2EKIA

Solution structures of the tgs domain of human developmentally-regulated gtp-binding protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Developmentally-regulated GTP-binding protein 1
publication title Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ekiA00
1DOXA 3ZYYX 1TJEA 1JW9D 1PUTA 1JRPA 4C7ZA 5MPOA 1WWTA 3VR9B 3W5UB 1SF0A 3FC4A 1I7HA 1E0ZA 3B2FA 1DOIA 2K9XA 1GPXA 2PVOD 3CIRB 3AE7B 3AEAB 3HUIA 4N58A 3SR6A 1F0ZA 2EKIA 1OQRA 1YJIA 1IUEA 1YQ3B 4N59A 1VJKA 1AWDA 3AE8B 4ZHOA 4YSZB 2E3TA 2PIAA 2Q5WD 3AV8A 4WWMA 3P4RB 1XLQA 3NS1A 3L4PA 3DWMA 2M56B 3DWGC 1J7CA 2ACZB 2DWQA 4YT0B 3P63A 1RYJA 1QOFA 4C80A 1A70A 3P4QB 4JX1C 2JQRB 3NVZA 2G1EA 3PO0A 4YSXB 3AE9B 4KX6B 1QOAA 1XLNA 2W3SA 5EE3A 1TKYA 4HRSA 4IDIA 1JWBD 4WQMA 2FBWB 1B9RA 2K22A 1XLPA 2AX5A 3AM9A 3W5VB 1DGJA 1RM6C 1KRHA 5EE0A 2QJLA 4YTMB 3ABVB 1N5WA 2PKOA 3AE3B 2HTME 3CWIA 2H88B 1EWYC 1J7AA 2M19A 4YSYB 5H8YE 1NENB 2Y5CA 3B2GA 1N62A 1XLOA 5EE1A 2BS3B 4YXDB 2WDQB 4JWSC 1NYRA 4N6EB 1ZUD2 1UWMA 3BIID 1KFYB 2WU5B 5G5HA 5C3JB 1J7BA 1FMAD 3EUB2 3KWLA 4FXCA 4YTNB 1JWAD 1NI3A 1PFDA 1JQ4A 2B76B 1FRDA 5C2TB 5G5GA 1NEKB 2MH7A 1V97A 2W3RA 1CZPA 2CJNA 2WLBA 2WU2B 1R7SA 2BS2B 1E7PB 1YQ4B 2BT6A 3AH7A 1GAQB 1WRIA 2CU3A 2N0SB 4US9A 2H89B 1AYFA 1FIQA 1WGKA 2DBYA 1OQQA 3AEEB 1VLBA 2LEKA 1ZP0B 2PVGC 4JWUC 5EE9A 2W55A 1VDVA 2MJ3A 3LB8C 4HROA 1FXAA 3AN1A 1FFVA 3SFDB 1FM0D 2KAJA 3HVZA 4US8A 1XO3A 4P6VF 1CJEA 1SB3C 4ITKA 3ETRA 3LXFA 4LTUA 3HRDD 1WYGA 3AE2B 5GXGB 3AB5A 2L52A 1KF6B 2K5PA 1QF6A 5AUIA 3W9CB 3AMZA 3AECB 4YTPB 4A9AA 2WDVB 3WCQA 1T3QA 2JX5A 1JALA 3NRZA 3AE6B 3AE1B 3AEDB 1ZOYB 1QOGA 4C7YA 5AUKA 1DOYA 1L6UA 1SIJA 1N60A 5H92C 1N61A 2WQYB 1E6EB 1TYGB 3NVYA 3AE5B 1L5PA 4ZHPA 1FXIA 1ROEA 2WS3B 1FO4A 2QIEB 3P4SB 2W54A 1E9MA 1TKEA 1RWSA 2WDRB 1L0VB 1FRRA 1V8CA 1OFFA 1L6VA 2KMMA 2L83A 2MJEA 3AE4B 3B9JA 2CJOA 3AEFB 1N63A 3P1MA 1QT9A 1TKGA 2MJDA 3AEBB 1E10A 3VRBB 3VRAB 1RFKA 3NVVA 3RPFC 3VR8B 3FAHA 1WXQA 1PDXA 2BS4B 1ZXIA 1N5XA 1NYQA 1JROA 3NVWA 2WP9B 3SFEB 1QOBA 3AEGB 2OHFA 3P4PB 1QLBB 1NVID 1FFUA 1YJJA 4ZOHC 4USAA
chains in the Genus database with same CATH superfamily
5J2RA 3W5UB 2J4XA 3I57A 4LK0M 4R3DA 2K8HA 2LHEA 2LGYA 4GIVA 4E71A 3DBHB 5IA7A 1L0XB 3H7PA 3P4QB 2ZJDA 4A55A 2C7NB 2W3SA 2XBBC 3RNAC 2WXRA 4YTMB 4ARCA 2GBKA 2V9HA 1M94A 2NS5A 2Z8LA 2BS3B 2GRIA 3CSFA 4F1SA 1FMAD 3EUB2 1NI3A 4MJSA 4O1NA 1FRDA 3QA8A 2MH7A 2KFKA 2WU2B 2DX5B 4E3CA 1YQ4B 3RYTA 2DBYA 1OQQA 3RN9C 3LB8C 4EE2A 1V5TA 4W9JA 2NTTA 1WR1A 1KLUD 1MVKA 3LXFA 1E90A 1QF6A 4K3CA 1KTKA 1VR9A 3U30A 3IVFA 1C4PA 3IAS1 4A8XC 2MBQA 3AE6B 1ZOYB 1V2YA 4WJQA 3DBRI 2KLGA 2DENB 1TYGB 3DBLI 2BYFA 4FJZA 5BYRA 4AP4C 1HZ5A 3QWZB 2W54A 3H8HA 2XK5B 4P16A 1YD8U 1KH0A 2Y5PA 2J0KA 4HKZE 3PRZA 3ZLZA 3RI7C 4IKGA 1QKZA 1GUAB 1E8ZA 4WQOB 3NVVA 1GOZA 1JRUA 2ZEQA 1K52A 3SFEB 2OJRA 1VZ7A 1YN4A 1PQSA 3ZYYX 1TJEA 3Q3MC 1PUTA 3BVZA 1FNVA 3TEZA 4LJOB 1TIFA 1V1PB 2ZPNA 5JXVA 4LDTB 4LLGM 3L4PA 1V80A 1ZDXA 4TSSA 4K7WA 3EFCA 4HRSA 3MHZA 3P2BA 2JSVX 2M19A 1J7AA 1JWMD 5D3IB 2OOBB 1ZUD2 2M0XA 3C0RB 3BIID 5C3JB 1WJNA 2KDMA 2ONQA 2KK8A 1NBFC 2N9LA 3CMMB 3UIOB 4OHJA 1ACCA 3DHIC 4HPLB 2KDIA 2KWVB 2KDFB 2I1KA 3A9JA 4IOIE 1D4BA 4OVZA 4A9AA 4BKGA 1T3QA 2PW9A 1S3SG 4PYUA 4YL8A 2C60A 2FCSA 2WXHA 2KO3A 2LRUA 3L16A 2IPKD 3X0WA 2KN5A 4W9DA 3PT2B 4P1BC 5IOIA 2DYBA 3TCAA 4W9LA 1L6VA 2L3ZA 1WH3A 1QT9A 3VRBB 1JMLA 3RPFC 3ZO5B 2BTEA 1PDXA 2SEBD 2HE7A 4DHZE 1WRDB 2YVCA 2FAZA 4C56C 4XDCA 5MPOA 4ANWA 2JXTA 5G55A 4N58A 4ASWC 3N32A 2QILA 1MFWA 5IAAC 2XNAC 2NR2A 2MRPA 4GDKA 3V60A 3AV8A 2DYMA 5BYQA 3VHTC 3RNGC 1J7CA 4KSLC 3ZNZB 2KX3A 2ZPYA 4EEWA 1TKYA 4RF0A 2QEJC 2MW5A 2WXNA 4OZCA 4FA6A 3RNFC 1NENB 4FHKA 1FD6A 4WJPA 3MC0B 2WDQB 2WU5B 1KJTA 2B76B 3KWVA 2K8CA 1WXMA 3A9KB 4PS7A 2JZZA 1V6EA 4BBNF 2AL6A 1KOTA 2FCQA 4ZYSA 2WGSA 1VLBA 2ZCCA 3B08A 3OWEB 1P0RA 2KAJA 2LVQA 3W1YA 1Y56A 3VQIA 3ZTDA 2N7DA 4II2B 3DBHI 2D3GA 4CQNA 2WDVB 3DVGY 2JVCA 1JALA 2V0GA 1UZXB 3NUHB 3AE1B 4ANVA 1Y8RC 4C7YA 2LJIA 2G9HD 1WE7A 5HG2A 4DBGA 4C4VB 1FO4A 2CKHB 1C77A 3PHXB 2KC2A 4GDLB 1C76A 1IP9A 5AEKB 3AEBB 3AULA 1SJED 4L1BA 1AN8A 2M0AA 2LUMA 3M62B 5CX3A 1FFUA 4PT5A 4OZAA 1TY0A 5CHFA 4P7IA 1SE2A 4B95A 3VH3B 1P1AA 4EZJA 1UWXA 1GPXA 4II3B 3H1UA 2LUEA 1QQRA 2YEPB 4NNJB 4XYCA 2QHOA 5IO9A 3DWMA 3Q69A 4YSXB 3PO0A 2FIFA 1MPEA 4RH6A 4KX6B 3H7SA 4ACFA 4XE0A 1DYQA 3L08A 2WXOA 1RFAA 4KDIC 4AJWA 3QAQA 1I4QA 3R3MA 4A6QA 1N62A 1NDDA 1WGYA 1T6BX 2A5UA 2OEDA 3BVGA 3WANA 2KWCA 1CZPA 1HEZE 2CJNA 4OZBA 3Q3NC 4DQOC 1WRIA 2WWZA 4TUUA 4HK2A 4MEMA 3NZSA 4JWUC 3PTFC 3N30A 4FJVB 3DBLB 2BBCA 1UBQA 3ONSA 1UGJA 2CHZA 3ZKJC 4W9CA 1L2NA 1KLGD 1HA5A 3KUCB 2O2VA 1TS4A 2NVUI 2LVOA 1BT0A 2WNMA 1WJ4A 4LDTD 3QCAA 4ZHPA 1EU3A 1SEBD 3Q14C 2WS3B 2L83A 2KANA 4EZLA 3AEFB 5BMIA 2KJRA 4DDGD 1LFDA 4A90A 2V1YA 2BWES 5HFYA 1C4AA 1WXQA 3KYCD 1PGAA 4N9F4 3IBEA 2YLMA 2N9XA 2PJHA 3TL5A 2LZ6A 2KVZA 4ZRKA 1ZDVA 4IWOA 3VR9B 5KHOA 3B2FA 2PVOD 2MP2B 5CHVC 3ZGZA 1TS3A 1R4NB 1P7EA 1WY8A 4HCNB 3A1QB 2OJWA 2E3TA 4WWMA 4JIOU 3V6CB 2JQRB 2KLCA 1VCBA 4AQ7A 2ZW1A 4W9KA 1ZW7A 3T3OA 2IJ0A 3APDA 3LYYA 2PMVA 3MHSD 3HVDA 3BZDB 3R8BA 3S2AA 1PFDA 2ICIA 3M63B 4XC2A 2LMCA 2ZVOA 3MC9A 4RF1A 4W9HA 3IHPC 4WIPA 1FIQA 1XCQL 3DHHC 4HROA 4HXDA 3SFDB 1MG4A 4FJYA 4REZA 1EF5A 4NPNA 3U52E 5FR3A 1SGHA 2IY0B 3UI3A 2JX5A 3PPAA 2ON8A 5GMVA 2KKCA 3TEXA 3W2DA 3MC8A 5H92C 3DCGA 2FIDA 4JE3B 3ZIMA 4GOCA 2KT7A 5HI1A 2D10A 1K51A 2J42A 4K7UA 2MJDA 1YX5B 3FILB 2JU6X 1ZKHA 5BMGA 3PVLA 3P4PB 4AS1A 1WIAA 3NY5A 4ZOHC 2RDGA 4GGQA 4G11A 3VH4B 3OG5A 2TSSA 1LXDA 1YJ1A 3U8ZA 