3M62B

Crystal structure of ufd2 in complex with the ubiquitin-like (ubl) domain of rad23
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
72
structure length
72
Chain Sequence
SLTFKNFKKEKVPLDLEPSNTILETKTKLAQSISCEESQIKLIYSGKVLQDSKTVSECGLKDGDQVVFMVSQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase/protein binding
molecule keywords Ubiquitin conjugation factor E4
publication title The yeast E4 ubiquitin ligase Ufd2 interacts with the ubiquitin-like domains of Rad23 and Dsk2 via a novel and distinct ubiquitin-like binding domain.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 14
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2010-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3m62B00
2M1MA 5DPWA 2DYOA 5CX3A 3V6CB 3T8MA 2CHWA 4CO7A 1WXAA 2PE6B 3M3JA 4LCDE 1V49A 4NJ7A 3C0RB 3VFKA 2L00B 1EO6A 3WIMA 2ZCCA 3WAPA 3DDCB 2W9NA 1ISNA 2WWZA 3WA0A 1L2NA 4WWNA 3KH0A 2WYQA 1EUVB 2D2QA 2KJHB 2M8SA 3DOWA 5AZHA 2D07B 3L0WB 5IAAC 4EOYA 2DZJA 2ZPNA 2HE7A 1C1YB 5EDSA 2CHXA 4ZDVA 3ONSA 3Q3FA 3PVLA 2N1VA 4MGYE 3DBHI 1OEYA 1WF9A 3DVGX 4ZYNA 2WX1A 4MSMB 4DHZE 3JW0X 1YQBA 2FCMA 4A3PA 1OTRB 2LGXA 5DPRA 3WAOA 4NAWB 2EMTA 4FADA 1V9JA 1UH6A 3VH4B 1Y8RC 4W9KA 3ZDMC 2IO3B 3ZUNA 2MWSB 1YIWA 2AYOB 4BVUC 3DVGY 1WXVA 3NY5A 3PHWB 4HXDA 2BKRB 3H7SA 2MW5A 2O2VA 3HHMA 2L0TA 1D3ZA 2M0XA 1GC7A 4MGZE 5C23A 1E7VA 3RCZA 1WGYA 2CHZA 2LASA 1SE9A 2ZZPB 3QA8A 4W9CA 2MP2B 2KANA 2UWQA 3A4RA 1WJ4A 3L17A 3QK0A 2LVOA 4F8CB 5LXHA 4KSLC 1IYFA 2FIFA 2NBUA 2LJ5A 1WGHA 3TJPA 2HD5B 4MELA 1WM3A 4NJ6A 1WGRA 3UQAA 3IG3A 3N30A 4GXBA 2KNBA 1Q5WB 2BYVE 4ICVA 4XC2A 2MRPA 2N1WA 3D32A 1WY8A 2CKHB 3R7RA 2G4SA 4HK2A 1UGMA 2D10A 4ZRJA 4M8NA 4M0WB 1E8ZA 2KWVB 3L54A 3TCAA 2AL6A 4EZKA 1NBFC 2DX5B 3B08A 1V86A 1P1AA 3V6EB 2A4ZA 1WH3A 2NBWB 3H7PB 4WWPA 4II3B 4GSWA 4MDKE 4FULA 1WX8A 4TUUA 3ZKJC 1U4AA 4NAWA 3ZTCA 1RRBA 4K7WA 2XK5A 3CF6E 4ICUA 3ECIA 3PRMB 2I1KA 3LDZE 1ZGUB 2A5UA 4IG7B 3APCA 4W9EA 2KK8A 3PGEA 3UF8A 1HE8A 3RYTA 2FCNA 1RLFA 3MJWA 2IO2B 3ZW3A 5D2MB 2BPSA 2Y5BB 1WMHA 4G3XB 1WIAA 2AL3A 4BBNC 1RFAA 2G4DB 2KVRA 3QJZA 4OVUA 3R66C 2KDEB 2KTRA 3PRZA 2O6VA 4FLHA 1WXSA 4WWOA 2KWCA 2MP2A 4EZJA 1YJ1A 5LLIA 2JY6A 4DDID 4AJYB 3ZTDA 3HM3A 4HJKA 2BYEA 1WI0A 2J7QB 4TV3A 2MA9B 4RM9A 4F7ZA 5E6NA 2GOWA 4MH0E 5JH5C 3QCAA 3VTWA 2KZRA 2KJRA 3X0WA 1VD2A 4OVVA 3EC8A 3ZVVA 1KM7A 3UGBB 2O2VB 3APDA 1QZEA 3DBSA 4GN1A 2IY0B 3U8ZA 4RM8A 2O6VD 4ANXA 2XEWA 2JVCA 2LUEA 4G0NB 4IUMB 3X23A 2VRRB 2DYMA 2HTHA 5C1ZA 4IM3A 4AWJA 4E74A 4KDIC 2D3GA 4ASWC 4JLCA 5FR6A 2PPHA 4X57B 1V2YA 2M4NA 2NPTB 3OJ4B 1CMXB 1Z2MA 2JXXA 3EHVA 3OLMD 3SU8X 1V5OA 2KO3A 2J0MA 3QWZB 4DHJD 3ZNGC 1R4NI 4DBGA 3VTVA 2KQ7A 2AEHA 2DHZA 2IYDB 1S3SG 3QAQA 4AP4C 2KN5A 1JRUA 3SD5A 1UD7A 2D11A 1XD3B 3UIOB 2LI5A 2QHOA 3OAWA 2KMAA 3DCGA 3NS8A 1E8XA 1WX7A 1GNUA 1WR1A 2DZIA 1IPGA 3PLUA 3ZNID 3AXCA 1YD8U 4GDLB 1UBQA 3ML9A 2FCSA 2KXJA 3KUCB 1UBIA 3ML8A 3K9OB 4F1SA 2XK5B 4G50A 3ZRFA 1E5WA 4JQWC 4TKNA 4K7UA 2BWES 1R4MI 4G11A 4EFOA 2YLMA 4WJPA 1WJ6A 4J6IA 3L16A 2FCQA 1LM8B 2K6DB 4MEMA 3ZNZB 1NDDA 3I3TB 2K8HA 3QC8B 1WMHB 3SDLC 4DXAB 4KDLB 1J19A 5JZEB 2KTRB 2K8BA 4FN2A 2YVCA 2O6VB 4HCNB 2KC2A 4BBNF 3H1UA 4K7SA 3PV1A 2N9PC 2NPTA 2PE9A 2JUOA 3H9DA 3VVWB 4W9GA 3EECA 4CYEA 2FNJB 1IP9A 4NPNA 1WJNA 2ASQA 4A3OA 2KX0A 3SHQA 1F9JA 3RULA 3KW5B 3QX1A 4BOZB 1WZ0A 3GOEA 4MSQB 3DVNV 3KUDB 1BT0A 3AU4A 2MBOA 2REXA 2RSUA 3AU5A 1WYWB 3VDZA 4E3CA 4GIVA 4DHZB 3VUWA 1GC6A 1NI2A 4URKA 1L7YA 3LJ3A 3ZIMA 4GDLA 3BY4B 2LD9A 4PS3A 3JVZX 1P98A 2DYBA 4B95A 3ALBA 5DPSA 5JHAA 1S1QB 2LRUA 4FBJB 5KHQA 3ZDTA 3O65B 1A5RA 3CSFA 2LGDA 1G6JA 3V62A 1OGWA 3IBEA 4NQKE 2MX2A 5IA7A 3KUZA 3ZNHB 2L76A 2WX0A 1J8CA 2KFKB 4E71A 4BOSC 4WJOA 2K6QA 5LXIB 4P7IA 2JRHA 3H6NA 4B6WA 1P0RA 1H4RA 2LWPA 1YX5B 2XBBC 2I1JA 2KDIA 2PEAA 3WANA 1LFDA 3R3MA 1KOTA 4IWOA 4HPMB 4AUQC 2C5LC 4GMVA 5D7GA 2JPHA 5E6PA 2MLBA 1WGGA 3DBRI 4FJVB 2JRIB 5DPTA 4CHKA 1TTNA 4KIKA 5L95C 4FJZA 2FUHB 4IWPA 5GMVA 4BKTA 4DK5A 2PJHA 4NY0A 1WR6E 4RMAA 3W1SA 2FIDA 1E7UA 2G45B 3PT2B 3VQIA 1Q1OA 3DBLI 2KC1A 4W9IA 2V1YA 3U30A 4ZRKA 4GDKB 2K1FA 2OOBB 2R2QA 4LJOB 2DENB 2GBNA 4KSKC 2J0KA 3UQBA 1I35A 2C7MB 2K8CA 3U7DA 3TIXA 2ZPYA 5D94A 4I6PA 2ZNVB 4MGKE 2L7RA 3PREA 1X1MA 3TBLD 1XQQA 4W9JA 3W1YA 4BKSD 1V6EA 2WDTB 2IO1B 3V61A 3A33B 2N9XA 1WE7A 3QIJA 2KKCA 4HPLB 5CHVC 1V80A 2KFJA 3NZSA 2JT4B 5AZGA 2KJ6A 2DAFA 2FAZA 3UIPB 2GBKA 4FJYA 1TGZB 4A20A 4HDOA 2C7NB 2KFKA 4ANWA 3NZUA 4WQOB 5KHOA 1E8YA 4LDTD 4DWFA 1V5TA 3HM6X 2ZVNA 3RZWC 3WAMA 4TQ0A 2N4FA 2RGFA 2K25A 5J18A 2KDBA 1EF5A 1WXMA 2RD0A 3M62B 4XX5A 1E90A 3ZRCA 4LJPB 3M63B 3CSTA 3A9KB 4W9LA 1UZXB 3WALA 2BWFA 1T0YA 2EMSA 2IY1B 2LVPA 4HLEA 5J17A 2GBJA 2C9WB 2KOXA 2N7EA 3L08A 2JZZA 5CHFA 4WJNA 3DQVA 3S2AA 4IM2A 3ZO5B 4EKUA 3RZFA 2MBBB 1FXTB 2L05A 3APFA 3HK0A 3M95A 4N9F4 4HWIB 4FA6A 2MBQA 2CU1A 4MM3A 4GDKA 5L83A 5DCNA 2Z0DB 2CS4A 5J2RA 4ANUA 3B1LX 1Q0WB 3N32A 5AEKB 3A1QA 4PYUA 3A9JB 3VAWA 2KX3A 2N7DA 2J0JA 3NHEB 4KV2A 2HJ8A 1TBEA 1WZ3A 3JSVB 1WFYA 3N3KB 4GU2A 5G55A 2MSED 2RPQA 1OEYJ 1Z5SB 2L8JA 5AZFA 3PHXB 4JIOU 2IO0B 2LGYA 4ZRIA 2K39A 1E8WA 1WE6A 1I42A 3UINB 3IVFA 1OQYA 3VTUA 2CR5A 2DAJA 2ZNVC 3NOBA 2NR2A 3TMPB 4KIKB 5TR5A 3R7QA 1SGHA 1YX6B 4KZCA 2Z59B 2N9EB 3AI5A 4MJSA 4WAAA 4DHJB 4JL9A 3CMMB 3B0AA 4LDTB 2IZVB 2MBHA 4K81A 1WM2A 3A9KA 3BINA 1H8CA 2JWZA 2NVUI 2LRWA 2GMIC 2M17A 2KLGA 1KLVA 3ENEA 3GZNI 3MTNB 2ZEQA 3RT3B 4K1RB 1K8RB 3T9LA 1PQSA 2MBEA 3DVNU 5CHWA 3VUXA 3L13A 5E6OA 2KDFB 2UYZB 3V60A 4KVGB 3K9PB 3KYCD 1AARA 2Z0EB 2IBIB 3VH3B 2KD0A 3VUYA 1XT9B 2NCNA 1ZKHA 1WJUA 4EZLA 2DZKA 3A9JA 4BFRA 3RD2A 3PSEB 2LXAA 3VHTC 2NS5A 3JYUA 2C60A 2LXCA 4FHKA 1M94A 3PTFC 3JSVA 3KVFB 4IWQA 5JHBA 3PS6A 4B9KA 2R2OA 1TZ1A 3MHSD 4HCPB 4GB9A 1UELA 5CTRC 2GBRA 2L3ZA 4BKSA 4IW0A 4II2B 3QQ8B 4FHJA 4I6LB 4I6NB 1WGDA 4GGQA 1GJZA 2BF8B 3KYDD 5D6JB 2KMCA 1GUAB 2ZJDA 5BO4B 2KTFA 2MQJA 4XZ4A 1WX9A 1LQBA 4NQLB 3ZLZA 1VCBA 4NNJB 1MG8A 2LZ6A 2RR9A 3PLVA 3TL5A 4MGIE 1V81A 2BKFA 2DZMA 3A4SC 4TQ1A 3PPAA 4WJQA 2L0FA 4YL8A 2NBVB 1SIFA 3AULA 3A1QB 2GBMA 4M8MA 2B3AA 2LVQA 1EF1A 3DPDA 4PS7A 5G2NA 1J0GA 3HIZA 5HKHA 1RAXA 1GG3A 3Q3JA 3W1SC 4BKGA 2V4LA 3PZDA 4AJWA 4JGHB 3RUIB 3IFWB 2G3QB 2C7HA 4KZ0A 4W9FA 2KQSA 2KLCA 2KWUB 2KHWB 1ZW7A 2ZVOA 4HDQA 2BGFA 3QHTA 1C3TA 2BYFA 2OJRA 4EUTA 2MCNB 3P2BA 4AOFA 2AWTA 1WRDB 1KJTA 4PYZA 4EEWA 4HVBA 3IHPC 3QARA 2JF5A 2V3SA 4IM0A 3VXWA 4ANVA 1P3QU 2EKEC 4W9DA 4MJSB 3OJ3A 1P9DU 3H7PA 3PRPB 4W9HA 4GOCA 3L10B 4IC7B 2ZCBA 4PS8A 4DDGD 1LXDA 3EFUA 2JZ3B
chains in the Genus database with same CATH superfamily
