2EKIA

Solution structures of the tgs domain of human developmentally-regulated gtp-binding protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
93
structure length
93
Chain Sequence
GSSGSSGYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLIKEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Developmentally-regulated GTP-binding protein 1
publication title Solution structures of the TGS domain of human developmentally-regulated GTP-binding protein 1
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 14
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2007-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02824 TGS TGS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2ekiA00
4YT0B 1NEKB 1QT9A 3P63A 3AV8A 1JROA 1RYJA 3NS1A 3W5VB 4ZHOA 1V97A 1IUEA 2EKIA 2BS2B 3DWGC 1TKYA 2HTME 3AE5B 1YJJA 4JWSC 1VJKA 1JWBD 2N0SB 3AE6B 1NI3A 2BT6A 1CJEA 1OFFA 1FXAA 1N62A 4USAA 1N60A 2M19A 3FC4A 1TKEA 2QJLA 1V8CA 1DOIA 2JQRB 2JX5A 3B2GA 3VRAB 3AE9B 3VR9B 3KWLA 1L5PA 3CWIA 1RWSA 2L83A 1FFUA 1ZUD2 2KAJA 3AMZA 5MPOA 2KMMA 1OQQA 3P4SB 2WDRB 4A9AA 1NYQA 1XLOA 2OHFA 1J7CA 1ROEA 1TYGB 1FRDA 1ZXIA 5EE0A 1QOAA 1B9RA 4KX6B 2K5PA 2G1EA 4JX1C 2BS4B 3ETRA 1E9MA 1WRIA 1TKGA 1OQRA 4YTPB 1FO4A 2H88B 2QIEB 1AWDA 3AE7B 3AEBB 5G5GA 3B9JA 5G5HA 1N5XA 2BS3B 2Y5CA 2CJOA 5H92C 2L52A 3LXFA 1XLNA 1YJIA 4N6EB 4HROA 4C7ZA 4YSZB 4US8A 1DOYA 3AECB 3NVYA 1QOGA 3ZYYX 1CZPA 3W5UB 2MJDA 4ITKA 1WWTA 2W3SA 3VRBB 1VDVA 4ZOHC 1N61A 1JQ4A 2WU2B 5AUIA 3RPFC 1GPXA 5C2TB 1SB3C 3P1MA 3AEEB 2PIAA 2W3RA 1JW9D 2WDVB 3BIID 3P4QB 1N63A 1YQ4B 1KFYB 3AH7A 1T3QA 1AYFA 1SIJA 5EE1A 1WYGA 2PVOD 2W55A 3NRZA 4JWUC 5GXGB 4P6VF 1RFKA 3CIRB 1L6VA 5EE3A 2WLBA 3AB5A 4C7YA 1SF0A 2K22A 2Q5WD 5C3JB 1N5WA 1PUTA 1GAQB 2AX5A 1F0ZA 1J7AA 1A70A 1JWAD 1QLBB 3DWMA 3AEDB 3LB8C 1R7SA 3B2FA 1WXQA 3AEAB 3P4PB 2K9XA 3FAHA 1PDXA 1FRRA 3NVZA 3NVWA 4WQMA 1E0ZA 4HRSA 3WCQA 4LTUA 4WWMA 1YQ3B 4IDIA 1DGJA 2CJNA 1E6EB 2WDQB 2H89B 2MJEA 1EWYC 3HUIA 3VR8B 4FXCA 1JRPA 1I7HA 1XLQA 4YSYB 1TJEA 3HRDD 4ZHPA 5AUKA 1FFVA 5H8YE 1RM6C 2B76B 4YXDB 2DBYA 1DOXA 3SFDB 4C80A 1QF6A 1KF6B 1J7BA 1FXIA 2CU3A 4YTNB 1L0VB 3NVVA 3AEFB 2ACZB 3ABVB 5EE9A 1JALA 1WGKA 3L4PA 3P4RB 1FIQA 1E7PB 1NENB 1XLPA 2E3TA 2WS3B 2PVGC 1QOBA 2WQYB 1UWMA 1FMAD 1L6UA 1QOFA 1PFDA 1FM0D 2WU5B 4YSXB 3W9CB 1NVID 1NYRA 2DWQA 3AE1B 3AEGB 4N59A 4N58A 3PO0A 3SFEB 1ZP0B 2FBWB 3AE4B 3SR6A 4YTMB 3AE3B 1ZOYB 1XO3A 2PKOA 2W54A 2MJ3A 3AE2B 3AM9A 3EUB2 3AN1A 3HVZA 2M56B 3AE8B 2WP9B 1VLBA 4US9A 1E10A 2LEKA 1KRHA 2MH7A
chains in the Genus database with same CATH superfamily
2AQ1B 4X57B 4HVBA 1FPYA 3VXWA 1NDDA 1OFFA 4HEA1 2JZPA 2OEDA 4WQOB 3VUXA 1TKEA 1E5WA 1K53A 1UNSA 3TBLD 1YD8U 1OQQA 2WGSA 4ARIA 1F9JA 2WXKA 3PPAA 4CO7A 1R4MI 2G1EA 4R3DA 2BB5A 3VFKA 1C78A 2K8BA 4KKIA 2QIEB 1RRBA 1IBXB 2WXOA 2MSED 1MG8A 1LO5D 2IY1B 2L52A 1I4XA 3A4SC 1KM7A 1XEEA 1GC7A 1GPXA 5C2TB 4AUQC 3DHHC 4WURA 1AYFA 1P0RA 4ICVA 4W9GA 3JW0X 2Q5WD 2DYOA 4CQNA 3NOBA 2NPTA 2MLBA 1P1AA 3APDA 3MJWA 4HCNB 1R4MB 3ONSA 1AARA 2QCZA 1EWYC 2INPE 2FCSA 4AJWA 4DXAB 2VRRB 2ICIA 2KFKA 3PZDA 3V6EB 4C80A 2HE7A 1STEA 4M0WB 1F2RC 3NVVA 3FILB 3L4PA 1FCCC 5E6JA 2K3UA 4O1NA 2AL3A 4FJVB 2PTLA 3ZDMC 2KMCA 3RMKC 4ZHOA 5IAAC 2FNJB 3HM3A 4IWQA 3IHPC 4MGYE 2FCMA 4WAFA 1SXTA 2LGYA 2FUG1 3VTWA 4IOIE 3U4EG 1VD2A 3AU5A 3NZSA 3SDLC 1V86A 1P3QU 2KNBA 1VJKA 3BYYB 4EZLA 1CQVA 3RNBC 3OG5A 3FC4A 1QQRA 4JIOU 2L1AA 2XBBC 3VR9B 1FNUA 3Q8AA 4S0RA 2KWDA 2GOWA 4MSMB 1ROEA 4J3OD 2J7QB 1MI0A 2ZW0A 2N7DA 3U7ZA 1GG3A 5HHDG 1OQRA 2C7HA 4FA6A 4QAYA 1YMHE 3MFGA 4JPSA 3AE7B 1N5XA 1N6ZA 1XLNA 4GDLB 1V5TA 1ZE3D 3ZYYX 1QOGA 3M63B 4LLGM 1R4NI 4GLSC 2DAFA 1D5ZC 3NJTA 3H1UA 5BMGA 2GBJA 3AH7A 3KW5B 4YL8A 2BYVE 4LNKA 2N1VA 3IBEA 1F0ZA 2JWUA 1UGMA 2DLBA 3FAHA 1FRRA 3AXCA 4KIKA 3CF6E 1D5XC 3GZNI 1WM3A 1V80A 1WXMA 3IXSA 2NR2A 3TL5A 1L2NA 4P16A 4MSQB 3KUDB 1QF6A 1D5MC 2CU3A 2HD5B 3N30A 4W9LA 4FJYA 1R4NB 1UWXA 4IWPA 2KC1A 2JZZA 2WU5B 4XDDA 4YTMB 1ZP0B 4GU2A 3HVZA 2X8XX 4B6WA 2WP9B 1YOVB 3A1QA 3E9SA 2MH7A 1J19A 2DX5B 4JQWC 2GI9A 3GZNB 2G4SA 4FLHA 3VAWA 4PT5A 1TKYA 2KDMA 4JWSC 2MX2A 4NJCA 1HQRD 2N0SB 1PQSA 2PPHA 1N62A 3GE8C 2LJIA 3VH4B 2O2VA 4ZRIA 2JQRB 1L5PA 2NBWB 1H4RA 1WYWB 5MPOA 2D07B 2BGFA 4ZYNA 4B95A 1TYGB 1I4QA 1ZXIA 3ZXRA 5G55A 4GB9A 2JU6X 2LVPA 2E6XA 4S17A 3PRZA 4NJ6A 1OEYA 2CJOA 4BKSA 2LWPA 3EC8A 3VRBB 1N61A 3RPFC 4HPPA 1BT0A 2GRIA 4JWUC 3AU4A 4P6VF 3OAWA 3QK0A 3ZVVA 3BVMA 4DHZE 3WAMA 1SE3A 2MP2A 4K7WA 3RI7C 4W9HA 1PYWD 3U30A 3VH3B 5JHBA 1E8YA 1XLQA 4W9FA 1FFVA 1UUPA 4TKNA 3K9PB 5C23A 4XGAB 1JALA 1F77A 4WJPA 3SEBA 2WQYB 1TGZB 2WX1A 4IUMB 4OHJA 4RCOA 2HTHA 1NVID 1KH0A 4K3CA 2V3PA 1ZOYB 2Y5BB 3SHQA 3AE2B 4G50A 4DBGA 1IGDA 2C60A 1MJDA 4MT5A 3DPDA 2MBHA 2PMVA 1VLBA 1HTOA 1RAXA 4HKQA 2K25A 3QC8B 3VTUA 1E7VA 1OTRB 3RNCC 3AE6B 1NI3A 3U2SC 1KLGD 5D2MB 3BY4B 2K6QA 1EF1A 3MHZA 3DVNV 3AMZA 2KMMA 1B1ZA 4FJZA 2KJ6A 4C56C 1E8XA 4JX1C 1WRIA 2XNAC 1WJUA 2YEPF 1AWDA 3ENEA 5G5GA 4C00A 2ZZPB 2V0GA 1WXSA 2AEHA 4XDCA 3V05A 2K8CA 1MG4A 3P1MA 3C19A 1ET6A 1SBBB 2KOXA 4YWGG 3TEZA 1KTKA 2W55A 4WJNA 5AZFA 3BINA 2NCNA 2G3QB 3LB8C 2LGSA 3KYDD 4HRSA 4WWMA 1PGXA 4XX5A 3HUIA 3WAOA 5H8YE 1FD6A 3ZKJC 3DCGA 4BOZB 3RUIB 2R2QA 2MBEA 1V49A 4BVUC 3TIXA 5DPRA 1LM8B 4NZLB 2RMMA 2ZNVC 1FM0D 2Z0EB 1J0GA 1XO3A 2QEJC 3EUB2 2B3AA 2GBNA 1T0YA 1GB4A 4ZRKA 3GS2A 2K0PA 2KLGA 1YJJA 1I4GA 1WJ4A 1Q10A 2A4ZA 4HK2A 4M01A 4HCPB 1SJED 3TCAA 1WGGA 1MVKA 3DBRI 4NPNA 2WDRB 2RDBC 4FN2A 2ZCCA 3RN9C 1B9RA 1JMLA 2KQ7A 5G2NA 3VQIA 3EFUA 4OVUA 2M17A 4FHKA 1PGBA 4YSZB 1QZEA 1CZPA 3EECA 5IO9A 4L2YA 3JVZX 3R7QA 3ZJTA 4NAWA 3OLMD 