2IO3B

Crystal structure of human senp2 in complex with rangap1-sumo-2
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
74
structure length
74
Chain Sequence
LKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sentrin-specific protease 2
publication title Structural basis for SENP2 protease interactions with SUMO precursors and conjugated substrates.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding, hydrolase
total genus 11
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2006-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2io3B00
3KYDD 5DCNA 1EO6A 2MBHA 2BGFA 4PS7A 3PREA 3RD2A 2MBOA 5G2NA 3TJPA 1WH3A 2DZKA 2KX3A 2LXAA 2MQJA 4GOCA 5AZHA 4BKSA 3APCA 3QJZA 2RGFA 4P7IA 2NPTB 2V4LA 3DCGA 4MDKE 1UBIA 1E8YA 2N1WA 4N9F4 4BBNC 2A5UA 3EHVA 4CHKA 2G4DB 4K7SA 4BFRA 5JHBA 3L0WB 2IY0B 3W1SC 3Q3FA 1WX7A 2FNJB 2K1FA 1EF1A 2LXCA 2JRHA 4B95A 1WI0A 3QIJA 4FJYA 5TR5A 2JPHA 3QX1A 4HCPB 2K8HA 4NQLB 4AWJA 3H7PB 1E5WA 2M4NA 1I42A 2LVPA 2DYOA 4HPLB 2UWQA 4EZKA 2J0KA 2DZMA 4MJSB 2KJHB 3A9KA 1WZ0A 3ALBA 2MBBB 3QC8B 2CU1A 3VXWA 1GC7A 5AZFA 3PRZA 3ZTCA 1WX9A 1J19A 1V49A 1P1AA 2LRUA 1Z5SB 2JF5A 5IA7A 4GXBA 4IUMB 3MHSD 4RM8A 5KHQA 3KH0A 4FJZA 2G4SA 2GOWA 1UGMA 4E71A 3V61A 2LD9A 1S1QB 3R7QA 3O65B 1WXVA 1MG8A 3NZUA 2K8BA 1Q5WB 4HK2A 4LDTB 3V6CB 3ZKJC 4E74A 5E6PA 2DAFA 3UQAA 2WX1A 2Z0EB 3Q3JA 2BKRB 4GIVA 1OGWA 2KANA 4EZLA 2MBQA 3H9DA 4J6IA 2KFKA 1H4RA 3X23A 4BOSC 5L83A 3LJ3A 5J2RA 2IO0B 2C60A 4AUQC 1WJ4A 4DHJD 1WXMA 1V5TA 2KTRA 3UGBB 2HJ8A 2EMSA 3N32A 4BBNF 4X57B 2MRPA 4W9FA 3PLUA 4JQWC 2WWZA 2RR9A 3S2AA 4BKTA 4URKA 4IW0A 1NI2A 3RT3B 3R3MA 3HIZA 2MSED 4GDKB 4FULA 4I6PA 2KWVB 2NPTA 4XZ4A 5J17A 1GG3A 1L7YA 4IWOA 2KDIA 1UZXB 3VUYA 3AU5A 5LXHA 2XK5B 2C7MB 3UIOB 3A4SC 3UINB 1RLFA 3RUIB 5JH5C 2KN5A 3K9PB 3ZNGC 3ML8A 4LJPB 3KVFB 3VAWA 2ZNVC 1V86A 3N3KB 4GGQA 3VUWA 4HWIB 1V81A 2B3AA 2KVRA 3H7PA 4OVUA 3IFWB 3TIXA 4ANUA 2EMTA 4DHJB 1A5RA 2NBVB 2NR2A 4EEWA 4MJSA 2KWCA 2G3QB 1C1YB 1WGHA 2YLMA 3EFUA 3VDZA 3U8ZA 2IZVB 2O6VA 3KUCB 3PRPB 2CS4A 4HXDA 3APFA 1EUVB 1TGZB 4WWNA 4B9KA 2L3ZA 4KZ0A 2O2VB 1PQSA 3VHTC 2C5LC 3GZNI 3RZWC 2KJ6A 1S3SG 1BT0A 3WAOA 2AWTA 4WAAA 4NJ7A 4MH0E 2K39A 2DZIA 2KDEB 1GNUA 4DHZB 2Z0DB 1TTNA 2PPHA 3L08A 4RMAA 2IO2B 4NJ6A 2D11A 3PS6A 5GMVA 4BOZB 2R2QA 2BKFA 3DPDA 3RULA 3WIMA 3M3JA 3PT2B 4MGKE 2K25A 4EZJA 1D3ZA 3DOWA 1UD7A 3ZDTA 2D2QA 1SIFA 2DHZA 4K7UA 3WAMA 2LUEA 5CHFA 2KC1A 4TQ1A 3EC8A 3A33B 4GSWA 4FBJB 2DZJA 1WFYA 2JUOA 3T9LA 1TBEA 1P3QU 2FCNA 2ZPYA 4HCNB 4MELA 1E8XA 3NZSA 1RFAA 3QWZB 4IM0A 5DPWA 2WYQA 2JY6A 2XK5A 1SGHA 4WJPA 2C7NB 2M8SA 1WE6A 3APDA 4GDLB 3ZVVA 2ZCBA 4IM2A 2LGYA 2DAJA 3T8MA 2DENB 1V6EA 3QAQA 4M8MA 2HE7A 4JIOU 4ANXA 3A9JA 4M8NA 4DDGD 5CHVC 3ZW3A 3VQIA 4FLHA 3AI5A 4IWQA 1ZW7A 3CSTA 4EFOA 2MP2B 2KC2A 4LJOB 1XT9B 3W1YA 1P0RA 2KJRA 1YD8U 1KM7A 3NY5A 4JLCA 3PGEA 5LXIB 5BO4B 2LGDA 3QHTA 1SE9A 4W9CA 4PYZA 4KIKB 5L95C 1WF9A 3JW0X 2IO3B 2CKHB 3SHQA 2OOBB 3WALA 4EKUA 1WRDB 3D32A 2GBJA 4JL9A 3ZTDA 3SD5A 4KZCA 3L10B 3RYTA 3ZRCA 2KNBA 2O2VA 3DVGY 3OAWA 2KDFB 4OVVA 2NBWB 4NAWB 4W9DA 2LVOA 2C9WB 3ONSA 4FN2A 3PTFC 4RM9A 1FXTB 5D6JB 2N9EB 1WXAA 3I3TB 3VTVA 4BVUC 3AU4A 3WANA 2PE9A 3UIPB 1ZKHA 5AZGA 5J18A 2FIDA 3HM3A 5HKHA 4F7ZA 1UH6A 2MX2A 2PEAA 4FHJA 1EF5A 1AARA 3HM6X 5DPSA 1WXSA 2M0XA 4BKSD 3DBSA 4DHZE 1VCBA 2DYMA 1E90A 3ENEA 3VFKA 3NHEB 1WZ3A 1KOTA 3HHMA 3QARA 2WX0A 1HE8A 3PRMB 4G11A 4GMVA 4NPNA 2L76A 3ZLZA 2J0JA 2L00B 4WJQA 2BYVE 3A4RA 1V80A 3H6NA 3B08A 3BINA 2BPSA 1H8CA 1IP9A 3ML9A 2ZCCA 1LM8B 3K9OB 3P2BA 3TMPB 1I35A 2GBNA 3MTNB 1ISNA 1WIAA 2K8CA 4NNJB 4F8CB 3DQVA 3DBLI 4FADA 1LXDA 1WX8A 2LI5A 4K81A 3SU8X 2N7DA 2KWUB 4G0NB 2D10A 2L8JA 3B0AA 2KMAA 3L54A 5C1ZA 2MP2A 4JGHB 4WJOA 1XD3B 4XX5A 3A1QB 5LLIA 2BF8B 3DVNU 2KTFA 4G3XB 4ANVA 4F1SA 3IVFA 2MBEA 4GN1A 3W1SA 1YIWA 2GBMA 4KIKA 3RCZA 5JHAA 2VRRB 2GBKA 2JVCA 3L13A 2N9PC 3N30A 4KSKC 2R2OA 4E3CA 1J8CA 4NQKE 3ZDMC 1KJTA 2ZJDA 2V3SA 4M0WB 5D2MB 5E6NA 1WR1A 1IPGA 2CHWA 3M63B 1GJZA 3VH3B 4ZRIA 3H1UA 2FCQA 4WJNA 4GB9A 1UBQA 2UYZB 1WR6E 2CHXA 1WJ6A 3DVGX 4FA6A 1WMHB 4WQOB 5CX3A 4CO7A 2RPQA 4DBGA 2MCNB 1R4NI 2KX0A 2L0FA 3PPAA 1J0GA 2NS5A 1VD2A 1T0YA 3PV1A 3QK0A 4II3B 4HDOA 4DDID 1C3TA 3VUXA 2Y5BB 5KHOA 4KVGB 2K6DB 4W9JA 2J7QB 2I1KA 1P9DU 5DPRA 1RRBA 3VVWB 4I6NB 4MGIE 4KDIC 4GDKA 2HD5B 5E6OA 3QA8A 5C23A 3WA0A 4DWFA 3LDZE 2KZRA 3KW5B 3U7DA 2KFKB 3IBEA 3KUZA 1NDDA 1Z2MA 3IG3A 2V1YA 4ASWC 2KTRB 3ZRFA 4II2B 4LCDE 4ICVA 3ZNID 1OTRB 2BYFA 2M1MA 2IY1B 2JZZA 2O6VD 4TKNA 1GC6A 3V6EB 2ZEQA 3A1QA 2AL6A 3KYCD 3ZUNA 1E8ZA 1CMXB 1Q1OA 3BY4B 1WYWB 2LRWA 3OJ4B 4TV3A 2NCNA 3DBRI 4HDQA 2LWPA 1M94A 3V62A 4LDTD 2JT4B 3MJWA 5EDSA 2JRIB 1LQBA 2N1VA 4TUUA 4ZRJA 1WY8A 4HPMB 3L17A 2CR5A 2RSUA 2WDTB 3OJ3A 1NBFC 2ZVOA 4AP4C 5IAAC 4ANWA 4XC2A 2JXXA 2KMCA 2FAZA 2M17A 1F9JA 1GUAB 3PSEB 2MW5A 2KO3A 2YVCA 3DDCB 1WJNA 2BWES 5CHWA 1KLVA 2DYBA 2I1JA 1V9JA 2GBRA 3JSVB 1WGYA 3TCAA 1WMHA 3EECA 4ZYNA 1YJ1A 1ZGUB 3PLVA 3IHPC 2O6VB 1UELA 4PS8A 1P98A 2L0TA 1TZ1A 2KFJA 1G6JA 3VTWA 5JZEB 1Q0WB 2BYEA 4W9IA 5CTRC 3SDLC 1L2NA 3PHXB 2LGXA 1V5OA 2FCSA 1V2YA 3B1LX 3M62B 4ZRKA 2OJRA 3WAPA 2AEHA 2KXJA 4AOFA 4A3OA 4TQ0A 4MGZE 1WGRA 3TL5A 5FR6A 3DVNV 3JVZX 2FIFA 2QHOA 2IO1B 4KV2A 3V60A 2D07B 2N9XA 1JRUA 3PZDA 1WE7A 1WM2A 3HK0A 3KUDB 4GDLA 1OEYJ 1WM3A 4HVBA 2C7HA 4IG7B 2XEWA 2KK8A 2NVUI 2G45B 2N7EA 4G50A 4W9EA 4W9HA 3H7SA 4BKGA 1XQQA 3DBHI 2D3GA 1R4MI 4W9KA 2ZZPB 1YX6B 5DPTA 2MLBA 4YL8A 4NY0A 2KHWB 2DX5B 4MSQB 2BWFA 3CSFA 1Y8RC 3M95A 2MWSB 2ASQA 3QQ8B 2N4FA 4IC7B 1OEYA 2FUHB 4DK5A 2L05A 2CHZA 2HTHA 2KD0A 2W9NA 2REXA 3RZFA 4CYEA 1K8RB 2RD0A 2XBBC 3X0WA 3AXCA 3NOBA 4FJVB 4IWPA 5G55A 4GU2A 2KKCA 2LVQA 2PE6B 3R66C 4I6LB 4EUTA 2KLGA 3A9JB 4NAWA 4W9LA 3UQBA 3TBLD 2J0MA 2NBUA 3NS8A 3OLMD 1IYFA 2PJHA 3PHWB 3QCAA 1X1MA 4MSMB 2K6QA 2JWZA 1E7VA 2KDBA 3ECIA 3ZO5B 2AYOB 2AL3A 3AULA 4HJKA 4WWOA 2KLCA 2Z59B 3JSVA 4PYUA 4W9GA 1U4AA 3U30A 4DXAB 1E7UA 3A9KB 1LFDA 2L7RA 3CMMB 4KSLC 4PS3A 3ZNHB 5D7GA 3VH4B 4A3PA 4B6WA 3ZNZB 3ZIMA 2EKEC 2ZNVB 1WGGA 1WGDA 4MGYE 4ZDVA 2A4ZA 1YQBA 1QZEA 5AEKB 1WJUA 4AJWA 2ZVNA 3C0RB 2LASA 1RAXA 3VTUA 4FHKA 2ZPNA 2FCMA 2MA9B 3CF6E 3UF8A 1E8WA 4MM3A 1OQYA 4AJYB 2KQSA 2LJ5A 4KDLB 4WWPA 2IYDB 4K1RB 3GOEA 4HLEA 3L16A 4K7WA 4MEMA 2LZ6A 3JYUA 4ICUA 5D94A 2KOXA 2JZ3B 4IM3A 2IBIB 3PVLA 4A20A 1YX5B 4EOYA 2KQ7A 2GMIC 3R7RA
chains in the Genus database with same CATH superfamily
