3M62B

Crystal structure of ufd2 in complex with the ubiquitin-like (ubl) domain of rad23
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
SLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin conjugation factor E4
publication title The yeast E4 ubiquitin ligase Ufd2 interacts with the ubiquitin-like domains of Rad23 and Dsk2 via a novel and distinct ubiquitin-like binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase/protein binding
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m62B00
4HCNB 3L08A 5AZHA 1FXTB 2GOWA 1UZXB 3JVZX 1P1AA 4ANWA 1IPGA 2AL6A 4KSKC 2RGFA 4G11A 4KV2A 5JZEB 3CSFA 3UQBA 1YX5B 2MX2A 4K7SA 5E6NA 4AWJA 4B9KA 3DDCB 3BINA 5L83A 4WWPA 2OJRA 2EKEC 4W9KA 1H8CA 1KM7A 2IO1B 3KH0A 2KX0A 3DCGA 1J0GA 1WMHB 5D94A 3S2AA 4G50A 3A1QA 3VAWA 4NAWB 1UH6A 2HJ8A 2DX5B 2MSED 4ZRKA 1WI0A 3UF8A 3ZNGC 1YQBA 3KW5B 4GB9A 4JL9A 2MBEA 4OVVA 2KK8A 2C7MB 2KXJA 4FN2A 4TQ1A 2LVPA 2CHZA 1OTRB 4ICUA 1V81A 1P98A 3QC8B 1T0YA 2JZZA 1WJNA 2WX1A 1CMXB 2Y5BB 3B1LX 4W9CA 4W9GA 1XQQA 1E5WA 2LXAA 2N1VA 2ZVOA 4GU2A 4WWNA 1YX6B 5BO4B 3EC8A 2NS5A 4GDLA 1I35A 4GDKA 3H7PA 3TIXA 3C0RB 1YD8U 3PSEB 3RUIB 3A1QB 3PT2B 3V6CB 2FCMA 2KHWB 1E8XA 4K7WA 3V62A 4OVUA 5CX3A 2NBVB 1UBQA 2V3SA 3PRMB 4MSMB 3KYCD 2C7NB 2RSUA 4FJZA 4HJKA 3RCZA 2KNBA 3DPDA 4XZ4A 4GIVA 1KLVA 1L2NA 1WE6A 1G6JA 2HE7A 2O6VA 4LDTD 4ZYNA 4EZLA 2D10A 4MSQB 4IG7B 4KZ0A 4XX5A 4MGIE 1WY8A 4MGYE 3KUDB 2CS4A 2GBKA 5JHAA 4MGKE 2NR2A 3I3TB 2N9XA 4GDKB 4XC2A 4EZKA 3VH3B 3H7PB 4F1SA 1WZ0A 3NZSA 4BKSA 1LXDA 4LJOB 4TKNA 2JT4B 4GSWA 4EKUA 5CTRC 1E7UA 1J19A 3HK0A 1VCBA 2KLCA 3PRZA 5AZFA 4MGZE 1AARA 2K6QA 3CMMB 1V6EA 3A4SC 4FJYA 4A3OA 2KX3A 4W9EA 2KANA 2CKHB 3VUYA 4ZRJA 1OQYA 3R7RA 2BYFA 4DK5A 2FIDA 2FUHB 3QHTA 2D3GA 4F7ZA 1C1YB 2O6VB 5C23A 4KIKB 2N7DA 5KHOA 3ZTDA 4FJVB 3QIJA 1QZEA 3JYUA 4ZRIA 3M3JA 2KKCA 3OAWA 3PHWB 5LXHA 4W9IA 5D7GA 5LLIA 3W1YA 3ZVVA 1WX9A 4IWPA 2Z59B 2DZMA 4EFOA 5JHBA 4WAAA 2ZPYA 4URKA 2HD5B 4IWOA 1WF9A 2OOBB 2O2VA 3DBLI 2N9EB 2LRUA 1WXVA 2BYVE 2DAJA 2K39A 2ZNVB 4KSLC 4BKTA 4IM3A 1ZGUB 1S3SG 2LVOA 2LWPA 5AEKB 4W9JA 2FAZA 2MCNB 4W9FA 2LZ6A 2KTRA 5D2MB 3M63B 3ENEA 3NY5A 1RRBA 2DHZA 3APCA 5DCNA 2J0MA 2NCNA 2YLMA 3L17A 3DBHI 5CHVC 3PTFC 3WALA 4DHJD 2NBWB 1WGGA 4IWQA 2M0XA 2KDFB 3RT3B 2DZKA 4PS3A 1WH3A 2BKFA 4DBGA 4GOCA 2ZNVC 2ZCBA 2KC2A 4KDLB 3VHTC 4II2B 1XD3B 4IW0A 3X23A 3ZKJC 4M8MA 1EF5A 3EFUA 2GBJA 3ML8A 2DYBA 3Q3JA 3UIPB 2O2VB 4N9F4 2DZJA 3H7SA 3KUCB 3VUXA 2KWVB 1EO6A 2L0TA 3DBRI 3HHMA 3LJ3A 3W1SC 4W9LA 2M1MA 1V5TA 2KWCA 2DAFA 2FCSA 4E74A 2LD9A 1RLFA 4JLCA 3R7QA 2KTRB 3B08A 2KN5A 2KDIA 1Z2MA 3AU5A 4BBNC 1TBEA 4BBNF 3H9DA 3QA8A 3DBSA 3R3MA 4MDKE 4WJNA 3PGEA 2UWQA 3NS8A 4JIOU 2KWUB 4AJYB 2MBBB 2DENB 3UGBB 4DDID 3N30A 4WWOA 4E71A 4FA6A 3U8ZA 1RFAA 1Y8RC 5C1ZA 1YIWA 2DYMA 1TZ1A 1KJTA 2MWSB 1ZKHA 1ISNA 3GOEA 5DPWA 2LXCA 2JRIB 4NJ7A 2GBNA 2AWTA 3VUWA 4EUTA 3AULA 3WA0A 2B3AA 1WXSA 3WAOA 3Q3FA 3AU4A 4B95A 4MEMA 2KVRA 3SU8X 4DHZE 1ZW7A 1Q0WB 1F9JA 5FR6A 1UGMA 1WIAA 4EEWA 2KDBA 2FNJB 4X57B 2NPTA 2KFJA 3HM3A 2AEHA 3ECIA 1SE9A 2JWZA 4MJSA 2G4SA 4MELA 2M17A 4AOFA 1WFYA 2CHWA 4RMAA 1WM3A 5J18A 2O6VD 2BF8B 1V80A 2IY1B 3MTNB 3NHEB 4II3B 2A5UA 3V60A 4WJOA 4EOYA 2ZVNA 1EUVB 4DDGD 1E8ZA 2RPQA 2D11A 5DPRA 1K8RB 2WWZA 1TTNA 1WR1A 2AL3A 3ZO5B 2J0JA 4PS8A 1NI2A 1WGYA 2PE6B 3M95A 4GDLB 2J0KA 3HIZA 3U30A 2NPTB 2L0FA 2K8HA 2L76A 2MA9B 2A4ZA 3A33B 1R4MI 3OJ4B 1GC6A 2FCQA 2EMTA 4W9DA 1UELA 1WGRA 5EDSA 2WX0A 1Q5WB 3ZNHB 3DQVA 4ZDVA 4YL8A 2KO3A 3VTVA 3PS6A 1LQBA 3L0WB 4B6WA 2ZEQA 3M62B 4K81A 3LDZE 2JZ3B 3QJZA 1GUAB 2UYZB 2C7HA 1UBIA 3H6NA 4HWIB 1OEYJ 2ZZPB 3PZDA 4HK2A 4MM3A 1TGZB 3KYDD 5IA7A 4IM2A 1LM8B 2JPHA 4I6LB 4BKGA 3QK0A 3WAPA 5JH5C 1RAXA 2K1FA 3QCAA 3PRPB 3RZFA 2KLGA 4WJQA 2RD0A 4LCDE 2R2QA 5L95C 5J2RA 2N1WA 2JXXA 4FLHA 4NQLB 3NOBA 4NPNA 4HLEA 2D2QA 3H1UA 1E8WA 4BOZB 3RULA 5G2NA 3TL5A 2C9WB 3AI5A 1XT9B 2KJ6A 2DZIA 3QAQA 4DXAB 4LJPB 3MHSD 1E7VA 2LUEA 2W9NA 3DVGY 4F8CB 4LDTB 2WYQA 2IO0B 3ZIMA 1E90A 3DVNV 3JW0X 4P7IA 4TV3A 4BFRA 2CR5A 2L3ZA 3D32A 2LGYA 4GN1A 4WJPA 1L7YA 4BVUC 3B0AA 4GGQA 2I1KA 4G0NB 1BT0A 4FBJB 1PQSA 5GMVA 3UINB 2MLBA 2L7RA 1D3ZA 4HCPB 2FIFA 2Z0EB 3L10B 3BY4B 4HPLB 2K8BA 2LVQA 1IP9A 2K8CA 1NBFC 3T9LA 3P2BA 3MJWA 4IM0A 3VQIA 5CHWA 3X0WA 5J17A 2L00B 3IVFA 3V6EB 5HKHA 2RR9A 2PPHA 3ZUNA 2KJRA 2LASA 3CSTA 2KMAA 2BKRB 4ASWC 3IG3A 4PYZA 2MQJA 2XK5A 2IZVB 2DYOA 2JVCA 2QHOA 3A4RA 4NNJB 3APDA 3IHPC 3QWZB 2MBHA 2BPSA 3KUZA 2WDTB 1HE8A 1WR6E 2IO3B 3A9JA 3SD5A 3PPAA 2MP2A 2CHXA 2AYOB 4NY0A 4HVBA 1V2YA 2G45B 2LRWA 1S1QB 1KOTA 3ONSA 3ZRCA 3WIMA 2J7QB 2GMIC 2CU1A 2PE9A 2ZPNA 3ALBA 1H4RA 1UD7A 2HTHA 4HDQA 5TR5A 1P3QU 3OLMD 3ZNID 5DPSA 4DWFA 1WYWB 3R66C 4WQOB 2N4FA 3QX1A 4EZJA 4DHJB 1WE7A 1Z5SB 2C5LC 3L16A 2XK5B 3VVWB 1WZ3A 2K6DB 4I6NB 4KDIC 3UQAA 3DOWA 3K9OB 4KVGB 2LJ5A 4A3PA 1WJUA 3DVNU 2NBUA 4A20A 3SHQA 1V86A 4K7UA 3A9JB 1VD2A 2L05A 4GXBA 2MP2B 4RM8A 3EHVA 5LXIB 1IYFA 1WJ4A 3VTWA 4FADA 2KC1A 2ZJDA 3HM6X 4RM9A 5DPTA 3PLVA 2JY6A 3SDLC 3ZW3A 5AZGA 2L8JA 1SGHA 1GJZA 1JRUA 1MG8A 2JUOA 3T8MA 3ZDMC 4BKSD 4ANUA 1A5RA 3JSVA 3OJ3A 1WGHA 4IC7B 3VFKA 3ZNZB 2KFKA 2BWES 4PS7A 4G3XB 1P0RA 2NVUI 4JQWC 1C3TA 3ZTCA 5E6OA 2K25A 1WJ6A 3TJPA 2LGDA 4MJSB 4AJWA 2MBOA 2IO2B 4NQKE 2KQSA 2KJHB 2Z0DB 4CO7A 2JF5A 1WM2A 1WX7A 3L13A 4PYUA 4ANXA 4KIKA 3VDZA 4NJ6A 2ZCCA 2KTFA 1X1MA 4MH0E 3QARA 1LFDA 4I6PA 3PHXB 2GBMA 2M8SA 3WANA 2N7EA 5D6JB 4E3CA 4HPMB 3WAMA 3UIOB 3JSVB 4TUUA 2KFKB 2BYEA 1V5OA 3L54A 3N3KB 4IUMB 3V61A 2PEAA 4TQ0A 3IFWB 2IBIB 2GBRA 1GG3A 2MW5A 3U7DA 3KVFB 2FCNA 3A9KA 1P9DU 2VRRB 2XBBC 3NZUA 1WRDB 1M94A 3VXWA 4M8NA 2LGXA 5KHQA 4AUQC 2MRPA 3PLUA 3W1SA 4FULA 1U4AA 4JGHB 3PREA 2PJHA 2ASQA 2REXA 4W9HA 1YJ1A 2V4LA 3RD2A 3TBLD 1V49A 3APFA 2V1YA 1V9JA 2KMCA 1WXAA 2EMSA 1Q1OA 2M4NA 2N9PC 1EF1A 3IBEA 2LI5A 2D07B 4FHKA 4AP4C 4CYEA 2YVCA 2KQ7A 3CF6E 3ML9A 2I1JA 4ANVA 2KD0A 1SIFA 5IAAC 4K1RB 2G3QB 3GZNI 5CHFA 1NDDA 2R2OA 4HXDA 4M0WB 4KZCA 3A9KB 1R4NI 3ZRFA 2IYDB 2C60A 2MBQA 2XEWA 2BWFA 2KDEB 4CHKA 3VTUA 3DVGX 3N32A 1E8YA 1WXMA 3ZDTA 4FHJA 4BOSC 1GC7A 4J6IA 3ZLZA 2IY0B 2KOXA 3O65B 5G55A 3RYTA 3PVLA 3PV1A 5E6PA 3AXCA 4HDOA 2JRHA 3K9PB 1OGWA 1WGDA 1WX8A 3TMPB 1I42A 3QQ8B 1WMHA 2KZRA 1GNUA 1OEYA 3TCAA 2BGFA 3VH4B 2G4DB 3RZWC 1J8CA 4GMVA 4NAWA 4DHZB 3EECA 4ICVA
chains in the Genus database with same CATH superfamily