4OVZA 5DCNA 3SD5A 3PLUA 2FAZA 4UDUC 2MRPA 5FK9C 4AP4C 3MP9A 3A1QB 2JVCA 3DBRB 1A70A 1JWAD 1R7SA 3AEAB 3RULA 3NVZA 4K7SA 4RGMA 4G11A 1E6EB 2JWZA 2D10A 4KGSA 4II3B 1TJEA 3A9KA 4WWOA 2IDYA 5LLIA 2UU7A 1WJ6A 3UIOB 1VZ6A 5DPWA 2V4IB 1UZXB 2KACA 4DXFA 1P7EA 1VZ7A 3Q14C 1YN5A 2IGDA 4I6PA 2AL6A 2KN4A 2M0XA 4N59A 5BYQA 2KHWB 3PO0A 1FXTB 3QCAA 2INCC 1KJTA 4TMAB 1TS2A 5GMVA 3QX1A 4G0NB 2W9NA 1TY2A 2ZVNA 5J17A 3N3KB 2KWVB 3VVWB 4E74A 4A8XC 1WMHA 3RNFC 2BWFA 2V3SA 1I4PA 2AYOB 1N60A 4W9DA 4DHJD 3ZUNA 2BYEA 2JT4B 2KKCA 3U8ZA 2N9XA 2DNFA 4MDKE 2WXLA 1VRAB 3ML8A 4ACFA 5E6PA 2O6VB 2RPVA 4FHJA 3WA0A 2IO3B 1GJZA 3A4RA 1YJIA 2PW9A 4C7ZA 1ESFA 1K51A 3N20C 4NQLB 1EU3A 2ASQA 2WU2B 2GBRA 2OJRA 3H7PB 1C9FA 2I38A 5EE1A 2GB1A 5GXGB 3UF8A 2V3NA 1KLUD 3PRPB 4DWFA 2N9KA 1SF0A 3Q8BA 1J7AA 1IGCA 2JRHA 2CHXA 4LJOB 1YQ3B 3MC0B 5CTRC 2FE8A 1E90A 2BYFA 1LQBA 3VR8B 2DYBA 3HIZA 5D94A 1Q0WB 3B08A 3V3XA 1V1PB 4MGIE 4MJSA 4JGHB 2SEBD 5EE9A 2KTRB 2KWUB 1WGKA 2RD0A 2ZNVB 3K9OB 4W9EA 3WALA 2FIDA 1AW7A 2J53A 4KGRA 1PFDA 2RDGA 1UELA 2DENB 3QIJA 3AM9A 4MGKE 1WZ3A 2BW2A 3QJZA 4ZRPA 2TSSA 4M02A 3NZUA 1UGJA 1ZW7A 1XCTL 2GLSA 1V2YA 3UI3A 1SE2A 2IO1B 3L16A 2ZPYA 2L83A 4EFOA 3QWZB 5L95C 3Q8FA 4IG7B 2CU1A 2L00B 4GN1A 3J9CA 4BZAA 4HWIB 4KKJA 1E9MA 1WR6E 4GGQA 3ZW3A 4F7ZA 2Y5CA 5AZHA 2DZJA 4LDTB 3W5UB 4P1CC 2FCQA 4BBNC 2CS4A 3ZO5B 2J0MA 2ON8A 3VDZA 2ZCBA 1WYGA 4KZ0A 1ET9A 3RZWC 5IP4D 3RNEC 2A5UA 4AWJA 5C3JB 1WRDB 2IGGA 5AZGA 2GMIC 5CHVC 1C4PA 3MJ5A 4ZRQA 3DBHI 1L7YA 3IG3A 1UBQA 3NG0A 4PYUA 1YX5B 2KX0A 2LUMA 2C9WB 3DVGX 4MM3B 1CMXB 3PZ8A 3T8MA 1DOXA 2PE6B 2LVOA 3HVDA 2WXGA 3N1ZC 3H8HA 1TS3A 1I35A 2BKRB 2KFJA 2XN9C 2HJ1A 1QOFA 3UQAA 4N58A 2W54A 4GSWA 3MC9A 2IO2B 4HDQA 3BZDB 2D3CA 4US9A 1TZ1A 3DBHB 1QT9A 4AJYB 1MPEA 5BO4B 2NVUI 4PS8A 1ACCA 3R3MA 2IBIB 5LNK1 4J6IA 2W82A 2KT7A 3PRMB 3DOWA 2MA9B 2JYEA 2LASA 3I9V1 5T8IA 3VRAB 2LMCA 3VHTC 5L83A 2KAJA 2PE9A 3IT4B 1YJ1A 1NYQA 1XLOA 5FR6A 2WXIA 2DZMA 3U7DA 2KVRA 3UQBA 5AEKB 2MQJA 2UYZB 3R2TA 1C1YB 4A3OA 1IYFA 2D5GA 1MHHE 3VUWA 1BUIC 5LXIB 3B9JA 3JSVB 1K52A 2L32A 1FCLA 4NAMA 3ZDTA 4TQ1A 2ZVOA 3CSTA 1E8WA 1WWTA 2W3SA 5AUIA 4TQ0A 4MGZE 1X1MA 4BFRA 2WDVB 2KLCA 2MBOA 1GB1A 4C7YA 2INNE 4AS1A 1FEHA 1PUTA 3P42A 5D3DA 2KJHB 1YQBA 3P4PB 1F2RI 3NVWA 4RGOS 4OVVA 1WE6A 2LHEA 3T3OA 4WH4A 3H6NA 1Y56A 1WX8A 3LDZE 1V6EA 4NQKE 3L0WB 5EDSA 1XLPA 1WX9A 2Z0DB 3W1SA 2LGDA 3N1YC 1IP9A 2MWSB 1LXDA 3Q8EA 1T0SC 2DZIA 3WIMA 2QMTA 2LRWA 1OQYA 3KH0A 1JWUD 4HPLB 2EMSA 4RGNA 1WM2A 4FBJB 1F52A 3KLSX 4RM9A 4OZCA 2KX3A 2EKIA 1JRUA 2K8HA 2NMQA 4EZKA 2MBBB 1JWBD 2BT6A 1EM7A 2NTTA 2YEPB 4KV2A 4ICUA 4RM8A 4OZBA 4E3CA 1DOIA 3Q3OC 3CWIA 2KQSA 1WE7A 3RZFA 2KMAA 3ZRFA 3ZXVA 3TMPB 1TKGA 3QARA 1JWSD 4URKA 3TSSA 1WGHA 1WXVA 4RF0A 4E71A 3DBSA 3T9LA 1HZ5A 2NPTB 3I3TB 3W1SC 1WY8A 4NY0A 2W3RA 1JW9D 3ZTDA 1IBXA 4RFBA 5E6OA 1N5WA 2KFKB 5BYSA 3AEDB 3B2FA 3ZIMA 2K9XA 4LTUA 2AQ3B 1YNTE 2WHIA 1WZ0A 1D4BA 3X23A 4IC7B 3O65B 4CHKA 1UF0A 3P2BA 4YTNB 3ZRCA 2RSUA 4K1RB 4BBNF 1YX6B 2WS3B 3Q3MC 2L8JA 2YVCA 1ISNA 4IM2A 2JYTA 5TR5A 3CMMB 4BOSC 1UH6A 2FBWB 4M0WA 3IVFA 3PT2B 3FILA 2KC2A 4BKTA 1TIFA 3R2IA 2NBVB 4ZHPA 1YN4A 4DK5A 2N9EB 3P63A 3APCA 1L0XB 3AE5B 2WDTB 3L17A 4M8MA 3IAM1 3TUOA 4ANUA 1V8CA 2JX5A 2PLPA 3B2GA 3D32A 3RNAC 3M95A 4DDID 1C79A 3PS6A 3L10B 2M0AA 3PGEA 4KSKC 2WXJA 3AEBB 2G9HD 2WXMA 2KYWA 3NVYA 2N7JA 2V1YA 1QILA 2K39A 4IM3A 1JQ4A 2REXA 1SB3C 2G4DB 1XXGA 3EHVA 4A6QA 4ARCA 1YQ4B 4KIKB 1SIJA 3AULA 3S2AA 1RFKA 2Y3AA 5EE3A 4GDLA 2DAJA 2C5LC 4DDGD 2KVZA 2BWES 1QLBB 2KANA 5IN7A 3QA8A 3LJ3A 4JE3B 1PDXA 4WQMA 3R7RA 3WCQA 1WGRA 3Q3NC 4FULA 2WDQB 2QSDA 3FKYA 1JRPA 2MHJA 1NI2A 2B76B 3KUZA 4IWOA 4EE2A 4DHZB 3B1LX 5DPTA 2LD9A 4AOFA 2QC8A 1JWMD 4TUUA 2PJHA 3EFCA 5IKCM 3AN1A 3PLVA 3AE8B 2O2VB 4TV3A 3UINB 3EGRA 2XK5A 3ML9A 4P7IA 1RYJA 3PTFC 3TEYA 2HDEA 1G6JA 1WH3A 2XEWA 3RNGC 3KVFB 1TY0A 2KZRA 4GOCA 3VUYA 1H8CA 4B0MA 4OW0A 2LGXA 4GMVA 5FR3A 3ZGZA 4D2KA 1U4AA 1WSPA 2M8SA 2ONQA 3LXFA 4HROA 4US8A 4MELA 2WNMA 3PV1A 2ZEQA 2MP2B 2X38A 2KQ4X 1XQQA 3N32A 4KGTA 5CHFA 2L3ZA 1XD3B 2WXPA 2AWTA 4KSLC 2CHZA 4A20A 3W2DA 4IDIA 2VH1A 1TBEA 5J2RA 4I6LB 1EU4A 4YSYB 1XT9B 3HRDD 5AUKA 5HFYA 2DBYA 3B0AA 1TTNA 3SFDB 2WXRA 1HXYD 1XF5L 1J7BA 2BB6A 3AEFB 1QKZA 2R2OA 2RGFA 4H2AA 2DZKA 2L7RA 3BVGA 1Z5SB 3GOEA 2L0FA 3TEWA 1EF5A 2PEAA 1FMAD 2V9HA 3MHSD 2DWQA 3AE1B 4GDKA 3RCZA 2WXHA 2N9LA 2JRIB 4LJPB 4A3PA 1ENFA 1Z2MA 3QQ8B 2Y5PA 4GIVA 4MACA 2JZ3B 4B0EA 3Q3FA 4WJQA 2JF5A 3NS1A 2JPHA 4HDOA 2EELA 2INDC 2HTME 3I5JC 2Z8LA 2BF8B 4USAA 2D3BA 2K1FA 1V81A 4G3XB 2NTSA 2JXXA 3LYYA 5HI1A 4A90A 1HEZE 1ZUD2 2RDHA 1M4VA 1WGDA 3R66C 3CSFA 4ZRJA 3RD2A 2V4LA 2IO0B 5C1ZA 3C0RB 5EE0A 4LNOA 1FNVA 5BYRA 1F1HA 3NHEB 2WYQA 3V60A 1C76A 4B9KA 5G5HA 3MTNB 2BS3B 3GE3C 1ZPSA 2ZW1A 1GUAB 2LJ5A 1XCQL 3L54A 5LXHA 2K6DB 3A9JA 2ZPNA 3BIID 2IPKD 2PIAA 3UGBB 1PGAA 3H9DA 2I1JA 1WXAA 4KZCA 4M8NA 4KDLB 2K22A 2JXTA 2KDEB 3DWMA 1WXQA 4W9CA 2LRUA 3PZ7A 1HZ6A 1A5RA 2MEKA 2CJNA 4DQOC 3RFZB 1YN3A 3RT3B 2H89B 1SJHD 2MJEA 1I7HA 4A55A 1RM6C 4XYCA 3ZTCA 1E7UA 1KF6B 2N1WA 3QHTA 3DVGY 4JL9A 4RF1A 4EUTA 3W1YA 1C77A 5J18A 2N7EA 1QOBA 3DHGC 3I57A 3QAQA 4II2B 1SE9A 3L13A 1WIAA 3V61A 4LNFA 3EA6A 4RGTA 1E10A 5KHQA 3L08A 1NEKB 1SE4A 3OWEB 5D6JB 4DXGA 2BTEA 1GOZA 4XC2A 2KJRA 4HJGE 5HG2A 4W9JA 1FNWA 5CX3A 2M19A 2KWCA 1D3ZA 1V9JA 1D6EC 3KWLA 4PS3A 4XE0A 1HTQA 2WXNA 4KX6B 2D11A 4WJOA 1FO4A 3BVZA 2LUEA 4NAWB 1WGYA 2I1KA 3NUHB 5HKHA 2R61A 2BQQA 3HHMA 2QHOA 2LGIA 4N9F4 2BVCA 3APFA 3IT6B 3WAPA 1T3QA 5DPSA 2L76A 4OZAA 3V62A 1YIWA 1GAQB 3A9KB 5JZEB 1WX7A 1ZDVA 2XK5B 3KUCB 1C4AA 3NY5A 2L05A 2IJ0A 1E0ZA 1DGJA 2C7MB 1P9DU 