4XC2A

Crystal structure of gabarap in complex with kbtbd6 lir peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
MGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CUL3-KBTBD6/KBTBD7 Ubiquitin Ligase Cooperates with GABARAP Proteins to Spatially Restrict TIAM1-RAC1 Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GABA(A) receptor-associated protein
total genus 35
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4xc2A00
2KHWB 5CX3A 3UIOB 3HHMA 2C5LC 1C1YB 2D3GA 4GXBA 2W9NA 1V5OA 4CO7A 4URKA 3DBHI 3IG3A 5D6JB 3RUIB 2ZZPB 2KNBA 3M95A 5CTRC 3SD5A 3ZNID 3IBEA 3VXWA 2HTHA 4GDLB 2KN5A 1LM8B 2HJ8A 4NNJB 2NS5A 2BF8B 4DHZB 3PLUA 2J0MA 4IG7B 4FADA 4IM2A 2XEWA 4A3PA 3N32A 2CHZA 5CHVC 3T8MA 1C3TA 2BYEA 3KYDD 4LJOB 2UYZB 2PJHA 2ZPYA 2JZZA 4EKUA 4B9KA 1H4RA 2IO1B 4W9FA 2PE6B 3RYTA 3B0AA 2JXXA 4GIVA 2JVCA 2PPHA 5D94A 3BY4B 5KHQA 4MM3A 5DCNA 1WH3A 2M17A 3PRMB 4FN2A 1K8RB 2DENB 3TJPA 2CHXA 3JSVB 4EFOA 2FCNA 4PS3A 5JH5C 1UELA 2LVQA 2DZKA 2ZNVB 2V1YA 4GN1A 3DQVA 3VTUA 4HLEA 2O6VA 2N9XA 2MX2A 3EC8A 2AWTA 2M1MA 3KVFB 3S2AA 4E71A 5LLIA 2BWES 3M3JA 1WX7A 4WJNA 3R7QA 1I42A 2IZVB 2KFKB 2VRRB 3PVLA 4IW0A 3PGEA 2WDTB 4W9DA 2R2QA 5J18A 3H7SA 2KTFA 1LXDA 4NJ7A 2KJ6A 4DHJB 1E90A 1JRUA 2BKRB 5AZHA 2KLGA 3U30A 1IP9A 3VAWA 2IBIB 4KSLC 2FAZA 2L7RA 4G11A 3WALA 4MGZE 1OEYA 2KC2A 3HM6X 2OJRA 5AZGA 3L0WB 4IWPA 3UIPB 1ZKHA 5DPTA 1V81A 3WAMA 3APDA 5E6NA 5LXIB 2MWSB 3TL5A 2LUEA 5G2NA 3H1UA 2AL6A 1M94A 1PQSA 1J19A 3VH4B 1FXTB 4KVGB 2O6VD 3AI5A 3O65B 1SE9A 3ZIMA 3ZDTA 3ZNGC 5J17A 1WFYA 1WY8A 1Z2MA 2Y5BB 3EFUA 3PS6A 4PS7A 4IWQA 4W9KA 1V80A 2NPTA 1EF5A 3A4RA 4N9F4 4W9GA 5FR6A 3VTVA 2DYBA 3AULA 4DBGA 4AOFA 1KLVA 2DHZA 4NAWB 3VHTC 1CMXB 2KTRB 2KFJA 1GC7A 1WGYA 4NAWA 3ZDMC 3KW5B 4BKGA 3A9KA 4GU2A 4M8NA 1WGGA 3RZWC 2AEHA 2Z0DB 1UBIA 4KIKB 5HKHA 3V60A 1H8CA 1RLFA 3OJ4B 3ONSA 2MCNB 1WF9A 1V5TA 3PT2B 2MQJA 2L05A 2LXCA 5E6PA 2C7HA 3VTWA 4CYEA 3JSVA 3UGBB 3VDZA 3U8ZA 3B1LX 1LFDA 4DDGD 4EOYA 3M62B 3QJZA 4WWOA 3RULA 2YLMA 4RMAA 2KFKA 4FJZA 3ZRFA 3PZDA 1Q5WB 2L00B 1QZEA 4MH0E 3MHSD 4HDQA 3KUZA 3DVGY 4XX5A 4HCNB 4JGHB 2ZCCA 4ZRKA 4GDKA 2J0KA 1LQBA 1E8ZA 2MBQA 2KXJA 1E8XA 1TGZB 1ZW7A 1WR1A 2G45B 4PS8A 3H9DA 3UQBA 4FBJB 5IA7A 3SHQA 2ASQA 2MP2B 2O6VB 3D32A 2C9WB 4A20A 3X0WA 2KO3A 1WM2A 1V49A 2N7EA 4K1RB 2EKEC 4AP4C 4I6NB 4LJPB 3H7PB 3QX1A 5CHFA 4NJ6A 5C1ZA 2LGYA 4RM8A 1UZXB 1WZ3A 3ECIA 4KIKA 2KD0A 2O2VA 1A5RA 2ZVOA 2D11A 4ANUA 2K6QA 4PYUA 2MW5A 3EECA 1WZ0A 1WJ6A 1TZ1A 1OTRB 3UQAA 2MRPA 3A33B 3W1YA 2AL3A 5G55A 3A1QA 4MJSA 1TTNA 2HE7A 4MELA 4W9IA 1Y8RC 2RGFA 2GOWA 2OOBB 2FCQA 1GG3A 3Q3FA 2MBHA 3PRPB 4FLHA 4TV3A 3ZTCA 3EHVA 3PLVA 3P2BA 2KDBA 3ZVVA 4A3OA 1EF1A 3TIXA 4E3CA 1L7YA 3BINA 3VQIA 1MG8A 2IO3B 3ML9A 5DPSA 3SDLC 3PTFC 4MGKE 4MSMB 5J2RA 3LJ3A 3L13A 4MSQB 1ISNA 2A4ZA 2KWCA 1D3ZA 3QQ8B 1P9DU 4F1SA 4MJSB 5L83A 4AUQC 4ZYNA 2RD0A 2KLCA 2KOXA 1WXMA 2IYDB 2NR2A 1E8YA 2L0TA 2GBNA 3KUCB 2N4FA 3HIZA 5TR5A 2KK8A 1P3QU 2KMCA 2N7DA 4IC7B 2MA9B 2K8HA 5EDSA 4HWIB 1E7VA 3NOBA 3CMMB 4F8CB 1EUVB 2BGFA 2NBVB 4RM9A 4I6PA 2KWUB 2CR5A 4WAAA 4MGIE 4BVUC 2N1VA 1VD2A 4AWJA 5DPWA 4B95A 4KZ0A 3N30A 3APFA 2Z59B 4OVUA 4WJOA 2K8BA 3DBLI 4FJYA 1WE6A 4IUMB 4LDTB 2O2VB 3JVZX 3N3KB 4KDLB 4NQLB 2LVOA 3I3TB 4P7IA 3V61A 3ENEA 1NDDA 1UBQA 2C7NB 2FCSA 3ZO5B 1NI2A 2I1KA 4DK5A 2NBUA 2C60A 2LD9A 5AEKB 1T0YA 2B3AA 5C23A 3RD2A 2G4DB 4KDIC 2LASA 2ZVNA 5E6OA 2MBEA 3NZUA 5GMVA 1V86A 1EO6A 1WX9A 2LI5A 2IY1B 2BYVE 2G3QB 2REXA 3JYUA 3KYCD 4ANXA 2Z0EB 1WXAA 1ZGUB 4KV2A 1IYFA 4TKNA 2KANA 4EZKA 1XQQA 3DDCB 4JIOU 3IVFA 3PPAA 2KQSA 2PE9A 4MDKE 3R7RA 1U4AA 1P0RA 3PHWB 3V6CB 3Q3JA 2KDFB 4FA6A 4ICVA 3VFKA 4NQKE 2CKHB 3DBRI 2RSUA 4II2B 4JL9A 2LZ6A 1E8WA 1YD8U 2KDEB 4AJWA 4BKSA 3WANA 3W1SA 4FHJA 2N9PC 3WA0A 4K81A 2ZPNA 3H6NA 1OGWA 3QIJA 4W9EA 5D2MB 3RT3B 3QC8B 2KMAA 4HJKA 2D2QA 4HPLB 4M8MA 1YJ1A 3MTNB 4DXAB 2JRIB 4EZJA 1WIAA 4DHZE 3VUYA 1HE8A 2BPSA 2XK5B 3PREA 4E74A 3NY5A 2AYOB 1RRBA 1WJ4A 1GUAB 4G0NB 4GB9A 2ZCBA 4W9HA 1XT9B 2KKCA 2LWPA 3DBSA 3VUWA 3W1SC 1R4NI 4DHJD 2KDIA 1WXSA 3SU8X 2D07B 1NBFC 4EUTA 4J6IA 2RR9A 3A1QB 4XC2A 1BT0A 4AJYB 4MGYE 4II3B 1XD3B 1WXVA 3H7PA 2J0JA 4G50A 1WRDB 4K7SA 4K7WA 4I6LB 3V62A 2DYMA 3GZNI 2JZ3B 2JT4B 2GBJA 2M0XA 1YQBA 3ZLZA 1AARA 5JZEB 1I35A 1WR6E 2M8SA 2KWVB 4GDKB 4ANWA 4GMVA 4ZRJA 2LRUA 3PV1A 3L08A 2LGDA 4KSKC 4ASWC 2DZIA 2FCMA 3ZTDA 4WQOB 2GBMA 2BWFA 5L95C 1IPGA 2LVPA 4JLCA 4GGQA 3C0RB 2GBRA 2FNJB 1G6JA 2FIDA 2NCNA 1WGHA 2K1FA 3K9PB 2LGXA 2V4LA 2MLBA 3CSTA 1P1AA 2GMIC 3ZW3A 1WGDA 2IO0B 2RPQA 2ZEQA 2PEAA 4FULA 1F9JA 4BBNC 1UD7A 2C7MB 3MJWA 3NHEB 2DX5B 4HVBA 2KC1A 4GDLA 4BOSC 2L3ZA 1Q0WB 4PYZA 1WGRA 1YIWA 4BKSD 2KJHB 4WJPA 3WAPA 3M63B 3ZKJC 3DVNV 2FUHB 2CU1A 1P98A 1KM7A 3HK0A 3LDZE 4W9CA 2G4SA 3V6EB 1SGHA 4F7ZA 4HXDA 2KQ7A 3ML8A 5JHAA 2IY0B 3PHXB 4TQ1A 2XBBC 3ZNHB 2EMSA 2DYOA 2R2OA 3ALBA 2FIFA 3DCGA 2EMTA 2DZMA 4IM0A 4W9LA 2JRHA 2WX1A 3RZFA 1WJNA 1WM3A 3A9JB 3UINB 3ZRCA 2K8CA 3QARA 1WI0A 4EEWA 3L17A 1GNUA 4BFRA 4MEMA 1UH6A 5BO4B 3OLMD 2L76A 3IFWB 1OEYJ 4CHKA 1Z5SB 2IO2B 2QHOA 3L54A 4ZRIA 3QHTA 3QA8A 3DVGX 4ICUA 2D10A 3X23A 4X57B 2GBKA 2NBWB 3CF6E 4BBNF 1RAXA 1VCBA 1YX5B 2BKFA 4GOCA 4LDTD 1S3SG 4K7UA 4HPMB 4WWPA 4HK2A 2N9EB 4NPNA 3QK0A 3NZSA 3RCZA 4BKTA 1KOTA 2NVUI 1WE7A 3ZUNA 2KJRA 2DAJA 3KH0A 1X1MA 1WJUA 4TUUA 3QWZB 5CHWA 2WWZA 1TBEA 3TMPB 3APCA 2DAFA 1UGMA 2LJ5A 4M0WB 2KX3A 3B08A 3R66C 2A5UA 3QAQA 2DZJA 4DWFA 5JHBA 3OJ3A 2JUOA 3U7DA 1Q1OA 3R3MA 1GJZA 3PRZA 2KZRA 3DPDA 2HD5B 3WAOA 1L2NA 3AU5A 4W9JA 4XZ4A 4OVVA 2JY6A 4BOZB 4ZDVA 1YX6B 2MBBB 1J0GA 1V6EA 3T9LA 3QCAA 3DOWA 3CSFA 3WIMA 1WYWB 2MP2A 4HDOA 4DDID 3A4SC 2N1WA 1OQYA 3DVNU 1V9JA 2JPHA 2MSED 4FJVB 3ZNZB 2XK5A 2I1JA 3UF8A 1J8CA 3AU4A 2JF5A 1WX8A 3VUXA 4GSWA 3GOEA 2ZNVC 4B6WA 2J7QB 2WX0A 4WWNA 5D7GA 5DPRA 4JQWC 4NY0A 1RFAA 3K9OB 2JWZA 3AXCA 2CHWA 5LXHA 2L8JA 3IHPC 2BYFA 2K25A 2M4NA 1S1QB 2MBOA 3L16A 1E5WA 1R4MI 2YVCA 1WMHB 2LXAA 4TQ0A 3KUDB 5KHOA 2NPTB 4WJQA 1WMHA 3TBLD 2CS4A 4HCPB 4EZLA 3PSEB 4LCDE 4KZCA 2K39A 2ZJDA 2V3SA 2KTRA 1GC6A 3A9KB 1SIFA 1V2YA 4FHKA 3HM3A 2LRWA 4G3XB 1E7UA 3VH3B 2KX0A 3L10B 3A9JA 3OAWA 4IWOA 5AZFA 2KVRA 4YL8A 2UWQA 2WYQA 2K6DB 5IAAC 4ANVA 2L0FA 3NS8A 4IM3A 3TCAA 3VVWB 1KJTA 3JW0X
chains in the Genus database with same CATH superfamily