4HCNB 1FXTB 1E10A 1TY2A 1R4MB 3AM9A 4KV2A 4K3BA 4B9KA 3BINA 5L83A 3KH0A 2KX0A 1N6ZA 2WXQA 1J0GA 3N20C 1WMHB 3S2AA 3AEGB 3U2SC 3A1QA 2JX5A 4NAWB 4C4VB 1D4BA 1WI0A 1DOXA 4GB9A 3AH7A 1VDVA 3EFCA 2C7MB 3T3OA 2KXJA 1TKYA 3P63A 2V9HA 3QC8B 2NTSA 2QMTA 1V1PA 2WX1A 1VZ6A 3B1LX 4WWNA 1E5WA 2LXAA 2ZVOA 5BO4B 4TMAB 4GDKA 3DHIC 3TIXA 4OW0A 3NVVA 1WXQA 3NUHB 3I57A 1N61A 2LJIA 1QT9A 5BMGA 1V97A 3AE5B 4MSMB 2JU6X 3Q2AC 1XO3A 2KNBA 3DPDA 4XZ4A 4GIVA 3FKYA 5BMHA 1WE6A 2HE7A 1XF5L 4JE3B 4ZYNA 3AE3B 1N5WA 1WY8A 3KUDB 1YOVB 3ZGZA 5JHAA 4RGMA 4MGKE 2NR2A 4XC2A 5FK9C 3H7PB 1WZ0A 1JRPA 4TKNA 3ZJUA 1J19A 3HK0A 1VCBA 3Q3MC 2M19A 4MGZE 3SEBA 2BYFA 2LHEA 2FIDA 3QHTA 4FJVB 3QIJA 3M3JA 2KKCA 3OAWA 4W9IA 1XLOA 4EFOA 5JHBA 2KAJA 2ZPYA 4URKA 2L1AA 1WF9A 2K39A 2ZNVB 4KSLC 4IM3A 2LVOA 5EE1A 1N62A 3NZ3A 2MCNB 4W9FA 3M63B 4LTUA 3L17A 2YLMA 4LK0M 1K51A 4DHJD 3PTFC 4OZCA 3RT3B 1XEEA 4DBGA 2ZNVC 2ZCBA 4II2B 3ML8A 2GBJA 3VUXA 3KUCB 2L0TA 4LLGM 2M1MA 2DAFA 2FCSA 1RLFA 2WDVB 2I38A 3TUOA 1R7SA 3QA8A 4MDKE 3R3MA 3NS8A 4DDID 4AJYB 3UGBB 4JX1C 1ROEA 3RMKC 4IOIE 3OWEB 1KJTA 2TSSA 3C8YA 1ISNA 2JRIB 4NJ7A 2AWTA 4WH4A 1FM0D 2WXKA 5IOIA 1CQVA 3DHHC 3Q3FA 3WAOA 4B95A 3SU8X 2KVRA 1WRIA 1E9MA 2WXHA 1AYFA 3PZ8A 1F9JA 1GOZA 1HTOA 2KDBA 2FNJB 1KRHA 4X57B 1FEHA 5BMIA 2GI9A 4RGOS 4MELA 4AOFA 3RNBC 2H89B 3GZNB 2O6VD 2BF8B 3BWUD 1V80A 2IY1B 4XDDA 4II3B 3N1YC 4MACA 1YNTE 2A5UA 3V60A 4WJOA 4EOYA 2D3AA 1E8ZA 2D11A 1I4HA 2QCZA 3M95A 3KWVA 1IGCA 1ZE3D 1TIFA 2NPTB 1QOAA 2L0FA 1HQRD 1QILA 2MA9B 3OJ4B 2FCQA 2SEBD 4W9DA 1UELA 3VRBB 2OHFA 1KLUD 4YL8A 3VTVA 3FILB 1J7CA 1LM8B 2JPHA 2M0AA 4BKGA 4R3DA 5JH5C 4WJQA 2N1WA 4FLHA 1E8WA 4BOZB 1QKZA 2IGGA 5EE9A 2W9NA 4LDTB 4MM3B 4TV3A 4BFRA 2ZW1A 3GE8C 4GN1A 1FXAA 4GGQA 2I1KA 1ACCA 5GMVA 3UINB 1D3ZA 1FNUA 2Z0EB 3L10B 3GB1A 2V4IB 3DHGC 3MJWA 4IM0A 3IAM1 2QILA 4KGSA 5C2TB 5HKHA 2KJRA 4L1BA 4RFBA 2BKRB 3MC9A 2QHOA 4NNJB 3IHPC 2J52A 2DBYA 3KUZA 2WDTB 3KQ4A 1HE8A 1WR6E 4C80A 2MP2A 4NY0A 1F2RI 1I4PA 1RYJA 3ONSA 5GXGB 3LXFA 2CU1A 3ALBA 1UD7A 4WIPA 4WQOB 2ZW0A 2N4FA 3QX1A 2CU3A 1NENB 1FMAD 1Z5SB 1OQQA 1WZ3A 2WU2B 3DVNU 4A20A 3P1MA 1QOBA 1V86A 4K7UA 1VD2A 5LXIB 4FXCA 4WAFA 3AMZA 1HTQA 2KC1A 2KWDA 1GPXA 3SDLC 2JY6A 3ZW3A 1ZPSA 1MHHE 2L8JA 1E7PB 3T8MA 3ZNZB 4JWUC 1VZ8A 3W9CB 3FAHA 2MHJA 3TJPA 4A8XC 2KJHB 3AE1B 1IBXB 1RFKA 4MH0E 3PHXB 3WANA 3AE2B 2N7EA 5D6JB 4HPMB 3WAMA 4DXFA 2W3SA 2KFKB 1V5OA 3L54A 2KN4A 2GBRA 4M0WA 3A9KA 1P9DU 2VRRB 2L52A 1WRDB 3AV8A 2LGXA 2RDGA 3E9SA 3W1SA 3I63C 2PJHA 2REXA 1YJ1A 2V4LA 3BVMA 4K3CA 1DOIA 1I4GA 5I4DA 2EMSA 3IBEA 2D07B 4KKIA 1VZ7A 2YVCA 1FCCC 3ML9A 1L0YB 1SIFA 4N6EB 1NDDA 2R2OA 2BYTA 2C60A 2XEWA 4CHKA 1XCTL 1E8YA 2PIAA 1GC7A 3PV1A 5E6PA 2JRHA 1WX8A 4A9AA 1I42A 1WMHA 2G4DB 4NAWA 4DHZB 1C77A 3PO0A 4NJCA 4C4VA 1OFFA 5AZHA 2GOWA 1UZXB 1P1AA 1IPGA 1UWMA 2MJ3A 2AL6A 5JZEB 3CSFA 3UQBA 1YX5B 4AWJA 2OJRA 5D3IB 1ENFA 2H88B 2WDQB 4KX6B 4G50A 3VAWA 2IJ0A 3BK2A 2HJ8A 1TZOA 1ZP0B 3UF8A 3ZJTA 1AWDA 4JL9A 5FR3A 4JPSA 1TKEA 4OVVA 2KK8A 2BVCA 4FN2A 2LVPA 3SR6A 2PVGC 1OTRB 2Y5PA 4HEA1 1IUEA 1WJNA 4IKGA 4W9GA 4PT5A 2NS5A 3RNCC 3H7PA 3C0RB 1JROA 3V6CB 5D3DA 1ZDVA 2BB5A 4XE0A 1E8XA 4K7WA 1STEA 3RI7C 4NAMA 2MEKA 2WHIA 1KLVA 4H2AA 4RF1A 1G6JA 4LDTD 4MSQB 1EU3A 4XX5A 2AQ1B 4MGYE 1C76A 2CS4A 3V05A 2N9XA 4PK1A 3VH3B 3NZSA 1LXDA 4LJOB 2G9HD 5CTRC 3PRZA 2VH1A 3CMMB 2LGIA 4FJYA 2KX3A 3U7ZA 2KANA 2CKHB 4ZRJA 2FUHB 1WGKA 2AX5A 2D3GA 4F7ZA 2O6VB 3SFEB 2N7DA 5KHOA 4N58A 3NVYA 2WDRB 5D7GA 5LLIA 3W1YA 4ACFA 3ZVVA 3ZJVA 4IWPA 4US8A 1JWBD 3DBLI 1M4VA 2LRUA 1K53A 1WXVA 2BYVE 2LUMA 2LWPA 5AEKB 4W9JA 2LZ6A 2INCC 3APCA 5DCNA 2NCNA 5CHVC 2NBWB 2N9KA 4IWQA 2KDFB 4TSSA 4PS3A 4KDLB 3X23A 4M8MA 3EFUA 3Q3JA 1F0ZA 3H7SA 2KWVB 3DBRI 4OVZA 3W1SC 2WGSA 1ZXHA 1PDXA 4E74A 2LD9A 1XLQA 4YT0B 1Z2MA 1NYQA 3H9DA 1L4ZB 5BYSA 4WJNA 3PGEA 1HZ6A 2UWQA 2QSDA 2KWUB 1HA5A 3J9CA 3N30A 4WWOA 3U8ZA 1RFAA 2WU5B 2DYMA 1TZ1A 4BAXA 3MHZA 1FIQA 1ZKHA 2KQ4X 3VUWA 4EUTA 3AULA 2B3AA 3NRZA 2RPVA 1Q0WB 2WXPA 3I5JC 1PGBA 1KH0A 2ICIA 2NPTA 2HDEA 3BYTB 3ECIA 2JWZA 4MJSA 1RWSA 2INDC 2FUG1 2PKOA 3FILA 1WSPA 2ZVNA 1JQ4A 2WWZA 3ZXVA 3ZO5B 2QJLA 1NI2A 3DWMA 4ZOHC 2AQ2B 1T0SC 1L6VA 3U30A 2QIEB 2L76A 2A4ZA 3A33B 1FO4A 1WGRA 2FE8A 5FKAC 1LQBA 1Q10A 4K81A 3M62B 4US9A 3LDZE 2JZ3B 3QJZA 1FRRA 5MPOA 3R2TA 2C7HA 1OEYJ 4MM3A 1TS2A 4I6LB 3QK0A 2K1FA 5T8IA 3RZFA 1AN8A 4LCDE 4L2YA 4P1CC 3P42A 4DXGA 4C7ZA 2D2QA 4IDIA 3RULA 4S0RA 3TL5A 3ETRA 1QLBB 2KJ6A 3I9V1 1BUIC 4LJPB 4F8CB 1E7VA 2IO0B 3IT6B 4KGRA 1E90A 3DVNV 4L23A 2CR5A 3IXSA 1L7YA 2NMQA 1ESFA 4FBJB 1PQSA 2BS3B 1I4XA 1IP9A 3R2IA 3Q8CA 1NBFC 3T9LA 1C4AA 1XLPA 3V6EB 5HHDG 1LO5D 2LASA 3CSTA 3IG3A 4PYZA 2R61A 1PGXA 5E6JA 4XWWA 2IZVB 2DYOA 1KLGD 3APDA 3QWZB 2MBHA 3AEBB 1D5MC 1L0VB 2IO3B 3PPAA 2AYOB 1PUTA 2W3RA 3WIMA 2XNAC 5DPSA 4DWFA 2LGSA 2K3UA 2DLBA 3L16A 1WE7A 1YJJA 2XK5B 1HXYD 1ET9A 3NS1A 1ZOYB 4KVGB 1B1ZA 1P7EA 1KF6B 3A9JB 3DBLB 2L05A 3RFZB 3EHVA 1MG4A 1IBXA 1WJ4A 4FADA 2N9LA 1FRDA 2ZJDA 2GLSA 3PLVA 2ACZB 1FNVA 1SGHA 3HVZA 3LYYA 4ANUA 1A5RA 4IC7B 3VFKA 4B0EA 1MHXA 2KFKA 4G3XB 1P0RA 1GAQB 5E6OA 2K25A 2XN9C 2L32A 4MJSB 5TSSA 2JXTA 3IT4B 3L13A 4ANXA 4NJ6A 5C3JB 3QARA 1LFDA 4I6PA 2LHDA 2PTLA 1FXIA 3N3KB 4XGAB 3V61A 2PEAA 1C9FA 4D2KA 2IBIB 3E56A 2MW5A 3U7DA 2AQ3B 3KVFB 2FCNA 4ITKA 3CWIA 1YJIA 3VXWA 4Q2JA 4M8NA 5KHQA 4AUQC 2D5GA 4JGHB 1U4AA 3NJTA 3APFA 3Q3OC 1F77A 4LNOA 2KMCA 1Q1OA 2YEPB 4AQ7A 1N5XA 2KQ7A 3LB8C 1SIJA 2KD0A 2UU7A 2FBWB 4FHJA 4LNIA 4RGNA 3O65B 5G55A 3PVLA 2WXGA 1OGWA 3RNEC 3QQ8B 1GNUA 1UGJA 1UNSA 3RZWC 1D5XC 1A70A 1J8CA 4GMVA 2GB1A 3JVZX 4ANWA 4A6QA 3BIID 4KSKC 4G11A 1MFWA 3NVZA 2BS2B 3TEWA 3EA6A 2EKEC 4HKQA 3H8HA 4YTNB 1KM7A 4RH6A 3DCGA 1UH6A 1JWSD 1NI3A 1NEKB 2D3CA 3Q8BA 3RNGC 2CHZA 1V81A 1P98A 4UDUC 1T0YA 2Y5BB 4W9CA 1XQQA 4GU2A 1YX6B 1I35A 1KTKA 1J7AA 3FC4A 3RUIB 2FCMA 2KHWB 2D3BA 3V62A 1SF0A 5CX3A 2RSUA 3Q8EA 1OQRA 1ZUD2 3RNFC 2CJOA 2O6VA 2Z8LA 2D10A 5IKCM 4P6VF 1T5XD 4MGIE 3BYYB 1EWYC 4F1SA 3W5UB 1QF6A 2JT4B 4GSWA 1E7UA 2VZKB 2KLCA 1AARA 2K6QA 4BZAA 2BBCA 3A4SC 4W9EA 2G1EA 3TSSA 3VUYA 3EGRA 2K9XA 3Q8AA 1ZXIA 1QZEA 3JYUA 4ZRIA 4KGTA 5LXHA 3U4EG 2Z59B 2HD5B 3P4PB 2N9EB 3VRAB 3P4QB 1ZGUB 3AECB 3AE4B 2FAZA 5D2MB 2QEJC 5BYRA 1RRBA 1CJEA 1TS4A 3ZYYX 2N7JA 4ZHPA 2OJWA 1WGGA 1XCQL 2LMCA 2DZKA 1JWMD 2BKFA 2K22A 3VHTC 4IW0A 2EELA 1EF5A 1I4RA 2O2VB 3HHMA 1EO6A 3LJ3A 1SJED 4W9LA 4YSZB 4YSYB 1V5TA 2KWCA 2KVZA 3R7QA 2KTRB 1FPYA 2KDIA 1TBEA 3DBSA 1VR9A 3ZXRA 5C1ZA 1MVKA 3GOEA 1D6EC 2LXCA 1CZPA 2GBNA 3WA0A 1WXSA 3GP7A 3AE8B 2BB6A 4MEMA 4DHZE 1UGMA 2PLPA 1YQ3B 2K5PA 1F52A 1C4PA 4EEWA 4GLSC 3L4PA 1L5PA 5G5HA 1TKGA 1QOFA 1WFYA 1Y56A 2CHWA 4RMAA 1TYGB 5J18A 3MTNB 4C00A 1TT5B 4DDGD 4RCOA 1JMLA 1VLBA 5DPRA 3MP9A 1WR1A 2J0JA 4PS8A 3Q14C 3RPFC 4A55A 4USAA 1SBBB 2K8HA 2NTTA 3DWGC 4OZAA 1GC6A 2EMTA 5EDSA 3DQVA 4ZDVA 2WXFA 4B0MA 4B6WA 2ZEQA 1GUAB 2UYZB 3UI3A 3H6NA 1UBIA 5IA7A 3KYDD 1UWXA 4IM2A 2BTEA 3WAPA 3QCAA 2JZPA 2KLGA 2RD0A 2R2QA 5L95C 3ZQ4A 2W54A 4HLEA 1F2RC 2JSVX 1FFUA 2BW2A 1LGRA 2JWUA 2LFIA 2IGDA 3ZIMA 2LGYA 4WJPA 4BVUC 2WXOA 4ZYSA 1BT0A 2MLBA 2KT7A 5G5GA 4HPLB 2LVQA 1ET6A 2JQRB 3P2BA 3VQIA 3T3NA 3X0WA 5J17A 5H92C 2L00B 2PPHA 1DYQA 2KMAA 1T3QA 1L0XB 2MQJA 2XK5A 2JVCA 1D5ZC 3A4RA 4LNNA 3AN1A 1TJEA 1PYWD 3A9JA 3SD5A 3V3XA 1T0QC 2CHXA 4WWMA 4HVBA 1V2YA 1CK1A 5AUIA 3NVWA 3ZRCA 3TEXA 2WXRA 2HTHA 3OLMD 2V0GA 1WYWB 3R66C 2C5LC 4I6NB 1JALA 2VZKD 3K9OB 4A3PA 3SHQA 4GXBA 4C7YA 4RM8A 2ON8A 4HKZE 3VTWA 3HM6X 4RM9A 5AZGA 4YTPB 2KACA 1GJZA 1AW7A 1KFYB 2QC8A 3ZDMC 4BKSD 3OJ3A 1WGHA 1WYGA 4PS7A 2WXNA 4JQWC 3AB5A 2RMMA 2IO2B 4NZLB 3W2DA 2Z0DB 4CO7A 1WM2A 1WX7A 4PYUA 2V3PA 2BT6A 4KIKA 3VDZA 1DOYA 2ZCCA 2KTFA 1YQ4B 1GB1A 1ZDXA 4E3CA 3UIOB 3JSVB 1P7FA 5IN7A 2INNE 1N63A 2M56B 3IFWB 1RM6C 1SEBD 1GG3A 1E6EB 1XXGA 2WP9B 2XBBC 3NZUA 3PLUA 4FULA 3TBLD 4W9HA 3RD2A 3GE3C 1K52A 3B2GA 4RNAA 3N1XC 1WXAA 4AP4C 4CYEA 1EF1A 2LI5A 2E6XA 3CF6E 3Q6BA 1HZ5A 5IAAC 1MJDA 4K1RB 1FNWA 1JWAD 4HXDA 4KZCA 1R4NI 3VTUA 4P16A 2Q5WD 4J6IA 3ZLZA 