 1XNQQ 3RMHA 5JAVA 4C7ZA 1L0XB 1OXSC 4DV1L 1VDZA 3VUYA 3A1QA 5ELNA 4LF8L 3QQ8B 4RKLA 2O4XA 1HUNA 4OXPA 4POFA 3NP8A 2FAZA 1Q8KA 1ZYRD 2DZKA 2N7EA 5EGTA 3BZDB 1O7ZA 5E1FA 2KT7A 4A20A 3HG9A 2FE8A 2NVTH 3T3NA 4DK0A 3HKSA 5IGFA 1DONA 3RNEC 2XRQD 4HRSA 4WWNA 4YTPB 3NOBA 5GAHC 2KCCA 1MHWC 4GOPC 1WGYA 1N36L 3Q3JA 4DV4L 2C7HA 4JI5Q 4XC2A 1WZ0A 2L5TA 2E2HB 4NPSA 1WI5A 1WTXA 1EZ8A 4N9PA 3V6CB 3MJWA 3A5UA 3RNUA 2LVPA 1EY9A 2B63G 2RDBC 5C4JH 1QF6A 1VQGA 3DHGC 1IKLA 3Q14C 2UXCL 3T53B 4C3HB 1GKHA 3PRPB 4JI4L 1E5WA 2GLSA 5LLIA 2W55A 1JE4A 1VZ7A 1VQLA 4K7UA 3HOZB 1K9MC 3CD6A 4GN1A 1PA6A 1WYWB 4MGZE 1EY8A 4P74A 3AE5B 2KCTA 3VUWA 5JPNC 2K32A 1K50A 1KHIA 2REXA 2FXQA 1GXDC 1LFDA 4DK5A 2W54A 1DGJA 1WX7A 3U4EG 2RCFA 5CORA 3GTOB 2GB1A 1R4PB 3M4PA 2VQEQ 1JQYD 1GJXA 4FF4A 1SYGA 4NJ6A 4B3SL 1P16A 4A3DH 2ON8A 1WTWA 5C5MA 1EYAA 1SN8A 2JEAI 1E10A 3APCA 1KNAA 3TS0A 3OAWA 3DMUA 1B1ZA 2LI5A 1VQEA 1CZGA 3D6WA 4DV6L 1LTGD 3PUWA 4DR3Q 2BW2A 2DGYA 5EE0A 1A0IA 2PI2A 2BTEA 4A3DB 3A55A 1WIAA 4WQMA 3CCLA 1HTOA 3R93A 1WX8A 3HOUG 2K4KA 1STEA 4N9TA 4PG3A 3MHZA 4EUTA 1VQ9A 5H1SE 5M5XH 3P1MA 3DWMA 5DPSA 2JVCA 1L1OC 1SRUA 1U9RA 2CWAA 4JI1Q 1T0SC 2E6XA 2WLBA 4FULA 1C76A 3BVMA 3H0GG 2MJDA 3LGJA 3P4PB 1NJIC 1WE6A 2M8SA 4DR5L 1F9JA 1WTPA 1UWMA 3NVWA 2DYMA 5BO4B 1WTOA 2DJFC 4LF7Q 4C3JB 2RPVA 1WGKA 2EYPA 2D0PA 3A7AB 5C5LA 5C4JB 1YQ3B 4B3TQ 3L0WB 2UWQA 3Q2AC 2Z1CA 5F2DA 3BU2A 4YCWA 1Y69U 4NNJB 4O42A 4LUVA 1I6VC 4IFDJ 3S1QH 4FP5D 4LF6Q 5FR6A 4H02A 1SFOH 3W3AA 5A35A 4K8IA 2HDLA 5ELFA 3PIOA 2F0JA 2DYOA 4A3JB 2KOXA 3TRZA 3K5MA 5I2XA 3R7RA 3SK5A 5IT9L 4FHJA 5IT9E 1PRTC 2VQFL 2QIEB 2AHOB 1R4NI 5L95C 5C4ZA 3HUIA 4KX6B 2E5LL 4NJ7A 1EF1A 4DGZA 3LXFA 2KX3A 1BO0A 1JWSD 2GOWA 1V1QA 2MUYA 4KD4A 3QX1A 3OTOQ 5EPLA 4HCNB 1CKNA 3CCEA 1NY4A 3OLMD 3GTKH 4AUQC 3E9HA 4LDTD 5DNFA 4KJOA 2VQEL 2L76A 4KIKA 4MH8A 1F2YA 1ICWA 1QLBB 2L3ZA 2PTLA 3JAMc 1ZEQX 2MO0A 3RZDB 1S40A 1YI2A 2UXDQ 1B50A 3L08A 2F1MA 3U50C 1RD9D 1WXVA 1UWXA 3I4NB 4JBJA 1V1OA 3A56A 4PZ8A 4JX1C 4GS3A 3WANA 3TN2A 2R3ZA 3KBGA 1FCCC 3I9V1 2KLGA 3IVFA 5LMNW 2WDVB 4GXBA 1L4DB 4HJGE 2IHEA 3M4OH 4KVGB 5FK9C 1AH9A 4IUNA 5FLXE 4B9KA 3LJ3A 1DOLA 2KHSA 1WXMA 4JI0Q 3S2AA 2WQYB 2JXXA 2ZJQA 5BMHA 4MACA 2FIDA 2KVRA 4XIGS 1I4QA 4K6LA 3ZQ4A 3NVYA 2Z4HA 1ZDVA 2F0KA 1CKOA 4RH6A 4WJQA 3K6OA 1SMYC 4LUOA 1PFMA 3J7AV 4LJOB 2L11A 2NVQH 2UUCQ 4OWWB 1TWHH 3I4MH 1U4LA 1Q0WB 4DDID 5JPMC 5A2QL 1GHJA 2IO0B 4GDKA 4DAYB 1S4ZA 3EIVA 3AN1A 4X66Q 2L1AA 4ZRIA 3NUCA 4HIDA 3GE3C 4ZRKA 1IXRA 5M3FB 3HOYB 2K5HA 4JPBW 3WWVA 3GTQH 1IZ6A 3QR8A 2KCMA 2UYZB 1UE7A 3PO0A 2K05A 2YEPB 2K9XA 4RFBA 1LTAD 3V05A 4BA2I 1MG4A 3UGBB 1I4XA 4IWOA 4CDFC 5IYDH 2GBMA 3AFPA 3HZXA 2X8XX 2EY6A 4A3EG 4Q0FA 3I4NH 1MG8A 4O2DA 1GB4A 1VQNA 4A3IB 2L00B 2AUKA 3HS0C 2XWJB 3WCQA 4AYBB 1M4VA 5CHWA 1HNXQ 4I7ZC 3HOXB 2M0AA 2RHSB 4GMVA 4DAVA 1TU2B 4CYEA 1I5FA 2EQSA 5D3DA 2I0QA 5DLQE 2A19A 2R7ZH 3P42A 1T5EA 1EUVB 1I4RA 2D3BA 3DOWA 2CFMA 2VY3A 2Z6KA 4XXEA 1N33Q 1JWBD 2D5GA 1K3BC 4IFDI 1SIFA 1Q46A 4KTAA 1YN5A 1WGRA 5E4WC 2VZKB 2Y0SB 4XT3B 1XMQQ 3AE8B 2KMCA 2NTSA 4LNIA 1Q1EA 2UXCQ 2XIWA 4Y7NH 4L5TA 2FINB 3TP6A 3QC8B 3BK2A 1QVFA 1PVOA 5L83A 3P75A 1C4CA 1JJ2A 3RZDH 2GI9A 3EFUA 3RLNA 3Q8BA 4DR4Q 4P1BC 4DK1A 2MLBA 4FYDA 1Y1VG 