2EKIA

Solution structures of the tgs domain of human developmentally-regulated gtp-binding protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Developmentally-regulated GTP-binding protein 1
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ekiA00
3NVZA 1ROEA 1ZUD2 1T3QA 1DOIA 5C3JB 3B9JA 2MH7A 3AE3B 3AEGB 1XLPA 3AE9B 1RWSA 3AH7A 2LEKA 2H88B 1FFUA 4YTMB 3SFDB 1KFYB 1CZPA 1PDXA 3AECB 1RYJA 1PFDA 3AE7B 1ZOYB 4YT0B 1E9MA 3LB8C 4JWUC 1FO4A 1V97A 3P4QB 4WWMA 3VR9B 1YJJA 2H89B 3EUB2 1N5WA 1E6EB 1L6VA 2WDQB 3FAHA 2DWQA 1R7SA 2EKIA 2DBYA 3KWLA 3DWMA 1PUTA 3NVWA 4N58A 1TKGA 2B76B 2WDVB 5AUIA 1QT9A 1FXIA 1ZP0B 1WWTA 2WLBA 3CWIA 1N60A 3W5VB 4YSZB 5H92C 1JWBD 1XLQA 5EE0A 1J7BA 1VJKA 2JQRB 4US8A 1J7AA 3HVZA 1WRIA 1L6UA 3RPFC 3AE8B 1B9RA 2K5PA 3AEFB 3AV8A 3VRAB 3VR8B 2FBWB 4ZHPA 1WXQA 1FIQA 1J7CA 1FM0D 2Q5WD 4C7YA 1E10A 4HRSA 1N63A 1E0ZA 1JRPA 3AE6B 1FFVA 1NEKB 2OHFA 1XO3A 1YJIA 1KF6B 3P4PB 4A9AA 3ZYYX 1OFFA 1JALA 1JROA 2QJLA 3AMZA 3NS1A 2W54A 4N6EB 2WDRB 1KRHA 1TJEA 2PIAA 1QOGA 2PVGC 4HROA 3VRBB 1QLBB 2K9XA 2WQYB 3AN1A 2G1EA 4C7ZA 1WYGA 3DWGC 3FC4A 3W5UB 4C80A 2E3TA 4JWSC 2QIEB 1JW9D 2WU2B 1FMAD 2Y5CA 1YQ4B 1QOBA 1SIJA 2M56B 3AE2B 2PKOA 5C2TB 1CJEA 3AEBB 1NENB 2L52A 3CIRB 5EE9A 5G5GA 2K22A 4ZOHC 4YTNB 5MPOA 3PO0A 1QF6A 1L5PA 2KAJA 1VDVA 1RM6C 2BT6A 2M19A 2MJDA 3ABVB 3P4SB 4JX1C 5EE1A 1E7PB 2WU5B 2ACZB 2JX5A 3P63A 1DOXA 5H8YE 3SR6A 3B2FA 1TKEA 2AX5A 2WP9B 2BS4B 3B2GA 2L83A 3L4PA 1RFKA 4WQMA 1FRDA 1YQ3B 1DOYA 2BS3B 4FXCA 4LTUA 1L0VB 1EWYC 3ETRA 3LXFA 3AE5B 3W9CB 1VLBA 4YSXB 1TKYA 4YSYB 1SF0A 2KMMA 2CJOA 3AB5A 3BIID 1NYQA 3AE1B 2W3SA 4ZHOA 3NRZA 1SB3C 2MJEA 3NVVA 1QOAA 2WS3B 1QOFA 1GPXA 3SFEB 5G5HA 1OQQA 2CU3A 4IDIA 1OQRA 1ZXIA 1N62A 4KX6B 4YTPB 2HTME 1A70A 1GAQB 3HUIA 2MJ3A 1N61A 1NYRA 2PVOD 1AWDA 1WGKA 4P6VF 4USAA 2BS2B 1DGJA 4US9A 3WCQA 1UWMA 5GXGB 1F0ZA 1FRRA 1NI3A 1JQ4A 1JWAD 2N0SB 3HRDD 4N59A 1NVID 2W55A 3NVYA 5EE3A 4ITKA 3AE4B 1XLNA 1IUEA 1AYFA 1FXAA 1V8CA 4YXDB 2CJNA 3AEEB 3AEDB 3AEAB 3P1MA 1XLOA 1I7HA 5AUKA 2W3RA 3AM9A 3P4RB 1N5XA 1TYGB
chains in the Genus database with same CATH superfamily
4HDOA 2RDGA 3NVZA 2ZEQA 3PZ7A 2IO2B 1KOTA 1J19A 1E90A 4LNNA 4WJOA 3TL5A 4RMAA 1LXDA 4EE2A 3WALA 3P4QB 4NNJB 2JPHA 2B76B 3U8ZA 4MJSA 1UZXB 1V1PA 2LMCA 4E71A 4NAWA 1MVKA 2MRPA 5JH5C 3HVDA 1H8CA 2J4XA 1FCCC 2Q5WD 4TQ0A 4HRSA 1NEKB 4C56C 4RGMA 4W9EA 2INNE 3OJ3A 1FXTB 1H4RA 5I4DA 2JYEA 2HJ8A 2KYWA 4IKGA 2JUOA 4IWOA 4NPNA 2FE8A 1FNUA 2K22A 2NR2A 2DHZA 4K7SA 3ZNGC 4NQLB 3P2BA 4AP4C 1YN5A 4ANVA 3PPAA 3L4PA 3M62B 2FCQA 2D10A 1V9JA 2CR5A 3Q3JA 2JRHA 4XWTA 1I4RA 2IGDA 1UGMA 3N1ZC 3RZWC 2GI9A 2M0AA 2MWSB 1BT0A 1K53A 3GE3C 4J3OD 1ZXIA 4JQWC 2WXLA 2KQSA 5D2MB 4ZYNA 4MGZE 1C1YB 1GAQB 1KLUD 1DGJA 3KYCD 1TT5B 2KXJA 1VR9A 5FR3A 2MBEA 4EZLA 3NOBA 3ZTDA 4AJWA 1V86A 3TSSA 2JF5A 3P1MA 3U2SC 1ZPSA 1XQQA 1I7HA 3A33B 4BVUC 2GBJA 1ROEA 1LQBA 4BOZB 3BWUD 1UELA 2KWCA 1Q10A 2Z0EB 3M95A 1YD8U 4MGKE 4M8NA 2PE9A 2O2VB 2OEDA 1TKGA 2GBRA 2G3QB 1V2YA 4WWPA 4B0EA 4GLSC 1YX5B 2GBMA 2LFIA 3ZNZB 2LZ6A 1I35A 4ASWC 2FCSA 3U52E 2K39A 2BTEA 3AE6B 1XO3A 2JY6A 2Z59B 1D4BA 5D3IB 4N6EB 3TEYA 1TJEA 4KGRA 1WJ4A 2E3TA 4NY0A 1UBIA 5DPTA 3X0WA 4EEWA 1JWUD 4YTNB 1CQVA 2MP2A 4Q2JA 1XEEA 4WURA 1V6EA 1A5RA 3BVMA 4WIPA 3EA6A 2BVCA 3WA0A 4GDLA 2W82A 4R3DA 5J2RA 3W9CB 2J52A 2K1FA 3QA8A 1C78A 5AZHA 2KWDA 2WS3B 3DBHB 2INPE 2KJHB 4KX6B 2CHWA 2BW2A 2QC8A 2AYOB 2DZIA 2Z8LA 3EGRA 1WH3A 1F0ZA 2K8BA 1GB4A 2W55A 3EECA 3R2IA 1IBXB 2X8XX 3AE4B 5KHQA 3A9KA 3QQ8B 3UQBA 2K8CA 1TGZB 2WGSA 2IO1B 2E6XA 1NBFC 3JVZX 2K25A 3QARA 2G45B 1E8YA 3WAMA 3DDCB 2IGHA 1SJHD 2C7MB 1AARA 4W9GA 1PQSA 2X38A 2VZKD 2TSSA 3KWLA 4XDDA 1UD7A 4GDKA 1XLQA 5EE0A 4ARIA 1FNWA 5G2NA 1WRIA 1M4VA 1WGYA 4RM8A 1LO5D 4XYCA 2JRIB 1JMLA 3M3JA 3P4PB 1Z2MA 2PIAA 1QOGA 2DLBA 2G4SA 2ZPNA 4RM9A 1I4HA 1JW9D 3NY5A 2MQJA 2PKOA 1TIFA 1L5PA 3QWZB 4JL9A 4XGAB 3KW5B 2FIFA 4BFRA 2D07B 1UH6A 5HG2A 2WXFA 2KDFB 2NPTB 4TSSA 2IZVB 1YQ3B 4F7ZA 2D11A 2KK8A 2K6DB 5L95C 3PSEB 3PREA 1D5XC 3PT2B 3CF6E 2N9EB 2WHIA 3DBRI 3NS8A 1NI3A 4YWGG 1SJED 4K3BA 4N59A 1ZDXA 4YXDB 3AEDB 4MGIE 3SDLC 3BVZA 1YN3A 2GRIA 1T0YA 3SFDB 3TCAA 4AJYB 3W1SA 4DXGA 3QC8B 1L6VA 2R61A 4PS7A 4C4VA 3R2TA 4GGQA 3ZJUA 3A9KB 3W5VB 4YSZB 4OZCA 1L6UA 4WWNA 2K5PA 2G4DB 2FBWB 5C23A 2AQ2B 1J7CA 4PS3A 4AOFA 1S1QB 3I57A 1T5XD 3RNCC 4HCNB 4BAXA 2WXRA 1ZDVA 3L08A 4HROA 4JGHB 1QLBB 2WQYB 3AN1A 2JSVX 1WYGA 1MI0A 2V9HA 4PT5A 4ZYSA 1SE2A 3J9CA 2M56B 3T3NA 2C5LC 1Y8RC 1CJEA 3QCAA 4L23A 1PGBA 4ZOHC 3IVFA 4JLCA 2D3GA 2N9PC 3U7ZA 1XF5L 4DHZE 2YLMA 3ZUNA 4BKSD 1E7PB 4GU2A 1HTQA 1XT9B 1SBBB 3DBLB 2WP9B 2LXCA 5G55A 1OEYJ 1T0SC 3RFZB 2CS4A 1F9JA 2O6VD 3AXCA 2CU1A 3JSVA 2MBHA 5LXHA 1E5WA 1QOAA 3AI5A 1YN4A 1BMLC 1UGJA 2AL6A 3A1QA 2MCNB 1KLGD 4A55A 2KMCA 1A70A 3T3OA 4USAA 1UWMA 1KM7A 3KUDB 2C60A 3Q8CA 2JZZA 4DWFA 1WXAA 1Z5SB 1BXTA 2JXXA 2FIDA 2KX0A 4FJVB 3P4RB 1N5XA 4KZ0A 1AW7A 1ZUD2 3VXWA 3ZRCA 2Y5BB 2DAJA 2KLGA 3DBLI 3AH7A 5AZGA 2H88B 2RDBC 2CHZA 2G9HD 3AE7B 3GZNI 4NJ7A 1EF5A 1FO4A 3EHVA 2I2YA 4K81A 1E6EB 1E8WA 3AU5A 2C9WB 1PUTA 3ZDTA 4P1BC 3WANA 2WXIA 4P16A 3TEXA 5FK9C 2WLBA 4NQKE 3CMMB 1J7BA 1EM7A 1GOZA 3VRAB 1E10A 2M17A 1FIQA 4WAFA 3IBEA 2SAKA 2DAFA 1R4MB 1YJIA 3SD5A 1YIWA 5BMIA 1JALA 2WDRB 1LM8B 3QK0A 1ET9A 3MP9A 2M1MA 2RSUA 1KTKA 2LGXA 4A8XC 2M4NA 3AEBB 1NENB 2FUHB 3CIRB 2M19A 2ICIA 2ACZB 2JX5A 4LNIA 3N32A 3VH4B 2XEWA 2KO3A 3UF8A 1DOYA 3BINA 3AE5B 2N9LA 5IO9A 1L0YB 3KYDD 2MJEA 3K9PB 2ZCCA 3DBRB 3AULA 5KHOA 1OQRA 2EMTA 1FEHA 4E3CA 1IP9A 1XCTL 3H1UA 1P7EA 4OZBA 2ZNVC 1IGCA 2MBQA 