1QILA 3TMPB 4NAWB 2JY6A 2ZW0A 5E6PA 2HJ1A 2PE9A 3K9PB 2MCNB 2FCNA 3L54A 2JF5A 1BMLC 4FULA 2NTSA 5EE3A 3AU5A 3TSSA 2VH2A 1T0YA 1KRHA 3DDCB 2QJLA 3I5JC 4AJYB 4NQKE 4MDKE 2Y5CA 2ZVNA 1GJZA 2KYWA 2KFJA 5BYSA 2RMMA 3WAMA 4K1RB 2QC8A 2R61A 4MELA 4EOYA 3VTWA 3RNEC 1PYWD 3W1SC 1L4DB 3C19A 2RD0A 2MHJA 3OLMD 4NJCA 1H8CA 3ETRA 5LLIA 4QAYA 3VTUA 3I9V1 3OJ3A 1UBIA 1BXTA 2XK5A 3DVNV 4BKSA 3NRZA 2VZKD 1IGCA 2I1JA 5D7GA 2KQ7A 1SIJA 1N61A 2N9PC 2BKRB 4W9GA 2CR5A 3AE5B 3ZJVA 1WMHB 2BYEA 4W9FA 1WJ6A 3P4SB 4ZRQA 1XT9B 1L0VB 1FRRA 2AYOB 2JXXA 1UF0A 2KX0A 3RNCC 4KGSA 2PEAA 1E10A 3PREA 3NVWA 1N5XA 4LNIA 4AUQC 2L0FA 4TMAB 3N9YC 4JPSA 4D2KA 3BVMA 3AEAB 2BKFA 4GN1A 4IUMB 3RD2A 3V3XA 2EKEC 4ARIA 3ZXVA 1I4XA 2I38A 3CF6E 1WI0A 1XLNA 4WQMA 2FBWB 5JH5C 2L0TA 3ZUNA 3MTNB 1RM6C 4ZYNA 1Z2MA 3AI5A 4YXDB 4B0EA 4AOFA 2G45B 1SJHD 4Q2JA 1JQ4A 1F77A 4NJ6A 1VD2A 2JUOA 3N1XC 4G50A 5C2TB 2W3RA 2EMTA 4RGTA 2KDEB 2MBBB 4US9A 4ZHOA 1YN5A 4JLCA 2GB1A 4KIKB 5HHDG 4FHJA 3Q8FA 4P6VF 3T9LA 1R4NI 3HRDD 2UYZB 3ZQ4A 5IP4D 4BZAA 5EDSA 1GG3A 3ZDTA 1E8WA 2RR9A 3GE3C 5AUKA 1L6UA 2MBEA 2IBIB 1K53A 2CJOA 2D3AA 2LGSA 2LRWA 2D3CA 3ML9A 3VR8B 1MI0A 4JGHB 3VVWB 3IFWB 2X8XX 5AZFA 1R4MB 1D5ZC 2G4DB 4IM0A 2KN4A 3ZJUA 3MJ5A 3SU8X 1SSNA 3LJ3A 4MSMB 4LNNA 4FBJB 2R2OA 3BINA 2IGHA 1AWDA 1SBBB 3P4RB 1TT5B 3Q8EA 4RMAA 4YT0B 2R2QA 1D5MC 1WX9A 3AE9B 2DYOA 4G3XB 2IYDB 1JWBD 3EGRA 3A9KA 2M1MA 4EUTA 2PTLA 1TTNA 3E9SA 3B0AA 5EE1A 3B2GA 4PK1A 3Q8BA 2L7RA 3URYA 3MFGA 2VH1A 3KWLA 1WX7A 3KUDB 1ZE3D 5DPWA 1FEHA 2INCC 3HIZA 4MM3B 4MH0E 1JWUD 2JZ3B 3HHMA 2H89B 2N7JA 1ZP0B 3VFKA 1L0YB 1TZ1A 5IKCM 4US8A 1XO3A 3VTVA 4LTUA 1YX6B 4C4VA 2INNE 2K5PA 4GDLA 1ZGUB 1YIWA 3JW0X 1WX8A 2GBJA 4E74A 4MH8A 2FUHB 3P42A 1FXIA 3TEWA 2HTHA 4CYEA 2M8SA 2YEPF 1N63A 2PPHA 4HEA1 1WGDA 2KWDA 2MLBA 4M02A 2WYQA 1NYQA 1JWSD 3AEGB 3L0WB 4IC7B 2J0JA 1DOXA 1GB4A 2WXKA 1WWTA 4GU2A 1U4AA 1E8YA 2N1VA 1VZ8A 2LI5A 4GDKB 4IM3A 3O13A 2IY1B 3AE7B 3SR6A 1K8RB 3IAM1 1P9DU 3R66C 3OAWA 1IUEA 4N59A 3AE8B 2UWQA 2K1FA 4MGKE 1I4HA 1E7UA 4URKA 1QOFA 2B3AA 1TS5A 2BWFA 4IDIA 3JSVB 1J19A 1AARA 3PLUA 4HDQA 3A4SC 4S17A 3B1LX 3WIMA 4YSYB 5D94A 2C7HA 3IG3A 1J0GA 2C9WB 4RM8A 4MACA 2VZKB 5HKHA 4W9IA 2BS2B 2GMIC 4X57B 2KJHB 3AXCA 2G4SA 2KJ6A 3DVGX 1V86A 1D6EC 1QZEA 3AE2B 5AUIA 4EZKA 3BK1A 1WGRA 3AECB 4I6PA 4A3PA 1S1QB 1WXAA 2DZIA 3KUZA 2D07B 2DZJA 2LASA 2LHDA 1IBXB 4EKUA 2LXAA 2QIEB 2WDRB 3AE4B 1V1OA 3M3JA 4NZLB 5FK9C 4A20A 4XZ4A 4KSKC 5BO4B 1OGWA 4XDDA 4DK5A 4HPMB 1G6JA 1GB1A 2BYVE 2JT4B 2RSUA 3R2IA 4HJKA 3ZRFA 2J7QB 1BUIC 4WURA 3A1QA 1NVID 3V05A 5L95C 4C7ZA 2K3UA 2FE8A 4L23A 4M8NA 1F9JA 2KXJA 3WALA 5IN7A 1L4ZB 2L8JA 2INPE 3APFA 4BAXA 2LGIA 3O65B 2MBOA 4TQ1A 2AQ3B 2DWQA 2V4IB 1A70A 3NVZA 1L7YA 4ZRIA 4S0RA 1MJDA 3CWIA 5T8IA 3L10B 2BQQA 2HDEA 3KVFB 1YOVB 2REXA 2JWZA 1E7VA 1WXSA 1R4MI 3PHWB 4RGNA 4GXBA 1H4RA 4RNAA 2FUG1 1M4VA 2NBWB 1IPGA 1GAQB 2N0SB 2CU3A 2NMQA 3VDZA 4KKIA 3JVZX 3QARA 1FM0D 3SDLC 1CJEA 4XGAB 5AZHA 1CK1A 5GXGB 5J18A 3M95A 1KLVA 2AWTA 1FCLA 1RRBA 1FXTB 2RDBC 4F8CB 3U4EG 2LFIA 4WWPA 4RFBA 3QJZA 2WQYB 1E6EB 3FILA 4DHZB 1WE6A 2NPTA 1UELA 4RGMA 4IG7B 5JHBA 4MGYE 3BYYB 4K3BA 2CS4A 2LXCA 4HVBA 4NAWA 2GOWA 4LNOA 1RAXA 3FAHA 3RUIB 5DCNA 4LJPB 1QLBB 4MT5A 4ANXA 4M0WB 3ENEA 1JW9D 1WGHA 3GZNB 2BF8B 3N1YC 3RT3B 2WXGA 3W1SA 1GNUA 2N7EA 1I7HA 5DPSA 3CIRB 1F0ZA 3HUIA 2AQ2B 1N6ZA 2FNJB 2EKIA 3ZNGC 3PRMB 2L1AA 3PZ8A 3CSTA 3FKYA 3PS6A 3DWGC 4C80A 3TEYA 4BOZB 3L17A 2DHZA 2K22A 1PGXA 2AX5A 3AM9A 1XQQA 3PZDA 5EE0A 1N5WA 2PKOA 3AE3B 3EECA 3U7DA 2MX2A 1UWMA 1YQBA 2RPVA 4CHKA 4YWGG 3MJWA 1XXGA 1TGZB 4NQLB 3NHEB 1AW7A 2Z0DB 1E7PB 2BT6A 2LD9A 3AH7A 2KTRB 1AYFA 1WGKA 3PSEB 4PYZA 4XWTA 4DDID 1EM7A 1C79A 2O6VB 2RPQA 2LVPA 3AN1A 4ITKA 4JL9A 1WMHA 2GBRA 1HXYD 4YTPB 5LXHA 4K7SA 4XWWA 3I3TB 1HTOA 4DWFA 3AEDB 1XD3B 1HTQA 3QC8B 4HKQA 4KZCA 1C3TA 3X23A 3GB1A 2WXIA 3EA6A 1ROEA 1E9MA 3TIXA 3NJTA 3IXSA 2Z59B 1V9JA 1MHXA 3GS2A 1TKGA 2GI9A 2DNFA 2JWUA 4ZDVA 1SXTA 3Q3JA 4LNFA 3TUOA 2MBHA 3KH0A 1F52A 4RGOS 5BMHA 2K9XA 3KQ4A 3WAPA 1TS2A 1EWCA 3PV1A 1MHHE 2K0PA 1OQRA 3OJ4B 3C8YA 1VJKA 3AU4A 2D3BA 2Q5WD 3A4RA 1ZPSA 4IWQA 3Q2AC 5CHWA 4L2YA 3P63A 1Q1OA 1T0RC 2HD5B 1RLFA 1V1PA 2KOXA 3RZWC 1OEYJ 1C78A 5LXIB 1DGJA 3UQBA 5H8YE 2H88B 2W82A 2PE6B 1TY2A 4HJGE 2GBMA 3ZW3A 4N6EB 5L83A 4KIKA 2DZMA 1I4RA 2BVCA 3H7PB 1J7BA 5I4DA 4YTNB 2M17A 3ZVVA 3KLSX 4J3OD 3NG0A 3NZ3A 1V81A 1WZ3A 4BFRA 1R7SA 2X38A 4WJOA 2VRRB 1EO6A 4RM9A 2MA9B 2PVGC 2LEKA 2HJ8A 5EE9A 2W55A 1VDVA 2MJ3A 4DHJB 3LDZE 4ANUA 1CMXB 3EC8A 1Q10A 3DVNU 1YMHE 2D5GA 2V3NA 5J17A 4ICVA 4MJSB 4IWPA 1PGBA 2KFKB 2IO0B 3AMZA 2ZZPB 2WXFA 4M8MA 2FCMA 4NY0A 3QQ8B 1F2RI 1QOGA 1DOYA 4GB9A 4I6NB 1SIFA 4DXFA 4OW0A 3IT6B 2LGDA 2JPHA 1V49A 1OFFA 2MJEA 1FNWA 2WXJA 5LNK1 3P1MA 2J52A 1OEYA 3BYTB 3V61A 1QOBA 1ENFA 1YJJA 1T0SC 4HCPB 2WXPA 3V62A 1WZ0A 3FC4A 3VUYA 1DOIA 2RDHA 1I42A 3D32A 4J6IA 3A33B 3GE8C 4GLSC 2IO2B 3DPDA 4G0NB 2L00B 2N9KA 4WWNA 1UUPA 5D6JB 1B9RA 4MM3A 2PLPA 2Y5BB 2Y3AA 2L05A 1P98A 4A3OA 2V3SA 2WXMA 1XLOA 3PRPB 1P3QU 3Q3OC 1ESFA 5JHAA 1FNUA 1TBEA 2BB6A 1JWAD 3QIJA 4ZRPA 1UH6A 4F7ZA 1F1HA 4M00A 1NEKB 3KW5B 4IM2A 3V6EB 2BYTA 3GZNI 1WR6E 2CU1A 3WA0A 1VRAB 2ASQA 3ZTCA 3HVZA 3MP9A 2IZVB 2K6DB 3RZFA 1XCTL 2L52A 4HPPA 3BY4B 1STEA 5FKAC 1I35A 1LQBA 2DZKA 4OVUA 1D3ZA 3UF8A 1XF5L 3ZRCA 4M01A 3WCQA 3APCA 1VZ6A 3EFUA 3Q3FA 2MEKA 2QMTA 3UQAA 2SAKA 4HLEA 1IYFA 3A9JB 3NVYA 1SE3A 1P7FA 2WHIA 3BWUD 1WM2A 2GLSA 2LJ5A 3N1ZC 2I2YA 1D5XC 2KC1A 2AQ1B 1OQYA 1Q5WB 2M4NA 2WP9B 3ZDMC 1SE9A 1V5OA 4KV2A 4B0MA 2D2QA 3VAWA 3Q8AA 4KGRA 2IO3B 1LM8B 1WYWB 