2M1MA 5DPWA 4YSYB 4CO7A 2FE8A 2PE6B 3URYA 3C0RB 1EO6A 3WIMA 1C77A 4LNNA 5AUIA 2WYQA 4LK0M 3ZJTA 2R61A 3DOWA 5AZHA 1I4QA 4RGTA 2ZPNA 4KKJA 2QILA 5BMHA 3DBHI 1OEYA 4ZYNA 1FEHA 2MJEA 1YQBA 2FCMA 3Q8BA 4WQMA 4C80A 1R4MB 3IT4B 2BKRB 3H7SA 2MW5A 1NEKB 2QDFA 3HHMA 1UGJA 2L0TA 1V8CA 3ZQ4A 2LEKA 1D3ZA 4ZOHC 3RCZA 1KLUD 4W9CA 2KANA 1FCCC 2UWQA 1IYFA 4KSLC 2NBUA 2LJ5A 4JE3B 1WGHA 3N9YC 1WM3A 1KFYB 4A6QA 1N6ZA 1SE3A 1Q5WB 4XC2A 4HK2A 1UGMA 2ZW0A 3TCAA 1VJKA 2LGSA 1EU3A 1NBFC 3B08A 5G5GA 1P1AA 3V6EB 2A4ZA 2NBWB 3VRBB 4ARCA 4II3B 3ZTCA 4NAWA 1N62A 4ICUA 1I4HA 3ECIA 1HTQA 4N6EB 2I1KA 2A5UA 3BYTB 2KK8A 3UF8A 1HE8A 1BXTA 2FCNA 4G3XB 4BBNC 2KVRA 2V3NA 1HA5A 2D3AA 2KDEB 1ZOYB 2O6VA 3ZJUA 4WWOA 2MP2A 4EZJA 1YJ1A 2JY6A 2LHDA 4AJYB 1F52A 2WXNA 3AE3B 5EE9A 4HJKA 2HJ1A 1WI0A 1A70A 3W2DA 2MA9B 4RM9A 3Q6BA 2V9HA 2D3CA 3AV8A 1QOAA 3EC8A 3ZXRA 3HVDA 3APDA 3RI7C 3DBSA 2IY0B 2QEJC 5HHDG 3X23A 2VRRB 2JQRB 4AWJA 1YJIA 5FR6A 2PPHA 4X57B 1FMAD 2NPTB 2X38A 3OJ4B 3P4PB 2BB5A 3EHVA 1N61A 4DHJD 1E0ZA 1GB1A 3ZNGC 2JU6X 2IYDB 3MFGA 3QAQA 4AP4C 3AEAB 2D11A 4KGRA 4JPSA 3LYYA 1ROEA 3OAWA 3NS8A 2OJWA 2DZIA 2I2YA 4GDLB 1VZ8A 2SAKA 1Y56A 4XGAB 1N5XA 3KUCB 5GXGB 1UBIA 2L52A 3NRZA 1R7SA 4EFOA 1YN3A 2YLMA 2FCQA 5BYRA 3QC8B 2E3TA 1J19A 5JZEB 2KC2A 4K7SA 1B1ZA 2JUOA 4CYEA 2FNJB 1JRPA 1WJNA 2ASQA 1TYGB 4JX1C 5EE0A 1L0VB 1FXIA 3Q69A 1L0YB 3U52E 3Q8EA 3DVNV 3AU5A 2MJ3A 3SFEB 4URKA 3B2GA 2DYBA 4N58A 5DPSA 2TSSA 3HVZA 3Q3MC 2FUG1 2LMCA 3O65B 3GZNB 3AE4B 2LGDA 1G6JA 4K3BA 1ZDVA 3IBEA 3ZNHB 2WX0A 3O13A 1J8CA 4WJOA 2K6QA 1D5MC 3IXSA 4A90A 2XBBC 3MC0B 2PEAA 1V1PB 1J7AA 1C9FA 1KOTA 2UU7A 3AEFB 2C5LC 5D7GA 5E6PA 3AN1A 2OEDA 4C7ZA 4CHKA 4KIKA 4FJZA 4M00A 4DK5A 2PJHA 2ON8A 1E7UA 3DBLI 4W9IA 2V1YA 1QILA 3MP9A 4KSKC 4DXFA 2K8CA 2BVCA 1JMLA 3W1YA 2WDTB 3V61A 3AM9A 3Q3NC 2KKCA 5CHVC 1V80A 2N7JA 3NZSA 2JT4B 1TS3A 1ET6A 2GBKA 4A20A 2KFKA 3NZUA 5KHOA 2HTME 4LDTD 3RZWC 4TQ0A 2RGFA 1J7BA 4XX5A 3RNFC 2KQ4X 3ZRCA 2WXOA 3FILA 1L4DB 4KKIA 1MFWA 2BWFA 2BS4B 5J17A 2LVPA 4HLEA 5MPOA 2JX5A 3L08A 2JZZA 4WJNA 3ZO5B 2WGSA 2NTTA 1TS2A 3RZFA 2WDQB 3BVMA 4GDKA 5DCNA 2Z0DB 5J2RA 1PYWD 2JXTA 3IT6B 3NHEB 4KV2A 2HJ8A 2INCC 2VZKD 1WFYA 4GU2A 1MVKA 2MSED 2RPQA 1OEYJ 1MI0A 3DBHB 2L8JA 1GB4A 3PHXB 1T0RC 1ZPSA 1WE6A 3IVFA 3PO0A 4LTUA 2CR5A 5BYSA 2NR2A 2L32A 1YX6B 2G1EA 4MJSA 4WAAA 5IN7A 4K81A 3A9KA 4IDIA 4ACFA 3B2FA 3BINA 2AQ1B 3KLSX 2KLGA 5C2TB 1K8RB 1I4RA 1F77A 5CHWA 2XN9C 5E6OA 2UYZB 3KYCD 1AARA 3ZXVA 3MC9A 3VH3B 2KD0A 4A8XC 2NCNA 4YWGG 1M94A 5JHBA 4IWQA 3PS6A 1DGJA 3MHSD 2K3UA 1UELA 4LNIA 4IW0A 4I6LB 3KYDD 5D6JB 1RM6C 1DOXA 3RNGC 1JCKB 2ZJDA 2KTFA 2MQJA 3ZLZA 3FC4A 1VCBA 4NNJB 1MG8A 2LZ6A 1IGDA 3TL5A 2BKFA 3IAS1 4WJQA 4WIPA 4YL8A 2INNE 3AULA 3A1QB 1JWBD 1PGAA 3HIZA 4ZYSA 3PZDA 3RUIB 2PTLA 2KHWB 1ZW7A 2M19A 2BYFA 2KVZA 3P2BA 4AOFA 4PYZA 1KJTA 1DOIA 4IM0A 2V4IB 1P3QU 2M56B 3H8HA 4IC7B 3TEWA 1LXDA 5CX3A 2CHWA 1WXAA 1V49A 4NJ7A 3W5VB 2M0AA 2ZCCA 2W9NA 1ISNA 1L2NA 2PLPA 4EOYA 2NMQA 4ZDVA 2JZPA 3ONSA 3Q3FA 3DVGX 4MSMB 2L83A 3JW0X 5DPRA 1XLPA 5IKCM 2Q5WD 4TMAB 3VH4B 3ZDMC 3ZUNA 1YIWA 4RGMA 2QJLA 3DVGY 4HXDA 2LFIA 1GC7A 1M4VA 1MHHE 5D3IB 1VZ7A 3L17A 2LVOA 4MELA 3UQAA 4FXCA 2KNBA 1SSNA 3AMZA 3U4EG 2PMVA 1TIFA 2KWVB 2AL6A 4NAMA 4EZKA 1FIQA 1YQ4B 1V86A 1WH3A 1Q10A 1V97A 5FR3A 2QMTA 4K7WA 1QT9A 1KF6B 1ZGUB 2WQYB 1OFFA 3BIID 4YXDB 3ZW3A 2BPSA 1WIAA 2AL3A 1RFAA 3QJZA 2WXHA 1HXYD 4FLHA 3HM3A 1VZ6A 2PKOA 1ACCA 4TV3A 1CK1A 1TJEA 4F7ZA 2GOWA 2IPKD 2IGHA 4IOIE 4OVVA 4M0WA 4YSZB 1IBXB 3ZVVA 3P1MA 4N59A 3UGBB 2O2VB 1QZEA 3TEYA 3BYYB 4GN1A 4ANXA 2GI9A 2XEWA 1C4AA 4G0NB 5C1ZA 2DYMA 2HTHA 2ONQA 4IM3A 2WU5B 1SXTA 1I4PA 4JLCA 1V2YA 2M4NA 2JXXA 4P6VF 4MACA 1V5OA 1L6VA 2KO3A 3E9SA 1R4NI 4DBGA 3VTVA 1YQ3B 2AEHA 2DHZA 2WXQA 3Q2AC 3SD5A 1V1PA 1UD7A 3NVWA 5BMGA 1IPGA 2KACA 1XCTL 3WCQA 1L5PA 2FCSA 4KGSA 4EE2A 3ML8A 4F1SA 2XK5B 3ZRFA 1E5WA 4TKNA 4YTNB 2GLSA 1C78A 4WJPA 4J6IA 3E56A 3L16A 1LM8B 5FKAC 4MEMA 3ZNZB 3I3TB 1WMHB 3SDLC 1L6UA 4KDLB 2KTRB 2YVCA 3AEGB 2MJDA 1NYRA 3EECA 2J42A 4W9GA 3P4QB 1HZ5A 1TKGA 4NPNA 3RNBC 4A3OA 2KX0A 2WXPA 1F9JA 4JWUC 1UF0A 2QIEB 4USAA 1WZ0A 4L1BA 2WNMA 4WH4A 2BS2B 3FAHA 1SJHD 3KUDB 5IO9A 1BT0A 3AU4A 2REXA 1WYWB 4RH6A 4GIVA 3EUB2 1LGRA 1GC6A 1NI2A 1L7YA 3LJ3A 3BY4B 4PS3A 3JVZX 5JHAA 2LRUA 4RF0A 5C3JB 2FBWB 3CSFA 1CJEA 1OGWA 4NQKE 2QC8A 3DHHC 2XNAC 1KH0A 3H6NA 3U7ZA 2LWPA 3AH7A 2I1JA 1LFDA 2PIAA 3NS1A 3PZ7A 4GMVA 4S17A 4C4VB 1WGGA 3DBRI 1EWYC 2FUHB 4IWPA 4BKTA 4NY0A 1K51A 3VQIA 1Q1OA 3U30A 4YT0B 4ZRKA 2K1FA 2AQ2B 2QCZA 2OOBB 4LJOB 2DENB 3UQBA 2C7MB 4MH8A 2ZPYA 2G9HD 3N20C 2ZNVB 3LB8C 1XQQA 3T3NA 3A33B 2N9XA 1WE7A 3I57A 2BYTA 4HPLB 1YJJA 2KFJA 4J3OD 2FAZA 1TGZB 2OHFA 1E8YA 1V5TA 3HM6X 4KGTA 2N4FA 3M62B 1VDVA 1T0YA 2EMSA 4Q2JA 2N7EA 3S2AA 2Y5CA 3RN9C 5HI1A 3APFA 2L05A 2WXIA 1OQQA 2YEPF 2CS4A 1FPYA 1Q0WB 3A1QA 1UNSA 3A9JB 3VAWA 2PW9A 1DYQA 1WZ3A 4LNFA 5AZFA 4JIOU 2IO0B 2K39A 1I42A 1OQYA 2ZNVC 3NOBA 3R2TA 2BW2A 1MJDA 3TMPB 3R7QA 1OQRA 4C56C 4YSXB 3AI5A 2WHIA 4JL9A 3DWGC 4LDTB 2IZVB 1T3QA 1WM2A 4ITKA 1H8CA 4JWSC 2GMIC 2M17A 4HKZE 1JWAD 4AQ7A 4K1RB 3DVNU 3L13A 3EFCA 3N1ZC 4KVGB 1PGBA 5EE3A 2Z0EB 4ZRPA 1XT9B 1RFKA 2RDGA 1WJUA 4EZLA 4BFRA 3RD2A 3JYUA 3JSVA 4B9KA 2R2OA 2BB6A 4HCPB 1P7EA 2H89B 2VZKB 2Y5PA 1GJZA 1WGDA 2PVGC 1GUAB 3SFDB 1KTKA 4MM3B 4TQ1A 3PPAA 2L0FA 2NBVB 1SIFA 2B3AA 2LVQA 1RAXA 5IP4D 2WXKA 1TT5B 4AJWA 1PFDA 3IFWB 2G3QB 1P7FA 2W3RA 2WXFA 4W9FA 3Q8CA 1E6EB 2KQSA 2KLCA 2WS3B 4EUTA 2JF5A 3Q3OC 4W9DA 3OJ3A 3SEBA 1P9DU 5E6JA 4W9HA 1C79A 2DBYA 3W5UB 4TSSA 3V6CB 2WLBA 1TKEA 2ACZB 3AEDB 4QAYA 2KDMA 2LJIA 1C4CA 3M3JA 4LCDE 3U2SC 3VFKA 2L00B 4XWTA 3RNAC 3WAPA 2K5PA 5IOIA 2WWZA 3KH0A 4LLGM 1IGCA 2WU2B 1R4NB 2M8SA 1WSPA 2ZW1A 3L0WB 5IAAC 1C1YB 5EDSA 2CHXA 1SBBB 3PVLA 2N1VA 4ZHPA 1MPEA 3EGRA 4HJGE 3C19A 4DHZE 3Q14C 1D5XC 4A3PA 1UWXA 2LGXA 2JWUA 4NAWB 1V9JA 2K0PA 1D4BA 4W9KA 1VRAB 2PVOD 3DHIC 5EE1A 4BVUC 2AYOB 1IBXA 3NY5A 3PHWB 1VR9A 2O2VA 3OWEB 1SB3C 4MGZE 1TKYA 3MC8A 1E7VA 2BTEA 1CZPA 1WGYA 2CHZA 1PGXA 3AE1B 1SE9A 3QA8A 3KWVA 4B0EA 2MP2B 5LXHA 1FO4A 4RF1A 1C4PA 4OZBA 3TJPA 1WGRA 2KT7A 3IG3A 2BYVE 4ICVA 2MRPA 1ZUD2 1WY8A 4ZRJA 2D10A 4M8NA 1E8ZA 3L54A 2NTSA 3KQ4A 4WWPA 3ABVB 3C8YA 4FULA 4M02A 1RRBA 2XK5A 1K53A 4WURA 1D5ZC 3AE5B 3PRMB 4XDCA 2VH1A 4XYCA 3LDZE 1QOGA 4IG7B 3APCA 4W9EA 3RYTA 3MJWA 2IO2B 1FRRA 2AQ3B 2INDC 1WMHA 2KWDA 3V05A 2G4DB 4OVUA 3R66C 2KTRA 2KWCA 3AE6B 5LLIA 1XLQA 3ZTDA 4RGOS 1I4XA 4P1CC 3DBRB 3AE9B 5JH5C 3HRDD 1I4GA 3QCAA 3VTWA 3X0WA 1VD2A 4MT5A 1FNVA 2KYWA 2D3BA 4YTPB 2O6VD 4HPPA 3TEZA 1F2RI 3ZJVA 1DOYA 2D3GA 1V1OA 3R2IA 2I38A 3OLMD 3SU8X 2IGGA 1YN5A 1D6EC 2AX5A 2J0MA 3QWZB 2KQ7A 3AEBB 2BBCA 2KN5A 1JRUA 1HEZE 1XEEA 2YEPB 1C76A 3PZ8A 1WX7A 1ZXHA 1ZXIA 3PLUA 3ZNID 3AXCA 4C4VA 1UBQA 2Z8LA 1E7PB 3K9OB 1EU4A 4JQWC 2BWES 4G11A 1WJ6A 4YTMB 2LGIA 3R8BA 1NYQA 2K8HA 4DXAB 1NI3A 4US9A 2INPE 2NPTA 3VVWB 1IP9A 1JROA 3SHQA 1FD6A 3QX1A 3TEXA 2WXMA 3GOEA 4MSQB 3AEEB 3MHZA 2MBOA 2RSUA 1SEBD 4OZAA 4E3CA 3VUWA 2W3SA 2GRIA 4GDLA 4OVZA 1P98A 4B95A 3ALBA 4XE0A 1XCQL 1FM0D 5KHQA 1HTOA 4A9AA 2DWQA 1A5RA 3V62A 4ZHOA 2MX2A 2L76A 2KFKB 4E71A 4BOSC 1L4ZB 2WDRB 1K52A 1TY2A 4B6WA 1H4RA 2KDIA 4OW0A 5HG2A 4IWOA 4HPMB 2IJ0A 3V3XA 2MLBA 1QOFA 2JRIB 5L95C 1BMLC 4RMAA 2G45B 3PT2B 3I63C 2KC1A 4GDKB 1QQRA 3DBLB 2B76B 2GBNA 1I35A 1JWMD 3U7DA 3BZDB 4MGKE 2L7RA 3PREA 1X1MA 3TBLD 4W9JA 1V6EA 2W55A 3Q8FA 4HKQA 2DNFA 2KJ6A 3HUIA 3N1YC 3NVZA 4GLSC 4HDOA 2C7NB 4DWFA 2ZVNA 4DQOC 3KWLA 5J18A 2KDBA 1WXMA 1ET9A 3NVVA 2L1AA 4XWWA 3A9KB 4W9LA 1UZXB 2IY1B 3P63A 2C9WB 4HRSA 1WXQA 5CHFA 3UI3A 4EKUA 2WP9B 4N9F4 4OZCA 2W54A 4HWIB 1ESFA 4FA6A 2MBQA 2CU1A 4MM3A 5L83A 5AEKB 3N32A 5HFYA 3N3KB 5G55A 1T6BX 1QF6A 1Z5SB 3TUOA 2HDEA 2LGYA 1E8WA 1ZE3D 3UINB 3VTUA 4WWMA 2DAJA 1SGHA 2GB1A 3NZ3A 1KLGD 4DHJB 1XLNA 3B0AA 4NJCA 4A55A 1PUTA 4BZAA 