4XC2A

Crystal structure of gabarap in complex with kbtbd6 lir peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
MGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords GABA(A) receptor-associated protein
publication title CUL3-KBTBD6/KBTBD7 Ubiquitin Ligase Cooperates with GABARAP Proteins to Spatially Restrict TIAM1-RAC1 Signaling.
pubmed doi rcsb
source organism Homo sapiens
total genus 35
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4xc2A00
4CHKA 2DAJA 2XK5B 4OVVA 3V6CB 1C3TA 4TKNA 3ZDTA 5IA7A 2BKRB 2NBVB 2HTHA 2LRUA 5DPTA 2JRIB 2KX3A 3PSEB 4HJKA 4ICVA 4JL9A 4W9LA 1KM7A 1WR6E 2DZJA 1P9DU 2D07B 2K25A 2M17A 2DZKA 3DVGY 4BOSC 4FJVB 1OGWA 3ML8A 4AWJA 4ZDVA 1GC6A 4M8NA 4NAWA 1P98A 2Y5BB 4XX5A 4EEWA 4I6NB 2KLCA 1GUAB 2NBUA 3JSVB 2FIDA 4GU2A 2MA9B 3U8ZA 2V4LA 3UF8A 3JW0X 2GBJA 1WXVA 4KVGB 4W9IA 4IM2A 2KO3A 1WX9A 4MSQB 2EMTA 1WJ6A 2VRRB 1KLVA 2K6QA 1S3SG 5CHFA 3PVLA 3QC8B 3O65B 4IWPA 1P0RA 3TL5A 3IG3A 4JQWC 4JIOU 2KFKB 2ZCCA 3APDA 1J0GA 3Q3JA 4RM9A 2J7QB 4K81A 4KIKB 2HD5B 4WWPA 3KH0A 3NOBA 1TTNA 1C1YB 2GBNA 4MJSA 2N7DA 2MP2B 3BINA 3RD2A 2DHZA 1OTRB 2FAZA 2G3QB 2IO2B 2PEAA 1LM8B 3VFKA 2C60A 1WE6A 2DAFA 1KJTA 2C7HA 3VHTC 3ZLZA 3PRMB 3OAWA 4EUTA 2KWUB 4AJWA 4FN2A 4K7WA 1I42A 2RD0A 3AULA 1J8CA 3QWZB 3RUIB 5AZHA 2MQJA 2ZVNA 2MLBA 3ZVVA 3R7RA 1LXDA 1EF1A 1UZXB 3N32A 4PS3A 4LJOB 4NQLB 3SD5A 2LVPA 2JZZA 1I35A 3VTVA 3APFA 1EUVB 3N3KB 3WANA 1LQBA 3ECIA 4DDGD 3L54A 2PJHA 4KZ0A 2WDTB 3WIMA 2JY6A 3H9DA 4GDKB 2IYDB 5JZEB 3UQAA 4F7ZA 4M0WB 2ZPYA 2XK5A 2KDBA 2BF8B 3PRPB 2IZVB 2V3SA 2LGXA 4NPNA 4IUMB 1WIAA 1ZGUB 2MRPA 2NPTB 3PZDA 4BKSD 3S2AA 3ZNID 2LJ5A 1EF5A 3QJZA 3VVWB 1JRUA 4DXAB 2LASA 3R66C 2LVOA 1YD8U 3QHTA 4ICUA 2WX0A 2GBRA 3BY4B 1WXAA 2L05A 2N9EB 1XT9B 3A1QB 4BKTA 4AUQC 1CMXB 3ZNGC 3AU4A 5G55A 2IO3B 2CS4A 4IW0A 3PLUA 2R2QA 3K9PB 5EDSA 4KZCA 3DBHI 1RLFA 2K8HA 1T0YA 2BPSA 1TZ1A 1NI2A 3UINB 3VUXA 2L7RA 4JLCA 4IG7B 2JPHA 2KJRA 1ZKHA 2CHXA 4J6IA 3U7DA 4FA6A 1X1MA 2JVCA 2QHOA 2C7NB 3V60A 4W9KA 4PS8A 2FCMA 3DQVA 3U30A 1YQBA 4WJNA 2KZRA 3X23A 1QZEA 4EZJA 5KHOA 4G3XB 4TQ0A 1UGMA 3A9JB 2REXA 5AZGA 2ZCBA 2KWCA 4DHJB 5L83A 3AU5A 1RFAA 2IY1B 2KTFA 3MHSD 4MH0E 4A3OA 2NBWB 4FHJA 3TBLD 2RPQA 1U4AA 1E7UA 3A9KA 3CMMB 3PS6A 3HHMA 3QX1A 2L76A 1WMHB 5DPRA 3ZIMA 1YX5B 4WQOB 3L17A 4ZRIA 1ISNA 2O6VB 1WI0A 4BBNC 2MW5A 3EECA 1K8RB 1WJUA 4DDID 2YLMA 3RULA 5J2RA 5HKHA 1WZ3A 4E3CA 2JRHA 3ZW3A 4FADA 2KMAA 3NHEB 3VTUA 1TGZB 2MBHA 1SGHA 2WWZA 2IO1B 1UD7A 3EHVA 2KDEB 4GOCA 4GDLB 2O2VA 5GMVA 3OJ3A 1Q0WB 2R2OA 3WAOA 3I3TB 2RR9A 1SIFA 4MSMB 2LXCA 2KQSA 2G4SA 3PLVA 3EC8A 4IWOA 2JZ3B 3PHWB 4F1SA 3L13A 2PE6B 2DZMA 2KFJA 3KUCB 5D6JB 2L8JA 4EZLA 5LXHA 3C0RB 2MX2A 1WXMA 2LVQA 4NY0A 3L16A 4BVUC 2GBKA 1G6JA 2IY0B 2ZEQA 4EOYA 3OJ4B 4WWNA 5IAAC 4RMAA 5D7GA 2FUHB 1M94A 4HPLB 5DPSA 3TJPA 1UELA 5J18A 3OLMD 1MG8A 1WR1A 2HE7A 5DPWA 1TBEA 3IVFA 2GOWA 5D2MB 1WZ0A 3VH3B 5C1ZA 1WJNA 4TQ1A 4WWOA 4P7IA 4K7SA 4FJZA 2AL6A 2N1WA 4NJ6A 3ALBA 4DBGA 4AJYB 3MTNB 2M8SA 4CYEA 3K9OB 4K1RB 2KJHB 4WAAA 4WJOA 4MGKE 2MBBB 4HWIB 3PV1A 3ZKJC 1WRDB 3RZWC 3A9JA 3ZNZB 2DX5B 1WM2A 3RZFA 4MM3A 3QQ8B 1P3QU 4II3B 4PS7A 4BOZB 3B08A 2PPHA 4KSLC 3M63B 4ASWC 1H8CA 4HCPB 3H6NA 4A20A 1EO6A 1V6EA 5E6NA 2C7MB 4DK5A 1PQSA 1V2YA 2NCNA 3JYUA 4HDOA 2EKEC 2KQ7A 1WMHA 2KKCA 1BT0A 3VQIA 3TMPB 3ZDMC 3ZRCA 2KXJA 1SE9A 5C23A 3B1LX 4FULA 1WM3A 4EZKA 3HM3A 5J17A 2MWSB 1VD2A 2ZZPB 2PE9A 3VAWA 4GGQA 2BKFA 3T8MA 2XBBC 1Q1OA 3LDZE 2D11A 3W1SC 1RAXA 2I1KA 3IFWB 3N30A 2K6DB 4AP4C 4DWFA 3TCAA 2FCSA 2KHWB 3WAMA 4MEMA 4I6LB 1WGGA 2FIFA 2N9PC 4KDLB 4MGZE 3WA0A 2DYOA 4IWQA 4MDKE 4ZRJA 1WF9A 3CSTA 2JUOA 2Z59B 2LGDA 3RCZA 3PTFC 4I6PA 1V81A 3M95A 4FLHA 4GDLA 3ZTDA 4W9FA 2N4FA 3PREA 4NAWB 1UBIA 3JSVA 1R4NI 3H1UA 4HVBA 2BYFA 2KD0A 3NS8A 4WJPA 1L2NA 5JHAA 3RT3B 1WGDA 3PHXB 4GB9A 2LI5A 2MBOA 3NY5A 2MCNB 2N1VA 2UWQA 1Q5WB 2W9NA 1WX8A 3SU8X 4B95A 4YL8A 4HDQA 3AI5A 2AYOB 3ZO5B 3HK0A 2FNJB 2KFKA 2N9XA 3AXCA 4MGIE 3ZRFA 2A4ZA 2KTRB 2KC2A 3APCA 3QARA 4CO7A 1Z5SB 2L0TA 3IBEA 2LUEA 2J0KA 2L00B 3A33B 3H7PB 4KIKA 4W9HA 4HCNB 2NVUI 5CTRC 5TR5A 2K39A 5BO4B 2MP2A 4W9EA 2C9WB 2K8CA 4XC2A 4W9CA 2LD9A 4PYUA 5CX3A 2YVCA 1R4MI 2ZPNA 1YX6B 1KOTA 2V1YA 3MJWA 2JXXA 2ZVOA 4IC7B 3DPDA 1E5WA 3SHQA 4ANUA 2CKHB 2NS5A 5LXIB 3HM6X 4M8MA 2J0MA 1WGYA 3W1YA 1GC7A 4ZRKA 4HXDA 3DOWA 4ANXA 2ZNVB 2MBEA 3H7SA 3VUWA 2M4NA 2AL3A 3D32A 4HPMB 1YIWA 2D3GA 3DDCB 4DHZE 1V9JA 2K1FA 4A3PA 2CHZA 4N9F4 3DVNU 4HLEA 4LDTD 4B9KA 2ZNVC 4GDKA 3VTWA 2GMIC 2M0XA 4NJ7A 1E8WA 5JH5C 2IBIB 4FJYA 2G45B 1OEYA 1RRBA 2FCNA 3ML9A 4HK2A 3UGBB 2RSUA 2FCQA 2NPTA 2C5LC 1IPGA 1OEYJ 3T9LA 4W9DA 4GSWA 1IYFA 4ANWA 1GJZA 2AEHA 1WY8A 3ENEA 3PT2B 4FBJB 5FR6A 1WX7A 4DHJD 3A1QA 1YJ1A 1NBFC 4GN1A 1NDDA 2AWTA 3DVGX 4E74A 1S1QB 1WH3A 2J0JA 1E7VA 4BFRA 1WFYA 5KHQA 3ONSA 3R7QA 3ZNHB 1IP9A 5E6OA 3PGEA 5E6PA 3KW5B 3UIOB 1J19A 2WX1A 1H4RA 5D94A 2EMSA 2O6VD 3QAQA 3KYDD 4PYZA 5AZFA 5DCNA 3WAPA 3B0AA 3CSFA 3KUDB 2B3AA 2WYQA 4NNJB 3V62A 2KC1A 2KX0A 4II2B 2LRWA 3L10B 2JF5A 1WYWB 3EFUA 2KWVB 3V6EB 4XZ4A 4BKGA 3IHPC 2KTRA 5JHBA 2Z0EB 1WE7A 2ZJDA 4GMVA 4DHZB 3H7PA 4TV3A 1WJ4A 4BBNF 4EKUA 2NR2A 2KNBA 2BGFA 1E8YA 4AOFA 3A9KB 1Y8RC 2A5UA 3HIZA 3QIJA 4G0NB 1E90A 5G2NA 3KYCD 3VH4B 2CU1A 3VUYA 4JGHB 3UIPB 1L7YA 2O6VA 2D2QA 3L0WB 3QCAA 2I1JA 4EFOA 1D3ZA 2D10A 2JWZA 2KMCA 2KN5A 1V49A 2GBMA 3X0WA 1XQQA 4OVUA 3JVZX 4B6WA 4W9GA 3KUZA 3SDLC 4URKA 5L95C 3PRZA 5CHWA 1P1AA 2KANA 3QA8A 4GIVA 4MELA 1V5OA 4F8CB 2DZIA 4ANVA 3R3MA 4TUUA 2UYZB 2KDFB 2DENB 1UBQA 4LJPB 1VCBA 3DVNV 3UQBA 1GNUA 3Q3FA 4IM0A 2Z0DB 2ASQA 3DCGA 2KJ6A 3LJ3A 1WGRA 2O2VB 3NZSA 1Z2MA 3WALA 3ZUNA 2MBQA 1V80A 2KK8A 4K7UA 3DBSA 3NZUA 4MGYE 4NQKE 1V86A 3VXWA 3M62B 2XEWA 2L3ZA 3A4SC 5LLIA 1OQYA 1ZW7A 2OJRA 1E8XA 2KOXA 4KDIC 1UH6A 3TIXA 2DYBA 3ZTCA 1A5RA 5AEKB 2G4DB 2M1MA 2BYEA 4X57B 1FXTB 1XD3B 2KDIA 4KV2A 1V5TA 4LDTB 2LXAA 4ZYNA 2CHWA 4MJSB 4IM3A 1F9JA 2HJ8A 2LGYA 4RM8A 4G50A 4G11A 3RYTA 3PPAA 5CHVC 3L08A 1LFDA 2DYMA 3CF6E 2BYVE 2JT4B 4BKSA 2OOBB 3A4RA 2LWPA 2IO0B 2L0FA 4LCDE 2N7EA 3GZNI 3V61A 2KLGA 4GXBA 2BWFA 1GG3A 3P2BA 2CR5A 1HE8A 2BWES 2K8BA 1WXSA 3QK0A 4KSKC 4W9JA 4WJQA 2RGFA 3KVFB 3M3JA 1E8ZA 3VDZA 1AARA 3GOEA 2MSED 3DBLI 3DBRI 2KVRA 3W1SA 4FHKA 1WGHA 4E71A 2LZ6A
chains in the Genus database with same CATH superfamily