4DHZE 1YN3A 4ZYNA 5BMGA 2H5XA 2RR9A 3PZ7A 2WXGA 4OVUA 3DHIC 2K8CA 2EMSA 3N1YC 1I7HA 1N5XA 2B2YA 3NWTA 2LS01 4OELB 4TSSA 2PE6B 1L2NA 1YNTE 1BBWA 1YZ6A 2BBCA 1IBLQ 4P7IA 1LO5D 4P72A 3HOYH 3MC9A 1EL0A 2PKOA 2Q8TA 2V3SA 5H8YE 1B8AA 2JA8B 3W5UB 3NJTA 2DYBA 1G291 1PFNA 1SE8A 2I5HA 5BN5A 2V1CC 2PPBC 4PK1A 4OWXB 3IT6B 4FXDA 4NZLB 5D94A 4KY5A 5FO7B 4B3MQ 1ASYA 4BBRH 4ICVA 2EOTA 4C7YA 4GOPB 4B0MA 1O7LA 1J5EQ 2XBBC 1W2BA 1AE3A 1KAAA 4C3IB 4KKSA 4A3FG 1VMPA 2G9HD 1FXIA 2G45B 3HOZH 2C7NB 2KJ6A 3ALBA 3ZGZA 3AMZA 4NDXA 2OHFA 1GC7A 1F52A 1Y8PB 1L4ZB 1NAPA 4C3HH 2R7ZB 3CU7A 2NR2A 3U7ZA 3K0YA 2RKSA 2CCZA 3CCMA 2O5JC 4XE0A 3S1NB 4OGQC 2BA0A 4LNNA 1HZCA 3NTIA 2PW9A 3TDQA 3QOJA 4Q2JA 3MXPA 1MHHE 3W2DA 3U9SA 3EROA 3ITPA 5M5XB 3MXNB 4KLKA 4FF3A 4U68A 1K0SA 2XRSD 2UXBL 5LXIB 3UDFA 2OEDA 1TS5A 1Q12A 1RFAA 2L05A 1C78A 3IHPC 4QIWE 1QOFA 1KABA 3DBHB 4RM8A 5FOBB 1F9SA 1VQAA 4ARIA 1OTRB 2NYZD 4ZYSA 2H1EA 2KTRB 2HTHA 1JRPA 3ZXRA 2WXKA 3DWQA 2K5PA 2IW3A 4OVZA 1FR3A 3DQVA 1HZ6A 4YL8A 3EHVA 3AU5A 3JYUA 4II2B 2D2CC 1IBKL 2C9OA 4HAEA 1U4MA 2A74C 4XQJA 2WX0A 4C4VA 1CZWA 4H0LC 2K22A 5ISRA 1XJVA 4LJZC 3VR8B 1STNA 4JV5Q 4X6AH 4DV0Q 4L2YA 4YSYB 1I94L 4IOIE 3RNGC 1JC7A 1KQSA 5IP9G 4TKOB 4C00A 4YCVA 2FCMA 4YXDB 1K83H 2NVTB 3PUYA 3ZRFA 3MJ5A 2Q8RE 4GKJQ 1K3RA 4IALA 1TS4A 4K8JA 2Z59B 1A3TA 5BYSA 3E0EA 2JRIB 2NPTA 2PJHA 1E8WA 5D2MB 4C2MH 1TY2A 3CF5A 2WNMA 3AEEB 3Q69A 5NUCA 1EFID 2EZVA 1PHJA 4RWSC 1WFYA 5KRUA 4BY1G 3EVQA 1MHXA 3VRBB 1KFYB 3QG1A 4DV0L 3ZUNA 4K1RB 5ELOA 5C2TB 1PH7A 4DXFA 2F3IA 4KN7C 3B9JA 3K7AB 4GIVA 1VQDA 1VJKA 1E0ZA 1EWHA 5IN7A 2K52A 5EE1A 1O7IA 2L0TA 2ALYB 1OQYA 4RGMA 1VQKA 1Y8OB 2ZTEA 2GBRA 4ZUJA 4ZRJA 1KRTA 1IL8A 3M3YH 2N0SB 4OIKA 1HE8A 3W9CB 3QWZB 2ICIA 3GTKB 2HD5B 4PYZA 1WX9A 3E56A 3MC8A 3C1EA 2F0IA 3D3RA 1PDXA 3G7LA 3LWUA 5T1GA 2LFIA 4O1NA 1WCMG 3FKIH 1JB7A 3ABVB 2Z6BA 1X9NA 2WX1A 4P75A 2A5UA 5K36H 3L0OA 3BJUA 5G2NA 1MI2A 1WYDA 1P3QU 1WH3A 1FO4A 4LFCQ 2G9DA 1XLPA 4MTNA 3ZTCA 3K80C 1BXTA 1FFVA 4PMWA 4PQXA 5C6AA 2NVXB 4W9KA 1OXVA 3RULA 5JZEB 3NPPA 1T0RC 1TKEA 1NUCA 2PZUA 3IFWB 1CZPA 3RN9C 1K53A 1KLGD 3PHWB 1C4AA 3VR5A 3ZJVA 4WJOA 2BT6A 1VQCA 4GNXC 2I5LX 1WJ6A 3APDA 4KKJA 2QMTA 4XWWA 5CHVC 2K5DA 4DK6C 2VXWA 2NVUI 1EIHA 1NBFC 2Q2TA 4YY3L 3CCSA 4YWGG 1NR2A 4LTUA 2XTIA 1QUQA 4EQ5A 2B8FA 2J52A 2B39A 4KN4C 1JW9D 2NVQB 1K52A 2VW9A 3NTKA 3SK4A 1XO3A 1E1OA 2A68D 3S24A 2EKEC 1ZW7A 2LVQA 3Q6BA 3ECIA 4JIOU 1TS3A 3VDZA 1HZ5A 5K36G 1XEEA 4KY7A 3MHSD 4OZCA 3UQBA 3X0WA 2RSNA 1LM8B 2IGGA 2B63B 2R7DA 2O6VB 4X3KA 2PVOD 4DWFA 5EPJA 2HE7A 1X6OA 4K5XA 1I50H 3RMKC 5BN4A 4GDLB 3T13A 1F2RI 4X62Q 1I4GA 2G3QB 1E7UA 1P8LA 1WRDB 3NE5B 3EECA 1V2YA 1LTBD 3S15H 3GOEA 2B76B 1DD2A 1OGWA 2R93B 1WY8A 1YMHE 4J3OD 3B08A 4A3PA 3F2BA 4DNTB 2ZT9C 4JBMA 2F0WA 4UY8C 1VCBA 2WXHA 2WB1G 4CHKA 3ZNZB 2BB6A 1LTRD 3KJOA 2K04A 2O6VD 2ZXOA 1ZYRC 1IBXB 4HIOA 2X38A 2JUOA 4A90A 1O80A 1SE2A 4A75A 1G2SA 5CV5A 2OTLA 4JCVE 2DNCA 2BDOA 4WFN3 5GMVA 3CP0A 1B9MA 1F2LA 3FPUB 3GTMH 1D7QA 5IAAC 3GTPH 4GN4B 1DXMA 2F0OA 5CV6A 1B3AA 1C8CA 3FP9A 5BYQA 4HIMA 4A3JG 1N60A 4X64Q 2L4NA 2B8GA 1M1KC 3GV3A 4BBRB 2N55A 4OO1G 2PMVA 1I6HB 2PQEA 4LUZA 2CQAA 2D3AA 1HTLD 1VQ6A 4BBNF 5J3BA 3L2PA 1CKMA 3SK6A 3J7YW 2RD0A 2CKZB 1WXSA 4BZAA 