4XC2A

Crystal structure of gabarap in complex with kbtbd6 lir peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
MGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GABA(A) receptor-associated protein
publication title CUL3-KBTBD6/KBTBD7 Ubiquitin Ligase Cooperates with GABARAP Proteins to Spatially Restrict TIAM1-RAC1 Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 35
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4xc2A00
2JRHA 3Q3JA 4E71A 3A1QA 1H8CA 4GDKA 2NPTA 2K8HA 2MA9B 1WGGA 3IFWB 3UINB 4LJOB 2ZNVB 1Q0WB 3OLMD 4KDLB 3ZRFA 3RZFA 2JPHA 2MWSB 2DZJA 1V6EA 2DYBA 2JUOA 2XBBC 3NOBA 4DHJD 3DBSA 2KD0A 5KHOA 2G4DB 2M0XA 1JRUA 1E90A 2ZVOA 4BVUC 2Z0EB 2B3AA 1WXAA 3R7QA 4A3OA 4W9IA 1Z5SB 3NZUA 3A33B 1RAXA 3ZLZA 4PS8A 3RT3B 3WAMA 3QA8A 4K7WA 2CR5A 2MSED 3B0AA 3PLVA 3TBLD 3VH3B 3WIMA 2MBHA 1WI0A 2KFJA 2PE6B 2KLCA 2FAZA 2R2OA 3QK0A 5JZEB 2MBEA 4NAWB 5HKHA 2K8CA 3CSFA 2KX3A 4HCNB 4CHKA 5KHQA 3R66C 5JHAA 1C3TA 3QWZB 2M8SA 3AXCA 3M95A 5J17A 1WF9A 3WAOA 2D11A 1TZ1A 2LGYA 4OVVA 3PREA 2LVQA 1M94A 1IPGA 1OEYA 4FN2A 4BBNC 4E3CA 1WR1A 1GG3A 1E8WA 3ZNHB 4AOFA 3B1LX 1E7UA 3ZTDA 4NAWA 1VCBA 4MGKE 3RUIB 3WANA 3O65B 4BKSD 3ZO5B 4IWOA 4W9EA 2KJHB 2ZCBA 4JIOU 3UIPB 2LZ6A 1WX9A 4RM9A 4KZCA 1WJNA 4MEMA 2J7QB 1GNUA 4IW0A 4PYUA 3RD2A 1V80A 2O6VA 5L95C 2KJ6A 2OJRA 2JVCA 3Q3FA 3NHEB 4IM0A 3LJ3A 2N7DA 3PRMB 2QHOA 2KOXA 4DWFA 2N7EA 1OTRB 1V2YA 3ENEA 3VUYA 1ZW7A 1WYWB 4W9KA 3EHVA 2MW5A 2RGFA 5EDSA 4FADA 3UGBB 2FIDA 2REXA 2PEAA 1HE8A 1Q1OA 2ASQA 2L0FA 2NBUA 1EF5A 3VTWA 3M62B 4WJNA 4EEWA 1RRBA 4TQ0A 3VH4B 2MBQA 4MELA 1YIWA 5C23A 1UELA 3R3MA 4IM2A 4J6IA 5E6OA 3TJPA 4W9LA 5CHVC 2L7RA 1ZKHA 2FCSA 2PE9A 1TTNA 4DHZE 2XK5A 1SGHA 1EO6A 2IO1B 2KANA 1GJZA 4GMVA 5CHFA 1L7YA 3VHTC 2IZVB 2JWZA 4ZRJA 4MJSA 3IVFA 4N9F4 3V60A 2MBOA 4KVGB 1P9DU 2C7HA 1YX6B 4NQLB 1WE7A 1VD2A 5TR5A 3RULA 1XD3B 2KLGA 3QJZA 2GBRA 5JHBA 1KJTA 2LXCA 3PPAA 2A4ZA 3CSTA 3DPDA 3TL5A 1E8YA 2GBNA 2KC1A 4W9GA 3V61A 4I6LB 4NQKE 3GOEA 2JRIB 2C7NB 5C1ZA 2IO3B 2MX2A 2CHWA 4HVBA 3AI5A 3TMPB 2GBMA 1IP9A 4WQOB 1EF1A 2MP2A 3OJ3A 4PYZA 2MBBB 4LCDE 1TGZB 1U4AA 4GGQA 2K39A 2JZZA 2LASA 3DQVA 2L3ZA 1GUAB 4GDLB 4JL9A 2DHZA 2LVPA 4F7ZA 3KW5B 2K1FA 1LXDA 3W1SC 3ZNID 3APDA 2FCQA 3DVNU 4HLEA 4P7IA 1X1MA 4NY0A 1Q5WB 2BYVE 1WXMA 2ZNVC 3ONSA 4AWJA 2WDTB 2MRPA 4HDOA 3ZKJC 5E6PA 3H1UA 2FIFA 2DZMA 4WJPA 4AJYB 2KNBA 1YJ1A 2N9PC 3T9LA 3ZNGC 2N4FA 2L8JA 2CKHB 4GDLA 2N9XA 1QZEA 2GOWA 3AU4A 1GC6A 2RSUA 2LGDA 1FXTB 1WGRA 1J19A 3ZW3A 2K8BA 4MGZE 3ZNZB 4BKTA 4HPMB 2LXAA 3L0WB 3D32A 3L16A 4TV3A 4MH0E 3W1YA 2KMCA 4FHJA 4FULA 5GMVA 1WGDA 3ECIA 1LFDA 3N30A 3N3KB 2AYOB 2JF5A 1J8CA 1LQBA 4W9FA 4KIKA 1D3ZA 2KWUB 3ZDTA 1V86A 3L17A 4ANWA 5G2NA 4DXAB 3DBRI 2O6VB 4HPLB 2GMIC 3AULA 4EUTA 5G55A 1P3QU 1T0YA 2IY1B 3S2AA 3VDZA 2D07B 2L00B 3ZTCA 2KJRA 3M3JA 4GN1A 3SD5A 4HWIB 3PGEA 4EKUA 2IO2B 3UQBA 3RZWC 4A3PA 3PLUA 4DDGD 4MGIE 1I42A 3SHQA 3C0RB 2RPQA 2ZPNA 2A5UA 3DCGA 3KYDD 3A4RA 3DVNV 4ZYNA 1OQYA 4LJPB 3PRPB 4HK2A 2OOBB 1E8XA 4FA6A 4IC7B 4KV2A 2KZRA 1GC7A 2BYFA 3KUCB 1L2NA 2BYEA 2V1YA 2LUEA 3KUZA 1UD7A 2IYDB 4B6WA 2KTRB 4K1RB 1WIAA 1A5RA 3ZDMC 2ZPYA 5E6NA 2N1WA 4PS3A 2PPHA 2XK5B 3IG3A 4IWQA 4DHJB 5FR6A 1KOTA 4URKA 5IA7A 4GXBA 3WALA 2Y5BB 2KHWB 1KM7A 3KVFB 4YL8A 4MJSB 2WWZA 1YX5B 2BWFA 1R4MI 3AU5A 2V3SA 4I6PA 1H4RA 2KX0A 4ZDVA 2G4SA 3RCZA 2IBIB 4M8MA 3A4SC 4W9DA 4WWOA 2KTRA 2N9EB 2KO3A 3PRZA 5D7GA 2FCNA 5BO4B 2IY0B 4HJKA 2BPSA 4XZ4A 1WMHA 3QARA 3U8ZA 3PS6A 2G3QB 4B95A 2EMTA 1UBQA 3PHXB 3IHPC 1J0GA 3VAWA 3ZVVA 2M4NA 4XC2A 3H6NA 5D2MB 1WXVA 4G0NB 2C7MB 3SDLC 4KSLC 5IAAC 1C1YB 2J0KA 2L05A 3R7RA 3MJWA 4BOSC 3QQ8B 2K6DB 2MP2B 3PSEB 3JYUA 3A9JA 4K81A 1XT9B 3CF6E 4DDID 2AL3A 3HHMA 3DVGX 3PHWB 2JXXA 4ICVA 1WFYA 3PV1A 4BFRA 2BGFA 1P0RA 3H9DA 2V4LA 1WR6E 4LDTB 2UYZB 3ML9A 2MQJA 2LVOA 2NS5A 3QX1A 2JY6A 2JZ3B 3U30A 4MGYE 4OVUA 4EZLA 1WY8A 4FJVB 2DZIA 5L83A 4A20A 2GBJA 2KTFA 2ZZPB 3QHTA 4MSMB 4ANUA 4HDQA 2N1VA 3VTVA 2D3GA 2AEHA 5AEKB 4I6NB 4BKSA 3OAWA 4M8NA 2KQSA 1V5TA 2DYMA 2KDEB 4WWPA 2LWPA 3X23A 3QAQA 2KFKA 4NJ7A 1TBEA 1WX7A 2NCNA 4GSWA 4K7UA 3ML8A 2O6VD 3BY4B 4AUQC 4BBNF 1MG8A 2O2VA 4W9HA 1RLFA 4GU2A 4E74A 3HM6X 3VUXA 1S3SG 3MTNB 3EFUA 3V6CB 2PJHA 4G50A 3H7PB 3VVWB 1G6JA 3MHSD 1EUVB 1WH3A 4G11A 3WA0A 1WE6A 2BKRB 4II2B 4KIKB 1P98A 2FNJB 4IG7B 3V62A 4W9CA 2VRRB 2DZKA 2EKEC 2I1KA 5AZGA 2ZJDA 4XX5A 1WGHA 3N32A 5CTRC 3UIOB 1R4NI 2KC2A 4CO7A 1WJ6A 4MSQB 1Y8RC 2J0MA 3M63B 4PS7A 4WJOA 1WZ3A 2HD5B 3ZRCA 3B08A 1ISNA 3H7PA 2BWES 4DBGA 3GZNI 3IBEA 1IYFA 1RFAA 3ZUNA 2CHXA 2LD9A 2C9WB 4GIVA 3W1SA 4F1SA 1OGWA 3QC8B 3EECA 2C5LC 3KH0A 2WX0A 3P2BA 3RYTA 1WJUA 2HJ8A 3NZSA 2XEWA 2BKFA 3VUWA 4X57B 1UBIA 4TQ1A 3DOWA 1KLVA 1WX8A 2EMSA 2AWTA 2KDFB 3BINA 4HXDA 4F8CB 2HTHA 1UH6A 4DHZB 2JT4B 3ZIMA 4NJ6A 1V9JA 2YLMA 3NS8A 5AZFA 2LRUA 2KWVB 3UQAA 3VQIA 3H7SA 2AL6A 3APCA 4MM3A 2LGXA 2ZVNA 5JH5C 4IUMB 2CU1A 4FHKA 2KN5A 2G45B 1WJ4A 2C60A 3L10B 2YVCA 3V6EB 1LM8B 4K7SA 1Z2MA 4KSKC 1WM3A 2CS4A 2J0JA 4HCPB 5AZHA 2L0TA 3PVLA 2FUHB 2DAJA 2K6QA 2KKCA 2ZCCA 2RD0A 1E7VA 5D6JB 1SE9A 2UWQA 3PT2B 2NR2A 3PTFC 4LDTD 2KWCA 3JW0X 3K9OB 2LI5A 1WMHB 3NY5A 4G3XB 4MDKE 2D10A 1V81A 2DYOA 2DENB 2RR9A 5J18A 4BOZB 3QIJA 4ANVA 1WXSA 3EC8A 4EFOA 2I1JA 1V49A 4M0WB 4BKGA 3L08A 1K8RB 3DVGY 3QCAA 3TCAA 2GBKA 3L54A 3UF8A 1WGYA 5DPRA 4WWNA 3WAPA 1UZXB 3A9JB 3T8MA 1UGMA 1CMXB 2HE7A 3HIZA 3OJ4B 3SU8X 2Z0DB 4EOYA 4NPNA 1V5OA 3LDZE 2R2QA 4ASWC 1NI2A 2D2QA 2M17A 1WM2A 2KDBA 1YQBA 2IO0B 4JQWC 2KDIA 5CHWA 3L13A 2WYQA 1I35A 2BF8B 1YD8U 2LRWA 4FJYA 2KMAA 2DAFA 2MCNB 1S1QB 4ZRIA 4JLCA 2M1MA 3VXWA 2W9NA 1OEYJ 4ANXA 3JVZX 4CYEA 2NBVB 4EZJA 2KK8A 1E5WA 4FJZA 4KDIC 3K9PB 3U7DA 4AP4C 3JSVB 3TIXA 3PZDA 4NNJB 2KVRA 1P1AA 2KFKB 1WZ0A 4WJQA 4FLHA 1XQQA 5LXHA 2ZEQA 2O2VB 3X0WA 2L76A 5D94A 1ZGUB 2CHZA 2K25A 1PQSA 3DBHI 3ALBA 4RM8A 5DCNA 1NDDA 2FCMA 3VTUA 3HM3A 3A9KB 5J2RA 4TUUA 4ZRKA 3I3TB 4W9JA 4GOCA 3JSVA 1F9JA 2KXJA 2DX5B 1E8ZA 4GB9A 4EZKA 1WRDB 5CX3A 5LLIA 3A1QB 3HK0A 5DPWA 4GDKB 4DK5A 2NPTB 4ICUA 5DPSA 2MLBA 2NVUI 4KZ0A 4AJWA 3DDCB 3VFKA 2KQ7A 1BT0A 2LJ5A 1AARA 3KUDB 4RMAA 4FBJB 4II3B 3CMMB 4WAAA 2NBWB 3A9KA 1SIFA 2Z59B 5LXIB 3APFA 4IWPA 4TKNA 1NBFC 3DBLI 4JGHB 4IM3A 5DPTA 2WX1A 4B9KA 3KYCD
chains in the Genus database with same CATH superfamily
