2EKIA

Solution structures of the tgs domain of human developmentally-regulated gtp-binding protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Developmentally-regulated GTP-binding protein 1
publication title Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1
rcsb
source organism Homo sapiens
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ekiA00
1YQ4B 3AV8A 1N5XA 1FFUA 3AE8B 4LTUA 2N0SB 1FFVA 2AX5A 1PUTA 1TJEA 1SB3C 2K9XA 1PFDA 3LXFA 3BIID 3ZYYX 1NI3A 2K22A 2OHFA 2PKOA 1FO4A 1FXAA 3AEGB 3AE2B 3AEEB 2WDQB 4YSYB 1KF6B 1RM6C 1FIQA 3AE7B 3AEBB 1E10A 3P63A 2ACZB 1DOIA 1JWAD 1KRHA 1DGJA 1NYQA 4ITKA 1QOBA 1RYJA 1AYFA 2W3RA 3NVZA 5C2TB 1FRRA 1N60A 1N61A 1RFKA 1ROEA 2PVOD 3AE9B 5G5HA 1A70A 2JQRB 1OQRA 4YTPB 3AE3B 3FC4A 2CU3A 3LB8C 3CWIA 5AUKA 3CIRB 3AM9A 1EWYC 1IUEA 2B76B 2Y5CA 3B2GA 4WWMA 1ZOYB 3W9CB 2Q5WD 2FBWB 2E3TA 3VR9B 1YJIA 3W5VB 4C80A 4ZHOA 3DWGC 2WDVB 3WCQA 5EE9A 1FRDA 1JROA 1XLNA 1WGKA 4HRSA 1XLQA 1ZUD2 2DWQA 4JWUC 4IDIA 1OFFA 3HVZA 5AUIA 2EKIA 1NEKB 1WRIA 2WU2B 5EE1A 1I7HA 1N63A 1YQ3B 3AE4B 1JALA 2MJDA 4JX1C 3NS1A 1B9RA 3NVWA 1XO3A 1TKYA 1VJKA 4WQMA 1TKEA 4YSXB 3AB5A 4JWSC 5C3JB 1N5WA 1XLPA 3NRZA 4YSZB 4KX6B 4FXCA 2W3SA 3AEAB 4YTMB 1JW9D 1ZXIA 2KAJA 3KWLA 3L4PA 1QLBB 1R7SA 2CJNA 5EE0A 2PVGC 4US8A 2BS3B 4YT0B 1OQQA 1F0ZA 2BT6A 3NVYA 2JX5A 1T3QA 1L6UA 4A9AA 2MJEA 1V8CA 1NYRA 3ABVB 2KMMA 1E0ZA 1SIJA 5H92C 4ZHPA 1WWTA 1JWBD 1WYGA 4YXDB 1QF6A 1ZP0B 2DBYA 5GXGB 2WQYB 3PO0A 1FMAD 1L0VB 3P4PB 4HROA 5G5GA 4C7ZA 1J7CA 3AH7A 2G1EA 1QOFA 3AEFB 3W5UB 2BS4B 2M56B 1GPXA 2L83A 3VRBB 1AWDA 1L6VA 2QJLA 1TKGA 2M19A 1SF0A 2W55A 3AE5B 3SFEB 3B2FA 4N59A 2MH7A 2LEKA 4N58A 2L52A 1CJEA 1L5PA 1JQ4A 1J7BA 2W54A 3HRDD 3AEDB 3DWMA 1KFYB 3B9JA 1E9MA 3HUIA 2CJOA 2HTME 1J7AA 1E6EB 1VDVA 3VRAB 1N62A 3FAHA 1PDXA 1DOXA 1E7PB 1RWSA 2MJ3A 3AN1A 1GAQB 4US9A 3ETRA 2WP9B 3AMZA 5EE3A 4ZOHC 1NENB 3AE1B 3AECB 1NVID 1WXQA 1FXIA 2QIEB 2PIAA 2WU5B 3P4QB 4N6EB 3VR8B 1VLBA 3SFDB 1QOAA 1DOYA 1FM0D 2WDRB 2BS2B 2K5PA 3AE6B 2WLBA 1V97A 1UWMA 4P6VF 4YTNB 1TYGB 3SR6A 3P1MA 5MPOA 3P4SB 1QOGA 1JRPA 4C7YA 2H88B 3RPFC 3EUB2 3P4RB 1XLOA 2H89B 5H8YE 1CZPA 1YJJA 3NVVA 2WS3B 4USAA 1QT9A
chains in the Genus database with same CATH superfamily
4LTUA 4W9IA 3PHWB 2WXNA 1I4GA 1FXAA 4ZRIA 3D32A 3AE7B 5L95C 2BKRB 4REZA 1JWAD 4EOYA 2YVCA 3NVZA 1PGAA 1ROEA 5AZFA 2B76B 1SE3A 4KGSA 1UBQA 4GXBA 1F2RI 3NUHB 2XNAC 3RFZB 5BYQA 2WXMA 2J7QB 4XYCA 1GOZA 3AU4A 1WX7A 2LXAA 1M4VA 3MHSD 1ZW7A 4J3OD 5EE0A 1SJED 1HA5A 2V3SA 1OQQA 4BKSA 1WY8A 4F8CB 3P2BA 4ACFA 4B95A 2HTHA 2QSDA 1WXVA 2BGFA 2G45B 2WYQA 2ON8A 1FMAD 4CO7A 2UU7A 4IM2A 4PK1A 2N9PC 3CMMB 2CU1A 2JZPA 4ZDVA 1V5TA 1CJEA 2K25A 1LFDA 1J7BA 2QDFA 3VRAB 5JH5C 1WMHB 3OJ3A 3N3KB 2MW5A 2KTRA 4II3B 1R4NI 3ML9A 3V05A 4ZRJA 4AS1A 3RPFC 4LLGM 1P7EA 2DENB 4MGYE 4AJWA 5JXVA 1FFVA 2AX5A 4KSKC 2WX0A 1UZXB 4C4VA 4ANUA 3SHQA 1BXTA 2K6DB 5J2RA 3KQ4A 3HHMA 1E90A 1SE9A 4LNNA 1YOVB 2N7EA 3ENEA 1F2RC 3RZFA 3W9CB 4GB9A 3DBLB 2RDHA 5CHVC 1JROA 3C8YA 2KQ7A 4HLEA 3HVZA 1I4XA 2ICIA 1P7FA 2N9LA 3OAWA 2NBVB 3FKYA 4P1CC 4B9KA 1WJUA 2KVZA 2BYFA 3X0WA 1CK1A 2D3AA 4FXCA 2JRIB 2K8CA 3KWLA 4WURA 2LJ5A 2LVOA 5FR3A 4NPNA 2D2QA 4BAXA 2ZCCA 2PJHA 5HG2A 3DHGC 2YEPB 3VH3B 1E0ZA 1GB1A 3KYCD 5IO9A 5DPTA 2HD5B 2BYTA 2DBYA 5IA7A 3IVFA 2L83A 1OQYA 4HPLB 1OTRB 4IM3A 2M0XA 2LUEA 1T5XD 2ZVOA 1MI0A 2MWSB 1OEYA 3DBHI 3BYTB 4IWOA 1EU4A 2JZ3B 4BFRA 1J19A 2PIAA 2NR2A 3H7PB 1DOYA 2INCC 5BMIA 4WQOB 4LK0M 4DQOC 2WXLA 2I1JA 2NTSA 4C7YA 2FE8A 2KWVB 1WRDB 2N1VA 4ZYNA 2WXKA 3AE8B 1RLFA 1SB3C 1C1YB 1HTQA 4KZ0A 1WJNA 3Q14C 4R3DA 3WA0A 1HZ5A 1EF5A 1E5WA 2KWCA 3TJPA 4K1RB 3ZXVA 4MH0E 2LRUA 3APCA 1PQSA 1J8CA 2MP2B 1MHXA 3W5VB 4C80A 1WJ6A 3DWGC 3PRMB 1UF0A 2ZJDA 4ZRQA 1QZEA 3N20C 1T0RC 5AUIA 1KJTA 2O6VB 4PS3A 4JQWC 3DVNU 4OZCA 2JSVX 3T3NA 3H8HA 4L2YA 3VUYA 1SXTA 3DCGA 2KWUB 2KAJA 4AUQC 4US8A 1Z2MA 3I3TB 1WM3A 4GGQA 3ZXRA 2DX5B 4ANVA 4LNKA 2IO1B 3DVNV 5D3IB 2G1EA 3AEFB 3VUXA 2M19A 2VH2A 2GBKA 2O6VD 2NTTA 2FUHB 2CJOA 2G4SA 4LNIA 3ZGZA 1PDXA 1V2YA 4ANWA 3V60A 4E74A 1NBFC 4LJPB 1ET9A 1IP9A 2V9HA 4K7UA 1Y56A 3PGEA 5HHDG 2LHEA 2KOXA 2KQSA 3IBEA 4MELA 3ZQ4A 2I2YA 4G50A 1OEYJ 2J4XA 5AZHA 3W1YA 1KF6B 1WF9A 3JVZX 1E10A 3A9JA 1MVKA 3PHXB 3TL5A 4NAWB 1RYJA 2WNMA 4HJKA 1TS5A 5BMGA 3TMPB 1XCQL 4IM0A 4ZRPA 1YQBA 3S2AA 2PW9A 2ZPNA 3JSVA 2ONQA 1FD6A 1Z5SB 1P1AA 1HTOA 2DWQA 4M8MA 3DBSA 2MA9B 1XXGA 2IYDB 4LJOB 1ZKHA 4JWSC 2DNFA 1P0RA 2R2QA 4HWIB 1RRBA 4W9HA 2L1AA 2CJNA 3A9KB 1WIAA 5LNK1 3L54A 3PLUA 4GDKB 2IO0B 4PYUA 4WJQA 2NCNA 4MM3B 2I1KA 4DHZB 1X1MA 1ZPSA 4BKGA 4DDGD 1Q0WB 3QHTA 3RMKC 1E7VA 3MJWA 5KHQA 1HE8A 1WXAA 1V6EA 3B2FA 3N1ZC 1SIFA 1QQRA 1D5ZC 3ZNZB 1RFAA 3N9YC 3UGBB 2VRRB 1RWSA 2NS5A 1EWCA 1GAQB 2N9EB 1UGJA 1TGZB 4WIPA 2BYEA 3P4QB 2ZNVC 2DZMA 1XF5L 2WLBA 4C00A 1TYGB 2L3ZA 2C5LC 3ZDTA 4HKQA 2NPTB 4GSWA 3ZTCA 3P4RB 2MBOA 4X57B 1MHHE 3QARA 2D3GA 2MEKA 4WWPA 1C3TA 3LJ3A 1FIQA 2KT7A 4P7IA 1ZE3D 2BWFA 2RDGA 3RNFC 4XC2A 3BY4B 3FILB 1QOBA 5C2TB 1N61A 4GU2A 2LGSA 4YWGG 3I9V1 4K3BA 3R3MA 1IUEA 3RCZA 1HEZE 4HDQA 1Y8RC 2LXCA 4MM3A 1XLQA 4IDIA 4B0EA 2NBUA 2WU2B 1B9RA 1Q10A 3NS1A 3QX1A 5FKAC 2GOWA 4HXDA 1D5MC 3PS6A 3H9DA 1JCKB 1AARA 2FUG1 3RNCC 2IY1B 4N9F4 4XWTA 4OW0A 2Y5PA 3ZRCA 2HE7A 1NYRA 3ABVB 4ZHPA 1EO6A 1JWMD 1P3QU 3QAQA 4OZAA 3RNAC 1J7CA 1IPGA 3AH7A 1SE2A 2JRHA 1YNTE 2M56B 2NPTA 3IFWB 1TZ1A 1MFWA 1IYFA 4GDLA 2LJIA 2KLCA 1C4PA 2E6XA 1E8WA 3SEBA 4CQNA 3Q8CA 3SDLC 3FAHA 4P1BC 1TS4A 2BTEA 4US9A 5DCNA 3BVGA 3ZUNA 2BS2B 4HPPA 3RYTA 3H6NA 2KC2A 4PYZA 4A6QA 3HM6X 4ZRKA 1STEA 1LGRA 2WS3B 1ZGUB 3U52E 2AQ3B 2J0MA 3NZUA 4IUMB 2K22A 2PKOA 2RR9A 3AEEB 3BVMA 2RGFA 2CKHB 2ZW0A 1RFKA 2FCSA 2BW2A 2KX0A 3AM9A 3R2TA 2Q5WD 1NI2A 3KLSX 3PZ7A 2TSSA 3K9OB 4NQLB 3BYYB 4IWPA 2DZIA 1Q1OA 1WGYA 3W1SA 1JALA 1PGXA 2MBQA 2OEDA 3NJTA 1N5WA 3BZDB 4YSZB 4KX6B 4IWQA 1XT9B 2WXIA 1ZXIA 2KTRB 2KJHB 1KOTA 4BKSD 1U4AA 2DAFA 2PVGC 2WXPA 4FN2A 4A8XC 1F0ZA 3NZSA 2G9HD 4EE2A 2KMMA 2X38A 2BKFA 4AP4C 4YXDB 3DHIC 1SBBB 4C7ZA 4HCNB 3BK1A 4C4VB 5L83A 3WAOA 3TIXA 2DZJA 2CS4A 4XE0A 3Q8AA 3M62B 4OVZA 3SFEB 2ZW1A 1UNSA 2I38A 4RM9A 4W9KA 5C23A 3TEZA 1C76A 2JXXA 2WP9B 3EGRA 4ZOHC 3AECB 2QIEB 1VLBA 1E8YA 3U2SC 1WR6E 2WXOA 2K5PA 2PLPA 4K81A 1MPEA 2JYEA 4MGIE 1YQ4B 3SD5A 4NQKE 3DVGX 2PPHA 4LDTB 2KK8A 3TBLD 2PE6B 1RM6C 2FIDA 2WGSA 4EKUA 1DGJA 3R7QA 3WIMA 4IOIE 3MTNB 5E6JA 1A70A 4WWNA 1WE7A 4W9JA 3Q3FA 1WZ3A 3IXSA 1WXSA 3ZRFA 3K9PB 5JZEB 1GJZA 3VHTC 1L4ZB 1YN3A 3RUIB 3RI7C 3U8ZA 4FADA 4HRSA 2JPHA 1WGDA 1WGKA 5GMVA 4MSMB 1OFFA 3PV1A 1FNVA 2XK5A 1YQ3B 5LLIA 3CSTA 3NHEB 3ZVVA 1TTNA 3QC8B 3Q3OC 4YSXB 3Q6BA 4LDTD 3VTVA 4E71A 3AEAB 1I35A 1ET6A 1C79A 5CHFA 2V4IB 4L23A 2D10A 2AWTA 4C56C 1L6UA 1R4NB 4NNJB 1L0XB 1KH0A 2VZKB 2Z8LA 2KDMA 2IO3B 3PO0A 1UGMA 2N9KA 2V3NA 3URYA 5IKCM 2ZPYA 3VRBB 2LI5A 3UINB 5AEKB 1L6VA 2W55A 2AQ1B 1I4HA 2AEHA 2AL6A 1L0YB 2DZKA 1VRAB 3KUZA 3HRDD 1KFYB 4QAYA 5E6OA 4XDCA 1I4PA 2HDEA 2GMIC 4HJGE 2D11A 1KLGD 3EECA 4RF0A 2MX2A 4OVUA 1FXIA 3ZTDA 3Q3MC 2Y5BB 3W2DA 3AE6B 5FK9C 3P4SB 2VZKD 2RPQA 3AV8A 2K9XA 2KDFB 2L76A 2WWZA 3MJ5A 2PMVA 2D07B 2AL3A 2O2VA 4EZJA 5D6JB 1SJHD 4M00A 3E56A 2JF5A 2GB1A 1ENFA 3KYDD 1N60A 4DK5A 1EWYC 2G3QB 4TV3A 1V86A 5HFYA 1YJIA 1B1ZA 1E7UA 1FRDA 2QEJC 1ZUD2 2MHJA 4GOCA 4OHJA 3NZ3A 1VCBA 1WRIA 3DBHB 1N63A 2INNE 2REXA 2MJDA 4JX1C 3MC9A 1VJKA 4TQ0A 3VQIA 4XWWA 4KIKA 4KGRA 4A3PA 1JW9D 4XX5A 2PTLA 2QILA 3H1UA 3CSFA 3GOEA 3VTWA 4BOZB 3Q8BA 1JWBD 3IAM1 2WXGA 1CQVA 1QF6A 3U7ZA 3P4PB 1L0VB 1WZ0A 3A9JB 3DBRI 2BS4B 1NDDA 1FNUA 2KDEB 2LEKA 4A90A 3UQBA 2CHZA 2KXJA 4NJCA 3GZNI 2KDIA 3NY5A 4MDKE 1J7AA 3JSVB 4KSLC 3APDA 3AMZA 1NENB 3BWUD 3OWEB 4TMAB 1A5RA 4N6EB 3SFDB 2IGHA 5DPSA 1EM7A 1J0GA 1UD7A 2RDBC 2BBCA 1YIWA 1L4DB 3DQVA 1YJJA 3NVVA 2DAJA 4G0NB 5IP4D 1FFUA 3GE8C 4UDUC 1PFDA 3ZYYX 3N1XC 3AEGB 4ANXA 2WDQB 4YSYB 1WE6A 3PRZA 1KRHA 3U4EG 3MC8A 2KLGA 4BBNF 1FRRA 4FBJB 2BB5A 5LXHA 5G5HA 3VUWA 4YTPB 4M0WA 2KVRA 5BO4B 3FC4A 1V1PA 4WH4A 2EKEC 5CX3A 5G55A 2FBWB 1WR1A 1IBXA 2KFJA 2GRIA 4JE3B 4GLSC 3DOWA 3QJZA 4W9CA 4EZKA 2Y3AA 1EU3A 4H2AA 3A4SC 2JUOA 3PVLA 3A1QA 2L0FA 4TQ1A 3ZIMA 4EUTA 4PS8A 3V6CB 2JXTA 5TSSA 3NVYA 2MJEA 2ZNVB 4TSSA 3B1LX 2ZEQA 2HJ1A 4S17A 1QOFA 1SE4A 3Q8FA 3QK0A 2C9WB 1UELA 1WGGA 4DHZE 2K6QA 2KJRA 1ESFA 1FEHA 1F52A 1K52A 4RGMA 4AJYB 2JZZA 1TZOA 4RNAA 3UIPB 3AN1A 4P16A 1WH3A 3AE1B 3WANA 3ZJUA 2LVQA 2FIFA 1M94A 3NOBA 4S0RA 1YN5A 4URKA 3SR6A 2LWPA 2IY0B 2KWDA 3RT3B 1FCLA 3EUB2 5H8YE 1V1OA 3WAMA 1MJDA 1QT9A 3ZNGC 5TR5A 3OLMD 3L16A 4PT5A 3R8BA 2KN5A 5BMHA 2WXQA 4KGTA 2QHOA 1FO4A 2MRPA 3V6EB 1PYWD 4K7WA 3AULA 4M02A 3PZ8A 1L7YA 4ITKA 1R4MI 3AE3B 1LQBA 2FCNA 2KFKA 3L10B 1I4QA 2J0KA 3B2GA 3T3OA 4WWMA 1WM2A 3VDZA 3VR9B 2KHWB 2JVCA 4GDLB 4WJPA 2Z59B 1E8ZA 2EKIA 2ZCBA 2DYOA 4ZYSA 1GB4A 3NVWA 1GC6A 2M8SA 3RD2A 4B0MA 4FJZA 2IGGA 1ISNA 4GMVA 4NY0A 2JU6X 2FCQA 2ZVNA 2W9NA 2XBBC 3NG0A 2MCNB 2C7MB 2LGDA 2MH7A 2LZ6A 2KYWA 3M95A 3GE3C 1BT0A 3AEDB 2MQJA 3HUIA 3IT6B 1EUVB 2KZRA 5FR6A 4FJVB 1WSPA 1DOXA 2WXRA 1GC7A 4DDID 2V3PA 1TY0A 1S1QB 1LO5D 3MC0B 4ICVA 4XDDA 3C0RB 4W9DA 1UWMA 5MPOA 2WXFA 4A55A 4USAA 2KJ6A 1HXYD 1TJEA 3Q2AC 4HPMB 1XCTL 3UQAA 3AEBB 2C7HA 4FLHA 4WWOA 3PPAA 4FULA 4FJYA 1VZ7A 2KDBA 3P42A 1WJ4A 4F7ZA 2KO3A 2L00B 4KDIC 1N6ZA 1XQQA 4NJ7A 3T8MA 1H4RA 2WDVB 3IT4B 3EHVA 1V80A 4MGZE 2NBWB 2KD0A 3RNEC 2GBJA 1JMLA 2X8XX 2YEPF 4KVGB 2LASA 3GS2A 3CF6E 4II2B 3MFGA 1C9FA 2RSUA 2W3SA 1Q5WB 4W9LA 3L0WB 2CR5A 2BS3B 3W1SC 1ZDVA 4I6NB 4A9AA 1V8CA 3LYYA 5H92C 2VH1A 1C4CA 4KDLB 3KUDB 2K8HA 2KACA 2UWQA 2L05A 1UUPA 4BBNC 2CHXA 3M63B 1WGHA 3C19A 1RAXA 4ASWC 3KH0A 2V0GA 2LMCA 3OJ4B 3UF8A 3H7SA 3B9JA 1K50A 3APFA 1N62A 3MP9A 3PTFC 1D3ZA 4FHJA 3QWZB 2GBRA 2XK5B 3RN9C 1KM7A 1V97A 2JT4B 4IKGA 1QOGA 1T0QC 2KKCA 1G6JA 2J42A 3LXFA 3T9LA 3M3JA 1NI3A 1V49A 4MJSA 2ASQA 3V62A 3AE2B 2LGXA 5LXIB 1DOIA 3PRPB 1F9JA 4O1NA 1NYQA 4IG7B 3N30A 1YX5B 1OQRA 4BOSC 1AN8A 2CU3A 4HVBA 2MLBA 3ZO5B 5AUKA 3CIRB 3GP7A 1EF1A 3VFKA 1I7HA 4OVVA 1DYQA 2DYMA 1WI0A 2Z0DB 2K3UA 2EMTA 2EELA 2DYBA 4DXAB 2AYOB 2B3AA 2NMQA 1T3QA 1C77A 2L7RA 2C7NB 1YX6B 2YLMA 4BZAA 1UWXA 3R7RA 3DBLI 2O2VB 1YN4A 2QC8A 1TKGA 4A3OA 3QA8A 4A20A 2FAZA 1KLVA 2KTFA 2A5UA 2V4LA 4DWFA 2HTME 2JWZA 4RCOA 2MJ3A 3L17A 4DBGA 1FCCC 4AQ7A 2JYTA 1WXQA 2MBBB 1GNUA 3ZJTA 2D3BA 1FM0D 5HI1A 2V1YA 2IPKD 4RH6A 5BYRA 4P6VF 4MGKE 1JWUD 2GLSA 2H88B 2JWUA 3O65B 4KIKB 4IW0A 4RF1A 3SU8X 5D94A 2BWES 3U7DA 3RNGC 1ZXHA 4BKTA 2ZZPB 4RGNA 2M0AA 2N9XA 3TEWA 2IBIB 5E6NA 3Q69A 1GUAB 1D4BA 2JQRB 2A4ZA 3LB8C 3CWIA 4TKNA 5EDSA 2J52A 4W9GA 5D2MB 3VAWA 2K0PA 3VTUA 4ZHOA 4M01A 3WCQA 1WMHA 1XLNA 1NEKB 1PGBA 1WYWB 4K3CA 5EE1A 3PZDA 2PE9A 4WJNA 3B08A 3OG5A 4PS7A 4JGHB 4DHJB 1TIFA 3AB5A 5G2NA 5C3JB 1XLPA 4YTMB 2M17A 3ZJVA 2IGDA 3UIOB 3E9SA 1QLBB 3I57A 2OJRA 1JRUA 2KC1A 1IGCA 5D3DA 4OZBA 3TSSA 2RPVA 1SIJA 2J53A 1XEEA 4IC7B 4RGTA 1I42A 5GXGB 1H8CA 3ZKJC 2R2OA 4JL9A 1TS2A 3HVDA 2QJLA 1SF0A 2DHZA 3ECIA 4WAAA 4M0WB 2L52A 1V1PB 1L5PA 2GBNA 1K51A 3EA6A 4RMAA 2QMTA 3ZW3A 1VDVA 2LUMA 4DHJD 4ARCA 3L13A 4XGAB 5EE3A 1VR9A 1L2NA 4D2KA 4FHKA 1IBXB 2LRWA 3PT2B 2SEBD 1TBEA 2WU5B 1SEBD 1QOAA 1P9DU 2WDRB 1D5XC 5J18A 4B6WA 2RMMA 3HIZA 4YTNB 3P1MA 3DPDA 3GB1A 1VD2A 