2KMAA 1E8ZA 1U4AA 4MH8A 2O6VB 2RPVA 4ACFA 4A90A 4B9KA 3VTWA 3KUZA 1EWCA 5AUKA 3PRZA 5DPRA 1MJDA 3T9LA 2L1AA 2L00B 3ZTCA 3LDZE 1XCQL 1WI0A 4XDCA 2DWQA 4S0RA 2ZJDA 4JPSA 5J17A 4DHJB 1FCLA 4N58A 3VUYA 3HIZA 4ARCA 2WDVB 2BKRB 4W9LA 1QT9A 1TZ1A 3CWIA 1J0GA 2NTTA 3TBLD 2VH2A 4HPLB 3QIJA 1RRBA 2MA9B 2XK5A 1Y56A 2RMMA 1WR1A 4A9AA 2K8HA 3LJ3A 1JROA 4I6LB 2J53A 1TS5A 3SU8X 2BPSA 2N1WA 2O6VA 1WGHA 2I1KA 4HJKA 2INDC 4LK0M 1V5OA 1D6EC 1WZ0A 4K1RB 1SIJA 3DVGX 2PPHA 2L52A 4KGSA 3R7RA 1WGRA 2WDTB 2FUG1 2BKFA 3TEWA 3Q14C 5BYSA 4LTUA 4L1BA 3TMPB 4MSQB 1GG3A 4EZJA 2N7JA 2WXMA 4W9DA 3AE1B 2WXQA 1WF9A 2M8SA 4ICVA 3I63C 4TV3A 2JZPA 4D2KA 2DZKA 4E74A 3R3MA 4FLHA 2BBCA 1V80A 2NBUA 4QAYA 1Q0WB 2HTME 4IWPA 3IT6B 4W9FA 2V1YA 1WXVA 2N7EA 1WE7A 4O1NA 1ZE3D 1XLNA 4GB9A 3DHHC 5L83A 3AEAB 3T8MA 1D5MC 2KJ6A 2KQ7A 2KACA 1IBXA 4MSMB 1K52A 3DCGA 3AEGB 1S3SG 2GOWA 2WXOA 1UWXA 4RGNA 1SEBD 1C79A 2R2OA 1N5WA 3Q3MC 3V60A 3DHGC 4LDTB 1JWBD 3V6EB 2WXNA 1L4ZB 1J7AA 1ZGUB 3HVZA 4C4VB 1WR6E 4M0WB 1B9RA 2JXTA 4FN2A 4MELA 2UWQA 1P98A 2ZW0A 3AU4A 3ML9A 4K7WA 1OFFA 3SEBA 1WMHB 3I9V1 2O2VA 2VZKB 4JWSC 3PRMB 3PLVA 3DVNV 2WXPA 1SXTA 4LJPB 1V81A 3MC0B 2KX3A 2DYMA 3P4SB 2OOBB 1DOXA 3SR6A 2KLCA 2L83A 2DX5B 1FRDA 2QCZA 2WX1A 5JZEB 4ICUA 1VLBA 5EDSA 1TS3A 1WX9A 3UQAA 3ALBA 5D6JB 1P9DU 4ZRPA 1YOVB 3M63B 1RFAA 3PZ8A 1B1ZA 3OG5A 2JU6X 2CU3A 5IN7A 2OJRA 1JWSD 1WJ6A 1N61A 2QEJC 4HPPA 2BS2B 3V05A 1WM2A 4H2AA 2NMQA 4DK5A 4RGTA 4BBNC 4J6IA 4C00A 4IWQA 3L10B 4JE3B 1WXMA 4FHKA 3A4SC 4XE0A 3L13A 2KTRA 4KDLB 3Q3FA 4IUMB 2MH7A 5IKCM 1XLPA 4GSWA 2UYZB 3KUCB 1FFUA 4YTMB 3PGEA 1ESFA 1ZKHA 4YT0B 2I38A 1E9MA 3RCZA 1R4MI 1P3QU 1OQYA 1NI2A 4G3XB 4WWOA 3EUB2 4GDKB 3Q6BA 2IY0B 4EUTA 5IP4D 1FNVA 4FULA 4BBNF 4TQ1A 1Q5WB 2LGDA 1WIAA 4US8A 1SE3A 3AV8A 4REZA 3VR8B 3KH0A 2RGFA 1DYQA 4KIKB 4M02A 3C19A 4FHJA 1KRHA 2IYDB 2HTHA 1GB1A 1P0RA 2FCMA 5C2TB 3H7PA 2WXKA 4K7UA 1I4QA 4DHJD 2B3AA 2BF8B 4ZRQA 3R8BA 5EE1A 2WU5B 5H8YE 4DQOC 1TKEA 3W1YA 3RMKC 1SE9A 4WQMA 2LVPA 4FXCA 3ETRA 4GOCA 1V1PB 3RULA 1X1MA 1ACCA 3Q8FA 2CKHB 3PLUA 4RF0A 2W3SA 5LLIA 3NZSA 2BYEA 4KSLC 5JHBA 3BYTB 5G5HA 4ZRIA 3EFCA 3OAWA 4P6VF 2D3CA 3MHSD 3VQIA 3RNGC 3NVYA 2LRWA 5TSSA 2KJRA 3O13A 3MHZA 4IC7B 3VDZA 3PZDA 3MTNB 3NZ3A 3RN9C 2KC2A 4OVVA 1CZPA 1C76A 1PDXA 3AECB 3RYTA 2LGYA 3LB8C 4WWMA 4OW0A 3U30A 3WAPA 2H89B 3VVWB 2ZVOA 2NPTA 4X57B 1RAXA 2WXGA 2N9XA 1FXIA 1WWTA 4IM2A 4GMVA 4MEMA 2GB1A 3W1SC 4DHZB 2FNJB 1IGDA 2PMVA 3NUHB 3ONSA 3RPFC 3AEFB 4IOIE 2KKCA 1IPGA 1WXQA 5E6NA 1LGRA 3KVFB 4OVUA 3V6CB 4M0WA 3ZYYX 2XN9C 2QJLA 3AMZA 3EFUA 4PS8A 3RNFC 2REXA 4C7ZA 3ZNID 3BZDB 1VCBA 4M8MA 3APCA 3PS6A 2KWUB 5LNK1 4I6NB 2YEPF 3L17A 2BYFA 2PEAA 4G50A 5EE9A 1KH0A 3UI3A 1PGXA 1RM6C 2MJDA 5D7GA 2I1JA 3ENEA 3QX1A 2DYOA 1VZ6A 2IDYA 2MP2B 1ZXHA 1JWMD 3AB5A 2HE7A 2KDMA 5BO4B 2NS5A 1L0XB 2K6QA 3JW0X 3FILB 1XD3B 1I4GA 2VRRB 3A9JB 2ZW1A 1N62A 1R4NB 1K50A 1MPEA 3JYUA 2PVOD 3NZUA 3WCQA 1HXYD 1FRRA 2N0SB 1F77A 2IGGA 3PV1A 4LJOB 4MGYE 4CHKA 1CMXB 2HDEA 1MHXA 4IM0A 3TJPA 3H6NA 2IBIB 2N9KA 5HI1A 4HJGE 2UU7A 4W9KA 2MBOA 3RNBC 2FAZA 1YJJA 3C8YA 3K9OB 3DWMA 3NVWA 5AEKB 4HK2A 1F2RI 1I4PA 3LYYA 1UBQA 3KQ4A 1EUVB 4PYUA 2SEBD 1ENFA 4UDUC 2V4IB 2XBBC 2BYVE 4DXAB 2WU2B 3B08A 5IA7A 5C1ZA 1YQ4B 2ZPYA 5CHFA 5D3DA 2EKEC 5MPOA 4HEA1 3TIXA 4B6WA 2MW5A 3H9DA 3GB1A 3I5JC 3ZQ4A 3ZRFA 4W9IA 1MG8A 2AX5A 2WXJA 2LRUA 2BS3B 1L0VB 3S2AA 3C0RB 5LXIB 2KMMA 3ECIA 3BIID 1BUIC 2PE6B 2LD9A 4S17A 4AQ7A 4RH6A 1GPXA 1UNSA 4WH4A 2IO0B 2AQ3B 2AEHA 2GMIC 2KANA 2D5GA 1PGAA 1WGKA 4US9A 2KD0A 2A5UA 3U7DA 2KQ4X 3VUXA 1V8CA 1FXAA 2ONQA 1V1OA 3URYA 4F1SA 4FBJB 4HDQA 2HJ1A 1HQRD 3R66C 3AM9A 1TYGB 4OHJA 3MJ5A 3DVGY 4HXDA 1DOIA 5C3JB 3B9JA 4TMAB 4HKQA 4CQNA 4P7IA 1GUAB 1RWSA 3PVLA 3Q8EA 2LEKA 2XNAC 5D94A 4B0MA 1QQRA 2INCC 2JWUA 4KKIA 3ZDMC 1MHHE 1OEYA 2EKIA 3MC9A 4KKJA 1WX8A 4RNAA 3H7PB 5IAAC 5H92C 4MH0E 1VZ8A 4I6PA 2JQRB 4WJNA 3GE8C 2DZMA 2NVUI 2RR9A 2KVRA 1N63A 4F8CB 3HM3A 1IYFA 4BKSA 4NAMA 4RGOS 2JT4B 2LXAA 2KFJA 1VD2A 2RPQA 3VRBB 4HVBA 4KV2A 3ZJVA 2D2QA 3L16A 3X23A 4AWJA 4C80A 3PRPB 3VTVA 4MM3A 5G5GA 3DBSA 1TZOA 4FA6A 1WM3A 5BYQA 4NZLB 2KWVB 4W9CA 1I4XA 3QJZA 1RFKA 2LI5A 4B95A 3ZO5B 2Z0DB 1HTOA 5T8IA 4A3PA 3Q3NC 1NYQA 5E6PA 2IY1B 3DHIC 2KZRA 2DNFA 3IHPC 1GNUA 2LASA 3OWEB 2YVCA 4BZAA 3QAQA 3V3XA 3N20C 2NBVB 4KSKC 3VTUA 1NYRA 1F1HA 4EFOA 4M01A 5GXGB 4DBGA 3RNAC 1F2RC 1FPYA 3L54A 2KDIA 1ZW7A 3NJTA 3IG3A 1LFDA 1SSNA 5DPSA 2MEKA 1GJZA 3IT4B 3N30A 2DENB 2LJIA 3WAOA 5E6OA 4FJZA 3HM6X 2YEPB 2KN5A 2WX0A 5BMHA 2KVZA 3VUWA 4NJCA 2DBYA 1QKZA 1MG4A 2FCNA 1WGGA 1WSPA 4II2B 1N60A 1E8XA 3VH3B 3WIMA 2C7HA 4ZDVA 1WRDB 4AUQC 2PW9A 2ZVNA 2IPKD 1YX6B 2L05A 2KDBA 1K51A 4II3B 3V61A 2NBWB 2NTSA 2WNMA 4MM3B 4ANWA 4RCOA 3DWGC 3GP7A 3FC4A 2LUMA 2IO3B 3RI7C 2KHWB 2LHDA 3L0WB 3RD2A 3GS2A 2V0GA 3RUIB 3RZFA 2BT6A 4G0NB 1ISNA 2J0MA 2R2QA 4LDTD 3B2FA 1PYWD 2Y3AA 3NHEB 4PK1A 4YSXB 4LLGM 2QILA 1TY2A 3H7SA 4FJYA 1SB3C 2VH1A 3BK1A 1C4AA 4CYEA 2L32A 2XK5B 2N4FA 5JHAA 2MJ3A 1STEA 1G6JA 1AWDA 4XWWA 2ZCBA 4RFBA 3P42A 4WJPA 1V5TA 2JVCA 2J42A 2ZNVB 3ZJTA 4ITKA 3VFKA 1AYFA 1WMHA 3BVGA 2BWES 2DZJA 2NCNA 1F52A 3IAM1 3TEZA 4L2YA 4LNKA 2D3AA 2GLSA 5AZFA 3ZGZA 1KFYB 4EOYA 1RYJA 4KGTA 4JWUC 1T0QC 4EKUA 2JWZA 2QSDA 3VR9B 3N1YC 3FAHA 1R7SA 3B1LX 1WJUA 1WXSA 4PYZA 1WY8A 2LGSA 1VJKA 1FD6A 3AE8B 1L4DB 5CTRC 3KWVA 3NG0A 1C3TA 1JRPA 2V3NA 1FFVA 1OTRB 5IOIA 4A20A 2ZZPB 4HPMB 4EZKA 3KLSX 2LHEA 3V62A 2BQQA 1HZ5A 2LUEA 4JX1C 4WQOB 3E9SA 1P1AA 3JSVB 2BS4B 3B2GA 2EELA 3E56A 3Q3OC 2PJHA 1D3ZA 1J8CA 4MJSB 3NRZA 4RF1A 1MFWA 1QOFA 2KT7A 1OQQA 