1V86A

Solution structure of the ubiquitin domain from mouse d7wsu128e protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
b'GSSGSSGDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA segment, Chr 7, Wayne State University 128, expressed
publication title Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v86A00
2BWES 2ZCBA 2GBRA 3O65B 4LJOB 5HKHA 1WZ3A 3MTNB 1V81A 4G0NB 4MM3A 2KNBA 4LDTD 1WGHA 4HPLB 3W1YA 2KDBA 3M3JA 2Y5BB 3ECIA 2IY0B 4W9CA 4MJSB 3S2AA 1J8CA 4FJVB 4NQKE 1JRUA 3VQIA 3ZRCA 5CX3A 4G11A 4KSKC 4LCDE 2FCQA 2G45B 1XQQA 3NY5A 4K7UA 2JZ3B 2HJ8A 3T9LA 1XT9B 3ZLZA 2BYVE 2PE6B 4DHJB 4GGQA 2C5LC 5JHAA 1KOTA 4AP4C 1WE7A 3VDZA 2KVRA 3NZUA 3PTFC 4XZ4A 1V86A 2FCSA 5DPSA 1TGZB 3N30A 4KZCA 4HCNB 2G4DB 2LI5A 2LVOA 1WJUA 2N9EB 3ZIMA 2XK5A 2Z0EB 3H9DA 2KWCA 3RD2A 3EHVA 1CMXB 3UQBA 1KJTA 2V3SA 4BKTA 3ZVVA 1X1MA 2KTFA 1EUVB 3A9KA 2K8BA 4AUQC 5IA7A 2KFKB 4GN1A 3PHXB 4M0WB 3OAWA 1WX8A 2MLBA 1H4RA 2DZJA 3QWZB 2PPHA 4GOCA 4N9F4 1WMHA 4AJWA 1NDDA 1E5WA 2AYOB 2KQ7A 3B1LX 1GC6A 2LGDA 4I6PA 2BWFA 4ANWA 4DWFA 1QZEA 2AL3A 3VAWA 2N1VA 4FA6A 2WWZA 3CSFA 1WJNA 3PV1A 5CHWA 4MSQB 3VXWA 3QC8B 4GIVA 2DAJA 2Z59B 3OLMD 4BKGA 2L76A 3LDZE 4WWNA 1WFYA 1WF9A 3PLVA 1RAXA 3GZNI 3RZWC 2JT4B 2WX0A 1ZW7A 4NAWB 4DDGD 1D3ZA 3APFA 4CHKA 2JZZA 3IG3A 1Q1OA 2MP2B 1YQBA 3A1QB 5D7GA 3SDLC 3WIMA 1S1QB 2CHWA 2K25A 5C1ZA 2LGYA 4EZJA 1YIWA 2ZVOA 3PRMB 2JXXA 4JQWC 4BOZB 3TMPB 2FAZA 4P7IA 3V62A 2C60A 4ANVA 2MBEA 3PLUA 2R2QA 3H1UA 1WXAA 3H7PA 5DPTA 5CTRC 2BKFA 2M8SA 4KVGB 4E74A 3LJ3A 1BT0A 4HVBA 2KZRA 3KYCD 3QAQA 4F8CB 3AXCA 1GUAB 4K7SA 4HJKA 1IP9A 1S3SG 4IWQA 1F9JA 2YVCA 4PS8A 2O6VB 2M17A 1RFAA 3L17A 2NBWB 4W9HA 1WR6E 3ML9A 1YJ1A 4I6NB 1C1YB 5J2RA 2JPHA 3A33B 4WJPA 2FUHB 