1STEA

Staphylococcal enterotoxin c2 from staphylococcus aureus
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
238
structure length
238
Chain Sequence
ESQPDPTPDELHKSSEFTGTMGNMKYLYDDHYVSATKVMSVDKFLAHDLIYNISDKKLKNYDKVKTELLNEDLAKKYKDEVVDVYGSNYYVNCYFSSKDNVGKVTGGKTCMYGGITKHEGNHFDNGNLQNVLIRVYENKRNTISFEVQTDKKSVTAQELDIKARNFLINKKNLYEFNSSPYETGYIKFIENNGNTFWYDMMPAPGDKFDQSKYLMMYNDNKTVDSKSVKIEVHLTTKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the superantigen enterotoxin C2 from Staphylococcus aureus reveals a zinc-binding site.
pubmed doi rcsb
molecule tags Enterotoxin
molecule keywords STAPHYLOCOCCAL ENTEROTOXIN C2
total genus 70
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1995-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01123 Stap_Strp_toxin Staphylococcal/Streptococcal toxin, OB-fold domain
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1steA01
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1steA02
1JWMD 1TY2A 1S5ED 2QILA 1CQVA 1I4RA 1CT1D 1LT3D 3BVMA 1M4VA 1BCPF 1V1OA 1TS3A 1UNSA 1FNUA 5FK9C 1GOZA 1KLUD 4RGNA 1PTOD 1JQYD 1TY0A 1PZID 4RCOA 2RDGA 1TS5A 3URYA 1EEFD 1LTTD 1XXGA 3R2TA 1D5XC 1SBBB 1LT6D 1SE3A 3MC0B 4RHRA 1LTID 3EFXD 1DJRD 1ENFA 1EWCA 5ELEA 1BCPB 1V1PA 1HA5A 1EU3A 4ZYSA 1ET9A 1YN4A 1L0XB 4DXGA 1FNWA 1D5ZC 3GP7A 1EFID 2CHBD 2IPKD 2O2LD 2Z8LA 1LTBD 2QEJC 1PRTD 4RFBA 1LTSD 2AQ3B 1STEA 1G8ZD 1HTLD 1AW7A 4RGTA 1BCPC 1DYQA 1FD7D 1S5CD 1PTOH 5ELCA 2WV6D 3BZDB 4C56C 1JR0D 1LTGD 5TSSA 1YN3A 3BYYB 1RCVD 1UUPA 2NTTA 1LLRD 2AQ1B 1XTCD 2RDHA 4NZLB 5ELBA 1PRTF 1T5XD 3SEBA 1S5BD 4K6LA 5FKAC 1LT5D 3OWEB 2IJ0A 1D5MC 1LT4D 1SJHD 2G9HD 1JWUD 1EEID 3BVZA 5ELFA 3KLSX 2SEBD 3R2IA 2TSSA 4L6TB 4UDUC 1RDPD 1SE2A 3R8BA 1PZJD 4O1NA 1KLGD 1CHQD 1QILA 1PRTB 2XN9C 1PTOC 1CK1A 5I4DA 1BCPD 5D3IB 1I4GA 1HQRD 3BVGA 1B1ZA 4OHJA 1B44D 1PZKD 2XNAC 1S5DD 3W2DA 4TSSA 1CHPD 1D6EC 1TS2A 1I4QA 1PTOB 1KTKA 5D3DA 3DWPA 1F77A 5ELDA 4BWGB 1SE4A 1LTAD 4RH6A 1S5FD 1JCKB 1RD9D 1BXTA 1PYWD 3BYTB 1JWSD 2R61A 3V05A 1YN5A 4RGOS 2XRQD 1SXTA 1TS4A 3MFGA 2ICIA 1HXYD 2XRSD 1EU4A 2AQ2B 1LTRD 1I4PA 4RGMA 2J4XA 1L0YB 1ET6A 3CHBD 1ESFA 1V1PB 1FGBD 1FNVA 4Z9CB 1LO5D 1RF2D 3DWAA 1SJED 3TSSA 4L63B 2NTSA 4RHSA 1PRTC 1MD2D 3O13A 4DXFA 3DWQA 1AN8A 1PTOF 1I4XA 1SEBD 3EA6A 1I4HA
chains in the Genus database with same CATH superfamily
1BVSA 4GDKB 4GNXB 3W1SC 2F0QA 1KDBA 1SNMA 1V8QA 2QILA 2YLMA 3B2FA 1F52A 2FUHB 4IPGA 1U5KA 3K8AA 3S1RB 1GC6A 2O6VA 2WXKA 3KWVA 5CV5A 3Q3JA 1IYFA 2LJ5A 4DK5A 2LGYA 1TBEA 4HDOA 2ZNVB 5ELNA 5J22A 4GKJQ 2MJ3A 2CR5A 1QJOA 3N1YC 4A3MB 2K33A 2ZJRA 3VUXA 3URYA 3LB8C 1UELA 4HJ9A 2KWCA 4A3LG 1SBBB 2N88A 3JW0X 3RULA 1GVPA 2Y5PA 4EZJA 2R7DA 5ELEA 1N62A 1WXVA 3OMCA 1GG3A 4C00A 3PUYA 5JJKA 1EU3A 1FR3A 3BZCA 1ET9A 4ZUIA 4KGSA 4YCWA 5CHWA 5FR6A 3RLNA 1VQGA 3BS1A 1CKNA 5FO7B 2UUCQ 1EFID 4IKGA 3KBGA 2L3ZA 2WHIA 2PW7A 2KXJA 1WYDA 4HJKA 3Q8EA 1PRTD 3TZUA 4XYQA 3OTOL 3PO3H 3TCAA 1F0ZA 3RN5A 3ZGZA 2KO3A 2F0UA 1BUIC 1TIFA 4GB9A 3K0YA 3F8TA 2Q8TA 4TV3A 5CORA 4ZLTF 4LNIA 3RPFC 1OXTA 3GTPB 5C1ZA 3SDLC 2PMVA 1KIXA 2IZVB 2QC8A 2R6GA 2D2QA 2BPSA 3BYYB 1TWHB 2R93B 1LACA 1C7YA 1GAQB 1U4MA 5EGTA 1JROA 3HIZA 3SFEB 1SIFA 2AX5A 2DBYA 4DK3C 2WX1A 2F0VA 1K8OA 2PQAA 3H15A 2MJEA 2K5VA 5IYBH 1T6BX 1PH9A 1J5EL 1VCBA 3AU7A 2C9OA 4MIUA 4II3B 1E24A 1EIGA 4CO7A 2RPVA 2RHSB 3K59A 1DGSA 3CCQA 3PUVA 4OIKA 1XMQQ 2N7JA 1TKEA 1G2TA 1IBXB 2L0TA 1KABA 1SRUA 3ZDTA 1R4MI 4GSWA 5TR5A 4HIKA 5HG2A 2BCOA 2KCNA 4XTCS 1NDDA 4R4TA 3TEHB 2F0LA 2Y0SE 1F2MA 2B2YC 3GDEA 3E0EA 2A69C 5IYCH 4GNXA 4A3CG 1GC7A 2JPHA 5KHOA 2RDFA 4IJHA 3J7AF 4WQMA 3APCA 1TS2A 1SN8A 3EQLC 2NVXB 4YSXB 3QX1A 4C3JH 2JWUA 2E2HH 4FJZA 3PREA 3E9IA 3K5LA 1FRDA 1LTAD 3STBD 5C3EB 1ILQA 4NAWA 2Z6KA 4JGHB 3MFYA 4IOAA 1OXUA 2I1KA 3AEAB 1A3TA 3R93A 3NBHB 3EJIA 1LV9A 1VQ7A 4KY7A 1X6OA 4IUNA 1K3BC 4RGMA 1VQHA 2EMTA 5BN5A 1LUZA 3AEBB 3QJZA 3S1QB 3CMAA 4OO1I 1J19A 4X62L 1OXVA 4A6QA 1S40A 4JI4Q 4OZAA 5L83A 3QHTA 5LXHA 5CBAE 2OTLA 2WXQA 3MHBA 1I4XA 2WP9B 2E75C 1SEBD 4P73A 3BWUD 1HEZE 1I4HA 2R3ZA 4R3DA 4RNAA 1Z9FA 1QVFA 4EOYA 3Q0AA 3NHHA 1EYCA 2KVMA 5C2TB 1SDFA 2I5LX 1BKBA 1K51A 1BR9A 2B8GA 3T53B 5COYA 2ASQA 2BS2B 3SGIA 2DYBA 5KHQA 4YWGG 3PGEA 4NY0A 2M1MA 3AE9B 2A1AA 3UINB 2ID0A 3KOJA 4BBNC 2FCQA 2B39A 3S1RH 1IL2A 1FFVA 1HZ5A 1PQSA 1QOFA 1WGRA 3EC8A 1EIYB 1HZCA 1PFSA 1Q82C 1WRIA 4IUPA 1VJKA 2M9VA 2IPKD 1EQTA 1WD0A 2AUKA 1Z47A 4CYEA 1JE4A 1BT0A 3AFPA 4G11A 2LI5A 4X3SA 3KK7A 2MNAA 2B63B 1G8ZD 4A3GG 2MBHA 2F0WA 4HCEA 4MTNA 3D4RA 4K2KA 3EIVA 4JLCA 1XT9B 2CS4A 4JI7L 2HIVA 1KNAA 2EXDA 1MJEA 4X57B 3AH7A 1GKHA 3PIOA 3LXFA 1DOYA 5M3FB 4EZLA 1WJUA 1I42A 4ITKA 4B0MA 1OTRB 2N55A 3M4OB 5KRUA 4A3MG 3Q8CA 1BF4A 1ESRA 5KEEA 3M3YB 3IL8A 3FKIB 4XX5A 2K1FA 3CF6E 3IHPC 3L10B 3J80E 3M4YA 4B0EA 2UWQA 4O1NA 1G6ZA 2DN8A 1KLGD 2LXKA 4BY7H 4W9GA 2Z4HA 4KK7A 1HNZL 2XBBC 4DXAB 1UAPA 3ULJA 1GUWA 2E3TA 1KAWA 4M00A 3NJTA 4AS1A 4US9A 4I6LB 2Z6BA 2KAJA 3BK1A 1JW9D 3DHGC 3DXJC 3NTHA 1L2FA 3BVGA 1EYDA 2BH8A 5J1ZA 1WIAA 1F9SA 2LVQA 3LDZE 1EY7A 1EF5A 2JA7B 2LRWA 3C8YA 2F0IA 3M85A 3N20C 1D6EC 4EEWA 4QIWE 3DBHI 1GUNA 3JYUA 