4DR3L 1XWEA 5I9PA 4A93G 1SAPA 4V190 2K5WA 2ES2A 4JLCA 3U8ZA 4DK3C 4DV3Q 5HY6A 1SYFA 1N32L 4MGYE 4XDCA 1VQ7A 2IGDA 1QNKA 4HKZE 5DEHA 1JICA 4A3BG 1C1YB 3RCZA 4AP4C 2CR5A 3CSFA 2JE6I 1YQBA 3H0GH 1QOHA 3CPFA 1HJPA 2LXAA 1M90C 3H7PA 4LFAQ 4P2CB 3WA0A 1MVKA 1SBBB 3E6ZX 5T1IA 5JJZA 4USAA 5GAGC 1EIYB 3BG3A 1E9MA 4MZ9A 3J80E 2ONQA 5J18A 4CGYB 2ENBA 3BS1A 2N9KA 4HCPB 4JK1C 2VQFQ 3M7GA 4TRDA 3KLSX 3DWGC 4RCOA 2BYEA 5DPWA 4G0NB 2HQEA 3Q24A 2JA7G 3ZIMA 1NR4A 2L0CA 4G7ZC 3BDOA 3L17A 4YHHQ 4FF2A 2N9PC 4DV2Q 1SNCA 3K59A 3V6EB 3CPWA 2HIXA 3S15B 1VQ8A 5EPKA 1TWGH 2N1VA 5CV9A 1STYA 4JI6Q 1LQBA 3AU4A 3S9WA 4W9HA 1I50B 1H9KA 4DV4Q 2HJ8A 2NMQA 3S16B 2MX2A 2Z4IA 4DV7L 1CKNB 2VS1A 3D32A 1VF5C 1X3GA 1TIID 5C44G 4JI8Q 1PH4A 3H3VH 1PYSB 5CTRC 3K8AA 1AYFA 4G7HC 1WGGA 2KHWB 2WS3B 1XTDA 2FBWB 2AEHA 2KQ4X 5C44H 3MFYA 2UUBL 1D8LA 2LXCA 3A9JB 3Q8FA 1NYRA 4H44C 5M5YH 3DLLA 3HOYG 3HKZB 5EKKA 3NENA 1OQRA 4EQPA 4KHPL 1HNZL 3C1FA 3TBIB 2A69C 1TT5B 2QJLA 3FRPB 3A54A 3X3NA 4DHJD 1OTCA 2MW5A 4E3CA 1AP0A 1R4MI 2J7QB 4WORA 1T0QC 4IUQA 3DBRI 2K5QA 3OW7A 2R92H 1GC6A 1HNZQ 3W5VB 3UDGA 2JX5A 1ESRA 4EZLA 4UP9A 1HRJA 2A6ED 4A55A 5CR3A 1LACA 4AQYQ 2EYHA 1CM9A 4BA1I 4LF6L 2XEWA 1WRIA 2VZKD 1UE1A 3HM6X 1R9TB 4R4TA 1XTCD 2PMZB 2IX1A 2EMTA 1SIJA 1P7FA 3SHQA 5KHQA 1EY4A 3JAME 4IPHA 2F0FA 3V2TA 2M56B 1FL0A 1YHQA 4BVUC 2D11A 1N61A 4HJ9A 3MA2B 3RUIB 3BY4B 1XCTL 4AWJA 1EU4A 4PT5A 1VQPA 4DXAB 3M7NA 1S3OA 2BA1A 2EDGA 2GN5A 2L12A 5C3WA 3C3LA 4A93H 1FM0D 1JROA 1I4HA 3I5JC 3L54A 1K8GA 3AE7B 3T9LA 2F0GA 5IWAQ 1DOMA 5CHFA 3U7DA 4WJWA 4YWKA 4B9WA 1ZGUB 4OEMB 5E4XA 2M0XA 1OXXK 2VZAA 4QUCA 3HVDA 2F0TA 4LLGM 1YNXA 2WIIB 1ZUD2 3HRDD 2FMCA 3NXWA 3AYHB 1WXQA 3L7ZC 2PW7A 3SEBA 1GO3E 4NAMA 3ERSX 5FO8B 5C0XG 1WYGA 3P63A 1BBUA 4GOPA 2VUMB 3AECB 1CQVA 3I3TB 1IYVA 1XLNA 4B3SQ 5I6WA 1L6VA 3FVQA 1TR5A 1A3UA 4RHRA 1QOAA 2ZVNA 5TR5A 5AEKB 4TMAB 3DDCB 2JA6B 1WGDA 1RF2D 3AEVA 1R9TH 1WM3A 4DV7Q 4KHVA 4WQOB 3S14B 2OEOA 4UHVA 4HJ5A 4BBSB 1ISNA 2CJOA 2JSVX 2K8HA 1Y1VB 4HK2A 2O5IC 5GQOA 3GTOH 1AFPA 1EEID 4OW0A 2JQRB 4IW0A 4IO9A 3KDFB 3ULLA 1JT8A 1V81A 4B3RQ 1AARA 1J8CA 4IOAA 1PFDA 4LF9L 1NEKB 3A1QB 3RNAC 3O65B 2DHZA 4UP8A 1R7SA 1VMCA 5M5WH 3VTWA 4H7BA 1H9MA 3I4LA 4RGTA 3UE0A 1D2BA 4IQZA 3P7JA 1N63A 3TEYA 2N88A 4DR2Q 1LGRA 1N33L 5E6JA 3H15A 1YITA 1H9SA 3V60A 1GPXA 3E3XA 4IFDG 3D0FA 2B2TA 4F87A 1SSOA 4GN5A 1L0WA 1QVGA 4OO1H 2WXLA 2NVYH 3OW2A 2WXFA 4CDEC 3RNBC 1KDBA 1AWDA 3UI3A 1SR3A 2BH2A 3HEJA 3EFCA 5ELDA 2SOBA 2JXMB 4B08A 3WIMA 2DLBA 3RLFA 1HH2P 4TKNA 3R3MA 1EYCA 2I07B 3NBHB 3M95A 3A7LA 1S5ED 4R4OA 3NBIA 4HCSA 5KYLA 1JOKA 3DBRB 5AZHA 4DUYQ 4X3SA 4IUTA 3V3XA 2JN4A 4A3FH 2V1YA 5M3MB 4IWPA 5JVH3 1EIGA 1TS2A 2QDBA 3MAQA 1QOGA 1V49A 4HDOA 1BOSA 4KHPQ 1E24A 4QL5A 2H88B 4M8AA 3M3JA 2RSOA 5GXGB 4A3DG 1JOQA 2W3SA 3Q3OC 1EEFD 2K3UA 4OVVA 3S17B 2KQSA 1LLRD 5L37A 2LASA 2GBKA 4NMZA 1PTOB 2WXIA 4PS7A 5D65A 1VS0A 2WP8J 3C19A 1ZE3D 2AYOB 2AWOA 3Q23A 2C60A 2VUMH 3RYTA 5DM73 3BZCA 3S1RH 4MT5A 2SNMA 1VQIA 5I4DA 3J81L 3S2HH 1C9FA 2C35B 2ID0A 2F4VQ 4K3BA 3CRKC 3BVGA 2BOSA 2DNEA 3KF8A 1FD7D 4K5WA 2WXJA 3S14H 5KGUA 2G5DA 2UUAL 2FJ2A 2R7FA 3IL8A 3CCJA 1A63A 2L55A 4LAAA 2J0TD 4DUYL 3QARA 2LGYA 1IGDA 1A2UA 3PPAA 1DGSA 1XX8A 1JJGA 3AMUA 2GRIA 3FKIB 