2K6QA 2XEWA 2O6VD 3RCZA 3JSVA 3J9CA 1YJIA 2KVRA 4FLHA 4UDUC 1XEEA 3NS1A 4KKJA 3ZNHB 2IO1B 1GC7A 5E6JA 1E5WA 1UD7A 2NBUA 1QOAA 2BPSA 3SD5A 2J0MA 1TZOA 3W5VB 1I4GA 1X1MA 2AEHA 3ZXRA 1GC6A 3ABVB 3IT4B 2HTME 3Q8CA 1LO5D 2C5LC 4KGTA 4JWSC 1WXVA 4H2AA 5G5HA 2BB5A 2A4ZA 1C4CA 2N1WA 3H9DA 2ZCBA 3QX1A 2KD0A 1C9FA 4W9EA 1C1YB 3DHGC 2JRIB 4HWIB 5G2NA 3ML8A 4B6WA 2QDFA 2KMAA 2KQSA 3Q6BA 3ALBA 1HE8A 1YNTE 1SB3C 3QK0A 1EU4A 2KACA 5C23A 1IBXA 3AB5A 1EUVB 2WDTB 1FPYA 4KZ0A 4AWJA 4FN2A 3T3NA 3HM3A 2KZRA 1I4PA 4LCDE 4OVVA 2DLBA 3PLVA 4TKNA 4FADA 1L5PA 1T0QC 1TKEA 3NOBA 1RWSA 2N4FA 2KMMA 3U7ZA 4B9KA 5AZGA 2DAJA 4HDOA 3ECIA 4WH4A 3BK2A 2CHWA 2IDYA 4GMVA 3VRAB 1OTRB 5E6OA 2K39A 2EMSA 3KYDD 1ZXIA 2IGDA 5E6NA 5TR5A 3N20C 4KVGB 4USAA 1JRPA 3UGBB 4BBNC 4DXGA 1SF0A 2JYEA 3UINB 4DHJD 3HM6X 1HZ6A 2UU7A 4BKSD 3NS8A 1ET9A 1YQ3B 4YSZB 1WJUA 2V4LA 2ZNVB 2MP2A 5FR6A 1WF9A 4JX1C 3GP7A 2KTFA 2KMCA 2GBNA 2WX1A 3DBRB 4KDLB 3GOEA 1J8CA 2KHWB 3I63C 2MWSB 1Z5SB 2WXLA 1EWYC 2KWUB 3QHTA 2MQJA 3RFZB 4FXCA 2ZNVC 5G5GA 1V97A 2WLBA 1Q0WB 1WFYA 4WAFA 2N9EB 1ISNA 1ZXHA 3SHQA 2QCZA 2J53A 3HK0A 3UIPB 3DQVA 1FXAA 3H6NA 4P1CC 5C1ZA 2K8BA 1KF6B 1EF1A 1ET6A 4WJNA 4PS8A 3RNBC 1YN3A 2JRHA 2RGFA 2WX0A 1F2RC 1N60A 3RULA 1SE4A 3VUXA 1CQVA 4MSQB 5CTRC 5TSSA 2O2VB 3EHVA 4DXAB 2D11A 3PZ7A 1V8CA 2LGXA 1FCCC 2IGGA 2XN9C 4M0WA 1WM3A 4BKTA 1K50A 3NZUA 2NCNA 3WAOA 4I6LB 1JROA 2KNBA 2OHFA 5KHQA 4TQ0A 4NJ7A 4BOSC 4JQWC 2K25A 2E6XA 1UGMA 3L13A 1E0ZA 4TV3A 1WGGA 4ICUA 4XX5A 2JYTA 2EELA 2PIAA 2G3QB 1XLQA 4BVUC 2M56B 2ACZB 2L76A 1RYJA 4RCOA 2G1EA 4MGZE 1HQRD 1XLPA 2KQ4X 3VXWA 4PS3A 5D2MB 3VUWA 1E8XA 2KTRA 4GSWA 1NYRA 5D3DA 1B1ZA 2O6VA 4ZRJA 1KFYB 2W9NA 3RMKC 3N3KB 4IW0A 3R2TA 4CO7A 3SEBA 3TJPA 1WSPA 3AEEB 1JCKB 3DOWA 2CHXA 1IGDA 2WXQA 1UNSA 1FFVA 3TBLD 1MG8A 5DPRA 1WYGA 3ZJTA 3W9CB 2JZPA 4LNKA 3JYUA 2NPTB 4WAAA 2V3PA 3T8MA 2DAFA 2MSED 3DBSA 4K81A 3R7RA 1LGRA 2BW2A 5JZEB 2Z0EB 2C7MB 2LWPA 1KM7A 2NBVB 2AL3A 3K9OB 3ZNID 3B9JA 2BGFA 3E56A 4MGIE 1A5RA 4C00A 5DPTA 1RFKA 2INDC 2QSDA 1NI2A 3R7QA 4NAMA 2BS4B 2L32A 3U2SC 3PGEA 2KDBA 1T5XD 4EFOA 4WWOA
chains in the Genus database with same CATH topology
1DOXA 1ZDVA 1GB4A 2WXPA 2WXKA 1WWTA 3VR9B 3W5UB 1VZ8A 4GDKB 3FC4A 3O13A 3B2FA 2J4XA 1DOIA 2RDHA 3I57A 2PVOD 4LK0M 4R3DA 3AE7B 3SR6A 3ZGZA 1TS3A 3IAM1 1P7EA 1IUEA 2LHEA 4N59A 3AE8B 4GLSC 2E3TA 4WWMA 2N9KA 1UUPA 1I4HA 1L0XB 1QOFA 3P4QB 2JQRB 4A55A 1TS5A 2W3SA 4IDIA 4AQ7A 1B9RA 2ZW1A 2PLPA 2Y3AA 2WXRA 4YTMB 3T3OA 4ARCA 2WXMA 2IJ0A 3LYYA 2PMVA 4YSYB 1XLOA 2Z8LA 2BS3B 3BZDB 3HVDA 2GRIA 3R8BA 1ESFA 1FNUA 1FMAD 3EUB2 2BB6A 2VZKB 1JWAD 4MACA 1NI3A 1PFDA 2ICIA 4ZRPA 4O1NA 1FRDA 2LMCA 1NEKB 2MH7A 2WU2B 4RF1A 2BS2B 1YQ4B 4WIPA 2BYTA 2DBYA 1FIQA 1OQQA 1VRAB 1XCQL 3LB8C 4HROA 4EE2A 2NTTA 3SFDB 1KLUD 3HVZA 3MP9A 1MVKA 3LXFA 1D6EC 3AE2B 1XCTL 2L52A 4REZA 1QF6A 5AUIA 1STEA 3BK1A 5FKAC 3U52E 5FR3A 3AECB 1KTKA 1VR9A 1XF5L 3UI3A 3WCQA 2JX5A 1C4PA 2ON8A 3IAS1 4A8XC 1VZ6A 2MEKA 3AE6B 2QMTA 1ZOYB 2SAKA 3TEXA 3W2DA 5H92C 2LHDA 1TYGB 3NVYA 1SE3A 1IBXB 4JE3B 1P7FA 5BYRA 2QIEB 1HZ5A 2W54A 3BWUD 2WDRB 3H8HA 4P16A 1KH0A 1V1OA 3AE4B 5HI1A 2Y5PA 4NZLB 5FK9C 4HKZE 1K51A 2I2YA 1D5XC 2J42A 4IKGA 2MJDA 1QKZA 4XDDA 3FILB 3NVVA 1GB1A 2AQ1B 2JU6X 1GOZA 3R2IA 2WP9B 1K52A 5BMGA 1BUIC 3SFEB 4WURA 3P4PB 1NVID 4AS1A 4B0MA 4ZOHC 3V05A 1VZ7A 2RDGA 1YN4A 3Q8AA 1TJEA 2TSSA 4KGRA 3ZYYX 1PUTA 4C7ZA 3BVZA 2K3UA 2FE8A 1QILA 1FNVA 4NAWB 3TEZA 4L23A 2ZW0A 1L4ZB 3J9CA 1YJIA 2INPE 1V1PB 4UDUC 5JXVA 1XEEA 3NS1A 2LGIA 4KKJA 4LLGM 3L4PA 1BMLC 4TQ1A 2AQ3B 2DWQA 2V4IB 5E6JA 1ZDXA 1A70A 2NTSA 3NVZA 4TSSA 1QOAA 5EE3A 4HRSA 3TSSA 1TZOA 3W5VB 3MHZA 1I4GA 1KRHA 2QJLA 3ABVB 3IT4B 2HTME 2JSVX 2M19A 1LO5D 1J7AA 3CWIA 3Q8CA 5T8IA 2Y5CA 4KGTA 1JWMD 4JWSC 5D3IB 5BYSA 1ZUD2 2HDEA 4H2AA 3BIID 5G5HA 2BB5A 5C3JB 2KDMA 1C4CA 2RMMA 4RGNA 2R61A 1C9FA 4RNAA 2ONQA 2FUG1 1M4VA 1GAQB 2N0SB 2CU3A 1PYWD 2N9LA 1L4DB 2NMQA 4OHJA 4KKIA 4NJCA 1ACCA 1FM0D 1YNTE 1CJEA 1SB3C 3ETRA 1IBXA 1CK1A 1EU4A 2KACA 4IOIE 5GXGB 3AB5A 1D4BA 4OVZA 3I9V1 1FCLA 1BXTA 4A9AA 1T3QA 2PW9A 3T3NA 3U4EG 3NRZA 2LFIA 2VZKD 1IGCA 4RFBA 2WXHA 5D7GA 1I4PA 1SIJA 1N61A 2DLBA 2IPKD 1E6EB 2WQYB 3FILA 3AE5B 1L5PA 3ZJVA 3P4SB 4ZRQA 1TKEA 4RGMA 1RWSA 1L0VB 1FRRA 1L6VA 2KMMA 3U7ZA 3BYYB 4WH4A 4KGSA 3BK2A 1QT9A 2IDYA 1E10A 3VRBB 3VRAB 1JMLA 3RPFC 2BTEA 3FAHA 1PDXA 3NVWA 1ZXIA 1N5XA 2IGDA 2SEBD 1QLBB 4MT5A 4USAA 1JW9D 4C56C 1JRPA 4TMAB 4XDCA 3N9YC 5MPOA 2WXGA 4JPSA 1SF0A 2JXTA 2JYEA 3W1SA 4DXGA 1I7HA 4D2KA 3BVMA 3CIRB 1HZ6A 3AEAB 3HUIA 4N58A 1F0ZA 2AQ2B 1ET9A 3V3XA 2QILA 2EKIA 2XNAC 4ARIA 1YQ3B 4YSZB 2L1AA 3AV8A 2DYMA 3PZ8A 1I4XA 5BYQA 2I38A 3DWGC 1J7CA 4C80A 3TEYA 4JX1C 1XLNA 3GP7A 1TKYA 4RF0A 2QEJC 2FBWB 4WQMA 2K22A 1PGXA 2AX5A 3AM9A 1RM6C 5EE0A 2WXNA 4OZCA 1N5WA 2PKOA 3AE3B 2WXLA 1EWYC 1NENB 1FD6A 4YXDB 3MC0B 2WDQB 2RPVA 1UWMA 4B0EA 4YWGG 2WU5B 1SJHD 3RFZB 4FXCA 4Q2JA 1XXGA 1JQ4A 1F77A 2B76B 3KWVA 5C2TB 5G5GA 1V97A 2W3RA 1AW7A 2WLBA 4RGTA 4WAFA 1E7PB 2BT6A 3AH7A 4US9A 1ZXHA 1AYFA 1WGKA 4ZHOA 4ZYSA 1VLBA 1YN5A 4XWTA 1EM7A 1C79A 2J53A 3OWEB 2GB1A 1FXAA 3AN1A 5HHDG 2KAJA 3Q8FA 4P6VF 1Y56A 4ITKA 3VQIA 3HRDD 3ZQ4A 1KF6B 1ET6A 1HXYD 4YTPB 4XWWA 4CQNA 2WDVB 1YN3A 1JALA 2V0GA 3NUHB 3AE1B 3AEDB 4C7YA 5AUKA 1L6UA 2LJIA 1F2RC 1N60A 4HKQA 1SE4A 1CQVA 2G9HD 5HG2A 3GB1A 2WXIA 3EA6A 5TSSA 1ROEA 1FO4A 1E9MA 1C77A 4GDLB 3PZ7A 1V8CA 3IXSA 1FCCC 2IGGA 2XN9C 1K53A 1MHXA 2CJOA 4M0WA 1C76A 1K50A 3GS2A 1TKGA 3AEBB 2GI9A 2JWUA 1SJED 4L1BA 1AN8A 1SXTA 3VR8B 1MI0A 2M0AA 2LUMA 1JROA 2OHFA 1FFUA 4TQ0A 4PT5A 4OZAA 1D5ZC 