4XC2A

Crystal structure of gabarap in complex with kbtbd6 lir peptide
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
116
structure length
116
Chain Sequence
MGFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFLYIAYSDESVYG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CUL3-KBTBD6/KBTBD7 Ubiquitin Ligase Cooperates with GABARAP Proteins to Spatially Restrict TIAM1-RAC1 Signaling.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords GABA(A) receptor-associated protein
total genus 35
structure length 116
sequence length 116
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-12-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4xc2A00
4EZKA 2KTRA 2WWZA 2KTFA 3KH0A 1QZEA 3EFUA 3ZDTA 1G6JA 2M17A 4WQOB 4WWOA 1E5WA 2FAZA 2KVRA 3AULA 4HDQA 3X23A 2JZ3B 4HJKA 4IC7B 4EEWA 2C7HA 1L7YA 4IM2A 4DDID 3ZLZA 3RT3B 3RCZA 3A1QA 4FJZA 4KSKC 2N9PC 4YL8A 1C3TA 2C60A 4DK5A 2QHOA 2RD0A 2I1KA 3KYDD 4HWIB 4DHJB 2ZPYA 2IO0B 2LVQA 3D32A 5AZFA 5TR5A 4HCNB 2KDEB 3ZDMC 2KD0A 1JRUA 3TCAA 1UGMA 3QC8B 2FIDA 2YVCA 1GNUA 2CU1A 1WGGA 4K7WA 3ML8A 3A9KA 4IWOA 1RLFA 1WH3A 3DPDA 3KUCB 4EZJA 3CMMB 4GOCA 4BFRA 2MLBA 3U30A 2K6QA 3U7DA 1E7UA 2JF5A 1NI2A 2KFKA 2N1VA 4AP4C 1WM2A 3CF6E 2MWSB 1UBIA 4PYZA 5CTRC 3L13A 3TL5A 4HCPB 1SIFA 3ZW3A 2AEHA 1WXVA 4MDKE 1WXSA 4II3B 3IBEA 2M0XA 5J2RA 2LRUA 5DPWA 4GDLA 2BYEA 3KVFB 3PRMB 4I6PA 1VCBA 3ZRCA 3V60A 2EKEC 5AZHA 3W1SC 4BKSA 2NPTA 2GBNA 4CYEA 1D3ZA 5LXIB 1V5OA 3RYTA 3DVGY 4LJPB 2Z0EB 3PTFC 1GG3A 2LASA 2ZJDA 3PRPB 3PV1A 1BT0A 1P0RA 5D2MB 1EF1A 4GDKA 3TMPB 4FLHA 1J0GA 1PQSA 4AUQC 1J8CA 3RZFA 1Q0WB 3IHPC 2PJHA 2L7RA 2VRRB 2RGFA 5AEKB 1K8RB 4NAWB 4OVVA 4DHZE 4FADA 3P2BA 1WMHB 2B3AA 2UYZB 4NNJB 5LXHA 1V2YA 2IZVB 3SD5A 4M8MA 1WJUA 3BINA 2K39A 2KJHB 3A9KB 4ZDVA 3ZIMA 1RFAA 3V61A 4GB9A 4IUMB 2KN5A 3PLVA 2PE9A 3OAWA 2AL3A 3NS8A 2G4SA 1KJTA 2BF8B 4I6LB 3ZKJC 1UD7A 4FULA 2DZMA 5D6JB 2ZNVC 1H4RA 3A4RA 4MJSA 4ZRJA 2KWUB 3VVWB 1P3QU 1KLVA 1SE9A 1Q5WB 4F7ZA 2CHXA 3TJPA 2RR9A 4G11A 2MRPA 2JZZA 1A5RA 1J19A 3PT2B 2WX1A 1ZGUB 3MTNB 3L0WB 3QHTA 2I1JA 5IA7A 1WGYA 3PHWB 4KIKB 2K6DB 5D7GA 2M4NA 4MELA 4FN2A 3KW5B 3JSVB 4EFOA 4RM9A 3SU8X 1UBQA 4MGIE 2LRWA 2AYOB 2PEAA 5CX3A 4ANUA 3UF8A 3A33B 4NAWA 2ZEQA 3VTWA 1R4MI 3VUXA 3DVNU 3ZO5B 5J17A 4KIKA 4MGYE 2KANA 1V49A 3ZNZB 2MA9B 1GC6A 5CHFA 4LDTD 4AWJA 1U4AA 1H8CA 2HE7A 3A4SC 2A4ZA 2XK5B 1WXMA 2KQ7A 2WX0A 4B6WA 2O6VB 5HKHA 4IM0A 2IY1B 2KJ6A 2DAJA 2JVCA 3NHEB 2LD9A 2L0FA 1ZW7A 4IM3A 3IVFA 1I35A 1E7VA 1WGDA 4G0NB 2EMSA 4LJOB 3UINB 4W9JA 2PPHA 1X1MA 3DBSA 4FJYA 3C0RB 3CSFA 2KC2A 2MP2A 4NPNA 5E6NA 2M8SA 3WAOA 1WJ6A 2GBMA 4URKA 2NS5A 3VH4B 2LGXA 2DYOA 4WWNA 3HK0A 3QCAA 2KX0A 4GMVA 1Y8RC 3EHVA 3RUIB 1V5TA 3QQ8B 3JYUA 3DQVA 3NY5A 4HVBA 1I42A 4E74A 4EZLA 1CMXB 1YD8U 3DBLI 4K81A 4MSQB 3R7QA 4E71A 3VTUA 1YJ1A 2DHZA 3B1LX 3K9PB 4G50A 4W9FA 4WJNA 1TGZB 3PSEB 2LXAA 4XC2A 1IYFA 1Z5SB 3UIPB 2W9NA 3KYCD 3UGBB 3VTVA 3RD2A 3W1YA 4ICUA 1TBEA 3N3KB 3Q3FA 2KMAA 2ZPNA 4ANXA 1F9JA 4GU2A 3TBLD 2MSED 4BOSC 3JW0X 5D94A 2A5UA 3HIZA 4JLCA 4TQ1A 3VFKA 2D2QA 2ASQA 3ENEA 4MJSB 1TTNA 3OJ3A 4WJPA 4ANWA 4JQWC 3MJWA 3PRZA 4W9DA 1WR6E 2NBUA 1P1AA 4EKUA 1GC7A 2KHWB 2PE6B 3O65B 3APDA 2O2VB 2L0TA 4KDLB 5JHAA 4NQKE 1LFDA 2KFKB 1WM3A 1E8ZA 2DYMA 5CHWA 3W1SA 4K7SA 4MH0E 3QARA 1WGRA 4OVUA 3H7PB 2O6VD 2L3ZA 3KUZA 4PS7A 4W9LA 3ZTDA 1WGHA 4RMAA 2GBKA 5DPSA 2J0JA 2FUHB 2KDFB 2KXJA 4KVGB 3WAPA 2L8JA 4XX5A 2Z59B 2FNJB 3MHSD 4W9HA 2G4DB 4W9GA 1WX8A 4HK2A 2WYQA 2L00B 2J0KA 2JXXA 3N30A 3VH3B 4BOZB 4JGHB 1KM7A 1WMHA 2LGDA 2DZIA 2NBVB 2XBBC 4FHJA 4GIVA 4BKGA 2JUOA 1E8XA 2N9EB 3M3JA 2OJRA 3IFWB 3QWZB 4G3XB 4TQ0A 4W9IA 4DXAB 4HDOA 2D07B 3L54A 4NQLB 3ZRFA 4HPMB 3EECA 5GMVA 2D3GA 4BBNC 4EUTA 2L05A 2FCSA 1WE7A 2K1FA 1V6EA 2KX3A 4KDIC 2NPTB 1NDDA 1E8WA 2O2VA 1KOTA 2HJ8A 4ZRIA 3RZWC 1XD3B 1L2NA 1WZ0A 1NBFC 2DZKA 3B0AA 2C7MB 1WZ3A 3CSTA 2G45B 1RAXA 4FJVB 1ZKHA 3PGEA 2MQJA 3L10B 5DCNA 3B08A 1S1QB 3PVLA 2BPSA 2NVUI 2CS4A 4RM8A 2LZ6A 2D10A 4A3PA 4MGKE 1YIWA 1V9JA 2LXCA 4AJYB 4F8CB 2V4LA 4P7IA 4B9KA 1IPGA 2UWQA 3HHMA 1WX9A 4GSWA 2KWCA 1EF5A 4GXBA 2KO3A 2BGFA 3PHXB 5C23A 1WFYA 2K8CA 1M94A 3PS6A 4AJWA 4B95A 3QJZA 3VAWA 4ASWC 1WRDB 2KLGA 3S2AA 1S3SG 2JY6A 3ONSA 4PS8A 1XT9B 4N9F4 1V81A 2LUEA 4MM3A 2KKCA 1YQBA 2KQSA 1V80A 3DVNV 3EC8A 4NY0A 2FCMA 4CO7A 4ZYNA 4BVUC 5L95C 1E90A 2C9WB 4IW0A 2M1MA 3M63B 2CKHB 3PREA 3VUYA 4TUUA 3SDLC 3ZNGC 1LM8B 2GBRA 3GOEA 1OQYA 2ZNVB 4M0WB 3VDZA 1XQQA 3UQAA 2JWZA 4W9CA 3PPAA 3QX1A 2MBEA 4FA6A 2LI5A 2N1WA 1WXAA 1GJZA 2V1YA 1YX5B 3WANA 4XZ4A 3QAQA 3JSVA 1ISNA 1HE8A 2DX5B 2KWVB 3L17A 4W9EA 3JVZX 2MBOA 2ZVOA 4II2B 1RRBA 3PLUA 4WAAA 2BWFA 3L08A 2MW5A 4FBJB 1Z2MA 4HPLB 2GOWA 5E6OA 1WR1A 3ZNHB 2G3QB 2IO3B 4K1RB 4F1SA 3QK0A 3A1QB 4KZ0A 4EOYA 2D11A 2XK5A 4IG7B 2DYBA 4PYUA 5E6PA 5JHBA 2AL6A 1C1YB 2MCNB 1SGHA 2RPQA 2ZVNA 2KK8A 4DDGD 2HD5B 5J18A 3ZTCA 2CHWA 4LDTB 4JIOU 4E3CA 1WYWB 3ZNID 4MSMB 3NOBA 2MP2B 3H7PA 3H6NA 3N32A 2FCQA 1UELA 1OTRB 4BKTA 2R2OA 2LVOA 2K25A 2J7QB 2NBWB 2WDTB 4ZRKA 3M62B 3OLMD 4MEMA 2LJ5A 2V3SA 1WF9A 2BYVE 2JT4B 3T8MA 2GMIC 4BKSD 2JPHA 2BKRB 2AWTA 2K8HA 2NR2A 2ZZPB 3HM3A 3NZSA 4GDLB 5G2NA 4AOFA 2CR5A 5C1ZA 2KLCA 4JL9A 1R4NI 3ZVVA 3LJ3A 3L16A 4KSLC 4ANVA 3PZDA 1Q1OA 3LDZE 4GDKB 1OEYJ 4A20A 3UQBA 1WX7A 1V86A 4J6IA 1EUVB 3X0WA 3ZUNA 3VQIA 4WJOA 4DHJD 2KNBA 3V62A 4K7UA 3SHQA 2C7NB 2XEWA 2EMTA 3K9OB 2KOXA 3DOWA 1OGWA 2DZJA 1OEYA 2L76A 2Z0DB 3WIMA 4BBNF 2LWPA 4DWFA 1IP9A 2NCNA 1WE6A 3ALBA 4HLEA 2JRIB 2KDBA 3DBRI 1WY8A 5KHOA 2K8BA 4PS3A 3VUWA 4I6NB 2MBHA 1AARA 4ICVA 3QA8A 2BWES 2IYDB 3VHTC 4CHKA 3DBHI 2DENB 1GUAB 3T9LA 3QIJA 2BYFA 4NJ6A 3RULA 3DVGX 1YX6B 3IG3A 4TV3A 3WAMA 2MBQA 2GBJA 2N9XA 2MX2A 1MG8A 2OOBB 2FCNA 3Q3JA 1LXDA 3APCA 4GGQA 2KJRA 1VD2A 1TZ1A 2KTRB 2KZRA 3A9JA 3BY4B 3R7RA 4WJQA 4DBGA 1FXTB 2C5LC 2HTHA 2IO2B 3WA0A 5LLIA 4KV2A 3APFA 5IAAC 2J0MA 1P98A 2LGYA 3H1UA 2R2QA 3M95A 4DHZB 5AZGA 1WIAA 3H7SA 4IWQA 5G55A 4X57B 2KMCA 4M8NA 2KDIA 4TKNA 3A9JB 3KUDB 5L83A 2REXA 5DPTA 2N7EA 3AU4A 4IWPA 5CHVC 5DPRA 2KC1A 3TIXA 2LVPA 1P9DU 2CHZA 3DDCB 2O6VA 2JRHA 2FIFA 4FHKA 3U8ZA 3AXCA 3V6CB 4HXDA 2MBBB 3HM6X 1EO6A 4A3OA 3GZNI 5JZEB 1WI0A 5BO4B 3UIOB 4WWPA 2N4FA 4KZCA 2IO1B 3ML9A 2BKFA 4GN1A 3AI5A 3ECIA 2IBIB 2N7DA 1E8YA 2ZCBA 3DCGA 2DAFA 5JH5C 3I3TB 3R3MA 4W9KA 3R66C 3AU5A 4NJ7A 1LQBA 3WALA 2Y5BB 3OJ4B 1UZXB 1WJNA 1UH6A 1WJ4A 2ZCCA 5FR6A 1T0YA 3H9DA 4LCDE 4MGZE 5EDSA 3NZUA 3V6EB 2KFJA 5KHQA 2RSUA 3VXWA 2IY0B 2YLMA
chains in the Genus database with same CATH superfamily