1HEZE 2MBHA 4PS7A 2MBOA 2Q5WD 3TJPA 4YSXB 2RGFA 4MH8A 4P7IA 2JU6X 4YSZB 1C9FA 4N58A 1TKGA 1E8YA 2N1WA 3NVWA 3EHVA 3N20C 4CHKA 4K7SA 5BMHA 3AEDB 4HJGE 3Q3FA 1WX7A 2PIAA 4MACA 2FNJB 2K1FA 3DHGC 4B95A 1WI0A 5TR5A 2JPHA 1I42A 2DYOA 2QDFA 4EZKA 2J0KA 3BYYB 4A8XC 1KFYB 2XN9C 3ALBA 3VXWA 3PRZA 1V49A 3MJ5A 3DBRB 2N0SB 5KHQA 3KH0A 5HI1A 3V61A 4ARIA 4C7YA 4HKZE 4LDTB 3FKYA 1GAQB 2KANA 3MP9A 1H4RA 5IN7A 2WQYB 4AUQC 1WJ4A 4WURA 1TT5B 2PW9A 2HJ8A 3N32A 2JQRB 4X57B 2J42A 2MRPA 3S2AA 2LHEA 4URKA 3HIZA 2MSED 4I6PA 4XZ4A 2KWVB 2NPTA 3VUYA 2W3SA 3AU5A 1UUPA 1WWTA 5BYSA 3UIOB 3V3XA 3LYYA 2JSVX 2KN5A 3K9PB 3ZNGC 2B3AA 1C4PA 4XE0A 3H7PA 4ANUA 2EMTA 4EEWA 1HXYD 1WGHA 3I57A 4RGOS 3U8ZA 2O6VA 4HXDA 2O2VB 1E10A 4JX1C 2KJ6A 1S3SG 2V9HA 4MH0E 2KDEB 4ZOHC 2Z0DB 2W54A 2PPHA 3L08A 2IO2B 2D11A 3PS6A 4ARCA 2R2QA 4K3CA 3DPDA 4MGKE 1UD7A 5CHFA 2WXFA 2EKIA 1QOBA 1TBEA 1P3QU 2JYEA 2ZPYA 3AE7B 4IM0A 2XK5A 1ZOYB 1XLOA 2C7NB 2M8SA 3APDA 4WH4A 3ZVVA 2GLSA 4IM2A 2ACZB 3CWIA 3T8MA 4M8MA 4DDGD 5CHVC 2GI9A 1ZW7A 3W1YA 4HEA1 5FKAC 1P0RA 1L6VA 2KJRA 1YD8U 3NY5A 1D5ZC 3VR8B 4OZBA 4PYZA 4KIKB 3JW0X 3R8BA 3D32A 4JL9A 4KZCA 3NVYA 3ZRCA 1LO5D 1I4HA 3OAWA 2KDFB 1CQVA 1SBBB 2C9WB 1F2RC 5AUKA 1XCTL 2PE9A 1KF6B 1ZKHA 5G5GA 1UH6A 1AYFA 4FHJA 1EF5A 1P7FA 1WXSA 4BKSD 3RFZB 1WYGA 2DYMA 2D5GA 3VFKA 3IXSA 2WXRA 4GMVA 2J0JA 2L00B 4KGSA 4WJQA 1QOGA 3H6NA 1HZ6A 3BINA 2BPSA 1H8CA 2ZCCA 3P2BA 3TMPB 2INCC 3N1YC 3MTNB 1WIAA 4HPPA 4F8CB 1LXDA 1WX8A 2LI5A 1YN4A 2KWUB 4HROA 3L54A 2R61A 3A1QB 2MJ3A 2WXPA 4IKGA 4F1SA 3DBHB 2CU3A 3RCZA 5JHAA 2VRRB 1L4DB 2IGHA 4YWGG 4NQKE 4JWSC 1FCLA 1ZDVA 1K53A 4BZAA 3M63B 1UWXA 2MJDA 4D2KA 1WR6E 4FA6A 4CO7A 2KX0A 3PPAA 2NS5A 4II3B 2WP9B 3AE6B 3VUXA 2K5PA 4KVGB 2BB6A 2K6DB 1WXQA 4W9JA 2BS3B 2J7QB 2M56B 1PUTA 1JROA 3QA8A 1OFFA 4DWFA 3LDZE 3U7DA 2KFKB 3IBEA 1VLBA 1NDDA 4ASWC 5EE9A 1DGJA 2KTRB 3ZRFA 4II2B 4LCDE 4ICVA 2PVGC 4RGTA 2AQ1B 2IY1B 2JZZA 4LNFA 4YXDB 1GC6A 1E8ZA 1WYWB 3AE8B 2LWPA 1M94A 4LDTD 5EDSA 4TUUA 2N1VA 2PKOA 2K9XA 1TZOA 4WIPA 4DQOC 3TEXA 1NBFC 5IAAC 4ANWA 1QOAA 2FAZA 2M17A 1F9JA 3RI7C 3PSEB 4N6EB 4Q2JA 1WJNA 5H92C 1KLVA 2AX5A 2I1JA 1WMHA 2QJLA 3IHPC 1UELA 3BVZA 1TY2A 2KFJA 1G6JA 5JZEB 1Q0WB 5CTRC 3PHXB 3B1LX 3MC8A 3M62B 5FR3A 4MGZE 3TSSA 2FIFA 4ITKA 4P1BC 2N9XA 1OEYJ 4HVBA 3AEBB 2C7HA 3U4EG 2NVUI 2G45B 3H7SA 4BKGA 3DBHI 2D3GA 2ZZPB 1YX6B 2BQQA 2DWQA 3ZJUA 2DX5B 2BWFA 5TSSA 4US8A 1Y8RC 2N4FA 4DK5A 4XGAB 3T3NA 1SB3C 4CYEA 3X0WA 2PMVA 5G55A 2KKCA 3I9V1 3R66C 2PLPA 3AE4B 2V3NA 2KLGA 3A9JB 4W9LA 2NBUA 2QEJC 2N9LA 3AULA 2AL3A 1L4ZB 1JRPA 2INPE 3U30A 1I4PA 3CMMB 3ZGZA 1ESFA 4XDDA 4A3PA 1QT9A 1C79A 2D3BA 3U2SC 3IT4B 4ZHPA 3VTUA 1JALA 1E8WA 4K1RB 3GOEA 1L5PA 3L16A 1N62A 4MEMA 1I4XA 1D5XC 4EOYA 2OHFA 2KQ7A 1T0RC 3R7RA 3GE8C 1ET6A 2BGFA 2MQJA 2LXAA 5AZHA 1I4QA 1N60A 2NPTB 3FC4A 1UBIA 1K50A 5JHBA 1SF0A 4JPSA 2IY0B 2LHDA 2LXCA 1WSPA 4HCPB 1XLQA 2K8HA 2RMMA 4AWJA 3H7PB 1E5WA 2UWQA 1ZDXA 4DXFA 1V8CA 1WZ0A 3QC8B 2QIEB 5AZFA 3ZTCA 1WX9A 2LRUA 1P1AA 5IA7A 4IUMB 3MHSD 2LD9A 3V6CB 4HK2A 3C19A 5E6PA 3UQAA 4GIVA 4CQNA 4EZLA 2KYWA 3P4PB 2KFKA 3V05A 2HTME 2WXNA 3E56A 2KTRA 1GB1A 4OW0A 4M01A 3PLUA 4JQWC 1FXAA 4BKTA 1XEEA 2Y3AA 4GDKB 2WDQB 1Q10A 2X38A 4RF0A 1TS4A 4R3DA 2XK5B 4OZCA 1WRIA 3A4SC 3UINB 3U7ZA 3DHIC 1JWBD 1T6BX 3ML8A 4LJPB 1BMLC 3VUWA 2ZNVC 3DBLB 4GGQA 4LNNA 1JWMD 3B2FA 2KVRA 3AE5B 3IFWB 4OVUA 4DHJB 1JMLA 1FCCC 2VH1A 2NR2A 4MJSA 2QSDA 3SFEB 1C1YB 3EFUA 2YLMA 3ZYYX 3VDZA 2IZVB 5H8YE 3Q6BA 1TYGB 1VDVA 4B9KA 4KZ0A 5HFYA 1PQSA 3GZNI 2AWTA 4WAAA 1XO3A 2K39A 4DHZB 1GNUA 1TTNA 4RMAA 4BOZB 1SXTA 3T3OA 4H2AA 2BKFA 1XXGA 5C3JB 2IGGA 1QOFA 3EA6A 1CK1A 2DHZA 4K7UA 5I4DA 2LUEA 4TQ1A 3EC8A 2DZJA 2JUOA 2LJIA 3T9LA 4HCNB 1SE3A 1TKEA 1XCQL 2KDMA 3OWEB 4B0MA 2RDHA 4MELA 1E8XA 1K52A 3NZSA 5DPWA 2WYQA 2IJ0A 3TEYA 2KWDA 1SGHA 4WJPA 1N5XA 3QAQA 2NMQA 4QAYA 3AEAB 4JIOU 1UWMA 1NYRA 2GB1A 3A9JA 3P4RB 4M8NA 4N59A 4FLHA 4IWQA 4LJOB 1XT9B 2DLBA 1KM7A 2BVCA 4YSYB 4RGNA 5BO4B 1WF9A 2W82A 2JXTA 2QMTA 3SD5A 3RYTA 4K3BA 4W9DA 2LVOA 3URYA 3RPFC 3ONSA 4FN2A 4TMAB 1FXTB 3FILB 1PGBA 3VTVA 3WANA 2WHIA 3ZJVA 5J18A 4C00A 5HKHA 5C2TB 2MX2A 2M0XA 3DBSA 1R7SA 1Y56A 1YMHE 3NHEB 1KOTA 3HHMA 2WXKA 4G11A 1F52A 1GB4A 3A4RA 1TS3A 3K9OB 1I35A 1FRRA 2GBNA 1WGKA 3Q8BA 4NNJB 3DBLI 4FADA 3TEZA 3SU8X 2N7DA 4G0NB 3B0AA 1MFWA 2KMAA 2D3AA 2NTTA 2MP2A 4WJOA 4XX5A 3DVNU 3IVFA 1R4MB 4A55A 1EU3A 2L1AA 5GXGB 3W1SA 3Q8AA 2JZPA 5BYQA 3L13A 1N61A 2N9PC 2YEPF 2R2OA 3P1MA 2V4IB 2ZJDA 3Q8CA 4B0EA 2HJ1A 3VRBB 1VJKA 2MH7A 3Q3NC 4WJNA 2J4XA 1L0YB 2UYZB 2CHXA 1WMHB 1AW7A 2RPQA 3AE2B 2MCNB 1ZUD2 2WXOA 3RN9C 4LNKA 1L0VB 3ZXRA 1FFVA 1VD2A 1T0YA 3UI3A 1SIJA 1PGXA 5KHOA 3SR6A 4EE2A 2I1KA 3J9CA 1QILA 1RRBA 4OVZA 4MGIE 4GDKA 2HD5B 5E6OA 3KW5B 2FE8A 4USAA 2V1YA 2KMMA 2WS3B 2KQ4X 1OTRB 3U52E 1RM6C 2O6VD 2G1EA 2MHJA 3ZUNA 5EE0A 1CMXB 1Q1OA 3BY4B 2XNAC 5IOIA 3OJ4B 2NCNA 1N5WA 3DBRI 4HDQA 1JQ4A 2L52A 2JT4B 3MC9A 2JRIB 4IOIE 4ZRJA 1T5XD 2BT6A 4M00A 2WXGA 1NI3A 1MJDA 2BBCA 2WXQA 4NJCA 4LLGM 1E0ZA 2KO3A 5CHWA 2DYBA 1V9JA 3TCAA 3EECA 4ZYNA 2I2YA 1STEA 2WLBA 1YNTE 1TZ1A 3NVVA 3VTWA 4MT5A 3SDLC 4XWWA 1L2NA 2OJRA 2KXJA 4AOFA 5FR6A 2UU7A 3DVNV 2L83A 2CJOA 1JRUA 1TS2A 3PZDA 3PO0A 3AE3B 4IG7B 2N7EA 2NTSA 2J52A 4G50A 2DNFA 2QC8A 1R4MI 4W9KA 5DPTA 1M4VA 4YL8A 4NY0A 3BK2A 2MWSB 3QQ8B 4IC7B 2FUHB 2HTHA 2KD0A 2REXA 1K8RB 2RD0A 4S17A 1QF6A 1ACCA 3DHHC 4FJVB 4S0RA 4I6LB 3UQBA 2J0MA 3OLMD 2PJHA 3MHZA 3PHWB 2VZKB 1HZ5A 4MSMB 3FILA 2JWZA 3ZO5B 3ECIA 2AYOB 3P4QB 1T0SC 2ICIA 2KLCA 4PYUA 5HG2A 1I4RA 4DXAB 1KLUD 1E7UA 1DOYA 4KSLC 4OHJA 3HRDD 5D7GA 4UDUC 4B6WA 2ZNVB 1WGGA 1WGDA 1UGJA 2A4ZA 1YQBA 5AEKB 1WJUA 2LFIA 2ZVNA 2ZPNA 4GLSC 3Q8EA 1D5MC 1VZ7A 1C4AA 2FCMA 4AJYB 1HTOA 1V1PB 4WWPA 2IYDB 1MG4A 4HLEA 2LZ6A 3JYUA 4ICUA 1BUIC 2KOXA 3PVLA 1R4NB 1FNWA 1FNVA 3KYDD 5DCNA 1EO6A 3KWVA 3PREA 2DZKA 2KX3A 4GOCA 3APCA 4ACFA 3QJZA 2H89B 2V4LA 3DCGA 4MDKE 2A5UA 3AN1A 1KTKA 5EE3A 2J53A 2E3TA 3L0WB 2Z8LA 3AE9B 4FJYA 2M4NA 1C4CA 2DZMA 4MJSB 1IGDA 2WNMA 2CU1A 3AEGB 1NENB 4GXBA 4RM8A 2WXIA 3IAM1 4BAXA 2G4SA 2GOWA 3R7QA 1MG8A 3Q3MC 3NZUA 1IUEA 4RF1A 2WDRB 2WX1A 2Z0EB 3OG5A 1E6EB 1I4GA 3H9DA 3X23A 4BOSC 3LJ3A 2IO0B 1WXMA 1V5TA 2JX5A 2RR9A 4LNIA 1YN3A 2HDEA 2MEKA 2WXJA 1ROEA 4FXCA 5J17A 1KH0A 4IWOA 2KDIA 1UZXB 3BIID 2C7MB 1RLFA 3RUIB 1LGRA 2LGIA 1IGCA 3VAWA 3N3KB 1V86A 4HWIB 1AWDA 3BYTB 1FO4A 1A5RA 1TJEA 2AQ2B 3KUCB 3PRPB 1OQQA 1EUVB 1TGZB 1OQRA 2IPKD 2C5LC 3RZWC 1V1OA 4P16A 1BT0A 2B76B 1KRHA 4AS1A 5GMVA 1B1ZA 1EU4A 1D3ZA 3P63A 3ZXVA 2D2QA 2BB5A 1YQ3B 4FBJB 3AV8A 1FD6A 3GS2A 4YTPB 3Q69A 3QWZB 2JY6A 2FBWB 1WE6A 3BK1A 4GDLB 2BW2A 2ZCBA 2LGYA 3RNAC 5T8IA 1V6EA 4RNAA 3RNFC 4RCOA 3VQIA 3CSTA 4EFOA 2MP2B 2KC2A 2WGSA 3AECB 1UNSA 2VH2A 2IO3B 2RDGA 3SHQA 4L2YA 1WRDB 3DWGC 1ZXIA 3BVMA 2AQ3B 2NBWB 3AEEB 3PTFC 1F1HA 2N9EB 1TS5A 3AU4A 1J7AA 4OZAA 1V1PA 1IBXB 4F7ZA 1E7PB 3I63C 4C4VB 3HVZA 1N6ZA 1D6EC 4DHZE 3R2TA 3EFCA 2H88B 3AMZA 1WZ3A 2INNE 3PRMB 4NPNA 2L76A 3ZLZA 1XLPA 4YTMB 2BYVE 1V80A 1IP9A 3ML9A 1VR9A 1LM8B 1J7BA 2VZKD 4L23A 5AUIA 3DQVA 1NEKB 4C80A 1MI0A 2D10A 5LLIA 2BF8B 4ANVA 5IP4D 5MPOA 2Y5PA 2K22A 2KAJA 4GN1A 3IAS1 3VR9B 3O13A 2GBKA 2JVCA 2G9HD 3RNGC 1J8CA 3ZDMC 3NZ3A 1KJTA 2M0AA 3NJTA 4M0WB 5D2MB 1PDXA 3H1UA 3N1ZC 2FCQA 4KGTA 4GB9A 1ZP0B 1F77A 1WJ6A 3DVGX 5G5HA 2L0FA 4A90A 1J0GA 2KVZA 4J3OD 3QK0A 4RH6A 1GPXA 1P9DU 4WQMA 3VVWB 4I6NB 1HTQA 3WA0A 3IG3A 2RPVA 1TIFA 2I38A 2BYFA 2M1MA 4TKNA 3RMKC 3V6EB 1QLBB 3KWLA 2AL6A 3KYCD 1FFUA 2LRWA 3Q14C 3NVZA 4XWTA 1KLGD 3MJWA 1LQBA 1FMAD 1WY8A 4HPMB 3L17A 2CR5A 2RSUA 3OJ3A 2ZVOA 2JXXA 2KMCA 1TY0A 2MW5A 4IDIA 1YJIA 1WGYA 1F2RI 1PFDA 3EUB2 1ZGUB 4W9IA 2LUMA 2LGXA 1V5OA 1FPYA 2FCSA 4A3OA 1WGRA 3W5VB 4WWMA 3MFGA 4EUTA 1MHXA 2IO1B 1WM2A 3HK0A 3KUDB 4GDLA 2X8XX 1RWSA 3PZ7A 2XEWA 2KK8A 4RGMA 3CSFA 1FRDA 1JWUD 3RNCC 2L05A 2BYTA 4NZLB 2BS4B 3AXCA 3NOBA 1N63A 1UF0A 5BYRA 4GU2A 1FXIA 3NS1A 2LVQA 2PE6B 2ZW1A 5IKCM 1IYFA 4C56C 1X1MA 2K6QA 1E7VA 2KDBA 