2E76C 4BY1H 4ZRZA 4POFA 2UUAL 4OX9L 5ELOA 3VHTC 5ELDA 3TMPB 1SE4A 2IY5B 2WDTB 2F4IA 1IBMQ 3UDIA 4XDCA 1E2ZA 1QE6A 2IX0A 1FXIA 2JEBI 2VQFQ 4A3IG 2RGFA 1PDQA 3HOVG 1ZUD2 1RM6C 2Z59B 4X6AH 3QAQA 4A3BG 2J42A 2R92G 4PS8A 1WTRA 2I5MX 4JX1C 4OONA 1KNEA 1Q8KA 5T1GA 4X66L 2SNSA 1FFUA 1PUTA 3HRDD 3IG3A 3KYDD 5DNFA 1F9QA 4EVOA 4AYBE 5I6YA 3HOWB 2ZXRA 1V9JA 4UY8C 4DA2A 3X0WA 5FLXL 2LKVA 2V4IB 3NBIA 3VR4A 3RNEC 3U58A 5D6JB 3UI3A 1X3EA 4A3JG 4WWMA 1FEHA 1EYAA 1T9HA 4A3FH 1HZBA 1K8MA 3RZDB 2AYOB 1S72A 2FUG1 3CXCA 2L52A 3APDA 2AWNA 3H91A 4LWCA 1L7YA 3AE4B 1N9WA 3RR5A 3MXUA 2WFWA 1EUVB 4DV7Q 1EEFD 3ZIMA 4IUMB 1SF0A 1H9SA 4BY1B 1TT5B 4K5VA 2PKOA 2J0MA 4OWWB 3PIO3 1HA6A 2FNJB 4KV2A 1MHHE 3HZXA 2VXWA 5I2YA 4QQBX 2V1CC 2O2LD 5K36H 2DZKA 3HP3A 3KUDB 2UXDL 1SYEA 5CTRC 1G51A 2PMZB 1LTSD 4FF2A 2I38A 2IHFA 3WIMA 1SROA 2JA5B 1WR6E 4HJGE 2D0OA 3N52A 1G291 3V62A 3WCQA 2O4XA 2L0CA 4LAAA 2QSDA 4A93H 1D7QA 1WZ3A 1E8YA 4JI2Q 3RN9C 2KN5A 2G3QB 2C9WB 4BVUC 5JXVA 3HKZB 1WTVA 1F2RC 4OEMB 3RFZB 4MGZE 1Y1WG 5CV8A 1YQBA 1YITA 1PRTF 3SEBA 2ICEC 1EY0A 3FKIH 1WZ0A 5JJZA 5FLXc 3PPAA 1WH3A 1JICA 1TT2A 1SFOB 1DOLA 2ZXPA 2QJLA 1TWCH 4QUFA 2EJFC 2TSSA 3P4QB 4DV5L 2ZXOA 4H0LC 3EHVA 1ONLA 3CKIB 5CV4A 3K81C 1XJVA 2CWPA 1HNZQ 4NAMA 5EPLA 3SK5A 1X9NA 1K0SA 2J53A 4CHKA 3T1HQ 2JA8H 1HQMC 1AZPA 4JPSA 1PTOC 2D3CA 3KFUA 2HD5B 3I8ZA 2HQEA 4FP5D 2UXCQ 4DV6L 1Y8NB 1E8ZA 3ND8A 1GD7A 2CU1A 1I4GA 3RZDH 3JSVA 1A5RA 3PO0A 2RD0A 4GMVA 3CPWA 1B44D 4W9FA 1KDCA 4FLHA 3CU7A 4HIOA 5M5YB 1UD7A 2BT6A 2L32A 3GTLB 1IXRA 2ZJDA 3IVFA 4EQNA 4ZRIA 4HXDA 2DZMA 4H2AA 3TUOA 1PTOB 3IKJA 1KRSA 1R7SA 1GJZA 5D3DA 4ZKCB 3DWPA 2JA8G 1C48A 4FJVB 3ZDMC 2K04A 2H89B 2F0NA 3CCMA 2XWJB 4BBSH 3MHZA 4DR6L 4Y7NH 4BOZB 1KLVA 3V05A 1WR1A 3QC8B 2R7FA 5JEAH 4AQYQ 2KCTA 1B4OA 1CKNB 2KFJA 5AUKA 3P1MA 5C0XG 2JRHA 4BKSD 3DBRB 4FHJA 2J4XA 3U9SA 1DZ1A 3HOUB 3S2HB 1ESFA 3FRPB 4PT5A 1KOTA 3QR8A 5IO9A 1FNVA 3TSSA 1Q8IA 2KHJA 2ALYB 5C3XA 1VQEA 1F9PA 4F87A 3W1BA 4FXCA 1BUVT 2LUEA 1PTOF 2ZPNA 2HTME 3Q6BA 5EBCA 1MHWC 4MDKE 2EYMA 4NKLA 1WM3A 4IG7B 4S17A 1UBQA 1EQVA 3RUIB 3FDTA 4LFBL 2J52A 3T3OA 4W9KA 1WWTA 1SE8A 5JVG3 4R9WA 3OAWA 1GUAB 5D14A 2KENA 3A8JE 1H95A 3KDFA 1WGDA 2BKRB 4HVBA 5J17A 1X54A 1SNDA 2C35B 1P1AA 3AM9A 1QQRA 2ZNVC 2RHQB 4P1BC 1L0WA 1W6JA 3F1ZA 3MC0B 4XYOA 4W9CA 3HKZG 3FPUB 3UE1A 3HRZC 4O42A 3UDFA 1JRPA 1OQRA 1S3SG 4IJLA 1R4MB 3KF6A 2MRPA 1JALA 4YY3L 4DXGA 3S16B 1FNWA 2M8SA 4OO1H 2PO4A 4JI2L 3V6CB 1E3PA 2P5ZX 3W1SA 2A6EC 2E5LQ 1T0QC 4DR1Q 1R9TB 2JYEA 3DHIC 3CW2C 2AWTA 1NYRA 1B7YB 5C6AA 1JT8A 1HZ6A 4XDDA 2L8JA 3T13A 2D10A 2L76A 3VDZA 3EECA 1Y1VG 5CHFA 2VZKB 2KBNA 1A2TA 4GS3A 5HGTA 1PH1A 2R93G 5TSSA 2INDC 2WS3B 3NPPA 4C1NI 4LF7Q 3GOEA 5LMNQ 1TKYA 3T9LA 1QWYA 1P3QU 1PH7A 2NTTA 3TS2A 2F52A 5I2XA 5FR3A 3L3OC 1SMYC 2M0AA 2JA5H 2KWDA 3L54A 5IP9G 1NVID 3HOXB 4US8A 5EPJA 2BH2A 2MA9B 4A8XC 2EDGA 1STGA 1XCTL 2MP2B 4AJYB 1R4NB 1DD2A 4GKKQ 2K25A 2ZM6Q 3B9JA 3AMZA 4GU2A 3R8BA 4LFAL 4LUVA 3H9DA 4DUZL 2KOXA 1VQ9A 3GB1A 1VQNA 5CV9A 2KWUB 3RNFC 2CH4W 4TQ0A 2VB2X 1STNA 4P75A 5E7NA 2R7ZB 2V3PA 2O2VB 5EPKA 1J7AA 3DBSA 1LABA 3F2UA 5D3IB 3OJ3A 5IP9H 1SB3C 4DFAA 1PA6A 1MKHA 3SE0A 2JVCA 4B3SL 2VQEQ 4W9IA 4G0NB 4DHJD 1S5DD 2WXGA 1A0IA 2F0JA 3G6EA 1VQFA 5GAGC 2LSSA 2XK5B 4G7HC 4LLGM 3J81E 3FEWX 2VQFL 2O5IC 4NXNQ 3GTGH 3WWVA 1V9PA 3PZ7A 4EQPA 4XYCA 2JY6A 3E9SA 2LVOA 3SK8A 3J81L 3KUZA 3U4VA 2RCFA 4N58A 1HFNA 1F1HA 1XCQL 2ACZB 4KVGB 2BB6A 2VB3X 1EY8A 1YNJC 5M5WH 3CMEA 4LF6L 4ODGA 2FINB 3IFDA 4KY5A 2K6DB 2AQ2B 2NBWB 1I4PA 4DV2L 2LMCA 3I3TB 2B2WC 2IGGA 2NN6I 2JYOA 4U673 3CC2A 1IPGA 1SIJA 3NXWA 4Z9CB 4DR4L 3AE8B 1RF2D 1K28A 1SJED 2RKSA 1PV4A 2MEKA 3IAS1 1VQIA 3ONSA 4R4IA 1WD1A 4MACA 3S2AA 4KGTA 1MD2D 4DXFA 1X3GA 2F0GA 2NVQH 1KF6B 1QKZA 1WTOA 1FMAD 2MWSB 3RNGC 3HOWH 3ZTCA 3TBLD 3D31A 5CHVC 3P1HA 1JC7A 2BW2A 3ZXVA 4YIJA 5IGBA 4Q5VA 5C23A 1NNXA 4DNTB 1IYVA 1BOSA 3VDYA 2Y5BB 3VQIA 5EDSA 2PQAB 3F2DA 3DVNU 2K1BA 2IBIB 2RDGA 1C0AA 1TS5A 2Z1CA 3QO2A 2JA5G 5JEAG 4GOPA 3CSTA 3Q8AA 3FHWA 1MGSA 1W2BA 3S17H 4C1NK 3VTWA 5F2DA 3QWNA 2HTHA 3CCVA 3GS2A 1SGHA 4HKQA 3QG1A 1KM7A 4NPSA 2ZM6L 1XNQQ 4LJPB 4P6VF 4KD3A 2MHJA 2RSUA 2LASA 3GP7A 4DR3Q 5BMHA 5EBDA 2Z4IA 1JOQA 2JU6X 2LD9A 4CDCC 1J6QA 3J80L 3MEHA 4JI1L 1QF6A 4ICVA 2M00A 4LF9Q 1IBLL 1N36Q 1QZGA 1K52A 1VRAB 3U30A 1S5CD 5LMNL 2V0GA 1AWDA 1GHJA 4YTMB 1YJIA 4NMZA 5KIXA 4WFN3 1RIPA 2H4OA 1Q3LA 5C4XH 4DAPA 1HCZA 3L0OA 5H8YE 3SD5A 2UYZB 5M3MH 1O78A 3NZSA 4NZLB 1R4QB 4BBNF 1PFNA 3CMMB 4J3OD 1S5BD 4EX5A 5KNBA 4LNFA 1Z7TA 5K5PA 4C3IB 1BDOA 4KHPL 4IUTA 2M2LA 2RF4A 2D62A 1LM8B 4YY3Q 2DY7A 1PH5A 1MSGA 5IT9L 4C80A 4AJWA 3PLUA 2XIWA 4BAXA 1M1KC 2A8VA 2KVZA 1YNND 3ZJTA 1UE5A 3AB9A 1HR0Q 1KDAA 3ZUNA 1OEYJ 4HSPA 2UU9Q 2LXCA 2K39A 1YOVB 2B2UA 2BDOA 1NMGA 3MAQA 3CWIA 1TWHH 4LNQA 1ZKOA 1UE1A 3R66C 2PZWA 1WE7A 3RZOH 4K14A 2A68D 1E7UA 3D6WA 5GADC 4RCNA 1WX8A 2EELA 4ZYNA 2IDYA 2SOBA 5EQ0A 4HJ5A 4AH6A 2CFMA 3JC66 4F8CB 1K0RA 2E74C 2MW5A 1KTKA 2QKIC 3U50C 4F8MA 1UWXA 4DR2L 4HROA 4KGRA 2NBVB 4HEDA 4LNKA 4BWGB 4EGVA 3J7ZC 4OW0A 2V4DA 3GTJH 1EWYC 1YQ4B 1WCMB 4XE0A 4LF4L 3GTMB 3K5OA 1O80A 1WGKA 2GBRA 2IO2B 