4EZKA 3KH0A 1QZEA 3ZDTA 5H92C 2FAZA 1XCQL 1QOBA 4HDQA 2D5GA 1ZP0B 3X23A 4IC7B 2C7HA 3BVGA 3RT3B 1UF0A 2C60A 3KYDD 4M01A 4DHJB 3KQ4A 2ZPYA 3D32A 3NG0A 4HCNB 3P4RB 1GNUA 2CU1A 1WGGA 4OW0A 4IWOA 1QQRA 1WH3A 4EZJA 2G9HD 5EE0A 2MLBA 1NYQA 4BAXA 1NI2A 4AP4C 2LGSA 2MWSB 4HKQA 1OFFA 1UBIA 4PYZA 3RNAC 1BUIC 1L5PA 4XE0A 4KGTA 1WXVA 4J3OD 3R8BA 3IBEA 5DPWA 4GDLA 3IXSA 4BKSA 3DBRB 2NPTA 2GBNA 1QILA 3FKYA 4LJPB 3PTFC 5D2MB 4Q2JA 4XYCA 4AUQC 2J4XA 2PJHA 5FR3A 5IN7A 2VRRB 5AEKB 2YEPF 1K8RB 1YJIA 2AQ2B 2PVGC 4OVVA 3GE8C 3P2BA 3U7ZA 3RI7C 3AV8A 4C4VA 1V2YA 2IZVB 3BINA 4IUMB 3PLVA 1KJTA 1PUTA 1ZUD2 2DZMA 5D6JB 2ZNVC 4MJSA 1GB1A 1I4HA 3RPFC 1KLVA 4B0EA 1FPYA 1MVKA 3TJPA 3LB8C 2WX1A 1ZGUB 2I1JA 5IA7A 3PHWB 2K6DB 4A55A 4FN2A 3TEWA 2VZKB 2PEAA 3T3NA 2ZEQA 1R4MI 3VUXA 4MGYE 2KANA 3ZNZB 2MA9B 4LDTD 1H8CA 3KLSX 2HE7A 2A4ZA 1ZPSA 2WX0A 2BS4B 5HKHA 1E7PB 3AEEB 2KJ6A 3RFZB 2V0GA 1P7EA 1E0ZA 4G0NB 1MI0A 3KWLA 3DBSA 1N61A 1TKGA 2RMMA 3WAOA 1WJ6A 2NS5A 3Q8EA 2KAJA 4GMVA 1V5TA 2HTME 3DQVA 4ZRQA 1HEZE 2WXFA 1IP9A 4MSQB 1B1ZA 1SXTA 3PSEB 1IYFA 3KYCD 1SSNA 3W1YA 4ICUA 1TBEA 1N6ZA 1FRDA 4C7ZA 2ZPNA 4RH6A 4ANXA 4BOSC 3JW0X 3TSSA 2D2QA 3ENEA 4WJPA 4ANWA 4JQWC 2HDEA 4JPSA 1T3QA 2NBUA 1P1AA 3N20C 3O65B 3APDA 2O2VB 3AE5B 2WXPA 2ZW0A 2KWDA 3RNBC 2IJ0A 3QARA 4JX1C 1T6BX 2M0AA 4US9A 4RMAA 4IOIE 3OWEB 5DPSA 2FUHB 3EUB2 2KXJA 4KVGB 3WAPA 4XX5A 4WURA 1YJJA 1WXQA 2JXXA 4RFBA 4BOZB 1UWXA 4BKGA 3DBLB 3QWZB 4NQLB 5GMVA 1A70A 4EUTA 1PGXA 2FCSA 1V6EA 2NPTB 2K0PA 2WXHA 1KOTA 2HJ8A 1D4BA 1L2NA 2DZKA 3B0AA 1RAXA 3W5VB 4FJVB 3PGEA 3L10B 5AUIA 3WCQA 1S1QB 2FUG1 2BPSA 4MGKE 3ZJVA 1VZ7A 4HPPA 4GSWA 2KWCA 1T0QC 3PHXB 2K8CA 1M94A 1MG4A 3UI3A 1KTKA 1HTQA 2KLGA 1S3SG 1XT9B 3DHGC 2FCMA 2EKIA 4BVUC 5TSSA 1FFUA 1JROA 5MPOA 1LM8B 1FRRA 3GOEA 1OQYA 2ZNVB 1XQQA 3N1XC 2Y5CA 1YX5B 3WANA 4XZ4A 4W9EA 2DX5B 1RYJA 3GP7A 1RRBA 2MW5A 1Z2MA 4HPLB 1TS5A 3ZNHB 2IO3B 4K1RB 1TZOA 1GOZA 2PKOA 4USAA 2D11A 2XK5A 2IPKD 2WU5B 3EA6A 2KK8A 1QT9A 4AQ7A 1I4RA 2LHEA 5BMGA 4MSMB 3NOBA 3N32A 3HUIA 4A90A 3RMKC 2KN4A 1OTRB 1UELA 1STEA 1SBBB 2K25A 3Q8CA 1N62A 2ZZPB 5G2NA 2CR5A 3AECB 4JL9A 3ZXVA 1DGJA 2WXNA 1BMLC 4ANVA 3IT4B 2DBYA 1XCTL 1V86A 1QOGA 3X0WA 2OJWA 1ENFA 2WP9B 2LEKA 1E6EB 1GB4A 3K9OB 3TEZA 4BBNF 1PFDA 4ARIA 4M00A 3FILB 2NCNA 1T5XD 3P63A 2KDBA 3VUWA 4ICVA 3QA8A 2IYDB 2VH1A 3DBHI 3T9LA 5IO9A 1QLBB 1TIFA 2KJRA 2IO2B 5LLIA 3APFA 5IAAC 2R2QA 1WIAA 3H7SA 4M8NA 2KDIA 4TKNA 1FFVA 2N7EA 2KC1A 3TIXA 2LVPA 2CHZA 5G5GA 1KF6B 2RDGA 2O6VA 2FIFA 1XLOA 4UDUC 3GZNI 2INCC 3N1YC 5BO4B 2IO1B 2J42A 2BKFA 3AH7A 1TY0A 1FEHA 3AE3B 3DCGA 3AEFB 5JH5C 3AU5A 1QF6A 4KX6B 4LNOA 2RSUA 2YLMA 3Q3OC 3NUHB 4OZAA 1RFKA 2KVRA 3ZJUA 3AULA 4H2AA 2LJIA 3NVWA 4HJKA 1PGBA 1QOAA 2J52A 4IM2A 3ZLZA 3RCZA 1ZOYB 2N9PC 4YL8A 1C3TA 2MHJA 2RD0A 1C79A 4HWIB 2K9XA 4WIPA 1V1PA 5AZFA 1TKYA 2JYEA 2YVCA 1RLFA 3KUCB 1JMLA 4HKZE 4ZRPA 3U7DA 3I9V1 1WM2A 3CF6E 4MH8A 4RCOA 3TL5A 4XWWA 4LK0M 3TUOA 2WDVB 4REZA 2M0XA 2LRUA 1WSPA 3KVFB 4IKGA 2EKEC 3W1SC 5LXIB 1V5OA 3RYTA 4KGRA 3Q2AC 2ZJDA 1BT0A 1P0RA 3NVYA 4GDKA 3TMPB 1J0GA 4QAYA 1J8CA 2KVZA 1F52A 3IHPC 2L7RA 3IAS1 1FNWA 4NAWB 4FADA 4A8XC 1ESFA 3FILA 2B3AA 4NNJB 1AWDA 1YMHE 1R4NB 1CK1A 2H88B 3A9KB 4ZDVA 4GB9A 1GAQB 2LUMA 4PK1A 3OAWA 2H89B 1ZXHA 3C8YA 1ZXIA 2INPE 3C19A 4ZRJA 4YWGG 2WQYB 1Q5WB 2WHIA 1A5RA 3PT2B 3NRZA 4US8A 4KIKB 2M4NA 4YXDB 4RNAA 3J9CA 1JRPA 2JX5A 4MGIE 2AYOB 3UF8A 3Q8BA 1YQ3B 3VTWA 2Y5PA 5J17A 3ZO5B 4AWJA 3DHIC 3L4PA 3A4SC 1ET6A 1WXMA 1F2RI 3NJTA 3MC0B 4B6WA 1V97A 2IY1B 4L2YA 2L0FA 3IVFA 1XF5L 1I35A 1C4AA 4LJOB 4W9JA 2PPHA 3BVMA 2QEJC 3CSFA 5G5HA 2MP2A 3IAM1 4A6QA 1L0VB 4L1BA 2LGXA 4WWNA 3QCAA 2KX0A 3EHVA 4JWSC 1ET9A 4E71A 3R7QA 4W9FA 1IGCA 2PIAA 2LXAA 1NYRA 1YN4A 2W9NA 3VTVA 2N9LA 3RD2A 4WWMA 2W54A 1EWYC 4DQOC 4NAMA 1UWMA 4HJGE 1LGRA 2KMAA 1FMAD 1JW9D 2D3CA 3HIZA 3VFKA 1NVID 3OJ3A 2L32A 4W9DA 1WR6E 2BBCA 4OZBA 2KQ4X 4EKUA 4KDLB 2L0TA 3R2IA 4NQKE 2KFKB 2DYMA 5BMIA 1D5MC 1N5WA 2GLSA 2AQ3B 1E9MA 4OVUA 3H7PB 2O6VD 4W9LA 1JWSD 1WGHA 2PTLA 2WXQA 2GBKA 2KDFB 2L8JA 1HZ6A 1NENB 1WX8A 2L00B 3VH3B 1YN3A 4M02A 2AQ1B 2NBVB 2LGDA 4GIVA 2OJRA 4TQ0A 4DXAB 4HDOA 3AE6B 3L54A 1C9FA 3EECA 2JWUA 3PO0A 1WE7A 2KX3A 3RZWC 3CSTA 1WZ3A 2G45B 1ZKHA 4CQNA 2MQJA 3PVLA 4RM8A 1I4PA 1XLPA 2LZ6A 4A9AA 4A3PA 1XO3A 4ZOHC 1GPXA 1V9JA 2V9HA 4F8CB 2YEPB 3HHMA 1N5XA 4B9KA 5LNK1 4GXBA 3PS6A 4YTMB 1VJKA 3QJZA 3VAWA 4ASWC 1WRDB 1TJEA 1AN8A 2RPVA 3S2AA 2JY6A 4N9F4 2LUEA 3AEAB 4MM3A 1UUPA 1YQBA 4XDDA 4K3CA 3DVNV 2C9WB 3PREA 3AE9B 4TUUA 2R61A 3VDZA 2NMQA 5AUKA 2MBEA 2N1WA 1K51A 1SJED 4NZLB 2V1YA 3L17A 2MBOA 2JXTA 3P42A 3ZQ4A 4FBJB 2IGDA 1L4ZB 1WR1A 1MHHE 2WS3B 3QK0A 4C7YA 4KZ0A 4EOYA 3O13A 4PYUA 3BWUD 5JHBA 1DOXA 2E3TA 4PT5A 3ZTCA 3ZNID 4LNIA 2L52A 4BKTA 2QDFA 3Q8FA 1FNVA 3AE8B 4ZRKA 4MEMA 3RNGC 2V3SA 1WF9A 2BYVE 2JT4B 3BZDB 2GMIC 2X38A 2JPHA 2K8HA 2AWTA 2MJEA 2NR2A 3HM3A 4AOFA 4BKSD 1XLNA 1R4NI 4MACA 3ZVVA 2K3UA 3LJ3A 4KSLC 2IGGA 3PZDA 3UQBA 4GDKB 1R7SA 2I38A 4LNFA 1FIQA 4WJOA 1V8CA 4MM3B 4K7UA 1FCCC 3SHQA 5C2TB 2KOXA 2DZJA 1OEYA 2W3RA 2SAKA 1WE6A 4HLEA 1TT5B 1WY8A 2K8BA 3NZ3A 4I6NB 3BK2A 4P6VF 1D5ZC 3ETRA 2DENB 3Q14C 1GUAB 1VLBA 2KDMA 4NJ6A 1YX6B 2GBJA 3Q6BA 1SE3A 1LXDA 4JWUC 2KZRA 2PMVA 3R7RA 4DBGA 2HTHA 3WA0A 5HI1A 3H1UA 1F1HA 1IBXA 1V1OA 2KMCA 3A9JB 3KUDB 3VRAB 2ONQA 1P9DU 3P1MA 3B9JA 3AXCA 3N9YC 2MBBB 2NTTA 1JQ4A 2D3BA 2IBIB 2N7DA 2W55A 1E8YA 3R3MA 1LQBA 1LO5D 3P4SB 3OJ4B 1UZXB 1WJNA 1UH6A 1WJ4A 1T0YA 2M56B 3H9DA 3V6EB 2WGSA 2KFJA 5HHDG 2IY0B 2KTRA 5IKCM 3Q8AA 3GZNB 4C00A 2JZ3B 4GLSC 1L7YA 4DDID 1D6EC 3URYA 4DK5A 2I1KA 2ZW1A 2ACZB 3GE3C 2VZKD 5TR5A 2RDBC 2KMMA 2KD0A 1UGMA 2NTSA 3QC8B 3CIRB 4K7WA 3A9KA 3SFDB 3DPDA 3CMMB 4BFRA 2K6QA 4YTNB 5EE3A 3MFGA 2EELA 1SIFA 2OHFA 3ZW3A 5IOIA 1WXSA 4II3B 3DBHB 4LTUA 5J2RA 2BYEA 1J7BA 5AZHA 1N63A 3DWGC 2PVOD 2Z0EB 1GG3A 2LASA 3PRPB 4FLHA 1PQSA 1MHXA 1XLQA 3RZFA 1Q0WB 1PDXA 4DHZE 4O1NA 2QSDA 1WMHB 2UYZB 2WXKA 3SD5A 5BYQA 3ZIMA 1RFAA 3V61A 4HRSA 1IGDA 4IDIA 2AL3A 1MFWA 2G4SA 4I6LB 3ZKJC 1NEKB 1UD7A 2INNE 1H4RA 3MC8A 3U52E 4P1CC 2KWUB 3VVWB 2LMCA 2CHXA 2RR9A 4G11A 2MRPA 2JZZA 5C3JB 5D3DA 3V05A 2PW9A 1J19A 3L0WB 1WGYA 3LXFA 3U4EG 4MELA 3JSVB 2LRWA 2Q5WD 5CX3A 4JE3B 5JXVA 2W3SA 3DVNU 4KIKA 1V49A 1GC6A 1C76A 1JWMD 1U4AA 2N0SB 4ZHPA 1JALA 5BMHA 1KRHA 3R2TA 4IM3A 4XWTA 1E7VA 1WGDA 2EMSA 3UINB 4FJYA 3N1ZC 5HFYA 2KC2A 2IDYA 4NPNA 1V1PB 1TS3A 2M8SA 2GBMA 2DYOA 1FXAA 1VRAB 3HK0A 1L6UA 2MJDA 3QQ8B 3JYUA 4N59A 4E74A 4N6EB 4EZLA 1YD8U 4K81A 1YJ1A 2DHZA 4G50A 2KYWA 4N58A 1TGZB 4XC2A 4S17A 1I4XA 2Y3AA 1Z5SB 2CU3A 3UGBB 3W9CB 5HG2A 2BS2B 3N3KB 2BB5A 2CJNA 3TBLD 3FC4A 3P4QB 2MSED 2UU7A 1CJEA 4JLCA 3RNCC 1TTNA 4RGOS 3PRZA 5FK9C 2LGIA 2PE6B 2VH2A 2QC8A 2B76B 1ZDXA 5BYRA 1WM3A 5CHWA 2FE8A 4K7SA 4MH0E 2KT7A 1QOFA 1K53A 1SIJA 5H8YE 4PS7A 3LYYA 2L1AA 2QMTA 3ZTDA 3KWVA 1CQVA 2K5PA 2FNJB 3MHSD 4W9HA 4HK2A 4LLGM 2WYQA 3N30A 1KM7A 3IT6B 1WMHA 2XBBC 2QJLA 2JUOA 2GI9A 1E8XA 1QKZA 2N9EB 3ABVB 3M3JA 1JWBD 2D07B 4HROA 3VRBB 4DXGA 2WXGA 2L05A 4RF1A 4KDIC 2JYTA 1E8WA 4XGAB 4ZRIA 1XD3B 2W82A 1BXTA 2C7MB 3AE2B 5DCNA 3B08A 3MHZA 2G1EA 3HVDA 2D10A 1YIWA 4RGTA 3GB1A 4AJYB 4P7IA 2UWQA 1PGAA 4RF0A 1OQQA 2BGFA 4AJWA 2X8XX 3I57A 3ONSA 4PS8A 1UNSA 1VR9A 2V3NA 2V4IB 4NY0A 4CO7A 3AN1A 4ZYNA 1E90A 1WWTA 4IW0A 4ARCA 1SE2A 3SDLC 1AYFA 2GBRA 2DWQA 2JWZA 4W9CA 1WXAA 3B2GA 1GJZA 3JSVA 1ISNA 1HE8A 3AEGB 3JVZX 2D3AA 2ZVOA 3CWIA 1T0SC 3PLUA 3L08A 5E6OA 3AE7B 2G3QB 4M0WA 4F1SA 3HVZA 3AE1B 3ZXRA 4IG7B 2FBWB 1MJDA 2DYBA 1HTOA 1D5XC 2AL6A 3MC9A 1SGHA 2RPQA 4RGMA 4DDGD 2HD5B 5J18A 2CHWA 4LDTB 4JIOU 4E3CA 1WYWB 2MP2B 3H7PA 3H6NA 3NS1A 4BZAA 2WDTB 2LJ5A 2ICIA 4HVBA 1K52A 5C1ZA 1L0XB 2KLCA 2L83A 1XEEA 2V3PA 3L16A 2WLBA 1Q1OA 1OEYJ 4A20A 1EM7A 3U2SC 1IBXB 1WX7A 2E6XA 4J6IA 1EUVB 3ZUNA 3V62A 3FAHA 1J7AA 1SB3C 1EWCA 3DOWA 3WIMA 4DWFA 2LWPA 3ALBA 2IGHA 4S0RA 1ACCA 1HXYD 2JRIB 