3ZNID 4HXDA 4ZYSA 1WR1A 2J42A 2UWQA 4BKGA 4WWNA 2FUHB 4YXDB 5JHAA 2VH2A 4Q2JA 4LNIA 1T0QC 4ITKA 2KDIA 2YLMA 4K7UA 4F1SA 3DDCB 4P1BC 4YSXB 1RLFA 2RPQA 3IFWB 3KYCD 1WMHB 4IKGA 1K8RB 2M56B 3PHWB 2WX0A 2LEKA 1Y8RC 3URYA 4YT0B 2WXQA 3Q2AC 3PHXB 3Q6BA 2KD0A 2CKHB 2KTFA 4W9KA 1V1OA 4BKSD 1GNUA 3DWGC 4DHJB 2Z59B 5FKAC 3RYTA 1ZDXA 2VZKB 2GBKA 1RWSA 2KN5A 1FFUA 1L0YB 1S3SG 2OHFA 1QOAA 2LI5A 1WF9A 4YTPB 4C4VA 2ZJDA 2LFIA 4NJ7A 4HJKA 3ZJUA 1HA5A 4FADA 4XZ4A 2O6VD 2DYMA 3DQVA 1JCKB 1VDVA 1C3TA 2O6VA 1LGRA 4GDKB 1N63A 5JH5C 3NRZA 1P7FA 3CIRB 1L6VA 1WJNA 2WLBA 1VCBA 4I6NB 1Q1OA 4XWWA 1UD7A 1SIFA 2LVQA 2FCNA 2KDBA 5CHWA 1T5XD 3H7PA 2BPSA 4MJSB 4BAXA 3GP7A 3U52E 1ZGUB 2M1MA 3GB1A 4FXCA 1V5OA 2OJWA 3BK2A 3KWVA 2BKFA 3ZNHB 2ACZB 3ABVB 4RNAA 2RR9A 2D3GA 2JSVX 5KHOA 3PSEB 3A33B 1SSNA 2C7NB 2L0TA 3SFEB 4WIPA 1V1PA 2CR5A 2KTRA 2CHWA 2J0JA 5D7GA 1KRHA 1NBFC 2IYDB 3ZQ4A 3E56A 3AV8A 1JROA 2N9PC 2QILA 2WWZA 3TJPA 1EWCA 1V97A 3W5VB 3A9JB 1EUVB 3MC8A 3C8YA 2IY0B 1I4RA 1CJEA 3DBLI 3X0WA 4PK1A 3O13A 2D3AA 2QJLA 2NBUA 3V6CB 5JXVA 2EMTA 1E8ZA 3BK1A 1J7CA 3BYTB 5I4DA 2JUOA 4KVGB 4HPMB 1I42A 4MH0E 4XWTA 1Q5WB 4EKUA 2LXAA 5H92C 1DOYA 1GC6A 4LNNA 4N6EB 1KLVA 4TSSA 3AECB 2MJDA 1TZOA 4ZOHC 3ECIA 1CK1A 4L1BA 3DBLB 3AEEB 4LDTD 1L4ZB 1AN8A 2AQ2B 2D2QA 2LHDA 5E6NA 1I4HA 2KK8A 4ANWA 1VZ8A 1MHXA 4JLCA 2IZVB 2AX5A 4RH6A 4ANXA 1KOTA 1OEYJ 3UIPB 2WXFA 1T0RC 4EEWA 4HLEA 3T3NA 4WWPA 5IA7A 4EZJA 3HM6X 1S1QB 3JYUA 2MCNB 4IW0A 1DYQA 5TSSA 4REZA 1RFAA 3HK0A 4EOYA 1EO6A 3ZLZA 2J0KA 3WANA 3ZJVA 2MW5A 3NZ3A 4MH8A 1L0VB 3M62B 3ZNZB 1E7PB 2E3TA 1HE8A 1UWMA 1L6UA 4MM3A 3AEGB 3TEXA 1M94A 3SR6A 3AE4B 1ZKHA 3AE3B 4PS7A 2PKOA 4CYEA 3Q69A 2M4NA 3R8BA 3KQ4A 1IPGA 2LXCA 1TS5A 5D3IB 1BMLC 3DVNU 3ALBA 4HKZE 2I2YA 1IUEA 2BS2B 1LFDA 4PYZA 2GBMA 2OOBB 1TT5B 3ZNGC 2KO3A 3SU8X 1FXAA 2BBCA 3PVLA 3IAS1 3AI5A 3Q3JA 3AE9B 1VR9A 1BXTA 3OJ3A 2NS5A 3P4SB 4A9AA 3OJ4B 3VTVA 1FRDA 2FIFA 4LCDE 2K5PA 4ANVA 1OGWA 2BS4B 3ETRA 2DHZA 4AQ7A 4ZDVA 2BYTA 1TS4A 2JY6A 2H88B 3N1XC 1K50A 1J8CA 2LZ6A 1UBIA 3N9YC 1MFWA 2HJ8A 2KDFB 4F8CB 4IM0A 4KDIC 1SEBD 2KXJA 4W9IA 2MBQA 2G45B 3BWUD 3P4QB 1KFYB 5BMIA 3JSVA 3M3JA 2PVOD 3DHIC 2J52A 2J4XA 2SAKA 3AB5A 2N4FA 1P98A 2QDFA 1ZXHA 4ASWC 4LK0M 3I63C 4NNJB 1C4CA 4WAAA 2IGHA 4K81A 3PREA 5BMHA 1FXIA 3Q8CA 3P4RB 1FIQA 1NENB 1SGHA 5IOIA 2PVGC 4K3BA 1L4DB 4GXBA 3NS8A 3W9CB 1NYRA 4C4VB 4RMAA 1WFYA 1T6BX 2MJ3A 3H7SA 4M00A 2VZKD 4MEMA 1WI0A 2EKEC 4L23A
chains in the Genus database with same CATH topology
1NEKB 1SE4A 2AQ1B 3GS2A 3OWEB 4DXGA 2BTEA 1GOZA 2EKIA 2NMQA 2K0PA 4HJGE 5HG2A 1YJJA 1I4GA 1JWBD 2BT6A 1OFFA 1EM7A 4HEA1 1FNWA 2JZPA 2M19A 2OEDA 2NTTA 2YEPB 1TKEA 4OZBA 1Q10A 1DOIA 1K53A 1UNSA 1D6EC 3KWLA 3CWIA 1SJED 4XE0A 1MVKA 1OQQA 2WDRB 4ARIA 2WXNA 2WXKA 1B9RA 4KX6B 1JMLA 2G1EA 4R3DA 2BB5A 1C78A 1TKGA 4KKIA 1FO4A 3BVZA 3VQIA 4NAWB 2QIEB 1JWSD 1IBXB 3NUHB 2WXOA 2R61A 1LO5D 3TSSA 1PGBA 2L52A 4YSZB 4RF0A 1I4XA 1HZ5A 1CZPA 4L2YA 2LGIA 1XEEA 1GPXA 5C2TB 3ZJTA 2W3RA 1JW9D 3IT6B 4OVZA 4WURA 1IBXA 1AYFA 1T3QA 4UDUC 5FK9C 4RFBA 4OZAA 3MP9A 2Q5WD 2DYOA 4CQNA 1N5WA 1GAQB 1A70A 1JWAD 5BYSA 1ZDVA 3AEDB 1R7SA 1C4AA 3B2FA 3AEAB 2K9XA 3NVZA 2IJ0A 1E0ZA 4LTUA 1DGJA 4RGMA 1E6EB 2AQ3B 1YNTE 1EWYC 4ZYSA 2INPE 2J42A 4KGSA 1TJEA 1D4BA 2ICIA 4YXDB 2IDYA 4C80A 1STEA 4Q2JA 4YTNB 1F2RC 3NVVA 3FILB 3L4PA 4ITKA 1FCCC 2WS3B 5E6JA 2K3UA 1VZ6A 4O1NA 2V4IB 2KACA 2JYTA 4DXFA 1P7EA 1VZ7A 1YN5A 2IGDA 4YSXB 2PTLA 2KN4A 5BYQA 4N59A 4ZHOA 3PO0A 2FBWB 4M0WA 4IKGA 3FILA 4TMAB 4WAFA 1SXTA 2FUG1 1TS2A 2M56B 4IOIE 3R2IA 3U4EG 2LEKA 4ZHPA 1YN4A 1TY2A 3URYA 4YT0B 2WXQA 3P63A 1V1OA 3DWGC 4A8XC 1L0XB 3AE5B 1VJKA 3BYYB 1CQVA 3IAM1 1I4PA 5FKAC 3TUOA 1N60A 3FC4A 1ZDXA 1QQRA 1V8CA 2VZKB 2JX5A 2L1AA 2PLPA 3B2GA 3VR9B 1FNUA 1RWSA 3Q8AA 1FFUA 1L0YB 2KWDA 2OHFA 1C79A 1ROEA 4J3OD 1QOAA 2WXLA 1MI0A 2M0AA 2ZW0A 1VRAB 3U7ZA 4YTPB 5HHDG 1OQRA 2WXJA 2RPVA 1YMHE 2LFIA 3MFGA 3AE7B 3AEBB 4JPSA 1N5XA 2G9HD 3ZJUA 2WXMA 1HA5A 1XLNA 1YJIA 2PW9A 1ESFA 4GDLB 4C7ZA 1ZE3D 3NVYA 2N7JA 1QOGA 3ZYYX 1K51A 2DYMA 1EU3A 1QILA 1JCKB 1VDVA 4LLGM 1JQ4A 2WU2B 4GLSC 1SB3C 1XXGA 1D5ZC 4A6QA 1C9FA 4GDKB 1N63A 5BMGA 1YQ4B 4ARCA 3AH7A 2I38A 1SIJA 2GB1A 5EE1A 5GXGB 3NRZA 2V3NA 1KLUD 1P7FA 1RFKA 2Y3AA 3CIRB 1L6VA 5EE3A 2WLBA 2N9KA 1SF0A 4XWWA 1F0ZA 3Q8BA 1J7AA 1IGCA 2JWUA 1QLBB 2DLBA 1T5XD 4JE3B 3FAHA 1PDXA 1FRRA 4WQMA 3WCQA 3GP7A 3U52E 1YQ3B 3MC0B 2FE8A 1D5XC 3GB1A 2WDQB 2QSDA 3IXSA 3VR8B 4FXCA 1JRPA 2B76B 4P16A 3BK2A 3KWVA 4EE2A 1QF6A 3V3XA 1D5MC 1V1PB 2CU3A 2ACZB 3ABVB 2SEBD 5EE9A 4RNAA 1WGKA 1JWMD 1UWXA 2JSVX 1AW7A 2J53A 4KGRA 1PFDA 2WU5B 2RDGA 4XDDA 1SSNA 4YTMB 3SFEB 1ZP0B 4WIPA 3AM9A 1V1PA 3AN1A 3HVZA 3AE8B 2BW2A 2WP9B 5D7GA 1KRHA 2TSSA 3E9SA 2MH7A 4ZRPA 3ZQ4A 2GI9A 3E56A 3EGRA 3AV8A 1JROA 1RYJA 2QILA 3W5VB 1EWCA 1V97A 4PT5A 1TKYA 2KDMA 3TEYA 2HDEA 1UGJA 4JWSC 4NJCA 1HQRD 1XCTL 2N0SB 3C8YA 1I4RA 1CJEA 3UI3A 1N62A 2LJIA 1SE2A 3O13A 1TY0A 2QJLA 2JQRB 5JXVA 1L5PA 2L83A 5MPOA 4B0MA 4OW0A 5FR3A 3BK1A 3Q8FA 1J7CA 1TYGB 1I4QA 1ZXIA 3BYTB 3ZGZA 4D2KA 5I4DA 3J9CA 2JU6X 4KKJA 1E9MA 2E6XA 1WSPA 4XWTA 2ONQA 2Y5CA 2CJOA 5H92C 3LXFA 1DOYA 4N6EB 4HROA 4US8A 2WNMA 4TSSA 3AECB 3W5UB 2MJDA 1TZOA 2X38A 2KQ4X 3VRBB 4ZOHC 1CK1A 1N61A 3RPFC 4L1BA 4KGTA 3AEEB 2GRIA 2ON8A 1L4ZB 1AN8A 2AQ2B 1WYGA 4JWUC 2LHDA 1ET9A 4P6VF 1I4HA 1VZ8A 3BVMA 1MHXA 2WXPA 5C3JB 2AX5A 4RH6A 2IGGA 1SE3A 2WXFA 3T3NA 1C4PA 3MJ5A 4ZRQA 1PYWD 3W2DA 4IDIA 1DYQA 5TSSA 4REZA 1EU4A 2LUMA 1XLQA 4YSYB 3HRDD 4MM3B 5AUKA 1FFVA 3PZ8A 1UUPA 5HFYA 2DBYA 1DOXA 3SFDB 2WXRA 3ZJVA 1HXYD 1XF5L 1J7BA 3HVDA 2BB6A 3NZ3A 4MH8A 1L0VB 3AEFB 1QKZA 2WXGA 