4KX6B 3BWUD 1L0XB 2Z59B 3JSVA 4W9GA 1IBXA 1SEBD 3LB8C 1T3QA 2L7RA 4C4VA 3ZIMA 4MGYE 1DYQA 4KKIA 4AJWA 3C0RB 1JW9D 3AE1B 1FNUA 2MA9B 3UF8A 4MM3A 5HHDG 2K0PA 1PYWD 3B9JA 2IBIB 3I5JC 1VZ8A 4A6QA 1CZPA 3IT6B 3RD2A 5G2NA 3E9SA 1WH3A 4BKSA 2K3UA 1RYJA 4N9F4 3AH7A 4BBNC 1SSNA 2N9KA 2G4DB 4BFRA 1TKYA 3NUHB 4M0WA 4P6VF 1DOIA 3W1SC 3W2DA 1EF1A 2E6XA 3P42A 2JRHA 5FK9C 3QIJA 4ZHOA 3QX1A 4NQLB 1SJHD 2LVPA 4HPLB 1JWAD 3ETRA 2PTLA 1YOVB 2KJHB 3A9KA 2MBBB 3DWMA 1GC7A 3KLSX 2M19A 3NG0A 3N9YC 1J19A 1FIQA 1Z5SB 2JF5A 1C77A 4FJZA 5JXVA 4E71A 1UGMA 3GB1A 1SE4A 1S1QB 3O65B 1WXVA 2K8BA 1Q5WB 3ZKJC 4E74A 2DAFA 3Q3JA 2BKRB 1OGWA 2MBQA 4J6IA 4HRSA 5J2RA 5L83A 2C60A 2CJNA 4DHJD 3UGBB 4M02A 2EMSA 3ZQ4A 4BBNF 3PZ8A 4W9FA 2WWZA 4IW0A 1NI2A 3N1XC 3RT3B 3R3MA 4FULA 1YN5A 3GE3C 1GG3A 1L7YA 4LK0M 5LXHA 2WU2B 3RNBC 3KQ4A 3SEBA 5JH5C 1J7CA 4ZYSA 3KVFB 3H8HA 3ZJTA 1V81A 3TIXA 2QCZA 2NBVB 2KWCA 2G3QB 3HUIA 3BZDB 3P4SB 2CS4A 1NYQA 3APFA 4P1CC 4WWNA 2L3ZA 1HQRD 2V3PA 3VHTC 4C7ZA 3WAOA 4NJ7A 2DZIA 1MVKA 1QQRA 2IDYA 4RFBA 4NJ6A 2SAKA 3RULA 3WIMA 2RDBC 3M3JA 3PT2B 2K25A 4EZJA 2BTEA 3DOWA 3ZDTA 1SIFA 1I7HA 4ZRPA 3WAMA 2KC1A 3A33B 4GSWA 1WFYA 2FCNA 3B2GA 1RFAA 1D4BA 4YT0B 2DAJA 4LTUA 2DENB 2HE7A 1ZPSA 1YJJA 4ANXA 5LNK1 1PGAA 1VRAB 3ZW3A 4LNOA 3AI5A 4O1NA 1JWSD 4ZRQA 1ENFA 1SJED 4JLCA 1C78A 3PGEA 3MC0B 5LXIB 2LGDA 3AB5A 3QHTA 1SE9A 4W9CA 5L95C 3WALA 2CKHB 4EKUA 2OOBB 4REZA 1RFKA 2GBJA 3ZTDA 3L10B 2KNBA 2O2VA 3DVGY 2MJEA 4NAWB 4OVVA 4RM9A 5D6JB 1WXAA 3I3TB 4BVUC 1EM7A 1L6UA 3UIPB 5AZGA 2FIDA 3HM3A 3WCQA 2PEAA 1AARA 3HM6X 5DPSA 3C8YA 1AN8A 1VCBA 1E90A 3ENEA 4PT5A 2YEPB 3Q2AC 3QARA 2WX0A 3SFDB 1HE8A 3Q8FA 2WU5B 3B08A 1ZXHA 4TSSA 3AEFB 4KKJA 4AQ7A 1V97A 1ISNA 2K8CA 4K81A 4JE3B 2DBYA 1CJEA 2L8JA 5C1ZA 3RNEC 4JGHB 1XD3B 4XYCA 2KTFA 4G3XB 2LMCA 2MBEA 1YIWA 2GBMA 4KIKA 4KSKC 3N30A 1EWCA 4E3CA 2WXMA 2V3SA 5E6NA 1WR1A 1P7EA 1E9MA 1IPGA 2CHWA 2LGSA 1GJZA 3VH3B 4ZRIA 5IO9A 2ZW0A 1UBQA 2FUG1 4WQOB 5CX3A 2GRIA 4DBGA 1R4NI 2N7JA 3W5UB 1MHHE 3PV1A 3CIRB 4HDOA 4DDID 1C3TA 2Y5BB 2JWUA 3Q3OC 1QKZA 5DPRA 3GZNB 4KDIC 5C23A 2KZRA 2W55A 5D3IB 2IGDA 3KUZA 1Z2MA 1JCKB 4US9A 1XLNA 2WXLA 4PK1A 3ZNID 1K51A 2ZEQA 3A1QA 3L4PA 1C76A 4TV3A 2Y5CA 1T0QC 1NVID 1FM0D 1BXTA 3TUOA 3V62A 1SE2A 2W3RA 5D3DA 3TEWA 2WDTB 4AP4C 4XC2A 1GUAB 2KN4A 1XF5L 2YVCA 3DDCB 4DXGA 2BWES 3LXFA 2GBRA 2L32A 3JSVB 2WDVB 1YJ1A 2SEBD 1ET9A 2KT7A 3PLVA 2O6VB 3ABVB 4PS8A 2D3CA 1P98A 2EELA 2L0TA 4NAMA 2BYEA 2BS2B 1V2YA 4L1BA 4ZRKA 5EE1A 3WAPA 2AEHA 4TQ0A 3TL5A 4JWUC 4MM3B 3JVZX 2ON8A 2QHOA 4KV2A 3V60A 2D07B 2QILA 1B9RA 1WE7A 3FAHA 1WM3A 3W9CB 2LEKA 1GOZA 2V0GA 4W9EA 4W9HA 1XQQA 2ONQA 2KACA 5E6JA 2MLBA 4YTNB 3R2IA 3HVDA 3EGRA 2KHWB 4MSQB 2OJWA 3M95A 2TSSA 2ASQA 1OEYA 2CHZA 2WXHA 2W9NA 1HA5A 1A70A 3RZFA 2XBBC 4WAFA 4IWPA 5BMGA 4A9AA 4NAWA 3TBLD 4XDCA 3NS8A 3QCAA 2INDC 4HJKA 4WWOA 1U4AA 5BMIA 3A9KB 1LFDA 4PS3A 3ZNHB 1DOXA 3VH4B 1EWYC 1MPEA 3ZNZB 4ZDVA 2EKEC 1VZ6A 3VRAB 1ZE3D 1FEHA 1QZEA 2PVOD 3AM9A 1YQ4B 2JYTA 1RAXA 2LASA 3NRZA 4FHKA 4KGRA 3BVGA 3CF6E 1OQYA 2KQSA 2LJ5A 4KDLB 1F0ZA 3GP7A 4K7WA 5D94A 2OEDA 2JZ3B 4IM3A 4A20A 1YX5B 4HKQA 2GMIC
chains in the Genus database with same CATH topology
3KYDD 5DCNA 1EO6A 2MBHA 2BGFA 4PS7A 3PREA 3RD2A 2MBOA 5G2NA 3TJPA 1WH3A 2DZKA 2KX3A 2LXAA 2MQJA 4GOCA 5AZHA 4BKSA 3APCA 3QJZA 2RGFA 4P7IA 2NPTB 2V4LA 3DCGA 4MDKE 1UBIA 1E8YA 2N1WA 4N9F4 4BBNC 2A5UA 3EHVA 4CHKA 2G4DB 4K7SA 4BFRA 5JHBA 3L0WB 2IY0B 3W1SC 3Q3FA 1WX7A 2FNJB 2K1FA 1EF1A 2LXCA 2JRHA 4B95A 1WI0A 3QIJA 4FJYA 5TR5A 2JPHA 3QX1A 4HCPB 2K8HA 4NQLB 4AWJA 3H7PB 1E5WA 2M4NA 1I42A 2LVPA 2DYOA 4HPLB 2UWQA 4EZKA 2J0KA 2DZMA 4MJSB 2KJHB 3A9KA 1WZ0A 3ALBA 2MBBB 3QC8B 2CU1A 3VXWA 1GC7A 5AZFA 3PRZA 3ZTCA 1WX9A 1J19A 1V49A 1P1AA 2LRUA 1Z5SB 2JF5A 5IA7A 4GXBA 4IUMB 3MHSD 4RM8A 5KHQA 3KH0A 4FJZA 2G4SA 2GOWA 1UGMA 4E71A 3V61A 2LD9A 1S1QB 3R7QA 3O65B 1WXVA 1MG8A 3NZUA 2K8BA 1Q5WB 4HK2A 4LDTB 3V6CB 3ZKJC 4E74A 5E6PA 2DAFA 3UQAA 2WX1A 2Z0EB 3Q3JA 2BKRB 4GIVA 1OGWA 2KANA 4EZLA 2MBQA 3H9DA 4J6IA 2KFKA 1H4RA 3X23A 4BOSC 5L83A 3LJ3A 5J2RA 2IO0B 2C60A 4AUQC 1WJ4A 4DHJD 1WXMA 1V5TA 2KTRA 3UGBB 2HJ8A 2EMSA 3N32A 4BBNF 4X57B 2MRPA 4W9FA 3PLUA 4JQWC 2WWZA 2RR9A 3S2AA 4BKTA 4URKA 4IW0A 1NI2A 3RT3B 3R3MA 3HIZA 2MSED 4GDKB 4FULA 4I6PA 2KWVB 2NPTA 4XZ4A 5J17A 1GG3A 1L7YA 4IWOA 2KDIA 1UZXB 3VUYA 3AU5A 5LXHA 2XK5B 2C7MB 3UIOB 3A4SC 3UINB 1RLFA 3RUIB 5JH5C 2KN5A 3K9PB 3ZNGC 3ML8A 4LJPB 3KVFB 3VAWA 2ZNVC 1V86A 3N3KB 4GGQA 3VUWA 4HWIB 1V81A 2B3AA 2KVRA 3H7PA 4OVUA 3IFWB 3TIXA 4ANUA 2EMTA 4DHJB 1A5RA 2NBVB 2NR2A 4EEWA 4MJSA 2KWCA 2G3QB 1C1YB 1WGHA 2YLMA 3EFUA 3VDZA 3U8ZA 2IZVB 2O6VA 3KUCB 3PRPB 2CS4A 4HXDA 3APFA 1EUVB 1TGZB 4WWNA 4B9KA 2L3ZA 4KZ0A 2O2VB 1PQSA 3VHTC 2C5LC 3GZNI 3RZWC 2KJ6A 1S3SG 1BT0A 3WAOA 2AWTA 4WAAA 4NJ7A 4MH0E 2K39A 2DZIA 2KDEB 1GNUA 4DHZB 2Z0DB 1TTNA 2PPHA 3L08A 4RMAA 2IO2B 4NJ6A 2D11A 3PS6A 5GMVA 4BOZB 2R2QA 2BKFA 3DPDA 3RULA 3WIMA 3M3JA 3PT2B 4MGKE 2K25A 4EZJA 1D3ZA 3DOWA 1UD7A 3ZDTA 2D2QA 1SIFA 2DHZA 4K7UA 3WAMA 2LUEA 5CHFA 2KC1A 4TQ1A 3EC8A 3A33B 4GSWA 4FBJB 2DZJA 1WFYA 2JUOA 3T9LA 1TBEA 1P3QU 2FCNA 2ZPYA 4HCNB 4MELA 1E8XA 3NZSA 1RFAA 3QWZB 4IM0A 5DPWA 2WYQA 2JY6A 2XK5A 1SGHA 4WJPA 2C7NB 2M8SA 1WE6A 3APDA 4GDLB 3ZVVA 2ZCBA 4IM2A 2LGYA 2DAJA 3T8MA 2DENB 1V6EA 3QAQA 4M8MA 2HE7A 4JIOU 4ANXA 3A9JA 4M8NA 4DDGD 5CHVC 3ZW3A 3VQIA 4FLHA 3AI5A 4IWQA 1ZW7A 3CSTA 4EFOA 2MP2B 2KC2A 4LJOB 1XT9B 3W1YA 1P0RA 2KJRA 1YD8U 1KM7A 3NY5A 4JLCA 3PGEA 5LXIB 5BO4B 2LGDA 3QHTA 1SE9A 4W9CA 4PYZA 4KIKB 5L95C 1WF9A 3JW0X 2IO3B 2CKHB 3SHQA 2OOBB 3WALA 4EKUA 1WRDB 3D32A 2GBJA 4JL9A 3ZTDA 3SD5A 4KZCA 3L10B 3RYTA 3ZRCA 2KNBA 2O2VA 3DVGY 3OAWA 2KDFB 4OVVA 2NBWB 4NAWB 4W9DA 2LVOA 2C9WB 3ONSA 4FN2A 3PTFC 4RM9A 1FXTB 5D6JB 2N9EB 1WXAA 3I3TB 3VTVA 4BVUC 3AU4A 3WANA 2PE9A 3UIPB 1ZKHA 5AZGA 5J18A 2FIDA 3HM3A 5HKHA 4F7ZA 1UH6A 2MX2A 2PEAA 4FHJA 1EF5A 1AARA 3HM6X 5DPSA 1WXSA 2M0XA 4BKSD 3DBSA 4DHZE 1VCBA 2DYMA 1E90A 3ENEA 3VFKA 3NHEB 1WZ3A 1KOTA 3HHMA 3QARA 2WX0A 1HE8A 3PRMB 4G11A 4GMVA 4NPNA 2L76A 3ZLZA 2J0JA 2L00B 4WJQA 2BYVE 3A4RA 1V80A 3H6NA 3B08A 3BINA 2BPSA 1H8CA 1IP9A 3ML9A 2ZCCA 1LM8B 3K9OB 3P2BA 3TMPB 1I35A 2GBNA 3MTNB 1ISNA 1WIAA 2K8CA 4NNJB 4F8CB 3DQVA 3DBLI 4FADA 1LXDA 1WX8A 2LI5A 4K81A 3SU8X 2N7DA 2KWUB 4G0NB 2D10A 2L8JA 3B0AA 2KMAA 3L54A 5C1ZA 2MP2A 4JGHB 4WJOA 1XD3B 4XX5A 3A1QB 5LLIA 2BF8B 3DVNU 2KTFA 4G3XB 4ANVA 4F1SA 3IVFA 2MBEA 4GN1A 3W1SA 1YIWA 2GBMA 4KIKA 3RCZA 5JHAA 2VRRB 2GBKA 2JVCA 3L13A 2N9PC 3N30A 4KSKC 2R2OA 4E3CA 1J8CA 4NQKE 3ZDMC 1KJTA 2ZJDA 2V3SA 4M0WB 5D2MB 5E6NA 1WR1A 1IPGA 2CHWA 3M63B 1GJZA 3VH3B 4ZRIA 3H1UA 2FCQA 4WJNA 4GB9A 1UBQA 2UYZB 1WR6E 2CHXA 1WJ6A 3DVGX 4FA6A 1WMHB 4WQOB 5CX3A 4CO7A 2RPQA 4DBGA 2MCNB 1R4NI 2KX0A 2L0FA 3PPAA 1J0GA 2NS5A 1VD2A 1T0YA 3PV1A 3QK0A 4II3B 4HDOA 4DDID 1C3TA 3VUXA 2Y5BB 5KHOA 4KVGB 2K6DB 4W9JA 2J7QB 2I1KA 1P9DU 5DPRA 1RRBA 3VVWB 4I6NB 4MGIE 4KDIC 4GDKA 2HD5B 5E6OA 3QA8A 5C23A 3WA0A 4DWFA 3LDZE 2KZRA 3KW5B 3U7DA 2KFKB 3IBEA 3KUZA 1NDDA 1Z2MA 3IG3A 2V1YA 4ASWC 2KTRB 3ZRFA 4II2B 4LCDE 4ICVA 3ZNID 1OTRB 2BYFA 2M1MA 2IY1B 2JZZA 2O6VD 4TKNA 1GC6A 3V6EB 2ZEQA 3A1QA 2AL6A 3KYCD 3ZUNA 1E8ZA 1CMXB 1Q1OA 