3TBLD 2Q2IA 5C23A 2Q2UA 1IGCA 4LFAL 4TQUS 3ZNGC 1S5CD 1MBYA 1A6XA 1RRBA 2MRPA 4EQOA 2UUCL 4G50A 4TQ0A 2D07B 3OG5A 3UF8A 4A3EB 2J0JA 5AJ3L 5CX3A 3GZNI 3GTLB 2GVAA 5C44B 2LKVA 1ET9A 5E6PA 1Q1OA 4ANVA 2KOLA 2Q2HA 3I91A 5IIFA 2E2DC 1PYBA 2F0LA 1EY7A 4L5QA 2MQJA 3U2SC 3I57A 1PH6A 4BXXG 2RMMA 3AE9B 2RQXA 3HOWH 2W82A 3WALA 3L16A 3X23A 3J81i 1E0BA 3NG0A 2KWCA 2MA9B 3DEPA 2KJHB 4GLVB 1SNOA 5IP7H 5BYRA 1L1OB 4RGNA 1EFWA 4JWUC 2UXDL 2ZCCA 2I38A 2NCNA 1LTLA 4BFRA 1RLFA 3S17H 4LFBQ 1OEYA 1T3QA 3IFDA 3MEFA 1C0AA 1NI2A 2AWNA 2F0QA 3DBLI 1NE3A 4QUFA 2R61A 1UF0A 2LGXA 4HROA 1IP9A 2QILA 3G48A 5EBDA 2KJRA 4HKQA 2D3CA 3E9IA 3A9KB 2IL8A 1GUAB 1FGBD 3VR3A 2LEKA 3EJIA 1YJ9A 3VUXA 4NXML 2JPHA 3RZFA 4LF8Q 1QG7A 1LTSD 3ZJUA 4KSKC 3J80c 3PGZA 4PV1C 1GNUA 5J39A 2QKIC 2JXTA 4K0KL 3U30A 4ZRQA 4BOZB 2RF4A 4Z9CB 2JA5H 4ID6A 3QOLA 2HUGA 3HOZG 2OF1A 1PRTD 4N58A 1KH0A 3KLSA 1RYJA 3CCUA 1G8ZD 2F4VL 2G1EA 3OJ3A 2MP1A 3ERQA 4CBVA 1YX6B 3HFZB 1B53A 1SNDA 4IURA 2DWQA 5EDSA 1NSNS 3ND9A 4LNFA 1DOKA 4J1MA 1V43A 4B3TL 3H1UA 1XPOA 3S1NH 3I55A 2JYEA 3HP3A 1PH2A 4KI0A 4DDGD 4WWPA 1IHZA 4PYUA 3KOJA 4U673 3GTPB 1IW7D 3O13A 1OXTA 2BYFA 3T3OA 3GP7A 5DPTA 1STGA 2R93G 4KDLB 4MNOA 4GLSC 3N6RA 3M85A 1ILPA 2N78A 3T1HQ 2M19A 2KTRA 2MHVA 4W9GA 1D5ZC 2FNJB 4EKUA 4KKIA 2BYTA 3X3MA 3MVVA 2HTME 4HWIB 4XWTA 3SK8A 5JJLA 1J5EL 5LXHA 3QCAA 5MPOA 3TZDA 4DAMA 3JAMi 3QB3A 3CC4A 3ML8A 3H0GB 3AH7A 3PQIA 4K2LA 2KHJA 4DV5L 3BDLA 4HDQA 5EAYA 4TV3A 2PLPA 2LSSA 3S2DH 3ML9A 4IPGA 3QHTA 5COYA 1L1OA 4JVZA 3PUZA 2FCNA 3P20A 1XMOQ 3U52E 1W3SA 2EY1A 2QDFA 4G4KA 4WJPA 4BBRG 1JCKB 2MBBB 1MFWA 2KQ7A 1DZ1A 2L15A 1I6HH 2AL6A 2CQOA 2EPBA 1V80A 4KGTA 5IYCH 1RJTA 2ZXPA 4A3MG 1VDVA 2WDQB 2FCQA 1JALA 4FHKA 4MM3B 1RODA 2I1KA 1U4PA 4ZRPA 1GJZA 2JA5G 3V62A 3PGEA 1PLFA 1ROEA 2ATWA 3J7A5 3BIID 2WACA 1N6ZA 1UGJA 3TZUA 4IKGA 2BH8A 4XQNA 1DM0B 4GZYC 3T1HL 3PT2B 4DR6L 1WJ4A 1PGXA 1XXGA 4O0AA 4BY1B 4RF1A 2OOBB 5IGGA 1UE6A 2X6GA 2PW5A 1G6ZA 4J15A 3AQQA 3AULA 4K7WA 4ZLTF 2LGDA 4I6PA 4WAAA 1HUMA 4KZCA 2R7ZG 3W1YA 2B63H 3ZW3A 2CWPA 5KNCA 2LGIA 1OFFA 1R4MB 5LMUL 2AL3A 1XCQL 1F9RA 2D62A 2F0MA 1UE5A 1X3EA 2EYOA 3B6YA 4LFCL 5HURA 3KUZA 3ZJYC 3PCOB 5IE8A 2E2IH 2WKDA 2LWPA 3H6NA 4G11A 2KWUB 4M01A 4EZJA 3CKIB 1RDPD 4HMJA 2KENA 4LF5Q 3I4NG 2NZ1D 4POGA 1C79A 1GUTA 2RGFA 1KDAA 2R92B 3F8TA 4BOSC 3Q3NC 1TWGB 4JOIA 2JY6A 3VTVA 5JHBA 2MEKA 4G3XB 3NQTA 2AX5A 2PMZE 1ESFA 4JBKA 1SROA 4S3SA 5CV8A 2KLCA 1SYBA 4OWTB 3TL5A 3H8HA 5KIXA 1VQFA 1SXTA 2JWUA 3PSIA 4LNQA 5IYBH 1RTNA 1HZ9A 5CV4A 1PQSA 3DXJC 3CCRA 4REZA 4F8MA 1X3PA 2JP1A 1F9QA 4AJYB 3EA6A 1LYLA 5G3LD 1YHBA 2LFNA 2PQAA 2BGFA 4WURA 1GOZA 1KOTA 4QF4A 2Z0EB 2VRRB 3B2FA 2JA6H 3TS2A 2O2VB 3FKIG 4GGQA 3J81E 3TEWA 4R1JA 1FPYA 3S1RB 2BVCA 5DPRA 1EZ6A 4KJNA 2LUMA 2ZEQA 2KX0A 5EE3A 3ZRCA 3N52A 4HN7A 1TQOA 4JI0L 1JJCB 5BR8Q 1HNXL 2RPQA 4NPNA 5IOIA 4BY7B 1B7YB 3D8GA 3DM1A 1S3SG 2YU9B 4C1NI 3M63B 1HXYD 4JV5L 3PRZA 1K83B 5GROA 1YVCA 3OMGA 4MH0E 4BAXA 1SSNA 2HQLA 3FHWA 1YJ1A 3BWUD 2VH2A 5JJIA 3PHXB 4GNXA 3NEMA 2XNAC 3A4RA 1ENAA 1MD2D 2Z9HA 2KBNA 1NCVA 3B0AA 4LNOA 3PIP3 2PIAA 2ASBA 3OYYA 2R2OA 4KV6A 3UQAA 4LCDE 1T6BX 1MSHA 1UNSA 1JB3A 3AXCA 3PVLA 1RM6C 1VQJA 1HCZA 3ZDTA 4AIMA 1LT4D 2DZJA 1QUQB 1YHAA 1XLQA 2HD3A 3S1MH 4OO1I 3HOVH 3V61A 3P2BA 3FMCA 5CC4A 4GN3B 4JI3L 2JK8A 3F2CA 1GAQB 3CMEA 2KTFA 3DBSA 4IC7B 2M4NA 3T8MA 1BKBA 1YNNC 3JAML 1HR0Q 1X3QA 5D3IB 3J9CA 4C1NK 4QCLA 1V8CA 1ZXHA 2GMIC 2KD0A 3KW5B 4IJHA 3LWEA 4HJ8A 1EO6A 3SGIA 4DHJB 5JH5C 4EVOA 1B9NA 1EOTA 1NMGA 3AV8A 5D14A 3K57A 4MSMB 4X64L 5C3EG 2YLMA 4YHHL 1KNEA 1X32A 5KYIA 2ZPYA 1WOCA 1YN4A 4KIKB 4DAPA