3W9CB 4P16A 2NVUI 3DHGC 3RMKC 3ENEA 3MTNB 2MBEA 1FFVA 3VUXA 1TS4A 2RMMA 3Q8AA 3V60A 2IDYA 4RFBA 1FFUA 1SF0A 1XLOA 3VUYA 4XDDA 2DZKA 2LXAA 2LXCA 3PTFC 4K3CA 5BYQA 5CTRC 3ZYYX 2N9KA 2L3ZA 4OHJA 4BKSA 1KRHA 4II2B 1T0SC 1RWSA 4FHJA 4UDUC 1WX9A 1LQBA 2KMMA 2RR9A 1JQ4A 1JALA 1SIJA 4MGIE 3A4SC 4M8MA 2GBMA 1EF1A 1LO5D 5G2NA 5HKHA 3W1SC 2MHJA 2KWUB 2ZVOA 1QLBB 1YN4A 2MH7A 2OJRA 3IAM1 4EEWA 5H92C 3QARA 4REZA 2WXJA 2V3SA 3VXWA 3BVZA 2MEKA 3PRPB 3L10B 1PDXA 4AS1A 1XO3A 3J9CA 2ZCBA 4PS8A 1FXAA 3EFUA 2JZ3B 4HROA 2DYOA 3T8MA 1N60A 1FRDA 4H2AA 4LNKA 3DDCB 3WA0A 4BAXA 4WWNA 2CJOA 1EUVB 2D2QA 2KJHB 2D07B 2DZJA 2HE7A 2CJNA 4MGYE 1WF9A 2WX1A 4L2YA 4S0RA 1OTRB 3WAOA 3AE2B 2EMTA 4FADA 1UH6A 1Y8RC 5FK9C 1L0XB 2IO3B 2MWSB 3AECB 1WXVA 2H88B 1CQVA 2IGDA 2M0XA 1N5WA 4DXGA 2RDHA 5C23A 2LASA 3EA6A 2ZZPB 3P4SB 4F8CB 3QK0A 3A4RA 1MHXA 1WJ4A 2FIFA 2WXLA 2HD5B 1N63A 4NJ6A 1QKZA 3N30A 4GXBA 1F2RC 1FCLA 4RNAA 2N1WA 3D32A 1RYJA 2CKHB 1UWMA 1AYFA 2G4SA 3R7RA 3ZIMA 4M0WB 1I7HA 1T5XD 2DX5B 3BK2A 3H7PB 1YNTE 4GSWA 4MDKE 3ZKJC 1WX8A 4TUUA 1UUPA 1U4AA 2K22A 3CF6E 3AE8B 3FKYA 2X8XX 1XF5L 3PGEA 2VH2A 1K50A 3GS2A 1RLFA 5D2MB 2Y5BB 5TSSA 1FNWA 1TY0A 3RPFC 1AW7A 2N9LA 3GE3C 3PRZA 1WXSA 3I9V1 1BUIC 2E6XA 4DDID 2JYTA 2BYEA 2J7QB 5E6NA 4C00A 4MH0E 2KZRA 2KJRA 2QSDA 1KM7A 4CQNA 3CWIA 2LHEA 3U8ZA 4RM8A 5H8YE 1HZ6A 4IKGA 2JVCA 2LUEA 4IUMB 4E74A 4KDIC 4ASWC 1EM7A 3L4PA 1CMXB 1T0QC 1Z2MA 3GP7A 2BS3B 1S3SG 1STEA 3ZGZA 1XD3B 3UIOB 2LI5A 2QHOA 1AWDA 2KMAA 3DCGA 1E8XA 1GNUA 1WR1A 5G5HA 1YD8U 1SE4A 3ML9A 2KXJA 4G50A 4K7UA 1R4MI 1J7CA 4KX6B 4R3DA 3I5JC 1QOBA 2K6DB 1NDDA 2J53A 1JWUD 1JWSD 4FN2A 2K8BA 4HCNB 1IUEA 2O6VB 3RNEC 4BBNF 3H1UA 3PV1A 2V3PA 2N9PC 2PE9A 3H9DA 3P4RB 3RULA 3KW5B 4BOZB 1F0ZA 2BQQA 3NG0A 1MG4A 3VDZA 4DHZB 4RGNA 3AE7B 2LD9A 2RDBC 4B0MA 1S1QB 4FBJB 3ZDTA 1ZP0B 5BMIA 1SJED 5IA7A 3KUZA 5JXVA 2RPVA 4RCOA 4D2KA 5LXIB 1AN8A 3BWUD 2JRHA 4P7IA 1P0RA 1YX5B 3NUHB 3WANA 3R3MA 4P1BC 1GAQB 4AUQC 2JPHA 1ENFA 1TS5A 1TZOA 2BT6A 1GPXA 4FJVB 5DPTA 4C7YA 1TTNA 5GMVA 2J4XA 1WR6E 3W1SA 2FIDA 2K9XA 3VR9B 2DLBA 1E10A 2R2QA 2LUMA 2J0KA 3RFZB 3NJTA 3TIXA 5D94A 4I6PA 4BKSD 2IO1B 3LXFA 3QIJA 3TSSA 5AZGA 2DAFA 3UIPB 4FJYA 4LNOA 2ICIA 2N0SB 3P42A 4ANWA 4WQOB 2W82A 2D5GA 3NVYA 2EKIA 3WAMA 4NZLB 3RNCC 2K25A 5I4DA 1EF5A 2RD0A 2WXGA 1E90A 4LJPB 3M63B 3CSTA 3WALA 2GBJA 4HEA1 2KAJA 1E9MA 2KOXA 1WGKA 4US8A 3DQVA 1GOZA 4IM2A 1NENB 3OG5A 2MBBB 1FXTB 3HK0A 3M95A 2Y3AA 1YMHE 4ANUA 3B1LX 3BVGA 4PYUA 2KX3A 2N7DA 2J0JA 1TBEA 3JSVB 3SR6A 1EWCA 4ZRIA 1HQRD 3GB1A 1SE2A 1B9RA 1YOVB 4KIKB 2WDVB 5TR5A 4KZCA 4M01A 3N1XC 2Z59B 2N9EB 2V0GA 1WWTA 3CMMB 1WYGA 3BK1A 4PT5A 2MBHA 5D3DA 1WRIA 2WXRA 2JWZA 5LNK1 2LRWA 1KLVA 3GZNI 3VRAB 3RT3B 2ZEQA 3AB5A 3T9LA 1PQSA 1JW9D 4ARIA 2KDFB 1ZDXA 4O1NA 3K9PB 2IBIB 1ZKHA 3A9JA 3PSEB 3VHTC 2NS5A 2C60A 4FHKA 2CU3A 2JSVX 3KVFB 3B9JA 2SEBD 1TZ1A 4GB9A 2GBRA 3FILB 2EELA 1F1HA 3T3OA 3CIRB 2JYEA 3QQ8B 4I6NB 4GGQA 2BF8B 2KMCA 2KN4A 5T8IA 1NVID 3MJ5A 5BO4B 4XZ4A 4NQLB 4ZRQA 3PLVA 3GE8C 1XXGA 1V81A 2DZMA 4WAFA 4PS7A 3DPDA 1J0GA 3ETRA 1GG3A 3Q3JA 4BKGA 2V4LA 4L23A 4JGHB 2J52A 4KZ0A 2C7HA 4HDQA 2BGFA 3QHTA 1C3TA 2MCNB 2AWTA 1WRDB 3VR8B 1VLBA 4HVBA 1FNUA 3IHPC 3DWMA 5AUKA 4ANVA 2EKEC 4MJSB 3H7PA 4GOCA 4DDGD 4PK1A
chains in the Genus database with same CATH topology
2M1MA 5DPWA 2DYOA 5CX3A 3V6CB 3T8MA 2CHWA 4CO7A 1WXAA 2PE6B 3M3JA 4LCDE 1V49A 4NJ7A 3C0RB 3VFKA 2L00B 1EO6A 3WIMA 2ZCCA 3WAPA 3DDCB 2W9NA 1ISNA 2WWZA 3WA0A 1L2NA 4WWNA 3KH0A 2WYQA 1EUVB 2D2QA 2KJHB 2M8SA 3DOWA 5AZHA 2D07B 3L0WB 5IAAC 4EOYA 2DZJA 2ZPNA 2HE7A 1C1YB 5EDSA 2CHXA 4ZDVA 3ONSA 3Q3FA 3PVLA 2N1VA 4MGYE 3DBHI 1OEYA 1WF9A 3DVGX 4ZYNA 2WX1A 4MSMB 4DHZE 3JW0X 1YQBA 2FCMA 4A3PA 1OTRB 2LGXA 5DPRA 3WAOA 4NAWB 2EMTA 4FADA 1V9JA 1UH6A 3VH4B 1Y8RC 4W9KA 3ZDMC 2IO3B 3ZUNA 2MWSB 1YIWA 2AYOB 4BVUC 3DVGY 1WXVA 3NY5A 3PHWB 4HXDA 2BKRB 3H7SA 2MW5A 2O2VA 3HHMA 2L0TA 1D3ZA 2M0XA 1GC7A 4MGZE 5C23A 1E7VA 3RCZA 1WGYA 2CHZA 2LASA 1SE9A 2ZZPB 3QA8A 4W9CA 2MP2B 2KANA 2UWQA 3A4RA 1WJ4A 3L17A 3QK0A 2LVOA 4F8CB 5LXHA 4KSLC 1IYFA 2FIFA 2NBUA 2LJ5A 1WGHA 3TJPA 2HD5B 4MELA 1WM3A 4NJ6A 1WGRA 3UQAA 3IG3A 3N30A 4GXBA 2KNBA 1Q5WB 2BYVE 4ICVA 4XC2A 2MRPA 2N1WA 3D32A 1WY8A 2CKHB 3R7RA 2G4SA 4HK2A 1UGMA 2D10A 4ZRJA 4M8NA 4M0WB 1E8ZA 2KWVB 3L54A 3TCAA 2AL6A 4EZKA 1NBFC 2DX5B 3B08A 1V86A 1P1AA 3V6EB 2A4ZA 1WH3A 2NBWB 3H7PB 4WWPA 4II3B 4GSWA 4MDKE 4FULA 1WX8A 4TUUA 3ZKJC 1U4AA 4NAWA 3ZTCA 1RRBA 4K7WA 2XK5A 3CF6E 4ICUA 3ECIA 3PRMB 2I1KA 3LDZE 1ZGUB 2A5UA 4IG7B 3APCA 4W9EA 2KK8A 3PGEA 3UF8A 1HE8A 3RYTA 2FCNA 1RLFA 3MJWA 2IO2B 3ZW3A 5D2MB 2BPSA 2Y5BB 1WMHA 4G3XB 1WIAA 2AL3A 4BBNC 1RFAA 2G4DB 2KVRA 3QJZA 4OVUA 3R66C 2KDEB 2KTRA 3PRZA 2O6VA 4FLHA 1WXSA 4WWOA 2KWCA 2MP2A 4EZJA 1YJ1A 5LLIA 2JY6A 4DDID 4AJYB 3ZTDA 3HM3A 4HJKA 2BYEA 1WI0A 2J7QB 4TV3A 2MA9B 4RM9A 4F7ZA 5E6NA 2GOWA 4MH0E 5JH5C 3QCAA 3VTWA 2KZRA 2KJRA 3X0WA 1VD2A 4OVVA 3EC8A 3ZVVA 1KM7A 3UGBB 2O2VB 3APDA 1QZEA 3DBSA 4GN1A 2IY0B 3U8ZA 4RM8A 2O6VD 4ANXA 2XEWA 2JVCA 2LUEA 4G0NB 4IUMB 3X23A 2VRRB 2DYMA 2HTHA 5C1ZA 4IM3A 4AWJA 4E74A 4KDIC 2D3GA 4ASWC 4JLCA 5FR6A 2PPHA 4X57B 1V2YA 2M4NA 2NPTB 3OJ4B 1CMXB 1Z2MA 2JXXA 3EHVA 3OLMD 3SU8X 1V5OA 2KO3A 2J0MA 3QWZB 4DHJD 3ZNGC 1R4NI 4DBGA 3VTVA 2KQ7A 2AEHA 2DHZA 2IYDB 1S3SG 3QAQA 4AP4C 2KN5A 1JRUA 3SD5A 1UD7A 2D11A 1XD3B 3UIOB 2LI5A 2QHOA 3OAWA 2KMAA 3DCGA 3NS8A 1E8XA 1WX7A 1GNUA 1WR1A 2DZIA 1IPGA 3PLUA 3ZNID 3AXCA 1YD8U 4GDLB 1UBQA 3ML9A 2FCSA 2KXJA 3KUCB 1UBIA 3ML8A 3K9OB 4F1SA 2XK5B 4G50A 3ZRFA 1E5WA 4JQWC 4TKNA 4K7UA 2BWES 1R4MI 4G11A 4EFOA 2YLMA 4WJPA 1WJ6A 4J6IA 3L16A 2FCQA 1LM8B 2K6DB 4MEMA 3ZNZB 1NDDA 3I3TB 2K8HA 3QC8B 1WMHB 3SDLC 4DXAB 4KDLB 1J19A 5JZEB 2KTRB 2K8BA 4FN2A 2YVCA 2O6VB 4HCNB 2KC2A 4BBNF 3H1UA 4K7SA 3PV1A 2N9PC 2NPTA 2PE9A 2JUOA 3H9DA 3VVWB 4W9GA 3EECA 4CYEA 2FNJB 1IP9A 4NPNA 1WJNA 2ASQA 4A3OA 2KX0A 3SHQA 1F9JA 3RULA 3KW5B 3QX1A 4BOZB 1WZ0A 3GOEA 4MSQB 3DVNV 3KUDB 1BT0A 3AU4A 2MBOA 2REXA 2RSUA 3AU5A 1WYWB 3VDZA 4E3CA 4GIVA 4DHZB 3VUWA 1GC6A 1NI2A 4URKA 1L7YA 3LJ3A 3ZIMA 4GDLA 3BY4B 2LD9A 4PS3A 3JVZX 1P98A 2DYBA 4B95A 3ALBA 5DPSA 5JHAA 1S1QB 2LRUA 4FBJB 5KHQA 3ZDTA 3O65B 1A5RA 3CSFA 2LGDA 1G6JA 3V62A 1OGWA 3IBEA 4NQKE 2MX2A 5IA7A 3KUZA 3ZNHB 2L76A 2WX0A 1J8CA 2KFKB 4E71A 4BOSC 4WJOA 2K6QA 5LXIB 4P7IA 2JRHA 3H6NA 4B6WA 1P0RA 1H4RA 2LWPA 1YX5B 2XBBC 2I1JA 2KDIA 2PEAA 3WANA 1LFDA 3R3MA 1KOTA 4IWOA 4HPMB 4AUQC 2C5LC 4GMVA 5D7GA 2JPHA 5E6PA 2MLBA 1WGGA 3DBRI 4FJVB 2JRIB 5DPTA 4CHKA 1TTNA 4KIKA 5L95C 4FJZA 2FUHB 4IWPA 5GMVA 4BKTA 4DK5A 2PJHA 4NY0A 1WR6E 4RMAA 3W1SA 2FIDA 1E7UA 2G45B 3PT2B 3VQIA 1Q1OA 3DBLI 2KC1A 4W9IA 2V1YA 3U30A 4ZRKA 4GDKB 2K1FA 2OOBB 2R2QA 4LJOB 2DENB 2GBNA 4KSKC 2J0KA 3UQBA 1I35A 2C7MB 2K8CA 3U7DA 3TIXA 2ZPYA 5D94A 4I6PA 2ZNVB 4MGKE 2L7RA 3PREA 1X1MA 3TBLD 1XQQA 4W9JA 3W1YA 4BKSD 1V6EA 2WDTB 2IO1B 3V61A 3A33B 2N9XA 1WE7A 3QIJA 2KKCA 4HPLB 5CHVC 1V80A 2KFJA 3NZSA 2JT4B 5AZGA 2KJ6A 2DAFA 2FAZA 3UIPB 2GBKA 4FJYA 1TGZB 4A20A 4HDOA 2C7NB 2KFKA 4ANWA 3NZUA 4WQOB 5KHOA 1E8YA 4LDTD 4DWFA 1V5TA 3HM6X 2ZVNA 3RZWC 3WAMA 4TQ0A 2N4FA 2RGFA 2K25A 5J18A 2KDBA 1EF5A 1WXMA 2RD0A 3M62B 4XX5A 1E90A 3ZRCA 4LJPB 3M63B 3CSTA 3A9KB 4W9LA 