2K0PA 2D3AA 2D3GA 3Q2AC 4URKA 2KT7A 2WU2B 3ZNID 3GS2A 2HTHA 4GDLB 4NNJB 4DHZB 3PLUA 4IM2A 2XEWA 2JQRB 2DWQA 3N32A 4RF0A 2BYEA 4LJOB 3AE9B 2ZPYA 1MG4A 1KF6B 2PVOD 3Q3OC 2PE6B 1YQ3B 2JXXA 4MM3B 3RNGC 4GIVA 4XWWA 2JVCA 2PPHA 5D94A 1K52A 3BY4B 5KHQA 5DCNA 2M17A 4EFOA 1UELA 2V1YA 3DQVA 2AQ2B 2ZW0A 1JROA 2AWTA 2M1MA 1WX7A 1L4ZB 3GB1A 2EELA 1I42A 3U7ZA 4IW0A 1DOYA 3PGEA 2KTFA 1LXDA 1SF0A 5AZHA 2KLGA 3VAWA 2D3BA 2FAZA 2L7RA 4YSZB 2KC2A 2QMTA 1JWSD 3FILA 4YXDB 4A8XC 3H1UA 1J19A 3VH4B 1T0SC 2O6VD 3AI5A 3O65B 3ZIMA 1T6BX 2TSSA 3ZDTA 1HA5A 1WFYA 3ZNGC 1Z2MA 3EFUA 3PS6A 4PS7A 3AE1B 4IWQA 4W9KA 4YWGG 5FR6A 4WWMA 3AULA 3P4PB 5IP4D 1F1HA 4BZAA 2KTRB 4YTMB 4NAWA 1WGGA 1RLFA 1WF9A 2HTME 1ZDXA 2L05A 5E6PA 1FEHA 4CYEA 4DDGD 3M62B 3HUIA 2KFKA 1N62A 1ZOYB 1QF6A 1I4QA 2B76B 2G9HD 3MHSD 3Q8BA 1V1PB 4JGHB 1LQBA 1E8ZA 2MBQA 1YJJA 1FNWA 1E8XA 1SXTA 1ZW7A 1LO5D 4RGMA 4FBJB 1JWAD 2O6VB 2LHEA 1TS5A 2E3TA 1WM2A 4I6NB 4LJPB 1IBXA 5C1ZA 4RM8A 2KYWA 3ZYYX 1K50A 2QJLA 2D11A 3U4EG 2K6QA 3EECA 1WZ0A 1WJ6A 1TZ1A 2V9HA 3W1YA 3Q3MC 4OZCA 4W9IA 1Y8RC 2GOWA 1GG3A 3Q3FA 3PRPB 3ZTCA 2RDHA 1FCCC 3P2BA 4YSYB 3ZVVA 1EF1A 1XLNA 2BW2A 1TS2A 5MPOA 1MG8A 2IO3B 5DPSA 1Y56A 3PTFC 4MSMB 1UUPA 3E56A 4F1SA 4MJSB 5FKAC 2L0TA 4YSXB 1VRAB 2N7DA 2MA9B 1YN4A 5EDSA 4YT0B 4ZHOA 3NOBA 3PZ8A 1EUVB 2BGFA 2NBVB 1FNUA 4RM9A 1HXYD 1QILA 2MJDA 4BVUC 4AWJA 3I9V1 5DPWA 2Z59B 1ZUD2 1WE6A 1QOAA 3EGRA 3JVZX 2GLSA 3I3TB 2INPE 2FBWB 1ROEA 1NDDA 3ZO5B 4A9AA 2LD9A 2KVZA 5C23A 2B3AA 3RD2A 2PW9A 2E6XA 5GMVA 1V86A 2KWDA 2D3CA 4ANXA 3AMZA 1ZGUB 4A90A 1F77A 1T5XD 1C79A 2CKHB 4NQKE 4JL9A 1E8WA 1E9MA 2KDEB 4AJWA 3B9JA 2N9PC 2ZPNA 2KACA 3QC8B 4HJKA 4M8MA 5I4DA 3VUYA 5IN7A 2XK5B 5BYSA 3MFGA 4KKIA 1L4DB 4W9HA 1SEBD 3DBSA 2LWPA 1R4NI 1F2RC 1NBFC 4MH8A 4J6IA 1YN3A 2RR9A 3A1QB 1WXVA 2L83A 2J0JA 4K7SA 4XDDA 1I35A 1ET9A 1IGCA 1FXIA 2M8SA 4GDKB 2SAKA 1IGDA 4KSKC 2DZIA 4WQOB 5L95C 3C0RB 2PMVA 2FNJB 1WGHA 3CSTA 2MLBA 1P1AA 3BVGA 4XDCA 1WGDA 4ZOHC 2LEKA 1I7HA 2ZEQA 2WNMA 2J42A 1F9JA 3RNFC 1NVID 3NHEB 5JXVA 1F0ZA 3IT6B 1JMLA 4GDLA 1TYGB 3LXFA 2L3ZA 4WH4A 1WGRA 1ESFA 1YIWA 4WJPA 3M63B 3DVNV 3T3NA 1FRRA 3EUB2 1B1ZA 4W9CA 2G4SA 4F7ZA 3ML8A 4N58A 5JHAA 1JALA 2R2OA 2DZMA 4W9LA 2Q5WD 2JRHA 3ZQ4A 3A9JB 3ZRCA 4PK1A 2DNFA 1WI0A 2BT6A 4EEWA 4MEMA 5BO4B 1F2RI 2IO2B 2MEKA 3L54A 3NG0A 3QA8A 4A6QA 4ICUA 2D10A 3X23A 2WDVB 1OFFA 2NBWB 3R2TA 4BAXA 1RAXA 1VCBA 4GOCA 4WWPA 3MC0B 4K7UA 4HPMB 4HK2A 3AE8B 4BKTA 3RCZA 5BMIA 1KFYB 2GB1A 3ZUNA 1L0YB 5CHWA 1WJUA 3QWZB 2WWZA 3APCA 1ZE3D 4M0WB 2FE8A 3B08A 4K3BA 2A5UA 4KGSA 3QAQA 4LTUA 1L2NA 2KZRA 1HQRD 1WXQA 5IKCM 2W54A 2AQ3B 1YX6B 1RYJA 3ZXVA 3CSFA 1CK1A 5T8IA 1P7EA 4FJVB 1PGBA 3ZNZB 3DHHC 1J8CA 4GSWA 3GOEA 2ZNVC 4WWNA 1RFAA 3K9OB 3AXCA 2CHWA 2L8JA 2M4NA 2MBOA 1QOGA 2YVCA 2LXAA 3KLSX 5KHOA 4WJQA 1WMHA 2CS4A 4EZLA 4KZCA 1C4PA 4ITKA 4G3XB 1V2YA 2OEDA 3VH3B 1J7AA 2KX0A 3L10B 4IWOA 4QAYA 4RCOA 3MHZA 2JYTA 2K6DB 5IAAC 4IM3A 3VVWB 4DDID 5C3JB 5CX3A 1VLBA 4GXBA 1V5OA 3DBHI 1SJED 5D6JB 1SIJA 1R7SA 2ZZPB 5CTRC 3BVMA 4EE2A 5BMHA 3KQ4A 3VXWA 2KQ4X 1N5WA 2HJ8A 3AEFB 2NS5A 2BF8B 4IG7B 4FADA 4A3PA 1YQ4B 5HI1A 1MFWA 2CHZA 4IKGA 4ARCA 4B9KA 2VH2A 4W9FA 3DHGC 3B0AA 2UU7A 4FN2A 4LK0M 1K8RB 1GB4A 1QT9A 3VTUA 3ZJUA 2O6VA 1V1OA 2LMCA 3EC8A 3BVZA 4E71A 5LLIA 4WJNA 2VRRB 2J53A 4OZAA 1WYGA 1E90A 1JRUA 3VR8B 5IO9A 3NVZA 5GXGB 2OJRA 4ACFA 1FMAD 2K3UA 3L0WB 1N61A 4IWPA 2BTEA 4JPSA 3WAMA 1AYFA 3L4PA 2AL6A 1PQSA 1FXTB 4KVGB 1SE9A 1PGAA 4C4VA 1V97A 1EF5A 4KKJA 4DBGA 4AOFA 1KLVA 4NAWB 2KFJA 1GC7A 3ZDMC 3RZWC 2AEHA 2Z0DB 1UBIA 5G5GA 1V5TA 2Y5CA 4MT5A 2C7HA 3VTWA 3BYTB 3U8ZA 3QJZA 4HEA1 2G1EA 4RMAA 1I4RA 4FJZA 3ZRFA 1Q5WB 2L00B 2OJWA 3LYYA 4HDQA 3KUZA 2JX5A 4ZRKA 4GDKA 2J0KA 2G45B 2WXFA 5EE9A 3SHQA 5IA7A 4RF1A 1DGJA 1WRIA 3BK2A 3X0WA 2N7EA 2EKEC 1PGXA 3H7PB 3EFCA 4JWUC 4NJ6A 3AEAB 1UZXB 1WZ3A 4KIKA 2ZVOA 1BUIC 2WHIA 4PYUA 4MJSA 2HE7A 2RGFA 4FLHA 4M00A 3EHVA 1K53A 3W5UB 3MC8A 1PUTA 3NUHB 1L7YA 3SDLC 4MGKE 3O13A 2KWCA 1D3ZA 4AUQC 2KLCA 2CJNA 1ENFA 1XLQA 2M0AA 2IYDB 2V3NA 3ETRA 2N4FA 3HIZA 5TR5A 5EE1A 2KMCA 2K8HA 2W55A 2JXTA 3URYA 2D5GA 3CMMB 1UWMA 1PFDA 2CR5A 4WAAA 3SEBA 2IGGA 4KZ0A 4WJOA 4FJYA 4IUMB 1RM6C 3N3KB 4NQLB 1QKZA 4N6EB 2C7NB 2VH1A 2I1KA 4DK5A 5AEKB 4IOIE 1T0YA 1VDVA 2G4DB 5E6OA 1WX9A 2LI5A 2CU3A 2BYVE 2G3QB 2Z0EB 1UNSA 1XXGA 4RH6A 2KANA 4JIOU 3GZNB 4C4VB 2KQSA 3R7RA 4ICVA 2WXJA 5AUIA 2LZ6A 5TSSA 1YD8U 4BKSA 2BS3B 3WANA 1FPYA 3WA0A 3QIJA 1OGWA 4W9EA 3RT3B 3HVZA 3AE7B 4GLSC 2D2QA 1Q10A 4EZJA 2JRIB 1WIAA 3J9CA 3TUOA 2BPSA 4KGRA 2WXKA 3NY5A 1NEKB 1WJ4A 4GB9A 2ZCBA 3W1SC 2WXPA 1YMHE 2KDIA 4S0RA 1WXSA 5H8YE 2D07B 4AJYB 1VR9A 1XD3B 4G50A 1JWUD 1FIQA 1WRDB 1JCKB 4K7WA 2PTLA 4I6LB 2DYMA 1KH0A 2JT4B 2GBJA 1YQBA 4RGTA 4AS1A 3DBHB 4ZRJA 2JZPA 1ZP0B 2LRUA 3PV1A 2LGDA 1DOXA 1T3QA 2GBMA 4RFBA 4GGQA 4P1BC 2WGSA 2FIDA 2NCNA 2QCZA 5HFYA 4FULA 1RFKA 4MACA 3EA6A 4XYCA 1TS3A 4BOSC 2WXHA 3DWGC 2I2YA 4PYZA 2Z8LA 4L2YA 2FUHB 2CU1A 3AV8A 1KM7A 2AQ1B 3V6EB 1SGHA 3AEGB 4HXDA 2KQ7A 1MHXA 1N63A 1L6UA 2LUMA 2IY0B 2Y3AA 4TQ1A 2XBBC 3ZNHB 2EMSA 2DYOA 3ALBA 1GPXA 2WX1A 3I5JC 4FXCA 1AN8A 3UINB 1EWCA 4HPPA 3QARA 2BVCA 1HZ5A 3P4SB 4BFRA 2JWUA 1I4HA 4CHKA 2L76A 1OEYJ 1Z5SB 4XE0A 3TSSA 1GOZA 2BQQA 3DVGX 3TEWA 2WXOA 3CF6E 3SFDB 4LDTD 1J7BA 2N9EB 4NPNA 2NVUI 3FKYA 1WE7A 3KH0A 1TBEA 1UGMA 2KX3A 3NS1A 2XN9C 2DZJA 5JHBA 3U7DA 3R3MA 3W5VB 1GJZA 3PRZA 3AU5A 4PT5A 3Q3NC 2N0SB 1B9RA 4XZ4A 1SE2A 4L1BA 4BOZB 1J0GA 3T9LA 3QCAA 4YTPB 2YEPB 3VRBB 1WYWB 3WIMA 2WXQA 2LJIA 4HDOA 3A4SC 2N1WA 2N9KA 1YJIA 5C2TB 2JPHA 2RMMA 2MSED 2I1JA 3UF8A 1WX8A 1JWBD 4OZBA 2GI9A 2INNE 2J7QB 2WX0A 5DPRA 4NY0A 2JWZA 2BYFA 2K25A 1L6VA 1E5WA 1UF0A 1WMHB 4P16A 3KUDB 3CWIA 4LNKA 2ZJDA 2V3SA 2KTRA 4FHKA 2LRWA 3OAWA 3N1YC 4YL8A 1NI3A 4US8A 1XCQL 2L0FA 3NS8A 2KHWB 3UIOB 1T0QC 3HHMA 4JWSC 3RUIB 3M95A 1MPEA 1IBXB 2WDRB 4J3OD 4ZYSA 2J0MA 4C00A 5CHVC 3T8MA 3KYDD 3ZJTA 2UYZB 4EKUA 2N7JA 2FUG1 1H4RA 5H92C 2IO1B 4RGOS 3AH7A 1D5MC 5BMGA 2V4IB 3TEZA 1NYRA 3AE3B 3PRMB 5JH5C 4PS3A 2KAJA 2LVQA 2DZKA 3RMKC 3I57A 2MH7A 2MX2A 3KVFB 3M3JA 1M4VA 2QDFA 2IZVB 2KFKB 3PVLA 3B2GA 4W9DA 5J18A 4NJ7A 2KJ6A 3R2IA 3C19A 3U2SC 2BKRB 1JW9D 4DXFA 2IBIB 4KSLC 4G11A 4MGZE 1OEYA 4XGAB 3PO0A 4OVZA 1TY0A 1SBBB 2NMQA 1XO3A 3APDA 5E6NA 5LXIB 3TL5A 2LUEA 1JRPA 1M94A 4ZRPA 1WY8A 3RI7C 3TEYA 2QEJC 1V80A 2NPTA 3A4RA 4W9GA 3VTVA 4L23A 2DYBA 3NVVA 3OWEB 2PVGC 4WURA 1TJEA 4OW0A 3KW5B 4BKGA 3IXSA 3V60A 3OJ4B 3ONSA 3PT2B 2LXCA 4HRSA 3UGBB 3VDZA 3B1LX 2L1AA 4WWOA 3RULA 3RN9C 2INCC 5D3DA 2BYTA 3DBRB 1QZEA 3DVGY 4XX5A 3GE8C 2KXJA 2ICIA 2WXNA 1WR1A 2IDYA 1PYWD 2ASQA 1ACCA 2K5PA 3D32A 3V3XA 1P7FA 4K1RB 4AP4C 2RPVA 3QX1A 2LGYA 2O2VA 1A5RA 5BYQA 3MJ5A 3UQAA 2LGSA 2MRPA 3A33B 3P4QB 2AL3A 3V05A 5G55A 3A1QA 4OHJA 4ARIA 5EE0A 4MELA 3RNEC 3N9YC 4ZHPA 2OOBB 4XWTA 1MI0A 1VJKA 2KDBA 4KGTA 4A3OA 3TIXA 1SJHD 3BINA 1I4GA 3VQIA 3IAS1 3LJ3A 3L13A 4MSQB 1ISNA 2A4ZA 4ZYNA 2RD0A 2KOXA 1WXMA 3AE5B 1SE3A 1D6EC 1GAQB 5AUKA 3SR6A 1QOBA 4P1CC 4IC7B 1K51A 4HWIB 1WGKA 1D4BA 1E7VA 1FRDA 2H89B 4I6PA 4C56C 3ZXRA 4MGIE 2INDC 4B95A 1HTOA 3RFZB 2L52A 3BIID 4LDTB 1ZPSA 2O2VB 3CIRB 3P4RB 4KDLB 3V61A 1LGRA 2FCSA 1NI2A 2NBUA 2C60A 1L0XB 2BS2B 2LHDA 2IY1B 2REXA 3AE2B 3JYUA 3FC4A 3VRAB 1IYFA 1XEEA 4TKNA 3NVWA 3PPAA 2PE9A 1P0RA 3V6CB 3Q3JA 1TKGA 4FA6A 3AB5A 4UDUC 1TT5B 4RNAA 3VFKA 2R61A 1MJDA 3DBRI 2IGDA 2RSUA 1TS4A 4FHJA 4K81A 1EU4A 4Q2JA 5D2MB 2KMAA 2RDBC 2JU6X 4HPLB 4DXAB 1C4AA 4C80A 1HE8A 4LLGM 4E74A 1J7CA 2AYOB 1RRBA 1GUAB 3VUWA 1XT9B 2KKCA 4DHJD 3BZDB 5FK9C 3RNBC 2X8XX 1I4PA 1BT0A 2BS4B 3Q8EA 3H7PA 4AQ7A 1JQ4A 3Q69A 4B0MA 3N1XC 2M0XA 1CJEA 3ZLZA 5JZEB 2QSDA 3Q8CA 1ZXIA 2KWVB 1WWTA 1N60A 1C9FA 4ANWA 2V0GA 2FCMA 3VR9B 3ZTDA 2BWFA 2JSVX 1IPGA 2GBRA 1G6JA 5EE3A 3K9PB 2WLBA 2V4LA 2GMIC 2PEAA 2KN4A 4BBNC 4US9A 3MJWA 4JX1C 1VZ6A 2DX5B 4HVBA 4DQOC 1Q0WB 1TKEA 4BKSD 2KJHB 3WAPA 3ZKJC 3LDZE 3W2DA 3N1ZC 3C8YA 3R8BA 3PHXB 1AWDA 3DCGA 4IM0A 3RZFA 1WJNA 1WM3A 4DXGA 2K8CA 2ONQA 2QIEB 3L17A 1GNUA 2QC8A 3OLMD 1SSNA 2DLBA 4ZRIA 3QHTA 1CQVA 2WXGA 3AEBB 4H2AA 4X57B 1YX5B 