4IDIA 2L7RA 3IXSA 2M0XA 3CSTA 4IW0A 2L8JA 1EF1A 3A4RA 3PTFC 3HRDD 5DPWA 3PHWB 3AEEB 5DCNA 3APFA 1XLOA 2C7NB 1T3QA 3AE3B 1E7UA 4YL8A 1WGDA 2V3PA 4G11A 3UIPB 2JYTA 2BGFA 2BYTA 1HEZE 4BOSC 1JCKB 4ZRKA 1T0RC 2N1VA 4MACA 5AUIA 4HWIB 2JZ3B 2KN4A 3DVNU 5FR6A 1ET6A 3A1QB 4TUUA 1KF6B 1VZ7A 3NS1A 1V49A 4W9JA 2GBNA 4LCDE 2PVGC 5GMVA 3VAWA 3GOEA 4A6QA 1TS2A 4HKZE 2ASQA 3AE2B 1QILA 1QF6A 2KNBA 4GN1A 4ANXA 1VDVA 3ABVB 4KVGB 3BY4B 1C9FA 3PHXB 3B0AA 4TKNA 2KTFA 2LVOA 5BMGA 3LXFA 4DDGD 3I3TB 1TKYA 4OZAA 1SF0A 5FKAC 4MT5A 5HHDG 3RT3B 3BYYB 3SFEB 2KC1A 1JRUA 4KIKA 3HUIA 2J7QB 2PLPA 4K3CA 1SE4A 3MC8A 1NVID 4W9HA 3N1XC 2D3BA 2CJNA 1C4CA 4AS1A 4LNFA 3OLMD 2EMSA 1UF0A 3Q8BA 1OGWA 3IAS1 3ZIMA 4KDIC 3CSFA 3VHTC 3W2DA 3N9YC 1PFDA 1V97A 2KTRB 2HD5B 1HZ6A 1P7FA 1Q1OA 4FADA 4WJQA 2WDQB 3SHQA 2L0FA 4M00A 3HHMA 3ZXVA 2BB6A 4GIVA 4LNOA 3QHTA 1C77A 2A4ZA 1EO6A 1E7VA 3ML8A 4C7YA 1FM0D 1SIFA 3A9JA 3O65B 4XZ4A 1GC7A 1E0ZA 2Y5PA 2OHFA 4IG7B 4XX5A 3MJWA 2L76A 1EU3A 2W54A 2KFKB 2QHOA 2W9NA 2MLBA 2K9XA 2L0TA 3W5UB 3Q8AA 2QIEB 3GZNB 1EU4A 2Y5CA 1QOBA 1WE6A 3ZLZA 3APDA 3D32A 4GDLB 2AQ1B 1L7YA 3OJ4B 1I42A 2LGIA 3Q69A 1T6BX 3U4EG 3DBHI 1KLVA 2L3ZA 5CHVC 3FILA 1EWYC 4N9F4 4YSYB 4BKGA 2MSED 2QDFA 1TY0A 1WJNA 2ON8A 1SGHA 2BB5A 3NVVA 4A3OA 1YJ1A 4HLEA 2V4LA 1L2NA 3ZXRA 1UUPA 4DXFA 1WZ3A 2RDHA 4ZRJA 4YTPB 1TS4A 1XXGA 1GC6A 4WAAA 1R4NI 2LJ5A 2DYBA 5TR5A 1JQ4A 1JWAD 3IFWB 1TTNA 3DPDA 3Q2AC 1IUEA 1WFYA 4GXBA 3HK0A 4HCPB 5E6JA 2KDEB 1KJTA 2W3RA 3H8HA 5HKHA 1WX7A 3AE9B 4BKTA 1CK1A 2LWPA 4OVZA 2BWFA 1ZOYB 1D5ZC 4XC2A 1HE8A 1AN8A 3DQVA 5J18A 2GBKA 4NJ6A 1QZEA 3UGBB 4P1CC 4KZCA 4JIOU 1ZP0B 1WYWB 4CO7A 3EC8A 2IJ0A 4ZHPA 2KFKA 2N7DA 2K0PA 2LVQA 5CHWA 4MDKE 1RLFA 2KOXA 2MX2A 2G1EA 3UIOB 2WXHA 5JXVA 1N6ZA 1FMAD 3DOWA 3R7QA 1K8RB 2RD0A 3PO0A 5CX3A 2MHJA 2KAJA 4DDID 3N3KB 2CHXA 3P63A 3ZKJC 2AL3A 2J0KA 1M94A 1YQBA 2WYQA 3ZNHB 2V3SA 1NDDA 2CJOA 5BYRA 2K3UA 4ZHOA 4ANUA 2AWTA 1YNTE 2WWZA 3ZW3A 3TUOA 3BK2A 3ZVVA 1YMHE 2PTLA 2J0JA 3RNEC 5HFYA 1C4PA 2OJWA 4IM3A 1TBEA 2MBBB 3UINB 1VRAB 5EE3A 4URKA 1HA5A 3FKYA 2QMTA 3MFGA 4NAWB
chains in the Genus database with same CATH topology
2RDGA 1AW7A 3NVZA 1ZUD2 3TEZA 3PZ7A 4L2YA 3NZ3A 3AH7A 3ZGZA 2H88B 1KFYB 1CZPA 1C76A 1PDXA 1RYJA 3AECB 2G9HD 4EE2A 3AE7B 4KGTA 3LB8C 4JWUC 1FO4A 3P4QB 2QSDA 4OW0A 4WWMA 3VR9B 2I2YA 2H89B 1E6EB 3FAHA 1R7SA 1PUTA 2B76B 2WXIA 2WXGA 1V1PA 2LMCA 1FXIA 4P16A 1WWTA 5FK9C 2WLBA 3TEXA 1MVKA 2GB1A 1IGDA 2PMVA 1J7BA 1VJKA 3HVDA 3NUHB 1EM7A 3RPFC 2J4XA 1FD6A 1GOZA 3AE8B 1L4DB 3AEFB 3VRAB 4IOIE 1E10A 1WXQA 1FCCC 1FIQA 2Q5WD 3KWVA 4TQ0A 4WAFA 4HRSA 2SAKA 1JRPA 2V3NA 1FFVA 1NEKB 4C56C 1YJIA 4RGMA 2INNE 5BMIA 4M0WA 3ZYYX 1JALA 2QJLA 2XN9C 3AMZA 2WDRB 5I4DA 4C7ZA 3BZDB 1ET9A 2JYEA 3MP9A 3KLSX 1KTKA 4IKGA 2LHEA 4A8XC 5LNK1 2YEPF 1HZ5A 1NENB 3AEBB 3CIRB 5EE9A 2FE8A 1FNUA 2K22A 1KH0A 3UI3A 1PGXA 1RM6C 2M19A 2MJDA 2ICIA 4JX1C 1YN5A 5D7GA 2ACZB 2JX5A 3E9SA 2DYOA 2BS4B 3B2GA 3L4PA 1VZ6A 1DOYA 2IDYA 1ZXHA 3AE5B 1JWMD 4XWTA 2EELA 2N9LA 3E56A 1I4RA 3AB5A 2IGDA 2KDMA 1L0YB 3NRZA 4RF1A 1L0XB 2GI9A 2MJEA 2M0AA 3FILB 1QOFA 1K53A 4J3OD 1I4GA 1OQQA 4IDIA 1OQRA 1ZXIA 1N62A 2ZW1A 2WXLA 1K50A 1MPEA 1FEHA 1GAQB 3IXSA 1KLUD 2PVOD 3WCQA 1DGJA 1XCTL 1HXYD 1P7EA 1FRRA 1VR9A 4OZBA 5FR3A 1IGCA 2N0SB 1F77A 3HRDD 2IGGA 4MH8A 2RPVA 4A90A 3TSSA 3AEEB 3P1MA 3U2SC 1ZPSA 1EWCA 1XLOA 1I7HA 5AUKA 1ROEA 1T3QA 2HDEA 1MHXA 3AE3B 3BWUD 1Q10A 2L1AA 2N9KA 2V3PA 5HI1A 4HJGE 1XCQL 2JYTA 2BYTA 1HEZE 4XDCA 1JCKB 1YJJA 2DWQA 3C8YA 4JPSA 1FCLA 2OEDA 3DWMA 3NVWA 4N58A 1TKGA 4ARCA 2WDVB 4MACA 1QT9A 5AUIA 4B0EA 4GLSC 3CWIA 2KN4A 2LFIA 2NTTA 1F2RI 1ET6A 3U52E 1I4PA 3LYYA 2BTEA 3KQ4A 1Y56A 3AE6B 1XO3A 2RMMA 1KF6B 4A9AA 2SEBD 1VZ7A 3NS1A 1JROA 5D3IB 1D4BA 4N6EB 1ENFA 2J53A 3TEYA 1TJEA 1TS5A 4UDUC 2PVGC 2V4IB 4KGRA 4A6QA 4LK0M 2E3TA 1D6EC 2WU2B 1TS2A 4HKZE 1YQ4B 1SIJA 3AE2B 2L52A 4KGSA 5D3DA 1QILA 5MPOA 1JWUD 4YTNB 1QF6A 4HEA1 1VDVA 3ABVB 1CQVA 2FUG1 3GB1A 1XEEA 4Q2JA 4WURA 1C9FA 3BVMA 3TEWA 3ZQ4A 4WIPA 2AX5A 3EA6A 2WXJA 2W82A 5BYSA 2BS3B 4LTUA 5BMGA 1L0VB 4R3DA 3LXFA 3W9CB 1TKYA 2J52A 4L1BA 4OZAA 1SF0A 2KMMA 2N7JA 3BIID 1C78A 2WXMA 1BUIC 4MT5A 5FKAC 3AE1B 2WXQA 2KWDA 5HHDG 4AQ7A 2JZPA 2WS3B 4D2KA 4RH6A 3BYYB 3SFEB 1UNSA 1GPXA 4WH4A 2BBCA 2INPE 2AQ3B 4KX6B 2BW2A 2HTME 3HUIA 2D5GA 1PGAA 1WGKA 4US9A 3EGRA 2PLPA 2Z8LA 3IT6B 1F0ZA 1SE4A 2KQ4X 4O1NA 1NVID 1GB4A 2W55A 3R2IA 1IBXB 3AE4B 1ZE3D 1XLNA 1V8CA 1FXAA 2ONQA 1V1OA 3URYA 2CJNA 3AEAB 1C4CA 4AS1A 1HQRD 3AM9A 3Q8BA 1D5MC 1TYGB 1IBXA 2KACA 4OHJA 3IAS1 3MJ5A 1DOIA 1K52A 2E6XA 3B9JA 4TMAB 5C3JB 4HKQA 4CQNA 3AEGB 1RWSA 3Q8EA 2LEKA 2XNAC 2WXOA 4B0MA 1UWXA 4RGNA 2IGHA 3W2DA 3N9YC 1PFDA 1QQRA 1SJHD 1V97A 2JWUA 1SEBD 1C79A 1HZ6A 4KKIA 1P7FA 1N5WA 2X38A 2WDQB 1MHHE 2VZKD 2EKIA 5TSSA 2TSSA 3KWLA 4KKJA 4RNAA 2BB6A 4XDDA 5H92C 1JWBD 1VZ8A 1XLQA 5EE0A 1C77A 4ARIA 1FNWA 2WXNA 2JQRB 1L4ZB 1J7AA 3HVZA 1WRIA 1B9RA 2JXTA 1M4VA 4C7YA 1FM0D 1LO5D 1N63A 1E0ZA 2Y5PA 1JMLA 2OHFA 2ZW0A 3P4PB 4NAMA 4RGOS 1OFFA 1EU3A 2W54A 3SEBA 3I9V1 2PIAA 1QOGA 2DLBA 3VRBB 2K9XA 3ZJVA 2VZKB 3W5UB 4C80A 3Q8AA 4JWSC 2QIEB 1I4HA 1JW9D 1EU4A 2Y5CA 1QOBA 2WXPA 2PKOA 1SXTA 5G5GA 4GDLB 3MC0B 2AQ1B 1L5PA 1TZOA 2DYMA 2LGIA 3P4SB 3Q69A 1T6BX 5BYQA 3SR6A 1DOXA 3U4EG 4NZLB 1I4XA 2L83A 5HG2A 1RFKA 2WXFA 4TSSA 1FRDA 1YQ3B 3FILA 1EWYC 1VLBA 4YSYB 1TS3A 5T8IA 1NYQA 1TY0A 2ON8A 4ZRPA 2BB5A 3NVVA 3OWEB 3PZ8A 1B1ZA 2JU6X 1UUPA 4DXFA 3V3XA 2CU3A 1D5XC 2RDHA 4YTPB 1TS4A 1JWSD 1XXGA 1N61A 1NYRA 2QEJC 2BS2B 3V05A 5GXGB 1NI3A 4YWGG 1JQ4A 1F2RC 4H2AA 1JWAD 1SJED 2NMQA 