2IO3B

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
LKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding, hydrolase
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io3B00
2BYFA 3WANA 2CU1A 4GU2A 1XQQA 2KWUB 1HE8A 3W1YA 1E8YA 3CMMB 2O6VD 2UYZB 2MLBA 1E8WA 4GGQA 1WR6E 2AL6A 4EUTA 3HM3A 2C7HA 3IFWB 2XBBC 3AXCA 4DHJD 2HD5B 2ZCBA 2M0XA 2ZZPB 3R66C 4W9GA 3TL5A 5JH5C 2Z0DB 5DPRA 2LWPA 1WY8A 4GDLB 3DCGA 2QHOA 5D94A 3ZO5B 3B08A 4WJPA 2IO3B 2KTRB 4WJOA 1GJZA 2MP2A 2GBJA 3KUZA 2Y5BB 3RZWC 2KFKA 4XZ4A 3M95A 1WX8A 2JRHA 2W9NA 3V6CB 5FR6A 2DX5B 1PQSA 3NZUA 4BFRA 4DDGD 2KX3A 1VCBA 2BYVE 4JLCA 1E90A 2KZRA 1OTRB 3D32A 4XC2A 2K1FA 2WDTB 3VQIA 3CF6E 3UIOB 5G2NA 3L0WB 2IYDB 2CS4A 3L10B 1R4NI 2L76A 5D2MB 3HIZA 3QHTA 4XX5A 1I35A 2BWFA 4FBJB 3PZDA 1F9JA 1UH6A 5CX3A 2K8CA 4A3PA 1RAXA 4EZKA 2D07B 4K7UA 2GBKA 4K7SA 4ZRKA 3PT2B 2KDBA 3WAPA 5IA7A 4TUUA 3LDZE 3PHXB 2IY0B 2JT4B 4IWPA 2K6DB 3JYUA 1QZEA 1S3SG 2KQ7A 3MTNB 4GDLA 2LGYA 4JGHB 2KN5A 3VH4B 2D2QA 4NQLB 3DVNU 4FULA 2XEWA 1XT9B 3R7RA 2KTRA 2DYBA 2MBOA 2CHWA 2D3GA 2K8BA 2KLGA 3ML8A 3PTFC 1UZXB 4M0WB 3NY5A 4JIOU 2N4FA 1VD2A 1SE9A 2GBMA 2L05A 2LJ5A 2KC1A 4WAAA 4B95A 2KHWB 5DCNA 2JPHA 3H7SA 4NPNA 3PREA 4RM8A 3T8MA 3PRZA 3SU8X 1RLFA 1WE6A 2KX0A 2LVOA 5DPSA 3UINB 2FNJB 4BBNC 1P3QU 2KXJA 1EO6A 2J0MA 1IYFA 4HWIB 1IPGA 4KSLC 2CR5A 2ZPNA 2ZNVC 2L0TA 4B9KA 1GUAB 4TKNA 4P7IA 2BF8B 3H1UA 1WRDB 4W9EA 4I6NB 1E8XA 4GN1A 3ZLZA 2L7RA 1Q0WB 2IZVB 3TMPB 3VUXA 5HKHA 4FJYA 3ZRFA 1C1YB 2O2VA 3WA0A 3U8ZA 4F8CB 3JW0X 3A9KB 2KMCA 2C60A 3WALA 3N30A 3GZNI 4MM3A 3A9JB 4NAWB 1KLVA 3QX1A 3R3MA 4HCNB 5C23A 3VTVA 1IP9A 2CHZA 2O6VB 1UGMA 3PGEA 3HM6X 4HPMB 4KZ0A 1TBEA 1YIWA 4URKA 2NR2A 1WGRA 2FCQA 2L00B 3S2AA 1WH3A 3PV1A 2KANA 3CSTA 3DPDA 4W9HA 4DHJB 3WAMA 3NHEB 2MX2A 5CTRC 2M4NA 4GB9A 1TTNA 1SGHA 1D3ZA 2GBRA 2LXCA 4JQWC 3LJ3A 4YL8A 1V86A 3VHTC 3U7DA 2K39A 1WM3A 4KDLB 5AZHA 1CMXB 2D10A 1V5TA 2KC2A 4W9KA 3APFA 5L83A 4CYEA 2CHXA 2JVCA 3B0AA 2N9XA 3VUYA 2FIFA 3AU5A 4FJZA 4ZYNA 3KW5B 5AZFA 2IO2B 4ZRIA 3TIXA 3ZDMC 3L13A 4AOFA 4ANWA 2YLMA 3DBLI 3ZVVA 2FAZA 3L17A 2MBBB 2BKFA 1V80A 2C7NB 1LQBA 1Q5WB 1K8RB 1KM7A 5D7GA 4I6PA 4BKSD 1WJ6A 3DVGY 2GBNA 1H4RA 3ZTDA 1WJ4A 2J0KA 1WMHB 3A9KA 4ZDVA 3BINA 4N9F4 4MSMB 1TGZB 5J2RA 4A20A 3A9JA 2A4ZA 4NAWA 4FHKA 5IAAC 3UQAA 4JL9A 4IM3A 4AJYB 3QWZB 4TQ1A 1E7UA 2KQSA 5LLIA 4KSKC 4E71A 2NPTB 1J8CA 2WX0A 3EC8A 5AEKB 1KOTA 4LDTD 4W9LA 2MQJA 2ZEQA 2JZ3B 5BO4B 3DBSA 4CHKA 2HE7A 2ZPYA 2BPSA 1AARA 3WAOA 4KDIC 2DYOA 2FIDA 1J0GA 2N7EA 2G4SA 4IM2A 4MJSB 1L7YA 2UWQA 4EFOA 5E6OA 2G3QB 2LRWA 4FN2A 4DHZB 1KJTA 1OGWA 3M62B 2GOWA 2J7QB 1E8ZA 2C5LC 5JZEB 2M8SA 3PSEB 3Q3JA 4FJVB 2DZJA 2WWZA 1Y8RC 2AYOB 4IM0A 2R2OA 2JXXA 2LVQA 1UBQA 3SD5A 4NNJB 4G50A 2RPQA 3IVFA 4GDKB 4EEWA 3NZSA 4M8NA 1OEYJ 2A5UA 2LI5A 3A1QB 3NOBA 3ZNZB 3IG3A 2M1MA 4IUMB 4RMAA 2DZIA 1A5RA 2KWVB 1WMHA 4HVBA 2V1YA 1YD8U 2NBVB 2B3AA 4W9JA 1WIAA 4I6LB 4PS7A 1WGGA 3VUWA 1WGDA 1I42A 1TZ1A 1WI0A 2NPTA 3A4RA 4M8MA 5J18A 3ENEA 3PPAA 1WJUA 1RFAA 3T9LA 3RUIB 3NS8A 1GG3A 3QQ8B 4MDKE 4BOSC 4DXAB 4PYZA 4WJNA 1Z2MA 1YX5B 5L95C 2J0JA 5TR5A 3H7PB 4KVGB 5DPTA 3A33B 1LXDA 4GMVA 2IY1B 2RGFA 3C0RB 4HCPB 3MHSD 1ISNA 4KV2A 3KUCB 4J6IA 3ML9A 5CHFA 4ICUA 5GMVA 3UIPB 3VDZA 3EHVA 1GNUA 1OEYA 3JVZX 3H9DA 4GSWA 1ZGUB 3OJ3A 3ZNID 3RD2A 2DZMA 2OJRA 2MBEA 3OLMD 2ZJDA 4X57B 3AU4A 5JHBA 4EZJA 2L0FA 3V62A 1WM2A 4BKTA 3L08A 4RM9A 1NI2A 2Z59B 4GDKA 3ZIMA 1WXAA 2MSED 3HK0A 4FHJA 2MCNB 1WX7A 3RT3B 3A1QA 1V5OA 1E7VA 3VTUA 3I3TB 2EKEC 2LVPA 4W9FA 4A3OA 3DVNV 2N1WA 3VTWA 3ZDTA 2DENB 5J17A 3KH0A 4KIKB 2KDIA 3CSFA 4W9IA 1V9JA 4AJWA 2HJ8A 4K81A 1P0RA 2BYEA 1V2YA 2VRRB 3QJZA 2I1JA 3JSVB 5CHVC 3TBLD 4MH0E 2KK8A 4DHZE 5CHWA 2KD0A 2L3ZA 2DAFA 2FCSA 3H6NA 4IWQA 4ASWC 2FCMA 4IC7B 1Q1OA 4HLEA 1WGHA 4HXDA 4NQKE 3A4SC 3H7PA 3HHMA 4WQOB 3PRPB 5AZGA 4KZCA 2IO1B 4G11A 3ZW3A 1WR1A 3N3KB 1WZ0A 3M3JA 2LD9A 4WJQA 3PVLA 4ANXA 2NBWB 3IBEA 3ALBA 3V61A 1WFYA 3DVGX 2KO3A 2KWCA 3DDCB 2LUEA 5E6NA 3UQBA 4TV3A 4IG7B 2PPHA 3PLUA 4II2B 2AWTA 2V4LA 2IO0B 2NBUA 2RD0A 2PE6B 4MGKE 3W1SA 3UF8A 3X23A 3KYCD 2CKHB 2K25A 3WIMA 3PS6A 4IWOA 1R4MI 4OVVA 3RYTA 4E3CA 3L54A 4BOZB 3ZNGC 3DOWA 4PYUA 2L8JA 4EKUA 1WE7A 3KYDD 4MGIE 2KFJA 1WF9A 2O6VA 4PS3A 4GXBA 4ZRJA 5E6PA 1NDDA 2JRIB 4NY0A 2KLCA 3DBHI 1MG8A 4GIVA 4LJOB 2REXA 2ZCCA 2ZVOA 2C7MB 1RRBA 4KIKA 2EMTA 2AL3A 3AI5A 4NJ6A 4WWPA 2R2QA 4WWNA 3RCZA 3QC8B 4DBGA 2I1KA 3JSVA 3V6EB 1WX9A 2JY6A 3IHPC 2K6QA 4HJKA 3SHQA 1H8CA 2XK5B 4BKSA 1YJ1A 4ANVA 2KNBA 2KDEB 1UBIA 2LGDA 2MBHA 1WZ3A 4MEMA 4CO7A 3QIJA 1S1QB 1UELA 2K8HA 4MGYE 2NS5A 2NVUI 4EZLA 1U4AA 1WXVA 3QK0A 4W9CA 1UD7A 4W9DA 2GMIC 3RZFA 4II3B 2LGXA 1P98A 2FCNA 1C3TA 4G0NB 2BGFA 2JUOA 2KJRA 3QARA 2IBIB 3L16A 4WWOA 5LXHA 3ONSA 1WXMA 3OAWA 5C1ZA 4K1RB 4HDOA 4FADA 4MELA 3MJWA 4HPLB 3KUDB 2RR9A 2JWZA 1EF1A 2C9WB 5JHAA 3TCAA 3PRMB 2ZNVB 4F1SA 3PLVA 1YQBA 1L2NA 4NJ7A 3APDA 4LJPB 2D11A 2OOBB 2KDFB 4BKGA 2O2VB 2PE9A 2PJHA 4DK5A 1P1AA 2M17A 2DZKA 5KHOA 4FA6A 1EUVB 2V3SA 3M63B 3ZUNA 3ECIA 4OVUA 3GOEA 3VXWA 4AUQC 4ANUA 2DHZA 1V81A 4MJSA 2FUHB 2XK5A 4ICVA 3R7QA 2NCNA 2KJ6A 2ASQA 3X0WA 1ZW7A 2DAJA 3ZRCA 3UGBB 1X1MA 1EF5A 5D6JB 2MBQA 5LXIB 3VVWB 2KKCA 3P2BA 2LASA 4BBNF 3QAQA 2RSUA 3APCA 4MSQB 4HK2A 3O65B 2WYQA 4K7WA 3VAWA 4BVUC 1BT0A 3AULA 4GOCA 4DWFA 3EFUA 4DDID 2KMAA 1J19A 2LXAA 3DBRI 1WXSA 2KOXA 2JF5A 3OJ4B 4FLHA 2KJHB 2MRPA 1WYWB 4IW0A 3V60A 1WGYA 2HTHA 1YX6B 2BWES 3BY4B 3VFKA 2ZVNA 4EOYA 2N9PC 1GC6A 2MA9B 3K9PB 5G55A 1OQYA 2LRUA 1FXTB 4AWJA 2KVRA 2N1VA 2KTFA 2AEHA 1XD3B 3DQVA 4MGZE 1G6JA 2DYMA 2LZ6A 4LCDE 2EMSA 3ZKJC 3B1LX 3K9OB 4E74A 2WX1A 3KVFB 3ZTCA 3SDLC 3ZNHB 1LFDA 1V6EA 2G45B 2MWSB 1M94A 2MP2B 3U30A 1WJNA 2KFKB 3EECA 1JRUA 3TJPA 3RULA 4HDQA 4G3XB 3VH3B 2MW5A 4PS8A 3QA8A 2N7DA 1E5WA 1P9DU 5DPWA 1LM8B 2N9EB 4LDTB 3W1SC 1T0YA 4B6WA 2YVCA 3Q3FA 5KHQA 4AP4C 1NBFC 1SIFA 2JZZA 3N32A 4F7ZA 1ZKHA 1GC7A 2G4DB 3QCAA 2BKRB 2Z0EB 1V49A 2PEAA 4TQ0A 5EDSA 1Z5SB 3PHWB
chains in the Genus database with same CATH superfamily
1XQQA 1E8WA 1TY2A 3DBRB 3HM3A 2C7HA 4K3CA 2ZCBA 1WY8A 1SEBD 2IO3B 1GJZA 3CWIA 2WXMA 3RZWC 2SEBD 4RF1A 2JRHA 2MJ3A 5FR6A 1F0ZA 3NZUA 3EUB2 2INNE 2BW2A 2WDTB 3CF6E 2BB6A 1D4BA 2IYDB 2CS4A 2FBWB 3L10B 1R4NI 2BS2B 2INPE 1DOIA 5D2MB 3HIZA 2L52A 1XF5L 1D5ZC 2BWFA 1SE4A 1PGAA 3ABVB 4TUUA 3PHXB 5IN7A 2IY0B 1QZEA 2KQ7A 3MC0B 2XEWA 1SSNA 1FFUA 3AEFB 2CHWA 2K8BA 1QKZA 4M0WB 4JIOU 2N4FA 1WWTA 1SE9A 2GBMA 1F1HA 1WXQA 1L4DB 2JPHA 4NPNA 4OZCA 3T8MA 1RLFA 2KX0A 2LVOA 4BBNC 2KXJA 1KLGD 2WDRB 4B9KA 4TKNA 4BAXA 2PW9A 4OW0A 2ZW1A 1C4AA 2PTLA 2IZVB 4WWMA 1JWSD 3VUXA 3AE6B 3ZRFA 2WS3B 2O2VA 2K22A 4FXCA 4F8CB 2KMCA 4YTNB 3R2TA 4QAYA 4NAWB 4C4VA 5BYRA 3VR9B 2FE8A 1UGMA 3HM6X 2VZKD 2KANA 1YJIA 1I7HA 3CSTA 4W9HA 4PK1A 3WAMA 2JXTA 1V86A 3VHTC 2K39A 4US9A 1V5TA 2KC2A 1C78A 2CHXA 3B0AA 2FIFA 3KW5B 4ZRIA 3ZDMC 4AOFA 2YLMA 1D6EC 2QEJC 3L17A 2BKFA 2KYWA 1LQBA 4XDDA 1WMHB 3AE9B 3A9KA 3BINA 1TGZB 3A9JA 2A4ZA 1FIQA 2YEPF 3EC8A 5AEKB 2MQJA 5BO4B 3FAHA 2UU7A 2ZPYA 3GZNB 1AARA 3TEXA 5FKAC 5G5HA 4XGAB 2N7EA 2G4SA 2LHEA 4P16A 1L7YA 2I2YA 4EFOA 3N20C 4FN2A 2LRWA 1KJTA 1P7FA 3AE8B 