1V86A

Solution structure of the ubiquitin domain from mouse d7wsu128e protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
GSSGSSGDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords DNA segment, Chr 7, Wayne State University 128, expressed
publication title Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
rcsb
source organism Mus musculus
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v86A00
2N7DA 4KIKA 4IWQA 3H9DA 3S2AA 5JH5C 1Q0WB 2KDEB 2GBNA 4GSWA 4HWIB 5FR6A 4WJPA 3QWZB 1A5RA 4ZRKA 2JF5A 2OOBB 4HPLB 1LM8B 2NBWB 4K7UA 2XBBC 1WXVA 1P1AA 2CR5A 2NR2A 2LVPA 2Z0EB 4PYZA 3L54A 1WRDB 4IM2A 1LFDA 2QHOA 3JVZX 3UIPB 3PVLA 1KLVA 4XZ4A 3WALA 2CU1A 3DPDA 1E7VA 2G4SA 3Q3JA 1E8ZA 3KW5B 1V86A 2O6VD 3NS8A 4KIKB 2PJHA 3RZWC 4II3B 3C0RB 2HD5B 1I42A 3ML8A 4YL8A 5LXHA 1NBFC 2REXA 3A9KA 3EC8A 3AU5A 2KANA 2NS5A 4GDLB 3QCAA 4JIOU 1CMXB 2KWVB 1V9JA 3ZDMC 4MJSA 2C5LC 3UQAA 4W9KA 2NPTA 3TCAA 4MELA 2LUEA 3DBLI 2N4FA 3JW0X 3QX1A 3EHVA 2JXXA 3L08A 4XC2A 3AU4A 5CHVC 4AWJA 4LJOB 4NJ6A 4WJOA 2MSED 1WGDA 3QIJA 1LXDA 2FNJB 4NQKE 5L83A 5D7GA 2Z0DB 4I6PA 3OAWA 5JHBA 2N9XA 4HJKA 3N32A 2BWFA 3L0WB 4DHZB 2UWQA 2JRHA 4GIVA 2C60A 4BBNC 2LASA 2N1WA 4I6LB 5D94A 1WIAA 2L7RA 2XEWA 4WJQA 1WE6A 3PLUA 2B3AA 4AUQC 4M8MA 2G3QB 5DCNA 3WAPA 2ZPYA 1WGGA 4FADA 2ZNVB 2YLMA 4LDTD 4TUUA 4E74A 1EO6A 1LQBA 3AXCA 2BKRB 2JUOA 4MM3A 3H7PA 2J0KA 4JGHB 3BY4B 4JL9A 2DHZA 2K1FA 2MWSB 1C1YB 2KD0A 1E7UA 2FUHB 5DPSA 3JYUA 5E6PA 4W9FA 3K9OB 2CHWA 2L3ZA 5C1ZA 4IWPA 5DPRA 3M62B 1J19A 1OEYJ 4HDQA 2IYDB 3I3TB 1SIFA 2KWCA 3CSFA 3IG3A 5L95C 1WGRA 3DBHI 5E6NA 4KVGB 4IM3A 4AJWA 4AJYB 2K39A 4F7ZA 2MP2A 4ICUA 2ZJDA 4HK2A 3L13A 3A33B 4W9LA 2LGXA 2DENB 5DPWA 4IUMB 3KUCB 3BINA 2DAJA 4HVBA 2KJRA 2LZ6A 4ZYNA 2Z59B 2FIDA 4KZ0A 3OJ4B 3ZIMA 3ZUNA 2O6VA 2W9NA 3PHXB 2C9WB 4JLCA 3HM6X 4LJPB 3R7RA 3TL5A 3A4RA 3Q3FA 2LXAA 1Q1OA 4GOCA 3ZVVA 1XD3B 2PPHA 2ZVOA 4W9EA 3ZO5B 2FCNA 4A20A 2DAFA 3PHWB 4BKTA 4JQWC 1WMHB 4TKNA 2L0FA 2MQJA 3H7SA 3KUZA 1E90A 4FULA 4W9DA 1G6JA 1V80A 1KM7A 2EMTA 2O6VB 3QK0A 3VXWA 3APCA 4WJNA 3GZNI 1NDDA 1WX7A 2M8SA 3R66C 2WDTB 4HLEA 2HJ8A 3PGEA 2ZVNA 3M95A 3ZLZA 4K7SA 4A3OA 1KJTA 2K6QA 4EKUA 2KVRA 2L00B 3UIOB 2A4ZA 3PRZA 5JHAA 4XX5A 4DHJD 1Z2MA 3ZRCA 1P9DU 4GDLA 3VUWA 4EOYA 3DVNV 4BBNF 2GBMA 2ZNVC 2K8HA 5CX3A 2ASQA 3AI5A 3V60A 1GG3A 2V3SA 2KMCA 3NZSA 5EDSA 1YQBA 2GBJA 2GBRA 1IYFA 3SHQA 4K7WA 2L0TA 1UD7A 2MBQA 2O2VB 3UGBB 4K81A 1OTRB 2I1KA 3T8MA 4B95A 2JVCA 2JZ3B 3KH0A 4KDIC 4KV2A 4B6WA 5CTRC 2FCQA 4TQ0A 3V62A 4BKSD 2LI5A 3X23A 1Z5SB 2PE6B 2AL6A 1WI0A 2XK5A 3WAOA 3DBRI 2C7MB 2BYFA 2MA9B 3NZUA 2JZZA 3EECA 2NVUI 2KTRA 2GBKA 2ZEQA 2R2QA 3QQ8B 2KDBA 3PLVA 2D3GA 3SU8X 4OVUA 3IVFA 4BKGA 5J18A 3VUYA 1BT0A 1E8YA 1QZEA 2LJ5A 2MRPA 5E6OA 5KHOA 3RYTA 4CO7A 2JWZA 4KZCA 2CS4A 1RRBA 5DPTA 3TJPA 1Q5WB 3ML9A 4ICVA 1GUAB 2LVOA 3OJ3A 3QHTA 2LXCA 4MSMB 5AEKB 1WGHA 3PRPB 4GN1A 4MGKE 2XK5B 2BF8B 3ZNGC 2DZIA 4W9CA 4F8CB 3LDZE 2KTRB 1TZ1A 1SE9A 3IFWB 3PREA 2RGFA 3UINB 4EEWA 1P3QU 4FN2A 4AOFA 1V5OA 3ONSA 4RMAA 4IC7B 5G2NA 3TIXA 4FBJB 2KK8A 2KC1A 1WX9A 1OEYA 2JT4B 4ZRJA 1WJ4A 3VVWB 3WIMA 1ZW7A 2N7EA 3H6NA 1X1MA 3APDA 4WWOA 2NBVB 4KDLB 4J6IA 4RM9A 1D3ZA 1UELA 2FAZA 2BYEA 3DDCB 4GXBA 1WZ3A 3VTUA 2KZRA 2KLCA 5TR5A 2IBIB 3MHSD 2KNBA 1YJ1A 3KUDB 4W9HA 1C3TA 2BWES 4MDKE 2IO2B 3PTFC 2LGDA 3M3JA 5AZGA 1WX8A 2HTHA 3RULA 4BOSC 2MW5A 2G4DB 1PQSA 3ALBA 1EUVB 4HCPB 2NCNA 1YX5B 3DCGA 1V81A 1UBIA 3HIZA 3ENEA 3KYDD 4HDOA 4I6NB 5GMVA 1WJUA 4MH0E 1RLFA 2EKEC 2KLGA 3ECIA 1L7YA 1WFYA 3O65B 3GOEA 1WR1A 3HHMA 1JRUA 3VH3B 5LXIB 3U8ZA 2DZKA 3B1LX 4W9GA 3T9LA 2N9EB 1WMHA 5C23A 3NHEB 1WYWB 2K25A 4WWPA 1WXMA 4PS8A 2DYMA 3TBLD 2G45B 3MTNB 3VUXA 3VTVA 2KOXA 4BOZB 2MLBA 2K8CA 1V2YA 2KXJA 1J0GA 2JRIB 1VD2A 1WE7A 2M0XA 1WXAA 2BGFA 3CMMB 4MGZE 2AEHA 1KOTA 3KVFB 3N3KB 3RUIB 4KSLC 2AYOB 2C7HA 3VTWA 3ZW3A 4E71A 4N9F4 3DVGY 4DK5A 3WA0A 2D2QA 2M17A 2MBOA 4WAAA 2MX2A 4ZDVA 2L8JA 4NAWA 2AL3A 4IWOA 4NPNA 1P98A 2ZCCA 2VRRB 1SGHA 2BPSA 2IO3B 2KDFB 1IP9A 2O2VA 2MCNB 2GOWA 3X0WA 4BVUC 3DQVA 3ZNID 1UBQA 1OQYA 4WWNA 2DX5B 4KSKC 3R7QA 1E8WA 2J0JA 1R4NI 1RAXA 2Y5BB 4PS7A 3QAQA 4W9IA 3L16A 1OGWA 3V6CB 4FJVB 1MG8A 3DBSA 3ZRFA 2C7NB 5CHWA 1UH6A 2KMAA 3AULA 4FA6A 2J7QB 4DHZE 4NAWB 3HK0A 2PEAA 1IPGA 3W1SC 4ANVA 2RR9A 3V6EB 4NNJB 3CSTA 3ZKJC 4ASWC 2LWPA 4NQLB 4MGIE 4G50A 2KJHB 2LRWA 4M8NA 4F1SA 2RPQA 4G3XB 3A1QB 3CF6E 3OLMD 3A4SC 3L17A 3A9JB 3RCZA 3NY5A 2KKCA 4P7IA 3H1UA 4CYEA 4LDTB 4DDID 1I35A 1WGYA 5D6JB 1U4AA 4GMVA 2J0MA 4GDKB 1EF1A 1TGZB 4IG7B 1P0RA 3PV1A 1UGMA 4MGYE 3SD5A 5J17A 4HCNB 1R4MI 5IA7A 3DVNU 1WM3A 1WJ6A 3U7DA 2EMSA 2MBBB 2BYVE 2CHZA 2WWZA 4MEMA 3VH4B 3W1SA 1ZGUB 2ZZPB 3VFKA 3ZTDA 3W1YA 3B0AA 2A5UA 3B08A 4X57B 3ZNHB 3QJZA 4RM8A 3UF8A 4E3CA 1GNUA 1UZXB 1F9JA 2IY1B 1WR6E 2FCMA 5IAAC 1WF9A 1RFAA 3RD2A 4NY0A 3N30A 3SDLC 1YIWA 2KFKA 4ZRIA 1WXSA 5JZEB 3WANA 1K8RB 5BO4B 4HXDA 4IW0A 4NJ7A 4URKA 4B9KA 2KO3A 1TTNA 3DVGX 4FHJA 3U30A 2JPHA 1YD8U 3ZTCA 2OJRA 4EFOA 2RSUA 4CHKA 4DBGA 3TMPB 1J8CA 4GU2A 2KX0A 4EZLA 3APFA 2K6DB 4EUTA 1EF5A 1XQQA 2KQSA 5G55A 2RD0A 2WYQA 1T0YA 2KC2A 4WQOB 5CHFA 1V5TA 3PT2B 2KN5A 3L10B 3A9KB 2LD9A 1WJNA 3ZNZB 3PPAA 4IM0A 2LVQA 2KFKB 1E5WA 1GC7A 2DZJA 1HE8A 2LRUA 1XT9B 3IHPC 3PRMB 4HPMB 2ZCBA 2ZPNA 2NPTB 2KTFA 4MJSB 5AZHA 4A3PA 4ANWA 2IY0B 4FHKA 1WZ0A 3UQBA 2D10A 4G11A 3QA8A 2YVCA 2V4LA 3KYCD 2N1VA 4BFRA 2DZMA 2PE9A 2WX0A 3RZFA 4EZJA 1WY8A 2IO1B 3DOWA 3LJ3A 3QC8B 2UYZB 3QARA 2IO0B 2KDIA 4K1RB 1S1QB 1V6EA 2D11A 2CHXA 4LCDE 2D07B 2FCSA 4FJYA 4MSQB 3R3MA 4PS3A 2MBEA 2GMIC 2KFJA 2BKFA 4W9JA 4DXAB 1M94A 2M1MA 3HM3A 1GC6A 3NOBA 1YX6B 2N9PC 3V61A 1H4RA 3H7PB 2AWTA 4BKSA 1NI2A 2KWUB 4DHJB 2DYOA 2IZVB 2R2OA 5KHQA 2V1YA 2M4NA 1TBEA 5J2RA 2JY6A 2MBHA 1ISNA 2K8BA 3M63B 1E8XA 3PSEB 1AARA 4II2B 3VQIA 5D2MB 1GJZA 2HE7A 3IBEA 4AP4C 4EZKA 1H8CA 3VDZA 3JSVA 3ZDTA 4ANUA 3RT3B 5HKHA 4GB9A 3VHTC 2FIFA 2MP2B 3P2BA 1L2NA 1S3SG 2KHWB 1VCBA 3A1QA 1Y8RC 4TQ1A 3A9JA 2KX3A 3EFUA 4FLHA 2KQ7A 4OVVA 1WM2A 2WX1A 3VAWA 1ZKHA 3D32A 4FJZA 4GDKA 4TV3A 2NBUA 2KJ6A 3PS6A 3MJWA 2L05A 4DWFA 4GGQA 2DYBA 5LLIA 3PZDA 3K9PB 1WH3A 3WAMA 4DDGD 1FXTB 2L76A 1V49A 2I1JA 4G0NB 4PYUA 4ANXA 3JSVB 5AZFA 4M0WB 2LGYA 2CKHB
chains in the Genus database with same CATH superfamily