2JRHA 1TKYA 1K52A 3DBRB 1E9MA 2PVGC 2MA9B 3IFWB 3UINB 1Q0WB 3BZDB 1AN8A 4N59A 3W5UB 2JUOA 3NOBA 4DHJD 4ZHOA 3DBSA 2M0XA 2ZVOA 2JU6X 1F2RI 2B3AA 4YTMB 4LTUA 1TY2A 4W9IA 3NZUA 3ZLZA 4IDIA 4PS8A 2DNFA 3QA8A 2MSED 3PLVA 4R3DA 2KLCA 1OQQA 3BYYB 3QK0A 4CHKA 3R66C 3QWZB 2K3UA 1TZ1A 2V3PA 1N6ZA 3V3XA 4BBNC 2VZKB 1QILA 3AEAB 4ZOHC 1V8CA 4NAWA 1YOVB 3LXFA 3WANA 5HHDG 3ZO5B 1NENB 2HJ1A 4IWOA 1SE2A 2ZCBA 3UIPB 4ACFA 2LZ6A 4IW0A 4PYUA 2AX5A 2O6VA 3RNCC 2KJ6A 4RGTA 3Q3FA 2WS3B 3LJ3A 3PRMB 4DWFA 5EE9A 1V2YA 4US8A 1WYWB 3EHVA 2GI9A 2BTEA 1OQRA 2REXA 2L0FA 4WJNA 4EEWA 5FK9C 4MELA 1Y56A 5E6OA 4W9LA 5CHVC 1QOGA 3BVMA 2FCSA 4B0MA 3KLSX 1EO6A 2BB6A 2KN4A 1V1OA 2IZVB 2JWZA 3V60A 4MJSA 1QOBA 4OZCA 1WE7A 5G5GA 5TR5A 3RULA 4NZLB 3QJZA 1KJTA 1RM6C 3O13A 2A4ZA 4A8XC 1E8YA 3U7ZA 4NQKE 1CZPA 3GOEA 2JRIB 2IO3B 1L4DB 2MBBB 3GZNB 1U4AA 1CQVA 3AH7A 2WXPA 2QDFA 3VR9B 1GUAB 3W1SC 2K1FA 3BVGA 2FCQA 1Q5WB 2ZNVC 3ZKJC 2MRPA 4WJPA 2DZMA 2WDRB 2N9PC 4MH8A 2N4FA 1XEEA 2L8JA 1QZEA 3I9V1 2M19A 3AU4A 2LGDA 1N5XA 4HPMB 2J4XA 3N30A 2AYOB 1AWDA 4W9FA 3RMKC 3NG0A 1D3ZA 2KWUB 5G2NA 1XXGA 2O6VB 3U52E 4WWMA 2GMIC 3AULA 1T0YA 2D07B 2L00B 3M3JA 3RI7C 4ZYSA 4GN1A 4EKUA 2IO2B 3PLUA 1IBXB 4DDGD 3R2TA 2ZPNA 1K51A 1GB1A 1OQYA 5AUKA 5H92C 1E8XA 3VRBB 2J52A 2KZRA 2BYFA 3Q3NC 3ZJUA 4YSXB 3SFDB 3Q8CA 3DHIC 4M01A 4DHJB 1KOTA 2SAKA 4URKA 1KM7A 1RFKA 4MJSB 1R4MI 3AU5A 3BIID 4I6PA 4JWUC 4ZDVA 4WWOA 2KTRA 2N9EB 2GLSA 1PDXA 4XZ4A 1RWSA 1J0GA 4XC2A 4OZAA 1VZ7A 4KSLC 5IAAC 2J0KA 3R7RA 3AE7B 4ITKA 2K6DB 3TUOA 2L32A 3A9JA 2INPE 2DBYA 4DDID 1SE3A 4RFBA 4ICVA 1WFYA 3H9DA 2ON8A 1FCCC 4USAA 3SEBA 2JZ3B 3LB8C 4MGYE 4HRSA 2DZIA 2QC8A 2GBJA 2ZZPB 3QHTA 4ANUA 4HDQA 2CJOA 1SE4A 2Y5CA 3VRAB 3VTVA 4EE2A 3OAWA 2KDEB 1TS3A 2XN9C 3IAS1 3BY4B 1JW9D 1YN3A 5IN7A 3EFUA 4KGSA 1VDVA 1JRPA 4DQOC 2TSSA 3MHSD 1IGCA 4G11A 3RFZB 3MFGA 3WA0A 4LNFA 1WE6A 4K3CA 1P98A 4IG7B 2PW9A 3V62A 1D5ZC 1WSPA 3N32A 2RDGA 1R4NI 4CO7A 4PS7A 4N6EB 2FE8A 1N60A 3OG5A 4DBGA 4CQNA 5E6JA 3AE4B 2WXMA 2NMQA 3EECA 3KH0A 3NZSA 3AE2B 3VUWA 2INCC 3DOWA 1WX8A 2KDFB 2V9HA 1N62A 4F8CB 2LRUA 3UQAA 2AL6A 3APCA 5JH5C 4IUMB 3V05A 2WXOA 3AEFB 1WJ4A 3C19A 3V6EB 2CS4A 2J0JA 5AZHA 2FUHB 4OVZA 2GRIA 1SE9A 3PTFC 2UWQA 5J18A 4LDTD 3K9OB 1FMAD 2YEPF 1YQ4B 2DYOA 3MC0B 2RR9A 5JXVA 3TEZA 4BOZB 2IGHA 4EFOA 1V49A 4BKGA 1FPYA 3L08A 5HI1A 3DVGY 4A6QA 2WQYB 3NUHB 1WGYA 2N9LA 3A9JB 3OJ4B 3SU8X 1V5OA 2OHFA 2KDBA 1DOYA 1OFFA 3L13A 1C76A 1YD8U 3HUIA 4YTPB 1MPEA 4ZRIA 3VXWA 4ANXA 2KWDA 3N1YC 4KDIC 3K9PB 3P4PB 4RGOS 1L6UA 1WZ0A 1FIQA 5LXHA 1I4QA 3X0WA 5D94A 1ZGUB 4QAYA 2K25A 4XWTA 3ALBA 1NDDA 2INNE 3VTUA 1L0YB 1EU3A 4REZA 1T6BX 2YEPB 4TUUA 4GOCA 2DX5B 4GB9A 5CX3A 5I4DA 2MEKA 3GB1A 1NVID 4GDKB 1ROEA 2NPTB 5DPSA 4AJWA 4RMAA 3W2DA 3BVZA 3A9KA 3APFA 4IWPA 2IDYA 2NTSA 4TKNA 5C2TB 4B9KA 3Q3JA 4E71A 3TSSA 1VRAB 3E9SA 2OJWA 3C8YA 4HKQA 1A70A 1E0ZA 4AS1A 3ZRFA 4A55A 2JPHA 2PIAA 1T3QA 4K3BA 4BVUC 2LEKA 1D5XC 5EE0A 3WAMA 3B0AA 3AEGB 3WIMA 1WI0A 1EWCA 5JZEB 5BMGA 3CSFA 2KX3A 5JHAA 2FBWB 4RGNA 3AXCA 3M95A 5J17A 1ZUD2 2D11A 4OVVA 1MHHE 3CWIA 4KX6B 1M94A 2KMMA 4E3CA 2MJDA 2JYTA 4ZHPA 4MGKE 3RPFC 3O65B 2KVZA 2KJHB 4KZCA 1RYJA 3GP7A 1V80A 2KT7A 3Q69A 4IM0A 2N7DA 2QHOA 1MI0A 1XF5L 3HVZA 4P1BC 1ZW7A 2WXKA 2RGFA 4FADA 4YSZB 2PEAA 2ASQA 1MG4A 4AQ7A 2K9XA 4NAMA 4TQ0A 3VH4B 2MBQA 1YIWA 3DBHB 3P4SB 4IM2A 4MT5A 4J6IA 1QQRA 2BW2A 4M00A 3OWEB 1ZKHA 1AYFA 1XLOA 2PE9A 1KH0A 1SGHA 5CHFA 1L7YA 2BS4B 4KVGB 2C7HA 1FCLA 1TS4A 1XD3B 2KLGA 2JZPA 5JHBA 2LXCA 3AEDB 3BK2A 3DPDA 4W9GA 4TSSA 2K5PA 2C7NB 3AM9A 5C1ZA 5IO9A 2CHWA 4HVBA 3TMPB 1LO5D 3B2GA 3W9CB 1EF1A 4PYZA 2MJEA 4LCDE 1F77A 4GGQA 4GDLB 1UWXA 2BB5A 1EU4A 1PUTA 4P7IA 1DYQA 2BYVE 1T0SC 4JWSC 3DWMA 4C7ZA 2KNBA 3ZNGC 1ENFA 2G9HD 1ZDXA 1UWMA 2RSUA 3DHGC 4MGZE 3L16A 1UNSA 4FULA 3ECIA 1LFDA 1QT9A 2JF5A 1J8CA 2D3BA 2BS2B 3ZDTA 4ANWA 3NRZA 4DXFA 1P7FA 1I4GA 4EUTA 1P3QU 2VH2A 2IY1B 1WRIA 3ZTCA 2KJRA 4HWIB 3RZWC 4A3PA 1R7SA 3DCGA 3A4RA 2SEBD 1C4AA 3DVNV 2OOBB 4FA6A 2V1YA 1UD7A 2IYDB 3GS2A 4WURA 4K1RB 3RNAC 2LUMA 4PS3A 1IBXA 5IA7A 4GXBA 3WALA 4LNIA 2Y5BB 2WWZA 2BWFA 1KFYB 2G4SA 3A4SC 5D7GA 1SJED 3B2FA 4RF0A 3NZ3A 1FNUA 4L23A 1UBQA 2ICIA 1N61A 3ZVVA 3LYYA 5D2MB 1WXVA 5AUIA 3DWGC 3FILA 4BOSC 3QQ8B 4ZRPA 2WXNA 3AB5A 3CF6E 3RNBC 2AQ2B 3PHWB 2JXXA 1ET9A 3PV1A 4RNAA 2BGFA 4OHJA 1DGJA 3ML9A 2MQJA 4EZLA 1WY8A 4A20A 1XCTL 2RPVA 2KDMA 4MSMB 2N1VA 2D3GA 2AEHA 4I6NB 1I7HA 1HA5A 1V5TA 2KFKA 2ZW1A 4AUQC 1FNVA 1RLFA 2RDBC 4GU2A 4E74A 1T0QC 1S3SG 1BMLC 3MTNB 3IT6B 3VVWB 1G6JA 2BKRB 4II2B 2KACA 2FNJB 2V3NA 2VRRB 5AZGA 2BS3B 5CTRC 1ZE3D 3UIOB 2RMMA 1Y8RC 2J0MA 3AEBB 4WJOA 1WZ3A 3ZRCA 3Q8EA 2BWES 3FAHA 3IBEA 1E6EB 2L52A 1ZOYB 2CHXA 4DXGA 3QC8B 2I2YA 1PGXA 5BYQA 2C5LC 3RYTA 2HJ8A 1I4RA 3BK1A 1D6EC 2XEWA 2BKFA 4S17A 1KLVA 2AWTA 4KKIA 4HXDA 1L5PA 1JWBD 3ZIMA 4O1NA 3H7SA 1TZOA 1DOIA 2LGXA 4FHKA 3VR8B 1KRHA 2G45B 3L10B 2WXGA 4IOIE 2WXJA 3ZGZA 2H88B 1EWYC 2DAJA 2LHEA 1XLPA 2NR2A 3T9LA 1DOXA 3JW0X 1TT5B 4NJCA 2D10A 4BAXA 3KQ4A 2DENB 3N9YC 2K0PA 4M0WB 3IXSA 3QCAA 1C9FA 3FILB 3L54A 5DPRA 4WWNA 2H89B 3WAPA 3ETRA 1UZXB 3Q8FA 3T8MA 2LGSA 3E56A 2Z0DB 2N7JA 3ZYYX 4EOYA 2R2QA 1WM2A 3AEEB 2JX5A 2WHIA 3Q6BA 4XGAB 2M1MA 1OEYJ 2MHJA 3JVZX 3Q3OC 2NBVB 4CYEA 1B1ZA 3U7DA 4AP4C 1HTQA 3TIXA 2KFKB 4RCOA 2N0SB 2ZEQA 2BBCA 1ACCA 4PT5A 1L0VB 3DBHI 1J7AA 2FCMA 2Z8LA 2WNMA 4ZRKA 3I3TB 1F9JA 1E8ZA 1WYGA 2JQRB 3A1QB 3HK0A 1F2RC 4C7YA 1F0ZA 3NVYA 3DDCB 2LJ5A 4II3B 4XYCA 1NBFC 1KF6B 4EZKA 4GDKA 1MFWA 2NPTA 3J9CA 2K8HA 2QSDA 3MJ5A 2DWQA 3OLMD 2N9KA 3RZFA 2XBBC 1SXTA 5KHOA 1JRUA 1CJEA 3ZJVA 2Z0EB 3R7QA 1GAQB 4A3OA 2M56B 1RAXA 2INDC 1T5XD 2CR5A 3TBLD 1N63A 2MBHA 2KFJA 2FAZA 1SJHD 2WP9B 5D3DA 1FXIA 1JCKB 1QOFA 2IGGA 2M8SA 1FEHA 1WF9A 3WAOA 2LGYA 2WXFA 4RH6A 1JWSD 2LVQA 1OEYA 3AE6B 1E8WA 2L1AA 3ZNHB 2X8XX 4US9A 3B1LX 1E7UA 3ZTDA 3RUIB 4BKSD 2CU3A 4JIOU 1WX9A 4RM9A 4RGMA 1FD6A 3R2IA 4WAFA 2W3RA 3RD2A 3Q8BA 3EA6A 1STEA 2JVCA 3URYA 3TEYA 2KOXA 1L4ZB 3W5VB 3ENEA 3VUYA 3U2SC 2MW5A 5EDSA 1HE8A 3PZ8A 1Q1OA 3VTWA 3M62B 1RRBA 1ZXHA 2AQ1B 5C23A 1UELA 3R3MA 1JWMD 3TJPA 4YSYB 1TTNA 4DHZE 2KANA 2W3SA 4WQMA 1NYRA 1UF0A 1GJZA 4GMVA 3VHTC 1FRRA 4XE0A 4XDCA 2MBOA 1JWAD 1QOAA 1P9DU 1IGDA 1YX6B 4NQLB 2GBRA 2VH1A 2GBNA 3P63A 3V61A 4I6LB 2BT6A 2MX2A 3AI5A 4LNKA 1IP9A 4WQOB 2LJIA 2MP2A 3TEWA 1FNWA 1MJDA 2UU7A 1P7EA 4ARCA 2JZZA 2LASA 3DQVA 2L3ZA 4A90A 2LVPA 1LXDA 3ZNID 3ZXVA 1C78A 2WDQB 3DVNU 1WXMA 2WGSA 2WDTB 5E6PA 3H1UA 4AJYB 2J42A 1YJ1A 2CKHB 4GDLA 2N9XA 2GOWA 3KWVA 3ZNZB 3WCQA 2LXAA 4TV3A 4MH0E 3AMZA 4FHJA 5GMVA 1WGDA 3N3KB 1LQBA 1XO3A 3L17A 2E6XA 3BWUD 4PK1A 5G55A 2G1EA 2WXIA 3UQBA 3PGEA 2WDVB 4OW0A 1NEKB 1I42A 3PO0A 3C0RB 2RPQA 2A5UA 5G5HA 2QILA 3PRPB 4HK2A 4IC7B 3P42A 1L2NA 2BYEA 3KUZA 4B6WA 5HG2A 3MP9A 5E6NA 4IWQA 5FR6A 1F1HA 4BZAA 1SBBB 1IUEA 1TYGB 4YL8A 1XLQA 1B9RA 2KX0A 4M8MA 4W9DA 3UI3A 2IY0B 4HJKA 1WMHA 4B95A 3Q3MC 1ESFA 3VAWA 3HRDD 1YNTE 2LFIA 3H6NA 2BVCA 4G0NB 3SDLC 2L05A 2BYTA 2MP2B 3JYUA 4K81A 4OZBA 3HHMA 4C4VB 4BFRA 2V4LA 1WR6E 1E7PB 4LDTB 2ZW0A 2UYZB 4P6VF 2NS5A 3QX1A 2V4IB 1YQ3B 3U30A 4OVUA 5L83A 1YMHE 2KTFA 3MHZA 2KQSA 3X23A 2Y3AA 3IT4B 1TBEA 1WX7A 3ML8A 2O6VD 1PGBA 4BBNF 3B9JA 2Y5PA 3HM6X 3VUXA 2EKIA 1VZ6A 3V6CB 2PJHA 4G50A 3H7PB 2I38A 1WH3A 3Q8AA 1Q10A 2I1KA 2EKEC 4YT0B 2ZJDA 1BXTA 2IGDA 2KC2A 1C79A 1WGKA 2HD5B 3B08A 1ISNA 1IYFA 4H2AA 1RFAA 3ZUNA 2CJNA 2LD9A 2RDHA 4Q2JA 4GIVA 3W1SA 1OGWA 1I4PA 1LGRA 1SSNA 2WX0A 1WJUA 4X57B 4TQ1A 3FKYA 1QKZA 4NJ6A 5AZFA 3EFCA 2KWVB 4LNOA 2CU1A 1TY0A 2X38A 3R8BA 2C60A 4YTNB 1TIFA 2YVCA 2KQ4X 1WM3A 4HCPB 1T0RC 2WXQA 5IOIA 2ZCCA 3DHHC 1MHXA 5D6JB 3PT2B 4MM3A 3NY5A 2LI5A 4G3XB 1WMHB 2AQ3B 3L4PA 1ZPSA 1D5MC 3AV8A 5FR3A 2E3TA 3ZXRA 3TCAA 2WXRA 2GBKA 4HROA 3UF8A 1YN5A 1PFDA 3IAM1 4JE3B 1UGMA 1CMXB 4KGRA 4NPNA 3LDZE 4ASWC 1NI2A 3CIRB 1ZDVA 1XLNA 3EGRA 2IO0B 2KDIA 3N1ZC 4P16A 1GB4A 3U4EG 2BF8B 3ABVB 2PVOD 2WU2B 1TKEA 2KYWA 2LRWA 3NVZA 4M0WA 5BYSA 2HTME 3I63C 1S1QB 4EZJA 4FJZA 3GE3C 3JSVB 1SB3C 4NNJB 1P1AA 1QF6A 4WJQA 1C77A 1L0XB 1FXAA 5C3JB 5DCNA 4RM8A 4RF1A 4TMAB 