2WWZA 2R2OA 4TSSA 1NI3A 3IVFA 2GRIA 4M8NA 4IUMB 2M1MA 3TEYA 4RMAA 1A5RA 3DBLB 2B3AA 4W9JA 1TS3A 5IO9A 3OWEB 1WIAA 4ITKA 2N7JA 4JPSA 3T3OA 5J18A 3DHGC 2KAJA 3T9LA 1I4XA 1V8CA 3QQ8B 4MDKE 4PYZA 3Q3OC 1UGJA 2QIEB 5DPTA 3A33B 2XNAC 3NVVA 4GMVA 3AECB 2RGFA 4HCPB 1ISNA 4J6IA 2VZKB 3VDZA 3MC9A 1YN3A 1OEYA 4GSWA 1ZGUB 3OJ3A 4X57B 5HHDG 4S0RA 4EZJA 3V62A 1WM2A 4BKTA 3VR8B 1PGBA 1WXAA 2GI9A 1V5OA 1XLPA 1E7VA 3I3TB 2LVPA 4YXDB 2WXOA 2N1WA 2KDIA 3CSFA 1FMAD 2TSSA 2Z8LA 1V9JA 1MPEA 1YMHE 1V2YA 2VRRB 2JYTA 2KK8A 1QT9A 2ACZB 2KD0A 1L0YB 2L3ZA 2DAFA 2FCSA 4IWQA 4IC7B 1WGHA 4HXDA 4NQKE 3A4SC 3H7PA 4M01A 4HJGE 1FEHA 3ALBA 1IUEA 3NZ3A 2LUEA 5E6NA 3RNGC 1YOVB 4IG7B 4TMAB 2IO0B 2NBUA 2PE6B 3W1SA 3X23A 3UF8A 2J52A 4WAFA 3O13A 2BS3B 2WHIA 3PS6A 3WIMA 1R4MI 3KLSX 1ET6A 1WE7A 4MGIE 2KFJA 2Y5PA 4GXBA 2LEKA 1IBXA 2ZCCA 2ZVOA 2C7MB 4KIKA 1CQVA 4HPPA 4WWPA 1JMLA 2K0PA 1TS2A 4WIPA 3JSVA 3W2DA 4OVZA 4DBGA 4HJKA 1H8CA 4KGRA 4BKSA 2KDEB 2MBHA 4LK0M 3QIJA 2IGDA 2D5GA 1UELA 2K8HA 2NS5A 2NVUI 1WXVA 1M4VA 4W9CA 1NVID 2ICIA 3P63A 5EE9A 4KGTA 1JWBD 3Q6BA 2KJRA 2IBIB 1UNSA 3U52E 1ZUD2 4K1RB 1NENB 2RR9A 2JWZA 5JHAA 1FCLA 3PRMB 1YQBA 3RNAC 4NJ7A 3AE5B 4D2KA 3V3XA 4IDIA 4BKGA 2JYEA 1J7BA 1EUVB 3M63B 1VDVA 2DHZA 1V81A 4A6QA 2FUHB 4ICVA 3R7QA 2NCNA 3DBHB 1ZW7A 2MBQA 3EA6A 5LXIB 1LO5D 3P2BA 3W5VB 3QAQA 1K51A 1BXTA 3SR6A 3DHIC 3AM9A 2KMAA 3DBRI 3KWLA 2KJHB 2MRPA 3MFGA 1YX6B 2BWES 5BMHA 3VFKA 3NRZA 1OQYA 2LRUA 3BK2A 2AEHA 2LZ6A 3MJ5A 2EMSA 3K9OB 2MJEA 2B76B 3SDLC 4YSXB 3U30A 3EECA 4HDQA 4G3XB 2MW5A 4PS8A 5IOIA 2N7DA 1E5WA 3W1SC 1T0YA 1AWDA 5KHQA 1NBFC 2RPVA 3N32A 1ZKHA 2Z0EB 5EDSA 2DNFA 3BVZA 3WANA 1OQQA 2MEKA 3N1YC 2KWUB 3CIRB 1E8YA 1RYJA 2PIAA 3CMMB 1JALA 1PUTA 1DGJA 1I4QA 1E10A 3IFWB 3AXCA 1TT5B 2HD5B 2ZZPB 3R66C 4LNNA 2WXQA 5DPRA 3NUHB 4IKGA 1F77A 5D94A 3ZO5B 4WJOA 2HTME 2MP2A 2GBJA 1D5XC 3ZJVA 2GLSA 5HFYA 3M95A 1WX8A 2W9NA 3LYYA 2DX5B 1PQSA 1PFDA 2KX3A 4NAMA 2DWQA 3D32A 3P4PB 2W82A 1N60A 3UIOB 3L0WB 5EE1A 3AH7A 1HTOA 3PZDA 3P4RB 4DQOC 5CX3A 1SJED 4EZKA 2GBKA 4ZRKA 1XLQA 3WAPA 3LDZE 3JYUA 3MTNB 1FNUA 4JGHB 2LGYA 4C4VB 3VH4B 2D2QA 4FULA 2KTRA 2DYBA 2MBOA 1KLUD 1KH0A 3ML8A 4ACFA 1UZXB 2J53A 1VD2A 2AX5A 3H7SA 3PRZA 3SU8X 3KWVA 4RGNA 4RGMA 1EO6A 1IYFA 2L0TA 1GUAB 2QC8A 4P7IA 2KT7A 1WRDB 4W9EA 1E8XA 4GN1A 3ZLZA 5HKHA 1NYRA 3IXSA 3T3NA 2R61A 2QCZA 3A9KB 4HRSA 2C60A 5T8IA 3GZNI 1SE2A 1HA5A 1QLBB 3A9JB 4MH8A 1KLVA 4L1BA 3QX1A 3R3MA 2ON8A 1IP9A 3VTVA 4HPMB 1F2RC 1YIWA 1E0ZA 2BQQA 2L00B 3S2AA 3RI7C 3PV1A 3NHEB 2MX2A 4RGTA 4C7YA 4REZA 1D3ZA 2LXCA 1FO4A 1WM3A 4KDLB 4USAA 2D10A 2D3BA 1ZPSA 4CYEA 3AU5A 4YWGG 5AZFA 2IO2B 3L13A 2OJWA 4ANWA 3BWUD 3DBLI 3ZVVA 3ZXRA 3GP7A 2C7NB 1HXYD 1KM7A 5D7GA 4I6PA 4BKSD 1H4RA 1YQ3B 5HG2A 1WJ4A 2J0KA 1I4HA 3Q8BA 3PZ8A 4ZDVA 4N9F4 3Q8FA 4A20A 4H2AA 4K3BA 3BYTB 4FHKA 3QWZB 3BVMA 4E71A 2KACA 1KOTA 4LDTD 2HE7A 4KDIC 1YQ4B 1J0GA 2FUG1 4PT5A 3AEDB 4LLGM 3M62B 3AEBB 2WQYB 1E8ZA 1J7CA 4YSZB 3PSEB 3Q3JA 3UI3A 3C8YA 2DZJA 2BT6A 1Y8RC 4O1NA 4IM0A 2JXXA 4NNJB 4G50A 1OEYJ 1XLOA 2A5UA 3ZNZB 4S17A 2KWVB 1WSPA 2NBVB 4PS7A 3VUWA 2NPTA 3A4RA 3BK1A 1I4RA 1RFAA 1L5PA 4DXAB 5L95C 1TZOA 2J0JA 3H7PB 4KVGB 1LXDA 2DBYA 1KRHA 3MHSD 4KV2A 3KUCB 4ZRPA 1FPYA 3EGRA 3EHVA 1GNUA 3H9DA 2DZMA 2OJRA 3RNFC 2MBEA 3OLMD 5JHBA 3AU4A 2L0FA 1JW9D 1NI2A 4GDKA 4M02A 2MCNB 3RT3B 2EKEC 2WXFA 3E56A 1E6EB 4A3OA 3IT4B 1NEKB 3ZDTA 1IBXB 4KIKB 4WQMA 4K81A 1P0RA 2BYEA 3JSVB 1A70A 4DHZE 4ARCA 4NJCA 4XE0A 1TIFA 1C76A 2W3SA 2IO1B 1WZ0A 3PVLA 3IBEA 3DVGX 3UQBA 3Q2AC 4TV3A 2PPHA 3PLUA 4II2B 2NMQA 4MGKE 3KYCD 2K25A 2W3RA 4E3CA 3L54A 4LTUA 3DOWA 4EKUA 4P1CC 5E6PA 3DBHI 3GB1A 3AI5A 3QC8B 1JROA 4YTPB 2JY6A 1FNVA 4ANVA 2KNBA 2MH7A 3E9SA 5EE3A 1S1QB 4EZLA 3AE7B 1V97A 2GMIC 3RFZB 3I57A 2AQ2B 3RZFA 1C9FA 2LGXA 1P98A 2FCNA 1C3TA 3RNCC 1KF6B 1WXMA 1FFVA 1EM7A 4MELA 3MJWA 2BBCA 3KUDB 1EF1A 2C9WB 3TEZA 1TJEA 3PLVA 2H88B 1L4ZB 4DK5A 2E6XA 4ZHOA 3ECIA 1QOBA 4AUQC 2BTEA 1ROEA 3ZRCA 3ETRA 2QJLA 4ARIA 3UGBB 1EF5A 5D6JB 1SF0A 2KKCA 4BBNF 2DLBA 3MC8A 3APCA 3NS1A 3O65B 2WYQA 4B0MA 1BT0A 3HVDA 2KOXA 1R7SA 1IGCA 2CJNA 2KDMA 3V60A 1WGYA 5FK9C 5BMGA 1GC6A 1SBBB 4AWJA 2KTFA 4MGZE 2DYMA 3DWMA 3U7ZA 4LCDE 3Q3NC 1K50A 1R4NB 2WX1A 3ZTCA 2WP9B 2MP2B 2JQRB 1C4PA 2INDC 1JRUA 1AW7A 1P9DU 5DPWA 1L6UA 2JZZA 3Q8CA 4TQ0A 1V1OA 1Z5SB 3UIPB 3FILA 1CK1A 1HE8A 2YEPB 3W1YA 2RDGA 2O6VD 4JWSC 1WR6E 4EUTA 5H92C 1ZXHA 4XWTA 2BS4B 3HUIA 3KQ4A 2M0XA 4W9GA 4C80A 5JH5C 3DCGA 4HEA1 1FRDA 1XO3A 3B08A 2KTRB 1BMLC 3KUZA 2Y5BB 2KFKA 4HROA 4XZ4A 2V3PA 2RDBC 2BYVE 1TYGB 4JLCA 3RMKC 3VQIA 2BB5A 1MVKA 5G2NA 3ZJTA 3QHTA 1JRPA 1I35A 4FBJB 1B1ZA 1UH6A 4A3PA 1RAXA 3GS2A 2D07B 3PZ7A 4K7SA 2KDBA 1L6VA 3RNBC 5IA7A 2K6DB 1S3SG 4GDLA 4NQLB 3DVNU 5AUIA 2D3GA 1ZE3D 3NY5A 1DOXA 4XDCA 2D3AA 2L05A 2KC1A 4WAAA 5DCNA 4RH6A 5DPSA 3GE8C 1P3QU 2J0MA 4HWIB 1IPGA 3Q69A 2CR5A 2ZNVC 2L7RA 1Q0WB 4FJYA 4LNKA 1C1YB 3MP9A 3U8ZA 3JW0X 1AN8A 3N30A 2JZPA 1WGKA 5C23A 1QOAA 2O6VB 4KZ0A 1TBEA 4URKA 2NR2A 1WGRA 2KQ4X 3TUOA 5CTRC 1HEZE 2M4NA 1T0SC 2MHJA 4GB9A 3TEWA 1TTNA 1SGHA 4WH4A 2VH1A 2GBRA 4JQWC 3LJ3A 4YL8A 3U7DA 1CMXB 3APFA 2N9KA 2IGGA 1FXAA 3VUYA 2WXPA 4FJZA 2PMVA 3TIXA 3LXFA 2LHDA 1ZP0B 2GBNA 4US8A 1TKGA 3AN1A 3BYYB 4MSMB 4MT5A 4AJYB 4N6EB 4TQ1A 1E7UA 3AEAB 4KSKC 2NPTB 1J8CA 2JZ3B 3U2SC 3WAOA 4XWWA 4IM2A 2MJDA 1N63A 3RN9C 2UWQA 2ZW0A 4DHZB 1LGRA 1OGWA 2GOWA 1YJJA 2J7QB 2C5LC 2M8SA 2E3TA 3SD5A 3ZYYX 4GDKB 3ZQ4A 3NZSA 3NOBA 2LI5A 1Q10A 4N59A 3IG3A 2DZIA 4HVBA 3B9JA 3AEEB 4GLSC 4I6LB 4A9AA 3BIID 4M8MA 2KWDA 1MI0A 1R4MB 1WJUA 4OHJA 2GB1A 3NS8A 3VRBB 3B2FA 4BOSC 4WJNA 4N58A 1YX5B 1E9MA 4OZBA 1PYWD 2IY1B 2VH2A 3C0RB 2Y3AA 3JVZX 2V9HA 3RD2A 2I38A 1N5WA 2M19A 4JE3B 2RMMA 2JU6X 2Z59B 2WXHA 2MSED 4FHJA 3H8HA 1WX7A 3A1QA 3VTUA 3HVZA 1N61A 1CZPA 3W9CB 3DVNV 2L32A 4HKQA 2QSDA 2X8XX 2LJIA 2DENB 3KH0A 1TKEA 1FNWA 4A90A 2X38A 4AJWA 5CHVC 3TBLD 2AQ1B 4MH0E 1SXTA 2NTSA 5HI1A 3WCQA 1FCCC 2W55A 2HDEA 4HLEA 4WQOB 3HHMA 1YN4A 4G11A 3N3KB 1ENFA 3AE3B 4ANXA 2N9LA 1JWAD 1XCTL 1HQRD 2AWTA 2V4LA 2K3UA 2LGIA 2CKHB 4IWOA 4OVVA 3RYTA 4L2YA 2M56B 2WDVB 4PYUA 3LB8C 3Q14C 1WF9A 2O6VA 1P7EA 1ACCA 1NDDA 2JRIB 2KLCA 4GIVA 4LJOB 2REXA 3W5UB 1RRBA 1N6ZA 2EMTA 2WXLA 4NJ6A 2R2QA 4WWNA 3V6EB 1F2RI 3IHPC 3SHQA 4MACA 1GPXA 1YJ1A 2LGSA 1UBIA 2LGDA 4MEMA 4CO7A 1BUIC 4MGYE 3QK0A 2AQ3B 1HTQA 2LFIA 4L23A 2BGFA 1ESFA 2JUOA 3QARA 3L16A 4WWOA 4ZRQA 2QMTA 4FADA 1HZ5A 1RFKA 1MHHE 2WDQB 2ZNVB 4LJPB 2D11A 2KDFB 2PE9A 5KHOA 2HJ1A 3ZUNA 4KGSA 4MM3B 3GOEA 4ANUA 1XXGA 3N1ZC 5D3DA 1DYQA 1WYGA 2XK5A 3X0WA 1MFWA 4BZAA 3L4PA 1TS4A 2Y5CA 3P42A 2RSUA 4MSQB 2IGHA 3AULA 4GOCA 4EE2A 3EFUA 4DDID 2LXAA 5BMIA 4M00A 5H8YE 3FILB 2JF5A 4FLHA 1WYWB 2HTHA 3BY4B 1D5MC 2PLPA 4DXGA 3K9PB 2KVRA 2N1VA 2WLBA 1XD3B 1G6JA 3U4EG 3ZKJC 3B1LX 4HKZE 1PDXA 2CU3A 2MWSB 1ZDVA 1JCKB 3BVGA 1WJNA 2KFKB 3TJPA 3VH3B 1MJDA 2PVGC 1LM8B 4LDTB 1Y56A 4B6WA 5BYSA 4AP4C 1I4GA 1SIFA 1HZ6A 1C77A 2G4DB 2XN9C 1V49A 2BYFA 2CU1A 2BYTA 4GU2A 1V1PA 4LNOA 2WXJA 2UYZB 2MLBA 4GGQA 2AL6A 2XBBC 4DHJD 3TL5A 1ET9A 4DXFA 1VR9A 2Z0DB 3EFCA 2LWPA 4GDLB 1OQRA 2PVOD 2QHOA 3DHHC 4WJPA 1TY0A 2M0AA 1I4PA 1K53A 1AYFA 4YSYB 3V6CB 