2QDFA 3S2AA 4HROA 1AN8A 5G5HA 3Q3NC 1ZP0B 4HWIB 5IO9A 1A5RA 1LM8B 4DXFA 1WXVA 2NR2A 2LVPA 4PYZA 1WRDB 3UIPB 1C77A 1SXTA 3AE3B 3N1YC 3KWLA 4KKIA 3DPDA 1E7VA 3Q3JA 4II3B 3C0RB 1I42A 5LXHA 1NBFC 3A9KA 1CMXB 2KWVB 1XLNA 3ZDMC 4MJSA 2K5PA 3JW0X 2N4FA 3QX1A 1WYGA 5CHVC 4AWJA 4XC2A 3AU4A 1JWBD 1VZ7A 1ENFA 2D3CA 2Z0DB 5JHBA 4HJKA 4DHZB 2JRHA 4GIVA 2N1WA 3AM9A 4RF1A 3GP7A 5DCNA 5IN7A 2WU5B 1FXIA 1B9RA 4XGAB 1D5ZC 2D3AA 3RFZB 2ZW0A 4JGHB 3BY4B 5TSSA 3R2TA 2DHZA 2K1FA 1N5WA 1R7SA 4NJCA 2CHWA 4IWPA 1V1PA 1OQQA 2E3TA 1OEYJ 3FILB 2V3PA 2WXJA 3CSFA 3P63A 4IM3A 2BVCA 3Q3MC 1Y56A 3AEDB 2QC8A 2J4XA 2ZJDA 4W9LA 3BVZA 1L0YB 4IUMB 3BINA 2KJRA 1TKGA 3P42A 2O6VA 2V0GA 3HM6X 4LJPB 3TL5A 5D3DA 1XD3B 3P4SB 4W9EA 2FCNA 4BKTA 1M4VA 4TKNA 2L0FA 3RNGC 4FULA 1E90A 1G6JA 1V80A 1KM7A 3N1ZC 4WJNA 1E7PB 1WX7A 3R66C 2A4ZA 5LNK1 4OVZA 4DHJD 3ZRCA 3VUWA 4EOYA 1V97A 3DVNV 1YJJA 2GBMA 2V4IB 2ZNVC 5CX3A 1FCCC 3C8YA 5EDSA 1L4DB 1YQBA 2DNFA 2KMMA 2GBJA 2GBRA 1ZDVA 4K7WA 3ZGZA 1SE3A 1I4QA 4BKSD 1Z5SB 2HDEA 3DBRI 2BYFA 3NZUA 2VH1A 2GBKA 2ZEQA 3PLVA 2D3GA 1VDVA 1PFDA 4L23A 4CO7A 1FNVA 5KHOA 1VZ6A 2CS4A 1RRBA 2JU6X 5HG2A 2Y3AA 2LXCA 1ZXIA 4N58A 2DZIA 2KTRB 2WLBA 1SE9A 3UINB 2KACA 1EU4A 2J52A 1D5XC 3NVVA 2N7EA 3ZJVA 3RNBC 4RGNA 1VRAB 1JWSD 3SFDB 1UELA 2FAZA 5TR5A 4OZBA 3RNAC 3MHSD 1XF5L 2JYEA 1WX8A 2HTHA 4BOSC 2R61A 5H92C 4YSZB 1C9FA 3HIZA 1FO4A 4HDOA 5GMVA 2PKOA 1MPEA 4IDIA 1WR1A 3VH3B 5LXIB 3B1LX 2N9LA 1F0ZA 3U7ZA 3NHEB 1WYWB 4C00A 4HJGE 4PS8A 3EA6A 2M0AA 2K8CA 1V2YA 1KLUD 2KXJA 4C7ZA 1WE7A 4MGZE 2BGFA 1KOTA 1PGAA 3RUIB 2BS4B 2C7HA 3ZW3A 4E71A 4N9F4 2MBOA 3BVMA 4NAMA 3AE4B 2L8JA 3BIID 3CWIA 5BYQA 5H8YE 2O2VA 2MCNB 2GOWA 2GI9A 3T3NA 1UBQA 2SEBD 4US8A 1E8WA 3UI3A 1NYRA 2CJOA 3QAQA 3L16A 1OGWA 2J7QB 1L6UA 1OFFA 4ZRQA 3W1SC 1XXGA 2IPKD 3E9SA 3LXFA 4RFBA 4NQLB 1QF6A 1I7HA 1P7EA 2GRIA 3CF6E 3NY5A 3H1UA 5D6JB 4GMVA 4B0MA 2Y5PA 3HUIA 3SD5A 1R4MI 5IA7A 4BZAA 2EMSA 2W82A 5FKAC 3W1YA 4M00A 3B0AA 3AECB 4RM8A 2D5GA 5IAAC 1WR6E 2FE8A 4HEA1 3RD2A 2IJ0A 2OEDA 3SDLC 3WANA 1K8RB 4IW0A 4NJ7A 4URKA 1I4GA 4YTMB 1TKEA 4ZHPA 1PGBA 2RSUA 3TMPB 1J8CA 3APFA 4EUTA 1EF5A 4MACA 2EKIA 2KC2A 1FD6A 2QILA 1FM0D 1JWAD 4IKGA 3A9KB 4YT0B 1PYWD 3H8HA 4GLSC 2N7JA 1E5WA 2AQ2B 1WRIA 4MJSB 2ZCBA 3EUB2 5AZHA 1XLOA 1WZ0A 3UQBA 4HKZE 4M01A 3KYCD 2N1VA 4WH4A 2WX0A 3RZFA 3LJ3A 2IO0B 2D11A 2CHXA 2D07B 4ARIA 4P1BC 2BTEA 2I38A 3GE8C 2LHEA 4JX1C 3AEEB 4YSXB 4BKSA 1NI2A 2IZVB 2R2OA 1KF6B 2V1YA 4JWSC 1V1PB 2JXTA 4LNFA 3M63B 3Q14C 3BK2A 5D2MB 2WXOA 3Q3OC 1Y8RC 4FLHA 4OVVA 2HTME 5G5GA 1SB3C 4GDKA 2INCC 2DYBA 3N9YC 2L76A 1V49A 4PYUA 4HRSA 3DHHC 2LGYA 1PQSA 2N7DA 2CKHB 1C4AA 4IWQA 3H9DA 4UDUC 4ZHOA 2W54A 3MC0B 4GSWA 1MHHE 1YNTE 5FR6A 2NBWB 1SIJA 2CR5A 1FXAA 2Z0EB 1D6EC 1LFDA 3JVZX 4IM2A 2WU2B 5GXGB 1CK1A 4O1NA 3KW5B 1V86A 1ZE3D 2O6VD 3NS8A 4KIKB 2BYTA 3ML8A 2JQRB 3TUOA 4YL8A 1IGCA 4JWUC 4XDCA 4R3DA 1V9JA 2CU3A 4LNIA 1BXTA 2C5LC 3DBLI 3EHVA 3L08A 3RI7C 4NJ6A 4WJOA 1WGDA 4NQKE 4I6PA 3OAWA 2LASA 4I6LB 1EM7A 1GOZA 3PLUA 4K3BA 4MH8A 3WAPA 2ZPYA 2YLMA 1FRDA 2AX5A 4E74A 4EE2A 3AXCA 1SJHD 3MFGA 1TIFA 2EELA 3BK1A 1UGJA 1AYFA 1E7UA 5DPSA 3W9CB 3IT4B 2WXIA 5E6PA 4W9FA 2PMVA 3K9OB 1GAQB 4WAFA 2GLSA 1J19A 1XCQL 3IAM1 3I3TB 4XWWA 5FK9C 2KWCA 1STEA 5E6NA 4KVGB 1QQRA 2MH7A 4AJWA 3VR8B 4F7ZA 3Q69A 4HK2A 4A6QA 1K52A 4C56C 2LGXA 1KLGD 2DENB 3DWMA 5DPWA 3LB8C 3AH7A 2Z59B 4KZ0A 3ZIMA 3PHXB 2C9WB 2J42A 3R7RA 3A4RA 5BYRA 1N6ZA 1Q1OA 1K51A 2PPHA 2N9KA 3MC8A 2WS3B 2DAFA 1EU3A 2RPVA 4JQWC 4WURA 2WXHA 2EMTA 3E56A 2AQ3B 3VXWA 4RCOA 3APCA 2Z8LA 3HVDA 5HI1A 3GZNI 1JMLA 1ZDXA 2M8SA 3PGEA 3ZLZA 4K7SA 1QOGA 1KJTA 1MFWA 3NJTA 1UUPA 1F52A 1Z2MA 4S17A 2QEJC 3V60A 3AE7B 4C80A 3I5JC 5T8IA 1IYFA 2L0TA 1N63A 3UGBB 2O2VB 3DBRB 2WXQA 2HJ1A 4K81A 4B95A 2JVCA 2WXGA 3KH0A 4KDIC 4KV2A 5D3IB 2XN9C 1ACCA 1C76A 3X23A 2MA9B 3BWUD 1XLPA 2BS2B 3RNFC 4WIPA 1QZEA 1E8YA 3TJPA 1XCTL 2LVOA 3J9CA 1V8CA 2L52A 1B1ZA 2XK5B 4W9CA 4F8CB 1KTKA 1JCKB 1TZ1A 3IXSA 1RYJA 3N1XC 1RFKA 1TKYA 4XWTA 1P3QU 4FN2A 4RMAA 4IC7B 3I57A 1WGKA 4ZRJA 1WX9A 1OEYA 2JT4B 1WJ4A 1C4CA 2BB5A 3APDA 3P1MA 2NBVB 3NRZA 2IDYA 2BYEA 3DDCB 2KZRA 2INPE 1YJ1A 2KNBA 2ZW1A 2BWES 3Q8CA 4MDKE 3PTFC 2LGDA 2PVGC 2X8XX 2MW5A 2WXFA 3ALBA 4HCPB 1EUVB 1YX5B 4MH0E 3NUHB 1T5XD 1ET6A 4W9GA 1WMHA 1UF0A 2K25A 1WXMA 2DYMA 2LUMA 3TBLD 2WDRB 2G45B 3MTNB 3VTVA 2KOXA 2MLBA 1J0GA 2JRIB 1SEBD 2AYOB 1Q10A 2RDBC 3WA0A 5EE0A 2ON8A 4NAWA 4NPNA 3O13A 2VRRB 2BPSA 2KDFB 5BMIA 4N59A 3R8BA 3X0WA 2JYTA 1OQYA 1R4NI 4W9IA 3V6CB 1MG8A 1QLBB 3ZRFA 1WSPA 1UH6A 2KMAA 3HK0A 4REZA 4C4VA 3CSTA 1UWMA 4MGIE 2LRWA 3ABVB 4OZAA 1R4MB 4LNNA 4LDTB 2WDVB 2J0MA 4GDKB 1SSNA 4BAXA 1E9MA 1P0RA 2OJWA 2NTTA 3FC4A 3PZ8A 1UWXA 1WM3A 1K50A 2KN4A 2MBBB 2BYVE 3Q8BA 1T6BX 3ZTDA 1T0RC 1FFVA 1WF9A 1RFAA 2M19A 4S0RA 4LLGM 1YIWA 2KFKA 4YSYB 5BO4B 2MJEA 3U30A 2KX0A 1DGJA 2K6DB 1XQQA 1TY0A 1WXQA 2KQSA 3KQ4A 2RD0A 5CHFA 1PDXA 2JWUA 1V5TA 3PT2B 2KN5A 1F1HA 3PPAA 4IM0A 2VH2A 2DZJA 2LRUA 3IHPC 3U52E 2ZPNA 4A3PA 1SE2A 4G11A 2K22A 1YJIA 2QIEB 2PE9A 3BZDB 1FPYA 3QC8B 3U4EG 2SAKA 2G1EA 4USAA 3NS1A 3R3MA 2MBEA 1WWTA 2KFJA 2BKFA 2M1MA 1GC6A 1IUEA 1H4RA 2AWTA 1GB1A 1NEKB 2KWUB 1ZXHA 5J2RA 2MBHA 3DHGC 3IAS1 1BUIC 3AE1B 4EZKA 5BYSA 5HKHA 1H8CA 3AE2B 1EWYC 1L2NA 1VCBA 1VZ8A 1KFYB 4P16A 3RNEC 2KDMA 4TV3A 3U2SC 1YN4A 5LLIA 3K9PB 1WH3A 3WAMA 1FXTB 3JSVB 4M0WB 3OWEB 1Q0WB 3T3OA 4WJPA 2IGDA 4HPLB 1F77A 2NMQA 2XBBC 4YWGG 2QCZA 3L54A 2QHOA 4LNOA 4ZYSA 3PVLA 1KLVA 3AN1A 3WALA 2G4SA 2W55A 3ETRA 2WXNA 2PJHA 3MP9A 3RZWC 3DBLB 2KANA 2NS5A 2ONQA 4JIOU 3UQAA 4MELA 2KAJA 1XEEA 3WIMA 2MSED 1YQ4B 2FNJB 3I63C 5L83A 2N9XA 3N32A 2E6XA 1YOVB 1L4ZB 5AUIA 5D94A 2XEWA 4WJQA 2WXRA 3Q6BA 1D4BA 4M8MA 2PLPA 2G3QB 2PTLA 2WXMA 2QSDA 3B9JA 1WGGA 4FADA 4TUUA 1LQBA 2JUOA 4MM3A 4JL9A 1T0SC 3PZ7A 2LGSA 4OW0A 2MWSB 2KD0A 2L3ZA 5C1ZA 5DPRA 3W2DA 3M62B 1AW7A 4KGSA 4HDQA 2YEPB 1SIFA 2KT7A 3IG3A 3HVZA 4HKQA 2XNAC 3NVYA 2K39A 4ICUA 3FAHA 4A90A 3KUCB 2DAJA 1DOXA 5AUKA 4HVBA 3ZJUA 2FIDA 3ZUNA 5MPOA 1DOYA 1YN3A 3Q3FA 2LXAA 3KLSX 1ZPSA 4MT5A 3ZVVA 3DWGC 3ZO5B 3NG0A 4A20A 3GZNB 2W3RA 1WMHB 2KVZA 2MQJA 3KUZA 4L2YA 2MJ3A 1SBBB 3VRBB 1N5XA 2JZPA 2O6VB 5IKCM 4H2AA 2BQQA 3RPFC 1QILA 1NDDA 2HJ8A 4EKUA 4RF0A 2L00B 1N60A 3PRZA 3AE6B 5JHAA 4XX5A 1NENB 1P9DU 4GDLA 2K8HA 2ASQA 2W3SA 3AI5A 2V3SA 2KMCA 4WQMA 4IOIE 1FNWA 3SHQA 1UD7A 2MBQA 3T8MA 2WDQB 4YXDB 4B6WA 1MVKA 3ZXVA 5CTRC 2FCQA 2ACZB 2RMMA 3V62A 2LI5A 3RNCC 4A8XC 3WAOA 2C7MB 3EECA 2NVUI 2KTRA 3AV8A 1TS2A 3MC9A 2R2QA 3QQ8B 2KDBA 3SU8X 4OVUA 4BKGA 5J18A 4C4VB 3VUYA 2LJ5A 5E6OA 2MRPA 3RYTA 2JWZA 5DPTA 4ICVA 1SF0A 2BB6A 3QHTA 4MSMB 5AEKB 2JX5A 2VZKD 3PRPB 4GN1A 4YTPB 4Q2JA 3CIRB 3IFWB 5BMHA 1GB4A 4EEWA 4ARCA 1V5OA 3TIXA 2KC1A 1ZOYB 3VVWB 1ZW7A 1A70A 1I4PA 1D3ZA 2I2YA 2G9HD 1WZ3A 1JROA 3VTUA 3AE9B 2KLCA 2IBIB 2V9HA 3KUDB 1C3TA 5C3JB 1I4XA 2G4DB 1V81A 1UBIA 4B0EA 2L1AA 1RLFA 3WCQA 3ECIA 3O65B 2WQYB 3GOEA 3HHMA 1JRUA 3T9LA 5C23A 1DOIA 4WWPA 1I4RA 1VJKA 4BOZB 1TT5B 2IGHA 1VD2A 2M0XA 3CMMB 2AEHA 3N3KB 4KSLC 2DWQA 3URYA 4DK5A 3B2FA 2D2QA 1JWUD 4WAAA 1HZ5A 1F2RI 4LNKA 4ZDVA 4IWOA 1IBXA 5E6JA 1R4NB 2K3UA 3R2IA 3ZNID 3Q8AA 1L0VB 3R7QA 1RAXA 1TJEA 4PS7A 1FNUA 2BBCA 2N0SB 4DHZE 2DBYA 2BS3B 1IPGA 4ASWC 2JSVX 1HXYD 2LWPA 2INNE 4RH6A 1C79A 4G50A 2KJHB 4F1SA 2RPQA 4G3XB 4JE3B 3RCZA 2KKCA 4P7IA 4DDID 1U4AA 3AEFB 3SFEB 4ITKA 1UGMA 1TYGB 4NZLB 2KQ4X 4US9A 3U7DA 2BT6A 3VH4B 2WWZA 1N61A 3W1SA 3B08A 3ZNHB 4E3CA 3UF8A 1F9JA 3RMKC 4NY0A 1NI3A 3N30A 5JZEB 1TTNA 3DVGX 3ZTCA 4EFOA 4AS1A 2OJRA 4DBGA 4GU2A 3RN9C 4WQOB 1T3QA 1T0YA 3HRDD 2MJDA 2PIAA 4OZCA 4QAYA 2LVQA 3PRMB 1GC7A 2L83A 4HPMB 4ANWA 4FHKA 1PUTA 2D10A 2YVCA 4BFRA 1DYQA 2J53A 1WY8A 2IO1B 3I9V1 2DLBA 2UYZB 3QARA 2V3NA 4FJYA 4WWMA 3DBHB 4MSQB 3TEWA 4PS3A 4HPPA 1MJDA 1E0ZA 2GMIC 4J3OD 2INDC 3HM3A 3NOBA 2N9PC 3V61A 4MM3B 2ICIA 2KWDA 1BMLC 4AQ7A 4DHJB 2TSSA 2FUG1 2LMCA 1TZOA 1E8XA 3PSEB 1RWSA 4II2B 3ZQ4A 4PT5A 3AE5B 3ZDTA 4ANUA 3RT3B 4GB9A 3VHTC 4ACFA 1QOBA 1S3SG 2KHWB 3A1QA 4TQ1A 3A9JA 2KX3A 2KQ7A 3VAWA 2WX1A 3W5VB 2PVOD 3VRAB 4FJZA 2WXKA 2NBUA 1LO5D 3MJWA 