chains in the Genus database with same CATH topology
3K58A 1N5WA 2F0VA 4TQ1A 3VA5A 1H9RA 1BUVT 3OIQA 1TWHB 2WB1B 4ZRZA 1QOBA 2IDYA 1UAPA 3PO3B 3QIAA 4KD3A 3URYA 1YJJA 2EYLA 1MSGA 3WOEA 2BE5C 1J7BA 4JE3B 1N62A 4C3IG 4A3FB 2WXQA 4A3BB 2L52A 1DOXA 3S1MB 2WXMA 5I9OA 1XF5L 2FFKB 4DQOC 1F2MA 2EVBA 4KMUC 2PYKA 2QCPX 2RA4A 4ULLA 3VR9B 1EWCA 2JA7B 3PMFA 2DBYA 1SMYD 3VA7A 3K5LA 3BDCA 2X6LA 5KEEA 1QB5D 1FEHA 2R6GA 4P16A 1FYCA 5FR3A 1C4PA 2EJGC 1D1IA 2WV6D 2HCIA 3IFTA 4ODGA 1BQQT 4HMIA 5H92C 3GTGB 3OWFA 4KHZA 1Y8NB 3NSWA 1SF0A 3UI2A 4QMGA 1O78A 5HI1A 4IN3A 2WINB 1YNJC 1PFBA 4R9WA 2A68C 3A8JE 1KLUD 2K7VA 4KY6A 4H13C 3C2PA 1GUGA 3Q8CA 3KQ4A 1Z7TA 1TZOA 2XWBB 2WXOA 3VR2A 3L3OC 5FKAC 2RBMA 1PUTA 3BYYB 2EY5A 2IX0A 1ILQA 4PNYA 1A70A 3IAM1 4ABNA 3FILA 1PZKD 1I4PA 4MIUA 1ZP0B 2NN6I 1WWTA 4OL7A 1SNMA 3I70A 3MTSA 1LT5D 1STAA 4LK1C 3I8ZA 3AEDB 1WCMB 3AB5A 3LX0A 4ZHOA 5FO9B 2BS3B 4LK0M 1RCVD 3PUXA 1TWCB 1RWSA 3TSSA 5C4HA 1Y1WB 3AE4B 1E7PB 2KCNA 4D2KA 5T8IA 1C77A 2B2TC 1QNUA 3AEFB 3PZ8A 4FO2A 3E0JA 2E3TA 3BK1A 5LHY1 2Y3AA 1QQRA 3H3VC 2EKIA 2KA7A 1SDFA 1QILA 5ELBA 1GUWA 3KWLA 2KAJA 4BWGB 5DM63 3NBHA 4K2KA 2X69A 2CU3A 2B2UC 1B9RA 4PMCA 2LHDA 4P6VF 2B2UA 3WOFA 1PRTB 4WAFA 3T56B 3PO2B 2RVLA 2KWDA 3M4OB 1F9PA 4WWMA 2L1BA 1GHKA 5KNBA 2KEEA 1VCIA 1GUSA 3M3YB 1WD1A 1BUIC 2EELA 1F0ZA 1E2WA 1QJOA 2E75C 2F0EA 1ZPSA 3ONAB 5IGCA 5CBAE 1EWYC 4DAYA 3DHQA 4B0EA 5TSSA 3KK7A 4WRDA 3WDNA 2SAKA 4X3TA 3S2DB 3NHHA 5C3XA 3AEGB 4LMQD 1PGAA 4EGVA 4R8IA 4HR7B 5C4XB 1HTPA 4NJCA 1A2TA 4V0BA 1T5XD 2ZW0A 3FILB 2A6EC 3RFZB 1SE3A 3SDZA 1C4QA 5A2QE 4YSZB 1KRHA 3I72A 3VYTA 2WAQB 1JWUD 2WDRB 1SNQA 5JEAJ 5C0XH 3LYYA 3RD4A 1EQVA 2F3WA 2PVGC 1JOOA 4G57A 3IXSA 1IYUA 1Q10A 1BCPF 2NTTA 5EQ0A 4M0WA 3KBXA 1NENB 2J42A 2E2IB 3OIPA 4HEA1 3IT4B 4DU9A 2EJMA 1CI3M 2N9LA 5EBCA 1SB3C 1NYQA 1STBA 2JZPA 1SJHD 5CYUA 4C3JG 2KJXA 1BBXC 1L6UA 1D5XC 4US9A 3SR1A 1AN8A 2NB0A 2VB2X 2IPKD 4CJ2C 2BS2B 1W6KA 2HCCA 2K6AA 1QE6A 2K28A 1J7AA 5AFWA 4XYOA 1SYEA 3VQIA 5EKIA 4A6QA 1MI0A 2EY2A 4DNRB 2Y5CA 2JYOA 2PCFB 5IGDA 2CJNA 2HDEA 1PYWD 3J80L 1YNND 1EY0A 3AEAB 3T51B 2NBFA 2WXRA 4CKBA 2WXNA 5IOCA 1LT6D 1ENFA 4NP5A 1HEZE 3PUVA 2XVSA 4RKBA 1OO9B 4L8JA 4K5VA 1GUNA 3M4YA 4FXKC 1B44D 5C3JB 1QWYA 3TUOA 1SYDA 3DUZA 2AUJD 3TMEA 1QKZA 1FMAD 4ZHPA 4Y7NB 4FXCA 4XDXA 5HHDG 3V96A 5EE9A 2K33A 5G5HA 2YYZA 1SJED 2FHTA 3P4RB 3MC0B 2PZTA 3AEBB 3E5SA 4FXGC 4CKEA 2L32A 4A3GB 3F2UA 3S1QB 2GA4B 2KN4A 1TWAB 2NWGA 4I65A 3SVMA 2B2VC 2MJ8A 1OQQA 3RPFC 4RAUC 1CJEA 1PXUA 1M8AA 1P7EA 5M5WB 4A8XC 1D5MC 2PO4A 3Q6SA 5JEAG 2EE1A 2C5CA 2D5DA 5M5YB 2KQ3A 4KKTA 1K8MA 1ENCA 4IUUA 3HVZA 5J22A 2WU5B 4AQ7A 1PTOF 1RTOA 1DJRD 2KDMA 1SEBD 3AE1B 1Q90A 2VB3X 1WTVA 1D4BA 3SFEB 3GO5A 1RHPA 3DWAA 2LJIA 5E3FA 4OZBA 3KUPA 2K0PA 1KTKA 3B2GA 1ONLA 1S5DD 4J8QA 4KK7A 4N6EB 1VR9A 1WSPA 2K01A 5D7GA 3SE0A 4US8A 1VLBA 3L9AX 2E76C 