3BY4B 1WYWB 2LRWA 3OJ4B 4TV3A 2NCNA 3DBRI 4HDQA 2LWPA 1M94A 3V62A 4LDTD 2JT4B 3MJWA 5EDSA 2JRIB 1LQBA 2N1VA 4TUUA 4ZRJA 1WY8A 4HPMB 3L17A 2CR5A 2RSUA 2WDTB 3OJ3A 1NBFC 2ZVOA 4AP4C 5IAAC 4ANWA 4XC2A 2JXXA 2KMCA 2FAZA 2M17A 1F9JA 1GUAB 3PSEB 2MW5A 2KO3A 2YVCA 3DDCB 1WJNA 2BWES 5CHWA 1KLVA 2DYBA 2I1JA 1V9JA 2GBRA 3JSVB 1WGYA 3TCAA 1WMHA 3EECA 4ZYNA 1YJ1A 1ZGUB 3PLVA 3IHPC 2O6VB 1UELA 4PS8A 1P98A 2L0TA 1TZ1A 2KFJA 1G6JA 3VTWA 5JZEB 1Q0WB 2BYEA 4W9IA 5CTRC 3SDLC 1L2NA 3PHXB 2LGXA 1V5OA 2FCSA 1V2YA 3B1LX 3M62B 4ZRKA 2OJRA 3WAPA 2AEHA 2KXJA 4AOFA 4A3OA 4TQ0A 4MGZE 1WGRA 3TL5A 5FR6A 3DVNV 3JVZX 2FIFA 2QHOA 2IO1B 4KV2A 3V60A 2D07B 2N9XA 1JRUA 3PZDA 1WE7A 1WM2A 3HK0A 3KUDB 4GDLA 1OEYJ 1WM3A 4HVBA 2C7HA 4IG7B 2XEWA 2KK8A 2NVUI 2G45B 2N7EA 4G50A 4W9EA 4W9HA 3H7SA 4BKGA 1XQQA 3DBHI 2D3GA 1R4MI 4W9KA 2ZZPB 1YX6B 5DPTA 2MLBA 4YL8A 4NY0A 2KHWB 2DX5B 4MSQB 2BWFA 3CSFA 1Y8RC 3M95A 2MWSB 2ASQA 3QQ8B 2N4FA 4IC7B 1OEYA 2FUHB 4DK5A 2L05A 2CHZA 2HTHA 2KD0A 2W9NA 2REXA 3RZFA 4CYEA 1K8RB 2RD0A 2XBBC 3X0WA 3AXCA 3NOBA 4FJVB 4IWPA 5G55A 4GU2A 2KKCA 2LVQA 2PE6B 3R66C 4I6LB 4EUTA 2KLGA 3A9JB 4NAWA 4W9LA 3UQBA 3TBLD 2J0MA 2NBUA 3NS8A 3OLMD 1IYFA 2PJHA 3PHWB 3QCAA 1X1MA 4MSMB 2K6QA 2JWZA 1E7VA 2KDBA 3ECIA 3ZO5B 2AYOB 2AL3A 3AULA 4HJKA 4WWOA 2KLCA 2Z59B 3JSVA 4PYUA 4W9GA 1U4AA 3U30A 4DXAB 1E7UA 3A9KB 1LFDA 2L7RA 3CMMB 4KSLC 4PS3A 3ZNHB 5D7GA 3VH4B 4A3PA 4B6WA 3ZNZB 3ZIMA 2EKEC 2ZNVB 1WGGA 1WGDA 4MGYE 4ZDVA 2A4ZA 1YQBA 1QZEA 5AEKB 1WJUA 4AJWA 2ZVNA 3C0RB 2LASA 1RAXA 3VTUA 4FHKA 2ZPNA 2FCMA 2MA9B 3CF6E 3UF8A 1E8WA 4MM3A 1OQYA 4AJYB 2KQSA 2LJ5A 4KDLB 4WWPA 2IYDB 4K1RB 3GOEA 4HLEA 3L16A 4K7WA 4MEMA 2LZ6A 3JYUA 4ICUA 5D94A 2KOXA 2JZ3B 4IM3A 2IBIB 3PVLA 4A20A 1YX5B 4EOYA 2KQ7A 2GMIC 3R7RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KYD D;  5DCN A;  1EO6 A;  2MBH A;  2BGF A;  4PS7 A;  3PRE A;  3RD2 A;  2MBO A;  5G2N A;  3TJP A;  1WH3 A;  2DZK A;  2KX3 A;  2LXA A;  2MQJ A;  4GOC A;  5AZH A;  4BKS A;  3APC A;  3QJZ A;  2RGF A;  4P7I A;  2NPT B;  2V4L A;  3DCG A;  4MDK E;  1UBI A;  1E8Y A;  2N1W A;  4N9F 4;  4BBN C;  2A5U A;  3EHV A;  4CHK A;  2G4D B;  4K7S A;  4BFR A;  5JHB A;  3L0W B;  2IY0 B;  3W1S C;  3Q3F A;  1WX7 A;  2FNJ B;  2K1F A;  1EF1 A;  2LXC A;  2JRH A;  4B95 A;  1WI0 A;  3QIJ A;  4FJY A;  5TR5 A;  2JPH A;  3QX1 A;  4HCP B;  2K8H A;  4NQL B;  4AWJ A;  3H7P B;  1E5W A;  2M4N A;  1I42 A;  2LVP A;  2DYO A;  4HPL B;  2UWQ A;  4EZK A;  2J0K A;  2DZM A;  4MJS B;  2KJH B;  3A9K A;  1WZ0 A;  3ALB A;  2MBB B;  3QC8 B;  2CU1 A;  3VXW A;  1GC7 A;  5AZF A;  3PRZ A;  3ZTC A;  1WX9 A;  1J19 A;  1V49 A;  1P1A A;  2LRU A;  1Z5S B;  2JF5 A;  5IA7 A;  4GXB A;  4IUM B;  3MHS D;  4RM8 A;  5KHQ A;  3KH0 A;  4FJZ A;  2G4S A;  2GOW A;  1UGM A;  4E71 A;  3V61 A;  2LD9 A;  1S1Q B;  3R7Q A;  3O65 B;  1WXV A;  1MG8 A;  3NZU A;  2K8B A;  1Q5W B;  4HK2 A;  4LDT B;  3V6C B;  3ZKJ C;  4E74 A;  5E6P A;  2DAF A;  3UQA A;  2WX1 A;  2Z0E B;  3Q3J A;  2BKR B;  4GIV A;  1OGW A;  2KAN A;  4EZL A;  2MBQ A;  3H9D A;  4J6I A;  2KFK A;  1H4R A;  3X23 A;  4BOS C;  5L83 A;  3LJ3 A;  5J2R A;  2IO0 B;  2C60 A;  4AUQ C;  1WJ4 A;  4DHJ D;  1WXM A;  1V5T A;  2KTR A;  3UGB B;  2HJ8 A;  2EMS A;  3N32 A;  4BBN F;  4X57 B;  2MRP A;  4W9F A;  3PLU A;  4JQW C;  2WWZ A;  2RR9 A;  3S2A A;  4BKT A;  4URK A;  4IW0 A;  1NI2 A;  3RT3 B;  3R3M A;  3HIZ A;  2MSE D;  4GDK B;  4FUL A;  4I6P A;  2KWV B;  2NPT A;  4XZ4 A;  5J17 A;  1GG3 A;  1L7Y A;  4IWO A;  2KDI A;  1UZX B;  3VUY A;  3AU5 A;  5LXH A;  2XK5 B;  2C7M B;  3UIO B;  3A4S C;  3UIN B;  1RLF A;  3RUI B;  5JH5 C;  2KN5 A;  3K9P B;  3ZNG C;  3ML8 A;  4LJP B;  3KVF B;  3VAW A;  2ZNV C;  1V86 A;  3N3K B;  4GGQ A;  3VUW A;  4HWI B;  1V81 A;  2B3A A;  2KVR A;  3H7P A;  4OVU A;  3IFW B;  3TIX A;  4ANU A;  2EMT A;  4DHJ B;  1A5R A;  2NBV B;  2NR2 A;  4EEW A;  4MJS A;  2KWC A;  2G3Q B;  1C1Y B;  1WGH A;  2YLM A;  3EFU A;  3VDZ A;  3U8Z A;  2IZV B;  2O6V A;  3KUC B;  3PRP B;  2CS4 A;  4HXD A;  3APF A;  1EUV B;  1TGZ B;  4WWN A;  4B9K A;  2L3Z A;  4KZ0 A;  2O2V B;  1PQS A;  3VHT C;  2C5L C;  3GZN I;  3RZW C;  2KJ6 A;  1S3S G;  1BT0 A;  3WAO A;  2AWT A;  4WAA A;  4NJ7 A;  4MH0 E;  2K39 A;  2DZI A;  2KDE B;  1GNU A;  4DHZ B;  2Z0D B;  1TTN A;  2PPH A;  3L08 A;  4RMA A;  2IO2 B;  4NJ6 A;  2D11 A;  3PS6 A;  5GMV A;  4BOZ B;  2R2Q A;  2BKF A;  3DPD A;  3RUL A;  3WIM A;  3M3J A;  3PT2 B;  4MGK E;  2K25 A;  4EZJ A;  1D3Z A;  3DOW A;  1UD7 A;  3ZDT A;  2D2Q A;  1SIF A;  2DHZ A;  4K7U A;  3WAM A;  2LUE A;  5CHF A;  2KC1 A;  4TQ1 A;  3EC8 A;  3A33 B;  4GSW A;  4FBJ B;  2DZJ A;  1WFY A;  2JUO A;  3T9L A;  1TBE A;  1P3Q U;  2FCN A;  2ZPY A;  4HCN B;  4MEL A;  1E8X A;  3NZS A;  1RFA A;  3QWZ B;  4IM0 A;  5DPW A;  2WYQ A;  2JY6 A;  2XK5 A;  1SGH A;  4WJP A;  2C7N B;  2M8S A;  1WE6 A;  3APD A;  4GDL B;  3ZVV A;  2ZCB A;  4IM2 A;  2LGY A;  2DAJ A;  3T8M A;  2DEN B;  1V6E A;  3QAQ A;  4M8M A;  2HE7 A;  4JIO U;  4ANX A;  3A9J A;  4M8N A;  4DDG D;  5CHV C;  3ZW3 A;  3VQI A;  4FLH A;  3AI5 A;  4IWQ A;  1ZW7 A;  3CST A;  4EFO A;  2MP2 B;  2KC2 A;  4LJO B;  1XT9 B;  3W1Y A;  1P0R A;  2KJR A;  1YD8 U;  1KM7 A;  3NY5 A;  4JLC A;  3PGE A;  5LXI B;  5BO4 B;  2LGD A;  3QHT A;  1SE9 A;  4W9C A;  4PYZ A;  4KIK B;  5L95 C;  1WF9 A;  3JW0 X;  2IO3 B;  2CKH B;  3SHQ A;  2OOB B;  3WAL A;  4EKU A;  1WRD B;  3D32 A;  2GBJ A;  4JL9 A;  3ZTD A;  3SD5 A;  4KZC A;  3L10 B;  3RYT A;  3ZRC A;  2KNB A;  2O2V A;  3DVG Y;  3OAW A;  2KDF B;  4OVV A;  2NBW B;  4NAW B;  4W9D A;  2LVO A;  2C9W B;  3ONS A;  4FN2 A;  3PTF C;  4RM9 A;  1FXT B;  5D6J B;  2N9E B;  1WXA A;  3I3T B;  3VTV A;  4BVU C;  3AU4 A;  3WAN A;  2PE9 A;  3UIP B;  1ZKH A;  5AZG A;  5J18 A;  2FID A;  3HM3 A;  5HKH A;  4F7Z A;  1UH6 A;  2MX2 A;  2PEA A;  4FHJ A;  1EF5 A;  1AAR A;  3HM6 X;  5DPS A;  1WXS A;  2M0X A;  4BKS D;  3DBS A;  4DHZ E;  1VCB A;  2DYM A;  1E90 A;  3ENE A;  3VFK A;  3NHE B;  1WZ3 A;  1KOT A;  3HHM A;  3QAR A;  2WX0 A;  1HE8 A;  3PRM B;  4G11 A;  4GMV A;  4NPN A;  2L76 A;  3ZLZ A;  2J0J A;  2L00 B;  4WJQ A;  2BYV E;  3A4R A;  1V80 A;  3H6N A;  3B08 A;  3BIN A;  2BPS A;  1H8C A;  1IP9 A;  3ML9 A;  2ZCC A;  1LM8 B;  3K9O B;  3P2B A;  3TMP B;  1I35 A;  2GBN A;  3MTN B;  1ISN A;  1WIA A;  2K8C A;  4NNJ B;  4F8C B;  3DQV A;  3DBL I;  4FAD A;  1LXD A;  1WX8 A;  2LI5 A;  4K81 A;  3SU8 X;  2N7D A;  2KWU B;  4G0N B;  2D10 A;  2L8J A;  3B0A A;  2KMA A;  3L54 A;  5C1Z A;  2MP2 A;  4JGH B;  4WJO A;  1XD3 B;  4XX5 A;  3A1Q B;  5LLI A;  2BF8 B;  3DVN U;  2KTF A;  4G3X B;  4ANV A;  4F1S A;  3IVF A;  2MBE A;  4GN1 A;  3W1S A;  1YIW A;  2GBM A;  4KIK A;  3RCZ A;  5JHA A;  2VRR B;  2GBK A;  2JVC A;  3L13 A;  2N9P C;  3N30 A;  4KSK C;  2R2O A;  4E3C A;  1J8C A;  4NQK E;  3ZDM C;  1KJT A;  2ZJD A;  2V3S A;  4M0W B;  5D2M B;  5E6N A;  1WR1 A;  1IPG A;  2CHW A;  3M63 B;  1GJZ A;  3VH3 B;  4ZRI A;  3H1U A;  2FCQ A;  4WJN A;  4GB9 A;  1UBQ A;  2UYZ B;  1WR6 E;  2CHX A;  1WJ6 A;  3DVG X;  4FA6 A;  1WMH B;  4WQO B;  5CX3 A;  4CO7 A;  2RPQ A;  4DBG A;  2MCN B;  1R4N I;  2KX0 A;  2L0F A;  3PPA A;  1J0G A;  2NS5 