1CZPA 3HK0A 2WDTB 3A1QB 2SAKA 3IG3A 2BYVE 2KMCA 3BIID 2DLBA 2OHFA 2C60A 3ONSA 4RGOS 4WJOA 4YL8A 2PEAA 3BK2A 4DXFA 4HKZE 2M1MA 2WHIA 2KNBA 3AE9B 1S3SG 4AOFA 2EMSA 3PREA 4EZLA 3RNBC 1E8XA 1BMLC 4W9FA 2Y5CA 5IOIA 3V61A 1FXTB 3DBRB 1WX9A 4JWUC 1UH6A 3QCAA 4LNFA 1MG8A 3H7PA 5CHWA 3AE4B 1KTKA 4LCDE 4MT5A 1HQRD 2D5GA 3GZNB 3PSEB 4WQMA 1IGDA 4AWJA 4G11A 2IDYA 4KKJA 2K1FA 2WXJA 4NZLB 2N1WA 2MBHA 2JX5A 2BVCA 1D6EC 1WYGA 4EFOA 1FNWA 2KX3A 3LDZE 1KLUD 4CYEA 2IO2B 3EFCA 4HROA 1QKZA 5G5GA 2FCMA 3NS8A 1GPXA 3ML8A 2HJ8A 2MP2A 2L8JA 3AE5B 4N59A 4ARIA 3R66C 5IAAC 2KFKB 1V81A 2W54A 3EC8A 2O6VA 4JIOU 1YD8U 3I5JC 1TY2A 1E7PB 1JWSD 2GBMA 3ETRA 1NVID 3RZWC 4HK2A 3A4RA 2BQQA 4CHKA 1YMHE 2AQ2B 3WALA 1C78A 1SGHA 4TUUA 3QIJA 2OOBB 2L0TA 1N5XA 4J6IA 2N0SB 5T8IA 2LD9A 3VXWA 2QCZA 3V3XA 1WGRA 1F1HA 4KKIA 1UBIA 2XN9C 4ICUA 1I4RA 3KW5B 2XEWA 1AYFA 2W3RA 4JPSA 2PVOD 4BVUC 3EFUA 1XD3B 2NVUI 2BF8B 3N32A 4GIVA 1ACCA 1YJ1A 3MHZA 1ZOYB 2N7JA 1K8RB 5EE9A 1VZ6A 1WFYA 1WXMA 3IHPC 3WAPA 3Q3JA 3ZDMC 4L1BA 2LHDA 4NJ6A 3R2IA 1CMXB 1XO3A 1TKYA 3KUCB 3NRZA 2J0JA 3L4PA 5KHOA 2K39A 1R7SA 5HKHA 3A33B 3B0AA 2LGIA 4MH8A 1VZ8A 1P98A 1BUIC 2R61A 3O13A 4LNOA 4NAWA 3QQ8B 1ZP0B 1TT5B 2LFIA 4K7SA 3DDCB 3U30A 3W5UB 2FNJB 3HM3A 2L32A 1AW7A 2WXHA 5I4DA 5DPRA 2LVPA 2BB6A 1T0YA 1R4MB 2KMAA 3DWMA 3KWVA 5AZGA 1ZDXA 1E6EB 1TS3A 4NAMA 4HDOA 3ZLZA 3ALBA 3X23A 3VR8B 1T6BX 3J9CA 3I63C 3A9KA 4MEMA 2MBEA 4GDKA 3BVZA 1JRPA 2GI9A 3TEYA 4I6LB 1PUTA 2WX1A 3AXCA 3L08A 1MG4A 5CTRC 2IZVB 2KANA 5JHBA 3P63A 2ACZB 5IN7A 3ZNHB 2D3CA 4KV2A 2LGYA 4JLCA 2N7DA 3RULA 3TCAA 4M8NA 4FA6A 4Q2JA 2KN4A 2E3TA 2RD0A 2G4DB 1LXDA 2INPE 3AU5A 3IAS1 2M4NA 4I6PA 1V9JA 3VH4B 2KQ4X 5C1ZA 2N4FA 2BPSA 1TKEA 4E3CA 3AI5A 3Q8EA 3PLVA 2W82A 4RM8A 2IJ0A 1SSNA 4YT0B 3DHHC 2BT6A 3ZNID 1GG3A 2Z0EB 1WWTA 3FILA 1V5OA 1WX8A 2UYZB 4MJSB 3N1YC 2WQYB 4HEA1 3UI3A 5J17A 3BINA 1QILA 1T0SC 4F1SA 4G3XB 1AWDA 3TUOA 5JHAA 3KVFB 3TEXA 1F77A 4GN1A 1C4AA 4MACA 3VVWB 4N58A 3DVGY 1HZ6A 5BYSA 2OJWA 1JQ4A 1E9MA 4XZ4A 1LM8B 3JYUA 2CHWA 4WAFA 1OGWA 3Q3NC 1K53A 2MSED 4W9EA 5DPWA 1FPYA 4RFBA 4DXGA 2JY6A 4HCPB 2K8BA 4EEWA 4MSQB 1XLOA 2H89B 5D7GA 3JW0X 2INDC 5E6PA 4KZCA
chains in the Genus database with same CATH topology
1FFUA 1MHHE 4LTUA 4UDUC 2MEKA 1ZXHA 1PFDA 2WXNA 1I4GA 3ZYYX 1FXAA 3AEGB 2WDQB 4YSYB 4RGNA 1FIQA 2M0AA 3AE7B 1ZE3D 3TEWA 4REZA 2RDGA 1JWAD 1KRHA 3U4EG 3FILB 1QOBA 3Q69A 5C2TB 3NVZA 1FRRA 1N61A 1PGAA 2BB5A 1ROEA 5G5HA 1D4BA 2JQRB 4M0WA 4YTPB 3FC4A 3LB8C 1V1PA 3CWIA 4YWGG 4WH4A 3I9V1 2B76B 1IUEA 2J52A 1SE3A 1HEZE 2K0PA 4KGSA 2FBWB 4ZHOA 1F2RI 3WCQA 3NUHB 1XLNA 2XNAC 1IBXA 1XLQA 3RFZB 4IDIA 5BYQA 2WXMA 4B0EA 1GOZA 1NEKB 1PGBA 2GRIA 5EE1A 2WU2B 1B9RA 1Q10A 3NS1A 4JE3B 4GLSC 5FKAC 1M4VA 1D5MC 2Y3AA 3AB5A 1EU3A 5C3JB 4H2AA 1XLPA 1JCKB 4YTMB 2FUG1 3ZJVA 2IGDA 3E9SA 1QLBB 3I57A 4TQ1A 4J3OD 5EE0A 1SJED 1IGCA 4XWTA 4OW0A 1HA5A 5D3DA 4OZBA 1OQQA 2JXTA 2Y5PA 5TSSA 3NVYA 2MJEA 1NYRA 2RPVA 3ABVB 3TSSA 1SIJA 4TSSA 2QSDA 2J53A 1JWMD 1XEEA 4ZHPA 4RGTA 2ON8A 4OZAA 5GXGB 1FMAD 1J7CA 3AH7A 1QOFA 1SE2A 1SE4A 1TS2A 3HVDA 1YNTE 2M56B 3Q8FA 2QJLA 1SF0A 2JZPA 2LJIA 2L52A 1C4PA 1CJEA 1L5PA 1V1PB 2E6XA 1K51A 1J7BA 3EA6A 1ESFA 1FEHA 2QMTA 1K52A 3SEBA 4RGMA 4CQNA 3Q8CA 1VDVA 2LUMA 3VRAB 4ARCA 3FAHA 1TZOA 4RNAA 1TS4A 2BTEA 3AN1A 4US9A 4P16A 1VR9A 5EE3A 4D2KA 3AE1B 1IBXB 3ZJUA 3BVGA 2SEBD 2WU5B 1SEBD 1QOAA 2WDRB 2BS2B 1D5XC 2RMMA 1YN5A 4YTNB 3V05A 3SR6A 3P1MA 4A6QA 4AS1A 2KWDA 3RPFC 1FCLA 3EUB2 4LLGM 3GB1A 5H8YE 1P7EA 1V1OA 1CZPA 1STEA 2WS3B 1QT9A 3U52E 5JXVA 2AQ3B 2SAKA 1FFVA 2AX5A 4PT5A 3R8BA 5BMHA 2WXQA 4KGTA 3BIID 2DLBA 2K22A 2OHFA 2PKOA 1FO4A 3AEEB 3BVMA 4RGOS 1PYWD 3BK2A 1BXTA 3KQ4A 2ZW0A 3PZ8A 4DXFA 4HKZE 4ITKA 3AE9B 1RFKA 3AE3B 2BW2A 1I4QA 1BMLC 3AM9A 1F2RC 2Y5CA 3B2GA 3T3OA 4WWMA 3R2TA 3W9CB 2Q5WD 3VR9B 2RDHA 4GDLB 3KLSX 3PZ7A 1JROA 2TSSA 3C8YA 4JWUC 3HVZA 1I4XA 3BYYB 2ICIA 1P7FA 2EKIA 2N9LA 2DYOA 3W1SA 3AE4B 1KTKA 1JALA 4ZYSA 1PGXA 4MT5A 1GB4A 3NVWA 2OEDA 1HQRD 2D5GA 4B0MA 4WQMA 1IGDA 1N5WA 3BZDB 1CK1A 4YSZB 4KX6B 4FXCA 2WXIA 1ZXIA 3KWLA 2IDYA 4WURA 2IGGA 4KKJA 5FR3A 2PVGC 2WXPA 2WXJA 4A8XC 4NZLB 1F0ZA 5HG2A 2G9HD 4EE2A 2JX5A 2JU6X 2YEPB 2KMMA 2X38A 1E0ZA 1GB1A 1D6EC 1WYGA 1FNWA 4YXDB 1KLUD 2BYTA 2DBYA 1SBBB 4C7ZA 4HROA 1QKZA 3BK1A 5G5GA 1GPXA 2L83A 4XE0A 3Q8AA 4OVZA 3AE5B 1T5XD 3SFEB 4N59A 1MI0A 2MH7A 4ARIA 2ZW1A 1UNSA 2W54A 3AEDB 2I38A 3BYTB 3HUIA 3IT6B 1TY2A 1WSPA 1DOXA 1E7PB 1JWSD 3TEZA 1EU4A 2WXRA 1C76A 2WP9B 3ETRA 3EGRA 4ZOHC 3AECB 1NVID 2V3PA 2QIEB 2PIAA 1TY0A 1VLBA 3U2SC 1DOYA 1LO5D 2WXOA 3MC0B 4XDDA 2K5PA 1YMHE 2AQ2B 2PLPA 2WXLA 4LK0M 4DQOC 5BMIA 2NTSA 1UWMA 1C78A 5MPOA 1MPEA 2WXFA 4C7YA 2JYEA 2FE8A 4A55A 2WXKA 4USAA 1YQ4B 1N5XA 3AE8B 2N0SB 5T8IA 1HXYD 1TJEA 1SB3C 1XCTL 3V3XA 4R3DA 1HZ5A 4KKIA 1RM6C 3AEBB 2XN9C 1DGJA 1I4RA 1AYFA 1VZ7A 2W3RA 4IOIE 4JPSA 5E6JA 3P42A 2PVOD 1A70A 3IXSA 1ACCA 3MHZA 1ZOYB 1MHXA 3W5VB 4C80A 1L4ZB 1YN3A 2N7JA 3DWGC 2WDVB 5EE9A 1VZ6A 3IT4B 4ZRQA 4HRSA 1WGKA 1OFFA 1FNVA 5AUIA 4L1BA 2LHDA 1JMLA 1YQ3B 4OZCA 3R2IA 2JSVX 2YEPF 3T3NA 3H8HA 1XO3A 1TKYA 4L2YA 3GS2A 4YSXB 1SXTA 3MFGA 1C9FA 3NRZA 2W3SA 3AEAB 1ET6A 3L4PA 1C79A 2KAJA 2V4IB 1R7SA 4L23A 4US8A 2BS3B 2LGIA 1ZDVA 4C56C 4MH8A 1VZ8A 1BUIC 1L6UA 2R61A 4A9AA 1V8CA 3LYYA 5H92C 3O13A 1L0XB 1KH0A 1C4CA 2VZKB 5D3IB 2Z8LA 2KDMA 1ZP0B 2KACA 3PO0A 2LFIA 2N9KA 2V3NA 2G1EA 3AEFB 3URYA 3W5UB 2L32A 1UUPA 1AW7A 3VRBB 2WXHA 1L6VA 2M19A 5I4DA 2W55A 2AQ1B 1I4HA 2BB6A 2V0GA 2LMCA 2NTTA 1L0YB 1VRAB 3HRDD 3DWMA 3KWVA 1KFYB 3B9JA 1ZDXA 2CJOA 1E6EB 1TS3A 4XDCA 1I4PA 1K50A 