4BFRA 3OG5A 3AE4B 4DDGD 1VCBA 1E90A 2KZRA 1OTRB 1QILA 4XC2A 2K1FA 3I63C 2KMMA 4XYCA 4KKIA 2L76A 1EWYC 5FR3A 4XX5A 2W54A 1F9JA 2K8CA 1ZDXA 4K7UA 1KFYB 1GB4A 1TKYA 3PT2B 2K9XA 3NVWA 2V0GA 1NYQA 2JSVX 2JT4B 4IWPA 2KVZA 3TSSA 4R3DA 1K52A 2KN5A 5AUKA 1FRRA 1XT9B 1C4CA 3R7RA 1DOYA 1SJHD 4RF0A 1J7AA 2KLGA 2K5PA 2L83A 3PTFC 2WXGA 4ZYSA 4RNAA 2BVCA 2LJ5A 4B95A 2KHWB 3PREA 4RM8A 2INCC 1WE6A 3UINB 4J3OD 2FNJB 1T6BX 4KSLC 4A8XC 2ZPNA 3N1XC 2BF8B 3H1UA 4I6NB 3N9YC 4Q2JA 1EWCA 3TMPB 1FXIA 3WA0A 3C19A 3ZXVA 2NTTA 3WALA 1C79A 3FC4A 4MM3A 3AE1B 1SB3C 4HCNB 2CHZA 3PGEA 3FKYA 2FCQA 3V05A 1WH3A 3AEGB 4M0WA 3IAM1 3DPDA 4DHJB 2H89B 3Q8AA 4WURA 1JQ4A 5MPOA 2IDYA 1XLNA 5AZHA 1B9RA 4W9KA 5IKCM 5L83A 2JVCA 2V4IB 2N9XA 1JWUD 4ZYNA 2WXKA 3AV8A 4IOIE 2JWUA 1YN5A 2FAZA 2MBBB 1TS5A 1ZXIA 1V80A 1Q5WB 1K8RB 2QDFA 3IT6B 1WJ6A 3DVGY 4OZAA 3ZTDA 3HRDD 1T5XD 5J2RA 4NAWA 5IAAC 2KN4A 3UQAA 4RGOS 4JL9A 4IM3A 2IJ0A 1SIJA 2KQSA 4JWUC 5LLIA 2WX0A 4RCOA 4CHKA 4W9LA 2ZEQA 3DBSA 2BPSA 1FM0D 2DYOA 2FIDA 1OFFA 1L0XB 4MJSB 5E6OA 2G3QB 3ZGZA 3Q3MC 5TSSA 2LUMA 5JZEB 4FJVB 2AYOB 2WGSA 2LMCA 2LVQA 1UBQA 1E7PB 2RDHA 2RPQA 4EEWA 3P4SB 4A55A 3RPFC 3A1QB 4C56C 5IP4D 2PKOA 1UWXA 1WMHA 2V1YA 5E6JA 1YD8U 5EE0A 2IPKD 1WGGA 1RWSA 1KTKA 1WGDA 1I42A 1TZ1A 1WI0A 4ZOHC 2J42A 3ENEA 3PPAA 1QOGA 3DWGC 3RUIB 1UF0A 1GG3A 3VRAB 2OHFA 1Z2MA 5TR5A 1CJEA 2EELA 3J9CA 3RNEC 3B2GA 4C7ZA 1VZ7A 1T3QA 3ML9A 1UUPA 4ICUA 5CHFA 5GMVA 4KX6B 2G9HD 3ZNID 2ZJDA 1VLBA 4AS1A 3L08A 4B0EA 4RM9A 4JX1C 3ZIMA 3HK0A 5I4DA 2SAKA 5LNK1 3P1MA 4W9FA 2EKIA 3NG0A 2ONQA 3VTWA 5JXVA 1FD6A 5J17A 1GB1A 1N62A 4W9IA 2HJ8A 3QJZA 2D3CA 5G5GA 2I1JA 2WXNA 1UWMA 5CHWA 3H6NA 4ASWC 2FCMA 1Q1OA 5AZGA 3PRPB 4KZCA 3ZW3A 1WR1A 3PO0A 3M3JA 2LD9A 4WJQA 2NBWB 1EU4A 3V61A 1XCQL 1STEA 1PGXA 1T0RC 3I5JC 1WFYA 2KO3A 2KWCA 3DDCB 4LNFA 1IGDA 2WXRA 2WU5B 2RD0A 3R8BA 4BOZB 3ZNGC 2L8JA 3SEBA 3NJTA 3KYDD 3AMZA 4PS3A 4ZRJA 1ZOYB 4NY0A 1MG8A 2CJOA 2WU2B 2L1AA 1XEEA 2AL3A 5C2TB 1T0QC 3RCZA 1F52A 1VRAB 2I1KA 2OEDA 1WX9A 3P4QB 2K6QA 1QOFA 2XK5B 2Q5WD 3MHZA 1WZ3A 4C00A 3SFDB 1U4AA 2G1EA 3GE3C 3IAS1 1UD7A 4W9DA 3NVYA 1QQRA 4II3B 3SFEB 4G0NB 3URYA 1GOZA 5LXHA 3ONSA 3OAWA 5C1ZA 1N5XA 4HDOA 4HPLB 3TCAA 4AQ7A 4F1SA 2QILA 1L2NA 4YT0B 3APDA 5GXGB 2OOBB 2O2VB 2V3NA 2PJHA 1P1AA 2M17A 2DZKA 4FA6A 2V3SA 4OVUA 2WXIA 3VXWA 4P6VF 4MJSA 1GAQB 2KJ6A 2ASQA 1MHXA 2DAJA 2N0SB 1X1MA 1QF6A 3VVWB 2LASA 2J4XA 3ZJUA 4KKJA 4HK2A 1MG4A 4K7WA 3VAWA 4BVUC 4DWFA 3AE2B 1J19A 1WXSA 5BYQA 2WNMA 4P1BC 3OJ4B 4IW0A 1V1PB 1WRIA 2ZVNA 4EOYA 2N9PC 5G55A 2MA9B 4NZLB 1EU3A 1FXTB 1VZ8A 4LNIA 1L0VB 1VJKA 3DQVA 4CQNA 1SE3A 4E74A 3KVFB 1JWMD 1YNTE 3ZNHB 1LFDA 1V6EA 3BZDB 2G45B 1M94A 4UDUC 3Q8EA 1RM6C 4ZHPA 3RULA 3AB5A 3R2IA 1VZ6A 3QA8A 4RFBA 2N9EB 5D3IB 2YVCA 3NVZA 3Q3FA 3I9V1 4F7ZA 1GC7A 5C3JB 2JX5A 3QCAA 2BKRB 4YTMB 2PEAA 3PHWB
chains in the Genus database with same CATH topology
2BYFA 3WANA 2CU1A 4GU2A 1XQQA 2KWUB 1HE8A 3W1YA 1E8YA 3CMMB 2O6VD 2UYZB 2MLBA 1E8WA 4GGQA 1WR6E 2AL6A 4EUTA 3HM3A 2C7HA 3IFWB 2XBBC 3AXCA 4DHJD 2HD5B 2ZCBA 2M0XA 2ZZPB 3R66C 4W9GA 3TL5A 5JH5C 2Z0DB 5DPRA 2LWPA 1WY8A 4GDLB 3DCGA 2QHOA 5D94A 3ZO5B 3B08A 4WJPA 2IO3B 2KTRB 4WJOA 1GJZA 2MP2A 2GBJA 3KUZA 2Y5BB 3RZWC 2KFKA 4XZ4A 3M95A 1WX8A 2JRHA 2W9NA 3V6CB 5FR6A 2DX5B 1PQSA 3NZUA 4BFRA 4DDGD 2KX3A 1VCBA 2BYVE 4JLCA 1E90A 2KZRA 1OTRB 3D32A 4XC2A 2K1FA 2WDTB 3VQIA 3CF6E 3UIOB 5G2NA 3L0WB 2IYDB 2CS4A 3L10B 1R4NI 2L76A 5D2MB 3HIZA 3QHTA 4XX5A 1I35A 2BWFA 4FBJB 3PZDA 1F9JA 1UH6A 5CX3A 2K8CA 4A3PA 1RAXA 4EZKA 2D07B 4K7UA 2GBKA 4K7SA 4ZRKA 3PT2B 2KDBA 3WAPA 5IA7A 4TUUA 3LDZE 3PHXB 2IY0B 2JT4B 4IWPA 2K6DB 3JYUA 1QZEA 1S3SG 2KQ7A 3MTNB 4GDLA 2LGYA 4JGHB 2KN5A 3VH4B 2D2QA 4NQLB 3DVNU 4FULA 2XEWA 1XT9B 3R7RA 2KTRA 2DYBA 2MBOA 2CHWA 2D3GA 2K8BA 2KLGA 3ML8A 3PTFC 1UZXB 4M0WB 3NY5A 4JIOU 2N4FA 1VD2A 1SE9A 2GBMA 2L05A 2LJ5A 2KC1A 4WAAA 4B95A 2KHWB 5DCNA 2JPHA 3H7SA 4NPNA 3PREA 4RM8A 3T8MA 3PRZA 3SU8X 1RLFA 1WE6A 2KX0A 2LVOA 5DPSA 3UINB 2FNJB 4BBNC 1P3QU 2KXJA 1EO6A 2J0MA 1IYFA 4HWIB 1IPGA 4KSLC 2CR5A 2ZPNA 2ZNVC 2L0TA 4B9KA 1GUAB 4TKNA 4P7IA 2BF8B 3H1UA 1WRDB 4W9EA 4I6NB 1E8XA 4GN1A 3ZLZA 2L7RA 1Q0WB 2IZVB 3TMPB 3VUXA 5HKHA 4FJYA 3ZRFA 1C1YB 2O2VA 3WA0A 3U8ZA 4F8CB 3JW0X 3A9KB 2KMCA 2C60A 3WALA 3N30A 3GZNI 4MM3A 3A9JB 4NAWB 1KLVA 3QX1A 3R3MA 4HCNB 5C23A 3VTVA 1IP9A 2CHZA 2O6VB 1UGMA 3PGEA 3HM6X 4HPMB 4KZ0A 1TBEA 1YIWA 4URKA 2NR2A 1WGRA 2FCQA 2L00B 3S2AA 1WH3A 3PV1A 2KANA 3CSTA 3DPDA 4W9HA 4DHJB 3WAMA 3NHEB 2MX2A 5CTRC 2M4NA 4GB9A 1TTNA 1SGHA 1D3ZA 2GBRA 2LXCA 4JQWC 3LJ3A 4YL8A 1V86A 3VHTC 3U7DA 2K39A 1WM3A 4KDLB 5AZHA 1CMXB 2D10A 1V5TA 2KC2A 4W9KA 3APFA 5L83A 4CYEA 2CHXA 2JVCA 3B0AA 2N9XA 3VUYA 2FIFA 3AU5A 4FJZA 4ZYNA 3KW5B 5AZFA 2IO2B 4ZRIA 3TIXA 3ZDMC 3L13A 4AOFA 4ANWA 2YLMA 3DBLI 3ZVVA 2FAZA 3L17A 2MBBB 2BKFA 1V80A 2C7NB 1LQBA 1Q5WB 1K8RB 1KM7A 5D7GA 4I6PA 4BKSD 1WJ6A 3DVGY 2GBNA 1H4RA 3ZTDA 1WJ4A 2J0KA 1WMHB 3A9KA 4ZDVA 3BINA 4N9F4 4MSMB 1TGZB 5J2RA 4A20A 3A9JA 2A4ZA 4NAWA 4FHKA 5IAAC 3UQAA 4JL9A 4IM3A 4AJYB 3QWZB 4TQ1A 1E7UA 2KQSA 5LLIA 4KSKC 4E71A 2NPTB 1J8CA 2WX0A 3EC8A 5AEKB 1KOTA 4LDTD 4W9LA 2MQJA 2ZEQA 2JZ3B 5BO4B 3DBSA 4CHKA 2HE7A 2ZPYA 2BPSA 1AARA 3WAOA 4KDIC 2DYOA 2FIDA 1J0GA 2N7EA 2G4SA 4IM2A 4MJSB 1L7YA 2UWQA 4EFOA 5E6OA 2G3QB 2LRWA 4FN2A 4DHZB 1KJTA 1OGWA 3M62B 2GOWA 2J7QB 1E8ZA 2C5LC 5JZEB 2M8SA 3PSEB 3Q3JA 4FJVB 2DZJA 2WWZA 1Y8RC 2AYOB 4IM0A 2R2OA 2JXXA 2LVQA 1UBQA 3SD5A 4NNJB 4G50A 2RPQA 3IVFA 4GDKB 4EEWA 3NZSA 4M8NA 1OEYJ 2A5UA 2LI5A 3A1QB 3NOBA 3ZNZB 3IG3A 2M1MA 4IUMB 4RMAA 2DZIA 1A5RA 2KWVB 1WMHA 4HVBA 2V1YA 1YD8U 2NBVB 2B3AA 4W9JA 1WIAA 4I6LB 4PS7A 1WGGA 3VUWA 1WGDA 1I42A 1TZ1A 1WI0A 2NPTA 3A4RA 4M8MA 5J18A 3ENEA 3PPAA 1WJUA 1RFAA 3T9LA 3RUIB 3NS8A 1GG3A 3QQ8B 4MDKE 4BOSC 4DXAB 4PYZA 4WJNA 1Z2MA 1YX5B 5L95C 2J0JA 5TR5A 3H7PB 4KVGB 5DPTA 3A33B 1LXDA 4GMVA 2IY1B 2RGFA 3C0RB 4HCPB 3MHSD 1ISNA 4KV2A 3KUCB 4J6IA 3ML9A 5CHFA 4ICUA 5GMVA 3UIPB 3VDZA 3EHVA 1GNUA 1OEYA 3JVZX 3H9DA 4GSWA 1ZGUB 3OJ3A 3ZNID 3RD2A 2DZMA 2OJRA 2MBEA 3OLMD 2ZJDA 4X57B 3AU4A 5JHBA 4EZJA 2L0FA 3V62A 1WM2A 4BKTA 3L08A 4RM9A 1NI2A 2Z59B 4GDKA 3ZIMA 1WXAA 2MSED 3HK0A 4FHJA 2MCNB 1WX7A 3RT3B 3A1QA 1V5OA 1E7VA 3VTUA 3I3TB 2EKEC 2LVPA 4W9FA 4A3OA 3DVNV 2N1WA 3VTWA 3ZDTA 2DENB 5J17A 3KH0A 4KIKB 2KDIA 3CSFA 4W9IA 1V9JA 4AJWA 2HJ8A 4K81A 1P0RA 2BYEA 1V2YA 2VRRB 3QJZA 2I1JA 3JSVB 5CHVC 3TBLD 4MH0E 2KK8A 4DHZE 5CHWA 2KD0A 2L3ZA 2DAFA 2FCSA 3H6NA 4IWQA 4ASWC 2FCMA 4IC7B 1Q1OA 4HLEA 1WGHA 4HXDA 4NQKE 3A4SC 3H7PA 3HHMA 4WQOB 3PRPB 5AZGA 4KZCA 2IO1B 4G11A 3ZW3A 1WR1A 3N3KB 1WZ0A 3M3JA 2LD9A 4WJQA 3PVLA 4ANXA 2NBWB 3IBEA 3ALBA 3V61A 1WFYA 3DVGX 2KO3A 2KWCA 3DDCB 2LUEA 5E6NA 3UQBA 4TV3A 4IG7B 2PPHA 3PLUA 4II2B 2AWTA 2V4LA 2IO0B 2NBUA 2RD0A 2PE6B 4MGKE 3W1SA 3UF8A 3X23A 3KYCD 2CKHB 2K25A 3WIMA 3PS6A 4IWOA 1R4MI 4OVVA 3RYTA 4E3CA 3L54A 4BOZB 3ZNGC 3DOWA 4PYUA 2L8JA 4EKUA 1WE7A 3KYDD 4MGIE 2KFJA 1WF9A 2O6VA 4PS3A 4GXBA 4ZRJA 5E6PA 1NDDA 2JRIB 4NY0A 2KLCA 3DBHI 1MG8A 4GIVA 4LJOB 2REXA 2ZCCA 2ZVOA 2C7MB 1RRBA 4KIKA 2EMTA 2AL3A 3AI5A 4NJ6A 4WWPA 2R2QA 4WWNA 3RCZA 3QC8B 4DBGA 2I1KA 3JSVA 