5DCNA 1NBFC 1P1AA 4HLEA 2NBUA 1WJ4A 4DBGA 3ZDMC 3UQAA 1ZKHA 4B9KA 4MGYE 3RT3B 4GSWA 2MBQA 1FXTB 2W9NA 2BYFA 1Z5SB 2MSED 2LRUA 4JLCA 1P3QU 4MSMB 3DBLI 3R3MA 2C7MB 2ZPNA 2KANA 3JW0X 5LXHA 2NCNA 4KDLB 2AL6A 1V80A 4A20A 5DPRA 3ENEA 5AEKB 4GDLA 2LASA 1TZ1A 1WY8A 2C9WB 2WYQA 2LZ6A 4OVVA 1RLFA 1H8CA 1L7YA 3EFUA 3IVFA 1UZXB 5JZEB 4PS3A 2CKHB 3ZNHB 2ZCCA 2ZVNA 4FJYA 4AJYB 1E8ZA 1GG3A 3M62B 4KIKB 5CHVC 5KHOA 3ZTDA 1L2NA 2WDTB 2KWVB 1WGGA 4PYUA 2QHOA 2EKEC 1WH3A 5C23A 3K9PB 2IZVB 2KDEB 2PJHA 1UD7A 1UBQA 3HK0A 4PS7A 1MG8A 3V6EB 4EUTA 4MDKE 2G3QB 4IG7B 3A4SC 1G6JA 1KLVA 4ZRJA 4W9IA 4II3B 1GC7A 4TUUA 4W9LA 4URKA 2L0TA 2DYMA 3Q3FA 4MGIE 4GXBA 4GB9A 2BPSA 5AZGA 1WM2A 2OJRA 2IO1B 4HDOA 4ANUA 3CMMB 3KVFB 3PVLA 4FN2A 4J6IA 1WGDA 3L10B 2BGFA 2KWUB 4W9FA 4FADA 4NY0A 4YL8A 4M8MA 2MQJA 3L16A 2O6VD 5LXIB 1UGMA 3QA8A 2K6DB 1LM8B 2LUEA 4PYZA 4KV2A 4W9EA 2MCNB 2UYZB 5D2MB 2KD0A 2IO3B 3AU4A 2N9PC 4F1SA 5L83A 5G2NA 3IBEA 4CO7A 3TCAA 1WX9A 2GMIC 3MHSD 2NBVB 5E6NA 4ZRKA 2KO3A 4K1RB 2N7EA 3KUDB 2MP2A 4FHKA 4JIOU 3SD5A 2LRWA 2DENB 2DX5B 1J19A 2L05A 2BYEA 3VUYA 5IAAC 1TTNA 3PS6A 4HCPB 2EMTA 2V4LA 3TL5A 1ISNA 1RRBA 1YX5B 2N7DA 5JHBA 3A9JB 3TBLD 3JSVA 1P0RA 4TQ1A 1WGRA 2B3AA 3MJWA 2JWZA 2MX2A 3OJ3A 5GMVA 2XK5B 3HM6X 3T8MA 3X0WA 2DZMA 3W1SC 1A5RA 4WJOA 3HM3A 2FIDA 2O2VB 2GBJA 1ZGUB 4X57B 1LQBA 3A9KB 2KX3A 1K8RB 2KC1A 4BKSD 2YLMA 3B0AA 2M4NA 2RSUA 4AOFA 3DVGX 2J7QB 3B08A 1OEYJ 3VUWA 4NJ6A 4BBNC 2OOBB 1WMHB 2J0JA 3V6CB 3NHEB 5E6PA 2ZNVB 1TBEA 3APDA 2KN5A 2PE9A 2KTRA 4IM2A 5AZFA 3WAPA 3VTVA 4JGHB 2DYBA 4E3CA 5AZHA 2KX0A 1WZ0A 2DHZA 4LJPB 4MELA 3SU8X 4WQOB 3U8ZA 3WA0A 4GDKA 3TIXA 1GNUA 3ZDTA 1I35A 2KHWB 3ZNZB 2HE7A 4HPMB 2DYOA 4HK2A 3X23A 3ZO5B 3EECA 2JUOA 4AWJA 3HIZA 1E7VA 