1N62A 3ZGZA 1PDXA 2HDEA 3MP9A 4HJGE 4NAMA 1KLGD 4RF0A 1ET9A 1FXIA 1Y56A 3VR8B 5HHDG 1T6BX 3J9CA 3W2DA 3AE6B 2LHEA 1V97A 4IKGA 5FK9C 3P4SB 1QOGA 1JRPA 3BVZA 3ZQ4A 2VZKD 2I2YA 2GI9A 3TEYA 3AV8A 2J42A 2K9XA 1PUTA 3LXFA 1NI3A 2J4XA 3MJ5A 2PMVA 3AE2B 1KF6B 1E10A 1MVKA 3P63A 2ACZB 1DOIA 1SJHD 3E56A 4NAWB 4O1NA 1NYQA 1RYJA 2GB1A 2WNMA 1ENFA 5BMGA 1TS5A 1N60A 1XCQL 1OQRA 1AN8A 2CU3A 4Q2JA 5AUKA 3CIRB 4ZRPA 1EWYC 2KN4A 3GP7A 5HFYA 2PW9A 2E3TA 1YJIA 2ONQA 1B1ZA 1FD6A 2INPE 1FRDA 3IAS1 2QEJC 1ZUD2 2DWQA 4OHJA 3NZ3A 1WRIA 1I7HA 1N63A 2INNE 2KQ4X 1DYQA 1XXGA 2DYMA 2MJDA 4JX1C 1VJKA 1TKEA 4TQ0A 2K3UA 3Q8EA 3VQIA 4JWSC 4XWWA 2EELA 4KGRA 2W82A 1JW9D 2L1AA 2CJNA 2IJ0A 5LNK1 1SSNA 4YT0B 2PTLA 4GDKB 2QILA 2BT6A 2NMQA 1T3QA 1C77A 4MM3B 1WWTA 1JWBD 3FILA 3IAM1 2WXGA 3Q8BA 1CQVA 1QF6A 3U7ZA 1ZPSA 1UWXA 2WQYB 3P4PB 1L0VB 4HEA1 3UI3A 2BS4B 1QILA 1FNUA 1YN4A 1AWDA 1TKGA 3TUOA 3TEXA 1F77A 1C4AA 3B2FA 4MACA 2LEKA 1QQRA 4A90A 4N58A 1D5ZC 1HZ6A 4NJCA 5BYSA 1JQ4A 3N9YC 1E9MA 2HTME 1J7AA 4RCOA 2MJ3A 1RWSA 1EWCA 1GAQB 1FCCC 1UGJA 3AMZA 1NENB 4AQ7A 3BWUD 4WAFA 2JYTA 4WIPA 3OWEB 1WXQA 4TMAB 3P4QB 4N6EB 3ZJTA 1K53A 3SFDB 2IGHA 5HI1A 1FM0D 2IPKD 1EM7A 4RH6A 1XF5L 2WLBA 5BYRA 4RFBA 4DXGA 4P6VF 1TYGB 1JWUD 4HKQA 2BBCA 2H88B 2JWUA 3P4RB 1L4DB 1XLOA 2H89B 5D7GA 1YJJA 3NVVA 4RF1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YQ4 B;  3AV8 A;  1N5X A;  1FFU A;  3AE8 B;  4LTU A;  2N0S B;  1FFV A;  2AX5 A;  1PUT A;  1TJE A;  1SB3 C;  2K9X A;  1PFD A;  3LXF A;  3BII D;  3ZYY X;  1NI3 A;  2K22 A;  2OHF A;  2PKO A;  1FO4 A;  1FXA A;  3AEG B;  3AE2 B;  3AEE B;  2WDQ B;  4YSY B;  1KF6 B;  1RM6 C;  1FIQ A;  3AE7 B;  3AEB B;  1E10 A;  3P63 A;  2ACZ B;  1DOI A;  1JWA D;  1KRH A;  1DGJ A;  1NYQ A;  4ITK A;  1QOB A;  1RYJ A;  1AYF A;  2W3R A;  3NVZ A;  5C2T B;  1FRR A;  1N60 A;  1N61 A;  1RFK A;  1ROE A;  2PVO D;  3AE9 B;  5G5H A;  1A70 A;  2JQR B;  1OQR A;  4YTP B;  3AE3 B;  3FC4 A;  2CU3 A;  3LB8 C;  3CWI A;  5AUK A;  3CIR B;  3AM9 A;  1EWY C;  1IUE A;  2B76 B;  2Y5C A;  3B2G A;  4WWM A;  1ZOY B;  3W9C B;  2Q5W D;  2FBW B;  2E3T A;  3VR9 B;  1YJI A;  3W5V B;  4C80 A;  4ZHO A;  3DWG C;  2WDV B;  3WCQ A;  5EE9 A;  1FRD A;  1JRO A;  1XLN A;  1WGK A;  4HRS A;  1XLQ A;  1ZUD 2;  2DWQ A;  4JWU C;  4IDI A;  1OFF A;  3HVZ A;  5AUI A;  2EKI A;  1NEK B;  1WRI A;  2WU2 B;  5EE1 A;  1I7H A;  1N63 A;  1YQ3 B;  3AE4 B;  1JAL A;  2MJD A;  4JX1 C;  3NS1 A;  1B9R A;  3NVW A;  1XO3 A;  1TKY A;  1VJK A;  4WQM A;  1TKE A;  4YSX B;  3AB5 A;  4JWS C;  5C3J B;  1N5W A;  1XLP A;  3NRZ A;  4YSZ B;  4KX6 B;  4FXC A;  2W3S A;  3AEA B;  4YTM B;  1JW9 D;  1ZXI A;  2KAJ A;  3KWL A;  3L4P A;  1QLB B;  1R7S A;  2CJN A;  5EE0 A;  2PVG C;  4US8 A;  2BS3 B;  4YT0 B;  1OQQ A;  1F0Z A;  2BT6 A;  3NVY A;  2JX5 A;  1T3Q A;  1L6U A;  4A9A A;  2MJE A;  1V8C A;  1NYR A;  3ABV B;  2KMM A;  1E0Z A;  1SIJ A;  5H92 C;  4ZHP A;  1WWT A;  1JWB D;  1WYG A;  4YXD B;  1QF6 A;  1ZP0 B;  2DBY A;  5GXG B;  2WQY B;  3PO0 A;  1FMA D;  1L0V B;  3P4P B;  4HRO A;  5G5G A;  4C7Z A;  1J7C A;  3AH7 A;  2G1E A;  1QOF A;  3AEF B;  3W5U B;  2BS4 B;  2M56 B;  1GPX A;  2L83 A;  3VRB B;  1AWD A;  1L6V A;  2QJL A;  1TKG A;  2M19 A;  1SF0 A;  2W55 A;  3AE5 B;  3SFE B;  3B2F A;  4N59 A;  2MH7 A;  2LEK A;  4N58 A;  2L52 A;  1CJE A;  1L5P A;  1JQ4 A;  1J7B A;  2W54 A;  3HRD D;  3AED B;  3DWM A;  1KFY B;  3B9J A;  1E9M A;  3HUI A;  2CJO A;  2HTM E;  1J7A A;  1E6E B;  1VDV A;  3VRA B;  1N62 A;  3FAH A;  1PDX A;  1DOX A;  1E7P B;  1RWS A;  2MJ3 A;  3AN1 A;  1GAQ B;  4US9 A;  3ETR A;  2WP9 B;  3AMZ A;  5EE3 A;  4ZOH C;  1NEN B;  3AE1 B;  3AEC B;  1NVI D;  1WXQ A;  1FXI A;  2QIE B;  2PIA A;  2WU5 B;  3P4Q B;  4N6E B;  3VR8 B;  1VLB A;  3SFD B;  1QOA A;  1DOY A;  1FM0 D;  2WDR B;  2BS2 B;  2K5P A;  3AE6 B;  2WLB A;  1V97 A;  1UWM A;  4P6V F;  4YTN B;  1TYG B;  3SR6 A;  3P1M A;  5MPO A;  3P4S B;  1QOG A;  1JRP A;  4C7Y A;  2H88 B;  3RPF C;  3EUB 2;  3P4R B;  1XLO A;  2H89 B;  5H8Y E;  1CZP A;  1YJJ A;  3NVV A;  2WS3 B;  4USA A;  1QT9 A; 
#chains in the Genus database with same CATH topology
 4LTU A;  4W9I A;  3PHW B;  2WXN A;  1I4G A;  1FXA A;  4ZRI A;  3D32 A;  3AE7 B;  5L95 C;  2BKR B;  4REZ A;  1JWA D;  4EOY A;  2YVC A;  3NVZ A;  1PGA A;  1ROE A;  5AZF A;  2B76 B;  1SE3 A;  4KGS A;  1UBQ A;  4GXB A;  1F2R I;  3NUH B;  2XNA C;  3RFZ B;  5BYQ A;  2WXM A;  2J7Q B;  4XYC A;  1GOZ A;  3AU4 A;  1WX7 A;  2LXA A;  1M4V A;  3MHS D;  1ZW7 A;  4J3O D;  5EE0 A;  1SJE D;  1HA5 A;  2V3S A;  1OQQ A;  4BKS A;  1WY8 A;  4F8C B;  3P2B A;  4ACF A;  4B95 A;  2HTH A;  2QSD A;  1WXV A;  2BGF A;  2G45 B;  2WYQ A;  2ON8 A;  1FMA D;  4CO7 A;  2UU7 A;  4IM2 A;  4PK1 A;  2N9P C;  3CMM B;  2CU1 A;  2JZP A;  4ZDV A;  1V5T A;  1CJE A;  2K25 A;  1LFD A;  1J7B A;  2QDF A;  3VRA B;  5JH5 C;  1WMH B;  3OJ3 A;  3N3K B;  2MW5 A;  2KTR A;  4II3 B;  1R4N I;  3ML9 A;  3V05 A;  4ZRJ A;  4AS1 A;  3RPF C;  4LLG M;  1P7E A;  2DEN B;  4MGY E;  4AJW A;  5JXV A;  1FFV A;  2AX5 A;  4KSK C;  2WX0 A;  1UZX B;  4C4V A;  4ANU A;  3SHQ A;  1BXT A;  2K6D B;  5J2R A;  3KQ4 A;  3HHM A;  1E90 A;  1SE9 A;  4LNN A;  1YOV B;  2N7E A;  3ENE A;  1F2R C;  3RZF A;  3W9C B;  4GB9 A;  3DBL B;  2RDH A;  5CHV C;  1JRO A;  3C8Y A;  2KQ7 A;  4HLE A;  3HVZ A;  1I4X A;  2ICI A;  1P7F A;  2N9L A;  3OAW A;  2NBV B;  3FKY A;  4P1C C;  4B9K A;  1WJU A;  2KVZ A;  2BYF A;  3X0W A;  1CK1 A;  2D3A A;  4FXC A;  2JRI B;  2K8C A;  3KWL A;  4WUR A;  2LJ5 A;  2LVO A;  5FR3 A;  4NPN A;  2D2Q A;  4BAX A;  