1S3SG 4IDIA 3NZSA 1KOTA 2KJRA 4TUUA 1GB1A 2LJ5A 1RWSA 3B2FA 3R66C 4LNFA 4DWFA 3OJ3A 2JUOA 3WAOA 2HD5B 3BWUD 1JWMD 4W9JA 4S17A 2ACZB 4N59A 2SEBD 3DVNU 4M01A 4WAFA 1C77A 3AU4A 4B6WA 5D7GA 2MJEA 3IHPC 3Q8FA 1S1QB 3L16A 4P6VF 3AE6B 4TQ0A 3TBLD 3PSEB 4LCDE 4A55A 2IJ0A 1L0VB 2LFIA 2W82A 3HM3A 1E7UA 5AZFA 4TMAB 1R4MB 2KVRA 1MVKA 2UWQA 1N6ZA 3TCAA 1MHHE 1FO4A 2HDEA 1N5XA 1D5ZC 2C5LC 1C1YB 3Q8AA 2W9NA 4CO7A 3IG3A 1TKYA 2KNBA 3SD5A 4C7YA 3IBEA 2KN5A 1LM8B 3ZGZA 2OHFA 1SE4A 1C3TA 2PJHA 2JZZA 3P63A 2W3RA 2BBCA 3RYTA 2XNAC 1HEZE 4MM3A 3Q14C 1WH3A 2DENB 3TJPA 3DWMA 2CHXA 3IT4B 3JSVB 2FCNA 2LGIA 2ZNVB 4GN1A 4HLEA 2PKOA 1FM0D 2N9XA 3S2AA 2H88B 2BWES 3R7QA 1XCTL 2BB6A 2WDTB 2R2QA 3H7SA 1FCLA 4DHJB 2WQYB 3U30A 3MP9A 1IP9A 3ZJVA 3WALA 2I38A 1FNVA 3HM6X 5AZGA 2ZW1A 4M0WA 3UIPB 2WDQB 1ZKHA 4WIPA 5DPTA 1V81A 2MWSB 1NYQA 5G2NA 1QQRA 4C7ZA 1QLBB 1XLOA 5J17A 2Y5BB 4LNIA 4N9F4 2WP9B 3DBLB 1E7PB 2DHZA 5D3IB 3VHTC 1CMXB 1WGYA 1STEA 3AEDB 2Y5PA 3A9KA 4GU2A 4M8NA 2J52A 1H8CA 4KIKB 5HKHA 4KX6B 2MCNB 1PDXA 2MQJA 3ABVB 1TZOA 3JSVA 1LFDA 3KWVA 4EOYA 1DYQA 2PLPA 2YLMA 2KMMA 1TIFA 3PZDA 1AW7A 4MH0E 3T3OA 4HCNB 2ZCCA 1V1PA 1C4CA 1QOFA 5BYRA 1TGZB 1BMLC 4PS8A 3H9DA 3NVYA 1BXTA 2CJOA 3UQBA 3RNAC 2MP2B 1L5PA 2C9WB 4A20A 4R3DA 3RPFC 2KO3A 1V49A 3E9SA 3BK1A 5CHFA 1XLPA 2DBYA 5E6JA 3ECIA 2KD0A 4ANUA 4RGNA 4HKZE 2MW5A 3N20C 1OTRB 1V8CA 1A70A 1TTNA 2QILA 2WXLA 2FCQA 3FILB 2MBHA 4TV3A 4JE3B 2IPKD 3PLVA 1OQRA 1IUEA 4USAA 3NJTA 3Q6BA 1HZ6A 1YOVB 2NTTA 3AN1A 4E3CA 3ML9A 1ZXHA 1EM7A 5J2RA 2MHJA 4REZA 3RNCC 1D5XC 2NTSA 3QQ8B 1P9DU 4D2KA 5L83A 4ZRQA 2NR2A 3W9CB 1E8YA 5IOIA 2GBNA 3KUCB 2KK8A 1P3QU 3TEXA 2GRIA 2JYEA 5HG2A 1E10A 4F8CB 1FFVA 2KWUB 3MC9A 1E0ZA 2N1VA 1VD2A 5G5HA 2WU5B 3N30A 3APFA 3BYYB 1YNTE 4M02A 2MJ3A 4YTNB 4OVUA 2K8BA 3DBLI 3HRDD 1DOIA 2LVOA 4P7IA 1ZDVA 3P1MA 3ENEA 1UBQA 4NJCA 4KDIC 2LASA 2ZVNA 2MBEA 3NZUA 1FXAA 1EO6A 4LNNA 3KYCD 1WXAA 2EKIA 4KV2A 4EZKA 1XQQA 3DDCB 2N9LA 3IVFA 1UWXA 4MDKE 1U4AA 3PHWB 2KDFB 1CZPA 2K22A 1SB3C 3UI3A 1OQQA 3AE4B 4II2B 1KLGD 3I63C 1FD6A 3W1SA 1R4NB 3H6NA 2WS3B 2WXMA 3P42A 3H8HA 1YJ1A 3MTNB 4DHZE 2X38A 1VZ8A 3PREA 4G0NB 1C76A 3SU8X 4EUTA 4XC2A 3AM9A 2ON8A 3HVDA 4MGYE 4II3B 1TY2A 3WCQA 4WQMA 3PZ7A 3V62A 2PIAA 3GZNI 2JZ3B 2AX5A 4HJGE 1AARA 1YN5A 1WR6E 3IAM1 1ET6A 3LB8C 4GMVA 4ASWC 3L08A 2YEPF 3AEEB 2LVPA 4JLCA 4NAMA 3SFEB 2L32A 2K1FA 3NRZA 3U52E 2LGXA 3ZW3A 2RPQA 2IO0B 2WXRA 3KWLA 1UD7A 2C7MB 5LNK1 2KC1A 1T0RC 3GP7A 2VZKD 3FAHA 1P98A 3HK0A 4K3CA 1KTKA 4HROA 2FIFA 2EMTA 1UGJA 1F52A 2VZKB 1HTQA 1XF5L 2M19A 1VZ7A 3GE3C 1UH6A 4B0EA 3IFWB 2RDGA 4TSSA 2QHOA 1FFUA 2BB5A 2GBKA 4BBNF 2BKFA 1NENB 1I4XA 1EWYC 1C78A 3QK0A 3NZ3A 1EU3A 5HHDG 2DAJA 1X1MA 3TMPB 2DAFA 2M56B 1Q1OA 2J4XA 3DPDA 3AECB 4O1NA 4OVVA 2JY6A 2V3PA 3OG5A 4ZDVA 2MBBB 1V6EA 3DOWA 2MP2A 1OQYA 2K9XA 1V9JA 2HJ1A 2XK5A 1E6EB 1WSPA 2JF5A 4LNOA 3VUXA 4JQWC 4HKQA 5LXHA 4NZLB 1R4MI 4CQNA 2NPTB 4HCPB 1KRHA 2K39A 2IGHA 2KDMA 2W3SA 1GC6A 3A9KB 1SIFA 3A9JA 5FR3A 1KLUD 2WYQA 2WXIA 3DHIC 4ANVA 1KJTA 3JW0X
chains in the Genus database with same CATH topology
2KHWB 5CX3A 3UIOB 3HHMA 2C5LC 1C1YB 2D3GA 4GXBA 2W9NA 1V5OA 4CO7A 4URKA 3DBHI 3IG3A 5D6JB 3RUIB 2ZZPB 2KNBA 3M95A 5CTRC 3SD5A 3ZNID 3IBEA 3VXWA 2HTHA 4GDLB 2KN5A 1LM8B 2HJ8A 4NNJB 2NS5A 2BF8B 4DHZB 3PLUA 2J0MA 4IG7B 4FADA 4IM2A 2XEWA 4A3PA 3N32A 2CHZA 5CHVC 3T8MA 1C3TA 2BYEA 3KYDD 4LJOB 2UYZB 2PJHA 2ZPYA 2JZZA 4EKUA 4B9KA 1H4RA 2IO1B 4W9FA 2PE6B 3RYTA 3B0AA 2JXXA 4GIVA 2JVCA 2PPHA 5D94A 3BY4B 5KHQA 4MM3A 5DCNA 1WH3A 2M17A 3PRMB 4FN2A 1K8RB 2DENB 3TJPA 2CHXA 3JSVB 4EFOA 2FCNA 4PS3A 5JH5C 1UELA 2LVQA 2DZKA 2ZNVB 2V1YA 4GN1A 3DQVA 3VTUA 4HLEA 2O6VA 2N9XA 2MX2A 3EC8A 2AWTA 2M1MA 3KVFB 3S2AA 4E71A 5LLIA 2BWES 3M3JA 1WX7A 4WJNA 3R7QA 1I42A 2IZVB 2KFKB 2VRRB 3PVLA 4IW0A 3PGEA 2WDTB 4W9DA 2R2QA 5J18A 3H7SA 2KTFA 1LXDA 4NJ7A 2KJ6A 4DHJB 1E90A 1JRUA 2BKRB 5AZHA 2KLGA 3U30A 1IP9A 3VAWA 2IBIB 4KSLC 2FAZA 2L7RA 4G11A 3WALA 4MGZE 1OEYA 2KC2A 3HM6X 2OJRA 5AZGA 3L0WB 4IWPA 3UIPB 1ZKHA 5DPTA 1V81A 3WAMA 3APDA 5E6NA 5LXIB 2MWSB 3TL5A 2LUEA 5G2NA 3H1UA 2AL6A 1M94A 1PQSA 1J19A 3VH4B 1FXTB 4KVGB 2O6VD 3AI5A 3O65B 1SE9A 3ZIMA 3ZDTA 3ZNGC 5J17A 1WFYA 1WY8A 1Z2MA 2Y5BB 3EFUA 3PS6A 4PS7A 4IWQA 4W9KA 1V80A 2NPTA 1EF5A 3A4RA 4N9F4 4W9GA 5FR6A 3VTVA 2DYBA 3AULA 4DBGA 4AOFA 1KLVA 2DHZA 4NAWB 3VHTC 1CMXB 2KTRB 2KFJA 1GC7A 1WGYA 4NAWA 3ZDMC 3KW5B 4BKGA 3A9KA 4GU2A 4M8NA 1WGGA 3RZWC 2AEHA 2Z0DB 1UBIA 4KIKB 5HKHA 3V60A 1H8CA 1RLFA 3OJ4B 3ONSA 2MCNB 1WF9A 1V5TA 3PT2B 2MQJA 2L05A 2LXCA 5E6PA 2C7HA 3VTWA 4CYEA 3JSVA 3UGBB 3VDZA 3U8ZA 3B1LX 1LFDA 4DDGD 4EOYA 3M62B 3QJZA 4WWOA 3RULA 2YLMA 4RMAA 2KFKA 4FJZA 3ZRFA 3PZDA 1Q5WB 2L00B 1QZEA 4MH0E 3MHSD 4HDQA 3KUZA 3DVGY 4XX5A 4HCNB 4JGHB 2ZCCA 4ZRKA 4GDKA 2J0KA 1LQBA 1E8ZA 2MBQA 2KXJA 1E8XA 1TGZB 1ZW7A 1WR1A 2G45B 4PS8A 3H9DA 3UQBA 4FBJB 5IA7A 3SHQA 2ASQA 2MP2B 2O6VB 3D32A 2C9WB 4A20A 3X0WA 2KO3A 1WM2A 1V49A 2N7EA 4K1RB 2EKEC 4AP4C 4I6NB 4LJPB 3H7PB 3QX1A 5CHFA 4NJ6A 5C1ZA 2LGYA 4RM8A 1UZXB 1WZ3A 3ECIA 4KIKA 2KD0A 2O2VA 1A5RA 2ZVOA 2D11A 4ANUA 2K6QA 4PYUA 2MW5A 3EECA 1WZ0A 1WJ6A 1TZ1A 1OTRB 3UQAA 2MRPA 3A33B 3W1YA 2AL3A 5G55A 3A1QA 4MJSA 1TTNA 2HE7A 4MELA 4W9IA 1Y8RC 2RGFA 2GOWA 2OOBB 2FCQA 1GG3A 3Q3FA 2MBHA 3PRPB 4FLHA 4TV3A 3ZTCA 3EHVA 3PLVA 3P2BA 2KDBA 3ZVVA 4A3OA 1EF1A 3TIXA 4E3CA 1L7YA 3BINA 3VQIA 1MG8A 2IO3B 3ML9A 5DPSA 3SDLC 3PTFC 4MGKE 4MSMB 5J2RA 3LJ3A 3L13A 4MSQB 1ISNA 2A4ZA 2KWCA 1D3ZA 3QQ8B 1P9DU 4F1SA 4MJSB 5L83A 4AUQC 4ZYNA 2RD0A 2KLCA 2KOXA 1WXMA 2IYDB 2NR2A 1E8YA 2L0TA 2GBNA 3KUCB 2N4FA 3HIZA 5TR5A 2KK8A 1P3QU 2KMCA 2N7DA 4IC7B 2MA9B 2K8HA 5EDSA 4HWIB 1E7VA 3NOBA 3CMMB 4F8CB 1EUVB 2BGFA 2NBVB 4RM9A 4I6PA 2KWUB 2CR5A 4WAAA 4MGIE 4BVUC 2N1VA 1VD2A 4AWJA 5DPWA 4B95A 4KZ0A 3N30A 3APFA 2Z59B 4OVUA 4WJOA 2K8BA 3DBLI 4FJYA 1WE6A 4IUMB 4LDTB 2O2VB 3JVZX 3N3KB 4KDLB 4NQLB 2LVOA 3I3TB 4P7IA 3V61A 3ENEA 1NDDA 1UBQA 2C7NB 2FCSA 3ZO5B 1NI2A 2I1KA 4DK5A 2NBUA 2C60A 2LD9A 5AEKB 1T0YA 2B3AA 5C23A 3RD2A 2G4DB 4KDIC 2LASA 2ZVNA 5E6OA 2MBEA 3NZUA 5GMVA 1V86A 1EO6A 1WX9A 2LI5A 2IY1B 2BYVE 2G3QB 2REXA 3JYUA 3KYCD 4ANXA 2Z0EB 1WXAA 1ZGUB 4KV2A 1IYFA 4TKNA 2KANA 4EZKA 1XQQA 3DDCB 4JIOU 3IVFA 3PPAA 2KQSA 2PE9A 4MDKE 3R7RA 1U4AA 1P0RA 3PHWB 3V6CB 3Q3JA 2KDFB 4FA6A 4ICVA 3VFKA 4NQKE 2CKHB 3DBRI 2RSUA 4II2B 4JL9A 2LZ6A 1E8WA 1YD8U 2KDEB 4AJWA 4BKSA 3WANA 3W1SA 4FHJA 2N9PC 3WA0A 4K81A 2ZPNA 3H6NA 1OGWA 3QIJA 4W9EA 5D2MB 3RT3B 3QC8B 2KMAA 4HJKA 2D2QA 4HPLB 4M8MA 1YJ1A 3MTNB 4DXAB 2JRIB 4EZJA 1WIAA 4DHZE 3VUYA 1HE8A 2BPSA 2XK5B 3PREA 4E74A 3NY5A 2AYOB 1RRBA 1WJ4A 1GUAB 4G0NB 4GB9A 2ZCBA 4W9HA 1XT9B 2KKCA 2LWPA 3DBSA 3VUWA 3W1SC 1R4NI 4DHJD 2KDIA 1WXSA 3SU8X 2D07B 1NBFC 4EUTA 4J6IA 2RR9A 3A1QB 4XC2A 1BT0A 4AJYB 4MGYE 4II3B 1XD3B 1WXVA 3H7PA 2J0JA 4G50A 1WRDB 4K7SA 4K7WA 4I6LB 3V62A 2DYMA 3GZNI 2JZ3B 2JT4B 2GBJA 2M0XA 1YQBA 3ZLZA 1AARA 5JZEB 1I35A 1WR6E 2M8SA 2KWVB 4GDKB 4ANWA 4GMVA 4ZRJA 2LRUA 3PV1A 3L08A 2LGDA 4KSKC 4ASWC 2DZIA 2FCMA 3ZTDA 4WQOB 2GBMA 2BWFA 5L95C 1IPGA 2LVPA 4JLCA 4GGQA 3C0RB 2GBRA 2FNJB 1G6JA 2FIDA 2NCNA 1WGHA 2K1FA 3K9PB 2LGXA 2V4LA 2MLBA 3CSTA 1P1AA 2GMIC 3ZW3A 1WGDA 2IO0B 