2D07B 2K39A 3PRPB 2IO0B 2RGFA 4W9JA 2KLCA 3R7QA 5KHQA 2FCMA 3C0RB 1E7UA 4NQLB 3WALA 3A4RA 2ASQA 2BF8B 2L3ZA 3L13A 2NPTA 4EKUA 4WWPA 4ANXA 2JF5A 2R2OA 3AULA 3V60A 2GBKA 3ALBA 2ZZPB 3CF6E 2UWQA 3DVGY 4WJQA 5D94A 5TR5A 3DPDA 2LD9A 1UELA 2RPQA 3CSTA 4CYEA 2KDIA 4HWIB 2D10A 2D3GA 3JVZX 4W9DA 3ZNID 4K81A 4ZDVA 4NJ7A 5G55A 2D2QA 4TQ0A 4A3OA 4HDQA 4MJSA 3UF8A 2N9XA 3QX1A 2HD5B 2V1YA 3JYUA 2L00B 2CU1A 2PEAA 1LXDA 1GJZA 3QQ8B 2C7HA 2CR5A 4RMAA 3QHTA 1NI2A 4XC2A 2GOWA 2I1JA 3L0WB 3KH0A 2LXAA 1WI0A 4JL9A 3DBHI 2LVQA 4KSLC 2AEHA 4DHZE 3UGBB 3ZRFA 3VVWB 3P2BA 3VUXA 3RYTA 2K6QA 3RUIB 4IUMB 2KC2A 1SE9A 2DZKA 2KMCA 1SIFA 2KOXA 1WGYA 2LGXA 3ZW3A 4BFRA 5L95C 4B6WA 2ZPYA 3M95A 2REXA 4GU2A 2MBHA 3VTWA 4I6LB 3N32A 1Z2MA 5CHFA 3WANA 3KUZA 3PPAA 2MWSB 1PQSA 3DBSA 2FIFA 2KK8A 2MW5A 3D32A 4IM3A 1UH6A 2ZNVC 3NS8A 2NR2A 1OTRB 2KFKA 3DDCB 4B95A 2KJRA 1WIAA 2I1KA 3BINA 4EZKA 2LJ5A 2N4FA 4WAAA 2CHXA 3DVNU 4IWPA 1V6EA 3UIOB 2D11A 2LXCA 3KYDD 4GDLB 2MA9B 3ONSA 5J17A 1R4NI 4KDIC 3QCAA 3U7DA 1Q0WB 2XEWA 4NPNA 1IYFA 2KJHB 4ICVA 3IFWB 3OJ4B 3PSEB 3H6NA 4BBNF 4DXAB 4NNJB 5FR6A 4EZLA 3VFKA 3L08A 2JVCA 3PRZA 3UIPB 2KXJA 3HHMA 4NAWA 2C7NB 2IY1B 4MGKE 3A9JA 4A3PA 1IPGA 1J0GA 1WXSA 3A1QA 1EF5A 1OEYA 2KQSA 2ZEQA 4MH0E 1EF1A 4II2B 2J0KA 4FULA 3RZFA 2RR9A 2IBIB 2O2VA 4K7WA 1WM3A 3N3KB 2KDFB 4W9GA 1VCBA 3I3TB 3NOBA 2KMAA 2G4SA 1SGHA 2DZIA 3GOEA 4OVUA 3R66C 1WYWB 1AARA 1C3TA 4IWOA 2M0XA 2GBNA 3DVNV 1R4MI 1WX7A 3KW5B 2L8JA 4ASWC 4E71A 1P98A 2KJ6A 1YX6B 4ZRIA 1V5TA 2DAFA 1WR1A 1VD2A 2L0FA 2VRRB 2HTHA 1E8YA 2BKRB 3QARA 4MEMA 4FJZA 5DPWA 1P9DU 1HE8A 1V5OA 1UBIA 4F7ZA 3VH3B 2O6VA 4EOYA 2MBOA 1E8XA 4FHJA 4G3XB 4RM9A 3DOWA 4LDTB 2ZJDA 2WX1A 3K9OB 3ZNGC 2L7RA 4ZYNA 2KLGA 4BOSC 4M8NA 1Q5WB 4GMVA 