1SEBD 3HM3A 1VR9A 4IKGA 4XWWA 4YXDB 4B0EA 5LLIA 4S0RA 4DK5A 4ICUA 4L2YA 2MLBA 4KZ0A 2KQ7A 3KUDB 4FBJB 4KKJA 5H8YE 1QLBB 2NBWB 1SIFA 1N5WA 3AE9B 1C4PA 5DPTA 4IM3A 1NI3A 4UDUC 4YWGG 3A1QA 1H8CA 1AW7A 2EELA 1WGGA 2JWUA 3ZQ4A 4LJOB 1ET6A 2ZNVB 4KDLB 3EUB2 2QJLA 2MWSB 2DZJA 1V6EA 2DYBA 1VJKA 3AE8B 1HTOA 2KD0A 2G4DB 1E90A 3SFEB 3TEXA 3AN1A 1WXAA 3N20C 1Z5SB 3BYTB 3A33B 2D5GA 3MC8A 3RT3B 1D4BA 4K7WA 3VH3B 1V1PA 2QIEB 1YN4A 2PE6B 2R2OA 2GB1A 2MBEA 2WLBA 3H8HA 2K8CA 4HCNB 4NAWB 4C00A 5HKHA 5KHQA 4HJGE 1C3TA 4MM3B 3P4RB 5BMIA 3FC4A 3PREA 1IPGA 5TSSA 1JMLA 4FN2A 4MACA 1WR1A 1GG3A 3MC9A 4AOFA 1VCBA 3SR6A 2WU5B 2LGIA 1JROA 1ZXIA 4W9EA 1KTKA 1WJNA 4MEMA 2J7QB 1GNUA 5L95C 2OJRA 2PKOA 3NHEB 5EE1A 2MH7A 1OTRB 2N7EA 4W9KA 2R61A 3UGBB 2FIDA 2NBUA 1HQRD 1EF5A 1CK1A 1FRDA 2WXHA 2L7RA 2XK5A 3NS1A 2IO1B 5HFYA 3RN9C 2NTTA 1JALA 1V97A 4ZRJA 3IVFA 1F52A 4N9F4 4ZRQA 1KLUD 1E10A 1WXQA 1M4VA 1TJEA 3I5JC 1VD2A 5D3IB 2KAJA 3DBLB 3PPAA 3CSTA 3TL5A 2KC1A 1FO4A 1HXYD 2B76B 2D3AA 2PLPA 2GBMA 1HZ5A 3OJ3A 2QCZA 1VZ8A 1TGZB 1K53A 3KWLA 2K39A 4JL9A 2DHZA 4F7ZA 3KW5B 1SF0A 3APDA 1V1PB 2J53A 4D2KA 4HLEA 1X1MA 4NY0A 2K22A 4AWJA 3ONSA 4HDOA 3AE3B 1J7BA 2FIFA 1BUIC 1PYWD 2LMCA 5T8IA 3AE1B 1YJJA 1KLGD 1GC6A 1FXTB 1WGRA 1J19A 3ZW3A 2K8BA 4BKTA 3L0WB 4HPPA 3D32A 4JPSA 3N1XC 3W1YA 3ZJTA 2KMCA 2LHDA 3P4QB 4WIPA 4KIKA 1V86A 4DXAB 3DBRI 4HPLB 3S2AA 3VDZA 3SD5A 4MGIE 3SHQA 3KYDD 4ZYNA 1WWTA 4LJPB 4KV2A 1GC7A 3KUCB 2LUEA 2KTRB 1WIAA 1A5RA 3ZDMC 2ZPYA 2N1WA 2PPHA 2XK5B 3IG3A 1HZ6A 2KHWB 3KVFB 1K50A 2QMTA 1YX5B 2V3SA 1H4RA 3RCZA 2IBIB 2KO3A 3PRZA 2FCNA 5BO4B 2BPSA 3QARA 3U8ZA 3PS6A 2G3QB 2EMTA 3PHXB 3IHPC 5EE3A 1ZP0B 4C80A 1SIJA 2M4NA 2C7MB 1C1YB 4N58A 1PGAA 3MJWA 3I57A 3PSEB 1NYQA 2JXTA 1XT9B 4A9AA 2AL3A 3Q2AC 3DVGX 1P0RA 2QEJC 2IJ0A 1MVKA 5BYRA 2LVOA 2JY6A 1I4XA 2OEDA 4FJVB 4M02A 3RNGC 4FXCA 3T3NA 3P1MA 4C4VA 5AEKB 4BKSA 4P1CC 4M8NA 2DYMA 4WWPA 2LWPA 3QAQA 4NJ7A 4K7UA 2NCNA 1HEZE 4GSWA 5IP4D 1J7CA 2VZKD 1MG8A 2O2VA 4W9HA 1FM0D 2ACZB 3AECB 4LNNA 4HEA1 1FFVA 1YJIA 1EUVB 4KIKB 4J3OD 4W9CA 3HVDA 2DZKA 4XX5A 1WGHA 1TKGA 3NJTA 2V0GA 1WJ6A 2PTLA 4MSQB 3M63B 1JWUD 3H7PA 3GZNI 4C56C 2C9WB 4L1BA 4F1SA 2PMVA 3P2BA 3GE8C 4GLSC 1UBIA 1XCQL 1UUPA 2EMSA 3BINA 2HTHA 1UH6A 4DHZB 2JT4B 1V9JA 2YLMA 3NS8A 1GOZA 3VQIA 2ZVNA 2XNAC 5GXGB 2Q5WD 2KN5A 2FUG1 1R4MB 1LM8B 4K7SA 1Z2MA 4KSKC 2DLBA 3PVLA 2L0TA 1GPXA 2K6QA 2KKCA 2MJ3A 3RNEC 2RD0A 1E7VA 1L6VA 4MDKE 2KWCA 1V81A 4LLGM 5MPOA 1C4CA 2W55A 3QIJA 4ANVA 3RNFC 1WXSA 3EC8A 2I1JA 1VLBA 1TS2A 3NVVA 1K8RB 1FFUA 2D3CA 2WXLA 2BQQA 3PZ7A 2HE7A 3HIZA 2L83A 2D2QA 2M17A 4WH4A 1YQBA 4JQWC 1I4HA 4XDDA 5CHWA 2WYQA 1I35A 4JX1C 3T3OA 4FJYA 2DAFA 2KMAA 2MCNB 4JLCA 2W9NA 4HKZE 5FKAC 2KK8A 1E5WA 3AE5B 5BMHA 3PZDA 2KVRA 4ARIA 5IKCM 2W82A 1UGJA 4FLHA 1XQQA 2JSVX 2O2VB 2L76A 2CHZA 1PQSA 1JQ4A 2IPKD 3NVWA 3A9KB 1TS5A 2W54A 5J2RA 2JYEA 4KGTA 4W9JA 3JSVA 2KXJA 1WRDB 4LK0M 2HDEA 5DPWA 3Q14C 2NVUI 3VFKA 1BT0A 1AARA 1R4NB 2ONQA 3CMMB 4WAAA 2Z59B 5LXIB 5LNK1 1EM7A 4JGHB 3DBLI 2WX1A 2M0AA 3KYCD
chains in the Genus database with same CATH topology
2JRHA 3Q3JA 4E71A 3A1QA 1H8CA 4GDKA 2NPTA 2K8HA 2MA9B 1WGGA 3IFWB 3UINB 4LJOB 2ZNVB 1Q0WB 3OLMD 4KDLB 3ZRFA 3RZFA 2JPHA 2MWSB 2DZJA 1V6EA 2DYBA 2JUOA 2XBBC 3NOBA 4DHJD 3DBSA 2KD0A 5KHOA 2G4DB 2M0XA 1JRUA 1E90A 2ZVOA 4BVUC 2Z0EB 2B3AA 1WXAA 3R7QA 4A3OA 4W9IA 1Z5SB 3NZUA 3A33B 1RAXA 3ZLZA 4PS8A 3RT3B 3WAMA 3QA8A 4K7WA 2CR5A 2MSED 3B0AA 3PLVA 3TBLD 3VH3B 3WIMA 2MBHA 1WI0A 2KFJA 2PE6B 2KLCA 2FAZA 2R2OA 3QK0A 5JZEB 2MBEA 4NAWB 5HKHA 2K8CA 3CSFA 2KX3A 4HCNB 4CHKA 5KHQA 3R66C 5JHAA 1C3TA 3QWZB 2M8SA 3AXCA 3M95A 5J17A 1WF9A 3WAOA 2D11A 1TZ1A 2LGYA 4OVVA 3PREA 2LVQA 1M94A 1IPGA 1OEYA 4FN2A 4BBNC 4E3CA 1WR1A 1GG3A 1E8WA 3ZNHB 4AOFA 3B1LX 1E7UA 3ZTDA 4NAWA 1VCBA 4MGKE 3RUIB 3WANA 3O65B 4BKSD 3ZO5B 4IWOA 4W9EA 2KJHB 2ZCBA 4JIOU 3UIPB 2LZ6A 1WX9A 4RM9A 4KZCA 1WJNA 4MEMA 2J7QB 1GNUA 4IW0A 4PYUA 3RD2A 1V80A 2O6VA 5L95C 2KJ6A 2OJRA 2JVCA 3Q3FA 3NHEB 4IM0A 3LJ3A 2N7DA 3PRMB 2QHOA 2KOXA 4DWFA 2N7EA 1OTRB 1V2YA 3ENEA 3VUYA 1ZW7A 1WYWB 4W9KA 3EHVA 2MW5A 2RGFA 5EDSA 4FADA 3UGBB 2FIDA 2REXA 2PEAA 1HE8A 1Q1OA 2ASQA 2L0FA 2NBUA 1EF5A 3VTWA 3M62B 4WJNA 4EEWA 1RRBA 4TQ0A 3VH4B 2MBQA 4MELA 1YIWA 5C23A 1UELA 3R3MA 4IM2A 4J6IA 5E6OA 3TJPA 4W9LA 5CHVC 2L7RA 1ZKHA 2FCSA 2PE9A 1TTNA 4DHZE 2XK5A 1SGHA 1EO6A 2IO1B 2KANA 1GJZA 4GMVA 5CHFA 1L7YA 3VHTC 2IZVB 2JWZA 4ZRJA 4MJSA 3IVFA 4N9F4 3V60A 2MBOA 4KVGB 1P9DU 2C7HA 1YX6B 4NQLB 1WE7A 1VD2A 5TR5A 3RULA 1XD3B 2KLGA 3QJZA 2GBRA 5JHBA 1KJTA 2LXCA 3PPAA 2A4ZA 3CSTA 3DPDA 3TL5A 1E8YA 2GBNA 2KC1A 4W9GA 3V61A 4I6LB 4NQKE 3GOEA 2JRIB 2C7NB 5C1ZA 2IO3B 2MX2A 2CHWA 4HVBA 3AI5A 3TMPB 2GBMA 1IP9A 4WQOB 1EF1A 2MP2A 3OJ3A 4PYZA 2MBBB 4LCDE 1TGZB 1U4AA 4GGQA 2K39A 2JZZA 2LASA 3DQVA 2L3ZA 1GUAB 4GDLB 4JL9A 2DHZA 2LVPA 4F7ZA 3KW5B 2K1FA 1LXDA 3W1SC 3ZNID 3APDA 2FCQA 3DVNU 4HLEA 4P7IA 1X1MA 4NY0A 1Q5WB 2BYVE 1WXMA 2ZNVC 3ONSA 4AWJA 2WDTB 2MRPA 4HDOA 3ZKJC 5E6PA 3H1UA 2FIFA 2DZMA 4WJPA 4AJYB 2KNBA 1YJ1A 2N9PC 3T9LA 3ZNGC 2N4FA 2L8JA 2CKHB 4GDLA 2N9XA 1QZEA 2GOWA 3AU4A 1GC6A 2RSUA 2LGDA 1FXTB 1WGRA 1J19A 3ZW3A 2K8BA 4MGZE 3ZNZB 4BKTA 4HPMB 2LXAA 3L0WB 3D32A 3L16A 4TV3A 4MH0E 3W1YA 2KMCA 4FHJA 4FULA 5GMVA 1WGDA 3ECIA 1LFDA 3N30A 3N3KB 2AYOB 2JF5A 1J8CA 1LQBA 4W9FA 4KIKA 1D3ZA 2KWUB 3ZDTA 1V86A 3L17A 4ANWA 5G2NA 4DXAB 3DBRI 2O6VB 4HPLB 2GMIC 3AULA 4EUTA 5G55A 1P3QU 1T0YA 2IY1B 3S2AA 3VDZA 2D07B 2L00B 3ZTCA 2KJRA 3M3JA 4GN1A 3SD5A 4HWIB 3PGEA 4EKUA 2IO2B 3UQBA 3RZWC 4A3PA 3PLUA 4DDGD 4MGIE 1I42A 3SHQA 3C0RB 2RPQA 2ZPNA 2A5UA 3DCGA 3KYDD 3A4RA 3DVNV 4ZYNA 1OQYA 4LJPB 3PRPB 4HK2A 2OOBB 1E8XA 4FA6A 4IC7B 4KV2A 2KZRA 1GC7A 2BYFA 3KUCB 1L2NA 2BYEA 2V1YA 2LUEA 3KUZA 1UD7A 2IYDB 4B6WA 2KTRB 4K1RB 1WIAA 1A5RA 3ZDMC 2ZPYA 5E6NA 2N1WA 4PS3A 2PPHA 2XK5B 3IG3A 4IWQA 4DHJB 5FR6A 1KOTA 4URKA 5IA7A 4GXBA 3WALA 2Y5BB 2KHWB 1KM7A 3KVFB 4YL8A 4MJSB 2WWZA 1YX5B 2BWFA 1R4MI 3AU5A 2V3SA 4I6PA 1H4RA 2KX0A 4ZDVA 2G4SA 3RCZA 2IBIB 4M8MA 3A4SC 4W9DA 4WWOA 2KTRA 2N9EB 2KO3A 3PRZA 5D7GA 2FCNA 5BO4B 2IY0B 4HJKA 2BPSA 4XZ4A 1WMHA 3QARA 3U8ZA 3PS6A 2G3QB 4B95A 2EMTA 1UBQA 3PHXB 3IHPC 1J0GA 3VAWA 3ZVVA 2M4NA 4XC2A 3H6NA 5D2MB 1WXVA 4G0NB 2C7MB 3SDLC 4KSLC 5IAAC 1C1YB 2J0KA 2L05A 3R7RA 3MJWA 4BOSC 3QQ8B 2K6DB 2MP2B 3PSEB 3JYUA 3A9JA 4K81A 1XT9B 3CF6E 4DDID 2AL3A 3HHMA 3DVGX 3PHWB 2JXXA 4ICVA 1WFYA 3PV1A 4BFRA 2BGFA 1P0RA 3H9DA 2V4LA 1WR6E 4LDTB 2UYZB 3ML9A 2MQJA 2LVOA 2NS5A 3QX1A 2JY6A 2JZ3B 3U30A 4MGYE 4OVUA 4EZLA 1WY8A 4FJVB 2DZIA 5L83A 4A20A 2GBJA 2KTFA 2ZZPB 3QHTA 4MSMB 4ANUA 4HDQA 2N1VA 3VTVA 2D3GA 2AEHA 5AEKB 4I6NB 4BKSA 3OAWA 4M8NA 2KQSA 1V5TA 2DYMA 2KDEB 4WWPA 2LWPA 3X23A 3QAQA 2KFKA 4NJ7A 1TBEA 1WX7A 2NCNA 4GSWA 4K7UA 3ML8A 2O6VD 3BY4B 4AUQC 4BBNF 1MG8A 2O2VA 4W9HA 1RLFA 4GU2A 4E74A 3HM6X 3VUXA 1S3SG 3MTNB 3EFUA 3V6CB 2PJHA 4G50A 3H7PB 3VVWB 1G6JA 3MHSD 1EUVB 1WH3A 4G11A 3WA0A 1WE6A 2BKRB 4II2B 4KIKB 1P98A 2FNJB 4IG7B 3V62A 4W9CA 2VRRB 2DZKA 2EKEC 2I1KA 5AZGA 2ZJDA 4XX5A 1WGHA 3N32A 5CTRC 3UIOB 1R4NI 2KC2A 4CO7A 1WJ6A 4MSQB 1Y8RC 2J0MA 3M63B 4PS7A 4WJOA 1WZ3A 2HD5B 3ZRCA 3B08A 1ISNA 3H7PA 2BWES 4DBGA 3GZNI 3IBEA 