3DBRI 5KHOA 4PS3A 1AARA 2BWES 4CHKA 3QIJA 2BYFA 3PZ8A 4OVZA 2JSVX 3DWMA 5EE9A 4YSZB 1NI3A 3E9SA 2N9XA 1MG8A 1Q10A 4KGSA 4GGQA 1TY2A 2Z8LA 1YQ4B 4ZHOA 4WJQA 2C5LC 2MEKA 1M4VA 1P98A 1FD6A 5L83A 5DPTA 5DPRA 4LNNA 4FHKA 4KKJA 3V6CB 4HXDA 3AEBB 3HM6X 1EO6A 1UGJA 2WDQB 1J7CA 5JZEB 1WI0A 2QILA 3UIOB 2N4FA 4KZCA 3ML9A 3AI5A 3ECIA 1XXGA 4K3BA 2ZCBA 2DAFA 3WALA 4YT0B 3RNFC 3SR6A 4LCDE 2BS3B 3EFCA 3NZUA 2JZPA 2JQRB 2WWZA 2KTFA 1WGKA 3EFUA 3BIID 1G6JA 2M17A 4WQOB 4WWOA 1E5WA 1EU4A 4EEWA 1TS2A 3A1QA 4FJZA 4KSKC 5D3IB 2QHOA 2QCZA 3EGRA 2IO0B 2LVQA 3H8HA 1I4GA 3MJ5A 1JWAD 5I4DA 2BYTA 1L0YB 2KDEB 3ZDMC 1JRUA 4NJCA 3TCAA 2FIDA 3ML8A 4GOCA 4RGNA 4TSSA 3U30A 1E7UA 2JF5A 2KFKA 2N1VA 1DOYA 4R3DA 5CTRC 3L13A 4HCPB 2AEHA 4MDKE 3W5UB 3PRMB 1WYGA 4I6PA 1VCBA 3ZRCA 2WXJA 1C4PA 3V60A 1D3ZA 4CYEA 5FKAC 1B9RA 3DVGY 3PV1A 1EF1A 3W2DA 4MT5A 1HZ5A 1DOIA 4EE2A 2RGFA 1C78A 2HJ1A 5LXHA 4M8MA 3BYTB 1WJUA 2K39A 2KJHB 2LHDA 3NVVA 2KN5A 2PE9A 3NS8A 2BF8B 3RN9C 3HRDD 4FULA 3A4RA 4DXFA 1P3QU 4C4VB 3ZYYX 1SE9A 4F7ZA 2MJ3A 3Q69A 4ACFA 3MTNB 3OG5A 3QHTA 5D7GA 2GB1A 3KW5B 4EFOA 4RM9A 3SU8X 1UBQA 4ANUA 1TYGB 1RWSA 2DNFA 4ITKA 3A33B 4NAWA 2DLBA 5BYSA 5CHFA 2BB6A 2XK5B 2KQ7A 1WRIA 2O6VB 4IM0A 2DAJA 2JVCA 3NHEB 2LD9A 1ZW7A 2QIEB 2XNAC 1YOVB 1X1MA 3C0RB 5E6NA 4URKA 1VDVA 3VH4B 1Y8RC 3E56A 3RUIB 4KKIA 3NY5A 1YNTE 1I42A 1CMXB 3DBLI 3VTUA 3B1LX 3K9PB 3AEDB 4WJNA 1JWUD 1EU3A 3UIPB 1T0RC 3Q3FA 2CJOA 2WXLA 1F9JA 4GU2A 4D2KA 5D94A 2A5UA 4B0MA 1F2RC 4TQ1A 2ASQA 4MJSB 3B2FA 3MJWA 4YSYB 1L6VA 1GC7A 2KHWB 2M19A 5JHAA 1SE4A 3MP9A 1LFDA 1Y56A 1L4DB 3PZ7A 1E8ZA 2SEBD 3W1SA 2KACA 1WGRA 1TS4A 1K50A 2L3ZA 3KUZA 1I7HA 4P1BC 2J0JA 1ZDVA 2Z59B 2G4DB 4W9GA 1VZ6A 2J0KA 3GS2A 4JGHB 1SJHD 2DZIA 4FHJA 4WH4A 4G3XB 3IFWB 4W9IA 4HEA1 3ZRFA 2OEDA 4HPMB 4OHJA 2D3GA 4BBNC 1KH0A 3P4PB 4YSXB 2GRIA 2N7JA 4FXCA 3DHHC 2K1FA 1F0ZA 1NDDA 2O2VA 2WXOA 1WZ0A 1NBFC 3I5JC 3I63C 4C80A 2NVUI 2WXMA 2CS4A 1KLUD 2WXIA 4WAFA 2J53A 2LXCA 2V4LA 1IPGA 1WX9A 2BT6A 1FNUA 1EF5A 2KO3A 5C23A 1WFYA 2ON8A 3NVZA 2I2YA 1R4MB 4B95A 1FO4A 1RM6C 3Q3NC 1C77A 1V81A 1E10A 2KKCA 2KQSA 1V80A 3EC8A 3V3XA 5L95C 2PLPA 2M1MA 3M63B 2CKHB 3VUYA 3TEYA 3ZNGC 3VR8B 4M0WB 1N60A 3UQAA 2WNMA 3PPAA 3QX1A 4FA6A 2LI5A 4WQMA 1IUEA 3QAQA 4ZYSA 2KWVB 2MH7A 3VR9B 4II2B 1FCLA 4WAAA 2BWFA 1YN5A 3SFEB 3ZGZA 2GOWA 1VZ8A 4P16A 2BTEA 3A1QB 1DYQA 5GXGB 3AE4B 5E6PA 1FXIA 5EE1A 1C1YB 2XN9C 2MCNB 3BK1A 2ZVNA 4L23A 4TMAB 2RDHA 3SEBA 4C56C 1OQRA 4LNKA 2FCQA 2TSSA 2R2OA 3ZJTA 2LVOA 2J7QB 2NBWB 3M62B 3OLMD 1AW7A 3T8MA 2WDRB 2BKRB 4GDLB 3RNEC 3NZSA 4AS1A 1C4CA 1ROEA 1PYWD 3LDZE 2BW2A 2AX5A 3AB5A 3VQIA 4DHJD 2KNBA 2C7NB 2K22A 2XEWA 2LFIA 2EMTA 1OGWA 2L76A 2WU2B 2Z0DB 5E6JA 1I4QA 2MBHA 3VHTC 4XDCA 3RULA 1TKEA 3DVGX 3IG3A 4TV3A 3AMZA 3WAMA 2MBQA 2BQQA 2MX2A 2OOBB 1F77A 2FCNA 3Q3JA 1FM0D 3APCA 2INDC 1MPEA 1SEBD 1VD2A 1ZE3D 1TZ1A 1JCKB 1HA5A 2KTRB 3A9JA 1KFYB 2N9KA 3BY4B 1FXTB 4KV2A 2BVCA 2J0MA 2LGYA 2WXRA 3M95A 5T8IA 4DHZB 5AZGA 4IWQA 5G55A 4X57B 2REXA 3AM9A 4IWPA 3AU4A 3BVZA 5CHVC 1SF0A 3Q3MC 3DDCB 4YTPB 2JRHA 1KLGD 3U8ZA 2JU6X 4A3OA 3TEXA 4WWPA 3T3OA 4GN1A 1P7FA 1CZPA 1HQRD 4OZCA 3I3TB 4W9KA 3R66C 4NJ7A 3BYYB 2Y5BB 2ZCCA 5FR6A 4MGZE 5EDSA 5IP4D 5KHQA 3VXWA
chains in the Genus database with same CATH topology
4EZKA 2KTRA 2WWZA 2KTFA 3KH0A 1QZEA 3EFUA 3ZDTA 1G6JA 2M17A 4WQOB 4WWOA 1E5WA 2FAZA 2KVRA 3AULA 4HDQA 3X23A 2JZ3B 4HJKA 4IC7B 4EEWA 2C7HA 1L7YA 4IM2A 4DDID 3ZLZA 3RT3B 3RCZA 3A1QA 4FJZA 4KSKC 2N9PC 4YL8A 1C3TA 2C60A 4DK5A 2QHOA 2RD0A 2I1KA 3KYDD 4HWIB 4DHJB 2ZPYA 2IO0B 2LVQA 3D32A 5AZFA 5TR5A 4HCNB 2KDEB 3ZDMC 2KD0A 1JRUA 3TCAA 1UGMA 3QC8B 2FIDA 2YVCA 1GNUA 2CU1A 1WGGA 4K7WA 3ML8A 3A9KA 4IWOA 1RLFA 1WH3A 3DPDA 3KUCB 4EZJA 3CMMB 4GOCA 4BFRA 2MLBA 3U30A 2K6QA 3U7DA 1E7UA 2JF5A 1NI2A 2KFKA 2N1VA 4AP4C 1WM2A 3CF6E 2MWSB 1UBIA 4PYZA 5CTRC 3L13A 3TL5A 4HCPB 1SIFA 3ZW3A 2AEHA 1WXVA 4MDKE 1WXSA 4II3B 3IBEA 2M0XA 5J2RA 2LRUA 5DPWA 4GDLA 2BYEA 3KVFB 3PRMB 4I6PA 1VCBA 3ZRCA 3V60A 2EKEC 5AZHA 3W1SC 4BKSA 2NPTA 2GBNA 4CYEA 1D3ZA 5LXIB 1V5OA 3RYTA 3DVGY 4LJPB 2Z0EB 3PTFC 1GG3A 2LASA 2ZJDA 3PRPB 3PV1A 1BT0A 1P0RA 5D2MB 1EF1A 4GDKA 3TMPB 4FLHA 1J0GA 1PQSA 4AUQC 1J8CA 3RZFA 1Q0WB 3IHPC 2PJHA 2L7RA 2VRRB 2RGFA 5AEKB 1K8RB 4NAWB 4OVVA 4DHZE 4FADA 3P2BA 1WMHB 2B3AA 2UYZB 4NNJB 5LXHA 1V2YA 2IZVB 3SD5A 4M8MA 1WJUA 3BINA 2K39A 2KJHB 3A9KB 4ZDVA 3ZIMA 1RFAA 3V61A 4GB9A 4IUMB 2KN5A 3PLVA 2PE9A 3OAWA 2AL3A 3NS8A 2G4SA 1KJTA 2BF8B 4I6LB 3ZKJC 1UD7A 4FULA 2DZMA 5D6JB 2ZNVC 1H4RA 3A4RA 4MJSA 4ZRJA 2KWUB 3VVWB 1P3QU 1KLVA 1SE9A 1Q5WB 4F7ZA 2CHXA 3TJPA 2RR9A 4G11A 2MRPA 2JZZA 1A5RA 1J19A 3PT2B 2WX1A 1ZGUB 3MTNB 3L0WB 3QHTA 2I1JA 5IA7A 1WGYA 3PHWB 4KIKB 2K6DB 5D7GA 2M4NA 4MELA 4FN2A 3KW5B 3JSVB 4EFOA 4RM9A 3SU8X 1UBQA 4MGIE 2LRWA 2AYOB 2PEAA 5CX3A 4ANUA 3UF8A 3A33B 4NAWA 2ZEQA 3VTWA 1R4MI 3VUXA 3DVNU 3ZO5B 5J17A 4KIKA 4MGYE 2KANA 1V49A 3ZNZB 2MA9B 1GC6A 5CHFA 4LDTD 4AWJA 1U4AA 1H8CA 2HE7A 3A4SC 2A4ZA 2XK5B 1WXMA 2KQ7A 2WX0A 4B6WA 2O6VB 5HKHA 4IM0A 2IY1B 2KJ6A 2DAJA 2JVCA 3NHEB 2LD9A 2L0FA 1ZW7A 4IM3A 3IVFA 1I35A 1E7VA 1WGDA 4G0NB 2EMSA 4LJOB 3UINB 4W9JA 2PPHA 1X1MA 3DBSA 4FJYA 3C0RB 3CSFA 2KC2A 2MP2A 4NPNA 5E6NA 2M8SA 3WAOA 1WJ6A 2GBMA 4URKA 2NS5A 3VH4B 2LGXA 2DYOA 4WWNA 3HK0A 3QCAA 2KX0A 4GMVA 1Y8RC 3EHVA 3RUIB 1V5TA 3QQ8B 3JYUA 3DQVA 3NY5A 4HVBA 1I42A 4E74A 4EZLA 1CMXB 1YD8U 3DBLI 4K81A 4MSQB 3R7QA 4E71A 3VTUA 1YJ1A 2DHZA 3B1LX 3K9PB 4G50A 4W9FA 4WJNA 1TGZB 3PSEB 2LXAA 4XC2A 1IYFA 1Z5SB 3UIPB 2W9NA 3KYCD 3UGBB 3VTVA 3RD2A 3W1YA 4ICUA 1TBEA 3N3KB 3Q3FA 2KMAA 2ZPNA 4ANXA 1F9JA 4GU2A 3TBLD 2MSED 4BOSC 3JW0X 5D94A 2A5UA 3HIZA 4JLCA 4TQ1A 3VFKA 2D2QA 2ASQA 3ENEA 4MJSB 1TTNA 3OJ3A 4WJPA 4ANWA 4JQWC 3MJWA 3PRZA 4W9DA 1WR6E 2NBUA 1P1AA 4EKUA 1GC7A 2KHWB 2PE6B 3O65B 3APDA 2O2VB 2L0TA 4KDLB 5JHAA 4NQKE 1LFDA 2KFKB 1WM3A 1E8ZA 2DYMA 5CHWA 3W1SA 4K7SA 4MH0E 3QARA 1WGRA 4OVUA 3H7PB 2O6VD 2L3ZA 3KUZA 4PS7A 4W9LA 3ZTDA 1WGHA 4RMAA 2GBKA 5DPSA 2J0JA 2FUHB 2KDFB 2KXJA 4KVGB 3WAPA 2L8JA 4XX5A 2Z59B 2FNJB 3MHSD 4W9HA 2G4DB 4W9GA 1WX8A 4HK2A 2WYQA 2L00B 2J0KA 2JXXA 3N30A 3VH3B 4BOZB 4JGHB 1KM7A 1WMHA 2LGDA 2DZIA 2NBVB 2XBBC 4FHJA 4GIVA 4BKGA 2JUOA 1E8XA 2N9EB 3M3JA 2OJRA 3IFWB 3QWZB 4G3XB 4TQ0A 4W9IA 4DXAB 4HDOA 2D07B 3L54A 4NQLB 3ZRFA 4HPMB 3EECA 5GMVA 2D3GA 4BBNC 4EUTA 2L05A 2FCSA 1WE7A 2K1FA 1V6EA 2KX3A 4KDIC 2NPTB 1NDDA 1E8WA 2O2VA 1KOTA 2HJ8A 4ZRIA 3RZWC 1XD3B 1L2NA 1WZ0A 1NBFC 2DZKA 3B0AA 2C7MB 1WZ3A 3CSTA 2G45B 1RAXA 4FJVB 1ZKHA 3PGEA 2MQJA 3L10B 5DCNA 3B08A 1S1QB 3PVLA 2BPSA 2NVUI 2CS4A 4RM8A 2LZ6A 2D10A 4A3PA 4MGKE 1YIWA 1V9JA 2LXCA 4AJYB 4F8CB 2V4LA 4P7IA 4B9KA 1IPGA 2UWQA 3HHMA 1WX9A 4GSWA 2KWCA 1EF5A 4GXBA 2KO3A 2BGFA 3PHXB 5C23A 1WFYA 2K8CA 1M94A 3PS6A 4AJWA 4B95A 3QJZA 3VAWA 4ASWC 1WRDB 2KLGA 3S2AA 1S3SG 2JY6A 3ONSA 4PS8A 1XT9B 4N9F4 1V81A 2LUEA 4MM3A 2KKCA 1YQBA 2KQSA 1V80A 3DVNV 3EC8A 4NY0A 2FCMA 4CO7A 4ZYNA 4BVUC 5L95C 1E90A 2C9WB 4IW0A 2M1MA 3M63B 2CKHB 3PREA 3VUYA 4TUUA 3SDLC 3ZNGC 1LM8B 2GBRA 3GOEA 1OQYA 2ZNVB 4M0WB 3VDZA 1XQQA 3UQAA 2JWZA 4W9CA 3PPAA 3QX1A 2MBEA 4FA6A 2LI5A 2N1WA 1WXAA 1GJZA 2V1YA 1YX5B 3WANA 4XZ4A 3QAQA 3JSVA 1ISNA 1HE8A 2DX5B 2KWVB 3L17A 4W9EA 3JVZX 2MBOA 