2IY0B 3RYTA 4ZRQA 3AXCA 1WGDA 2KZRA 1OEYA 3TCAA 3AEDB 3MC0B 1B9RA 3ABVB 3MFGA 3L08A 2RGFA 2SAKA 1DGJA 2MX2A 4K7SA 5E6NA 3DDCB 1PFDA 4WWPA 4RF0A 4W9KA 1H8CA 1TS3A 2IO1B 1YMHE 1JW9D 5D94A 1YN3A 1WWTA 2KDMA 3VR9B 2DX5B 2MSED 2RDHA 4ZRKA 3ZNGC 1YQBA 3KW5B 2MBEA 4O1NA 2ONQA 3IAS1 2BQQA 3O13A 4TQ1A 4HPPA 4ICUA 2JZZA 2V3NA 4YTMB 1CMXB 2N1VA 1GB4A 3EC8A 4GDLA 4YSXB 1YD8U 3PSEB 1TS5A 3A1QB 3PT2B 4OVUA 2NBVB 1UBQA 2V3SA 3PRMB 3KYCD 2C7NB 3AEFB 4FJZA 4HJKA 3RCZA 2MJEA 3DBRB 1L2NA 4EZLA 4IG7B 4KZ0A 1V1PB 2KYWA 2W82A 2GBKA 3I3TB 3AEAB 4GDKB 4XDCA 4EZKA 2MH7A 3GS2A 4JWSC 4BKSA 3TEYA 1BMLC 4EKUA 2IGHA 2E3TA 5AZFA 1V6EA 2HTME 1YN5A 1T0RC 4A3OA 3OG5A 4DK5A 3R7RA 1OQYA 5HG2A 5IO9A 1C1YB 5C23A 3URYA 4KIKB 4RGTA 4HROA 3Q8FA 3ZTDA 2WXMA 1XLNA 3PHWB 1T6BX 1QOGA 1WX9A 2DZMA 4WAAA 5EE0A 4LNFA 1MPEA 4IWOA 2HJ1A 2IPKD 2OOBB 2O2VA 5LNK1 1V8CA 1F1HA 2DAJA 4BKTA 4M02A 1S3SG 2KMMA 1VRAB 2KTRA 3BVGA 3ENEA 3NY5A 2DHZA 1NVID 2J0MA 3DBHI 3WALA 2YEPF 2DNFA 2M0XA 2J53A 4CQNA 1WH3A 4GOCA 2BS4B 2KC2A 1XD3B 3ZKJC 2WQYB 5HI1A 2DYBA 4N59A 3UIPB 1FCLA 1NYRA 4N9F4 2DZJA 4HRSA 4ARIA 4S17A 3TEZA 3N9YC 4JLCA 3B08A 2IDYA 2KN5A 4A90A 4BBNC 3AU5A 4BBNF 2Y5CA 4REZA 3HVDA 4JIOU 2MBBB 2DENB 2LEKA 4E71A 4FA6A 1Y8RC 1MI0A 5AUKA 1YIWA 3VR8B 2MWSB 5DPWA 4DQOC 4M01A 4C56C 3AU4A 3N1ZC 1ZW7A 5FR6A 1WIAA 3RN9C 1C4CA 2KFJA 3BVZA 3HM3A 2AEHA 1SE9A 3MJ5A 2G4SA 2J4XA 2M17A 5H8YE 1WM3A 3NHEB 5EE3A 1R4NB 2J42A 4OHJA 1C79A 2VH2A 1EUVB 2RPQA 3U52E 2WXJA 1K8RB 2WXIA 1TTNA 2AL3A 2INPE 1WGYA 2PE6B 1EU4A 3WCQA 4GDLB 2J0KA 3HIZA 2RDBC 1BXTA 5HFYA 1R4MI 4M00A 2WX0A 1Q5WB 3P4SB 3ZNHB 2I2YA 2KO3A 3PS6A 3L0WB 1EWCA 1J7BA 4HWIB 2ZZPB 3PZDA 2K0PA 4HK2A 1TGZB 4YWGG 4XYCA 1RAXA 2X8XX 3PRPB 3W5VB 3AE7B 5J2RA 2GRIA 2JXXA 4NPNA 4NQLB 3NOBA 3H1UA 2OEDA 3KLSX 5G2NA 2L83A 2C9WB 3AI5A 1XT9B 2DZIA 3QAQA 4DXAB 2WXLA 3MHSD 2LUEA 3DVGY 3EUB2 3R8BA 2WYQA 3CIRB 2Y3AA 3JW0X 4OZBA 3B9JA 4P7IA 2L3ZA 1EM7A 3D32A 3B0AA 5JXVA 2JYEA 1UUPA 4G0NB 1I7HA 2L7RA 4HCPB 3MC8A 2FIFA 3BY4B 2K8BA 2K8CA 5CHWA 3Q69A 4LNKA 3HUIA 3IVFA 2RR9A 3ZUNA 3Q3NC 1I4QA 4MT5A 4ASWC 1UF0A 4ZRPA 2EKIA 4MH8A 2BPSA 4KKJA 1L4DB 1SE4A 1KOTA 2G45B 2LRWA 1S1QB 2PVOD 1VJKA 3SFDB 2JYTA 1FFVA 2J7QB 2GMIC 2PE9A 2ZPNA 1JCKB 4HDQA 1H4RA 3ZNID 5TR5A 1P3QU 1PGAA 4EE2A 4EZJA 4DHJB 2WNMA 3B2FA 3VVWB 1L6UA 5BYQA 4KDIC 2K6DB 3UQAA 3DOWA 2LJ5A 1SB3C 3AE6B 1WJUA 2NBUA 4WQMA 2WS3B 2B76B 2MP2B 1C78A 1IYFA 2WLBA 5DPTA 1SE2A 2PW9A 4P1BC 1JRUA 1MG8A 2JUOA 3DBHB 3JSVA 1TY0A 3HRDD 2BWES 4QAYA 2NVUI 2PMVA 1C3TA 3ZTCA 4ARCA 1YN4A 1WJ6A 2LGDA 3P4RB 1QQRA 1K50A 2MBOA 4AJWA 2X38A 1SE3A 4NQKE 2KQSA 2JF5A 2MJDA 1X1MA 2GBMA 2M8SA 5IP4D 4XWTA 4TUUA 2DWQA 2BYEA 2W55A 4IUMB 4TQ0A 2CJNA 4HJGE 1SSNA 2N0SB 3AE9B 1M94A 2MRPA 1SJHD 4AS1A 3PREA 3PZ7A 2ASQA 3KWLA 1N60A 1V49A 2V1YA 1V9JA 3BZDB 1SXTA 1E0ZA 4FHKA 2M4NA 2N9PC 1V1OA 2I1JA 4ANVA 1HEZE 4YXDB 1IGDA 4J3OD 1FD6A 2G3QB 3GZNI 5CHFA 2QDFA 3AEEB 4M0WB 3A9KB 3ZRFA 2IYDB 2MBQA 4ZHOA 2BWFA 2KDEB 3DVGX 3N32A 1WXMA 3ZDTA 4BOSC 2KOXA 4WURA 3BK1A 4HDOA 3K9PB 3TMPB 1JWUD 3NG0A 3VH4B 2BGFA 3RNAC 3EECA 3C19A 4ICVA
chains in the Genus database with same CATH topology
4HCNB 3L08A 5AZHA 1FXTB 2GOWA 1UZXB 3JVZX 1P1AA 4ANWA 1IPGA 2AL6A 4KSKC 2RGFA 4G11A 4KV2A 5JZEB 3CSFA 3UQBA 1YX5B 2MX2A 4K7SA 5E6NA 4AWJA 4B9KA 3DDCB 3BINA 5L83A 4WWPA 2OJRA 2EKEC 4W9KA 1H8CA 1KM7A 2IO1B 3KH0A 2KX0A 3DCGA 1J0GA 1WMHB 5D94A 3S2AA 4G50A 3A1QA 3VAWA 4NAWB 1UH6A 2HJ8A 2DX5B 2MSED 4ZRKA 1WI0A 3UF8A 3ZNGC 1YQBA 3KW5B 4GB9A 4JL9A 2MBEA 4OVVA 2KK8A 2C7MB 2KXJA 4FN2A 4TQ1A 2LVPA 2CHZA 1OTRB 4ICUA 1V81A 1P98A 3QC8B 1T0YA 2JZZA 1WJNA 2WX1A 1CMXB 2Y5BB 3B1LX 4W9CA 4W9GA 1XQQA 1E5WA 2LXAA 2N1VA 2ZVOA 4GU2A 4WWNA 1YX6B 5BO4B 3EC8A 2NS5A 4GDLA 1I35A 4GDKA 3H7PA 3TIXA 3C0RB 1YD8U 3PSEB 3RUIB 3A1QB 3PT2B 3V6CB 2FCMA 2KHWB 1E8XA 4K7WA 3V62A 4OVUA 5CX3A 2NBVB 1UBQA 2V3SA 3PRMB 4MSMB 3KYCD 2C7NB 2RSUA 4FJZA 4HJKA 3RCZA 2KNBA 3DPDA 4XZ4A 4GIVA 1KLVA 1L2NA 1WE6A 1G6JA 2HE7A 2O6VA 4LDTD 4ZYNA 4EZLA 2D10A 4MSQB 4IG7B 4KZ0A 4XX5A 4MGIE 1WY8A 4MGYE 3KUDB 2CS4A 2GBKA 5JHAA 4MGKE 2NR2A 3I3TB 2N9XA 4GDKB 4XC2A 4EZKA 3VH3B 3H7PB 4F1SA 1WZ0A 3NZSA 4BKSA 1LXDA 4LJOB 4TKNA 2JT4B 4GSWA 4EKUA 5CTRC 1E7UA 1J19A 3HK0A 1VCBA 2KLCA 3PRZA 5AZFA 4MGZE 1AARA 2K6QA 3CMMB 1V6EA 3A4SC 4FJYA 4A3OA 2KX3A 4W9EA 2KANA 2CKHB 3VUYA 4ZRJA 1OQYA 3R7RA 2BYFA 4DK5A 2FIDA 2FUHB 3QHTA 2D3GA 4F7ZA 1C1YB 2O6VB 5C23A 4KIKB 2N7DA 5KHOA 3ZTDA 4FJVB 3QIJA 1QZEA 3JYUA 4ZRIA 3M3JA 2KKCA 3OAWA 3PHWB 5LXHA 4W9IA 5D7GA 5LLIA 3W1YA 3ZVVA 1WX9A 4IWPA 2Z59B 2DZMA 4EFOA 5JHBA 4WAAA 2ZPYA 4URKA 2HD5B 4IWOA 1WF9A 2OOBB 2O2VA 3DBLI 2N9EB 2LRUA 1WXVA 2BYVE 2DAJA 2K39A 2ZNVB 4KSLC 4BKTA 4IM3A 1ZGUB 1S3SG 2LVOA 2LWPA 5AEKB 4W9JA 2FAZA 2MCNB 4W9FA 2LZ6A 2KTRA 5D2MB 3M63B 3ENEA 3NY5A 1RRBA 2DHZA 3APCA 5DCNA 2J0MA 2NCNA 2YLMA 3L17A 3DBHI 5CHVC 3PTFC 3WALA 4DHJD 2NBWB 1WGGA 4IWQA 2M0XA 2KDFB 3RT3B 2DZKA 4PS3A 1WH3A 2BKFA 4DBGA 4GOCA 2ZNVC 2ZCBA 2KC2A 4KDLB 3VHTC 4II2B 1XD3B 4IW0A 3X23A 3ZKJC 4M8MA 1EF5A 3EFUA 2GBJA 3ML8A 2DYBA 3Q3JA 3UIPB 2O2VB 4N9F4 2DZJA 3H7SA 3KUCB 3VUXA 2KWVB 1EO6A 2L0TA 3DBRI 3HHMA 3LJ3A 3W1SC 4W9LA 2M1MA 1V5TA 2KWCA 2DAFA 2FCSA 4E74A 2LD9A 1RLFA 4JLCA 3R7QA 2KTRB 3B08A 2KN5A 2KDIA 1Z2MA 3AU5A 4BBNC 1TBEA 4BBNF 3H9DA 3QA8A 3DBSA 3R3MA 4MDKE 4WJNA 3PGEA 2UWQA 3NS8A 4JIOU 2KWUB 4AJYB 2MBBB 2DENB 3UGBB 4DDID 3N30A 4WWOA 4E71A 4FA6A 3U8ZA 1RFAA 1Y8RC 5C1ZA 1YIWA 2DYMA 1TZ1A 1KJTA 2MWSB 1ZKHA 1ISNA 3GOEA 5DPWA 2LXCA 2JRIB 4NJ7A 2GBNA 2AWTA 3VUWA 4EUTA 3AULA 3WA0A 2B3AA 1WXSA 3WAOA 3Q3FA 3AU4A 4B95A 4MEMA 2KVRA 3SU8X 4DHZE 1ZW7A 1Q0WB 1F9JA 5FR6A 1UGMA 1WIAA 4EEWA 2KDBA 2FNJB 4X57B 2NPTA 2KFJA 3HM3A 2AEHA 3ECIA 1SE9A 2JWZA 4MJSA 2G4SA 4MELA 2M17A 4AOFA 1WFYA 2CHWA 4RMAA 1WM3A 5J18A 2O6VD 2BF8B 1V80A 2IY1B 3MTNB 3NHEB 4II3B 2A5UA 3V60A 4WJOA 4EOYA 2ZVNA 1EUVB 4DDGD 1E8ZA 2RPQA 2D11A 5DPRA 1K8RB 2WWZA 1TTNA 1WR1A 2AL3A 3ZO5B 2J0JA 4PS8A 1NI2A 1WGYA 2PE6B 3M95A 4GDLB 2J0KA 3HIZA 3U30A 2NPTB 2L0FA 2K8HA 2L76A 2MA9B 2A4ZA 3A33B 1R4MI 3OJ4B 1GC6A 2FCQA 2EMTA 4W9DA 1UELA 1WGRA 5EDSA 2WX0A 1Q5WB 3ZNHB 3DQVA 4ZDVA 4YL8A 2KO3A 3VTVA 3PS6A 1LQBA 3L0WB 4B6WA 2ZEQA 3M62B 4K81A 3LDZE 2JZ3B 3QJZA 1GUAB 2UYZB 2C7HA 1UBIA 3H6NA 4HWIB 1OEYJ 2ZZPB 3PZDA 4HK2A 4MM3A 1TGZB 3KYDD 5IA7A 4IM2A 1LM8B 2JPHA 4I6LB 4BKGA 3QK0A 3WAPA 5JH5C 1RAXA 2K1FA 3QCAA 3PRPB 3RZFA 2KLGA 4WJQA 2RD0A 4LCDE 2R2QA 5L95C 5J2RA 2N1WA 2JXXA 4FLHA 4NQLB 3NOBA 4NPNA 4HLEA 2D2QA 3H1UA 1E8WA 4BOZB 3RULA 5G2NA 3TL5A 2C9WB 3AI5A 1XT9B 2KJ6A 2DZIA 3QAQA 4DXAB 4LJPB 3MHSD 1E7VA 2LUEA 2W9NA 3DVGY 4F8CB 4LDTB 2WYQA 2IO0B 3ZIMA 1E90A 3DVNV 3JW0X 4P7IA 4TV3A 4BFRA 2CR5A 2L3ZA 3D32A 2LGYA 4GN1A 4WJPA 1L7YA 4BVUC 3B0AA 4GGQA 2I1KA 4G0NB 1BT0A 4FBJB 1PQSA 5GMVA 3UINB 2MLBA 2L7RA 1D3ZA 4HCPB 2FIFA 2Z0EB 3L10B 3BY4B 4HPLB 2K8BA 2LVQA 1IP9A 2K8CA 1NBFC 3T9LA 3P2BA 3MJWA 4IM0A 3VQIA 5CHWA 3X0WA 5J17A 2L00B 3IVFA 3V6EB 5HKHA 2RR9A 2PPHA 3ZUNA 2KJRA 2LASA 3CSTA 2KMAA 2BKRB 4ASWC 3IG3A 4PYZA 2MQJA 2XK5A 2IZVB 2DYOA 2JVCA 2QHOA 3A4RA 4NNJB 3APDA 3IHPC 3QWZB 2MBHA 2BPSA 3KUZA 2WDTB 1HE8A 1WR6E 2IO3B 3A9JA 3SD5A 3PPAA 2MP2A 2CHXA 2AYOB 4NY0A 4HVBA 1V2YA 2G45B 