4RGTA 4N59A 1ZDXA 1IUEA 4YXDB 1SSNA 3AEDB 5E6JA 2MEKA 2W3RA 3IT4B 4JE3B 3H8HA 2LJIA 3BVZA 4XE0A 1YN3A 2MH7A 1XLPA 2GRIA 2YEPB 3AE9B 1CK1A 1FFUA 4YTMB 3SFDB 1ESFA 4OVZA 5BMHA 1ZOYB 1D5ZC 1E9MA 2I38A 4YT0B 1AN8A 4NJCA 3W1SA 3EUB2 4DXGA 1L6VA 4GDKB 2R61A 2DBYA 1QKZA 3R2TA 3ZJUA 1FNVA 1WSPA 1ZP0B 3W5VB 1N60A 4TQ1A 4YSZB 4OZCA 2IJ0A 4US8A 1L6UA 2PW9A 2IPKD 1SE3A 2K5PA 3AV8A 4REZA 2FBWB 3VR8B 4ZHPA 2AQ2B 1J7CA 2K0PA 1DYQA 3I57A 1T5XD 1K51A 2NTSA 2WNMA 1KRHA 2WXRA 4MM3B 1ZDVA 4HROA 1QLBB 2WQYB 3AN1A 2JSVX 2G1EA 4RCOA 1WYGA 1MI0A 3DWGC 2WXHA 3GP7A 3FC4A 4PT5A 1GB1A 5JXVA 4ZYSA 1SE2A 2LUMA 1FMAD 3J9CA 2LHDA 2M56B 5C2TB 3T3NA 3GS2A 2V0GA 1CJEA 2WXKA 4L23A 1PGBA 1I4QA 4ZOHC 3PO0A 4ZRQA 3U7ZA 2KAJA 1XF5L 3R8BA 2BT6A 5EE1A 1E7PB 2WU5B 3P63A 5H8YE 3B2FA 4DQOC 1SBBB 1TKEA 1PYWD 2WP9B 2Y3AA 4WQMA 4FXCA 3ETRA 4YSXB 3RFZB 1V1PB 4LLGM 2CJOA 5BYRA 2QILA 1TY2A 1ACCA 3Q8FA 4RF0A 2W3SA 2K3UA 4ZHOA 1SB3C 1QOAA 1YN4A 3BK1A 1C4AA 1BMLC 1UGJA 1YNTE 3BYTB 5G5HA 2L32A 3TUOA 3BK2A 1KLGD 4A55A 1YMHE 1A70A 2PTLA 3T3OA 2MJ3A 1STEA 4USAA 4P6VF 1AWDA 4XWWA 5HFYA 1C4PA 4RFBA 1UWMA 3P42A 3Q8CA 3VQIA 2J42A 1VRAB 5EE3A 3NVYA 3ZJTA 4ITKA 1HA5A 1AYFA 2QMTA 3BVGA 1BXTA 3MFGA 4NAWB 3P4RB 3O13A 1N5XA 3MHZA 3IAM1
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NVZ A;  1ROE A;  1ZUD 2;  1T3Q A;  1DOI A;  5C3J B;  3B9J A;  2MH7 A;  3AE3 B;  3AEG B;  1XLP A;  3AE9 B;  1RWS A;  3AH7 A;  2LEK A;  2H88 B;  1FFU A;  4YTM B;  3SFD B;  1KFY B;  1CZP A;  1PDX A;  3AEC B;  1RYJ A;  1PFD A;  3AE7 B;  1ZOY B;  4YT0 B;  1E9M A;  3LB8 C;  4JWU C;  1FO4 A;  1V97 A;  3P4Q B;  4WWM A;  3VR9 B;  1YJJ A;  2H89 B;  3EUB 2;  1N5W A;  1E6E B;  1L6V A;  2WDQ B;  3FAH A;  2DWQ A;  1R7S A;  2EKI A;  2DBY A;  3KWL A;  3DWM A;  1PUT A;  3NVW A;  4N58 A;  1TKG A;  2B76 B;  2WDV B;  5AUI A;  1QT9 A;  1FXI A;  1ZP0 B;  1WWT A;  2WLB A;  3CWI A;  1N60 A;  3W5V B;  4YSZ B;  5H92 C;  1JWB D;  1XLQ A;  5EE0 A;  1J7B A;  1VJK A;  2JQR B;  4US8 A;  1J7A A;  3HVZ A;  1WRI A;  1L6U A;  3RPF C;  3AE8 B;  1B9R A;  2K5P A;  3AEF B;  3AV8 A;  3VRA B;  3VR8 B;  2FBW B;  4ZHP A;  1WXQ A;  1FIQ A;  1J7C A;  1FM0 D;  2Q5W D;  4C7Y A;  1E10 A;  4HRS A;  1N63 A;  1E0Z A;  1JRP A;  3AE6 B;  1FFV A;  1NEK B;  2OHF A;  1XO3 A;  1YJI A;  1KF6 B;  3P4P B;  4A9A A;  3ZYY X;  1OFF A;  1JAL A;  1JRO A;  2QJL A;  3AMZ A;  3NS1 A;  2W54 A;  4N6E B;  2WDR B;  1KRH A;  1TJE A;  2PIA A;  1QOG A;  2PVG C;  4HRO A;  3VRB B;  1QLB B;  2K9X A;  2WQY B;  3AN1 A;  2G1E A;  4C7Z A;  1WYG A;  3DWG C;  3FC4 A;  3W5U B;  4C80 A;  2E3T A;  4JWS C;  2QIE B;  1JW9 D;  2WU2 B;  1FMA D;  2Y5C A;  1YQ4 B;  1QOB A;  1SIJ A;  2M56 B;  3AE2 B;  2PKO A;  5C2T B;  1CJE A;  3AEB B;  1NEN B;  2L52 A;  3CIR B;  5EE9 A;  5G5G A;  2K22 A;  4ZOH C;  4YTN B;  5MPO A;  3PO0 A;  1QF6 A;  1L5P A;  2KAJ A;  1VDV A;  1RM6 C;  2BT6 A;  2M19 A;  2MJD A;  3ABV B;  3P4S B;  4JX1 C;  5EE1 A;  1E7P B;  2WU5 B;  2ACZ B;  2JX5 A;  3P63 A;  1DOX A;  5H8Y E;  3SR6 A;  3B2F A;  1TKE A;  2AX5 A;  2WP9 B;  2BS4 B;  3B2G A;  2L83 A;  3L4P A;  1RFK A;  4WQM A;  1FRD A;  1YQ3 B;  1DOY A;  2BS3 B;  4FXC A;  4LTU A;  1L0V B;  1EWY C;  3ETR A;  3LXF A;  3AE5 B;  3W9C B;  1VLB A;  4YSX B;  1TKY A;  4YSY B;  1SF0 A;  2KMM A;  2CJO A;  3AB5 A;  3BII D;  1NYQ A;  3AE1 B;  2W3S A;  4ZHO A;  3NRZ A;  1SB3 C;  2MJE A;  3NVV A;  1QOA A;  2WS3 B;  1QOF A;  1GPX A;  3SFE B;  5G5H A;  1OQQ A;  2CU3 A;  4IDI A;  1OQR A;  1ZXI A;  1N62 A;  4KX6 B;  4YTP B;  2HTM E;  1A70 A;  1GAQ B;  3HUI A;  2MJ3 A;  1N61 A;  1NYR A;  2PVO D;  1AWD A;  1WGK A;  4P6V F;  4USA A;  2BS2 B;  1DGJ A;  4US9 A;  3WCQ A;  1UWM A;  5GXG B;  1F0Z A;  1FRR A;  1NI3 A;  1JQ4 A;  1JWA D;  2N0S B;  3HRD D;  4N59 A;  1NVI D;  2W55 A;  3NVY A;  5EE3 A;  4ITK A;  3AE4 B;  1XLN A;  1IUE A;  1AYF A;  1FXA A;  1V8C A;  4YXD B;  2CJN A;  3AEE B;  3AED B;  3AEA B;  3P1M A;  1XLO A;  1I7H A;  5AUK A;  2W3R A;  3AM9 A;  3P4R B;  1N5X A;  1TYG B; 
#chains in the Genus database with same CATH topology
 4HDO A;  2RDG A;  3NVZ A;  2ZEQ A;  3PZ7 A;  2IO2 B;  1KOT A;  1J19 A;  1E90 A;  4LNN A;  4WJO A;  3TL5 A;  4RMA A;  1LXD A;  4EE2 A;  3WAL A;  3P4Q B;  4NNJ B;  2JPH A;  2B76 B;  3U8Z A;  4MJS A;  1UZX B;  1V1P A;  2LMC A;  4E71 A;  4NAW A;  1MVK A;  2MRP A;  5JH5 C;  3HVD A;  1H8C A;  2J4X A;  1FCC C;  2Q5W D;  4TQ0 A;  4HRS A;  1NEK B;  4C56 C;  4RGM A;  4W9E A;  2INN E;  3OJ3 A;  1FXT B;  1H4R A;  5I4D A;  2JYE A;  2HJ8 A;  2KYW A;  4IKG A;  2JUO A;  4IWO A;  4NPN A;  2FE8 A;  1FNU A;  2K22 A;  2NR2 A;  2DHZ A;  4K7S A;  3ZNG C;  4NQL B;  3P2B A;  4AP4 C;  1YN5 A;  4ANV A;  3PPA A;  3L4P A;  3M62 B;  2FCQ A;  2D10 A;  1V9J A;  2CR5 A;  3Q3J A;  2JRH A;  4XWT A;  1I4R A;  2IGD A;  1UGM A;  3N1Z C;  3RZW C;  2GI9 A;  2M0A A;  2MWS B;  1BT0 A;  1K53 A;  3GE3 C;  4J3O D;  1ZXI A;  4JQW C;  2WXL A;  2KQS A;  5D2M B;  4ZYN A;  4MGZ E;  1C1Y B;  1GAQ B;  1KLU D;  1DGJ A;  3KYC D;  1TT5 B;  2KXJ A;  1VR9 A;  5FR3 A;  2MBE A;  4EZL A;  3NOB A;  3ZTD A;  4AJW A;  1V86 A;  3TSS A;  2JF5 A;  3P1M A;  3U2S C;  1ZPS A;  1XQQ A;  1I7H A;  3A33 B;  4BVU C;  2GBJ A;  1ROE A;  1LQB A;  4BOZ B;  3BWU D;  1UEL A;  2KWC A;  1Q10 A;  2Z0E B;  3M95 A;  1YD8 U;  4MGK E;  4M8N A;  2PE9 A;  2O2V B;  2OED A;  1TKG A;  2GBR A;  2G3Q B;  1V2Y A;  4WWP A;  4B0E A;  4GLS C;  1YX5 B;  2GBM A;  2LFI A;  3ZNZ B;  2LZ6 A;  1I35 A;  4ASW C;  2FCS A;  3U52 E;  2K39 A;  2BTE A;  3AE6 B;  1XO3 A;  2JY6 A;  2Z59 B;  1D4B