2W82A 2XK5B 3HUIA 3GE8C 4OVVA 5HI1A 2B76B 1JALA 4TKNA 5IA7A 1BMLC 2AQ3B 1C4AA 2WU2B 3PSEB 4HJKA 1KM7A 1WR6E 3IT4B 1T3QA 2D07B 2M17A 3Q69A 3NJTA 3DVGY 1SIJA 3ML8A 4AWJA 1KFYB 2QEJC 3AE1B 2KYWA 2Y5BB 1ET6A 4XX5A 4YSYB 4GU2A 2BS3B 1R4MB 3U8ZA 2GBJA 1L6VA 4IM2A 4MSQB 3RNCC 5CHFA 3APDA 4KIKB 1OTRB 2FAZA 1KJTA 4KX6B 2KWUB 1I42A 2RD0A 1J8CA 2LHEA 4M00A 3QWZB 4L23A 2MQJA 2JX5A 2MLBA 2I2YA 3R7RA 3AM9A 3N32A 4RCOA 4NQLB 3SD5A 2JZZA 1UWMA 2WDTB 2IYDB 3N1ZC 4F7ZA 4M0WB 2XK5A 2KDBA 3PRPB 1HEZE 1JRPA 2MRPA 2PKOA 1EF5A 3R66C 2LVOA 1YD8U 3QHTA 5GXGB 1WXAA 2L05A 3A1QB 1XT9B 3I5JC 3ZNGC 1D6EC 4IW0A 4OHJA 2R2QA 5FR3A 1Q10A 3DBHI 2K8HA 1TZ1A 1C76A 3NG0A 3VUXA 2DWQA 3BIID 1ZKHA 2CHXA 4OZBA 3U30A 4WJNA 3Q8EA 4G3XB 5FKAC 5HHDG 1E9MA 2Y5PA 2LHDA 1ZUD2 2W55A 1WRIA 1WYGA 1TKEA 4WQOB 3L17A 2O6VB 4BBNC 3BWUD 1K8RB 3FILB 3TEWA 4DDID 4FADA 3B9JA 1SGHA 1PUTA 3HRDD 3P42A 3EHVA 4GOCA 4M0WA 1JCKB 4GDLB 1A70A 4YXDB 2M19A 2O2VA 4JPSA 1Q0WB 4ACFA 2ICIA 1DOXA 5BMIA 2R2OA 3WAOA 3I3TB 1SIFA 1RFKA 3PLVA 3EC8A 5AUIA 2WXOA 1RM6C 2MX2A 2PTLA 1M4VA 4Q2JA 4B0EA 4EOYA 4WWNA 2FUHB 2AQ1B 3TJPA 3SR6A 5J18A 3BK1A 2HE7A 2GOWA 5D2MB 1WZ0A 3VH3B 5C1ZA 4K7SA 4PK1A 1N63A 2AL6A 3ALBA 3MTNB 2M8SA 4CYEA 3AE2B 2MBBB 3ZKJC 1WRDB 3SFDB 1VJKA 2DX5B 1WM2A 1P3QU 3PZ8A 1B9RA 4PS7A 1EU3A 1YQ4B 2WXRA 4ZOHC 3VR9B 1MHXA 4A20A 1V6EA 2C7MB 4DK5A 1PQSA 1V2YA 1I4HA 2KQ7A 1F0ZA 2MJEA 1QF6A 3VQIA 3TMPB 2EELA 3ZRCA 2GLSA 3Q14C 2ZZPB 2BKFA 2XBBC 1Q1OA 3FILA 3ZXRA 3GB1A 1WSPA 4LLGM 1V1OA 1WGGA 2N9PC 4KDLB 3WA0A 3I9V1 3RCZA 2J4XA 3PTFC 4GDLA 2DNFA 4DQOC 3PREA 4NAWB 4JX1C 3NS1A 4NAMA 1UGJA 2KN4A 2EKIA 2KT7A 2OHFA 2MBOA 1TJEA 2N1VA 2UWQA 3ZJUA 4HPPA 4OVZA 4UDUC 3SU8X 2QCZA 2JXTA 4XYCA 1N6ZA 2KFKA 3AXCA 4XDDA 3APCA 1EM7A 1JWMD 3IBEA 2L0TA 2J0KA 2L00B 2LUEA 3H7PB 3A33B 3GE3C 3BYYB 5TR5A 2MP2A 2QDFA 1NEKB 1ZXHA 2X38A 4PYUA 1J7CA 5CX3A 1DGJA 1YX6B 3W9CB 4IC7B 5LXIB 3HM6X 3CIRB 2J0MA 4M8MA 4C4VA 4C7ZA 2WXHA 2ZNVB 1TS4A 1SJHD 4N9F4 3DVNU 4C00A 4B9KA 2ZNVC 1C4PA 2M0XA 3DBHB 5JH5C 2H88B 3L4PA 1R7SA 4FJYA 4DXFA 4RF1A 2FCQA 2C5LC 4GSWA 1CQVA 1QOGA 3GZNB 3Q8BA 4GN1A 3AV8A 1S1QB 4BFRA 1WFYA 1DYQA 3PGEA 5E6PA 3E9SA 4RGTA 2VH2A 3KWVA 5BYRA 1FPYA 3V62A 3L10B 3R8BA 1SE3A 4XZ4A 5G5GA 1WE7A 2YEPF 4GMVA 4DHZB 3H7PA 1FEHA 1VZ7A 3P4SB 4AOFA 3A9KB 3SFEB 3HIZA 3VH4B 1E90A 3RNFC 4JGHB 3CWIA 2NTSA 3LXFA 5MPOA 2D10A 2M0AA 4IKGA 1V49A 3JVZX 2ZW1A 3SDLC 4URKA 3Q3OC 5CHWA 4GIVA 4S0RA 1JQ4A 4P1CC 2BTEA 2R61A 2ASQA 3W5VB 1MI0A 2MBQA 1FMAD 1V80A 2D3BA 4USAA 1V86A 3IT6B 2Q5WD 3A4SC 3BYTB 5LLIA 2OJRA 1RYJA 1UH6A 2QMTA 1GB4A 5BYQA 1QOBA 1A5RA 3V3XA 5AEKB 2G4DB 4X57B 1XD3B 4KV2A 2LGSA 2LXAA 3R2TA 1ZP0B 3MFGA 4RM8A 1ACCA 3L08A 2DYMA 3RNAC 1L0XB 2L1AA 2LWPA 2BWFA 3QK0A 2K8BA 4WJQA 2L32A 3KVFB 2GI9A 4MM3B 4AQ7A 4OZCA 1WXQA 3VDZA 1MHHE 2JQRB 4H2AA 1ZXIA 1C78A 2CU3A 1FD6A 2KVRA 3W1SA 3MHZA 1F2RI 1ZPSA 4LNFA 2LUMA 3RMKC 3ZDTA 2BKRB 5DPTA 2HTHA 2LRUA 2KX3A 4JL9A 3U4EG 2DZJA 2DZKA 1OGWA 4ZDVA 4N6EB 3LYYA 4AS1A 4RF0A 2NBUA 2FIDA 1HQRD 3NRZA 2MA9B 1FO4A 3J9CA 2LEKA 2KO3A 2VRRB 2W3SA 1S3SG 3PVLA 2V3NA 3TL5A 3IG3A 4JQWC 4JIOU 1I7HA 1MPEA 4N59A 1J0GA 4RM9A 2N7JA 1N5XA 2HD5B 5D3IB 3KWLA 3KH0A 3VRBB 1TTNA 1C1YB 2GBNA 2XN9C 2WQYB 1D5ZC 2N7DA 3RD2A 2G3QB 2PEAA 1XO3A 1WE6A 2C7HA 3RFZB 4AJWA 1N5WA 1SE2A 4LJOB 2N0SB 3VTVA 1EUVB 3N3KB 3L54A 2PJHA 1YN5A 4GDKB 3UQAA 4JWUC 2BF8B 1V97A 1NENB 4IUMB 1WIAA 1VLBA 1ZGUB 2NPTB 3PZDA 3ZNID 1TYGB 3HVZA 2WDQB 3DHGC 2N9EB 4AUQC 1PGAA 3AU4A 2CS4A 5EDSA 2WXLA 1T0YA 1FNVA 1KF6B 1NI2A 5G5HA 4J3OD 2K5PA 5H92C 1CK1A 4KKJA 2KJRA 4J6IA 3U7DA 4FA6A 1X1MA 3V60A 4W9KA 3DQVA 1YQBA 3AEFB 5KHOA 1UGMA 3A9JB 1SBBB 4RNAA 3IAM1 2KWCA 3MHSD 1RFAA 2YEPB 1K50A 4MH0E 2GB1A 3TBLD 1ISNA 1WI0A 2K22A 3PO0A 3P4QB 3RULA 2BW2A 2MJDA 2JRHA 3ZW3A 3NHEB 1J7AA 3EFCA 3NZ3A 2PVGC 5GMVA 2ONQA 2VZKD 4L1BA 2LXCA 2KQSA 4IWOA 4F1SA 2PE6B 5LXHA 1LGRA 3C0RB 3P63A 2GBKA 3BZDB 2IY0B 5IAAC 2TSSA 3GS2A 1WR1A 2L83A 1I4XA 1VZ8A 2PVOD 1WJNA 2NTTA 4QAYA 4FJZA 1C77A 4NJ6A 4WAAA 4HWIB 1F2RC 3A9JA 3ZNZB 3N20C 3RZFA 4P6VF 4K3BA 4II3B 1N62A 5IP4D 3M63B 4US8A 1UWXA 5E6NA 4HDOA 2EKEC 1WGKA 3FKYA 2KXJA 2FE8A 1WM3A 4EZKA 3HM3A 5J17A 1VD2A 3LDZE 1RAXA 2K6DB 3EUB2 4MEMA 3GP7A 4I6LB 1T0QC 2DYOA 4IWQA 4ZRJA 2WDVB 2JUOA 2LGDA 2FBWB 1ROEA 3AEEB 3T3NA 1QT9A 1UBIA 4PT5A 3TEYA 1R4NI 3NS8A 4RGMA 4P1BC 5JHAA 4GB9A 2MCNB 4C7YA 2W9NA 1ESFA 3ZO5B 2V4IB 3ZRFA 2KTRB 3QARA 3VVWB 4KIKA 1E0ZA 1XF5L 2NVUI 2K9XA 5BO4B 4W9EA 4WWMA 2C9WB 2LD9A 2RMMA 1FXAA 3IXSA 1AN8A 2CKHB 2NS5A 1GC7A 4ZRKA 3D32A 4ZRQA 4XWTA 2LMCA 4DHZE 2K1FA 4A3PA 2WU5B 2CHZA 2V9HA 4LDTD 3NVZA 3VTWA 1IGCA 2IBIB 2IGHA 1FRRA 1RRBA 2BS4B 3BK2A 4OW0A 3MC0B 2BVCA 3LB8C 4W9DA 2NMQA 2ZW0A 4TMAB 2VH1A 4DHJD 3A1QA 1I4RA 5I4DA 1WH3A 5T8IA 4HKQA 1HA5A 1J19A 2MH7A 5D94A 3QAQA 3KYDD 4LNOA 3CSFA 2CJNA 2B3AA 2WYQA 4HRSA 4NNJB 2MJ3A 2KC1A 2KX0A 2LRWA 2JF5A 3EFUA 3TUOA 2KWVB 4LK0M 3V6EB 4ITKA 3TSSA 4BKGA 2KTRA 3W5UB 2ZJDA 5E6JA 3C19A 3AB5A 1SJED 3BVGA 3V05A 1QOAA 4EKUA 3NVVA 1XCQL 1Y8RC 2A5UA 4G0NB 4S17A 3I63C 2WNMA 3QCAA 2O6VA 3ZXVA 2WXGA 1C4CA 2JWZA 3MC8A 3RNBC 4B6WA 1XQQA 4OVUA 3Q8CA 2JYEA 5BMHA 2KANA 3QA8A 1L0VB 1V5OA 3AE3B 4F8CB 2DZIA 4WURA 4DXGA 2AQ2B 1AYFA 1GNUA 2X8XX 2Z0DB 1KTKA 1Z2MA 3WALA 1K52A 4K7UA 4MGYE 4NQKE 1QLBB 3M62B 2XEWA 4FXCA 2KDMA 1E8XA 3TIXA 1FXTB 3MC9A 3ZJTA 4LDTB 1T5XD 1OQQA 4IM3A 2LGYA 3RYTA 4LTUA 5CHVC 1LFDA 1MFWA 1JW9D 1DOIA 2OOBB 4LCDE 2KLGA 4GXBA 2PW9A 4A90A 2CR5A 1VZ6A 2J52A 1YN3A 1WXSA 4KSKC 2ON8A 4W9JA 4ARCA 1E8ZA 3GOEA 1T0RC 2MSED 3N9YC 3DBLI 3DBRI 3HVDA 1WGHA 1OFFA 3VR8B 1GB1A 2LZ6A 4CHKA 1R4NB 2Y5CA 3V6CB 1T0SC 2JRIB 3ZGZA 4ICVA 4W9LA 4KKIA 1P9DU 2K25A 2D3CA 4NAWA 5JXVA 2KLCA 1GUAB 3FC4A 1HTOA 3JSVB 3U52E 2V4LA 3UF8A 3JW0X 2WGSA 1WXVA 3AEAB 4KVGB 4W9IA 2JU6X 1WX9A 1WJ6A 2OEDA 1FFVA 4XWWA 2MEKA 3IAS1 2K6QA 3MJ5A 3QC8B 3O65B 2ZCCA 4NZLB 3AH7A 3UI3A 3WCQA 2DHZA 1LM8B 3N1XC 2C60A 2G1EA 2DAFA 1ZDVA 3VHTC 3ZLZA 3PRMB 4A55A 3ZJVA 4FN2A 4K7WA 3AULA 4ZHPA 3ABVB 3RUIB 2KWDA 3ZVVA 1LXDA 1EF1A 1UZXB 2W54A 3WANA 1LQBA 4JE3B 1VDVA 2JY6A 1STEA 3H9DA 1XLOA 2UU7A 2IZVB 2V3SA 2LGXA 4BKSD 1JRUA 3AE8B 4KGSA 2LASA 1IBXB 4ICUA 2GBRA 4BKTA 1CMXB 1K53A 5G55A 2IO3B 4MT5A 2WXMA 3PLUA 2WXPA 2BYTA 2PLPA 2BPSA 3UINB 1TS3A 3Q8FA 4JLCA 3RNGC 4IG7B 3MP9A 2JVCA 2QHOA 2C7NB 3X23A 4EZJA 2K3UA 3AE6B 4YT0B 5L83A 3AU5A 2LGIA 2NBWB 1U4AA 3A9KA 2WP9B 3CMMB 3PS6A 3QX1A 5DPRA 3RI7C 1YX5B 4N58A 4ZRIA 1F1HA 1FCCC 2MW5A 3EECA 2XNAC 1WJUA 5J2RA 5HKHA 1SXTA 1YOVB 3ZQ4A 2BQQA 1C79A 2WWZA 2QILA 3AE9B 1C9FA 2WXJA 2IO1B 1UD7A 2E6XA 1TKYA 4YSZB 3OJ3A 4MSMB 1V8CA 2JZ3B 4ARIA 2DZMA 2KFJA 4EZLA 1WXMA 2LVQA 3TEZA 3L16A 2ZEQA 3AE7B 3OJ4B 4B0MA 2LJIA 1M94A 5HFYA 1UELA 1E6EB 2BB5A 3OLMD 3DBLB 1MG8A 1TBEA 2INDC 3IVFA 3OG5A 4WWOA 1NYQA 2PMVA 4DBGA 2N1WA 1CJEA 4AJYB 3K9OB 2BB6A 1E10A 1FNWA 3DHIC 3PV1A 3RZWC 5IKCM 4RFBA 3KLSX 4MM3A 3QQ8B 4XDCA 2QJLA 3B08A 4KSLC 4ASWC 5C3JB 2NCNA 1SSNA 3ZDMC 1SE9A 5C23A 3B1LX 4FULA 2MWSB 4GGQA 2D11A 2I1KA 3IFWB 3N30A 4LNKA 4DWFA 3TCAA 2KHWB 2JSVX 3WAMA 1NYRA 2MHJA 4MDKE 1WF9A 3CSTA 2Z59B 1V81A 3M95A 4FLHA 1K51A 2N4FA 2W3RA 4HVBA 4M01A 1WGDA 5EE0A 3NY5A 1Q5WB 5C2TB 2BT6A 4B95A 4HDQA 3AI5A 3HK0A 2FNJB 2N9XA 4MGIE 5IN7A 3Q3MC 1Z5SB 1J7BA 3FAHA 4HCNB 1T6BX 5CTRC 2CJOA 2K8CA 4XC2A 4W9CA 1DOYA 1MVKA 2YVCA 2ZPNA 1I4PA 3MJWA 2ZVOA 3DPDA 2QC8A 1E5WA 3SHQA 2RDHA 4YTNB 3P4RB 3W1YA 4ANXA 4HXDA 1GOZA 3VUWA 2MBEA 2M4NA 2D3GA 4GDKA 4LNIA 2GMIC 2RPVA 4NJ7A 1E8WA 1TT5B 5IO9A 4US9A 2G45B 1OEYA 2FCNA 3ML9A 4HK2A 3UGBB 2NPTA 1IPGA 1D5XC 1JROA 1OEYJ 3T9LA 1IYFA 4ANWA 1WWTA 2J53A 3ENEA 3PT2B 5FR6A 4YSXB 1YJ1A 2WXNA 1NDDA 2AWTA 3DVGX 1D4BA 4E74A 2J0JA 1E7VA 4R3DA 5E6OA 3BVZA 3KW5B 3UIOB 4EE2A 2M56B 1XLPA 2N9KA 2O6VD 4PYZA 3WAPA 1LO5D 3KUDB 2KQ4X 1PGXA 3Q2AC 4WAFA 1NI3A 2WXIA 2Z0EB 4TV3A 1L6UA 3N1YC 1SB3C 2NR2A 1E8YA 1TS5A 3QIJA 5G2NA 3DWGC 3KYCD 1VR9A 1L7YA 3L0WB 1QKZA 2D2QA 4EFOA 1D3ZA 3EA6A 3BVMA 2KN5A 1ZE3D 4LNNA 3X0WA 2GBMA 3KUZA 2AX5A 2FUG1 4MELA 5AUKA 4XE0A 3R3MA 4TUUA 2UYZB 2KDFB 2DENB 1UBQA 3RN9C 4CQNA 2RDGA 