2RPQA 2ZEQA 2PEAA 4FULA 1F9JA 4BBNC 1UD7A 2C7MB 3MJWA 3NHEB 2DX5B 4HVBA 2KC1A 4GDLA 4BOSC 2L3ZA 1Q0WB 4PYZA 1WGRA 1YIWA 4BKSD 2KJHB 4WJPA 3WAPA 3M63B 3ZKJC 3DVNV 2FUHB 2CU1A 1P98A 1KM7A 3HK0A 3LDZE 4W9CA 2G4SA 3V6EB 1SGHA 4F7ZA 4HXDA 2KQ7A 3ML8A 5JHAA 2IY0B 3PHXB 4TQ1A 2XBBC 3ZNHB 2EMSA 2DYOA 2R2OA 3ALBA 2FIFA 3DCGA 2EMTA 2DZMA 4IM0A 4W9LA 2JRHA 2WX1A 3RZFA 1WJNA 1WM3A 3A9JB 3UINB 3ZRCA 2K8CA 3QARA 1WI0A 4EEWA 3L17A 1GNUA 4BFRA 4MEMA 1UH6A 5BO4B 3OLMD 2L76A 3IFWB 1OEYJ 4CHKA 1Z5SB 2IO2B 2QHOA 3L54A 4ZRIA 3QHTA 3QA8A 3DVGX 4ICUA 2D10A 3X23A 4X57B 2GBKA 2NBWB 3CF6E 4BBNF 1RAXA 1VCBA 1YX5B 2BKFA 4GOCA 4LDTD 1S3SG 4K7UA 4HPMB 4WWPA 4HK2A 2N9EB 4NPNA 3QK0A 3NZSA 3RCZA 4BKTA 1KOTA 2NVUI 1WE7A 3ZUNA 2KJRA 2DAJA 3KH0A 1X1MA 1WJUA 4TUUA 3QWZB 5CHWA 2WWZA 1TBEA 3TMPB 3APCA 2DAFA 1UGMA 2LJ5A 4M0WB 2KX3A 3B08A 3R66C 2A5UA 3QAQA 2DZJA 4DWFA 5JHBA 3OJ3A 2JUOA 3U7DA 1Q1OA 3R3MA 1GJZA 3PRZA 2KZRA 3DPDA 2HD5B 3WAOA 1L2NA 3AU5A 4W9JA 4XZ4A 4OVVA 2JY6A 4BOZB 4ZDVA 1YX6B 2MBBB 1J0GA 1V6EA 3T9LA 3QCAA 3DOWA 3CSFA 3WIMA 1WYWB 2MP2A 4HDOA 4DDID 3A4SC 2N1WA 1OQYA 3DVNU 1V9JA 2JPHA 2MSED 4FJVB 3ZNZB 2XK5A 2I1JA 3UF8A 1J8CA 3AU4A 2JF5A 1WX8A 3VUXA 4GSWA 3GOEA 2ZNVC 4B6WA 2J7QB 2WX0A 4WWNA 5D7GA 5DPRA 4JQWC 4NY0A 1RFAA 3K9OB 2JWZA 3AXCA 2CHWA 5LXHA 2L8JA 3IHPC 2BYFA 2K25A 2M4NA 1S1QB 2MBOA 3L16A 1E5WA 1R4MI 2YVCA 1WMHB 2LXAA 4TQ0A 3KUDB 5KHOA 2NPTB 4WJQA 1WMHA 3TBLD 2CS4A 4HCPB 4EZLA 3PSEB 4LCDE 4KZCA 2K39A 2ZJDA 2V3SA 2KTRA 1GC6A 3A9KB 1SIFA 1V2YA 4FHKA 3HM3A 2LRWA 4G3XB 1E7UA 3VH3B 2KX0A 3L10B 3A9JA 3OAWA 4IWOA 5AZFA 2KVRA 4YL8A 2UWQA 2WYQA 2K6DB 5IAAC 4ANVA 2L0FA 3NS8A 4IM3A 3TCAA 3VVWB 1KJTA 3JW0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KHW B;  5CX3 A;  3UIO B;  3HHM A;  2C5L C;  1C1Y B;  2D3G A;  4GXB A;  2W9N A;  1V5O A;  4CO7 A;  4URK A;  3DBH I;  3IG3 A;  5D6J B;  3RUI B;  2ZZP B;  2KNB A;  3M95 A;  5CTR C;  3SD5 A;  3ZNI D;  3IBE A;  3VXW A;  2HTH A;  4GDL B;  2KN5 A;  1LM8 B;  2HJ8 A;  4NNJ B;  2NS5 A;  2BF8 B;  4DHZ B;  3PLU A;  2J0M A;  4IG7 B;  4FAD A;  4IM2 A;  2XEW A;  4A3P A;  3N32 A;  2CHZ A;  5CHV C;  3T8M A;  1C3T A;  2BYE A;  3KYD D;  4LJO B;  2UYZ B;  2PJH A;  2ZPY A;  2JZZ A;  4EKU A;  4B9K A;  1H4R A;  2IO1 B;  4W9F A;  2PE6 B;  3RYT A;  3B0A A;  2JXX A;  4GIV A;  2JVC A;  2PPH A;  5D94 A;  3BY4 B;  5KHQ A;  4MM3 A;  5DCN A;  1WH3 A;  2M17 A;  3PRM B;  4FN2 A;  1K8R B;  2DEN B;  3TJP A;  2CHX A;  3JSV B;  4EFO A;  2FCN A;  4PS3 A;  5JH5 C;  1UEL A;  2LVQ A;  2DZK A;  2ZNV B;  2V1Y A;  4GN1 A;  3DQV A;  3VTU A;  4HLE A;  2O6V A;  2N9X A;  2MX2 A;  3EC8 A;  2AWT A;  2M1M A;  3KVF B;  3S2A A;  4E71 A;  5LLI A;  2BWE S;  3M3J A;  1WX7 A;  4WJN A;  3R7Q A;  1I42 A;  2IZV B;  2KFK B;  2VRR B;  3PVL A;  4IW0 A;  3PGE A;  2WDT B;  4W9D A;  2R2Q A;  5J18 A;  3H7S A;  2KTF A;  1LXD A;  4NJ7 A;  2KJ6 A;  4DHJ B;  1E90 A;  1JRU A;  2BKR B;  5AZH A;  2KLG A;  3U30 A;  1IP9 A;  3VAW A;  2IBI B;  4KSL C;  2FAZ A;  2L7R A;  4G11 A;  3WAL A;  4MGZ E;  1OEY A;  2KC2 A;  3HM6 X;  2OJR A;  5AZG A;  3L0W B;  4IWP A;  3UIP B;  1ZKH A;  5DPT A;  1V81 A;  3WAM A;  3APD A;  5E6N A;  5LXI B;  2MWS B;  3TL5 A;  2LUE A;  5G2N A;  3H1U A;  2AL6 A;  1M94 A;  1PQS A;  1J19 A;  3VH4 B;  1FXT B;  4KVG B;  2O6V D;  3AI5 A;  3O65 B;  1SE9 A;  3ZIM A;  3ZDT A;  3ZNG C;  5J17 A;  1WFY A;  1WY8 A;  1Z2M A;  2Y5B B;  3EFU A;  3PS6 A;  4PS7 A;  4IWQ A;  4W9K A;  1V80 A;  2NPT A;  1EF5 A;  3A4R A;  4N9F 4;  4W9G A;  5FR6 A;  3VTV A;  2DYB A;  3AUL A;  4DBG A;  4AOF A;  1KLV A;  2DHZ A;  4NAW B;  3VHT C;  1CMX B;  2KTR B;  2KFJ A;  1GC7 A;  1WGY A;  4NAW A;  3ZDM C;  3KW5 B;  4BKG A;  3A9K A;  4GU2 A;  4M8N A;  1WGG A;  3RZW C;  2AEH A;  2Z0D B;  1UBI A;  4KIK B;  5HKH A;  3V60 A;  1H8C A;  1RLF A;  3OJ4 B;  3ONS A;  2MCN B;  1WF9 A;  1V5T A;  3PT2 B;  2MQJ A;  2L05 A;  2LXC A;  5E6P A;  2C7H A;  3VTW A;  4CYE A;  3JSV A;  3UGB B;  3VDZ A;  3U8Z A;  3B1L X;  1LFD A;  4DDG D;  4EOY A;  3M62 B;  3QJZ A;  4WWO A;  3RUL A;  2YLM A;  4RMA A;  2KFK A;  4FJZ A;  3ZRF A;  3PZD A;  1Q5W B;  2L00 B;  1QZE A;  4MH0 E;  3MHS D;  4HDQ A;  3KUZ A;  3DVG Y;  4XX5 A;  4HCN B;  4JGH B;  2ZCC A;  4ZRK A;  4GDK A;  2J0K A;  1LQB A;  1E8Z A;  2MBQ A;  2KXJ A;  1E8X A;  1TGZ B;  1ZW7 A;  1WR1 A;  2G45 B;  4PS8 A;  3H9D A;  3UQB A;  4FBJ B;  5IA7 A;  3SHQ A;  2ASQ A;  2MP2 B;  2O6V B;  3D32 A;  2C9W B;  4A20 A;  3X0W A;  2KO3 A;  1WM2 A;  1V49 A;  2N7E A;  4K1R B;  2EKE C;  4AP4 C;  4I6N B;  4LJP B;  3H7P B;  3QX1 A;  5CHF A;  4NJ6 A;  5C1Z A;  2LGY A;  4RM8 A;  1UZX B;  1WZ3 A;  3ECI A;  4KIK A;  2KD0 A;  2O2V A;  1A5R A;  2ZVO A;  2D11 A;  4ANU A;  2K6Q A;  4PYU A;  2MW5 A;  3EEC A;  1WZ0 A;  1WJ6 A;  1TZ1 A;  1OTR B;  3UQA A;  2MRP A;  3A33 B;  3W1Y A;  2AL3 A;  5G55 A;  3A1Q A;  4MJS A;  1TTN A;  2HE7 A;  4MEL A;  4W9I A;  1Y8R C;  2RGF A;  2GOW A;  2OOB B;  2FCQ A;  1GG3 A;  3Q3F A;  2MBH A;  3PRP B;  4FLH A;  4TV3 A;  3ZTC A;  3EHV A;  3PLV A;  3P2B A;  2KDB A;  3ZVV A;  4A3O A;  1EF1 A;  3TIX A;  4E3C A;  1L7Y A;  3BIN A;  3VQI A;  1MG8 A;  2IO3 B;  3ML9 A;  5DPS A;  3SDL C;  3PTF C;  4MGK E;  4MSM B;  5J2R A;  3LJ3 A;  3L13 A;  4MSQ B;  1ISN A;  2A4Z A;  2KWC A;  1D3Z A;  3QQ8 B;  1P9D U;  4F1S A;  4MJS B;  5L83 A;  4AUQ C;  4ZYN A;  2RD0 A;  2KLC A;  2KOX A;  1WXM A;  2IYD B;  2NR2 A;  1E8Y A;  2L0T A;  2GBN A;  3KUC B;  2N4F A;  3HIZ A;  5TR5 A;  2KK8 A;  1P3Q U;  2KMC A;  2N7D A;  4IC7 B;  2MA9 B;  2K8H A;  5EDS A;  4HWI B;  1E7V A;  3NOB A;  3CMM B;  4F8C B;  1EUV B;  2BGF A;  2NBV B;  4RM9 A;  4I6P A;  2KWU B;  2CR5 A;  4WAA A;  4MGI E;  4BVU C;  2N1V A;  1VD2 A;  4AWJ A;  5DPW A;  4B95 A;  4KZ0 A;  3N30 A;  3APF A;  2Z59 B;  4OVU A;  4WJO A;  2K8B A;  3DBL I;  4FJY A;  1WE6 A;  4IUM B;  4LDT B;  2O2V B;  3JVZ X;  3N3K B;  4KDL B;  4NQL B;  2LVO A;  3I3T B;  4P7I A;  3V61 A;  3ENE A;  1NDD A;  1UBQ A;  2C7N B;  2FCS A;  3ZO5 B;  1NI2 A;  2I1K A;  4DK5 A;  2NBU A;  2C60 A;  2LD9 A;  5AEK B;  1T0Y A;  2B3A A;  5C23 A;  3RD2 A;  2G4D B;  4KDI C;  2LAS A;  2ZVN A;  5E6O A;  2MBE A;  3NZU A;  5GMV A;  1V86 A;  1EO6 A;  1WX9 A;  2LI5 A;  2IY1 B;  2BYV E;  2G3Q B;  2REX A;  3JYU A;  3KYC D;  4ANX A;  2Z0E B;  1WXA A;  1ZGU B;  4KV2 A;  1IYF A;  4TKN A;  2KAN A;  4EZK A;  1XQQ A;  3DDC B;  4JIO U;  3IVF A;  3PPA A;  2KQS A;  2PE9 A;  4MDK E;  3R7R A;  1U4A A;  1P0R A;  3PHW B;  3V6C B;  3Q3J A;  2KDF B;  4FA6 A;  4ICV A;  3VFK A;  4NQK E;  2CKH B;  3DBR I;  2RSU A;  4II2 B;  4JL9 A;  2LZ6 A;  1E8W A;  1YD8 U;  2KDE B;  4AJW A;  4BKS A;  3WAN A;  3W1S A;  4FHJ A;  2N9P C;  3WA0 A;  4K81 A;  2ZPN A;  3H6N A;  1OGW A;  3QIJ A;  4W9E A;  5D2M B;  3RT3 B;  3QC8 B;  2KMA A;  4HJK A;  2D2Q A;  4HPL B;  4M8M A;  1YJ1 A;  3MTN B;  4DXA B;  2JRI B;  4EZJ A;  1WIA A;  4DHZ E;  3VUY A;  1HE8 A;  2BPS A;  2XK5 B;  3PRE A;  4E74 A;  3NY5 A;  2AYO B;  1RRB A;  1WJ4 A;  1GUA B;  4G0N B;  4GB9 A;  2ZCB A;  4W9H A;  1XT9 B;  2KKC A;  2LWP A;  3DBS A;  3VUW A;  3W1S C;  1R4N I;  4DHJ D;  2KDI A;  1WXS A;  3SU8 X;  2D07 B;  1NBF C;  