A;  5D3I B;  4N6E B;  3TEY A;  1TJE A;  4KGR A;  1WJ4 A;  2E3T A;  4NY0 A;  1UBI A;  5DPT A;  3X0W A;  4EEW A;  1JWU D;  4YTN B;  1CQV A;  2MP2 A;  4Q2J A;  1XEE A;  4WUR A;  1V6E A;  1A5R A;  3BVM A;  4WIP A;  3EA6 A;  2BVC A;  3WA0 A;  4GDL A;  2W82 A;  4R3D A;  5J2R A;  3W9C B;  2J52 A;  2K1F A;  3QA8 A;  1C78 A;  5AZH A;  2KWD A;  2WS3 B;  3DBH B;  2INP E;  2KJH B;  4KX6 B;  2CHW A;  2BW2 A;  2QC8 A;  2AYO B;  2DZI A;  2Z8L A;  3EGR A;  1WH3 A;  1F0Z A;  2K8B A;  1GB4 A;  2W55 A;  3EEC A;  3R2I A;  1IBX B;  2X8X X;  3AE4 B;  5KHQ A;  3A9K A;  3QQ8 B;  3UQB A;  2K8C A;  1TGZ B;  2WGS A;  2IO1 B;  2E6X A;  1NBF C;  3JVZ X;  2K25 A;  3QAR A;  2G45 B;  1E8Y A;  3WAM A;  3DDC B;  2IGH A;  1SJH D;  2C7M B;  1AAR A;  4W9G A;  1PQS A;  2X38 A;  2VZK D;  2TSS A;  3KWL A;  4XDD A;  1UD7 A;  4GDK A;  1XLQ A;  5EE0 A;  4ARI A;  1FNW A;  5G2N A;  1WRI A;  1M4V A;  1WGY A;  4RM8 A;  1LO5 D;  4XYC A;  2JRI B;  1JML A;  3M3J A;  3P4P B;  1Z2M A;  2PIA A;  1QOG A;  2DLB A;  2G4S A;  2ZPN A;  4RM9 A;  1I4H A;  1JW9 D;  3NY5 A;  2MQJ A;  2PKO A;  1TIF A;  1L5P A;  3QWZ B;  4JL9 A;  4XGA B;  3KW5 B;  2FIF A;  4BFR A;  2D07 B;  1UH6 A;  5HG2 A;  2WXF A;  2KDF B;  2NPT B;  4TSS A;  2IZV B;  1YQ3 B;  4F7Z A;  2D11 A;  2KK8 A;  2K6D B;  5L95 C;  3PSE B;  3PRE A;  1D5X C;  3PT2 B;  3CF6 E;  2N9E B;  2WHI A;  3DBR I;  3NS8 A;  1NI3 A;  4YWG G;  1SJE D;  4K3B A;  4N59 A;  1ZDX A;  4YXD B;  3AED B;  4MGI E;  3SDL C;  3BVZ A;  1YN3 A;  2GRI A;  1T0Y A;  3SFD B;  3TCA A;  4AJY B;  3W1S A;  4DXG A;  3QC8 B;  1L6V A;  2R61 A;  4PS7 A;  4C4V A;  3R2T A;  4GGQ A;  3ZJU A;  3A9K B;  3W5V B;  4YSZ B;  4OZC A;  1L6U A;  4WWN A;  2K5P A;  2G4D B;  2FBW B;  5C23 A;  2AQ2 B;  1J7C A;  4PS3 A;  4AOF A;  1S1Q B;  3I57 A;  1T5X D;  3RNC C;  4HCN B;  4BAX A;  2WXR A;  1ZDV A;  3L08 A;  4HRO A;  4JGH B;  1QLB B;  2WQY B;  3AN1 A;  2JSV X;  1WYG A;  1MI0 A;  2V9H A;  4PT5 A;  4ZYS A;  1SE2 A;  3J9C A;  2M56 B;  3T3N A;  2C5L C;  1Y8R C;  1CJE A;  3QCA A;  4L23 A;  1PGB A;  4ZOH C;  3IVF A;  4JLC A;  2D3G A;  2N9P C;  3U7Z A;  1XF5 L;  4DHZ E;  2YLM A;  3ZUN A;  4BKS D;  1E7P B;  4GU2 A;  1HTQ A;  1XT9 B;  1SBB B;  3DBL B;  2WP9 B;  2LXC A;  5G55 A;  1OEY J;  1T0S C;  3RFZ B;  2CS4 A;  1F9J A;  2O6V D;  3AXC A;  2CU1 A;  3JSV A;  2MBH A;  5LXH A;  1E5W A;  1QOA A;  3AI5 A;  1YN4 A;  1BML C;  1UGJ A;  2AL6 A;  3A1Q A;  2MCN B;  1KLG D;  4A55 A;  2KMC A;  1A70 A;  3T3O A;  4USA A;  1UWM A;  1KM7 A;  3KUD B;  2C60 A;  3Q8C A;  2JZZ A;  4DWF A;  1WXA A;  1Z5S B;  1BXT A;  2JXX A;  2FID A;  2KX0 A;  4FJV B;  3P4R B;  1N5X A;  4KZ0 A;  1AW7 A;  1ZUD 2;  3VXW A;  3ZRC A;  2Y5B B;  2DAJ A;  2KLG A;  3DBL I;  3AH7 A;  5AZG A;  2H88 B;  2RDB C;  2CHZ A;  2G9H D;  3AE7 B;  3GZN I;  4NJ7 A;  1EF5 A;  1FO4 A;  3EHV A;  2I2Y A;  4K81 A;  1E6E B;  1E8W A;  3AU5 A;  2C9W B;  1PUT A;  3ZDT A;  4P1B C;  3WAN A;  2WXI A;  4P16 A;  3TEX A;  5FK9 C;  2WLB A;  4NQK E;  3CMM B;  1J7B A;  1EM7 A;  1GOZ A;  3VRA B;  1E10 A;  2M17 A;  1FIQ A;  4WAF A;  3IBE A;  2SAK A;  2DAF A;  1R4M B;  1YJI A;  3SD5 A;  1YIW A;  5BMI A;  1JAL A;  2WDR B;  1LM8 B;  3QK0 A;  1ET9 A;  3MP9 A;  2M1M A;  2RSU A;  1KTK A;  2LGX A;  4A8X C;  2M4N A;  3AEB B;  1NEN B;  2FUH B;  3CIR B;  2M19 A;  2ICI A;  2ACZ B;  2JX5 A;  4LNI A;  3N32 A;  3VH4 B;  2XEW A;  2KO3 A;  3UF8 A;  1DOY A;  3BIN A;  3AE5 B;  2N9L A;  5IO9 A;  1L0Y B;  3KYD D;  2MJE A;  3K9P B;  2ZCC A;  3DBR B;  3AUL A;  5KHO A;  1OQR A;  2EMT A;  1FEH A;  4E3C A;  1IP9 A;  1XCT L;  3H1U A;  1P7E A;  4OZB A;  2ZNV C;  1IGC A;  2MBQ A;  2KMA A;  1E8Z A;  1U4A A;  4MH8 A;  2O6V B;  2RPV A;  4ACF A;  4A90 A;  4B9K A;  3VTW A;  3KUZ A;  1EWC A;  5AUK A;  3PRZ A;  5DPR A;  1MJD A;  3T9L A;  2L1A A;  2L00 B;  3ZTC A;  3LDZ E;  1XCQ L;  1WI0 A;  4XDC A;  2DWQ A;  4S0R A;  2ZJD A;  4JPS A;  5J17 A;  4DHJ B;  1FCL A;  4N58 A;  3VUY A;  3HIZ A;  4ARC A;  2WDV B;  2BKR B;  4W9L A;  1QT9 A;  1TZ1 A;  3CWI A;  1J0G A;  2NTT A;  3TBL D;  2VH2 A;  4HPL B;  3QIJ A;  1RRB A;  2MA9 B;  2XK5 A;  1Y56 A;  2RMM A;  1WR1 A;  4A9A A;  2K8H A;  3LJ3 A;  1JRO A;  4I6L B;  2J53 A;  1TS5 A;  3SU8 X;  2BPS A;  2N1W A;  2O6V A;  1WGH A;  2I1K A;  4HJK A;  2IND C;  4LK0 M;  1V5O A;  1D6E C;  1WZ0 A;  4K1R B;  1SIJ A;  3DVG X;  2PPH A;  2L52 A;  4KGS A;  3R7R A;  1WGR A;  2WDT B;  2FUG 1;  2BKF A;  3TEW A;  3Q14 C;  5BYS A;  4LTU A;  4L1B A;  3TMP B;  4MSQ B;  1GG3 A;  4EZJ A;  2N7J A;  2WXM A;  4W9D A;  3AE1 B;  2WXQ A;  1WF9 A;  2M8S A;  4ICV A;  3I63 C;  4TV3 A;  2JZP A;  4D2K A;  2DZK A;  4E74 A;  3R3M A;  4FLH A;  2BBC A;  1V80 A;  2NBU A;  4QAY A;  1Q0W B;  2HTM E;  4IWP A;  3IT6 B;  4W9F A;  2V1Y A;  1WXV A;  2N7E A;  1WE7 A;  4O1N A;  1ZE3 D;  1XLN A;  4GB9 A;  3DHH C;  5L83 A;  3AEA B;  3T8M A;  1D5M C;  2KJ6 A;  2KQ7 A;  2KAC A;  1IBX A;  4MSM B;  1K52 A;  3DCG A;  3AEG B;  1S3S G;  2GOW A;  2WXO A;  1UWX A;  4RGN A;  1SEB D;  1C79 A;  2R2O A;  1N5W A;  3Q3M C;  3V60 A;  3DHG C;  4LDT B;  1JWB D;  3V6E B;  2WXN A;  1L4Z B;  1J7A A;  1ZGU B;  3HVZ A;  4C4V B;  1WR6 E;  4M0W B;  1B9R A;  2JXT A;  4FN2 A;  4MEL A;  2UWQ A;  1P98 A;  2ZW0 A;  3AU4 A;  3ML9 A;  4K7W A;  1OFF A;  3SEB A;  1WMH B;  3I9V 1;  2O2V A;  2VZK B;  4JWS C;  3PRM B;  3PLV A;  3DVN V;  2WXP A;  1SXT A;  4LJP B;  1V81 A;  3MC0 B;  2KX3 A;  2DYM A;  3P4S B;  2OOB B;  1DOX A;  3SR6 A;  2KLC A;  2L83 A;  2DX5 B;  1FRD A;  2QCZ A;  2WX1 A;  5JZE B;  4ICU A;  1VLB A;  5EDS