4H2AA 1JALA 3H8HA 1F77A 1E7PB 1TS3A 2E3TA 3BVGA 3SEBA 2WQYB 4OHJA 1UWMA 2XN9C 4RCOA 3TEWA 1FMAD 1L6UA 1QOFA 1NVID 2DWQA 3AE1B 3AEGB 2WXHA 4N58A 3TEXA 1KH0A 3SR6A 2N9LA 3AE4B 2V3PA 3AE3B 1ZOYB 2PKOA 1ENFA 2W54A 3AE2B 1IGDA 3Q69A 4MT5A 2PMVA 3R8BA 1VLBA 3BZDB 3KQ4A 4US9A 2Y5PA 4MACA 4B0EA 1TS5A 1QT9A 5D3IB 1MPEA 1BMLC 3NS1A 4HKZE 2I2YA 1ACCA 1IUEA 5LNK1 2BS2B 2EELA 2HTME 4HKQA 2W82A 2Z8LA 3AE6B 1NI3A 1FXAA 2BBCA 2JYEA 4USAA 3I9V1 3U2SC 1KLGD 3IAS1 5T8IA 2NTSA 3LYYA 3AE9B 3VRAB 1VR9A 1BXTA 3MHZA 5HI1A 4A90A 2LMCA 1HEZE 1ZUD2 2KAJA 2RDHA 1M4VA 3AMZA 2KMMA 3IT4B 3P4SB 4A9AA 1NYQA 1XLOA 1B1ZA 2WXIA 1FRDA 5EE0A 4C56C 5BYRA 1FNVA 2K5PA 1C76A 4JX1C 2BS4B 3ETRA 4AQ7A 2BYTA 3R2TA 1WRIA 2XNAC 1TS4A 2YEPF 2H88B 2D5GA 1AWDA 1K50A 1MHHE 1BUIC 5G5GA 3B9JA 5G5HA 1K52A 2L32A 2BS3B 1FCLA 4NAMA 3N9YC 1ZPSA 2ZW1A 4TQ1A 2V0GA 1XCQL 4XDCA 3V05A 1WWTA 2W3SA 1SEBD 5AUIA 4TQ0A 3P1MA 3BWUD 1ET6A 2IPKD 2PIAA 1SBBB 2WDVB 3BIID 3P4QB 1PGAA 4YWGG 3TEZA 1KFYB 5BMIA 1KTKA 2PVOD 2W55A 1GB1A 2J52A 2J4XA 2SAKA 3AB5A 4C7YA 2INNE 2K22A 4AS1A 1FEHA 2JXTA 1PUTA 1ZXHA 3P42A 5D3DA 3DWMA 3LB8C 1WXQA 3P4PB 1F2RI 1HZ6A 3PZ7A 3NVWA 4RGOS 4HRSA 4WWMA 2MEKA 2CJNA 1PGXA 4DQOC 3RFZB 1YN3A 2H89B 1SJHD 2MJEA 3HUIA 2LHEA 4LK0M 3T3OA 1I7HA 4A55A 4WH4A 5H8YE 1Y56A 1FD6A 1RM6C 1C4CA 2IGHA 1KF6B 5BMHA 1FXIA 4RF1A 3Q8CA 3P4RB 1C77A 1FIQA 1NENB 1XLPA 3W1SA 4NZLB 2PVGC 1QOBA 3I57A 2RMMA 1L4DB 1FM0D 3Q8EA 3W9CB 1NYRA 2QMTA 1JWUD 1T6BX 1XO3A 2MJ3A 2QEJC 3EUB2 4RGNA 3EA6A 4RGTA 2VZKD 1E10A 3KLSX 4L23A 4OZCA 1GB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YT0 B;  1NEK B;  1QT9 A;  3P63 A;  3AV8 A;  1JRO A;  1RYJ A;  3NS1 A;  3W5V B;  4ZHO A;  1V97 A;  1IUE A;  2EKI A;  2BS2 B;  3DWG C;  1TKY A;  2HTM E;  3AE5 B;  1YJJ A;  4JWS C;  1VJK A;  1JWB D;  2N0S B;  3AE6 B;  1NI3 A;  2BT6 A;  1CJE A;  1OFF A;  1FXA A;  1N62 A;  4USA A;  1N60 A;  2M19 A;  3FC4 A;  1TKE A;  2QJL A;  1V8C A;  1DOI A;  2JQR B;  2JX5 A;  3B2G A;  3VRA B;  3AE9 B;  3VR9 B;  3KWL A;  1L5P A;  3CWI A;  1RWS A;  2L83 A;  1FFU A;  1ZUD 2;  2KAJ A;  3AMZ A;  5MPO A;  2KMM A;  1OQQ A;  3P4S B;  2WDR B;  4A9A A;  1NYQ A;  1XLO A;  2OHF A;  1J7C A;  1ROE A;  1TYG B;  1FRD A;  1ZXI A;  5EE0 A;  1QOA A;  1B9R A;  4KX6 B;  2K5P A;  2G1E A;  4JX1 C;  2BS4 B;  3ETR A;  1E9M A;  1WRI A;  1TKG A;  1OQR A;  4YTP B;  1FO4 A;  2H88 B;  2QIE B;  1AWD A;  3AE7 B;  3AEB B;  5G5G A;  3B9J A;  5G5H A;  1N5X A;  2BS3 B;  2Y5C A;  2CJO A;  5H92 C;  2L52 A;  3LXF A;  1XLN A;  1YJI A;  4N6E B;  4HRO A;  4C7Z A;  4YSZ B;  4US8 A;  1DOY A;  3AEC B;  3NVY A;  1QOG A;  3ZYY X;  1CZP A;  3W5U B;  2MJD A;  4ITK A;  1WWT A;  2W3S A;  3VRB B;  1VDV A;  4ZOH C;  1N61 A;  1JQ4 A;  2WU2 B;  5AUI A;  3RPF C;  1GPX A;  5C2T B;  1SB3 C;  3P1M A;  3AEE B;  2PIA A;  2W3R A;  1JW9 D;  2WDV B;  3BII D;  3P4Q B;  1N63 A;  1YQ4 B;  1KFY B;  3AH7 A;  1T3Q A;  1AYF A;  1SIJ A;  5EE1 A;  1WYG A;  2PVO D;  2W55 A;  3NRZ A;  4JWU C;  5GXG B;  4P6V F;  1RFK A;  3CIR B;  1L6V A;  5EE3 A;  2WLB A;  3AB5 A;  4C7Y A;  1SF0 A;  2K22 A;  2Q5W D;  5C3J B;  1N5W A;  1PUT A;  1GAQ B;  2AX5 A;  1F0Z A;  1J7A A;  1A70 A;  1JWA D;  1QLB B;  3DWM A;  3AED B;  3LB8 C;  1R7S A;  3B2F A;  1WXQ A;  3AEA B;  3P4P B;  2K9X A;  3FAH A;  1PDX A;  1FRR A;  3NVZ A;  3NVW A;  4WQM A;  1E0Z A;  4HRS A;  3WCQ A;  4LTU A;  4WWM A;  1YQ3 B;  4IDI A;  1DGJ A;  2CJN A;  1E6E B;  2WDQ B;  2H89 B;  2MJE A;  1EWY C;  3HUI A;  3VR8 B;  4FXC A;  1JRP A;  1I7H A;  1XLQ A;  4YSY B;  1TJE A;  3HRD D;  4ZHP A;  5AUK A;  1FFV A;  5H8Y E;  1RM6 C;  2B76 B;  4YXD B;  2DBY A;  1DOX A;  3SFD B;  4C80 A;  1QF6 A;  1KF6 B;  1J7B A;  1FXI A;  2CU3 A;  4YTN B;  1L0V B;  3NVV A;  3AEF B;  2ACZ B;  3ABV B;  5EE9 A;  1JAL A;  1WGK A;  3L4P A;  3P4R B;  1FIQ A;  1E7P B;  1NEN B;  1XLP A;  2E3T A;  2WS3 B;  2PVG C;  1QOB A;  2WQY B;  1UWM A;  1FMA D;  1L6U A;  1QOF A;  1PFD A;  1FM0 D;  2WU5 B;  4YSX B;  3W9C B;  1NVI D;  1NYR A;  2DWQ A;  3AE1 B;  3AEG B;  4N59 A;  4N58 A;  3PO0 A;  3SFE B;  1ZP0 B;  2FBW B;  3AE4 B;  3SR6 A;  4YTM B;  3AE3 B;  1ZOY B;  1XO3 A;  2PKO A;  2W54 A;  2MJ3 A;  3AE2 B;  3AM9 A;  3EUB 2;  3AN1 A;  3HVZ A;  2M56 B;  3AE8 B;  2WP9 B;  1VLB A;  4US9 A;  1E10 A;  2LEK A;  1KRH A;  2MH7 A; 
#chains in the Genus database with same CATH topology
 2AQ1 B;  4X57 B;  4HVB A;  1FPY A;  3VXW A;  1NDD A;  1OFF A;  4HEA 1;  2JZP A;  2OED A;  4WQO B;  3VUX A;  1TKE A;  1E5W A;  1K53 A;  1UNS A;  3TBL D;  1YD8 U;  1OQQ A;  2WGS A;  4ARI A;  1F9J A;  2WXK A;  3PPA A;  4CO7 A;  1R4M I;  2G1E A;  4R3D A;  2BB5 A;  3VFK A;  1C78 A;  2K8B A;  4KKI A;  2QIE B;  1RRB A;  1IBX B;  2WXO A;  2MSE D;  1MG8 A;  1LO5 D;  2IY1 B;  2L52 A;  1I4X A;  3A4S C;  1KM7 A;  1XEE A;  1GC7 A;  1GPX A;  5C2T B;  4AUQ C;  3DHH C;  4WUR A;  1AYF A;  1P0R A;  4ICV A;  4W9G A;  3JW0 X;  2Q5W D;  2DYO A;  4CQN A;  3NOB A;  2NPT A;  2MLB A;  1P1A A;  3APD A;  3MJW A;  4HCN B;  1R4M B;  3ONS A;  1AAR A;  2QCZ A;  1EWY C;  2INP E;  2FCS A;  4AJW A;  4DXA B;  2VRR B;  2ICI A;  2KFK A;  3PZD A;  3V6E B;  4C80 A;  2HE7 A;  1STE A;  4M0W B;  1F2R C;  3NVV A;  3FIL B;  3L4P A;  1FCC C;  5E6J A;  2K3U A;  4O1N A;  2AL3 A;  4FJV B;  2PTL A;  3ZDM C;  2KMC A;  3RMK C;  4ZHO A;  5IAA C;  2FNJ B;  3HM3 A;  4IWQ A;  3IHP C;  4MGY E;  2FCM A;  4WAF A;  1SXT A;  2LGY A;  2FUG 1;  3VTW A;  4IOI E;  3U4E G;  1VD2 A;  3AU5 A;  3NZS A;  3SDL C;  1V86 A;  1P3Q U;  2KNB A;  1VJK A;  3BYY B;  4EZL A;  1CQV A;  3RNB C;  3OG5 A;  3FC4 A;  1QQR A;  4JIO U;  2L1A A;  2XBB