2ZVOA 4II2B 1RRBA 3PLUA 4WAAA 2BWFA 3L08A 2MW5A 4FBJB 1Z2MA 4HPLB 2GOWA 5E6OA 1WR1A 3ZNHB 2G3QB 2IO3B 4K1RB 4F1SA 3QK0A 3A1QB 4KZ0A 4EOYA 2D11A 2XK5A 4IG7B 2DYBA 4PYUA 5E6PA 5JHBA 2AL6A 1C1YB 2MCNB 1SGHA 2RPQA 2ZVNA 2KK8A 4DDGD 2HD5B 5J18A 3ZTCA 2CHWA 4LDTB 4JIOU 4E3CA 1WYWB 3ZNID 4MSMB 3NOBA 2MP2B 3H7PA 3H6NA 3N32A 2FCQA 1UELA 1OTRB 4BKTA 2R2OA 2LVOA 2K25A 2J7QB 2NBWB 2WDTB 4ZRKA 3M62B 3OLMD 4MEMA 2LJ5A 2V3SA 1WF9A 2BYVE 2JT4B 3T8MA 2GMIC 4BKSD 2JPHA 2BKRB 2AWTA 2K8HA 2NR2A 2ZZPB 3HM3A 3NZSA 4GDLB 5G2NA 4AOFA 2CR5A 5C1ZA 2KLCA 4JL9A 1R4NI 3ZVVA 3LJ3A 3L16A 4KSLC 4ANVA 3PZDA 1Q1OA 3LDZE 4GDKB 1OEYJ 4A20A 3UQBA 1WX7A 1V86A 4J6IA 1EUVB 3X0WA 3ZUNA 3VQIA 4WJOA 4DHJD 2KNBA 3V62A 4K7UA 3SHQA 2C7NB 2XEWA 2EMTA 3K9OB 2KOXA 3DOWA 1OGWA 2DZJA 1OEYA 2L76A 2Z0DB 3WIMA 4BBNF 2LWPA 4DWFA 1IP9A 2NCNA 1WE6A 3ALBA 4HLEA 2JRIB 2KDBA 3DBRI 1WY8A 5KHOA 2K8BA 4PS3A 3VUWA 4I6NB 2MBHA 1AARA 4ICVA 3QA8A 2BWES 2IYDB 3VHTC 4CHKA 3DBHI 2DENB 1GUAB 3T9LA 3QIJA 2BYFA 4NJ6A 3RULA 3DVGX 1YX6B 3IG3A 4TV3A 3WAMA 2MBQA 2GBJA 2N9XA 2MX2A 1MG8A 2OOBB 2FCNA 3Q3JA 1LXDA 3APCA 4GGQA 2KJRA 1VD2A 1TZ1A 2KTRB 2KZRA 3A9JA 3BY4B 3R7RA 4WJQA 4DBGA 1FXTB 2C5LC 2HTHA 2IO2B 3WA0A 5LLIA 4KV2A 3APFA 5IAAC 2J0MA 1P98A 2LGYA 3H1UA 2R2QA 3M95A 4DHZB 5AZGA 1WIAA 3H7SA 4IWQA 5G55A 4X57B 2KMCA 4M8NA 2KDIA 4TKNA 3A9JB 3KUDB 5L83A 2REXA 5DPTA 2N7EA 3AU4A 4IWPA 5CHVC 5DPRA 2KC1A 3TIXA 2LVPA 1P9DU 2CHZA 3DDCB 2O6VA 2JRHA 2FIFA 4FHKA 3U8ZA 3AXCA 3V6CB 4HXDA 2MBBB 3HM6X 1EO6A 4A3OA 3GZNI 5JZEB 1WI0A 5BO4B 3UIOB 4WWPA 2N4FA 4KZCA 2IO1B 3ML9A 2BKFA 4GN1A 3AI5A 3ECIA 2IBIB 2N7DA 1E8YA 2ZCBA 3DCGA 2DAFA 5JH5C 3I3TB 3R3MA 4W9KA 3R66C 3AU5A 4NJ7A 1LQBA 3WALA 2Y5BB 3OJ4B 1UZXB 1WJNA 1UH6A 1WJ4A 2ZCCA 5FR6A 1T0YA 3H9DA 4LCDE 4MGZE 5EDSA 3NZUA 3V6EB 2KFJA 5KHQA 2RSUA 3VXWA 2IY0B 2YLMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EZK A;  2KTR A;  2WWZ A;  2KTF A;  3KH0 A;  1QZE A;  3EFU A;  3ZDT A;  1G6J A;  2M17 A;  4WQO B;  4WWO A;  1E5W A;  2FAZ A;  2KVR A;  3AUL A;  4HDQ A;  3X23 A;  2JZ3 B;  4HJK A;  4IC7 B;  4EEW A;  2C7H A;  1L7Y A;  4IM2 A;  4DDI D;  3ZLZ A;  3RT3 B;  3RCZ A;  3A1Q A;  4FJZ A;  4KSK C;  2N9P C;  4YL8 A;  1C3T A;  2C60 A;  4DK5 A;  2QHO A;  2RD0 A;  2I1K A;  3KYD D;  4HWI B;  4DHJ B;  2ZPY A;  2IO0 B;  2LVQ A;  3D32 A;  5AZF A;  5TR5 A;  4HCN B;  2KDE B;  3ZDM C;  2KD0 A;  1JRU A;  3TCA A;  1UGM A;  3QC8 B;  2FID A;  2YVC A;  1GNU A;  2CU1 A;  1WGG A;  4K7W A;  3ML8 A;  3A9K A;  4IWO A;  1RLF A;  1WH3 A;  3DPD A;  3KUC B;  4EZJ A;  3CMM B;  4GOC A;  4BFR A;  2MLB A;  3U30 A;  2K6Q A;  3U7D A;  1E7U A;  2JF5 A;  1NI2 A;  2KFK A;  2N1V A;  4AP4 C;  1WM2 A;  3CF6 E;  2MWS B;  1UBI A;  4PYZ A;  5CTR C;  3L13 A;  3TL5 A;  4HCP B;  1SIF A;  3ZW3 A;  2AEH A;  1WXV A;  4MDK E;  1WXS A;  4II3 B;  3IBE A;  2M0X A;  5J2R A;  2LRU A;  5DPW A;  4GDL A;  2BYE A;  3KVF B;  3PRM B;  4I6P A;  1VCB A;  3ZRC A;  3V60 A;  2EKE C;  5AZH A;  3W1S C;  4BKS A;  2NPT A;  2GBN A;  4CYE A;  1D3Z A;  5LXI B;  1V5O A;  3RYT A;  3DVG Y;  4LJP B;  2Z0E B;  3PTF C;  1GG3 A;  2LAS A;  2ZJD A;  3PRP B;  3PV1 A;  1BT0 A;  1P0R A;  5D2M B;  1EF1 A;  4GDK A;  3TMP B;  4FLH A;  1J0G A;  1PQS A;  4AUQ C;  1J8C A;  3RZF A;  1Q0W B;  3IHP C;  2PJH A;  2L7R A;  2VRR B;  2RGF A;  5AEK B;  1K8R B;  4NAW B;  4OVV A;  4DHZ E;  4FAD A;  3P2B A;  1WMH B;  2B3A A;  2UYZ B;  4NNJ B;  5LXH A;  1V2Y A;  2IZV B;  3SD5 A;  4M8M A;  1WJU A;  3BIN A;  2K39 A;  2KJH B;  3A9K B;  4ZDV A;  3ZIM A;  1RFA A;  3V61 A;  4GB9 A;  4IUM B;  2KN5 A;  3PLV A;  2PE9 A;  3OAW A;  2AL3 A;  3NS8 A;  2G4S A;  1KJT A;  2BF8 B;  4I6L B;  3ZKJ C;  1UD7 A;  4FUL A;  2DZM A;  5D6J B;  2ZNV C;  1H4R A;  3A4R A;  4MJS A;  4ZRJ A;  2KWU B;  3VVW B;  1P3Q U;  1KLV A;  1SE9 A;  1Q5W B;  4F7Z A;  2CHX A;  3TJP A;  2RR9 A;  4G11 A;  2MRP A;  2JZZ A;  1A5R A;  1J19 A;  3PT2 B;  2WX1 A;  1ZGU B;  3MTN B;  3L0W B;  3QHT A;  2I1J A;  5IA7 A;  1WGY A;  3PHW B;  4KIK B;  2K6D B;  5D7G A;  2M4N A;  4MEL A;  4FN2 A;  3KW5 B;  3JSV B;  4EFO A;  4RM9 A;  3SU8 X;  1UBQ A;  4MGI E;  2LRW A;  2AYO B;  2PEA A;  5CX3 A;  4ANU A;  3UF8 A;  3A33 B;  4NAW A;  2ZEQ A;  3VTW A;  1R4M I;  3VUX A;  3DVN U;  3ZO5 B;  5J17 A;  4KIK A;  4MGY E;  2KAN A;  1V49 A;  3ZNZ B;  2MA9 B;  1GC6 A;  5CHF A;  4LDT D;  4AWJ A;  1U4A A;  1H8C A;  2HE7 A;  3A4S C;  2A4Z A;  2XK5 B;  1WXM A;  2KQ7 A;  2WX0 A;  4B6W A;  2O6V B;  5HKH A;  4IM0 A;  2IY1 B;  2KJ6 A;  2DAJ A;  2JVC A;  3NHE B;  2LD9 A;  2L0F A;  1ZW7 A;  4IM3 A;  3IVF A;  1I35 A;  1E7V A;  1WGD A;  4G0N B;  2EMS A;  4LJO B;  3UIN B;  4W9J A;  2PPH A;  1X1M A;  3DBS A;  4FJY A;  3C0R B;  3CSF A;  2KC2 A;  2MP2 A;  4NPN A;  5E6N A;  2M8S A;  3WAO A;  1WJ6 A;  2GBM A;  4URK A;  2NS5 A;  3VH4 B;  2LGX A;  2DYO A;  4WWN A;  3HK0 A;  3QCA A;  2KX0 A;  4GMV A;  1Y8R C;  3EHV A;  3RUI B;  1V5T A;  3QQ8 B;  3JYU A;  3DQV A;  3NY5 A;  4HVB A;  1I42 A;  4E74 A;  4EZL A;  1CMX B;  1YD8 U;  3DBL I;  4K81 A;  4MSQ B;  3R7Q A;  4E71 A;  3VTU A;  1YJ1 A;  2DHZ A;  3B1L X;  3K9P B;  4G50 A;  4W9F A;  4WJN A;  1TGZ B;  3PSE B;  2LXA A;  4XC2 A;  1IYF A;  1Z5S B;  3UIP B;  2W9N A;  3KYC D;  3UGB B;  3VTV A;  3RD2 A;  3W1Y A;  4ICU A;  1TBE A;  3N3K B;  3Q3F A;  2KMA A;  2ZPN A;  4ANX A;  1F9J A;  4GU2 A;  3TBL D;  2MSE D;  4BOS C;  3JW0 X;  5D94 A;  2A5U A;  3HIZ A;  4JLC A;  4TQ1 A;  3VFK A;  2D2Q A;  2ASQ A;  3ENE A;  4MJS B;  1TTN A;  3OJ3 A;  4WJP A;  4ANW A;  4JQW C;  3MJW A;  3PRZ A;  4W9D A;  1WR6 E;  2NBU A;  1P1A A;  4EKU A;  1GC7 A;  2KHW B;  2PE6 B;  3O65 B;  3APD A;  2O2V B;  2L0T A;  4KDL B;  5JHA A;  4NQK E;  1LFD A;  2KFK B;  1WM3 A;  1E8Z A;  2DYM A;  5CHW A;  3W1S A;  4K7S A;  4MH0 E;  3QAR A;  1WGR A;  4OVU A;  3H7P B;  2O6V D;  2L3Z A;  3KUZ A;  4PS7 A;  4W9L A;  3ZTD A;  1WGH A;  4RMA A;  2GBK A;  5DPS A;  2J0J A;  2FUH B;  2KDF B;  2KXJ A;  4KVG B;  3WAP A;  2L8J A;  4XX5 A;  2Z59 B;  2FNJ B;  3MHS D;  4W9H A;  2G4D B;  4W9G A;  1WX8 A;  4HK2 A;  2WYQ A;  2L00 B;  2J0K A;  2JXX A;  3N30 A;  3VH3 B;  4BOZ B;  4JGH B;  1KM7 A;  1WMH A;  2LGD A;  2DZI A;  2NBV B;  2XBB C;  4FHJ A;  4GIV A;  4BKG A;  2JUO A;  1E8X A;  2N9E B;  3M3J A;  2OJR A;  3IFW B;  3QWZ B;  4G3X B;  4TQ0 A;  4W9I A;  4DXA B;  4HDO A;  2D07 B;  3L54 A;  4NQL B;  3ZRF A;  4HPM B;  3EEC A;  5GMV A;  2D3G A;  4BBN C;  4EUT A;  2L05 A;  2FCS A;  1WE7 A;  2K1F A;  1V6E A;  2KX3 A;  4KDI C;  2NPT B;  1NDD A;  1E8W A;  2O2V A;  1KOT A;  2HJ8 A;  4ZRI A;  3RZW C;  1XD3 B;  1L2N A;  1WZ0 A;  1NBF C;  2DZK A;  3B0A A;  2C7M B;  1WZ3 A;  3CST A;  2G45 B;  1RAX A;  4FJV B;  1ZKH A;  3PGE A;  2MQJ A;  3L10 B;  5DCN A;  3B08 A;  1S1Q B;  3PVL A;  2BPS A;  2NVU I;  2CS4 A;  4RM8 A;  2LZ6 A;  2D10 A;  4A3P A;  4MGK E;  1YIW A;  1V9J A;  2LXC A;  4AJY B;  4F8C B;  2V4L A;  4P7I A;  4B9K A;  1IPG A;  2UWQ A;  3HHM A;  1WX9 A;  4GSW A;  2KWC A;  1EF5 A;  4GXB A;  2KO3 A;  2BGF A;  3PHX B;  5C23 A;  1WFY A;  2K8C A;  1M94 A;  3PS6 A;  4AJW A;  4B95 A;  3QJZ A;  3VAW A;  4ASW C;  1WRD B;  2KLG A;  3S2A A;  1S3S G;  2JY6 A;  3ONS A;  4PS8 A;  1XT9 