4EUT A;  4J6I A;  2RR9 A;  3A1Q B;  4XC2 A;  1BT0 A;  4AJY B;  4MGY E;  4II3 B;  1XD3 B;  1WXV A;  3H7P A;  2J0J A;  4G50 A;  1WRD B;  4K7S A;  4K7W A;  4I6L B;  3V62 A;  2DYM A;  3GZN I;  2JZ3 B;  2JT4 B;  2GBJ A;  2M0X A;  1YQB A;  3ZLZ A;  1AAR A;  5JZE B;  1I35 A;  1WR6 E;  2M8S A;  2KWV B;  4GDK B;  4ANW A;  4GMV A;  4ZRJ A;  2LRU A;  3PV1 A;  3L08 A;  2LGD A;  4KSK C;  4ASW C;  2DZI A;  2FCM A;  3ZTD A;  4WQO B;  2GBM A;  2BWF A;  5L95 C;  1IPG A;  2LVP A;  4JLC A;  4GGQ A;  3C0R B;  2GBR A;  2FNJ B;  1G6J A;  2FID A;  2NCN A;  1WGH A;  2K1F A;  3K9P B;  2LGX A;  2V4L A;  2MLB A;  3CST A;  1P1A A;  2GMI C;  3ZW3 A;  1WGD A;  2IO0 B;  2RPQ A;  2ZEQ A;  2PEA A;  4FUL A;  1F9J A;  4BBN C;  1UD7 A;  2C7M B;  3MJW A;  3NHE B;  2DX5 B;  4HVB A;  2KC1 A;  4GDL A;  4BOS C;  2L3Z A;  1Q0W B;  4PYZ A;  1WGR A;  1YIW A;  4BKS D;  2KJH B;  4WJP A;  3WAP A;  3M63 B;  3ZKJ C;  3DVN V;  2FUH B;  2CU1 A;  1P98 A;  1KM7 A;  3HK0 A;  3LDZ E;  4W9C A;  2G4S A;  3V6E B;  1SGH A;  4F7Z A;  4HXD A;  2KQ7 A;  3ML8 A;  5JHA A;  2IY0 B;  3PHX B;  4TQ1 A;  2XBB C;  3ZNH B;  2EMS A;  2DYO A;  2R2O A;  3ALB A;  2FIF A;  3DCG A;  2EMT A;  2DZM A;  4IM0 A;  4W9L A;  2JRH A;  2WX1 A;  3RZF A;  1WJN A;  1WM3 A;  3A9J B;  3UIN B;  3ZRC A;  2K8C A;  3QAR A;  1WI0 A;  4EEW A;  3L17 A;  1GNU A;  4BFR A;  4MEM A;  1UH6 A;  5BO4 B;  3OLM D;  2L76 A;  3IFW B;  1OEY J;  4CHK A;  1Z5S B;  2IO2 B;  2QHO A;  3L54 A;  4ZRI A;  3QHT A;  3QA8 A;  3DVG X;  4ICU A;  2D10 A;  3X23 A;  4X57 B;  2GBK A;  2NBW B;  3CF6 E;  4BBN F;  1RAX A;  1VCB A;  1YX5 B;  2BKF A;  4GOC A;  4LDT D;  1S3S G;  4K7U A;  4HPM B;  4WWP A;  4HK2 A;  2N9E B;  4NPN A;  3QK0 A;  3NZS A;  3RCZ A;  4BKT A;  1KOT A;  2NVU I;  1WE7 A;  3ZUN A;  2KJR A;  2DAJ A;  3KH0 A;  1X1M A;  1WJU A;  4TUU A;  3QWZ B;  5CHW A;  2WWZ A;  1TBE A;  3TMP B;  3APC A;  2DAF A;  1UGM A;  2LJ5 A;  4M0W B;  2KX3 A;  3B08 A;  3R66 C;  2A5U A;  3QAQ A;  2DZJ A;  4DWF A;  5JHB A;  3OJ3 A;  2JUO A;  3U7D A;  1Q1O A;  3R3M A;  1GJZ A;  3PRZ A;  2KZR A;  3DPD A;  2HD5 B;  3WAO A;  1L2N A;  3AU5 A;  4W9J A;  4XZ4 A;  4OVV A;  2JY6 A;  4BOZ B;  4ZDV A;  1YX6 B;  2MBB B;  1J0G A;  1V6E A;  3T9L A;  3QCA A;  3DOW A;  3CSF A;  3WIM A;  1WYW B;  2MP2 A;  4HDO A;  4DDI D;  3A4S C;  2N1W A;  1OQY A;  3DVN U;  1V9J A;  2JPH A;  2MSE D;  4FJV B;  3ZNZ B;  2XK5 A;  2I1J A;  3UF8 A;  1J8C A;  3AU4 A;  2JF5 A;  1WX8 A;  3VUX A;  4GSW A;  3GOE A;  2ZNV C;  4B6W A;  2J7Q B;  2WX0 A;  4WWN A;  5D7G A;  5DPR A;  4JQW C;  4NY0 A;  1RFA A;  3K9O B;  2JWZ A;  3AXC A;  2CHW A;  5LXH A;  2L8J A;  3IHP C;  2BYF A;  2K25 A;  2M4N A;  1S1Q B;  2MBO A;  3L16 A;  1E5W A;  1R4M I;  2YVC A;  1WMH B;  2LXA A;  4TQ0 A;  3KUD B;  5KHO A;  2NPT B;  4WJQ A;  1WMH A;  3TBL D;  2CS4 A;  4HCP B;  4EZL A;  3PSE B;  4LCD E;  4KZC A;  2K39 A;  2ZJD A;  2V3S A;  2KTR A;  1GC6 A;  3A9K B;  1SIF A;  1V2Y A;  4FHK A;  3HM3 A;  2LRW A;  4G3X B;  1E7U A;  3VH3 B;  2KX0 A;  3L10 B;  3A9J A;  3OAW A;  4IWO A;  5AZF A;  2KVR A;  4YL8 A;  2UWQ A;  2WYQ A;  2K6D B;  5IAA C;  4ANV A;  2L0F A;  3NS8 A;  4IM3 A;  3TCA A;  3VVW B;  1KJT A;  3JW0 X; 
#chains in the Genus database with same CATH topology
 2K0P A;  2D3A A;  2D3G A;  3Q2A C;  4URK A;  2KT7 A;  2WU2 B;  3ZNI D;  3GS2 A;  2HTH A;  4GDL B;  4NNJ B;  4DHZ B;  3PLU A;  4IM2 A;  2XEW A;  2JQR B;  2DWQ A;  3N32 A;  4RF0 A;  2BYE A;  4LJO B;  3AE9 B;  2ZPY A;  1MG4 A;  1KF6 B;  2PVO D;  3Q3O C;  2PE6 B;  1YQ3 B;  2JXX A;  4MM3 B;  3RNG C;  4GIV A;  4XWW A;  2JVC A;  2PPH A;  5D94 A;  1K52 A;  3BY4 B;  5KHQ A;  5DCN A;  2M17 A;  4EFO A;  1UEL A;  2V1Y A;  3DQV A;  2AQ2 B;  2ZW0 A;  1JRO A;  2AWT A;  2M1M A;  1WX7 A;  1L4Z B;  3GB1 A;  2EEL A;  1I42 A;  3U7Z A;  4IW0 A;  1DOY A;  3PGE A;  2KTF A;  1LXD A;  1SF0 A;  5AZH A;  2KLG A;  3VAW A;  2D3B A;  2FAZ A;  2L7R A;  4YSZ B;  2KC2 A;  2QMT A;  1JWS D;  3FIL A;  4YXD B;  4A8X C;  3H1U A;  1J19 A;  3VH4 B;  1T0S C;  2O6V D;  3AI5 A;  3O65 B;  3ZIM A;  1T6B X;  2TSS A;  3ZDT A;  1HA5 A;  1WFY A;  3ZNG C;  1Z2M A;  3EFU A;  3PS6 A;  4PS7 A;  3AE1 B;  4IWQ A;  4W9K A;  4YWG G;  5FR6 A;  4WWM A;  3AUL A;  3P4P B;  5IP4 D;  1F1H A;  4BZA A;  2KTR B;  4YTM B;  4NAW A;  1WGG A;  1RLF A;  1WF9 A;  2HTM E;  1ZDX A;  2L05 A;  5E6P A;  1FEH A;  4CYE A;  4DDG D;  3M62 B;  3HUI A;  2KFK A;  1N62 A;  1ZOY B;  1QF6 A;  1I4Q A;  2B76 B;  2G9H D;  3MHS D;  3Q8B A;  1V1P B;  4JGH B;  1LQB A;  1E8Z A;  2MBQ A;  1YJJ A;  1FNW A;  1E8X A;  1SXT A;  1ZW7 A;  1LO5 D;  4RGM A;  4FBJ B;  1JWA D;  2O6V B;  2LHE A;  1TS5 A;  2E3T A;  1WM2 A;  4I6N B;  4LJP B;  1IBX A;  5C1Z A;  4RM8 A;  2KYW A;  3ZYY X;  1K50 A;  2QJL A;  2D11 A;  3U4E G;  2K6Q A;  3EEC A;  1WZ0 A;  1WJ6 A;  1TZ1 A;  2V9H A;  3W1Y A;  3Q3M C;  4OZC A;  4W9I A;  1Y8R C;  2GOW A;  1GG3 A;  3Q3F A;  3PRP B;  3ZTC A;  2RDH A;  1FCC C;  3P2B A;  4YSY B;  3ZVV A;  1EF1 A;  1XLN A;  2BW2 A;  1TS2 A;  5MPO A;  1MG8 A;  2IO3 B;  5DPS A;  1Y56 A;  3PTF C;  4MSM B;  1UUP A;  3E56 A;  4F1S A;  4MJS B;  5FKA C;  2L0T A;  4YSX B;  1VRA B;  2N7D A;  2MA9 B;  1YN4 A;  5EDS A;  4YT0 B;  4ZHO A;  3NOB A;  3PZ8 A;  1EUV B;  2BGF A;  2NBV B;  1FNU A;  4RM9 A;  1HXY D;  1QIL A;  2MJD A;  4BVU C;  4AWJ A;  3I9V 1;  5DPW A;  2Z59 B;  1ZUD 2;  1WE6 A;  1QOA A;  3EGR A;  3JVZ X;  2GLS A;  3I3T B;  2INP E;  2FBW B;  1ROE A;  1NDD A;  3ZO5 B;  4A9A A;  2LD9 A;  2KVZ A;  5C23 A;  2B3A A;  3RD2 A;  2PW9 A;  2E6X A;  5GMV A;  1V86 A;  2KWD A;  2D3C A;  4ANX A;  3AMZ A;  1ZGU B;  4A90 A;  1F77 A;  1T5X D;  1C79 A;  2CKH B;  4NQK E;  4JL9 A;  1E8W A;  1E9M A;  2KDE B;  4AJW A;  3B9J A;  2N9P C;  2ZPN A;  2KAC A;  3QC8 B;  4HJK A;  4M8M A;  5I4D A;  3VUY A;  5IN7 A;  2XK5 B;  5BYS A;  3MFG A;  4KKI A;  1L4D B;  4W9H A;  1SEB D;  3DBS A;  2LWP A;  1R4N I;  1F2R C;  1NBF C;  4MH8 A;  4J6I A;  1YN3 A;  2RR9 A;  3A1Q B;  1WXV A;  2L83 A;  2J0J A;  4K7S A;  4XDD A;  1I35 A;  1ET9 A;  1IGC A;  1FXI A;  2M8S A;  4GDK B;  2SAK A;  1IGD A;  4KSK C;  2DZI A;  4WQO B;  5L95 C;  3C0R B;  2PMV A;  2FNJ B;  1WGH A;  3CST A;  2MLB A;  1P1A A;  3BVG A;  4XDC A;  1WGD A;  4ZOH C;  2LEK A;  1I7H A;  2ZEQ A;  2WNM A;  2J42 A;  1F9J A;  3RNF C;  1NVI D;  3NHE B;  5JXV A;  1F0Z A;  3IT6 B;  1JML A;  4GDL A;  1TYG B;  3LXF A;  2L3Z A;  4WH4 A;  1WGR A;  1ESF A;  1YIW A;  4WJP A;  3M63 B;  3DVN V;  3T3N A;  1FRR A;  3EUB 2;  1B1Z A;  4W9C A;  2G4S A;  4F7Z A;  3ML8 A;  4N58 A;  5JHA A;  1JAL A;  2R2O A;  2DZM A;  4W9L A;  2Q5W D;  2JRH A;  3ZQ4 A;  3A9J B;  3ZRC A;  4PK1 A;  2DNF A;  1WI0 A;  2BT6 A;  4EEW A;  4MEM A;  5BO4 B;  1F2R I;  2IO2 B;  2MEK A;  3L54 A;  3NG0 A;  3QA8 A;  4A6Q A;  4ICU A;  2D10 A;  3X23 A;  2WDV B;  1OFF A;  2NBW B;  3R2T A;  4BAX A;  1RAX A;  1VCB A;  4GOC A;  4WWP A;  3MC0 B;  4K7U A;  4HPM B;  4HK2 A;  3AE8 B;  4BKT A;  3RCZ A;  5BMI A;  1KFY B;  2GB1 A;  3ZUN A;  1L0Y B;  5CHW A;  1WJU A;  3QWZ B;  2WWZ A;  3APC A;  1ZE3 D;  4M0W B;  2FE8 A;  3B08 A;  4K3B A;  2A5U A;  4KGS A;  3QAQ A;  4LTU A;  1L2N A;  2KZR