C;  3VR9 B;  1FNU A;  3Q8A A;  4S0R A;  2KWD A;  2GOW A;  4MSM B;  1ROE A;  4J3O D;  2J7Q B;  1MI0 A;  2ZW0 A;  2N7D A;  3U7Z A;  1GG3 A;  5HHD G;  1OQR A;  2C7H A;  4FA6 A;  4QAY A;  1YMH E;  3MFG A;  4JPS A;  3AE7 B;  1N5X A;  1N6Z A;  1XLN A;  4GDL B;  1V5T A;  1ZE3 D;  3ZYY X;  1QOG A;  3M63 B;  4LLG M;  1R4N I;  4GLS C;  2DAF A;  1D5Z C;  3NJT A;  3H1U A;  5BMG A;  2GBJ A;  3AH7 A;  3KW5 B;  4YL8 A;  2BYV E;  4LNK A;  2N1V A;  3IBE A;  1F0Z A;  2JWU A;  1UGM A;  2DLB A;  3FAH A;  1FRR A;  3AXC A;  4KIK A;  3CF6 E;  1D5X C;  3GZN I;  1WM3 A;  1V80 A;  1WXM A;  3IXS A;  2NR2 A;  3TL5 A;  1L2N A;  4P16 A;  4MSQ B;  3KUD B;  1QF6 A;  1D5M C;  2CU3 A;  2HD5 B;  3N30 A;  4W9L A;  4FJY A;  1R4N B;  1UWX A;  4IWP A;  2KC1 A;  2JZZ A;  2WU5 B;  4XDD A;  4YTM B;  1ZP0 B;  4GU2 A;  3HVZ A;  2X8X X;  4B6W A;  2WP9 B;  1YOV B;  3A1Q A;  3E9S A;  2MH7 A;  1J19 A;  2DX5 B;  4JQW C;  2GI9 A;  3GZN B;  2G4S A;  4FLH A;  3VAW A;  4PT5 A;  1TKY A;  2KDM A;  4JWS C;  2MX2 A;  4NJC A;  1HQR D;  2N0S B;  1PQS A;  2PPH A;  1N62 A;  3GE8 C;  2LJI A;  3VH4 B;  2O2V A;  4ZRI A;  2JQR B;  1L5P A;  2NBW B;  1H4R A;  1WYW B;  5MPO A;  2D07 B;  2BGF A;  4ZYN A;  4B95 A;  1TYG B;  1I4Q A;  1ZXI A;  3ZXR A;  5G55 A;  4GB9 A;  2JU6 X;  2LVP A;  2E6X A;  4S17 A;  3PRZ A;  4NJ6 A;  1OEY A;  2CJO A;  4BKS A;  2LWP A;  3EC8 A;  3VRB B;  1N61 A;  3RPF C;  4HPP A;  1BT0 A;  2GRI A;  4JWU C;  3AU4 A;  4P6V F;  3OAW A;  3QK0 A;  3ZVV A;  3BVM A;  4DHZ E;  3WAM A;  1SE3 A;  2MP2 A;  4K7W A;  3RI7 C;  4W9H A;  1PYW D;  3U30 A;  3VH3 B;  5JHB A;  1E8Y A;  1XLQ A;  4W9F A;  1FFV A;  1UUP A;  4TKN A;  3K9P B;  5C23 A;  4XGA B;  1JAL A;  1F77 A;  4WJP A;  3SEB A;  2WQY B;  1TGZ B;  2WX1 A;  4IUM B;  4OHJ A;  4RCO A;  2HTH A;  1NVI D;  1KH0 A;  4K3C A;  2V3P A;  1ZOY B;  2Y5B B;  3SHQ A;  3AE2 B;  4G50 A;  4DBG A;  1IGD A;  2C60 A;  1MJD A;  4MT5 A;  3DPD A;  2MBH A;  2PMV A;  1VLB A;  1HTO A;  1RAX A;  4HKQ A;  2K25 A;  3QC8 B;  3VTU A;  1E7V A;  1OTR B;  3RNC C;  3AE6 B;  1NI3 A;  3U2S C;  1KLG D;  5D2M B;  3BY4 B;  2K6Q A;  1EF1 A;  3MHZ A;  3DVN V;  3AMZ A;  2KMM A;  1B1Z A;  4FJZ A;  2KJ6 A;  4C56 C;  1E8X A;  4JX1 C;  1WRI A;  2XNA C;  1WJU A;  2YEP F;  1AWD A;  3ENE A;  5G5G A;  4C00 A;  2ZZP B;  2V0G A;  1WXS A;  2AEH A;  4XDC A;  3V05 A;  2K8C A;  1MG4 A;  3P1M A;  3C19 A;  1ET6 A;  1SBB B;  2KOX A;  4YWG G;  3TEZ A;  1KTK A;  2W55 A;  4WJN A;  5AZF A;  3BIN A;  2NCN A;  2G3Q B;  3LB8 C;  2LGS A;  3KYD D;  4HRS A;  4WWM A;  1PGX A;  4XX5 A;  3HUI A;  3WAO A;  5H8Y E;  1FD6 A;  3ZKJ C;  3DCG A;  4BOZ B;  3RUI B;  2R2Q A;  2MBE A;  1V49 A;  4BVU C;  3TIX A;  5DPR A;  1LM8 B;  4NZL B;  2RMM A;  2ZNV C;  1FM0 D;  2Z0E B;  1J0G A;  1XO3 A;  2QEJ C;  3EUB 2;  2B3A A;  2GBN A;  1T0Y A;  1GB4 A;  4ZRK A;  3GS2 A;  2K0P A;  2KLG A;  1YJJ A;  1I4G A;  1WJ4 A;  1Q10 A;  2A4Z A;  4HK2 A;  4M01 A;  4HCP B;  1SJE D;  3TCA A;  1WGG A;  1MVK A;  3DBR I;  4NPN A;  2WDR B;  2RDB C;  4FN2 A;  2ZCC A;  3RN9 C;  1B9R A;  1JML A;  2KQ7 A;  5G2N A;  3VQI A;  3EFU A;  4OVU A;  2M17 A;  4FHK A;  1PGB A;  4YSZ B;  1QZE A;  1CZP A;  3EEC A;  5IO9 A;  4L2Y A;  3JVZ X;  3R7Q A;  3ZJT A;  4NAW A;  3OLM D;  4OVZ A;  5DCN A;  3SD5 A;  3PLU A;  2FAZ A;  4UDU C;  2MRP A;  5FK9 C;  4AP4 C;  3MP9 A;  3A1Q B;  2JVC A;  3DBR B;  1A70 A;  1JWA D;  1R7S A;  3AEA B;  3RUL A;  3NVZ A;  4K7S A;  4RGM A;  4G11 A;  1E6E B;  2JWZ A;  2D10 A;  4KGS A;  4II3 B;  1TJE A;  3A9K A;  4WWO A;  2IDY A;  5LLI A;  2UU7 A;  1WJ6 A;  3UIO B;  1VZ6 A;  5DPW A;  2V4I B;  1UZX B;  2KAC A;  4DXF A;  1P7E A;  1VZ7 A;  3Q14 C;  1YN5 A;  2IGD A;  4I6P A;  2AL6 A;  2KN4 A;  2M0X A;  4N59 A;  5BYQ A;  2KHW B;  3PO0 A;  1FXT B;  3QCA A;  2INC C;  1KJT A;  4TMA B;  1TS2 A;  5GMV A;  3QX1 A;  4G0N B;  2W9N A;  1TY2 A;  2ZVN A;  5J17 A;  3N3K B;  2KWV B;  3VVW B;  4E74 A;  4A8X C;  1WMH A;  3RNF C;  2BWF A;  2V3S A;  1I4P A;  2AYO B;  1N60 A;  4W9D A;  4DHJ D;  3ZUN A;  2BYE A;  2JT4 B;  2KKC A;  3U8Z A;  2N9X A;  2DNF A;  4MDK E;  2WXL A;  1VRA B;  3ML8 A;  4ACF A;  5E6P A;  2O6V B;  2RPV A;  4FHJ A;  3WA0 A;  2IO3 B;  1GJZ A;  3A4R A;  1YJI A;  2PW9 A;  4C7Z A;  1ESF A;  1K51 A;  3N20 C;  4NQL B;  1EU3 A;  2ASQ A;  2WU2 B;  2GBR A;  2OJR A;  3H7P B;  1C9F A;  2I38 A;  5EE1 A;  2GB1 A;  5GXG B;  3UF8 A;  2V3N A;  1KLU D;  3PRP B;  4DWF A;  2N9K A;  1SF0 A;  3Q8B A;  1J7A A;  1IGC A;  2JRH A;  2CHX A;  4LJO B;  1YQ3 B;  3MC0 B;  5CTR C;  2FE8 A;  1E90 A;  2BYF A;  1LQB A;  3VR8 B;  2DYB A;  3HIZ A;  5D94 A;  1Q0W B;  3B08 A;  3V3X A;  1V1P B;  4MGI E;  4MJS A;  4JGH B;  2SEB D;  5EE9 A;  2KTR B;  2KWU B;  1WGK A;  2RD0 A;  2ZNV B;  3K9O B;  4W9E A;  3WAL A;  2FID A;  1AW7 A;  2J53 A;  4KGR A;  1PFD A;  2RDG A;  1UEL A;  2DEN B;  3QIJ A;  3AM9 A;  4MGK E;  1WZ3 A;  2BW2 A;  3QJZ A;  4ZRP A;  2TSS A;  4M02 A;  3NZU A;  1UGJ A;  1ZW7 A;  1XCT L;  2GLS A;  1V2Y A;  3UI3 A;  1SE2 A;  2IO1 B;  3L16 A;  2ZPY A;  2L83 A;  4EFO A;  3QWZ B;  5L95 C;  3Q8F A;  4IG7 B;  2CU1 A;  2L00 B;  4GN1 A;  3J9C A;  4BZA A;  4HWI B;  4KKJ A;  1E9M A;  1WR6 E;  4GGQ A;  3ZW3 A;  4F7Z A;  2Y5C A;  5AZH A;  2DZJ A;  4LDT B;  3W5U B;  4P1C C;  2FCQ A;  4BBN C;  2CS4 A;  3ZO5 B;  2J0M A;  2ON8 A;  3VDZ A;  2ZCB A;  1WYG A;  4KZ0 A;  1ET9 A;  3RZW C;  5IP4 D;  3RNE C;  2A5U A;  4AWJ A;  5C3J B;  1WRD B;  2IGG A;  5AZG A;  2GMI C;  5CHV C;  1C4P A;  3MJ5 A;  4ZRQ A;  3DBH I;  1L7Y A;  3IG3 A;  1UBQ A;  3NG0 A;  4PYU A;  1YX5 B;  2KX0 A;  2LUM A;  2C9W B;  3DVG X;  4MM3 