2LRWA 1S1QB 1KOTA 3ONSA 3ZRCA 3WIMA 2J7QB 2GMIC 2CU1A 2PE9A 2ZPNA 3ALBA 1H4RA 1UD7A 2HTHA 4HDQA 5TR5A 1P3QU 3OLMD 3ZNID 5DPSA 4DWFA 1WYWB 3R66C 4WQOB 2N4FA 3QX1A 4EZJA 4DHJB 1WE7A 1Z5SB 2C5LC 3L16A 2XK5B 3VVWB 1WZ3A 2K6DB 4I6NB 4KDIC 3UQAA 3DOWA 3K9OB 4KVGB 2LJ5A 4A3PA 1WJUA 3DVNU 2NBUA 4A20A 3SHQA 1V86A 4K7UA 3A9JB 1VD2A 2L05A 4GXBA 2MP2B 4RM8A 3EHVA 5LXIB 1IYFA 1WJ4A 3VTWA 4FADA 2KC1A 2ZJDA 3HM6X 4RM9A 5DPTA 3PLVA 2JY6A 3SDLC 3ZW3A 5AZGA 2L8JA 1SGHA 1GJZA 1JRUA 1MG8A 2JUOA 3T8MA 3ZDMC 4BKSD 4ANUA 1A5RA 3JSVA 3OJ3A 1WGHA 4IC7B 3VFKA 3ZNZB 2KFKA 2BWES 4PS7A 4G3XB 1P0RA 2NVUI 4JQWC 1C3TA 3ZTCA 5E6OA 2K25A 1WJ6A 3TJPA 2LGDA 4MJSB 4AJWA 2MBOA 2IO2B 4NQKE 2KQSA 2KJHB 2Z0DB 4CO7A 2JF5A 1WM2A 1WX7A 3L13A 4PYUA 4ANXA 4KIKA 3VDZA 4NJ6A 2ZCCA 2KTFA 1X1MA 4MH0E 3QARA 1LFDA 4I6PA 3PHXB 2GBMA 2M8SA 3WANA 2N7EA 5D6JB 4E3CA 4HPMB 3WAMA 3UIOB 3JSVB 4TUUA 2KFKB 2BYEA 1V5OA 3L54A 3N3KB 4IUMB 3V61A 2PEAA 4TQ0A 3IFWB 2IBIB 2GBRA 1GG3A 2MW5A 3U7DA 3KVFB 2FCNA 3A9KA 1P9DU 2VRRB 2XBBC 3NZUA 1WRDB 1M94A 3VXWA 4M8NA 2LGXA 5KHQA 4AUQC 2MRPA 3PLUA 3W1SA 4FULA 1U4AA 4JGHB 3PREA 2PJHA 2ASQA 2REXA 4W9HA 1YJ1A 2V4LA 3RD2A 3TBLD 1V49A 3APFA 2V1YA 1V9JA 2KMCA 1WXAA 2EMSA 1Q1OA 2M4NA 2N9PC 1EF1A 3IBEA 2LI5A 2D07B 4FHKA 4AP4C 4CYEA 2YVCA 2KQ7A 3CF6E 3ML9A 2I1JA 4ANVA 2KD0A 1SIFA 5IAAC 4K1RB 2G3QB 3GZNI 5CHFA 1NDDA 2R2OA 4HXDA 4M0WB 4KZCA 3A9KB 1R4NI 3ZRFA 2IYDB 2C60A 2MBQA 2XEWA 2BWFA 2KDEB 4CHKA 3VTUA 3DVGX 3N32A 1E8YA 1WXMA 3ZDTA 4FHJA 4BOSC 1GC7A 4J6IA 3ZLZA 2IY0B 2KOXA 3O65B 5G55A 3RYTA 3PVLA 3PV1A 5E6PA 3AXCA 4HDOA 2JRHA 3K9PB 1OGWA 1WGDA 1WX8A 3TMPB 1I42A 3QQ8B 1WMHA 2KZRA 1GNUA 1OEYA 3TCAA 2BGFA 3VH4B 2G4DB 3RZWC 1J8CA 4GMVA 4NAWA 4DHZB 3EECA 4ICVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HCN B;  3L08 A;  5AZH A;  1FXT B;  2GOW A;  1UZX B;  3JVZ X;  1P1A A;  4ANW A;  1IPG A;  2AL6 A;  4KSK C;  2RGF A;  4G11 A;  4KV2 A;  5JZE B;  3CSF A;  3UQB A;  1YX5 B;  2MX2 A;  4K7S A;  5E6N A;  4AWJ A;  4B9K A;  3DDC B;  3BIN A;  5L83 A;  4WWP A;  2OJR A;  2EKE C;  4W9K A;  1H8C A;  1KM7 A;  2IO1 B;  3KH0 A;  2KX0 A;  3DCG A;  1J0G A;  1WMH B;  5D94 A;  3S2A A;  4G50 A;  3A1Q A;  3VAW A;  4NAW B;  1UH6 A;  2HJ8 A;  2DX5 B;  2MSE D;  4ZRK A;  1WI0 A;  3UF8 A;  3ZNG C;  1YQB A;  3KW5 B;  4GB9 A;  4JL9 A;  2MBE A;  4OVV A;  2KK8 A;  2C7M B;  2KXJ A;  4FN2 A;  4TQ1 A;  2LVP A;  2CHZ A;  1OTR B;  4ICU A;  1V81 A;  1P98 A;  3QC8 B;  1T0Y A;  2JZZ A;  1WJN A;  2WX1 A;  1CMX B;  2Y5B B;  3B1L X;  4W9C A;  4W9G A;  1XQQ A;  1E5W A;  2LXA A;  2N1V A;  2ZVO A;  4GU2 A;  4WWN A;  1YX6 B;  5BO4 B;  3EC8 A;  2NS5 A;  4GDL A;  1I35 A;  4GDK A;  3H7P A;  3TIX A;  3C0R B;  1YD8 U;  3PSE B;  3RUI B;  3A1Q B;  3PT2 B;  3V6C B;  2FCM A;  2KHW B;  1E8X A;  4K7W A;  3V62 A;  4OVU A;  5CX3 A;  2NBV B;  1UBQ A;  2V3S A;  3PRM B;  4MSM B;  3KYC D;  2C7N B;  2RSU A;  4FJZ A;  4HJK A;  3RCZ A;  2KNB A;  3DPD A;  4XZ4 A;  4GIV A;  1KLV A;  1L2N A;  1WE6 A;  1G6J A;  2HE7 A;  2O6V A;  4LDT D;  4ZYN A;  4EZL A;  2D10 A;  4MSQ B;  4IG7 B;  4KZ0 A;  4XX5 A;  4MGI E;  1WY8 A;  4MGY E;  3KUD B;  2CS4 A;  2GBK A;  5JHA A;  4MGK E;  2NR2 A;  3I3T B;  2N9X A;  4GDK B;  4XC2 A;  4EZK A;  3VH3 B;  3H7P B;  4F1S A;  1WZ0 A;  3NZS A;  4BKS A;  1LXD A;  4LJO B;  4TKN A;  2JT4 B;  4GSW A;  4EKU A;  5CTR C;  1E7U A;  1J19 A;  3HK0 A;  1VCB A;  2KLC A;  3PRZ A;  5AZF A;  4MGZ E;  1AAR A;  2K6Q A;  3CMM B;  1V6E A;  3A4S C;  4FJY A;  4A3O A;  2KX3 A;  4W9E A;  2KAN A;  2CKH B;  3VUY A;  4ZRJ A;  1OQY A;  3R7R A;  2BYF A;  4DK5 A;  2FID A;  2FUH B;  3QHT A;  2D3G A;  4F7Z A;  1C1Y B;  2O6V B;  5C23 A;  4KIK B;  2N7D A;  5KHO A;  3ZTD A;  4FJV B;  3QIJ A;  1QZE A;  3JYU A;  4ZRI A;  3M3J A;  2KKC A;  3OAW A;  3PHW B;  5LXH A;  4W9I A;  5D7G A;  5LLI A;  3W1Y A;  3ZVV A;  1WX9 A;  4IWP A;  2Z59 B;  2DZM A;  4EFO A;  5JHB A;  4WAA A;  2ZPY A;  4URK A;  2HD5 B;  4IWO A;  1WF9 A;  2OOB B;  2O2V A;  3DBL I;  2N9E B;  2LRU A;  1WXV A;  2BYV E;  2DAJ A;  2K39 A;  2ZNV B;  4KSL C;  4BKT A;  4IM3 A;  1ZGU B;  1S3S G;  2LVO A;  2LWP A;  5AEK B;  4W9J A;  2FAZ A;  2MCN B;  4W9F A;  2LZ6 A;  2KTR A;  5D2M B;  3M63 B;  3ENE A;  3NY5 A;  1RRB A;  2DHZ A;  3APC A;  5DCN A;  2J0M A;  2NCN A;  2YLM A;  3L17 A;  3DBH I;  5CHV C;  3PTF C;  3WAL A;  4DHJ D;  2NBW B;  1WGG A;  4IWQ A;  2M0X A;  2KDF B;  3RT3 B;  2DZK A;  4PS3 A;  1WH3 A;  2BKF A;  4DBG A;  4GOC A;  2ZNV C;  2ZCB A;  2KC2 A;  4KDL B;  3VHT C;  4II2 B;  1XD3 B;  4IW0 A;  3X23 A;  3ZKJ C;  4M8M A;  1EF5 A;  3EFU A;  2GBJ A;  3ML8 A;  2DYB A;  3Q3J A;  3UIP B;  2O2V B;  4N9F 4;  2DZJ A;  3H7S A;  3KUC B;  3VUX A;  2KWV B;  1EO6 A;  2L0T A;  3DBR I;  3HHM A;  3LJ3 A;  3W1S C;  4W9L A;  2M1M A;  1V5T A;  2KWC A;  2DAF A;  2FCS A;  4E74 A;  2LD9 A;  1RLF A;  4JLC A;  3R7Q A;  2KTR B;  3B08 A;  2KN5 A;  2KDI A;  1Z2M A;  3AU5 A;  4BBN C;  1TBE A;  4BBN F;  3H9D A;  3QA8 A;  3DBS A;  3R3M A;  4MDK E;  4WJN A;  3PGE A;  2UWQ A;  3NS8 A;  4JIO U;  2KWU B;  4AJY B;  2MBB B;  2DEN B;  3UGB B;  4DDI D;  3N30 A;  4WWO A;  4E71 A;  4FA6 A;  3U8Z A;  1RFA A;  1Y8R C;  5C1Z A;  1YIW A;  2DYM A;  1TZ1 A;  1KJT A;  2MWS B;  1ZKH A;  1ISN A;  3GOE A;  5DPW A;  2LXC A;  2JRI B;  4NJ7 A;  2GBN A;  2AWT A;  3VUW A;  4EUT A;  3AUL A;  3WA0 A;  2B3A A;  1WXS A;  3WAO A;  3Q3F A;  3AU4 A;  4B95 A;  4MEM A;  2KVR A;  3SU8 X;  4DHZ E;  1ZW7 A;  1Q0W B;  1F9J A;  5FR6 A;  1UGM A;  1WIA A;  4EEW A;  2KDB A;  2FNJ B;  4X57 B;  2NPT A;  2KFJ A;  3HM3 A;  2AEH A;  3ECI A;  1SE9 A;  2JWZ A;  4MJS A;  2G4S A;  4MEL A;  2M17 A;  4AOF A;  1WFY A;  2CHW A;  4RMA A;  1WM3 A;  5J18 A;  2O6V D;  2BF8 B;  1V80 A;  2IY1 B;  3MTN B;  3NHE B;  4II3 B;  2A5U A;  3V60 A;  4WJO A;  4EOY A;  2ZVN A;  1EUV B;  4DDG D;  1E8Z A;  2RPQ A;  2D11 A;  5DPR A;  1K8R B;  2WWZ A;  1TTN A;  1WR1 A;  2AL3 A;  3ZO5 B;  2J0J A;  4PS8 A;  1NI2 A;  1WGY A;  2PE6 B;  3M95 A;  4GDL B;  2J0K A;  3HIZ A;  3U30 A;  2NPT B;  2L0F A;  2K8H A;  2L76 A;  2MA9 B;  2A4Z A;  3A33 B;  1R4M I;  3OJ4 B;  1GC6 A;  2FCQ A;  2EMT A;  4W9D A;  1UEL A;  1WGR A;  5EDS A;  2WX0 A;  1Q5W B;  3ZNH B;  3DQV A;  4ZDV A;  4YL8 A;  2KO3 A;  3VTV A;  3PS6 A;  1LQB A;  3L0W B;  4B6W A;  2ZEQ A;  3M62 B;  4K81 A;  3LDZ E;  2JZ3 B;  3QJZ A;  1GUA B;  2UYZ B;  2C7H A;  1UBI A;  3H6N A;  4HWI B;  1OEY J;  2ZZP B;  3PZD A;  4HK2 A;  4MM3 A;  1TGZ B;  3KYD D;  5IA7 A;  4IM2 A;  1LM8 B;  2JPH A;  4I6L B;  4BKG A;  3QK0 A;  3WAP A;  5JH5 C;  1RAX A;  2K1F A;  3QCA A;  3PRP B;  3RZF A;  2KLG A;  4WJQ A;  2RD0 A;  4LCD E;  2R2Q A;  5L95 C;  5J2R A;  2N1W A;  2JXX A;  4FLH A;  4NQL B;  3NOB A;  4NPN A;  4HLE A;  2D2Q A;  3H1U A;  1E8W A;  4BOZ B;  3RUL A;  5G2N A;  3TL5 A;  2C9W B;  3AI5 A;  1XT9 B;  2KJ6 A;  2DZI A;  3QAQ A;  4DXA B;  4LJP B;  3MHS D;  1E7V A;  2LUE A;  2W9N A;  3DVG Y;  4F8C B;  4LDT B;  2WYQ A;  2IO0 B;  3ZIM A;  1E90 A;  3DVN V;  3JW0 X;  4P7I A;  4TV3 A;  4BFR A;  2CR5 A;  2L3Z A;  3D32 A;  2LGY A;  4GN1 A;  4WJP A;  1L7Y A;  4BVU C;  3B0A A;  4GGQ A;  2I1K A;  4G0N B;  1BT0 A;  4FBJ B;  