4WJNA 4HXDA 4MGZE 3VH4B 1EO6A 1Y8RC 3VTUA 4DHZB 2Z0DB 2MRPA 5D6JB 4WWOA 1E8WA 3H7SA 3JSVB 3TJPA 3U30A 3AI5A 3IHPC 3PT2B 3QIJA 5EDSA 3PHWB 3ZTCA 2NVUI 2A4ZA 3APCA 4DHJD 2CHZA 2XBBC 3AU5A 3SHQA 2FNJB 2MBBB 5JH5C 4IC7B 1WJ6A 3RCZA 2IO2B 2M1MA 2A5UA 2K8HA 1WRDB 4EEWA 4DDID 1WXVA 3WAMA 2K1FA 4FLHA 3W1SA 3UINB 2AWTA 4BVUC 2KKCA 1M94A 2KFJA 1LFDA 3H7PB 3M63B 4W9KA 2LVPA 4IM0A 5E6OA 3PGEA 3V61A 2KTRB 1V49A 4EFOA 4RM8A 2N1WA 4KZ0A 4BKSA 3L54A 1KM7A 2LWPA 1WE6A 3ML8A 4GDKB 1XD3B 2JY6A 4KIKA 2K8CA 1WXMA 4ICUA 2GBMA 3PZDA 2JRHA 4XX5A 3NZSA 3ZUNA 1I42A 3WAOA 1E90A 3BY4B 3EC8A 3KUCB 4FBJB 2NS5A 1YD8U 1V9JA 5LLIA 1T0YA 5J18A 3RULA 4IW0A 3DCGA 5BO4B 3Q3JA 1U4AA 2NPTB 3R7RA 4TV3A 1OQYA 3ZKJC 3QK0A 1OGWA 2CS4A 2JRIB 2RD0A 2EMSA 3DBRI 3PREA 4TKNA 1V2YA 2FCNA 3DQVA 3VHTC 3QJZA 2IYDB 2J0MA 4G50A 4DK5A
chains in the Genus database with same CATH superfamily
5HFYA 1Q10A 3MTNB 3IT6B 2KNBA 1F52A 2JYEA 3W1YA 3M3JA 2Y5BB 1J8CA 3SFDB 1GOZA 5CX3A 1UWMA 4G11A 3N1YC 2HJ8A 3T9LA 1XT9B 1V1OA 1JROA 3RNCC 5JHAA 4AP4C 1WE7A 3NZUA 4XZ4A 1V86A 1TS5A 3E56A 2TSSA 3TEYA 1XCTL 3AE6B 5BYQA 3ABVB 4BKTA 3VRBB 3EUB2 3P4RB 2IGGA 2K8BA 4RF1A 5IA7A 2KFKB 3PHXB 5I4DA 3OAWA 3ZGZA 2MLBA 1H4RA 2PPHA 2KQ7A 1E5WA 2LGDA 4I6PA 4ANWA 1QZEA 3VAWA 1SE3A 2N1VA 1QT9A 4FA6A 2WWZA 1WJNA 3AEGB 3PV1A 5CHWA 4LTUA 3VXWA 3QC8B 3N1ZC 4GIVA 1QOBA 1WFYA 2GRIA 1RAXA 2PKOA 3RZWC 3AE3B 2E3TA 1ZW7A 4NAWB 3NZ3A 2JZZA 1Q1OA 2MP2B 2K25A 3SR6A 5C1ZA 3TEWA 2ZVOA 3PRMB 4JQWC 2JYTA 2K0PA 3DHHC 1HTQA 3Q8CA 5DPTA 5CTRC 2BKFA 4HKQA 3LJ3A 1BT0A 4JWUC 2DNFA 2YVCA 2M17A 2WP9B 4ZRPA 4WJPA 4LNKA 2NBUA 1ZKHA 3RPFC 2BYFA 2LRUA 3NS1A 3DBLI 3R3MA 2ZPNA 4BAXA 2N0SB 3JW0X 5LXHA 4KDLB 4GDLA 1TZ1A 2WYQA 2LZ6A 3O13A 1RLFA 3NVZA 1H8CA 