4AQYL 4B9KA 4GLVB 4JVZA 1MIUA 4LFCL 3QK0A 4DHZE 1YMHE 4QJFA 2M17A 2RA4A 2KT7A 3CC7A 4XC2A 3EUB2 2HDLA 2NVQB 4GDKA 3RMKC 2Q5WD 3B1LX 1QUQA 4IQZA 4EKUA 4L63B 2RVLA 4RHSA 1DOIA 3PZ8A 3F2BA 2OEOA 3M95A 1FCCC 1SAPA 1N60A 3RLOA 3K80C 3P7JA 4C3JB 2JX5A 1XYIA 4FN2A 4WAAA 5KYLA 1JWMD 1VS0A 2PZUA 1CFMA 4N8FA 3W1GA 4A3EH 1WI0A 4ZAIA 4EFOA 2K5DA 3TQYA 4WH4A 1C4PA 4B3MQ 3NK9A 3P20A 4C7ZA 3PSEB 4DHZB 3M4QA 2K5QA 4KJOA 4OXPA 1V1OA 4MHEA 4LK1C 1XPUA 4FO2A 3EFUA 3L13A 1UNSA 3NSWA 4JOIC 4E74A 2DY8A 1KLUD 1WXAA 1X32A 5IODA 1LYLA 4A3GH 1JQYD 3GE8C 1VQ5A 1TWAH 3OWFA 1WTPA 1FVIA 4MJSA 1K8AC 4LDTD 1C4CA 3KDFB 4A3IH 1FO4A 3T1HL 4A3BH 2KKCA 2Q8RE 1DJRD 4ZK9B 2MBOA 1M94A 4MGIE 3MTSA 3KLSA 4BBRH 4QB4A 1VQKA 3HOUG 2IYDB 2XGTA 1J7BA 4HPLB 1L0XB 4L5RC 4A93B 1FXTB 1HPCA 3G4SA 2WWZA 4DV0Q 2YU9H 3A7LA 2LGSA 3BY4B 1C8CA 2C7NB 3CQZB 1WJJA 1YQ3B 1Z2MA 3DCGA 4JW0A 4R8NA 4DV2Q 3D0FA 4QY7A 1JJ2A 2F4VL 1IL8A 2JA6G 1HZAA 3Q2AC 5E6JA 2RSNA 1N32L 1M8AA 4KSKC 3QB3A 1WJ4A 4L23A 4ZKBB 4LF8L 3CD6A 2B2UC 1T0SC 5DLQE 2GBNA 3ZNZB 1EUJA 1I6HB 2AQ1B 2SNMA 2I5HA 1WF9A 4MH0E 3BG3A 3WANA 4QF4A 4BA1I 3R3OA 3B08A 1TU2B 3Q3NC 4YCVA 3OIQA 1YI2A 2IJ0A 2JRIB 1Q81C 3HGBA 3PIPA 2XTIA 3J81c 1M90C 2B63H 3DEOA 4JV5Q 3B2GA 4A3GB 4ABNA 2E2JH 3I4NG 4HR7B 2WKDA 5LMUL 3ZJVA 2BOSA 2DNEA 2RQXA 4B3SQ 3HOXG 2C5LC 4A3IB 4IFDJ 1SSNA 3A56A 3GZNI 2B29A 3NUHB 1PGBA 2PVGC 1N63A 2HJ8A 3RNAC 4DV7L 3QA8A 3ND9A 1WGGA 5L95C 1EY5A 4DV1L 3A4SC 2L0FA 3Q14C 3U9OA 3OMGA 1G2SA 4A93G 3KQ4A 1WX9A 3HOVH 3Q3OC 2VY3A 5BR8Q 2QDFA 1E22A 2R92H 2B8FA 2PI2A 4A4IA 1GM5A 1PZKD 1MVKA 3ZNID 4GXBA 2EYHA 3RZFA 3FAHA 5DPSA 1WXQA 4KKSA 4GKKL 2DNFA 2DZIA 5H1SE 3EGRA 3TJPA 1AE2A 3H3VC 4XQQA 2WXMA 1WCMH 3T1YQ 4A9AA 4JYAQ 4XT3B 5JJIA 1EL0A 4G4KA 1K53A 4A90A 1RD9D 4ICUA 1VQ4A 4X66Q 5AJ3Q 1TZ1A 2WXOA 2B2VA 2BA0A 3SR1A 5HHDG 4F7ZA 1ZKHA 4LF7L 1JJGA 5G55A 3ZRFA 1EOVA 4DK1A 5IGDA 1N5WA 3MFGA 4BZAA 4HIDA 1UH6A 3PRZA 2WB1E 3T4AC 3K5NA 3CCUA 1E8WA 3EROA 1RFAA 2IO0B 1X65A 2JE6I 5IN7A 5AFWA 3PHWB 4WJ3M 4OX9Q 1L4ZB 3VR6A 1NY4A 3S16H 5G2NA 3OPOA 5ISRA 3VAWA 4JCVE 1Y69U 5BN3A 3PF4A 2O5JC 4HJ8A 3W5UB 4BY7B 2WB1B 3SXHA 1BCPF 1SLJA 2KYWA 1YJ9A 4IW0A 3S24A 2IGDA 4FA6A 2NZHA 1S4ZA 1RYJA 1GO3E 3K7AH 4A3JB 4M02A 4YSYB 1E1OA 1Z5SB 2L05A 4HCSA 4PYUA 3OLMD 1IYUA 4UHVA 2WP8J 4A3MH 1VQ8A 3A4RA 2D3GA 1D5XC 3VRAB 3PV1A 2OJRA 4R1JA 5C4XG 1ENFA 1XTDA 2DENB 1V1PA 3KJOA 4CJ2C 1WYGA 4ZYSA 1B3AA 1I50H 2KOLA 4A3DH 2NVYH 2JA8B 2NB0A 1LGRA 3A5ZB 3TDQA 3J80c 1YJNA 2XEWA 4A3KH 3TEZA 4BXXG 2LS01 4KD4A 1QOGA 5CC4A 1WFQA 3DBHB 2Y5CA 4P7IA 1IW7D 2KZRA 3TIXA 4URKA 3V96A 4X64Q 1RLFA 2FIFA 2DAFA 4MT5A 5E6OA 1B53A 3RNUA 2IX1A 2H5XA 1WY8A 4N9F4 3AV8A 4B9XA 5G5GA 1LLRD 2D5DA 4AIMA 1XD3B 1GUTA 1IKLA 2KJXA 4C4VA 1UF0A 3OWEB 2CW0C 4MGKE 4A3KG 3HVZA 3UI2A 4C2MB 3LX0A 4GLAC 2PE9A 4RMAA 3RD4A 1XMOL 1ZDXA 4YWLA 1YVCA 1IKMA 2N9EB 3ECIA 3TEWA 1IHZA 4P2CB 1BMLC 1QZHA 4HLEA 2KQ7A 2JQRB 1I94L 3FILB 4HK2A 2IGHA 4II2B 1RJTA 2B2TA 1V1QA 1NEKB 1WGHA 3S14H 1DM0B 1I3QH 2PPBC 4HCNB 4ALPA 2VZAA 4BFRA 1B50A 4NJ7A 4ACFA 2NVXH 4A75A 3FC4A 4J6IA 3PF5A 1KQSA 3T16A 4L5QA 1B2TA 5C3WA 2NPTA 2O6VB 4AYBB 1JJCB 3LJ3A 3ZYYX 1WE6A 1S1QB 4A55A 4IFDH 1TKWB 2EJGC 2N9KA 1PGAA 1MJCA 1KJTA 4TQ1A 3NE5B 3VR3A 3QIJA 1JCKB 1H9MA 2CKZB 4M8AA 5JPNC 2JXMB 4NJ6A 1AEXA 4F1SA 1UWMA 1ZP0B 5IGCA 1KL9A 1IBKQ 1SXTA 3EVQA 4A3LH 3ZLZA 3NRZA 4KHZA 5CV7A 3JVZX 2PNRC 1K9MC 5DPTA 2WAQB 3IT6B 3I7FA 1SYDA 5AUIA 2DJGC 1NAPA 3H7PA 2BE5D 4R4QA 2PEAA 4KZCA 4Q2JA 5GXGB 2ON8A 1HNXQ 1ZOYB 3I63C 5LNK1 1LO5D 4NJCA 1CA5A 2KMMA 2WLBA 2UXDQ 3MWYW 1HNWL 3A8KE 2G9DA 2PW5A 2WU5B 4M0WA 3EA6A 1AZQA 4A3OA 1STAA 4DN4M 3J7A5 2KTRB 5DM73 2B76B 2BYEA 3MJWA 1FGUA 5J39A 2LFIA 3S17B 3MC9A 3NY5A 3T3NA 1TZOA 2Y0SB 1ENCA 1VZ8A 2D9UA 3BK2A 3PUWA 1V2YA 2CU3A 5JAVA 5A2QE 3OOCA 3IBEA 3MC8A 4B3ML 3VH4B 5FK9C 5C0XH 1Q46A 3GTOB 1TWGH 5GQOA 1Q1BA 4AOFA 4BKGA 2MJ8A 4LJZC 1LT6D 3IFTA 3FKYA 2LVPA 4LJOB 2EQSA 3M4OH 2FE8A 1GPXA 3G6JB 5FLXE 1V80A 2D3AA 4LFCQ 2CW0D 3PO2H 1WM2A 1WOCA 3MVVA 1V43A 4OZBA 2HQLA 1U4RA 5EKKA 5M9OA 2IO3B 2WXHA 4L1BA 2WDRB 3I90A 4JIOU 3CIRB 4IOIE 1SMYD 2AQ3B 2D11A 2B2TC 2VUMH 1RL2A 5JHAA 1XLNA 1SNQA 3AFQA 1A3UA 3Q8DA 1GHKA 1YN3A 4NAWB 3HOUH 3S2HH 2NMQA 3L4PA 1YNNC 1NUCA 3T51B 2RDHA 1Q12A 3U4ZA 3Q22A 1T5XD 2B2WA 2N7EA 4WAFA 2OCEA 5MPOA 4NXMQ 2BGFA 2Y0SG 1U4AA 2VZKD 1AP0A 2GBKA 4V0BA 2LJIA 1FIQA 2Q2UA 4Q0FA 3WDNA 2LRUA 3SFDB 2L1BA 4J6HA 1CZPA 1E5WA 3HG9A 1SE2A 2DHZA 2MBEA 1PYSB 2KHSA 2UUBQ 1BQQT 3NS1A 4MELA 3TP5A 3SK4A 4MEMA 2KDEB 3PLVA 1YEZA 2K9XA 3J7YW 2VS1A 1IBXA 5G3LF 2F3WA 3A55A 3DM1A 4GZYC 1DXMA 4HWIB 4M0WB 2ZCCA 2N9PC 1P0RA 1L1OA 3RI7C 5L37A 1JOOA 2QA4A 3W3AA 4YWKA 2CH4A 1XLQA 1ZGUB 4UP9A 3V61A 1NSNS 2WIIB 3A0JA 3NZ3A 1I5FA 1E8XA 2JYTA 5I9OA 5FLMG 1WFYA 3PS6A 3KVFB 1CHPD 2YTYA 3GTKB 2JJQA 2NR2A 4WQOB 3A1QA 1RHPA 1HZ9A 3D8GA 5DEHA 1ASZA 2LWPA 1PMRA 1OQYA 3PVLA 5BYQA 4AWJA 2NVTB 1GUGA 2KA7A 4JI6Q 4HTHA 2MCNB 4C7YA 4LNNA 3D3RA 1L6VA 4CHTB 4DPGA 2EKIA 1NYQA 2BKFA 4YL8A 4JQWC 1CKOA 4NDXA 1PVOA 2XRSD 4JI7Q 2JA7G 1XNQL 1L5PA 1LTRD 1WTHA 1EWIA 4PZ8A 2M0XA 4GDLB 2WKCA 4ZRJA 1CZGA 4JI6L 4LCDE 5BR8L 1L2NA 4OO1G 2NTSA 1JRUA 3CPFA 