1PQS A;  5GMV A;  3UIN B;  2MLB A;  2L7R A;  1D3Z A;  4HCP B;  2FIF A;  2Z0E B;  3L10 B;  3BY4 B;  4HPL B;  2K8B A;  2LVQ A;  1IP9 A;  2K8C A;  1NBF C;  3T9L A;  3P2B A;  3MJW A;  4IM0 A;  3VQI A;  5CHW A;  3X0W A;  5J17 A;  2L00 B;  3IVF A;  3V6E B;  5HKH A;  2RR9 A;  2PPH A;  3ZUN A;  2KJR A;  2LAS A;  3CST A;  2KMA A;  2BKR B;  4ASW C;  3IG3 A;  4PYZ A;  2MQJ A;  2XK5 A;  2IZV B;  2DYO A;  2JVC A;  2QHO A;  3A4R A;  4NNJ B;  3APD A;  3IHP C;  3QWZ B;  2MBH A;  2BPS A;  3KUZ A;  2WDT B;  1HE8 A;  1WR6 E;  2IO3 B;  3A9J A;  3SD5 A;  3PPA A;  2MP2 A;  2CHX A;  2AYO B;  4NY0 A;  4HVB A;  1V2Y A;  2G45 B;  2LRW A;  1S1Q B;  1KOT A;  3ONS A;  3ZRC A;  3WIM A;  2J7Q B;  2GMI C;  2CU1 A;  2PE9 A;  2ZPN A;  3ALB A;  1H4R A;  1UD7 A;  2HTH A;  4HDQ A;  5TR5 A;  1P3Q U;  3OLM D;  3ZNI D;  5DPS A;  4DWF A;  1WYW B;  3R66 C;  4WQO B;  2N4F A;  3QX1 A;  4EZJ A;  4DHJ B;  1WE7 A;  1Z5S B;  2C5L C;  3L16 A;  2XK5 B;  3VVW B;  1WZ3 A;  2K6D B;  4I6N B;  4KDI C;  3UQA A;  3DOW A;  3K9O B;  4KVG B;  2LJ5 A;  4A3P A;  1WJU A;  3DVN U;  2NBU A;  4A20 A;  3SHQ A;  1V86 A;  4K7U A;  3A9J B;  1VD2 A;  2L05 A;  4GXB A;  2MP2 B;  4RM8 A;  3EHV A;  5LXI B;  1IYF A;  1WJ4 A;  3VTW A;  4FAD A;  2KC1 A;  2ZJD A;  3HM6 X;  4RM9 A;  5DPT A;  3PLV A;  2JY6 A;  3SDL C;  3ZW3 A;  5AZG A;  2L8J A;  1SGH A;  1GJZ A;  1JRU A;  1MG8 A;  2JUO A;  3T8M A;  3ZDM C;  4BKS D;  4ANU A;  1A5R A;  3JSV A;  3OJ3 A;  1WGH A;  4IC7 B;  3VFK A;  3ZNZ B;  2KFK A;  2BWE S;  4PS7 A;  4G3X B;  1P0R A;  2NVU I;  4JQW C;  1C3T A;  3ZTC A;  5E6O A;  2K25 A;  1WJ6 A;  3TJP A;  2LGD A;  4MJS B;  4AJW A;  2MBO A;  2IO2 B;  4NQK E;  2KQS A;  2KJH B;  2Z0D B;  4CO7 A;  2JF5 A;  1WM2 A;  1WX7 A;  3L13 A;  4PYU A;  4ANX A;  4KIK A;  3VDZ A;  4NJ6 A;  2ZCC A;  2KTF A;  1X1M A;  4MH0 E;  3QAR A;  1LFD A;  4I6P A;  3PHX B;  2GBM A;  2M8S A;  3WAN A;  2N7E A;  5D6J B;  4E3C A;  4HPM B;  3WAM A;  3UIO B;  3JSV B;  4TUU A;  2KFK B;  2BYE A;  1V5O A;  3L54 A;  3N3K B;  4IUM B;  3V61 A;  2PEA A;  4TQ0 A;  3IFW B;  2IBI B;  2GBR A;  1GG3 A;  2MW5 A;  3U7D A;  3KVF B;  2FCN A;  3A9K A;  1P9D U;  2VRR B;  2XBB C;  3NZU A;  1WRD B;  1M94 A;  3VXW A;  4M8N A;  2LGX A;  5KHQ A;  4AUQ C;  2MRP A;  3PLU A;  3W1S A;  4FUL A;  1U4A A;  4JGH B;  3PRE A;  2PJH A;  2ASQ A;  2REX A;  4W9H A;  1YJ1 A;  2V4L A;  3RD2 A;  3TBL D;  1V49 A;  3APF A;  2V1Y A;  1V9J A;  2KMC A;  1WXA A;  2EMS A;  1Q1O A;  2M4N A;  2N9P C;  1EF1 A;  3IBE A;  2LI5 A;  2D07 B;  4FHK A;  4AP4 C;  4CYE A;  2YVC A;  2KQ7 A;  3CF6 E;  3ML9 A;  2I1J A;  4ANV A;  2KD0 A;  1SIF A;  5IAA C;  4K1R B;  2G3Q B;  3GZN I;  5CHF A;  1NDD A;  2R2O A;  4HXD A;  4M0W B;  4KZC A;  3A9K B;  1R4N I;  3ZRF A;  2IYD B;  2C60 A;  2MBQ A;  2XEW A;  2BWF A;  2KDE B;  4CHK A;  3VTU A;  3DVG X;  3N32 A;  1E8Y A;  1WXM A;  3ZDT A;  4FHJ A;  4BOS C;  1GC7 A;  4J6I A;  3ZLZ A;  2IY0 B;  2KOX A;  3O65 B;  5G55 A;  3RYT A;  3PVL A;  3PV1 A;  5E6P A;  3AXC A;  4HDO A;  2JRH A;  3K9P B;  1OGW A;  1WGD A;  1WX8 A;  3TMP B;  1I42 A;  3QQ8 B;  1WMH A;  2KZR A;  1GNU A;  1OEY A;  3TCA A;  2BGF A;  3VH4 B;  2G4D B;  3RZW C;  1J8C A;  4GMV A;  4NAW A;  4DHZ B;  3EEC A;  4ICV A; 
#chains in the Genus database with same CATH topology
 4HCN B;  1FXT B;  1E10 A;  1TY2 A;  1R4M B;  3AM9 A;  4KV2 A;  4K3B A;  4B9K A;  3BIN A;  5L83 A;  3KH0 A;  2KX0 A;  1N6Z A;  2WXQ A;  1J0G A;  3N20 C;  1WMH B;  3S2A A;  3AEG B;  3U2S C;  3A1Q A;  2JX5 A;  4NAW B;  4C4V B;  1D4B A;  1WI0 A;  1DOX A;  4GB9 A;  3AH7 A;  1VDV A;  3EFC A;  2C7M B;  3T3O A;  2KXJ A;  1TKY A;  3P63 A;  2V9H A;  3QC8 B;  2NTS A;  2QMT A;  1V1P A;  2WX1 A;  1VZ6 A;  3B1L X;  4WWN A;  1E5W A;  2LXA A;  2ZVO A;  5BO4 B;  4TMA B;  4GDK A;  3DHI C;  3TIX A;  4OW0 A;  3NVV A;  1WXQ A;  3NUH B;  3I57 A;  1N61 A;  2LJI A;  1QT9 A;  5BMG A;  1V97 A;  3AE5 B;  4MSM B;  2JU6 X;  3Q2A C;  1XO3 A;  2KNB A;  3DPD A;  4XZ4 A;  4GIV A;  3FKY A;  5BMH A;  1WE6 A;  2HE7 A;  1XF5 L;  4JE3 B;  4ZYN A;  3AE3 B;  1N5W A;  1WY8 A;  3KUD B;  1YOV B;  3ZGZ A;  5JHA A;  4RGM A;  4MGK E;  2NR2 A;  4XC2 A;  5FK9 C;  3H7P B;  1WZ0 A;  1JRP A;  4TKN A;  3ZJU A;  1J19 A;  3HK0 A;  1VCB A;  3Q3M C;  2M19 A;  4MGZ E;  3SEB A;  2BYF A;  2LHE A;  2FID A;  3QHT A;  4FJV B;  3QIJ A;  3M3J A;  2KKC A;  3OAW A;  4W9I A;  1XLO A;  4EFO A;  5JHB A;  2KAJ A;  2ZPY A;  4URK A;  2L1A A;  1WF9 A;  2K39 A;  2ZNV B;  4KSL C;  4IM3 A;  2LVO A;  5EE1 A;  1N62 A;  3NZ3 A;  2MCN B;  4W9F A;  3M63 B;  4LTU A;  3L17 A;  2YLM A;  4LK0 M;  1K51 A;  4DHJ D;  3PTF C;  4OZC A;  3RT3 B;  1XEE A;  4DBG A;  2ZNV C;  2ZCB A;  4II2 B;  3ML8 A;  2GBJ A;  3VUX A;  3KUC B;  2L0T A;  4LLG M;  2M1M A;  2DAF A;  2FCS A;  1RLF A;  2WDV B;  2I38 A;  3TUO A;  1R7S A;  3QA8 A;  4MDK E;  3R3M A;  3NS8 A;  4DDI D;  4AJY B;  3UGB B;  4JX1 C;  1ROE A;  3RMK C;  4IOI E;  3OWE B;  1KJT A;  2TSS A;  3C8Y A;  1ISN A;  2JRI B;  4NJ7 A;  2AWT A;  4WH4 A;  1FM0 D;  2WXK A;  5IOI A;  1CQV A;  3DHH C;  3Q3F A;  3WAO A;  4B95 A;  3SU8 X;  2KVR A;  1WRI A;  1E9M A;  2WXH A;  1AYF A;  3PZ8 A;  1F9J A;  1GOZ A;  1HTO A;  2KDB A;  2FNJ B;  1KRH A;  4X57 B;  1FEH A;  5BMI A;  2GI9 A;  4RGO S;  4MEL A;  4AOF A;  3RNB C;  2H89 B;  3GZN B;  2O6V D;  2BF8 B;  3BWU D;  1V80 A;  2IY1 B;  4XDD A;  4II3 B;  3N1Y C;  4MAC A;  1YNT E;  2A5U A;  3V60 A;  4WJO A;  4EOY A;  2D3A A;  1E8Z A;  2D11 A;  1I4H A;  2QCZ A;  3M95 A;  3KWV A;  1IGC A;  1ZE3 D;  1TIF A;  2NPT B;  1QOA A;  2L0F A;  1HQR D;  1QIL A;  2MA9 B;  3OJ4 B;  2FCQ A;  2SEB D;  4W9D A;  1UEL A;  3VRB B;  2OHF A;  1KLU D;  4YL8 A;  3VTV A;  3FIL B;  1J7C A;  1LM8 B;  2JPH A;  2M0A A;  4BKG A;  4R3D A;  5JH5 C;  4WJQ A;  2N1W A;  4FLH A;  1E8W A;  4BOZ B;  1QKZ A;  2IGG A;  5EE9 A;  2W9N A;  4LDT B;  4MM3 B;  4TV3 A;  4BFR A;  2ZW1 A;  3GE8 C;  4GN1 A;  1FXA A;  4GGQ A;  2I1K A;  1ACC A;  5GMV A;  3UIN B;  1D3Z A;  1FNU A;  2Z0E B;  3L10 B;  3GB1 A;  2V4I B;  3DHG C;  3MJW A;  4IM0 A;  3IAM 1;  2QIL A;  4KGS A;  5C2T B;  5HKH A;  2KJR A;  4L1B A;  4RFB A;  2BKR B;  3MC9 A;  2QHO A;  4NNJ B;  3IHP C;  2J52 A;  2DBY A;  3KUZ A;  2WDT B;  3KQ4 A;  1HE8 A;  1WR6 E;  4C80 A;  2MP2 A;  4NY0 A;  1F2R I;  1I4P A;  1RYJ A;  3ONS A;  5GXG B;  3LXF A;  2CU1 A;  3ALB A;  1UD7 A;  4WIP A;  4WQO B;  2ZW0 A;  2N4F A;  3QX1 A;  2CU3 A;  1NEN B;  1FMA D;  1Z5S B;  1OQQ A;  1WZ3 A;  2WU2 B;  3DVN U;  4A20 A;  3P1M A;  1QOB A;  1V86 A;  4K7U A;  1VD2 A;  5LXI B;  4FXC A;  4WAF A;  3AMZ A;  1HTQ A;  2KC1 A;  2KWD A;  1GPX A;  3SDL C;  2JY6 A;  3ZW3 A;  1ZPS A;  1MHH E;  2L8J A;  1E7P B;  3T8M A;  3ZNZ B;  4JWU C;  1VZ8 A;  3W9C B;  3FAH A;  2MHJ A;  3TJP A;  4A8X C;  2KJH B;  3AE1 B;  1IBX B;  1RFK A;  4MH0 E;  3PHX B;  3WAN A;  3AE2 B;  2N7E A;  5D6J B;  4HPM B;  3WAM A;  4DXF A;  2W3S A;  2KFK B;  1V5O A;  3L54 A;  2KN4 A;  2GBR A;  4M0W A;  3A9K A;  1P9D U;  2VRR B;  2L52 A;  1WRD B;  3AV8 A;  2LGX A;  2RDG A;  3E9S A;  3W1S A;  3I63 C;  2PJH A;  2REX A;  1YJ1 A;  2V4L A;  3BVM A;  4K3C A;  1DOI A;  1I4G A;  5I4D A;  2EMS A;  3IBE