3V6EB 1WX9A 2JY6A 3IHPC 2K6QA 4HJKA 3SHQA 1H8CA 2XK5B 4BKSA 1YJ1A 4ANVA 2KNBA 2KDEB 1UBIA 2LGDA 2MBHA 1WZ3A 4MEMA 4CO7A 3QIJA 1S1QB 1UELA 2K8HA 4MGYE 2NS5A 2NVUI 4EZLA 1U4AA 1WXVA 3QK0A 4W9CA 1UD7A 4W9DA 2GMIC 3RZFA 4II3B 2LGXA 1P98A 2FCNA 1C3TA 4G0NB 2BGFA 2JUOA 2KJRA 3QARA 2IBIB 3L16A 4WWOA 5LXHA 3ONSA 1WXMA 3OAWA 5C1ZA 4K1RB 4HDOA 4FADA 4MELA 3MJWA 4HPLB 3KUDB 2RR9A 2JWZA 1EF1A 2C9WB 5JHAA 3TCAA 3PRMB 2ZNVB 4F1SA 3PLVA 1YQBA 1L2NA 4NJ7A 3APDA 4LJPB 2D11A 2OOBB 2KDFB 4BKGA 2O2VB 2PE9A 2PJHA 4DK5A 1P1AA 2M17A 2DZKA 5KHOA 4FA6A 1EUVB 2V3SA 3M63B 3ZUNA 3ECIA 4OVUA 3GOEA 3VXWA 4AUQC 4ANUA 2DHZA 1V81A 4MJSA 2FUHB 2XK5A 4ICVA 3R7QA 2NCNA 2KJ6A 2ASQA 3X0WA 1ZW7A 2DAJA 3ZRCA 3UGBB 1X1MA 1EF5A 5D6JB 2MBQA 5LXIB 3VVWB 2KKCA 3P2BA 2LASA 4BBNF 3QAQA 2RSUA 3APCA 4MSQB 4HK2A 3O65B 2WYQA 4K7WA 3VAWA 4BVUC 1BT0A 3AULA 4GOCA 4DWFA 3EFUA 4DDID 2KMAA 1J19A 2LXAA 3DBRI 1WXSA 2KOXA 2JF5A 3OJ4B 4FLHA 2KJHB 2MRPA 1WYWB 4IW0A 3V60A 1WGYA 2HTHA 1YX6B 2BWES 3BY4B 3VFKA 2ZVNA 4EOYA 2N9PC 1GC6A 2MA9B 3K9PB 5G55A 1OQYA 2LRUA 1FXTB 4AWJA 2KVRA 2N1VA 2KTFA 2AEHA 1XD3B 3DQVA 4MGZE 1G6JA 2DYMA 2LZ6A 4LCDE 2EMSA 3ZKJC 3B1LX 3K9OB 4E74A 2WX1A 3KVFB 3ZTCA 3SDLC 3ZNHB 1LFDA 1V6EA 2G45B 2MWSB 1M94A 2MP2B 3U30A 1WJNA 2KFKB 3EECA 1JRUA 3TJPA 3RULA 4HDQA 4G3XB 3VH3B 2MW5A 4PS8A 3QA8A 2N7DA 1E5WA 1P9DU 5DPWA 1LM8B 2N9EB 4LDTB 3W1SC 1T0YA 4B6WA 2YVCA 3Q3FA 5KHQA 4AP4C 1NBFC 1SIFA 2JZZA 3N32A 4F7ZA 1ZKHA 1GC7A 2G4DB 3QCAA 2BKRB 2Z0EB 1V49A 2PEAA 4TQ0A 5EDSA 1Z5SB 3PHWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BYF A;  3WAN A;  2CU1 A;  4GU2 A;  1XQQ A;  2KWU B;  1HE8 A;  3W1Y A;  1E8Y A;  3CMM B;  2O6V D;  2UYZ B;  2MLB A;  1E8W A;  4GGQ A;  1WR6 E;  2AL6 A;  4EUT A;  3HM3 A;  2C7H A;  3IFW B;  2XBB C;  3AXC A;  4DHJ D;  2HD5 B;  2ZCB A;  2M0X A;  2ZZP B;  3R66 C;  4W9G A;  3TL5 A;  5JH5 C;  2Z0D B;  5DPR A;  2LWP A;  1WY8 A;  4GDL B;  3DCG A;  2QHO A;  5D94 A;  3ZO5 B;  3B08 A;  4WJP A;  2IO3 B;  2KTR B;  4WJO A;  1GJZ A;  2MP2 A;  2GBJ A;  3KUZ A;  2Y5B B;  3RZW C;  2KFK A;  4XZ4 A;  3M95 A;  1WX8 A;  2JRH A;  2W9N A;  3V6C B;  5FR6 A;  2DX5 B;  1PQS A;  3NZU A;  4BFR A;  4DDG D;  2KX3 A;  1VCB A;  2BYV E;  4JLC A;  1E90 A;  2KZR A;  1OTR B;  3D32 A;  4XC2 A;  2K1F A;  2WDT B;  3VQI A;  3CF6 E;  3UIO B;  5G2N A;  3L0W B;  2IYD B;  2CS4 A;  3L10 B;  1R4N I;  2L76 A;  5D2M B;  3HIZ A;  3QHT A;  4XX5 A;  1I35 A;  2BWF A;  4FBJ B;  3PZD A;  1F9J A;  1UH6 A;  5CX3 A;  2K8C A;  4A3P A;  1RAX A;  4EZK A;  2D07 B;  4K7U A;  2GBK A;  4K7S A;  4ZRK A;  3PT2 B;  2KDB A;  3WAP A;  5IA7 A;  4TUU A;  3LDZ E;  3PHX B;  2IY0 B;  2JT4 B;  4IWP A;  2K6D B;  3JYU A;  1QZE A;  1S3S G;  2KQ7 A;  3MTN B;  4GDL A;  2LGY A;  4JGH B;  2KN5 A;  3VH4 B;  2D2Q A;  4NQL B;  3DVN U;  4FUL A;  2XEW A;  1XT9 B;  3R7R A;  2KTR A;  2DYB A;  2MBO A;  2CHW A;  2D3G A;  2K8B A;  2KLG A;  3ML8 A;  3PTF C;  1UZX B;  4M0W B;  3NY5 A;  4JIO U;  2N4F A;  1VD2 A;  1SE9 A;  2GBM A;  2L05 A;  2LJ5 A;  2KC1 A;  4WAA A;  4B95 A;  2KHW B;  5DCN A;  2JPH A;  3H7S A;  4NPN A;  3PRE A;  4RM8 A;  3T8M A;  3PRZ A;  3SU8 X;  1RLF A;  1WE6 A;  2KX0 A;  2LVO A;  5DPS A;  3UIN B;  2FNJ B;  4BBN C;  1P3Q U;  2KXJ A;  1EO6 A;  2J0M A;  1IYF A;  4HWI B;  1IPG A;  4KSL C;  2CR5 A;  2ZPN A;  2ZNV C;  2L0T A;  4B9K A;  1GUA B;  4TKN A;  4P7I A;  2BF8 B;  3H1U A;  1WRD B;  4W9E A;  4I6N B;  1E8X A;  4GN1 A;  3ZLZ A;  2L7R A;  1Q0W B;  2IZV B;  3TMP B;  3VUX A;  5HKH A;  4FJY A;  3ZRF A;  1C1Y B;  2O2V A;  3WA0 A;  3U8Z A;  4F8C B;  3JW0 X;  3A9K B;  2KMC A;  2C60 A;  3WAL A;  3N30 A;  3GZN I;  4MM3 A;  3A9J B;  4NAW B;  1KLV A;  3QX1 A;  3R3M A;  4HCN B;  5C23 A;  3VTV A;  1IP9 A;  2CHZ A;  2O6V B;  1UGM A;  3PGE A;  3HM6 X;  4HPM B;  4KZ0 A;  1TBE A;  1YIW A;  4URK A;  2NR2 A;  1WGR A;  2FCQ A;  2L00 B;  3S2A A;  1WH3 A;  3PV1 A;  2KAN A;  3CST A;  3DPD A;  4W9H A;  4DHJ B;  3WAM A;  3NHE B;  2MX2 A;  5CTR C;  2M4N A;  4GB9 A;  1TTN A;  1SGH A;  1D3Z A;  2GBR A;  2LXC A;  4JQW C;  3LJ3 A;  4YL8 A;  1V86 A;  3VHT C;  3U7D A;  2K39 A;  1WM3 A;  4KDL B;  5AZH A;  1CMX B;  2D10 A;  1V5T A;  2KC2 A;  4W9K A;  3APF A;  5L83 A;  4CYE A;  2CHX A;  2JVC A;  3B0A A;  2N9X A;  3VUY A;  2FIF A;  3AU5 A;  4FJZ A;  4ZYN A;  3KW5 B;  5AZF A;  2IO2 B;  4ZRI A;  3TIX A;  3ZDM C;  3L13 A;  4AOF A;  4ANW A;  2YLM A;  3DBL I;  3ZVV A;  2FAZ A;  3L17 A;  2MBB B;  2BKF A;  1V80 A;  2C7N B;  1LQB A;  1Q5W B;  1K8R B;  1KM7 A;  5D7G A;  4I6P A;  4BKS D;  1WJ6 A;  3DVG Y;  2GBN A;  1H4R A;  3ZTD A;  1WJ4 A;  2J0K A;  1WMH B;  3A9K A;  4ZDV A;  3BIN A;  4N9F 4;  4MSM B;  1TGZ B;  5J2R A;  4A20 A;  3A9J A;  2A4Z A;  4NAW A;  4FHK A;  5IAA C;  3UQA A;  4JL9 A;  4IM3 A;  4AJY B;  3QWZ B;  4TQ1 A;  1E7U A;  2KQS A;  5LLI A;  4KSK C;  4E71 A;  2NPT B;  1J8C A;  2WX0 A;  3EC8 A;  5AEK B;  1KOT A;  4LDT D;  4W9L A;  2MQJ A;  2ZEQ A;  2JZ3 B;  5BO4 B;  3DBS A;  4CHK A;  2HE7 A;  2ZPY A;  2BPS A;  1AAR A;  3WAO A;  4KDI C;  2DYO A;  2FID A;  1J0G A;  2N7E A;  2G4S A;  4IM2 A;  4MJS B;  1L7Y A;  2UWQ A;  4EFO A;  5E6O A;  2G3Q B;  2LRW A;  4FN2 A;  4DHZ B;  1KJT A;  1OGW A;  3M62 B;  2GOW A;  2J7Q B;  1E8Z A;  2C5L C;  5JZE B;  2M8S A;  3PSE B;  3Q3J A;  4FJV B;  2DZJ A;  2WWZ A;  1Y8R C;  2AYO B;  4IM0 A;  2R2O A;  2JXX A;  2LVQ A;  1UBQ A;  3SD5 A;  4NNJ B;  4G50 A;  2RPQ A;  3IVF A;  4GDK B;  4EEW A;  3NZS A;  4M8N A;  1OEY J;  2A5U A;  2LI5 A;  3A1Q B;  3NOB A;  3ZNZ B;  3IG3 A;  2M1M A;  4IUM B;  4RMA A;  2DZI A;  1A5R A;  2KWV B;  1WMH A;  4HVB A;  2V1Y A;  1YD8 U;  2NBV B;  2B3A A;  4W9J A;  1WIA A;  4I6L B;  4PS7 A;  1WGG A;  3VUW A;  1WGD A;  1I42 A;  1TZ1 A;  1WI0 A;  2NPT A;  3A4R A;  4M8M A;  5J18 A;  3ENE A;  3PPA A;  1WJU A;  1RFA A;  3T9L A;  3RUI B;  3NS8 A;  1GG3 A;  3QQ8 B;  4MDK E;  4BOS C;  4DXA B;  4PYZ A;  4WJN A;  1Z2M A;  1YX5 B;  5L95 C;  2J0J A;  5TR5 A;  3H7P B;  4KVG B;  5DPT A;  3A33 B;  1LXD A;  4GMV A;  2IY1 B;  2RGF A;  3C0R B;  4HCP B;  3MHS D;  1ISN A;  4KV2 A;  3KUC B;  4J6I A;  3ML9 A;  5CHF A;  4ICU A;  5GMV A;  3UIP B;  3VDZ A;  3EHV A;  1GNU A;  1OEY A;  3JVZ X;  3H9D A;  4GSW A;  1ZGU B;  3OJ3 A;  3ZNI D;  3RD2 A;  2DZM A;  2OJR A;  2MBE A;  3OLM D;  2ZJD A;  4X57 B;  3AU4 A;  5JHB A;  4EZJ A;  2L0F A;  3V62 A;  1WM2 A;  4BKT A;  3L08 A;  4RM9 A;  1NI2 A;  2Z59 B;  4GDK A;  3ZIM A;  1WXA A;  2MSE D;  3HK0 A;  4FHJ A;  2MCN B;  1WX7 A;  3RT3 B;  3A1Q A;  1V5O A;  1E7V A;  3VTU A;  3I3T B;  2EKE C;  2LVP A;  4W9F A;  4A3O A;  3DVN V;  2N1W A;  3VTW A;  3ZDT A;  2DEN B;  5J17 A;  3KH0 A;  4KIK B;  2KDI A;  3CSF A;  4W9I A;  1V9J A;  4AJW A;  2HJ8 A;  4K81 A;  1P0R A;  2BYE A;  1V2Y A;  2VRR B;  3QJZ A;  2I1J A;  3JSV B;  5CHV C;  3TBL D;  4MH0 E;  2KK8 A;  4DHZ E;  5CHW A;  2KD0 A;  2L3Z A;  2DAF A;  2FCS A;  3H6N A;  4IWQ A;  4ASW C;  2FCM A;  4IC7 B;  1Q1O A;  4HLE A;  1WGH A;  4HXD A;  4NQK E;  3A4S C;  3H7P A;  3HHM A;  4WQO B;  3PRP B;  5AZG A;  4KZC A;  2IO1 B;  4G11 A;  3ZW3 A;  1WR1 A;  3N3K B;  1WZ0 A;  3M3J A;  2LD9 A;  