1Q1EA 4P16A 5LL6S 3DVGX 4K6DA 2N0SB 3D4DA 4DV4Q 3RNCC 3K0XA 2EY1A 2JT4B 3IXSA 2A73B 2GVAA 2BS4B 3H6NA 4K81A 4HN7A 2K22A 3DHQA 1X56A 1I4RA 2IX3A 2QCPX 5I9PA 3AEFB 1P16A 3ITPA 1PH4A 5E1FA 4J15A 3BINA 3ZTDA 1GOZA 3T56B 1V49A 1V8CA 2INCC 4JV5L 4FYDA 3I4LA 1OFFA 3TL5A 1W6KA 3CSFA 3I4MG 2KCCA 3ZW3A 1U0LA 2Z9HA 1YJJA 4OVVA 1SE3A 4RHRA 1I6HH 1P8LA 2CHXA 1VMPA 3P4RB 1E6EB 3VUYA 2G1EA 3RUZA 3JAME 1YZ6A 1XPRA 1FJGL 1E1TA 1JE5A 1SNCA 3P75A 5LMNW 1YHQA 1A63A 1JORA 4GLXA 1E9MA 2D3BA 4XXEA 4K2LA 5BMIA 2K5PA 3K57A 3GTOH 2FCMA 1GNUA 3P4PB 2N9XA 1T3QA 3FMCA 5EE0A 4ZOHC 1V97A 4K5WA 5IYDH 2L9HA 1G6PA 4KKTA 5LLIA 3J80i 3HS0C 1PFMA 4YT0B 3A8IE 1H9KA 3TREA 3A9KA 3UIPB 4PS7A 3N32A 1GB4A 5AEKB 4PK1A 2IL8A 2NN6H 4HAEA 3RD2A 4OELB 5DPWA 3HM6X 1ZPSA 5FOBB 1ICFB 2PW9A 4N59A 3ONAB 2VQEL 3PMFA 1CQFA 2KFKA 3L9AX 4P71A 4IM3A 1D3ZA 2MLBA 3DHHC 3R7RA 2CHWA 1GUSA 3G48A 2F0SA 4LDTB 3AB5A 1SE9A 4JPBW 3ALBA 3NVYA 2I46A 1PHJA 3PO2G 3OYYA 3T8MA 4GOCA 1ZDVA 4IALA 4HKZE 4KDIC 4C3IG 4DUZQ 1RAXA 2DX5B 2VL6A 4A3BB 3UDGA 3HOZB 4B3RQ 3OW7A 5T1IA 1K83H 1JMCA 1V6EA 2IY1B 2LGXA 2MQHA 3GD7A 5M3MB 2YVCA 1Y1WH 3PO3B 3U7ZA 3AECB 3HOZG 4B3RL 3VTUA 3OHXC 4CKBA 3AI5A 1O7IA 5JPMC 1NR4A 4H02A 5T8IA 2F1MA 3H7SA 3IT4B 4YTPB 1WJNA 2KDBA 3UF8A 4LF4Q 2MO1A 3L08A 1X3PA 2KWVB 4DR7L 2KHWB 5HKHA 4E71A 1N34Q 1UGMA 2EY5A 3GV3A 3M63B 1AH9A 4GLSC 1BXTA 3BYTB 4O0AA 2E5LL 3H09A 1EF1A 3MJ5A 4ZRPA 2YEPB 3GTPH 2KECA 3WOFA 3CCSA 3GTKH 2LHDA 4DDGD 4KIKA 4TKOB 1ET6A 4XQNA 3V60A 3WAOA 4E6IA 4IPDA 3RZWC 2EYFA 4B9WA 1NI2A 3C1FA 3EN2A 4RAUC 3M3YH 1BNZA 5EKIA 1AN8A 2UUCL 2HCIA 1EIHA 3M4PA 1FM0D 4PNYA 1HUNA 2BA1A 5C44H 4X3TA 4N9TA 5FLMH 5IGGA 2UU9L 1XNRQ 1ZYRD 1C79A 2A5UA 2B2VC 2FFKB 4OIJA 3AE1B 3AE2B 1Y56A 1Q5WB 1YIJA 2CHZA 2G45B 4RCOA 1RFKA 2MPMA 1ILPA 4JL9A 1R4NI 1MPEA 3AEVA 2WNMA 3R2TA 3H0GB 2QF7A 3Q24A 1R9TH 1SNPA 1AFPA 2SDFA 2NS5A 1RODA 3PUZA 1PDXA 4WJ4A 2OQ0A 3ZO5B 2KDMA 1Y14B 5AZHA 1T0YA 4DR5Q 1VQLA 3NP8A 3BIID 3GZNB 3I9V1 3VR8B 4ASWC 4D2KA 1OEYA 3RT3B 4H7BA 1Q10A 3GTGB 2BB5A 2K50A 3LNNA 4DR6Q 2KDIA 1STEA 3W5OA 3STBC 1OQQA 2N3SA 1BCPC 1FD7D 4Y52H 2JZZA 2V4LA 2ZEQA 3P42A 4HPPA 1XLPA 1LFDA 4IO9A 4WJNA 2WV6D 5IA7A 1O7YA 3AE5B 4YHHL 3I55A 3GTLH 4WIPA 5EE9A 1HH2P 4USAA 2KMCA 2QGQA 3I4MB 2KX0A 5C4JB 5ELBA 2J7QB 2CJOA 2N9LA 1TTNA 4IPHA 3TRZA 3RCZA 3NWSA 1F2YA 1NTGA 4JE3B 4MJSB 4W9JA 3D6CA 3S2DH 2C5CA 3K7UC 3KLSX 3ENEA 3R2IA 4OL7A 4NNJB 4W9DA 3S1MH 1U9RA 1XWEA 4TRDA 3CCEA 3OW2A 2JA6B 1OGWA 3CCRA 2W9NA 3S1NB 5DAUA 2WXIA 3UQAA 1QILA 1STHA 2F0EA 2DZJA 3Q3FA 2G4DB 1PYBA 1CMXB 4YTNB 1UE7A 3AEEB 2NBFA 4DUYQ 3NQTA 1JB7A 1TR5A 4P1CC 1QZEA 3L17A 4LF5Q 5IAAC 2LGDA 2DYMA 2QW7A 2JK8A 2AWOA 2BDNA 5IKCM 4OHJA 5IGEA 2A74C 3HEJA 2UUBL 4Y7NB 2PNHA 2JSVX 1UGJA 3TZDA 2BYFA 4GN1A 4OVZA 2Y3AA 4BY7G 1A62A 2WDVB 4WRDA 2WXNA 2QDLA 3B6YA 1YJWA 4DAYA 4WJWA 4ILWA 5JVH3 1PH8A 3HOWG 2Q8IB 1HRJA 2MHVA 4K0KL 4ZRQA 4NP5A 4MM3B 2PCFB 4DV3Q 3ZRCA 3Q6SA 1K3RA 3C1EA 2VW9A 3VYTA 3AMUA 1A2UA 1WTQA 1WMHB 4CDEC 1L0YB 4RKBA 1VQPA 1EZ8A 1VQOA 2MBBB 2PIAA 4ID6A 1F9JA 1MI0A 3CF5A 2K03A 2AKWB 1YNXA 4JYAL 1J8CA 1NI3A 3HK0A 2K8CA 1F2LA 2A4ZA 2PYKA 3JAMc 1SFOH 3LYYA 1H9RA 3PO2B 3SK6A 2F0HA 1YD8U 3KW5B 1TWCB 4A3DG 1I3QB 2VUMG 2H88B 5JH5C 2JXXA 5KGUA 4IFDG 5C4HA 4OWTB 1ZXHA 3M3JA 1DCZA 1U4LA 2MBQA 4PG3A 4HJAA 1WVLA 3KLRA 3VVWB 1HTQA 5M5XH 4NQKE 4ANVA 4UP8A 4DV1Q 1VQCA 4JOIA 2FMMA 2R2QA 2TMPA 2FBWB 3OIPA 1HUMA 3FILA 1MHXA 3UIOB 3I72A 2NWGA 5FJ8G 2F03A 4KZ0A 2JA9A 3H94A 4KI0A 2FAZA 1WXSA 3E9HA 2HDMA 2KJ6A 3HUIA 3SVMA 1OO9B 3X3NA 3H8HA 4G7OC 1Y1VB 1LTBD 4TQUS 1SYGA 2QEJC 1DGJA 2KMAA 2L00B 4YXDB 4XZ4A 5J18A 2JUOA 2RMMA 4FXGC 4BA2I 1PH2A 4ZDVA 2LEKA 1ZYRC 2ZTDA 1C78A 1X3FA 1PFDA 1TKGA 4JK1C 4QUCA 4C3IH 3QJYA 1IUEA 5ELCA 3QWZB 1K8RB 1LTGD 5HI1A 1N32Q 1GB1A 1QVGA 3ICEA 2F4VQ 1JWAD 5IP7G 4KDLB 2XSCA 3P4SB 1CTMA 1XTCD 3E3XA 5E4WC 4IFDI 1VLBA 4EE2A 2E2IB 3ABVB 2E2DC 3A1QB 3DLLA 2KN4A 2IW3A 2GBJA 3KYHC 3M62B 4DWFA 3NTIA 4V190 1JWUD 1EEID 1L4DB 2MUYA 1Y8RC 2VRRB 2K6AA 3N6RA 2Q2IA 2N7DA 1H8CA 3CRLC 1D4BA 3VRBB 1C9OA 3VUWA 4E3CA 3K5MA 2NN6G 4IM0A 1PRTB 3O65B 3GTJB 1ACCA 5KNDA 4KKIA 4L5SA 2EPBA 2LGIA 4ARIA 5I4DA 5G5HA 3BJUA 1H9JA 4IDIA 2AMCB 3PCOB 2V1YA 2KFKB 2AL6A 4H13C 4IOCA 4XQJA 3NELA 3CAMA 3W2DA 2VNUD 3NVZA 3UE0A 1WMHA 2CVRA 3AQQA 2PLPA 3KWLA 1UWVA 4JI3Q 1HHVA 4K8IA 3GTMH 5D94A 1DOXA 4NQLB 4RG1A 4A3EB 2PJHA 2F0FA 2CWAA 3PRPB 4KN7C 3Q8BA 2GI9A 3A54A 1CA6A 2OWOA 4A3EG 4RF0A 1MG8A 3AEGB 1UEBA 4EQOA 3BZKA 2O6VD 3KUCB 1PYWD 3RLFA 4DF7A 4WORA 4DAYB 3CRKC 4P74A 1STBA 2PZTA 2A6HD 1NBWA 3I70A 4ME3A 1NR2A 4C3HB 2ZJPA 1WYWB 3ZNGC 2HHHL 4UAIA 2BS3B 1EU4A 2B3GA 2IY0B 4U68A 5IE8A 1OTCA 4X64L 1SYCA 4WWPA 2XVSA 3NVVA 3V6EB 2QEXA 1EY4A 2EY6A 3ZJUA 1QLBB 4ZHOA 1ZXIA 2EJMA 2ZTEA 3PIP3 5M3FG 2KQSA 4WJQA 4DR2Q 1FYCA 4IURA 2X6LA 4DV6Q 1D2BA 3U2SC 1A6XA 1FRRA 2O2VA 3F2CA 2DLBA 1CM9A 3P63A 1C4QA 5CR3A 3PT2B 1QCBD 5G3LD 1N33Q 2WXJA 3VFKA 1E0BA 3BVMA 1ISNA 3MZ5A 1ML0D 5BN4A 2KEEA 1XNRL 4RGNA 4K5XA 3A9JA 5D7GA 2F0TA 1PTOD 4MZ9A 3I4NB 2MP2A 4OGQC 2Z0SA 4H44C 1PH3A 1ZW7A 5IOIA 3FKIG 1D1IA 3HOVB 1VDZA 5E6PA 1HR0L 1TVXA 4X62Q 4FXKC 2EYLA 4M1UB 4TMAB 1F2RI 