1IYFA 1RFAA 3ZUNA 2CHXA 2LD9A 2C9WB 4GIVA 3W1SA 4F1SA 1OGWA 3QC8B 3EECA 2C5LC 3KH0A 2WX0A 3P2BA 3RYTA 1WJUA 2HJ8A 3NZSA 2XEWA 2BKFA 3VUWA 4X57B 1UBIA 4TQ1A 3DOWA 1KLVA 1WX8A 2EMSA 2AWTA 2KDFB 3BINA 4HXDA 4F8CB 2HTHA 1UH6A 4DHZB 2JT4B 3ZIMA 4NJ6A 1V9JA 2YLMA 3NS8A 5AZFA 2LRUA 2KWVB 3UQAA 3VQIA 3H7SA 2AL6A 3APCA 4MM3A 2LGXA 2ZVNA 5JH5C 4IUMB 2CU1A 4FHKA 2KN5A 2G45B 1WJ4A 2C60A 3L10B 2YVCA 3V6EB 1LM8B 4K7SA 1Z2MA 4KSKC 1WM3A 2CS4A 2J0JA 4HCPB 5AZHA 2L0TA 3PVLA 2FUHB 2DAJA 2K6QA 2KKCA 2ZCCA 2RD0A 1E7VA 5D6JB 1SE9A 2UWQA 3PT2B 2NR2A 3PTFC 4LDTD 2KWCA 3JW0X 3K9OB 2LI5A 1WMHB 3NY5A 4G3XB 4MDKE 2D10A 1V81A 2DYOA 2DENB 2RR9A 5J18A 4BOZB 3QIJA 4ANVA 1WXSA 3EC8A 4EFOA 2I1JA 1V49A 4M0WB 4BKGA 3L08A 1K8RB 3DVGY 3QCAA 3TCAA 2GBKA 3L54A 3UF8A 1WGYA 5DPRA 4WWNA 3WAPA 1UZXB 3A9JB 3T8MA 1UGMA 1CMXB 2HE7A 3HIZA 3OJ4B 3SU8X 2Z0DB 4EOYA 4NPNA 1V5OA 3LDZE 2R2QA 4ASWC 1NI2A 2D2QA 2M17A 1WM2A 2KDBA 1YQBA 2IO0B 4JQWC 2KDIA 5CHWA 3L13A 2WYQA 1I35A 2BF8B 1YD8U 2LRWA 4FJYA 2KMAA 2DAFA 2MCNB 1S1QB 4ZRIA 4JLCA 2M1MA 3VXWA 2W9NA 1OEYJ 4ANXA 3JVZX 4CYEA 2NBVB 4EZJA 2KK8A 1E5WA 4FJZA 4KDIC 3K9PB 3U7DA 4AP4C 3JSVB 3TIXA 3PZDA 4NNJB 2KVRA 1P1AA 2KFKB 1WZ0A 4WJQA 4FLHA 1XQQA 5LXHA 2ZEQA 2O2VB 3X0WA 2L76A 5D94A 1ZGUB 2CHZA 2K25A 1PQSA 3DBHI 3ALBA 4RM8A 5DCNA 1NDDA 2FCMA 3VTUA 3HM3A 3A9KB 5J2RA 4TUUA 4ZRKA 3I3TB 4W9JA 4GOCA 3JSVA 1F9JA 2KXJA 2DX5B 1E8ZA 4GB9A 4EZKA 1WRDB 5CX3A 5LLIA 3A1QB 3HK0A 5DPWA 4GDKB 4DK5A 2NPTB 4ICUA 5DPSA 2MLBA 2NVUI 4KZ0A 4AJWA 3DDCB 3VFKA 2KQ7A 1BT0A 2LJ5A 1AARA 3KUDB 4RMAA 4FBJB 4II3B 3CMMB 4WAAA 2NBWB 3A9KA 1SIFA 2Z59B 5LXIB 3APFA 4IWPA 4TKNA 1NBFC 3DBLI 4JGHB 4IM3A 5DPTA 2WX1A 4B9KA 3KYCD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRH A;  3Q3J A;  4E71 A;  3A1Q A;  1H8C A;  4GDK A;  2NPT A;  2K8H A;  2MA9 B;  1WGG A;  3IFW B;  3UIN B;  4LJO B;  2ZNV B;  1Q0W B;  3OLM D;  4KDL B;  3ZRF A;  3RZF A;  2JPH A;  2MWS B;  2DZJ A;  1V6E A;  2DYB A;  2JUO A;  2XBB C;  3NOB A;  4DHJ D;  3DBS A;  2KD0 A;  5KHO A;  2G4D B;  2M0X A;  1JRU A;  1E90 A;  2ZVO A;  4BVU C;  2Z0E B;  2B3A A;  1WXA A;  3R7Q A;  4A3O A;  4W9I A;  1Z5S B;  3NZU A;  3A33 B;  1RAX A;  3ZLZ A;  4PS8 A;  3RT3 B;  3WAM A;  3QA8 A;  4K7W A;  2CR5 A;  2MSE D;  3B0A A;  3PLV A;  3TBL D;  3VH3 B;  3WIM A;  2MBH A;  1WI0 A;  2KFJ A;  2PE6 B;  2KLC A;  2FAZ A;  2R2O A;  3QK0 A;  5JZE B;  2MBE A;  4NAW B;  5HKH A;  2K8C A;  3CSF A;  2KX3 A;  4HCN B;  4CHK A;  5KHQ A;  3R66 C;  5JHA A;  1C3T A;  3QWZ B;  2M8S A;  3AXC A;  3M95 A;  5J17 A;  1WF9 A;  3WAO A;  2D11 A;  1TZ1 A;  2LGY A;  4OVV A;  3PRE A;  2LVQ A;  1M94 A;  1IPG A;  1OEY A;  4FN2 A;  4BBN C;  4E3C A;  1WR1 A;  1GG3 A;  1E8W A;  3ZNH B;  4AOF A;  3B1L X;  1E7U A;  3ZTD A;  4NAW A;  1VCB A;  4MGK E;  3RUI B;  3WAN A;  3O65 B;  4BKS D;  3ZO5 B;  4IWO A;  4W9E A;  2KJH B;  2ZCB A;  4JIO U;  3UIP B;  2LZ6 A;  1WX9 A;  4RM9 A;  4KZC A;  1WJN A;  4MEM A;  2J7Q B;  1GNU A;  4IW0 A;  4PYU A;  3RD2 A;  1V80 A;  2O6V A;  5L95 C;  2KJ6 A;  2OJR A;  2JVC A;  3Q3F A;  3NHE B;  4IM0 A;  3LJ3 A;  2N7D A;  3PRM B;  2QHO A;  2KOX A;  4DWF A;  2N7E A;  1OTR B;  1V2Y A;  3ENE A;  3VUY A;  1ZW7 A;  1WYW B;  4W9K A;  3EHV A;  2MW5 A;  2RGF A;  5EDS A;  4FAD A;  3UGB B;  2FID A;  2REX A;  2PEA A;  1HE8 A;  1Q1O A;  2ASQ A;  2L0F A;  2NBU A;  1EF5 A;  3VTW A;  3M62 B;  4WJN A;  4EEW A;  1RRB A;  4TQ0 A;  3VH4 B;  2MBQ A;  4MEL A;  1YIW A;  5C23 A;  1UEL A;  3R3M A;  4IM2 A;  4J6I A;  5E6O A;  3TJP A;  4W9L A;  5CHV C;  2L7R A;  1ZKH A;  2FCS A;  2PE9 A;  1TTN A;  4DHZ E;  2XK5 A;  1SGH A;  1EO6 A;  2IO1 B;  2KAN A;  1GJZ A;  4GMV A;  5CHF A;  1L7Y A;  3VHT C;  2IZV B;  2JWZ A;  4ZRJ A;  4MJS A;  3IVF A;  4N9F 4;  3V60 A;  2MBO A;  4KVG B;  1P9D U;  2C7H A;  1YX6 B;  4NQL B;  1WE7 A;  1VD2 A;  5TR5 A;  3RUL A;  1XD3 B;  2KLG A;  3QJZ A;  2GBR A;  5JHB A;  1KJT A;  2LXC A;  3PPA A;  2A4Z A;  3CST A;  3DPD A;  3TL5 A;  1E8Y A;  2GBN A;  2KC1 A;  4W9G A;  3V61 A;  4I6L B;  4NQK E;  3GOE A;  2JRI B;  2C7N B;  5C1Z A;  2IO3 B;  2MX2 A;  2CHW A;  4HVB A;  3AI5 A;  3TMP B;  2GBM A;  1IP9 A;  4WQO B;  1EF1 A;  2MP2 A;  3OJ3 A;  4PYZ A;  2MBB B;  4LCD E;  1TGZ B;  1U4A A;  4GGQ A;  2K39 A;  2JZZ A;  2LAS A;  3DQV A;  2L3Z A;  1GUA B;  4GDL B;  4JL9 A;  2DHZ A;  2LVP A;  4F7Z A;  3KW5 B;  2K1F A;  1LXD A;  3W1S C;  3ZNI D;  3APD A;  2FCQ A;  3DVN U;  4HLE A;  4P7I A;  1X1M A;  4NY0 A;  1Q5W B;  2BYV E;  1WXM A;  2ZNV C;  3ONS A;  4AWJ A;  2WDT B;  2MRP A;  4HDO A;  3ZKJ C;  5E6P A;  3H1U A;  2FIF A;  2DZM A;  4WJP A;  4AJY B;  2KNB A;  1YJ1 A;  2N9P C;  3T9L A;  3ZNG C;  2N4F A;  2L8J A;  2CKH B;  4GDL A;  2N9X A;  1QZE A;  2GOW A;  3AU4 A;  1GC6 A;  2RSU A;  2LGD A;  1FXT B;  1WGR A;  1J19 A;  3ZW3 A;  2K8B A;  4MGZ E;  3ZNZ B;  4BKT A;  4HPM B;  2LXA A;  3L0W B;  3D32 A;  3L16 A;  4TV3 A;  4MH0 E;  3W1Y A;  2KMC A;  4FHJ A;  4FUL A;  5GMV A;  1WGD A;  3ECI A;  1LFD A;  3N30 A;  3N3K B;  2AYO B;  2JF5 A;  1J8C A;  1LQB A;  4W9F A;  4KIK A;  1D3Z A;  2KWU B;  3ZDT A;  1V86 A;  3L17 A;  4ANW A;  5G2N A;  4DXA B;  3DBR I;  2O6V B;  4HPL B;  2GMI C;  3AUL A;  4EUT A;  5G55 A;  1P3Q U;  1T0Y A;  2IY1 B;  3S2A A;  3VDZ A;  2D07 B;  2L00 B;  3ZTC A;  2KJR A;  3M3J A;  4GN1 A;  3SD5 A;  4HWI B;  3PGE A;  4EKU A;  2IO2 B;  3UQB A;  3RZW C;  4A3P A;  3PLU A;  4DDG D;  4MGI E;  1I42 A;  3SHQ A;  3C0R B;  2RPQ A;  2ZPN A;  2A5U A;  3DCG A;  3KYD D;  3A4R A;  3DVN V;  4ZYN A;  1OQY A;  4LJP B;  3PRP B;  4HK2 A;  2OOB B;  1E8X A;  4FA6 A;  4IC7 B;  4KV2 A;  2KZR A;  1GC7 A;  2BYF A;  3KUC B;  1L2N A;  2BYE A;  2V1Y A;  2LUE A;  3KUZ A;  1UD7 A;  2IYD B;  4B6W A;  2KTR B;  4K1R B;  1WIA A;  1A5R A;  3ZDM C;  2ZPY A;  5E6N A;  2N1W A;  4PS3 A;  2PPH A;  2XK5 B;  3IG3 A;  4IWQ A;  4DHJ B;  5FR6 A;  1KOT A;  4URK A;  5IA7 A;  4GXB A;  3WAL A;  2Y5B B;  2KHW B;  1KM7 A;  3KVF B;  4YL8 A;  4MJS B;  2WWZ A;  1YX5 B;  2BWF A;  1R4M I;  3AU5 A;  2V3S A;  4I6P A;  1H4R A;  2KX0 A;  4ZDV A;  2G4S A;  3RCZ A;  2IBI B;  4M8M A;  3A4S C;  4W9D A;  4WWO A;  2KTR A;  2N9E B;  2KO3 A;  3PRZ A;  5D7G A;  2FCN A;  5BO4 B;  2IY0 B;  4HJK A;  2BPS A;  4XZ4 A;  1WMH A;  3QAR A;  3U8Z A;  3PS6 A;  2G3Q B;  4B95 A;  2EMT A;  1UBQ A;  3PHX B;  3IHP C;  1J0G A;  3VAW A;  3ZVV A;  2M4N A;  4XC2 A;  3H6N A;  5D2M B;  1WXV A;  4G0N B;  2C7M B;  3SDL C;  4KSL C;  5IAA C;  1C1Y B;  2J0K A;  2L05 A;  3R7R A;  3MJW A;  4BOS C;  3QQ8 B;  2K6D B;  2MP2 B;  3PSE B;  3JYU A;  3A9J A;  4K81 A;  1XT9 B;  3CF6 E;  4DDI D;  2AL3 A;  3HHM A;  3DVG X;  3PHW B;  2JXX A;  4ICV A;  1WFY A;  3PV1 A;  4BFR A;  2BGF A;  1P0R A;  3H9D A;  2V4L A;  1WR6 E;  4LDT B;  2UYZ B;  3ML9 A;  2MQJ A;  2LVO A;  2NS5 A;  3QX1 A;  2JY6 A;  2JZ3 B;  3U30 A;  4MGY E;  4OVU A;  4EZL A;  1WY8 A;  4FJV B;  2DZI A;  5L83 A;  4A20 A;  2GBJ A;  2KTF A;  2ZZP B;  3QHT A;  4MSM B;  4ANU A;  4HDQ A;  2N1V A;  3VTV A;  2D3G A;  2AEH A;  5AEK B;  4I6N B;  4BKS A;  3OAW A;  4M8N A;  2KQS A;  1V5T A;  2DYM A;  2KDE B;  4WWP A;  2LWP A;  3X23 A;  3QAQ A;  2KFK A;  4NJ7 A;  1TBE A;  