1UZXB 3WALA 2BWFA 1T0YA 2EMSA 2IY1B 2LVPA 4HLEA 5J17A 2GBJA 2C9WB 2KOXA 2N7EA 3L08A 2JZZA 5CHFA 4WJNA 3DQVA 3S2AA 4IM2A 3ZO5B 4EKUA 3RZFA 2MBBB 1FXTB 2L05A 3APFA 3HK0A 3M95A 4N9F4 4HWIB 4FA6A 2MBQA 2CU1A 4MM3A 4GDKA 5L83A 5DCNA 2Z0DB 2CS4A 5J2RA 4ANUA 3B1LX 1Q0WB 3N32A 5AEKB 3A1QA 4PYUA 3A9JB 3VAWA 2KX3A 2N7DA 2J0JA 3NHEB 4KV2A 2HJ8A 1TBEA 1WZ3A 3JSVB 1WFYA 3N3KB 4GU2A 5G55A 2MSED 2RPQA 1OEYJ 1Z5SB 2L8JA 5AZFA 3PHXB 4JIOU 2IO0B 2LGYA 4ZRIA 2K39A 1E8WA 1WE6A 1I42A 3UINB 3IVFA 1OQYA 3VTUA 2CR5A 2DAJA 2ZNVC 3NOBA 2NR2A 3TMPB 4KIKB 5TR5A 3R7QA 1SGHA 1YX6B 4KZCA 2Z59B 2N9EB 3AI5A 4MJSA 4WAAA 4DHJB 4JL9A 3CMMB 3B0AA 4LDTB 2IZVB 2MBHA 4K81A 1WM2A 3A9KA 3BINA 1H8CA 2JWZA 2NVUI 2LRWA 2GMIC 2M17A 2KLGA 1KLVA 3ENEA 3GZNI 3MTNB 2ZEQA 3RT3B 4K1RB 1K8RB 3T9LA 1PQSA 2MBEA 3DVNU 5CHWA 3VUXA 3L13A 5E6OA 2KDFB 2UYZB 3V60A 4KVGB 3K9PB 3KYCD 1AARA 2Z0EB 2IBIB 3VH3B 2KD0A 3VUYA 1XT9B 2NCNA 1ZKHA 1WJUA 4EZLA 2DZKA 3A9JA 4BFRA 3RD2A 3PSEB 2LXAA 3VHTC 2NS5A 3JYUA 2C60A 2LXCA 4FHKA 1M94A 3PTFC 3JSVA 3KVFB 4IWQA 5JHBA 3PS6A 4B9KA 2R2OA 1TZ1A 3MHSD 4HCPB 4GB9A 1UELA 5CTRC 2GBRA 2L3ZA 4BKSA 4IW0A 4II2B 3QQ8B 4FHJA 4I6LB 4I6NB 1WGDA 4GGQA 1GJZA 2BF8B 3KYDD 5D6JB 2KMCA 1GUAB 2ZJDA 5BO4B 2KTFA 2MQJA 4XZ4A 1WX9A 1LQBA 4NQLB 3ZLZA 1VCBA 4NNJB 1MG8A 2LZ6A 2RR9A 3PLVA 3TL5A 4MGIE 1V81A 2BKFA 2DZMA 3A4SC 4TQ1A 3PPAA 4WJQA 2L0FA 4YL8A 2NBVB 1SIFA 3AULA 3A1QB 2GBMA 4M8MA 2B3AA 2LVQA 1EF1A 3DPDA 4PS7A 5G2NA 1J0GA 3HIZA 5HKHA 1RAXA 1GG3A 3Q3JA 3W1SC 4BKGA 2V4LA 3PZDA 4AJWA 4JGHB 3RUIB 3IFWB 2G3QB 2C7HA 4KZ0A 4W9FA 2KQSA 2KLCA 2KWUB 2KHWB 1ZW7A 2ZVOA 4HDQA 2BGFA 3QHTA 1C3TA 2BYFA 2OJRA 4EUTA 2MCNB 3P2BA 4AOFA 2AWTA 1WRDB 1KJTA 4PYZA 4EEWA 4HVBA 3IHPC 3QARA 2JF5A 2V3SA 4IM0A 3VXWA 4ANVA 1P3QU 2EKEC 4W9DA 4MJSB 3OJ3A 1P9DU 3H7PA 3PRPB 4W9HA 4GOCA 3L10B 4IC7B 2ZCBA 4PS8A 4DDGD 1LXDA 3EFUA 2JZ3B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M1M A;  5DPW A;  2DYO A;  5CX3 A;  3V6C B;  3T8M A;  2CHW A;  4CO7 A;  1WXA A;  2PE6 B;  3M3J A;  4LCD E;  1V49 A;  4NJ7 A;  3C0R B;  3VFK A;  2L00 B;  1EO6 A;  3WIM A;  2ZCC A;  3WAP A;  3DDC B;  2W9N A;  1ISN A;  2WWZ A;  3WA0 A;  1L2N A;  4WWN A;  3KH0 A;  2WYQ A;  1EUV B;  2D2Q A;  2KJH B;  2M8S A;  3DOW A;  5AZH A;  2D07 B;  3L0W B;  5IAA C;  4EOY A;  2DZJ A;  2ZPN A;  2HE7 A;  1C1Y B;  5EDS A;  2CHX A;  4ZDV A;  3ONS A;  3Q3F A;  3PVL A;  2N1V A;  4MGY E;  3DBH I;  1OEY A;  1WF9 A;  3DVG X;  4ZYN A;  2WX1 A;  4MSM B;  4DHZ E;  3JW0 X;  1YQB A;  2FCM A;  4A3P A;  1OTR B;  2LGX A;  5DPR A;  3WAO A;  4NAW B;  2EMT A;  4FAD A;  1V9J A;  1UH6 A;  3VH4 B;  1Y8R C;  4W9K A;  3ZDM C;  2IO3 B;  3ZUN A;  2MWS B;  1YIW A;  2AYO B;  4BVU C;  3DVG Y;  1WXV A;  3NY5 A;  3PHW B;  4HXD A;  2BKR B;  3H7S A;  2MW5 A;  2O2V A;  3HHM A;  2L0T A;  1D3Z A;  2M0X A;  1GC7 A;  4MGZ E;  5C23 A;  1E7V A;  3RCZ A;  1WGY A;  2CHZ A;  2LAS A;  1SE9 A;  2ZZP B;  3QA8 A;  4W9C A;  2MP2 B;  2KAN A;  2UWQ A;  3A4R A;  1WJ4 A;  3L17 A;  3QK0 A;  2LVO A;  4F8C B;  5LXH A;  4KSL C;  1IYF A;  2FIF A;  2NBU A;  2LJ5 A;  1WGH A;  3TJP A;  2HD5 B;  4MEL A;  1WM3 A;  4NJ6 A;  1WGR A;  3UQA A;  3IG3 A;  3N30 A;  4GXB A;  2KNB A;  1Q5W B;  2BYV E;  4ICV A;  4XC2 A;  2MRP A;  2N1W A;  3D32 A;  1WY8 A;  2CKH B;  3R7R A;  2G4S A;  4HK2 A;  1UGM A;  2D10 A;  4ZRJ A;  4M8N A;  4M0W B;  1E8Z A;  2KWV B;  3L54 A;  3TCA A;  2AL6 A;  4EZK A;  1NBF C;  2DX5 B;  3B08 A;  1V86 A;  1P1A A;  3V6E B;  2A4Z A;  1WH3 A;  2NBW B;  3H7P B;  4WWP A;  4II3 B;  4GSW A;  4MDK E;  4FUL A;  1WX8 A;  4TUU A;  3ZKJ C;  1U4A A;  4NAW A;  3ZTC A;  1RRB A;  4K7W A;  2XK5 A;  3CF6 E;  4ICU A;  3ECI A;  3PRM B;  2I1K A;  3LDZ E;  1ZGU B;  2A5U A;  4IG7 B;  3APC A;  4W9E A;  2KK8 A;  3PGE A;  3UF8 A;  1HE8 A;  3RYT A;  2FCN A;  1RLF A;  3MJW A;  2IO2 B;  3ZW3 A;  5D2M B;  2BPS A;  2Y5B B;  1WMH A;  4G3X B;  1WIA A;  2AL3 A;  4BBN C;  1RFA A;  2G4D B;  2KVR A;  3QJZ A;  4OVU A;  3R66 C;  2KDE B;  2KTR A;  3PRZ A;  2O6V A;  4FLH A;  1WXS A;  4WWO A;  2KWC A;  2MP2 A;  4EZJ A;  1YJ1 A;  5LLI A;  2JY6 A;  4DDI D;  4AJY B;  3ZTD A;  3HM3 A;  4HJK A;  2BYE A;  1WI0 A;  2J7Q B;  4TV3 A;  2MA9 B;  4RM9 A;  4F7Z A;  5E6N A;  2GOW A;  4MH0 E;  5JH5 C;  3QCA A;  3VTW A;  2KZR A;  2KJR A;  3X0W A;  1VD2 A;  4OVV A;  3EC8 A;  3ZVV A;  1KM7 A;  3UGB B;  2O2V B;  3APD A;  1QZE A;  3DBS A;  4GN1 A;  2IY0 B;  3U8Z A;  4RM8 A;  2O6V D;  4ANX A;  2XEW A;  2JVC A;  2LUE A;  4G0N B;  4IUM B;  3X23 A;  2VRR B;  2DYM A;  2HTH A;  5C1Z A;  4IM3 A;  4AWJ A;  4E74 A;  4KDI C;  2D3G A;  4ASW C;  4JLC A;  5FR6 A;  2PPH A;  4X57 B;  1V2Y A;  2M4N A;  2NPT B;  3OJ4 B;  1CMX B;  1Z2M A;  2JXX A;  3EHV A;  3OLM D;  3SU8 X;  1V5O A;  2KO3 A;  2J0M A;  3QWZ B;  4DHJ D;  3ZNG C;  1R4N I;  4DBG A;  3VTV A;  2KQ7 A;  2AEH A;  2DHZ A;  2IYD B;  1S3S G;  3QAQ A;  4AP4 C;  2KN5 A;  1JRU A;  3SD5 A;  1UD7 A;  2D11 A;  1XD3 B;  3UIO B;  2LI5 A;  2QHO A;  3OAW A;  2KMA A;  3DCG A;  3NS8 A;  1E8X A;  1WX7 A;  1GNU A;  1WR1 A;  2DZI A;  1IPG A;  3PLU A;  3ZNI D;  3AXC A;  1YD8 U;  4GDL B;  1UBQ A;  3ML9 A;  2FCS A;  2KXJ A;  3KUC B;  1UBI A;  3ML8 A;  3K9O B;  4F1S A;  2XK5 B;  4G50 A;  3ZRF A;  1E5W A;  4JQW C;  4TKN A;  4K7U A;  2BWE S;  1R4M I;  4G11 A;  4EFO A;  2YLM A;  4WJP A;  1WJ6 A;  4J6I A;  3L16 A;  2FCQ A;  1LM8 B;  2K6D B;  4MEM A;  3ZNZ B;  1NDD A;  3I3T B;  2K8H A;  3QC8 B;  1WMH B;  3SDL C;  4DXA B;  4KDL B;  1J19 A;  5JZE B;  2KTR B;  2K8B A;  4FN2 A;  2YVC A;  2O6V B;  4HCN B;  2KC2 A;  4BBN F;  3H1U A;  4K7S A;  3PV1 A;  2N9P C;  2NPT A;  2PE9 A;  2JUO A;  3H9D A;  3VVW B;  4W9G A;  3EEC A;  4CYE A;  2FNJ B;  1IP9 A;  4NPN A;  1WJN A;  2ASQ A;  4A3O A;  2KX0 A;  3SHQ A;  1F9J A;  3RUL A;  3KW5 B;  3QX1 A;  4BOZ B;  1WZ0 A;  3GOE A;  4MSQ B;  3DVN V;  3KUD B;  1BT0 A;  3AU4 A;  2MBO A;  2REX A;  2RSU A;  3AU5 A;  1WYW B;  3VDZ A;  4E3C A;  4GIV A;  4DHZ B;  3VUW A;  1GC6 A;  1NI2 A;  4URK A;  1L7Y A;  3LJ3 A;  3ZIM A;  4GDL A;  3BY4 B;  2LD9 A;  4PS3 A;  3JVZ X;  1P98 A;  2DYB A;  4B95 A;  3ALB A;  5DPS A;  5JHA A;  1S1Q B;  2LRU A;  4FBJ B;  5KHQ A;  3ZDT A;  3O65 B;  1A5R A;  3CSF A;  2LGD A;  1G6J A;  3V62 A;  1OGW A;  3IBE A;  4NQK E;  2MX2 A;  5IA7 A;  3KUZ A;  3ZNH B;  2L76 A;  2WX0 A;  1J8C A;  2KFK B;  4E71 A;  4BOS C;  4WJO A;  2K6Q A;  5LXI B;  4P7I A;  2JRH A;  3H6N A;  4B6W A;  1P0R A;  1H4R A;  2LWP A;  1YX5 B;  2XBB C;  2I1J A;  2KDI A;  2PEA A;  3WAN A;  1LFD A;  3R3M A;  1KOT A;  4IWO A;  4HPM B;  4AUQ C;  2C5L C;  4GMV A;  5D7G A;  2JPH A;  5E6P A;  2MLB A;  1WGG A;  3DBR I;  4FJV B;  2JRI B;  5DPT A;  4CHK A;  1TTN A;  4KIK A;  5L95 C;  4FJZ A;  2FUH B;  4IWP A;  5GMV A;  4BKT A;  4DK5 A;  2PJH A;  4NY0 A;  1WR6 E;  4RMA A;  3W1S A;  2FID A;  1E7U A;  2G45 B;  3PT2 B;  3VQI A;  1Q1O A;  3DBL I;  2KC1 A;  4W9I A;  2V1Y A;  3U30 A;  4ZRK A;  4GDK B;  2K1F A;  2OOB B;  2R2Q A;  4LJO B;  2DEN B;  2GBN A;  4KSK C;  2J0K A;  3UQB A;  1I35 A;  2C7M B;  2K8C A;  3U7D A;  3TIX A;  2ZPY A;  5D94 A;  4I6P A;  2ZNV B;  4MGK E;  2L7R A;  3PRE A;  1X1M A;  3TBL D;  1XQQ A;  4W9J A;  3W1Y A;  4BKS