4GDLA 5IWAL 3H3VI 1E7PB 1YN4A 2EVBA 2OF1A 4PMBA 4FF1A 1IGDA 1QT9A 2K0PA 4G50A 5E4XA 1S3OA 5JOBA 1B9MA 2CHBD 1UBIA 1Q0WB 4K3CA 4L2YA 2C60A 1K73C 3MXGA 2JF5A 4RFBA 1C3TA 3K7AB 4B6WA 5EKLA 4RGTA 1N34L 2EZVA 2ATWA 1GJXA 1P7EA 4DR7Q 2RDBC 3DMUA 1T0RC 1V81A 1XO3A 1XQQA 3LWUA 2QHOA 4J1MA 4I7ZC 4C56C 2K5NA 4GNXC 3PSIA 2YU9B 2QMTA 3APFA 3KF6B 5CYUA 5DCNA 4N9PA 1N36L 3JAMi 2CQOA 3Q8FA 1RCVD 4A3CH 2FMCA 2ZJQA 4DBGA 2X69A 2A68C 4KKUA 2B3AA 2KDFB 3CCLA 4DAVA 4N6EB 3ZVVA 1LT5D 1D1KA 1XMQL 3TS0A 3HOYB 1MFWA 3I57A 4EQ5A 4DDID 4DR3L 1ICWA 4QL5A 1EO6A 1L1OC 1Y1WB 2SEBD 2UXBQ 4CDFC 2LXAA 1YBYA 4K7SA 1PZJD 2DNCA 2NPTB 1BO0A 1JQ4A 1EOTA 2I0QA 2VH2A 2K05A 1KH0A 2E2JB 3RMHA 2D5GA 4MN3A 1IGCA 2HT1A 2EE1A 2Z0DB 5C0XI 2ZZPB 4FXDA 4WWNA 5IOCA 4DQOC 4QCLA 4HEA1 2BBCA 4G7ZC 4YCUA 5M3FH 2MH7A 1HQRD 4MTKA 3ER0A 3IAYA 2N4FA 3ETRA 3KF8A 1JOKA 1VR9A 2N1WA 3U7DA 2FHTA 4PV1C 2OHFA 3MTNB 2B63G 2R92B 2L11A 1X3QA 1HTPA 4RKLA 4ME5A 3NTKA 2I1JA 2KACA 2E8GA 1L0VB 1TWAB 2Q2HA 3AEDB 3IAM1 4LNOA 4RH6A 2ZW0A 1UE6A 1WI5A 4GN3B 5IYBG 4C2MH 4G57A 5GAEC 1HJPA 3E6ZX 3OTOQ 2N8NA 5DM63 2D2CC 3D4WA 1YN5A 3B0AA 3U52E 4HSVA 5LL6X 1NENB 1FD6A 1CJEA 2BF8B 1FL0A 1X1MA 4HDQA 2IHEA 3HVDA 1BBUA 3I4OA 1AYFA 2EYPA 2HUGA 4DNIA 2LXJA 4W9HA 3ZJYC 2MGSA 2KC1A 2WAQE 1VQBA 3I56A 2K52A 2DYOA 3VR9B 2PMZE 4C3HG 4P72A 1C76A 3AE3B 3JSVB 4MGYE 1TJEA 4LF5L 3DWQA 5EJWA 1S5ED 4RMFA 4FADA 1BBWA 1A15A 2KCMA 2WU2B 3N3KB 2PE6B 3V3XA 1RKNA 2AHOB 1CT1D 1V86A 1LT3D 4KLKA 4EUTA 1CZWA 1PH6A 3QARA 1Q90A 5IIFA 2F0OA 3PO3G 3R7QA 2MFIA 1I7HA 2LZ6A 2WXRA 2CCZA 1I50B 5IYDG 5HY6A 3C3LA 2GA4B 4ZCKA 4KV6A 3UGBB 2PQEA 2X6GA 5D2MB 4QMGA 1STYA 1CI3M 4N8X1 3FP9A 2OXPA 3WAPA 2EIFA 2KHIA 1XLOA 1ENAA 1X55A 3TN2A 2BYTA 4IN3A 1EWCA 4XGAB 3QOLA 3HKSA 1ASYA 1HA5A 4A3JH 3PQIA 3P2BA 2LHEA 3NS8A 3SR6A 1D5ZC 3NBHA 2L12A 3S2DB 4FBJB 4S3SA 3R3MA 3KH0A 1TYGB 3A9KB 3DEPA 4JI8Q 1J7CA 3K9OB 4F88A 2L4NA 2Z6KC 1EQQA 4YSZB 5BYRA 1DYQA 1E2WA 2H1EA 4BS9A 3VA7A 4XT1B 2A6HC 5I6WA 3SHLA 3DM3A 5A2QL 5IY0A 4M8NA 3BZDB 2K6QA 1YJ1A 2HE7A 4F7XA 1A3VA 2CKHB 4QAYA 1W3SA 3I2ZA 2PI2E 4R4OA 2CJNA 4I6PA 1GUOA 2F3IA 3OJ4B 1EM7A 1KHIA 1H9SB 2ES2A 1J8IA 3DVGY 1XPOA 3QIAA 2HIXA 4DR1L 2BTEA 2BWES 2PTLA 4GIVA 2DUDA 2G9HD 2WQYB 1LXDA 2E6XA 3GQBA 2RSOA 5IYCG 3NVWA 4AQ7A 4JG2A 1B9RA 5C5LA 4WURA 2GMIC 5CX3A 3KF8B 3NOBA 4JWSC 1E2VA 4K8JA 3AE6B 2ZPYA 2M56B 3VYRA 2G4SA 4C3JG 2XN9C 4A76A 3JAML 2DWQA 2W82A 4W9EA 1VQ6A 2W3SA 2A19A 1WSPA 5AZFA 3HOYG 5FO8B 4C4VB 1BCPD 5A35A 4NXML 4KSLC 1SMXA 4JI4L 3NEMA 5JEAJ 3KUPA 3Q23A 4LFBQ 3I3CA 2V9HA 4K1RB 3WA0A 2WXFA 4QIWB 3AULA 2LFNA 4TSSA 4FDBA 2N78A 1QNKA 3ULLA 3VR5A 4NPNA 1N8RC 4KHPQ 3PRMB 2EYJA 1B9NA 2KC2A 3U8ZA 1EZ6A 4R8IA 3GTQB 2RBMA 5C3JB 3SDZA 4FNFA 2VUMB 3ML9A 4J8QA 2LMCB 2R61A 3I4MH 1QVCA 4HIMA 3TEXA 4A3PA 3BDCA 1K50A 1ZEQX 1EIFA 4JI5L 5M5YH 1C4AA 3I5JC 3BDLA 1HXYD 4LUZA 1VZ7A 4NB3A 2F0DA 3WOEA 5C0XJ 2WACA 1IBLQ 1V1PB 3L16A 4MM3A 4JBWA 1DOKA 3DUZA 4A3KB 3DWAA 3J81i 2PPHA 4JI8L 4DHJB 3CCJA 1PRTC 3H3VH 1I6VC 5M5WB 4JBJA 1CSPA 3O13A 4UPAA 1CKMA 1E7VA 1WTXA 2FXQA 1TWGB 4CJ0B 4IWPA 4JI3L 1FPYA 2FJ2A 4KMUC 3PHXB 3ULPA 2FIDA 3UQBA 3N30A 1EWHA 1VDVA 2MX2A 3X3MA 1D8LA 1TS3A 1J5EQ 2K28A 2AUJD 2YYZA 1FNUA 4APVA 3MHSD 4OZCA 2UXCL 1J0GA 4QGUA 1TY0A 2JEAI 1PZID 2DGYA 3DPDA 2WINB 3A9JB 2NCNA 1MSHA 1Y1VH 1HNWQ 1B3QA 3E56A 1YNTE 4KN4C 1EY6A 1AARA 1YIWA 5JHBA 1Y8PB 3VH3B 1O7ZA 2A6ED 2HCCA 2K14A 4DV5Q 4M8MA 4HMIA 2WAQG 1QOHA 2J7ZA 3K58A 1VMCA 1SYFA 4FF4A 4XDXA 1IBKL 1Q1OA 2GLSA 5JZEB 4TKNA 1YHAA 3LWEA 2L5TA 4GOPC 4ANXA 4BOSC 4K3BA 4L5TA 1SSOA 4DR4Q 1VF5C 5HGQA 1P98A 3AU4A 1HTLD 1AW7A 2F0MA 3Q3MC 2IO1B 3HOYH 1UZXB 1KC8C 1KRHA 3HOXH 3TP7A 1EYGA 2A5HA 1NBFC 1YX5B 1F9RA 1TWFH 2KJRA 5GMVA 1TGZB 4LF6Q 1FJGQ 1OXXK 3IRBA 4ZHPA 4JBKA 4I6NB 4A20A 4HRSA 2KTFA 3DQVA 2WYQA 5J3BA 3ZNHB 1HTOA 1KD1C 3G7LA 1KRTA 5FKAC 3M9BA 4NXNL 1MI2A 3E5SA 1T5EA 1D5MC 3AU5A 5EE1A 3N1XC 1SJHD 2KX3A 2K75A 4L8JA 1NE3A 2J0JA 2QIEB 1RTOA 3FPPA 5C44B 2VH1A 4AP4C 1G6JA 1RDPD 4JC0A 1YNJD 1HFGA 1WGYA 5K36G 3HM3A 2L15A 1RWSA 2KLCA 3SHQA 4IUUA 4FF3A 3E0JA 1VQMA 3TP8A 1HR0W 3KJPA 3D32A 2XWBB 3NZUA 2K7VA 2M4NA 2MP1A 3HKZE 4DV4L 3CQZH 2OEDA 3WALA 2EY2A 4PMWA 3CC4A 4YWMA 1EY9A 3J81j 3H0GH 3DVNV 3AYHB 1B1ZA 1F2ZA 4CKCA 5M5XB 2WDQB 3L0WB 3W9CB 4DNRB 1AE3A 3BU2A 3MEFA 2IWHA 4BBRB 3MXPA 4K7WA 5D65A 2K5HA 3KBXA 4LFAQ 3PZDA 2KUMA 2UXBL 4A3DB 1XEEA 4RM9A 2Q2TA 4KY6A 3K6OA 5CGKA 2QCZA 1Q7YC 4C3HH 2F0KA 2OJWA 4IUQA 3RZOB 4MSQB 4B3TL 4JI0L 1KXLA 1IW7C 4PQXA 5CMDA 5JJLA 4GN4B 2CQAA 4WJPA 5DPRA 3NQIA 1JWSD 3L7ZC 4RWSC 3VXWA 2WXPA 2SAKA 1TS4A 1UEAB 2D07B 2I07B 2NVYB 5LXIB 3M7GA 5IT9c 1P7FA 1QOAA 1V5OA 2J0KA 1IBML 4MH8A 3U4EG 4W9LA 1FGBD 3S15H 3GTQH 4RM8A 1YHBA 3HOZH 4K0KQ 2NBUA 4R4CA 2KJHB 3S9WA 2IT1A 2MQJA 1TXYA 3KYCD 4KX6B 1WXMA 1K8GA 1TIID 5GROA 4IWQA 1JB3A 1FCLA 1WCMG 4AYBG 3AE7B 1KFYB 2NZOA 3NWTA 4ZRKA 3HFZB 5EAYA 5IWAQ 3VR2A 2KK8A 3DBLI 2JA6H 5AZGA 1EFWA 1U4PA 4UP7A 3GV6A 4JBMA 1RRBA 3OG5A 4GOPB 2LY7A 4BXXH 3TMEA 3S14B 2GOWA 3RNBC 3IFWB 2YTXA 2HDEA 1LTTD 4NW2A 2NVUI 3RN2A 2D0PA 2BWFA 2K01A 1MG4A 3Q69A 3S1QH 3PUXA 1LTID 4FHKA 3CP0A 1I35A 3C0RB 5IP7H 1BCPB 