1WX7 A;  2NCN A;  4GSW A;  4K7U A;  3ML8 A;  2O6V D;  3BY4 B;  4AUQ C;  4BBN F;  1MG8 A;  2O2V A;  4W9H A;  1RLF A;  4GU2 A;  4E74 A;  3HM6 X;  3VUX A;  1S3S G;  3MTN B;  3EFU A;  3V6C B;  2PJH A;  4G50 A;  3H7P B;  3VVW B;  1G6J A;  3MHS D;  1EUV B;  1WH3 A;  4G11 A;  3WA0 A;  1WE6 A;  2BKR B;  4II2 B;  4KIK B;  1P98 A;  2FNJ B;  4IG7 B;  3V62 A;  4W9C A;  2VRR B;  2DZK A;  2EKE C;  2I1K A;  5AZG A;  2ZJD A;  4XX5 A;  1WGH A;  3N32 A;  5CTR C;  3UIO B;  1R4N I;  2KC2 A;  4CO7 A;  1WJ6 A;  4MSQ B;  1Y8R C;  2J0M A;  3M63 B;  4PS7 A;  4WJO A;  1WZ3 A;  2HD5 B;  3ZRC A;  3B08 A;  1ISN A;  3H7P A;  2BWE S;  4DBG A;  3GZN I;  3IBE A;  1IYF A;  1RFA A;  3ZUN A;  2CHX A;  2LD9 A;  2C9W B;  4GIV A;  3W1S A;  4F1S A;  1OGW A;  3QC8 B;  3EEC A;  2C5L C;  3KH0 A;  2WX0 A;  3P2B A;  3RYT A;  1WJU A;  2HJ8 A;  3NZS A;  2XEW A;  2BKF A;  3VUW A;  4X57 B;  1UBI A;  4TQ1 A;  3DOW A;  1KLV A;  1WX8 A;  2EMS A;  2AWT A;  2KDF B;  3BIN A;  4HXD A;  4F8C B;  2HTH A;  1UH6 A;  4DHZ B;  2JT4 B;  3ZIM A;  4NJ6 A;  1V9J A;  2YLM A;  3NS8 A;  5AZF A;  2LRU A;  2KWV B;  3UQA A;  3VQI A;  3H7S A;  2AL6 A;  3APC A;  4MM3 A;  2LGX A;  2ZVN A;  5JH5 C;  4IUM B;  2CU1 A;  4FHK A;  2KN5 A;  2G45 B;  1WJ4 A;  2C60 A;  3L10 B;  2YVC A;  3V6E B;  1LM8 B;  4K7S A;  1Z2M A;  4KSK C;  1WM3 A;  2CS4 A;  2J0J A;  4HCP B;  5AZH A;  2L0T A;  3PVL A;  2FUH B;  2DAJ A;  2K6Q A;  2KKC A;  2ZCC A;  2RD0 A;  1E7V A;  5D6J B;  1SE9 A;  2UWQ A;  3PT2 B;  2NR2 A;  3PTF C;  4LDT D;  2KWC A;  3JW0 X;  3K9O B;  2LI5 A;  1WMH B;  3NY5 A;  4G3X B;  4MDK E;  2D10 A;  1V81 A;  2DYO A;  2DEN B;  2RR9 A;  5J18 A;  4BOZ B;  3QIJ A;  4ANV A;  1WXS A;  3EC8 A;  4EFO A;  2I1J A;  1V49 A;  4M0W B;  4BKG A;  3L08 A;  1K8R B;  3DVG Y;  3QCA A;  3TCA A;  2GBK A;  3L54 A;  3UF8 A;  1WGY A;  5DPR A;  4WWN A;  3WAP A;  1UZX B;  3A9J B;  3T8M A;  1UGM A;  1CMX B;  2HE7 A;  3HIZ A;  3OJ4 B;  3SU8 X;  2Z0D B;  4EOY A;  4NPN A;  1V5O A;  3LDZ E;  2R2Q A;  4ASW C;  1NI2 A;  2D2Q A;  2M17 A;  1WM2 A;  2KDB A;  1YQB A;  2IO0 B;  4JQW C;  2KDI A;  5CHW A;  3L13 A;  2WYQ A;  1I35 A;  2BF8 B;  1YD8 U;  2LRW A;  4FJY A;  2KMA A;  2DAF A;  2MCN B;  1S1Q B;  4ZRI A;  4JLC A;  2M1M A;  3VXW A;  2W9N A;  1OEY J;  4ANX A;  3JVZ X;  4CYE A;  2NBV B;  4EZJ A;  2KK8 A;  1E5W A;  4FJZ A;  4KDI C;  3K9P B;  3U7D A;  4AP4 C;  3JSV B;  3TIX A;  3PZD A;  4NNJ B;  2KVR A;  1P1A A;  2KFK B;  1WZ0 A;  4WJQ A;  4FLH A;  1XQQ A;  5LXH A;  2ZEQ A;  2O2V B;  3X0W A;  2L76 A;  5D94 A;  1ZGU B;  2CHZ A;  2K25 A;  1PQS A;  3DBH I;  3ALB A;  4RM8 A;  5DCN A;  1NDD A;  2FCM A;  3VTU A;  3HM3 A;  3A9K B;  5J2R A;  4TUU A;  4ZRK A;  3I3T B;  4W9J A;  4GOC A;  3JSV A;  1F9J A;  2KXJ A;  2DX5 B;  1E8Z A;  4GB9 A;  4EZK A;  1WRD B;  5CX3 A;  5LLI A;  3A1Q B;  3HK0 A;  5DPW A;  4GDK B;  4DK5 A;  2NPT B;  4ICU A;  5DPS A;  2MLB A;  2NVU I;  4KZ0 A;  4AJW A;  3DDC B;  3VFK A;  2KQ7 A;  1BT0 A;  2LJ5 A;  1AAR A;  3KUD B;  4RMA A;  4FBJ B;  4II3 B;  3CMM B;  4WAA A;  2NBW B;  3A9K A;  1SIF A;  2Z59 B;  5LXI B;  3APF A;  4IWP A;  4TKN A;  1NBF C;  3DBL I;  4JGH B;  4IM3 A;  5DPT A;  2WX1 A;  4B9K A;  3KYC D; 
#chains in the Genus database with same CATH topology
 2JRH A;  1TKY A;  1K52 A;  3DBR B;  1E9M A;  2PVG C;  2MA9 B;  3IFW B;  3UIN B;  1Q0W B;  3BZD B;  1AN8 A;  4N59 A;  3W5U B;  2JUO A;  3NOB A;  4DHJ D;  4ZHO A;  3DBS A;  2M0X A;  2ZVO A;  2JU6 X;  1F2R I;  2B3A A;  4YTM B;  4LTU A;  1TY2 A;  4W9I A;  3NZU A;  3ZLZ A;  4IDI A;  4PS8 A;  2DNF A;  3QA8 A;  2MSE D;  3PLV A;  4R3D A;  2KLC A;  1OQQ A;  3BYY B;  3QK0 A;  4CHK A;  3R66 C;  3QWZ B;  2K3U A;  1TZ1 A;  2V3P A;  1N6Z A;  3V3X A;  4BBN C;  2VZK B;  1QIL A;  3AEA B;  4ZOH C;  1V8C A;  4NAW A;  1YOV B;  3LXF A;  3WAN A;  5HHD G;  3ZO5 B;  1NEN B;  2HJ1 A;  4IWO A;  1SE2 A;  2ZCB A;  3UIP B;  4ACF A;  2LZ6 A;  4IW0 A;  4PYU A;  2AX5 A;  2O6V A;  3RNC C;  2KJ6 A;  4RGT A;  3Q3F A;  2WS3 B;  3LJ3 A;  3PRM B;  4DWF A;  5EE9 A;  1V2Y A;  4US8 A;  1WYW B;  3EHV A;  2GI9 A;  2BTE A;  1OQR A;  2REX A;  2L0F A;  4WJN A;  4EEW A;  5FK9 C;  4MEL A;  1Y56 A;  5E6O A;  4W9L A;  5CHV C;  1QOG A;  3BVM A;  2FCS A;  4B0M A;  3KLS X;  1EO6 A;  2BB6 A;  2KN4 A;  1V1O A;  2IZV B;  2JWZ A;  3V60 A;  4MJS A;  1QOB A;  4OZC A;  1WE7 A;  5G5G A;  5TR5 A;  3RUL A;  4NZL B;  3QJZ A;  1KJT A;  1RM6 C;  3O13 A;  2A4Z A;  4A8X C;  1E8Y A;  3U7Z A;  4NQK E;  1CZP A;  3GOE A;  2JRI B;  2IO3 B;  1L4D B;  2MBB B;  3GZN B;  1U4A A;  1CQV A;  3AH7 A;  2WXP A;  2QDF A;  3VR9 B;  1GUA B;  3W1S C;  2K1F A;  3BVG A;  2FCQ A;  1Q5W B;  2ZNV C;  3ZKJ C;  2MRP A;  4WJP A;  2DZM A;  2WDR B;  2N9P C;  4MH8 A;  2N4F A;  1XEE A;  2L8J A;  1QZE A;  3I9V 1;  2M19 A;  3AU4 A;  2LGD A;  1N5X A;  4HPM B;  2J4X A;  3N30 A;  2AYO B;  1AWD A;  4W9F A;  3RMK C;  3NG0 A;  1D3Z A;  2KWU B;  5G2N A;  1XXG A;  2O6V B;  3U52 E;  4WWM A;  2GMI C;  3AUL A;  1T0Y A;  2D07 B;  2L00 B;  3M3J A;  3RI7 C;  4ZYS A;  4GN1 A;  4EKU A;  2IO2 B;  3PLU A;  1IBX B;  4DDG D;  3R2T A;  2ZPN A;  1K51 A;  1GB1 A;  1OQY A;  5AUK A;  5H92 C;  1E8X A;  3VRB B;  2J52 A;  2KZR A;  2BYF A;  3Q3N C;  3ZJU A;  4YSX B;  3SFD B;  3Q8C A;  3DHI C;  4M01 A;  4DHJ B;  1KOT A;  2SAK A;  4URK A;  1KM7 A;  1RFK A;  4MJS B;  1R4M I;  3AU5 A;  3BII D;  4I6P A;  4JWU C;  4ZDV A;  4WWO A;  2KTR A;  2N9E B;  2GLS A;  1PDX A;  4XZ4 A;  1RWS A;  1J0G A;  4XC2 A;  4OZA A;  1VZ7 A;  4KSL C;  5IAA C;  2J0K A;  3R7R A;  3AE7 B;  4ITK A;  2K6D B;  3TUO A;  2L32 A;  3A9J A;  2INP E;  2DBY A;  4DDI D;  1SE3 A;  4RFB A;  4ICV A;  1WFY A;  3H9D A;  2ON8 A;  1FCC C;  4USA A;  3SEB A;  2JZ3 B;  3LB8 C;  4MGY E;  4HRS A;  2DZI A;  2QC8 A;  2GBJ A;  2ZZP B;  3QHT A;  4ANU A;  4HDQ A;  2CJO A;  1SE4 A;  2Y5C A;  3VRA B;  3VTV A;  4EE2 A;  3OAW A;  2KDE B;  1TS3 A;  2XN9 C;  3IAS 1;  3BY4 B;  1JW9 D;  1YN3 A;  5IN7 A;  3EFU A;  4KGS A;  1VDV A;  1JRP A;  4DQO C;  2TSS A;  3MHS D;  1IGC A;  4G11 A;  3RFZ B;  3MFG A;  3WA0 A;  4LNF A;  1WE6 A;  4K3C A;  1P98 A;  4IG7 B;  2PW9 A;  3V62 A;  1D5Z C;  1WSP A;  3N32 A;  2RDG A;  1R4N I;  4CO7 A;  4PS7 A;  4N6E B;  2FE8 A;  1N60 A;  3OG5 A;  4DBG A;  4CQN A;  5E6J A;  3AE4 B;  2WXM A;  2NMQ A;  3EEC A;  3KH0 A;  3NZS A;  3AE2 B;  3VUW A;  2INC C;  3DOW A;  1WX8 A;  2KDF B;  2V9H A;  1N62 A;  4F8C B;  2LRU A;  3UQA A;  2AL6 A;  3APC A;  5JH5 C;  4IUM B;  3V05 A;  2WXO A;  3AEF B;  1WJ4 A;  3C19 A;  3V6E B;  2CS4 A;  2J0J A;  5AZH A;  2FUH B;  4OVZ A;  2GRI A;  1SE9 A;  3PTF C;  2UWQ A;  5J18 A;  4LDT D;  3K9O B;  1FMA D;  2YEP F;  1YQ4 B;  2DYO A;  3MC0 B;  2RR9 A;  5JXV A;  3TEZ A;  4BOZ B;  2IGH A;  4EFO A;  1V49 A;  4BKG A;  1FPY A;  3L08 A;  5HI1 A;  3DVG Y;  4A6Q A;  2WQY B;  3NUH B;  1WGY A;  2N9L A;  3A9J B;  3OJ4 B;  3SU8 X;  1V5O A;  2OHF A;  2KDB A;  1DOY A;  1OFF A;  3L13 A;  1C76 A;  1YD8 U;  3HUI A;  4YTP B;  1MPE A;  4ZRI A;  3VXW A;  4ANX A;  2KWD A;  3N1Y C;  4KDI C;  3K9P B;  3P4P B;  4RGO S;  1L6U A;  1WZ0 A;  1FIQ A;  5LXH A;  1I4Q A;  3X0W A;  5D94 A;  1ZGU B;  4QAY A;  