1STHA 3FEWX 1ZKOA 4XYQA 2M2LA 1VZ6A 1SYCA 2J7ZA 1XLOA 2EYJA 5BN3A 2WXPA 1EU3A 5JOBA 2QEJC 1FRRA 4HSVA 4CHTB 2V4DA 2IWHA 2XSCA 1CHPD 5KNDA 5LNK1 1CFMA 3KWVA 2Q8IB 1E2VA 1H9SB 2LMCA 3D31A 3OWEB 2JU6X 1VF7A 3W1SA 1XYIA 1TY0A 3GTJB 5IGBA 5ELCA 5AUIA 2J53A 5JEAH 1CHQD 2EJFC 3GD7A 3IKJA 3PV0A 4F88A 3R8BA 3AM9A 4YT0B 2F3VA 1EYDA 1BCPB 3IAS1 2A6HD 1J7CA 1IW7C 1CK1A 2MPMA 2I46A 1YJIA 1ACCA 4DF7A 5HGTA 1FFUA 5AUKA 1L0YB 4WIPA 3RZOB 1DOIA 3Q8EA 3I73A 5HFYA 4MHEA 1O7YA 4HSPA 2KVMA 3VR4A 4UAIA 2AQ1B 3KLRA 3OSOA 1FRDA 1CQFA 5CMDA 4XQQA 3GS2A 4MN3A 4IDIA 2LHEA 3P4QB 1WD0A 2WP9B 1DOYA 1PZJD 1LTID 1MPEA 2NVYB 1PGBA 3SFDB 3H94A 2F0HA 3FC4A 3I3CA 2JYTA 2M00A 4H2AA 3NVVA 1RFKA 2IX3A 1BCPC 4IFDH 2QSDA 2I2YA 4CQNA 4KKUA 2LY7A 3CIRB 4RCNA 2A5HA 1EQTA 3C46A 1HPCA 1TKWB 3SHLA 1AEXA 2NN6H 4ITKA 3EQLC 3P4SB 4QB4A 2N7JA 3HGBA 1LABA 3IAYA 1Z47A 1HHVA 4QIWB 3OPOA 4RGOS 1Z6HA 1GUOA 3T16A 2KMMA 1F77A 3A8KE 2AQ2B 4K6DA 4C3HG 3PIO3 2QF7A 4ZOHC 3MEHA 3NWSA 3GTMB 2SNSA 3HOWB 2WKCA 2D9UA 3Q8AA 3GB1A 3VYSA 5BMIA 1WTQA 4KGRA 1UEAB 2Y5PA 1RKNA 3D4DA 4N59A 1PTOC 5C0XJ 4ZUIA 1JWMD 1V97A 2IGHA 2B2WA 2OXPA 3HRZC 2E74C 1D6EC 2BB5A 3EUB2 5J1ZA 2F0NA 1CTMA 2Z8LA 1BDOA 1Q1BA 3MXNA 2OT2A 3D4RA 3I90A 3OMCA 4L6TB 3PZ7A 5C3EB 3J7AF 3VRAB 2J4XA 4ZK9B 3ND8A 3MFGA 3MZ5A 5JXVA 3TP5A 2ZXRA 3LB8C 5CGKA 3A8IE 4L1BA 3DEOA 3AU7A 5K5PA 1V1PB 1QT9A 1I3QB 1LTTD 2CW0C 3QO2A 3N9YC 2L9HA 3ZYYX 2INNE 2BDNA 1TVXA 3FAHA 2TMPA 3K5NA 3H09A 2FUG1 2LMCB 2A73B 3I4MB 1B4OA 1IKMA 2L83A 3GQBA 3GV6A 4RHSA 3Q22A 3HOUB 3NVZA 4IZ8A 3ZJTA 2DN8A 2V0GA 4A3KB 2V3NA 1ZXIA 4A3MB 3NUHB 1DYQA 1U4RA 1G2TA 2JA5B 2XN9C 4ZAIA 3HOVB 3C8YA 2DY7A 4A9AA 5G3LF 1FNUA 4AS1A 3NZ3A 3P1HA 4DN4M 1TKGA 5G5GA 3TP8A 2CHBD 1LT3D 3MWYW 3DWPA 1ZDXA 2EYFA 2FMMA 1BCPD 4C56C 1DCZA 1W6JA 1SNPA 3S2HB 2F0PA 1CA5A 1L0VB 3FPPA 2DY8A 1EY6A 4XT1B 4EQNA 5CBEE 1L5PA 2H4OA 2SDFA 4UDUC 1PTOH 1CT1D 1OXUA 1D1KA 1KF6B 1PZID 4XDDA 2AQ3B 3CWIA 2MH7A 3AE2B 3R3OA 3CQZB 4J6HA 1SFOB 2H89B 1AZPA 1WVLA 1PMRA 4E6IA 1F2ZA 1JORA 1AZQA 2V4IB 2Q5WD 1HFGA 4RA8A 3QWNA 4NAWB 4NW2A 3TEXA 2WU2B 4RNAA 2YEPF 5FLXL 3QJYA 1HA6A 2A6HC 4YTNB 1UUPA 3TEZA 4IUPA 4M1UB 1EY5A 1FIQA 2KEDA 1JR0D 1BNZA 3EFXD 4EE2A 5LL6S 4XTCS 4ARCA 3MXUA 3R2TA 1FNVA 1HA5A 1V1PA 5ELEA 3NS1A 1S5FD 1BR9A 1PDQA 1TYGB 2K03A 3GTQB 5EJWA 3SR6A 4FF1A 3VYRA 1GB1A 4ZQ3A 3AE3B 3CRLC 1S5BD 1II3A 3AE6B 4DA2A 2F4IA 1IUEA 1YQ4B 4IUVA 2A69D 4JWSC 4DFAA 2BCOA 4HTHA 2B2WC 4PMBA 1TKYA 2PZWA 2KACA 4HEDA 3SXHA 1VZ8A 4BS9A 5IODA 1TT2A 1ZOYB 1Q3LA 3NK9A 5IGEA 5M9OA 1VRAB 3EGRA 1G91A 2ICEC 1NVID 1C48A 3L4PA 4CJ1B 2RDHA 4ILWA 1ML0D 2K1BA 1FXAA 4Q5VA 4L23A 1ZXTA 4YIJA 1BF4A 4KGSA 2HDMA 1NI3A 4JBWA 3OOCA 5DAUA 2KUMA 3VYUA 1SE4A 2O2LD 1HQMC 3CHBD 1FD6A 4X3UA 1YNJD 1EM7A 3E9SA 1AW7A 1HFNA 4K14A 1FNWA 4F7XA 1Y56A 2TSSA 4OHJA 4A93B 4FNFA 2F0SA 3OHXC 3AB9A 5C0XI 1TJEA 2ACZB 1WTRA 2CVRA 1BMLC 2E2JB 1E2ZA 4DXGA 1JQ4A 1MGSA 1FCLA 4B9XA 5I6YA 1Q8IA 5LL6X 1KDCA 2MGSA 3G6JB 2SEBD 1CA6A 2VNUD 3R2IA 1LV9A 2IJ0A 3T4AC 3RUZA 5JVG3 2ZW1A 1JMLA 3MHBA 4OZAA 2CW0D 3LNNA 3BVZA 2PNRC 2RDGA 1K51A 5EKLA 3MXGA 4RF0A 2W3RA 2BE5D 2B2YC 3D6CA 3D4WA 2EXZA 4ZKBB 1R4QB 2IT1A 3TP7A 2F0DA 2MJ3A 3ETRA 1PRTF 2F03A 2INPE 3U9OA 4R3DA 4FVMA 3NQIA 4L63B 5I2YA 5CV7A 