3Q3FA 1PGBA 4IM0A 3DCGA 1L0YB 2KJ6A 3LJ3A 5LNK1 2O2VB 1AWDA 2KK8A 3NZUA 1MJDA 4C80A 3VXWA 2L3ZA 1ZW7A 2KOXA 4RGNA 1FNUA 1FM0D 1TKGA 4A8XC 1GPXA 2KDIA 1SF0A 1V5TA 4ZRPA 1PFDA 4ZYNA 4MJSB 1F9JA 2N9LA 3U2SC 4G50A 3PPAA 2WXFA 1HZ6A 1YN4A 1ET9A 2VZKB 2BYVE 2JT4B 3A4RA 1QQRA 2IO0B 3ZYYX 2N7EA 3GZNI 1IGDA 4P16A 1GG3A 3P2BA 2RGFA 3NVWA 3SEBA 1KH0A 3O13A 4ZYSA 5EE3A 2INPE 4XGAB 4FHKA 4REZA 2JZPA 1CZPA 4E71A 2DAJA 4YWGG 2H89B 3U7ZA 2LFIA 1C3TA 1MG4A 1YJJA 2NBVB 1AW7A 4BOSC 1JWBD 4FJVB 3B2GA 1B1ZA 1GC6A 1I4QA 2IGGA 4M8NA 1P98A 4EEWA 4I6NB 2SEBD 2E3TA 1EWCA 2EMTA 3VRAB 1KLVA 2WXKA 3RNEC 5EE1A 3NUHB 4GLSC 1P0RA 4IWPA 3URYA 1XCTL 1D5MC 2KFKB 2I38A 3Q3JA 2J7QB 4K81A 4WWPA 3NOBA 1FRDA 4MJSA 2MP2B 3BINA 2L52A 2IO2B 3VFKA 5BMGA 3OAWA 4EUTA 2V3PA 5AZHA 2ZVNA 4JWSC 4C4VB 1SE4A 4PS3A 1JWSD 2OJWA 2LVPA 2V0GA 1I35A 3APFA 3ECIA 4DDGD 1TY0A 4KZ0A 3AE5B 3WIMA 4HEA1 1YQ3B 5JZEB 1HTQA 2ZPYA 1PDXA 4ZHOA 4NPNA 1TY2A 3S2AA 2LJ5A 3QJZA 4DXAB 4YTMB 2KACA 1N60A 2WX0A 1JWUD 3BY4B 4RGOS 3PZ7A 2DLBA 4D2KA 1P7FA 1IUEA 3K9PB 4KZCA 1RLFA 1OQRA 3ETRA 3P1MA 4MH8A 2L7RA 1ZDXA 2JPHA 1N61A 3AMZA 4A6QA 4PS8A 2FCMA 1UUPA 2KZRA 1QZEA 4IOIE 4TQ0A 2REXA 2INNE 5AZGA 2ZCBA 4DHJB 4WH4A 2IY1B 2KTFA 2WXQA 4C56C 4A3OA 1V1PB 4FHJA 1KLUD 2RPQA 1E7UA 4WQMA 3HHMA 4KGRA 2L76A 1WMHB 3ZIMA 1P7EA 1E7PB 2IJ0A 4WIPA 3P4PB 2INCC 2YLMA 1WZ3A 4E3CA 1KLGD 2KMAA 3VTUA 1TGZB 1XLNA 2MBHA 1TZOA 2KDEB 2Y3AA 2HDEA 4K3CA 2KAJA 2ACZB 2RR9A 2G4SA 5TSSA 3PHWB 3L13A 3KUCB 5D6JB 3R2IA 2L8JA 4NY0A 4BVUC 1G6JA 1QOFA 1TIFA 2PIAA 4RMAA 5D7GA 5IOIA 2J42A 4HPLB 5DPSA 1YJIA 5DPWA 2D3AA 4TQ1A 2WLBA 4P7IA 2WDRB 3Q6BA 1HZ5A 4K1RB 2KJHB 4WJOA 4MGKE 4BOZB 2PPHA 1H8CA 4HCPB 3H6NA 1EO6A 3C8YA 1V1PA 3JYUA 3EGRA 1WMHA 2GRIA 2KKCA 1BT0A 1XLQA 2G9HD 4TSSA 2PE9A 3VAWA 3T8MA 3TEXA 3W1SC 4AP4C 4A9AA 2FCSA 2FIFA 1FCLA 4MGZE 1L5PA 1KRHA 2IGDA 4I6PA 3ZTDA 4W9FA 2HJ1A 3JSVA 3H1UA 2BYFA 2KD0A 4WJPA 1L2NA 3RT3B 3PHXB 1ENFA 2LI5A 1QILA 1XXGA 4IDIA 1WX8A 3AEBB 4YL8A 5EE9A 2AYOB 2IDYA 2A4ZA 4CO7A 2KC2A 5H8YE 2D5GA 2IPKD 1FXIA 2WS3B 1EU4A 4W9HA 2K39A 3E56A 3AEDB 3NVYA 1R4MI 3AEGB 1KOTA 3AN1A 2V1YA 3AE4B 2JXXA 2Z8LA 2BBCA 4ANUA 5FK9C 1BXTA 1HXYD 4HKZE 3I57A 1WGYA 1JWAD 3DOWA 2SAKA 3H7SA 2AL3A 3Q3NC 4HPMB 1YIWA 3DDCB 3KQ4A 1V9JA 4HLEA 1F52A 1ZOYB 4HJGE 5HG2A 2JYTA 1RWSA 2RSUA 1FFUA 1UNSA 4L2YA 3B2FA 1GJZA 2AEHA 1WY8A 1IBXA 4FBJB 2K0PA 1WX7A 1BUIC 1NBFC 1FIQA 3DWMA 1YNTE 2HTME 5KHQA 3ONSA 3R7QA 3ZNHB 4BAXA 1IP9A 1GAQB 3DBRB 3OWEB 2WX1A 1H4RA 3DHHC 2EMSA 2KMMA 5AZFA 5DCNA 3B0AA 1I4GA 4II2B 3T3OA 1WYWB 3H8HA 3W2DA 1YMHE 1F77A 3IHPC 5JHBA 4YTPB 1WJ4A 4BBNF 5BYSA 2QSDA 2KNBA 4BZAA 2BGFA 3VUYA 2CU1A 2KVZA 3UIPB 4MACA 2I1JA 2KMCA 3Q8AA 4NJCA 1XEEA 4W9GA 5L95C 3PRZA 1P1AA 4RH6A 2DBYA 4ANVA 2RDBC 1L4DB 4LJPB 1VCBA 3AECB 3DVNV 3UQBA 1NVID 4OZAA 1WGRA 3NZSA 1PYWD 1VRAB 3ZUNA 1TS2A 3DBSA 1OQYA 4KDIC 1EWYC 2JWUA 2DYBA 3RPFC 3ZTCA 2M1MA 1Y56A 2BYEA 2CHWA 4KGTA 2HJ8A 1JMLA 5D3DA 4G11A 2BS2B 3CF6E 4BKSA 1L4ZB 2L0FA 2WHIA 3V61A 4M02A 1UF0A 1HE8A 2BWES 4O1NA 3M3JA 1AARA 4HROA 1SEBD 2QIEB
chains in the Genus database with same CATH topology
4CHKA 2DAJA 2XK5B 4OVVA 3V6CB 1C3TA 4TKNA 3ZDTA 5IA7A 2BKRB 2NBVB 2HTHA 2LRUA 5DPTA 2JRIB 2KX3A 3PSEB 4HJKA 4ICVA 4JL9A 4W9LA 1KM7A 1WR6E 2DZJA 1P9DU 2D07B 2K25A 2M17A 2DZKA 3DVGY 4BOSC 4FJVB 1OGWA 3ML8A 4AWJA 4ZDVA 1GC6A 4M8NA 4NAWA 1P98A 2Y5BB 4XX5A 4EEWA 4I6NB 2KLCA 1GUAB 2NBUA 3JSVB 2FIDA 4GU2A 2MA9B 3U8ZA 2V4LA 3UF8A 3JW0X 2GBJA 1WXVA 4KVGB 4W9IA 4IM2A 2KO3A 1WX9A 4MSQB 2EMTA 1WJ6A 2VRRB 1KLVA 2K6QA 1S3SG 5CHFA 3PVLA 3QC8B 3O65B 4IWPA 1P0RA 3TL5A 3IG3A 4JQWC 4JIOU 2KFKB 2ZCCA 3APDA 1J0GA 3Q3JA 4RM9A 2J7QB 4K81A 4KIKB 2HD5B 4WWPA 3KH0A 3NOBA 1TTNA 1C1YB 2GBNA 4MJSA 2N7DA 2MP2B 3BINA 3RD2A 2DHZA 1OTRB 2FAZA 2G3QB 2IO2B 2PEAA 1LM8B 3VFKA 2C60A 1WE6A 2DAFA 1KJTA 2C7HA 3VHTC 3ZLZA 3PRMB 3OAWA 4EUTA 2KWUB 4AJWA 4FN2A 4K7WA 1I42A 2RD0A 3AULA 1J8CA 3QWZB 3RUIB 5AZHA 2MQJA 2ZVNA 2MLBA 3ZVVA 3R7RA 1LXDA 1EF1A 1UZXB 3N32A 4PS3A 4LJOB 4NQLB 3SD5A 2LVPA 2JZZA 1I35A 3VTVA 3APFA 1EUVB 3N3KB 3WANA 1LQBA 3ECIA 4DDGD 3L54A 2PJHA 4KZ0A 2WDTB 3WIMA 2JY6A 3H9DA 4GDKB 2IYDB 5JZEB 3UQAA 4F7ZA 4M0WB 2ZPYA 2XK5A 2KDBA 2BF8B 3PRPB 2IZVB 2V3SA 2LGXA 4NPNA 4IUMB 1WIAA 1ZGUB 2MRPA 2NPTB 3PZDA 4BKSD 3S2AA 3ZNID 2LJ5A 1EF5A 3QJZA 3VVWB 1JRUA 4DXAB 2LASA 3R66C 2LVOA 1YD8U 3QHTA 4ICUA 2WX0A 2GBRA 3BY4B 1WXAA 2L05A 2N9EB 1XT9B 3A1QB 4BKTA 4AUQC 1CMXB 3ZNGC 3AU4A 5G55A 2IO3B 2CS4A 4IW0A 3PLUA 2R2QA 3K9PB 5EDSA 4KZCA 3DBHI 1RLFA 2K8HA 1T0YA 2BPSA 1TZ1A 1NI2A 3UINB 3VUXA 2L7RA 4JLCA 4IG7B 2JPHA 2KJRA 1ZKHA 2CHXA 4J6IA 3U7DA 4FA6A 1X1MA 2JVCA 2QHOA 2C7NB 3V60A 4W9KA 4PS8A 2FCMA 3DQVA 3U30A 1YQBA 4WJNA 2KZRA 3X23A 1QZEA 4EZJA 5KHOA 4G3XB 4TQ0A 1UGMA 3A9JB 2REXA 5AZGA 2ZCBA 2KWCA 4DHJB 5L83A 3AU5A 1RFAA 2IY1B 2KTFA 3MHSD 4MH0E 4A3OA 2NBWB 4FHJA 3TBLD 2RPQA 1U4AA 1E7UA 3A9KA 3CMMB 3PS6A 3HHMA 3QX1A 2L76A 1WMHB 5DPRA 3ZIMA 1YX5B 4WQOB 3L17A 4ZRIA 1ISNA 2O6VB 1WI0A 4BBNC 2MW5A 3EECA 1K8RB 1WJUA 4DDID 2YLMA 3RULA 5J2RA 5HKHA 1WZ3A 4E3CA 2JRHA 3ZW3A 4FADA 2KMAA 3NHEB 3VTUA 1TGZB 2MBHA 1SGHA 2WWZA 2IO1B 1UD7A 3EHVA 2KDEB 4GOCA 4GDLB 2O2VA 5GMVA 3OJ3A 1Q0WB 2R2OA 3WAOA 3I3TB 2RR9A 1SIFA 4MSMB 2LXCA 2KQSA 2G4SA 3PLVA 3EC8A 4IWOA 2JZ3B 3PHWB 4F1SA 3L13A 2PE6B 2DZMA 2KFJA 3KUCB 5D6JB 2L8JA 4EZLA 5LXHA 3C0RB 2MX2A 1WXMA 2LVQA 4NY0A 3L16A 4BVUC 2GBKA 1G6JA 2IY0B 2ZEQA 4EOYA 3OJ4B 4WWNA 5IAAC 4RMAA 5D7GA 2FUHB 1M94A 4HPLB 5DPSA 3TJPA 1UELA 5J18A 3OLMD 1MG8A 1WR1A 2HE7A 5DPWA 1TBEA 3IVFA 2GOWA 5D2MB 1WZ0A 3VH3B 5C1ZA 1WJNA 4TQ1A 4WWOA 4P7IA 4K7SA 4FJZA 2AL6A 2N1WA 4NJ6A 3ALBA 4DBGA 4AJYB 3MTNB 2M8SA 4CYEA 3K9OB 4K1RB 2KJHB 4WAAA 4WJOA 4MGKE 2MBBB 4HWIB 3PV1A 3ZKJC 1WRDB 3RZWC 3A9JA 3ZNZB 2DX5B 1WM2A 3RZFA 4MM3A 3QQ8B 1P3QU 4II3B 4PS7A 4BOZB 3B08A 2PPHA 4KSLC 3M63B 4ASWC 1H8CA 4HCPB 3H6NA 4A20A 1EO6A 1V6EA 5E6NA 2C7MB 4DK5A 1PQSA 1V2YA 2NCNA 3JYUA 4HDOA 2EKEC 2KQ7A 1WMHA 2KKCA 1BT0A 3VQIA 3TMPB 3ZDMC 3ZRCA 2KXJA 1SE9A 5C23A 3B1LX 4FULA 1WM3A 4EZKA 3HM3A 5J17A 2MWSB 1VD2A 2ZZPB 2PE9A 3VAWA 4GGQA 2BKFA 3T8MA 2XBBC 1Q1OA 3LDZE 2D11A 3W1SC 1RAXA 2I1KA 3IFWB 3N30A 2K6DB 4AP4C 4DWFA 3TCAA 2FCSA 2KHWB 3WAMA 4MEMA 4I6LB 1WGGA 2FIFA 2N9PC 4KDLB 4MGZE 3WA0A 2DYOA 4IWQA 4MDKE 4ZRJA 1WF9A 3CSTA 2JUOA 2Z59B 2LGDA 3RCZA 3PTFC 4I6PA 1V81A 3M95A 4FLHA 4GDLA 3ZTDA 4W9FA 2N4FA 3PREA 4NAWB 1UBIA 3JSVA 1R4NI 3H1UA 4HVBA 2BYFA 2KD0A 3NS8A 4WJPA 1L2NA 5JHAA 3RT3B 1WGDA 3PHXB 4GB9A 2LI5A 2MBOA 3NY5A 2MCNB 2N1VA 2UWQA 1Q5WB 2W9NA 1WX8A 3SU8X 4B95A 4YL8A 4HDQA 3AI5A 2AYOB 3ZO5B 3HK0A 2FNJB 2KFKA 2N9XA 3AXCA 4MGIE 3ZRFA 2A4ZA 2KTRB 2KC2A 3APCA 3QARA 4CO7A 1Z5SB 2L0TA 3IBEA 2LUEA 2J0KA 2L00B 3A33B 3H7PB 4KIKA 4W9HA 4HCNB 2NVUI 5CTRC 5TR5A 2K39A 5BO4B 2MP2A 4W9EA 2C9WB 2K8CA 4XC2A 4W9CA 2LD9A 4PYUA 5CX3A 2YVCA 1R4MI 2ZPNA 1YX6B 1KOTA 2V1YA 3MJWA 2JXXA 2ZVOA 4IC7B 3DPDA 1E5WA 3SHQA 4ANUA 2CKHB 2NS5A 5LXIB 3HM6X 4M8MA 2J0MA 1WGYA 3W1YA 1GC7A 4ZRKA 4HXDA 3DOWA 4ANXA 2ZNVB 2MBEA 3H7SA 3VUWA 2M4NA 2AL3A 3D32A 4HPMB 1YIWA 2D3GA 3DDCB 4DHZE 1V9JA 2K1FA 4A3PA 2CHZA 4N9F4 3DVNU 4HLEA 4LDTD 4B9KA 2ZNVC 4GDKA 3VTWA 2GMIC 2M0XA 4NJ7A 1E8WA 5JH5C 2IBIB 4FJYA 