2K25 A;  4XWT A;  3ALB A;  1NDD A;  2INN E;  3VTU A;  1L0Y B;  1EU3 A;  4REZ A;  1T6B X;  2YEP B;  4TUU A;  4GOC A;  2DX5 B;  4GB9 A;  5CX3 A;  5I4D A;  2MEK A;  3GB1 A;  1NVI D;  4GDK B;  1ROE A;  2NPT B;  5DPS A;  4AJW A;  4RMA A;  3W2D A;  3BVZ A;  3A9K A;  3APF A;  4IWP A;  2IDY A;  2NTS A;  4TKN A;  5C2T B;  4B9K A;  3Q3J A;  4E71 A;  3TSS A;  1VRA B;  3E9S A;  2OJW A;  3C8Y A;  4HKQ A;  1A70 A;  1E0Z A;  4AS1 A;  3ZRF A;  4A55 A;  2JPH A;  2PIA A;  1T3Q A;  4K3B A;  4BVU C;  2LEK A;  1D5X C;  5EE0 A;  3WAM A;  3B0A A;  3AEG B;  3WIM A;  1WI0 A;  1EWC A;  5JZE B;  5BMG A;  3CSF A;  2KX3 A;  5JHA A;  2FBW B;  4RGN A;  3AXC A;  3M95 A;  5J17 A;  1ZUD 2;  2D11 A;  4OVV A;  1MHH E;  3CWI A;  4KX6 B;  1M94 A;  2KMM A;  4E3C A;  2MJD A;  2JYT A;  4ZHP A;  4MGK E;  3RPF C;  3O65 B;  2KVZ A;  2KJH B;  4KZC A;  1RYJ A;  3GP7 A;  1V80 A;  2KT7 A;  3Q69 A;  4IM0 A;  2N7D A;  2QHO A;  1MI0 A;  1XF5 L;  3HVZ A;  4P1B C;  1ZW7 A;  2WXK A;  2RGF A;  4FAD A;  4YSZ B;  2PEA A;  2ASQ A;  1MG4 A;  4AQ7 A;  2K9X A;  4NAM A;  4TQ0 A;  3VH4 B;  2MBQ A;  1YIW A;  3DBH B;  3P4S B;  4IM2 A;  4MT5 A;  4J6I A;  1QQR A;  2BW2 A;  4M00 A;  3OWE B;  1ZKH A;  1AYF A;  1XLO A;  2PE9 A;  1KH0 A;  1SGH A;  5CHF A;  1L7Y A;  2BS4 B;  4KVG B;  2C7H A;  1FCL A;  1TS4 A;  1XD3 B;  2KLG A;  2JZP A;  5JHB A;  2LXC A;  3AED B;  3BK2 A;  3DPD A;  4W9G A;  4TSS A;  2K5P A;  2C7N B;  3AM9 A;  5C1Z A;  5IO9 A;  2CHW A;  4HVB A;  3TMP B;  1LO5 D;  3B2G A;  3W9C B;  1EF1 A;  4PYZ A;  2MJE A;  4LCD E;  1F77 A;  4GGQ A;  4GDL B;  1UWX A;  2BB5 A;  1EU4 A;  1PUT A;  4P7I A;  1DYQ A;  2BYV E;  1T0S C;  4JWS C;  3DWM A;  4C7Z A;  2KNB A;  3ZNG C;  1ENF A;  2G9H D;  1ZDX A;  1UWM A;  2RSU A;  3DHG C;  4MGZ E;  3L16 A;  1UNS A;  4FUL A;  3ECI A;  1LFD A;  1QT9 A;  2JF5 A;  1J8C A;  2D3B A;  2BS2 B;  3ZDT A;  4ANW A;  3NRZ A;  4DXF A;  1P7F A;  1I4G A;  4EUT A;  1P3Q U;  2VH2 A;  2IY1 B;  1WRI A;  3ZTC A;  2KJR A;  4HWI B;  3RZW C;  4A3P A;  1R7S A;  3DCG A;  3A4R A;  2SEB D;  1C4A A;  3DVN V;  2OOB B;  4FA6 A;  2V1Y A;  1UD7 A;  2IYD B;  3GS2 A;  4WUR A;  4K1R B;  3RNA C;  2LUM A;  4PS3 A;  1IBX A;  5IA7 A;  4GXB A;  3WAL A;  4LNI A;  2Y5B B;  2WWZ A;  2BWF A;  1KFY B;  2G4S A;  3A4S C;  5D7G A;  1SJE D;  3B2F A;  4RF0 A;  3NZ3 A;  1FNU A;  4L23 A;  1UBQ A;  2ICI A;  1N61 A;  3ZVV A;  3LYY A;  5D2M B;  1WXV A;  5AUI A;  3DWG C;  3FIL A;  4BOS C;  3QQ8 B;  4ZRP A;  2WXN A;  3AB5 A;  3CF6 E;  3RNB C;  2AQ2 B;  3PHW B;  2JXX A;  1ET9 A;  3PV1 A;  4RNA A;  2BGF A;  4OHJ A;  1DGJ A;  3ML9 A;  2MQJ A;  4EZL A;  1WY8 A;  4A20 A;  1XCT L;  2RPV A;  2KDM A;  4MSM B;  2N1V A;  2D3G A;  2AEH A;  4I6N B;  1I7H A;  1HA5 A;  1V5T A;  2KFK A;  2ZW1 A;  4AUQ C;  1FNV A;  1RLF A;  2RDB C;  4GU2 A;  4E74 A;  1T0Q C;  1S3S G;  1BML C;  3MTN B;  3IT6 B;  3VVW B;  1G6J A;  2BKR B;  4II2 B;  2KAC A;  2FNJ B;  2V3N A;  2VRR B;  5AZG A;  2BS3 B;  5CTR C;  1ZE3 D;  3UIO B;  2RMM A;  1Y8R C;  2J0M A;  3AEB B;  4WJO A;  1WZ3 A;  3ZRC A;  3Q8E A;  2BWE S;  3FAH A;  3IBE A;  1E6E B;  2L52 A;  1ZOY B;  2CHX A;  4DXG A;  3QC8 B;  2I2Y A;  1PGX A;  5BYQ A;  2C5L C;  3RYT A;  2HJ8 A;  1I4R A;  3BK1 A;  1D6E C;  2XEW A;  2BKF A;  4S17 A;  1KLV A;  2AWT A;  4KKI A;  4HXD A;  1L5P A;  1JWB D;  3ZIM A;  4O1N A;  3H7S A;  1TZO A;  1DOI A;  2LGX A;  4FHK A;  3VR8 B;  1KRH A;  2G45 B;  3L10 B;  2WXG A;  4IOI E;  2WXJ A;  3ZGZ A;  2H88 B;  1EWY C;  2DAJ A;  2LHE A;  1XLP A;  2NR2 A;  3T9L A;  1DOX A;  3JW0 X;  1TT5 B;  4NJC A;  2D10 A;  4BAX A;  3KQ4 A;  2DEN B;  3N9Y C;  2K0P A;  4M0W B;  3IXS A;  3QCA A;  1C9F A;  3FIL B;  3L54 A;  5DPR A;  4WWN A;  2H89 B;  3WAP A;  3ETR A;  1UZX B;  3Q8F A;  3T8M A;  2LGS A;  3E56 A;  2Z0D B;  2N7J A;  3ZYY X;  4EOY A;  2R2Q A;  1WM2 A;  3AEE B;  2JX5 A;  2WHI A;  3Q6B A;  4XGA B;  2M1M A;  1OEY J;  2MHJ A;  3JVZ X;  3Q3O C;  2NBV B;  4CYE A;  1B1Z A;  3U7D A;  4AP4 C;  1HTQ A;  3TIX A;  2KFK B;  4RCO A;  2N0S B;  2ZEQ A;  2BBC A;  1ACC A;  4PT5 A;  1L0V B;  3DBH I;  1J7A A;  2FCM A;  2Z8L A;  2WNM A;  4ZRK A;  3I3T B;  1F9J A;  1E8Z A;  1WYG A;  2JQR B;  3A1Q B;  3HK0 A;  1F2R C;  4C7Y A;  1F0Z A;  3NVY A;  3DDC B;  2LJ5 A;  4II3 B;  4XYC A;  1NBF C;  1KF6 B;  4EZK A;  4GDK A;  1MFW A;  2NPT A;  3J9C A;  2K8H A;  2QSD A;  3MJ5 A;  2DWQ A;  3OLM D;  2N9K A;  3RZF A;  2XBB C;  1SXT A;  5KHO A;  1JRU A;  1CJE A;  3ZJV A;  2Z0E B;  3R7Q A;  1GAQ B;  4A3O A;  2M56 B;  1RAX A;  2IND C;  1T5X D;  2CR5 A;  3TBL D;  1N63 A;  2MBH A;  2KFJ A;  2FAZ A;  1SJH D;  2WP9 B;  5D3D A;  1FXI A;  1JCK B;  1QOF A;  2IGG A;  2M8S A;  1FEH A;  1WF9 A;  3WAO A;  2LGY A;  2WXF A;  4RH6 A;  1JWS D;  2LVQ A;  1OEY A;  3AE6 B;  1E8W A;  2L1A A;  3ZNH B;  2X8X X;  4US9 A;  3B1L X;  1E7U A;  3ZTD A;  3RUI B;  4BKS D;  2CU3 A;  4JIO U;  1WX9 A;  4RM9 A;  4RGM A;  1FD6 A;  3R2I A;  4WAF A;  2W3R A;  3RD2 A;  3Q8B A;  3EA6 A;  1STE A;  2JVC A;  3URY A;  3TEY A;  2KOX A;  1L4Z B;  3W5V B;  3ENE A;  3VUY A;  3U2S C;  2MW5 A;  5EDS A;  1HE8 A;  3PZ8 A;  1Q1O A;  3VTW A;  3M62 B;  1RRB A;  1ZXH A;  2AQ1 B;  5C23 A;  1UEL A;  3R3M A;  1JWM D;  3TJP A;  4YSY B;  1TTN A;  4DHZ E;  2KAN A;  2W3S A;  4WQM A;  1NYR A;  1UF0 A;  1GJZ A;  4GMV A;  3VHT C;  1FRR A;  4XE0 A;  4XDC A;  2MBO A;  1JWA D;  1QOA A;  1P9D U;  1IGD A;  1YX6 B;  4NQL B;  2GBR A;  2VH1 A;  2GBN A;  3P63 A;  3V61 A;  4I6L B;  2BT6 A;  2MX2 A;  3AI5 A;  4LNK A;  1IP9 A;  4WQO B;  2LJI A;  2MP2 A;  3TEW A;  1FNW A;  1MJD A;  2UU7 A;  1P7E A;  4ARC A;  2JZZ A;  2LAS A;  3DQV A;  2L3Z A;  4A90 A;  2LVP A;  1LXD A;  3ZNI D;  3ZXV A;  1C78 A;  2WDQ B;  3DVN U;  1WXM A;  2WGS A;  2WDT B;  5E6P A;  3H1U A;  4AJY B;  2J42 A;  1YJ1 A;  2CKH B;  4GDL A;  2N9X A;  2GOW A;  3KWV A;  3ZNZ B;  3WCQ A;  2LXA A;  4TV3 A;  4MH0 E;  3AMZ A;  4FHJ A;  5GMV A;  1WGD A;  3N3K B;  1LQB A;  1XO3 A;  3L17 A;  2E6X A;  3BWU D;  4PK1 A;  5G55 A;  2G1E A;  2WXI A;  3UQB A;  3PGE A;  2WDV B;  4OW0 A;  1NEK B;  1I42 A;  3PO0 A;  3C0R B;  2RPQ A;  2A5U A;  5G5H A;  2QIL A;  3PRP B;  4HK2 A;  4IC7 B;  3P42 A;  1L2N A;  2BYE A;  3KUZ A;  4B6W A;  5HG2 A;  3MP9 A;  5E6N A;  4IWQ A;  5FR6 A;  1F1H A;  4BZA A;  1SBB B;  1IUE A;  1TYG B;  4YL8 A;  1XLQ A;  1B9R A;  2KX0 A;  4M8M A;  4W9D A;  3UI3 A;  2IY0 B;  4HJK A;  1WMH A;  4B95 A;  3Q3M C;  1ESF A;  3VAW A;  3HRD D;  1YNT E;  2LFI A;  3H6N A;  2BVC A;  4G0N B;  3SDL C;  2L05 A;  2BYT A;  2MP2 B;  3JYU A;  4K81 A;  4OZB A;  3HHM A;  4C4V B;  4BFR A;  2V4L A;  1WR6 E;  1E7P B;  4LDT B;  2ZW0 A;  2UYZ B;  4P6V F;  2NS5 A;  3QX1 A;  2V4I B;  1YQ3 B;  3U30 A;  4OVU A;  5L83 A;  1YMH E;  2KTF A;  3MHZ A;  2KQS A;  3X23 A;  2Y3A A;  3IT4 B;  1TBE A;  1WX7 A;  3ML8 A;  2O6V D;  1PGB A;  4BBN F;  3B9J A;  2Y5P A;  3HM6 X;  3VUX A;  2EKI A;  1VZ6 A;  3V6C B;  2PJH A;  4G50 A;  3H7P B;  2I38 A;  1WH3 A;  3Q8A A;  1Q10 A;  2I1K A;  2EKE C;  4YT0 B;  2ZJD A;  1BXT A;  2IGD A;  2KC2 A;  1C79 A;  1WGK A;  2HD5 B;  3B08 A;  1ISN A;  1IYF A;  4H2A A;  1RFA A;  3ZUN A;  2CJN A;  2LD9 A;  2RDH