4WJQ A;  3PVL A;  4ANX A;  2NBW B;  3IBE A;  3ALB A;  3V61 A;  1WFY A;  3DVG X;  2KO3 A;  2KWC A;  3DDC B;  2LUE A;  5E6N A;  3UQB A;  4TV3 A;  4IG7 B;  2PPH A;  3PLU A;  4II2 B;  2AWT A;  2V4L A;  2IO0 B;  2NBU A;  2RD0 A;  2PE6 B;  4MGK E;  3W1S A;  3UF8 A;  3X23 A;  3KYC D;  2CKH B;  2K25 A;  3WIM A;  3PS6 A;  4IWO A;  1R4M I;  4OVV A;  3RYT A;  4E3C A;  3L54 A;  4BOZ B;  3ZNG C;  3DOW A;  4PYU A;  2L8J A;  4EKU A;  1WE7 A;  3KYD D;  4MGI E;  2KFJ A;  1WF9 A;  2O6V A;  4PS3 A;  4GXB A;  4ZRJ A;  5E6P A;  1NDD A;  2JRI B;  4NY0 A;  2KLC A;  3DBH I;  1MG8 A;  4GIV A;  4LJO B;  2REX A;  2ZCC A;  2ZVO A;  2C7M B;  1RRB A;  4KIK A;  2EMT A;  2AL3 A;  3AI5 A;  4NJ6 A;  4WWP A;  2R2Q A;  4WWN A;  3RCZ A;  3QC8 B;  4DBG A;  2I1K A;  3JSV A;  3V6E B;  1WX9 A;  2JY6 A;  3IHP C;  2K6Q A;  4HJK A;  3SHQ A;  1H8C A;  2XK5 B;  4BKS A;  1YJ1 A;  4ANV A;  2KNB A;  2KDE B;  1UBI A;  2LGD A;  2MBH A;  1WZ3 A;  4MEM A;  4CO7 A;  3QIJ A;  1S1Q B;  1UEL A;  2K8H A;  4MGY E;  2NS5 A;  2NVU I;  4EZL A;  1U4A A;  1WXV A;  3QK0 A;  4W9C A;  1UD7 A;  4W9D A;  2GMI C;  3RZF A;  4II3 B;  2LGX A;  1P98 A;  2FCN A;  1C3T A;  4G0N B;  2BGF A;  2JUO A;  2KJR A;  3QAR A;  2IBI B;  3L16 A;  4WWO A;  5LXH A;  3ONS A;  1WXM A;  3OAW A;  5C1Z A;  4K1R B;  4HDO A;  4FAD A;  4MEL A;  3MJW A;  4HPL B;  3KUD B;  2RR9 A;  2JWZ A;  1EF1 A;  2C9W B;  5JHA A;  3TCA A;  3PRM B;  2ZNV B;  4F1S A;  3PLV A;  1YQB A;  1L2N A;  4NJ7 A;  3APD A;  4LJP B;  2D11 A;  2OOB B;  2KDF B;  4BKG A;  2O2V B;  2PE9 A;  2PJH A;  4DK5 A;  1P1A A;  2M17 A;  2DZK A;  5KHO A;  4FA6 A;  1EUV B;  2V3S A;  3M63 B;  3ZUN A;  3ECI A;  4OVU A;  3GOE A;  3VXW A;  4AUQ C;  4ANU A;  2DHZ A;  1V81 A;  4MJS A;  2FUH B;  2XK5 A;  4ICV A;  3R7Q A;  2NCN A;  2KJ6 A;  2ASQ A;  3X0W A;  1ZW7 A;  2DAJ A;  3ZRC A;  3UGB B;  1X1M A;  1EF5 A;  5D6J B;  2MBQ A;  5LXI B;  3VVW B;  2KKC A;  3P2B A;  2LAS A;  4BBN F;  3QAQ A;  2RSU A;  3APC A;  4MSQ B;  4HK2 A;  3O65 B;  2WYQ A;  4K7W A;  3VAW A;  4BVU C;  1BT0 A;  3AUL A;  4GOC A;  4DWF A;  3EFU A;  4DDI D;  2KMA A;  1J19 A;  2LXA A;  3DBR I;  1WXS A;  2KOX A;  2JF5 A;  3OJ4 B;  4FLH A;  2KJH B;  2MRP A;  1WYW B;  4IW0 A;  3V60 A;  1WGY A;  2HTH A;  1YX6 B;  2BWE S;  3BY4 B;  3VFK A;  2ZVN A;  4EOY A;  2N9P C;  1GC6 A;  2MA9 B;  3K9P B;  5G55 A;  1OQY A;  2LRU A;  1FXT B;  4AWJ A;  2KVR A;  2N1V A;  2KTF A;  2AEH A;  1XD3 B;  3DQV A;  4MGZ E;  1G6J A;  2DYM A;  2LZ6 A;  4LCD E;  2EMS A;  3ZKJ C;  3B1L X;  3K9O B;  4E74 A;  2WX1 A;  3KVF B;  3ZTC A;  3SDL C;  3ZNH B;  1LFD A;  1V6E A;  2G45 B;  2MWS B;  1M94 A;  2MP2 B;  3U30 A;  1WJN A;  2KFK B;  3EEC A;  1JRU A;  3TJP A;  3RUL A;  4HDQ A;  4G3X B;  3VH3 B;  2MW5 A;  4PS8 A;  3QA8 A;  2N7D A;  1E5W A;  1P9D U;  5DPW A;  1LM8 B;  2N9E B;  4LDT B;  3W1S C;  1T0Y A;  4B6W A;  2YVC A;  3Q3F A;  5KHQ A;  4AP4 C;  1NBF C;  1SIF A;  2JZZ A;  3N32 A;  4F7Z A;  1ZKH A;  1GC7 A;  2G4D B;  3QCA A;  2BKR B;  2Z0E B;  1V49 A;  2PEA A;  4TQ0 A;  5EDS A;  1Z5S B;  3PHW B; 
#chains in the Genus database with same CATH topology
 1XQQ A;  1E8W A;  1TY2 A;  3DBR B;  3HM3 A;  2C7H A;  4K3C A;  2ZCB A;  1WY8 A;  1SEB D;  2IO3 B;  1GJZ A;  3CWI A;  2WXM A;  3RZW C;  2SEB D;  4RF1 A;  2JRH A;  2MJ3 A;  5FR6 A;  1F0Z A;  3NZU A;  3EUB 2;  2INN E;  2BW2 A;  2WDT B;  3CF6 E;  2BB6 A;  1D4B A;  2IYD B;  2CS4 A;  2FBW B;  3L10 B;  1R4N I;  2BS2 B;  2INP E;  1DOI A;  5D2M B;  3HIZ A;  2L52 A;  1XF5 L;  1D5Z C;  2BWF A;  1SE4 A;  1PGA A;  3ABV B;  4TUU A;  3PHX B;  5IN7 A;  2IY0 B;  1QZE A;  2KQ7 A;  3MC0 B;  2XEW A;  1SSN A;  1FFU A;  3AEF B;  2CHW A;  2K8B A;  1QKZ A;  4M0W B;  4JIO U;  2N4F A;  1WWT A;  1SE9 A;  2GBM A;  1F1H A;  1WXQ A;  1L4D B;  2JPH A;  4NPN A;  4OZC A;  3T8M A;  1RLF A;  2KX0 A;  2LVO A;  4BBN C;  2KXJ A;  1KLG D;  2WDR B;  4B9K A;  4TKN A;  4BAX A;  2PW9 A;  4OW0 A;  2ZW1 A;  1C4A A;  2PTL A;  2IZV B;  4WWM A;  1JWS D;  3VUX A;  3AE6 B;  3ZRF A;  2WS3 B;  2O2V A;  2K22 A;  4FXC A;  4F8C B;  2KMC A;  4YTN B;  3R2T A;  4QAY A;  4NAW B;  4C4V A;  5BYR A;  3VR9 B;  2FE8 A;  1UGM A;  3HM6 X;  2VZK D;  2KAN A;  1YJI A;  1I7H A;  3CST A;  4W9H A;  4PK1 A;  3WAM A;  2JXT A;  1V86 A;  3VHT C;  2K39 A;  4US9 A;  1V5T A;  2KC2 A;  1C78 A;  2CHX A;  3B0A A;  2FIF A;  3KW5 B;  4ZRI A;  3ZDM C;  4AOF A;  2YLM A;  1D6E C;  2QEJ C;  3L17 A;  2BKF A;  2KYW A;  1LQB A;  4XDD A;  1WMH B;  3AE9 B;  3A9K A;  3BIN A;  1TGZ B;  3A9J A;  2A4Z A;  1FIQ A;  2YEP F;  3EC8 A;  5AEK B;  2MQJ A;  5BO4 B;  3FAH A;  2UU7 A;  2ZPY A;  3GZN B;  1AAR A;  3TEX A;  5FKA C;  5G5H A;  4XGA B;  2N7E A;  2G4S A;  2LHE A;  4P16 A;  1L7Y A;  2I2Y A;  4EFO A;  3N20 C;  4FN2 A;  2LRW A;  1KJT A;  1P7F A;  3AE8 B;  2WWZ A;  2R2O A;  4TSS A;  1NI3 A;  3IVF A;  2GRI A;  4M8N A;  4IUM B;  2M1M A;  3TEY A;  4RMA A;  1A5R A;  3DBL B;  2B3A A;  4W9J A;  1TS3 A;  5IO9 A;  3OWE B;  1WIA A;  4ITK A;  2N7J A;  4JPS A;  3T3O A;  5J18 A;  3DHG C;  2KAJ A;  3T9L A;  1I4X A;  1V8C A;  3QQ8 B;  4MDK E;  4PYZ A;  3Q3O C;  1UGJ A;  2QIE B;  5DPT A;  3A33 B;  2XNA C;  3NVV A;  4GMV A;  3AEC B;  2RGF A;  4HCP B;  1ISN A;  4J6I A;  2VZK B;  3VDZ A;  3MC9 A;  1YN3 A;  1OEY A;  4GSW A;  1ZGU B;  3OJ3 A;  4X57 B;  5HHD G;  4S0R A;  4EZJ A;  3V62 A;  1WM2 A;  4BKT A;  3VR8 B;  1PGB A;  1WXA A;  2GI9 A;  1V5O A;  1XLP A;  1E7V A;  3I3T B;  2LVP A;  4YXD B;  2WXO A;  2N1W A;  2KDI A;  3CSF A;  1FMA D;  2TSS A;  2Z8L A;  1V9J A;  1MPE A;  1YMH E;  1V2Y A;  2VRR B;  2JYT A;  2KK8 A;  1QT9 A;  2ACZ B;  2KD0 A;  1L0Y B;  2L3Z A;  2DAF A;  2FCS A;  4IWQ A;  4IC7 B;  1WGH A;  4HXD A;  4NQK E;  3A4S C;  3H7P A;  4M01 A;  4HJG E;  1FEH A;  3ALB A;  1IUE A;  3NZ3 A;  2LUE A;  5E6N A;  3RNG C;  1YOV B;  4IG7 B;  4TMA B;  2IO0 B;  2NBU A;  2PE6 B;  3W1S A;  3X23 A;  3UF8 A;  2J52 A;  4WAF A;  3O13 A;  2BS3 B;  2WHI A;  3PS6 A;  3WIM A;  1R4M I;  3KLS X;  1ET6 A;  1WE7 A;  4MGI E;  2KFJ A;  2Y5P A;  4GXB A;  2LEK A;  1IBX A;  2ZCC A;  2ZVO A;  2C7M B;  4KIK A;  1CQV A;  4HPP A;  4WWP A;  1JML A;  2K0P A;  1TS2 A;  4WIP A;  3JSV A;  3W2D A;  4OVZ A;  4DBG A;  4HJK A;  1H8C A;  4KGR A;  4BKS A;  2KDE B;  2MBH A;  4LK0 M;  3QIJ A;  2IGD A;  2D5G A;  1UEL A;  2K8H A;  2NS5 A;  2NVU I;  1WXV A;  1M4V A;  4W9C A;  1NVI D;  2ICI A;  3P63 A;  5EE9 A;  4KGT A;  1JWB D;  3Q6B A;  2KJR A;  2IBI B;  1UNS A;  3U52 E;  1ZUD 2;  4K1R B;  1NEN B;  2RR9 A;  2JWZ A;  5JHA A;  1FCL A;  3PRM B;  1YQB A;  3RNA C;  4NJ7 A;  3AE5 B;  4D2K A;  3V3X A;  4IDI A;  4BKG A;  2JYE A;  1J7B A;  1EUV B;  3M63 B;  1VDV A;  2DHZ A;  1V81 A;  4A6Q A;  2FUH B;  4ICV A;  3R7Q A;  2NCN A;  3DBH B;  1ZW7 A;  2MBQ A;  3EA6 A;  5LXI B;  1LO5 D;  3P2B A;  3W5V B;  3QAQ A;  1K51 A;  1BXT A;  3SR6 A;  3DHI C;  3AM9 A;  2KMA A;  3DBR I;  3KWL A;  2KJH B;  2MRP A;  3MFG A;  1YX6 B;  2BWE S;  5BMH A;  3VFK A;  3NRZ A;  1OQY A;  2LRU A;  3BK2 A;  2AEH A;  2LZ6 A;  3MJ5 A;  2EMS A;  3K9O B;  2MJE A;  2B76 B;  3SDL C;  4YSX B;  3U30 A;  3EEC A;  4HDQ A;  4G3X