A;  1TS3 A;  1WX9 A;  3UQA A;  3ALB A;  5D6J B;  1P9D U;  4ZRP A;  1YOV B;  3M63 B;  1RFA A;  3PZ8 A;  1B1Z A;  3OG5 A;  2JU6 X;  2CU3 A;  5IN7 A;  2OJR A;  1JWS D;  1WJ6 A;  1N61 A;  2QEJ C;  4HPP A;  2BS2 B;  3V05 A;  1WM2 A;  4H2A A;  2NMQ A;  4DK5 A;  4RGT A;  4BBN C;  4J6I A;  4C00 A;  4IWQ A;  3L10 B;  4JE3 B;  1WXM A;  4FHK A;  3A4S C;  4XE0 A;  3L13 A;  2KTR A;  4KDL B;  3Q3F A;  4IUM B;  2MH7 A;  5IKC M;  1XLP A;  4GSW A;  2UYZ B;  3KUC B;  1FFU A;  4YTM B;  3PGE A;  1ESF A;  1ZKH A;  4YT0 B;  2I38 A;  1E9M A;  3RCZ A;  1R4M I;  1P3Q U;  1OQY A;  1NI2 A;  4G3X B;  4WWO A;  3EUB 2;  4GDK B;  3Q6B A;  2IY0 B;  4EUT A;  5IP4 D;  1FNV A;  4FUL A;  4BBN F;  4TQ1 A;  1Q5W B;  2LGD A;  1WIA A;  4US8 A;  1SE3 A;  3AV8 A;  4REZ A;  3VR8 B;  3KH0 A;  2RGF A;  1DYQ A;  4KIK B;  4M02 A;  3C19 A;  4FHJ A;  1KRH A;  2IYD B;  2HTH A;  1GB1 A;  1P0R A;  2FCM A;  5C2T B;  3H7P A;  2WXK A;  4K7U A;  1I4Q A;  4DHJ D;  2B3A A;  2BF8 B;  4ZRQ A;  3R8B A;  5EE1 A;  2WU5 B;  5H8Y E;  4DQO C;  1TKE A;  3W1Y A;  3RMK C;  1SE9 A;  4WQM A;  2LVP A;  4FXC A;  3ETR A;  4GOC A;  1V1P B;  3RUL A;  1X1M A;  1ACC A;  3Q8F A;  2CKH B;  3PLU A;  4RF0 A;  2W3S A;  5LLI A;  3NZS A;  2BYE A;  4KSL C;  5JHB A;  3BYT B;  5G5H A;  4ZRI A;  3EFC A;  3OAW A;  4P6V F;  2D3C A;  3MHS D;  3VQI A;  3RNG C;  3NVY A;  2LRW A;  5TSS A;  2KJR A;  3O13 A;  3MHZ A;  4IC7 B;  3VDZ A;  3PZD A;  3MTN B;  3NZ3 A;  3RN9 C;  2KC2 A;  4OVV A;  1CZP A;  1C76 A;  1PDX A;  3AEC B;  3RYT A;  2LGY A;  3LB8 C;  4WWM A;  4OW0 A;  3U30 A;  3WAP A;  2H89 B;  3VVW B;  2ZVO A;  2NPT A;  4X57 B;  1RAX A;  2WXG A;  2N9X A;  1FXI A;  1WWT A;  4IM2 A;  4GMV A;  4MEM A;  2GB1 A;  3W1S C;  4DHZ B;  2FNJ B;  1IGD A;  2PMV A;  3NUH B;  3ONS A;  3RPF C;  3AEF B;  4IOI E;  2KKC A;  1IPG A;  1WXQ A;  5E6N A;  1LGR A;  3KVF B;  4OVU A;  3V6C B;  4M0W A;  3ZYY X;  2XN9 C;  2QJL A;  3AMZ A;  3EFU A;  4PS8 A;  3RNF C;  2REX A;  4C7Z A;  3ZNI D;  3BZD B;  1VCB A;  4M8M A;  3APC A;  3PS6 A;  2KWU B;  5LNK 1;  4I6N B;  2YEP F;  3L17 A;  2BYF A;  2PEA A;  4G50 A;  5EE9 A;  1KH0 A;  3UI3 A;  1PGX A;  1RM6 C;  2MJD A;  5D7G A;  2I1J A;  3ENE A;  3QX1 A;  2DYO A;  1VZ6 A;  2IDY A;  2MP2 B;  1ZXH A;  1JWM D;  3AB5 A;  2HE7 A;  2KDM A;  5BO4 B;  2NS5 A;  1L0X B;  2K6Q A;  3JW0 X;  3FIL B;  1XD3 B;  1I4G A;  2VRR B;  3A9J B;  2ZW1 A;  1N62 A;  1R4N B;  1K50 A;  1MPE A;  3JYU A;  2PVO D;  3NZU A;  3WCQ A;  1HXY D;  1FRR A;  2N0S B;  1F77 A;  2IGG A;  3PV1 A;  4LJO B;  4MGY E;  4CHK A;  1CMX B;  2HDE A;  1MHX A;  4IM0 A;  3TJP A;  3H6N A;  2IBI B;  2N9K A;  5HI1 A;  4HJG E;  2UU7 A;  4W9K A;  2MBO A;  3RNB C;  2FAZ A;  1YJJ A;  3C8Y A;  3K9O B;  3DWM A;  3NVW A;  5AEK B;  4HK2 A;  1F2R I;  1I4P A;  3LYY A;  1UBQ A;  3KQ4 A;  1EUV B;  4PYU A;  2SEB D;  1ENF A;  4UDU C;  2V4I B;  2XBB C;  2BYV E;  4DXA B;  2WU2 B;  3B08 A;  5IA7 A;  5C1Z A;  1YQ4 B;  2ZPY A;  5CHF A;  5D3D A;  2EKE C;  5MPO A;  4HEA 1;  3TIX A;  4B6W A;  2MW5 A;  3H9D A;  3GB1 A;  3I5J C;  3ZQ4 A;  3ZRF A;  4W9I A;  1MG8 A;  2AX5 A;  2WXJ A;  2LRU A;  2BS3 B;  1L0V B;  3S2A A;  3C0R B;  5LXI B;  2KMM A;  3ECI A;  3BII D;  1BUI C;  2PE6 B;  2LD9 A;  4S17 A;  4AQ7 A;  4RH6 A;  1GPX A;  1UNS A;  4WH4 A;  2IO0 B;  2AQ3 B;  2AEH A;  2GMI C;  2KAN A;  2D5G A;  1PGA A;  1WGK A;  4US9 A;  2KD0 A;  2A5U A;  3U7D A;  2KQ4 X;  3VUX A;  1V8C A;  1FXA A;  2ONQ A;  1V1O A;  3URY A;  4F1S A;  4FBJ B;  4HDQ A;  2HJ1 A;  1HQR D;  3R66 C;  3AM9 A;  1TYG B;  4OHJ A;  3MJ5 A;  3DVG Y;  4HXD A;  1DOI A;  5C3J B;  3B9J A;  4TMA B;  4HKQ A;  4CQN A;  4P7I A;  1GUA B;  1RWS A;  3PVL A;  3Q8E A;  2LEK A;  2XNA C;  5D94 A;  4B0M A;  1QQR A;  2INC C;  2JWU A;  4KKI A;  3ZDM C;  1MHH E;  1OEY A;  2EKI A;  3MC9 A;  4KKJ A;  1WX8 A;  4RNA A;  3H7P B;  5IAA C;  5H92 C;  4MH0 E;  1VZ8 A;  4I6P A;  2JQR B;  4WJN A;  3GE8 C;  2DZM A;  2NVU I;  2RR9 A;  2KVR A;  1N63 A;  4F8C B;  3HM3 A;  1IYF A;  4BKS A;  4NAM A;  4RGO S;  2JT4 B;  2LXA A;  2KFJ A;  1VD2 A;  2RPQ A;  3VRB B;  4HVB A;  4KV2 A;  3ZJV A;  2D2Q A;  3L16 A;  3X23 A;  4AWJ A;  4C80 A;  3PRP B;  3VTV A;  4MM3 A;  5G5G A;  3DBS A;  1TZO A;  4FA6 A;  1WM3 A;  5BYQ A;  4NZL B;  2KWV B;  4W9C A;  1I4X A;  3QJZ A;  1RFK A;  2LI5 A;  4B95 A;  3ZO5 B;  2Z0D B;  1HTO A;  5T8I A;  4A3P A;  3Q3N C;  1NYQ A;  5E6P A;  2IY1 B;  3DHI C;  2KZR A;  2DNF A;  3IHP C;  1GNU A;  2LAS A;  3OWE B;  2YVC A;  4BZA A;  3QAQ A;  3V3X A;  3N20 C;  2NBV B;  4KSK C;  3VTU A;  1NYR A;  1F1H A;  4EFO A;  4M01 A;  5GXG B;  4DBG A;  3RNA C;  1F2R C;  1FPY A;  3L54 A;  2KDI A;  1ZW7 A;  3NJT A;  3IG3 A;  1LFD A;  1SSN A;  5DPS A;  2MEK A;  1GJZ A;  3IT4 B;  3N30 A;  2DEN B;  2LJI A;  3WAO A;  5E6O A;  4FJZ A;  3HM6 X;  2YEP B;  2KN5 A;  2WX0 A;  5BMH A;  2KVZ A;  3VUW A;  4NJC A;  2DBY A;  1QKZ A;  1MG4 A;  2FCN A;  1WGG A;  1WSP A;  4II2 B;  1N60 A;  1E8X A;  3VH3 B;  3WIM A;  2C7H A;  4ZDV A;  1WRD B;  4AUQ C;  2PW9 A;  2ZVN A;  2IPK D;  1YX6 B;  2L05 A;  2KDB A;  1K51 A;  4II3 B;  3V61 A;  2NBW B;  2NTS A;  2WNM A;  4MM3 B;  4ANW A;  4RCO A;  3DWG C;  3GP7 A;  3FC4 A;  2LUM A;  2IO3 B;  3RI7 C;  2KHW B;  2LHD A;  3L0W B;  3RD2 A;  3GS2 A;  2V0G A;  3RUI B;  3RZF A;  2BT6 A;  4G0N B;  1ISN A;  2J0M A;  2R2Q A;  4LDT D;  3B2F A;  1PYW D;  2Y3A A;  3NHE B;  4PK1 A;  4YSX B;  4LLG M;  2QIL A;  1TY2 A;  3H7S A;  4FJY A;  1SB3 C;  2VH1 A;  3BK1 A;  1C4A A;  4CYE A;  2L32 A;  2XK5 B;  2N4F A;  5JHA A;  2MJ3 A;  