A;  4Q2J A;  4GIV A;  3W1S A;  1OGW A;  1I4P A;  1LGR A;  1SSN A;  2WX0 A;  1WJU A;  4X57 B;  4TQ1 A;  3FKY A;  1QKZ A;  4NJ6 A;  5AZF A;  3EFC A;  2KWV B;  4LNO A;  2CU1 A;  1TY0 A;  2X38 A;  3R8B A;  2C60 A;  4YTN B;  1TIF A;  2YVC A;  2KQ4 X;  1WM3 A;  4HCP B;  1T0R C;  2WXQ A;  5IOI A;  2ZCC A;  3DHH C;  1MHX A;  5D6J B;  3PT2 B;  4MM3 A;  3NY5 A;  2LI5 A;  4G3X B;  1WMH B;  2AQ3 B;  3L4P A;  1ZPS A;  1D5M C;  3AV8 A;  5FR3 A;  2E3T A;  3ZXR A;  3TCA A;  2WXR A;  2GBK A;  4HRO A;  3UF8 A;  1YN5 A;  1PFD A;  3IAM 1;  4JE3 B;  1UGM A;  1CMX B;  4KGR A;  4NPN A;  3LDZ E;  4ASW C;  1NI2 A;  3CIR B;  1ZDV A;  1XLN A;  3EGR A;  2IO0 B;  2KDI A;  3N1Z C;  4P16 A;  1GB4 A;  3U4E G;  2BF8 B;  3ABV B;  2PVO D;  2WU2 B;  1TKE A;  2KYW A;  2LRW A;  3NVZ A;  4M0W A;  5BYS A;  2HTM E;  3I63 C;  1S1Q B;  4EZJ A;  4FJZ A;  3GE3 C;  3JSV B;  1SB3 C;  4NNJ B;  1P1A A;  1QF6 A;  4WJQ A;  1C77 A;  1L0X B;  1FXA A;  5C3J B;  5DCN A;  4RM8 A;  4RF1 A;  4TMA B;  1SEB D;  3HM3 A;  1VR9 A;  4IKG A;  4XWW A;  4YXD B;  4B0E A;  5LLI A;  4S0R A;  4DK5 A;  4ICU A;  4L2Y A;  2MLB A;  4KZ0 A;  2KQ7 A;  3KUD B;  4FBJ B;  4KKJ A;  5H8Y E;  1QLB B;  2NBW B;  1SIF A;  1N5W A;  3AE9 B;  1C4P A;  5DPT A;  4IM3 A;  1NI3 A;  4UDU C;  4YWG G;  3A1Q A;  1H8C A;  1AW7 A;  2EEL A;  1WGG A;  2JWU A;  3ZQ4 A;  4LJO B;  1ET6 A;  2ZNV B;  4KDL B;  3EUB 2;  2QJL A;  2MWS B;  2DZJ A;  1V6E A;  2DYB A;  1VJK A;  3AE8 B;  1HTO A;  2KD0 A;  2G4D B;  1E90 A;  3SFE B;  3TEX A;  3AN1 A;  1WXA A;  3N20 C;  1Z5S B;  3BYT B;  3A33 B;  2D5G A;  3MC8 A;  3RT3 B;  1D4B A;  4K7W A;  3VH3 B;  1V1P A;  2QIE B;  1YN4 A;  2PE6 B;  2R2O A;  2GB1 A;  2MBE A;  2WLB A;  3H8H A;  2K8C A;  4HCN B;  4NAW B;  4C00 A;  5HKH A;  5KHQ A;  4HJG E;  1C3T A;  4MM3 B;  3P4R B;  5BMI A;  3FC4 A;  3PRE A;  1IPG A;  5TSS A;  1JML A;  4FN2 A;  4MAC A;  1WR1 A;  1GG3 A;  3MC9 A;  4AOF A;  1VCB A;  3SR6 A;  2WU5 B;  2LGI A;  1JRO A;  1ZXI A;  4W9E A;  1KTK A;  1WJN A;  4MEM A;  2J7Q B;  1GNU A;  5L95 C;  2OJR A;  2PKO A;  3NHE B;  5EE1 A;  2MH7 A;  1OTR B;  2N7E A;  4W9K A;  2R61 A;  3UGB B;  2FID A;  2NBU A;  1HQR D;  1EF5 A;  1CK1 A;  1FRD A;  2WXH A;  2L7R A;  2XK5 A;  3NS1 A;  2IO1 B;  5HFY A;  3RN9 C;  2NTT A;  1JAL A;  1V97 A;  4ZRJ A;  3IVF A;  1F52 A;  4N9F 4;  4ZRQ A;  1KLU D;  1E10 A;  1WXQ A;  1M4V A;  1TJE A;  3I5J C;  1VD2 A;  5D3I B;  2KAJ A;  3DBL B;  3PPA A;  3CST A;  3TL5 A;  2KC1 A;  1FO4 A;  1HXY D;  2B76 B;  2D3A A;  2PLP A;  2GBM A;  1HZ5 A;  3OJ3 A;  2QCZ A;  1VZ8 A;  1TGZ B;  1K53 A;  3KWL A;  2K39 A;  4JL9 A;  2DHZ A;  4F7Z A;  3KW5 B;  1SF0 A;  3APD A;  1V1P B;  2J53 A;  4D2K A;  4HLE A;  1X1M A;  4NY0 A;  2K22 A;  4AWJ A;  3ONS A;  4HDO A;  3AE3 B;  1J7B A;  2FIF A;  1BUI C;  1PYW D;  2LMC A;  5T8I A;  3AE1 B;  1YJJ A;  1KLG D;  1GC6 A;  1FXT B;  1WGR A;  1J19 A;  3ZW3 A;  2K8B A;  4BKT A;  3L0W B;  4HPP A;  3D32 A;  4JPS A;  3N1X C;  3W1Y A;  3ZJT A;  2KMC A;  2LHD A;  3P4Q B;  4WIP A;  4KIK A;  1V86 A;  4DXA B;  3DBR I;  4HPL B;  3S2A A;  3VDZ A;  3SD5 A;  4MGI E;  3SHQ A;  3KYD D;  4ZYN A;  1WWT A;  4LJP B;  4KV2 A;  1GC7 A;  3KUC B;  2LUE A;  2KTR B;  1WIA A;  1A5R A;  3ZDM C;  2ZPY A;  2N1W A;  2PPH A;  2XK5 B;  3IG3 A;  1HZ6 A;  2KHW B;  3KVF B;  1K50 A;  2QMT A;  1YX5 B;  2V3S A;  1H4R A;  3RCZ A;  2IBI B;  2KO3 A;  3PRZ A;  2FCN A;  5BO4 B;  2BPS A;  3QAR A;  3U8Z A;  3PS6 A;  2G3Q B;  2EMT A;  3PHX B;  3IHP C;  5EE3 A;  1ZP0 B;  4C80 A;  1SIJ A;  2M4N A;  2C7M B;  1C1Y B;  4N58 A;  1PGA A;  3MJW A;  3I57 A;  3PSE B;  1NYQ A;  2JXT A;  1XT9 B;  4A9A A;  2AL3 A;  3Q2A C;  3DVG X;  1P0R A;  2QEJ C;  2IJ0 A;  1MVK A;  5BYR A;  2LVO A;  2JY6 A;  1I4X A;  2OED A;  4FJV B;  4M02 A;  3RNG C;  4FXC A;  3T3N A;  3P1M A;  4C4V A;  5AEK B;  4BKS A;  4P1C C;  4M8N A;  2DYM A;  4WWP A;  2LWP A;  3QAQ A;  4NJ7 A;  4K7U A;  2NCN A;  1HEZ E;  4GSW A;  5IP4 D;  1J7C A;  2VZK D;  1MG8 A;  2O2V A;  4W9H A;  1FM0 D;  2ACZ B;  3AEC B;  4LNN A;  4HEA 1;  1FFV A;  1YJI A;  1EUV B;  4KIK B;  4J3O D;  4W9C A;  3HVD A;  2DZK A;  4XX5 A;  1WGH A;  1TKG A;  3NJT A;  2V0G A;  1WJ6 A;  2PTL A;  4MSQ B;  3M63 B;  1JWU D;  3H7P A;  3GZN I;  4C56 C;  2C9W B;  4L1B A;  4F1S A;  2PMV A;  3P2B A;  3GE8 C;  4GLS C;  1UBI A;  1XCQ L;  1UUP A;  2EMS A;  3BIN A;  2HTH A;  1UH6 A;  4DHZ B;  2JT4 B;  1V9J A;  2YLM A;  3NS8 A;  1GOZ A;  3VQI A;  2ZVN A;  2XNA C;  5GXG B;  2Q5W D;  2KN5 A;  2FUG 1;  1R4M B;  1LM8 B;  4K7S A;  1Z2M A;  4KSK C;  2DLB A;  3PVL A;  2L0T A;  1GPX A;  2K6Q A;  2KKC A;  2MJ3 A;  3RNE C;  2RD0 A;  1E7V A;  1L6V A;  4MDK E;  2KWC A;  1V81 A;  4LLG M;  5MPO A;  1C4C A;  2W55 A;  3QIJ A;  4ANV A;  3RNF C;  1WXS A;  3EC8 A;  2I1J A;  1VLB A;  1TS2 A;  3NVV A;  1K8R B;  1FFU A;  2D3C A;  2WXL A;  2BQQ A;  3PZ7 A;  2HE7 A;  3HIZ A;  2L83 A;  2D2Q A;  2M17 A;  4WH4 A;  1YQB A;  4JQW C;  1I4H A;  4XDD A;  5CHW A;  2WYQ A;  1I35 A;  4JX1 C;  3T3O A;  4FJY A;  2DAF A;  2KMA A;  2MCN B;  4JLC A;  2W9N A;  4HKZ E;  5FKA C;  2KK8 A;  1E5W A;  3AE5 B;  5BMH A;  3PZD A;  2KVR A;  4ARI A;  5IKC M;  2W82 A;  1UGJ A;  4FLH A;  1XQQ A;  2JSV X;  2O2V B;  2L76 A;  2CHZ A;  1PQS A;  1JQ4 A;  2IPK D;  3NVW A;  3A9K B;  1TS5 A;  2W54 A;  5J2R A;  2JYE A;  4KGT A;  4W9J A;  3JSV A;  2KXJ A;  1WRD B;  4LK0 M;  2HDE A;  5DPW A;  3Q14 C;  2NVU I;  3VFK A;  1BT0 A;  1AAR A;  1R4N B;  2ONQ A;  3CMM B;  4WAA A;  2Z59 B;  5LXI B;  5LNK 1;  1EM7 A;  4JGH B;  3DBL I;  2WX1 A;  2M0A A;  3KYC D; 
#chains in the Genus database with same CATH homology
 2JRH A;  3Q3J A;  4E71 A;  3A1Q A;  1H8C A;  4GDK A;  2NPT A;  2K8H A;  2MA9 B;  1WGG A;  3IFW B;  3UIN B;  4LJO B;  2ZNV B;  1Q0W B;  3OLM D;  4KDL B;  3ZRF A;  3RZF A;  2JPH A;  2MWS B;  2DZJ A;  1V6E A;  2DYB A;  2JUO A;  2XBB C;  3NOB A;  4DHJ D;  3DBS A;  2KD0 A;  5KHO A;  2G4D B;  2M0X A;  1JRU A;  1E90 A;  2ZVO A;  4BVU C;  2Z0E B;  2B3A A;  1WXA A;  3R7Q A;  4A3O A;  4W9I A;  1Z5S B;  3NZU A;  3A33 B;  1RAX A;  3ZLZ A;  4PS8 A;  3RT3 B;  3WAM A;  3QA8 A;  4K7W A;  2CR5 A;  2MSE D;  3B0A A;  3PLV A;  3TBL D;  3VH3 B;  3WIM A;  2MBH A;  1WI0 A;  2KFJ A;  2PE6 B;  2KLC A;  2FAZ A;  2R2O A;  3QK0 A;  5JZE B;  2MBE A;  4NAW B;  5HKH A;  2K8C A;  3CSF A;  2KX3 A;  4HCN B;  4CHK A;  5KHQ A;  3R66 C;  5JHA A;  1C3T A;  3QWZ B;  2M8S A;  3AXC A;  3M95 A;  5J17 A;  1WF9 A;  3WAO A;  2D11 A;  1TZ1 A;  2LGY A;  4OVV A;  3PRE A;  2LVQ A;  1M94 A;  1IPG A;  1OEY A;  4FN2 A;  4BBN C;  4E3C A;  1WR1 A;  1GG3 A;  1E8W A;  3ZNH B;  4AOF A;  3B1L X;  1E7U A;  3ZTD A;  4NAW A;  1VCB A;  4MGK E;  3RUI B;  3WAN A;  3O65 B;  4BKS D;  3ZO5 B;  4IWO A;  4W9E A;  2KJH B;  2ZCB A;  4JIO U;  3UIP B;  2LZ6 A;  1WX9 A;  4RM9 A;  4KZC A;  1WJN A;  4MEM A;  2J7Q B;  1GNU A;  4IW0 A;  4PYU A;  3RD2 A;  1V80 A;  2O6V A;  5L95 C;  2KJ6 A;  2OJR A;  2JVC A;  3Q3F A;  3NHE B;  4IM0 A;  3LJ3 A;  2N7D A;  3PRM B;  2QHO A;  2KOX A;  4DWF A;  2N7E A;  1OTR B;  1V2Y A;  3ENE A;  3VUY A;  1ZW7 A;  1WYW B;  4W9K A;  3EHV A;  2MW5 A;  2RGF A;  5EDS A;  4FAD