2ZCC A;  2PJH A;  5HG2 A;  3DHG C;  2YEP B;  3VH3 B;  1E0Z A;  1GB1 A;  3KYC D;  5IO9 A;  5DPT A;  2HD5 B;  2BYT A;  2DBY A;  5IA7 A;  3IVF A;  2L83 A;  1OQY A;  4HPL B;  1OTR B;  4IM3 A;  2M0X A;  2LUE A;  1T5X D;  2ZVO A;  1MI0 A;  2MWS B;  1OEY A;  3DBH I;  3BYT B;  4IWO A;  1EU4 A;  2JZ3 B;  4BFR A;  1J19 A;  2PIA A;  2NR2 A;  3H7P B;  1DOY A;  2INC C;  5BMI A;  4WQO B;  4LK0 M;  4DQO C;  2WXL A;  2I1J A;  2NTS A;  4C7Y A;  2FE8 A;  2KWV B;  1WRD B;  2N1V A;  4ZYN A;  2WXK A;  3AE8 B;  1RLF A;  1SB3 C;  1C1Y B;  1HTQ A;  4KZ0 A;  1WJN A;  3Q14 C;  4R3D A;  3WA0 A;  1HZ5 A;  1EF5 A;  1E5W A;  2KWC A;  3TJP A;  4K1R B;  3ZXV A;  4MH0 E;  2LRU A;  3APC A;  1PQS A;  1J8C A;  2MP2 B;  1MHX A;  3W5V B;  4C80 A;  1WJ6 A;  3DWG C;  3PRM B;  1UF0 A;  2ZJD A;  4ZRQ A;  1QZE A;  3N20 C;  1T0R C;  5AUI A;  1KJT A;  2O6V B;  4PS3 A;  4JQW C;  3DVN U;  4OZC A;  2JSV X;  3T3N A;  3H8H A;  4L2Y A;  3VUY A;  1SXT A;  3DCG A;  2KWU B;  2KAJ A;  4AUQ C;  4US8 A;  1Z2M A;  3I3T B;  1WM3 A;  4GGQ A;  3ZXR A;  2DX5 B;  4ANV A;  4LNK A;  2IO1 B;  3DVN V;  5D3I B;  2G1E A;  3AEF B;  3VUX A;  2M19 A;  2VH2 A;  2GBK A;  2O6V D;  2NTT A;  2FUH B;  2CJO A;  2G4S A;  4LNI A;  3ZGZ A;  1PDX A;  1V2Y A;  4ANW A;  3V60 A;  4E74 A;  1NBF C;  4LJP B;  1ET9 A;  1IP9 A;  2V9H A;  4K7U A;  1Y56 A;  3PGE A;  5HHD G;  2LHE A;  2KOX A;  2KQS A;  3IBE A;  4MEL A;  3ZQ4 A;  2I2Y A;  4G50 A;  1OEY J;  2J4X A;  5AZH A;  3W1Y A;  1KF6 B;  1WF9 A;  3JVZ X;  1E10 A;  3A9J A;  1MVK A;  3PHX B;  3TL5 A;  4NAW B;  1RYJ A;  2WNM A;  4HJK A;  1TS5 A;  5BMG A;  3TMP B;  1XCQ L;  4IM0 A;  4ZRP A;  1YQB A;  3S2A A;  2PW9 A;  2ZPN A;  3JSV A;  2ONQ A;  1FD6 A;  1Z5S B;  1P1A A;  1HTO A;  2DWQ A;  4M8M A;  3DBS A;  2MA9 B;  1XXG A;  2IYD B;  4LJO B;  1ZKH A;  4JWS C;  2DNF A;  1P0R A;  2R2Q A;  4HWI B;  1RRB A;  4W9H A;  2L1A A;  2CJN A;  3A9K B;  1WIA A;  5LNK 1;  3L54 A;  3PLU A;  4GDK B;  2IO0 B;  4PYU A;  4WJQ A;  2NCN A;  4MM3 B;  2I1K A;  4DHZ B;  1X1M A;  1ZPS A;  4BKG A;  4DDG D;  1Q0W B;  3QHT A;  3RMK C;  1E7V A;  3MJW A;  5KHQ A;  1HE8 A;  1WXA A;  1V6E A;  3B2F A;  3N1Z C;  1SIF A;  1QQR A;  1D5Z C;  3ZNZ B;  1RFA A;  3N9Y C;  3UGB B;  2VRR B;  1RWS A;  2NS5 A;  1EWC A;  1GAQ B;  2N9E B;  1UGJ A;  1TGZ B;  4WIP A;  2BYE A;  3P4Q B;  2ZNV C;  2DZM A;  1XF5 L;  2WLB A;  4C00 A;  1TYG B;  2L3Z A;  2C5L C;  3ZDT A;  4HKQ A;  2NPT B;  4GSW A;  3ZTC A;  3P4R B;  2MBO A;  4X57 B;  1MHH E;  3QAR A;  2D3G A;  2MEK A;  4WWP A;  1C3T A;  3LJ3 A;  1FIQ A;  2KT7 A;  4P7I A;  1ZE3 D;  2BWF A;  2RDG A;  3RNF C;  4XC2 A;  3BY4 B;  3FIL B;  1QOB A;  5C2T B;  1N61 A;  4GU2 A;  2LGS A;  4YWG G;  3I9V 1;  4K3B A;  3R3M A;  1IUE A;  3RCZ A;  1HEZ E;  4HDQ A;  1Y8R C;  2LXC A;  4MM3 A;  1XLQ A;  4IDI A;  4B0E A;  2NBU A;  2WU2 B;  1B9R A;  1Q10 A;  3NS1 A;  3QX1 A;  5FKA C;  2GOW A;  4HXD A;  1D5M C;  3PS6 A;  3H9D A;  1JCK B;  1AAR A;  2FUG 1;  3RNC C;  2IY1 B;  4N9F 4;  4XWT A;  4OW0 A;  2Y5P A;  3ZRC A;  2HE7 A;  1NYR A;  3ABV B;  4ZHP A;  1EO6 A;  1JWM D;  1P3Q U;  3QAQ A;  4OZA A;  3RNA C;  1J7C A;  1IPG A;  3AH7 A;  1SE2 A;  2JRH A;  1YNT E;  2M56 B;  2NPT A;  3IFW B;  1TZ1 A;  1MFW A;  1IYF A;  4GDL A;  2LJI A;  2KLC A;  1C4P A;  2E6X A;  1E8W A;  3SEB A;  4CQN A;  3Q8C A;  3SDL C;  3FAH A;  4P1B C;  1TS4 A;  2BTE A;  4US9 A;  5DCN A;  3BVG A;  3ZUN A;  2BS2 B;  4HPP A;  3RYT A;  3H6N A;  2KC2 A;  4PYZ A;  4A6Q A;  3HM6 X;  4ZRK A;  1STE A;  1LGR A;  2WS3 B;  1ZGU B;  3U52 E;  2AQ3 B;  2J0M A;  3NZU A;  4IUM B;  2K22 A;  2PKO A;  2RR9 A;  3AEE B;  3BVM A;  2RGF A;  2CKH B;  2ZW0 A;  1RFK A;  2FCS A;  2BW2 A;  2KX0 A;  3AM9 A;  3R2T A;  2Q5W D;  1NI2 A;  3KLS X;  3PZ7 A;  2TSS A;  3K9O B;  4NQL B;  3BYY B;  4IWP A;  2DZI A;  1Q1O A;  1WGY A;  3W1S A;  1JAL A;  1PGX A;  2MBQ A;  2OED A;  3NJT A;  1N5W A;  3BZD B;  4YSZ B;  4KX6 B;  4IWQ A;  1XT9 B;  2WXI A;  1ZXI A;  2KTR B;  2KJH B;  1KOT A;  4BKS D;  1U4A A;  2DAF A;  2PVG C;  2WXP A;  4FN2 A;  4A8X C;  1F0Z A;  3NZS A;  2G9H D;  4EE2 A;  2KMM A;  2X38 A;  2BKF A;  4AP4 C;  4YXD B;  3DHI C;  1SBB B;  4C7Z A;  4HCN B;  3BK1 A;  4C4V B;  5L83 A;  3WAO A;  3TIX A;  2DZJ A;  2CS4 A;  4XE0 A;  3Q8A A;  3M62 B;  4OVZ A;  3SFE B;  2ZW1 A;  1UNS A;  2I38 A;  4RM9 A;  4W9K A;  5C23 A;  3TEZ A;  1C76 A;  2JXX A;  2WP9 B;  3EGR A;  4ZOH C;  3AEC B;  2QIE B;  1VLB A;  1E8Y A;  3U2S C;  1WR6 E;  2WXO A;  2K5P A;  2PLP A;  4K81 A;  1MPE A;  2JYE A;  4MGI E;  1YQ4 B;  3SD5 A;  4NQK E;  3DVG X;  2PPH A;  4LDT B;  2KK8 A;  3TBL D;  2PE6 B;  1RM6 C;  2FID A;  2WGS A;  4EKU A;  1DGJ A;  3R7Q A;  3WIM A;  4IOI E;  3MTN B;  5E6J A;  1A70 A;  4WWN A;  1WE7 A;  4W9J A;  3Q3F A;  1WZ3 A;  3IXS A;  1WXS A;  3ZRF A;  3K9P B;  5JZE B;  1GJZ A;  3VHT C;  1L4Z B;  1YN3 A;  3RUI B;  3RI7 C;  3U8Z A;  4FAD A;  4HRS A;  2JPH A;  1WGD A;  1WGK A;  5GMV A;  4MSM B;  1OFF A;  3PV1 A;  1FNV A;  2XK5 A;  1YQ3 B;  5LLI A;  3CST A;  3NHE B;  3ZVV A;  1TTN A;  3QC8 B;  3Q3O C;  4YSX B;  3Q6B A;  4LDT D;  3VTV A;  4E71 A;  3AEA B;  1I35 A;  1ET6 A;  1C79 A;  5CHF A;  2V4I B;  4L23 A;  2D10 A;  2AWT A;  4C56 C;  1L6U A;  1R4N B;  4NNJ B;  1L0X B;  1KH0 A;  2VZK B;  2Z8L A;  2KDM A;  2IO3 B;  3PO0 A;  1UGM A;  2N9K A;  2V3N A;  3URY A;  5IKC M;  2ZPY A;  3VRB B;  2LI5 A;  3UIN B;  5AEK B;  1L6V A;  2W55 A;  2AQ1 B;  1I4H A;  2AEH A;  2AL6 A;  1L0Y B;  2DZK A;  1VRA B;  3KUZ A;  3HRD D;  1KFY B;  4QAY A;  5E6O A;  4XDC A;  1I4P A;  2HDE A;  