2B2VA 1B2TA 4G7OC 1JWAD 1PTOD 5HG2A 1ET6A 4C80A 2F0UA 1IBXA 2JSOA 2BS4B 2KECA 4YTMB 1HQRD 1A3VA 3NRZA 2RDFA 4R8NA 2MJEA 4ZKCB 1K8OA 3VR6A 2JEBI 2NN6G 2V3PA 3BYTB 4ME5A 1TWFB 4JPSA 4NKLA 1E6EB 4GDKB 1F2RC 3Q0AA 3MP9A 1H9JA 4C2MB 3K5OA 1J9OA 1V8QA 3H91A 4OIJA 1A15A 3NTHA 1QCBD 1J8IA 4CKCA 4HCEA 2M9VA 4WH4A 3FDTA 2EYMA 3H6MA 4CJ0B 2NUCA 4C7ZA 3RMHA 5JAVA 1L0XB 1OXSC 1VDZA 4RKLA 2O4XA 1HUNA 3NP8A 1ZYRD 5EGTA 3BZDB 1O7ZA 5E1FA 3HG9A 2FE8A 3T3NA 4DK0A 1DONA 5IGFA 2XRQD 4HRSA 4YTPB 2KCCA 2L5TA 2E2HB 1WTXA 1EZ8A 4N9PA 1EY9A 1QF6A 1IKLA 3T53B 4C3HB 2W55A 1JE4A 1VZ7A 3HOZB 1EY8A 3AE5B 5JPNC 2K32A 1K50A 1GXDC 2W54A 1DGJA 3U4EG 5CORA 3GTOB 2GB1A 1R4PB 1JQYD 1GJXA 4FF4A 1SYGA 2ON8A 1WTWA 5C5MA 1EYAA 1E10A 2JEAI 1KNAA 3DMUA 1B1ZA 1CZGA 3D6WA 1LTGD 3PUWA 2BW2A 5EE0A 4A3DB 3A55A 4WQMA 3R93A 1STEA 4N9TA 3MHZA 3P1MA 3DWMA 1U9RA 2WLBA 2E6XA 1C76A 3BVMA 2MJDA 3P4PB 1WTPA 1UWMA 3NVWA 2DYMA 1WTOA 4C3JB 2RPVA 1WGKA 2EYPA 3A7AB 5C5LA 5C4JB 1YQ3B 2Z1CA 5F2DA 1Y69U 4O42A 1I6VC 4IFDJ 4FP5D 3W3AA 5A35A 4K8IA 2HDLA 5ELFA 2F0JA 2DYOA 4A3JB 3K5MA 5I2XA 3SK5A 5IT9L 5IT9E 1PRTC 2QIEB 5C4ZA 3HUIA 4KX6B 4DGZA 3LXFA 1BO0A 1JWSD 4KD4A 2MUYA 5EPLA 5DNFA 4KJOA 4MH8A 1F2YA 1ICWA 1QLBB 2PTLA 1ZEQX 3RZDB 1B50A 2F1MA 1RD9D 1UWXA 3I4NB 1V1OA 3A56A 4JX1C 3TN2A 2R3ZA 3KBGA 1FCCC 3I9V1 2WDVB 1L4DB 4HJGE 5FK9C 4IUNA 5FLXE 1DOLA 2KHSA 2WQYB 5BMHA 4MACA 4XIGS 1I4QA 4K6LA 3ZQ4A 3NVYA 2Z4HA 1ZDVA 2F0KA 4RH6A 3K6OA 1SMYC 1PFMA 3J7AV 2L11A 1U4LA 5JPMC 5A2QL 1GHJA 3AN1A 1S4ZA 2L1AA 3NUCA 5M3FB 3HOYB 3PO0A 2K05A 2YEPB 2K9XA 4RFBA 1LTAD 3V05A 4BA2I 1I4XA 3HZXA 2EY6A 4Q0FA 1GB4A 4A3IB 2AUKA 3HS0C 2XWJB 3WCQA 4AYBB 1M4VA 4I7ZC 3HOXB 2M0AA 4DAVA 1TU2B 5D3DA 3P42A 1T5EA 1I4RA 4XXEA 1JWBD 2D5GA 4IFDI 4KTAA 1YN5A 5E4WC 2VZKB 2Y0SB 4XT3B 3AE8B 2NTSA 1Q1EA 2XIWA 2FINB 3TP6A 3BK2A 3P75A 1C4CA 2GI9A 3Q8BA 4DK1A 4FYDA 1YN3A 5BMGA 2WXGA 1I7HA 1N5XA 2B2YA 3NWTA 2LS01 4TSSA 1YNTE 2BBCA 1LO5D 1EL0A 2PKOA 2Q8TA 5H8YE 2JA8B 3W5UB 1G291 1PFNA 5BN5A 2PPBC 3IT6B 4NZLB 4FXDA 4KY5A 5FO7B 2EOTA 4C7YA 4B0MA 1O7LA 1KAAA 4C3IB 4KKSA 1VMPA 2G9HD 1FXIA 3ZGZA 3AMZA 4NDXA 2OHFA 1Y8PB 1L4ZB 1NAPA 2R7ZB 3CU7A 3U7ZA 3K0YA 2RKSA 2O5JC 4XE0A 3S1NB 4OGQC 2BA0A 3NTIA 2PW9A 3TDQA 3QOJA 4Q2JA 3MXPA 1MHHE 5M5XB 3U9SA 3EROA 3ITPA 3W2DA 4FF3A 4U68A 2XRSD 2OEDA 1TS5A 1Q12A 1C78A 1QOFA 1KABA 5FOBB 1F9SA 2NYZD 4ZYSA 2H1EA 1JRPA 2WXKA 3DWQA 2K5PA 2IW3A 1FR3A 1HZ6A 2D2CC 2C9OA 4HAEA 1U4MA 2A74C 4XQJA 1CZWA 4H0LC 2K22A 5ISRA 4LJZC 3VR8B 1STNA 4L2YA 4YSYB 4IOIE 1JC7A 4TKOB 4YXDB 2NVTB 3PUYA 3MJ5A 2Q8RE 4IALA 1TS4A 4K8JA 1A3TA 5BYSA 1TY2A 2WNMA 3AEEB 3Q69A 5NUCA 1EFID 2EZVA 2BTEA 4RWSC 3VRBB 5KRUA 1MHXA 3EVQA 1KFYB 3QG1A 5C2TB 4DXFA 3B9JA 4KN7C 1E0ZA 3K7AB 1VJKA 1EWHA 5EE1A 4RGMA 1Y8OB 4ZUJA 1IL8A 2N0SB 3W9CB 4OIKA 2ICIA 3GTKB 3E56A 3C1EA 2F0IA 3D3RA 1PDXA 3G7LA 3LWUA 5T1GA 2LFIA 4O1NA 3ABVB 5K36H 1MI2A 1FO4A 2G9DA 1XLPA 1FFVA 1BXTA 4PMWA 4PQXA 5C6AA 2NVXB 1OXVA 3NPPA 1TKEA 1NUCA 2PZUA 1CZPA 1K53A 1KLGD 1C4AA 3VR5A 3ZJVA 2BT6A 4KKJA 2QMTA 4XWWA 2K5DA 2VXWA 1EIHA 4YWGG 1NR2A 4LTUA 2J52A 2B8FA 2B39A 4KN4C 1JW9D 2NVQB 1K52A 3NTKA 3SK4A 1XO3A 2A68D 1TS3A 1HZ5A 5K36G 1XEEA 4KY7A 2RSNA 2IGGA 2B63B 2PVOD 4X3KA 5EPJA 4K5XA 5BN4A 4GDLB 3T13A 1F2RI 