1TY0A 3TUOA 4RGOS 2KN4A 3ZJUA 3MJ5A 1SE2A 2E6XA 1SSNA 5BMHA 1E0ZA 1UWXA 2K9XA 1GPXA 3KQ4A 1TS2A 1EWCA 1MHHE 2K0PA 1OQRA 3C8YA 1QQRA 1VJKA 1AWDA 2IGHA 2JYTA 2EELA 2PIAA 1SBBB 2Q5WD 2YEPB 3P4RB 1XLQA 1ZPSA 3Q8EA 3DWMA 2M56B 2ACZB 4YT0B 4L2YA 3P63A 1RYJA 3Q69A 4RCOA 1D5MC 3PO0A 2G1EA 1MPEA 4RH6A 3AE9B 4KX6B 2DYOA 4YSXB 1V1PA 4XE0A 1JWBD 3EGRA 1C78A 1DYQA 1HQRD 1XLPA 2KQ4X 1DGJA 2WXOA 2PTLA 3E9SA 5H8YE 2H88B 1I4QA 2W82A 4A6QA 1TY2A 5EE1A 3B2GA 1N62A 4HJGE 1NYRA 5D3DA 1B1ZA 3Q8BA 1T6BX 4N6EB 3URYA 1KFYB 3MFGA 1I4RA 2OEDA 1J7BA 3KWLA 3BVGA 5I4DA 4YTNB 1ZE3D 3KLSX 4J3OD 1FEHA 3R2TA 3NZ3A 3SEBA 4MM3B 2CJNA 1CZPA 1HEZE 4OZBA 1R7SA 1WSPA 1JWUD 2X38A 4DQOC 1WRIA 2H89B 3AEEB 2PVGC 2LEKA 1ZP0B 2N7JA 4JWUC 1JCKB 2W55A 5EE9A 1VDVA 2MJ3A 1L0YB 1IGDA 2BBCA 1UNSA 1FFVA 2WXQA 4US8A 1Q10A 1XO3A 1UGJA 1YMHE 4LTUA 2D5GA 2V3NA 1WYGA 3ZJTA 1PGBA 1KLGD 1HA5A 2INNE 2K5PA 3W9CB 3AMZA 1TS4A 2JZPA 2WXFA 1F2RI 2V3PA 1QOGA 1DOYA 2WNMA 2BW2A 4MH8A 4DXFA 4ZHPA 4OW0A 1EU3A 1SEBD 1FXIA 3P42A 2WS3B 3IT6B 3TEWA 1OFFA 2L83A 2MJEA 3B9JA 1FNWA 2WXJA 3AEFB 5LNK1 2YEPF 3E56A 5BMIA 1N63A 3P1MA 4A90A 4HEA1 2J52A 1RFKA 2QSDA 2KWDA 5HFYA 1C4AA 1WXQA 3BYTB 2BS4B 1PGAA 4NAMA 1NYQA 1JWSD 2L32A 3U2SC 1QOBA 3AEGB 1T5XD 1ENFA 1YJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DOX A;  3ZYY X;  1TJE A;  1JW9 D;  1PUT A;  1JRP A;  4C7Z A;  5MPO A;  1WWT A;  3VR9 B;  3W5U B;  1SF0 A;  3FC4 A;  1I7H A;  1E0Z A;  3B2F A;  1DOI A;  2K9X A;  1GPX A;  2PVO D;  3CIR B;  3AE7 B;  3AEA B;  3HUI A;  4N58 A;  3SR6 A;  1F0Z A;  2EKI A;  1OQR A;  1YJI A;  1IUE A;  1YQ3 B;  4N59 A;  1VJK A;  1AWD A;  3AE8 B;  4ZHO A;  4YSZ B;  2E3T A;  2PIA A;  2Q5W D;  3AV8 A;  4WWM A;  3P4R B;  1XLQ A;  3NS1 A;  3L4P A;  3DWM A;  2M56 B;  3DWG C;  1J7C A;  2ACZ B;  2DWQ A;  4YT0 B;  3P63 A;  1RYJ A;  1QOF A;  4C80 A;  1A70 A;  3P4Q B;  4JX1 C;  2JQR B;  3NVZ A;  2G1E A;  3PO0 A;  4YSX B;  3AE9 B;  4KX6 B;  1QOA A;  1XLN A;  2W3S A;  5EE3 A;  1TKY A;  4HRS A;  4IDI A;  1JWB D;  4WQM A;  2FBW B;  1B9R A;  2K22 A;  1XLP A;  2AX5 A;  3AM9 A;  3W5V B;  1DGJ A;  1RM6 C;  1KRH A;  5EE0 A;  2QJL A;  4YTM B;  3ABV B;  1N5W A;  2PKO A;  3AE3 B;  2HTM E;  3CWI A;  2H88 B;  1EWY C;  1J7A A;  2M19 A;  4YSY B;  5H8Y E;  1NEN B;  2Y5C A;  3B2G A;  1N62 A;  1XLO A;  5EE1 A;  2BS3 B;  4YXD B;  2WDQ B;  4JWS C;  1NYR A;  4N6E B;  1ZUD 2;  1UWM A;  3BII D;  1KFY B;  2WU5 B;  5G5H A;  5C3J B;  1J7B A;  1FMA D;  3EUB 2;  3KWL A;  4FXC A;  4YTN B;  1JWA D;  1NI3 A;  1PFD A;  1JQ4 A;  2B76 B;  1FRD A;  5C2T B;  5G5G A;  1NEK B;  2MH7 A;  1V97 A;  2W3R A;  1CZP A;  2CJN A;  2WLB A;  2WU2 B;  1R7S A;  2BS2 B;  1E7P B;  1YQ4 B;  2BT6 A;  3AH7 A;  1GAQ B;  1WRI A;  2CU3 A;  2N0S B;  4US9 A;  2H89 B;  1AYF A;  1FIQ A;  1WGK A;  2DBY A;  1OQQ A;  3AEE B;  1VLB A;  2LEK A;  1ZP0 B;  2PVG C;  4JWU C;  5EE9 A;  2W55 A;  1VDV A;  2MJ3 A;  3LB8 C;  4HRO A;  1FXA A;  3AN1 A;  1FFV A;  3SFD B;  1FM0 D;  2KAJ A;  3HVZ A;  4US8 A;  1XO3 A;  4P6V F;  1CJE A;  1SB3 C;  4ITK A;  3ETR A;  3LXF A;  4LTU A;  3HRD D;  1WYG A;  3AE2 B;  5GXG B;  3AB5 A;  2L52 A;  1KF6 B;  2K5P A;  1QF6 A;  5AUI A;  3W9C B;  3AMZ A;  3AEC B;  4YTP B;  4A9A A;  2WDV B;  3WCQ A;  1T3Q A;  2JX5 A;  1JAL A;  3NRZ A;  3AE6 B;  3AE1 B;  3AED B;  1ZOY B;  1QOG A;  4C7Y A;  5AUK A;  1DOY A;  1L6U A;  1SIJ A;  1N60 A;  5H92 C;  1N61 A;  2WQY B;  1E6E B;  1TYG B;  3NVY A;  3AE5 B;  1L5P A;  4ZHP A;  1FXI A;  1ROE A;  2WS3 B;  1FO4 A;  2QIE B;  3P4S B;  2W54 A;  1E9M A;  1TKE A;  1RWS A;  2WDR B;  1L0V B;  1FRR A;  1V8C A;  1OFF A;  1L6V A;  2KMM A;  2L83 A;  2MJE A;  3AE4 B;  3B9J A;  2CJO A;  3AEF B;  1N63 A;  3P1M A;  1QT9 A;  1TKG A;  2MJD A;  3AEB B;  1E10 A;  3VRB B;  3VRA B;  1RFK A;  3NVV A;  3RPF C;  3VR8 B;  3FAH A;  1WXQ A;  1PDX A;  2BS4 B;  1ZXI A;  1N5X A;  1NYQ A;  1JRO A;  3NVW A;  2WP9 B;  3SFE B;  1QOB A;  3AEG B;  2OHF A;  3P4P B;  1QLB B;  1NVI D;  1FFU A;  1YJJ A;  4ZOH C;  4USA A; 
#chains in the Genus database with same CATH topology
 5J2R A;  3W5U B;  2J4X A;  3I57 A;  4LK0 M;  4R3D A;  2K8H A;  2LHE A;  2LGY A;  4GIV A;  4E71 A;  3DBH B;  5IA7 A;  1L0X B;  3H7P A;  3P4Q B;  2ZJD A;  4A55 A;  2C7N B;  2W3S A;  2XBB C;  3RNA C;  2WXR A;  4YTM B;  4ARC A;  2GBK A;  2V9H A;  1M94 A;  2NS5 A;  2Z8L A;  2BS3 B;  2GRI A;  3CSF A;  4F1S A;  1FMA D;  3EUB 2;  1NI3 A;  4MJS A;  4O1N A;  1FRD A;  3QA8 A;  2MH7 A;  2KFK A;  2WU2 B;  2DX5 B;  4E3C A;  1YQ4 B;  3RYT A;  2DBY A;  1OQQ A;  3RN9 C;  3LB8 C;  4EE2 A;  1V5T A;  4W9J A;  2NTT A;  1WR1 A;  1KLU D;  1MVK A;  3LXF A;  1E90 A;  1QF6 A;  4K3C A;  1KTK A;  1VR9 A;  3U30 A;  3IVF A;  1C4P A;  3IAS 1;  4A8X C;  2MBQ A;  3AE6 B;  1ZOY B;  1V2Y A;  4WJQ A;  3DBR I;  2KLG A;  2DEN B;  1TYG B;  3DBL I;  2BYF A;  4FJZ A;  5BYR A;  4AP4 C;  1HZ5 A;  3QWZ B;  2W54 A;  3H8H A;  2XK5 B;  4P16 A;  1YD8 U;  1KH0 A;  2Y5P A;  2J0K A;  4HKZ E;  3PRZ A;  3ZLZ A;  3RI7 C;  4IKG A;  1QKZ A;  1GUA B;  1E8Z A;  4WQO B;  3NVV A;  1GOZ A;  1JRU A;  2ZEQ A;  1K52 A;  3SFE B;  2OJR A;  1VZ7 A;  1YN4 A;  1PQS A;  3ZYY X;  1TJE A;  3Q3M C;  1PUT A;  3BVZ A;  1FNV A;  3TEZ A;  4LJO B;  1TIF A;  1V1P B;  2ZPN A;  5JXV A;  4LDT B;  4LLG M;  3L4P A;  1V80 A;  1ZDX A;  4TSS A;  4K7W A;  3EFC A;  4HRS A;  3MHZ A;  3P2B A;  2JSV X;  2M19 A;  1J7A A;  1JWM D;  5D3I B;  2OOB B;  1ZUD 2;  2M0X A;  3C0R B;  3BII D;  5C3J B;  1WJN A;  2KDM A;  2ONQ A;  2KK8 A;  1NBF C;  2N9L A;  3CMM B;  3UIO B;  4OHJ A;  1ACC A;  3DHI C;  4HPL B;  2KDI A;  2KWV B;  2KDF B;  2I1K A;  3A9J A;  4IOI E;  1D4B A;  4OVZ A;  4A9A A;  4BKG A;  1T3Q A;  2PW9 A;  1S3S G;  4PYU A;  4YL8 A;  2C60 A;  2FCS A;  2WXH A;  2KO3 A;  2LRU A;  3L16 A;  2IPK D;  3X0W A;  2KN5 A;  4W9D A;  3PT2 B;  4P1B C;  5IOI A;  2DYB A;  3TCA A;  4W9L A;  1L6V A;  2L3Z A;  1WH3 A;  1QT9 A;  3VRB B;  1JML A;  3RPF C;  3ZO5 B;  2BTE A;  1PDX A;  2SEB D;  2HE7 A;  4DHZ E;  1WRD B;  2YVC A;  2FAZ A;  4C56 C;  4XDC A;  5MPO A;  4ANW A;  2JXT A;  5G55 A;  4N58 A;  4ASW C;  3N32 A;  2QIL A;  1MFW A;  5IAA C;  2XNA C;  2NR2 A;  2MRP A;  4GDK A;  3V60 A;  3AV8 A;  2DYM A;  5BYQ A;  3VHT C;  3RNG C;  1J7C A;  4KSL C;  3ZNZ B;  2KX3 A;  2ZPY A;  4EEW A;  1TKY A;  4RF0 A;  2QEJ C;  2MW5 A;  2WXN A;  4OZC A;  4FA6 A;  3RNF C;  1NEN B;  4FHK A;  1FD6 A;  4WJP A;  3MC0 B;  2WDQ B;  2WU5 B;  1KJT A;  2B76 B;  3KWV A;  2K8C A;  1WXM A;  3A9K B;  4PS7 A;  2JZZ A;  1V6E A;  4BBN F;  2AL6 A;  1KOT A;  2FCQ A;  4ZYS A;  2WGS A;  1VLB A;  2ZCC A;  3B08 A;  3OWE B;  1P0R A;  2KAJ A;  2LVQ A;  3W1Y A;  1Y56 A;  3VQI A;  3ZTD A;  2N7D A;  4II2 B;  3DBH I;  2D3G A;  4CQN A;  2WDV B;  3DVG Y;  2JVC A;  1JAL A;  2V0G A;  1UZX B;  3NUH B;  3AE1 B;  4ANV A;  1Y8R C;  4C7Y A;  2LJI A;  2G9H D;  1WE7 A;  5HG2 A;  4DBG A;  4C4V B;  1FO4 A;  2CKH B;  1C77 A;  3PHX B;  2KC2 A;  4GDL B;  1C76 A;  1IP9 A;  5AEK B;  3AEB B;  3AUL A;  1SJE D;  4L1B A;  1AN8 A;  2M0A A;  2LUM A;  3M62 B;  5CX3 A;  1FFU A;  4PT5 A;  4OZA A;  1TY0 A;  5CHF A;  4P7I A;  1SE2 A;  4B95 A;  3VH3 B;  1P1A A;  4EZJ A;  1UWX A;  1GPX A;  4II3 B;  3H1U A;  2LUE A;  1QQR A;  2YEP B;  4NNJ B;  4XYC A;  2QHO A;  5IO9 A;  3DWM A;  3Q69 A;  4YSX B;  3PO0 A;  2FIF A;  1MPE A;  4RH6 A;  4KX6 B;  3H7S A;  4ACF A;  4XE0 A;  1DYQ A;  3L08 A;  2WXO A;  1RFA A;  4KDI C;  4AJW A;  3QAQ A;  1I4Q A;  3R3M A;  4A6Q A;  1N62 A;  1NDD A;  1WGY A;  1T6B X;  2A5U A;  2OED A;  3BVG A;  3WAN A;  2KWC A;  1CZP A;  1HEZ E;  2CJN A;  4OZB A;  3Q3N C;  4DQO C;  1WRI A;  2WWZ A;  4TUU A;  4HK2 A;  4MEM A;  3NZS A;  4JWU C;  3PTF C;  3N30 A;  4FJV B;  3DBL B;  2BBC A;  1UBQ A;  3ONS A;  1UGJ A;  2CHZ A;  3ZKJ C;  4W9C A;  1L2N A;  1KLG D;  1HA5 A;  3KUC B;  2O2V A;  1TS4 A;  2NVU I;  2LVO A;  1BT0 A;  2WNM A;  1WJ4 A;  4LDT D;  3QCA A;  4ZHP A;  1EU3 A;  1SEB D;  3Q14 C;  2WS3 B;  2L83 A;  2KAN A;  4EZL A;  3AEF B;  5BMI A;  2KJR A;  4DDG D;  1LFD A;  4A90 A;  2V1Y A;  2BWE S;  5HFY A;  1C4A A;  1WXQ A;  3KYC D;  1PGA A;  4N9F 4;  3IBE A;  2YLM A;  2N9X A;  2PJH A;  3TL5 A;  2LZ6 A;  2KVZ A;  4ZRK A;  1ZDV A;  4IWO A;  3VR9 B;  5KHO A;  3B2F A;  2PVO D;  2MP2 B;  5CHV C;  3ZGZ A;  1TS3 A;  1R4N B;  1P7E A;  1WY8 A;  4HCN B;  3A1Q B;  2OJW A;  2E3T A;  4WWM A;  4JIO U;  3V6C B;  2JQR B;  2KLC A;  1VCB A;  4AQ7 A;  2ZW1 A;  4W9K A;  1ZW7 A;  3T3O A;  2IJ0 A;  3APD A;  3LYY A;  2PMV A;  3MHS D;  3HVD A;  3BZD B;  3R8B A;  3S2A A;  1PFD A;  2ICI A;  3M63 B;  4XC2 A;  2LMC A;  2ZVO A;  3MC9 A;  4RF1 A;  4W9H A;  3IHP C;  4WIP A;  1FIQ A;  1XCQ L;  3DHH C;  4HRO A;  4HXD A;  3SFD B;  1MG4 A;  4FJY A;  4REZ A;  1EF5 A;  4NPN A;  3U52 E;  5FR3 A;  1SGH A;  2IY0 B;  3UI3 A;  2JX5 A;  3PPA A;  2ON8 A;  5GMV A;  2KKC A;  3TEX A;  3W2D A;  3MC8 A;  5H92 C;  3DCG A;  2FID A;  4JE3 B;  3ZIM A;  4GOC A;  2KT7 A;  5HI1 A;  2D10 A;  1K51 A;  2J42 A;  4K7U A;  2MJD A;  1YX5 B;  3FIL B;  2JU6 X;  1ZKH A;  5BMG A;  3PVL A;  3P4P B;  4AS1 A;  1WIA A;  3NY5 A;  4ZOH C;  2RDG A;  4GGQ A;  4G11 A;  3VH4 B;  3OG5 A;  2TSS A;  1LXD A;  1YJ1 A;  3U8Z A;  1QIL A;  3TMP B;  4NAW B;  2JY6 A;  2ZW0 A;  5E6P A;  2HJ1 A;  2PE9 A;  3K9P B;  2MCN B;  2FCN A;  3L54 A;  2JF5 A;  1BML C;  4FUL A;  2NTS A;  5EE3 A;  3AU5 A;  3TSS A;  2VH2 A;  1T0Y A;  1KRH A;  3DDC B;  2QJL A;  3I5J C;  4AJY B;  4NQK E;  4MDK E;  2Y5C A;  2ZVN A;  1GJZ A;  2KYW A;  2KFJ A;  5BYS A;  2RMM A;  3WAM A;  4K1R B;  2QC8 A;  2R61 A;  4MEL A;  4EOY A;  3VTW A;  3RNE C;  1PYW D;  3W1S C;  1L4D B;  3C19 A;  2RD0 A;  2MHJ A;  3OLM D;  4NJC A;  1H8C A;  3ETR A;  5LLI A;  4QAY A;  3VTU A;  3I9V 1;  3OJ3 A;  1UBI A;  1BXT A;  2XK5 A;  3DVN V;  4BKS A;  3NRZ A;  2VZK D;  1IGC A;  2I1J A;  5D7G A;  2KQ7 A;  1SIJ A;  1N61 A;  2N9P C;  2BKR B;  4W9G A;  2CR5 A;  3AE5 B;  3ZJV A;  1WMH B;  2BYE A;  4W9F A;  1WJ6 A;  3P4S B;  4ZRQ A;  1XT9 B;  1L0V B;  1FRR A;  2AYO B;  2JXX A;  1UF0 A;  2KX0 A;  3RNC C;  4KGS A;  2PEA A;  1E10 A;  3PRE A;  3NVW A;  1N5X A;  4LNI A;  4AUQ C;  2L0F A;  4TMA B;  3N9Y C;  4JPS A;  4D2K A;  3BVM A;  3AEA B;  2BKF A;  4GN1 A;  4IUM B;  3RD2 A;  3V3X A;  2EKE C;  4ARI A;  3ZXV A;  1I4X A;  2I38 A;  3CF6 E;  1WI0 A;  1XLN A;  4WQM A;  2FBW B;  5JH5 C;  2L0T A;  3ZUN A;  3MTN B;  1RM6 C;  4ZYN A;  1Z2M A;  3AI5 A;  4YXD B;  4B0E A;  4AOF A;  2G45 B;  1SJH D;  4Q2J A;  1JQ4 A;  1F77 A;  4NJ6 A;  1VD2 A;  2JUO A;  3N1X C;  4G50 A;  5C2T B;  2W3R A;  2EMT A;  4RGT A;  2KDE B;  2MBB B;  4US9 A;  4ZHO A;  1YN5 A;  4JLC A;  2GB1 A;  4KIK B;  5HHD G;  4FHJ A;  3Q8F A;  4P6V F;  3T9L A;  1R4N I;  3HRD D;  2UYZ B;  3ZQ4 A;  5IP4 D;  4BZA A;  5EDS A;  1GG3 A;  3ZDT A;  1E8W A;  2RR9 A;  3GE3 C;  5AUK A;  1L6U A;  2MBE A;  2IBI B;  1K53 A;  2CJO A;  2D3A A;  2LGS A;  2LRW A;  2D3C A;  3ML9 A;  3VR8 B;  1MI0 A;  4JGH B;  3VVW B;  3IFW B;  2X8X X;  5AZF A;  1R4M B;  1D5Z C;  2G4D B;  4IM0 A;  2KN4 A;  3ZJU A;  3MJ5 A;  3SU8 X;  1SSN A;  3LJ3 A;  4MSM B;  4LNN A;  4FBJ B;  2R2O A;  3BIN