2GMI C;  4HJG E;  2D11 A;  1KLG D;  3EEC A;  4RF0 A;  2MX2 A;  4OVU A;  1FXI A;  3ZTD A;  3Q3M C;  2Y5B B;  3W2D A;  3AE6 B;  5FK9 C;  3P4S B;  2VZK D;  2RPQ A;  3AV8 A;  2K9X A;  2KDF B;  2L76 A;  2WWZ A;  3MJ5 A;  2PMV A;  2D07 B;  2AL3 A;  2O2V A;  4EZJ A;  5D6J B;  1SJH D;  4M00 A;  3E56 A;  2JF5 A;  2GB1 A;  1ENF A;  3KYD D;  1N60 A;  4DK5 A;  1EWY C;  2G3Q B;  4TV3 A;  1V86 A;  5HFY A;  1YJI A;  1B1Z A;  1E7U A;  1FRD A;  2QEJ C;  1ZUD 2;  2MHJ A;  4GOC A;  4OHJ A;  3NZ3 A;  1VCB A;  1WRI A;  3DBH B;  1N63 A;  2INN E;  2REX A;  2MJD A;  4JX1 C;  3MC9 A;  1VJK A;  4TQ0 A;  3VQI A;  4XWW A;  4KIK A;  4KGR A;  4A3P A;  1JW9 D;  4XX5 A;  2PTL A;  2QIL A;  3H1U A;  3CSF A;  3GOE A;  3VTW A;  4BOZ B;  3Q8B A;  1JWB D;  3IAM 1;  2WXG A;  1CQV A;  1QF6 A;  3U7Z A;  3P4P B;  1L0V B;  1WZ0 A;  3A9J B;  3DBR I;  2BS4 B;  1NDD A;  1FNU A;  2KDE B;  2LEK A;  4A90 A;  3UQB A;  2CHZ A;  2KXJ A;  4NJC A;  3GZN I;  2KDI A;  3NY5 A;  4MDK E;  1J7A A;  3JSV B;  4KSL C;  3APD A;  3AMZ A;  1NEN B;  3BWU D;  3OWE B;  4TMA B;  1A5R A;  4N6E B;  3SFD B;  2IGH A;  5DPS A;  1EM7 A;  1J0G A;  1UD7 A;  2RDB C;  2BBC A;  1YIW A;  1L4D B;  3DQV A;  1YJJ A;  3NVV A;  2DAJ A;  4G0N B;  5IP4 D;  1FFU A;  3GE8 C;  4UDU C;  1PFD A;  3ZYY X;  3N1X C;  3AEG B;  4ANX A;  2WDQ B;  4YSY B;  1WE6 A;  3PRZ A;  1KRH A;  3U4E G;  3MC8 A;  2KLG A;  4BBN F;  1FRR A;  4FBJ B;  2BB5 A;  5LXH A;  5G5H A;  3VUW A;  4YTP B;  4M0W A;  2KVR A;  5BO4 B;  3FC4 A;  1V1P A;  4WH4 A;  2EKE C;  5CX3 A;  5G55 A;  2FBW B;  1WR1 A;  1IBX A;  2KFJ A;  2GRI A;  4JE3 B;  4GLS C;  3DOW A;  3QJZ A;  4W9C A;  4EZK A;  2Y3A A;  1EU3 A;  4H2A A;  3A4S C;  2JUO A;  3PVL A;  3A1Q A;  2L0F A;  4TQ1 A;  3ZIM A;  4EUT A;  4PS8 A;  3V6C B;  2JXT A;  5TSS A;  3NVY A;  2MJE A;  2ZNV B;  4TSS A;  3B1L X;  2ZEQ A;  2HJ1 A;  4S17 A;  1QOF A;  1SE4 A;  3Q8F A;  3QK0 A;  2C9W B;  1UEL A;  1WGG A;  4DHZ E;  2K6Q A;  2KJR A;  1ESF A;  1FEH A;  1F52 A;  1K52 A;  4RGM A;  4AJY B;  2JZZ A;  1TZO A;  4RNA A;  3UIP B;  3AN1 A;  4P16 A;  1WH3 A;  3AE1 B;  3WAN A;  3ZJU A;  2LVQ A;  2FIF A;  1M94 A;  3NOB A;  4S0R A;  1YN5 A;  4URK A;  3SR6 A;  2LWP A;  2IY0 B;  2KWD A;  3RT3 B;  1FCL A;  3EUB 2;  5H8Y E;  1V1O A;  3WAM A;  1MJD A;  1QT9 A;  3ZNG C;  5TR5 A;  3OLM D;  3L16 A;  4PT5 A;  3R8B A;  2KN5 A;  5BMH A;  2WXQ A;  4KGT A;  2QHO A;  1FO4 A;  2MRP A;  3V6E B;  1PYW D;  4K7W A;  3AUL A;  4M02 A;  3PZ8 A;  1L7Y A;  4ITK A;  1R4M I;  3AE3 B;  1LQB A;  2FCN A;  2KFK A;  3L10 B;  1I4Q A;  2J0K A;  3B2G A;  3T3O A;  4WWM A;  1WM2 A;  3VDZ A;  3VR9 B;  2KHW B;  2JVC A;  4GDL B;  4WJP A;  2Z59 B;  1E8Z A;  2EKI A;  2ZCB A;  2DYO A;  4ZYS A;  1GB4 A;  3NVW A;  1GC6 A;  2M8S A;  3RD2 A;  4B0M A;  4FJZ A;  2IGG A;  1ISN A;  4GMV A;  4NY0 A;  2JU6 X;  2FCQ A;  2ZVN A;  2W9N A;  2XBB C;  3NG0 A;  2MCN B;  2C7M B;  2LGD A;  2MH7 A;  2LZ6 A;  2KYW A;  3M95 A;  3GE3 C;  1BT0 A;  3AED B;  2MQJ A;  3HUI A;  3IT6 B;  1EUV B;  2KZR A;  5FR6 A;  4FJV B;  1WSP A;  1DOX A;  2WXR A;  1GC7 A;  4DDI D;  2V3P A;  1TY0 A;  1S1Q B;  1LO5 D;  3MC0 B;  4ICV A;  4XDD A;  3C0R B;  4W9D A;  1UWM A;  5MPO A;  2WXF A;  4A55 A;  4USA A;  2KJ6 A;  1HXY D;  1TJE A;  3Q2A C;  4HPM B;  1XCT L;  3UQA A;  3AEB B;  2C7H A;  4FLH A;  4WWO A;  3PPA A;  4FUL A;  4FJY A;  1VZ7 A;  2KDB A;  3P42 A;  1WJ4 A;  4F7Z A;  2KO3 A;  2L00 B;  4KDI C;  1N6Z A;  1XQQ A;  4NJ7 A;  3T8M A;  1H4R A;  2WDV B;  3IT4 B;  3EHV A;  1V80 A;  4MGZ E;  2NBW B;  2KD0 A;  3RNE C;  2GBJ A;  1JML A;  2X8X X;  2YEP F;  4KVG B;  2LAS A;  3GS2 A;  3CF6 E;  4II2 B;  3MFG A;  1C9F A;  2RSU A;  2W3S A;  1Q5W B;  4W9L A;  3L0W B;  2CR5 A;  2BS3 B;  3W1S C;  1ZDV A;  4I6N B;  4A9A A;  1V8C A;  3LYY A;  5H92 C;  2VH1 A;  1C4C A;  4KDL B;  3KUD B;  2K8H A;  2KAC A;  2UWQ A;  2L05 A;  1UUP A;  4BBN C;  2CHX A;  3M63 B;  1WGH A;  3C19 A;  1RAX A;  4ASW C;  3KH0 A;  2V0G A;  2LMC A;  3OJ4 B;  3UF8 A;  3H7S A;  3B9J A;  1K50 A;  3APF A;  1N62 A;  3MP9 A;  3PTF C;  1D3Z A;  4FHJ A;  3QWZ B;  2GBR A;  2XK5 B;  3RN9 C;  1KM7 A;  1V97 A;  2JT4 B;  4IKG A;  1QOG A;  1T0Q C;  2KKC A;  1G6J A;  2J42 A;  3LXF A;  3T9L A;  3M3J A;  1NI3 A;  1V49 A;  4MJS A;  2ASQ A;  3V62 A;  3AE2 B;  2LGX A;  5LXI B;  1DOI A;  3PRP B;  1F9J A;  4O1N A;  1NYQ A;  4IG7 B;  3N30 A;  1YX5 B;  1OQR A;  4BOS C;  1AN8 A;  2CU3 A;  4HVB A;  2MLB A;  3ZO5 B;  5AUK A;  3CIR B;  3GP7 A;  1EF1 A;  3VFK A;  1I7H A;  4OVV A;  1DYQ A;  2DYM A;  1WI0 A;  2Z0D B;  2K3U A;  2EMT A;  2EEL A;  2DYB A;  4DXA B;  2AYO B;  2B3A A;  2NMQ A;  1T3Q A;  1C77 A;  2L7R A;  2C7N B;  1YX6 B;  2YLM A;  4BZA A;  1UWX A;  3R7R A;  3DBL I;  2O2V B;  1YN4 A;  2QC8 A;  1TKG A;  4A3O A;  3QA8 A;  4A20 A;  2FAZ A;  1KLV A;  2KTF A;  2A5U A;  2V4L A;  4DWF A;  2HTM E;  2JWZ A;  4RCO A;  2MJ3 A;  3L17 A;  4DBG A;  1FCC C;  4AQ7 A;  2JYT A;  1WXQ A;  2MBB B;  1GNU A;  3ZJT A;  2D3B A;  1FM0 D;  5HI1 A;  2V1Y A;  2IPK D;  4RH6 A;  5BYR A;  4P6V F;  4MGK E;  1JWU D;  2GLS A;  2H88 B;  2JWU A;  3O65 B;  4KIK B;  4IW0 A;  4RF1 A;  3SU8 X;  5D94 A;  2BWE S;  3U7D A;  3RNG C;  1ZXH A;  4BKT A;  2ZZP B;  4RGN A;  2M0A A;  2N9X A;  3TEW A;  2IBI B;  5E6N A;  3Q69 A;  1GUA B;  1D4B A;  2JQR B;  2A4Z A;  3LB8 C;  3CWI A;  4TKN A;  5EDS A;  2J52 A;  4W9G A;  5D2M B;  3VAW A;  2K0P A;  3VTU A;  4ZHO A;  4M01 A;  3WCQ A;  1WMH A;  1XLN A;  1NEK B;  1PGB A;  1WYW B;  4K3C A;  5EE1 A;  3PZD A;  2PE9 A;  4WJN A;  3B08 A;  3OG5 A;  4PS7 A;  4JGH