A;  2D07 B;  4KKI A;  1VZ7 A;  2YVC A;  1FCC C;  3ML9 A;  1L0Y B;  1SIF A;  4N6E B;  1NDD A;  2R2O A;  2BYT A;  2C60 A;  2XEW A;  4CHK A;  1XCT L;  1E8Y A;  2PIA A;  1GC7 A;  3PV1 A;  5E6P A;  2JRH A;  1WX8 A;  4A9A A;  1I42 A;  1WMH A;  2G4D B;  4NAW A;  4DHZ B;  1C77 A;  3PO0 A;  4NJC A;  4C4V A;  1OFF A;  5AZH A;  2GOW A;  1UZX B;  1P1A A;  1IPG A;  1UWM A;  2MJ3 A;  2AL6 A;  5JZE B;  3CSF A;  3UQB A;  1YX5 B;  4AWJ A;  2OJR A;  5D3I B;  1ENF A;  2H88 B;  2WDQ B;  4KX6 B;  4G50 A;  3VAW A;  2IJ0 A;  3BK2 A;  2HJ8 A;  1TZO A;  1ZP0 B;  3UF8 A;  3ZJT A;  1AWD A;  4JL9 A;  5FR3 A;  4JPS A;  1TKE A;  4OVV A;  2KK8 A;  2BVC A;  4FN2 A;  2LVP A;  3SR6 A;  2PVG C;  1OTR B;  2Y5P A;  4HEA 1;  1IUE A;  1WJN A;  4IKG A;  4W9G A;  4PT5 A;  2NS5 A;  3RNC C;  3H7P A;  3C0R B;  1JRO A;  3V6C B;  5D3D A;  1ZDV A;  2BB5 A;  4XE0 A;  1E8X A;  4K7W A;  1STE A;  3RI7 C;  4NAM A;  2MEK A;  2WHI A;  1KLV A;  4H2A A;  4RF1 A;  1G6J A;  4LDT D;  4MSQ B;  1EU3 A;  4XX5 A;  2AQ1 B;  4MGY E;  1C76 A;  2CS4 A;  3V05 A;  2N9X A;  4PK1 A;  3VH3 B;  3NZS A;  1LXD A;  4LJO B;  2G9H D;  5CTR C;  3PRZ A;  2VH1 A;  3CMM B;  2LGI A;  4FJY A;  2KX3 A;  3U7Z A;  2KAN A;  2CKH B;  4ZRJ A;  2FUH B;  1WGK A;  2AX5 A;  2D3G A;  4F7Z A;  2O6V B;  3SFE B;  2N7D A;  5KHO A;  4N58 A;  3NVY A;  2WDR B;  5D7G A;  5LLI A;  3W1Y A;  4ACF A;  3ZVV A;  3ZJV A;  4IWP A;  4US8 A;  1JWB D;  3DBL I;  1M4V A;  2LRU A;  1K53 A;  1WXV A;  2BYV E;  2LUM A;  2LWP A;  5AEK B;  4W9J A;  2LZ6 A;  2INC C;  3APC A;  5DCN A;  2NCN A;  5CHV C;  2NBW B;  2N9K A;  4IWQ A;  2KDF B;  4TSS A;  4PS3 A;  4KDL B;  3X23 A;  4M8M A;  3EFU A;  3Q3J A;  1F0Z A;  3H7S A;  2KWV B;  3DBR I;  4OVZ A;  3W1S C;  2WGS A;  1ZXH A;  1PDX A;  4E74 A;  2LD9 A;  1XLQ A;  4YT0 B;  1Z2M A;  1NYQ A;  3H9D A;  1L4Z B;  5BYS A;  4WJN A;  3PGE A;  1HZ6 A;  2UWQ A;  2QSD A;  2KWU B;  1HA5 A;  3J9C A;  3N30 A;  4WWO A;  3U8Z A;  1RFA A;  2WU5 B;  2DYM A;  1TZ1 A;  4BAX A;  3MHZ A;  1FIQ A;  1ZKH A;  2KQ4 X;  3VUW A;  4EUT A;  3AUL A;  2B3A A;  3NRZ A;  2RPV A;  1Q0W B;  2WXP A;  3I5J C;  1PGB A;  1KH0 A;  2ICI A;  2NPT A;  2HDE A;  3BYT B;  3ECI A;  2JWZ A;  4MJS A;  1RWS A;  2IND C;  2FUG 1;  2PKO A;  3FIL A;  1WSP A;  2ZVN A;  1JQ4 A;  2WWZ A;  3ZXV A;  3ZO5 B;  2QJL A;  1NI2 A;  3DWM A;  4ZOH C;  2AQ2 B;  1T0S C;  1L6V A;  3U30 A;  2QIE B;  2L76 A;  2A4Z A;  3A33 B;  1FO4 A;  1WGR A;  2FE8 A;  5FKA C;  1LQB A;  1Q10 A;  4K81 A;  3M62 B;  4US9 A;  3LDZ E;  2JZ3 B;  3QJZ A;  1FRR A;  5MPO A;  3R2T A;  2C7H A;  1OEY J;  4MM3 A;  1TS2 A;  4I6L B;  3QK0 A;  2K1F A;  5T8I A;  3RZF A;  1AN8 A;  4LCD E;  4L2Y A;  4P1C C;  3P42 A;  4DXG A;  4C7Z A;  2D2Q A;  4IDI A;  3RUL A;  4S0R A;  3TL5 A;  3ETR A;  1QLB B;  2KJ6 A;  3I9V 1;  1BUI C;  4LJP B;  4F8C B;  1E7V A;  2IO0 B;  3IT6 B;  4KGR A;  1E90 A;  3DVN V;  4L23 A;  2CR5 A;  3IXS A;  1L7Y A;  2NMQ A;  1ESF A;  4FBJ B;  1PQS A;  2BS3 B;  1I4X A;  1IP9 A;  3R2I A;  3Q8C A;  1NBF C;  3T9L A;  1C4A A;  1XLP A;  3V6E B;  5HHD G;  1LO5 D;  2LAS A;  3CST A;  3IG3 A;  4PYZ A;  2R61 A;  1PGX A;  5E6J A;  4XWW A;  2IZV B;  2DYO A;  1KLG D;  3APD A;  3QWZ B;  2MBH A;  3AEB B;  1D5M C;  1L0V B;  2IO3 B;  3PPA A;  2AYO B;  1PUT A;  2W3R A;  3WIM A;  2XNA C;  5DPS A;  4DWF A;  2LGS A;  2K3U A;  2DLB A;  3L16 A;  1WE7 A;  1YJJ A;  2XK5 B;  1HXY D;  1ET9 A;  3NS1 A;  1ZOY B;  4KVG B;  1B1Z A;  1P7E A;  1KF6 B;  3A9J B;  3DBL B;  2L05 A;  3RFZ B;  3EHV A;  1MG4 A;  1IBX A;  1WJ4 A;  4FAD A;  2N9L A;  1FRD A;  2ZJD A;  2GLS A;  3PLV A;  2ACZ B;  1FNV A;  1SGH A;  3HVZ A;  3LYY A;  4ANU A;  1A5R A;  4IC7 B;  3VFK A;  4B0E A;  1MHX A;  2KFK A;  4G3X B;  1P0R A;  1GAQ B;  5E6O A;  2K25 A;  2XN9 C;  2L32 A;  4MJS B;  5TSS A;  2JXT A;  3IT4 B;  3L13 A;  4ANX A;  4NJ6 A;  5C3J B;  3QAR A;  1LFD A;  4I6P A;  2LHD A;  2PTL A;  1FXI A;  3N3K B;  4XGA B;  3V61 A;  2PEA A;  1C9F A;  4D2K A;  2IBI B;  3E56 A;  2MW5 A;  3U7D A;  2AQ3 B;  3KVF B;  2FCN A;  4ITK A;  3CWI A;  1YJI A;  3VXW A;  4Q2J A;  4M8N A;  5KHQ A;  4AUQ C;  2D5G A;  4JGH B;  1U4A A;  3NJT A;  3APF A;  3Q3O C;  1F77 A;  4LNO A;  2KMC A;  1Q1O A;  2YEP B;  4AQ7 A;  1N5X A;  2KQ7 A;  3LB8 C;  1SIJ A;  2KD0 A;  2UU7 A;  2FBW B;  4FHJ A;  4LNI A;  4RGN A;  3O65 B;  5G55 A;  3PVL A;  2WXG A;  1OGW A;  3RNE C;  3QQ8 B;  1GNU A;  1UGJ A;  1UNS A;  3RZW C;  1D5X C;  1A70 A;  1J8C A;  4GMV A;  2GB1 A;  3JVZ X;  4ANW A;  4A6Q A;  3BII D;  4KSK C;  4G11 A;  1MFW A;  3NVZ A;  2BS2 B;  3TEW A;  3EA6 A;  2EKE C;  4HKQ A;  3H8H A;  4YTN B;  1KM7 A;  4RH6 A;  3DCG A;  1UH6 A;  1JWS D;  1NI3 A;  1NEK B;  2D3C A;  3Q8B A;  3RNG C;  2CHZ A;  1V81 A;  1P98 A;  4UDU C;  1T0Y A;  2Y5B B;  4W9C A;  1XQQ A;  4GU2 A;  1YX6 B;  1I35 A;  1KTK A;  1J7A A;  3FC4 A;  3RUI B;  2FCM A;  2KHW B;  2D3B A;  3V62 A;  1SF0 A;  5CX3 A;  2RSU A;  3Q8E A;  1OQR A;  1ZUD 2;  3RNF C;  2CJO A;  2O6V A;  2Z8L A;  2D10 A;  5IKC M;  4P6V F;  1T5X D;  4MGI E;  3BYY B;  1EWY C;  4F1S A;  3W5U B;  1QF6 A;  2JT4 B;  4GSW A;  1E7U A;  2VZK B;  2KLC A;  1AAR A;  2K6Q A;  4BZA A;  2BBC A;  3A4S C;  4W9E A;  2G1E A;  3TSS A;  3VUY A;  3EGR A;  2K9X A;  3Q8A A;  1ZXI A;  1QZE A;  3JYU A;  4ZRI A;  4KGT A;  5LXH A;  3U4E G;  2Z59 B;  2HD5 B;  3P4P B;  2N9E B;  3VRA B;  3P4Q B;  1ZGU B;  3AEC B;  3AE4 B;  2FAZ A;  5D2M B;  2QEJ C;  5BYR A;  1RRB A;  1CJE A;  1TS4 A;  3ZYY X;  2N7J A;  4ZHP A;  2OJW A;  1WGG A;  1XCQ L;  2LMC A;  2DZK A;  1JWM D;  2BKF A;  2K22 A;  3VHT C;  4IW0 A;  2EEL A;  1EF5 A;  1I4R A;  2O2V B;  3HHM A;  1EO6 A;  3LJ3 A;  1SJE D;  4W9L A;  4YSZ B;  4YSY B;  1V5T A;  2KWC A;  2KVZ A;  3R7Q A;  2KTR B;  1FPY A;  2KDI A;  1TBE A;  3DBS A;  1VR9 A;  3ZXR A;  5C1Z A;  1MVK A;  3GOE A;  1D6E C;  2LXC A;  1CZP A;  2GBN A;  3WA0 A;  1WXS A;  3GP7 A;  3AE8 B;  2BB6 A;  4MEM A;  4DHZ E;  1UGM A;  2PLP A;  1YQ3 B;  2K5P A;  1F52 A;  1C4P A;  4EEW A;  4GLS C;  3L4P A;  1L5P A;  5G5H A;  1TKG A;  1QOF A;  1WFY A;  1Y56 A;  2CHW A;  4RMA A;  1TYG B;  5J18 A;  3MTN B;  4C00 A;  1TT5 B;  4DDG D;  4RCO A;  1JML A;  1VLB A;  5DPR A;  3MP9 A;  1WR1 A;  2J0J A;  4PS8 A;  3Q14 C;  3RPF C;  4A55 A;  4USA A;  1SBB B;  2K8H A;  2NTT A;  3DWG C;  4OZA A;  1GC6 A;  2EMT A;  5EDS A;  3DQV A;  4ZDV A;  2WXF A;  4B0M A;  4B6W A;  2ZEQ A;  1GUA B;  2UYZ B;  3UI3 A;  3H6N A;  1UBI A;  5IA7 A;  3KYD D;  1UWX A;  4IM2 A;  2BTE A;  3WAP A;  3QCA A;  2JZP A;  2KLG A;  2RD0 A;  2R2Q A;  5L95 C;  3ZQ4 A;  2W54 A;  4HLE A;  1F2R C;  2JSV X;  1FFU A;  2BW2 A;  1LGR A;  2JWU A;  2LFI A;  2IGD A;  3ZIM A;  2LGY A;  4WJP A;  4BVU C;  2WXO A;  4ZYS A;  1BT0 A;  2MLB A;  2KT7 A;  5G5G A;  4HPL B;  2LVQ A;  1ET6 A;  2JQR B;  3P2B A;  3VQI A;  3T3N A;  3X0W A;  5J17 A;  5H92 C;  2L00 B;  2PPH A;  1DYQ A;  2KMA A;  1T3Q A;  1L0X B;  2MQJ A;  2XK5 A;  2JVC A;  1D5Z C;  3A4R A;  4LNN A;  3AN1 A;  1TJE A;  1PYW D;  3A9J A;  3SD5 A;  3V3X A;  1T0Q C;  2CHX A;  4WWM A;  4HVB A;  1V2Y A;  1CK1 A;  5AUI A;  3NVW A;  3ZRC A;  3TEX A;  2WXR A;  2HTH A;  3OLM D;  2V0G A;  1WYW