2G45B 1OEYA 1RRBA 2FCNA 3ML9A 4HK2A 3UGBB 2RSUA 2FCQA 2NPTA 2C5LC 1IPGA 1OEYJ 3T9LA 4W9DA 4GSWA 1IYFA 4ANWA 1GJZA 2AEHA 1WY8A 3ENEA 3PT2B 4FBJB 5FR6A 1WX7A 4DHJD 3A1QA 1YJ1A 1NBFC 4GN1A 1NDDA 2AWTA 3DVGX 4E74A 1S1QB 1WH3A 2J0JA 1E7VA 4BFRA 1WFYA 5KHQA 3ONSA 3R7QA 3ZNHB 1IP9A 5E6OA 3PGEA 5E6PA 3KW5B 3UIOB 1J19A 2WX1A 1H4RA 5D94A 2EMSA 2O6VD 3QAQA 3KYDD 4PYZA 5AZFA 5DCNA 3WAPA 3B0AA 3CSFA 3KUDB 2B3AA 2WYQA 4NNJB 3V62A 2KC1A 2KX0A 4II2B 2LRWA 3L10B 2JF5A 1WYWB 3EFUA 2KWVB 3V6EB 4XZ4A 4BKGA 3IHPC 2KTRA 5JHBA 2Z0EB 1WE7A 2ZJDA 4GMVA 4DHZB 3H7PA 4TV3A 1WJ4A 4BBNF 4EKUA 2NR2A 2KNBA 2BGFA 1E8YA 4AOFA 3A9KB 1Y8RC 2A5UA 3HIZA 3QIJA 4G0NB 1E90A 5G2NA 3KYCD 3VH4B 2CU1A 3VUYA 4JGHB 3UIPB 1L7YA 2O6VA 2D2QA 3L0WB 3QCAA 2I1JA 4EFOA 1D3ZA 2D10A 2JWZA 2KMCA 2KN5A 1V49A 2GBMA 3X0WA 1XQQA 4OVUA 3JVZX 4B6WA 4W9GA 3KUZA 3SDLC 4URKA 5L95C 3PRZA 5CHWA 1P1AA 2KANA 3QA8A 4GIVA 4MELA 1V5OA 4F8CB 2DZIA 4ANVA 3R3MA 4TUUA 2UYZB 2KDFB 2DENB 1UBQA 4LJPB 1VCBA 3DVNV 3UQBA 1GNUA 3Q3FA 4IM0A 2Z0DB 2ASQA 3DCGA 2KJ6A 3LJ3A 1WGRA 2O2VB 3NZSA 1Z2MA 3WALA 3ZUNA 2MBQA 1V80A 2KK8A 4K7UA 3DBSA 3NZUA 4MGYE 4NQKE 1V86A 3VXWA 3M62B 2XEWA 2L3ZA 3A4SC 5LLIA 1OQYA 1ZW7A 2OJRA 1E8XA 2KOXA 4KDIC 1UH6A 3TIXA 2DYBA 3ZTCA 1A5RA 5AEKB 2G4DB 2M1MA 2BYEA 4X57B 1FXTB 1XD3B 2KDIA 4KV2A 1V5TA 4LDTB 2LXAA 4ZYNA 2CHWA 4MJSB 4IM3A 1F9JA 2HJ8A 2LGYA 4RM8A 4G50A 4G11A 3RYTA 3PPAA 5CHVC 3L08A 1LFDA 2DYMA 3CF6E 2BYVE 2JT4B 4BKSA 2OOBB 3A4RA 2LWPA 2IO0B 2L0FA 4LCDE 2N7EA 3GZNI 3V61A 2KLGA 4GXBA 2BWFA 1GG3A 3P2BA 2CR5A 1HE8A 2BWES 2K8BA 1WXSA 3QK0A 4KSKC 4W9JA 4WJQA 2RGFA 3KVFB 3M3JA 1E8ZA 3VDZA 1AARA 3GOEA 2MSED 3DBLI 3DBRI 2KVRA 3W1SA 4FHKA 1WGHA 4E71A 2LZ6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CHK A;  2DAJ A;  2XK5 B;  4OVV A;  3V6C B;  1C3T A;  4TKN A;  3ZDT A;  5IA7 A;  2BKR B;  2NBV B;  2HTH A;  2LRU A;  5DPT A;  2JRI B;  2KX3 A;  3PSE B;  4HJK A;  4ICV A;  4JL9 A;  4W9L A;  1KM7 A;  1WR6 E;  2DZJ A;  1P9D U;  2D07 B;  2K25 A;  2M17 A;  2DZK A;  3DVG Y;  4BOS C;  4FJV B;  1OGW A;  3ML8 A;  4AWJ A;  4ZDV A;  1GC6 A;  4M8N A;  4NAW A;  1P98 A;  2Y5B B;  4XX5 A;  4EEW A;  4I6N B;  2KLC A;  1GUA B;  2NBU A;  3JSV B;  2FID A;  4GU2 A;  2MA9 B;  3U8Z A;  2V4L A;  3UF8 A;  3JW0 X;  2GBJ A;  1WXV A;  4KVG B;  4W9I A;  4IM2 A;  2KO3 A;  1WX9 A;  4MSQ B;  2EMT A;  1WJ6 A;  2VRR B;  1KLV A;  2K6Q A;  1S3S G;  5CHF A;  3PVL A;  3QC8 B;  3O65 B;  4IWP A;  1P0R A;  3TL5 A;  3IG3 A;  4JQW C;  4JIO U;  2KFK B;  2ZCC A;  3APD A;  1J0G A;  3Q3J A;  4RM9 A;  2J7Q B;  4K81 A;  4KIK B;  2HD5 B;  4WWP A;  3KH0 A;  3NOB A;  1TTN A;  1C1Y B;  2GBN A;  4MJS A;  2N7D A;  2MP2 B;  3BIN A;  3RD2 A;  2DHZ A;  1OTR B;  2FAZ A;  2G3Q B;  2IO2 B;  2PEA A;  1LM8 B;  3VFK A;  2C60 A;  1WE6 A;  2DAF A;  1KJT A;  2C7H A;  3VHT C;  3ZLZ A;  3PRM B;  3OAW A;  4EUT A;  2KWU B;  4AJW A;  4FN2 A;  4K7W A;  1I42 A;  2RD0 A;  3AUL A;  1J8C A;  3QWZ B;  3RUI B;  5AZH A;  2MQJ A;  2ZVN A;  2MLB A;  3ZVV A;  3R7R A;  1LXD A;  1EF1 A;  1UZX B;  3N32 A;  4PS3 A;  4LJO B;  4NQL B;  3SD5 A;  2LVP A;  2JZZ A;  1I35 A;  3VTV A;  3APF A;  1EUV B;  3N3K B;  3WAN A;  1LQB A;  3ECI A;  4DDG D;  3L54 A;  2PJH A;  4KZ0 A;  2WDT B;  3WIM A;  2JY6 A;  3H9D A;  4GDK B;  2IYD B;  5JZE B;  3UQA A;  4F7Z A;  4M0W B;  2ZPY A;  2XK5 A;  2KDB A;  2BF8 B;  3PRP B;  2IZV B;  2V3S A;  2LGX A;  4NPN A;  4IUM B;  1WIA A;  1ZGU B;  2MRP A;  2NPT B;  3PZD A;  4BKS D;  3S2A A;  3ZNI D;  2LJ5 A;  1EF5 A;  3QJZ A;  3VVW B;  1JRU A;  4DXA B;  2LAS A;  3R66 C;  2LVO A;  1YD8 U;  3QHT A;  4ICU A;  2WX0 A;  2GBR A;  3BY4 B;  1WXA A;  2L05 A;  2N9E B;  1XT9 B;  3A1Q B;  4BKT A;  4AUQ C;  1CMX B;  3ZNG C;  3AU4 A;  5G55 A;  2IO3 B;  2CS4 A;  4IW0 A;  3PLU A;  2R2Q A;  3K9P B;  5EDS A;  4KZC A;  3DBH I;  1RLF A;  2K8H A;  1T0Y A;  2BPS A;  1TZ1 A;  1NI2 A;  3UIN B;  3VUX A;  2L7R A;  4JLC A;  4IG7 B;  2JPH A;  2KJR A;  1ZKH A;  2CHX A;  4J6I A;  3U7D A;  4FA6 A;  1X1M A;  2JVC A;  2QHO A;  2C7N B;  3V60 A;  4W9K A;  4PS8 A;  2FCM A;  3DQV A;  3U30 A;  1YQB A;  4WJN A;  2KZR A;  3X23 A;  1QZE A;  4EZJ A;  5KHO A;  4G3X B;  4TQ0 A;  1UGM A;  3A9J B;  2REX A;  5AZG A;  2ZCB A;  2KWC A;  4DHJ B;  5L83 A;  3AU5 A;  1RFA A;  2IY1 B;  2KTF A;  3MHS D;  4MH0 E;  4A3O A;  2NBW B;  4FHJ A;  3TBL D;  2RPQ A;  1U4A A;  1E7U A;  3A9K A;  3CMM B;  3PS6 A;  3HHM A;  3QX1 A;  2L76 A;  1WMH B;  5DPR A;  3ZIM A;  1YX5 B;  4WQO B;  3L17 A;  4ZRI A;  1ISN A;  2O6V B;  1WI0 A;  4BBN C;  2MW5 A;  3EEC A;  1K8R B;  1WJU A;  4DDI D;  2YLM A;  3RUL A;  5J2R A;  5HKH A;  1WZ3 A;  4E3C A;  2JRH A;  3ZW3 A;  4FAD A;  2KMA A;  3NHE B;  3VTU A;  1TGZ B;  2MBH A;  1SGH A;  2WWZ A;  2IO1 B;  1UD7 A;  3EHV A;  2KDE B;  4GOC A;  4GDL B;  2O2V A;  5GMV A;  3OJ3 A;  1Q0W B;  2R2O A;  3WAO A;  3I3T B;  2RR9 A;  1SIF A;  4MSM B;  2LXC A;  2KQS A;  2G4S A;  3PLV A;  3EC8 A;  4IWO A;  2JZ3 B;  3PHW B;  4F1S A;  3L13 A;  2PE6 B;  2DZM A;  2KFJ A;  3KUC B;  5D6J B;  2L8J A;  4EZL A;  5LXH A;  3C0R B;  2MX2 A;  1WXM A;  2LVQ A;  4NY0 A;  3L16 A;  4BVU C;  2GBK A;  1G6J A;  2IY0 B;  2ZEQ A;  4EOY A;  3OJ4 B;  4WWN A;  5IAA C;  4RMA A;  5D7G A;  2FUH B;  1M94 A;  4HPL B;  5DPS A;  3TJP A;  1UEL A;  5J18 A;  3OLM D;  1MG8 A;  1WR1 A;  2HE7 A;  5DPW A;  1TBE A;  3IVF A;  2GOW A;  5D2M B;  1WZ0 A;  3VH3 B;  5C1Z A;  1WJN A;  4TQ1 A;  4WWO A;  4P7I A;  4K7S A;  4FJZ A;  2AL6 A;  2N1W A;  4NJ6 A;  3ALB A;  4DBG A;  4AJY B;  3MTN B;  2M8S A;  4CYE A;  3K9O B;  4K1R B;  2KJH B;  4WAA A;  4WJO A;  4MGK E;  2MBB B;  4HWI B;  3PV1 A;  3ZKJ C;  1WRD B;  3RZW C;  3A9J A;  3ZNZ B;  2DX5 B;  1WM2 A;  3RZF A;  4MM3 A;  3QQ8 B;  1P3Q U;  4II3 B;  4PS7 A;  4BOZ B;  3B08 A;  2PPH A;  4KSL C;  3M63 B;  4ASW C;  1H8C A;  4HCP B;  3H6N A;  4A20 A;  1EO6 A;  1V6E A;  5E6N A;  2C7M B;  4DK5 A;  1PQS A;  1V2Y A;  2NCN A;  3JYU A;  4HDO A;  2EKE C;  2KQ7 A;  1WMH A;  2KKC A;  1BT0 A;  3VQI A;  3TMP B;  3ZDM C;  3ZRC A;  2KXJ A;  1SE9 A;  5C23 A;  3B1L X;  4FUL A;  1WM3 A;  4EZK A;  3HM3 A;  5J17 A;  2MWS B;  1VD2 A;  2ZZP B;  2PE9 A;  3VAW A;  4GGQ A;  2BKF A;  3T8M A;  2XBB C;  1Q1O A;  3LDZ E;  2D11 A;  3W1S C;  1RAX A;  2I1K A;  3IFW B;  3N30 A;  2K6D B;  4AP4 C;  4DWF A;  3TCA A;  2FCS A;  2KHW B;  3WAM A;  4MEM A;  4I6L B;  1WGG A;  2FIF A;  2N9P C;  4KDL B;  4MGZ E;  3WA0 A;  2DYO A;  4IWQ A;  4MDK E;  4ZRJ A;  1WF9 A;  3CST A;  2JUO A;  2Z59 B;  2LGD A;  3RCZ A;  3PTF C;  4I6P A;  1V81 A;  3M95 A;  4FLH A;  4GDL A;  3ZTD A;  4W9F A;  2N4F A;  3PRE A;  4NAW B;  1UBI A;  3JSV A;  1R4N I;  3H1U A;  4HVB A;  2BYF A;  2KD0 A;  3NS8 A;  4WJP A;  1L2N A;  5JHA A;  3RT3 B;  1WGD A;  3PHX B;  4GB9 A;  2LI5 A;  2MBO A;  3NY5 A;  2MCN B;  2N1V A;  2UWQ A;  1Q5W B;  2W9N A;  1WX8 A;  3SU8 X;  4B95 A;  4YL8 A;  4HDQ A;  3AI5 A;  2AYO B;  3ZO5 B;  3HK0 A;  2FNJ B;  2KFK A;  2N9X A;  3AXC A;  4MGI E;  3ZRF A;  2A4Z A;  2KTR B;  2KC2 A;  3APC A;  3QAR A;  4CO7 A;  1Z5S B;  2L0T A;  3IBE A;  2LUE A;  2J0K A;  2L00 B;  3A33 B;  3H7P B;  4KIK A;  4W9H A;  4HCN B;  2NVU I;  5CTR C;  