B;  1CMX B;  3PZ8 A;  3T8M A;  1DOX A;  2PE6 B;  2LVO A;  3HVD A;  2WXG A;  3N1Z C;  3H8H A;  1TS3 A;  1I35 A;  2BKR B;  2KFJ A;  2XN9 C;  2HJ1 A;  1QOF A;  3UQA A;  4N58 A;  2W54 A;  4GSW A;  3MC9 A;  2IO2 B;  4HDQ A;  3BZD B;  2D3C A;  4US9 A;  1TZ1 A;  3DBH B;  1QT9 A;  4AJY B;  1MPE A;  5BO4 B;  2NVU I;  4PS8 A;  1ACC A;  3R3M A;  2IBI B;  5LNK 1;  4J6I A;  2W82 A;  2KT7 A;  3PRM B;  3DOW A;  2MA9 B;  2JYE A;  2LAS A;  3I9V 1;  5T8I A;  3VRA B;  2LMC A;  3VHT C;  5L83 A;  2KAJ A;  2PE9 A;  3IT4 B;  1YJ1 A;  1NYQ A;  1XLO A;  5FR6 A;  2WXI A;  2DZM A;  3U7D A;  2KVR A;  3UQB A;  5AEK B;  2MQJ A;  2UYZ B;  3R2T A;  1C1Y B;  4A3O A;  1IYF A;  2D5G A;  1MHH E;  3VUW A;  1BUI C;  5LXI B;  3B9J A;  3JSV B;  1K52 A;  2L32 A;  1FCL A;  4NAM A;  3ZDT A;  4TQ1 A;  2ZVO A;  3CST A;  1E8W A;  1WWT A;  2W3S A;  5AUI A;  4TQ0 A;  4MGZ E;  1X1M A;  4BFR A;  2WDV B;  2KLC A;  2MBO A;  1GB1 A;  4C7Y A;  2INN E;  4AS1 A;  1FEH A;  1PUT A;  3P42 A;  5D3D A;  2KJH B;  1YQB A;  3P4P B;  1F2R I;  3NVW A;  4RGO S;  4OVV A;  1WE6 A;  2LHE A;  3T3O A;  4WH4 A;  3H6N A;  1Y56 A;  1WX8 A;  3LDZ E;  1V6E A;  4NQK E;  3L0W B;  5EDS A;  1XLP A;  1WX9 A;  2Z0D B;  3W1S A;  2LGD A;  3N1Y C;  1IP9 A;  2MWS B;  1LXD A;  3Q8E A;  1T0S C;  2DZI A;  3WIM A;  2QMT A;  2LRW A;  1OQY A;  3KH0 A;  1JWU D;  4HPL B;  2EMS A;  4RGN A;  1WM2 A;  4FBJ B;  1F52 A;  3KLS X;  4RM9 A;  4OZC A;  2KX3 A;  2EKI A;  1JRU A;  2K8H A;  2NMQ A;  4EZK A;  2MBB B;  1JWB D;  2BT6 A;  1EM7 A;  2NTT A;  2YEP B;  4KV2 A;  4ICU A;  4RM8 A;  4OZB A;  4E3C A;  1DOI A;  3Q3O C;  3CWI A;  2KQS A;  1WE7 A;  3RZF A;  2KMA A;  3ZRF A;  3ZXV A;  3TMP B;  1TKG A;  3QAR A;  1JWS D;  4URK A;  3TSS A;  1WGH A;  1WXV A;  4RF0 A;  4E71 A;  3DBS A;  3T9L A;  1HZ5 A;  2NPT B;  3I3T B;  3W1S C;  1WY8 A;  4NY0 A;  2W3R A;  1JW9 D;  3ZTD A;  1IBX A;  4RFB A;  5E6O A;  1N5W A;  2KFK B;  5BYS A;  3AED B;  3B2F A;  3ZIM A;  2K9X A;  4LTU A;  2AQ3 B;  1YNT E;  2WHI A;  1WZ0 A;  1D4B A;  3X23 A;  4IC7 B;  3O65 B;  4CHK A;  1UF0 A;  3P2B A;  4YTN B;  3ZRC A;  2RSU A;  4K1R B;  4BBN F;  1YX6 B;  2WS3 B;  3Q3M C;  2L8J A;  2YVC A;  1ISN A;  4IM2 A;  2JYT A;  5TR5 A;  3CMM B;  4BOS C;  1UH6 A;  2FBW B;  4M0W A;  3IVF A;  3PT2 B;  3FIL A;  2KC2 A;  4BKT A;  1TIF A;  3R2I A;  2NBV B;  4ZHP A;  1YN4 A;  4DK5 A;  2N9E B;  3P63 A;  3APC A;  1L0X B;  3AE5 B;  2WDT B;  3L17 A;  4M8M A;  3IAM 1;  3TUO A;  4ANU A;  1V8C A;  2JX5 A;  2PLP A;  3B2G A;  3D32 A;  3RNA C;  3M95 A;  4DDI D;  1C79 A;  3PS6 A;  3L10 B;  2M0A A;  3PGE A;  4KSK C;  2WXJ A;  3AEB B;  2G9H D;  2WXM A;  2KYW A;  3NVY A;  2N7J A;  2V1Y A;  1QIL A;  2K39 A;  4IM3 A;  1JQ4 A;  2REX A;  1SB3 C;  2G4D B;  1XXG A;  3EHV A;  4A6Q A;  4ARC A;  1YQ4 B;  4KIK B;  1SIJ A;  3AUL A;  3S2A A;  1RFK A;  2Y3A A;  5EE3 A;  4GDL A;  2DAJ A;  2C5L C;  4DDG D;  2KVZ A;  2BWE S;  1QLB B;  2KAN A;  5IN7 A;  3QA8 A;  3LJ3 A;  4JE3 B;  1PDX A;  4WQM A;  3R7R A;  3WCQ A;  1WGR A;  3Q3N C;  4FUL A;  2WDQ B;  2QSD A;  3FKY A;  1JRP A;  2MHJ A;  1NI2 A;  2B76 B;  3KUZ A;  4IWO A;  4EE2 A;  4DHZ B;  3B1L X;  5DPT A;  2LD9 A;  4AOF A;  2QC8 A;  1JWM D;  4TUU A;  2PJH A;  3EFC A;  5IKC M;  3AN1 A;  3PLV A;  3AE8 B;  2O2V B;  4TV3 A;  3UIN B;  3EGR A;  2XK5 A;  3ML9 A;  4P7I A;  1RYJ A;  3PTF C;  3TEY A;  2HDE A;  1G6J A;  1WH3 A;  2XEW A;  3RNG C;  3KVF B;  1TY0 A;  2KZR A;  4GOC A;  3VUY A;  1H8C A;  4B0M A;  4OW0 A;  2LGX A;  4GMV A;  5FR3 A;  3ZGZ A;  4D2K A;  1U4A A;  1WSP A;  2M8S A;  2ONQ A;  3LXF A;  4HRO A;  4US8 A;  4MEL A;  2WNM A;  3PV1 A;  2ZEQ A;  2MP2 B;  2X38 A;  2KQ4 X;  1XQQ A;  3N32 A;  4KGT A;  5CHF A;  2L3Z A;  1XD3 B;  2WXP A;  2AWT A;  4KSL C;  2CHZ A;  4A20 A;  3W2D A;  4IDI A;  2VH1 A;  1TBE A;  5J2R A;  4I6L B;  1EU4 A;  4YSY B;  1XT9 B;  3HRD D;  5AUK A;  5HFY A;  2DBY A;  3B0A A;  1TTN A;  3SFD B;  2WXR A;  1HXY D;  1XF5 L;  1J7B A;  2BB6 A;  3AEF B;  1QKZ A;  2R2O A;  2RGF A;  4H2A A;  2DZK A;  2L7R A;  3BVG A;  1Z5S B;  3GOE A;  2L0F A;  3TEW A;  1EF5 A;  2PEA A;  1FMA D;  2V9H A;  3MHS D;  2DWQ A;  3AE1 B;  4GDK A;  3RCZ A;  2WXH A;  2N9L A;  2JRI B;  4LJP B;  4A3P A;  1ENF A;  1Z2M A;  3QQ8 B;  2Y5P A;  4GIV A;  4MAC A;  2JZ3 B;  4B0E A;  3Q3F A;  4WJQ A;  2JF5 A;  3NS1 A;  2JPH A;  4HDO A;  2EEL A;  2IND C;  2HTM E;  3I5J C;  2Z8L A;  2BF8 B;  4USA A;  2D3B A;  2K1F A;  1V81 A;  4G3X B;  2NTS A;  2JXX A;  3LYY A;  5HI1 A;  4A90 A;  1HEZ E;  1ZUD 2;  2RDH A;  1M4V A;  1WGD A;  3R66 C;  3CSF A;  4ZRJ A;  3RD2 A;  2V4L A;  2IO0 B;  5C1Z A;  3C0R B;  5EE0 A;  4LNO A;  1FNV A;  5BYR A;  1F1H A;  3NHE B;  2WYQ A;  3V60 A;  1C76 A;  4B9K A;  5G5H A;  3MTN B;  2BS3 B;  3GE3 C;  1ZPS A;  2ZW1 A;  1GUA B;  2LJ5 A;  1XCQ L;  3L54 A;  5LXH A;  2K6D B;  3A9J A;  2ZPN A;  3BII D;  2IPK D;  2PIA A;  3UGB B;  1PGA A;  3H9D A;  2I1J A;  1WXA A;  4KZC A;  4M8N A;  4KDL B;  2K22 A;  2JXT A;  2KDE B;  3DWM A;  1WXQ A;  4W9C A;  2LRU A;  3PZ7 A;  1HZ6 A;  1A5R A;  2MEK A;  2CJN A;  4DQO C;  3RFZ B;  1YN3 A;  3RT3 B;  2H89 B;  1SJH D;  2MJE A;  1I7H A;  4A55 A;  1RM6 C;  4XYC A;  3ZTC A;  1E7U A;  1KF6 B;  2N1W A;  3QHT A;  3DVG Y;  4JL9 A;  4RF1 A;  4EUT A;  3W1Y A;  1C77 A;  5J18 A;  2N7E A;  1QOB A;  3DHG C;  3I57 A;  3QAQ A;  4II2 B;  1SE9 A;  3L13 A;  1WIA A;  3V61 A;  4LNF A;  3EA6 A;  4RGT A;  1E10 A;  5KHQ A;  3L08 A;  1NEK B;  1SE4 A;  3OWE B;  5D6J B;  4DXG A;  2BTE A;  1GOZ A;  4XC2 A;  2KJR A;  4HJG E;  5HG2 A;  4W9J A;  1FNW A;  5CX3 A;  2M19 A;  2KWC A;  1D3Z A;  1V9J