B;  4N9F 4;  1V81 A;  2LUE A;  4MM3 A;  2KKC A;  1YQB A;  2KQS A;  1V80 A;  3DVN V;  3EC8 A;  4NY0 A;  2FCM A;  4CO7 A;  4ZYN A;  4BVU C;  5L95 C;  1E90 A;  2C9W B;  4IW0 A;  2M1M A;  3M63 B;  2CKH B;  3PRE A;  3VUY A;  4TUU A;  3SDL C;  3ZNG C;  1LM8 B;  2GBR A;  3GOE A;  1OQY A;  2ZNV B;  4M0W B;  3VDZ A;  1XQQ A;  3UQA A;  2JWZ A;  4W9C A;  3PPA A;  3QX1 A;  2MBE A;  4FA6 A;  2LI5 A;  2N1W A;  1WXA A;  1GJZ A;  2V1Y A;  1YX5 B;  3WAN A;  4XZ4 A;  3QAQ A;  3JSV A;  1ISN A;  1HE8 A;  2DX5 B;  2KWV B;  3L17 A;  4W9E A;  3JVZ X;  2MBO A;  2ZVO A;  4II2 B;  1RRB A;  3PLU A;  4WAA A;  2BWF A;  3L08 A;  2MW5 A;  4FBJ B;  1Z2M A;  4HPL B;  2GOW A;  5E6O A;  1WR1 A;  3ZNH B;  2G3Q B;  2IO3 B;  4K1R B;  4F1S A;  3QK0 A;  3A1Q B;  4KZ0 A;  4EOY A;  2D11 A;  2XK5 A;  4IG7 B;  2DYB A;  4PYU A;  5E6P A;  5JHB A;  2AL6 A;  1C1Y B;  2MCN B;  1SGH A;  2RPQ A;  2ZVN A;  2KK8 A;  4DDG D;  2HD5 B;  5J18 A;  3ZTC A;  2CHW A;  4LDT B;  4JIO U;  4E3C A;  1WYW B;  3ZNI D;  4MSM B;  3NOB A;  2MP2 B;  3H7P A;  3H6N A;  3N32 A;  2FCQ A;  1UEL A;  1OTR B;  4BKT A;  2R2O A;  2LVO A;  2K25 A;  2J7Q B;  2NBW B;  2WDT B;  4ZRK A;  3M62 B;  3OLM D;  4MEM A;  2LJ5 A;  2V3S A;  1WF9 A;  2BYV E;  2JT4 B;  3T8M A;  2GMI C;  4BKS D;  2JPH A;  2BKR B;  2AWT A;  2K8H A;  2NR2 A;  2ZZP B;  3HM3 A;  3NZS A;  4GDL B;  5G2N A;  4AOF A;  2CR5 A;  5C1Z A;  2KLC A;  4JL9 A;  1R4N I;  3ZVV A;  3LJ3 A;  3L16 A;  4KSL C;  4ANV A;  3PZD A;  1Q1O A;  3LDZ E;  4GDK B;  1OEY J;  4A20 A;  3UQB A;  1WX7 A;  1V86 A;  4J6I A;  1EUV B;  3X0W A;  3ZUN A;  3VQI A;  4WJO A;  4DHJ D;  2KNB A;  3V62 A;  4K7U A;  3SHQ A;  2C7N B;  2XEW A;  2EMT A;  3K9O B;  2KOX A;  3DOW A;  1OGW A;  2DZJ A;  1OEY A;  2L76 A;  2Z0D B;  3WIM A;  4BBN F;  2LWP A;  4DWF A;  1IP9 A;  2NCN A;  1WE6 A;  3ALB A;  4HLE A;  2JRI B;  2KDB A;  3DBR I;  1WY8 A;  5KHO A;  2K8B A;  4PS3 A;  3VUW A;  4I6N B;  2MBH A;  1AAR A;  4ICV A;  3QA8 A;  2BWE S;  2IYD B;  3VHT C;  4CHK A;  3DBH I;  2DEN B;  1GUA B;  3T9L A;  3QIJ A;  2BYF A;  4NJ6 A;  3RUL A;  3DVG X;  1YX6 B;  3IG3 A;  4TV3 A;  3WAM A;  2MBQ A;  2GBJ A;  2N9X A;  2MX2 A;  1MG8 A;  2OOB B;  2FCN A;  3Q3J A;  1LXD A;  3APC A;  4GGQ A;  2KJR A;  1VD2 A;  1TZ1 A;  2KTR B;  2KZR A;  3A9J A;  3BY4 B;  3R7R A;  4WJQ A;  4DBG A;  1FXT B;  2C5L C;  2HTH A;  2IO2 B;  3WA0 A;  5LLI A;  4KV2 A;  3APF A;  5IAA C;  2J0M A;  1P98 A;  2LGY A;  3H1U A;  2R2Q A;  3M95 A;  4DHZ B;  5AZG A;  1WIA A;  3H7S A;  4IWQ A;  5G55 A;  4X57 B;  2KMC A;  4M8N A;  2KDI A;  4TKN A;  3A9J B;  3KUD B;  5L83 A;  2REX A;  5DPT A;  2N7E A;  3AU4 A;  4IWP A;  5CHV C;  5DPR A;  2KC1 A;  3TIX A;  2LVP A;  1P9D U;  2CHZ A;  3DDC B;  2O6V A;  2JRH A;  2FIF A;  4FHK A;  3U8Z A;  3AXC A;  3V6C B;  4HXD A;  2MBB B;  3HM6 X;  1EO6 A;  4A3O A;  3GZN I;  5JZE B;  1WI0 A;  5BO4 B;  3UIO B;  4WWP A;  2N4F A;  4KZC A;  2IO1 B;  3ML9 A;  2BKF A;  4GN1 A;  3AI5 A;  3ECI A;  2IBI B;  2N7D A;  1E8Y A;  2ZCB A;  3DCG A;  2DAF A;  5JH5 C;  3I3T B;  3R3M A;  4W9K A;  3R66 C;  3AU5 A;  4NJ7 A;  1LQB A;  3WAL A;  2Y5B B;  3OJ4 B;  1UZX B;  1WJN A;  1UH6 A;  1WJ4 A;  2ZCC A;  5FR6 A;  1T0Y A;  3H9D A;  4LCD E;  4MGZ E;  5EDS A;  3NZU A;  3V6E B;  2KFJ A;  5KHQ A;  2RSU A;  3VXW A;  2IY0 B;  2YLM A; 
#chains in the Genus database with same CATH topology
 4EZK A;  3KH0 A;  1QZE A;  3ZDT A;  5H92 C;  2FAZ A;  1XCQ L;  1QOB A;  4HDQ A;  2D5G A;  1ZP0 B;  3X23 A;  4IC7 B;  2C7H A;  3BVG A;  3RT3 B;  1UF0 A;  2C60 A;  3KYD D;  4M01 A;  4DHJ B;  3KQ4 A;  2ZPY A;  3D32 A;  3NG0 A;  4HCN B;  3P4R B;  1GNU A;  2CU1 A;  1WGG A;  4OW0 A;  4IWO A;  1QQR A;  1WH3 A;  4EZJ A;  2G9H D;  5EE0 A;  2MLB A;  1NYQ A;  4BAX A;  1NI2 A;  4AP4 C;  2LGS A;  2MWS B;  4HKQ A;  1OFF A;  1UBI A;  4PYZ A;  3RNA C;  1BUI C;  1L5P A;  4XE0 A;  4KGT A;  1WXV A;  4J3O D;  3R8B A;  3IBE A;  5DPW A;  4GDL A;  3IXS A;  4BKS A;  3DBR B;  2NPT A;  2GBN A;  1QIL A;  3FKY A;  4LJP B;  3PTF C;  5D2M B;  4Q2J A;  4XYC A;  4AUQ C;  2J4X A;  2PJH A;  5FR3 A;  5IN7 A;  2VRR B;  5AEK B;  2YEP F;  1K8R B;  1YJI A;  2AQ2 B;  2PVG C;  4OVV A;  3GE8 C;  3P2B A;  3U7Z A;  3RI7 C;  3AV8 A;  4C4V A;  1V2Y A;  2IZV B;  3BIN A;  4IUM B;  3PLV A;  1KJT A;  1PUT A;  1ZUD 2;  2DZM A;  5D6J B;  2ZNV C;  4MJS A;  1GB1 A;  1I4H A;  3RPF C;  1KLV A;  4B0E A;  1FPY A;  1MVK A;  3TJP A;  3LB8 C;  2WX1 A;  1ZGU B;  2I1J A;  5IA7 A;  3PHW B;  2K6D B;  4A55 A;  4FN2 A;  3TEW A;  2VZK B;  2PEA A;  3T3N A;  2ZEQ A;  1R4M I;  3VUX A;  4MGY E;  2KAN A;  3ZNZ B;  2MA9 B;  4LDT D;  1H8C A;  3KLS X;  2HE7 A;  2A4Z A;  1ZPS A;  2WX0 A;  2BS4 B;  5HKH A;  1E7P B;  3AEE B;  2KJ6 A;  3RFZ B;  2V0G A;  1P7E A;  1E0Z A;  4G0N B;  1MI0 A;  3KWL A;  3DBS A;  1N61 A;  1TKG A;  2RMM A;  3WAO A;  1WJ6 A;  2NS5 A;  3Q8E A;  2KAJ A;  4GMV A;  1V5T A;  2HTM E;  3DQV A;  4ZRQ A;  1HEZ E;  2WXF A;  1IP9 A;  4MSQ B;  1B1Z A;  1SXT A;  3PSE B;  1IYF A;  3KYC D;  1SSN A;  3W1Y A;  4ICU A;  1TBE A;  1N6Z A;  1FRD A;  4C7Z A;  2ZPN A;  4RH6 A;  4ANX A;  4BOS C;  3JW0 X;  3TSS A;  2D2Q A;  3ENE A;  4WJP A;  4ANW A;  4JQW C;  2HDE A;  4JPS A;  1T3Q A;  2NBU A;  1P1A A;  3N20 C;  3O65 B;  3APD A;  2O2V B;  3AE5 B;  2WXP A;  2ZW0 A;  2KWD A;  3RNB C;  2IJ0 A;  3QAR A;  4JX1 C;  1T6B X;  2M0A A;  4US9 A;  4RMA A;  4IOI E;  3OWE B;  5DPS A;  2FUH B;  3EUB 2;  2KXJ A;  4KVG B;  3WAP A;  4XX5 A;  4WUR A;  1YJJ A;  1WXQ A;  2JXX A;  4RFB A;  4BOZ B;  1UWX A;  4BKG A;  3DBL B;  3QWZ B;  4NQL B;  5GMV A;  1A70 A;  4EUT A;  1PGX A;  2FCS A;  1V6E A;  2NPT B;  2K0P A;  2WXH A;  1KOT A;  2HJ8 A;  1D4B A;  1L2N A;  2DZK A;  3B0A A;  1RAX A;  3W5V B;  4FJV B;  3PGE A;  3L10 B;  5AUI A;  3WCQ A;  1S1Q B;  2FUG 1;  2BPS A;  4MGK E;  3ZJV A;  1VZ7 A;  4HPP A;  4GSW A;  2KWC A;  1T0Q C;  3PHX B;  2K8C A;  1M94 A;  1MG4 A;  3UI3 A;  1KTK A;  1HTQ A;  2KLG A;  1S3S G;  1XT9 B;  3DHG C;  2FCM A;  2EKI A;  4BVU C;  5TSS A;  1FFU A;  1JRO A;  5MPO A;  1LM8 B;  1FRR A;  3GOE A;  1OQY A;  2ZNV B;  1XQQ A;  3N1X C;  2Y5C A;  1YX5 B;  3WAN A;  4XZ4 A;  4W9E A;  2DX5 B;  1RYJ A;  3GP7 A;  1RRB A;  2MW5 A;  1Z2M A;  4HPL B;  1TS5 A;  3ZNH B;  2IO3 B;  4K1R B;  1TZO A;  1GOZ A;  2PKO A;  4USA A;  2D11 A;  2XK5 A;  2IPK D;  2WU5 B;  3EA6 A;  2KK8 A;  1QT9 A;  4AQ7 A;  1I4R A;  2LHE A;  5BMG A;  4MSM B;  3NOB A;  3N32 A;  3HUI A;  4A90 A;  3RMK C;  2KN4 A;  1OTR B;  1UEL A;  1STE A;  1SBB B;  2K25 A;  3Q8C A;  1N62 A;  2ZZP B;  5G2N A;  2CR5 A;  3AEC B;  4JL9 A;  3ZXV A;  1DGJ A;  2WXN A;  1BML C;  4ANV A;  3IT4 B;  2DBY A;  1XCT L;  1V86 A;  1QOG A;  3X0W A;  2OJW A;  1ENF A;  2WP9 B;  2LEK A;  1E6E B;  1GB4 A;  3K9O B;  3TEZ A;  4BBN F;  1PFD A;  4ARI A;  4M00 A;  3FIL B;  2NCN A;  1T5X D;  3P63 A;  2KDB A;  3VUW A;  4ICV A;  3QA8 A;  2IYD B;  2VH1 A;  3DBH I;  3T9L A;  5IO9 A;  1QLB B;  1TIF A;  2KJR A;  2IO2 B;  5LLI A;  3APF A;  5IAA C;  2R2Q A;  1WIA A;  3H7S A;  4M8N A;  2KDI A;  4TKN A;  1FFV A;  2N7E A;  2KC1 A;  3TIX A;  2LVP A;  2CHZ A;  5G5G A;  1KF6 B;  2RDG A;  2O6V A;  2FIF A;  1XLO A;  4UDU C;  3GZN I;  