A;  1HQR D;  1WXQ A;  5IKC M;  2W54 A;  2AQ3 B;  1YX6 B;  1RYJ A;  3ZXV A;  3CSF A;  1CK1 A;  5T8I A;  1P7E A;  4FJV B;  1PGB A;  3ZNZ B;  3DHH C;  1J8C A;  4GSW A;  3GOE A;  2ZNV C;  4WWN A;  1RFA A;  3K9O B;  3AXC A;  2CHW A;  2L8J A;  2M4N A;  2MBO A;  1QOG A;  2YVC A;  2LXA A;  3KLS X;  5KHO A;  4WJQ A;  1WMH A;  2CS4 A;  4EZL A;  4KZC A;  1C4P A;  4ITK A;  4G3X B;  1V2Y A;  2OED A;  3VH3 B;  1J7A A;  2KX0 A;  3L10 B;  4IWO A;  4QAY A;  4RCO A;  3MHZ A;  2JYT A;  2K6D B;  5IAA C;  4IM3 A;  3VVW B;  4DDI D;  5C3J B;  5CX3 A;  1VLB A;  4GXB A;  1V5O A;  3DBH I;  1SJE D;  5D6J B;  1SIJ A;  1R7S A;  2ZZP B;  5CTR C;  3BVM A;  4EE2 A;  5BMH A;  3KQ4 A;  3VXW A;  2KQ4 X;  1N5W A;  2HJ8 A;  3AEF B;  2NS5 A;  2BF8 B;  4IG7 B;  4FAD A;  4A3P A;  1YQ4 B;  5HI1 A;  1MFW A;  2CHZ A;  4IKG A;  4ARC A;  4B9K A;  2VH2 A;  4W9F A;  3DHG C;  3B0A A;  2UU7 A;  4FN2 A;  4LK0 M;  1K8R B;  1GB4 A;  1QT9 A;  3VTU A;  3ZJU A;  2O6V A;  1V1O A;  2LMC A;  3EC8 A;  3BVZ A;  4E71 A;  5LLI A;  4WJN A;  2VRR B;  2J53 A;  4OZA A;  1WYG A;  1E90 A;  1JRU A;  3VR8 B;  5IO9 A;  3NVZ A;  5GXG B;  2OJR A;  4ACF A;  1FMA D;  2K3U A;  3L0W B;  1N61 A;  4IWP A;  2BTE A;  4JPS A;  3WAM A;  1AYF A;  3L4P A;  2AL6 A;  1PQS A;  1FXT B;  4KVG B;  1SE9 A;  1PGA A;  4C4V A;  1V97 A;  1EF5 A;  4KKJ A;  4DBG A;  4AOF A;  1KLV A;  4NAW B;  2KFJ A;  1GC7 A;  3ZDM C;  3RZW C;  2AEH A;  2Z0D B;  1UBI A;  5G5G A;  1V5T A;  2Y5C A;  4MT5 A;  2C7H A;  3VTW A;  3BYT B;  3U8Z A;  3QJZ A;  4HEA 1;  2G1E A;  4RMA A;  1I4R A;  4FJZ A;  3ZRF A;  1Q5W B;  2L00 B;  2OJW A;  3LYY A;  4HDQ A;  3KUZ A;  2JX5 A;  4ZRK A;  4GDK A;  2J0K A;  2G45 B;  2WXF A;  5EE9 A;  3SHQ A;  5IA7 A;  4RF1 A;  1DGJ A;  1WRI A;  3BK2 A;  3X0W A;  2N7E A;  2EKE C;  1PGX A;  3H7P B;  3EFC A;  4JWU C;  4NJ6 A;  3AEA B;  1UZX B;  1WZ3 A;  4KIK A;  2ZVO A;  1BUI C;  2WHI A;  4PYU A;  4MJS A;  2HE7 A;  2RGF A;  4FLH A;  4M00 A;  3EHV A;  1K53 A;  3W5U B;  3MC8 A;  1PUT A;  3NUH B;  1L7Y A;  3SDL C;  4MGK E;  3O13 A;  2KWC A;  1D3Z A;  4AUQ C;  2KLC A;  2CJN A;  1ENF A;  1XLQ A;  2M0A A;  2IYD B;  2V3N A;  3ETR A;  2N4F A;  3HIZ A;  5TR5 A;  5EE1 A;  2KMC A;  2K8H A;  2W55 A;  2JXT A;  3URY A;  2D5G A;  3CMM B;  1UWM A;  1PFD A;  2CR5 A;  4WAA A;  3SEB A;  2IGG A;  4KZ0 A;  4WJO A;  4FJY A;  4IUM B;  1RM6 C;  3N3K B;  4NQL B;  1QKZ A;  4N6E B;  2C7N B;  2VH1 A;  2I1K A;  4DK5 A;  5AEK B;  4IOI E;  1T0Y A;  1VDV A;  2G4D B;  5E6O A;  1WX9 A;  2LI5 A;  2CU3 A;  2BYV E;  2G3Q B;  2Z0E B;  1UNS A;  1XXG A;  4RH6 A;  2KAN A;  4JIO U;  3GZN B;  4C4V B;  2KQS A;  3R7R A;  4ICV A;  2WXJ A;  5AUI A;  2LZ6 A;  5TSS A;  1YD8 U;  4BKS A;  2BS3 B;  3WAN A;  1FPY A;  3WA0 A;  3QIJ A;  1OGW A;  4W9E A;  3RT3 B;  3HVZ A;  3AE7 B;  4GLS C;  2D2Q A;  1Q10 A;  4EZJ A;  2JRI B;  1WIA A;  3J9C A;  3TUO A;  2BPS A;  4KGR A;  2WXK A;  3NY5 A;  1NEK B;  1WJ4 A;  4GB9 A;  2ZCB A;  3W1S C;  2WXP A;  1YMH E;  2KDI A;  4S0R A;  1WXS A;  5H8Y E;  2D07 B;  4AJY B;  1VR9 A;  1XD3 B;  4G50 A;  1JWU D;  1FIQ A;  1WRD B;  1JCK B;  4K7W A;  2PTL A;  4I6L B;  2DYM A;  1KH0 A;  2JT4 B;  2GBJ A;  1YQB A;  4RGT A;  4AS1 A;  3DBH B;  4ZRJ A;  2JZP A;  1ZP0 B;  2LRU A;  3PV1 A;  2LGD A;  1DOX A;  1T3Q A;  2GBM A;  4RFB A;  4GGQ A;  4P1B C;  2WGS A;  2FID A;  2NCN A;  2QCZ A;  5HFY A;  4FUL A;  1RFK A;  4MAC A;  3EA6 A;  4XYC A;  1TS3 A;  4BOS C;  2WXH A;  3DWG C;  2I2Y A;  4PYZ A;  2Z8L A;  4L2Y A;  2FUH B;  2CU1 A;  3AV8 A;  1KM7 A;  2AQ1 B;  3V6E B;  1SGH A;  3AEG B;  4HXD A;  2KQ7 A;  1MHX A;  1N63 A;  1L6U A;  2LUM A;  2IY0 B;  2Y3A A;  4TQ1 A;  2XBB C;  3ZNH B;  2EMS A;  2DYO A;  3ALB A;  1GPX A;  2WX1 A;  3I5J C;  4FXC A;  1AN8 A;  3UIN B;  1EWC A;  4HPP A;  3QAR A;  2BVC A;  1HZ5 A;  3P4S B;  4BFR A;  2JWU A;  1I4H A;  4CHK A;  2L76 A;  1OEY J;  1Z5S B;  4XE0 A;  3TSS A;  1GOZ A;  2BQQ A;  3DVG X;  3TEW A;  2WXO A;  3CF6 E;  3SFD B;  4LDT D;  1J7B A;  2N9E B;  4NPN A;  2NVU I;  3FKY A;  1WE7 A;  3KH0 A;  1TBE A;  1UGM A;  2KX3 A;  3NS1 A;  2XN9 C;  2DZJ A;  5JHB A;  3U7D A;  3R3M A;  3W5V B;  1GJZ A;  3PRZ A;  3AU5 A;  4PT5 A;  3Q3N C;  2N0S B;  1B9R A;  4XZ4 A;  1SE2 A;  4L1B A;  4BOZ B;  1J0G A;  3T9L A;  3QCA A;  4YTP B;  2YEP B;  3VRB B;  1WYW B;  3WIM A;  2WXQ A;  2LJI A;  4HDO A;  3A4S C;  2N1W A;  2N9K A;  1YJI A;  5C2T B;  2JPH A;  2RMM A;  2MSE D;  2I1J A;  3UF8 A;  1WX8 A;  1JWB D;  4OZB A;  2GI9 A;  2INN E;  2J7Q B;  2WX0 A;  5DPR A;  4NY0 A;  2JWZ A;  2BYF A;  2K25 A;  1L6V A;  1E5W A;  1UF0 A;  1WMH B;  4P16 A;  3KUD B;  3CWI A;  4LNK A;  2ZJD A;  2V3S A;  2KTR A;  4FHK A;  2LRW A;  3OAW A;  3N1Y C;  4YL8 A;  1NI3 A;  4US8 A;  1XCQ L;  2L0F A;  3NS8 A;  2KHW B;  3UIO B;  1T0Q C;  3HHM A;  4JWS C;  3RUI B;  3M95 A;  1MPE A;  1IBX B;  2WDR B;  4J3O D;  4ZYS A;  2J0M A;  4C00 A;  5CHV C;  3T8M A;  3KYD D;  3ZJT A;  2UYZ B;  4EKU A;  2N7J A;  2FUG 1;  1H4R A;  5H92 C;  2IO1 B;  4RGO S;  3AH7 A;  1D5M C;  5BMG A;  2V4I B;  3TEZ A;  1NYR A;  3AE3 B;  3PRM B;  5JH5 C;  4PS3 A;  2KAJ A;  2LVQ A;  2DZK A;  3RMK C;  3I57 A;  2MH7 A;  2MX2 A;  3KVF B;  3M3J A;  1M4V A;  2QDF A;  2IZV B;  2KFK B;  3PVL A;  3B2G A;  4W9D A;  5J18 A;  4NJ7 A;  2KJ6 A;  3R2I A;  3C19 A;  3U2S C;  2BKR B;  1JW9 D;  4DXF A;  2IBI B;  4KSL C;  4G11 A;  4MGZ E;  1OEY A;  4XGA B;  3PO0 A;  4OVZ A;  1TY0 A;  1SBB B;  2NMQ A;  1XO3 A;  3APD A;  5E6N A;  5LXI B;  3TL5 A;  2LUE A;  1JRP A;  1M94 A;  4ZRP A;  1WY8 A;  3RI7 C;  3TEY A;  2QEJ C;  1V80 A;  2NPT A;  3A4R A;  4W9G A;  3VTV A;  4L23 A;  2DYB A;  3NVV A;  3OWE B;  2PVG C;  4WUR A;  1TJE A;  4OW0 A;  3KW5 B;  4BKG A;  3IXS A;  3V60 A;  3OJ4 B;  3ONS A;  3PT2 B;  2LXC A;  4HRS A;  3UGB B;  3VDZ A;  3B1L X;  2L1A A;  4WWO A;  3RUL A;  3RN9 C;  2INC C;  5D3D A;  2BYT A;  3DBR B;  1QZE A;  3DVG Y;  4XX5 A;  3GE8 C;  2KXJ A;  2ICI A;  2WXN A;  1WR1 A;  2IDY A;  1PYW D;  2ASQ A;  1ACC A;  2K5P A;  3D32 A;  3V3X A;  1P7F A;  4K1R B;  4AP4 C;  2RPV A;  3QX1 A;  2LGY A;  2O2V A;  1A5R A;  5BYQ A;  3MJ5 A;  3UQA A;  2LGS A;  2MRP A;  3A33 B;  3P4Q B;  2AL3 A;  3V05 A;  5G55 A;  3A1Q A;  4OHJ A;  4ARI A;  5EE0 A;  4MEL A;  3RNE C;  3N9Y C;  4ZHP A;  2OOB B;  4XWT A;  1MI0 A;  1VJK A;  2KDB A;  4KGT A;  4A3O A;  3TIX A;  1SJH D;  3BIN A;  1I4G A;  3VQI A;  3IAS 1;  3LJ3 A;  3L13 A;  4MSQ B;  1ISN A;  2A4Z A;  4ZYN A;  2RD0 A;  2KOX A;  1WXM A;  3AE5 B;  1SE3 A;  1D6E C;  1GAQ B;  5AUK A;  3SR6 A;  1QOB A;  4P1C C;  4IC7 B;  1K51 A;  4HWI B;  1WGK A;  1D4B A;  1E7V A;  1FRD A;  2H89 B;  4I6P A;  4C56 C;  3ZXR A;  4MGI E;  2IND C;  4B95 A;  1HTO A;  3RFZ B;  2L52 A;  3BII D;  4LDT B;  1ZPS A;  2O2V B;  3CIR B;  3P4R B;  4KDL B;  3V61 A;  1LGR A;  2FCS A;  1NI2 A;  2NBU A;  2C60 A;  1L0X B;  2BS2 B;  2LHD A;  2IY1 B;  2REX A;  3AE2 B;  3JYU A;  3FC4 A;  3VRA B;  1IYF A;  1XEE A;  4TKN A;  3NVW A;  3PPA A;  2PE9 A;  1P0R A;  3V6C B;  3Q3J A;  1TKG A;  4FA6 A;  3AB5 A;  4UDU C;  1TT5 B;  4RNA A;  3VFK A;  2R61 A;  1MJD A;  3DBR I;  2IGD A;  2RSU A;  1TS4 A;  4FHJ A;  4K81 