2RDHA 1YMHE 2PW9A 2I1JA 4G0NB 3P4QB 4ANXA 2AQ1B 2LFIA 4KIKA 2RDGA 2QJLA 5JH5C 2KDEB 2GBNA 1OQRA 3QWZB 4ZRKA 2JF5A 2OOBB 4K7UA 4KKJA 1CJEA 1P1AA 3Q8FA 1MI0A 4XZ4A 1QT9A 4KGRA 2WP9B 2CU1A 1E8ZA 2H88B 2HD5B 1JRPA 2REXA 1PGXA 3EC8A 3AU5A 4GDLB 3QCAA 1EWCA 2WXPA 4W9KA 2NPTA 3TCAA 3V3XA 2LUEA 1D5MC 2JXXA 3PO0A 4LJOB 1HZ6A 4XYCA 3QIJA 3AMZA 1LXDA 5D7GA 3V05A 2BWFA 3L0WB 1JQ4A 2LJIA 1FEHA 2UWQA 2C60A 3ZJTA 4BBNC 1KH0A 3TSSA 1N62A 1WIAA 2BW2A 2L7RA 1WE6A 4AUQC 2B3AA 1NVID 3C19A 2ZNVB 4LDTD 1TS5A 1EO6A 2BKRB 3TEXA 4TSSA 2M56B 3H7PA 2J0KA 1C1YB 2FUHB 1J7CA 4RGMA 3JYUA 1MG4A 2LHDA 4C7YA 1V1OA 2IYDB 3TEYA 5L95C 3W5UB 1WGRA 3DBHI 4LTUA 1NYQA 4A9AA 4AJYB 2MP2A 3L13A 3A33B 1L6VA 3IT6B 1KRHA 1FFUA 2LZ6A 4ZYNA 2QMTA 3OJ4B 2W9NA 1FRRA 4JLCA 5EE1A 4YTNB 5HFYA 4GOCA 1VR9A 1ZUD2 2ZVOA 1LGRA 3PHWB 2MHJA 1C4PA 4JPSA 4W9DA 3H7SA 3FKYA 3QK0A 4ZRPA 3GB1A 1ET9A 2WDTB 4K3CA 5JXVA 4HLEA 2ZVNA 3M95A 4A3OA 2K6QA 3MHZA 2KVRA 3EFCA 3UIOB 4L1BA 2X38A 4XE0A 4BBNF 1GG3A 3NZSA 3ZXRA 1IBXB 4D2KA 4N6EB 1K53A 1YQ3B 1OTRB 2I1KA 3KWVA 2JZ3B 4KGTA 1TS3A 4TQ0A 2PE6B 1GPXA 2AL6A 1WI0A 2XK5A 2JZZA 2CJNA 2OHFA 1QOAA 1ESFA 3IVFA 1BT0A 4KZCA 4A55A 4KX6B 1Q5WB 3ML9A 1GUAB 3OJ3A 2WNMA 2H89B 3GS2A 1WGHA 4MGKE 3AEAB 3NVWA 2BF8B 3ZNGC 5I4DA 3LDZE 3FILA 3AEGB 1FIQA 3PREA 2RGFA 1JWMD 3DHIC 4PK1A 3Q2AC 4AOFA 3ONSA 1J7AA 5G2NA 1F2RC 3NZ3A 4FBJB 2KK8A 3BYYB 4RNAA 3H6NA 1X1MA 4WWOA 1QOFA 4KDLB 4J6IA 1J7BA 4RM9A 4GXBA 1P7FA 2WGSA 5EE9A 4W9HA 4FXCA 3OG5A 2IO2B 3M3JA 5AZGA 3RULA 1IGDA 2NCNA 3DCGA 1E10A 3BVGA 3KYDD 3ENEA 4I6NB 1WJUA 2B76B 2EKEC 2KLGA 1L7YA 1WFYA 4CQNA 1TY2A 3U8ZA 2DZKA 3N20C 2N9EB 1HEZE 2MEKA 1XLQA 1L5PA 3VUXA 3SEBA 3L4PA 2FBWB 4XDDA 1WXAA 3KVFB 3SR6A 4DQOC 3VTWA 3DVGY 1T0QC 2D3BA 2M17A 2MX2A 2AL3A 1P98A 2YEPF 2ZCCA 3P4RB 1SGHA 2IO3B 1IP9A 2Y5CA 4BVUC 3DQVA 3AE8B 4WWNA 2DX5B 4KSKC 2J0JA 1AWDA 2Y5BB 4FJVB 1HTOA 3DBSA 3Q8EA 2C7NB 5CHWA 3AULA 4FA6A 4NAWB 1JALA 2IGGA 2PEAA 4ANVA 2RR9A 4RGTA 3V6EB 4NNJB 3ZKJC 2VZKB 4M8NA 4TMAB 1TS4A 3A1QB 1VLBA 3OLMD 3A4SC 3L17A 3A9JB 4DXGA 1HA5A 4OHJA 1L0XB 4CYEA 3NVZA 1I35A 1WGYA 5HHDG 3AEBB 1EF1A 1TGZB 4IG7B 4MGYE 3PV1A 5J17A 4HCNB 1FMAD 3DVNU 1WJ6A 4LK0M 3GE3C 5IP4D 2CHZA 4MEMA 1ZGUB 2ZZPB 3VFKA 2A5UA 4X57B 3QJZA 2K0PA 1GNUA 1UZXB 2IY1B 2FCMA 1HQRD 4ZRIA 1WXSA 2GB1A 4HXDA 3BYTB 1SE4A 4B9KA 2KO3A 5IOIA 4FHJA 2JPHA 1YD8U 1UNSA 1CQVA 4CHKA 2NTSA 4EZLA 2Q5WD 5BMGA 5G55A 1HTQA 2WYQA 1C78A 1RM6C 3L10B 2LD9A 1WJNA 3ZNZB 1YN5A 2KFKB 1HE8A 1XT9B 2NPTB 2KTFA 2IY0B 3VR9B 1JW9D 3QA8A 1CZPA 2V4LA 2LGIA 4ZOHC 2DZMA 4EZJA 3DOWA 2KDIA 4K1RB 1S1QB 1V6EA 4P6VF 4LCDE 2FCSA 5FR3A 2WHIA 4W9JA 4DXAB 1I4HA 1M94A 1QKZA 3AB5A 3B2GA 1YX6B 3H7PB 3LYYA 3MJ5A 2K9XA 1ROEA 3EGRA 2WXLA 2DYOA 5KHQA 4RGOS 2M4NA 2UU7A 1TBEA 1XO3A 4M02A 2JY6A 1ISNA 2K8BA 1E6EB 2KYWA 1FCLA 1AARA 3VQIA 1GJZA 2HE7A 3IBEA 4AP4C 3VDZA 3JSVA 4P1CC 2LEKA 2FIFA 2MP2B 4M0WA 1SJED 3P2BA 3ZYYX 5EE3A 1MHXA 3EFUA 2L32A 1WM2A 1ZKHA 3D32A 2KJ6A 3PS6A 3P4PB 2L05A 4DWFA 4GGQA 3PZDA 5C2TB 4DDGD 3TEZA 5AZFA
chains in the Genus database with same CATH topology
2N7DA 4KIKA 4IWQA 3H9DA 3S2AA 5JH5C 1Q0WB 2KDEB 2GBNA 4GSWA 4HWIB 5FR6A 4WJPA 3QWZB 1A5RA 4ZRKA 2JF5A 2OOBB 4HPLB 1LM8B 2NBWB 4K7UA 2XBBC 1WXVA 1P1AA 2CR5A 2NR2A 2LVPA 2Z0EB 4PYZA 3L54A 1WRDB 4IM2A 1LFDA 2QHOA 3JVZX 3UIPB 3PVLA 1KLVA 4XZ4A 3WALA 2CU1A 3DPDA 1E7VA 2G4SA 3Q3JA 1E8ZA 3KW5B 1V86A 2O6VD 3NS8A 4KIKB 2PJHA 3RZWC 4II3B 3C0RB 2HD5B 1I42A 3ML8A 4YL8A 5LXHA 1NBFC 2REXA 3A9KA 3EC8A 3AU5A 2KANA 2NS5A 4GDLB 3QCAA 4JIOU 1CMXB 2KWVB 1V9JA 3ZDMC 4MJSA 2C5LC 3UQAA 4W9KA 2NPTA 3TCAA 4MELA 2LUEA 3DBLI 2N4FA 3JW0X 3QX1A 3EHVA 2JXXA 3L08A 4XC2A 3AU4A 5CHVC 4AWJA 4LJOB 4NJ6A 4WJOA 2MSED 1WGDA 3QIJA 1LXDA 2FNJB 4NQKE 5L83A 5D7GA 2Z0DB 4I6PA 3OAWA 5JHBA 2N9XA 4HJKA 3N32A 2BWFA 3L0WB 4DHZB 2UWQA 2JRHA 4GIVA 2C60A 4BBNC 2LASA 2N1WA 4I6LB 5D94A 1WIAA 2L7RA 2XEWA 4WJQA 1WE6A 3PLUA 2B3AA 4AUQC 4M8MA 2G3QB 5DCNA 3WAPA 2ZPYA 1WGGA 4FADA 2ZNVB 2YLMA 4LDTD 4TUUA 4E74A 1EO6A 1LQBA 3AXCA 2BKRB 2JUOA 4MM3A 3H7PA 2J0KA 4JGHB 3BY4B 4JL9A 2DHZA 2K1FA 2MWSB 1C1YB 2KD0A 1E7UA 2FUHB 5DPSA 3JYUA 5E6PA 4W9FA 3K9OB 2CHWA 2L3ZA 5C1ZA 4IWPA 5DPRA 3M62B 1J19A 1OEYJ 4HDQA 2IYDB 3I3TB 1SIFA 2KWCA 3CSFA 3IG3A 5L95C 1WGRA 3DBHI 5E6NA 4KVGB 4IM3A 4AJWA 4AJYB 2K39A 4F7ZA 2MP2A 4ICUA 2ZJDA 4HK2A 3L13A 3A33B 4W9LA 2LGXA 2DENB 5DPWA 4IUMB 3KUCB 3BINA 2DAJA 4HVBA 2KJRA 2LZ6A 4ZYNA 2Z59B 2FIDA 4KZ0A 3OJ4B 3ZIMA 3ZUNA 2O6VA 2W9NA 3PHXB 2C9WB 4JLCA 3HM6X 4LJPB 3R7RA 3TL5A 3A4RA 3Q3FA 2LXAA 1Q1OA 4GOCA 3ZVVA 1XD3B 2PPHA 2ZVOA 4W9EA 3ZO5B 2FCNA 4A20A 2DAFA 3PHWB 4BKTA 4JQWC 1WMHB 4TKNA 2L0FA 2MQJA 3H7SA 3KUZA 1E90A 4FULA 4W9DA 1G6JA 1V80A 1KM7A 2EMTA 2O6VB 3QK0A 3VXWA 3APCA 4WJNA 3GZNI 1NDDA 1WX7A 2M8SA 3R66C 2WDTB 4HLEA 2HJ8A 3PGEA 2ZVNA 3M95A 3ZLZA 4K7SA 4A3OA 1KJTA 2K6QA 4EKUA 2KVRA 2L00B 3UIOB 2A4ZA 3PRZA 5JHAA 4XX5A 4DHJD 1Z2MA 3ZRCA 1P9DU 4GDLA 3VUWA 4EOYA 3DVNV 4BBNF 2GBMA 2ZNVC 2K8HA 5CX3A 2ASQA 3AI5A 3V60A 1GG3A 2V3SA 2KMCA 3NZSA 5EDSA 1YQBA 2GBJA 2GBRA 1IYFA 3SHQA 4K7WA 2L0TA 1UD7A 2MBQA 2O2VB 3UGBB 4K81A 1OTRB 2I1KA 3T8MA 4B95A 2JVCA 2JZ3B 3KH0A 4KDIC 4KV2A 4B6WA 5CTRC 2FCQA 4TQ0A 3V62A 4BKSD 2LI5A 3X23A 1Z5SB 2PE6B 2AL6A 1WI0A 2XK5A 3WAOA 3DBRI 2C7MB 2BYFA 2MA9B 3NZUA 2JZZA 3EECA 2NVUI 2KTRA 2GBKA 2ZEQA 2R2QA 3QQ8B 2KDBA 3PLVA 2D3GA 3SU8X 4OVUA 3IVFA 4BKGA 5J18A 3VUYA 1BT0A 1E8YA 1QZEA 2LJ5A 2MRPA 5E6OA 5KHOA 3RYTA 4CO7A 2JWZA 4KZCA 2CS4A 1RRBA 5DPTA 3TJPA 1Q5WB 3ML9A 4ICVA 1GUAB 2LVOA 3OJ3A 3QHTA 2LXCA 4MSMB 5AEKB 1WGHA 3PRPB 4GN1A 4MGKE 2XK5B 2BF8B 3ZNGC 2DZIA 4W9CA 4F8CB 3LDZE 2KTRB 1TZ1A 1SE9A 3IFWB 3PREA 2RGFA 3UINB 4EEWA 1P3QU 4FN2A 4AOFA 1V5OA 3ONSA 4RMAA 4IC7B 5G2NA 3TIXA 4FBJB 2KK8A 2KC1A 1WX9A 1OEYA 2JT4B 4ZRJA 1WJ4A 3VVWB 3WIMA 1ZW7A 2N7EA 3H6NA 1X1MA 3APDA 4WWOA 2NBVB 4KDLB 4J6IA 4RM9A 1D3ZA 1UELA 2FAZA 2BYEA 3DDCB 4GXBA 1WZ3A 3VTUA 2KZRA 2KLCA 5TR5A 2IBIB 3MHSD 2KNBA 1YJ1A 3KUDB 4W9HA 1C3TA 2BWES 4MDKE 2IO2B 3PTFC 2LGDA 3M3JA 5AZGA 1WX8A 2HTHA 3RULA 4BOSC 2MW5A 2G4DB 1PQSA 3ALBA 1EUVB 4HCPB 2NCNA 1YX5B 3DCGA 1V81A 1UBIA 3HIZA 3ENEA 3KYDD 4HDOA 4I6NB 5GMVA 1WJUA 4MH0E 1RLFA 2EKEC 2KLGA 3ECIA 1L7YA 1WFYA 3O65B 3GOEA 1WR1A 3HHMA 1JRUA 3VH3B 5LXIB 3U8ZA 2DZKA 3B1LX 4W9GA 3T9LA 2N9EB 1WMHA 5C23A 3NHEB 1WYWB 2K25A 4WWPA 1WXMA 4PS8A 2DYMA 3TBLD 2G45B 3MTNB 3VUXA 3VTVA 2KOXA 4BOZB 2MLBA 2K8CA 1V2YA 2KXJA 1J0GA 2JRIB 1VD2A 1WE7A 2M0XA 1WXAA 2BGFA 3CMMB 4MGZE 2AEHA 1KOTA 3KVFB 3N3KB 3RUIB 4KSLC 2AYOB 2C7HA 3VTWA 3ZW3A 4E71A 4N9F4 3DVGY 4DK5A 3WA0A 2D2QA 2M17A 2MBOA 4WAAA 2MX2A 4ZDVA 2L8JA 4NAWA 2AL3A 4IWOA 4NPNA 1P98A 2ZCCA 2VRRB 1SGHA 2BPSA 2IO3B 2KDFB 1IP9A 2O2VA 2MCNB 2GOWA 3X0WA 4BVUC 3DQVA 3ZNID 1UBQA 1OQYA 4WWNA 2DX5B 4KSKC 3R7QA 1E8WA 2J0JA 1R4NI 1RAXA 2Y5BB 4PS7A 3QAQA 4W9IA 3L16A 1OGWA 3V6CB 4FJVB 1MG8A 3DBSA 3ZRFA 2C7NB 5CHWA 1UH6A 2KMAA 3AULA 4FA6A 2J7QB 4DHZE 4NAWB 3HK0A 2PEAA 1IPGA 3W1SC 4ANVA 2RR9A 3V6EB 4NNJB 3CSTA 3ZKJC 4ASWC 2LWPA 4NQLB 4MGIE 4G50A 2KJHB 2LRWA 4M8NA 4F1SA 2RPQA 4G3XB 3A1QB 3CF6E 3OLMD 3A4SC 3L17A 3A9JB 3RCZA 3NY5A 2KKCA 4P7IA 3H1UA 4CYEA 4LDTB 4DDID 1I35A 1WGYA 5D6JB 1U4AA 4GMVA 2J0MA 4GDKB 1EF1A 