A;  1VD2 A;  1T0Y A;  3PV1 A;  3QK0 A;  4II3 B;  4HDO A;  4DDI D;  1C3T A;  3VUX A;  2Y5B B;  5KHO A;  4KVG B;  2K6D B;  4W9J A;  2J7Q B;  2I1K A;  1P9D U;  5DPR A;  1RRB A;  3VVW B;  4I6N B;  4MGI E;  4KDI C;  4GDK A;  2HD5 B;  5E6O A;  3QA8 A;  5C23 A;  3WA0 A;  4DWF A;  3LDZ E;  2KZR A;  3KW5 B;  3U7D A;  2KFK B;  3IBE A;  3KUZ A;  1NDD A;  1Z2M A;  3IG3 A;  2V1Y A;  4ASW C;  2KTR B;  3ZRF A;  4II2 B;  4LCD E;  4ICV A;  3ZNI D;  1OTR B;  2BYF A;  2M1M A;  2IY1 B;  2JZZ A;  2O6V D;  4TKN A;  1GC6 A;  3V6E B;  2ZEQ A;  3A1Q A;  2AL6 A;  3KYC D;  3ZUN A;  1E8Z A;  1CMX B;  1Q1O A;  3BY4 B;  1WYW B;  2LRW A;  3OJ4 B;  4TV3 A;  2NCN A;  3DBR I;  4HDQ A;  2LWP A;  1M94 A;  3V62 A;  4LDT D;  2JT4 B;  3MJW A;  5EDS A;  2JRI B;  1LQB A;  2N1V A;  4TUU A;  4ZRJ A;  1WY8 A;  4HPM B;  3L17 A;  2CR5 A;  2RSU A;  2WDT B;  3OJ3 A;  1NBF C;  2ZVO A;  4AP4 C;  5IAA C;  4ANW A;  4XC2 A;  2JXX A;  2KMC A;  2FAZ A;  2M17 A;  1F9J A;  1GUA B;  3PSE B;  2MW5 A;  2KO3 A;  2YVC A;  3DDC B;  1WJN A;  2BWE S;  5CHW A;  1KLV A;  2DYB A;  2I1J A;  1V9J A;  2GBR A;  3JSV B;  1WGY A;  3TCA A;  1WMH A;  3EEC A;  4ZYN A;  1YJ1 A;  1ZGU B;  3PLV A;  3IHP C;  2O6V B;  1UEL A;  4PS8 A;  1P98 A;  2L0T A;  1TZ1 A;  2KFJ A;  1G6J A;  3VTW A;  5JZE B;  1Q0W B;  2BYE A;  4W9I A;  5CTR C;  3SDL C;  1L2N A;  3PHX B;  2LGX A;  1V5O A;  2FCS A;  1V2Y A;  3B1L X;  3M62 B;  4ZRK A;  2OJR A;  3WAP A;  2AEH A;  2KXJ A;  4AOF A;  4A3O A;  4TQ0 A;  4MGZ E;  1WGR A;  3TL5 A;  5FR6 A;  3DVN V;  3JVZ X;  2FIF A;  2QHO A;  2IO1 B;  4KV2 A;  3V60 A;  2D07 B;  2N9X A;  1JRU A;  3PZD A;  1WE7 A;  1WM2 A;  3HK0 A;  3KUD B;  4GDL A;  1OEY J;  1WM3 A;  4HVB A;  2C7H A;  4IG7 B;  2XEW A;  2KK8 A;  2NVU I;  2G45 B;  2N7E A;  4G50 A;  4W9E A;  4W9H A;  3H7S A;  4BKG A;  1XQQ A;  3DBH I;  2D3G A;  1R4M I;  4W9K A;  2ZZP B;  1YX6 B;  5DPT A;  2MLB A;  4YL8 A;  4NY0 A;  2KHW B;  2DX5 B;  4MSQ B;  2BWF A;  3CSF A;  1Y8R C;  3M95 A;  2MWS B;  2ASQ A;  3QQ8 B;  2N4F A;  4IC7 B;  1OEY A;  2FUH B;  4DK5 A;  2L05 A;  2CHZ A;  2HTH A;  2KD0 A;  2W9N A;  2REX A;  3RZF A;  4CYE A;  1K8R B;  2RD0 A;  2XBB C;  3X0W A;  3AXC A;  3NOB A;  4FJV B;  4IWP A;  5G55 A;  4GU2 A;  2KKC A;  2LVQ A;  2PE6 B;  3R66 C;  4I6L B;  4EUT A;  2KLG A;  3A9J B;  4NAW A;  4W9L A;  3UQB A;  3TBL D;  2J0M A;  2NBU A;  3NS8 A;  3OLM D;  1IYF A;  2PJH A;  3PHW B;  3QCA A;  1X1M A;  4MSM B;  2K6Q A;  2JWZ A;  1E7V A;  2KDB A;  3ECI A;  3ZO5 B;  2AYO B;  2AL3 A;  3AUL A;  4HJK A;  4WWO A;  2KLC A;  2Z59 B;  3JSV A;  4PYU A;  4W9G A;  1U4A A;  3U30 A;  4DXA B;  1E7U A;  3A9K B;  1LFD A;  2L7R A;  3CMM B;  4KSL C;  4PS3 A;  3ZNH B;  5D7G A;  3VH4 B;  4A3P A;  4B6W A;  3ZNZ B;  3ZIM A;  2EKE C;  2ZNV B;  1WGG A;  1WGD A;  4MGY E;  4ZDV A;  2A4Z A;  1YQB A;  1QZE A;  5AEK B;  1WJU A;  4AJW A;  2ZVN A;  3C0R B;  2LAS A;  1RAX A;  3VTU A;  4FHK A;  2ZPN A;  2FCM A;  2MA9 B;  3CF6 E;  3UF8 A;  1E8W A;  4MM3 A;  1OQY A;  4AJY B;  2KQS A;  2LJ5 A;  4KDL B;  4WWP A;  2IYD B;  4K1R B;  3GOE A;  4HLE A;  3L16 A;  4K7W A;  4MEM A;  2LZ6 A;  3JYU A;  4ICU A;  5D94 A;  2KOX A;  2JZ3 B;  4IM3 A;  2IBI B;  3PVL A;  4A20 A;  1YX5 B;  4EOY A;  2KQ7 A;  2GMI C;  3R7R A; 
#chains in the Genus database with same CATH topology
 1HEZ E;  2MBH A;  4PS7 A;  2MBO A;  2Q5W D;  3TJP A;  4YSX B;  2RGF A;  4MH8 A;  4P7I A;  2JU6 X;  4YSZ B;  1C9F A;  4N58 A;  1TKG A;  1E8Y A;  2N1W A;  3NVW A;  3EHV A;  3N20 C;  4CHK A;  4K7S A;  5BMH A;  3AED B;  4HJG E;  3Q3F A;  1WX7 A;  2PIA A;  4MAC A;  2FNJ B;  2K1F A;  3DHG C;  4B95 A;  1WI0 A;  5TR5 A;  2JPH A;  1I42 A;  2DYO A;  2QDF A;  4EZK A;  2J0K A;  3BYY B;  4A8X C;  1KFY B;  2XN9 C;  3ALB A;  3VXW A;  3PRZ A;  1V49 A;  3MJ5 A;  3DBR B;  2N0S B;  5KHQ A;  3KH0 A;  5HI1 A;  3V61 A;  4ARI A;  4C7Y A;  4HKZ E;  4LDT B;  3FKY A;  1GAQ B;  2KAN A;  3MP9 A;  1H4R A;  5IN7 A;  2WQY B;  4AUQ C;  1WJ4 A;  4WUR A;  1TT5 B;  2PW9 A;  2HJ8 A;  3N32 A;  2JQR B;  4X57 B;  2J42 A;  2MRP A;  3S2A A;  2LHE A;  4URK A;  3HIZ A;  2MSE D;  4I6P A;  4XZ4 A;  2KWV B;  2NPT A;  3VUY A;  2W3S A;  3AU5 A;  1UUP A;  1WWT A;  5BYS A;  3UIO B;  3V3X A;  3LYY A;  2JSV X;  2KN5 A;  3K9P B;  3ZNG C;  2B3A A;  1C4P A;  4XE0 A;  3H7P A;  4ANU A;  2EMT A;  4EEW A;  1HXY D;  1WGH A;  3I57 A;  4RGO S;  3U8Z A;  2O6V A;  4HXD A;  2O2V B;  1E10 A;  4JX1 C;  2KJ6 A;  1S3S G;  2V9H A;  4MH0 E;  2KDE B;  4ZOH C;  2Z0D B;  2W54 A;  2PPH A;  3L08 A;  2IO2 B;  2D11 A;  3PS6 A;  4ARC A;  2R2Q A;  4K3C A;  3DPD A;  4MGK E;  1UD7 A;  5CHF A;  2WXF A;  2EKI A;  1QOB A;  1TBE A;  1P3Q U;  2JYE A;  2ZPY A;  3AE7 B;  4IM0 A;  2XK5 A;  1ZOY B;  1XLO A;  2C7N B;  2M8S A;  3APD A;  4WH4 A;  3ZVV A;  2GLS A;  4IM2 A;  2ACZ B;  3CWI A;  3T8M A;  4M8M A;  4DDG D;  5CHV C;  2GI9 A;  1ZW7 A;  3W1Y A;  4HEA 1;  5FKA C;  1P0R A;  1L6V A;  2KJR A;  1YD8 U;  3NY5 A;  1D5Z C;  3VR8 B;  4OZB A;  4PYZ A;  4KIK B;  3JW0 X;  3R8B A;  3D32 A;  4JL9 A;  4KZC A;  3NVY A;  3ZRC A;  1LO5 D;  1I4H A;  3OAW A;  2KDF B;  1CQV A;  1SBB B;  2C9W B;  1F2R C;  5AUK A;  1XCT L;  2PE9 A;  1KF6 B;  1ZKH A;  5G5G A;  1UH6 A;  1AYF A;  4FHJ A;  1EF5 A;  1P7F A;  1WXS A;  4BKS D;  3RFZ B;  1WYG A;  2DYM A;  2D5G A;  3VFK A;  3IXS A;  2WXR A;  4GMV A;  2J0J A;  2L00 B;  4KGS A;  4WJQ A;  1QOG A;  3H6N A;  1HZ6 A;  3BIN A;  2BPS A;  1H8C A;  2ZCC A;  3P2B A;  3TMP B;  2INC C;  3N1Y C;  3MTN B;  1WIA A;  4HPP A;  4F8C B;  1LXD A;  1WX8 A;  2LI5 A;  1YN4 A;  2KWU B;  4HRO A;  3L54 A;  2R61 A;  3A1Q B;  2MJ3 A;  2WXP A;  4IKG A;  4F1S A;  3DBH B;  2CU3 A;  3RCZ A;  5JHA A;  2VRR B;  1L4D B;  2IGH A;  4YWG G;  4NQK E;  4JWS C;  1FCL A;  1ZDV A;  1K53 A;  4BZA A;  3M63 B;  1UWX A;  2MJD A;  4D2K A;  1WR6 E;  4FA6 A;  4CO7 A;  2KX0 A;  3PPA A;  2NS5 A;  4II3 B;  2WP9 B;  3AE6 B;  3VUX A;  2K5P A;  4KVG B;  2BB6 A;  2K6D B;  1WXQ A;  4W9J A;  2BS3 B;  2J7Q B;  2M56 B;  1PUT A;  1JRO A;  3QA8 A;  1OFF A;  4DWF A;  3LDZ E;  3U7D A;  2KFK B;  3IBE A;  1VLB A;  1NDD A;  4ASW C;  5EE9 A;  1DGJ A;  2KTR B;  3ZRF A;  4II2 B;  4LCD E;  4ICV A;  2PVG C;  4RGT A;  2AQ1 B;  2IY1 B;  2JZZ A;  4LNF A;  4YXD B;  1GC6 A;  1E8Z A;  1WYW B;  3AE8 B;  2LWP A;  1M94 A;  4LDT D;  5EDS A;  4TUU A;  2N1V A;  2PKO A;  2K9X A;  1TZO A;  4WIP A;  4DQO C;  3TEX A;  1NBF C;  5IAA C;  4ANW A;  1QOA A;  2FAZ A;  2M17 A;  1F9J A;  3RI7 C;  3PSE B;  4N6E B;  4Q2J A;  1WJN A;  5H92 C;  1KLV A;  2AX5 A;  2I1J A;  1WMH A;  2QJL A;  3IHP C;  1UEL A;  3BVZ A;  1TY2 A;  2KFJ A;  1G6J A;  5JZE B;  1Q0W B;  5CTR C;  3PHX B;  3B1L X;  3MC8 A;  3M62 B;  5FR3 A;  4MGZ E;  3TSS A;  2FIF A;  4ITK A;  4P1B C;  2N9X A;  1OEY J;  4HVB A;  3AEB B;  2C7H A;  3U4E G;  2NVU I;  2G45 B;  3H7S A;  4BKG A;  3DBH I;  2D3G A;  2ZZP B;  1YX6 B;  2BQQ A;  2DWQ A;  3ZJU A;  2DX5 B;  2BWF A;  5TSS A;  4US8 A;  1Y8R C;  2N4F A;  4DK5 A;  4XGA B;  3T3N A;  1SB3 C;  4CYE A;  3X0W A;  2PMV A;  5G55 A;  2KKC A;  3I9V 1;  3R66 C;  2PLP A;  3AE4 B;  2V3N A;  2KLG A;  3A9J B;  4W9L A;  2NBU A;  2QEJ C;  2N9L A;  3AUL A;  