D;  1V6E A;  2WDT B;  2IO1 B;  3V61 A;  3A33 B;  2N9X A;  1WE7 A;  3QIJ A;  2KKC A;  4HPL B;  5CHV C;  1V80 A;  2KFJ A;  3NZS A;  2JT4 B;  5AZG A;  2KJ6 A;  2DAF A;  2FAZ A;  3UIP B;  2GBK A;  4FJY A;  1TGZ B;  4A20 A;  4HDO A;  2C7N B;  2KFK A;  4ANW A;  3NZU A;  4WQO B;  5KHO A;  1E8Y A;  4LDT D;  4DWF A;  1V5T A;  3HM6 X;  2ZVN A;  3RZW C;  3WAM A;  4TQ0 A;  2N4F A;  2RGF A;  2K25 A;  5J18 A;  2KDB A;  1EF5 A;  1WXM A;  2RD0 A;  3M62 B;  4XX5 A;  1E90 A;  3ZRC A;  4LJP B;  3M63 B;  3CST A;  3A9K B;  4W9L A;  1UZX B;  3WAL A;  2BWF A;  1T0Y A;  2EMS A;  2IY1 B;  2LVP A;  4HLE A;  5J17 A;  2GBJ A;  2C9W B;  2KOX A;  2N7E A;  3L08 A;  2JZZ A;  5CHF A;  4WJN A;  3DQV A;  3S2A A;  4IM2 A;  3ZO5 B;  4EKU A;  3RZF A;  2MBB B;  1FXT B;  2L05 A;  3APF A;  3HK0 A;  3M95 A;  4N9F 4;  4HWI B;  4FA6 A;  2MBQ A;  2CU1 A;  4MM3 A;  4GDK A;  5L83 A;  5DCN A;  2Z0D B;  2CS4 A;  5J2R A;  4ANU A;  3B1L X;  1Q0W B;  3N32 A;  5AEK B;  3A1Q A;  4PYU A;  3A9J B;  3VAW A;  2KX3 A;  2N7D A;  2J0J A;  3NHE B;  4KV2 A;  2HJ8 A;  1TBE A;  1WZ3 A;  3JSV B;  1WFY A;  3N3K B;  4GU2 A;  5G55 A;  2MSE D;  2RPQ A;  1OEY J;  1Z5S B;  2L8J A;  5AZF A;  3PHX B;  4JIO U;  2IO0 B;  2LGY A;  4ZRI A;  2K39 A;  1E8W A;  1WE6 A;  1I42 A;  3UIN B;  3IVF A;  1OQY A;  3VTU A;  2CR5 A;  2DAJ A;  2ZNV C;  3NOB A;  2NR2 A;  3TMP B;  4KIK B;  5TR5 A;  3R7Q A;  1SGH A;  1YX6 B;  4KZC A;  2Z59 B;  2N9E B;  3AI5 A;  4MJS A;  4WAA A;  4DHJ B;  4JL9 A;  3CMM B;  3B0A A;  4LDT B;  2IZV B;  2MBH A;  4K81 A;  1WM2 A;  3A9K A;  3BIN A;  1H8C A;  2JWZ A;  2NVU I;  2LRW A;  2GMI C;  2M17 A;  2KLG A;  1KLV A;  3ENE A;  3GZN I;  3MTN B;  2ZEQ A;  3RT3 B;  4K1R B;  1K8R B;  3T9L A;  1PQS A;  2MBE A;  3DVN U;  5CHW A;  3VUX A;  3L13 A;  5E6O A;  2KDF B;  2UYZ B;  3V60 A;  4KVG B;  3K9P B;  3KYC D;  1AAR A;  2Z0E B;  2IBI B;  3VH3 B;  2KD0 A;  3VUY A;  1XT9 B;  2NCN A;  1ZKH A;  1WJU A;  4EZL A;  2DZK A;  3A9J A;  4BFR A;  3RD2 A;  3PSE B;  2LXA A;  3VHT C;  2NS5 A;  3JYU A;  2C60 A;  2LXC A;  4FHK A;  1M94 A;  3PTF C;  3JSV A;  3KVF B;  4IWQ A;  5JHB A;  3PS6 A;  4B9K A;  2R2O A;  1TZ1 A;  3MHS D;  4HCP B;  4GB9 A;  1UEL A;  5CTR C;  2GBR A;  2L3Z A;  4BKS A;  4IW0 A;  4II2 B;  3QQ8 B;  4FHJ A;  4I6L B;  4I6N B;  1WGD A;  4GGQ A;  1GJZ A;  2BF8 B;  3KYD D;  5D6J B;  2KMC A;  1GUA B;  2ZJD A;  5BO4 B;  2KTF A;  2MQJ A;  4XZ4 A;  1WX9 A;  1LQB A;  4NQL B;  3ZLZ A;  1VCB A;  4NNJ B;  1MG8 A;  2LZ6 A;  2RR9 A;  3PLV A;  3TL5 A;  4MGI E;  1V81 A;  2BKF A;  2DZM A;  3A4S C;  4TQ1 A;  3PPA A;  4WJQ A;  2L0F A;  4YL8 A;  2NBV B;  1SIF A;  3AUL A;  3A1Q B;  2GBM A;  4M8M A;  2B3A A;  2LVQ A;  1EF1 A;  3DPD A;  4PS7 A;  5G2N A;  1J0G A;  3HIZ A;  5HKH A;  1RAX A;  1GG3 A;  3Q3J A;  3W1S C;  4BKG A;  2V4L A;  3PZD A;  4AJW A;  4JGH B;  3RUI B;  3IFW B;  2G3Q B;  2C7H A;  4KZ0 A;  4W9F A;  2KQS A;  2KLC A;  2KWU B;  2KHW B;  1ZW7 A;  2ZVO A;  4HDQ A;  2BGF A;  3QHT A;  1C3T A;  2BYF A;  2OJR A;  4EUT A;  2MCN B;  3P2B A;  4AOF A;  2AWT A;  1WRD B;  1KJT A;  4PYZ A;  4EEW A;  4HVB A;  3IHP C;  3QAR A;  2JF5 A;  2V3S A;  4IM0 A;  3VXW A;  4ANV A;  1P3Q U;  2EKE C;  4W9D A;  4MJS B;  3OJ3 A;  1P9D U;  3H7P A;  3PRP B;  4W9H A;  4GOC A;  3L10 B;  4IC7 B;  2ZCB A;  4PS8 A;  4DDG D;  1LXD A;  3EFU A;  2JZ3 B; 
#chains in the Genus database with same CATH topology
 2M1M A;  5DPW A;  4YSY B;  4CO7 A;  2FE8 A;  2PE6 B;  3URY A;  3C0R B;  1EO6 A;  3WIM A;  1C77 A;  4LNN A;  5AUI A;  2WYQ A;  4LK0 M;  3ZJT A;  2R61 A;  3DOW A;  5AZH A;  1I4Q A;  4RGT A;  2ZPN A;  4KKJ A;  2QIL A;  5BMH A;  3DBH I;  1OEY A;  4ZYN A;  1FEH A;  2MJE A;  1YQB A;  2FCM A;  3Q8B A;  4WQM A;  4C80 A;  1R4M B;  3IT4 B;  2BKR B;  3H7S A;  2MW5 A;  1NEK B;  2QDF A;  3HHM A;  1UGJ A;  2L0T A;  1V8C A;  3ZQ4 A;  2LEK A;  1D3Z A;  4ZOH C;  3RCZ A;  1KLU D;  4W9C A;  2KAN A;  1FCC C;  2UWQ A;  1IYF A;  4KSL C;  2NBU A;  2LJ5 A;  4JE3 B;  1WGH A;  3N9Y C;  1WM3 A;  1KFY B;  4A6Q A;  1N6Z A;  1SE3 A;  1Q5W B;  4XC2 A;  4HK2 A;  1UGM A;  2ZW0 A;  3TCA A;  1VJK A;  2LGS A;  1EU3 A;  1NBF C;  3B08 A;  5G5G A;  1P1A A;  3V6E B;  2A4Z A;  2NBW B;  3VRB B;  4ARC A;  4II3 B;  3ZTC A;  4NAW A;  1N62 A;  4ICU A;  1I4H A;  3ECI A;  1HTQ A;  4N6E B;  2I1K A;  2A5U A;  3BYT B;  2KK8 A;  3UF8 A;  1HE8 A;  1BXT A;  2FCN A;  4G3X B;  4BBN C;  2KVR A;  2V3N A;  1HA5 A;  2D3A A;  2KDE B;  1ZOY B;  2O6V A;  3ZJU A;  4WWO A;  2MP2 A;  4EZJ A;  1YJ1 A;  2JY6 A;  2LHD A;  4AJY B;  1F52 A;  2WXN A;  3AE3 B;  5EE9 A;  4HJK A;  2HJ1 A;  1WI0 A;  1A70 A;  3W2D A;  2MA9 B;  4RM9 A;  3Q6B A;  2V9H A;  2D3C A;  3AV8 A;  1QOA A;  3EC8 A;  3ZXR A;  3HVD A;  3APD A;  3RI7 C;  3DBS A;  2IY0 B;  2QEJ C;  5HHD G;  3X23 A;  2VRR B;  2JQR B;  4AWJ A;  1YJI A;  5FR6 A;  2PPH A;  4X57 B;  1FMA D;  2NPT B;  2X38 A;  3OJ4 B;  3P4P B;  2BB5 A;  3EHV A;  1N61 A;  4DHJ D;  1E0Z A;  1GB1 A;  3ZNG C;  2JU6 X;  2IYD B;  3MFG A;  3QAQ A;  4AP4 C;  3AEA B;  2D11 A;  4KGR A;  4JPS A;  3LYY A;  1ROE A;  3OAW A;  3NS8 A;  2OJW A;  2DZI A;  2I2Y A;  4GDL B;  1VZ8 A;  2SAK A;  1Y56 A;  4XGA B;  1N5X A;  3KUC B;  5GXG B;  1UBI A;  2L52 A;  3NRZ A;  1R7S A;  4EFO A;  1YN3 A;  2YLM A;  2FCQ A;  5BYR A;  3QC8 B;  2E3T A;  1J19 A;  5JZE B;  2KC2 A;  4K7S A;  1B1Z A;  2JUO A;  4CYE A;  2FNJ B;  1JRP A;  1WJN A;  2ASQ A;  1TYG B;  4JX1 C;  5EE0 A;  1L0V B;  1FXI A;  3Q69 A;  1L0Y B;  3U52 E;  3Q8E A;  3DVN V;  3AU5 A;  2MJ3 A;  3SFE B;  4URK A;  3B2G A;  2DYB A;  4N58 A;  5DPS A;  2TSS A;  3HVZ A;  3Q3M C;  2FUG 1;  2LMC A;  3O65 B;  3GZN B;  3AE4 B;  2LGD A;  1G6J A;  4K3B A;  1ZDV A;  3IBE A;  3ZNH B;  2WX0 A;  3O13 A;  1J8C A;  4WJO A;  2K6Q A;  1D5M C;  3IXS A;  4A90 A;  2XBB C;  3MC0 B;  2PEA A;  1V1P B;  1J7A A;  1C9F A;  1KOT A;  2UU7 A;  3AEF B;  2C5L C;  5D7G A;  5E6P A;  3AN1 A;  2OED A;  4C7Z A;  4CHK A;  4KIK A;  4FJZ A;  4M00 A;  4DK5 A;  2PJH A;  2ON8 A;  1E7U A;  3DBL I;  4W9I A;  2V1Y A;  1QIL A;  3MP9 A;  4KSK C;  4DXF A;  2K8C A;  2BVC A;  1JML A;  3W1Y A;  2WDT B;  3V61 A;  3AM9 A;  3Q3N C;  2KKC A;  5CHV C;  1V80 A;  2N7J A;  3NZS A;  2JT4 B;  1TS3 A;  1ET6 A;  2GBK A;  4A20 A;  2KFK A;  3NZU A;  5KHO A;  2HTM E;  4LDT D;  3RZW C;  4TQ0 A;  2RGF A;  1J7B A;  4XX5 A;  3RNF C;  2KQ4 X;  3ZRC A;  2WXO A;  3FIL A;  1L4D B;  4KKI A;  1MFW A;  2BWF A;  2BS4 B;  5J17 A;  2LVP A;  4HLE A;  5MPO A;  2JX5 A;  3L08 A;  2JZZ A;  4WJN A;  3ZO5 B;  2WGS A;  2NTT A;  1TS2 A;  3RZF A;  2WDQ B;  3BVM A;  4GDK A;  5DCN A;  2Z0D B;  5J2R A;  1PYW D;  2JXT A;  3IT6 B;  3NHE B;  4KV2 A;  2HJ8 A;  2INC C;  2VZK D;  1WFY A;  4GU2 A;  1MVK A;  2MSE D;  2RPQ A;  1OEY J;  1MI0 A;  3DBH B;  2L8J A;  1GB4 A;  3PHX B;  1T0R C;  1ZPS A;  1WE6 A;  3IVF A;  3PO0 A;  4LTU A;  2CR5 A;  5BYS A;  2NR2 A;  2L32 A;  1YX6 B;  2G1E A;  4MJS A;  4WAA A;  5IN7 A;  4K81 A;  3A9K A;  4IDI A;  4ACF A;  3B2F A;  3BIN A;  2AQ1 B;  3KLS X;  2KLG A;  5C2T B;  1K8R B;  1I4R A;  1F77 A;  5CHW A;  2XN9 C;  5E6O A;  2UYZ B;  3KYC D;  1AAR A;  3ZXV A;  3MC9 A;  3VH3 B;  2KD0 A;  4A8X C;  2NCN A;  4YWG G;  1M94 