5FO9B 1N33L 2C7HA 2X38A 4ARCA 2UU7A 1XF5L 2ZCBA 1QNUA 4JWUC 2EOTA 4ZQ3A 3ZKJC 2BVCA 3A5UA 3L2PA 1WRDB 3MXNA 4DAMA 2I2YA 1A70A 2EXZA 4X3KA 5HFYA 5AJ3L 3PTFC 3VYUA 4MSMB 3G71A 3FVQA 5KYIA 3H1UA 3T1YL 3TP6A 1V5TA 4B3TQ 4JI0Q 2NUCA 4DK6C 2LUMA 4HCPB 4PYZA 5BMGA 4XIGS 2OQKA 4YHHQ 4POGA 4B95A 2HHHQ 4CBVA 4IZ8A 5C4ZA 4GGQA 5E6NA 2RPQA 2RR9A 2JZPA 1LM0A 1WJ6A 2W3RA 2L1AA 4TUUA 4FJYA 4K6LA 1PGXA 2B2YA 4BY1G 1NCVA 2A69D 3MP9A 1K83B 2XK5A 5BYSA 2Z0EB 2K5WA 3S15B 2DJFC 5C4XB 4DR5L 1ROEA 1PLFA 3DBRI 1E10A 1QB5D 4IPCA 3J9CA 4KKJA 1CHQD 1MBYA 2G5DA 3VYSA 4LW1A 4CGYB 4X65Q 4PZ6A 1TWFB 2WX0A 1E0ZA 3NUCA 5LMUQ 3DBLB 4BBSB 1A8VA 2MJDA 3X23A 3C2PA 1PXUA 2MO0A 4AUQC 2YV5A 4TVAB 4HPMB 2ZVNA 2E2IH 3ERSX 4MNOA 1JMLA 2INNE 3GE3C 1II3A 2EYOA 2ZW1A 3LGJA 2KQ4X 2OOBB 1Z6HA 1HNXL 1N6ZA 2FCNA 2HD3A 4G3XB 2KANA 4ULLA 2INPE 1J9OA 2KQ3A 4LF8Q 4LMQD 1Y8OB 1YX6B 2F0PA 3EBEA 2DAJA 2RCNA 3S1NH 5C3EH 4CJ1B 1F77A 1SNOA 2ASBA 1HE8A 2C7MB 5EE3A 3RYTA 1S5FD 5CBEE 4LUOA 4I7AA 4X3UA 1B8AA 4DK0A 1QG7A 2L55A 3KLWA 4KHVA 2NZ1D 2XRQD 4DV0L 3VA5A 2JSOA 3MXNB 3ML8A 1E7ZA 2ICIA 2BQQA 1VZ6A 2K32A 1IYJB 1IP9A 4DKAC 3CHBD 4ANUA 2GBMA 3J7AV 3DOWA 2X8XX 1ZXTA 2AL3A 3H0GG 2L83A 4WJOA 2N49A 3N9YC 5C3EG 3W1YA 1CSQA 2WGSA 2KNBA 4EZKA 4KTAA 1TY2A 1N5XA 4BBSG 3ERQA 3NG0A 4KJNA 3QCAA 4CQNA 3A74A 1CQVA 4X65L 4OVUA 1VCIA 3A33B 1I94Q 1M4VA 2JN4A 1C1YB 3AXCA 2REXA 2OTJA 5HURA 1L1OB 4O2DA 4CKEA 4HJ7A 1LQBA 4K7UA 3QQ8B 3V2TA 1XMOQ 2V3SA 5KNCA 4ZUJA 2R7ZH 1VD2A 4IC7B 4M01A 1P9DU 4ANWA 2JWZA 3H6MA 4BKTA 1VQJA 1O7LA 1XXGA 5BO4B 3A7AB 2R93H 2BYVE 3DWGC 4A3FB 3EFXD 2AEHA 2GVBA 2KD0A 3SU8X 4IUVA 1VF7A 3PV0A 1L6UA 2V3NA 1QOBA 2BE5C 1R4PB 5NUCA 2W55A 4JI5Q 2NYZD 2YEPF 2Z8LA 3W5VB 1DONA 3ZQ4A 3S1MB 3OSOA 3I91A 2K8HA 4FULA 3UDXA 3QOJA 3I4NH 2FCSA 4REZA 4KIKB 3I73A 4A3FG 1NJIC 4LK0M 4DGZA 3MA2B 1PTOH 4OWXB 1JR0D 1G91A 1JWBD 2MSED 2J0TD 4RA8A 1VQAA 4DV3L 2KLGA 2WXLA 1MJDA 5IP4D 1UUPA 2GN5A 1VQDA 2KEDA 3TEYA 2UUAQ 5C4JH 1LT4D 1IZ6A 5E3FA 4HMJA 4B08A 3AN1A 3HHMA 1KAAA 2WB1G 3BVZA 4I65A 5ELFA 4L6TB 4UDUC 1C77A 1WX7A 1PFBA 2ZVOA 1N61A 2EKEC 2JXTA 2JQOA 5C5MA 2K8BA 3C19A 3N1ZC 1TQOA 3M7NA 3NENA 1LTLA 2OT2A 1DOMA 2QDBA 1CK1A 2F3VA 1SYBA 2NVTH 5J2RA 5CV6A 2N1VA 1B70B 4S0RA 5H92C 3EFCA 4DUYL 2YTVA 5IT9E 4GKJL 1QUQB 2JP1A 1E90A 1Q86C 2JA7H 2ENBA 2ZT9C 2ZTCA 2XNAC 4PMCA 5M3MG 5C44G 2KTRA 4GN5A 1ZE3D 1NMFA 2GRIA 1SR3A 2PVOD 2W54A 1EQRA 3DWMA 1I4QA 1OXSC 3ZXRA 5IGFA 1C9FA 3DDCB 1H4RA 3NHEB 1XX8A 4CDDC 4LF9L 3PGZA 2R7ZG 2R2OA 4JI1Q 4DU9A 5LHY1 5GAHC 2ONQA 2L7RA 3H7PB 3GO5A 1GXDC 4PZ7A 2E2HB 2GB1A 4PS3A 4RGOS 3TBIB 3WAMA 4IM2A 4BKSA 4XWWA 4WWOA 2K3UA 4LTUA 1CUKA 1FXAA 3K9PB 3VTVA 2KVRA 2K4KA 1BBXC 3BDOA 4FVMA 4BBRG 1WTWA 3C46A 2JZ3B 4RF1A 2M19A 4XWTA 2EMSA 1RTNA 5FJ8H 4IWOA 2HJ1A
chains in the Genus database with same CATH topology
4GDKB 2F0QA 1KDBA 1SNMA 1V8QA 2QILA 3B2FA 3S1RB 2WXKA 3KWVA 5CV5A 5J22A 2MJ3A 1QJOA 4A3MB 2K33A 3URYA 3LB8C 1SBBB 2N88A 2Y5PA 5ELEA 1N62A 3OMCA 3PUYA 1EU3A 1FR3A 4ZUIA 1ET9A 3BS1A 5FO7B 1EFID 4IKGA 3KBGA 2PW7A 3Q8EA 1PRTD 3TZUA 4XYQA 1F0ZA 3ZGZA 2F0UA 1BUIC 3K0YA 2Q8TA 5CORA 4ZLTF 3RPFC 1OXTA 3GTPB 2PMVA 2R6GA 3BYYB 1TWHB 2R93B 1LACA 1GAQB 1U4MA 5EGTA 1JROA 3SFEB 2AX5A 2DBYA 2F0VA 1K8OA 2MJEA 1T6BX 3AU7A 2C9OA 4MIUA 1EIGA 2RPVA 3K59A 3PUVA 4OIKA 2N7JA 1TKEA 1G2TA 1IBXB 1KABA 5HG2A 2BCOA 2KCNA 4XTCS 2F0LA 1F2MA 2B2YC 2A69C 2RDFA 4WQMA 3J7AF 1TS2A 3EQLC 2NVXB 4YSXB 2JWUA 1FRDA 3K5LA 1LTAD 5C3EB 1ILQA 3MFYA 1OXUA 3AEAB 1A3TA 3R93A 3EJIA 1LV9A 4KY7A 4IUNA 4RGMA 5BN5A 3AEBB 3S1QB 4OO1I 1OXVA 4A6QA 4OZAA 5CBAE 2WXQA 3MHBA 1I4XA 2WP9B 2E75C 1SEBD 3BWUD 1HEZE 1I4HA 2R3ZA 4R3DA 4RNAA 3Q0AA 3NHHA 1EYCA 2KVMA 5C2TB 1SDFA 1K51A 1BR9A 2B8GA 3T53B 5COYA 2BS2B 4YWGG 3AE9B 2ID0A 2B39A 1QOFA 1FFVA 1HZ5A 1WRIA 4IUPA 1VJKA 2M9VA 2IPKD 1EQTA 1WD0A 2AUKA 1Z47A 1JE4A 4X3SA 3KK7A 2B63B 1G8ZD 2F0WA 4HCEA 3D4RA 4K2KA 1KNAA 3AH7A 3LXFA 1DOYA 5M3FB 4ITKA 4B0MA 2N55A 3M4OB 5KRUA 3Q8CA 1BF4A 1ESRA 5KEEA 3M3YB 3IL8A 3FKIB 3J80E 3M4YA 4O1NA 1G6ZA 2DN8A 1KLGD 2Z4HA 4KK7A 1UAPA 1GUWA 2E3TA 4AS1A 4US9A 2KAJA 3BK1A 1JW9D 3DXJC 3NTHA 3BVGA 1EYDA 5J1ZA 1F9SA 1EY7A 2JA7B 3C8YA 2F0IA 3M85A 1D6EC 1GUNA 2E76C 4ZRZA 5ELDA 1SE4A 2F4IA 4XDCA 1E2ZA 1QE6A 2IX0A 1FXIA 2JEBI 1PDQA 1ZUD2 1RM6C 2J42A 1WTRA 4JX1C 5T1GA 1KNEA 3HRDD 4YTNB 2SNSA 1FFUA 1PUTA 5DNFA 1F9QA 4EVOA 5I6YA 3HOWB 2ZXRA 4DA2A 5FLXL 2LKVA 2V4IB 3NBIA 3VR4A 3UI3A 4WWMA 1FEHA 1EYAA 1K8MA 3RZDB 2FUG1 2L52A 2AWNA 3H91A 3AE4B 3MXUA 1EEFD 1SF0A 1H9SA 4BY1B 4K5VA 2PKOA 3PIO3 1HA6A 1MHHE 3HZXA 2VXWA 5I2YA 5K36H 2O2LD 3HP3A 1SYEA 4FF2A 2PMZB 1LTSD 2I38A 2JA5B 4HJGE 3N52A 1G291 3WCQA 2O4XA 2L0CA 4LAAA 2QSDA 5JXVA 3HKZB 1WTVA 1F2RC 3RFZB 5CV8A 1PRTF 3SEBA 2ICEC 1EY0A 5JJZA 1JICA 1TT2A 1SFOB 1DOLA 2ZXPA 2QJLA 4QUFA 2EJFC 2TSSA 3P4QB 2ZXOA 4H0LC 1ONLA 3CKIB 5CV4A 4NAMA 5EPLA 3SK5A 2J53A 1HQMC 1AZPA 4JPSA 1PTOC 3I8ZA 2HQEA 4FP5D 1Y8NB 3ND8A 1I4GA 3PO0A 1B44D 1KDCA 3CU7A 5M5YB 2BT6A 2L32A 3GTLB 4EQNA 4H2AA 3TUOA 1PTOB 3IKJA 1R7SA 5D3DA 4ZKCB 3DWPA 1C48A 2K04A 2H89B 2F0NA 2XWJB 3MHZA 3V05A 5JEAH 1B4OA 5AUKA 3P1MA 5C0XG 2J4XA 3U9SA 1DZ1A 3HOUB 