A;  2IGH A;  1AWD A;  1SBB B;  3P4R B;  1TT5 B;  3Q8E A;  4RMA A;  4YT0 B;  2R2Q A;  1D5M C;  1WX9 A;  3AE9 B;  2DYO A;  4G3X B;  2IYD B;  1JWB D;  3EGR A;  3A9K A;  2M1M A;  4EUT A;  2PTL A;  1TTN A;  3E9S A;  3B0A A;  5EE1 A;  3B2G A;  4PK1 A;  3Q8B A;  2L7R A;  3URY A;  3MFG A;  2VH1 A;  3KWL A;  1WX7 A;  3KUD B;  1ZE3 D;  5DPW A;  1FEH A;  2INC C;  3HIZ A;  4MM3 B;  4MH0 E;  1JWU D;  2JZ3 B;  3HHM A;  2H89 B;  2N7J A;  1ZP0 B;  3VFK A;  1L0Y B;  1TZ1 A;  5IKC M;  4US8 A;  1XO3 A;  3VTV A;  4LTU A;  1YX6 B;  4C4V A;  2INN E;  2K5P A;  4GDL A;  1ZGU B;  1YIW A;  3JW0 X;  1WX8 A;  2GBJ A;  4E74 A;  4MH8 A;  2FUH B;  3P42 A;  1FXI A;  3TEW A;  2HTH A;  4CYE A;  2M8S A;  2YEP F;  1N63 A;  2PPH A;  4HEA 1;  1WGD A;  2KWD A;  2MLB A;  4M02 A;  2WYQ A;  1NYQ A;  1JWS D;  3AEG B;  3L0W B;  4IC7 B;  2J0J A;  1DOX A;  1GB4 A;  2WXK A;  1WWT A;  4GU2 A;  1U4A A;  1E8Y A;  2N1V A;  1VZ8 A;  2LI5 A;  4GDK B;  4IM3 A;  3O13 A;  2IY1 B;  3AE7 B;  3SR6 A;  1K8R B;  3IAM 1;  1P9D U;  3R66 C;  3OAW A;  1IUE A;  4N59 A;  3AE8 B;  2UWQ A;  2K1F A;  4MGK E;  1I4H A;  1E7U A;  4URK A;  1QOF A;  2B3A A;  1TS5 A;  2BWF A;  4IDI A;  3JSV B;  1J19 A;  1AAR A;  3PLU A;  4HDQ A;  3A4S C;  4S17 A;  3B1L X;  3WIM A;  4YSY B;  5D94 A;  2C7H A;  3IG3 A;  1J0G A;  2C9W B;  4RM8 A;  4MAC A;  2VZK B;  5HKH A;  4W9I A;  2BS2 B;  2GMI C;  4X57 B;  2KJH B;  3AXC A;  2G4S A;  2KJ6 A;  3DVG X;  1V86 A;  1D6E C;  1QZE A;  3AE2 B;  5AUI A;  4EZK A;  3BK1 A;  1WGR A;  3AEC B;  4I6P A;  4A3P A;  1S1Q B;  1WXA A;  2DZI A;  3KUZ A;  2D07 B;  2DZJ A;  2LAS A;  2LHD A;  1IBX B;  4EKU A;  2LXA A;  2QIE B;  2WDR B;  3AE4 B;  1V1O A;  3M3J A;  4NZL B;  5FK9 C;  4A20 A;  4XZ4 A;  4KSK C;  5BO4 B;  1OGW A;  4XDD A;  4DK5 A;  4HPM B;  1G6J A;  1GB1 A;  2BYV E;  2JT4 B;  2RSU A;  3R2I A;  4HJK A;  3ZRF A;  2J7Q B;  1BUI C;  4WUR A;  3A1Q A;  1NVI D;  3V05 A;  5L95 C;  4C7Z A;  2K3U A;  2FE8 A;  4L23 A;  4M8N A;  1F9J A;  2KXJ A;  3WAL A;  5IN7 A;  1L4Z B;  2L8J A;  2INP E;  3APF A;  4BAX A;  2LGI A;  3O65 B;  2MBO A;  4TQ1 A;  2AQ3 B;  2DWQ A;  2V4I B;  1A70 A;  3NVZ A;  1L7Y A;  4ZRI A;  4S0R A;  1MJD A;  3CWI A;  5T8I A;  3L10 B;  2BQQ A;  2HDE A;  3KVF B;  1YOV B;  2REX A;  2JWZ A;  1E7V A;  1WXS A;  1R4M I;  3PHW B;  4RGN A;  4GXB A;  1H4R A;  4RNA A;  2FUG 1;  1M4V A;  2NBW B;  1IPG A;  1GAQ B;  2N0S B;  2CU3 A;  2NMQ A;  3VDZ A;  4KKI A;  3JVZ X;  3QAR A;  1FM0 D;  3SDL C;  1CJE A;  4XGA B;  5AZH A;  1CK1 A;  5GXG B;  5J18 A;  3M95 A;  1KLV A;  2AWT A;  1FCL A;  1RRB A;  1FXT B;  2RDB C;  4F8C B;  3U4E G;  2LFI A;  4WWP A;  4RFB A;  3QJZ A;  2WQY B;  1E6E B;  3FIL A;  4DHZ B;  1WE6 A;  2NPT A;  1UEL A;  4RGM A;  4IG7 B;  5JHB A;  4MGY E;  3BYY B;  4K3B A;  2CS4 A;  2LXC A;  4HVB A;  4NAW A;  2GOW A;  4LNO A;  1RAX A;  3FAH A;  3RUI B;  5DCN A;  4LJP B;  1QLB B;  4MT5 A;  4ANX A;  4M0W B;  3ENE A;  1JW9 D;  1WGH A;  3GZN B;  2BF8 B;  3N1Y C;  3RT3 B;  2WXG A;  3W1S A;  1GNU A;  2N7E A;  1I7H A;  5DPS A;  3CIR B;  1F0Z A;  3HUI A;  2AQ2 B;  1N6Z A;  2FNJ B;  2EKI A;  3ZNG C;  3PRM B;  2L1A A;  3PZ8 A;  3CST A;  3FKY A;  3PS6 A;  3DWG C;  4C80 A;  3TEY A;  4BOZ B;  3L17 A;  2DHZ A;  2K22 A;  1PGX A;  2AX5 A;  3AM9 A;  1XQQ A;  3PZD A;  5EE0 A;  1N5W A;  2PKO A;  3AE3 B;  3EEC A;  3U7D A;  2MX2 A;  1UWM A;  1YQB A;  2RPV A;  4CHK A;  4YWG G;  3MJW A;  1XXG A;  1TGZ B;  4NQL B;  3NHE B;  1AW7 A;  2Z0D B;  1E7P B;  2BT6 A;  2LD9 A;  3AH7 A;  2KTR B;  1AYF A;  1WGK A;  3PSE B;  4PYZ A;  4XWT A;  4DDI D;  1EM7 A;  1C79 A;  2O6V B;  2RPQ A;  2LVP A;  3AN1 A;  4ITK A;  4JL9 A;  1WMH A;  2GBR A;  1HXY D;  4YTP B;  5LXH A;  4K7S A;  4XWW A;  3I3T B;  1HTO A;  4DWF A;  3AED B;  1XD3 B;  1HTQ A;  3QC8 B;  4HKQ A;  4KZC A;  1C3T A;  3X23 A;  3GB1 A;  2WXI A;  3EA6 A;  1ROE A;  1E9M A;  3TIX A;  3NJT A;  3IXS A;  2Z59 B;  1V9J A;  1MHX A;  3GS2 A;  1TKG A;  2GI9 A;  2DNF A;  2JWU A;  4ZDV A;  1SXT A;  3Q3J A;  4LNF A;  3TUO A;  2MBH A;  3KH0 A;  1F52 A;  4RGO S;  5BMH A;  2K9X A;  3KQ4 A;  3WAP A;  1TS2 A;  1EWC A;  3PV1 A;  1MHH E;  2K0P A;  1OQR A;  3OJ4 B;  3C8Y A;  1VJK A;  3AU4 A;  2D3B A;  2Q5W D;  3A4R A;  1ZPS A;  4IWQ A;  3Q2A C;  5CHW A;  4L2Y A;  3P63 A;  1Q1O A;  1T0R C;  2HD5 B;  1RLF A;  1V1P A;  2KOX A;  3RZW C;  1OEY J;  1C78 A;  5LXI B;  1DGJ A;  3UQB A;  5H8Y E;  2H88 B;  2W82 A;  2PE6 B;  1TY2 A;  4HJG E;  2GBM A;  3ZW3 A;  4N6E B;  5L83 A;  4KIK A;  2DZM A;  1I4R A;  2BVC A;  3H7P B;  1J7B A;  5I4D A;  4YTN B;  2M17 A;  3ZVV A;  3KLS X;  4J3O D;  3NG0 A;  3NZ3 A;  1V81 A;  1WZ3 A;  4BFR A;  1R7S A;  2X38 A;  4WJO A;  2VRR B;  1EO6 A;  4RM9 A;  2MA9 B;  2PVG C;  2LEK A;  2HJ8 A;  5EE9 A;  2W55 A;  1VDV A;  2MJ3 A;  4DHJ B;  3LDZ E;  4ANU A;  1CMX B;  3EC8 A;  1Q10 A;  3DVN U;  1YMH E;  2D5G A;  2V3N A;  5J17 A;  4ICV A;  4MJS B;  4IWP A;  1PGB A;  2KFK B;  2IO0 B;  3AMZ A;  2ZZP B;  2WXF A;  4M8M A;  2FCM A;  4NY0 A;  3QQ8 B;  1F2R I;  1QOG A;  1DOY A;  4GB9 A;  4I6N B;  1SIF A;  4DXF A;  4OW0 A;  3IT6 B;  2LGD A;  2JPH A;  1V49 A;  1OFF A;  2MJE A;  1FNW A;  2WXJ A;  5LNK 1;  3P1M A;  2J52 A;  1OEY A;  3BYT B;  3V61 A;  1QOB A;  1ENF A;  1YJJ A;  1T0S C;  4HCP B;  2WXP A;  3V62 A;  1WZ0 A;  3FC4 A;  3VUY A;  1DOI A;  2RDH A;  1I42 A;  3D32 A;  4J6I A;  3A33 B;  3GE8 C;  4GLS C;  2IO2 B;  3DPD A;  4G0N B;  2L00 B;  2N9K A;  4WWN A;  1UUP A;  5D6J B;  1B9R A;  4MM3 A;  2PLP A;  2Y5B B;  2Y3A A;  2L05 A;  1P98 A;  4A3O A;  2V3S