B;  4DHJ B;  1TIF A;  3AB5 A;  5G2N A;  5C3J B;  1XLP A;  4YTM B;  2M17 A;  3ZJV A;  2IGD A;  3UIO B;  3E9S A;  1QLB B;  3I57 A;  2OJR A;  1JRU A;  2KC1 A;  1IGC A;  5D3D A;  4OZB A;  3TSS A;  2RPV A;  1SIJ A;  2J53 A;  1XEE A;  4IC7 B;  4RGT A;  1I42 A;  5GXG B;  1H8C A;  3ZKJ C;  2R2O A;  4JL9 A;  1TS2 A;  3HVD A;  2QJL A;  1SF0 A;  2DHZ A;  3ECI A;  4WAA A;  4M0W B;  2L52 A;  1V1P B;  1L5P A;  2GBN A;  1K51 A;  3EA6 A;  4RMA A;  2QMT A;  3ZW3 A;  1VDV A;  2LUM A;  4DHJ D;  4ARC A;  3L13 A;  4XGA B;  5EE3 A;  1VR9 A;  1L2N A;  4D2K A;  4FHK A;  1IBX B;  2LRW A;  3PT2 B;  2SEB D;  1TBE A;  2WU5 B;  1SEB D;  1QOA A;  1P9D U;  2WDR B;  1D5X C;  5J18 A;  4B6W A;  2RMM A;  3HIZ A;  4YTN B;  3P1M A;  3DPD A;  3GB1 A;  1VD2 A;  1CZP A;  3HK0 A;  2WDT B;  3A1Q B;  2SAK A;  3IG3 A;  2BYV E;  2KMC A;  3BII D;  2DLB A;  2OHF A;  2C60 A;  3ONS A;  4RGO S;  4WJO A;  4YL8 A;  2PEA A;  3BK2 A;  4DXF A;  4HKZ E;  2M1M A;  2WHI A;  2KNB A;  3AE9 B;  1S3S G;  4AOF A;  2EMS A;  3PRE A;  4EZL A;  3RNB C;  1E8X A;  1BML C;  4W9F A;  2Y5C A;  5IOI A;  3V61 A;  1FXT B;  3DBR B;  1WX9 A;  4JWU C;  1UH6 A;  3QCA A;  4LNF A;  1MG8 A;  3H7P A;  5CHW A;  3AE4 B;  1KTK A;  4LCD E;  4MT5 A;  1HQR D;  2D5G A;  3GZN B;  3PSE B;  4WQM A;  1IGD A;  4AWJ A;  4G11 A;  2IDY A;  4KKJ A;  2K1F A;  2WXJ A;  4NZL B;  2N1W A;  2MBH A;  2JX5 A;  2BVC A;  1D6E C;  1WYG A;  4EFO A;  1FNW A;  2KX3 A;  3LDZ E;  1KLU D;  4CYE A;  2IO2 B;  3EFC A;  4HRO A;  1QKZ A;  5G5G A;  2FCM A;  3NS8 A;  1GPX A;  3ML8 A;  2HJ8 A;  2MP2 A;  2L8J A;  3AE5 B;  4N59 A;  4ARI A;  3R66 C;  5IAA C;  2KFK B;  1V81 A;  2W54 A;  3EC8 A;  2O6V A;  4JIO U;  1YD8 U;  3I5J C;  1TY2 A;  1E7P B;  1JWS D;  2GBM A;  3ETR A;  1NVI D;  3RZW C;  4HK2 A;  3A4R A;  2BQQ A;  4CHK A;  1YMH E;  2AQ2 B;  3WAL A;  1C78 A;  1SGH A;  4TUU A;  3QIJ A;  2OOB B;  2L0T A;  1N5X A;  4J6I A;  2N0S B;  5T8I A;  2LD9 A;  3VXW A;  2QCZ A;  3V3X A;  1WGR A;  1F1H A;  4KKI A;  1UBI A;  2XN9 C;  4ICU A;  1I4R A;  3KW5 B;  2XEW A;  1AYF A;  2W3R A;  4JPS A;  2PVO D;  4BVU C;  3EFU A;  1XD3 B;  2NVU I;  2BF8 B;  3N32 A;  4GIV A;  1ACC A;  1YJ1 A;  3MHZ A;  1ZOY B;  2N7J A;  1K8R B;  5EE9 A;  1VZ6 A;  1WFY A;  1WXM A;  3IHP C;  3WAP A;  3Q3J A;  3ZDM C;  4L1B A;  2LHD A;  4NJ6 A;  3R2I A;  1CMX B;  1XO3 A;  1TKY A;  3KUC B;  3NRZ A;  2J0J A;  3L4P A;  5KHO A;  2K39 A;  1R7S A;  5HKH A;  3A33 B;  3B0A A;  2LGI A;  4MH8 A;  1VZ8 A;  1P98 A;  1BUI C;  2R61 A;  3O13 A;  4LNO A;  4NAW A;  3QQ8 B;  1ZP0 B;  1TT5 B;  2LFI A;  4K7S A;  3DDC B;  3U30 A;  3W5U B;  2FNJ B;  3HM3 A;  2L32 A;  1AW7 A;  2WXH A;  5I4D A;  5DPR A;  2LVP A;  2BB6 A;  1T0Y A;  1R4M B;  2KMA A;  3DWM A;  3KWV A;  5AZG A;  1ZDX A;  1E6E B;  1TS3 A;  4NAM A;  4HDO A;  3ZLZ A;  3ALB A;  3X23 A;  3VR8 B;  1T6B X;  3J9C A;  3I63 C;  3A9K A;  4MEM A;  2MBE A;  4GDK A;  3BVZ A;  1JRP A;  2GI9 A;  3TEY A;  4I6L B;  1PUT A;  2WX1 A;  3AXC A;  3L08 A;  1MG4 A;  5CTR C;  2IZV B;  2KAN A;  5JHB A;  3P63 A;  2ACZ B;  5IN7 A;  3ZNH B;  2D3C A;  4KV2 A;  2LGY A;  4JLC A;  2N7D A;  3RUL A;  3TCA A;  4M8N A;  4FA6 A;  4Q2J A;  2KN4 A;  2E3T A;  2RD0 A;  2G4D B;  1LXD A;  2INP E;  3AU5 A;  3IAS 1;  2M4N A;  4I6P A;  1V9J A;  3VH4 B;  2KQ4 X;  5C1Z A;  2N4F A;  2BPS A;  1TKE A;  4E3C A;  3AI5 A;  3Q8E A;  3PLV A;  2W82 A;  4RM8 A;  2IJ0 A;  1SSN A;  4YT0 B;  3DHH C;  2BT6 A;  3ZNI D;  1GG3 A;  2Z0E B;  1WWT A;  3FIL A;  1V5O A;  1WX8 A;  2UYZ B;  4MJS B;  3N1Y C;  2WQY B;  4HEA 1;  3UI3 A;  5J17 A;  3BIN A;  1QIL A;  1T0S C;  4F1S A;  4G3X B;  1AWD A;  3TUO A;  5JHA A;  3KVF B;  3TEX A;  1F77 A;  4GN1 A;  1C4A A;  4MAC A;  3VVW B;  4N58 A;  3DVG Y;  1HZ6 A;  5BYS A;  2OJW A;  1JQ4 A;  1E9M A;  4XZ4 A;  1LM8 B;  3JYU A;  2CHW A;  4WAF A;  1OGW A;  3Q3N C;  1K53 A;  2MSE D;  4W9E A;  5DPW A;  1FPY A;  4RFB A;  4DXG A;  2JY6 A;  4HCP B;  2K8B A;  4EEW A;  4MSQ B;  1XLO A;  2H89 B;  5D7G A;  3JW0 X;  2IND C;  5E6P A;  4KZC A; 
#chains in the Genus database with same CATH homology
 1FFU A;  1MHH E;  4LTU A;  4UDU C;  2MEK A;  1ZXH A;  1PFD A;  2WXN A;  1I4G A;  3ZYY X;  1FXA A;  3AEG B;  2WDQ B;  4YSY B;  4RGN A;  1FIQ A;  2M0A A;  3AE7 B;  1ZE3 D;  3TEW A;  4REZ A;  2RDG A;  1JWA D;  1KRH A;  3U4E G;  3FIL B;  1QOB A;  3Q69 A;  5C2T B;  3NVZ A;  1FRR A;  1N61 A;  1PGA A;  2BB5 A;  1ROE A;  5G5H A;  1D4B A;  2JQR B;  4M0W A;  4YTP B;  3FC4 A;  3LB8 C;  1V1P A;  3CWI A;  4YWG G;  4WH4 A;  3I9V 1;  2B76 B;  1IUE A;  2J52 A;  1SE3 A;  1HEZ E;  2K0P A;  4KGS A;  2FBW B;  4ZHO A;  1F2R I;  3WCQ A;  3NUH B;  1XLN A;  2XNA C;  1IBX A;  1XLQ A;  3RFZ B;  4IDI A;  5BYQ A;  2WXM A;  4B0E A;  1GOZ A;  1NEK B;  1PGB A;  2GRI A;  5EE1 A;  2WU2 B;  1B9R A;  1Q10 A;  3NS1 A;  4JE3 B;  4GLS C;  5FKA C;  1M4V A;  1D5M C;  2Y3A A;  3AB5 A;  1EU3 A;  5C3J B;  4H2A A;  1XLP A;  1JCK B;  4YTM B;  2FUG 1;  3ZJV A;  2IGD A;  3E9S A;  1QLB B;  3I57 A;  4TQ1 A;  4J3O D;  5EE0 A;  1SJE D;  1IGC A;  4XWT A;  4OW0 A;  1HA5 A;  5D3D A;  4OZB A;  1OQQ A;  2JXT A;  2Y5P A;  5TSS A;  3NVY A;  2MJE A;  1NYR A;  2RPV A;  3ABV B;  3TSS A;  1SIJ A;  4TSS A;  2QSD A;  2J53 A;  1JWM D;  1XEE A;  4ZHP A;  4RGT A;  2ON8 A;  4OZA A;  5GXG B;  1FMA D;  1J7C A;  3AH7 A;  1QOF A;  1SE2 A;  1SE4 A;  1TS2 A;  3HVD A;  1YNT E;  2M56 B;  3Q8F A;  2QJL A;  1SF0 A;  2JZP A;  2LJI A;  2L52 A;  1C4P A;  1CJE A;  1L5P A;  1V1P B;  2E6X A;  1K51 A;  1J7B A;  3EA6 A;  1ESF A;  1FEH A;  2QMT A;  1K52 A;  3SEB