A;  5JHB A;  4IWQ A;  3PS6 A;  1DGJ A;  3MHS D;  2K3U A;  1UEL A;  4LNI A;  4IW0 A;  4I6L B;  3KYD D;  5D6J B;  1RM6 C;  1DOX A;  3RNG C;  1JCK B;  2ZJD A;  2KTF A;  2MQJ A;  3ZLZ A;  3FC4 A;  1VCB A;  4NNJ B;  1MG8 A;  2LZ6 A;  1IGD A;  3TL5 A;  2BKF A;  3IAS 1;  4WJQ A;  4WIP A;  4YL8 A;  2INN E;  3AUL A;  3A1Q B;  1JWB D;  1PGA A;  3HIZ A;  4ZYS A;  3PZD A;  3RUI B;  2PTL A;  2KHW B;  1ZW7 A;  2M19 A;  2BYF A;  2KVZ A;  3P2B A;  4AOF A;  4PYZ A;  1KJT A;  1DOI A;  4IM0 A;  2V4I B;  1P3Q U;  2M56 B;  3H8H A;  4IC7 B;  3TEW A;  1LXD A;  5CX3 A;  2CHW A;  1WXA A;  1V49 A;  4NJ7 A;  3W5V B;  2M0A A;  2ZCC A;  2W9N A;  1ISN A;  1L2N A;  2PLP A;  4EOY A;  2NMQ A;  4ZDV A;  2JZP A;  3ONS A;  3Q3F A;  3DVG X;  4MSM B;  2L83 A;  3JW0 X;  5DPR A;  1XLP A;  5IKC M;  2Q5W D;  4TMA B;  3VH4 B;  3ZDM C;  3ZUN A;  1YIW A;  4RGM A;  2QJL A;  3DVG Y;  4HXD A;  2LFI A;  1GC7 A;  1M4V A;  1MHH E;  5D3I B;  1VZ7 A;  3L17 A;  2LVO A;  4MEL A;  3UQA A;  4FXC A;  2KNB A;  1SSN A;  3AMZ A;  3U4E G;  2PMV A;  1TIF A;  2KWV B;  2AL6 A;  4NAM A;  4EZK A;  1FIQ A;  1YQ4 B;  1V86 A;  1WH3 A;  1Q10 A;  1V97 A;  5FR3 A;  2QMT A;  4K7W A;  1QT9 A;  1KF6 B;  1ZGU B;  2WQY B;  1OFF A;  3BII D;  4YXD B;  3ZW3 A;  2BPS A;  1WIA A;  2AL3 A;  1RFA A;  3QJZ A;  2WXH A;  1HXY D;  4FLH A;  3HM3 A;  1VZ6 A;  2PKO A;  1ACC A;  4TV3 A;  1CK1 A;  1TJE A;  4F7Z A;  2GOW A;  2IPK D;  2IGH A;  4IOI E;  4OVV A;  4M0W A;  4YSZ B;  1IBX B;  3ZVV A;  3P1M A;  4N59 A;  3UGB B;  2O2V B;  1QZE A;  3TEY A;  3BYY B;  4GN1 A;  4ANX A;  2GI9 A;  2XEW A;  1C4A A;  4G0N B;  5C1Z A;  2DYM A;  2HTH A;  2ONQ A;  4IM3 A;  2WU5 B;  1SXT A;  1I4P A;  4JLC A;  1V2Y A;  2M4N A;  2JXX A;  4P6V F;  4MAC A;  1V5O A;  1L6V A;  2KO3 A;  3E9S A;  1R4N I;  4DBG A;  3VTV A;  1YQ3 B;  2AEH A;  2DHZ A;  2WXQ A;  3Q2A C;  3SD5 A;  1V1P A;  1UD7 A;  3NVW A;  5BMG A;  1IPG A;  2KAC A;  1XCT L;  3WCQ A;  1L5P A;  2FCS A;  4KGS A;  4EE2 A;  3ML8 A;  4F1S A;  2XK5 B;  3ZRF A;  1E5W A;  4TKN A;  4YTN B;  2GLS A;  1C78 A;  4WJP A;  4J6I A;  3E56 A;  3L16 A;  1LM8 B;  5FKA C;  4MEM A;  3ZNZ B;  3I3T B;  1WMH B;  3SDL C;  1L6U A;  4KDL B;  2KTR B;  2YVC A;  3AEG B;  2MJD A;  1NYR A;  3EEC A;  2J42 A;  4W9G A;  3P4Q B;  1HZ5 A;  1TKG A;  4NPN A;  3RNB C;  4A3O A;  2KX0 A;  2WXP A;  1F9J A;  4JWU C;  1UF0 A;  2QIE B;  4USA A;  1WZ0 A;  4L1B A;  2WNM A;  4WH4 A;  2BS2 B;  3FAH A;  1SJH D;  3KUD B;  5IO9 A;  1BT0 A;  3AU4 A;  2REX A;  1WYW B;  4RH6 A;  4GIV A;  3EUB 2;  1LGR A;  1GC6 A;  1NI2 A;  1L7Y A;  3LJ3 A;  3BY4 B;  4PS3 A;  3JVZ X;  5JHA A;  2LRU A;  4RF0 A;  5C3J B;  2FBW B;  3CSF A;  1CJE A;  1OGW A;  4NQK E;  2QC8 A;  3DHH C;  2XNA C;  1KH0 A;  3H6N A;  3U7Z A;  2LWP A;  3AH7 A;  2I1J A;  1LFD A;  2PIA A;  3NS1 A;  3PZ7 A;  4GMV A;  4S17 A;  4C4V B;  1WGG A;  3DBR I;  1EWY C;  2FUH B;  4IWP A;  4BKT A;  4NY0 A;  1K51 A;  3VQI A;  1Q1O A;  3U30 A;  4YT0 B;  4ZRK A;  2K1F A;  2AQ2 B;  2QCZ A;  2OOB B;  4LJO B;  2DEN B;  3UQB A;  2C7M B;  4MH8 A;  2ZPY A;  2G9H D;  3N20 C;  2ZNV B;  3LB8 C;  1XQQ A;  3T3N A;  3A33 B;  2N9X A;  1WE7 A;  3I57 A;  2BYT A;  4HPL B;  1YJJ A;  2KFJ A;  4J3O D;  2FAZ A;  1TGZ B;  2OHF A;  1E8Y A;  1V5T A;  3HM6 X;  4KGT A;  2N4F A;  3M62 B;  1VDV A;  1T0Y A;  2EMS A;  4Q2J A;  2N7E A;  3S2A A;  2Y5C A;  3RN9 C;  5HI1 A;  3APF A;  2L05 A;  2WXI A;  1OQQ A;  2YEP F;  2CS4 A;  1FPY A;  1Q0W B;  3A1Q A;  1UNS A;  3A9J B;  3VAW A;  2PW9 A;  1DYQ A;  1WZ3 A;  4LNF A;  5AZF A;  4JIO U;  2IO0 B;  2K39 A;  1I42 A;  1OQY A;  2ZNV C;  3NOB A;  3R2T A;  2BW2 A;  1MJD A;  3TMP B;  3R7Q A;  1OQR A;  4C56 C;  4YSX B;  3AI5 A;  2WHI A;  4JL9 A;  3DWG C;  4LDT B;  2IZV B;  1T3Q A;  1WM2 A;  4ITK A;  1H8C A;  4JWS C;  2GMI C;  2M17 A;  4HKZ E;  1JWA D;  4AQ7 A;  4K1R B;  3DVN U;  3L13 A;  3EFC A;  3N1Z C;  4KVG B;  1PGB A;  5EE3 A;  2Z0E B;  4ZRP A;  1XT9 B;  1RFK A;  2RDG A;  1WJU A;  4EZL A;  4BFR A;  3RD2 A;  3JYU A;  3JSV A;  4B9K A;  2R2O A;  2BB6 A;  4HCP B;  1P7E A;  2H89 B;  2VZK B;  2Y5P A;  1GJZ A;  1WGD A;  2PVG C;  1GUA B;  3SFD B;  1KTK A;  4MM3 B;  4TQ1 A;  3PPA A;  2L0F A;  2NBV B;  1SIF A;  2B3A A;  2LVQ A;  1RAX A;  5IP4 D;  2WXK A;  1TT5 B;  4AJW A;  1PFD A;  3IFW B;  2G3Q B;  1P7F A;  2W3R A;  2WXF A;  4W9F A;  3Q8C A;  1E6E B;  2KQS A;  2KLC A;  2WS3 B;  4EUT A;  2JF5 A;  3Q3O C;  4W9D A;  3OJ3 A;  3SEB A;  1P9D U;  5E6J A;  4W9H A;  1C79 A;  2DBY A;  3W5U B;  4TSS A;  3V6C B;  2WLB A;  1TKE A;  2ACZ B;  3AED B;  4QAY A;  2KDM A;  2LJI A;  1C4C A;  3M3J A;  4LCD E;  3U2S C;  3VFK A;  2L00 B;  4XWT A;  3RNA C;  3WAP A;  2K5P A;  5IOI A;  2WWZ A;  3KH0 A;  4LLG M;  1IGC A;  2WU2 B;  1R4N B;  2M8S A;  1WSP A;  2ZW1 A;  3L0W B;  5IAA C;  1C1Y B;  5EDS A;  2CHX A;  1SBB B;  3PVL A;  2N1V A;  4ZHP A;  1MPE A;  3EGR A;  4HJG E;  3C19 A;  4DHZ E;  3Q14 C;  1D5X C;  4A3P A;  1UWX A;  2LGX A;  2JWU A;  4NAW B;  1V9J A;  2K0P A;  1D4B A;  4W9K A;  1VRA B;  2PVO D;  3DHI C;  5EE1 A;  4BVU C;  2AYO B;  1IBX A;  3NY5 A;  3PHW B;  1VR9 A;  2O2V A;  3OWE B;  1SB3 C;  4MGZ E;  1TKY A;  3MC8 A;  1E7V A;  2BTE A;  1CZP A;  1WGY A;  2CHZ A;  1PGX A;  3AE1 B;  1SE9 A;  3QA8 A;  3KWV A;  4B0E A;  2MP2 B;  5LXH A;  1FO4 A;  4RF1 A;  1C4P A;  4OZB A;  3TJP A;  1WGR A;  2KT7 A;  3IG3 A;  2BYV E;  4ICV A;  2MRP A;  1ZUD 2;  1WY8 A;  4ZRJ A;  2D10 A;  4M8N A;  1E8Z A;  3L54 A;  2NTS A;  3KQ4 A;  4WWP A;  3ABV B;  3C8Y A;  4FUL A;  4M02 A;  1RRB A;  2XK5 A;  1K53 A;  4WUR A;  1D5Z C;  3AE5 B;  3PRM B;  4XDC A;  2VH1 A;  4XYC A;  3LDZ E;  1QOG A;  4IG7 B;  3APC A;  4W9E A;  3RYT A;  3MJW A;  2IO2 B;  1FRR A;  2AQ3 B;  2IND C;  1WMH A;  2KWD A;  3V05 A;  2G4D B;  4OVU A;  3R66 C;  2KTR A;  2KWC A;  3AE6 B;  5LLI A;  1XLQ A;  3ZTD A;  4RGO S;  1I4X A;  4P1C C;  3DBR B;  3AE9 B;  5JH5 C;  3HRD D;  1I4G A;  3QCA A;  3VTW A;  3X0W A;  1VD2 A;  4MT5 A;  1FNV A;  2KYW A;  2D3B A;  4YTP B;  2O6V D;  4HPP A;  3TEZ A;  1F2R I;  3ZJV A;  1DOY A;  2D3G A;  1V1O A;  3R2I A;  2I38 A;  3OLM D;  3SU8 X;  2IGG A;  1YN5 A;  1D6E C;  2AX5 A;  2J0M A;  3QWZ B;  2KQ7 A;  3AEB B;  2BBC A;  2KN5 A;  1JRU A;  1HEZ E;  1XEE A;  2YEP B;  1C76 A;  3PZ8 A;  1WX7 A;  1ZXH A;  1ZXI A;  3PLU A;  3ZNI D;  3AXC A;  4C4V A;  1UBQ A;  2Z8L A;  1E7P B;  3K9O B;  1EU4 A;  4JQW C;  2BWE S;  4G11 A;  1WJ6 A;  4YTM B;  2LGI A;  3R8B A;  1NYQ A;  2K8H A;  4DXA B;  1NI3 A;  4US9 A;  2INP E;  2NPT A;  3VVW B;  1IP9 A;  1JRO A;  3SHQ A;  1FD6 A;  3QX1 A;  3TEX A;  2WXM A;  3GOE A;  4MSQ B;  3AEE B;  3MHZ A;  2MBO A;  2RSU A;  1SEB D;  4OZA A;  4E3C A;  3VUW A;  2W3S A;  2GRI A;  4GDL A;  4OVZ A;  1P98 A;  4B95 A;  3ALB A;  4XE0 A;  1XCQ L;  1FM0 D;  5KHQ A;  1HTO A;  4A9A A;  2DWQ A;  1A5R A;  3V62 A;  4ZHO A;  2MX2 A;  2L76 A;  2KFK B;  4E71 A;  4BOS C;  1L4Z B;  2WDR B;  1K52 A;  1TY2 A;  4B6W A;  1H4R A;  2KDI A;  4OW0 A;  5HG2 A;  4IWO A;  4HPM B;  2IJ0 A;  3V3X A;  2MLB A;  1QOF A;  2JRI B;  5L95 C;  1BML C;  4RMA A;  2G45 B;  3PT2 B;  3I63 C;  2KC1 A;  4GDK B;  1QQR A;  3DBL B;  2B76 B;  2GBN A;  1I35 A;  1JWM D;  3U7D