1I4GA 3NE5B 1LTBD 2B76B 1DD2A 2R93B 1YMHE 4DNTB 2ZT9C 2F0WA 2WXHA 2BB6A 1LTRD 2K04A 2ZXOA 1ZYRC 1IBXB 2X38A 4A90A 1O80A 1SE2A 1G2SA 5CV5A 2DNCA 2BDOA 4WFN3 1B9MA 1F2LA 3FPUB 1DXMA 2F0OA 5CV6A 1B3AA 1C8CA 5BYQA 1N60A 2L4NA 2B8GA 3GV3A 4BBRB 2N55A 4OO1G 2PMVA 1I6HB 2PQEA 2CQAA 1HTLD 3SK6A 3J7YW 1XWEA 5I9PA 4YSXB 1SAPA 4V190 2K5WA 1SYFA 4XDCA 2IGDA 1QNKA 4HKZE 5DEHA 1JICA 2JE6I 1QOHA 4P2CB 1MVKA 1SBBB 3E6ZX 5T1IA 5JJZA 4USAA 1E9MA 3BG3A 3J80E 2ONQA 4CGYB 2ENBA 3BS1A 2N9KA 4JK1C 3M7GA 4TRDA 3KLSX 3DWGC 4RCOA 2HQEA 3Q24A 1NR4A 2L0CA 4G7ZC 3BDOA 4FF2A 1SNCA 3K59A 3S15B 5EPKA 5CV9A 1STYA 3S9WA 1I50B 1H9KA 2NMQA 3S16B 2Z4IA 1VF5C 1TIID 1AYFA 2WS3B 4G7HC 2FBWB 2KQ4X 3MFYA 3Q8FA 1NYRA 4H44C 3HKZB 5EKKA 1OQRA 4EQPA 2QJLA 3C1FA 3TBIB 2A69C 3FRPB 3A54A 3X3NA 1AP0A 4WORA 4IUQA 2K5QA 3OW7A 3W5VB 2JX5A 1ESRA 1HRJA 2A6ED 4A55A 5CR3A 1LACA 2EYHA 1CM9A 4BA1I 1WRIA 2VZKD 1R9TB 1XTCD 2PMZB 2IX1A 1SIJA 1P7FA 1EY4A 3JAME 2F0FA 3V2TA 2M56B 1N61A 3MA2B 1XCTL 1EU4A 4PT5A 3M7NA 2BA1A 2L12A 2EDGA 5C3WA 3C3LA 1FM0D 1JROA 4OZCA 1I4HA 3AE7B 2F0GA 1DOMA 4WJWA 4B9WA 5E4XA 3HVDA 1OXXK 4QUCA 2F0TA 4LLGM 2WIIB 1ZUD2 3HRDD 2FMCA 3NXWA 1WXQA 4NAMA 3L7ZC 2PW7A 3SEBA 5FO8B 5C0XG 1WYGA 3P63A 2VUMB 3AECB 1CQVA 1IYVA 1XLNA 5I6WA 1L6VA 3FVQA 1TR5A 1A3UA 4RHRA 1QOAA 4TMAB 2JA6B 1RF2D 4KHVA 3S14B 2OEOA 4BBSB 2CJOA 2JSVX 1Y1VB 2O5IC 1AFPA 4OW0A 1EEID 2JQRB 1PFDA 1NEKB 1R7SA 1VMCA 4H7BA 1H9MA 3I4LA 4RGTA 1D2BA 4IQZA 3P7JA 1N63A 3TEYA 2N88A 5E6JA 1H9SA 1GPXA 4IFDG 2B2TA 4F87A 1SSOA 2WXLA 4OO1H 2WXFA 1KDBA 1AWDA 3UI3A 3HEJA 5ELDA 2SOBA 2JXMB 4B08A 2DLBA 3RLFA 1EYCA 2I07B 3A7LA 1S5ED 5KYLA 3NBIA 4HCSA 1JOKA 4X3SA 4IUTA 3V3XA 5M3MB 5JVH3 1EIGA 1TS2A 2QDBA 3MAQA 1QOGA 1BOSA 2H88B 4M8AA 2RSOA 5GXGB 1JOQA 2W3SA 1EEFD 2K3UA 3S17B 1LLRD 4NMZA 1PTOB 2WXIA 5D65A 2WP8J 1ZE3D 2AWOA 3Q23A 5DM73 4MT5A 2SNMA 3J81L 5I4DA 1C9FA 2ID0A 3CRKC 3BVGA 2BOSA 2DNEA 3KF8A 1FD7D 4K5WA 2WXJA 5KGUA 2FJ2A 3IL8A 2L55A 4LAAA 2J0TD 1IGDA 1A2UA 1XX8A 2GRIA 3AMUA 3FKIB 1IGCA 4TQUS 1S5CD 1MBYA 1A6XA 4EQOA 4TQ0A 4A3EB 3GTLB 5C44B 2LKVA 1ET9A 2KOLA 3I91A 5IIFA 2E2DC 2F0LA 1EY7A 3U2SC 3I57A 2RMMA 3AE9B 2RQXA 2W82A 1E0BA 3DEPA 1SNOA 5BYRA 4RGNA 4JWUC 2I38A 1T3QA 3IFDA 2AWNA 2F0QA 4HROA 4QUFA 2R61A 2QILA 5EBDA 4HKQA 2IL8A 2LEKA 1FGBD 3VR3A 3EJIA 1QG7A 1LTSD 3ZJUA 4PV1C 2JXTA 5J39A 2QKIC 4ZRQA 4Z9CB 3QOLA 4ID6A 2HUGA 2OF1A 1PRTD 4N58A 1KH0A 3KLSA 1RYJA 2G1EA 1G8ZD 2MP1A 3ERQA 4CBVA 1B53A 1SNDA 4IURA 2DWQA 1NSNS 3ND9A 1DOKA 4J1MA 1V43A 2JYEA 3HP3A 4KI0A 1IHZA 4U673 3GTPB 1IW7D 3O13A 1OXTA 3T3OA 3GP7A 1STGA 4GLSC 3N6RA 3M85A 1ILPA 2M19A 2MHVA 1D5ZC 2BYTA 3X3MA 3MVVA 2HTME 4XWTA 3SK8A 5MPOA 3TZDA 3QB3A 3H0GB 3AH7A 4K2LA 3BDLA 2PLPA 5COYA 3PUZA 3P20A 3U52E 2EY1A 4G4KA 1JCKB 1DZ1A 4KGTA 2EPBA 1RJTA 2ZXPA 2WDQB 1VDVA 1JALA 4MM3B 1RODA 1U4PA 4ZRPA 1PLFA 1ROEA 3BIID 4KKIA 2WACA 4IKGA 1UGJA 3TZUA 4XQNA 1DM0B 4GZYC 1PGXA 1XXGA 4BY1B 4RF1A 5IGGA 2X6GA 2PW5A 1G6ZA 4ZLTF 1HUMA 5KNCA 2LGIA 4ARIA 1OFFA 1XCQL 1F9RA 2D62A 2F0MA 4J3OD 2EYOA 5HURA 4OVZA 2WKDA 3CKIB 1RDPD 4HMJA 2NZ1D 1C79A 1GUTA 1KDAA 2R92B 1TWGB 2MEKA 3NQTA 2AX5A 1ESFA 4S3SA 5CV8A 1SYBA 3H8HA 5KIXA 2JWUA 1SXTA 1RTNA 5CV4A 4REZA 3DXJC 4F8MA 1X3PA 2JP1A 1F9QA 3EA6A 5G3LD