3S2HB 1ESFA 3FRPB 4PT5A 1FNVA 3TSSA 1Q8IA 5C3XA 1F9PA 4F87A 4FXCA 1BUVT 1PTOF 2HTME 5EBCA 2EYMA 4NKLA 1EQVA 3FDTA 2J52A 3T3OA 1WWTA 5JVG3 4R9WA 5D14A 3A8JE 1SNDA 3AM9A 1QQRA 1W6JA 4XYOA 3MC0B 3FPUB 3HRZC 4O42A 1OQRA 1JRPA 1JALA 4DXGA 3S16B 1FNWA 4OO1H 2PO4A 3W1SA 2A6EC 1R9TB 2JYEA 1NYRA 5C6AA 1HZ6A 4XDDA 3T13A 2VZKB 1A2TA 5HGTA 2WS3B 5TSSA 3NPPA 4C1NI 1TKYA 1QWYA 2NTTA 5I2XA 5FR3A 3L3OC 1SMYC 2M0AA 2KWDA 1NVID 3HOXB 4US8A 5EPJA 4A8XC 2EDGA 1STGA 1XCTL 1DD2A 3B9JA 3AMZA 3R8BA 3GB1A 5CV9A 4TQ0A 2VB2X 1STNA 2R7ZB 2V3PA 5EPKA 1J7AA 1LABA 3F2UA 5D3IB 1SB3C 4DFAA 3SE0A 1S5DD 2WXGA 2F0JA 4G7HC 4LLGM 3J81E 3FEWX 2O5IC 3PZ7A 4EQPA 3E9SA 3SK8A 3J81L 4N58A 1HFNA 1XCQL 2ACZB 2BB6A 2VB3X 1EY8A 1YNJC 4ODGA 2FINB 3IFDA 4KY5A 2AQ2B 1I4PA 2LMCA 2B2WC 2IGGA 2NN6I 2JYOA 4U673 1SIJA 3AE8B 4KGSA 3NXWA 4Z9CB 1RF2D 2RKSA 1SJED 3IAS1 2MEKA 4MACA 1WD1A 4KGTA 1MD2D 4DXFA 1KF6B 2F0GA 1QKZA 4C80A 1WTOA 1FMAD 3D31A 3P1HA 1JC7A 2BW2A 4YIJA 5IGBA 4Q5VA 4DNTB 1IYVA 1BOSA 3VQIA 2K1BA 2RDGA 1TS5A 2Z1CA 3QO2A 3Q8AA 5JEAG 1MGSA 4C1NK 5F2DA 3QWNA 3GS2A 4HKQA 3QG1A 4P6VF 4KD3A 3GP7A 5BMHA 5EBDA 2Z4IA 1JOQA 2JU6X 3J80L 3MEHA 1QF6A 2M00A 1K52A 1VRAB 1S5CD 1AWDA 1GHJA 4YTMB 1YJIA 4NMZA 5KIXA 4WFN3 2H4OA 1Q3LA 4DAPA 1HCZA 5H8YE 1O78A 4NZLB 1R4QB 1PFNA 4J3OD 1S5BD 5KNBA 1Z7TA 5K5PA 4C3IB 1BDOA 4IUTA 2M2LA 2D62A 2DY7A 1MSGA 5IT9L 2XIWA 3ZJTA 1YNND 3AB9A 1KDAA 4HSPA 2B2UA 2BDOA 3MAQA 3CWIA 1ZKOA 2PZWA 4K14A 2A68D 3D6WA 4RCNA 2EELA 2IDYA 2SOBA 5EQ0A 2E74C 1KTKA 2QKIC 4F8MA 1UWXA 4HROA 4KGRA 4HEDA 4BWGB 4EGVA 4OW0A 2V4DA 1EWYC 1YQ4B 1WCMB 4XE0A 3GTMB 3K5OA 1O80A 1WGKA 1YMHE 2RA4A 3EUB2 2HDLA 2NVQB 2Q5WD 4IQZA 4L63B 2RVLA 4RHSA 1DOIA 3PZ8A 2OEOA 1FCCC 1SAPA 1N60A 2JX5A 4C3JB 3P7JA 1XYIA 5KYLA 1JWMD 2PZUA 1CFMA 4ZAIA 2K5DA 4WH4A 1C4PA 3NK9A 3P20A 4C7ZA 2K5QA 4KJOA 4MHEA 1V1OA 4LK1C 4FO2A 1UNSA 3NSWA 2DY8A 1KLUD 1X32A 5IODA 1JQYD 3OWFA 1WTPA 1C4CA 1FO4A 2Q8RE 1DJRD 4ZK9B 3MTSA 3KLSA 4QB4A 1J7BA 1L0XB 4A93B 1HPCA 3A7LA 1C8CA 3CQZB 1YQ3B 4R8NA 5E6JA 1IL8A 2RSNA 1M8AA 3QB3A 4L23A 4ZKBB 2B2UC 1I6HB 2AQ1B 2SNMA 3BG3A 4QF4A 4BA1I 3R3OA 1TU2B 3OIQA 2IJ0A 3HGBA 3B2GA 3DEOA 4A3GB 4ABNA 4HR7B 2WKDA 3ZJVA 2BOSA 2DNEA 2RQXA 4A3IB 4IFDJ 1SSNA 3A56A 3NUHB 1PGBA 2PVGC 1N63A 3ND9A 1EY5A 3U9OA 3OMGA 1G2SA 3KQ4A 2B8FA 1PZKD 1MVKA 2EYHA 3FAHA 1WXQA 4KKSA 3EGRA 3H3VC 4XQQA 2WXMA 4A9AA 4XT3B 1EL0A 4G4KA 1K53A 4A90A 1RD9D 2WXOA 2B2VA 2BA0A 3SR1A 5HHDG 4DK1A 1N5WA 5IGDA 3MFGA 3T4AC 3K5NA 3EROA 2JE6I 5AFWA 1L4ZB 3VR6A 3OPOA 5ISRA 1Y69U 5BN3A 2O5JC 3W5UB 4BY7B 2WB1B 3SXHA 1BCPF 2IGDA 1S4ZA 1RYJA 4YSYB 4A3JB 4HCSA 1IYUA 2WP8J 1D5XC 3VRAB 1ENFA 1V1PA 4CJ2C 1WYGA 4ZYSA 1B3AA 2KOLA 2JA8B 2NB0A 3TDQA 3TEZA 2LS01 4KD4A 1QOGA 5CC4A 2Y5CA 1IW7D 3V96A 4MT5A 1B53A 2IX1A 3AV8A 4B9XA 5G5GA 1LLRD 2D5DA 1GUTA 1IKLA 2KJXA 3OWEB 2CW0C 3HVZA 3UI2A 4C2MB 3LX0A 3RD4A 1ZDXA 3TEWA 1IHZA 4P2CB 1BMLC 2JQRB 3FILB 2IGHA 1RJTA 2B2TA 1NEKB 1DM0B 2PPBC 1B50A 3FC4A 3T16A 1B2TA 5C3WA 4AYBB 3ZYYX 4A55A 4IFDH 1TKWB 2EJGC 2N9KA 1PGAA 4TQ1A 3NE5B 3VR3A 1JCKB 1H9MA 4M8AA 5JPNC 2JXMB 1AEXA 1UWMA 1ZP0B 5IGCA 1SXTA 3EVQA 3NRZA 4KHZA 5CV7A 5AUIA 2PNRC 2WAQB 3IT6B 1SYDA 1NAPA 5GXGB 2BE5D 4Q2JA 2ON8A 1ZOYB 5LNK1 1LO5D 4NJCA 1CA5A 2KMMA 3MWYW 3A8KE 2G9DA 2PW5A 2WU5B 4M0WA 3EA6A 1AZQA 1STAA 4DN4M 5DM73 2B76B 5J39A 2LFIA 3S17B 3T3NA 1TZOA 2Y0SB 1ENCA 1VZ8A 2D9UA 3BK2A 3PUWA 2CU3A 5JAVA 5A2QE 3OOCA 5FK9C 5C0XH 3GTOB 1Q1BA 2MJ8A 4LJZC 1LT6D 3IFTA 1GPXA 2FE8A 3G6JB 5FLXE 2CW0D 3MVVA 1V43A 4OZBA 1U4RA 5EKKA 5M9OA 2WXHA 4L1BA 2WDRB 3I90A 3CIRB 4IOIE 1SMYD 2AQ3B 2B2TC 1XLNA 1SNQA 1A3UA 1GHKA 1YN3A 4NAWB 2NMQA 3L4PA 1YNNC 1NUCA 3T51B 2RDHA 1Q12A 3Q22A 1T5XD 2B2WA 4WAFA 5MPOA 2VZKD 1AP0A 4V0BA 2LJIA 1FIQA 4Q0FA 3WDNA 3SFDB 2L1BA 4J6HA 1CZPA 3HG9A 1SE2A 2KHSA 1BQQT 3NS1A 3TP5A 3SK4A 2K9XA 3J7YW 1IBXA 5G3LF 2F3WA 3A55A 3DM1A 4GZYC 1DXMA 1JOOA 3W3AA 1XLQA 1NSNS 2WIIB 3NZ3A 2JYTA 5I9OA 1CHPD 3GTKB 1RHPA 3D8GA 5DEHA 5BYQA 1PMRA 2NVTB 1GUGA 2KA7A 4HTHA 4C7YA 3D3RA 1L6VA 4CHTB 2EKIA 1NYQA 4NDXA 2XRSD 1L5PA 1LTRD 4GDLB 2WKCA 1CZGA 4OO1G 2NTSA 1Q1EA 4P16A 5LL6S 4K6DA 2N0SB 3D4DA 2EY1A 3IXSA 2A73B 2BS4B 4HN7A 2K22A 3DHQA 1I4RA 2IX3A 2QCPX 5I9PA 3AEFB 3ITPA 5E1FA 1GOZA 3T56B 1V8CA 4FYDA 3I4LA 1OFFA 1W6KA 2KCCA 1YJJA 1SE3A 4RHRA 1VMPA 3P4RB 1E6EB 2G1EA 3RUZA 3JAME 3P75A 1SNCA 1JORA 5BMIA 1E9MA 4XXEA 4K2LA 2K5PA 3K57A 3P4PB 1T3QA 3FMCA 5EE0A 4ZOHC 1V97A 4K5WA 2L9HA 4KKTA 4YT0B 3HS0C 1PFMA 3A8IE 1H9KA 1GB4A 2IL8A 2NN6H 4HAEA 1ZPSA 5FOBB 2PW9A 4N59A 3ONAB 3PMFA 1CQFA 3L9AX 1GUSA 2F0SA 3AB5A 3NVYA 2I46A 1ZDVA 4IALA 4HKZE 4C3IG 4A3BB 3HOZB 3OW7A 5T1IA 3GD7A 5M3MB 3U7ZA 3PO3B 3AECB 3OHXC 4CKBA 5JPMC 1NR4A 5T8IA 2F1MA 3IT4B 4YTPB 1X3PA 2EY5A 3GV3A 4GLSC 1BXTA 3BYTB 3MJ5A 3H09A 4ZRPA 2YEPB 2KECA 3WOFA 2LHDA 4TKOB 1ET6A 4XQNA 4E6IA 2EYFA 4B9WA 3C1FA 4RAUC 1BNZA 5EKIA 1AN8A 2HCIA 1EIHA 1FM0D 4PNYA 1HUNA 2BA1A 4X3TA 4N9TA 5IGGA 1ZYRD 1C79A 2B2VC 2FFKB 4OIJA 3AE1B 3AE2B 1Y56A 4RCOA 1RFKA 2MPMA 1ILPA 1MPEA 2WNMA 3R2TA 3H0GB 2QF7A 3Q24A 1AFPA 1SNPA 2SDFA 1RODA 3PUZA 1PDXA 2KDMA 3VR8B 3NP8A 3BIID 3I9V1 4D2KA 4H7BA 1Q10A 3GTGB 2BB5A 3LNNA 