A;  3UGB B;  2FID A;  2REX A;  2PEA A;  1HE8 A;  1Q1O A;  2ASQ A;  2L0F A;  2NBU A;  1EF5 A;  3VTW A;  3M62 B;  4WJN A;  4EEW A;  1RRB A;  4TQ0 A;  3VH4 B;  2MBQ A;  4MEL A;  1YIW A;  5C23 A;  1UEL A;  3R3M A;  4IM2 A;  4J6I A;  5E6O A;  3TJP A;  4W9L A;  5CHV C;  2L7R A;  1ZKH A;  2FCS A;  2PE9 A;  1TTN A;  4DHZ E;  2XK5 A;  1SGH A;  1EO6 A;  2IO1 B;  2KAN A;  1GJZ A;  4GMV A;  5CHF A;  1L7Y A;  3VHT C;  2IZV B;  2JWZ A;  4ZRJ A;  4MJS A;  3IVF A;  4N9F 4;  3V60 A;  2MBO A;  4KVG B;  1P9D U;  2C7H A;  1YX6 B;  4NQL B;  1WE7 A;  1VD2 A;  5TR5 A;  3RUL A;  1XD3 B;  2KLG A;  3QJZ A;  2GBR A;  5JHB A;  1KJT A;  2LXC A;  3PPA A;  2A4Z A;  3CST A;  3DPD A;  3TL5 A;  1E8Y A;  2GBN A;  2KC1 A;  4W9G A;  3V61 A;  4I6L B;  4NQK E;  3GOE A;  2JRI B;  2C7N B;  5C1Z A;  2IO3 B;  2MX2 A;  2CHW A;  4HVB A;  3AI5 A;  3TMP B;  2GBM A;  1IP9 A;  4WQO B;  1EF1 A;  2MP2 A;  3OJ3 A;  4PYZ A;  2MBB B;  4LCD E;  1TGZ B;  1U4A A;  4GGQ A;  2K39 A;  2JZZ A;  2LAS A;  3DQV A;  2L3Z A;  1GUA B;  4GDL B;  4JL9 A;  2DHZ A;  2LVP A;  4F7Z A;  3KW5 B;  2K1F A;  1LXD A;  3W1S C;  3ZNI D;  3APD A;  2FCQ A;  3DVN U;  4HLE A;  4P7I A;  1X1M A;  4NY0 A;  1Q5W B;  2BYV E;  1WXM A;  2ZNV C;  3ONS A;  4AWJ A;  2WDT B;  2MRP A;  4HDO A;  3ZKJ C;  5E6P A;  3H1U A;  2FIF A;  2DZM A;  4WJP A;  4AJY B;  2KNB A;  1YJ1 A;  2N9P C;  3T9L A;  3ZNG C;  2N4F A;  2L8J A;  2CKH B;  4GDL A;  2N9X A;  1QZE A;  2GOW A;  3AU4 A;  1GC6 A;  2RSU A;  2LGD A;  1FXT B;  1WGR A;  1J19 A;  3ZW3 A;  2K8B A;  4MGZ E;  3ZNZ B;  4BKT A;  4HPM B;  2LXA A;  3L0W B;  3D32 A;  3L16 A;  4TV3 A;  4MH0 E;  3W1Y A;  2KMC A;  4FHJ A;  4FUL A;  5GMV A;  1WGD A;  3ECI A;  1LFD A;  3N30 A;  3N3K B;  2AYO B;  2JF5 A;  1J8C A;  1LQB A;  4W9F A;  4KIK A;  1D3Z A;  2KWU B;  3ZDT A;  1V86 A;  3L17 A;  4ANW A;  5G2N A;  4DXA B;  3DBR I;  2O6V B;  4HPL B;  2GMI C;  3AUL A;  4EUT A;  5G55 A;  1P3Q U;  1T0Y A;  2IY1 B;  3S2A A;  3VDZ A;  2D07 B;  2L00 B;  3ZTC A;  2KJR A;  3M3J A;  4GN1 A;  3SD5 A;  4HWI B;  3PGE A;  4EKU A;  2IO2 B;  3UQB A;  3RZW C;  4A3P A;  3PLU A;  4DDG D;  4MGI E;  1I42 A;  3SHQ A;  3C0R B;  2RPQ A;  2ZPN A;  2A5U A;  3DCG A;  3KYD D;  3A4R A;  3DVN V;  4ZYN A;  1OQY A;  4LJP B;  3PRP B;  4HK2 A;  2OOB B;  1E8X A;  4FA6 A;  4IC7 B;  4KV2 A;  2KZR A;  1GC7 A;  2BYF A;  3KUC B;  1L2N A;  2BYE A;  2V1Y A;  2LUE A;  3KUZ A;  1UD7 A;  2IYD B;  4B6W A;  2KTR B;  4K1R B;  1WIA A;  1A5R A;  3ZDM C;  2ZPY A;  5E6N A;  2N1W A;  4PS3 A;  2PPH A;  2XK5 B;  3IG3 A;  4IWQ A;  4DHJ B;  5FR6 A;  1KOT A;  4URK A;  5IA7 A;  4GXB A;  3WAL A;  2Y5B B;  2KHW B;  1KM7 A;  3KVF B;  4YL8 A;  4MJS B;  2WWZ A;  1YX5 B;  2BWF A;  1R4M I;  3AU5 A;  2V3S A;  4I6P A;  1H4R A;  2KX0 A;  4ZDV A;  2G4S A;  3RCZ A;  2IBI B;  4M8M A;  3A4S C;  4W9D A;  4WWO A;  2KTR A;  2N9E B;  2KO3 A;  3PRZ A;  5D7G A;  2FCN A;  5BO4 B;  2IY0 B;  4HJK A;  2BPS A;  4XZ4 A;  1WMH A;  3QAR A;  3U8Z A;  3PS6 A;  2G3Q B;  4B95 A;  2EMT A;  1UBQ A;  3PHX B;  3IHP C;  1J0G A;  3VAW A;  3ZVV A;  2M4N A;  4XC2 A;  3H6N A;  5D2M B;  1WXV A;  4G0N B;  2C7M B;  3SDL C;  4KSL C;  5IAA C;  1C1Y B;  2J0K A;  2L05 A;  3R7R A;  3MJW A;  4BOS C;  3QQ8 B;  2K6D B;  2MP2 B;  3PSE B;  3JYU A;  3A9J A;  4K81 A;  1XT9 B;  3CF6 E;  4DDI D;  2AL3 A;  3HHM A;  3DVG X;  3PHW B;  2JXX A;  4ICV A;  1WFY A;  3PV1 A;  4BFR A;  2BGF A;  1P0R A;  3H9D A;  2V4L A;  1WR6 E;  4LDT B;  2UYZ B;  3ML9 A;  2MQJ A;  2LVO A;  2NS5 A;  3QX1 A;  2JY6 A;  2JZ3 B;  3U30 A;  4MGY E;  4OVU A;  4EZL A;  1WY8 A;  4FJV B;  2DZI A;  5L83 A;  4A20 A;  2GBJ A;  2KTF A;  2ZZP B;  3QHT A;  4MSM B;  4ANU A;  4HDQ A;  2N1V A;  3VTV A;  2D3G A;  2AEH A;  5AEK B;  4I6N B;  4BKS A;  3OAW A;  4M8N A;  2KQS A;  1V5T A;  2DYM A;  2KDE B;  4WWP A;  2LWP A;  3X23 A;  3QAQ A;  2KFK A;  4NJ7 A;  1TBE A;  1WX7 A;  2NCN A;  4GSW A;  4K7U A;  3ML8 A;  2O6V D;  3BY4 B;  4AUQ C;  4BBN F;  1MG8 A;  2O2V A;  4W9H A;  1RLF A;  4GU2 A;  4E74 A;  3HM6 X;  3VUX A;  1S3S G;  3MTN B;  3EFU A;  3V6C B;  2PJH A;  4G50 A;  3H7P B;  3VVW B;  1G6J A;  3MHS D;  1EUV B;  1WH3 A;  4G11 A;  3WA0 A;  1WE6 A;  2BKR B;  4II2 B;  4KIK B;  1P98 A;  2FNJ B;  4IG7 B;  3V62 A;  4W9C A;  2VRR B;  2DZK A;  2EKE C;  2I1K A;  5AZG A;  2ZJD A;  4XX5 A;  1WGH A;  3N32 A;  5CTR C;  3UIO B;  1R4N I;  2KC2 A;  4CO7 A;  1WJ6 A;  4MSQ B;  1Y8R C;  2J0M A;  3M63 B;  4PS7 A;  4WJO A;  1WZ3 A;  2HD5 B;  3ZRC A;  3B08 A;  1ISN A;  3H7P A;  2BWE S;  4DBG A;  3GZN I;  3IBE A;  1IYF A;  1RFA A;  3ZUN A;  2CHX A;  2LD9 A;  2C9W B;  4GIV A;  3W1S A;  4F1S A;  1OGW A;  3QC8 B;  3EEC A;  2C5L C;  3KH0 A;  2WX0 A;  3P2B A;  3RYT A;  1WJU A;  2HJ8 A;  3NZS A;  2XEW A;  2BKF A;  3VUW A;  4X57 B;  1UBI A;  4TQ1 A;  3DOW A;  1KLV A;  1WX8 A;  2EMS A;  2AWT A;  2KDF B;  3BIN A;  4HXD A;  4F8C B;  2HTH A;  1UH6 A;  4DHZ B;  2JT4 B;  3ZIM A;  4NJ6 A;  1V9J A;  2YLM A;  3NS8 A;  5AZF A;  2LRU A;  2KWV B;  3UQA A;  3VQI A;  3H7S A;  2AL6 A;  3APC A;  4MM3 A;  2LGX A;  2ZVN A;  5JH5 C;  4IUM B;  2CU1 A;  4FHK A;  2KN5 A;  2G45 B;  1WJ4 A;  2C60 A;  3L10 B;  2YVC A;  3V6E B;  1LM8 B;  4K7S A;  1Z2M A;  4KSK C;  1WM3 A;  2CS4 A;  2J0J A;  4HCP B;  5AZH A;  2L0T A;  3PVL A;  2FUH B;  2DAJ A;  2K6Q A;  2KKC A;  2ZCC A;  2RD0 A;  1E7V A;  5D6J B;  1SE9 A;  2UWQ A;  3PT2 B;  2NR2 A;  3PTF C;  4LDT D;  2KWC A;  3JW0 X;  3K9O B;  2LI5 A;  1WMH B;  3NY5 A;  4G3X B;  4MDK E;  2D10 A;  1V81 A;  2DYO A;  2DEN B;  2RR9 A;  5J18 A;  4BOZ B;  3QIJ A;  4ANV A;  1WXS A;  3EC8 A;  4EFO A;  2I1J A;  1V49 A;  4M0W B;  4BKG A;  3L08 A;  1K8R B;  3DVG Y;  3QCA A;  3TCA A;  2GBK A;  3L54 A;  3UF8 A;  1WGY A;  5DPR A;  4WWN A;  3WAP A;  1UZX B;  3A9J B;  3T8M A;  1UGM A;  1CMX B;  2HE7 A;  3HIZ A;  3OJ4 B;  3SU8 X;  2Z0D B;  4EOY A;  4NPN A;  1V5O A;  3LDZ E;  2R2Q A;  4ASW C;  1NI2 A;  2D2Q A;  2M17 A;  1WM2 A;  2KDB A;  1YQB A;  2IO0 B;  4JQW C;  2KDI A;  5CHW A;  3L13 A;  2WYQ A;  1I35 A;  2BF8 B;  1YD8 U;  2LRW A;  4FJY A;  2KMA A;  2DAF A;  2MCN B;  1S1Q B;  4ZRI A;  4JLC A;  2M1M A;  3VXW A;  2W9N A;  1OEY J;  4ANX A;  3JVZ X;  4CYE A;  2NBV B;  4EZJ A;  2KK8 A;  1E5W A;  4FJZ A;  4KDI C;  3K9P B;  3U7D A;  4AP4 C;  3JSV B;  3TIX A;  3PZD A;  4NNJ B;  2KVR A;  1P1A A;  2KFK B;  1WZ0 A;  4WJQ A;  4FLH A;  1XQQ A;  5LXH A;  2ZEQ A;  2O2V B;  3X0W A;  2L76 A;  5D94 A;  1ZGU B;  2CHZ A;  2K25 A;  1PQS A;  3DBH I;  3ALB A;  4RM8 A;  5DCN A;  1NDD A;  2FCM A;  3VTU A;  3HM3 A;  3A9K B;  5J2R A;  4TUU A;  4ZRK A;  3I3T B;  4W9J A;  4GOC A;  3JSV A;  1F9J A;  2KXJ A;  2DX5 B;  1E8Z A;  4GB9 A;  4EZK A;  1WRD B;  5CX3 A;  5LLI A;  3A1Q B;  3HK0 A;  5DPW A;  4GDK B;  4DK5 A;  2NPT B;  4ICU A;  5DPS A;  2MLB A;  2NVU I;  4KZ0 A;  4AJW A;  3DDC B;  3VFK A;  2KQ7 A;  1BT0 A;  2LJ5 A;  1AAR A;  3KUD B;  4RMA A;  4FBJ B;  4II3 B;  3CMM B;  4WAA A;  2NBW B;  3A9K A;  1SIF A;  2Z59 B;  5LXI B;  3APF A;  4IWP A;  4TKN A;  1NBF C;  3DBL I;  4JGH B;  4IM3 A;  5DPT A;  2WX1 A;  4B9K A;  3KYC D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...