1TGZB 4IG7B 1P0RA 3PV1A 1UGMA 4MGYE 3SD5A 5J17A 4HCNB 1R4MI 5IA7A 3DVNU 1WM3A 1WJ6A 3U7DA 2EMSA 2MBBB 2BYVE 2CHZA 2WWZA 4MEMA 3VH4B 3W1SA 1ZGUB 2ZZPB 3VFKA 3ZTDA 3W1YA 3B0AA 2A5UA 3B08A 4X57B 3ZNHB 3QJZA 4RM8A 3UF8A 4E3CA 1GNUA 1UZXB 1F9JA 2IY1B 1WR6E 2FCMA 5IAAC 1WF9A 1RFAA 3RD2A 4NY0A 3N30A 3SDLC 1YIWA 2KFKA 4ZRIA 1WXSA 5JZEB 3WANA 1K8RB 5BO4B 4HXDA 4IW0A 4NJ7A 4URKA 4B9KA 2KO3A 1TTNA 3DVGX 4FHJA 3U30A 2JPHA 1YD8U 3ZTCA 2OJRA 4EFOA 2RSUA 4CHKA 4DBGA 3TMPB 1J8CA 4GU2A 2KX0A 4EZLA 3APFA 2K6DB 4EUTA 1EF5A 1XQQA 2KQSA 5G55A 2RD0A 2WYQA 1T0YA 2KC2A 4WQOB 5CHFA 1V5TA 3PT2B 2KN5A 3L10B 3A9KB 2LD9A 1WJNA 3ZNZB 3PPAA 4IM0A 2LVQA 2KFKB 1E5WA 1GC7A 2DZJA 1HE8A 2LRUA 1XT9B 3IHPC 3PRMB 4HPMB 2ZCBA 2ZPNA 2NPTB 2KTFA 4MJSB 5AZHA 4A3PA 4ANWA 2IY0B 4FHKA 1WZ0A 3UQBA 2D10A 4G11A 3QA8A 2YVCA 2V4LA 3KYCD 2N1VA 4BFRA 2DZMA 2PE9A 2WX0A 3RZFA 4EZJA 1WY8A 2IO1B 3DOWA 3LJ3A 3QC8B 2UYZB 3QARA 2IO0B 2KDIA 4K1RB 1S1QB 1V6EA 2D11A 2CHXA 4LCDE 2D07B 2FCSA 4FJYA 4MSQB 3R3MA 4PS3A 2MBEA 2GMIC 2KFJA 2BKFA 4W9JA 4DXAB 1M94A 2M1MA 3HM3A 1GC6A 3NOBA 1YX6B 2N9PC 3V61A 1H4RA 3H7PB 2AWTA 4BKSA 1NI2A 2KWUB 4DHJB 2DYOA 2IZVB 2R2OA 5KHQA 2V1YA 2M4NA 1TBEA 5J2RA 2JY6A 2MBHA 1ISNA 2K8BA 3M63B 1E8XA 3PSEB 1AARA 4II2B 3VQIA 5D2MB 1GJZA 2HE7A 3IBEA 4AP4C 4EZKA 1H8CA 3VDZA 3JSVA 3ZDTA 4ANUA 3RT3B 5HKHA 4GB9A 3VHTC 2FIFA 2MP2B 3P2BA 1L2NA 1S3SG 2KHWB 1VCBA 3A1QA 1Y8RC 4TQ1A 3A9JA 2KX3A 3EFUA 4FLHA 2KQ7A 4OVVA 1WM2A 2WX1A 3VAWA 1ZKHA 3D32A 4FJZA 4GDKA 4TV3A 2NBUA 2KJ6A 3PS6A 3MJWA 2L05A 4DWFA 4GGQA 2DYBA 5LLIA 3PZDA 3K9PB 1WH3A 3WAMA 4DDGD 1FXTB 2L76A 1V49A 2I1JA 4G0NB 4PYUA 4ANXA 3JSVB 5AZFA 4M0WB 2LGYA 2CKHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N7D A;  4KIK A;  4IWQ A;  3H9D A;  3S2A A;  5JH5 C;  1Q0W B;  2KDE B;  2GBN A;  4GSW A;  4HWI B;  5FR6 A;  4WJP A;  3QWZ B;  1A5R A;  4ZRK A;  2JF5 A;  2OOB B;  4HPL B;  1LM8 B;  2NBW B;  4K7U A;  2XBB C;  1WXV A;  1P1A A;  2CR5 A;  2NR2 A;  2LVP A;  2Z0E B;  4PYZ A;  3L54 A;  1WRD B;  4IM2 A;  1LFD A;  2QHO A;  3JVZ X;  3UIP B;  3PVL A;  1KLV A;  4XZ4 A;  3WAL A;  2CU1 A;  3DPD A;  1E7V A;  2G4S A;  3Q3J A;  1E8Z A;  3KW5 B;  1V86 A;  2O6V D;  3NS8 A;  4KIK B;  2PJH A;  3RZW C;  4II3 B;  3C0R B;  2HD5 B;  1I42 A;  3ML8 A;  4YL8 A;  5LXH A;  1NBF C;  2REX A;  3A9K A;  3EC8 A;  3AU5 A;  2KAN A;  2NS5 A;  4GDL B;  3QCA A;  4JIO U;  1CMX B;  2KWV B;  1V9J A;  3ZDM C;  4MJS A;  2C5L C;  3UQA A;  4W9K A;  2NPT A;  3TCA A;  4MEL A;  2LUE A;  3DBL I;  2N4F A;  3JW0 X;  3QX1 A;  3EHV A;  2JXX A;  3L08 A;  4XC2 A;  3AU4 A;  5CHV C;  4AWJ A;  4LJO B;  4NJ6 A;  4WJO A;  2MSE D;  1WGD A;  3QIJ A;  1LXD A;  2FNJ B;  4NQK E;  5L83 A;  5D7G A;  2Z0D B;  4I6P A;  3OAW A;  5JHB A;  2N9X A;  4HJK A;  3N32 A;  2BWF A;  3L0W B;  4DHZ B;  2UWQ A;  2JRH A;  4GIV A;  2C60 A;  4BBN C;  2LAS A;  2N1W A;  4I6L B;  5D94 A;  1WIA A;  2L7R A;  2XEW A;  4WJQ A;  1WE6 A;  3PLU A;  2B3A A;  4AUQ C;  4M8M A;  2G3Q B;  5DCN A;  3WAP A;  2ZPY A;  1WGG A;  4FAD A;  2ZNV B;  2YLM A;  4LDT D;  4TUU A;  4E74 A;  1EO6 A;  1LQB A;  3AXC A;  2BKR B;  2JUO A;  4MM3 A;  3H7P A;  2J0K A;  4JGH B;  3BY4 B;  4JL9 A;  2DHZ A;  2K1F A;  2MWS B;  1C1Y B;  2KD0 A;  1E7U A;  2FUH B;  5DPS A;  3JYU A;  5E6P A;  4W9F A;  3K9O B;  2CHW A;  2L3Z A;  5C1Z A;  4IWP A;  5DPR A;  3M62 B;  1J19 A;  1OEY J;  4HDQ A;  2IYD B;  3I3T B;  1SIF A;  2KWC A;  3CSF A;  3IG3 A;  5L95 C;  1WGR A;  3DBH I;  5E6N A;  4KVG B;  4IM3 A;  4AJW A;  4AJY B;  2K39 A;  4F7Z A;  2MP2 A;  4ICU A;  2ZJD A;  4HK2 A;  3L13 A;  3A33 B;  4W9L A;  2LGX A;  2DEN B;  5DPW A;  4IUM B;  3KUC B;  3BIN A;  2DAJ A;  4HVB A;  2KJR A;  2LZ6 A;  4ZYN A;  2Z59 B;  2FID A;  4KZ0 A;  3OJ4 B;  3ZIM A;  3ZUN A;  2O6V A;  2W9N A;  3PHX B;  2C9W B;  4JLC A;  3HM6 X;  4LJP B;  3R7R A;  3TL5 A;  3A4R A;  3Q3F A;  2LXA A;  1Q1O A;  4GOC A;  3ZVV A;  1XD3 B;  2PPH A;  2ZVO A;  4W9E A;  3ZO5 B;  2FCN A;  4A20 A;  2DAF A;  3PHW B;  4BKT A;  4JQW C;  1WMH B;  4TKN A;  2L0F A;  2MQJ A;  3H7S A;  3KUZ A;  1E90 A;  4FUL A;  4W9D A;  1G6J A;  1V80 A;  1KM7 A;  2EMT A;  2O6V B;  3QK0 A;  3VXW A;  3APC A;  4WJN A;  3GZN I;  1NDD A;  1WX7 A;  2M8S A;  3R66 C;  2WDT B;  4HLE A;  2HJ8 A;  3PGE A;  2ZVN A;  3M95 A;  3ZLZ A;  4K7S A;  4A3O A;  1KJT A;  2K6Q A;  4EKU A;  2KVR A;  2L00 B;  3UIO B;  2A4Z A;  3PRZ A;  5JHA A;  4XX5 A;  4DHJ D;  1Z2M A;  3ZRC A;  1P9D U;  4GDL A;  3VUW A;  4EOY A;  3DVN V;  4BBN F;  2GBM A;  2ZNV C;  2K8H A;  5CX3 A;  2ASQ A;  3AI5 A;  3V60 A;  1GG3 A;  2V3S A;  2KMC A;  3NZS A;  5EDS A;  1YQB A;  2GBJ A;  2GBR A;  1IYF A;  3SHQ A;  4K7W A;  2L0T A;  1UD7 A;  2MBQ A;  2O2V B;  3UGB B;  4K81 A;  1OTR B;  2I1K A;  3T8M A;  4B95 A;  2JVC A;  2JZ3 B;  3KH0 A;  4KDI C;  4KV2 A;  4B6W A;  5CTR C;  2FCQ A;  4TQ0 A;  3V62 A;  4BKS D;  2LI5 A;  3X23 A;  1Z5S B;  2PE6 B;  2AL6 A;  1WI0 A;  2XK5 A;  3WAO A;  3DBR I;  2C7M B;  2BYF A;  2MA9 B;  3NZU A;  2JZZ A;  3EEC A;  2NVU I;  2KTR A;  2GBK A;  2ZEQ A;  2R2Q A;  3QQ8 B;  2KDB A;  3PLV A;  2D3G A;  3SU8 X;  4OVU A;  3IVF A;  4BKG A;  5J18 A;  3VUY A;  1BT0 A;  1E8Y A;  1QZE A;  2LJ5 A;  2MRP A;  5E6O A;  5KHO A;  3RYT A;  4CO7 A;  2JWZ A;  4KZC A;  2CS4 A;  1RRB A;  5DPT A;  3TJP A;  1Q5W B;  3ML9 A;  4ICV A;  1GUA B;  2LVO A;  3OJ3 A;  3QHT A;  2LXC A;  4MSM B;  5AEK B;  1WGH A;  3PRP B;  4GN1 A;  4MGK E;  2XK5 B;  2BF8 B;  3ZNG C;  2DZI A;  4W9C A;  4F8C B;  3LDZ E;  2KTR B;  1TZ1 A;  1SE9 A;  3IFW B;  3PRE A;  2RGF A;  3UIN B;  4EEW A;  1P3Q U;  4FN2 A;  4AOF A;  1V5O A;  3ONS A;  4RMA A;  4IC7 B;  5G2N A;  3TIX A;  4FBJ B;  2KK8 A;  2KC1 A;  1WX9 A;  1OEY A;  2JT4 B;  4ZRJ A;  1WJ4 A;  3VVW B;  3WIM A;  1ZW7 A;  2N7E A;  3H6N A;  1X1M A;  3APD A;  4WWO A;  2NBV B;  4KDL B;  4J6I A;  4RM9 A;  1D3Z A;  1UEL A;  2FAZ A;  2BYE A;  3DDC B;  4GXB A;  1WZ3 A;  3VTU A;  2KZR A;  2KLC A;  5TR5 A;  2IBI B;  3MHS D;  2KNB A;  1YJ1 A;  3KUD B;  4W9H A;  1C3T A;  2BWE S;  4MDK E;  2IO2 B;  3PTF C;  2LGD A;  3M3J A;  5AZG A;  1WX8 A;  2HTH A;  3RUL A;  4BOS C;  2MW5 A;  2G4D B;  1PQS A;  3ALB A;  1EUV B;  4HCP B;  2NCN A;  1YX5 B;  3DCG A;  1V81 A;  1UBI A;  3HIZ A;  3ENE A;  3KYD D;  4HDO A;  4I6N B;  5GMV A;  1WJU A;  4MH0 E;  1RLF A;  2EKE C;  2KLG A;  3ECI A;  1L7Y A;  1WFY A;  3O65 B;  3GOE A;  1WR1 A;  3HHM A;  1JRU A;  3VH3 B;  5LXI B;  3U8Z A;  2DZK A;  3B1L X;  4W9G A;  3T9L A;  2N9E B;  1WMH A;  5C23 A;  3NHE B;  1WYW B;  2K25 A;  4WWP A;  1WXM A;  4PS8 A;  2DYM A;  3TBL D;  2G45 B;  3MTN B;  3VUX A;  3VTV A;  2KOX A;  4BOZ B;  2MLB A;  2K8C A;  1V2Y A;  2KXJ A;  1J0G A;  2JRI B;  1VD2 A;  1WE7 A;  2M0X A;  1WXA A;  2BGF A;  3CMM B;  4MGZ E;  2AEH A;  1KOT A;  3KVF B;  3N3K B;  3RUI B;  4KSL C;  2AYO B;  2C7H A;  3VTW A;  3ZW3 A;  4E71 A;  4N9F 4;  3DVG Y;  4DK5 A;  3WA0 A;  2D2Q A;  2M17 A;  2MBO A;  4WAA A;  2MX2 A;  4ZDV A;  2L8J A;  4NAW A;  2AL3 A;  4IWO A;  4NPN A;  1P98 A;  2ZCC A;  2VRR B;  1SGH A;  2BPS A;  2IO3 B;  2KDF B;  1IP9 A;  2O2V A;  2MCN B;  2GOW A;  3X0W A;  4BVU C;  3DQV A;  3ZNI D;  1UBQ A;  1OQY A;  4WWN A;  2DX5 B;  4KSK C;  3R7Q A;  1E8W A;  2J0J A;  1R4N I;  1RAX A;  2Y5B B;  4PS7 A;  3QAQ A;  4W9I A;  3L16 A;  1OGW A;  3V6C B;  4FJV B;  1MG8 A;  3DBS A;  3ZRF A;  2C7N B;  5CHW A;  1UH6 A;  2KMA A;  3AUL A;  4FA6 A;  2J7Q B;  4DHZ E;  4NAW B;  3HK0 A;  2PEA A;  1IPG A;  3W1S C;  4ANV A;  2RR9 A;  3V6E B;  4NNJ B;  3CST A;  3ZKJ C;  4ASW C;  2LWP A;  4NQL B;  4MGI E;  4G50 A;  2KJH B;  2LRW A;  4M8N A;  4F1S A;  2RPQ A;  4G3X B;  3A1Q B;  3CF6 E;  3OLM D;  3A4S C;  3L17 A;  3A9J B;  3RCZ A;  3NY5 A;  2KKC A;  4P7I A;  3H1U A;  4CYE A;  4LDT B;  4DDI D;  1I35 A;  1WGY A;  5D6J B;  1U4A A;  4GMV A;  2J0M A;  4GDK B;  1EF1 A;  1TGZ B;  4IG7 B;  1P0R A;  3PV1 A;  1UGM A;  4MGY E;  3SD5 A;  5J17 A;  4HCN B;  1R4M I;  5IA7 A;  3DVN U;  1WM3 A;  1WJ6 A;  3U7D A;  2EMS A;  2MBB B;  2BYV E;  2CHZ A;  2WWZ A;  4MEM A;  3VH4 B;  3W1S A;  1ZGU B;  2ZZP B;  3VFK A;  3ZTD A;  3W1Y A;  3B0A A;  2A5U A;  3B08 A;  4X57 B;  3ZNH B;  3QJZ A;  4RM8 A;  3UF8 A;  4E3C A;  1GNU A;  1UZX B;  1F9J A;  2IY1 B;  1WR6 E;  2FCM A;  5IAA C;  1WF9 A;  1RFA A;  3RD2 A;  4NY0 A;  3N30 A;  3SDL C;  1YIW A;  2KFK A;  4ZRI A;  1WXS A;  5JZE B;  3WAN A;  1K8R B;  5BO4 B;  4HXD A;  4IW0 A;  4NJ7 A;  4URK A;  4B9K A;  2KO3 A;  1TTN A;  3DVG X;  4FHJ A;  3U30 A;  2JPH A;  1YD8 U;  3ZTC A;  2OJR A;  4EFO A;  2RSU A;  4CHK A;  4DBG A;  3TMP B;  1J8C A;  4GU2 A;  2KX0 A;  4EZL A;  3APF A;  2K6D B;  4EUT A;  1EF5 A;  1XQQ A;  2KQS A;  5G55 A;  2RD0 A;  2WYQ A;  1T0Y A;  2KC2 A;  4WQO B;  5CHF A;  1V5T A;  3PT2 B;  2KN5 A;  3L10 B;  3A9K B;  2LD9 A;  1WJN A;  3ZNZ B;  3PPA A;  4IM0 A;  2LVQ A;  2KFK B;  1E5W A;  1GC7 A;  2DZJ A;  1HE8 A;  2LRU A;  1XT9 B;  3IHP C;  3PRM B;  4HPM B;  2ZCB A;  2ZPN A;  2NPT B;  2KTF A;  4MJS B;  5AZH A;  4A3P A;  4ANW A;  2IY0 B;  4FHK A;  1WZ0 A;  3UQB A;  2D10 A;  4G11 A;  3QA8 A;  2YVC A;  2V4L A;  3KYC D;  2N1V A;  4BFR A;  2DZM A;  2PE9 A;  2WX0 A;  3RZF A;  4EZJ A;  1WY8 A;  2IO1 B;  3DOW A;  3LJ3 A;  3QC8 B;  2UYZ B;  3QAR A;  2IO0 B;  2KDI A;  4K1R B;  1S1Q B;  1V6E A;  2D11 A;  2CHX A;  4LCD E;  2D07 B;  2FCS A;  4FJY A;  4MSQ B;  3R3M A;  4PS3 A;  2MBE A;  2GMI C;  2KFJ A;  2BKF A;  4W9J A;  4DXA B;  1M94 A;  2M1M A;  3HM3 A;  1GC6 A;  3NOB A;  1YX6 B;  2N9P C;  3V61 A;  1H4R A;  3H7P B;  2AWT A;  4BKS A;  1NI2 A;  2KWU B;  4DHJ B;  2DYO A;  2IZV B;  2R2O A;  5KHQ A;  2V1Y A;  2M4N A;  1TBE A;  5J2R A;  2JY6 A;  2MBH A;  1ISN A;  2K8B A;  3M63 B;  1E8X A;  3PSE B;  1AAR A;  4II2 B;  3VQI A;  5D2M B;  1GJZ A;  2HE7 A;  3IBE A;  4AP4 C;  4EZK A;  1H8C A;  3VDZ A;  3JSV A;  3ZDT A;  4ANU A;  3RT3 B;  5HKH A;  4GB9 A;  3VHT C;  2FIF A;  2MP2 B;  3P2B A;  1L2N A;  1S3S G;  2KHW B;  1VCB A;  3A1Q A;  1Y8R C;  4TQ1 A;  3A9J A;  2KX3 A;  3EFU A;  4FLH A;  2KQ7 A;  4OVV A;  1WM2 A;  2WX1 A;  3VAW A;  1ZKH A;  3D32 A;  4FJZ A;  4GDK A;  4TV3 A;  2NBU A;  2KJ6 A;  3PS6 A;  3MJW A;  2L05 A;  4DWF A;  4GGQ A;  2DYB A;  5LLI A;  3PZD A;  3K9P B;  1WH3 A;  3WAM A;  4DDG D;  1FXT B;  2L76 A;  1V49 A;  2I1J A;  4G0N B;  4PYU A;  4ANX A;  3JSV B;  5AZF A;  4M0W B;  2LGY A;  2CKH B; 
#chains in the Genus database with same CATH topology
 2QDF A;  3S2A A;  4HRO A;  1AN8 A;  5G5H A;  3Q3N C;  1ZP0 B;  4HWI B;  5IO9 A;  1A5R A;  1LM8 B;  4DXF A;  1WXV A;  2NR2 A;  2LVP A;  4PYZ A;  1WRD B;  3UIP B;  1C77 A;  1SXT A;  3AE3 B;  3N1Y C;  3KWL A;  4KKI A;  3DPD A;  1E7V A;  3Q3J A;  4II3 B;  3C0R B;  1I42 A;  5LXH A;  1NBF C;  3A9K A;  1CMX B;  2KWV B;  1XLN A;  3ZDM C;  4MJS A;  2K5P A;  3JW0 X;  2N4F A;  3QX1 A;  1WYG A;  5CHV C;  4AWJ A;  4XC2 A;  3AU4 A;  1JWB D;  1VZ7 A;  1ENF A;  2D3C A;  2Z0D B;  5JHB A;  4HJK A;  4DHZ B;  2JRH A;  4GIV A;  2N1W A;  3AM9 A;  4RF1 A;  3GP7 A;  5DCN A;  5IN7 A;  2WU5 B;  1FXI A;  1B9R A;  4XGA B;  1D5Z C;  2D3A A;  3RFZ B;  2ZW0 A;  4JGH B;  3BY4 B;  5TSS A;  3R2T A;  2DHZ A;  2K1F A;  1N5W A;  1R7S A;  4NJC A;  2CHW A;  4IWP A;  1V1P A;  1OQQ A;  2E3T A;  1OEY J;  3FIL B;  2V3P A;  2WXJ A;  3CSF A;  3P63 A;  4IM3 A;  2BVC A;  3Q3M C;  1Y56 A;  3AED B;  2QC8 A;  2J4X A;  2ZJD A;  4W9L A;  3BVZ A;  1L0Y B;  4IUM B;  3BIN A;  2KJR A;  1TKG A;  3P42 A;  2O6V A;  2V0G A;  3HM6 X;  4LJP B;  3TL5 A;  5D3D A;  1XD3 B;  3P4S B;  4W9E A;  2FCN A;  4BKT A;  1M4V A;  4TKN A;  2L0F A;  3RNG C;  4FUL A;  1E90 A;  1G6J A;  1V80 A;  1KM7 A;  3N1Z C;  4WJN A;  1E7P B;  1WX7 A;  3R66 C;  2A4Z A;  5LNK 1;  4OVZ A;  4DHJ D;  3ZRC A;  3VUW A;  4EOY A;  1V97 A;  3DVN V;  1YJJ A;  2GBM A;  2V4I B;  2ZNV C;  5CX3 A;  1FCC C;  3C8Y A;  5EDS A;  1L4D B;  1YQB A;  2DNF A;  2KMM A;  2GBJ A;  2GBR A;  1ZDV A;  4K7W A;  3ZGZ A;  1SE3 A;  1I4Q A;  4BKS D;  1Z5S B;  2HDE A;  3DBR I;  2BYF A;  3NZU A;  2VH1 A;  2GBK A;  2ZEQ A;  3PLV A;  2D3G A;  1VDV A;  1PFD A;  4L23 A;  4CO7 A;  1FNV A;  5KHO A;  1VZ6 A;  2CS4 A;  1RRB A;  2JU6 X;  5HG2 A;  2Y3A A;  2LXC A;  1ZXI A;  4N58 A;  2DZI A;  2KTR B;  2WLB A;  1SE9 A;  3UIN B;  2KAC A;  1EU4 A;  2J52 A;  1D5X C;  3NVV A;  2N7E A;  3ZJV A;  3RNB C;  4RGN A;  1VRA B;  1JWS D;  3SFD B;  1UEL A;  2FAZ A;  5TR5 A;  4OZB A;  3RNA C;  3MHS D;  1XF5 L;  2JYE A;  1WX8 A;  2HTH A;  4BOS C;  2R61 A;  5H92 C;  4YSZ B;  1C9F A;  3HIZ A;  1FO4 A;  4HDO A;  5GMV A;  2PKO A;  1MPE A;  4IDI A;  1WR1 A;  3VH3 B;  5LXI B;  3B1L X;  2N9L A;  1F0Z A;  3U7Z A;  3NHE B;  1WYW B;  4C00 A;  4HJG E;  4PS8 A;  3EA6 A;  2M0A A;  2K8C A;  1V2Y A;  1KLU D;  2KXJ A;  4C7Z A;  1WE7 A;  4MGZ E;  2BGF A;  1KOT A;  1PGA A;  3RUI B;  2BS4 B;  2C7H A;  3ZW3 A;  4E71 A;  4N9F 4;  2MBO A;  3BVM A;  4NAM A;  3AE4 B;  2L8J A;  3BII D;  3CWI A;  5BYQ A;  5H8Y E;  2O2V A;  2MCN B;  2GOW A;  2GI9 A;  3T3N A;  1UBQ A;  2SEB D;  4US8 A;  1E8W A;  3UI3 A;  1NYR A;  2CJO A;  3QAQ A;  3L16 A;  1OGW A;  2J7Q B;  1L6U A;  1OFF A;  4ZRQ A;  3W1S C;  1XXG A;  2IPK D;  3E9S A;  3LXF A;  4RFB A;  4NQL B;  1QF6 A;  1I7H A;  1P7E A;  2GRI A;  3CF6 E;  3NY5 A;  3H1U A;  5D6J B;  4GMV A;  4B0M A;  2Y5P A;  3HUI A;  3SD5 A;  1R4M I;  5IA7 A;  4BZA A;  2EMS A;  2W82 A;  5FKA C;  3W1Y A;  4M00 A;  3B0A A;  3AEC B;  4RM8 A;  2D5G A;  5IAA C;  1WR6 E;  2FE8 A;  4HEA 1;  3RD2 A;  2IJ0 A;  2OED A;  3SDL C;  3WAN A;  1K8R B;  4IW0 A;  4NJ7 A;  4URK A;  1I4G A;  4YTM B;  1TKE A;  4ZHP A;  1PGB A;  2RSU A;  3TMP B;  1J8C A;  3APF A;  4EUT A;  1EF5 A;  4MAC A;  2EKI A;  2KC2 A;  1FD6 A;  2QIL A;  1FM0 D;  1JWA D;  4IKG A;  3A9K B;  4YT0 B;  1PYW D;  3H8H A;  4GLS C;  2N7J A;  1E5W A;  2AQ2 B;  1WRI A;  4MJS B;  2ZCB A;  3EUB 2;  5AZH A;  1XLO A;  1WZ0 A;  3UQB A;  4HKZ E;  4M01 A;  3KYC D;  2N1V A;  4WH4 A;  2WX0 A;  3RZF A;  3LJ3 A;  2IO0 B;  2D11 A;  2CHX A;  2D07 B;  4ARI A;  4P1B C;  2BTE A;  2I38 A;  3GE8 C;  2LHE A;  4JX1 C;  3AEE B;  4YSX B;  4BKS A;  1NI2 A;  2IZV B;  2R2O A;  1KF6 B;  2V1Y A;  4JWS C;  1V1P B;  2JXT A;  4LNF A;  3M63 B;  3Q14 C;  3BK2 A;  5D2M B;  2WXO A;  3Q3O C;  1Y8R C;  4FLH A;  4OVV A;  2HTM E;  5G5G A;  1SB3 C;  4GDK A;  2INC C;  2DYB A;  3N9Y C;  2L76 A;  