A;  4RGM A;  4CQN A;  3Q8C A;  1VDV A;  2LUM A;  3VRA B;  4ARC A;  3FAH A;  1TZO A;  4RNA A;  1TS4 A;  2BTE A;  3AN1 A;  4US9 A;  4P16 A;  1VR9 A;  5EE3 A;  4D2K A;  3AE1 B;  1IBX B;  3ZJU A;  3BVG A;  2SEB D;  2WU5 B;  1SEB D;  1QOA A;  2WDR B;  2BS2 B;  1D5X C;  2RMM A;  1YN5 A;  4YTN B;  3V05 A;  3SR6 A;  3P1M A;  4A6Q A;  4AS1 A;  2KWD A;  3RPF C;  1FCL A;  3EUB 2;  4LLG M;  3GB1 A;  5H8Y E;  1P7E A;  1V1O A;  1CZP A;  1STE A;  2WS3 B;  1QT9 A;  3U52 E;  5JXV A;  2AQ3 B;  2SAK A;  1FFV A;  2AX5 A;  4PT5 A;  3R8B A;  5BMH A;  2WXQ A;  4KGT A;  3BII D;  2DLB A;  2K22 A;  2OHF A;  2PKO A;  1FO4 A;  3AEE B;  3BVM A;  4RGO S;  1PYW D;  3BK2 A;  1BXT A;  3KQ4 A;  2ZW0 A;  3PZ8 A;  4DXF A;  4HKZ E;  4ITK A;  3AE9 B;  1RFK A;  3AE3 B;  2BW2 A;  1I4Q A;  1BML C;  3AM9 A;  1F2R C;  2Y5C A;  3B2G A;  3T3O A;  4WWM A;  3R2T A;  3W9C B;  2Q5W D;  3VR9 B;  2RDH A;  4GDL B;  3KLS X;  3PZ7 A;  1JRO A;  2TSS A;  3C8Y A;  4JWU C;  3HVZ A;  1I4X A;  3BYY B;  2ICI A;  1P7F A;  2EKI A;  2N9L A;  2DYO A;  3W1S A;  3AE4 B;  1KTK A;  1JAL A;  4ZYS A;  1PGX A;  4MT5 A;  1GB4 A;  3NVW A;  2OED A;  1HQR D;  2D5G A;  4B0M A;  4WQM A;  1IGD A;  1N5W A;  3BZD B;  1CK1 A;  4YSZ B;  4KX6 B;  4FXC A;  2WXI A;  1ZXI A;  3KWL A;  2IDY A;  4WUR A;  2IGG A;  4KKJ A;  5FR3 A;  2PVG C;  2WXP A;  2WXJ A;  4A8X C;  4NZL B;  1F0Z A;  5HG2 A;  2G9H D;  4EE2 A;  2JX5 A;  2JU6 X;  2YEP B;  2KMM A;  2X38 A;  1E0Z A;  1GB1 A;  1D6E C;  1WYG A;  1FNW A;  4YXD B;  1KLU D;  2BYT A;  2DBY A;  1SBB B;  4C7Z A;  4HRO A;  1QKZ A;  3BK1 A;  5G5G A;  1GPX A;  2L83 A;  4XE0 A;  3Q8A A;  4OVZ A;  3AE5 B;  1T5X D;  3SFE B;  4N59 A;  1MI0 A;  2MH7 A;  4ARI A;  2ZW1 A;  1UNS A;  2W54 A;  3AED B;  2I38 A;  3BYT B;  3HUI A;  3IT6 B;  1TY2 A;  1WSP A;  1DOX A;  1E7P B;  1JWS D;  3TEZ A;  1EU4 A;  2WXR A;  1C76 A;  2WP9 B;  3ETR A;  3EGR A;  4ZOH C;  3AEC B;  1NVI D;  2V3P A;  2QIE B;  2PIA A;  1TY0 A;  1VLB A;  3U2S C;  1DOY A;  1LO5 D;  2WXO A;  3MC0 B;  4XDD A;  2K5P A;  1YMH E;  2AQ2 B;  2PLP A;  2WXL A;  4LK0 M;  4DQO C;  5BMI A;  2NTS A;  1UWM A;  1C78 A;  5MPO A;  1MPE A;  2WXF A;  4C7Y A;  2JYE A;  2FE8 A;  4A55 A;  2WXK A;  4USA A;  1YQ4 B;  1N5X A;  3AE8 B;  2N0S B;  5T8I A;  1HXY D;  1TJE A;  1SB3 C;  1XCT L;  3V3X A;  4R3D A;  1HZ5 A;  4KKI A;  1RM6 C;  3AEB B;  2XN9 C;  1DGJ A;  1I4R A;  1AYF A;  1VZ7 A;  2W3R A;  4IOI E;  4JPS A;  5E6J A;  3P42 A;  2PVO D;  1A70 A;  3IXS A;  1ACC A;  3MHZ A;  1ZOY B;  1MHX A;  3W5V B;  4C80 A;  1L4Z B;  1YN3 A;  2N7J A;  3DWG C;  2WDV B;  5EE9 A;  1VZ6 A;  3IT4 B;  4ZRQ A;  4HRS A;  1WGK A;  1OFF A;  1FNV A;  5AUI A;  4L1B A;  2LHD A;  1JML A;  1YQ3 B;  4OZC A;  3R2I A;  2JSV X;  2YEP F;  3T3N A;  3H8H A;  1XO3 A;  1TKY A;  4L2Y A;  3GS2 A;  4YSX B;  1SXT A;  3MFG A;  1C9F A;  3NRZ A;  2W3S A;  3AEA B;  1ET6 A;  3L4P A;  1C79 A;  2KAJ A;  2V4I B;  1R7S A;  4L23 A;  4US8 A;  2BS3 B;  2LGI A;  1ZDV A;  4C56 C;  4MH8 A;  1VZ8 A;  1BUI C;  1L6U A;  2R61 A;  4A9A A;  1V8C A;  3LYY A;  5H92 C;  3O13 A;  1L0X B;  1KH0 A;  1C4C A;  2VZK B;  5D3I B;  2Z8L A;  2KDM A;  1ZP0 B;  2KAC A;  3PO0 A;  2LFI A;  2N9K A;  2V3N A;  2G1E A;  3AEF B;  3URY A;  3W5U B;  2L32 A;  1UUP A;  1AW7 A;  3VRB B;  2WXH A;  1L6V A;  2M19 A;  5I4D A;  2W55 A;  2AQ1 B;  1I4H A;  2BB6 A;  2V0G A;  2LMC A;  2NTT A;  1L0Y B;  1VRA B;  3HRD D;  3DWM A;  3KWV A;  1KFY B;  3B9J A;  1ZDX A;  2CJO A;  1E6E B;  1TS3 A;  4XDC A;  1I4P A;  1K50 A;  1N62 A;  3ZGZ A;  1PDX A;  2HDE A;  3MP9 A;  4HJG E;  4NAM A;  1KLG D;  4RF0 A;  1ET9 A;  1FXI A;  1Y56 A;  3VR8 B;  5HHD G;  1T6B X;  3J9C A;  3W2D A;  3AE6 B;  2LHE A;  1V97 A;  4IKG A;  5FK9 C;  3P4S B;  1QOG A;  1JRP A;  3BVZ A;  3ZQ4 A;  2VZK D;  2I2Y A;  2GI9 A;  3TEY A;  3AV8 A;  2J42 A;  2K9X A;  1PUT A;  3LXF A;  1NI3 A;  2J4X A;  3MJ5 A;  2PMV A;  3AE2 B;  1KF6 B;  1E10 A;  1MVK A;  3P63 A;  2ACZ B;  1DOI A;  1SJH D;  3E56 A;  4NAW B;  4O1N A;  1NYQ A;  1RYJ A;  2GB1 A;  2WNM A;  1ENF A;  5BMG A;  1TS5 A;  1N60 A;  1XCQ L;  1OQR A;  1AN8 A;  2CU3 A;  4Q2J A;  5AUK A;  3CIR B;  4ZRP A;  1EWY C;  2KN4 A;  3GP7 A;  5HFY A;  2PW9 A;  2E3T A;  1YJI A;  2ONQ A;  1B1Z A;  1FD6 A;  2INP E;  1FRD A;  3IAS 1;  2QEJ C;  1ZUD 2;  2DWQ A;  4OHJ A;  3NZ3 A;  1WRI A;  1I7H A;  1N63 A;  2INN E;  2KQ4 X;  1DYQ A;  1XXG A;  2DYM A;  2MJD A;  4JX1 C;  1VJK A;  1TKE A;  4TQ0 A;  2K3U A;  3Q8E A;  3VQI A;  4JWS C;  4XWW A;  2EEL A;  4KGR A;  2W82 A;  1JW9 D;  2L1A A;  2CJN A;  2IJ0 A;  5LNK 1;  1SSN A;  4YT0 B;  2PTL A;  4GDK B;  2QIL A;  2BT6 A;  2NMQ A;  1T3Q A;  1C77 A;  4MM3 B;  1WWT A;  1JWB D;  3FIL A;  3IAM 1;  2WXG A;  3Q8B A;  1CQV A;  1QF6 A;  3U7Z A;  1ZPS A;  1UWX A;  2WQY B;  3P4P B;  1L0V B;  4HEA 1;  3UI3 A;  2BS4 B;  1QIL A;  1FNU A;  1YN4 A;  1AWD A;  1TKG A;  3TUO A;  3TEX A;  1F77 A;  1C4A A;  3B2F A;  4MAC A;  2LEK A;  1QQR A;  4A90 A;  4N58 A;  1D5Z C;  1HZ6 A;  4NJC A;  5BYS A;  1JQ4 A;  3N9Y C;  1E9M A;  2HTM E;  1J7A A;  4RCO A;  2MJ3 A;  1RWS A;  1EWC A;  1GAQ B;  1FCC C;  1UGJ A;  3AMZ A;  1NEN B;  4AQ7 A;  3BWU D;  4WAF A;  2JYT A;  4WIP A;  3OWE B;  1WXQ A;  4TMA B;  3P4Q B;  4N6E B;  3ZJT A;  1K53 A;  3SFD B;  2IGH A;  5HI1 A;  1FM0 D;  2IPK D;  1EM7 A;  4RH6 A;  1XF5 L;  2WLB A;  5BYR A;  4RFB A;  4DXG A;  4P6V F;  1TYG B;  1JWU D;  4HKQ A;  2BBC A;  2H88 B;  2JWU A;  3P4R B;  1L4D B;  1XLO A;  2H89 B;  5D7G A;  1YJJ A;  3NVV A;  4RF1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...