2INC C;  3N1Y C;  5BO4 B;  2IO1 B;  2J42 A;  2BKF A;  3AH7 A;  1TY0 A;  1FEH A;  3AE3 B;  3DCG A;  3AEF B;  5JH5 C;  3AU5 A;  1QF6 A;  4KX6 B;  4LNO A;  2RSU A;  2YLM A;  3Q3O C;  3NUH B;  4OZA A;  1RFK A;  2KVR A;  3ZJU A;  3AUL A;  4H2A A;  2LJI A;  3NVW A;  4HJK A;  1PGB A;  1QOA A;  2J52 A;  4IM2 A;  3ZLZ A;  3RCZ A;  1ZOY B;  2N9P C;  4YL8 A;  1C3T A;  2MHJ A;  2RD0 A;  1C79 A;  4HWI B;  2K9X A;  4WIP A;  1V1P A;  5AZF A;  1TKY A;  2JYE A;  2YVC A;  1RLF A;  3KUC B;  1JML A;  4HKZ E;  4ZRP A;  3U7D A;  3I9V 1;  1WM2 A;  3CF6 E;  4MH8 A;  4RCO A;  3TL5 A;  4XWW A;  4LK0 M;  3TUO A;  2WDV B;  4REZ A;  2M0X A;  2LRU A;  1WSP A;  3KVF B;  4IKG A;  2EKE C;  3W1S C;  5LXI B;  1V5O A;  3RYT A;  4KGR A;  3Q2A C;  2ZJD A;  1BT0 A;  1P0R A;  3NVY A;  4GDK A;  3TMP B;  1J0G A;  4QAY A;  1J8C A;  2KVZ A;  1F52 A;  3IHP C;  2L7R A;  3IAS 1;  1FNW A;  4NAW B;  4FAD A;  4A8X C;  1ESF A;  3FIL A;  2B3A A;  4NNJ B;  1AWD A;  1YMH E;  1R4N B;  1CK1 A;  2H88 B;  3A9K B;  4ZDV A;  4GB9 A;  1GAQ B;  2LUM A;  4PK1 A;  3OAW A;  2H89 B;  1ZXH A;  3C8Y A;  1ZXI A;  2INP E;  3C19 A;  4ZRJ A;  4YWG G;  2WQY B;  1Q5W B;  2WHI A;  1A5R A;  3PT2 B;  3NRZ A;  4US8 A;  4KIK B;  2M4N A;  4YXD B;  4RNA A;  3J9C A;  1JRP A;  2JX5 A;  4MGI E;  2AYO B;  3UF8 A;  3Q8B A;  1YQ3 B;  3VTW A;  2Y5P A;  5J17 A;  3ZO5 B;  4AWJ A;  3DHI C;  3L4P A;  3A4S C;  1ET6 A;  1WXM A;  1F2R I;  3NJT A;  3MC0 B;  4B6W A;  1V97 A;  2IY1 B;  4L2Y A;  2L0F A;  3IVF A;  1XF5 L;  1I35 A;  1C4A A;  4LJO B;  4W9J A;  2PPH A;  3BVM A;  2QEJ C;  3CSF A;  5G5H A;  2MP2 A;  3IAM 1;  4A6Q A;  1L0V B;  4L1B A;  2LGX A;  4WWN A;  3QCA A;  2KX0 A;  3EHV A;  4JWS C;  1ET9 A;  4E71 A;  3R7Q A;  4W9F A;  1IGC A;  2PIA A;  2LXA A;  1NYR A;  1YN4 A;  2W9N A;  3VTV A;  2N9L A;  3RD2 A;  4WWM A;  2W54 A;  1EWY C;  4DQO C;  4NAM A;  1UWM A;  4HJG E;  1LGR A;  2KMA A;  1FMA D;  1JW9 D;  2D3C A;  3HIZ A;  3VFK A;  1NVI D;  3OJ3 A;  2L32 A;  4W9D A;  1WR6 E;  2BBC A;  4OZB A;  2KQ4 X;  4EKU A;  4KDL B;  2L0T A;  3R2I A;  4NQK E;  2KFK B;  2DYM A;  5BMI A;  1D5M C;  1N5W A;  2GLS A;  2AQ3 B;  1E9M A;  4OVU A;  3H7P B;  2O6V D;  4W9L A;  1JWS D;  1WGH A;  2PTL A;  2WXQ A;  2GBK A;  2KDF B;  2L8J A;  1HZ6 A;  1NEN B;  1WX8 A;  2L00 B;  3VH3 B;  1YN3 A;  4M02 A;  2AQ1 B;  2NBV B;  2LGD A;  4GIV A;  2OJR A;  4TQ0 A;  4DXA B;  4HDO A;  3AE6 B;  3L54 A;  1C9F A;  3EEC A;  2JWU A;  3PO0 A;  1WE7 A;  2KX3 A;  3RZW C;  3CST A;  1WZ3 A;  2G45 B;  1ZKH A;  4CQN A;  2MQJ A;  3PVL A;  4RM8 A;  1I4P A;  1XLP A;  2LZ6 A;  4A9A A;  4A3P A;  1XO3 A;  4ZOH C;  1GPX A;  1V9J A;  2V9H A;  4F8C B;  2YEP B;  3HHM A;  1N5X A;  4B9K A;  5LNK 1;  4GXB A;  3PS6 A;  4YTM B;  1VJK A;  3QJZ A;  3VAW A;  4ASW C;  1WRD B;  1TJE A;  1AN8 A;  2RPV A;  3S2A A;  2JY6 A;  4N9F 4;  2LUE A;  3AEA B;  4MM3 A;  1UUP A;  1YQB A;  4XDD A;  4K3C A;  3DVN V;  2C9W B;  3PRE A;  3AE9 B;  4TUU A;  2R61 A;  3VDZ A;  2NMQ A;  5AUK A;  2MBE A;  2N1W A;  1K51 A;  1SJE D;  4NZL B;  2V1Y A;  3L17 A;  2MBO A;  2JXT A;  3P42 A;  3ZQ4 A;  4FBJ B;  2IGD A;  1L4Z B;  1WR1 A;  1MHH E;  2WS3 B;  3QK0 A;  4C7Y A;  4KZ0 A;  4EOY A;  3O13 A;  4PYU A;  3BWU D;  5JHB A;  1DOX A;  2E3T A;  4PT5 A;  3ZTC A;  3ZNI D;  4LNI A;  2L52 A;  4BKT A;  2QDF A;  3Q8F A;  1FNV A;  3AE8 B;  4ZRK A;  4MEM A;  3RNG C;  2V3S A;  1WF9 A;  2BYV E;  2JT4 B;  3BZD B;  2GMI C;  2X38 A;  2JPH A;  2K8H A;  2AWT A;  2MJE A;  2NR2 A;  3HM3 A;  4AOF A;  4BKS D;  1XLN A;  1R4N I;  4MAC A;  3ZVV A;  2K3U A;  3LJ3 A;  4KSL C;  2IGG A;  3PZD A;  3UQB A;  4GDK B;  1R7S A;  2I38 A;  4LNF A;  1FIQ A;  4WJO A;  1V8C A;  4MM3 B;  4K7U A;  1FCC C;  3SHQ A;  5C2T B;  2KOX A;  2DZJ A;  1OEY A;  2W3R A;  2SAK A;  1WE6 A;  4HLE A;  1TT5 B;  1WY8 A;  2K8B A;  3NZ3 A;  4I6N B;  3BK2 A;  4P6V F;  1D5Z C;  3ETR A;  2DEN B;  3Q14 C;  1GUA B;  1VLB A;  2KDM A;  4NJ6 A;  1YX6 B;  2GBJ A;  3Q6B A;  1SE3 A;  1LXD A;  4JWU C;  2KZR A;  2PMV A;  3R7R A;  4DBG A;  2HTH A;  3WA0 A;  5HI1 A;  3H1U A;  1F1H A;  1IBX A;  1V1O A;  2KMC A;  3A9J B;  3KUD B;  3VRA B;  2ONQ A;  1P9D U;  3P1M A;  3B9J A;  3AXC A;  3N9Y C;  2MBB B;  2NTT A;  1JQ4 A;  2D3B A;  2IBI B;  2N7D A;  2W55 A;  1E8Y A;  3R3M A;  1LQB A;  1LO5 D;  3P4S B;  3OJ4 B;  1UZX B;  1WJN A;  1UH6 A;  1WJ4 A;  1T0Y A;  2M56 B;  3H9D A;  3V6E B;  2WGS A;  2KFJ A;  5HHD G;  2IY0 B;  2KTR A;  5IKC M;  3Q8A A;  3GZN B;  4C00 A;  2JZ3 B;  4GLS C;  1L7Y A;  4DDI D;  1D6E C;  3URY A;  4DK5 A;  2I1K A;  2ZW1 A;  2ACZ B;  3GE3 C;  2VZK D;  5TR5 A;  2RDB C;  2KMM A;  2KD0 A;  1UGM A;  2NTS A;  3QC8 B;  3CIR B;  4K7W A;  3A9K A;  3SFD B;  3DPD A;  3CMM B;  4BFR A;  2K6Q A;  4YTN B;  5EE3 A;  3MFG A;  2EEL A;  1SIF A;  2OHF A;  3ZW3 A;  5IOI A;  1WXS A;  4II3 B;  3DBH B;  4LTU A;  5J2R A;  2BYE A;  1J7B A;  5AZH A;  1N63 A;  3DWG C;  2PVO D;  2Z0E B;  1GG3 A;  2LAS A;  3PRP B;  4FLH A;  1PQS A;  1MHX A;  1XLQ A;  3RZF A;  1Q0W B;  1PDX A;  4DHZ E;  4O1N A;  2QSD A;  1WMH B;  2UYZ B;  2WXK A;  3SD5 A;  5BYQ A;  3ZIM A;  1RFA A;  3V61 A;  4HRS A;  1IGD A;  4IDI A;  2AL3 A;  1MFW A;  2G4S A;  4I6L B;  3ZKJ C;  1NEK B;  1UD7 A;  2INN E;  1H4R A;  3MC8 A;  3U52 E;  4P1C C;  2KWU B;  3VVW B;  2LMC A;  2CHX A;  2RR9 A;  4G11 A;  2MRP A;  2JZZ A;  5C3J B;  5D3D A;  3V05 A;  2PW9 A;  1J19 A;  3L0W B;  1WGY A;  3LXF A;  3U4E G;  4MEL A;  3JSV B;  2LRW A;  2Q5W D;  5CX3 A;  4JE3 B;  5JXV A;  2W3S A;  3DVN U;  4KIK A;  1V49 A;  1GC6 A;  1C76 A;  1JWM D;  1U4A A;  2N0S B;  4ZHP A;  1JAL A;  5BMH A;  1KRH A;  3R2T A;  4IM3 A;  4XWT A;  1E7V A;  1WGD A;  2EMS A;  3UIN B;  4FJY A;  3N1Z C;  5HFY A;  2KC2 A;  2IDY A;  4NPN A;  1V1P B;  1TS3 A;  2M8S A;  2GBM A;  2DYO A;  1FXA A;  1VRA B;  3HK0 A;  1L6U A;  2MJD A;  3QQ8 B;  3JYU A;  4N59 A;  4E74 A;  4N6E B;  4EZL A;  1YD8 U;  4K81 A;  1YJ1 A;  2DHZ A;  4G50 A;  2KYW A;  4N58 A;  1TGZ B;  4XC2 A;  4S17 A;  1I4X A;  2Y3A A;  1Z5S B;  2CU3 A;  3UGB B;  3W9C B;  5HG2 A;  2BS2 B;  3N3K B;  2BB5 A;  2CJN A;  3TBL D;  3FC4 A;  3P4Q B;  2MSE D;  2UU7 A;  1CJE A;  4JLC A;  3RNC C;  1TTN A;  4RGO S;  3PRZ A;  5FK9 C;  2LGI A;  2PE6 B;  2VH2 A;  2QC8 A;  2B76 B;  1ZDX A;  5BYR A;  1WM3 A;  5CHW A;  2FE8 A;  4K7S A;  4MH0 E;  2KT7 A;  1QOF A;  1K53 A;  1SIJ A;  5H8Y E;  4PS7 A;  3LYY A;  2L1A A;  2QMT A;  3ZTD A;  3KWV A;  1CQV A;  2K5P A;  2FNJ B;  3MHS D;  4W9H A;  4HK2 A;  4LLG M;  2WYQ A;  3N30 A;  1KM7 A;  3IT6 B;  1WMH A;  2XBB C;  2QJL A;  2JUO A;  2GI9 A;  1E8X A;  1QKZ A;  2N9E B;  3ABV B;  3M3J A;  1JWB D;  2D07 B;  4HRO A;  3VRB B;  4DXG A;  2WXG A;  2L05 A;  4RF1 A;  4KDI C;  2JYT A;  1E8W A;  4XGA B;  4ZRI A;  1XD3 B;  2W82 A;  1BXT A;  2C7M B;  3AE2 B;  5DCN A;  3B08 A;  3MHZ A;  2G1E A;  3HVD A;  2D10 A;  1YIW A;  4RGT A;  3GB1 A;  4AJY B;  4P7I A;  2UWQ A;  1PGA A;  4RF0 A;  1OQQ A;  2BGF A;  4AJW A;  2X8X X;  3I57 A;  3ONS A;  4PS8 A;  1UNS A;  1VR9 A;  2V3N A;  2V4I B;  4NY0 A;  4CO7 A;  3AN1 A;  4ZYN A;  1E90 A;  1WWT A;  4IW0 A;  4ARC A;  1SE2 A;  3SDL C;  1AYF A;  2GBR A;  2DWQ A;  2JWZ A;  4W9C A;  