A;  3BZD B;  4MGK E;  2L7R A;  3PRE A;  1X1M A;  3TBL D;  4W9J A;  1V6E A;  2W55 A;  3Q8F A;  4HKQ A;  2DNF A;  2KJ6 A;  3HUI A;  3N1Y C;  3NVZ A;  4GLS C;  4HDO A;  2C7N B;  4DWF A;  2ZVN A;  4DQO C;  3KWL A;  5J18 A;  2KDB A;  1WXM A;  1ET9 A;  3NVV A;  2L1A A;  4XWW A;  3A9K B;  4W9L A;  1UZX B;  2IY1 B;  3P63 A;  2C9W B;  4HRS A;  1WXQ A;  5CHF A;  3UI3 A;  4EKU A;  2WP9 B;  4N9F 4;  4OZC A;  2W54 A;  4HWI B;  1ESF A;  4FA6 A;  2MBQ A;  2CU1 A;  4MM3 A;  5L83 A;  5AEK B;  3N32 A;  5HFY A;  3N3K B;  5G55 A;  1T6B X;  1QF6 A;  1Z5S B;  3TUO A;  2HDE A;  2LGY A;  1E8W A;  1ZE3 D;  3UIN B;  3VTU A;  4WWM A;  2DAJ A;  1SGH A;  2GB1 A;  3NZ3 A;  1KLG D;  4DHJ B;  1XLN A;  3B0A A;  4NJC A;  4A55 A;  1PUT A;  4BZA A;  3W9C B;  4P16 A;  2NVU I;  3DHG C;  3RMK C;  3ENE A;  3MTN B;  2MBE A;  1FFV A;  3VUX A;  1TS4 A;  2RMM A;  3Q8A A;  3V60 A;  2IDY A;  4RFB A;  1FFU A;  1SF0 A;  1XLO A;  3VUY A;  4XDD A;  2DZK A;  2LXA A;  2LXC A;  3PTF C;  4K3C A;  5BYQ A;  5CTR C;  3ZYY X;  2N9K A;  2L3Z A;  4OHJ A;  4BKS A;  1KRH A;  4II2 B;  1T0S C;  1RWS A;  4FHJ A;  4UDU C;  1WX9 A;  1LQB A;  2KMM A;  2RR9 A;  1JQ4 A;  1JAL A;  1SIJ A;  4MGI E;  3A4S C;  4M8M A;  2GBM A;  1EF1 A;  1LO5 D;  5G2N A;  5HKH A;  3W1S C;  2MHJ A;  2KWU B;  2ZVO A;  1QLB B;  1YN4 A;  2MH7 A;  2OJR A;  3IAM 1;  4EEW A;  5H92 C;  3QAR A;  4REZ A;  2WXJ A;  2V3S A;  3VXW A;  3BVZ A;  2MEK A;  3PRP B;  3L10 B;  1PDX A;  4AS1 A;  1XO3 A;  3J9C A;  2ZCB A;  4PS8 A;  1FXA A;  3EFU A;  2JZ3 B;  4HRO A;  2DYO A;  3T8M A;  1N60 A;  1FRD A;  4H2A A;  4LNK A;  3DDC B;  3WA0 A;  4BAX A;  4WWN A;  2CJO A;  1EUV B;  2D2Q A;  2KJH B;  2D07 B;  2DZJ A;  2HE7 A;  2CJN A;  4MGY E;  1WF9 A;  2WX1 A;  4L2Y A;  4S0R A;  1OTR B;  3WAO A;  3AE2 B;  2EMT A;  4FAD A;  1UH6 A;  1Y8R C;  5FK9 C;  1L0X B;  2IO3 B;  2MWS B;  3AEC B;  1WXV A;  2H88 B;  1CQV A;  2IGD A;  2M0X A;  1N5W A;  4DXG A;  2RDH A;  5C23 A;  2LAS A;  3EA6 A;  2ZZP B;  3P4S B;  4F8C B;  3QK0 A;  3A4R A;  1MHX A;  1WJ4 A;  2FIF A;  2WXL A;  2HD5 B;  1N63 A;  4NJ6 A;  1QKZ A;  3N30 A;  4GXB A;  1F2R C;  1FCL A;  4RNA A;  2N1W A;  3D32 A;  1RYJ A;  2CKH B;  1UWM A;  1AYF A;  2G4S A;  3R7R A;  3ZIM A;  4M0W B;  1I7H A;  1T5X D;  2DX5 B;  3BK2 A;  3H7P B;  1YNT E;  4GSW A;  4MDK E;  3ZKJ C;  1WX8 A;  4TUU A;  1UUP A;  1U4A A;  2K22 A;  3CF6 E;  3AE8 B;  3FKY A;  2X8X X;  1XF5 L;  3PGE A;  2VH2 A;  1K50 A;  3GS2 A;  1RLF A;  5D2M B;  2Y5B B;  5TSS A;  1FNW A;  1TY0 A;  3RPF C;  1AW7 A;  2N9L A;  3GE3 C;  3PRZ A;  1WXS A;  3I9V 1;  1BUI C;  2E6X A;  4DDI D;  2JYT A;  2BYE A;  2J7Q B;  5E6N A;  4C00 A;  4MH0 E;  2KZR A;  2KJR A;  2QSD A;  1KM7 A;  4CQN A;  3CWI A;  2LHE A;  3U8Z A;  4RM8 A;  5H8Y E;  1HZ6 A;  4IKG A;  2JVC A;  2LUE A;  4IUM B;  4E74 A;  4KDI C;  4ASW C;  1EM7 A;  3L4P A;  1CMX B;  1T0Q C;  1Z2M A;  3GP7 A;  2BS3 B;  1S3S G;  1STE A;  3ZGZ A;  1XD3 B;  3UIO B;  2LI5 A;  2QHO A;  1AWD A;  2KMA A;  3DCG A;  1E8X A;  1GNU A;  1WR1 A;  5G5H A;  1YD8 U;  1SE4 A;  3ML9 A;  2KXJ A;  4G50 A;  4K7U A;  1R4M I;  1J7C A;  4KX6 B;  4R3D A;  3I5J C;  1QOB A;  2K6D B;  1NDD A;  2J53 A;  1JWU D;  1JWS D;  4FN2 A;  2K8B A;  4HCN B;  1IUE A;  2O6V B;  3RNE C;  4BBN F;  3H1U A;  3PV1 A;  2V3P A;  2N9P C;  2PE9 A;  3H9D A;  3P4R B;  3RUL A;  3KW5 B;  4BOZ B;  1F0Z A;  2BQQ A;  3NG0 A;  1MG4 A;  3VDZ A;  4DHZ B;  4RGN A;  3AE7 B;  2LD9 A;  2RDB C;  4B0M A;  1S1Q B;  4FBJ B;  3ZDT A;  1ZP0 B;  5BMI A;  1SJE D;  5IA7 A;  3KUZ A;  5JXV A;  2RPV A;  4RCO A;  4D2K A;  5LXI B;  1AN8 A;  3BWU D;  2JRH A;  4P7I A;  1P0R A;  1YX5 B;  3NUH B;  3WAN A;  3R3M A;  4P1B C;  1GAQ B;  4AUQ C;  2JPH A;  1ENF A;  1TS5 A;  1TZO A;  2BT6 A;  1GPX A;  4FJV B;  5DPT A;  4C7Y A;  1TTN A;  5GMV A;  2J4X A;  1WR6 E;  3W1S A;  2FID A;  2K9X A;  3VR9 B;  2DLB A;  1E10 A;  2R2Q A;  2LUM A;  2J0K A;  3RFZ B;  3NJT A;  3TIX A;  5D94 A;  4I6P A;  4BKS D;  2IO1 B;  3LXF A;  3QIJ A;  3TSS A;  5AZG A;  2DAF A;  3UIP B;  4FJY A;  4LNO A;  2ICI A;  2N0S B;  3P42 A;  4ANW A;  4WQO B;  2W82 A;  2D5G A;  3NVY A;  2EKI A;  3WAM A;  4NZL B;  3RNC C;  2K25 A;  5I4D A;  1EF5 A;  2RD0 A;  2WXG A;  1E90 A;  4LJP B;  3M63 B;  3CST A;  3WAL A;  2GBJ A;  4HEA 1;  2KAJ A;  1E9M A;  2KOX A;  1WGK A;  4US8 A;  3DQV A;  1GOZ A;  4IM2 A;  1NEN B;  3OG5 A;  2MBB B;  1FXT B;  3HK0 A;  3M95 A;  2Y3A A;  1YMH E;  4ANU A;  3B1L X;  3BVG A;  4PYU A;  2KX3 A;  2N7D A;  2J0J A;  1TBE A;  3JSV B;  3SR6 A;  1EWC A;  4ZRI A;  1HQR D;  3GB1 A;  1SE2 A;  1B9R A;  1YOV B;  4KIK B;  2WDV B;  5TR5 A;  4KZC A;  4M01 A;  3N1X C;  2Z59 B;  2N9E B;  2V0G A;  1WWT A;  3CMM B;  1WYG A;  3BK1 A;  4PT5 A;  2MBH A;  5D3D A;  1WRI A;  2WXR A;  2JWZ A;  5LNK 1;  2LRW A;  1KLV A;  3GZN I;  3VRA B;  3RT3 B;  2ZEQ A;  3AB5 A;  3T9L A;  1PQS A;  1JW9 D;  4ARI A;  2KDF B;  1ZDX A;  4O1N A;  3K9P B;  2IBI B;  1ZKH A;  3A9J A;  3PSE B;  3VHT C;  2NS5 A;  2C60 A;  4FHK A;  2CU3 A;  2JSV X;  3KVF B;  3B9J A;  2SEB D;  1TZ1 A;  4GB9 A;  2GBR A;  3FIL B;  2EEL A;  1F1H A;  3T3O A;  3CIR B;  2JYE A;  3QQ8 B;  4I6N B;  4GGQ A;  2BF8 B;  2KMC A;  2KN4 A;  5T8I A;  1NVI D;  3MJ5 A;  5BO4 B;  4XZ4 A;  4NQL B;  4ZRQ A;  3PLV A;  3GE8 C;  1XXG A;  1V81 A;  2DZM A;  4WAF A;  4PS7 A;  3DPD A;  1J0G A;  3ETR A;  1GG3 A;  3Q3J A;  4BKG A;  2V4L A;  4L23 A;  4JGH B;  2J52 A;  4KZ0 A;  2C7H A;  4HDQ A;  2BGF A;  3QHT A;  1C3T A;  2MCN B;  2AWT A;  1WRD B;  3VR8 B;  1VLB A;  4HVB A;  1FNU A;  3IHP C;  3DWM A;  5AUK A;  4ANV A;  2EKE C;  4MJS B;  3H7P A;  4GOC A;  4DDG D;  4PK1 A; 
#chains in the Genus database with same CATH homology
 2M1M A;  5DPW A;  2DYO A;  5CX3 A;  3V6C B;  3T8M A;  2CHW A;  4CO7 A;  1WXA A;  2PE6 B;  3M3J A;  4LCD E;  1V49 A;  4NJ7 A;  3C0R B;  3VFK A;  2L00 B;  1EO6 A;  3WIM A;  2ZCC A;  3WAP A;  3DDC B;  2W9N A;  1ISN A;  2WWZ A;  3WA0 A;  1L2N A;  4WWN A;  3KH0 A;  2WYQ A;  1EUV B;  2D2Q A;  2KJH B;  2M8S A;  3DOW A;  5AZH A;  2D07 B;  3L0W B;  5IAA C;  4EOY A;  2DZJ A;  2ZPN A;  2HE7 A;  1C1Y B;  5EDS A;  2CHX A;  4ZDV A;  3ONS A;  3Q3F A;  3PVL A;  2N1V A;  4MGY E;  3DBH I;  1OEY A;  1WF9 A;  3DVG X;  4ZYN A;  2WX1 A;  4MSM B;  4DHZ E;  3JW0 X;  1YQB A;  2FCM A;  4A3P A;  1OTR B;  2LGX A;  5DPR A;  3WAO A;  4NAW B;  2EMT A;  4FAD A;  1V9J A;  1UH6 A;  3VH4 B;  1Y8R C;  4W9K A;  3ZDM C;  2IO3 B;  3ZUN A;  2MWS B;  1YIW A;  2AYO B;  4BVU C;  3DVG Y;  1WXV A;  3NY5 A;  3PHW B;  4HXD A;  2BKR B;  3H7S A;  2MW5 A;  2O2V A;  3HHM A;  2L0T A;  1D3Z A;  2M0X A;  1GC7 A;  4MGZ E;  5C23 A;  1E7V A;  3RCZ A;  1WGY A;  2CHZ A;  2LAS A;  1SE9 A;  2ZZP B;  3QA8 A;  4W9C A;  2MP2 B;  2KAN A;  2UWQ A;  3A4R A;  1WJ4 A;  3L17 A;  3QK0 A;  2LVO A;  4F8C B;  5LXH A;  4KSL C;  1IYF A;  2FIF A;  2NBU A;  2LJ5 A;  1WGH A;  3TJP A;  2HD5 B;  4MEL A;  1WM3 A;  4NJ6 A;  1WGR A;  3UQA A;  3IG3 A;  3N30 A;  4GXB A;  2KNB A;  1Q5W B;  2BYV E;  4ICV A;  4XC2 A;  2MRP A;  2N1W A;  3D32 A;  1WY8 A;  2CKH B;  3R7R A;  2G4S A;  4HK2 A;  1UGM A;  2D10 A;  4ZRJ A;  4M8N A;  4M0W B;  1E8Z A;  2KWV B;  3L54 A;  3TCA A;  2AL6 