1V49 A;  4PYU A;  4HRS A;  3DHH C;  2LGY A;  1PQS A;  2N7D A;  2CKH B;  1C4A A;  4IWQ A;  3H9D A;  4UDU C;  4ZHO A;  2W54 A;  3MC0 B;  4GSW A;  1MHH E;  1YNT E;  5FR6 A;  2NBW B;  1SIJ A;  2CR5 A;  1FXA A;  2Z0E B;  1D6E C;  1LFD A;  3JVZ X;  4IM2 A;  2WU2 B;  5GXG B;  1CK1 A;  4O1N A;  3KW5 B;  1V86 A;  1ZE3 D;  2O6V D;  3NS8 A;  4KIK B;  2BYT A;  3ML8 A;  2JQR B;  3TUO A;  4YL8 A;  1IGC A;  4JWU C;  4XDC A;  4R3D A;  1V9J A;  2CU3 A;  4LNI A;  1BXT A;  2C5L C;  3DBL I;  3EHV A;  3L08 A;  3RI7 C;  4NJ6 A;  4WJO A;  1WGD A;  4NQK E;  4I6P A;  3OAW A;  2LAS A;  4I6L B;  1EM7 A;  1GOZ A;  3PLU A;  4K3B A;  4MH8 A;  3WAP A;  2ZPY A;  2YLM A;  1FRD A;  2AX5 A;  4E74 A;  4EE2 A;  3AXC A;  1SJH D;  3MFG A;  1TIF A;  2EEL A;  3BK1 A;  1UGJ A;  1AYF A;  1E7U A;  5DPS A;  3W9C B;  3IT4 B;  2WXI A;  5E6P A;  4W9F A;  2PMV A;  3K9O B;  1GAQ B;  4WAF A;  2GLS A;  1J19 A;  1XCQ L;  3IAM 1;  3I3T B;  4XWW A;  5FK9 C;  2KWC A;  1STE A;  5E6N A;  4KVG B;  1QQR A;  2MH7 A;  4AJW A;  3VR8 B;  4F7Z A;  3Q69 A;  4HK2 A;  4A6Q A;  1K52 A;  4C56 C;  2LGX A;  1KLG D;  2DEN B;  3DWM A;  5DPW A;  3LB8 C;  3AH7 A;  2Z59 B;  4KZ0 A;  3ZIM A;  3PHX B;  2C9W B;  2J42 A;  3R7R A;  3A4R A;  5BYR A;  1N6Z A;  1Q1O A;  1K51 A;  2PPH A;  2N9K A;  3MC8 A;  2WS3 B;  2DAF A;  1EU3 A;  2RPV A;  4JQW C;  4WUR A;  2WXH A;  2EMT A;  3E56 A;  2AQ3 B;  3VXW A;  4RCO A;  3APC A;  2Z8L A;  3HVD A;  5HI1 A;  3GZN I;  1JML A;  1ZDX A;  2M8S A;  3PGE A;  3ZLZ A;  4K7S A;  1QOG A;  1KJT A;  1MFW A;  3NJT A;  1UUP A;  1F52 A;  1Z2M A;  4S17 A;  2QEJ C;  3V60 A;  3AE7 B;  4C80 A;  3I5J C;  5T8I A;  1IYF A;  2L0T A;  1N63 A;  3UGB B;  2O2V B;  3DBR B;  2WXQ A;  2HJ1 A;  4K81 A;  4B95 A;  2JVC A;  2WXG A;  3KH0 A;  4KDI C;  4KV2 A;  5D3I B;  2XN9 C;  1ACC A;  1C76 A;  3X23 A;  2MA9 B;  3BWU D;  1XLP A;  2BS2 B;  3RNF C;  4WIP A;  1QZE A;  1E8Y A;  3TJP A;  1XCT L;  2LVO A;  3J9C A;  1V8C A;  2L52 A;  1B1Z A;  2XK5 B;  4W9C A;  4F8C B;  1KTK A;  1JCK B;  1TZ1 A;  3IXS A;  1RYJ A;  3N1X C;  1RFK A;  1TKY A;  4XWT A;  1P3Q U;  4FN2 A;  4RMA A;  4IC7 B;  3I57 A;  1WGK A;  4ZRJ A;  1WX9 A;  1OEY A;  2JT4 B;  1WJ4 A;  1C4C A;  2BB5 A;  3APD A;  3P1M A;  2NBV B;  3NRZ A;  2IDY A;  2BYE A;  3DDC B;  2KZR A;  2INP E;  1YJ1 A;  2KNB A;  2ZW1 A;  2BWE S;  3Q8C A;  4MDK E;  3PTF C;  2LGD A;  2PVG C;  2X8X X;  2MW5 A;  2WXF A;  3ALB A;  4HCP B;  1EUV B;  1YX5 B;  4MH0 E;  3NUH B;  1T5X D;  1ET6 A;  4W9G A;  1WMH A;  1UF0 A;  2K25 A;  1WXM A;  2DYM A;  2LUM A;  3TBL D;  2WDR B;  2G45 B;  3MTN B;  3VTV A;  2KOX A;  2MLB A;  1J0G A;  2JRI B;  1SEB D;  2AYO B;  1Q10 A;  2RDB C;  3WA0 A;  5EE0 A;  2ON8 A;  4NAW A;  4NPN A;  3O13 A;  2VRR B;  2BPS A;  2KDF B;  5BMI A;  4N59 A;  3R8B A;  3X0W A;  2JYT A;  1OQY A;  1R4N I;  4W9I A;  3V6C B;  1MG8 A;  1QLB B;  3ZRF A;  1WSP A;  1UH6 A;  2KMA A;  3HK0 A;  4REZ A;  4C4V A;  3CST A;  1UWM A;  4MGI E;  2LRW A;  3ABV B;  4OZA A;  1R4M B;  4LNN A;  4LDT B;  2WDV B;  2J0M A;  4GDK B;  1SSN A;  4BAX A;  1E9M A;  1P0R A;  2OJW A;  2NTT A;  3FC4 A;  3PZ8 A;  1UWX A;  1WM3 A;  1K50 A;  2KN4 A;  2MBB B;  2BYV E;  3Q8B A;  1T6B X;  3ZTD A;  1T0R C;  1FFV A;  1WF9 A;  1RFA A;  2M19 A;  4S0R A;  4LLG M;  1YIW A;  2KFK A;  4YSY B;  5BO4 B;  2MJE A;  3U30 A;  2KX0 A;  1DGJ A;  2K6D B;  1XQQ A;  1TY0 A;  1WXQ A;  2KQS A;  3KQ4 A;  2RD0 A;  5CHF A;  1PDX A;  2JWU A;  1V5T A;  3PT2 B;  2KN5 A;  1F1H A;  3PPA A;  4IM0 A;  2VH2 A;  2DZJ A;  2LRU A;  3IHP C;  3U52 E;  2ZPN A;  4A3P A;  1SE2 A;  4G11 A;  2K22 A;  1YJI A;  2QIE B;  2PE9 A;  3BZD B;  1FPY A;  3QC8 B;  3U4E G;  2SAK A;  2G1E A;  4USA A;  3NS1 A;  3R3M A;  2MBE A;  1WWT A;  2KFJ A;  2BKF A;  2M1M A;  1GC6 A;  1IUE A;  1H4R A;  2AWT A;  1GB1 A;  1NEK B;  2KWU B;  1ZXH A;  5J2R A;  2MBH A;  3DHG C;  3IAS 1;  1BUI C;  3AE1 B;  4EZK A;  5BYS A;  5HKH A;  1H8C A;  3AE2 B;  1EWY C;  1L2N A;  1VCB A;  1VZ8 A;  1KFY B;  4P16 A;  3RNE C;  2KDM A;  4TV3 A;  3U2S C;  1YN4 A;  5LLI A;  3K9P B;  1WH3 A;  3WAM A;  1FXT B;  3JSV B;  4M0W B;  3OWE B;  1Q0W B;  3T3O A;  4WJP A;  2IGD A;  4HPL B;  1F77 A;  2NMQ A;  2XBB C;  4YWG G;  2QCZ A;  3L54 A;  2QHO A;  4LNO A;  4ZYS A;  3PVL A;  1KLV A;  3AN1 A;  3WAL A;  2G4S A;  2W55 A;  3ETR A;  2WXN A;  2PJH A;  3MP9 A;  3RZW C;  3DBL B;  2KAN A;  2NS5 A;  2ONQ A;  4JIO U;  3UQA A;  4MEL A;  2KAJ A;  1XEE A;  3WIM A;  2MSE D;  1YQ4 B;  2FNJ B;  3I63 C;  5L83 A;  2N9X A;  3N32 A;  2E6X A;  1YOV B;  1L4Z B;  5AUI A;  5D94 A;  2XEW A;  4WJQ A;  2WXR A;  3Q6B A;  1D4B A;  4M8M A;  2PLP A;  2G3Q B;  2PTL A;  2WXM A;  2QSD A;  3B9J A;  1WGG A;  4FAD A;  4TUU A;  1LQB A;  2JUO A;  4MM3 A;  4JL9 A;  1T0S C;  3PZ7 A;  2LGS A;  4OW0 A;  2MWS B;  2KD0 A;  2L3Z A;  5C1Z A;  5DPR A;  3W2D A;  3M62 B;  1AW7 A;  4KGS A;  4HDQ A;  2YEP B;  1SIF A;  2KT7 A;  3IG3 A;  3HVZ A;  4HKQ A;  2XNA C;  3NVY A;  2K39 A;  4ICU A;  3FAH A;  4A90 A;  3KUC B;  2DAJ A;  1DOX A;  5AUK A;  4HVB A;  3ZJU A;  2FID A;  3ZUN A;  5MPO A;  1DOY A;  1YN3 A;  3Q3F A;  2LXA A;  3KLS X;  1ZPS A;  4MT5 A;  3ZVV A;  3DWG C;  3ZO5 B;  3NG0 A;  4A20 A;  3GZN B;  2W3R A;  1WMH B;  2KVZ A;  2MQJ A;  3KUZ A;  4L2Y A;  2MJ3 A;  1SBB B;  3VRB B;  1N5X A;  2JZP A;  2O6V B;  5IKC M;  4H2A A;  2BQQ A;  3RPF C;  1QIL A;  1NDD A;  2HJ8 A;  4EKU A;  4RF0 A;  2L00 B;  1N60 A;  3PRZ A;  3AE6 B;  5JHA A;  4XX5 A;  1NEN B;  1P9D U;  4GDL A;  2K8H A;  2ASQ A;  2W3S A;  3AI5 A;  2V3S A;  2KMC A;  4WQM A;  4IOI E;  1FNW A;  3SHQ A;  1UD7 A;  2MBQ A;  3T8M A;  2WDQ B;  4YXD B;  4B6W A;  1MVK A;  3ZXV A;  5CTR C;  2FCQ A;  2ACZ B;  2RMM A;  3V62 A;  2LI5 A;  3RNC C;  4A8X C;  3WAO A;  2C7M B;  3EEC A;  2NVU I;  2KTR A;  3AV8 A;  1TS2 A;  3MC9 A;  2R2Q A;  3QQ8 B;  2KDB A;  3SU8 X;  4OVU A;  4BKG A;  5J18 A;  4C4V B;  3VUY A;  2LJ5 A;  5E6O A;  2MRP A;  3RYT A;  2JWZ A;  5DPT A;  4ICV A;  1SF0 A;  2BB6 A;  3QHT A;  4MSM B;  5AEK B;  2JX5 A;  2VZK D;  3PRP B;  4GN1 A;  4YTP B;  4Q2J A;  3CIR B;  3IFW B;  5BMH A;  1GB4 A;  4EEW A;  4ARC A;  1V5O A;  3TIX A;  2KC1 A;  1ZOY B;  3VVW B;  1ZW7 A;  1A70 A;  1I4P A;  1D3Z A;  2I2Y A;  2G9H D;  1WZ3 A;  1JRO A;  3VTU A;  3AE9 B;  2KLC A;  2IBI B;  2V9H A;  3KUD B;  1C3T A;  5C3J B;  1I4X A;  2G4D B;  1V81 A;  1UBI A;  4B0E A;  2L1A A;  1RLF A;  3WCQ A;  3ECI A;  3O65 B;  2WQY B;  3GOE A;  3HHM A;  1JRU A;  3T9L A;  5C23 A;  1DOI A;  4WWP A;  1I4R A;  1VJK A;  4BOZ B;  1TT5 B;  2IGH A;  1VD2 A;  2M0X A;  3CMM B;  2AEH A;  3N3K B;  4KSL C;  2DWQ A;  3URY A;  4DK5 A;  3B2F A;  2D2Q A;  1JWU D;  4WAA A;  1HZ5 A;  1F2R I;  4LNK A;  4ZDV A;  4IWO A;  1IBX A;  5E6J A;  1R4N B;  2K3U A;  3R2I A;  3ZNI D;  3Q8A A;  1L0V B;  3R7Q A;  1RAX A;  1TJE A;  4PS7 A;  1FNU A;  2BBC A;  2N0S B;  4DHZ E;  2DBY A;  2BS3 B;  1IPG A;  4ASW C;  2JSV X;  1HXY D;  2LWP A;  2INN E;  4RH6 A;  1C79 A;  4G50 A;  2KJH B;  4F1S A;  2RPQ A;  4G3X B;  4JE3 B;  3RCZ A;  2KKC A;  4P7I A;  4DDI D;  1U4A A;  3AEF B;  3SFE B;  4ITK A;  1UGM A;  1TYG B;  4NZL B;  2KQ4 X;  4US9 A;  3U7D A;  