B;  2MW5 A;  4PS8 A;  5IOI A;  2N7D A;  1E5W A;  3W1S C;  1T0Y A;  1AWD A;  5KHQ A;  1NBF C;  2RPV A;  3N32 A;  1ZKH A;  2Z0E B;  5EDS A;  2DNF A;  3BVZ A;  3WAN A;  1OQQ A;  2MEK A;  3N1Y C;  2KWU B;  3CIR B;  1E8Y A;  1RYJ A;  2PIA A;  3CMM B;  1JAL A;  1PUT A;  1DGJ A;  1I4Q A;  1E10 A;  3IFW B;  3AXC A;  1TT5 B;  2HD5 B;  2ZZP B;  3R66 C;  4LNN A;  2WXQ A;  5DPR A;  3NUH B;  4IKG A;  1F77 A;  5D94 A;  3ZO5 B;  4WJO A;  2HTM E;  2MP2 A;  2GBJ A;  1D5X C;  3ZJV A;  2GLS A;  5HFY A;  3M95 A;  1WX8 A;  2W9N A;  3LYY A;  2DX5 B;  1PQS A;  1PFD A;  2KX3 A;  4NAM A;  2DWQ A;  3D32 A;  3P4P B;  2W82 A;  1N60 A;  3UIO B;  3L0W B;  5EE1 A;  3AH7 A;  1HTO A;  3PZD A;  3P4R B;  4DQO C;  5CX3 A;  1SJE D;  4EZK A;  2GBK A;  4ZRK A;  1XLQ A;  3WAP A;  3LDZ E;  3JYU A;  3MTN B;  1FNU A;  4JGH B;  2LGY A;  4C4V B;  3VH4 B;  2D2Q A;  4FUL A;  2KTR A;  2DYB A;  2MBO A;  1KLU D;  1KH0 A;  3ML8 A;  4ACF A;  1UZX B;  2J53 A;  1VD2 A;  2AX5 A;  3H7S A;  3PRZ A;  3SU8 X;  3KWV A;  4RGN A;  4RGM A;  1EO6 A;  1IYF A;  2L0T A;  1GUA B;  2QC8 A;  4P7I A;  2KT7 A;  1WRD B;  4W9E A;  1E8X A;  4GN1 A;  3ZLZ A;  5HKH A;  1NYR A;  3IXS A;  3T3N A;  2R61 A;  2QCZ A;  3A9K B;  4HRS A;  2C60 A;  5T8I A;  3GZN I;  1SE2 A;  1HA5 A;  1QLB B;  3A9J B;  4MH8 A;  1KLV A;  4L1B A;  3QX1 A;  3R3M A;  2ON8 A;  1IP9 A;  3VTV A;  4HPM B;  1F2R C;  1YIW A;  1E0Z A;  2BQQ A;  2L00 B;  3S2A A;  3RI7 C;  3PV1 A;  3NHE B;  2MX2 A;  4RGT A;  4C7Y A;  4REZ A;  1D3Z A;  2LXC A;  1FO4 A;  1WM3 A;  4KDL B;  4USA A;  2D10 A;  2D3B A;  1ZPS A;  4CYE A;  3AU5 A;  4YWG G;  5AZF A;  2IO2 B;  3L13 A;  2OJW A;  4ANW A;  3BWU D;  3DBL I;  3ZVV A;  3ZXR A;  3GP7 A;  2C7N B;  1HXY D;  1KM7 A;  5D7G A;  4I6P A;  4BKS D;  1H4R A;  1YQ3 B;  5HG2 A;  1WJ4 A;  2J0K A;  1I4H A;  3Q8B A;  3PZ8 A;  4ZDV A;  4N9F 4;  3Q8F A;  4A20 A;  4H2A A;  4K3B A;  3BYT B;  4FHK A;  3QWZ B;  3BVM A;  4E71 A;  2KAC A;  1KOT A;  4LDT D;  2HE7 A;  4KDI C;  1YQ4 B;  1J0G A;  2FUG 1;  4PT5 A;  3AED B;  4LLG M;  3M62 B;  3AEB B;  2WQY B;  1E8Z A;  1J7C A;  4YSZ B;  3PSE B;  3Q3J A;  3UI3 A;  3C8Y A;  2DZJ A;  2BT6 A;  1Y8R C;  4O1N A;  4IM0 A;  2JXX A;  4NNJ B;  4G50 A;  1OEY J;  1XLO A;  2A5U A;  3ZNZ B;  4S17 A;  2KWV B;  1WSP A;  2NBV B;  4PS7 A;  3VUW A;  2NPT A;  3A4R A;  3BK1 A;  1I4R A;  1RFA A;  1L5P A;  4DXA B;  5L95 C;  1TZO A;  2J0J A;  3H7P B;  4KVG B;  1LXD A;  2DBY A;  1KRH A;  3MHS D;  4KV2 A;  3KUC B;  4ZRP A;  1FPY A;  3EGR A;  3EHV A;  1GNU A;  3H9D A;  2DZM A;  2OJR A;  3RNF C;  2MBE A;  3OLM D;  5JHB A;  3AU4 A;  2L0F A;  1JW9 D;  1NI2 A;  4GDK A;  4M02 A;  2MCN B;  3RT3 B;  2EKE C;  2WXF A;  3E56 A;  1E6E B;  4A3O A;  3IT4 B;  1NEK B;  3ZDT A;  1IBX B;  4KIK B;  4WQM A;  4K81 A;  1P0R A;  2BYE A;  3JSV B;  1A70 A;  4DHZ E;  4ARC A;  4NJC A;  4XE0 A;  1TIF A;  1C76 A;  2W3S A;  2IO1 B;  1WZ0 A;  3PVL A;  3IBE A;  3DVG X;  3UQB A;  3Q2A C;  4TV3 A;  2PPH A;  3PLU A;  4II2 B;  2NMQ A;  4MGK E;  3KYC D;  2K25 A;  2W3R A;  4E3C A;  3L54 A;  4LTU A;  3DOW A;  4EKU A;  4P1C C;  5E6P A;  3DBH I;  3GB1 A;  3AI5 A;  3QC8 B;  1JRO A;  4YTP B;  2JY6 A;  1FNV A;  4ANV A;  2KNB A;  2MH7 A;  3E9S A;  5EE3 A;  1S1Q B;  4EZL A;  3AE7 B;  1V97 A;  2GMI C;  3RFZ B;  3I57 A;  2AQ2 B;  3RZF A;  1C9F A;  2LGX A;  1P98 A;  2FCN A;  1C3T A;  3RNC C;  1KF6 B;  1WXM A;  1FFV A;  1EM7 A;  4MEL A;  3MJW A;  2BBC A;  3KUD B;  1EF1 A;  2C9W B;  3TEZ A;  1TJE A;  3PLV A;  2H88 B;  1L4Z B;  4DK5 A;  2E6X A;  4ZHO A;  3ECI A;  1QOB A;  4AUQ C;  2BTE A;  1ROE A;  3ZRC A;  3ETR A;  2QJL A;  4ARI A;  3UGB B;  1EF5 A;  5D6J B;  1SF0 A;  2KKC A;  4BBN F;  2DLB A;  3MC8 A;  3APC A;  3NS1 A;  3O65 B;  2WYQ A;  4B0M A;  1BT0 A;  3HVD A;  2KOX A;  1R7S A;  1IGC A;  2CJN A;  2KDM A;  3V60 A;  1WGY A;  5FK9 C;  5BMG A;  1GC6 A;  1SBB B;  4AWJ A;  2KTF A;  4MGZ E;  2DYM A;  3DWM A;  3U7Z A;  4LCD E;  3Q3N C;  1K50 A;  1R4N B;  2WX1 A;  3ZTC A;  2WP9 B;  2MP2 B;  2JQR B;  1C4P A;  2IND C;  1JRU A;  1AW7 A;  1P9D U;  5DPW A;  1L6U A;  2JZZ A;  3Q8C A;  4TQ0 A;  1V1O A;  1Z5S B;  3UIP B;  3FIL A;  1CK1 A;  1HE8 A;  2YEP B;  3W1Y A;  2RDG A;  2O6V D;  4JWS C;  1WR6 E;  4EUT A;  5H92 C;  1ZXH A;  4XWT A;  2BS4 B;  3HUI A;  3KQ4 A;  2M0X A;  4W9G A;  4C80 A;  5JH5 C;  3DCG A;  4HEA 1;  1FRD A;  1XO3 A;  3B08 A;  2KTR B;  1BML C;  3KUZ A;  2Y5B B;  2KFK A;  4HRO A;  4XZ4 A;  2V3P A;  2RDB C;  2BYV E;  1TYG B;  4JLC A;  3RMK C;  3VQI A;  2BB5 A;  1MVK A;  5G2N A;  3ZJT A;  3QHT A;  1JRP A;  1I35 A;  4FBJ B;  1B1Z A;  1UH6 A;  4A3P A;  1RAX A;  3GS2 A;  2D07 B;  3PZ7 A;  4K7S A;  2KDB A;  1L6V A;  3RNB C;  5IA7 A;  2K6D B;  1S3S G;  4GDL A;  4NQL B;  3DVN U;  5AUI A;  2D3G A;  1ZE3 D;  3NY5 A;  1DOX A;  4XDC A;  2D3A A;  2L05 A;  2KC1 A;  4WAA A;  5DCN A;  4RH6 A;  5DPS A;  3GE8 C;  1P3Q U;  2J0M A;  4HWI B;  1IPG A;  3Q69 A;  2CR5 A;  2ZNV C;  2L7R A;  1Q0W B;  4FJY A;  4LNK A;  1C1Y B;  3MP9 A;  3U8Z A;  3JW0 X;  1AN8 A;  3N30 A;  2JZP A;  1WGK A;  5C23 A;  1QOA A;  2O6V B;  4KZ0 A;  1TBE A;  4URK A;  2NR2 A;  1WGR A;  2KQ4 X;  3TUO A;  5CTR C;  1HEZ E;  2M4N A;  1T0S C;  2MHJ A;  4GB9 A;  3TEW A;  1TTN A;  1SGH A;  4WH4 A;  2VH1 A;  2GBR A;  4JQW C;  3LJ3 A;  4YL8 A;  3U7D A;  1CMX B;  3APF A;  2N9K A;  2IGG A;  1FXA A;  3VUY A;  2WXP A;  4FJZ A;  2PMV A;  3TIX A;  3LXF A;  2LHD A;  1ZP0 B;  2GBN A;  4US8 A;  1TKG A;  3AN1 A;  3BYY B;  4MSM B;  4MT5 A;  4AJY B;  4N6E B;  4TQ1 A;  1E7U A;  3AEA B;  4KSK C;  2NPT B;  1J8C A;  2JZ3 B;  3U2S C;  3WAO A;  4XWW A;  4IM2 A;  2MJD A;  1N63 A;  3RN9 C;  2UWQ A;  2ZW0 A;  4DHZ B;  1LGR A;  1OGW A;  2GOW A;  1YJJ A;  2J7Q B;  2C5L C;  2M8S A;  2E3T A;  3SD5 A;  3ZYY X;  4GDK B;  3ZQ4 A;  3NZS A;  3NOB A;  2LI5 A;  1Q10 A;  4N59 A;  3IG3 A;  2DZI A;  4HVB A;  3B9J A;  3AEE B;  4GLS C;  4I6L B;  4A9A A;  3BII D;  4M8M A;  2KWD A;  1MI0 A;  1R4M B;  1WJU A;  4OHJ A;  2GB1 A;  3NS8 A;  3VRB B;  3B2F A;  4BOS C;  4WJN A;  4N58 A;  1YX5 B;  1E9M A;  4OZB A;  1PYW D;  2IY1 B;  2VH2 A;  3C0R B;  2Y3A A;  3JVZ X;  2V9H A;  3RD2 A;  2I38 A;  1N5W A;  2M19 A;  4JE3 B;  2RMM A;  2JU6 X;  2Z59 B;  2WXH A;  2MSE D;  4FHJ A;  3H8H A;  1WX7 A;  3A1Q A;  3VTU A;  3HVZ A;  1N61 A;  1CZP A;  3W9C B;  3DVN V;  2L32 A;  4HKQ A;  2QSD A;  2X8X X;  2LJI A;  2DEN B;  3KH0 A;  1TKE A;  1FNW A;  4A90 A;  2X38 A;  4AJW A;  5CHV C;  3TBL D;  2AQ1 B;  4MH0 E;  1SXT A;  2NTS A;  5HI1 A;  3WCQ A;  1FCC C;  2W55 A;  2HDE A;  4HLE A;  4WQO B;  3HHM A;  1YN4 A;  4G11 A;  3N3K B;  1ENF A;  3AE3 B;  4ANX A;  2N9L A;  1JWA D;  1XCT L;  1HQR D;  2AWT A;  2V4L A;  2K3U A;  2LGI A;  2CKH B;  4IWO A;  4OVV A;  3RYT A;  4L2Y A;  2M56 B;  2WDV B;  4PYU A;  3LB8 C;  3Q14 C;  1WF9 A;  2O6V A;  1P7E A;  1ACC A;  1NDD A;  2JRI B;  2KLC A;  4GIV A;  4LJO B;  2REX A;  3W5U B;  1RRB A;  1N6Z A;  2EMT A;  2WXL A;  4NJ6 A;  2R2Q A;  4WWN A;  3V6E B;  1F2R I;  3IHP C;  3SHQ A;  4MAC A;  1GPX A;  1YJ1 A;  2LGS A;  1UBI A;  2LGD A;  4MEM A;  4CO7 A;  1BUI C;  4MGY E;  3QK0 