5TR5 A;  2K39 A;  5BO4 B;  2MP2 A;  4W9E A;  2C9W B;  2K8C A;  4XC2 A;  4W9C A;  2LD9 A;  4PYU A;  5CX3 A;  2YVC A;  1R4M I;  2ZPN A;  1YX6 B;  1KOT A;  2V1Y A;  3MJW A;  2JXX A;  2ZVO A;  4IC7 B;  3DPD A;  1E5W A;  3SHQ A;  4ANU A;  2CKH B;  2NS5 A;  5LXI B;  3HM6 X;  4M8M A;  2J0M A;  1WGY A;  3W1Y A;  1GC7 A;  4ZRK A;  4HXD A;  3DOW A;  4ANX A;  2ZNV B;  2MBE A;  3H7S A;  3VUW A;  2M4N A;  2AL3 A;  3D32 A;  4HPM B;  1YIW A;  2D3G A;  3DDC B;  4DHZ E;  1V9J A;  2K1F A;  4A3P A;  2CHZ A;  4N9F 4;  3DVN U;  4HLE A;  4LDT D;  4B9K A;  2ZNV C;  4GDK A;  3VTW A;  2GMI C;  2M0X A;  4NJ7 A;  1E8W A;  5JH5 C;  2IBI B;  4FJY A;  2G45 B;  1OEY A;  1RRB A;  2FCN A;  3ML9 A;  4HK2 A;  3UGB B;  2RSU A;  2FCQ A;  2NPT A;  2C5L C;  1IPG A;  1OEY J;  3T9L A;  4W9D A;  4GSW A;  1IYF A;  4ANW A;  1GJZ A;  2AEH A;  1WY8 A;  3ENE A;  3PT2 B;  4FBJ B;  5FR6 A;  1WX7 A;  4DHJ D;  3A1Q A;  1YJ1 A;  1NBF C;  4GN1 A;  1NDD A;  2AWT A;  3DVG X;  4E74 A;  1S1Q B;  1WH3 A;  2J0J A;  1E7V A;  4BFR A;  1WFY A;  5KHQ A;  3ONS A;  3R7Q A;  3ZNH B;  1IP9 A;  5E6O A;  3PGE A;  5E6P A;  3KW5 B;  3UIO B;  1J19 A;  2WX1 A;  1H4R A;  5D94 A;  2EMS A;  2O6V D;  3QAQ A;  3KYD D;  4PYZ A;  5AZF A;  5DCN A;  3WAP A;  3B0A A;  3CSF A;  3KUD B;  2B3A A;  2WYQ A;  4NNJ B;  3V62 A;  2KC1 A;  2KX0 A;  4II2 B;  2LRW A;  3L10 B;  2JF5 A;  1WYW B;  3EFU A;  2KWV B;  3V6E B;  4XZ4 A;  4BKG A;  3IHP C;  2KTR A;  5JHB A;  2Z0E B;  1WE7 A;  2ZJD A;  4GMV A;  4DHZ B;  3H7P A;  4TV3 A;  1WJ4 A;  4BBN F;  4EKU A;  2NR2 A;  2KNB A;  2BGF A;  1E8Y A;  4AOF A;  3A9K B;  1Y8R C;  2A5U A;  3HIZ A;  3QIJ A;  4G0N B;  1E90 A;  5G2N A;  3KYC D;  3VH4 B;  2CU1 A;  3VUY A;  4JGH B;  3UIP B;  1L7Y A;  2O6V A;  2D2Q A;  3L0W B;  3QCA A;  2I1J A;  4EFO A;  1D3Z A;  2D10 A;  2JWZ A;  2KMC A;  2KN5 A;  1V49 A;  2GBM A;  3X0W A;  1XQQ A;  4OVU A;  3JVZ X;  4B6W A;  4W9G A;  3KUZ A;  3SDL C;  4URK A;  5L95 C;  3PRZ A;  5CHW A;  1P1A A;  2KAN A;  3QA8 A;  4GIV A;  4MEL A;  1V5O A;  4F8C B;  2DZI A;  4ANV A;  3R3M A;  4TUU A;  2UYZ B;  2KDF B;  2DEN B;  1UBQ A;  4LJP B;  1VCB A;  3DVN V;  3UQB A;  1GNU A;  3Q3F A;  4IM0 A;  2Z0D B;  2ASQ A;  3DCG A;  2KJ6 A;  3LJ3 A;  1WGR A;  2O2V B;  3NZS A;  1Z2M A;  3WAL A;  3ZUN A;  2MBQ A;  1V80 A;  2KK8 A;  4K7U A;  3DBS A;  3NZU A;  4MGY E;  4NQK E;  1V86 A;  3VXW A;  3M62 B;  2XEW A;  2L3Z A;  3A4S C;  5LLI A;  1OQY A;  1ZW7 A;  2OJR A;  1E8X A;  2KOX A;  4KDI C;  1UH6 A;  3TIX A;  2DYB A;  3ZTC A;  1A5R A;  5AEK B;  2G4D B;  2M1M A;  2BYE A;  4X57 B;  1FXT B;  1XD3 B;  2KDI A;  4KV2 A;  1V5T A;  4LDT B;  2LXA A;  4ZYN A;  2CHW A;  4MJS B;  4IM3 A;  1F9J A;  2HJ8 A;  2LGY A;  4RM8 A;  4G50 A;  4G11 A;  3RYT A;  3PPA A;  5CHV C;  3L08 A;  1LFD A;  2DYM A;  3CF6 E;  2BYV E;  2JT4 B;  4BKS A;  2OOB B;  3A4R A;  2LWP A;  2IO0 B;  2L0F A;  4LCD E;  2N7E A;  3GZN I;  3V61 A;  2KLG A;  4GXB A;  2BWF A;  1GG3 A;  3P2B A;  2CR5 A;  1HE8 A;  2BWE S;  2K8B A;  1WXS A;  3QK0 A;  4KSK C;  4W9J A;  4WJQ A;  2RGF A;  3KVF B;  3M3J A;  1E8Z A;  3VDZ A;  1AAR A;  3GOE A;  2MSE D;  3DBL I;  3DBR I;  2KVR A;  3W1S A;  4FHK A;  1WGH A;  4E71 A;  2LZ6 A; 
#chains in the Genus database with same CATH topology
 2W82 A;  2XK5 B;  3HUI A;  3GE8 C;  4OVV A;  5HI1 A;  2B76 B;  1JAL A;  4TKN A;  5IA7 A;  1BML C;  2AQ3 B;  1C4A A;  2WU2 B;  3PSE B;  4HJK A;  1KM7 A;  1WR6 E;  3IT4 B;  1T3Q A;  2D07 B;  2M17 A;  3Q69 A;  3NJT A;  3DVG Y;  1SIJ A;  3ML8 A;  4AWJ A;  1KFY B;  2QEJ C;  3AE1 B;  2KYW A;  2Y5B B;  1ET6 A;  4XX5 A;  4YSY B;  4GU2 A;  2BS3 B;  1R4M B;  3U8Z A;  2GBJ A;  1L6V A;  4IM2 A;  4MSQ B;  3RNC C;  5CHF A;  3APD A;  4KIK B;  1OTR B;  2FAZ A;  1KJT A;  4KX6 B;  2KWU B;  1I42 A;  2RD0 A;  1J8C A;  2LHE A;  4M00 A;  3QWZ B;  4L23 A;  2MQJ A;  2JX5 A;  2MLB A;  2I2Y A;  3R7R A;  3AM9 A;  3N32 A;  4RCO A;  4NQL B;  3SD5 A;  2JZZ A;  1UWM A;  2WDT B;  2IYD B;  3N1Z C;  4F7Z A;  4M0W B;  2XK5 A;  2KDB A;  3PRP B;  1HEZ E;  1JRP A;  2MRP A;  2PKO A;  1EF5 A;  3R66 C;  2LVO A;  1YD8 U;  3QHT A;  5GXG B;  1WXA A;  2L05 A;  3A1Q B;  1XT9 B;  3I5J C;  3ZNG C;  1D6E C;  4IW0 A;  4OHJ A;  2R2Q A;  5FR3 A;  1Q10 A;  3DBH I;  2K8H A;  1TZ1 A;  1C76 A;  3NG0 A;  3VUX A;  2DWQ A;  3BII D;  1ZKH A;  2CHX A;  4OZB A;  3U30 A;  4WJN A;  3Q8E A;  4G3X B;  5FKA C;  5HHD G;  1E9M A;  2Y5P A;  2LHD A;  1ZUD 2;  2W55 A;  1WRI A;  1WYG A;  1TKE A;  4WQO B;  3L17 A;  2O6V B;  4BBN C;  3BWU D;  1K8R B;  3FIL B;  3TEW A;  4DDI D;  4FAD A;  3B9J A;  1SGH A;  1PUT A;  3HRD D;  3P42 A;  3EHV A;  4GOC A;  4M0W A;  1JCK B;  4GDL B;  1A70 A;  4YXD B;  2M19 A;  2O2V A;  4JPS A;  1Q0W B;  4ACF A;  2ICI A;  1DOX A;  5BMI A;  2R2O A;  3WAO A;  3I3T B;  1SIF A;  1RFK A;  3PLV A;  3EC8 A;  5AUI A;  2WXO A;  1RM6 C;  2MX2 A;  2PTL A;  1M4V A;  4Q2J A;  4B0E A;  4EOY A;  4WWN A;  2FUH B;  2AQ1 B;  3TJP A;  3SR6 A;  5J18 A;  3BK1 A;  2HE7 A;  2GOW A;  5D2M B;  1WZ0 A;  3VH3 B;  5C1Z A;  4K7S A;  4PK1 A;  1N63 A;  2AL6 A;  3ALB A;  3MTN B;  2M8S A;  4CYE A;  3AE2 B;  2MBB B;  3ZKJ C;  1WRD B;  3SFD B;  1VJK A;  2DX5 B;  1WM2 A;  1P3Q U;  3PZ8 A;  1B9R A;  4PS7 A;  1EU3 A;  1YQ4 B;  2WXR A;  4ZOH C;  3VR9 B;  1MHX A;  4A20 A;  1V6E A;  2C7M B;  4DK5 A;  1PQS A;  1V2Y A;  1I4H A;  2KQ7 A;  1F0Z A;  2MJE A;  1QF6 A;  3VQI A;  3TMP B;  2EEL A;  3ZRC A;  2GLS A;  3Q14 C;  2ZZP B;  2BKF A;  2XBB C;  1Q1O A;  3FIL A;  3ZXR A;  3GB1 A;  1WSP A;  4LLG M;  1V1O A;  1WGG A;  2N9P C;  4KDL B;  3WA0 A;  3I9V 1;  3RCZ A;  2J4X A;  3PTF C;  4GDL A;  2DNF A;  4DQO C;  3PRE A;  4NAW B;  4JX1 C;  3NS1 A;  4NAM A;  1UGJ A;  2KN4 A;  2EKI A;  2KT7 A;  2OHF A;  2MBO A;  1TJE A;  2N1V A;  2UWQ A;  3ZJU A;  4HPP A;  4OVZ A;  4UDU C;  3SU8 X;  2QCZ A;  2JXT A;  4XYC A;  1N6Z A;  2KFK A;  3AXC A;  4XDD A;  3APC A;  1EM7 A;  1JWM D;  3IBE A;  2L0T A;  2J0K A;  2L00 B;  2LUE A;  3H7P B;  3A33 B;  3GE3 C;  3BYY B;  5TR5 A;  2MP2 A;  2QDF A;  1NEK B;  1ZXH A;  2X38 A;  4PYU A;  1J7C A;  5CX3 A;  1DGJ A;  1YX6 B;  3W9C B;  4IC7 B;  5LXI B;  3HM6 X;  3CIR B;  2J0M A;  4M8M A;  4C4V A;  4C7Z A;  2WXH A;  2ZNV B;  1TS4 A;  1SJH D;  4N9F 4;  3DVN U;  4C00 A;  4B9K A;  2ZNV C;  1C4P A;  2M0X A;  3DBH B;  5JH5 C;  2H88 B;  3L4P A;  1R7S A;  4FJY A;  4DXF A;  4RF1 A;  2FCQ A;  2C5L C;  4GSW A;  1CQV A;  1QOG A;  3GZN B;  3Q8B A;  4GN1 A;  3AV8 A;  1S1Q B;  4BFR A;  1WFY A;  1DYQ A;  3PGE A;  5E6P A;  3E9S A;  4RGT A;  2VH2 A;  3KWV A;  5BYR A;  1FPY A;  3V62 A;  3L10 B;  3R8B A;  1SE3 A;  4XZ4 A;  5G5G A;  1WE7 A;  2YEP F;  4GMV A;  4DHZ B;  3H7P A;  1FEH A;  1VZ7 A;  3P4S B;  4AOF A;  3A9K B;  3SFE B;  3HIZ A;  3VH4 B;  1E90 A;  3RNF C;  4JGH B;  3CWI A;  2NTS A;  3LXF A;  5MPO A;  2D10 A;  2M0A A;  4IKG A;  1V49 A;  3JVZ X;  2ZW1 A;  3SDL C;  4URK A;  3Q3O C;  5CHW A;  4GIV A;  4S0R A;  1JQ4 A;  4P1C C;  2BTE A;  2R61 A;  2ASQ A;  3W5V B;  1MI0 A;  2MBQ A;  1FMA D;  1V80 A;  2D3B A;  4USA A;  1V86 A;  3IT6 B;  2Q5W D;  3A4S C;  3BYT B;  5LLI A;  2OJR A;  1RYJ A;  1UH6 A;  2QMT A;  1GB4 A;  