2BT6 A;  3VH4 B;  2WWZ A;  1N61 A;  3W1S A;  3B08 A;  3ZNH B;  4E3C A;  3UF8 A;  1F9J A;  3RMK C;  4NY0 A;  1NI3 A;  3N30 A;  5JZE B;  1TTN A;  3DVG X;  3ZTC A;  4EFO A;  4AS1 A;  2OJR A;  4DBG A;  4GU2 A;  3RN9 C;  4WQO B;  1T3Q A;  1T0Y A;  3HRD D;  2MJD A;  2PIA A;  4OZC A;  4QAY A;  2LVQ A;  3PRM B;  1GC7 A;  2L83 A;  4HPM B;  4ANW A;  4FHK A;  1PUT A;  2D10 A;  2YVC A;  4BFR A;  1DYQ A;  2J53 A;  1WY8 A;  2IO1 B;  3I9V 1;  2DLB A;  2UYZ B;  3QAR A;  2V3N A;  4FJY A;  4WWM A;  3DBH B;  4MSQ B;  3TEW A;  4PS3 A;  4HPP A;  1MJD A;  1E0Z A;  2GMI C;  4J3O D;  2IND C;  3HM3 A;  3NOB A;  2N9P C;  3V61 A;  4MM3 B;  2ICI A;  2KWD A;  1BML C;  4AQ7 A;  4DHJ B;  2TSS A;  2FUG 1;  2LMC A;  1TZO A;  1E8X A;  3PSE B;  1RWS A;  4II2 B;  3ZQ4 A;  4PT5 A;  3AE5 B;  3ZDT A;  4ANU A;  3RT3 B;  4GB9 A;  3VHT C;  4ACF A;  1QOB A;  1S3S G;  2KHW B;  3A1Q A;  4TQ1 A;  3A9J A;  2KX3 A;  2KQ7 A;  3VAW A;  2WX1 A;  3W5V B;  2PVO D;  3VRA B;  4FJZ A;  2WXK A;  2NBU A;  1LO5 D;  3MJW A;  2RDH A;  1YMH E;  2PW9 A;  2I1J A;  4G0N B;  3P4Q B;  4ANX A;  2AQ1 B;  2LFI A;  4KIK A;  2RDG A;  2QJL A;  5JH5 C;  2KDE B;  2GBN A;  1OQR A;  3QWZ B;  4ZRK A;  2JF5 A;  2OOB B;  4K7U A;  4KKJ A;  1CJE A;  1P1A A;  3Q8F A;  1MI0 A;  4XZ4 A;  1QT9 A;  4KGR A;  2WP9 B;  2CU1 A;  1E8Z A;  2H88 B;  2HD5 B;  1JRP A;  2REX A;  1PGX A;  3EC8 A;  3AU5 A;  4GDL B;  3QCA A;  1EWC A;  2WXP A;  4W9K A;  2NPT A;  3TCA A;  3V3X A;  2LUE A;  1D5M C;  2JXX A;  3PO0 A;  4LJO B;  1HZ6 A;  4XYC A;  3QIJ A;  3AMZ A;  1LXD A;  5D7G A;  3V05 A;  2BWF A;  3L0W B;  1JQ4 A;  2LJI A;  1FEH A;  2UWQ A;  2C60 A;  3ZJT A;  4BBN C;  1KH0 A;  3TSS A;  1N62 A;  1WIA A;  2BW2 A;  2L7R A;  1WE6 A;  4AUQ C;  2B3A A;  1NVI D;  3C19 A;  2ZNV B;  4LDT D;  1TS5 A;  1EO6 A;  2BKR B;  3TEX A;  4TSS A;  2M56 B;  3H7P A;  2J0K A;  1C1Y B;  2FUH B;  1J7C A;  4RGM A;  3JYU A;  1MG4 A;  2LHD A;  4C7Y A;  1V1O A;  2IYD B;  3TEY A;  5L95 C;  3W5U B;  1WGR A;  3DBH I;  4LTU A;  1NYQ A;  4A9A A;  4AJY B;  2MP2 A;  3L13 A;  3A33 B;  1L6V A;  3IT6 B;  1KRH A;  1FFU A;  2LZ6 A;  4ZYN A;  2QMT A;  3OJ4 B;  2W9N A;  1FRR A;  4JLC A;  5EE1 A;  4YTN B;  5HFY A;  4GOC A;  1VR9 A;  1ZUD 2;  2ZVO A;  1LGR A;  3PHW B;  2MHJ A;  1C4P A;  4JPS A;  4W9D A;  3H7S A;  3FKY A;  3QK0 A;  4ZRP A;  3GB1 A;  1ET9 A;  2WDT B;  4K3C A;  5JXV A;  4HLE A;  2ZVN A;  3M95 A;  4A3O A;  2K6Q A;  3MHZ A;  2KVR A;  3EFC A;  3UIO B;  4L1B A;  2X38 A;  4XE0 A;  4BBN F;  1GG3 A;  3NZS A;  3ZXR A;  1IBX B;  4D2K A;  4N6E B;  1K53 A;  1YQ3 B;  1OTR B;  2I1K A;  3KWV A;  2JZ3 B;  4KGT A;  1TS3 A;  4TQ0 A;  2PE6 B;  1GPX A;  2AL6 A;  1WI0 A;  2XK5 A;  2JZZ A;  2CJN A;  2OHF A;  1QOA A;  1ESF A;  3IVF A;  1BT0 A;  4KZC A;  4A55 A;  4KX6 B;  1Q5W B;  3ML9 A;  1GUA B;  3OJ3 A;  2WNM A;  2H89 B;  3GS2 A;  1WGH A;  4MGK E;  3AEA B;  3NVW A;  2BF8 B;  3ZNG C;  5I4D A;  3LDZ E;  3FIL A;  3AEG B;  1FIQ A;  3PRE A;  2RGF A;  1JWM D;  3DHI C;  4PK1 A;  3Q2A C;  4AOF A;  3ONS A;  1J7A A;  5G2N A;  1F2R C;  3NZ3 A;  4FBJ B;  2KK8 A;  3BYY B;  4RNA A;  3H6N A;  1X1M A;  4WWO A;  1QOF A;  4KDL B;  4J6I A;  1J7B A;  4RM9 A;  4GXB A;  1P7F A;  2WGS A;  5EE9 A;  4W9H A;  4FXC A;  3OG5 A;  2IO2 B;  3M3J A;  5AZG A;  3RUL A;  1IGD A;  2NCN A;  3DCG A;  1E10 A;  3BVG A;  3KYD D;  3ENE A;  4I6N B;  1WJU A;  2B76 B;  2EKE C;  2KLG A;  1L7Y A;  1WFY A;  4CQN A;  1TY2 A;  3U8Z A;  2DZK A;  3N20 C;  2N9E B;  1HEZ E;  2MEK A;  1XLQ A;  1L5P A;  3VUX A;  3SEB A;  3L4P A;  2FBW B;  4XDD A;  1WXA A;  3KVF B;  3SR6 A;  4DQO C;  3VTW A;  3DVG Y;  1T0Q C;  2D3B A;  2M17 A;  2MX2 A;  2AL3 A;  1P98 A;  2YEP F;  2ZCC A;  3P4R B;  1SGH A;  2IO3 B;  1IP9 A;  2Y5C A;  4BVU C;  3DQV A;  3AE8 B;  4WWN A;  2DX5 B;  4KSK C;  2J0J A;  1AWD A;  2Y5B B;  4FJV B;  1HTO A;  3DBS A;  3Q8E A;  2C7N B;  5CHW A;  3AUL A;  4FA6 A;  4NAW B;  1JAL A;  2IGG A;  2PEA A;  4ANV A;  2RR9 A;  4RGT A;  3V6E B;  4NNJ B;  3ZKJ C;  2VZK B;  4M8N A;  4TMA B;  1TS4 A;  3A1Q B;  1VLB A;  3OLM D;  3A4S C;  3L17 A;  3A9J B;  4DXG A;  1HA5 A;  4OHJ A;  1L0X B;  4CYE A;  3NVZ A;  1I35 A;  1WGY A;  5HHD G;  3AEB B;  1EF1 A;  1TGZ B;  4IG7 B;  4MGY E;  3PV1 A;  5J17 A;  4HCN B;  1FMA D;  3DVN U;  1WJ6 A;  4LK0 M;  3GE3 C;  5IP4 D;  2CHZ A;  4MEM A;  1ZGU B;  2ZZP B;  3VFK A;  2A5U A;  4X57 B;  3QJZ A;  2K0P A;  1GNU A;  1UZX B;  2IY1 B;  2FCM A;  1HQR D;  4ZRI A;  1WXS A;  2GB1 A;  4HXD A;  3BYT B;  1SE4 A;  4B9K A;  2KO3 A;  5IOI A;  4FHJ A;  2JPH A;  1YD8 U;  1UNS A;  1CQV A;  4CHK A;  2NTS A;  4EZL A;  2Q5W D;  5BMG A;  5G55 A;  1HTQ A;  2WYQ A;  1C78 A;  1RM6 C;  3L10 B;  2LD9 A;  1WJN A;  3ZNZ B;  1YN5 A;  2KFK B;  1HE8 A;  1XT9 B;  2NPT B;  2KTF A;  2IY0 B;  3VR9 B;  1JW9 D;  3QA8 A;  1CZP A;  2V4L A;  2LGI A;  4ZOH C;  2DZM A;  4EZJ A;  3DOW A;  2KDI A;  4K1R B;  1S1Q B;  1V6E A;  4P6V F;  4LCD E;  2FCS A;  5FR3 A;  2WHI A;  4W9J A;  4DXA B;  1I4H A;  1M94 A;  1QKZ A;  3AB5 A;  3B2G A;  1YX6 B;  3H7P B;  3LYY A;  3MJ5 A;  2K9X A;  1ROE A;  3EGR A;  2WXL A;  2DYO A;  5KHQ A;  4RGO S;  2M4N A;  2UU7 A;  1TBE A;  1XO3 A;  4M02 A;  2JY6 A;  1ISN A;  2K8B A;  1E6E B;  2KYW A;  1FCL A;  1AAR A;  3VQI A;  1GJZ A;  2HE7 A;  3IBE A;  4AP4 C;  3VDZ A;  3JSV A;  4P1C C;  2LEK A;  2FIF A;  2MP2 B;  4M0W A;  1SJE D;  3P2B A;  3ZYY X;  5EE3 A;  1MHX A;  3EFU A;  2L32 A;  1WM2 A;  1ZKH A;  3D32 A;  2KJ6 A;  3PS6 A;  3P4P B;  2L05 A;  4DWF A;  4GGQ A;  3PZD A;  5C2T B;  4DDG D;  3TEZ A;  5AZF A; 
#chains in the Genus database with same CATH homology
 2N7D A;  4KIK A;  4IWQ A;  3H9D A;  3S2A A;  5JH5 C;  1Q0W B;  2KDE B;  2GBN A;  4GSW A;  4HWI B;  5FR6 A;  4WJP A;  3QWZ B;  1A5R A;  4ZRK A;  2JF5 A;  2OOB B;  4HPL B;  1LM8 B;  2NBW B;  4K7U A;  2XBB C;  1WXV A;  1P1A A;  2CR5 A;  2NR2 A;  2LVP A;  2Z0E B;  4PYZ A;  3L54 A;  1WRD B;  4IM2 A;  1LFD A;  2QHO A;  3JVZ X;  3UIP B;  3PVL A;  1KLV A;  4XZ4 A;  3WAL A;  2CU1 A;  3DPD A;  1E7V A;  2G4S A;  3Q3J A;  1E8Z A;  3KW5 B;  1V86 A;  2O6V D;  3NS8 A;  4KIK B;  2PJH A;  3RZW C;  4II3 B;  3C0R B;  2HD5 B;  1I42 A;  3ML8 A;  4YL8 A;  5LXH A;  1NBF C;  2REX A;  3A9K A;  3EC8 A;  3AU5 A;  2KAN A;  2NS5 A;  4GDL B;  3QCA A;  4JIO U;  1CMX B;  2KWV B;  1V9J A;  3ZDM C;  4MJS A;  2C5L C;  3UQA A;  4W9K A;  2NPT A;  3TCA A;  4MEL A;  2LUE A;  3DBL I;  2N4F A;  3JW0 X;  3QX1 A;  3EHV A;  2JXX A;  3L08 A;  4XC2 A;  3AU4 A;  5CHV C;  4AWJ A;  4LJO B;  4NJ6 A;  4WJO A;  2MSE D;  1WGD A;  3QIJ A;  1LXD A;  2FNJ B;  4NQK E;  5L83 A;  5D7G A;  2Z0D B;  4I6P A;  3OAW A;  5JHB A;  2N9X A;  4HJK A;  3N32 A;  2BWF A;  3L0W B;  4DHZ B;  2UWQ A;  2JRH A;  4GIV A;  2C60 A;  4BBN C;  2LAS A;  2N1W A;  4I6L B;  5D94 A;  1WIA A;  2L7R A;  2XEW A;  4WJQ A;  1WE6 A;  3PLU A;  2B3A A;  4AUQ C;  4M8M A;  2G3Q B;  5DCN A;  3WAP A;  2ZPY A;  1WGG A;  4FAD A;  2ZNV B;  2YLM A;  4LDT D;  4TUU A;  4E74 A;  1EO6 A;  1LQB A;  3AXC A;  2BKR B;  2JUO A;  4MM3 A;  3H7P A;  2J0K A;  4JGH B;  3BY4 B;  4JL9 A;  2DHZ A;  2K1F A;  2MWS B;  1C1Y B;  2KD0 A;  1E7U A;  