A;  2AQ3 B;  1HTQ A;  2LFI A;  4L23 A;  2BGF A;  1ESF A;  2JUO A;  3QAR A;  3L16 A;  4WWO A;  4ZRQ A;  2QMT A;  4FAD A;  1HZ5 A;  1RFK A;  1MHH E;  2WDQ B;  2ZNV B;  4LJP B;  2D11 A;  2KDF B;  2PE9 A;  5KHO A;  2HJ1 A;  3ZUN A;  4KGS A;  4MM3 B;  3GOE A;  4ANU A;  1XXG A;  3N1Z C;  5D3D A;  1DYQ A;  1WYG A;  2XK5 A;  3X0W A;  1MFW A;  4BZA A;  3L4P A;  1TS4 A;  2Y5C A;  3P42 A;  2RSU A;  4MSQ B;  2IGH A;  3AUL A;  4GOC A;  4EE2 A;  3EFU A;  4DDI D;  2LXA A;  5BMI A;  4M00 A;  5H8Y E;  3FIL B;  2JF5 A;  4FLH A;  1WYW B;  2HTH A;  3BY4 B;  1D5M C;  2PLP A;  4DXG A;  3K9P B;  2KVR A;  2N1V A;  2WLB A;  1XD3 B;  1G6J A;  3U4E G;  3ZKJ C;  3B1L X;  4HKZ E;  1PDX A;  2CU3 A;  2MWS B;  1ZDV A;  1JCK B;  3BVG A;  1WJN A;  2KFK B;  3TJP A;  3VH3 B;  1MJD A;  2PVG C;  1LM8 B;  4LDT B;  1Y56 A;  4B6W A;  5BYS A;  4AP4 C;  1I4G A;  1SIF A;  1HZ6 A;  1C77 A;  2G4D B;  2XN9 C;  1V49 A;  2BYF A;  2CU1 A;  2BYT A;  4GU2 A;  1V1P A;  4LNO A;  2WXJ A;  2UYZ B;  2MLB A;  4GGQ A;  2AL6 A;  2XBB C;  4DHJ D;  3TL5 A;  1ET9 A;  4DXF A;  1VR9 A;  2Z0D B;  3EFC A;  2LWP A;  4GDL B;  1OQR A;  2PVO D;  2QHO A;  3DHH C;  4WJP A;  1TY0 A;  2M0A A;  1I4P A;  1K53 A;  1AYF A;  4YSY B;  3V6C B;  4BFR A;  3OG5 A;  3AE4 B;  4DDG D;  1VCB A;  1E90 A;  2KZR A;  1OTR B;  1QIL A;  4XC2 A;  2K1F A;  3I63 C;  2KMM A;  4XYC A;  4KKI A;  2L76 A;  1EWY C;  5FR3 A;  4XX5 A;  2W54 A;  1F9J A;  2K8C A;  1ZDX A;  4K7U A;  1KFY B;  1GB4 A;  1TKY A;  3PT2 B;  2K9X A;  3NVW A;  2V0G A;  1NYQ A;  2JSV X;  2JT4 B;  4IWP A;  2KVZ A;  3TSS A;  4R3D A;  1K52 A;  2KN5 A;  5AUK A;  1FRR A;  1XT9 B;  1C4C A;  3R7R A;  1DOY A;  1SJH D;  4RF0 A;  1J7A A;  2KLG A;  2K5P A;  2L83 A;  3PTF C;  2WXG A;  4ZYS A;  4RNA A;  2BVC A;  2LJ5 A;  4B95 A;  2KHW B;  3PRE A;  4RM8 A;  2INC C;  1WE6 A;  3UIN B;  4J3O D;  2FNJ B;  1T6B X;  4KSL C;  4A8X C;  2ZPN A;  3N1X C;  2BF8 B;  3H1U A;  4I6N B;  3N9Y C;  4Q2J A;  1EWC A;  3TMP B;  1FXI A;  3WA0 A;  3C19 A;  3ZXV A;  2NTT A;  3WAL A;  1C79 A;  3FC4 A;  4MM3 A;  3AE1 B;  1SB3 C;  4HCN B;  2CHZ A;  3PGE A;  3FKY A;  2FCQ A;  3V05 A;  1WH3 A;  3AEG B;  4M0W A;  3IAM 1;  3DPD A;  4DHJ B;  2H89 B;  3Q8A A;  4WUR A;  1JQ4 A;  5MPO A;  2IDY A;  1XLN A;  5AZH A;  1B9R A;  4W9K A;  5IKC M;  5L83 A;  2JVC A;  2V4I B;  2N9X A;  1JWU D;  4ZYN A;  2WXK A;  3AV8 A;  4IOI E;  2JWU A;  1YN5 A;  2FAZ A;  2MBB B;  1TS5 A;  1ZXI A;  1V80 A;  1Q5W B;  1K8R B;  2QDF A;  3IT6 B;  1WJ6 A;  3DVG Y;  4OZA A;  3ZTD A;  3HRD D;  1T5X D;  5J2R A;  4NAW A;  5IAA C;  2KN4 A;  3UQA A;  4RGO S;  4JL9 A;  4IM3 A;  2IJ0 A;  1SIJ A;  2KQS A;  4JWU C;  5LLI A;  2WX0 A;  4RCO A;  4CHK A;  4W9L A;  2ZEQ A;  3DBS A;  2BPS A;  1FM0 D;  2DYO A;  2FID A;  1OFF A;  1L0X B;  4MJS B;  5E6O A;  2G3Q B;  3ZGZ A;  3Q3M C;  5TSS A;  2LUM A;  5JZE B;  4FJV B;  2AYO B;  2WGS A;  2LMC A;  2LVQ A;  1UBQ A;  1E7P B;  2RDH A;  2RPQ A;  4EEW A;  3P4S B;  4A55 A;  3RPF C;  3A1Q B;  4C56 C;  5IP4 D;  2PKO A;  1UWX A;  1WMH A;  2V1Y A;  5E6J A;  1YD8 U;  5EE0 A;  2IPK D;  1WGG A;  1RWS A;  1KTK A;  1WGD A;  1I42 A;  1TZ1 A;  1WI0 A;  4ZOH C;  2J42 A;  3ENE A;  3PPA A;  1QOG A;  3DWG C;  3RUI B;  1UF0 A;  1GG3 A;  3VRA B;  2OHF A;  1Z2M A;  5TR5 A;  1CJE A;  2EEL A;  3J9C A;  3RNE C;  3B2G A;  4C7Z A;  1VZ7 A;  1T3Q A;  3ML9 A;  1UUP A;  4ICU A;  5CHF A;  5GMV A;  4KX6 B;  2G9H D;  3ZNI D;  2ZJD A;  1VLB A;  4AS1 A;  3L08 A;  4B0E A;  4RM9 A;  4JX1 C;  3ZIM A;  3HK0 A;  5I4D A;  2SAK A;  5LNK 1;  3P1M A;  4W9F A;  2EKI A;  3NG0 A;  2ONQ A;  3VTW A;  5JXV A;  1FD6 A;  5J17 A;  1GB1 A;  1N62 A;  4W9I A;  2HJ8 A;  3QJZ A;  2D3C A;  5G5G A;  2I1J A;  2WXN A;  1UWM A;  5CHW A;  3H6N A;  4ASW C;  2FCM A;  1Q1O A;  5AZG A;  3PRP B;  4KZC A;  3ZW3 A;  1WR1 A;  3PO0 A;  3M3J A;  2LD9 A;  4WJQ A;  2NBW B;  1EU4 A;  3V61 A;  1XCQ L;  1STE A;  1PGX A;  1T0R C;  3I5J C;  1WFY A;  2KO3 A;  2KWC A;  3DDC B;  4LNF A;  1IGD A;  2WXR A;  2WU5 B;  2RD0 A;  3R8B A;  4BOZ B;  3ZNG C;  2L8J A;  3SEB A;  3NJT A;  3KYD D;  3AMZ A;  4PS3 A;  4ZRJ A;  1ZOY B;  4NY0 A;  1MG8 A;  2CJO A;  2WU2 B;  2L1A A;  1XEE A;  2AL3 A;  5C2T B;  1T0Q C;  3RCZ A;  1F52 A;  1VRA B;  2I1K A;  2OED A;  1WX9 A;  3P4Q B;  2K6Q A;  1QOF A;  2XK5 B;  2Q5W D;  3MHZ A;  1WZ3 A;  4C00 A;  3SFD B;  1U4A A;  2G1E A;  3GE3 C;  3IAS 1;  1UD7 A;  4W9D A;  3NVY A;  1QQR A;  4II3 B;  3SFE B;  4G0N B;  3URY A;  1GOZ A;  5LXH A;  3ONS A;  3OAW A;  5C1Z A;  1N5X A;  4HDO A;  4HPL B;  3TCA A;  4AQ7 A;  4F1S A;  2QIL A;  1L2N A;  4YT0 B;  3APD A;  5GXG B;  2OOB B;  2O2V B;  2V3N A;  2PJH A;  1P1A A;  2M17 A;  2DZK A;  4FA6 A;  2V3S A;  4OVU A;  2WXI A;  3VXW A;  4P6V F;  4MJS A;  1GAQ B;  2KJ6 A;  2ASQ A;  1MHX A;  2DAJ A;  2N0S B;  1X1M A;  1QF6 A;  3VVW B;  2LAS A;  2J4X A;  3ZJU A;  4KKJ A;  4HK2 A;  1MG4 A;  4K7W A;  3VAW A;  4BVU C;  4DWF A;  3AE2 B;  1J19 A;  1WXS A;  5BYQ A;  2WNM A;  4P1B C;  3OJ4 B;  4IW0 A;  1V1P B;  1WRI A;  2ZVN A;  4EOY A;  2N9P C;  5G55 A;  2MA9 B;  4NZL B;  1EU3 A;  1FXT B;  1VZ8 A;  4LNI A;  1L0V B;  1VJK A;  3DQV A;  4CQN A;  1SE3 A;  4E74 A;  3KVF B;  1JWM D;  1YNT E;  3ZNH B;  1LFD A;  1V6E A;  3BZD B;  2G45 B;  1M94 A;  4UDU C;  3Q8E A;  1RM6 C;  4ZHP A;  3RUL A;  3AB5 A;  3R2I A;  1VZ6 A;  3QA8 A;  4RFB A;  2N9E B;  5D3I B;  2YVC A;  3NVZ A;  3Q3F A;  3I9V 1;  4F7Z A;  1GC7 A;  5C3J B;  2JX5 A;  3QCA A;  2BKR B;  4YTM B;  2PEA A;  3PHW B; 
#chains in the Genus database with same CATH homology
 2BYF A;  3WAN A;  2CU1 A;  4GU2 A;  1XQQ A;  2KWU B;  1HE8 A;  3W1Y A;  1E8Y A;  3CMM B;  2O6V D;  2UYZ B;  2MLB A;  1E8W A;  4GGQ A;  1WR6 E;  2AL6 A;  4EUT A;  3HM3 A;  2C7H A;  3IFW B;  2XBB C;  3AXC A;  4DHJ D;  2HD5 B;  2ZCB A;  2M0X A;  2ZZP B;  3R66 C;  4W9G A;  3TL5 A;  5JH5 C;  2Z0D B;  5DPR A;  2LWP A;  1WY8 A;  4GDL B;  3DCG A;  2QHO A;  5D94 A;  3ZO5 B;  3B08 A;  4WJP A;  2IO3 B;  2KTR B;  4WJO A;  1GJZ A;  2MP2 A;  2GBJ A;  3KUZ A;  2Y5B B;  3RZW C;  2KFK A;  4XZ4 A;  3M95 A;  1WX8 A;  2JRH A;  2W9N A;  3V6C B;  5FR6 A;  2DX5 B;  1PQS A;  3NZU A;  4BFR A;  4DDG D;  2KX3 A;  1VCB A;  2BYV E;  4JLC A;  1E90 A;  2KZR A;  1OTR B;  3D32 A;  4XC2 A;  2K1F A;  2WDT B;  3VQI A;  3CF6 E;  3UIO B;  5G2N A;  3L0W B;  2IYD B;  2CS4 A;  3L10 B;  1R4N I;  2L76 A;  5D2M B;  3HIZ A;  3QHT A;  4XX5 A;  1I35 A;  2BWF A;  4FBJ B;  3PZD A;  1F9J A;  1UH6 A;  5CX3 A;  2K8C A;  4A3P A;  1RAX A;  4EZK A;  2D07 B;  4K7U A;  2GBK A;  4K7S A;  4ZRK A;  3PT2 B;  2KDB A;  3WAP A;  5IA7 A;  4TUU A;  3LDZ E;  3PHX B;  2IY0 B;  2JT4 B;  4IWP A;  2K6D B;  3JYU A;  1QZE A;  1S3S G;  2KQ7 A;  3MTN B;  4GDL A;  2LGY A;  4JGH B;  2KN5 A;  3VH4 B;  2D2Q A;  4NQL B;  3DVN U;  4FUL A;  2XEW A;  1XT9 B;  3R7R A;  2KTR A;  2DYB A;  2MBO A;  2CHW A;  2D3G A;  2K8B A;  2KLG A;  3ML8 A;  3PTF C;  1UZX B;  4M0W B;  3NY5 A;  4JIO U;  2N4F A;  1VD2 A;  1SE9 A;  2GBM A;  2L05 A;  2LJ5 A;  2KC1 A;  4WAA A;  4B95 A;  2KHW B;  5DCN A;  2JPH A;  3H7S A;  4NPN A;  3PRE A;  4RM8 A;  3T8M A;  