2AL3 A;  1L4Z B;  1JRP A;  2INP E;  3U30 A;  1I4P A;  3CMM B;  3ZGZ A;  1ESF A;  4XDD A;  4A3P A;  1QT9 A;  1C79 A;  2D3B A;  3U2S C;  3IT4 B;  4ZHP A;  3VTU A;  1JAL A;  1E8W A;  4K1R B;  3GOE A;  1L5P A;  3L16 A;  1N62 A;  4MEM A;  1I4X A;  1D5X C;  4EOY A;  2OHF A;  2KQ7 A;  1T0R C;  3R7R A;  3GE8 C;  1ET6 A;  2BGF A;  2MQJ A;  2LXA A;  5AZH A;  1I4Q A;  1N60 A;  2NPT B;  3FC4 A;  1UBI A;  1K50 A;  5JHB A;  1SF0 A;  4JPS A;  2IY0 B;  2LHD A;  2LXC A;  1WSP A;  4HCP B;  1XLQ A;  2K8H A;  2RMM A;  4AWJ A;  3H7P B;  1E5W A;  2UWQ A;  1ZDX A;  4DXF A;  1V8C A;  1WZ0 A;  3QC8 B;  2QIE B;  5AZF A;  3ZTC A;  1WX9 A;  2LRU A;  1P1A A;  5IA7 A;  4IUM B;  3MHS D;  2LD9 A;  3V6C B;  4HK2 A;  3C19 A;  5E6P A;  3UQA A;  4GIV A;  4CQN A;  4EZL A;  2KYW A;  3P4P B;  2KFK A;  3V05 A;  2HTM E;  2WXN A;  3E56 A;  2KTR A;  1GB1 A;  4OW0 A;  4M01 A;  3PLU A;  4JQW C;  1FXA A;  4BKT A;  1XEE A;  2Y3A A;  4GDK B;  2WDQ B;  1Q10 A;  2X38 A;  4RF0 A;  1TS4 A;  4R3D A;  2XK5 B;  4OZC A;  1WRI A;  3A4S C;  3UIN B;  3U7Z A;  3DHI C;  1JWB D;  1T6B X;  3ML8 A;  4LJP B;  1BML C;  3VUW A;  2ZNV C;  3DBL B;  4GGQ A;  4LNN A;  1JWM D;  3B2F A;  2KVR A;  3AE5 B;  3IFW B;  4OVU A;  4DHJ B;  1JML A;  1FCC C;  2VH1 A;  2NR2 A;  4MJS A;  2QSD A;  3SFE B;  1C1Y B;  3EFU A;  2YLM A;  3ZYY X;  3VDZ A;  2IZV B;  5H8Y E;  3Q6B A;  1TYG B;  1VDV A;  4B9K A;  4KZ0 A;  5HFY A;  1PQS A;  3GZN I;  2AWT A;  4WAA A;  1XO3 A;  2K39 A;  4DHZ B;  1GNU A;  1TTN A;  4RMA A;  4BOZ B;  1SXT A;  3T3O A;  4H2A A;  2BKF A;  1XXG A;  5C3J B;  2IGG A;  1QOF A;  3EA6 A;  1CK1 A;  2DHZ A;  4K7U A;  5I4D A;  2LUE A;  4TQ1 A;  3EC8 A;  2DZJ A;  2JUO A;  2LJI A;  3T9L A;  4HCN B;  1SE3 A;  1TKE A;  1XCQ L;  2KDM A;  3OWE B;  4B0M A;  2RDH A;  4MEL A;  1E8X A;  1K52 A;  3NZS A;  5DPW A;  2WYQ A;  2IJ0 A;  3TEY A;  2KWD A;  1SGH A;  4WJP A;  1N5X A;  3QAQ A;  2NMQ A;  4QAY A;  3AEA B;  4JIO U;  1UWM A;  1NYR A;  2GB1 A;  3A9J A;  3P4R B;  4M8N A;  4N59 A;  4FLH A;  4IWQ A;  4LJO B;  1XT9 B;  2DLB A;  1KM7 A;  2BVC A;  4YSY B;  4RGN A;  5BO4 B;  1WF9 A;  2W82 A;  2JXT A;  2QMT A;  3SD5 A;  3RYT A;  4K3B A;  4W9D A;  2LVO A;  3URY A;  3RPF C;  3ONS A;  4FN2 A;  4TMA B;  1FXT B;  3FIL B;  1PGB A;  3VTV A;  3WAN A;  2WHI A;  3ZJV A;  5J18 A;  4C00 A;  5HKH A;  5C2T B;  2MX2 A;  2M0X A;  3DBS A;  1R7S A;  1Y56 A;  1YMH E;  3NHE B;  1KOT A;  3HHM A;  2WXK A;  4G11 A;  1F52 A;  1GB4 A;  3A4R A;  1TS3 A;  3K9O B;  1I35 A;  1FRR A;  2GBN A;  1WGK A;  3Q8B A;  4NNJ B;  3DBL I;  4FAD A;  3TEZ A;  3SU8 X;  2N7D A;  4G0N B;  3B0A A;  1MFW A;  2KMA A;  2D3A A;  2NTT A;  2MP2 A;  4WJO A;  4XX5 A;  3DVN U;  3IVF A;  1R4M B;  4A55 A;  1EU3 A;  2L1A A;  5GXG B;  3W1S A;  3Q8A A;  2JZP A;  5BYQ A;  3L13 A;  1N61 A;  2N9P C;  2YEP F;  2R2O A;  3P1M A;  2V4I B;  2ZJD A;  3Q8C A;  4B0E A;  2HJ1 A;  3VRB B;  1VJK A;  2MH7 A;  3Q3N C;  4WJN A;  2J4X A;  1L0Y B;  2UYZ B;  2CHX A;  1WMH B;  1AW7 A;  2RPQ A;  3AE2 B;  2MCN B;  1ZUD 2;  2WXO A;  3RN9 C;  4LNK A;  1L0V B;  3ZXR A;  1FFV A;  1VD2 A;  1T0Y A;  3UI3 A;  1SIJ A;  1PGX A;  5KHO A;  3SR6 A;  4EE2 A;  2I1K A;  3J9C A;  1QIL A;  1RRB A;  4OVZ A;  4MGI E;  4GDK A;  2HD5 B;  5E6O A;  3KW5 B;  2FE8 A;  4USA A;  2V1Y A;  2KMM A;  2WS3 B;  2KQ4 X;  1OTR B;  3U52 E;  1RM6 C;  2O6V D;  2G1E A;  2MHJ A;  3ZUN A;  5EE0 A;  1CMX B;  1Q1O A;  3BY4 B;  2XNA C;  5IOI A;  3OJ4 B;  2NCN A;  1N5W A;  3DBR I;  4HDQ A;  1JQ4 A;  2L52 A;  2JT4 B;  3MC9 A;  2JRI B;  4IOI E;  4ZRJ A;  1T5X D;  2BT6 A;  4M00 A;  2WXG A;  1NI3 A;  1MJD A;  2BBC A;  2WXQ A;  4NJC A;  4LLG M;  1E0Z A;  2KO3 A;  5CHW A;  2DYB A;  1V9J A;  3TCA A;  3EEC A;  4ZYN A;  2I2Y A;  1STE A;  2WLB A;  1YNT E;  1TZ1 A;  3NVV A;  3VTW A;  4MT5 A;  3SDL C;  4XWW A;  1L2N A;  2OJR A;  2KXJ A;  4AOF A;  5FR6 A;  2UU7 A;  3DVN V;  2L83 A;  2CJO A;  1JRU A;  1TS2 A;  3PZD A;  3PO0 A;  3AE3 B;  4IG7 B;  2N7E A;  2NTS A;  2J52 A;  4G50 A;  2DNF A;  2QC8 A;  1R4M I;  4W9K A;  5DPT A;  1M4V A;  4YL8 A;  4NY0 A;  3BK2 A;  2MWS B;  3QQ8 B;  4IC7 B;  2FUH B;  2HTH A;  2KD0 A;  2REX A;  1K8R B;  2RD0 A;  4S17 A;  1QF6 A;  1ACC A;  3DHH C;  4FJV B;  4S0R A;  4I6L B;  3UQB A;  2J0M A;  3OLM D;  2PJH A;  3MHZ A;  3PHW B;  2VZK B;  1HZ5 A;  4MSM B;  3FIL A;  2JWZ A;  3ZO5 B;  3ECI A;  2AYO B;  3P4Q B;  1T0S C;  2ICI A;  2KLC A;  4PYU A;  5HG2 A;  1I4R A;  4DXA B;  1KLU D;  1E7U A;  1DOY A;  4KSL C;  4OHJ A;  3HRD D;  5D7G A;  4UDU C;  4B6W A;  2ZNV B;  1WGG A;  1WGD A;  1UGJ A;  2A4Z A;  1YQB A;  5AEK B;  1WJU A;  2LFI A;  2ZVN A;  2ZPN A;  4GLS C;  3Q8E A;  1D5M C;  1VZ7 A;  1C4A A;  2FCM A;  4AJY B;  1HTO A;  1V1P B;  4WWP A;  2IYD B;  1MG4 A;  4HLE A;  2LZ6 A;  3JYU A;  4ICU A;  1BUI C;  2KOX A;  3PVL A;  1R4N B;  1FNW A;  1FNV A;  3KYD D;  5DCN A;  1EO6 A;  3KWV A;  3PRE A;  2DZK A;  2KX3 A;  4GOC A;  3APC A;  4ACF A;  3QJZ A;  2H89 B;  2V4L A;  3DCG A;  4MDK E;  2A5U A;  3AN1 A;  1KTK A;  5EE3 A;  2J53 A;  2E3T A;  3L0W B;  2Z8L A;  3AE9 B;  4FJY A;  2M4N A;  1C4C A;  2DZM A;  4MJS B;  1IGD A;  2WNM A;  2CU1 A;  3AEG B;  1NEN B;  4GXB A;  4RM8 A;  2WXI A;  3IAM 1;  4BAX A;  2G4S A;  2GOW A;  3R7Q A;  1MG8 A;  3Q3M C;  3NZU A;  1IUE A;  4RF1 A;  2WDR B;  2WX1 A;  2Z0E B;  3OG5 A;  1E6E B;  1I4G A;  3H9D A;  3X23 A;  4BOS C;  3LJ3 A;  2IO0 B;  1WXM A;  1V5T A;  2JX5 A;  2RR9 A;  4LNI A;  1YN3 A;  2HDE A;  2MEK A;  2WXJ A;  1ROE A;  4FXC A;  5J17 A;  1KH0 A;  4IWO A;  2KDI A;  1UZX B;  3BII D;  2C7M B;  1RLF A;  3RUI B;  1LGR A;  2LGI A;  1IGC A;  3VAW A;  3N3K B;  1V86 A;  4HWI B;  1AWD A;  3BYT B;  1FO4 A;  1A5R A;  1TJE A;  2AQ2 B;  3KUC B;  3PRP B;  1OQQ A;  1EUV B;  1TGZ B;  1OQR A;  2IPK D;  2C5L C;  3RZW C;  1V1O A;  4P16 A;  1BT0 A;  2B76 B;  1KRH A;  4AS1 A;  5GMV A;  1B1Z A;  1EU4 A;  1D3Z A;  3P63 A;  3ZXV A;  2D2Q A;  2BB5 A;  1YQ3 B;  4FBJ B;  3AV8 A;  1FD6 A;  3GS2 A;  4YTP B;  3Q69 A;  3QWZ B;  2JY6 A;  2FBW B;  1WE6 A;  3BK1 A;  4GDL B;  2BW2 A;  2ZCB A;  2LGY A;  3RNA C;  5T8I A;  1V6E A;  4RNA A;  3RNF C;  4RCO A;  3VQI A;  3CST A;  4EFO A;  2MP2 B;  2KC2 A;  2WGS A;  3AEC B;  1UNS A;  2VH2 A;  2IO3 B;  2RDG A;  3SHQ A;  4L2Y A;  1WRD B;  3DWG C;  1ZXI A;  3BVM A;  2AQ3 B;  2NBW B;  3AEE B;  3PTF C;  1F1H A;  2N9E B;  1TS5 A;  3AU4 A;  1J7A A;  4OZA A;  1V1P A;  1IBX B;  4F7Z A;  1E7P B;  3I63 C;  4C4V B;  3HVZ A;  1N6Z A;  1D6E C;  4DHZ E;  3R2T A;  3EFC A;  2H88 B;  3AMZ A;  1WZ3 A;  2INN E;  3PRM B;  4NPN A;  2L76 A;  3ZLZ A;  1XLP A;  4YTM B;  2BYV E;  1V80 A;  1IP9 A;  3ML9 A;  1VR9 A;  1LM8 B;  1J7B A;  2VZK D;  4L23 A;  5AUI A;  3DQV A;  1NEK B;  4C80 A;  1MI0 A;  2D10 A;  5LLI A;  2BF8 B;  4ANV A;  5IP4 D;  5MPO A;  2Y5P A;  2K22 A;  2KAJ A;  4GN1 A;  3IAS 1;  3VR9 B;  3O13 A;  2GBK A;  2JVC A;  2G9H D;  3RNG C;  1J8C A;  3ZDM C;  3NZ3 A;  1KJT A;  2M0A A;  3NJT A;  4M0W B;  5D2M B;  1PDX A;  3H1U A;  3N1Z C;  2FCQ A;  4KGT A;  4GB9 A;  1ZP0 B;  1F77 A;  1WJ6 A;  3DVG X;  5G5H A;  2L0F A;  4A90 A;  1J0G A;  2KVZ A;  4J3O D;  3QK0 A;  4RH6 A;  1GPX A;  1P9D U;  4WQM A;  3VVW B;  4I6N B;  1HTQ A;  3WA0 A;  3IG3 A;  2RPV A;  1TIF A;  2I38 A;  2BYF A;  2M1M A;  4TKN A;  3RMK C;  3V6E B;  1QLB B;  3KWL A;  2AL6 A;  3KYC D;  1FFU A;  2LRW A;  3Q14 C;  3NVZ A;  4XWT A;  1KLG D;  3MJW A;  1LQB A;  1FMA D;  1WY8 A;  4HPM B;  3L17 A;  2CR5 A;  2RSU A;  3OJ3 A;  2ZVO A;  2JXX A;  2KMC A;  1TY0 A;  2MW5 A;  4IDI A;  1YJI A;  1WGY A;  1F2R I;  1PFD A;  3EUB 2;  1ZGU B;  4W9I A;  2LUM A;  2LGX A;  1V5O A;  1FPY A;  2FCS A;  4A3O A;  1WGR A;  3W5V B;  4WWM A;  3MFG A;  4EUT A;  1MHX A;  2IO1 B;  1WM2 A;  3HK0 A;  3KUD B;  4GDL A;  2X8X X;  1RWS A;  3PZ7 A;  2XEW A;  2KK8 A;  4RGM A;  3CSF A;  1FRD A;  1JWU D;  3RNC C;  2L05 A;  2BYT A;  4NZL B;  2BS4 B;  3AXC A;  3NOB A;  1N63 A;  1UF0 A;  5BYR A;  4GU2 A;  1FXI A;  3NS1 A;  2LVQ A;  2PE6 B;  2ZW1 A;  5IKC M;  1IYF A;  4C56 C;  1X1M A;  2K6Q A;  1E7V A;  2KDB A;  4KX6 B;  3BWU D;  1L0X B;  2Z59 B;  3JSV A;  4W9G A;  1IBX A;  1SEB D;  3LB8 C;  1T3Q A;  2L7R A;  4C4V A;  3ZIM A;  4MGY E;  1DYQ A;  4KKI A;  4AJW A;  3C0R B;  1JW9 D;  3AE1 B;  1FNU A;  2MA9 B;  3UF8 A;  4MM3 A;  5HHD G;  2K0P A;  1PYW D;  3B9J A;  2IBI B;  3I5J C;  1VZ8 A;  4A6Q A;  1CZP A;  3IT6 B;  3RD2 A;  5G2N A;  3E9S A;  1WH3 A;  4BKS A;  2K3U A;  1RYJ A;  4N9F 4;  3AH7 A;  4BBN C;  1SSN A;  2N9K A;  2G4D B;  4BFR A;  1TKY A;  3NUH B;  4M0W A;  4P6V F;  1DOI A;  3W1S C;  3W2D A;  1EF1 A;  2E6X A;  3P42 A;  2JRH A;  5FK9 C;  3QIJ A;  4ZHO A;  3QX1 A;  4NQL B;  1SJH D;  2LVP A;  4HPL B;  1JWA D;  3ETR A;  2PTL A;  1YOV B;  2KJH B;  3A9K A;  2MBB B;  3DWM A;  1GC7 A;  3KLS X;  2M19 A;  3NG0 A;  3N9Y C;  1J19 A;  1FIQ A;  1Z5S B;  2JF5 A;  1C77 A;  4FJZ A;  5JXV A;  4E71 A;  1UGM A;  3GB1 A;  1SE4 A;  1S1Q B;  3O65 B;  1WXV A;  2K8B A;  1Q5W B;  3ZKJ C;  4E74 A;  2DAF A;  3Q3J A;  2BKR B;  1OGW A;  2MBQ A;  4J6I A;  4HRS A;  5J2R A;  5L83 A;  2C60 A;  2CJN A;  4DHJ D;  3UGB B;  4M02 A;  2EMS A;  3ZQ4 A;  4BBN F;  3PZ8 A;  4W9F A;  2WWZ A;  4IW0 A;  1NI2 A;  3N1X C;  3RT3 B;  3R3M A;  4FUL A;  1YN5 A;  3GE3 C;  1GG3 A;  1L7Y A;  4LK0 M;  5LXH A;  2WU2 B;  3RNB C;  3KQ4 A;  3SEB A;  5JH5 C;  1J7C A;  4ZYS A;  3KVF B;  3H8H A;  3ZJT A;  1V81 A;  3TIX A;  2QCZ A;  2NBV B;  2KWC A;  2G3Q B;  3HUI A;  3BZD B;  3P4S B;  2CS4 A;  1NYQ A;  3APF A;  4P1C C;  4WWN A;  2L3Z A;  1HQR D;  2V3P A;  3VHT C;  4C7Z A;  3WAO A;  4NJ7 A;  2DZI A;  1MVK A;  1QQR A;  2IDY A;  4RFB A;  4NJ6 A;  2SAK A;  3RUL A;  3WIM A;  2RDB C;  3M3J A;  3PT2 B;  2K25 A;  4EZJ A;  2BTE A;  3DOW A;  3ZDT A;  1SIF A;  1I7H A;  4ZRP A;  3WAM A;  2KC1 A;  3A33 B;  4GSW A;  1WFY A;  2FCN A;  3B2G A;  1RFA A;  1D4B A;  4YT0 B;  2DAJ A;  4LTU A;  2DEN B;  2HE7 A;  1ZPS A;  1YJJ A;  4ANX A;  5LNK 1;  1PGA A;  1VRA B;  3ZW3 A;  4LNO A;  3AI5 A;  4O1N A;  1JWS D;  4ZRQ A;  1ENF A;  1SJE D;  4JLC A;  1C78 A;  3PGE A;  3MC0 B;  5LXI B;  2LGD A;  3AB5 A;  3QHT A;  1SE9 A;  4W9C A;  5L95 C;  3WAL A;  2CKH B;  4EKU A;  2OOB B;  4REZ A;  1RFK A;  2GBJ A;  3ZTD A;  3L10 B;  2KNB A;  2O2V A;  3DVG Y;  2MJE A;  4NAW B;  4OVV A;  4RM9 A;  5D6J B;  1WXA A;  3I3T B;  4BVU C;  1EM7 A;  1L6U A;  3UIP B;  5AZG A;  2FID A;  3HM3 A;  3WCQ A;  2PEA A;  1AAR A;  3HM6 X;  5DPS A;  3C8Y A;  1AN8 A;  1VCB A;  1E90 A;  3ENE A;  4PT5 A;  2YEP B;  3Q2A C;  3QAR A;  2WX0 A;  3SFD B;  1HE8 A;  3Q8F A;  2WU5 B;  3B08 A;  1ZXH A;  4TSS A;  3AEF B;  4KKJ A;  4AQ7 A;  1V97 A;  1ISN A;  2K8C A;  4K81 A;  4JE3 B;  2DBY A;  1CJE A;  2L8J A;  5C1Z A;  3RNE C;  4JGH B;  1XD3 B;  4XYC A;  2KTF A;  4G3X B;  2LMC A;  2MBE A;  1YIW A;  2GBM A;  4KIK A;  4KSK C;  3N30 A;  1EWC A;  4E3C A;  2WXM A;  2V3S A;  5E6N A;  1WR1 A;  1P7E A;  1E9M A;  1IPG A;  2CHW A;  2LGS A;  1GJZ A;  3VH3 B;  4ZRI A;  5IO9 A;  2ZW0 A;  1UBQ A;  2FUG 1;  4WQO B;  5CX3 A;  2GRI A;  4DBG A;  1R4N I;  2N7J A;  3W5U B;  1MHH E;  3PV1 A;  3CIR B;  4HDO A;  4DDI D;  1C3T A;  2Y5B B;  2JWU A;  3Q3O C;  1QKZ A;  5DPR A;  3GZN B;  4KDI C;  5C23 A;  2KZR A;  2W55 A;  5D3I B;  2IGD A;  3KUZ A;  1Z2M A;  1JCK B;  4US9 A;  1XLN A;  2WXL A;  4PK1 A;  3ZNI D;  1K51 A;  2ZEQ A;  3A1Q A;  3L4P A;  1C76 A;  4TV3 A;  2Y5C A;  1T0Q C;  1NVI D;  1FM0 D;  1BXT A;  3TUO A;  3V62 A;  1SE2 A;  2W3R A;  5D3D A;  3TEW A;  2WDT B;  4AP4 C;  4XC2 A;  1GUA B;  2KN4 A;  1XF5 L;  2YVC A;  3DDC B;  4DXG A;  2BWE S;  3LXF A;  2GBR A;  2L32 A;  3JSV B;  2WDV B;  1YJ1 A;  2SEB D;  1ET9 A;  2KT7 A;  3PLV A;  2O6V B;  3ABV B;  4PS8 A;  2D3C A;  1P98 A;  2EEL A;  2L0T A;  4NAM A;  2BYE A;  2BS2 B;  1V2Y A;  4L1B A;  4ZRK A;  5EE1 A;  3WAP A;  2AEH A;  4TQ0 A;  3TL5 A;  4JWU C;  4MM3 B;  3JVZ X;  2ON8 A;  2QHO A;  4KV2 A;  3V60 A;  2D07 B;  2QIL A;  1B9R A;  1WE7 A;  3FAH A;  1WM3 A;  3W9C B;  2LEK A;  1GOZ A;  2V0G A;  4W9E A;  4W9H A;  1XQQ A;  2ONQ A;  2KAC A;  5E6J A;  2MLB A;  4YTN B;  3R2I A;  3HVD A;  3EGR A;  2KHW B;  4MSQ B;  2OJW A;  3M95 A;  2TSS A;  2ASQ A;  1OEY A;  2CHZ A;  2WXH A;  2W9N A;  1HA5 A;  1A70 A;  3RZF A;  2XBB C;  4WAF A;  4IWP A;  5BMG A;  4A9A A;  4NAW A;  3TBL D;  4XDC A;  3NS8 A;  3QCA A;  2IND C;  4HJK A;  4WWO A;  1U4A A;  5BMI A;  3A9K B;  1LFD A;  4PS3 A;  3ZNH B;  1DOX A;  3VH4 B;  1EWY C;  1MPE A;  3ZNZ B;  4ZDV A;  2EKE C;  1VZ6 A;  3VRA B;  1ZE3 D;  1FEH A;  1QZE A;  2PVO D;  3AM9 A;  1YQ4 B;  2JYT A;  1RAX A;  2LAS A;  3NRZ A;  4FHK A;  4KGR A;  3BVG A;  3CF6 E;  1OQY A;  2KQS A;  2LJ5 A;  4KDL B;  1F0Z A;  3GP7 A;  4K7W A;  5D94 A;  2OED A;  2JZ3 B;  4IM3 A;  4A20 A;  1YX5 B;  4HKQ A;  2GMI C; 
#chains in the Genus database with same CATH homology
 3KYD D;  5DCN A;  1EO6 A;  2MBH A;  2BGF A;  4PS7 A;  3PRE A;  3RD2 A;  2MBO A;  5G2N A;  3TJP A;  1WH3 A;  2DZK A;  2KX3 A;  2LXA A;  2MQJ A;  4GOC A;  5AZH A;  4BKS A;  3APC A;  3QJZ A;  2RGF A;  4P7I A;  2NPT B;  2V4L A;  3DCG A;  4MDK E;  1UBI A;  1E8Y A;  2N1W A;  4N9F 4;  4BBN C;  2A5U A;  3EHV A;  4CHK A;  2G4D B;  4K7S A;  4BFR A;  5JHB A;  3L0W B;  2IY0 B;  3W1S C;  3Q3F A;  1WX7 A;  2FNJ B;  2K1F A;  1EF1 A;  2LXC A;  2JRH A;  4B95 A;  1WI0 A;  3QIJ A;  4FJY A;  5TR5 A;  2JPH A;  3QX1 A;  4HCP B;  2K8H A;  4NQL B;  4AWJ A;  3H7P B;  1E5W A;  2M4N A;  1I42 A;  2LVP A;  2DYO A;  4HPL B;  2UWQ A;  4EZK A;  2J0K A;  2DZM A;  4MJS B;  2KJH B;  3A9K A;  1WZ0 A;  3ALB A;  2MBB B;  3QC8 B;  2CU1 A;  3VXW A;  1GC7 A;  5AZF A;  3PRZ A;  3ZTC A;  1WX9 A;  1J19 A;  1V49 A;  1P1A A;  2LRU A;  1Z5S B;  2JF5 A;  5IA7 A;  4GXB A;  4IUM B;  3MHS D;  4RM8 A;  5KHQ A;  3KH0 A;  4FJZ A;  2G4S A;  2GOW A;  1UGM A;  4E71 A;  3V61 A;  2LD9 A;  1S1Q B;  3R7Q A;  3O65 B;  1WXV A;  1MG8 A;  3NZU A;  2K8B A;  1Q5W B;  4HK2 A;  4LDT B;  3V6C B;  3ZKJ C;  4E74 A;  5E6P A;  2DAF A;  3UQA A;  2WX1 A;  2Z0E B;  3Q3J A;  2BKR B;  4GIV A;  1OGW A;  2KAN A;  4EZL A;  2MBQ A;  3H9D A;  4J6I A;  2KFK A;  1H4R A;  3X23 A;  4BOS C;  5L83 A;  3LJ3 A;  5J2R A;  2IO0 B;  2C60 A;  4AUQ C;  1WJ4 A;  4DHJ D;  1WXM A;  1V5T A;  2KTR A;  3UGB B;  2HJ8 A;  2EMS A;  3N32 A;  4BBN F;  4X57 B;  2MRP A;  4W9F A;  3PLU A;  4JQW C;  2WWZ A;  2RR9 A;  