2FUH B;  5DPS A;  3JYU A;  5E6P A;  4W9F A;  3K9O B;  2CHW A;  2L3Z A;  5C1Z A;  4IWP A;  5DPR A;  3M62 B;  1J19 A;  1OEY J;  4HDQ A;  2IYD B;  3I3T B;  1SIF A;  2KWC A;  3CSF A;  3IG3 A;  5L95 C;  1WGR A;  3DBH I;  5E6N A;  4KVG B;  4IM3 A;  4AJW A;  4AJY B;  2K39 A;  4F7Z A;  2MP2 A;  4ICU A;  2ZJD A;  4HK2 A;  3L13 A;  3A33 B;  4W9L A;  2LGX A;  2DEN B;  5DPW A;  4IUM B;  3KUC B;  3BIN A;  2DAJ A;  4HVB A;  2KJR A;  2LZ6 A;  4ZYN A;  2Z59 B;  2FID A;  4KZ0 A;  3OJ4 B;  3ZIM A;  3ZUN A;  2O6V A;  2W9N A;  3PHX B;  2C9W B;  4JLC A;  3HM6 X;  4LJP B;  3R7R A;  3TL5 A;  3A4R A;  3Q3F A;  2LXA A;  1Q1O A;  4GOC A;  3ZVV A;  1XD3 B;  2PPH A;  2ZVO A;  4W9E A;  3ZO5 B;  2FCN A;  4A20 A;  2DAF A;  3PHW B;  4BKT A;  4JQW C;  1WMH B;  4TKN A;  2L0F A;  2MQJ A;  3H7S A;  3KUZ A;  1E90 A;  4FUL A;  4W9D A;  1G6J A;  1V80 A;  1KM7 A;  2EMT A;  2O6V B;  3QK0 A;  3VXW A;  3APC A;  4WJN A;  3GZN I;  1NDD A;  1WX7 A;  2M8S A;  3R66 C;  2WDT B;  4HLE A;  2HJ8 A;  3PGE A;  2ZVN A;  3M95 A;  3ZLZ A;  4K7S A;  4A3O A;  1KJT A;  2K6Q A;  4EKU A;  2KVR A;  2L00 B;  3UIO B;  2A4Z A;  3PRZ A;  5JHA A;  4XX5 A;  4DHJ D;  1Z2M A;  3ZRC A;  1P9D U;  4GDL A;  3VUW A;  4EOY A;  3DVN V;  4BBN F;  2GBM A;  2ZNV C;  2K8H A;  5CX3 A;  2ASQ A;  3AI5 A;  3V60 A;  1GG3 A;  2V3S A;  2KMC A;  3NZS A;  5EDS A;  1YQB A;  2GBJ A;  2GBR A;  1IYF A;  3SHQ A;  4K7W A;  2L0T A;  1UD7 A;  2MBQ A;  2O2V B;  3UGB B;  4K81 A;  1OTR B;  2I1K A;  3T8M A;  4B95 A;  2JVC A;  2JZ3 B;  3KH0 A;  4KDI C;  4KV2 A;  4B6W A;  5CTR C;  2FCQ A;  4TQ0 A;  3V62 A;  4BKS D;  2LI5 A;  3X23 A;  1Z5S B;  2PE6 B;  2AL6 A;  1WI0 A;  2XK5 A;  3WAO A;  3DBR I;  2C7M B;  2BYF A;  2MA9 B;  3NZU A;  2JZZ A;  3EEC A;  2NVU I;  2KTR A;  2GBK A;  2ZEQ A;  2R2Q A;  3QQ8 B;  2KDB A;  3PLV A;  2D3G A;  3SU8 X;  4OVU A;  3IVF A;  4BKG A;  5J18 A;  3VUY A;  1BT0 A;  1E8Y A;  1QZE A;  2LJ5 A;  2MRP A;  5E6O A;  5KHO A;  3RYT A;  4CO7 A;  2JWZ A;  4KZC A;  2CS4 A;  1RRB A;  5DPT A;  3TJP A;  1Q5W B;  3ML9 A;  4ICV A;  1GUA B;  2LVO A;  3OJ3 A;  3QHT A;  2LXC A;  4MSM B;  5AEK B;  1WGH A;  3PRP B;  4GN1 A;  4MGK E;  2XK5 B;  2BF8 B;  3ZNG C;  2DZI A;  4W9C A;  4F8C B;  3LDZ E;  2KTR B;  1TZ1 A;  1SE9 A;  3IFW B;  3PRE A;  2RGF A;  3UIN B;  4EEW A;  1P3Q U;  4FN2 A;  4AOF A;  1V5O A;  3ONS A;  4RMA A;  4IC7 B;  5G2N A;  3TIX A;  4FBJ B;  2KK8 A;  2KC1 A;  1WX9 A;  1OEY A;  2JT4 B;  4ZRJ A;  1WJ4 A;  3VVW B;  3WIM A;  1ZW7 A;  2N7E A;  3H6N A;  1X1M A;  3APD A;  4WWO A;  2NBV B;  4KDL B;  4J6I A;  4RM9 A;  1D3Z A;  1UEL A;  2FAZ A;  2BYE A;  3DDC B;  4GXB A;  1WZ3 A;  3VTU A;  2KZR A;  2KLC A;  5TR5 A;  2IBI B;  3MHS D;  2KNB A;  1YJ1 A;  3KUD B;  4W9H A;  1C3T A;  2BWE S;  4MDK E;  2IO2 B;  3PTF C;  2LGD A;  3M3J A;  5AZG A;  1WX8 A;  2HTH A;  3RUL A;  4BOS C;  2MW5 A;  2G4D B;  1PQS A;  3ALB A;  1EUV B;  4HCP B;  2NCN A;  1YX5 B;  3DCG A;  1V81 A;  1UBI A;  3HIZ A;  3ENE A;  3KYD D;  4HDO A;  4I6N B;  5GMV A;  1WJU A;  4MH0 E;  1RLF A;  2EKE C;  2KLG A;  3ECI A;  1L7Y A;  1WFY A;  3O65 B;  3GOE A;  1WR1 A;  3HHM A;  1JRU A;  3VH3 B;  5LXI B;  3U8Z A;  2DZK A;  3B1L X;  4W9G A;  3T9L A;  2N9E B;  1WMH A;  5C23 A;  3NHE B;  1WYW B;  2K25 A;  4WWP A;  1WXM A;  4PS8 A;  2DYM A;  3TBL D;  2G45 B;  3MTN B;  3VUX A;  3VTV A;  2KOX A;  4BOZ B;  2MLB A;  2K8C A;  1V2Y A;  2KXJ A;  1J0G A;  2JRI B;  1VD2 A;  1WE7 A;  2M0X A;  1WXA A;  2BGF A;  3CMM B;  4MGZ E;  2AEH A;  1KOT A;  3KVF B;  3N3K B;  3RUI B;  4KSL C;  2AYO B;  2C7H A;  3VTW A;  3ZW3 A;  4E71 A;  4N9F 4;  3DVG Y;  4DK5 A;  3WA0 A;  2D2Q A;  2M17 A;  2MBO A;  4WAA A;  2MX2 A;  4ZDV A;  2L8J A;  4NAW A;  2AL3 A;  4IWO A;  4NPN A;  1P98 A;  2ZCC A;  2VRR B;  1SGH A;  2BPS A;  2IO3 B;  2KDF B;  1IP9 A;  2O2V A;  2MCN B;  2GOW A;  3X0W A;  4BVU C;  3DQV A;  3ZNI D;  1UBQ A;  1OQY A;  4WWN A;  2DX5 B;  4KSK C;  3R7Q A;  1E8W A;  2J0J A;  1R4N I;  1RAX A;  2Y5B B;  4PS7 A;  3QAQ A;  4W9I A;  3L16 A;  1OGW A;  3V6C B;  4FJV B;  1MG8 A;  3DBS A;  3ZRF A;  2C7N B;  5CHW A;  1UH6 A;  2KMA A;  3AUL A;  4FA6 A;  2J7Q B;  4DHZ E;  4NAW B;  3HK0 A;  2PEA A;  1IPG A;  3W1S C;  4ANV A;  2RR9 A;  3V6E B;  4NNJ B;  3CST A;  3ZKJ C;  4ASW C;  2LWP A;  4NQL B;  4MGI E;  4G50 A;  2KJH B;  2LRW A;  4M8N A;  4F1S A;  2RPQ A;  4G3X B;  3A1Q B;  3CF6 E;  3OLM D;  3A4S C;  3L17 A;  3A9J B;  3RCZ A;  3NY5 A;  2KKC A;  4P7I A;  3H1U A;  4CYE A;  4LDT B;  4DDI D;  1I35 A;  1WGY A;  5D6J B;  1U4A A;  4GMV A;  2J0M A;  4GDK B;  1EF1 A;  1TGZ B;  4IG7 B;  1P0R A;  3PV1 A;  1UGM A;  4MGY E;  3SD5 A;  5J17 A;  4HCN B;  1R4M I;  5IA7 A;  3DVN U;  1WM3 A;  1WJ6 A;  3U7D A;  2EMS A;  2MBB B;  2BYV E;  2CHZ A;  2WWZ A;  4MEM A;  3VH4 B;  3W1S A;  1ZGU B;  2ZZP B;  3VFK A;  3ZTD A;  3W1Y A;  3B0A A;  2A5U A;  3B08 A;  4X57 B;  3ZNH B;  3QJZ A;  4RM8 A;  3UF8 A;  4E3C A;  1GNU A;  1UZX B;  1F9J A;  2IY1 B;  1WR6 E;  2FCM A;  5IAA C;  1WF9 A;  1RFA A;  3RD2 A;  4NY0 A;  3N30 A;  3SDL C;  1YIW A;  2KFK A;  4ZRI A;  1WXS A;  5JZE B;  3WAN A;  1K8R B;  5BO4 B;  4HXD A;  4IW0 A;  4NJ7 A;  4URK A;  4B9K A;  2KO3 A;  1TTN A;  3DVG X;  4FHJ A;  3U30 A;  2JPH A;  1YD8 U;  3ZTC A;  2OJR A;  4EFO A;  2RSU A;  4CHK A;  4DBG A;  3TMP B;  1J8C A;  4GU2 A;  2KX0 A;  4EZL A;  3APF A;  2K6D B;  4EUT A;  1EF5 A;  1XQQ A;  2KQS A;  5G55 A;  2RD0 A;  2WYQ A;  1T0Y A;  2KC2 A;  4WQO B;  5CHF A;  1V5T A;  3PT2 B;  2KN5 A;  3L10 B;  3A9K B;  2LD9 A;  1WJN A;  3ZNZ B;  3PPA A;  4IM0 A;  2LVQ A;  2KFK B;  1E5W A;  1GC7 A;  2DZJ A;  1HE8 A;  2LRU A;  1XT9 B;  3IHP C;  3PRM B;  4HPM B;  2ZCB A;  2ZPN A;  2NPT B;  2KTF A;  4MJS B;  5AZH A;  4A3P A;  4ANW A;  2IY0 B;  4FHK A;  1WZ0 A;  3UQB A;  2D10 A;  4G11 A;  3QA8 A;  2YVC A;  2V4L A;  3KYC D;  2N1V A;  4BFR A;  2DZM A;  2PE9 A;  2WX0 A;  3RZF A;  4EZJ A;  1WY8 A;  2IO1 B;  3DOW A;  3LJ3 A;  3QC8 B;  2UYZ B;  3QAR A;  2IO0 B;  2KDI A;  4K1R B;  1S1Q B;  1V6E A;  2D11 A;  2CHX A;  4LCD E;  2D07 B;  2FCS A;  4FJY A;  4MSQ B;  3R3M A;  4PS3 A;  2MBE A;  2GMI C;  2KFJ A;  2BKF A;  4W9J A;  4DXA B;  1M94 A;  2M1M A;  3HM3 A;  1GC6 A;  3NOB A;  1YX6 B;  2N9P C;  3V61 A;  1H4R A;  3H7P B;  2AWT A;  4BKS A;  1NI2 A;  2KWU B;  4DHJ B;  2DYO A;  2IZV B;  2R2O A;  5KHQ A;  2V1Y A;  2M4N A;  1TBE A;  5J2R A;  2JY6 A;  2MBH A;  1ISN A;  2K8B A;  3M63 B;  1E8X A;  3PSE B;  1AAR A;  4II2 B;  3VQI A;  5D2M B;  1GJZ A;  2HE7 A;  3IBE A;  4AP4 C;  4EZK A;  1H8C A;  3VDZ A;  3JSV A;  3ZDT A;  4ANU A;  3RT3 B;  5HKH A;  4GB9 A;  3VHT C;  2FIF A;  2MP2 B;  3P2B A;  1L2N A;  1S3S G;  2KHW B;  1VCB A;  3A1Q A;  1Y8R C;  4TQ1 A;  3A9J A;  2KX3 A;  3EFU A;  4FLH A;  2KQ7 A;  4OVV A;  1WM2 A;  2WX1 A;  3VAW A;  1ZKH A;  3D32 A;  4FJZ A;  4GDK A;  4TV3 A;  2NBU A;  2KJ6 A;  3PS6 A;  3MJW A;  2L05 A;  4DWF A;  4GGQ A;  2DYB A;  5LLI A;  3PZD A;  3K9P B;  1WH3 A;  3WAM A;  4DDG D;  1FXT B;  2L76 A;  1V49 A;  2I1J A;  4G0N B;  4PYU A;  4ANX A;  3JSV B;  5AZF A;  4M0W B;  2LGY A;  2CKH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...