5BYQ A;  1QOB A;  1A5R A;  3V3X A;  5AEK B;  2G4D B;  4X57 B;  1XD3 B;  4KV2 A;  2LGS A;  2LXA A;  3R2T A;  1ZP0 B;  3MFG A;  4RM8 A;  1ACC A;  3L08 A;  2DYM A;  3RNA C;  1L0X B;  2L1A A;  2LWP A;  2BWF A;  3QK0 A;  2K8B A;  4WJQ A;  2L32 A;  3KVF B;  2GI9 A;  4MM3 B;  4AQ7 A;  4OZC A;  1WXQ A;  3VDZ A;  1MHH E;  2JQR B;  4H2A A;  1ZXI A;  1C78 A;  2CU3 A;  1FD6 A;  2KVR A;  3W1S A;  3MHZ A;  1F2R I;  1ZPS A;  4LNF A;  2LUM A;  3RMK C;  3ZDT A;  2BKR B;  5DPT A;  2HTH A;  2LRU A;  2KX3 A;  4JL9 A;  3U4E G;  2DZJ A;  2DZK A;  1OGW A;  4ZDV A;  4N6E B;  3LYY A;  4AS1 A;  4RF0 A;  2NBU A;  2FID A;  1HQR D;  3NRZ A;  2MA9 B;  1FO4 A;  3J9C A;  2LEK A;  2KO3 A;  2VRR B;  2W3S A;  1S3S G;  3PVL A;  2V3N A;  3TL5 A;  3IG3 A;  4JQW C;  4JIO U;  1I7H A;  1MPE A;  4N59 A;  1J0G A;  4RM9 A;  2N7J A;  1N5X A;  2HD5 B;  5D3I B;  3KWL A;  3KH0 A;  3VRB B;  1TTN A;  1C1Y B;  2GBN A;  2XN9 C;  2WQY B;  1D5Z C;  2N7D A;  3RD2 A;  2G3Q B;  2PEA A;  1XO3 A;  1WE6 A;  2C7H A;  3RFZ B;  4AJW A;  1N5W A;  1SE2 A;  4LJO B;  2N0S B;  3VTV A;  1EUV B;  3N3K B;  3L54 A;  2PJH A;  1YN5 A;  4GDK B;  3UQA A;  4JWU C;  2BF8 B;  1V97 A;  1NEN B;  4IUM B;  1WIA A;  1VLB A;  1ZGU B;  2NPT B;  3PZD A;  3ZNI D;  1TYG B;  3HVZ A;  2WDQ B;  3DHG C;  2N9E B;  4AUQ C;  1PGA A;  3AU4 A;  2CS4 A;  5EDS A;  2WXL A;  1T0Y A;  1FNV A;  1KF6 B;  1NI2 A;  5G5H A;  4J3O D;  2K5P A;  5H92 C;  1CK1 A;  4KKJ A;  2KJR A;  4J6I A;  3U7D A;  4FA6 A;  1X1M A;  3V60 A;  4W9K A;  3DQV A;  1YQB A;  3AEF B;  5KHO A;  1UGM A;  3A9J B;  1SBB B;  4RNA A;  3IAM 1;  2KWC A;  3MHS D;  1RFA A;  2YEP B;  1K50 A;  4MH0 E;  2GB1 A;  3TBL D;  1ISN A;  1WI0 A;  2K22 A;  3PO0 A;  3P4Q B;  3RUL A;  2BW2 A;  2MJD A;  2JRH A;  3ZW3 A;  3NHE B;  1J7A A;  3EFC A;  3NZ3 A;  2PVG C;  5GMV A;  2ONQ A;  2VZK D;  4L1B A;  2LXC A;  2KQS A;  4IWO A;  4F1S A;  2PE6 B;  5LXH A;  1LGR A;  3C0R B;  3P63 A;  2GBK A;  3BZD B;  2IY0 B;  5IAA C;  2TSS A;  3GS2 A;  1WR1 A;  2L83 A;  1I4X A;  1VZ8 A;  2PVO D;  1WJN A;  2NTT A;  4QAY A;  4FJZ A;  1C77 A;  4NJ6 A;  4WAA A;  4HWI B;  1F2R C;  3A9J A;  3ZNZ B;  3N20 C;  3RZF A;  4P6V F;  4K3B A;  4II3 B;  1N62 A;  5IP4 D;  3M63 B;  4US8 A;  1UWX A;  5E6N A;  4HDO A;  2EKE C;  1WGK A;  3FKY A;  2KXJ A;  2FE8 A;  1WM3 A;  4EZK A;  3HM3 A;  5J17 A;  1VD2 A;  3LDZ E;  1RAX A;  2K6D B;  3EUB 2;  4MEM A;  3GP7 A;  4I6L B;  1T0Q C;  2DYO A;  4IWQ A;  4ZRJ A;  2WDV B;  2JUO A;  2LGD A;  2FBW B;  1ROE A;  3AEE B;  3T3N A;  1QT9 A;  1UBI A;  4PT5 A;  3TEY A;  1R4N I;  3NS8 A;  4RGM A;  4P1B C;  5JHA A;  4GB9 A;  2MCN B;  4C7Y A;  2W9N A;  1ESF A;  3ZO5 B;  2V4I B;  3ZRF A;  2KTR B;  3QAR A;  3VVW B;  4KIK A;  1E0Z A;  1XF5 L;  2NVU I;  2K9X A;  5BO4 B;  4W9E A;  4WWM A;  2C9W B;  2LD9 A;  2RMM A;  1FXA A;  3IXS A;  1AN8 A;  2CKH B;  2NS5 A;  1GC7 A;  4ZRK A;  3D32 A;  4ZRQ A;  4XWT A;  2LMC A;  4DHZ E;  2K1F A;  4A3P A;  2WU5 B;  2CHZ A;  2V9H A;  4LDT D;  3NVZ A;  3VTW A;  1IGC A;  2IBI B;  2IGH A;  1FRR A;  1RRB A;  2BS4 B;  3BK2 A;  4OW0 A;  3MC0 B;  2BVC A;  3LB8 C;  4W9D A;  2NMQ A;  2ZW0 A;  4TMA B;  2VH1 A;  4DHJ D;  3A1Q A;  1I4R A;  5I4D A;  1WH3 A;  5T8I A;  4HKQ A;  1HA5 A;  1J19 A;  2MH7 A;  5D94 A;  3QAQ A;  3KYD D;  4LNO A;  3CSF A;  2CJN A;  2B3A A;  2WYQ A;  4HRS A;  4NNJ B;  2MJ3 A;  2KC1 A;  2KX0 A;  2LRW A;  2JF5 A;  3EFU A;  3TUO A;  2KWV B;  4LK0 M;  3V6E B;  4ITK A;  3TSS A;  4BKG A;  2KTR A;  3W5U B;  2ZJD A;  5E6J A;  3C19 A;  3AB5 A;  1SJE D;  3BVG A;  3V05 A;  1QOA A;  4EKU A;  3NVV A;  1XCQ L;  1Y8R C;  2A5U A;  4G0N B;  4S17 A;  3I63 C;  2WNM A;  3QCA A;  2O6V A;  3ZXV A;  2WXG A;  1C4C A;  2JWZ A;  3MC8 A;  3RNB C;  4B6W A;  1XQQ A;  4OVU A;  3Q8C A;  2JYE A;  5BMH A;  2KAN A;  3QA8 A;  1L0V B;  1V5O A;  3AE3 B;  4F8C B;  2DZI A;  4WUR A;  4DXG A;  2AQ2 B;  1AYF A;  1GNU A;  2X8X X;  2Z0D B;  1KTK A;  1Z2M A;  3WAL A;  1K52 A;  4K7U A;  4MGY E;  4NQK E;  1QLB B;  3M62 B;  2XEW A;  4FXC A;  2KDM A;  1E8X A;  3TIX A;  1FXT B;  3MC9 A;  3ZJT A;  4LDT B;  1T5X D;  1OQQ A;  4IM3 A;  2LGY A;  3RYT A;  4LTU A;  5CHV C;  1LFD A;  1MFW A;  1JW9 D;  1DOI A;  2OOB B;  4LCD E;  2KLG A;  4GXB A;  2PW9 A;  4A90 A;  2CR5 A;  1VZ6 A;  2J52 A;  1YN3 A;  1WXS A;  4KSK C;  2ON8 A;  4W9J A;  4ARC A;  1E8Z A;  3GOE A;  1T0R C;  2MSE D;  3N9Y C;  3DBL I;  3DBR I;  3HVD A;  1WGH A;  1OFF A;  3VR8 B;  1GB1 A;  2LZ6 A;  4CHK A;  1R4N B;  2Y5C A;  3V6C B;  1T0S C;  2JRI B;  3ZGZ A;  4ICV A;  4W9L A;  4KKI A;  1P9D U;  2K25 A;  2D3C A;  4NAW A;  5JXV A;  2KLC A;  1GUA B;  3FC4 A;  1HTO A;  3JSV B;  3U52 E;  2V4L A;  3UF8 A;  3JW0 X;  2WGS A;  1WXV A;  3AEA B;  4KVG B;  4W9I A;  2JU6 X;  1WX9 A;  1WJ6 A;  2OED A;  1FFV A;  4XWW A;  2MEK A;  3IAS 1;  2K6Q A;  3MJ5 A;  3QC8 B;  3O65 B;  2ZCC A;  4NZL B;  3AH7 A;  3UI3 A;  3WCQ A;  2DHZ A;  1LM8 B;  3N1X C;  2C60 A;  2G1E A;  2DAF A;  1ZDV A;  3VHT C;  3ZLZ A;  3PRM B;  4A55 A;  3ZJV A;  4FN2 A;  4K7W A;  3AUL A;  4ZHP A;  3ABV B;  3RUI B;  2KWD A;  3ZVV A;  1LXD A;  1EF1 A;  1UZX B;  2W54 A;  3WAN A;  1LQB A;  4JE3 B;  1VDV A;  2JY6 A;  1STE A;  3H9D A;  1XLO A;  2UU7 A;  2IZV B;  2V3S A;  2LGX A;  4BKS D;  1JRU A;  3AE8 B;  4KGS A;  2LAS A;  1IBX B;  4ICU A;  2GBR A;  4BKT A;  1CMX B;  1K53 A;  5G55 A;  2IO3 B;  4MT5 A;  2WXM A;  3PLU A;  2WXP A;  2BYT A;  2PLP A;  2BPS A;  3UIN B;  1TS3 A;  3Q8F A;  4JLC A;  3RNG C;  4IG7 B;  3MP9 A;  2JVC A;  2QHO A;  2C7N B;  3X23 A;  4EZJ A;  2K3U A;  3AE6 B;  4YT0 B;  5L83 A;  3AU5 A;  2LGI A;  2NBW B;  1U4A A;  3A9K A;  2WP9 B;  3CMM B;  3PS6 A;  3QX1 A;  5DPR A;  3RI7 C;  1YX5 B;  4N58 A;  4ZRI A;  1F1H A;  1FCC C;  2MW5 A;  3EEC A;  2XNA C;  1WJU A;  5J2R A;  5HKH A;  1SXT A;  1YOV B;  3ZQ4 A;  2BQQ A;  1C79 A;  2WWZ A;  2QIL A;  3AE9 B;  1C9F A;  2WXJ A;  2IO1 B;  1UD7 A;  2E6X A;  1TKY A;  4YSZ B;  3OJ3 A;  4MSM B;  1V8C A;  2JZ3 B;  4ARI A;  2DZM A;  2KFJ A;  4EZL A;  1WXM A;  2LVQ A;  3TEZ A;  3L16 A;  2ZEQ A;  3AE7 B;  3OJ4 B;  4B0M A;  2LJI A;  1M94 A;  5HFY A;  1UEL A;  1E6E B;  2BB5 A;  3OLM D;  3DBL B;  1MG8 A;  1TBE A;  2IND C;  3IVF A;  3OG5 A;  4WWO A;  1NYQ A;  2PMV A;  4DBG A;  2N1W A;  1CJE A;  4AJY B;  3K9O B;  2BB6 A;  1E10 A;  1FNW A;  3DHI C;  3PV1 A;  3RZW C;  5IKC M;  4RFB A;  3KLS X;  4MM3 A;  3QQ8 B;  4XDC A;  2QJL A;  3B08 A;  4KSL C;  4ASW C;  5C3J B;  2NCN A;  1SSN A;  3ZDM C;  1SE9 A;  5C23 A;  3B1L X;  4FUL A;  2MWS B;  4GGQ A;  2D11 A;  2I1K A;  3IFW B;  3N30 A;  4LNK A;  4DWF A;  3TCA A;  2KHW B;  2JSV X;  3WAM A;  1NYR A;  2MHJ A;  4MDK E;  1WF9 A;  3CST A;  2Z59 B;  1V81 A;  3M95 A;  4FLH A;  1K51 A;  2N4F A;  2W3R A;  4HVB A;  4M01 A;  1WGD A;  5EE0 A;  3NY5 A;  1Q5W B;  5C2T B;  2BT6 A;  4B95 A;  4HDQ A;  3AI5 A;  3HK0 A;  2FNJ B;  2N9X A;  4MGI E;  5IN7 A;  3Q3M C;  1Z5S B;  1J7B A;  3FAH A;  4HCN B;  1T6B X;  5CTR C;  2CJO A;  2K8C A;  4XC2 A;  4W9C A;  1DOY A;  1MVK A;  2YVC A;  2ZPN A;  1I4P A;  3MJW A;  2ZVO A;  3DPD A;  2QC8 A;  1E5W A;  3SHQ A;  2RDH A;  4YTN B;  3P4R B;  3W1Y A;  4ANX A;  4HXD