A;  2WXM A;  1XLO A;  3PRP B;  1P3Q U;  3Q3O C;  1ESF A;  5JHA A;  1FNU A;  1TBE A;  2BB6 A;  1JWA D;  3QIJ A;  4ZRP A;  1UH6 A;  4F7Z A;  1F1H A;  4M00 A;  1NEK B;  3KW5 B;  4IM2 A;  3V6E B;  2BYT A;  3GZN I;  1WR6 E;  2CU1 A;  3WA0 A;  1VRA B;  2ASQ A;  3ZTC A;  3HVZ A;  3MP9 A;  2IZV B;  2K6D B;  3RZF A;  1XCT L;  2L52 A;  4HPP A;  3BY4 B;  1STE A;  5FKA C;  1I35 A;  1LQB A;  2DZK A;  4OVU A;  1D3Z A;  3UF8 A;  1XF5 L;  3ZRC A;  4M01 A;  3WCQ A;  3APC A;  1VZ6 A;  3EFU A;  3Q3F A;  2MEK A;  2QMT A;  3UQA A;  2SAK A;  4HLE A;  1IYF A;  3A9J B;  3NVY A;  1SE3 A;  1P7F A;  2WHI A;  3BWU D;  1WM2 A;  2GLS A;  2LJ5 A;  3N1Z C;  2I2Y A;  1D5X C;  2KC1 A;  2AQ1 B;  1OQY A;  1Q5W B;  2M4N A;  2WP9 B;  3ZDM C;  1SE9 A;  1V5O A;  4KV2 A;  4B0M A;  2D2Q A;  3VAW A;  3Q8A A;  4KGR A;  2IO3 B;  1LM8 B;  1WYW B;  2K6Q A;  2XEW A;  2O6V D;  3RCZ A;  3JSV A;  3J9C A;  1YJI A;  2KVR A;  4FLH A;  4UDU C;  1XEE A;  3NS1 A;  4KKJ A;  3ZNH B;  2IO1 B;  1GC7 A;  5E6J A;  1E5W A;  1UD7 A;  2NBU A;  1QOA A;  2BPS A;  3SD5 A;  2J0M A;  1TZO A;  3W5V B;  1I4G A;  1X1M A;  2AEH A;  3ZXR A;  1GC6 A;  3ABV B;  3IT4 B;  2HTM E;  3Q8C A;  1LO5 D;  2C5L C;  4KGT A;  4JWS C;  1WXV A;  4H2A A;  5G5H A;  2BB5 A;  2A4Z A;  1C4C A;  2N1W A;  3H9D A;  2ZCB A;  3QX1 A;  2KD0 A;  1C9F A;  4W9E A;  1C1Y B;  3DHG C;  2JRI B;  4HWI B;  5G2N A;  3ML8 A;  4B6W A;  2QDF A;  2KMA A;  2KQS A;  3Q6B A;  3ALB A;  1HE8 A;  1YNT E;  1SB3 C;  3QK0 A;  1EU4 A;  2KAC A;  5C23 A;  1IBX A;  3AB5 A;  1EUV B;  2WDT B;  1FPY A;  4KZ0 A;  4AWJ A;  4FN2 A;  3T3N A;  3HM3 A;  2KZR A;  1I4P A;  4LCD E;  4OVV A;  2DLB A;  3PLV A;  4TKN A;  4FAD A;  1L5P A;  1T0Q C;  1TKE A;  3NOB A;  1RWS A;  2N4F A;  2KMM A;  3U7Z A;  4B9K A;  5AZG A;  2DAJ A;  4HDO A;  3ECI A;  4WH4 A;  3BK2 A;  2CHW A;  2IDY A;  4GMV A;  3VRA B;  1OTR B;  5E6O A;  2K39 A;  2EMS A;  3KYD D;  1ZXI A;  2IGD A;  5E6N A;  5TR5 A;  3N20 C;  4KVG B;  4USA A;  1JRP A;  3UGB B;  4BBN C;  4DXG A;  1SF0 A;  2JYE A;  3UIN B;  4DHJ D;  3HM6 X;  1HZ6 A;  2UU7 A;  4BKS D;  3NS8 A;  1ET9 A;  1YQ3 B;  4YSZ B;  1WJU A;  2V4L A;  2ZNV B;  2MP2 A;  5FR6 A;  1WF9 A;  4JX1 C;  3GP7 A;  2KTF A;  2KMC A;  2GBN A;  2WX1 A;  3DBR B;  4KDL B;  3GOE A;  1J8C A;  2KHW B;  3I63 C;  2MWS B;  1Z5S B;  2WXL A;  1EWY C;  2KWU B;  3QHT A;  2MQJ A;  3RFZ B;  4FXC A;  2ZNV C;  5G5G A;  1V97 A;  2WLB A;  1Q0W B;  1WFY A;  4WAF A;  2N9E B;  1ISN A;  1ZXH A;  3SHQ A;  2QCZ A;  2J53 A;  3HK0 A;  3UIP B;  3DQV A;  1FXA A;  3H6N A;  4P1C C;  5C1Z A;  2K8B A;  1KF6 B;  1EF1 A;  1ET6 A;  4WJN A;  4PS8 A;  3RNB C;  1YN3 A;  2JRH A;  2RGF A;  2WX0 A;  1F2R C;  1N60 A;  3RUL A;  1SE4 A;  3VUX A;  1CQV A;  4MSQ B;  5CTR C;  5TSS A;  2O2V B;  3EHV A;  4DXA B;  2D11 A;  3PZ7 A;  1V8C A;  2LGX A;  1FCC C;  2IGG A;  2XN9 C;  4M0W A;  1WM3 A;  4BKT A;  1K50 A;  3NZU A;  2NCN A;  3WAO A;  4I6L B;  1JRO A;  2KNB A;  2OHF A;  5KHQ A;  4TQ0 A;  4NJ7 A;  4BOS C;  4JQW C;  2K25 A;  2E6X A;  1UGM A;  3L13 A;  1E0Z A;  4TV3 A;  1WGG A;  4ICU A;  4XX5 A;  2JYT A;  2EEL A;  2PIA A;  2G3Q B;  1XLQ A;  4BVU C;  2M56 B;  2ACZ B;  2L76 A;  1RYJ A;  4RCO A;  2G1E A;  4MGZ E;  1HQR D;  1XLP A;  2KQ4 X;  3VXW A;  4PS3 A;  5D2M B;  3VUW A;  1E8X A;  2KTR A;  4GSW A;  1NYR A;  5D3D A;  1B1Z A;  2O6V A;  4ZRJ A;  1KFY B;  2W9N A;  3RMK C;  3N3K B;  4IW0 A;  3R2T A;  4CO7 A;  3SEB A;  3TJP A;  1WSP A;  3AEE B;  1JCK B;  3DOW A;  2CHX A;  1IGD A;  2WXQ A;  1UNS A;  1FFV A;  3TBL D;  1MG8 A;  5DPR A;  1WYG A;  3ZJT A;  3W9C B;  2JZP A;  4LNK A;  3JYU A;  2NPT B;  4WAA A;  2V3P A;  3T8M A;  2DAF A;  2MSE D;  3DBS A;  4K81 A;  3R7R A;  1LGR A;  2BW2 A;  5JZE B;  2Z0E B;  2C7M B;  2LWP A;  1KM7 A;  2NBV B;  2AL3 A;  3K9O B;  3ZNI D;  3B9J A;  2BGF A;  3E56 A;  4MGI E;  1A5R A;  4C00 A;  5DPT A;  1RFK A;  2IND C;  2QSD A;  1NI2 A;  3R7Q A;  4NAM A;  2BS4 B;  2L32 A;  3U2S C;  3PGE A;  2KDB A;  1T5X D;  4EFO A;  4WWO A; 
#chains in the Genus database with same CATH homology
 1DOX A;  1ZDV A;  1GB4 A;  2WXP A;  2WXK A;  1WWT A;  3VR9 B;  3W5U B;  1VZ8 A;  4GDK B;  3FC4 A;  3O13 A;  3B2F A;  2J4X A;  1DOI A;  2RDH A;  3I57 A;  2PVO D;  4LK0 M;  4R3D A;  3AE7 B;  3SR6 A;  3ZGZ A;  1TS3 A;  3IAM 1;  1P7E A;  1IUE A;  2LHE A;  4N59 A;  3AE8 B;  4GLS C;  2E3T A;  4WWM A;  2N9K A;  1UUP A;  1I4H A;  1L0X B;  1QOF A;  3P4Q B;  2JQR B;  4A55 A;  1TS5 A;  2W3S A;  4IDI A;  4AQ7 A;  1B9R A;  2ZW1 A;  2PLP A;  2Y3A A;  2WXR A;  4YTM B;  3T3O A;  4ARC A;  2WXM A;  2IJ0 A;  3LYY A;  2PMV A;  4YSY B;  1XLO A;  2Z8L A;  2BS3 B;  3BZD B;  3HVD A;  2GRI A;  3R8B A;  1ESF A;  1FNU A;  1FMA D;  3EUB 2;  2BB6 A;  2VZK B;  1JWA D;  4MAC A;  1NI3 A;  1PFD A;  2ICI A;  4ZRP A;  4O1N A;  1FRD A;  2LMC A;  1NEK B;  2MH7 A;  2WU2 B;  4RF1 A;  2BS2 B;  1YQ4 B;  4WIP A;  2BYT A;  2DBY A;  1FIQ A;  1OQQ A;  1VRA B;  1XCQ L;  3LB8 C;  4HRO A;  4EE2 A;  2NTT A;  3SFD B;  1KLU D;  3HVZ A;  3MP9 A;  1MVK A;  3LXF A;  1D6E C;  3AE2 B;  1XCT L;  2L52 A;  4REZ A;  1QF6 A;  5AUI A;  1STE A;  3BK1 A;  5FKA C;  3U52 E;  5FR3 A;  3AEC B;  1KTK A;  1VR9 A;  1XF5 L;  3UI3 A;  3WCQ A;  2JX5 A;  1C4P A;  2ON8 A;  3IAS 1;  4A8X C;  1VZ6 A;  2MEK A;  3AE6 B;  2QMT A;  1ZOY B;  2SAK A;  3TEX A;  3W2D A;  5H92 C;  2LHD A;  1TYG B;  3NVY A;  1SE3 A;  1IBX B;  4JE3 B;  1P7F A;  5BYR A;  2QIE B;  1HZ5 A;  2W54 A;  3BWU D;  2WDR B;  3H8H A;  4P16 A;  1KH0 A;  1V1O A;  3AE4 B;  5HI1 A;  2Y5P A;  4NZL B;  5FK9 C;  4HKZ E;  1K51 A;  2I2Y A;  1D5X C;  2J42 A;  4IKG A;  2MJD A;  1QKZ A;  4XDD A;  3FIL B;  3NVV A;  1GB1 A;  2AQ1 B;  2JU6 X;  1GOZ A;  3R2I A;  2WP9 B;  1K52 A;  5BMG A;  1BUI C;  3SFE B;  4WUR A;  3P4P B;  1NVI D;  4AS1 A;  4B0M A;  4ZOH C;  3V05 A;  1VZ7 A;  2RDG A;  1YN4 A;  3Q8A A;  1TJE A;  2TSS A;  4KGR A;  3ZYY X;  1PUT A;  4C7Z A;  3BVZ A;  2K3U A;  2FE8 A;  1QIL A;  1FNV A;  4NAW B;  3TEZ A;  4L23 A;  2ZW0 A;  1L4Z B;  3J9C A;  1YJI A;  2INP E;  1V1P B;  4UDU C;  5JXV A;  1XEE A;  3NS1 A;  2LGI A;  4KKJ A;  4LLG M;  3L4P A;  1BML C;  4TQ1 A;  2AQ3 B;  2DWQ A;  2V4I B;  5E6J A;  1ZDX A;  1A70 A;  2NTS A;  3NVZ A;  4TSS A;  1QOA A;  5EE3 A;  4HRS A;  3TSS A;  1TZO A;  3W5V B;  3MHZ A;  1I4G A;  1KRH A;  2QJL A;  3ABV B;  3IT4 B;  2HTM E;  2JSV X;  2M19 A;  1LO5 D;  1J7A A;  3CWI A;  3Q8C A;  5T8I A;  2Y5C A;  4KGT A;  1JWM D;  4JWS C;  5D3I B;  5BYS A;  1ZUD 2;  2HDE A;  4H2A A;  3BII D;  5G5H A;  2BB5 A;  5C3J B;  2KDM A;  1C4C A;  2RMM A;  4RGN A;  2R61 A;  1C9F A;  4RNA A;  2ONQ A;  2FUG 1;  1M4V A;  1GAQ B;  2N0S B;  2CU3 A;  1PYW D;  2N9L A;  1L4D B;  2NMQ A;  4OHJ A;  4KKI A;  4NJC A;  1ACC A;  1FM0 D;  1YNT E;  1CJE A;  1SB3 C;  3ETR A;  1IBX A;  1CK1 A;  1EU4 A;  2KAC A;  4IOI E;  5GXG B;  3AB5 A;  1D4B A;  4OVZ A;  3I9V 1;  1FCL A;  1BXT A;  4A9A A;  1T3Q A;  2PW9 A;  3T3N A;  3U4E G;  3NRZ A;  2LFI A;  2VZK D;  1IGC A;  4RFB A;  2WXH A;  5D7G A;  1I4P A;  1SIJ A;  1N61 A;  2DLB A;  2IPK D;  1E6E B;  2WQY B;  3FIL A;  3AE5 B;  1L5P A;  3ZJV A;  3P4S B;  4ZRQ A;  1TKE A;  4RGM A;  1RWS A;  1L0V B;  1FRR A;  1L6V A;  2KMM A;  3U7Z A;  3BYY B;  4WH4 A;  4KGS A;  3BK2 A;  1QT9 A;  2IDY A;  1E10 A;  3VRB B;  3VRA B;  1JML A;  3RPF C;  2BTE A;  3FAH A;  1PDX A;  3NVW A;  1ZXI A;  1N5X A;  2IGD A;  2SEB D;  1QLB B;  4MT5 A;  4USA A;  1JW9 D;  4C56 C;  1JRP A;  4TMA B;  4XDC A;  3N9Y C;  5MPO A;  2WXG A;  4JPS A;  1SF0 A;  2JXT A;  2JYE A;  3W1S A;  4DXG A;  1I7H A;  4D2K A;  3BVM A;  3CIR B;  1HZ6 A;  3AEA B;  3HUI A;  4N58 A;  1F0Z A;  2AQ2 B;  1ET9 A;  3V3X A;  2QIL A;  2EKI A;  2XNA C;  4ARI A;  1YQ3 B;  4YSZ B;  2L1A A;  3AV8 A;  2DYM A;  3PZ8 A;  1I4X A;  5BYQ A;  2I38 A;  3DWG C;  1J7C A;  4C80 A;  3TEY A;  4JX1 C;  1XLN A;  3GP7 A;  1TKY A;  4RF0 A;  2QEJ C;  2FBW B;  4WQM A;  2K22 A;  1PGX A;  2AX5 A;  3AM9 A;  1RM6 C;  5EE0 A;  2WXN A;  4OZC A;  1N5W A;  2PKO A;  3AE3 B;  2WXL A;  1EWY C;  1NEN B;  1FD6 A;  4YXD B;  3MC0 B;  2WDQ B;  2RPV A;  1UWM A;  4B0E A;  4YWG G;  2WU5 B;  1SJH D;  3RFZ B;  4FXC A;  4Q2J A;  1XXG A;  1JQ4 A;  1F77 A;  2B76 B;  3KWV A;  5C2T B;  5G5G A;  1V97 A;  2W3R A;  1AW7 A;  2WLB A;  4RGT A;  4WAF A;  1E7P B;  2BT6 A;  3AH7 A;  4US9 A;  1ZXH A;  1AYF A;  1WGK A;  4ZHO A;  4ZYS A;  1VLB A;  1YN5 A;  4XWT A;  1EM7 A;  1C79 A;  2J53 A;  3OWE B;  2GB1 A;  1FXA A;  3AN1 A;  5HHD G;  2KAJ A;  3Q8F A;  4P6V F;  1Y56 A;  4ITK A;  3VQI A;  3HRD D;  3ZQ4 A;  1KF6 B;  1ET6 A;  1HXY D;  4YTP B;  4XWW A;  4CQN A;  2WDV B;  1YN3 A;  1JAL A;  2V0G A;  3NUH B;  3AE1 B;  3AED B;  4C7Y A;  5AUK A;  1L6U A;  2LJI A;  1F2R C;  1N60 A;  4HKQ A;  1SE4 A;  1CQV A;  2G9H D;  5HG2 A;  3GB1 A;  2WXI A;  3EA6 A;  5TSS A;  1ROE A;  1FO4 A;  1E9M A;  1C77 A;  4GDL B;  3PZ7 A;  1V8C A;  3IXS A;  1FCC C;  2IGG A;  2XN9 C;  1K53 A;  1MHX A;  2CJO A;  4M0W A;  1C76 A;  1K50 A;  3GS2 A;  1TKG A;  3AEB B;  2GI9 A;  2JWU A;  1SJE D;  4L1B A;  1AN8 A;  1SXT A;  3VR8 B;  1MI0 A;  2M0A A;  2LUM A;  1JRO A;  2OHF A;  1FFU A;  4TQ0 A;  4PT5 A;  4OZA A;  1D5Z C;  1TY0 A;  3TUO A;  4RGO S;  2KN4 A;  3ZJU A;  3MJ5 A;  1SE2 A;  2E6X A;  1SSN A;  5BMH A;  1E0Z A;  1UWX A;  2K9X A;  1GPX A;  3KQ4 A;  1TS2 A;  1EWC A;  1MHH E;  2K0P A;  1OQR A;  3C8Y A;  1QQR A;  1VJK A;  1AWD A;  2IGH A;  2JYT A;  2EEL A;  2PIA A;  1SBB B;  2Q5W D;  2YEP B;  3P4R B;  1XLQ A;  1ZPS A;  3Q8E A;  3DWM A;  2M56 B;  2ACZ B;  4YT0 B;  4L2Y A;  3P63 A;  1RYJ A;  3Q69 A;  4RCO A;  1D5M C;  3PO0 A;  2G1E A;  1MPE A;  4RH6 A;  3AE9 B;  4KX6 B;  2DYO A;  4YSX B;  1V1P A;  4XE0 A;  1JWB D;  3EGR A;  1C78 A;  1DYQ A;  1HQR D;  1XLP A;  2KQ4 X;  1DGJ A;  2WXO A;  2PTL A;  3E9S A;  5H8Y E;  2H88 B;  1I4Q A;  2W82 A;  4A6Q A;  1TY2 A;  5EE1 A;  3B2G A;  1N62 A;  4HJG E;  1NYR A;  5D3D A;  1B1Z A;  3Q8B A;  1T6B X;  4N6E B;  3URY A;  1KFY B;  3MFG A;  1I4R A;  2OED A;  1J7B A;  3KWL A;  3BVG A;  5I4D A;  4YTN B;  1ZE3 D;  3KLS X;  4J3O D;  1FEH A;  3R2T A;  3NZ3 A;  3SEB A;  4MM3 B;  2CJN A;  1CZP A;  1HEZ E;  4OZB A;  1R7S A;  1WSP A;  1JWU D;  2X38 A;  4DQO C;  1WRI A;  2H89 B;  3AEE B;  2PVG C;  2LEK A;  1ZP0 B;  2N7J A;  4JWU C;  1JCK B;  2W55 A;  5EE9 A;  1VDV A;  2MJ3 A;  1L0Y B;  1IGD A;  2BBC A;  1UNS A;  1FFV A;  2WXQ A;  4US8 A;  1Q10 A;  1XO3 A;  1UGJ A;  1YMH E;  4LTU A;  2D5G A;  2V3N A;  1WYG A;  3ZJT A;  1PGB A;  1KLG D;  1HA5 A;  2INN E;  2K5P A;  3W9C B;  3AMZ A;  1TS4 A;  2JZP A;  2WXF A;  1F2R I;  2V3P A;  1QOG A;  1DOY A;  2WNM A;  2BW2 A;  4MH8 A;  4DXF A;  4ZHP A;  4OW0 A;  1EU3 A;  1SEB D;  1FXI A;  3P42 A;  2WS3 B;  3IT6 B;  3TEW A;  1OFF A;  2L83 A;  2MJE A;  3B9J A;  1FNW A;  2WXJ A;  3AEF B;  5LNK 1;  2YEP F;  3E56 A;  5BMI A;  1N63 A;  3P1M A;  4A90 A;  4HEA 1;  2J52 A;  1RFK A;  2QSD A;  2KWD A;  5HFY A;  1C4A A;  1WXQ A;  3BYT B;  2BS4 B;  1PGA A;  4NAM A;  1NYQ A;  1JWS D;  2L32 A;  3U2S C;  1QOB A;  3AEG B;  1T5X D;  1ENF A;  1YJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...