1STE A;  1G6J A;  1AWD A;  4XWW A;  2ZCB A;  4RFB A;  3P42 A;  4WJP A;  1V5T A;  2JVC A;  2J42 A;  2ZNV B;  3ZJT A;  4ITK A;  3VFK A;  1AYF A;  1WMH A;  3BVG A;  2BWE S;  2DZJ A;  2NCN A;  1F52 A;  3IAM 1;  3TEZ A;  4L2Y A;  4LNK A;  2D3A A;  2GLS A;  5AZF A;  3ZGZ A;  1KFY B;  4EOY A;  1RYJ A;  4KGT A;  4JWU C;  1T0Q C;  4EKU A;  2JWZ A;  2QSD A;  3VR9 B;  3N1Y C;  3FAH A;  1R7S A;  3B1L X;  1WJU A;  1WXS A;  4PYZ A;  1WY8 A;  2LGS A;  1VJK A;  1FD6 A;  3AE8 B;  1L4D B;  5CTR C;  3KWV A;  3NG0 A;  1C3T A;  1JRP A;  2V3N A;  1FFV A;  1OTR B;  5IOI A;  4A20 A;  2ZZP B;  4HPM B;  4EZK A;  3KLS X;  2LHE A;  3V62 A;  2BQQ A;  1HZ5 A;  2LUE A;  4JX1 C;  4WQO B;  3E9S A;  1P1A A;  3JSV B;  2BS4 B;  3B2G A;  2EEL A;  3E56 A;  3Q3O C;  2PJH A;  1D3Z A;  1J8C A;  4MJS B;  3NRZ A;  4RF1 A;  1MFW A;  1QOF A;  2KT7 A;  1OQQ A;  4IDI A;  2L7R A;  3IXS A;  2M0X A;  3CST A;  4IW0 A;  2L8J A;  1EF1 A;  3A4R A;  3PTF C;  3HRD D;  5DPW A;  3PHW B;  3AEE B;  5DCN A;  3APF A;  1XLO A;  2C7N B;  1T3Q A;  3AE3 B;  1E7U A;  4YL8 A;  1WGD A;  2V3P A;  4G11 A;  3UIP B;  2JYT A;  2BGF A;  2BYT A;  1HEZ E;  4BOS C;  1JCK B;  4ZRK A;  1T0R C;  2N1V A;  4MAC A;  5AUI A;  4HWI B;  2JZ3 B;  2KN4 A;  3DVN U;  5FR6 A;  1ET6 A;  3A1Q B;  4TUU A;  1KF6 B;  1VZ7 A;  3NS1 A;  1V49 A;  4W9J A;  2GBN A;  4LCD E;  2PVG C;  5GMV A;  3VAW A;  3GOE A;  4A6Q A;  1TS2 A;  4HKZ E;  2ASQ A;  3AE2 B;  1QIL A;  1QF6 A;  2KNB A;  4GN1 A;  4ANX A;  1VDV A;  3ABV B;  4KVG B;  3BY4 B;  1C9F A;  3PHX B;  3B0A A;  4TKN A;  2KTF A;  2LVO A;  5BMG A;  3LXF A;  4DDG D;  3I3T B;  1TKY A;  4OZA A;  1SF0 A;  5FKA C;  4MT5 A;  5HHD G;  3RT3 B;  3BYY B;  3SFE B;  2KC1 A;  1JRU A;  4KIK A;  3HUI A;  2J7Q B;  2PLP A;  4K3C A;  1SE4 A;  3MC8 A;  1NVI D;  4W9H A;  3N1X C;  2D3B A;  2CJN A;  1C4C A;  4AS1 A;  4LNF A;  3OLM D;  2EMS A;  1UF0 A;  3Q8B A;  1OGW A;  3IAS 1;  3ZIM A;  4KDI C;  3CSF A;  3VHT C;  3W2D A;  3N9Y C;  1PFD A;  1V97 A;  2KTR B;  2HD5 B;  1HZ6 A;  1P7F A;  1Q1O A;  4FAD A;  4WJQ A;  2WDQ B;  3SHQ A;  2L0F A;  4M00 A;  3HHM A;  3ZXV A;  2BB6 A;  4GIV A;  4LNO A;  3QHT A;  1C77 A;  2A4Z A;  1EO6 A;  1E7V A;  3ML8 A;  4C7Y A;  1FM0 D;  1SIF A;  3A9J A;  3O65 B;  4XZ4 A;  1GC7 A;  1E0Z A;  2Y5P A;  2OHF A;  4IG7 B;  4XX5 A;  3MJW A;  2L76 A;  1EU3 A;  2W54 A;  2KFK B;  2QHO A;  2W9N A;  2MLB A;  2K9X A;  2L0T A;  3W5U B;  3Q8A A;  2QIE B;  3GZN B;  1EU4 A;  2Y5C A;  1QOB A;  1WE6 A;  3ZLZ A;  3APD A;  3D32 A;  4GDL B;  2AQ1 B;  1L7Y A;  3OJ4 B;  1I42 A;  2LGI A;  3Q69 A;  1T6B X;  3U4E G;  3DBH I;  1KLV A;  2L3Z A;  5CHV C;  3FIL A;  1EWY C;  4N9F 4;  4YSY B;  4BKG A;  2MSE D;  2QDF A;  1TY0 A;  1WJN A;  2ON8 A;  1SGH A;  2BB5 A;  3NVV A;  4A3O A;  1YJ1 A;  4HLE A;  2V4L A;  1L2N A;  3ZXR A;  1UUP A;  4DXF A;  1WZ3 A;  2RDH A;  4ZRJ A;  4YTP B;  1TS4 A;  1XXG A;  1GC6 A;  4WAA A;  1R4N I;  2LJ5 A;  2DYB A;  5TR5 A;  1JQ4 A;  1JWA D;  3IFW B;  1TTN A;  3DPD A;  3Q2A C;  1IUE A;  1WFY A;  4GXB A;  3HK0 A;  4HCP B;  5E6J A;  2KDE B;  1KJT A;  2W3R A;  3H8H A;  5HKH A;  1WX7 A;  3AE9 B;  4BKT A;  1CK1 A;  2LWP A;  4OVZ A;  2BWF A;  1ZOY B;  1D5Z C;  4XC2 A;  1HE8 A;  1AN8 A;  3DQV A;  5J18 A;  2GBK A;  4NJ6 A;  1QZE A;  3UGB B;  4P1C C;  4KZC A;  4JIO U;  1ZP0 B;  1WYW B;  4CO7 A;  3EC8 A;  2IJ0 A;  4ZHP A;  2KFK A;  2N7D A;  2K0P A;  2LVQ A;  5CHW A;  4MDK E;  1RLF A;  2KOX A;  2MX2 A;  2G1E A;  3UIO B;  2WXH A;  5JXV A;  1N6Z A;  1FMA D;  3DOW A;  3R7Q A;  1K8R B;  2RD0 A;  3PO0 A;  5CX3 A;  2MHJ A;  2KAJ A;  4DDI D;  3N3K B;  2CHX A;  3P63 A;  3ZKJ C;  2AL3 A;  2J0K A;  1M94 A;  1YQB A;  2WYQ A;  3ZNH B;  2V3S A;  1NDD A;  2CJO A;  5BYR A;  2K3U A;  4ZHO A;  4ANU A;  2AWT A;  1YNT E;  2WWZ A;  3ZW3 A;  3TUO A;  3BK2 A;  3ZVV A;  1YMH E;  2PTL A;  2J0J A;  3RNE C;  5HFY A;  1C4P A;  2OJW A;  4IM3 A;  1TBE A;  2MBB B;  3UIN B;  1VRA B;  5EE3 A;  4URK A;  1HA5 A;  3FKY A;  2QMT A;  3MFG A;  4NAW B; 
#chains in the Genus database with same CATH homology
 2RDG A;  1AW7 A;  3NVZ A;  1ZUD 2;  3TEZ A;  3PZ7 A;  4L2Y A;  3NZ3 A;  3AH7 A;  3ZGZ A;  2H88 B;  1KFY B;  1CZP A;  1C76 A;  1PDX A;  1RYJ A;  3AEC B;  2G9H D;  4EE2 A;  3AE7 B;  4KGT A;  3LB8 C;  4JWU C;  1FO4 A;  3P4Q B;  2QSD A;  4OW0 A;  4WWM A;  3VR9 B;  2I2Y A;  2H89 B;  1E6E B;  3FAH A;  1R7S A;  1PUT A;  2B76 B;  2WXI A;  2WXG A;  1V1P A;  2LMC A;  1FXI A;  4P16 A;  1WWT A;  5FK9 C;  2WLB A;  3TEX A;  1MVK A;  2GB1 A;  1IGD A;  2PMV A;  1J7B A;  1VJK A;  3HVD A;  3NUH B;  1EM7 A;  3RPF C;  2J4X A;  1FD6 A;  1GOZ A;  3AE8 B;  1L4D B;  3AEF B;  3VRA B;  4IOI E;  1E10 A;  1WXQ A;  1FCC C;  1FIQ A;  2Q5W D;  3KWV A;  4TQ0 A;  4WAF A;  4HRS A;  2SAK A;  1JRP A;  2V3N A;  1FFV A;  1NEK B;  4C56 C;  1YJI A;  4RGM A;  2INN E;  5BMI A;  4M0W A;  3ZYY X;  1JAL A;  2QJL A;  2XN9 C;  3AMZ A;  2WDR B;  5I4D A;  4C7Z A;  3BZD B;  1ET9 A;  2JYE A;  3MP9 A;  3KLS X;  1KTK A;  4IKG A;  2LHE A;  4A8X C;  5LNK 1;  2YEP F;  1HZ5 A;  1NEN B;  3AEB B;  3CIR B;  5EE9 A;  2FE8 A;  1FNU A;  2K22 A;  1KH0 A;  3UI3 A;  1PGX A;  1RM6 C;  2M19 A;  2MJD A;  2ICI A;  4JX1 C;  1YN5 A;  5D7G A;  2ACZ B;  2JX5 A;  3E9S A;  2DYO A;  2BS4 B;  3B2G A;  3L4P A;  1VZ6 A;  1DOY A;  2IDY A;  1ZXH A;  3AE5 B;  1JWM D;  4XWT A;  2EEL A;  2N9L A;  3E56 A;  1I4R A;  3AB5 A;  2IGD A;  2KDM A;  1L0Y B;  3NRZ A;  4RF1 A;  1L0X B;  2GI9 A;  2MJE A;  2M0A A;  3FIL B;  1QOF A;  1K53 A;  4J3O D;  1I4G A;  1OQQ A;  4IDI A;  1OQR A;  