1WXA A;  3B2G A;  1GJZ A;  3JSV A;  1ISN A;  1HE8 A;  3AEG B;  3JVZ X;  2D3A A;  2ZVO A;  3CWI A;  1T0S C;  3PLU A;  3L08 A;  5E6O A;  3AE7 B;  2G3Q B;  4M0W A;  4F1S A;  3HVZ A;  3AE1 B;  3ZXR A;  4IG7 B;  2FBW B;  1MJD A;  2DYB A;  1HTO A;  1D5X C;  2AL6 A;  3MC9 A;  1SGH A;  2RPQ A;  4RGM A;  4DDG D;  2HD5 B;  5J18 A;  2CHW A;  4LDT B;  4JIO U;  4E3C A;  1WYW B;  2MP2 B;  3H7P A;  3H6N A;  3NS1 A;  4BZA A;  2WDT B;  2LJ5 A;  2ICI A;  4HVB A;  1K52 A;  5C1Z A;  1L0X B;  2KLC A;  2L83 A;  1XEE A;  2V3P A;  3L16 A;  2WLB A;  1Q1O A;  1OEY J;  4A20 A;  1EM7 A;  3U2S C;  1IBX B;  1WX7 A;  2E6X A;  4J6I A;  1EUV B;  3ZUN A;  3V62 A;  3FAH A;  1J7A A;  1SB3 C;  1EWC A;  3DOW A;  3WIM A;  4DWF A;  2LWP A;  3ALB A;  2IGH A;  4S0R A;  1ACC A;  1HXY D;  2JRI B;  3DBR I;  5KHO A;  4PS3 A;  1AAR A;  2BWE S;  4CHK A;  3QIJ A;  2BYF A;  3PZ8 A;  4OVZ A;  2JSV X;  3DWM A;  5EE9 A;  4YSZ B;  1NI3 A;  3E9S A;  2N9X A;  1MG8 A;  1Q10 A;  4KGS A;  4GGQ A;  1TY2 A;  2Z8L A;  1YQ4 B;  4ZHO A;  4WJQ A;  2C5L C;  2MEK A;  1M4V A;  1P98 A;  1FD6 A;  5L83 A;  5DPT A;  5DPR A;  4LNN A;  4FHK A;  4KKJ A;  3V6C B;  4HXD A;  3AEB B;  3HM6 X;  1EO6 A;  1UGJ A;  2WDQ B;  1J7C A;  5JZE B;  1WI0 A;  2QIL A;  3UIO B;  2N4F A;  4KZC A;  3ML9 A;  3AI5 A;  3ECI A;  1XXG A;  4K3B A;  2ZCB A;  2DAF A;  3WAL A;  4YT0 B;  3RNF C;  3SR6 A;  4LCD E;  2BS3 B;  3EFC A;  3NZU A;  2JZP A;  2JQR B;  2WWZ A;  2KTF A;  1WGK A;  3EFU A;  3BII D;  1G6J A;  2M17 A;  4WQO B;  4WWO A;  1E5W A;  1EU4 A;  4EEW A;  1TS2 A;  3A1Q A;  4FJZ A;  4KSK C;  5D3I B;  2QHO A;  2QCZ A;  3EGR A;  2IO0 B;  2LVQ A;  3H8H A;  1I4G A;  3MJ5 A;  1JWA D;  5I4D A;  2BYT A;  1L0Y B;  2KDE B;  3ZDM C;  1JRU A;  4NJC A;  3TCA A;  2FID A;  3ML8 A;  4GOC A;  4RGN A;  4TSS A;  3U30 A;  1E7U A;  2JF5 A;  2KFK A;  2N1V A;  1DOY A;  4R3D A;  5CTR C;  3L13 A;  4HCP B;  2AEH A;  4MDK E;  3W5U B;  3PRM B;  1WYG A;  4I6P A;  1VCB A;  3ZRC A;  2WXJ A;  1C4P A;  3V60 A;  1D3Z A;  4CYE A;  5FKA C;  1B9R A;  3DVG Y;  3PV1 A;  1EF1 A;  3W2D A;  4MT5 A;  1HZ5 A;  1DOI A;  4EE2 A;  2RGF A;  1C78 A;  2HJ1 A;  5LXH A;  4M8M A;  3BYT B;  1WJU A;  2K39 A;  2KJH B;  2LHD A;  3NVV A;  2KN5 A;  2PE9 A;  3NS8 A;  2BF8 B;  3RN9 C;  3HRD D;  4FUL A;  3A4R A;  4DXF A;  1P3Q U;  4C4V B;  3ZYY X;  1SE9 A;  4F7Z A;  2MJ3 A;  3Q69 A;  4ACF A;  3MTN B;  3OG5 A;  3QHT A;  5D7G A;  2GB1 A;  3KW5 B;  4EFO A;  4RM9 A;  3SU8 X;  1UBQ A;  4ANU A;  1TYG B;  1RWS A;  2DNF A;  4ITK A;  3A33 B;  4NAW A;  2DLB A;  5BYS A;  5CHF A;  2BB6 A;  2XK5 B;  2KQ7 A;  1WRI A;  2O6V B;  4IM0 A;  2DAJ A;  2JVC A;  3NHE B;  2LD9 A;  1ZW7 A;  2QIE B;  2XNA C;  1YOV B;  1X1M A;  3C0R B;  5E6N A;  4URK A;  1VDV A;  3VH4 B;  1Y8R C;  3E56 A;  3RUI B;  4KKI A;  3NY5 A;  1YNT E;  1I42 A;  1CMX B;  3DBL I;  3VTU A;  3B1L X;  3K9P B;  3AED B;  4WJN A;  1JWU D;  1EU3 A;  3UIP B;  1T0R C;  3Q3F A;  2CJO A;  2WXL A;  1F9J A;  4GU2 A;  4D2K A;  5D94 A;  2A5U A;  4B0M A;  1F2R C;  4TQ1 A;  2ASQ A;  4MJS B;  3B2F A;  3MJW A;  4YSY B;  1L6V A;  1GC7 A;  2KHW B;  2M19 A;  5JHA A;  1SE4 A;  3MP9 A;  1LFD A;  1Y56 A;  1L4D B;  3PZ7 A;  1E8Z A;  2SEB D;  3W1S A;  2KAC A;  1WGR A;  1TS4 A;  1K50 A;  2L3Z A;  3KUZ A;  1I7H A;  4P1B C;  2J0J A;  1ZDV A;  2Z59 B;  2G4D B;  4W9G A;  1VZ6 A;  2J0K A;  3GS2 A;  4JGH B;  1SJH D;  2DZI A;  4FHJ A;  4WH4 A;  4G3X B;  3IFW B;  4W9I A;  4HEA 1;  3ZRF A;  2OED A;  4HPM B;  4OHJ A;  2D3G A;  4BBN C;  1KH0 A;  3P4P B;  4YSX B;  2GRI A;  2N7J A;  4FXC A;  3DHH C;  2K1F A;  1F0Z A;  1NDD A;  2O2V A;  2WXO A;  1WZ0 A;  1NBF C;  3I5J C;  3I63 C;  4C80 A;  2NVU I;  2WXM A;  2CS4 A;  1KLU D;  2WXI A;  4WAF A;  2J53 A;  2LXC A;  2V4L A;  1IPG A;  1WX9 A;  2BT6 A;  1FNU A;  1EF5 A;  2KO3 A;  5C23 A;  1WFY A;  2ON8 A;  3NVZ A;  2I2Y A;  1R4M B;  4B95 A;  1FO4 A;  1RM6 C;  3Q3N C;  1C77 A;  1V81 A;  1E10 A;  2KKC A;  2KQS A;  1V80 A;  3EC8 A;  3V3X A;  5L95 C;  2PLP A;  2M1M A;  3M63 B;  2CKH B;  3VUY A;  3TEY A;  3ZNG C;  3VR8 B;  4M0W B;  1N60 A;  3UQA A;  2WNM A;  3PPA A;  3QX1 A;  4FA6 A;  2LI5 A;  4WQM A;  1IUE A;  3QAQ A;  4ZYS A;  2KWV B;  2MH7 A;  3VR9 B;  4II2 B;  1FCL A;  4WAA A;  2BWF A;  1YN5 A;  3SFE B;  3ZGZ A;  2GOW A;  1VZ8 A;  4P16 A;  2BTE A;  3A1Q B;  1DYQ A;  5GXG B;  3AE4 B;  5E6P A;  1FXI A;  5EE1 A;  1C1Y B;  2XN9 C;  2MCN B;  3BK1 A;  2ZVN A;  4L23 A;  4TMA B;  2RDH A;  3SEB A;  4C56 C;  1OQR A;  4LNK A;  2FCQ A;  2TSS A;  2R2O A;  3ZJT A;  2LVO A;  2J7Q B;  2NBW B;  3M62 B;  3OLM D;  1AW7 A;  3T8M A;  2WDR B;  2BKR B;  4GDL B;  3RNE C;  3NZS A;  4AS1 A;  1C4C A;  1ROE A;  1PYW D;  3LDZ E;  2BW2 A;  2AX5 A;  3AB5 A;  3VQI A;  4DHJ D;  2KNB A;  2C7N B;  2K22 A;  2XEW A;  2LFI A;  2EMT A;  1OGW A;  2L76 A;  2WU2 B;  2Z0D B;  5E6J A;  1I4Q A;  2MBH A;  3VHT C;  4XDC A;  3RUL A;  1TKE A;  3DVG X;  3IG3 A;  4TV3 A;  3AMZ A;  3WAM A;  2MBQ A;  2BQQ A;  2MX2 A;  2OOB B;  1F77 A;  2FCN A;  3Q3J A;  1FM0 D;  3APC A;  2IND C;  1MPE A;  1SEB D;  1VD2 A;  1ZE3 D;  1TZ1 A;  1JCK B;  1HA5 A;  2KTR B;  3A9J A;  1KFY B;  2N9K A;  3BY4 B;  1FXT B;  4KV2 A;  2BVC A;  2J0M A;  2LGY A;  2WXR A;  3M95 A;  5T8I A;  4DHZ B;  5AZG A;  4IWQ A;  5G55 A;  4X57 B;  2REX A;  3AM9 A;  4IWP A;  3AU4 A;  3BVZ A;  5CHV C;  1SF0 A;  3Q3M C;  3DDC B;  4YTP B;  2JRH A;  1KLG D;  3U8Z A;  2JU6 X;  4A3O A;  3TEX A;  4WWP A;  3T3O A;  4GN1 A;  1P7F A;  1CZP A;  1HQR D;  4OZC A;  3I3T B;  4W9K A;  3R66 C;  4NJ7 A;  3BYY B;  2Y5B B;  2ZCC A;  5FR6 A;  4MGZ E;  5EDS A;  5IP4 D;  5KHQ A;  3VXW A; 
#chains in the Genus database with same CATH homology
 4EZK A;  2KTR A;  2WWZ A;  2KTF A;  3KH0 A;  1QZE A;  3EFU A;  3ZDT A;  1G6J A;  2M17 A;  4WQO B;  4WWO A;  1E5W A;  2FAZ A;  2KVR A;  3AUL A;  4HDQ A;  3X23 A;  2JZ3 B;  4HJK A;  4IC7 B;  4EEW A;  2C7H A;  1L7Y A;  4IM2 A;  4DDI D;  3ZLZ A;  3RT3 B;  3RCZ A;  3A1Q A;  4FJZ A;  4KSK C;  2N9P C;  4YL8 A;  1C3T A;  2C60 A;  4DK5 A;  2QHO A;  2RD0 A;  2I1K A;  3KYD D;  4HWI B;  4DHJ B;  2ZPY A;  2IO0 B;  2LVQ A;  3D32 A;  5AZF A;  5TR5 A;  4HCN B;  2KDE B;  3ZDM C;  2KD0 A;  1JRU A;  3TCA A;  1UGM A;  3QC8 B;  2FID A;  2YVC A;  1GNU A;  2CU1 A;  1WGG A;  4K7W A;  3ML8 A;  3A9K A;  4IWO A;  1RLF A;  1WH3 A;  3DPD A;  3KUC B;  4EZJ A;  3CMM B;  4GOC A;  4BFR A;  2MLB A;  3U30 A;  2K6Q A;  3U7D A;  1E7U A;  2JF5 A;  1NI2 A;  2KFK A;  2N1V A;  4AP4 C;  1WM2 A;  3CF6 E;  2MWS B;  1UBI A;  4PYZ A;  5CTR C;  3L13 A;  3TL5 A;  4HCP B;  1SIF A;  3ZW3 A;  2AEH A;  1WXV A;  4MDK E;  1WXS A;  4II3 B;  3IBE A;  2M0X A;  5J2R A;  2LRU A;  5DPW A;  4GDL A;  2BYE A;  3KVF B;  3PRM B;  4I6P A;  1VCB A;  3ZRC A;  3V60 A;  2EKE C;  5AZH A;  3W1S C;  4BKS A;  2NPT A;  2GBN A;  4CYE A;  1D3Z A;  5LXI B;  1V5O A;  3RYT A;  3DVG Y;  4LJP B;  2Z0E B;  3PTF C;  1GG3 A;  2LAS A;  2ZJD A;  3PRP B;  3PV1 A;  1BT0 A;  1P0R A;  5D2M B;  1EF1 A;  4GDK A;  3TMP B;  4FLH A;  1J0G A;  1PQS A;  4AUQ C;  1J8C A;  3RZF A;  1Q0W B;  3IHP C;  2PJH A;  2L7R A;  2VRR B;  2RGF A;  5AEK B;  1K8R B;  4NAW B;  4OVV A;  4DHZ E;  4FAD A;  3P2B