3PRZ A;  3SU8 X;  1RLF A;  1WE6 A;  2KX0 A;  2LVO A;  5DPS A;  3UIN B;  2FNJ B;  4BBN C;  1P3Q U;  2KXJ A;  1EO6 A;  2J0M A;  1IYF A;  4HWI B;  1IPG A;  4KSL C;  2CR5 A;  2ZPN A;  2ZNV C;  2L0T A;  4B9K A;  1GUA B;  4TKN A;  4P7I A;  2BF8 B;  3H1U A;  1WRD B;  4W9E A;  4I6N B;  1E8X A;  4GN1 A;  3ZLZ A;  2L7R A;  1Q0W B;  2IZV B;  3TMP B;  3VUX A;  5HKH A;  4FJY A;  3ZRF A;  1C1Y B;  2O2V A;  3WA0 A;  3U8Z A;  4F8C B;  3JW0 X;  3A9K B;  2KMC A;  2C60 A;  3WAL A;  3N30 A;  3GZN I;  4MM3 A;  3A9J B;  4NAW B;  1KLV A;  3QX1 A;  3R3M A;  4HCN B;  5C23 A;  3VTV A;  1IP9 A;  2CHZ A;  2O6V B;  1UGM A;  3PGE A;  3HM6 X;  4HPM B;  4KZ0 A;  1TBE A;  1YIW A;  4URK A;  2NR2 A;  1WGR A;  2FCQ A;  2L00 B;  3S2A A;  1WH3 A;  3PV1 A;  2KAN A;  3CST A;  3DPD A;  4W9H A;  4DHJ B;  3WAM A;  3NHE B;  2MX2 A;  5CTR C;  2M4N A;  4GB9 A;  1TTN A;  1SGH A;  1D3Z A;  2GBR A;  2LXC A;  4JQW C;  3LJ3 A;  4YL8 A;  1V86 A;  3VHT C;  3U7D A;  2K39 A;  1WM3 A;  4KDL B;  5AZH A;  1CMX B;  2D10 A;  1V5T A;  2KC2 A;  4W9K A;  3APF A;  5L83 A;  4CYE A;  2CHX A;  2JVC A;  3B0A A;  2N9X A;  3VUY A;  2FIF A;  3AU5 A;  4FJZ A;  4ZYN A;  3KW5 B;  5AZF A;  2IO2 B;  4ZRI A;  3TIX A;  3ZDM C;  3L13 A;  4AOF A;  4ANW A;  2YLM A;  3DBL I;  3ZVV A;  2FAZ A;  3L17 A;  2MBB B;  2BKF A;  1V80 A;  2C7N B;  1LQB A;  1Q5W B;  1K8R B;  1KM7 A;  5D7G A;  4I6P A;  4BKS D;  1WJ6 A;  3DVG Y;  2GBN A;  1H4R A;  3ZTD A;  1WJ4 A;  2J0K A;  1WMH B;  3A9K A;  4ZDV A;  3BIN A;  4N9F 4;  4MSM B;  1TGZ B;  5J2R A;  4A20 A;  3A9J A;  2A4Z A;  4NAW A;  4FHK A;  5IAA C;  3UQA A;  4JL9 A;  4IM3 A;  4AJY B;  3QWZ B;  4TQ1 A;  1E7U A;  2KQS A;  5LLI A;  4KSK C;  4E71 A;  2NPT B;  1J8C A;  2WX0 A;  3EC8 A;  5AEK B;  1KOT A;  4LDT D;  4W9L A;  2MQJ A;  2ZEQ A;  2JZ3 B;  5BO4 B;  3DBS A;  4CHK A;  2HE7 A;  2ZPY A;  2BPS A;  1AAR A;  3WAO A;  4KDI C;  2DYO A;  2FID A;  1J0G A;  2N7E A;  2G4S A;  4IM2 A;  4MJS B;  1L7Y A;  2UWQ A;  4EFO A;  5E6O A;  2G3Q B;  2LRW A;  4FN2 A;  4DHZ B;  1KJT A;  1OGW A;  3M62 B;  2GOW A;  2J7Q B;  1E8Z A;  2C5L C;  5JZE B;  2M8S A;  3PSE B;  3Q3J A;  4FJV B;  2DZJ A;  2WWZ A;  1Y8R C;  2AYO B;  4IM0 A;  2R2O A;  2JXX A;  2LVQ A;  1UBQ A;  3SD5 A;  4NNJ B;  4G50 A;  2RPQ A;  3IVF A;  4GDK B;  4EEW A;  3NZS A;  4M8N A;  1OEY J;  2A5U A;  2LI5 A;  3A1Q B;  3NOB A;  3ZNZ B;  3IG3 A;  2M1M A;  4IUM B;  4RMA A;  2DZI A;  1A5R A;  2KWV B;  1WMH A;  4HVB A;  2V1Y A;  1YD8 U;  2NBV B;  2B3A A;  4W9J A;  1WIA A;  4I6L B;  4PS7 A;  1WGG A;  3VUW A;  1WGD A;  1I42 A;  1TZ1 A;  1WI0 A;  2NPT A;  3A4R A;  4M8M A;  5J18 A;  3ENE A;  3PPA A;  1WJU A;  1RFA A;  3T9L A;  3RUI B;  3NS8 A;  1GG3 A;  3QQ8 B;  4MDK E;  4BOS C;  4DXA B;  4PYZ A;  4WJN A;  1Z2M A;  1YX5 B;  5L95 C;  2J0J A;  5TR5 A;  3H7P B;  4KVG B;  5DPT A;  3A33 B;  1LXD A;  4GMV A;  2IY1 B;  2RGF A;  3C0R B;  4HCP B;  3MHS D;  1ISN A;  4KV2 A;  3KUC B;  4J6I A;  3ML9 A;  5CHF A;  4ICU A;  5GMV A;  3UIP B;  3VDZ A;  3EHV A;  1GNU A;  1OEY A;  3JVZ X;  3H9D A;  4GSW A;  1ZGU B;  3OJ3 A;  3ZNI D;  3RD2 A;  2DZM A;  2OJR A;  2MBE A;  3OLM D;  2ZJD A;  4X57 B;  3AU4 A;  5JHB A;  4EZJ A;  2L0F A;  3V62 A;  1WM2 A;  4BKT A;  3L08 A;  4RM9 A;  1NI2 A;  2Z59 B;  4GDK A;  3ZIM A;  1WXA A;  2MSE D;  3HK0 A;  4FHJ A;  2MCN B;  1WX7 A;  3RT3 B;  3A1Q A;  1V5O A;  1E7V A;  3VTU A;  3I3T B;  2EKE C;  2LVP A;  4W9F A;  4A3O A;  3DVN V;  2N1W A;  3VTW A;  3ZDT A;  2DEN B;  5J17 A;  3KH0 A;  4KIK B;  2KDI A;  3CSF A;  4W9I A;  1V9J A;  4AJW A;  2HJ8 A;  4K81 A;  1P0R A;  2BYE A;  1V2Y A;  2VRR B;  3QJZ A;  2I1J A;  3JSV B;  5CHV C;  3TBL D;  4MH0 E;  2KK8 A;  4DHZ E;  5CHW A;  2KD0 A;  2L3Z A;  2DAF A;  2FCS A;  3H6N A;  4IWQ A;  4ASW C;  2FCM A;  4IC7 B;  1Q1O A;  4HLE A;  1WGH A;  4HXD A;  4NQK E;  3A4S C;  3H7P A;  3HHM A;  4WQO B;  3PRP B;  5AZG A;  4KZC A;  2IO1 B;  4G11 A;  3ZW3 A;  1WR1 A;  3N3K B;  1WZ0 A;  3M3J A;  2LD9 A;  4WJQ A;  3PVL A;  4ANX A;  2NBW B;  3IBE A;  3ALB A;  3V61 A;  1WFY A;  3DVG X;  2KO3 A;  2KWC A;  3DDC B;  2LUE A;  5E6N A;  3UQB A;  4TV3 A;  4IG7 B;  2PPH A;  3PLU A;  4II2 B;  2AWT A;  2V4L A;  2IO0 B;  2NBU A;  2RD0 A;  2PE6 B;  4MGK E;  3W1S A;  3UF8 A;  3X23 A;  3KYC D;  2CKH B;  2K25 A;  3WIM A;  3PS6 A;  4IWO A;  1R4M I;  4OVV A;  3RYT A;  4E3C A;  3L54 A;  4BOZ B;  3ZNG C;  3DOW A;  4PYU A;  2L8J A;  4EKU A;  1WE7 A;  3KYD D;  4MGI E;  2KFJ A;  1WF9 A;  2O6V A;  4PS3 A;  4GXB A;  4ZRJ A;  5E6P A;  1NDD A;  2JRI B;  4NY0 A;  2KLC A;  3DBH I;  1MG8 A;  4GIV A;  4LJO B;  2REX A;  2ZCC A;  2ZVO A;  2C7M B;  1RRB A;  4KIK A;  2EMT A;  2AL3 A;  3AI5 A;  4NJ6 A;  4WWP A;  2R2Q A;  4WWN A;  3RCZ A;  3QC8 B;  4DBG A;  2I1K A;  3JSV A;  3V6E B;  1WX9 A;  2JY6 A;  3IHP C;  2K6Q A;  4HJK A;  3SHQ A;  1H8C A;  2XK5 B;  4BKS A;  1YJ1 A;  4ANV A;  2KNB A;  2KDE B;  1UBI A;  2LGD A;  2MBH A;  1WZ3 A;  4MEM A;  4CO7 A;  3QIJ A;  1S1Q B;  1UEL A;  2K8H A;  4MGY E;  2NS5 A;  2NVU I;  4EZL A;  1U4A A;  1WXV A;  3QK0 A;  4W9C A;  1UD7 A;  4W9D A;  2GMI C;  3RZF A;  4II3 B;  2LGX A;  1P98 A;  2FCN A;  1C3T A;  4G0N B;  2BGF A;  2JUO A;  2KJR A;  3QAR A;  2IBI B;  3L16 A;  4WWO A;  5LXH A;  3ONS A;  1WXM A;  3OAW A;  5C1Z A;  4K1R B;  4HDO A;  4FAD A;  4MEL A;  3MJW A;  4HPL B;  3KUD B;  2RR9 A;  2JWZ A;  1EF1 A;  2C9W B;  5JHA A;  3TCA A;  3PRM B;  2ZNV B;  4F1S A;  3PLV A;  1YQB A;  1L2N A;  4NJ7 A;  3APD A;  4LJP B;  2D11 A;  2OOB B;  2KDF B;  4BKG A;  2O2V B;  2PE9 A;  2PJH A;  4DK5 A;  1P1A A;  2M17 A;  2DZK A;  5KHO A;  4FA6 A;  1EUV B;  2V3S A;  3M63 B;  3ZUN A;  3ECI A;  4OVU A;  3GOE A;  3VXW A;  4AUQ C;  4ANU A;  2DHZ A;  1V81 A;  4MJS A;  2FUH B;  2XK5 A;  4ICV A;  3R7Q A;  2NCN A;  2KJ6 A;  2ASQ A;  3X0W A;  1ZW7 A;  2DAJ A;  3ZRC A;  3UGB B;  1X1M A;  1EF5 A;  5D6J B;  2MBQ A;  5LXI B;  3VVW B;  2KKC A;  3P2B A;  2LAS A;  4BBN F;  3QAQ A;  2RSU A;  3APC A;  4MSQ B;  4HK2 A;  3O65 B;  2WYQ A;  4K7W A;  3VAW A;  4BVU C;  1BT0 A;  3AUL A;  4GOC A;  4DWF A;  3EFU A;  4DDI D;  2KMA A;  1J19 A;  2LXA A;  3DBR I;  1WXS A;  2KOX A;  2JF5 A;  3OJ4 B;  4FLH A;  2KJH B;  2MRP A;  1WYW B;  4IW0 A;  3V60 A;  1WGY A;  2HTH A;  1YX6 B;  2BWE S;  3BY4 B;  3VFK A;  2ZVN A;  4EOY A;  2N9P C;  1GC6 A;  2MA9 B;  3K9P B;  5G55 A;  1OQY A;  2LRU A;  1FXT B;  4AWJ A;  2KVR A;  2N1V A;  2KTF A;  2AEH A;  1XD3 B;  3DQV A;  4MGZ E;  1G6J A;  2DYM A;  2LZ6 A;  4LCD E;  2EMS A;  3ZKJ C;  3B1L X;  3K9O B;  4E74 A;  2WX1 A;  3KVF B;  3ZTC A;  3SDL C;  3ZNH B;  1LFD A;  1V6E A;  2G45 B;  2MWS B;  1M94 A;  2MP2 B;  3U30 A;  1WJN A;  2KFK B;  3EEC A;  1JRU A;  3TJP A;  3RUL A;  4HDQ A;  4G3X B;  3VH3 B;  2MW5 A;  4PS8 A;  3QA8 A;  2N7D A;  1E5W A;  1P9D U;  5DPW A;  1LM8 B;  2N9E B;  4LDT B;  3W1S C;  1T0Y A;  4B6W A;  2YVC A;  3Q3F A;  5KHQ A;  4AP4 C;  1NBF C;  1SIF A;  2JZZ A;  3N32 A;  4F7Z A;  1ZKH A;  1GC7 A;  2G4D B;  3QCA A;  2BKR B;  2Z0E B;  1V49 A;  2PEA A;  4TQ0 A;  5EDS A;  1Z5S B;  3PHW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...