A;  1EU4 A;  4Q2J A;  5D2M B;  2KMA A;  2RDB C;  2JU6 X;  4HPL B;  4DXA B;  1C4A A;  4C80 A;  1HE8 A;  4LLG M;  4E74 A;  1J7C A;  2AYO B;  1RRB A;  1GUA B;  3VUW A;  1XT9 B;  2KKC A;  4DHJ D;  3BZD B;  5FK9 C;  3RNB C;  2X8X X;  1I4P A;  1BT0 A;  2BS4 B;  3Q8E A;  3H7P A;  4AQ7 A;  1JQ4 A;  3Q69 A;  4B0M A;  3N1X C;  2M0X A;  1CJE A;  3ZLZ A;  5JZE B;  2QSD A;  3Q8C A;  1ZXI A;  2KWV B;  1WWT A;  1N60 A;  1C9F A;  4ANW A;  2V0G A;  2FCM A;  3VR9 B;  3ZTD A;  2BWF A;  2JSV X;  1IPG A;  2GBR A;  1G6J A;  5EE3 A;  3K9P B;  2WLB A;  2V4L A;  2GMI C;  2PEA A;  2KN4 A;  4BBN C;  4US9 A;  3MJW A;  4JX1 C;  1VZ6 A;  2DX5 B;  4HVB A;  4DQO C;  1Q0W B;  1TKE A;  4BKS D;  2KJH B;  3WAP A;  3ZKJ C;  3LDZ E;  3W2D A;  3N1Z C;  3C8Y A;  3R8B A;  3PHX B;  1AWD A;  3DCG A;  4IM0 A;  3RZF A;  1WJN A;  1WM3 A;  4DXG A;  2K8C A;  2ONQ A;  2QIE B;  3L17 A;  1GNU A;  2QC8 A;  3OLM D;  1SSN A;  2DLB A;  4ZRI A;  3QHT A;  1CQV A;  2WXG A;  3AEB B;  4H2A A;  4X57 B;  1YX5 B;  1S3S G;  4IDI A;  3NZS A;  1KOT A;  2KJR A;  4TUU A;  1GB1 A;  2LJ5 A;  1RWS A;  3B2F A;  3R66 C;  4LNF A;  4DWF A;  3OJ3 A;  2JUO A;  3WAO A;  2HD5 B;  3BWU D;  1JWM D;  4W9J A;  4S17 A;  2ACZ B;  4N59 A;  2SEB D;  3DVN U;  4M01 A;  4WAF A;  1C77 A;  3AU4 A;  4B6W A;  5D7G A;  2MJE A;  3IHP C;  3Q8F A;  1S1Q B;  3L16 A;  4P6V F;  3AE6 B;  4TQ0 A;  3TBL D;  3PSE B;  4LCD E;  4A55 A;  2IJ0 A;  1L0V B;  2LFI A;  2W82 A;  3HM3 A;  1E7U A;  5AZF A;  4TMA B;  1R4M B;  2KVR A;  1MVK A;  2UWQ A;  1N6Z A;  3TCA A;  1MHH E;  1FO4 A;  2HDE A;  1N5X A;  1D5Z C;  2C5L C;  1C1Y B;  3Q8A A;  2W9N A;  4CO7 A;  3IG3 A;  1TKY A;  2KNB A;  3SD5 A;  4C7Y A;  3IBE A;  2KN5 A;  1LM8 B;  3ZGZ A;  2OHF A;  1SE4 A;  1C3T A;  2PJH A;  2JZZ A;  3P63 A;  2W3R A;  2BBC A;  3RYT A;  2XNA C;  1HEZ E;  4MM3 A;  3Q14 C;  1WH3 A;  2DEN B;  3TJP A;  3DWM A;  2CHX A;  3IT4 B;  3JSV B;  2FCN A;  2LGI A;  2ZNV B;  4GN1 A;  4HLE A;  2PKO A;  1FM0 D;  2N9X A;  3S2A A;  2H88 B;  2BWE S;  3R7Q A;  1XCT L;  2BB6 A;  2WDT B;  2R2Q A;  3H7S A;  1FCL A;  4DHJ B;  2WQY B;  3U30 A;  3MP9 A;  1IP9 A;  3ZJV A;  3WAL A;  2I38 A;  1FNV A;  3HM6 X;  5AZG A;  2ZW1 A;  4M0W A;  3UIP B;  2WDQ B;  1ZKH A;  4WIP A;  5DPT A;  1V81 A;  2MWS B;  1NYQ A;  5G2N A;  1QQR A;  4C7Z A;  1QLB B;  1XLO A;  5J17 A;  2Y5B B;  4LNI A;  4N9F 4;  2WP9 B;  3DBL B;  1E7P B;  2DHZ A;  5D3I B;  3VHT C;  1CMX B;  1WGY A;  1STE A;  3AED B;  2Y5P A;  3A9K A;  4GU2 A;  4M8N A;  2J52 A;  1H8C A;  4KIK B;  5HKH A;  4KX6 B;  2MCN B;  1PDX A;  2MQJ A;  3ABV B;  1TZO A;  3JSV A;  1LFD A;  3KWV A;  4EOY A;  1DYQ A;  2PLP A;  2YLM A;  2KMM A;  1TIF A;  3PZD A;  1AW7 A;  4MH0 E;  3T3O A;  4HCN B;  2ZCC A;  1V1P A;  1C4C A;  1QOF A;  5BYR A;  1TGZ B;  1BML C;  4PS8 A;  3H9D A;  3NVY A;  1BXT A;  2CJO A;  3UQB A;  3RNA C;  2MP2 B;  1L5P A;  2C9W B;  4A20 A;  4R3D A;  3RPF C;  2KO3 A;  1V49 A;  3E9S A;  3BK1 A;  5CHF A;  1XLP A;  2DBY A;  5E6J A;  3ECI A;  2KD0 A;  4ANU A;  4RGN A;  4HKZ E;  2MW5 A;  3N20 C;  1OTR B;  1V8C A;  1A70 A;  1TTN A;  2QIL A;  2WXL A;  2FCQ A;  3FIL B;  2MBH A;  4TV3 A;  4JE3 B;  2IPK D;  3PLV A;  1OQR A;  1IUE A;  4USA A;  3NJT A;  3Q6B A;  1HZ6 A;  1YOV B;  2NTT A;  3AN1 A;  4E3C A;  3ML9 A;  1ZXH A;  1EM7 A;  5J2R A;  2MHJ A;  4REZ A;  3RNC C;  1D5X C;  2NTS A;  3QQ8 B;  1P9D U;  4D2K A;  5L83 A;  4ZRQ A;  2NR2 A;  3W9C B;  1E8Y A;  5IOI A;  2GBN A;  3KUC B;  2KK8 A;  1P3Q U;  3TEX A;  2GRI A;  2JYE A;  5HG2 A;  1E10 A;  4F8C B;  1FFV A;  2KWU B;  3MC9 A;  1E0Z A;  2N1V A;  1VD2 A;  5G5H A;  2WU5 B;  3N30 A;  3APF A;  3BYY B;  1YNT E;  4M02 A;  2MJ3 A;  4YTN B;  4OVU A;  2K8B A;  3DBL I;  3HRD D;  1DOI A;  2LVO A;  4P7I A;  1ZDV A;  3P1M A;  3ENE A;  1UBQ A;  4NJC A;  4KDI C;  2LAS A;  2ZVN A;  2MBE A;  3NZU A;  1FXA A;  1EO6 A;  4LNN A;  3KYC D;  1WXA A;  2EKI A;  4KV2 A;  4EZK A;  1XQQ A;  3DDC B;  2N9L A;  3IVF A;  1UWX A;  4MDK E;  1U4A A;  3PHW B;  2KDF B;  1CZP A;  2K22 A;  1SB3 C;  3UI3 A;  1OQQ A;  3AE4 B;  4II2 B;  1KLG D;  3I63 C;  1FD6 A;  3W1S A;  1R4N B;  3H6N A;  2WS3 B;  2WXM A;  3P42 A;  3H8H A;  1YJ1 A;  3MTN B;  4DHZ E;  2X38 A;  1VZ8 A;  3PRE A;  4G0N B;  1C76 A;  3SU8 X;  4EUT A;  4XC2 A;  3AM9 A;  2ON8 A;  3HVD A;  4MGY E;  4II3 B;  1TY2 A;  3WCQ A;  4WQM A;  3PZ7 A;  3V62 A;  2PIA A;  3GZN I;  2JZ3 B;  2AX5 A;  4HJG E;  1AAR A;  1YN5 A;  1WR6 E;  3IAM 1;  1ET6 A;  3LB8 C;  4GMV A;  4ASW C;  3L08 A;  2YEP F;  3AEE B;  2LVP A;  4JLC A;  4NAM A;  3SFE B;  2L32 A;  2K1F A;  3NRZ A;  3U52 E;  2LGX A;  3ZW3 A;  2RPQ A;  2IO0 B;  2WXR A;  3KWL A;  1UD7 A;  2C7M B;  5LNK 1;  2KC1 A;  1T0R C;  3GP7 A;  2VZK D;  3FAH A;  1P98 A;  3HK0 A;  4K3C A;  1KTK A;  4HRO A;  2FIF A;  2EMT A;  1UGJ A;  1F52 A;  2VZK B;  1HTQ A;  1XF5 L;  2M19 A;  1VZ7 A;  3GE3 C;  1UH6 A;  4B0E A;  3IFW B;  2RDG A;  4TSS A;  2QHO A;  1FFU A;  2BB5 A;  2GBK A;  4BBN F;  2BKF A;  1NEN B;  1I4X A;  1EWY C;  1C78 A;  3QK0 A;  3NZ3 A;  1EU3 A;  5HHD G;  2DAJ A;  1X1M A;  3TMP B;  2DAF A;  2M56 B;  1Q1O A;  2J4X A;  3DPD A;  3AEC B;  4O1N A;  4OVV A;  2JY6 A;  2V3P A;  3OG5 A;  4ZDV A;  2MBB B;  1V6E A;  3DOW A;  2MP2 A;  1OQY A;  2K9X A;  1V9J A;  2HJ1 A;  2XK5 A;  1E6E B;  1WSP A;  2JF5 A;  4LNO A;  3VUX A;  4JQW C;  4HKQ A;  5LXH A;  4NZL B;  1R4M I;  4CQN A;  2NPT B;  4HCP B;  1KRH A;  2K39 A;  2IGH A;  2KDM A;  2W3S A;  1GC6 A;  3A9K B;  1SIF A;  3A9J A;  5FR3 A;  1KLU D;  2WYQ A;  2WXI A;  3DHI C;  4ANV A;  1KJT A;  3JW0 X; 
#chains in the Genus database with same CATH homology
 2KHW B;  5CX3 A;  3UIO B;  3HHM A;  2C5L C;  1C1Y B;  2D3G A;  4GXB A;  2W9N A;  1V5O A;  4CO7 A;  4URK A;  3DBH I;  3IG3 A;  5D6J B;  3RUI B;  2ZZP B;  2KNB A;  3M95 A;  5CTR C;  3SD5 A;  3ZNI D;  3IBE A;  3VXW A;  2HTH A;  4GDL B;  2KN5 A;  1LM8 B;  2HJ8 A;  4NNJ B;  2NS5 A;  2BF8 B;  4DHZ B;  3PLU A;  2J0M A;  4IG7 B;  4FAD A;  4IM2 A;  2XEW A;  4A3P A;  3N32 A;  2CHZ A;  5CHV C;  3T8M A;  1C3T A;  2BYE A;  3KYD D;  4LJO B;  2UYZ B;  2PJH A;  2ZPY A;  2JZZ A;  4EKU A;  4B9K A;  1H4R A;  2IO1 B;  4W9F A;  2PE6 B;  3RYT A;  3B0A A;  2JXX A;  4GIV A;  2JVC A;  2PPH A;  5D94 A;  3BY4 B;  5KHQ A;  4MM3 A;  5DCN A;  1WH3 A;  2M17 A;  3PRM B;  4FN2 A;  1K8R B;  2DEN B;  3TJP A;  2CHX A;  3JSV B;  4EFO A;  2FCN A;  4PS3 A;  5JH5 C;  1UEL A;  2LVQ A;  2DZK A;  2ZNV B;  2V1Y A;  4GN1 A;  3DQV A;  3VTU A;  4HLE A;  2O6V A;  2N9X A;  2MX2 A;  3EC8 A;  2AWT A;  2M1M A;  3KVF B;  3S2A A;  4E71 A;  5LLI A;  2BWE S;  3M3J A;  1WX7 A;  4WJN A;  3R7Q A;  1I42 A;  2IZV B;  2KFK B;  2VRR B;  3PVL A;  4IW0 A;  3PGE A;  2WDT B;  4W9D A;  2R2Q A;  5J18 A;  3H7S A;  2KTF A;  1LXD A;  4NJ7 A;  2KJ6 A;  4DHJ B;  1E90 A;  1JRU A;  2BKR B;  5AZH A;  2KLG A;  3U30 A;  1IP9 A;  3VAW A;  2IBI B;  4KSL C;  2FAZ A;  2L7R A;  4G11 A;  3WAL A;  4MGZ E;  1OEY A;  2KC2 A;  3HM6 X;  2OJR A;  5AZG A;  3L0W B;  4IWP A;  3UIP B;  1ZKH A;  5DPT A;  1V81 A;  3WAM A;  3APD A;  5E6N A;  5LXI B;  2MWS B;  3TL5 A;  2LUE A;  5G2N A;  3H1U A;  2AL6 A;  1M94 A;  1PQS