A;  1WMH B;  2B3A A;  2UYZ B;  4NNJ B;  5LXH A;  1V2Y A;  2IZV B;  3SD5 A;  4M8M A;  1WJU A;  3BIN A;  2K39 A;  2KJH B;  3A9K B;  4ZDV A;  3ZIM A;  1RFA A;  3V61 A;  4GB9 A;  4IUM B;  2KN5 A;  3PLV A;  2PE9 A;  3OAW A;  2AL3 A;  3NS8 A;  2G4S A;  1KJT A;  2BF8 B;  4I6L B;  3ZKJ C;  1UD7 A;  4FUL A;  2DZM A;  5D6J B;  2ZNV C;  1H4R A;  3A4R A;  4MJS A;  4ZRJ A;  2KWU B;  3VVW B;  1P3Q U;  1KLV A;  1SE9 A;  1Q5W B;  4F7Z A;  2CHX A;  3TJP A;  2RR9 A;  4G11 A;  2MRP A;  2JZZ A;  1A5R A;  1J19 A;  3PT2 B;  2WX1 A;  1ZGU B;  3MTN B;  3L0W B;  3QHT A;  2I1J A;  5IA7 A;  1WGY A;  3PHW B;  4KIK B;  2K6D B;  5D7G A;  2M4N A;  4MEL A;  4FN2 A;  3KW5 B;  3JSV B;  4EFO A;  4RM9 A;  3SU8 X;  1UBQ A;  4MGI E;  2LRW A;  2AYO B;  2PEA A;  5CX3 A;  4ANU A;  3UF8 A;  3A33 B;  4NAW A;  2ZEQ A;  3VTW A;  1R4M I;  3VUX A;  3DVN U;  3ZO5 B;  5J17 A;  4KIK A;  4MGY E;  2KAN A;  1V49 A;  3ZNZ B;  2MA9 B;  1GC6 A;  5CHF A;  4LDT D;  4AWJ A;  1U4A A;  1H8C A;  2HE7 A;  3A4S C;  2A4Z A;  2XK5 B;  1WXM A;  2KQ7 A;  2WX0 A;  4B6W A;  2O6V B;  5HKH A;  4IM0 A;  2IY1 B;  2KJ6 A;  2DAJ A;  2JVC A;  3NHE B;  2LD9 A;  2L0F A;  1ZW7 A;  4IM3 A;  3IVF A;  1I35 A;  1E7V A;  1WGD A;  4G0N B;  2EMS A;  4LJO B;  3UIN B;  4W9J A;  2PPH A;  1X1M A;  3DBS A;  4FJY A;  3C0R B;  3CSF A;  2KC2 A;  2MP2 A;  4NPN A;  5E6N A;  2M8S A;  3WAO A;  1WJ6 A;  2GBM A;  4URK A;  2NS5 A;  3VH4 B;  2LGX A;  2DYO A;  4WWN A;  3HK0 A;  3QCA A;  2KX0 A;  4GMV A;  1Y8R C;  3EHV A;  3RUI B;  1V5T A;  3QQ8 B;  3JYU A;  3DQV A;  3NY5 A;  4HVB A;  1I42 A;  4E74 A;  4EZL A;  1CMX B;  1YD8 U;  3DBL I;  4K81 A;  4MSQ B;  3R7Q A;  4E71 A;  3VTU A;  1YJ1 A;  2DHZ A;  3B1L X;  3K9P B;  4G50 A;  4W9F A;  4WJN A;  1TGZ B;  3PSE B;  2LXA A;  4XC2 A;  1IYF A;  1Z5S B;  3UIP B;  2W9N A;  3KYC D;  3UGB B;  3VTV A;  3RD2 A;  3W1Y A;  4ICU A;  1TBE A;  3N3K B;  3Q3F A;  2KMA A;  2ZPN A;  4ANX A;  1F9J A;  4GU2 A;  3TBL D;  2MSE D;  4BOS C;  3JW0 X;  5D94 A;  2A5U A;  3HIZ A;  4JLC A;  4TQ1 A;  3VFK A;  2D2Q A;  2ASQ A;  3ENE A;  4MJS B;  1TTN A;  3OJ3 A;  4WJP A;  4ANW A;  4JQW C;  3MJW A;  3PRZ A;  4W9D A;  1WR6 E;  2NBU A;  1P1A A;  4EKU A;  1GC7 A;  2KHW B;  2PE6 B;  3O65 B;  3APD A;  2O2V B;  2L0T A;  4KDL B;  5JHA A;  4NQK E;  1LFD A;  2KFK B;  1WM3 A;  1E8Z A;  2DYM A;  5CHW A;  3W1S A;  4K7S A;  4MH0 E;  3QAR A;  1WGR A;  4OVU A;  3H7P B;  2O6V D;  2L3Z A;  3KUZ A;  4PS7 A;  4W9L A;  3ZTD A;  1WGH A;  4RMA A;  2GBK A;  5DPS A;  2J0J A;  2FUH B;  2KDF B;  2KXJ A;  4KVG B;  3WAP A;  2L8J A;  4XX5 A;  2Z59 B;  2FNJ B;  3MHS D;  4W9H A;  2G4D B;  4W9G A;  1WX8 A;  4HK2 A;  2WYQ A;  2L00 B;  2J0K A;  2JXX A;  3N30 A;  3VH3 B;  4BOZ B;  4JGH B;  1KM7 A;  1WMH A;  2LGD A;  2DZI A;  2NBV B;  2XBB C;  4FHJ A;  4GIV A;  4BKG A;  2JUO A;  1E8X A;  2N9E B;  3M3J A;  2OJR A;  3IFW B;  3QWZ B;  4G3X B;  4TQ0 A;  4W9I A;  4DXA B;  4HDO A;  2D07 B;  3L54 A;  4NQL B;  3ZRF A;  4HPM B;  3EEC A;  5GMV A;  2D3G A;  4BBN C;  4EUT A;  2L05 A;  2FCS A;  1WE7 A;  2K1F A;  1V6E A;  2KX3 A;  4KDI C;  2NPT B;  1NDD A;  1E8W A;  2O2V A;  1KOT A;  2HJ8 A;  4ZRI A;  3RZW C;  1XD3 B;  1L2N A;  1WZ0 A;  1NBF C;  2DZK A;  3B0A A;  2C7M B;  1WZ3 A;  3CST A;  2G45 B;  1RAX A;  4FJV B;  1ZKH A;  3PGE A;  2MQJ A;  3L10 B;  5DCN A;  3B08 A;  1S1Q B;  3PVL A;  2BPS A;  2NVU I;  2CS4 A;  4RM8 A;  2LZ6 A;  2D10 A;  4A3P A;  4MGK E;  1YIW A;  1V9J A;  2LXC A;  4AJY B;  4F8C B;  2V4L A;  4P7I A;  4B9K A;  1IPG A;  2UWQ A;  3HHM A;  1WX9 A;  4GSW A;  2KWC A;  1EF5 A;  4GXB A;  2KO3 A;  2BGF A;  3PHX B;  5C23 A;  1WFY A;  2K8C A;  1M94 A;  3PS6 A;  4AJW A;  4B95 A;  3QJZ A;  3VAW A;  4ASW C;  1WRD B;  2KLG A;  3S2A A;  1S3S G;  2JY6 A;  3ONS A;  4PS8 A;  1XT9 B;  4N9F 4;  1V81 A;  2LUE A;  4MM3 A;  2KKC A;  1YQB A;  2KQS A;  1V80 A;  3DVN V;  3EC8 A;  4NY0 A;  2FCM A;  4CO7 A;  4ZYN A;  4BVU C;  5L95 C;  1E90 A;  2C9W B;  4IW0 A;  2M1M A;  3M63 B;  2CKH B;  3PRE A;  3VUY A;  4TUU A;  3SDL C;  3ZNG C;  1LM8 B;  2GBR A;  3GOE A;  1OQY A;  2ZNV B;  4M0W B;  3VDZ A;  1XQQ A;  3UQA A;  2JWZ A;  4W9C A;  3PPA A;  3QX1 A;  2MBE A;  4FA6 A;  2LI5 A;  2N1W A;  1WXA A;  1GJZ A;  2V1Y A;  1YX5 B;  3WAN A;  4XZ4 A;  3QAQ A;  3JSV A;  1ISN A;  1HE8 A;  2DX5 B;  2KWV B;  3L17 A;  4W9E A;  3JVZ X;  2MBO A;  2ZVO A;  4II2 B;  1RRB A;  3PLU A;  4WAA A;  2BWF A;  3L08 A;  2MW5 A;  4FBJ B;  1Z2M A;  4HPL B;  2GOW A;  5E6O A;  1WR1 A;  3ZNH B;  2G3Q B;  2IO3 B;  4K1R B;  4F1S A;  3QK0 A;  3A1Q B;  4KZ0 A;  4EOY A;  2D11 A;  2XK5 A;  4IG7 B;  2DYB A;  4PYU A;  5E6P A;  5JHB A;  2AL6 A;  1C1Y B;  2MCN B;  1SGH A;  2RPQ A;  2ZVN A;  2KK8 A;  4DDG D;  2HD5 B;  5J18 A;  3ZTC A;  2CHW A;  4LDT B;  4JIO U;  4E3C A;  1WYW B;  3ZNI D;  4MSM B;  3NOB A;  2MP2 B;  3H7P A;  3H6N A;  3N32 A;  2FCQ A;  1UEL A;  1OTR B;  4BKT A;  2R2O A;  2LVO A;  2K25 A;  2J7Q B;  2NBW B;  2WDT B;  4ZRK A;  3M62 B;  3OLM D;  4MEM A;  2LJ5 A;  2V3S A;  1WF9 A;  2BYV E;  2JT4 B;  3T8M A;  2GMI C;  4BKS D;  2JPH A;  2BKR B;  2AWT A;  2K8H A;  2NR2 A;  2ZZP B;  3HM3 A;  3NZS A;  4GDL B;  5G2N A;  4AOF A;  2CR5 A;  5C1Z A;  2KLC A;  4JL9 A;  1R4N I;  3ZVV A;  3LJ3 A;  3L16 A;  4KSL C;  4ANV A;  3PZD A;  1Q1O A;  3LDZ E;  4GDK B;  1OEY J;  4A20 A;  3UQB A;  1WX7 A;  1V86 A;  4J6I A;  1EUV B;  3X0W A;  3ZUN A;  3VQI A;  4WJO A;  4DHJ D;  2KNB A;  3V62 A;  4K7U A;  3SHQ A;  2C7N B;  2XEW A;  2EMT A;  3K9O B;  2KOX A;  3DOW A;  1OGW A;  2DZJ A;  1OEY A;  2L76 A;  2Z0D B;  3WIM A;  4BBN F;  2LWP A;  4DWF A;  1IP9 A;  2NCN A;  1WE6 A;  3ALB A;  4HLE A;  2JRI B;  2KDB A;  3DBR I;  1WY8 A;  5KHO A;  2K8B A;  4PS3 A;  3VUW A;  4I6N B;  2MBH A;  1AAR A;  4ICV A;  3QA8 A;  2BWE S;  2IYD B;  3VHT C;  4CHK A;  3DBH I;  2DEN B;  1GUA B;  3T9L A;  3QIJ A;  2BYF A;  4NJ6 A;  3RUL A;  3DVG X;  1YX6 B;  3IG3 A;  4TV3 A;  3WAM A;  2MBQ A;  2GBJ A;  2N9X A;  2MX2 A;  1MG8 A;  2OOB B;  2FCN A;  3Q3J A;  1LXD A;  3APC A;  4GGQ A;  2KJR A;  1VD2 A;  1TZ1 A;  2KTR B;  2KZR A;  3A9J A;  3BY4 B;  3R7R A;  4WJQ A;  4DBG A;  1FXT B;  2C5L C;  2HTH A;  2IO2 B;  3WA0 A;  5LLI A;  4KV2 A;  3APF A;  5IAA C;  2J0M A;  1P98 A;  2LGY A;  3H1U A;  2R2Q A;  3M95 A;  4DHZ B;  5AZG A;  1WIA A;  3H7S A;  4IWQ A;  5G55 A;  4X57 B;  2KMC A;  4M8N A;  2KDI A;  4TKN A;  3A9J B;  3KUD B;  5L83 A;  2REX A;  5DPT A;  2N7E A;  3AU4 A;  4IWP A;  5CHV C;  5DPR A;  2KC1 A;  3TIX A;  2LVP A;  1P9D U;  2CHZ A;  3DDC B;  2O6V A;  2JRH A;  2FIF A;  4FHK A;  3U8Z A;  3AXC A;  3V6C B;  4HXD A;  2MBB B;  3HM6 X;  1EO6 A;  4A3O A;  3GZN I;  5JZE B;  1WI0 A;  5BO4 B;  3UIO B;  4WWP A;  2N4F A;  4KZC A;  2IO1 B;  3ML9 A;  2BKF A;  4GN1 A;  3AI5 A;  3ECI A;  2IBI B;  2N7D A;  1E8Y A;  2ZCB A;  3DCG A;  2DAF A;  5JH5 C;  3I3T B;  3R3M A;  4W9K A;  3R66 C;  3AU5 A;  4NJ7 A;  1LQB A;  3WAL A;  2Y5B B;  3OJ4 B;  1UZX B;  1WJN A;  1UH6 A;  1WJ4 A;  2ZCC A;  5FR6 A;  1T0Y A;  3H9D A;  4LCD E;  4MGZ E;  5EDS A;  3NZU A;  3V6E B;  2KFJ A;  5KHQ A;  2RSU A;  3VXW A;  2IY0 B;  2YLM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...