1STEA 1OQQA 1BCPC 1FD7D 3P42A 1XLPA 2WV6D 1O7YA 3AE5B 5EE9A 4WIPA 4USAA 3I4MB 5C4JB 5ELBA 2CJOA 2N9LA 3NWSA 1F2YA 4JE3B 3D6CA 2C5CA 3KLSX 3R2IA 4OL7A 4TRDA 1U9RA 1XWEA 2JA6B 3S1NB 5DAUA 2WXIA 1QILA 1STHA 2F0EA 3AEEB 2NBFA 3NQTA 1TR5A 2DYMA 2AWOA 2BDNA 4OHJA 5IGEA 2A74C 3HEJA 4Y7NB 2JSVX 1UGJA 3TZDA 4OVZA 2Y3AA 2WDVB 4WRDA 2WXNA 4DAYA 4WJWA 4ILWA 5JVH3 2INPE 2Q8IB 1HRJA 2MHVA 4ZRQA 4NP5A 4MM3B 2PCFB 3Q6SA 3C1EA 3VYTA 3AMUA 1A2UA 1WTQA 1L0YB 4RKBA 2PIAA 1EZ8A 4ID6A 1MI0A 2K03A 1NI3A 1F2LA 2PYKA 3LYYA 1H9RA 3PO2B 3SK6A 2F0HA 1TWCB 1I3QB 2H88B 5KGUA 4IFDG 5C4HA 1ZXHA 1DCZA 1U4LA 1WVLA 3KLRA 2FMMA 2TMPA 2FBWB 3OIPA 1HUMA 3FILA 1MHXA 3I72A 2NWGA 2F03A 3H94A 4KI0A 2HDMA 3HUIA 3SVMA 1OO9B 3X3NA 3H8HA 4G7OC 1Y1VB 1LTBD 4TQUS 1SYGA 2QEJC 1DGJA 4YXDB 2RMMA 4FXGC 4BA2I 2LEKA 1ZYRC 1C78A 1PFDA 1TKGA 4JK1C 4QUCA 3QJYA 1IUEA 5ELCA 1LTGD 5HI1A 1GB1A 1JWAD 2XSCA 3P4SB 1CTMA 1XTCD 5E4WC 1VLBA 4IFDI 4EE2A 2E2IB 3ABVB 2E2DC 2KN4A 2IW3A 3NTIA 4V190 1JWUD 1EEID 1L4DB 2MUYA 2K6AA 3N6RA 3CRLC 1D4BA 3VRBB 3K5MA 2NN6G 1PRTB 3GTJB 1ACCA 5KNDA 4KKIA 2EPBA 2LGIA 4ARIA 5I4DA 5G5HA 4IDIA 1H9JA 4H13C 4XQJA 3W2DA 2VNUD 3NVZA 2CVRA 2PLPA 3KWLA 1HHVA 4K8IA 1DOXA 3Q8BA 4A3EB 2F0FA 4KN7C 2GI9A 3A54A 1CA6A 4RF0A 3AEGB 4EQOA 1PYWD 3RLFA 4DF7A 4WORA 3CRKC 1STBA 2PZTA 2A6HD 3I70A 1NR2A 4C3HB 2BS3B 4UAIA 1EU4A 4U68A 1SYCA 2XVSA 3NVVA 1EY4A 2EY6A 3ZJUA 1QLBB 4ZHOA 1ZXIA 2EJMA 3PIP3 1FYCA 4IURA 2X6LA 1D2BA 3U2SC 1A6XA 1FRRA 2DLBA 1CM9A 3P63A 1C4QA 5CR3A 1QCBD 5G3LD 2WXJA 1E0BA 3BVMA 3MZ5A 1ML0D 5BN4A 2KEEA 4RGNA 4K5XA 5D7GA 2F0TA 1PTOD 3I4NB 4OGQC 4H44C 1D1IA 3HOVB 1VDZA 1TVXA 4FXKC 2EYLA 4M1UB 4TMAB 1F2RI 4XWWA 1E7PB 2V0GA 1YN4A 2EVBA 2OF1A 4PMBA 4FF1A 1IGDA 1QT9A 2K0PA 5JOBA 5E4XA 1B9MA 2CHBD 4L2YA 3MXGA 4RFBA 3K7AB 5EKLA 4RGTA 2EZVA 1P7EA 1GJXA 3DMUA 1XO3A 3LWUA 4J1MA 4I7ZC 4C56C 2YU9B 2QMTA 5CYUA 4N9PA 3Q8FA 1RCVD 2FMCA 2X69A 2A68C 4KKUA 4DAVA 4N6EB 1LT5D 1D1KA 3HOYB 3I57A 1ICWA 1Y1WB 2SEBD 1PZJD 2DNCA 1BO0A 1JQ4A 1EOTA 2K05A 1KH0A 2E2JB 3RMHA 2D5GA 4MN3A 1IGCA 2EE1A 5C0XI 4FXDA 5IOCA 4DQOC 4QCLA 4HEA1 2BBCA 4G7ZC 2MH7A 1HQRD 3IAYA 3ETRA 1JOKA 3KF8A 1VR9A 2FHTA 4PV1C 2OHFA 2R92B 2L11A 1X3QA 1HTPA 4RKLA 4ME5A 3NTKA 2KACA 1L0VB 1TWAB 3AEDB 3IAM1 4RH6A 2ZW0A 1IKMA 4B0EA 4G57A 3E6ZX 5DM63 2D2CC 3D4WA 1YN5A 3U52E 4HSVA 5LL6X 1NENB 1FD6A 1CJEA 3HVDA 1AYFA 2EYPA 2HUGA 2MGSA 2DYOA 3VR9B 4C3HG 1C76A 3AE3B 1TJEA 3DWQA 5EJWA 1S5ED 1A15A 2WU2B 3V3XA 1RKNA 1CT1D 1LT3D 1CZWA 1Q90A 5IIFA 2F0OA 1I7HA 2WXRA 1I50B 3C3LA 2GA4B 4KV6A 2PQEA 2X6GA 4QMGA 1STYA 1CI3M 2OXPA 1XLOA 1ENAA 3TN2A 2BYTA 4IN3A 1EWCA 3QOLA 1HA5A 2LHEA 3SR6A 1D5ZC 3NBHA 2L12A 3S2DB 4S3SA 1TYGB 3DEPA 1J7CA 4F88A 2L4NA 4YSZB 5BYRA 1DYQA 1E2WA 2H1EA 3VA7A 4BS9A 4XT1B 5I6WA 2A6HC 3SHLA 5A2QL 3BZDB 4F7XA 1A3VA 2CJNA 1GUOA 1EM7A 1J8IA 1H9SB 3QIAA 2BTEA 2PTLA 2G9HD 2WQYB 2E6XA 3GQBA 2RSOA 3NVWA 4AQ7A 1B9RA 5C5LA 4WURA 4JWSC 1E2VA 4K8JA 3AE6B 2M56B 3VYRA 4C3JG 2XN9C 3JAML 2DWQA 2W82A 2W3SA 1WSPA 5FO8B 1BCPD 5A35A 5JEAJ 3Q23A 3KUPA 3I3CA 2WXFA 4QIWB 2LFNA 4TSSA 1QNKA 3VR5A 2EYJA 1B9NA 1EZ6A 4R8IA 3GTQB 2RBMA 5C3JB 3SDZA 4FNFA 2VUMB 4J8QA 2LMCB 2R61A 3TEXA 3BDCA 1K50A 1ZEQX 1C4AA 3BDLA 1HXYD 1VZ7A 2F0DA 3WOEA 5C0XJ 2WACA 1V1PB 4JBWA 1DOKA 3DUZA 4A3KB 3DWAA 1PRTC 1I6VC 5M5WB 3O13A 1WTXA 4CJ0B 1TWGB 2FJ2A 4KMUC 1EWHA 1VDVA 3X3MA 1TS3A 2K28A 2AUJD 2YYZA 1FNUA 4OZCA 2JEAI 1TY0A 1PZID 2WINB 1MSHA 3E56A 1YNTE 4KN4C 1EY6A 1Y8PB 1O7ZA 2A6ED 2HCCA 4HMIA 1QOHA 2J7ZA 3K58A 1VMCA 1SYFA 4FF4A 4XDXA 3LWEA 2L5TA 1SSOA 1VF5C 1HTLD 1AW7A 2F0MA 1KRHA 3TP7A 2A5HA 1F9RA 1OXXK 4ZHPA 4HRSA 3G7LA 5FKAC 1MI2A 3E5SA 1T5EA 1D5MC 5EE1A 1SJHD 4L8JA 2QIEB 1RTOA 3FPPA 5C44B 1RDPD 1YNJD 1HFGA 5K36G 1RWSA 4IUUA 4FF3A 3E0JA 3TP8A 2XWBB 2K7VA 2MP1A 2OEDA 2EY2A 4PMWA 1EY9A 1B1ZA 1F2ZA 4CKCA 5M5XB 2WDQB 3W9CB 4DNRB 2IWHA 4BBRB 3MXPA 5D65A 3KBXA 2KUMA 4A3DB 1XEEA 4KY6A 3K6OA 5CGKA 2F0KA 4IUQA 3RZOB 1IW7C 4PQXA 5CMDA 2CQAA 3NQIA 1JWSD 3L7ZC 4RWSC 2WXPA 2SAKA 1TS4A 1UEAB 2I07B 2NVYB 3M7GA 1QOAA 1P7FA 4MH8A 3U4EG 1FGBD 3S9WA 2IT1A 4KX6B 1TIID 1JB3A 1FCLA 3AE7B 1KFYB 3NWTA 3VR2A 1U4PA 3GV6A 2LY7A 3TMEA 3S14B 2HDEA 1LTTD 4NW2A 2K01A 3Q69A 3PUXA 1LTID 1BCPB 5FO9B 2X38A 4ARCA 1XF5L 1QNUA 4JWUC 2EOTA 4ZQ3A 3MXNA 2I2YA 1A70A 2EXZA 4X3KA 5HFYA 3VYUA 3FVQA 5KYIA 3TP6A 5BMGA 2NUCA 2LUMA 4XIGS 4CBVA 4IZ8A 5C4ZA 2JZPA 2W3RA 2L1AA 4K6LA 1PGXA 2B2YA 1NCVA 2A69D 3MP9A 1K83B 5BYSA 2K5WA 3S15B 5C4XB 1ROEA 1PLFA 1E10A 1QB5D 3J9CA 4KKJA 1CHQD 1MBYA 3VYSA 4CGYB 1E0ZA 1TWFB 3NUCA 4BBSB 2MJDA 3C2PA 1PXUA 1JMLA 2INNE 1II3A 2EYOA 2ZW1A 2KQ4X 1Z6HA 4ULLA 1J9OA 2KQ3A 4LMQD 1Y8OB 2F0PA 4CJ1B 1F77A 1SNOA 5EE3A 1S5FD 5CBEE 4DK0A 4X3UA 1QG7A 2L55A 4KHVA 2NZ1D 2XRQD 3VA5A 2JSOA 2ICIA 1VZ6A 2K32A 3CHBD 3J7AV 1ZXTA 2L83A 3N9YC 4KTAA 1TY2A 1N5XA 3ERQA 4KJNA 4CQNA 1CQVA 1VCIA 1M4VA 5HURA 4CKEA 3V2TA 5KNCA 4ZUJA 3H6MA 1XXGA 1O7LA 3A7AB 3DWGC 4A3FB 3EFXD 4IUVA 1VF7A 3PV0A 1L6UA 2V3NA 1QOBA 5NUCA 2BE5C 1R4PB 2W55A 2NYZD 2YEPF 2Z8LA 3W5VB 1DONA 3ZQ4A 3S1MB 3OSOA 3I91A 4REZA 3QOJA 3I73A 4LK0M 4DGZA 3MA2B 1PTOH 1JR0D 1G91A 1JWBD 2J0TD 4RA8A 2WXLA 1UUPA 2KEDA