1ZXI A;  1N62 A;  2ZW1 A;  2WXL A;  1K50 A;  1MPE A;  1FEH A;  1GAQ B;  3IXS A;  1KLU D;  2PVO D;  3WCQ A;  1DGJ A;  1XCT L;  1HXY D;  1P7E A;  1FRR A;  1VR9 A;  4OZB A;  5FR3 A;  1IGC A;  2N0S B;  1F77 A;  3HRD D;  2IGG A;  4MH8 A;  2RPV A;  4A90 A;  3TSS A;  3AEE B;  3P1M A;  3U2S C;  1ZPS A;  1EWC A;  1XLO A;  1I7H A;  5AUK A;  1ROE A;  1T3Q A;  2HDE A;  1MHX A;  3AE3 B;  3BWU D;  1Q10 A;  2L1A A;  2N9K A;  2V3P A;  5HI1 A;  4HJG E;  1XCQ L;  2JYT A;  2BYT A;  1HEZ E;  4XDC A;  1JCK B;  1YJJ A;  2DWQ A;  3C8Y A;  4JPS A;  1FCL A;  2OED A;  3DWM A;  3NVW A;  4N58 A;  1TKG A;  4ARC A;  2WDV B;  4MAC A;  1QT9 A;  5AUI A;  4B0E A;  4GLS C;  3CWI A;  2KN4 A;  2LFI A;  2NTT A;  1F2R I;  1ET6 A;  3U52 E;  1I4P A;  3LYY A;  2BTE A;  3KQ4 A;  1Y56 A;  3AE6 B;  1XO3 A;  2RMM A;  1KF6 B;  4A9A A;  2SEB D;  1VZ7 A;  3NS1 A;  1JRO A;  5D3I B;  1D4B A;  4N6E B;  1ENF A;  2J53 A;  3TEY A;  1TJE A;  1TS5 A;  4UDU C;  2PVG C;  2V4I B;  4KGR A;  4A6Q A;  4LK0 M;  2E3T A;  1D6E C;  2WU2 B;  1TS2 A;  4HKZ E;  1YQ4 B;  1SIJ A;  3AE2 B;  2L52 A;  4KGS A;  5D3D A;  1QIL A;  5MPO A;  1JWU D;  4YTN B;  1QF6 A;  4HEA 1;  1VDV A;  3ABV B;  1CQV A;  2FUG 1;  3GB1 A;  1XEE A;  4Q2J A;  4WUR A;  1C9F A;  3BVM A;  3TEW A;  3ZQ4 A;  4WIP A;  2AX5 A;  3EA6 A;  2WXJ A;  2W82 A;  5BYS A;  2BS3 B;  4LTU A;  5BMG A;  1L0V B;  4R3D A;  3LXF A;  3W9C B;  1TKY A;  2J52 A;  4L1B A;  4OZA A;  1SF0 A;  2KMM A;  2N7J A;  3BII D;  1C78 A;  2WXM A;  1BUI C;  4MT5 A;  5FKA C;  3AE1 B;  2WXQ A;  2KWD A;  5HHD G;  4AQ7 A;  2JZP A;  2WS3 B;  4D2K A;  4RH6 A;  3BYY B;  3SFE B;  1UNS A;  1GPX A;  4WH4 A;  2BBC A;  2INP E;  2AQ3 B;  4KX6 B;  2BW2 A;  2HTM E;  3HUI A;  2D5G A;  1PGA A;  1WGK A;  4US9 A;  3EGR A;  2PLP A;  2Z8L A;  3IT6 B;  1F0Z A;  1SE4 A;  2KQ4 X;  4O1N A;  1NVI D;  1GB4 A;  2W55 A;  3R2I A;  1IBX B;  3AE4 B;  1ZE3 D;  1XLN A;  1V8C A;  1FXA A;  2ONQ A;  1V1O A;  3URY A;  2CJN A;  3AEA B;  1C4C A;  4AS1 A;  1HQR D;  3AM9 A;  3Q8B A;  1D5M C;  1TYG B;  1IBX A;  2KAC A;  4OHJ A;  3IAS 1;  3MJ5 A;  1DOI A;  1K52 A;  2E6X A;  3B9J A;  4TMA B;  5C3J B;  4HKQ A;  4CQN A;  3AEG B;  1RWS A;  3Q8E A;  2LEK A;  2XNA C;  2WXO A;  4B0M A;  1UWX A;  4RGN A;  2IGH A;  3W2D A;  3N9Y C;  1PFD A;  1QQR A;  1SJH D;  1V97 A;  2JWU A;  1SEB D;  1C79 A;  1HZ6 A;  4KKI A;  1P7F A;  1N5W A;  2X38 A;  2WDQ B;  1MHH E;  2VZK D;  2EKI A;  5TSS A;  2TSS A;  3KWL A;  4KKJ A;  4RNA A;  2BB6 A;  4XDD A;  5H92 C;  1JWB D;  1VZ8 A;  1XLQ A;  5EE0 A;  1C77 A;  4ARI A;  1FNW A;  2WXN A;  2JQR B;  1L4Z B;  1J7A A;  3HVZ A;  1WRI A;  1B9R A;  2JXT A;  1M4V A;  4C7Y A;  1FM0 D;  1LO5 D;  1N63 A;  1E0Z A;  2Y5P A;  1JML A;  2OHF A;  2ZW0 A;  3P4P B;  4NAM A;  4RGO S;  1OFF A;  1EU3 A;  2W54 A;  3SEB A;  3I9V 1;  2PIA A;  1QOG A;  2DLB A;  3VRB B;  2K9X A;  3ZJV A;  2VZK B;  3W5U B;  4C80 A;  3Q8A A;  4JWS C;  2QIE B;  1I4H A;  1JW9 D;  1EU4 A;  2Y5C A;  1QOB A;  2WXP A;  2PKO A;  1SXT A;  5G5G A;  4GDL B;  3MC0 B;  2AQ1 B;  1L5P A;  1TZO A;  2DYM A;  2LGI A;  3P4S B;  3Q69 A;  1T6B X;  5BYQ A;  3SR6 A;  1DOX A;  3U4E G;  4NZL B;  1I4X A;  2L83 A;  5HG2 A;  1RFK A;  2WXF A;  4TSS A;  1FRD A;  1YQ3 B;  3FIL A;  1EWY C;  1VLB A;  4YSY B;  1TS3 A;  5T8I A;  1NYQ A;  1TY0 A;  2ON8 A;  4ZRP A;  2BB5 A;  3NVV A;  3OWE B;  3PZ8 A;  1B1Z A;  2JU6 X;  1UUP A;  4DXF A;  3V3X A;  2CU3 A;  1D5X C;  2RDH A;  4YTP B;  1TS4 A;  1JWS D;  1XXG A;  1N61 A;  1NYR A;  2QEJ C;  2BS2 B;  3V05 A;  5GXG B;  1NI3 A;  4YWG G;  1JQ4 A;  1F2R C;  4H2A A;  1JWA D;  1SJE D;  2NMQ A;  4RGT A;  4N59 A;  1ZDX A;  1IUE A;  4YXD B;  1SSN A;  3AED B;  5E6J A;  2MEK A;  2W3R A;  3IT4 B;  4JE3 B;  3H8H A;  2LJI A;  3BVZ A;  4XE0 A;  1YN3 A;  2MH7 A;  1XLP A;  2GRI A;  2YEP B;  3AE9 B;  1CK1 A;  1FFU A;  4YTM B;  3SFD B;  1ESF A;  4OVZ A;  5BMH A;  1ZOY B;  1D5Z C;  1E9M A;  2I38 A;  4YT0 B;  1AN8 A;  4NJC A;  3W1S A;  3EUB 2;  4DXG A;  1L6V A;  4GDK B;  2R61 A;  2DBY A;  1QKZ A;  3R2T A;  3ZJU A;  1FNV A;  1WSP A;  1ZP0 B;  3W5V B;  1N60 A;  4TQ1 A;  4YSZ B;  4OZC A;  2IJ0 A;  4US8 A;  1L6U A;  2PW9 A;  2IPK D;  1SE3 A;  2K5P A;  3AV8 A;  4REZ A;  2FBW B;  3VR8 B;  4ZHP A;  2AQ2 B;  1J7C A;  2K0P A;  1DYQ A;  3I57 A;  1T5X D;  1K51 A;  2NTS A;  2WNM A;  1KRH A;  2WXR A;  4MM3 B;  1ZDV A;  4HRO A;  1QLB B;  2WQY B;  3AN1 A;  2JSV X;  2G1E A;  4RCO A;  1WYG A;  1MI0 A;  3DWG C;  2WXH A;  3GP7 A;  3FC4 A;  4PT5 A;  1GB1 A;  5JXV A;  4ZYS A;  1SE2 A;  2LUM A;  1FMA D;  3J9C A;  2LHD A;  2M56 B;  5C2T B;  3T3N A;  3GS2 A;  2V0G A;  1CJE A;  2WXK A;  4L23 A;  1PGB A;  1I4Q A;  4ZOH C;  3PO0 A;  4ZRQ A;  3U7Z A;  2KAJ A;  1XF5 L;  3R8B A;  2BT6 A;  5EE1 A;  1E7P B;  2WU5 B;  3P63 A;  5H8Y E;  3B2F A;  4DQO C;  1SBB B;  1TKE A;  1PYW D;  2WP9 B;  2Y3A A;  4WQM A;  4FXC A;  3ETR A;  4YSX B;  3RFZ B;  1V1P B;  4LLG M;  2CJO A;  5BYR A;  2QIL A;  1TY2 A;  1ACC A;  3Q8F A;  4RF0 A;  2W3S A;  2K3U A;  4ZHO A;  1SB3 C;  1QOA A;  1YN4 A;  3BK1 A;  1C4A A;  1BML C;  1UGJ A;  1YNT E;  3BYT B;  5G5H A;  2L32 A;  3TUO A;  3BK2 A;  1KLG D;  4A55 A;  1YMH E;  1A70 A;  2PTL A;  3T3O A;  2MJ3 A;  1STE A;  4USA A;  4P6V F;  1AWD A;  4XWW A;  5HFY A;  1C4P A;  4RFB A;  1UWM A;  3P42 A;  3Q8C A;  3VQI A;  2J42 A;  1VRA B;  5EE3 A;  3NVY A;  3ZJT A;  4ITK A;  1HA5 A;  1AYF A;  2QMT A;  3BVG A;  1BXT A;  3MFG A;  4NAW B;  3P4R B;  3O13 A;  1N5X A;  3MHZ A;  3IAM 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...