B;  3R66 C;  2C5L C;  4I6N B;  1JAL A;  2VZK D;  3K9O B;  4A3P A;  3SHQ A;  4GXB A;  4C7Y A;  4RM8 A;  2ON8 A;  4HKZ E;  3VTW A;  3HM6 X;  4RM9 A;  5AZG A;  4YTP B;  2KAC A;  1GJZ A;  1AW7 A;  1KFY B;  2QC8 A;  3ZDM C;  4BKS D;  3OJ3 A;  1WGH A;  1WYG A;  4PS7 A;  2WXN A;  4JQW C;  3AB5 A;  2RMM A;  2IO2 B;  4NZL B;  3W2D A;  2Z0D B;  4CO7 A;  1WM2 A;  1WX7 A;  4PYU A;  2V3P A;  2BT6 A;  4KIK A;  3VDZ A;  1DOY A;  2ZCC A;  2KTF A;  1YQ4 B;  1GB1 A;  1ZDX A;  4E3C A;  3UIO B;  3JSV B;  1P7F A;  5IN7 A;  2INN E;  1N63 A;  2M56 B;  3IFW B;  1RM6 C;  1SEB D;  1GG3 A;  1E6E B;  1XXG A;  2WP9 B;  2XBB C;  3NZU A;  3PLU A;  4FUL A;  3TBL D;  4W9H A;  3RD2 A;  3GE3 C;  1K52 A;  3B2G A;  4RNA A;  3N1X C;  1WXA A;  4AP4 C;  4CYE A;  1EF1 A;  2LI5 A;  2E6X A;  3CF6 E;  3Q6B A;  1HZ5 A;  5IAA C;  1MJD A;  4K1R B;  1FNW A;  1JWA D;  4HXD A;  4KZC A;  1R4N I;  3VTU A;  4P16 A;  2Q5W D;  4J6I A;  3ZLZ A;  2IY0 B;  3RYT A;  4ZRQ A;  3AXC A;  1WGD A;  2KZR A;  1OEY A;  3TCA A;  3AED B;  3MC0 B;  1B9R A;  3ABV B;  3MFG A;  3L08 A;  2RGF A;  2SAK A;  1DGJ A;  2MX2 A;  4K7S A;  5E6N A;  3DDC B;  1PFD A;  4WWP A;  4RF0 A;  4W9K A;  1H8C A;  1TS3 A;  2IO1 B;  1YMH E;  1JW9 D;  5D94 A;  1YN3 A;  1WWT A;  2KDM A;  3VR9 B;  2DX5 B;  2MSE D;  2RDH A;  4ZRK A;  3ZNG C;  1YQB A;  3KW5 B;  2MBE A;  4O1N A;  2ONQ A;  3IAS 1;  2BQQ A;  3O13 A;  4TQ1 A;  4HPP A;  4ICU A;  2JZZ A;  2V3N A;  4YTM B;  1CMX B;  2N1V A;  1GB4 A;  3EC8 A;  4GDL A;  4YSX B;  1YD8 U;  3PSE B;  1TS5 A;  3A1Q B;  3PT2 B;  4OVU A;  2NBV B;  1UBQ A;  2V3S A;  3PRM B;  3KYC D;  2C7N B;  3AEF B;  4FJZ A;  4HJK A;  3RCZ A;  2MJE A;  3DBR B;  1L2N A;  4EZL A;  4IG7 B;  4KZ0 A;  1V1P B;  2KYW A;  2W82 A;  2GBK A;  3I3T B;  3AEA B;  4GDK B;  4XDC A;  4EZK A;  2MH7 A;  3GS2 A;  4JWS C;  4BKS A;  3TEY A;  1BML C;  4EKU A;  2IGH A;  2E3T A;  5AZF A;  1V6E A;  2HTM E;  1YN5 A;  1T0R C;  4A3O A;  3OG5 A;  4DK5 A;  3R7R A;  1OQY A;  5HG2 A;  5IO9 A;  1C1Y B;  5C23 A;  3URY A;  4KIK B;  4RGT A;  4HRO A;  3Q8F A;  3ZTD A;  2WXM A;  1XLN A;  3PHW B;  1T6B X;  1QOG A;  1WX9 A;  2DZM A;  4WAA A;  5EE0 A;  4LNF A;  1MPE A;  4IWO A;  2HJ1 A;  2IPK D;  2OOB B;  2O2V A;  5LNK 1;  1V8C A;  1F1H A;  2DAJ A;  4BKT A;  4M02 A;  1S3S G;  2KMM A;  1VRA B;  2KTR A;  3BVG A;  3ENE A;  3NY5 A;  2DHZ A;  1NVI D;  2J0M A;  3DBH I;  3WAL A;  2YEP F;  2DNF A;  2M0X A;  2J53 A;  4CQN A;  1WH3 A;  4GOC A;  2BS4 B;  2KC2 A;  1XD3 B;  3ZKJ C;  2WQY B;  5HI1 A;  2DYB A;  4N59 A;  3UIP B;  1FCL A;  1NYR A;  4N9F 4;  2DZJ A;  4HRS A;  4ARI A;  4S17 A;  3TEZ A;  3N9Y C;  4JLC A;  3B08 A;  2IDY A;  2KN5 A;  4A90 A;  4BBN C;  3AU5 A;  4BBN F;  2Y5C A;  4REZ A;  3HVD A;  4JIO U;  2MBB B;  2DEN B;  2LEK A;  4E71 A;  4FA6 A;  1Y8R C;  1MI0 A;  5AUK A;  1YIW A;  3VR8 B;  2MWS B;  5DPW A;  4DQO C;  4M01 A;  4C56 C;  3AU4 A;  3N1Z C;  1ZW7 A;  5FR6 A;  1WIA A;  3RN9 C;  1C4C A;  2KFJ A;  3BVZ A;  3HM3 A;  2AEH A;  1SE9 A;  3MJ5 A;  2G4S A;  2J4X A;  2M17 A;  5H8Y E;  1WM3 A;  3NHE B;  5EE3 A;  1R4N B;  2J42 A;  4OHJ A;  1C79 A;  2VH2 A;  1EUV B;  2RPQ A;  3U52 E;  2WXJ A;  1K8R B;  2WXI A;  1TTN A;  2AL3 A;  2INP E;  1WGY A;  2PE6 B;  1EU4 A;  3WCQ A;  4GDL B;  2J0K A;  3HIZ A;  2RDB C;  1BXT A;  5HFY A;  1R4M I;  4M00 A;  2WX0 A;  1Q5W B;  3P4S B;  3ZNH B;  2I2Y A;  2KO3 A;  3PS6 A;  3L0W B;  1EWC A;  1J7B A;  4HWI B;  2ZZP B;  3PZD A;  2K0P A;  4HK2 A;  1TGZ B;  4YWG G;  4XYC A;  1RAX A;  2X8X X;  3PRP B;  3W5V B;  3AE7 B;  5J2R A;  2GRI A;  2JXX A;  4NPN A;  4NQL B;  3NOB A;  3H1U A;  2OED A;  3KLS X;  5G2N A;  2L83 A;  2C9W B;  3AI5 A;  1XT9 B;  2DZI A;  3QAQ A;  4DXA B;  2WXL A;  3MHS D;  2LUE A;  3DVG Y;  3EUB 2;  3R8B A;  2WYQ A;  3CIR B;  2Y3A A;  3JW0 X;  4OZB A;  3B9J A;  4P7I A;  2L3Z A;  1EM7 A;  3D32 A;  3B0A A;  5JXV A;  2JYE A;  1UUP A;  4G0N B;  1I7H A;  2L7R A;  4HCP B;  3MC8 A;  2FIF A;  3BY4 B;  2K8B A;  2K8C A;  5CHW A;  3Q69 A;  4LNK A;  3HUI A;  3IVF A;  2RR9 A;  3ZUN A;  3Q3N C;  1I4Q A;  4MT5 A;  4ASW C;  1UF0 A;  4ZRP A;  2EKI A;  4MH8 A;  2BPS A;  4KKJ A;  1L4D B;  1SE4 A;  1KOT A;  2G45 B;  2LRW A;  1S1Q B;  2PVO D;  1VJK A;  3SFD B;  2JYT A;  1FFV A;  2J7Q B;  2GMI C;  2PE9 A;  2ZPN A;  1JCK B;  4HDQ A;  1H4R A;  3ZNI D;  5TR5 A;  1P3Q U;  1PGA A;  4EE2 A;  4EZJ A;  4DHJ B;  2WNM A;  3B2F A;  3VVW B;  1L6U A;  5BYQ A;  4KDI C;  2K6D B;  3UQA A;  3DOW A;  2LJ5 A;  1SB3 C;  3AE6 B;  1WJU A;  2NBU A;  4WQM A;  2WS3 B;  2B76 B;  2MP2 B;  1C78 A;  1IYF A;  2WLB A;  5DPT A;  1SE2 A;  2PW9 A;  4P1B C;  1JRU A;  1MG8 A;  2JUO A;  3DBH B;  3JSV A;  1TY0 A;  3HRD D;  2BWE S;  4QAY A;  2NVU I;  2PMV A;  1C3T A;  3ZTC A;  4ARC A;  1YN4 A;  1WJ6 A;  2LGD A;  3P4R B;  1QQR A;  1K50 A;  2MBO A;  4AJW A;  2X38 A;  1SE3 A;  4NQK E;  2KQS A;  2JF5 A;  2MJD A;  1X1M A;  2GBM A;  2M8S A;  5IP4 D;  4XWT A;  4TUU A;  2DWQ A;  2BYE A;  2W55 A;  4IUM B;  4TQ0 A;  2CJN A;  4HJG E;  1SSN A;  2N0S B;  3AE9 B;  1M94 A;  2MRP A;  1SJH D;  4AS1 A;  3PRE A;  3PZ7 A;  2ASQ A;  3KWL A;  1N60 A;  1V49 A;  2V1Y A;  1V9J A;  3BZD B;  1SXT A;  1E0Z A;  4FHK A;  2M4N A;  2N9P C;  1V1O A;  2I1J A;  4ANV A;  1HEZ E;  4YXD B;  1IGD A;  4J3O D;  1FD6 A;  2G3Q B;  3GZN I;  5CHF A;  2QDF A;  3AEE B;  4M0W B;  3A9K B;  3ZRF A;  2IYD B;  2MBQ A;  4ZHO A;  2BWF A;  2KDE B;  3DVG X;  3N32 A;  1WXM A;  3ZDT A;  4BOS C;  2KOX A;  4WUR A;  3BK1 A;  4HDO A;  3K9P B;  3TMP B;  1JWU D;  3NG0 A;  3VH4 B;  2BGF A;  3RNA C;  3EEC A;  3C19 A;  4ICV A; 
#chains in the Genus database with same CATH homology
 4HCN B;  3L08 A;  5AZH A;  1FXT B;  2GOW A;  1UZX B;  3JVZ X;  1P1A A;  4ANW A;  1IPG A;  2AL6 A;  4KSK C;  2RGF A;  4G11 A;  4KV2 A;  5JZE B;  3CSF A;  3UQB A;  1YX5 B;  2MX2 A;  4K7S A;  5E6N A;  4AWJ A;  4B9K A;  3DDC B;  3BIN A;  5L83 A;  4WWP A;  2OJR A;  2EKE C;  4W9K A;  1H8C A;  1KM7 A;  2IO1 B;  3KH0 A;  2KX0 A;  3DCG A;  1J0G A;  1WMH B;  5D94 A;  3S2A A;  4G50 A;  3A1Q A;  3VAW A;  4NAW B;  1UH6 A;  2HJ8 A;  2DX5 B;  2MSE D;  4ZRK A;  1WI0 A;  3UF8 A;  3ZNG C;  1YQB A;  3KW5 B;  4GB9 A;  4JL9 A;  2MBE A;  4OVV A;  2KK8 A;  2C7M B;  2KXJ A;  4FN2 A;  4TQ1 A;  2LVP A;  2CHZ A;  1OTR B;  4ICU A;  1V81 A;  1P98 A;  3QC8 B;  1T0Y A;  2JZZ A;  1WJN A;  2WX1 A;  1CMX B;  2Y5B B;  3B1L X;  4W9C A;  4W9G A;  1XQQ A;  1E5W A;  2LXA A;  2N1V A;  2ZVO A;  4GU2 A;  4WWN A;  1YX6 B;  5BO4 B;  3EC8 A;  2NS5 A;  4GDL A;  1I35 A;  4GDK A;  3H7P A;  3TIX A;  3C0R B;  1YD8 U;  3PSE B;  3RUI B;  3A1Q B;  3PT2 B;  3V6C B;  2FCM A;  2KHW B;  1E8X A;  4K7W A;  3V62 A;  4OVU A;  5CX3 A;  2NBV B;  1UBQ A;  2V3S A;  3PRM B;  4MSM B;  3KYC D;  2C7N B;  2RSU A;  4FJZ A;  4HJK A;  3RCZ A;  2KNB A;  3DPD A;  4XZ4 A;  4GIV A;  1KLV A;  1L2N A;  1WE6 A;  1G6J A;  2HE7 A;  2O6V A;  4LDT D;  4ZYN A;  4EZL A;  2D10 A;  4MSQ B;  4IG7 B;  4KZ0 A;  4XX5 A;  4MGI E;  1WY8 A;  4MGY E;  3KUD B;  2CS4 A;  2GBK A;  5JHA A;  4MGK E;  2NR2 A;  3I3T B;  2N9X A;  4GDK B;  4XC2 A;  4EZK A;  3VH3 B;  3H7P B;  4F1S A;  1WZ0 A;  3NZS A;  4BKS A;  1LXD