A;  1GOZ A;  3VUW A;  2MBE A;  2M4N A;  2D3G A;  4GDK A;  4LNI A;  2GMI C;  2RPV A;  4NJ7 A;  1E8W A;  1TT5 B;  5IO9 A;  4US9 A;  2G45 B;  1OEY A;  2FCN A;  3ML9 A;  4HK2 A;  3UGB B;  2NPT A;  1IPG A;  1D5X C;  1JRO A;  1OEY J;  3T9L A;  1IYF A;  4ANW A;  1WWT A;  2J53 A;  3ENE A;  3PT2 B;  5FR6 A;  4YSX B;  1YJ1 A;  2WXN A;  1NDD A;  2AWT A;  3DVG X;  1D4B A;  4E74 A;  2J0J A;  1E7V A;  4R3D A;  5E6O A;  3BVZ A;  3KW5 B;  3UIO B;  4EE2 A;  2M56 B;  1XLP A;  2N9K A;  2O6V D;  4PYZ A;  3WAP A;  1LO5 D;  3KUD B;  2KQ4 X;  1PGX A;  3Q2A C;  4WAF A;  1NI3 A;  2WXI A;  2Z0E B;  4TV3 A;  1L6U A;  3N1Y C;  1SB3 C;  2NR2 A;  1E8Y A;  1TS5 A;  3QIJ A;  5G2N A;  3DWG C;  3KYC D;  1VR9 A;  1L7Y A;  3L0W B;  1QKZ A;  2D2Q A;  4EFO A;  1D3Z A;  3EA6 A;  3BVM A;  2KN5 A;  1ZE3 D;  4LNN A;  3X0W A;  2GBM A;  3KUZ A;  2AX5 A;  2FUG 1;  4MEL A;  5AUK A;  4XE0 A;  3R3M A;  4TUU A;  2UYZ B;  2KDF B;  2DEN B;  1UBQ A;  3RN9 C;  4CQN A;  2RDG A;  3Q3F A;  1PGB A;  4IM0 A;  3DCG A;  1L0Y B;  2KJ6 A;  3LJ3 A;  5LNK 1;  2O2V B;  1AWD A;  2KK8 A;  3NZU A;  1MJD A;  4C80 A;  3VXW A;  2L3Z A;  1ZW7 A;  2KOX A;  4RGN A;  1FNU A;  1FM0 D;  1TKG A;  4A8X C;  1GPX A;  2KDI A;  1SF0 A;  1V5T A;  4ZRP A;  1PFD A;  4ZYN A;  4MJS B;  1F9J A;  2N9L A;  3U2S C;  4G50 A;  3PPA A;  2WXF A;  1HZ6 A;  1YN4 A;  1ET9 A;  2VZK B;  2BYV E;  2JT4 B;  3A4R A;  1QQR A;  2IO0 B;  3ZYY X;  2N7E A;  3GZN I;  1IGD A;  4P16 A;  1GG3 A;  3P2B A;  2RGF A;  3NVW A;  3SEB A;  1KH0 A;  3O13 A;  4ZYS A;  5EE3 A;  2INP E;  4XGA B;  4FHK A;  4REZ A;  2JZP A;  1CZP A;  4E71 A;  2DAJ A;  4YWG G;  2H89 B;  3U7Z A;  2LFI A;  1C3T A;  1MG4 A;  1YJJ A;  2NBV B;  1AW7 A;  4BOS C;  1JWB D;  4FJV B;  3B2G A;  1B1Z A;  1GC6 A;  1I4Q A;  2IGG A;  4M8N A;  1P98 A;  4EEW A;  4I6N B;  2SEB D;  2E3T A;  1EWC A;  2EMT A;  3VRA B;  1KLV A;  2WXK A;  3RNE C;  5EE1 A;  3NUH B;  4GLS C;  1P0R A;  4IWP A;  3URY A;  1XCT L;  1D5M C;  2KFK B;  2I38 A;  3Q3J A;  2J7Q B;  4K81 A;  4WWP A;  3NOB A;  1FRD A;  4MJS A;  2MP2 B;  3BIN A;  2L52 A;  2IO2 B;  3VFK A;  5BMG A;  3OAW A;  4EUT A;  2V3P A;  5AZH A;  2ZVN A;  4JWS C;  4C4V B;  1SE4 A;  4PS3 A;  1JWS D;  2OJW A;  2LVP A;  2V0G A;  1I35 A;  3APF A;  3ECI A;  4DDG D;  1TY0 A;  4KZ0 A;  3AE5 B;  3WIM A;  4HEA 1;  1YQ3 B;  5JZE B;  1HTQ A;  2ZPY A;  1PDX A;  4ZHO A;  4NPN A;  1TY2 A;  3S2A A;  2LJ5 A;  3QJZ A;  4DXA B;  4YTM B;  2KAC A;  1N60 A;  2WX0 A;  1JWU D;  3BY4 B;  4RGO S;  3PZ7 A;  2DLB A;  4D2K A;  1P7F A;  1IUE A;  3K9P B;  4KZC A;  1RLF A;  1OQR A;  3ETR A;  3P1M A;  4MH8 A;  2L7R A;  1ZDX A;  2JPH A;  1N61 A;  3AMZ A;  4A6Q A;  4PS8 A;  2FCM A;  1UUP A;  2KZR A;  1QZE A;  4IOI E;  4TQ0 A;  2REX A;  2INN E;  5AZG A;  2ZCB A;  4DHJ B;  4WH4 A;  2IY1 B;  2KTF A;  2WXQ A;  4C56 C;  4A3O A;  1V1P B;  4FHJ A;  1KLU D;  2RPQ A;  1E7U A;  4WQM A;  3HHM A;  4KGR A;  2L76 A;  1WMH B;  3ZIM A;  1P7E A;  1E7P B;  2IJ0 A;  4WIP A;  3P4P B;  2INC C;  2YLM A;  1WZ3 A;  4E3C A;  1KLG D;  2KMA A;  3VTU A;  1TGZ B;  1XLN A;  2MBH A;  1TZO A;  2KDE B;  2Y3A A;  2HDE A;  4K3C A;  2KAJ A;  2ACZ B;  2RR9 A;  2G4S A;  5TSS A;  3PHW B;  3L13 A;  3KUC B;  5D6J B;  3R2I A;  2L8J A;  4NY0 A;  4BVU C;  1G6J A;  1QOF A;  1TIF A;  2PIA A;  4RMA A;  5D7G A;  5IOI A;  2J42 A;  4HPL B;  5DPS A;  1YJI A;  5DPW A;  2D3A A;  4TQ1 A;  2WLB A;  4P7I A;  2WDR B;  3Q6B A;  1HZ5 A;  4K1R B;  2KJH B;  4WJO A;  4MGK E;  4BOZ B;  2PPH A;  1H8C A;  4HCP B;  3H6N A;  1EO6 A;  3C8Y A;  1V1P A;  3JYU A;  3EGR A;  1WMH A;  2GRI A;  2KKC A;  1BT0 A;  1XLQ A;  2G9H D;  4TSS A;  2PE9 A;  3VAW A;  3T8M A;  3TEX A;  3W1S C;  4AP4 C;  4A9A A;  2FCS A;  2FIF A;  1FCL A;  4MGZ E;  1L5P A;  1KRH A;  2IGD A;  4I6P A;  3ZTD A;  4W9F A;  2HJ1 A;  3JSV A;  3H1U A;  2BYF A;  2KD0 A;  4WJP A;  1L2N A;  3RT3 B;  3PHX B;  1ENF A;  2LI5 A;  1QIL A;  1XXG A;  4IDI A;  1WX8 A;  3AEB B;  4YL8 A;  5EE9 A;  2AYO B;  2IDY A;  2A4Z A;  4CO7 A;  2KC2 A;  5H8Y E;  2D5G A;  2IPK D;  1FXI A;  2WS3 B;  1EU4 A;  4W9H A;  2K39 A;  3E56 A;  3AED B;  3NVY A;  1R4M I;  3AEG B;  1KOT A;  3AN1 A;  2V1Y A;  3AE4 B;  2JXX A;  2Z8L A;  2BBC A;  4ANU A;  5FK9 C;  1BXT A;  1HXY D;  4HKZ E;  3I57 A;  1WGY A;  1JWA D;  3DOW A;  2SAK A;  3H7S A;  2AL3 A;  3Q3N C;  4HPM B;  1YIW A;  3DDC B;  3KQ4 A;  1V9J A;  4HLE A;  1F52 A;  1ZOY B;  4HJG E;  5HG2 A;  2JYT A;  1RWS A;  2RSU A;  1FFU A;  1UNS A;  4L2Y A;  3B2F A;  1GJZ A;  2AEH A;  1WY8 A;  1IBX A;  4FBJ B;  2K0P A;  1WX7 A;  1BUI C;  1NBF C;  1FIQ A;  3DWM A;  1YNT E;  2HTM E;  5KHQ A;  3ONS A;  3R7Q A;  3ZNH B;  4BAX A;  1IP9 A;  1GAQ B;  3DBR B;  3OWE B;  2WX1 A;  1H4R A;  3DHH C;  2EMS A;  2KMM A;  5AZF A;  5DCN A;  3B0A A;  1I4G A;  4II2 B;  3T3O A;  1WYW B;  3H8H A;  3W2D A;  1YMH E;  1F77 A;  3IHP C;  5JHB A;  4YTP B;  1WJ4 A;  4BBN F;  5BYS A;  2QSD A;  2KNB A;  4BZA A;  2BGF A;  3VUY A;  2CU1 A;  2KVZ A;  3UIP B;  4MAC A;  2I1J A;  2KMC A;  3Q8A A;  4NJC A;  1XEE A;  4W9G A;  5L95 C;  3PRZ A;  1P1A A;  4RH6 A;  2DBY A;  4ANV A;  2RDB C;  1L4D B;  4LJP B;  1VCB A;  3AEC B;  3DVN V;  3UQB A;  1NVI D;  4OZA A;  1WGR A;  3NZS A;  1PYW D;  1VRA B;  3ZUN A;  1TS2 A;  3DBS A;  1OQY A;  4KDI C;  1EWY C;  2JWU A;  2DYB A;  3RPF C;  3ZTC A;  2M1M A;  1Y56 A;  2BYE A;  2CHW A;  4KGT A;  2HJ8 A;  1JML A;  5D3D A;  4G11 A;  2BS2 B;  3CF6 E;  4BKS A;  1L4Z B;  2L0F A;  2WHI A;  3V61 A;  4M02 A;  1UF0 A;  1HE8 A;  2BWE S;  4O1N A;  3M3J A;  1AAR A;  4HRO A;  1SEB D;  2QIE B; 
#chains in the Genus database with same CATH homology
 4CHK A;  2DAJ A;  2XK5 B;  4OVV A;  3V6C B;  1C3T A;  4TKN A;  3ZDT A;  5IA7 A;  2BKR B;  2NBV B;  2HTH A;  2LRU A;  5DPT A;  2JRI B;  2KX3 A;  3PSE B;  4HJK A;  4ICV A;  4JL9 A;  4W9L A;  1KM7 A;  1WR6 E;  2DZJ A;  1P9D U;  2D07 B;  2K25 A;  2M17 A;  2DZK A;  3DVG Y;  4BOS C;  4FJV B;  1OGW A;  3ML8 A;  4AWJ A;  4ZDV A;  1GC6 A;  4M8N A;  4NAW A;  1P98 A;  2Y5B B;  4XX5 A;  4EEW A;  4I6N B;  2KLC A;  1GUA B;  2NBU A;  3JSV B;  2FID A;  4GU2 A;  2MA9 B;  3U8Z A;  2V4L A;  3UF8 A;  3JW0 X;  2GBJ A;  1WXV A;  4KVG B;  4W9I A;  4IM2 A;  2KO3 A;  1WX9 A;  4MSQ B;  2EMT A;  1WJ6 A;  2VRR B;  1KLV A;  2K6Q A;  1S3S G;  5CHF A;  3PVL A;  3QC8 B;  3O65 B;  4IWP A;  1P0R A;  3TL5 A;  3IG3 A;  4JQW C;  4JIO U;  2KFK B;  2ZCC A;  3APD A;  1J0G A;  3Q3J A;  4RM9 A;  2J7Q B;  4K81 A;  4KIK B;  2HD5 B;  4WWP A;  3KH0 A;  3NOB A;  1TTN A;  1C1Y B;  2GBN A;  4MJS A;  2N7D A;  2MP2 B;  3BIN A;  3RD2 A;  2DHZ A;  1OTR B;  2FAZ A;  2G3Q B;  2IO2 B;  2PEA A;  1LM8 B;  3VFK A;  2C60 A;  1WE6 A;  2DAF A;  1KJT A;  2C7H A;  3VHT C;  3ZLZ A;  3PRM B;  3OAW A;  4EUT A;  2KWU B;  4AJW A;  4FN2 A;  4K7W A;  1I42 A;  2RD0 A;  3AUL A;  1J8C A;  3QWZ B;  3RUI B;  5AZH A;  2MQJ A;  2ZVN A;  2MLB A;  3ZVV A;  3R7R A;  1LXD A;  1EF1 A;  1UZX B;  3N32 A;  4PS3 A;  4LJO B;  4NQL B;  3SD5 A;  2LVP A;  2JZZ A;  1I35 A;  3VTV A;  3APF A;  1EUV B;  3N3K B;  3WAN A;  1LQB A;  3ECI A;  4DDG D;  3L54 A;  2PJH A;  4KZ0 A;  2WDT B;  3WIM A;  2JY6 A;  3H9D A;  