A;  1J19 A;  3VH4 B;  1FXT B;  4KVG B;  2O6V D;  3AI5 A;  3O65 B;  1SE9 A;  3ZIM A;  3ZDT A;  3ZNG C;  5J17 A;  1WFY A;  1WY8 A;  1Z2M A;  2Y5B B;  3EFU A;  3PS6 A;  4PS7 A;  4IWQ A;  4W9K A;  1V80 A;  2NPT A;  1EF5 A;  3A4R A;  4N9F 4;  4W9G A;  5FR6 A;  3VTV A;  2DYB A;  3AUL A;  4DBG A;  4AOF A;  1KLV A;  2DHZ A;  4NAW B;  3VHT C;  1CMX B;  2KTR B;  2KFJ A;  1GC7 A;  1WGY A;  4NAW A;  3ZDM C;  3KW5 B;  4BKG A;  3A9K A;  4GU2 A;  4M8N A;  1WGG A;  3RZW C;  2AEH A;  2Z0D B;  1UBI A;  4KIK B;  5HKH A;  3V60 A;  1H8C A;  1RLF A;  3OJ4 B;  3ONS A;  2MCN B;  1WF9 A;  1V5T A;  3PT2 B;  2MQJ A;  2L05 A;  2LXC A;  5E6P A;  2C7H A;  3VTW A;  4CYE A;  3JSV A;  3UGB B;  3VDZ A;  3U8Z A;  3B1L X;  1LFD A;  4DDG D;  4EOY A;  3M62 B;  3QJZ A;  4WWO A;  3RUL A;  2YLM A;  4RMA A;  2KFK A;  4FJZ A;  3ZRF A;  3PZD A;  1Q5W B;  2L00 B;  1QZE A;  4MH0 E;  3MHS D;  4HDQ A;  3KUZ A;  3DVG Y;  4XX5 A;  4HCN B;  4JGH B;  2ZCC A;  4ZRK A;  4GDK A;  2J0K A;  1LQB A;  1E8Z A;  2MBQ A;  2KXJ A;  1E8X A;  1TGZ B;  1ZW7 A;  1WR1 A;  2G45 B;  4PS8 A;  3H9D A;  3UQB A;  4FBJ B;  5IA7 A;  3SHQ A;  2ASQ A;  2MP2 B;  2O6V B;  3D32 A;  2C9W B;  4A20 A;  3X0W A;  2KO3 A;  1WM2 A;  1V49 A;  2N7E A;  4K1R B;  2EKE C;  4AP4 C;  4I6N B;  4LJP B;  3H7P B;  3QX1 A;  5CHF A;  4NJ6 A;  5C1Z A;  2LGY A;  4RM8 A;  1UZX B;  1WZ3 A;  3ECI A;  4KIK A;  2KD0 A;  2O2V A;  1A5R A;  2ZVO A;  2D11 A;  4ANU A;  2K6Q A;  4PYU A;  2MW5 A;  3EEC A;  1WZ0 A;  1WJ6 A;  1TZ1 A;  1OTR B;  3UQA A;  2MRP A;  3A33 B;  3W1Y A;  2AL3 A;  5G55 A;  3A1Q A;  4MJS A;  1TTN A;  2HE7 A;  4MEL A;  4W9I A;  1Y8R C;  2RGF A;  2GOW A;  2OOB B;  2FCQ A;  1GG3 A;  3Q3F A;  2MBH A;  3PRP B;  4FLH A;  4TV3 A;  3ZTC A;  3EHV A;  3PLV A;  3P2B A;  2KDB A;  3ZVV A;  4A3O A;  1EF1 A;  3TIX A;  4E3C A;  1L7Y A;  3BIN A;  3VQI A;  1MG8 A;  2IO3 B;  3ML9 A;  5DPS A;  3SDL C;  3PTF C;  4MGK E;  4MSM B;  5J2R A;  3LJ3 A;  3L13 A;  4MSQ B;  1ISN A;  2A4Z A;  2KWC A;  1D3Z A;  3QQ8 B;  1P9D U;  4F1S A;  4MJS B;  5L83 A;  4AUQ C;  4ZYN A;  2RD0 A;  2KLC A;  2KOX A;  1WXM A;  2IYD B;  2NR2 A;  1E8Y A;  2L0T A;  2GBN A;  3KUC B;  2N4F A;  3HIZ A;  5TR5 A;  2KK8 A;  1P3Q U;  2KMC A;  2N7D A;  4IC7 B;  2MA9 B;  2K8H A;  5EDS A;  4HWI B;  1E7V A;  3NOB A;  3CMM B;  4F8C B;  1EUV B;  2BGF A;  2NBV B;  4RM9 A;  4I6P A;  2KWU B;  2CR5 A;  4WAA A;  4MGI E;  4BVU C;  2N1V A;  1VD2 A;  4AWJ A;  5DPW A;  4B95 A;  4KZ0 A;  3N30 A;  3APF A;  2Z59 B;  4OVU A;  4WJO A;  2K8B A;  3DBL I;  4FJY A;  1WE6 A;  4IUM B;  4LDT B;  2O2V B;  3JVZ X;  3N3K B;  4KDL B;  4NQL B;  2LVO A;  3I3T B;  4P7I A;  3V61 A;  3ENE A;  1NDD A;  1UBQ A;  2C7N B;  2FCS A;  3ZO5 B;  1NI2 A;  2I1K A;  4DK5 A;  2NBU A;  2C60 A;  2LD9 A;  5AEK B;  1T0Y A;  2B3A A;  5C23 A;  3RD2 A;  2G4D B;  4KDI C;  2LAS A;  2ZVN A;  5E6O A;  2MBE A;  3NZU A;  5GMV A;  1V86 A;  1EO6 A;  1WX9 A;  2LI5 A;  2IY1 B;  2BYV E;  2G3Q B;  2REX A;  3JYU A;  3KYC D;  4ANX A;  2Z0E B;  1WXA A;  1ZGU B;  4KV2 A;  1IYF A;  4TKN A;  2KAN A;  4EZK A;  1XQQ A;  3DDC B;  4JIO U;  3IVF A;  3PPA A;  2KQS A;  2PE9 A;  4MDK E;  3R7R A;  1U4A A;  1P0R A;  3PHW B;  3V6C B;  3Q3J A;  2KDF B;  4FA6 A;  4ICV A;  3VFK A;  4NQK E;  2CKH B;  3DBR I;  2RSU A;  4II2 B;  4JL9 A;  2LZ6 A;  1E8W A;  1YD8 U;  2KDE B;  4AJW A;  4BKS A;  3WAN A;  3W1S A;  4FHJ A;  2N9P C;  3WA0 A;  4K81 A;  2ZPN A;  3H6N A;  1OGW A;  3QIJ A;  4W9E A;  5D2M B;  3RT3 B;  3QC8 B;  2KMA A;  4HJK A;  2D2Q A;  4HPL B;  4M8M A;  1YJ1 A;  3MTN B;  4DXA B;  2JRI B;  4EZJ A;  1WIA A;  4DHZ E;  3VUY A;  1HE8 A;  2BPS A;  2XK5 B;  3PRE A;  4E74 A;  3NY5 A;  2AYO B;  1RRB A;  1WJ4 A;  1GUA B;  4G0N B;  4GB9 A;  2ZCB A;  4W9H A;  1XT9 B;  2KKC A;  2LWP A;  3DBS A;  3VUW A;  3W1S C;  1R4N I;  4DHJ D;  2KDI A;  1WXS A;  3SU8 X;  2D07 B;  1NBF C;  4EUT A;  4J6I A;  2RR9 A;  3A1Q B;  4XC2 A;  1BT0 A;  4AJY B;  4MGY E;  4II3 B;  1XD3 B;  1WXV A;  3H7P A;  2J0J A;  4G50 A;  1WRD B;  4K7S A;  4K7W A;  4I6L B;  3V62 A;  2DYM A;  3GZN I;  2JZ3 B;  2JT4 B;  2GBJ A;  2M0X A;  1YQB A;  3ZLZ A;  1AAR A;  5JZE B;  1I35 A;  1WR6 E;  2M8S A;  2KWV B;  4GDK B;  4ANW A;  4GMV A;  4ZRJ A;  2LRU A;  3PV1 A;  3L08 A;  2LGD A;  4KSK C;  4ASW C;  2DZI A;  2FCM A;  3ZTD A;  4WQO B;  2GBM A;  2BWF A;  5L95 C;  1IPG A;  2LVP A;  4JLC A;  4GGQ A;  3C0R B;  2GBR A;  2FNJ B;  1G6J A;  2FID A;  2NCN A;  1WGH A;  2K1F A;  3K9P B;  2LGX A;  2V4L A;  2MLB A;  3CST A;  1P1A A;  2GMI C;  3ZW3 A;  1WGD A;  2IO0 B;  2RPQ A;  2ZEQ A;  2PEA A;  4FUL A;  1F9J A;  4BBN C;  1UD7 A;  2C7M B;  3MJW A;  3NHE B;  2DX5 B;  4HVB A;  2KC1 A;  4GDL A;  4BOS C;  2L3Z A;  1Q0W B;  4PYZ A;  1WGR A;  1YIW A;  4BKS D;  2KJH B;  4WJP A;  3WAP A;  3M63 B;  3ZKJ C;  3DVN V;  2FUH B;  2CU1 A;  1P98 A;  1KM7 A;  3HK0 A;  3LDZ E;  4W9C A;  2G4S A;  3V6E B;  1SGH A;  4F7Z A;  4HXD A;  2KQ7 A;  3ML8 A;  5JHA A;  2IY0 B;  3PHX B;  4TQ1 A;  2XBB C;  3ZNH B;  2EMS A;  2DYO A;  2R2O A;  3ALB A;  2FIF A;  3DCG A;  2EMT A;  2DZM A;  4IM0 A;  4W9L A;  2JRH A;  2WX1 A;  3RZF A;  1WJN A;  1WM3 A;  3A9J B;  3UIN B;  3ZRC A;  2K8C A;  3QAR A;  1WI0 A;  4EEW A;  3L17 A;  1GNU A;  4BFR A;  4MEM A;  1UH6 A;  5BO4 B;  3OLM D;  2L76 A;  3IFW B;  1OEY J;  4CHK A;  1Z5S B;  2IO2 B;  2QHO A;  3L54 A;  4ZRI A;  3QHT A;  3QA8 A;  3DVG X;  4ICU A;  2D10 A;  3X23 A;  4X57 B;  2GBK A;  2NBW B;  3CF6 E;  4BBN F;  1RAX A;  1VCB A;  1YX5 B;  2BKF A;  4GOC A;  4LDT D;  1S3S G;  4K7U A;  4HPM B;  4WWP A;  4HK2 A;  2N9E B;  4NPN A;  3QK0 A;  3NZS A;  3RCZ A;  4BKT A;  1KOT A;  2NVU I;  1WE7 A;  3ZUN A;  2KJR A;  2DAJ A;  3KH0 A;  1X1M A;  1WJU A;  4TUU A;  3QWZ B;  5CHW A;  2WWZ A;  1TBE A;  3TMP B;  3APC A;  2DAF A;  1UGM A;  2LJ5 A;  4M0W B;  2KX3 A;  3B08 A;  3R66 C;  2A5U A;  3QAQ A;  2DZJ A;  4DWF A;  5JHB A;  3OJ3 A;  2JUO A;  3U7D A;  1Q1O A;  3R3M A;  1GJZ A;  3PRZ A;  2KZR A;  3DPD A;  2HD5 B;  3WAO A;  1L2N A;  3AU5 A;  4W9J A;  4XZ4 A;  4OVV A;  2JY6 A;  4BOZ B;  4ZDV A;  1YX6 B;  2MBB B;  1J0G A;  1V6E A;  3T9L A;  3QCA A;  3DOW A;  3CSF A;  3WIM A;  1WYW B;  2MP2 A;  4HDO A;  4DDI D;  3A4S C;  2N1W A;  1OQY A;  3DVN U;  1V9J A;  2JPH A;  2MSE D;  4FJV B;  3ZNZ B;  2XK5 A;  2I1J A;  3UF8 A;  1J8C A;  3AU4 A;  2JF5 A;  1WX8 A;  3VUX A;  4GSW A;  3GOE A;  2ZNV C;  4B6W A;  2J7Q B;  2WX0 A;  4WWN A;  5D7G A;  5DPR A;  4JQW C;  4NY0 A;  1RFA A;  3K9O B;  2JWZ A;  3AXC A;  2CHW A;  5LXH A;  2L8J A;  3IHP C;  2BYF A;  2K25 A;  2M4N A;  1S1Q B;  2MBO A;  3L16 A;  1E5W A;  1R4M I;  2YVC A;  1WMH B;  2LXA A;  4TQ0 A;  3KUD B;  5KHO A;  2NPT B;  4WJQ A;  1WMH A;  3TBL D;  2CS4 A;  4HCP B;  4EZL A;  3PSE B;  4LCD E;  4KZC A;  2K39 A;  2ZJD A;  2V3S A;  2KTR A;  1GC6 A;  3A9K B;  1SIF A;  1V2Y A;  4FHK A;  3HM3 A;  2LRW A;  4G3X B;  1E7U A;  3VH3 B;  2KX0 A;  3L10 B;  3A9J A;  3OAW A;  4IWO A;  5AZF A;  2KVR A;  4YL8 A;  2UWQ A;  2WYQ A;  2K6D B;  5IAA C;  4ANV A;  2L0F A;  3NS8 A;  4IM3 A;  3TCA A;  3VVW B;  1KJT A;  3JW0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...