A;  4LJO B;  4TKN A;  2JT4 B;  4GSW A;  4EKU A;  5CTR C;  1E7U A;  1J19 A;  3HK0 A;  1VCB A;  2KLC A;  3PRZ A;  5AZF A;  4MGZ E;  1AAR A;  2K6Q A;  3CMM B;  1V6E A;  3A4S C;  4FJY A;  4A3O A;  2KX3 A;  4W9E A;  2KAN A;  2CKH B;  3VUY A;  4ZRJ A;  1OQY A;  3R7R A;  2BYF A;  4DK5 A;  2FID A;  2FUH B;  3QHT A;  2D3G A;  4F7Z A;  1C1Y B;  2O6V B;  5C23 A;  4KIK B;  2N7D A;  5KHO A;  3ZTD A;  4FJV B;  3QIJ A;  1QZE A;  3JYU A;  4ZRI A;  3M3J A;  2KKC A;  3OAW A;  3PHW B;  5LXH A;  4W9I A;  5D7G A;  5LLI A;  3W1Y A;  3ZVV A;  1WX9 A;  4IWP A;  2Z59 B;  2DZM A;  4EFO A;  5JHB A;  4WAA A;  2ZPY A;  4URK A;  2HD5 B;  4IWO A;  1WF9 A;  2OOB B;  2O2V A;  3DBL I;  2N9E B;  2LRU A;  1WXV A;  2BYV E;  2DAJ A;  2K39 A;  2ZNV B;  4KSL C;  4BKT A;  4IM3 A;  1ZGU B;  1S3S G;  2LVO A;  2LWP A;  5AEK B;  4W9J A;  2FAZ A;  2MCN B;  4W9F A;  2LZ6 A;  2KTR A;  5D2M B;  3M63 B;  3ENE A;  3NY5 A;  1RRB A;  2DHZ A;  3APC A;  5DCN A;  2J0M A;  2NCN A;  2YLM A;  3L17 A;  3DBH I;  5CHV C;  3PTF C;  3WAL A;  4DHJ D;  2NBW B;  1WGG A;  4IWQ A;  2M0X A;  2KDF B;  3RT3 B;  2DZK A;  4PS3 A;  1WH3 A;  2BKF A;  4DBG A;  4GOC A;  2ZNV C;  2ZCB A;  2KC2 A;  4KDL B;  3VHT C;  4II2 B;  1XD3 B;  4IW0 A;  3X23 A;  3ZKJ C;  4M8M A;  1EF5 A;  3EFU A;  2GBJ A;  3ML8 A;  2DYB A;  3Q3J A;  3UIP B;  2O2V B;  4N9F 4;  2DZJ A;  3H7S A;  3KUC B;  3VUX A;  2KWV B;  1EO6 A;  2L0T A;  3DBR I;  3HHM A;  3LJ3 A;  3W1S C;  4W9L A;  2M1M A;  1V5T A;  2KWC A;  2DAF A;  2FCS A;  4E74 A;  2LD9 A;  1RLF A;  4JLC A;  3R7Q A;  2KTR B;  3B08 A;  2KN5 A;  2KDI A;  1Z2M A;  3AU5 A;  4BBN C;  1TBE A;  4BBN F;  3H9D A;  3QA8 A;  3DBS A;  3R3M A;  4MDK E;  4WJN A;  3PGE A;  2UWQ A;  3NS8 A;  4JIO U;  2KWU B;  4AJY B;  2MBB B;  2DEN B;  3UGB B;  4DDI D;  3N30 A;  4WWO A;  4E71 A;  4FA6 A;  3U8Z A;  1RFA A;  1Y8R C;  5C1Z A;  1YIW A;  2DYM A;  1TZ1 A;  1KJT A;  2MWS B;  1ZKH A;  1ISN A;  3GOE A;  5DPW A;  2LXC A;  2JRI B;  4NJ7 A;  2GBN A;  2AWT A;  3VUW A;  4EUT A;  3AUL A;  3WA0 A;  2B3A A;  1WXS A;  3WAO A;  3Q3F A;  3AU4 A;  4B95 A;  4MEM A;  2KVR A;  3SU8 X;  4DHZ E;  1ZW7 A;  1Q0W B;  1F9J A;  5FR6 A;  1UGM A;  1WIA A;  4EEW A;  2KDB A;  2FNJ B;  4X57 B;  2NPT A;  2KFJ A;  3HM3 A;  2AEH A;  3ECI A;  1SE9 A;  2JWZ A;  4MJS A;  2G4S A;  4MEL A;  2M17 A;  4AOF A;  1WFY A;  2CHW A;  4RMA A;  1WM3 A;  5J18 A;  2O6V D;  2BF8 B;  1V80 A;  2IY1 B;  3MTN B;  3NHE B;  4II3 B;  2A5U A;  3V60 A;  4WJO A;  4EOY A;  2ZVN A;  1EUV B;  4DDG D;  1E8Z A;  2RPQ A;  2D11 A;  5DPR A;  1K8R B;  2WWZ A;  1TTN A;  1WR1 A;  2AL3 A;  3ZO5 B;  2J0J A;  4PS8 A;  1NI2 A;  1WGY A;  2PE6 B;  3M95 A;  4GDL B;  2J0K A;  3HIZ A;  3U30 A;  2NPT B;  2L0F A;  2K8H A;  2L76 A;  2MA9 B;  2A4Z A;  3A33 B;  1R4M I;  3OJ4 B;  1GC6 A;  2FCQ A;  2EMT A;  4W9D A;  1UEL A;  1WGR A;  5EDS A;  2WX0 A;  1Q5W B;  3ZNH B;  3DQV A;  4ZDV A;  4YL8 A;  2KO3 A;  3VTV A;  3PS6 A;  1LQB A;  3L0W B;  4B6W A;  2ZEQ A;  3M62 B;  4K81 A;  3LDZ E;  2JZ3 B;  3QJZ A;  1GUA B;  2UYZ B;  2C7H A;  1UBI A;  3H6N A;  4HWI B;  1OEY J;  2ZZP B;  3PZD A;  4HK2 A;  4MM3 A;  1TGZ B;  3KYD D;  5IA7 A;  4IM2 A;  1LM8 B;  2JPH A;  4I6L B;  4BKG A;  3QK0 A;  3WAP A;  5JH5 C;  1RAX A;  2K1F A;  3QCA A;  3PRP B;  3RZF A;  2KLG A;  4WJQ A;  2RD0 A;  4LCD E;  2R2Q A;  5L95 C;  5J2R A;  2N1W A;  2JXX A;  4FLH A;  4NQL B;  3NOB A;  4NPN A;  4HLE A;  2D2Q A;  3H1U A;  1E8W A;  4BOZ B;  3RUL A;  5G2N A;  3TL5 A;  2C9W B;  3AI5 A;  1XT9 B;  2KJ6 A;  2DZI A;  3QAQ A;  4DXA B;  4LJP B;  3MHS D;  1E7V A;  2LUE A;  2W9N A;  3DVG Y;  4F8C B;  4LDT B;  2WYQ A;  2IO0 B;  3ZIM A;  1E90 A;  3DVN V;  3JW0 X;  4P7I A;  4TV3 A;  4BFR A;  2CR5 A;  2L3Z A;  3D32 A;  2LGY A;  4GN1 A;  4WJP A;  1L7Y A;  4BVU C;  3B0A A;  4GGQ A;  2I1K A;  4G0N B;  1BT0 A;  4FBJ B;  1PQS A;  5GMV A;  3UIN B;  2MLB A;  2L7R A;  1D3Z A;  4HCP B;  2FIF A;  2Z0E B;  3L10 B;  3BY4 B;  4HPL B;  2K8B A;  2LVQ A;  1IP9 A;  2K8C A;  1NBF C;  3T9L A;  3P2B A;  3MJW A;  4IM0 A;  3VQI A;  5CHW A;  3X0W A;  5J17 A;  2L00 B;  3IVF A;  3V6E B;  5HKH A;  2RR9 A;  2PPH A;  3ZUN A;  2KJR A;  2LAS A;  3CST A;  2KMA A;  2BKR B;  4ASW C;  3IG3 A;  4PYZ A;  2MQJ A;  2XK5 A;  2IZV B;  2DYO A;  2JVC A;  2QHO A;  3A4R A;  4NNJ B;  3APD A;  3IHP C;  3QWZ B;  2MBH A;  2BPS A;  3KUZ A;  2WDT B;  1HE8 A;  1WR6 E;  2IO3 B;  3A9J A;  3SD5 A;  3PPA A;  2MP2 A;  2CHX A;  2AYO B;  4NY0 A;  4HVB A;  1V2Y A;  2G45 B;  2LRW A;  1S1Q B;  1KOT A;  3ONS A;  3ZRC A;  3WIM A;  2J7Q B;  2GMI C;  2CU1 A;  2PE9 A;  2ZPN A;  3ALB A;  1H4R A;  1UD7 A;  2HTH A;  4HDQ A;  5TR5 A;  1P3Q U;  3OLM D;  3ZNI D;  5DPS A;  4DWF A;  1WYW B;  3R66 C;  4WQO B;  2N4F A;  3QX1 A;  4EZJ A;  4DHJ B;  1WE7 A;  1Z5S B;  2C5L C;  3L16 A;  2XK5 B;  3VVW B;  1WZ3 A;  2K6D B;  4I6N B;  4KDI C;  3UQA A;  3DOW A;  3K9O B;  4KVG B;  2LJ5 A;  4A3P A;  1WJU A;  3DVN U;  2NBU A;  4A20 A;  3SHQ A;  1V86 A;  4K7U A;  3A9J B;  1VD2 A;  2L05 A;  4GXB A;  2MP2 B;  4RM8 A;  3EHV A;  5LXI B;  1IYF A;  1WJ4 A;  3VTW A;  4FAD A;  2KC1 A;  2ZJD A;  3HM6 X;  4RM9 A;  5DPT A;  3PLV A;  2JY6 A;  3SDL C;  3ZW3 A;  5AZG A;  2L8J A;  1SGH A;  1GJZ A;  1JRU A;  1MG8 A;  2JUO A;  3T8M A;  3ZDM C;  4BKS D;  4ANU A;  1A5R A;  3JSV A;  3OJ3 A;  1WGH A;  4IC7 B;  3VFK A;  3ZNZ B;  2KFK A;  2BWE S;  4PS7 A;  4G3X B;  1P0R A;  2NVU I;  4JQW C;  1C3T A;  3ZTC A;  5E6O A;  2K25 A;  1WJ6 A;  3TJP A;  2LGD A;  4MJS B;  4AJW A;  2MBO A;  2IO2 B;  4NQK E;  2KQS A;  2KJH B;  2Z0D B;  4CO7 A;  2JF5 A;  1WM2 A;  1WX7 A;  3L13 A;  4PYU A;  4ANX A;  4KIK A;  3VDZ A;  4NJ6 A;  2ZCC A;  2KTF A;  1X1M A;  4MH0 E;  3QAR A;  1LFD A;  4I6P A;  3PHX B;  2GBM A;  2M8S A;  3WAN A;  2N7E A;  5D6J B;  4E3C A;  4HPM B;  3WAM A;  3UIO B;  3JSV B;  4TUU A;  2KFK B;  2BYE A;  1V5O A;  3L54 A;  3N3K B;  4IUM B;  3V61 A;  2PEA A;  4TQ0 A;  3IFW B;  2IBI B;  2GBR A;  1GG3 A;  2MW5 A;  3U7D A;  3KVF B;  2FCN A;  3A9K A;  1P9D U;  2VRR B;  2XBB C;  3NZU A;  1WRD B;  1M94 A;  3VXW A;  4M8N A;  2LGX A;  5KHQ A;  4AUQ C;  2MRP A;  3PLU A;  3W1S A;  4FUL A;  1U4A A;  4JGH B;  3PRE A;  2PJH A;  2ASQ A;  2REX A;  4W9H A;  1YJ1 A;  2V4L A;  3RD2 A;  3TBL D;  1V49 A;  3APF A;  2V1Y A;  1V9J A;  2KMC A;  1WXA A;  2EMS A;  1Q1O A;  2M4N A;  2N9P C;  1EF1 A;  3IBE A;  2LI5 A;  2D07 B;  4FHK A;  4AP4 C;  4CYE A;  2YVC A;  2KQ7 A;  3CF6 E;  3ML9 A;  2I1J A;  4ANV A;  2KD0 A;  1SIF A;  5IAA C;  4K1R B;  2G3Q B;  3GZN I;  5CHF A;  1NDD A;  2R2O A;  4HXD A;  4M0W B;  4KZC A;  3A9K B;  1R4N I;  3ZRF A;  2IYD B;  2C60 A;  2MBQ A;  2XEW A;  2BWF A;  2KDE B;  4CHK A;  3VTU A;  3DVG X;  3N32 A;  1E8Y A;  1WXM A;  3ZDT A;  4FHJ A;  4BOS C;  1GC7 A;  4J6I A;  3ZLZ A;  2IY0 B;  2KOX A;  3O65 B;  5G55 A;  3RYT A;  3PVL A;  3PV1 A;  5E6P A;  3AXC A;  4HDO A;  2JRH A;  3K9P B;  1OGW A;  1WGD A;  1WX8 A;  3TMP B;  1I42 A;  3QQ8 B;  1WMH A;  2KZR A;  1GNU A;  1OEY A;  3TCA A;  2BGF A;  3VH4 B;  2G4D B;  3RZW C;  1J8C A;  4GMV A;  4NAW A;  4DHZ B;  3EEC A;  4ICV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...