4GDK B;  2IYD B;  5JZE B;  3UQA A;  4F7Z A;  4M0W B;  2ZPY A;  2XK5 A;  2KDB A;  2BF8 B;  3PRP B;  2IZV B;  2V3S A;  2LGX A;  4NPN A;  4IUM B;  1WIA A;  1ZGU B;  2MRP A;  2NPT B;  3PZD A;  4BKS D;  3S2A A;  3ZNI D;  2LJ5 A;  1EF5 A;  3QJZ A;  3VVW B;  1JRU A;  4DXA B;  2LAS A;  3R66 C;  2LVO A;  1YD8 U;  3QHT A;  4ICU A;  2WX0 A;  2GBR A;  3BY4 B;  1WXA A;  2L05 A;  2N9E B;  1XT9 B;  3A1Q B;  4BKT A;  4AUQ C;  1CMX B;  3ZNG C;  3AU4 A;  5G55 A;  2IO3 B;  2CS4 A;  4IW0 A;  3PLU A;  2R2Q A;  3K9P B;  5EDS A;  4KZC A;  3DBH I;  1RLF A;  2K8H A;  1T0Y A;  2BPS A;  1TZ1 A;  1NI2 A;  3UIN B;  3VUX A;  2L7R A;  4JLC A;  4IG7 B;  2JPH A;  2KJR A;  1ZKH A;  2CHX A;  4J6I A;  3U7D A;  4FA6 A;  1X1M A;  2JVC A;  2QHO A;  2C7N B;  3V60 A;  4W9K A;  4PS8 A;  2FCM A;  3DQV A;  3U30 A;  1YQB A;  4WJN A;  2KZR A;  3X23 A;  1QZE A;  4EZJ A;  5KHO A;  4G3X B;  4TQ0 A;  1UGM A;  3A9J B;  2REX A;  5AZG A;  2ZCB A;  2KWC A;  4DHJ B;  5L83 A;  3AU5 A;  1RFA A;  2IY1 B;  2KTF A;  3MHS D;  4MH0 E;  4A3O A;  2NBW B;  4FHJ A;  3TBL D;  2RPQ A;  1U4A A;  1E7U A;  3A9K A;  3CMM B;  3PS6 A;  3HHM A;  3QX1 A;  2L76 A;  1WMH B;  5DPR A;  3ZIM A;  1YX5 B;  4WQO B;  3L17 A;  4ZRI A;  1ISN A;  2O6V B;  1WI0 A;  4BBN C;  2MW5 A;  3EEC A;  1K8R B;  1WJU A;  4DDI D;  2YLM A;  3RUL A;  5J2R A;  5HKH A;  1WZ3 A;  4E3C A;  2JRH A;  3ZW3 A;  4FAD A;  2KMA A;  3NHE B;  3VTU A;  1TGZ B;  2MBH A;  1SGH A;  2WWZ A;  2IO1 B;  1UD7 A;  3EHV A;  2KDE B;  4GOC A;  4GDL B;  2O2V A;  5GMV A;  3OJ3 A;  1Q0W B;  2R2O A;  3WAO A;  3I3T B;  2RR9 A;  1SIF A;  4MSM B;  2LXC A;  2KQS A;  2G4S A;  3PLV A;  3EC8 A;  4IWO A;  2JZ3 B;  3PHW B;  4F1S A;  3L13 A;  2PE6 B;  2DZM A;  2KFJ A;  3KUC B;  5D6J B;  2L8J A;  4EZL A;  5LXH A;  3C0R B;  2MX2 A;  1WXM A;  2LVQ A;  4NY0 A;  3L16 A;  4BVU C;  2GBK A;  1G6J A;  2IY0 B;  2ZEQ A;  4EOY A;  3OJ4 B;  4WWN A;  5IAA C;  4RMA A;  5D7G A;  2FUH B;  1M94 A;  4HPL B;  5DPS A;  3TJP A;  1UEL A;  5J18 A;  3OLM D;  1MG8 A;  1WR1 A;  2HE7 A;  5DPW A;  1TBE A;  3IVF A;  2GOW A;  5D2M B;  1WZ0 A;  3VH3 B;  5C1Z A;  1WJN A;  4TQ1 A;  4WWO A;  4P7I A;  4K7S A;  4FJZ A;  2AL6 A;  2N1W A;  4NJ6 A;  3ALB A;  4DBG A;  4AJY B;  3MTN B;  2M8S A;  4CYE A;  3K9O B;  4K1R B;  2KJH B;  4WAA A;  4WJO A;  4MGK E;  2MBB B;  4HWI B;  3PV1 A;  3ZKJ C;  1WRD B;  3RZW C;  3A9J A;  3ZNZ B;  2DX5 B;  1WM2 A;  3RZF A;  4MM3 A;  3QQ8 B;  1P3Q U;  4II3 B;  4PS7 A;  4BOZ B;  3B08 A;  2PPH A;  4KSL C;  3M63 B;  4ASW C;  1H8C A;  4HCP B;  3H6N A;  4A20 A;  1EO6 A;  1V6E A;  5E6N A;  2C7M B;  4DK5 A;  1PQS A;  1V2Y A;  2NCN A;  3JYU A;  4HDO A;  2EKE C;  2KQ7 A;  1WMH A;  2KKC A;  1BT0 A;  3VQI A;  3TMP B;  3ZDM C;  3ZRC A;  2KXJ A;  1SE9 A;  5C23 A;  3B1L X;  4FUL A;  1WM3 A;  4EZK A;  3HM3 A;  5J17 A;  2MWS B;  1VD2 A;  2ZZP B;  2PE9 A;  3VAW A;  4GGQ A;  2BKF A;  3T8M A;  2XBB C;  1Q1O A;  3LDZ E;  2D11 A;  3W1S C;  1RAX A;  2I1K A;  3IFW B;  3N30 A;  2K6D B;  4AP4 C;  4DWF A;  3TCA A;  2FCS A;  2KHW B;  3WAM A;  4MEM A;  4I6L B;  1WGG A;  2FIF A;  2N9P C;  4KDL B;  4MGZ E;  3WA0 A;  2DYO A;  4IWQ A;  4MDK E;  4ZRJ A;  1WF9 A;  3CST A;  2JUO A;  2Z59 B;  2LGD A;  3RCZ A;  3PTF C;  4I6P A;  1V81 A;  3M95 A;  4FLH A;  4GDL A;  3ZTD A;  4W9F A;  2N4F A;  3PRE A;  4NAW B;  1UBI A;  3JSV A;  1R4N I;  3H1U A;  4HVB A;  2BYF A;  2KD0 A;  3NS8 A;  4WJP A;  1L2N A;  5JHA A;  3RT3 B;  1WGD A;  3PHX B;  4GB9 A;  2LI5 A;  2MBO A;  3NY5 A;  2MCN B;  2N1V A;  2UWQ A;  1Q5W B;  2W9N A;  1WX8 A;  3SU8 X;  4B95 A;  4YL8 A;  4HDQ A;  3AI5 A;  2AYO B;  3ZO5 B;  3HK0 A;  2FNJ B;  2KFK A;  2N9X A;  3AXC A;  4MGI E;  3ZRF A;  2A4Z A;  2KTR B;  2KC2 A;  3APC A;  3QAR A;  4CO7 A;  1Z5S B;  2L0T A;  3IBE A;  2LUE A;  2J0K A;  2L00 B;  3A33 B;  3H7P B;  4KIK A;  4W9H A;  4HCN B;  2NVU I;  5CTR C;  5TR5 A;  2K39 A;  5BO4 B;  2MP2 A;  4W9E A;  2C9W B;  2K8C A;  4XC2 A;  4W9C A;  2LD9 A;  4PYU A;  5CX3 A;  2YVC A;  1R4M I;  2ZPN A;  1YX6 B;  1KOT A;  2V1Y A;  3MJW A;  2JXX A;  2ZVO A;  4IC7 B;  3DPD A;  1E5W A;  3SHQ A;  4ANU A;  2CKH B;  2NS5 A;  5LXI B;  3HM6 X;  4M8M A;  2J0M A;  1WGY A;  3W1Y A;  1GC7 A;  4ZRK A;  4HXD A;  3DOW A;  4ANX A;  2ZNV B;  2MBE A;  3H7S A;  3VUW A;  2M4N A;  2AL3 A;  3D32 A;  4HPM B;  1YIW A;  2D3G A;  3DDC B;  4DHZ E;  1V9J A;  2K1F A;  4A3P A;  2CHZ A;  4N9F 4;  3DVN U;  4HLE A;  4LDT D;  4B9K A;  2ZNV C;  4GDK A;  3VTW A;  2GMI C;  2M0X A;  4NJ7 A;  1E8W A;  5JH5 C;  2IBI B;  4FJY A;  2G45 B;  1OEY A;  1RRB A;  2FCN A;  3ML9 A;  4HK2 A;  3UGB B;  2RSU A;  2FCQ A;  2NPT A;  2C5L C;  1IPG A;  1OEY J;  3T9L A;  4W9D A;  4GSW A;  1IYF A;  4ANW A;  1GJZ A;  2AEH A;  1WY8 A;  3ENE A;  3PT2 B;  4FBJ B;  5FR6 A;  1WX7 A;  4DHJ D;  3A1Q A;  1YJ1 A;  1NBF C;  4GN1 A;  1NDD A;  2AWT A;  3DVG X;  4E74 A;  1S1Q B;  1WH3 A;  2J0J A;  1E7V A;  4BFR A;  1WFY A;  5KHQ A;  3ONS A;  3R7Q A;  3ZNH B;  1IP9 A;  5E6O A;  3PGE A;  5E6P A;  3KW5 B;  3UIO B;  1J19 A;  2WX1 A;  1H4R A;  5D94 A;  2EMS A;  2O6V D;  3QAQ A;  3KYD D;  4PYZ A;  5AZF A;  5DCN A;  3WAP A;  3B0A A;  3CSF A;  3KUD B;  2B3A A;  2WYQ A;  4NNJ B;  3V62 A;  2KC1 A;  2KX0 A;  4II2 B;  2LRW A;  3L10 B;  2JF5 A;  1WYW B;  3EFU A;  2KWV B;  3V6E B;  4XZ4 A;  4BKG A;  3IHP C;  2KTR A;  5JHB A;  2Z0E B;  1WE7 A;  2ZJD A;  4GMV A;  4DHZ B;  3H7P A;  4TV3 A;  1WJ4 A;  4BBN F;  4EKU A;  2NR2 A;  2KNB A;  2BGF A;  1E8Y A;  4AOF A;  3A9K B;  1Y8R C;  2A5U A;  3HIZ A;  3QIJ A;  4G0N B;  1E90 A;  5G2N A;  3KYC D;  3VH4 B;  2CU1 A;  3VUY A;  4JGH B;  3UIP B;  1L7Y A;  2O6V A;  2D2Q A;  3L0W B;  3QCA A;  2I1J A;  4EFO A;  1D3Z A;  2D10 A;  2JWZ A;  2KMC A;  2KN5 A;  1V49 A;  2GBM A;  3X0W A;  1XQQ A;  4OVU A;  3JVZ X;  4B6W A;  4W9G A;  3KUZ A;  3SDL C;  4URK A;  5L95 C;  3PRZ A;  5CHW A;  1P1A A;  2KAN A;  3QA8 A;  4GIV A;  4MEL A;  1V5O A;  4F8C B;  2DZI A;  4ANV A;  3R3M A;  4TUU A;  2UYZ B;  2KDF B;  2DEN B;  1UBQ A;  4LJP B;  1VCB A;  3DVN V;  3UQB A;  1GNU A;  3Q3F A;  4IM0 A;  2Z0D B;  2ASQ A;  3DCG A;  2KJ6 A;  3LJ3 A;  1WGR A;  2O2V B;  3NZS A;  1Z2M A;  3WAL A;  3ZUN A;  2MBQ A;  1V80 A;  2KK8 A;  4K7U A;  3DBS A;  3NZU A;  4MGY E;  4NQK E;  1V86 A;  3VXW A;  3M62 B;  2XEW A;  2L3Z A;  3A4S C;  5LLI A;  1OQY A;  1ZW7 A;  2OJR A;  1E8X A;  2KOX A;  4KDI C;  1UH6 A;  3TIX A;  2DYB A;  3ZTC A;  1A5R A;  5AEK B;  2G4D B;  2M1M A;  2BYE A;  4X57 B;  1FXT B;  1XD3 B;  2KDI A;  4KV2 A;  1V5T A;  4LDT B;  2LXA A;  4ZYN A;  2CHW A;  4MJS B;  4IM3 A;  1F9J A;  2HJ8 A;  2LGY A;  4RM8 A;  4G50 A;  4G11 A;  3RYT A;  3PPA A;  5CHV C;  3L08 A;  1LFD A;  2DYM A;  3CF6 E;  2BYV E;  2JT4 B;  4BKS A;  2OOB B;  3A4R A;  2LWP A;  2IO0 B;  2L0F A;  4LCD E;  2N7E A;  3GZN I;  3V61 A;  2KLG A;  4GXB A;  2BWF A;  1GG3 A;  3P2B A;  2CR5 A;  1HE8 A;  2BWE S;  2K8B A;  1WXS A;  3QK0 A;  4KSK C;  4W9J A;  4WJQ A;  2RGF A;  3KVF B;  3M3J A;  1E8Z A;  3VDZ A;  1AAR A;  3GOE A;  2MSE D;  3DBL I;  3DBR I;  2KVR A;  3W1S A;  4FHK A;  1WGH A;  4E71 A;  2LZ6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...