3S2A A;  4BKT A;  4URK A;  4IW0 A;  1NI2 A;  3RT3 B;  3R3M A;  3HIZ A;  2MSE D;  4GDK B;  4FUL A;  4I6P A;  2KWV B;  2NPT A;  4XZ4 A;  5J17 A;  1GG3 A;  1L7Y A;  4IWO A;  2KDI A;  1UZX B;  3VUY A;  3AU5 A;  5LXH A;  2XK5 B;  2C7M B;  3UIO B;  3A4S C;  3UIN B;  1RLF A;  3RUI B;  5JH5 C;  2KN5 A;  3K9P B;  3ZNG C;  3ML8 A;  4LJP B;  3KVF B;  3VAW A;  2ZNV C;  1V86 A;  3N3K B;  4GGQ A;  3VUW A;  4HWI B;  1V81 A;  2B3A A;  2KVR A;  3H7P A;  4OVU A;  3IFW B;  3TIX A;  4ANU A;  2EMT A;  4DHJ B;  1A5R A;  2NBV B;  2NR2 A;  4EEW A;  4MJS A;  2KWC A;  2G3Q B;  1C1Y B;  1WGH A;  2YLM A;  3EFU A;  3VDZ A;  3U8Z A;  2IZV B;  2O6V A;  3KUC B;  3PRP B;  2CS4 A;  4HXD A;  3APF A;  1EUV B;  1TGZ B;  4WWN A;  4B9K A;  2L3Z A;  4KZ0 A;  2O2V B;  1PQS A;  3VHT C;  2C5L C;  3GZN I;  3RZW C;  2KJ6 A;  1S3S G;  1BT0 A;  3WAO A;  2AWT A;  4WAA A;  4NJ7 A;  4MH0 E;  2K39 A;  2DZI A;  2KDE B;  1GNU A;  4DHZ B;  2Z0D B;  1TTN A;  2PPH A;  3L08 A;  4RMA A;  2IO2 B;  4NJ6 A;  2D11 A;  3PS6 A;  5GMV A;  4BOZ B;  2R2Q A;  2BKF A;  3DPD A;  3RUL A;  3WIM A;  3M3J A;  3PT2 B;  4MGK E;  2K25 A;  4EZJ A;  1D3Z A;  3DOW A;  1UD7 A;  3ZDT A;  2D2Q A;  1SIF A;  2DHZ A;  4K7U A;  3WAM A;  2LUE A;  5CHF A;  2KC1 A;  4TQ1 A;  3EC8 A;  3A33 B;  4GSW A;  4FBJ B;  2DZJ A;  1WFY A;  2JUO A;  3T9L A;  1TBE A;  1P3Q U;  2FCN A;  2ZPY A;  4HCN B;  4MEL A;  1E8X A;  3NZS A;  1RFA A;  3QWZ B;  4IM0 A;  5DPW A;  2WYQ A;  2JY6 A;  2XK5 A;  1SGH A;  4WJP A;  2C7N B;  2M8S A;  1WE6 A;  3APD A;  4GDL B;  3ZVV A;  2ZCB A;  4IM2 A;  2LGY A;  2DAJ A;  3T8M A;  2DEN B;  1V6E A;  3QAQ A;  4M8M A;  2HE7 A;  4JIO U;  4ANX A;  3A9J A;  4M8N A;  4DDG D;  5CHV C;  3ZW3 A;  3VQI A;  4FLH A;  3AI5 A;  4IWQ A;  1ZW7 A;  3CST A;  4EFO A;  2MP2 B;  2KC2 A;  4LJO B;  1XT9 B;  3W1Y A;  1P0R A;  2KJR A;  1YD8 U;  1KM7 A;  3NY5 A;  4JLC A;  3PGE A;  5LXI B;  5BO4 B;  2LGD A;  3QHT A;  1SE9 A;  4W9C A;  4PYZ A;  4KIK B;  5L95 C;  1WF9 A;  3JW0 X;  2IO3 B;  2CKH B;  3SHQ A;  2OOB B;  3WAL A;  4EKU A;  1WRD B;  3D32 A;  2GBJ A;  4JL9 A;  3ZTD A;  3SD5 A;  4KZC A;  3L10 B;  3RYT A;  3ZRC A;  2KNB A;  2O2V A;  3DVG Y;  3OAW A;  2KDF B;  4OVV A;  2NBW B;  4NAW B;  4W9D A;  2LVO A;  2C9W B;  3ONS A;  4FN2 A;  3PTF C;  4RM9 A;  1FXT B;  5D6J B;  2N9E B;  1WXA A;  3I3T B;  3VTV A;  4BVU C;  3AU4 A;  3WAN A;  2PE9 A;  3UIP B;  1ZKH A;  5AZG A;  5J18 A;  2FID A;  3HM3 A;  5HKH A;  4F7Z A;  1UH6 A;  2MX2 A;  2PEA A;  4FHJ A;  1EF5 A;  1AAR A;  3HM6 X;  5DPS A;  1WXS A;  2M0X A;  4BKS D;  3DBS A;  4DHZ E;  1VCB A;  2DYM A;  1E90 A;  3ENE A;  3VFK A;  3NHE B;  1WZ3 A;  1KOT A;  3HHM A;  3QAR A;  2WX0 A;  1HE8 A;  3PRM B;  4G11 A;  4GMV A;  4NPN A;  2L76 A;  3ZLZ A;  2J0J A;  2L00 B;  4WJQ A;  2BYV E;  3A4R A;  1V80 A;  3H6N A;  3B08 A;  3BIN A;  2BPS A;  1H8C A;  1IP9 A;  3ML9 A;  2ZCC A;  1LM8 B;  3K9O B;  3P2B A;  3TMP B;  1I35 A;  2GBN A;  3MTN B;  1ISN A;  1WIA A;  2K8C A;  4NNJ B;  4F8C B;  3DQV A;  3DBL I;  4FAD A;  1LXD A;  1WX8 A;  2LI5 A;  4K81 A;  3SU8 X;  2N7D A;  2KWU B;  4G0N B;  2D10 A;  2L8J A;  3B0A A;  2KMA A;  3L54 A;  5C1Z A;  2MP2 A;  4JGH B;  4WJO A;  1XD3 B;  4XX5 A;  3A1Q B;  5LLI A;  2BF8 B;  3DVN U;  2KTF A;  4G3X B;  4ANV A;  4F1S A;  3IVF A;  2MBE A;  4GN1 A;  3W1S A;  1YIW A;  2GBM A;  4KIK A;  3RCZ A;  5JHA A;  2VRR B;  2GBK A;  2JVC A;  3L13 A;  2N9P C;  3N30 A;  4KSK C;  2R2O A;  4E3C A;  1J8C A;  4NQK E;  3ZDM C;  1KJT A;  2ZJD A;  2V3S A;  4M0W B;  5D2M B;  5E6N A;  1WR1 A;  1IPG A;  2CHW A;  3M63 B;  1GJZ A;  3VH3 B;  4ZRI A;  3H1U A;  2FCQ A;  4WJN A;  4GB9 A;  1UBQ A;  2UYZ B;  1WR6 E;  2CHX A;  1WJ6 A;  3DVG X;  4FA6 A;  1WMH B;  4WQO B;  5CX3 A;  4CO7 A;  2RPQ A;  4DBG A;  2MCN B;  1R4N I;  2KX0 A;  2L0F A;  3PPA A;  1J0G A;  2NS5 A;  1VD2 A;  1T0Y A;  3PV1 A;  3QK0 A;  4II3 B;  4HDO A;  4DDI D;  1C3T A;  3VUX A;  2Y5B B;  5KHO A;  4KVG B;  2K6D B;  4W9J A;  2J7Q B;  2I1K A;  1P9D U;  5DPR A;  1RRB A;  3VVW B;  4I6N B;  4MGI E;  4KDI C;  4GDK A;  2HD5 B;  5E6O A;  3QA8 A;  5C23 A;  3WA0 A;  4DWF A;  3LDZ E;  2KZR A;  3KW5 B;  3U7D A;  2KFK B;  3IBE A;  3KUZ A;  1NDD A;  1Z2M A;  3IG3 A;  2V1Y A;  4ASW C;  2KTR B;  3ZRF A;  4II2 B;  4LCD E;  4ICV A;  3ZNI D;  1OTR B;  2BYF A;  2M1M A;  2IY1 B;  2JZZ A;  2O6V D;  4TKN A;  1GC6 A;  3V6E B;  2ZEQ A;  3A1Q A;  2AL6 A;  3KYC D;  3ZUN A;  1E8Z A;  1CMX B;  1Q1O A;  3BY4 B;  1WYW B;  2LRW A;  3OJ4 B;  4TV3 A;  2NCN A;  3DBR I;  4HDQ A;  2LWP A;  1M94 A;  3V62 A;  4LDT D;  2JT4 B;  3MJW A;  5EDS A;  2JRI B;  1LQB A;  2N1V A;  4TUU A;  4ZRJ A;  1WY8 A;  4HPM B;  3L17 A;  2CR5 A;  2RSU A;  2WDT B;  3OJ3 A;  1NBF C;  2ZVO A;  4AP4 C;  5IAA C;  4ANW A;  4XC2 A;  2JXX A;  2KMC A;  2FAZ A;  2M17 A;  1F9J A;  1GUA B;  3PSE B;  2MW5 A;  2KO3 A;  2YVC A;  3DDC B;  1WJN A;  2BWE S;  5CHW A;  1KLV A;  2DYB A;  2I1J A;  1V9J A;  2GBR A;  3JSV B;  1WGY A;  3TCA A;  1WMH A;  3EEC A;  4ZYN A;  1YJ1 A;  1ZGU B;  3PLV A;  3IHP C;  2O6V B;  1UEL A;  4PS8 A;  1P98 A;  2L0T A;  1TZ1 A;  2KFJ A;  1G6J A;  3VTW A;  5JZE B;  1Q0W B;  2BYE A;  4W9I A;  5CTR C;  3SDL C;  1L2N A;  3PHX B;  2LGX A;  1V5O A;  2FCS A;  1V2Y A;  3B1L X;  3M62 B;  4ZRK A;  2OJR A;  3WAP A;  2AEH A;  2KXJ A;  4AOF A;  4A3O A;  4TQ0 A;  4MGZ E;  1WGR A;  3TL5 A;  5FR6 A;  3DVN V;  3JVZ X;  2FIF A;  2QHO A;  2IO1 B;  4KV2 A;  3V60 A;  2D07 B;  2N9X A;  1JRU A;  3PZD A;  1WE7 A;  1WM2 A;  3HK0 A;  3KUD B;  4GDL A;  1OEY J;  1WM3 A;  4HVB A;  2C7H A;  4IG7 B;  2XEW A;  2KK8 A;  2NVU I;  2G45 B;  2N7E A;  4G50 A;  4W9E A;  4W9H A;  3H7S A;  4BKG A;  1XQQ A;  3DBH I;  2D3G A;  1R4M I;  4W9K A;  2ZZP B;  1YX6 B;  5DPT A;  2MLB A;  4YL8 A;  4NY0 A;  2KHW B;  2DX5 B;  4MSQ B;  2BWF A;  3CSF A;  1Y8R C;  3M95 A;  2MWS B;  2ASQ A;  3QQ8 B;  2N4F A;  4IC7 B;  1OEY A;  2FUH B;  4DK5 A;  2L05 A;  2CHZ A;  2HTH A;  2KD0 A;  2W9N A;  2REX A;  3RZF A;  4CYE A;  1K8R B;  2RD0 A;  2XBB C;  3X0W A;  3AXC A;  3NOB A;  4FJV B;  4IWP A;  5G55 A;  4GU2 A;  2KKC A;  2LVQ A;  2PE6 B;  3R66 C;  4I6L B;  4EUT A;  2KLG A;  3A9J B;  4NAW A;  4W9L A;  3UQB A;  3TBL D;  2J0M A;  2NBU A;  3NS8 A;  3OLM D;  1IYF A;  2PJH A;  3PHW B;  3QCA A;  1X1M A;  4MSM B;  2K6Q A;  2JWZ A;  1E7V A;  2KDB A;  3ECI A;  3ZO5 B;  2AYO B;  2AL3 A;  3AUL A;  4HJK A;  4WWO A;  2KLC A;  2Z59 B;  3JSV A;  4PYU A;  4W9G A;  1U4A A;  3U30 A;  4DXA B;  1E7U A;  3A9K B;  1LFD A;  2L7R A;  3CMM B;  4KSL C;  4PS3 A;  3ZNH B;  5D7G A;  3VH4 B;  4A3P A;  4B6W A;  3ZNZ B;  3ZIM A;  2EKE C;  2ZNV B;  1WGG A;  1WGD A;  4MGY E;  4ZDV A;  2A4Z A;  1YQB A;  1QZE A;  5AEK B;  1WJU A;  4AJW A;  2ZVN A;  3C0R B;  2LAS A;  1RAX A;  3VTU A;  4FHK A;  2ZPN A;  2FCM A;  2MA9 B;  3CF6 E;  3UF8 A;  1E8W A;  4MM3 A;  1OQY A;  4AJY B;  2KQS A;  2LJ5 A;  4KDL B;  4WWP A;  2IYD B;  4K1R B;  3GOE A;  4HLE A;  3L16 A;  4K7W A;  4MEM A;  2LZ6 A;  3JYU A;  4ICU A;  5D94 A;  2KOX A;  2JZ3 B;  4IM3 A;  2IBI B;  3PVL A;  4A20 A;  1YX5 B;  4EOY A;  2KQ7 A;  2GMI C;  3R7R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...