A;  4EZK A;  1NBF C;  2DX5 B;  3B08 A;  1V86 A;  1P1A A;  3V6E B;  2A4Z A;  1WH3 A;  2NBW B;  3H7P B;  4WWP A;  4II3 B;  4GSW A;  4MDK E;  4FUL A;  1WX8 A;  4TUU A;  3ZKJ C;  1U4A A;  4NAW A;  3ZTC A;  1RRB A;  4K7W A;  2XK5 A;  3CF6 E;  4ICU A;  3ECI A;  3PRM B;  2I1K A;  3LDZ E;  1ZGU B;  2A5U A;  4IG7 B;  3APC A;  4W9E A;  2KK8 A;  3PGE A;  3UF8 A;  1HE8 A;  3RYT A;  2FCN A;  1RLF A;  3MJW A;  2IO2 B;  3ZW3 A;  5D2M B;  2BPS A;  2Y5B B;  1WMH A;  4G3X B;  1WIA A;  2AL3 A;  4BBN C;  1RFA A;  2G4D B;  2KVR A;  3QJZ A;  4OVU A;  3R66 C;  2KDE B;  2KTR A;  3PRZ A;  2O6V A;  4FLH A;  1WXS A;  4WWO A;  2KWC A;  2MP2 A;  4EZJ A;  1YJ1 A;  5LLI A;  2JY6 A;  4DDI D;  4AJY B;  3ZTD A;  3HM3 A;  4HJK A;  2BYE A;  1WI0 A;  2J7Q B;  4TV3 A;  2MA9 B;  4RM9 A;  4F7Z A;  5E6N A;  2GOW A;  4MH0 E;  5JH5 C;  3QCA A;  3VTW A;  2KZR A;  2KJR A;  3X0W A;  1VD2 A;  4OVV A;  3EC8 A;  3ZVV A;  1KM7 A;  3UGB B;  2O2V B;  3APD A;  1QZE A;  3DBS A;  4GN1 A;  2IY0 B;  3U8Z A;  4RM8 A;  2O6V D;  4ANX A;  2XEW A;  2JVC A;  2LUE A;  4G0N B;  4IUM B;  3X23 A;  2VRR B;  2DYM A;  2HTH A;  5C1Z A;  4IM3 A;  4AWJ A;  4E74 A;  4KDI C;  2D3G A;  4ASW C;  4JLC A;  5FR6 A;  2PPH A;  4X57 B;  1V2Y A;  2M4N A;  2NPT B;  3OJ4 B;  1CMX B;  1Z2M A;  2JXX A;  3EHV A;  3OLM D;  3SU8 X;  1V5O A;  2KO3 A;  2J0M A;  3QWZ B;  4DHJ D;  3ZNG C;  1R4N I;  4DBG A;  3VTV A;  2KQ7 A;  2AEH A;  2DHZ A;  2IYD B;  1S3S G;  3QAQ A;  4AP4 C;  2KN5 A;  1JRU A;  3SD5 A;  1UD7 A;  2D11 A;  1XD3 B;  3UIO B;  2LI5 A;  2QHO A;  3OAW A;  2KMA A;  3DCG A;  3NS8 A;  1E8X A;  1WX7 A;  1GNU A;  1WR1 A;  2DZI A;  1IPG A;  3PLU A;  3ZNI D;  3AXC A;  1YD8 U;  4GDL B;  1UBQ A;  3ML9 A;  2FCS A;  2KXJ A;  3KUC B;  1UBI A;  3ML8 A;  3K9O B;  4F1S A;  2XK5 B;  4G50 A;  3ZRF A;  1E5W A;  4JQW C;  4TKN A;  4K7U A;  2BWE S;  1R4M I;  4G11 A;  4EFO A;  2YLM A;  4WJP A;  1WJ6 A;  4J6I A;  3L16 A;  2FCQ A;  1LM8 B;  2K6D B;  4MEM A;  3ZNZ B;  1NDD A;  3I3T B;  2K8H A;  3QC8 B;  1WMH B;  3SDL C;  4DXA B;  4KDL B;  1J19 A;  5JZE B;  2KTR B;  2K8B A;  4FN2 A;  2YVC A;  2O6V B;  4HCN B;  2KC2 A;  4BBN F;  3H1U A;  4K7S A;  3PV1 A;  2N9P C;  2NPT A;  2PE9 A;  2JUO A;  3H9D A;  3VVW B;  4W9G A;  3EEC A;  4CYE A;  2FNJ B;  1IP9 A;  4NPN A;  1WJN A;  2ASQ A;  4A3O A;  2KX0 A;  3SHQ A;  1F9J A;  3RUL A;  3KW5 B;  3QX1 A;  4BOZ B;  1WZ0 A;  3GOE A;  4MSQ B;  3DVN V;  3KUD B;  1BT0 A;  3AU4 A;  2MBO A;  2REX A;  2RSU A;  3AU5 A;  1WYW B;  3VDZ A;  4E3C A;  4GIV A;  4DHZ B;  3VUW A;  1GC6 A;  1NI2 A;  4URK A;  1L7Y A;  3LJ3 A;  3ZIM A;  4GDL A;  3BY4 B;  2LD9 A;  4PS3 A;  3JVZ X;  1P98 A;  2DYB A;  4B95 A;  3ALB A;  5DPS A;  5JHA A;  1S1Q B;  2LRU A;  4FBJ B;  5KHQ A;  3ZDT A;  3O65 B;  1A5R A;  3CSF A;  2LGD A;  1G6J A;  3V62 A;  1OGW A;  3IBE A;  4NQK E;  2MX2 A;  5IA7 A;  3KUZ A;  3ZNH B;  2L76 A;  2WX0 A;  1J8C A;  2KFK B;  4E71 A;  4BOS C;  4WJO A;  2K6Q A;  5LXI B;  4P7I A;  2JRH A;  3H6N A;  4B6W A;  1P0R A;  1H4R A;  2LWP A;  1YX5 B;  2XBB C;  2I1J A;  2KDI A;  2PEA A;  3WAN A;  1LFD A;  3R3M A;  1KOT A;  4IWO A;  4HPM B;  4AUQ C;  2C5L C;  4GMV A;  5D7G A;  2JPH A;  5E6P A;  2MLB A;  1WGG A;  3DBR I;  4FJV B;  2JRI B;  5DPT A;  4CHK A;  1TTN A;  4KIK A;  5L95 C;  4FJZ A;  2FUH B;  4IWP A;  5GMV A;  4BKT A;  4DK5 A;  2PJH A;  4NY0 A;  1WR6 E;  4RMA A;  3W1S A;  2FID A;  1E7U A;  2G45 B;  3PT2 B;  3VQI A;  1Q1O A;  3DBL I;  2KC1 A;  4W9I A;  2V1Y A;  3U30 A;  4ZRK A;  4GDK B;  2K1F A;  2OOB B;  2R2Q A;  4LJO B;  2DEN B;  2GBN A;  4KSK C;  2J0K A;  3UQB A;  1I35 A;  2C7M B;  2K8C A;  3U7D A;  3TIX A;  2ZPY A;  5D94 A;  4I6P A;  2ZNV B;  4MGK E;  2L7R A;  3PRE A;  1X1M A;  3TBL D;  1XQQ A;  4W9J A;  3W1Y A;  4BKS D;  1V6E A;  2WDT B;  2IO1 B;  3V61 A;  3A33 B;  2N9X A;  1WE7 A;  3QIJ A;  2KKC A;  4HPL B;  5CHV C;  1V80 A;  2KFJ A;  3NZS A;  2JT4 B;  5AZG A;  2KJ6 A;  2DAF A;  2FAZ A;  3UIP B;  2GBK A;  4FJY A;  1TGZ B;  4A20 A;  4HDO A;  2C7N B;  2KFK A;  4ANW A;  3NZU A;  4WQO B;  5KHO A;  1E8Y A;  4LDT D;  4DWF A;  1V5T A;  3HM6 X;  2ZVN A;  3RZW C;  3WAM A;  4TQ0 A;  2N4F A;  2RGF A;  2K25 A;  5J18 A;  2KDB A;  1EF5 A;  1WXM A;  2RD0 A;  3M62 B;  4XX5 A;  1E90 A;  3ZRC A;  4LJP B;  3M63 B;  3CST A;  3A9K B;  4W9L A;  1UZX B;  3WAL A;  2BWF A;  1T0Y A;  2EMS A;  2IY1 B;  2LVP A;  4HLE A;  5J17 A;  2GBJ A;  2C9W B;  2KOX A;  2N7E A;  3L08 A;  2JZZ A;  5CHF A;  4WJN A;  3DQV A;  3S2A A;  4IM2 A;  3ZO5 B;  4EKU A;  3RZF A;  2MBB B;  1FXT B;  2L05 A;  3APF A;  3HK0 A;  3M95 A;  4N9F 4;  4HWI B;  4FA6 A;  2MBQ A;  2CU1 A;  4MM3 A;  4GDK A;  5L83 A;  5DCN A;  2Z0D B;  2CS4 A;  5J2R A;  4ANU A;  3B1L X;  1Q0W B;  3N32 A;  5AEK B;  3A1Q A;  4PYU A;  3A9J B;  3VAW A;  2KX3 A;  2N7D A;  2J0J A;  3NHE B;  4KV2 A;  2HJ8 A;  1TBE A;  1WZ3 A;  3JSV B;  1WFY A;  3N3K B;  4GU2 A;  5G55 A;  2MSE D;  2RPQ A;  1OEY J;  1Z5S B;  2L8J A;  5AZF A;  3PHX B;  4JIO U;  2IO0 B;  2LGY A;  4ZRI A;  2K39 A;  1E8W A;  1WE6 A;  1I42 A;  3UIN B;  3IVF A;  1OQY A;  3VTU A;  2CR5 A;  2DAJ A;  2ZNV C;  3NOB A;  2NR2 A;  3TMP B;  4KIK B;  5TR5 A;  3R7Q A;  1SGH A;  1YX6 B;  4KZC A;  2Z59 B;  2N9E B;  3AI5 A;  4MJS A;  4WAA A;  4DHJ B;  4JL9 A;  3CMM B;  3B0A A;  4LDT B;  2IZV B;  2MBH A;  4K81 A;  1WM2 A;  3A9K A;  3BIN A;  1H8C A;  2JWZ A;  2NVU I;  2LRW A;  2GMI C;  2M17 A;  2KLG A;  1KLV A;  3ENE A;  3GZN I;  3MTN B;  2ZEQ A;  3RT3 B;  4K1R B;  1K8R B;  3T9L A;  1PQS A;  2MBE A;  3DVN U;  5CHW A;  3VUX A;  3L13 A;  5E6O A;  2KDF B;  2UYZ B;  3V60 A;  4KVG B;  3K9P B;  3KYC D;  1AAR A;  2Z0E B;  2IBI B;  3VH3 B;  2KD0 A;  3VUY A;  1XT9 B;  2NCN A;  1ZKH A;  1WJU A;  4EZL A;  2DZK A;  3A9J A;  4BFR A;  3RD2 A;  3PSE B;  2LXA A;  3VHT C;  2NS5 A;  3JYU A;  2C60 A;  2LXC A;  4FHK A;  1M94 A;  3PTF C;  3JSV A;  3KVF B;  4IWQ A;  5JHB A;  3PS6 A;  4B9K A;  2R2O A;  1TZ1 A;  3MHS D;  4HCP B;  4GB9 A;  1UEL A;  5CTR C;  2GBR A;  2L3Z A;  4BKS A;  4IW0 A;  4II2 B;  3QQ8 B;  4FHJ A;  4I6L B;  4I6N B;  1WGD A;  4GGQ A;  1GJZ A;  2BF8 B;  3KYD D;  5D6J B;  2KMC A;  1GUA B;  2ZJD A;  5BO4 B;  2KTF A;  2MQJ A;  4XZ4 A;  1WX9 A;  1LQB A;  4NQL B;  3ZLZ A;  1VCB A;  4NNJ B;  1MG8 A;  2LZ6 A;  2RR9 A;  3PLV A;  3TL5 A;  4MGI E;  1V81 A;  2BKF A;  2DZM A;  3A4S C;  4TQ1 A;  3PPA A;  4WJQ A;  2L0F A;  4YL8 A;  2NBV B;  1SIF A;  3AUL A;  3A1Q B;  2GBM A;  4M8M A;  2B3A A;  2LVQ A;  1EF1 A;  3DPD A;  4PS7 A;  5G2N A;  1J0G A;  3HIZ A;  5HKH A;  1RAX A;  1GG3 A;  3Q3J A;  3W1S C;  4BKG A;  2V4L A;  3PZD A;  4AJW A;  4JGH B;  3RUI B;  3IFW B;  2G3Q B;  2C7H A;  4KZ0 A;  4W9F A;  2KQS A;  2KLC A;  2KWU B;  2KHW B;  1ZW7 A;  2ZVO A;  4HDQ A;  2BGF A;  3QHT A;  1C3T A;  2BYF A;  2OJR A;  4EUT A;  2MCN B;  3P2B A;  4AOF A;  2AWT A;  1WRD B;  1KJT A;  4PYZ A;  4EEW A;  4HVB A;  3IHP C;  3QAR A;  2JF5 A;  2V3S A;  4IM0 A;  3VXW A;  4ANV A;  1P3Q U;  2EKE C;  4W9D A;  4MJS B;  3OJ3 A;  1P9D U;  3H7P A;  3PRP B;  4W9H A;  4GOC A;  3L10 B;  4IC7 B;  2ZCB A;  4PS8 A;  4DDG D;  1LXD A;  3EFU A;  2JZ3 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...