A;  1D6E C;  3KWL A;  4PS3 A;  4XE0 A;  1HTQ A;  2WXN A;  4KX6 B;  2D11 A;  4WJO A;  1FO4 A;  3BVZ A;  2LUE A;  4NAW B;  1WGY A;  2I1K A;  3NUH B;  5HKH A;  2R61 A;  2BQQ A;  3HHM A;  2QHO A;  2LGI A;  4N9F 4;  2BVC A;  3APF A;  3IT6 B;  3WAP A;  1T3Q A;  5DPS A;  2L76 A;  4OZA A;  3V62 A;  1YIW A;  1GAQ B;  3A9K B;  5JZE B;  1WX7 A;  1ZDV A;  2XK5 B;  3KUC B;  1C4A A;  3NY5 A;  2L05 A;  2IJ0 A;  1E0Z A;  1DGJ A;  2C7M B;  1P9D U;  3ZNI D;  4HXD A;  4ZYS A;  1WR1 A;  2J42 A;  2UWQ A;  4BKG A;  4WWN A;  2FUH B;  4YXD B;  5JHA A;  2VH2 A;  4Q2J A;  4LNI A;  1T0Q C;  4ITK A;  2KDI A;  2YLM A;  4K7U A;  4F1S A;  3DDC B;  4P1B C;  4YSX B;  1RLF A;  2RPQ A;  3IFW B;  3KYC D;  1WMH B;  4IKG A;  1K8R B;  2M56 B;  3PHW B;  2WX0 A;  2LEK A;  1Y8R C;  3URY A;  4YT0 B;  2WXQ A;  3Q2A C;  3PHX B;  3Q6B A;  2KD0 A;  2CKH B;  2KTF A;  4W9K A;  1V1O A;  4BKS D;  1GNU A;  3DWG C;  4DHJ B;  2Z59 B;  5FKA C;  3RYT A;  1ZDX A;  2VZK B;  2GBK A;  1RWS A;  2KN5 A;  1FFU A;  1L0Y B;  1S3S G;  2OHF A;  1QOA A;  2LI5 A;  1WF9 A;  4YTP B;  4C4V A;  2ZJD A;  2LFI A;  4NJ7 A;  4HJK A;  3ZJU A;  1HA5 A;  4FAD A;  4XZ4 A;  2O6V D;  2DYM A;  3DQV A;  1JCK B;  1VDV A;  1C3T A;  2O6V A;  1LGR A;  4GDK B;  1N63 A;  5JH5 C;  3NRZ A;  1P7F A;  3CIR B;  1L6V A;  1WJN A;  2WLB A;  1VCB A;  4I6N B;  1Q1O A;  4XWW A;  1UD7 A;  1SIF A;  2LVQ A;  2FCN A;  2KDB A;  5CHW A;  1T5X D;  3H7P A;  2BPS A;  4MJS B;  4BAX A;  3GP7 A;  3U52 E;  1ZGU B;  2M1M A;  3GB1 A;  4FXC A;  1V5O A;  2OJW A;  3BK2 A;  3KWV A;  2BKF A;  3ZNH B;  2ACZ B;  3ABV B;  4RNA A;  2RR9 A;  2D3G A;  2JSV X;  5KHO A;  3PSE B;  3A33 B;  1SSN A;  2C7N B;  2L0T A;  3SFE B;  4WIP A;  1V1P A;  2CR5 A;  2KTR A;  2CHW A;  2J0J A;  5D7G A;  1KRH A;  1NBF C;  2IYD B;  3ZQ4 A;  3E56 A;  3AV8 A;  1JRO A;  2N9P C;  2QIL A;  2WWZ A;  3TJP A;  1EWC A;  1V97 A;  3W5V B;  3A9J B;  1EUV B;  3MC8 A;  3C8Y A;  2IY0 B;  1I4R A;  1CJE A;  3DBL I;  3X0W A;  4PK1 A;  3O13 A;  2D3A A;  2QJL A;  2NBU A;  3V6C B;  5JXV A;  2EMT A;  1E8Z A;  3BK1 A;  1J7C A;  3BYT B;  5I4D A;  2JUO A;  4KVG B;  4HPM B;  1I42 A;  4MH0 E;  4XWT A;  1Q5W B;  4EKU A;  2LXA A;  5H92 C;  1DOY A;  1GC6 A;  4LNN A;  4N6E B;  1KLV A;  4TSS A;  3AEC B;  2MJD A;  1TZO A;  4ZOH C;  3ECI A;  1CK1 A;  4L1B A;  3DBL B;  3AEE B;  4LDT D;  1L4Z B;  1AN8 A;  2AQ2 B;  2D2Q A;  2LHD A;  5E6N A;  1I4H A;  2KK8 A;  4ANW A;  1VZ8 A;  1MHX A;  4JLC A;  2IZV B;  2AX5 A;  4RH6 A;  4ANX A;  1KOT A;  1OEY J;  3UIP B;  2WXF A;  1T0R C;  4EEW A;  4HLE A;  3T3N A;  4WWP A;  5IA7 A;  4EZJ A;  3HM6 X;  1S1Q B;  3JYU A;  2MCN B;  4IW0 A;  1DYQ A;  5TSS A;  4REZ A;  1RFA A;  3HK0 A;  4EOY A;  1EO6 A;  3ZLZ A;  2J0K A;  3WAN A;  3ZJV A;  2MW5 A;  3NZ3 A;  4MH8 A;  1L0V B;  3M62 B;  3ZNZ B;  1E7P B;  2E3T A;  1HE8 A;  1UWM A;  1L6U A;  4MM3 A;  3AEG B;  3TEX A;  1M94 A;  3SR6 A;  3AE4 B;  1ZKH A;  3AE3 B;  4PS7 A;  2PKO A;  4CYE A;  3Q69 A;  2M4N A;  3R8B A;  3KQ4 A;  1IPG A;  2LXC A;  1TS5 A;  5D3I B;  1BML C;  3DVN U;  3ALB A;  4HKZ E;  2I2Y A;  1IUE A;  2BS2 B;  1LFD A;  4PYZ A;  2GBM A;  2OOB B;  1TT5 B;  3ZNG C;  2KO3 A;  3SU8 X;  1FXA A;  2BBC A;  3PVL A;  3IAS 1;  3AI5 A;  3Q3J A;  3AE9 B;  1VR9 A;  1BXT A;  3OJ3 A;  2NS5 A;  3P4S B;  4A9A A;  3OJ4 B;  3VTV A;  1FRD A;  2FIF A;  4LCD E;  2K5P A;  4ANV A;  1OGW A;  2BS4 B;  3ETR A;  2DHZ A;  4AQ7 A;  4ZDV A;  2BYT A;  1TS4 A;  2JY6 A;  2H88 B;  3N1X C;  1K50 A;  1J8C A;  2LZ6 A;  1UBI A;  3N9Y C;  1MFW A;  2HJ8 A;  2KDF B;  4F8C B;  4IM0 A;  4KDI C;  1SEB D;  2KXJ A;  4W9I A;  2MBQ A;  2G45 B;  3BWU D;  3P4Q B;  1KFY B;  5BMI A;  3JSV A;  3M3J A;  2PVO D;  3DHI C;  2J52 A;  2J4X A;  2SAK A;  3AB5 A;  2N4F A;  1P98 A;  2QDF A;  1ZXH A;  4ASW C;  4LK0 M;  3I63 C;  4NNJ B;  1C4C A;  4WAA A;  2IGH A;  4K81 A;  3PRE A;  5BMH A;  1FXI A;  3Q8C A;  3P4R B;  1FIQ A;  1NEN B;  1SGH A;  5IOI A;  2PVG C;  4K3B A;  1L4D B;  4GXB A;  3NS8 A;  3W9C B;  1NYR A;  4C4V B;  4RMA A;  1WFY A;  1T6B X;  2MJ3 A;  3H7S A;  4M00 A;  2VZK D;  4MEM A;  1WI0 A;  2EKE C;  4L23 A; 
#chains in the Genus database with same CATH homology
 1NEK B;  1SE4 A;  2AQ1 B;  3GS2 A;  3OWE B;  4DXG A;  2BTE A;  1GOZ A;  2EKI A;  2NMQ A;  2K0P A;  4HJG E;  5HG2 A;  1YJJ A;  1I4G A;  1JWB D;  2BT6 A;  1OFF A;  1EM7 A;  4HEA 1;  1FNW A;  2JZP A;  2M19 A;  2OED A;  2NTT A;  2YEP B;  1TKE A;  4OZB A;  1Q10 A;  1DOI A;  1K53 A;  1UNS A;  1D6E C;  3KWL A;  3CWI A;  1SJE D;  4XE0 A;  1MVK A;  1OQQ A;  2WDR B;  4ARI A;  2WXN A;  2WXK A;  1B9R A;  4KX6 B;  1JML A;  2G1E A;  4R3D A;  2BB5 A;  1C78 A;  1TKG A;  4KKI A;  1FO4 A;  3BVZ A;  3VQI A;  4NAW B;  2QIE B;  1JWS D;  1IBX B;  3NUH B;  2WXO A;  2R61 A;  1LO5 D;  3TSS A;  1PGB A;  2L52 A;  4YSZ B;  4RF0 A;  1I4X A;  1HZ5 A;  1CZP A;  4L2Y A;  2LGI A;  1XEE A;  1GPX A;  5C2T B;  3ZJT A;  2W3R A;  1JW9 D;  3IT6 B;  4OVZ A;  4WUR A;  1IBX A;  1AYF A;  1T3Q A;  4UDU C;  5FK9 C;  4RFB A;  4OZA A;  3MP9 A;  2Q5W D;  2DYO A;  4CQN A;  1N5W A;  1GAQ B;  1A70 A;  1JWA D;  5BYS A;  1ZDV A;  3AED B;  1R7S A;  1C4A A;  3B2F A;  3AEA B;  2K9X A;  3NVZ A;  2IJ0 A;  1E0Z A;  4LTU A;  1DGJ A;  4RGM A;  1E6E B;  2AQ3 B;  1YNT E;  1EWY C;  4ZYS A;  2INP E;  2J42 A;  4KGS A;  1TJE A;  1D4B A;  2ICI A;  4YXD B;  2IDY A;  4C80 A;  1STE A;  4Q2J A;  4YTN B;  1F2R C;  3NVV A;  3FIL B;  3L4P A;  4ITK A;  1FCC C;  2WS3 B;  5E6J A;  2K3U A;  1VZ6 A;  4O1N A;  2V4I B;  2KAC A;  2JYT A;  4DXF A;  1P7E A;  1VZ7 A;  1YN5 A;  2IGD A;  4YSX B;  2PTL A;  2KN4 A;  5BYQ A;  4N59 A;  4ZHO A;  3PO0 A;  2FBW B;  4M0W A;  4IKG A;  3FIL A;  4TMA B;  4WAF A;  1SXT A;  2FUG 1;  1TS2 A;  2M56 B;  4IOI E;  3R2I A;  3U4E G;  2LEK A;  4ZHP A;  1YN4 A;  1TY2 A;  3URY A;  4YT0 B;  2WXQ A;  3P63 A;  1V1O A;  3DWG C;  4A8X C;  1L0X B;  3AE5 B;  1VJK A;  3BYY B;  1CQV A;  3IAM 1;  1I4P A;  5FKA C;  3TUO A;  1N60 A;  3FC4 A;  1ZDX A;  1QQR A;  1V8C A;  2VZK B;  2JX5 A;  2L1A A;  2PLP A;  3B2G A;  3VR9 B;  1FNU A;  1RWS A;  3Q8A A;  1FFU A;  1L0Y B;  2KWD A;  2OHF A;  1C79 A;  1ROE A;  4J3O D;  1QOA A;  2WXL A;  1MI0 A;  2M0A A;  2ZW0 A;  1VRA B;  3U7Z A;  4YTP B;  5HHD G;  1OQR A;  2WXJ A;  2RPV A;  1YMH E;  2LFI A;  3MFG A;  3AE7 B;  3AEB B;  4JPS A;  1N5X A;  2G9H D;  3ZJU A;  2WXM A;  1HA5 A;  1XLN A;  1YJI A;  2PW9 A;  1ESF A;  4GDL B;  4C7Z A;  1ZE3 D;  3NVY A;  2N7J A;  1QOG A;  3ZYY X;  1K51 A;  2DYM A;  1EU3 A;  1QIL A;  1JCK B;  1VDV A;  4LLG M;  1JQ4 A;  2WU2 B;  4GLS C;  1SB3 C;  1XXG A;  1D5Z C;  4A6Q A;  1C9F A;  4GDK B;  1N63 A;  5BMG A;  1YQ4 B;  4ARC A;  3AH7 A;  2I38 A;  1SIJ A;  2GB1 A;  5EE1 A;  5GXG B;  3NRZ A;  2V3N A;  1KLU D;  1P7F A;  1RFK A;  2Y3A A;  3CIR B;  1L6V A;  5EE3 A;  2WLB A;  2N9K A;  1SF0 A;  4XWW A;  1F0Z A;  3Q8B A;  1J7A A;  1IGC A;  2JWU A;  1QLB B;  2DLB A;  1T5X D;  4JE3 B;  3FAH A;  1PDX A;  1FRR A;  4WQM A;  3WCQ A;  3GP7 A;  3U52 E;  1YQ3 B;  3MC0 B;  2FE8 A;  1D5X C;  3GB1 A;  2WDQ B;  2QSD A;  3IXS A;  3VR8 B;  4FXC A;  1JRP A;  2B76 B;  4P16 A;  3BK2 A;  3KWV A;  4EE2 A;  1QF6 A;  3V3X A;  1D5M C;  1V1P B;  2CU3 A;  2ACZ B;  3ABV B;  2SEB D;  5EE9 A;  4RNA A;  1WGK A;  1JWM D;  1UWX A;  2JSV X;  1AW7 A;  2J53 A;  4KGR A;  1PFD A;  2WU5 B;  2RDG A;  4XDD A;  1SSN A;  4YTM B;  3SFE B;  1ZP0 B;  4WIP A;  3AM9 A;  1V1P A;  3AN1 A;  3HVZ A;  3AE8 B;  2BW2 A;  2WP9 B;  5D7G A;  1KRH A;  2TSS A;  3E9S A;  2MH7 A;  4ZRP A;  3ZQ4 A;  2GI9 A;  3E56 A;  3EGR A;  3AV8 A;  1JRO A;  1RYJ A;  2QIL A;  3W5V B;  1EWC A;  1V97 A;  4PT5 A;  1TKY A;  2KDM A;  3TEY A;  2HDE A;  1UGJ A;  4JWS C;  4NJC A;  1HQR D;  1XCT L;  2N0S B;  3C8Y A;  1I4R A;  1CJE A;  3UI3 A;  1N62 A;  2LJI A;  1SE2 A;  3O13 A;  1TY0 A;  2QJL A;  2JQR B;  5JXV A;  1L5P A;  2L83 A;  5MPO A;  4B0M A;  4OW0 A;  5FR3 A;  3BK1 A;  3Q8F A;  1J7C A;  1TYG B;  1I4Q A;  1ZXI A;  3BYT B;  3ZGZ A;  4D2K A;  5I4D A;  3J9C A;  2JU6 X;  4KKJ A;  1E9M A;  2E6X A;  1WSP A;  4XWT A;  2ONQ A;  2Y5C A;  2CJO A;  5H92 C;  3LXF A;  1DOY A;  4N6E B;  4HRO A;  4US8 A;  2WNM A;  4TSS A;  3AEC B;  3W5U B;  2MJD A;  1TZO A;  2X38 A;  2KQ4 X;  3VRB B;  4ZOH C;  1CK1 A;  1N61 A;  3RPF C;  4L1B A;  4KGT A;  3AEE B;  2GRI A;  2ON8 A;  1L4Z B;  1AN8 A;  2AQ2 B;  1WYG A;  4JWU C;  2LHD A;  1ET9 A;  4P6V F;  1I4H A;  1VZ8 A;  3BVM A;  1MHX A;  2WXP A;  5C3J B;  2AX5 A;  4RH6 A;  2IGG A;  1SE3 A;  2WXF A;  3T3N A;  1C4P A;  3MJ5 A;  4ZRQ A;  1PYW D;  3W2D A;  4IDI A;  1DYQ A;  5TSS A;  4REZ A;  1EU4 A;  2LUM A;  1XLQ A;  4YSY B;  3HRD D;  4MM3 B;  5AUK A;  1FFV A;  3PZ8 A;  1UUP A;  5HFY A;  2DBY A;  1DOX A;  3SFD B;  2WXR A;  3ZJV A;  1HXY D;  1XF5 L;  1J7B A;  3HVD A;  2BB6 A;  3NZ3 A;  4MH8 A;  1L0V B;  3AEF B;  1QKZ A;  2WXG A;  4H2A A;  1JAL A;  3H8H A;  1F77 A;  1E7P B;  1TS3 A;  2E3T A;  3BVG A;  3SEB A;  2WQY B;  4OHJ A;  1UWM A;  2XN9 C;  4RCO A;  3TEW A;  1FMA D;  1L6U A;  1QOF A;  1NVI D;  2DWQ A;  3AE1 B;  3AEG B;  2WXH A;  4N58 A;  3TEX A;  1KH0 A;  3SR6 A;  2N9L A;  3AE4 B;  2V3P A;  3AE3 B;  1ZOY B;  2PKO A;  1ENF A;  2W54 A;  3AE2 B;  1IGD A;  3Q69 A;  4MT5 A;  2PMV A;  3R8B A;  1VLB A;  3BZD B;  3KQ4 A;  4US9 A;  2Y5P A;  4MAC A;  4B0E A;  1TS5 A;  1QT9 A;  5D3I B;  1MPE A;  1BML C;  3NS1 A;  4HKZ E;  2I2Y A;  1ACC A;  1IUE A;  5LNK 1;  2BS2 B;  2EEL A;  2HTM E;  4HKQ A;  2W82 A;  2Z8L A;  3AE6 B;  1NI3 A;  1FXA A;  2BBC A;  2JYE A;  4USA A;  3I9V 1;  3U2S C;  1KLG D;  3IAS 1;  5T8I A;  2NTS A;  3LYY A;  3AE9 B;  3VRA B;  1VR9 A;  1BXT A;  3MHZ A;  5HI1 A;  4A90 A;  2LMC A;  1HEZ E;  1ZUD 2;  2KAJ A;  2RDH A;  1M4V A;  3AMZ A;  2KMM A;  3IT4 B;  3P4S B;  4A9A A;  1NYQ A;  1XLO A;  1B1Z A;  2WXI A;  1FRD A;  5EE0 A;  4C56 C;  5BYR A;  1FNV A;  2K5P A;  1C76 A;  4JX1 C;  2BS4 B;  3ETR A;  4AQ7 A;  2BYT A;  3R2T A;  1WRI A;  2XNA C;  1TS4 A;  2YEP F;  2H88 B;  2D5G A;  1AWD A;  1K50 A;  1MHH E;  1BUI C;  5G5G A;  3B9J A;  5G5H A;  1K52 A;  2L32 A;  2BS3 B;  1FCL A;  4NAM A;  3N9Y C;  1ZPS A;  2ZW1 A;  4TQ1 A;  2V0G A;  1XCQ L;  4XDC A;  3V05 A;  1WWT A;  2W3S A;  1SEB D;  5AUI A;  4TQ0 A;  3P1M A;  3BWU D;  1ET6 A;  2IPK D;  2PIA A;  1SBB B;  2WDV B;  3BII D;  3P4Q B;  1PGA A;  4YWG G;  3TEZ A;  1KFY B;  5BMI A;  1KTK A;  2PVO D;  2W55 A;  1GB1 A;  2J52 A;  2J4X A;  2SAK A;  3AB5 A;  4C7Y A;  2INN E;  2K22 A;  4AS1 A;  1FEH A;  2JXT A;  1PUT A;  1ZXH A;  3P42 A;  5D3D A;  3DWM A;  3LB8 C;  1WXQ A;  3P4P B;  1F2R I;  1HZ6 A;  3PZ7 A;  3NVW A;  4RGO S;  4HRS A;  4WWM A;  2MEK A;  2CJN A;  1PGX A;  4DQO C;  3RFZ B;  1YN3 A;  2H89 B;  1SJH D;  2MJE A;  3HUI A;  2LHE A;  4LK0 M;  3T3O A;  1I7H A;  4A55 A;  4WH4 A;  5H8Y E;  1Y56 A;  1FD6 A;  1RM6 C;  1C4C A;  2IGH A;  1KF6 B;  5BMH A;  1FXI A;  4RF1 A;  3Q8C A;  3P4R B;  1C77 A;  1FIQ A;  1NEN B;  1XLP A;  3W1S A;  4NZL B;  2PVG C;  1QOB A;  3I57 A;  2RMM A;  1L4D B;  1FM0 D;  3Q8E A;  3W9C B;  1NYR A;  2QMT A;  1JWU D;  1T6B X;  1XO3 A;  2MJ3 A;  2QEJ C;  3EUB 2;  4RGN A;  3EA6 A;  4RGT A;  2VZK D;  1E10 A;  3KLS X;  4L23 A;  4OZC A;  1GB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...