1BMLC 2CKHB 1PDXA 4FJYA 1E8ZA 1GG3A 3M62B 1HXYD 2QHOA 3K9PB 1UD7A 3HK0A 2MJDA 2OHFA 3C8YA 3EFCA 1T6BX 4ZRJA 4L2YA 2XN9C 4TUUA 1GB1A 4MGIE 5AZGA 2OJRA 2J42A 1WGDA 2BGFA 2O6VD 1UGMA 2K6DB 3RNAC 2DLBA 1QQRA 2KD0A 2SEBD 1C4PA 5GXGB 2GB1A 4CO7A 4DXFA 2WXOA 4PT5A 2KO3A 4HROA 3KUDB 3HRDD 2JZPA 1PGXA 2DX5B 3GZNB 4HCPB 1RRBA 1YX5B 2N7DA 1P0RA 2K3UA 2B3AA 4KGTA 3T8MA 3HM3A 4ZOHC 2GBJA 2KC1A 2WXKA 3B0AA 2I38A 1D5MC 4ARCA 1T0SC 3Q2AC 3V6CB 1FM0D 2ZNVB 2KN5A 2PE9A 3VTVA 2DYBA 5AZHA 2I2YA 1T0RC 3NJTA 1GNUA 3ZDTA 2KHWB 4H2AA 2UU7A 3R8BA 2DYOA 1JRPA 2D5GA 3OWEB 4AWJA 3U52E 5H92C 4LK0M 2WXRA 3PRPB 3R7QA 1ZOYB 3AE7B 2ASQA 2L3ZA 2JF5A 3AULA 5D94A 1MHHE 3CSTA 4CYEA 1FFVA 2KDIA 3B9JA 4HWIB 2D10A 2N9KA 4ZDVA 2HTME 3UF8A 4YSXB 2L00B 1GJZA 1EWYC 3LB8C 2Y3AA 1K51A 2I1JA 1VRAB 3AE8B 2KN4A 3KH0A 1HTOA 3DWMA 2LVQA 4KSLC 4DHZE 1XLQA 1FRDA 3VVWB 3P2BA 4XDCA 3VUXA 3RUIB 1EM7A 1SE9A 5IN7A 2LMCA 4BFRA 1PFDA 5L95C 3N32A 1Z2MA 5CHFA 3WANA 2NMQA 3PPAA 2MWSB 1PQSA 2BVCA 2QILA 3B2GA 3NS8A 1OTRB 3DDCB 4S0RA 4B95A 2KJRA 3BINA 4JE3B 2CHXA 2E6XA 2LXCA 2MA9B 5J17A 1IYFA 2XEWA 1SIJA 2KJHB 4ICVA 3PSEB 3H6NA 1KFYB 3VFKA 4ARIA 1QOGA 2PIAA 1UUPA 4KKIA 1HQRD 1WXSA 1ZUD2 2ZEQA 1OEYA 5AUKA 1EF1A 4II2B 1K50A 1SE4A 1A70A 4KGSA 1F2RC 3NOBA 3R2IA 2BTEA 1QKZA 3ZJTA 1JWAD 2MHJA 4ZRIA 4YTNB 1WR1A 1UGJA 1E8YA 3QARA 1QOFA 1QF6A 3VH3B 1GPXA 4EOYA 2MBOA 2WX1A 5H8YE 4ZYNA 2KLGA 4BOSC 4M8NA 2ICIA 1Y8RC 3VTUA 2J52A 1FMAD 1FEHA 2Z0DB 4A6QA 1AN8A 2QMTA 2CU3A 3U30A 4O1NA 3QIJA 3PHWB 1F77A 2A4ZA 4DHJD 2CHZA 3RNFC 2X8XX 3SHQA 4LNFA 2W54A 2IO2B 2AQ2B 1FD6A 3C19A 2LJIA 1WRDB 3WAMA 2K1FA 4XGAB 3UINB 1LFDA 4YTPB 2LVPA 1V49A 4TSSA 2CJOA 1DOYA 2WXIA 3L54A 3BYTB 2K8CA 1I4RA 3PZDA 1I42A 3WAOA 1E90A 2PLPA 3V05A 1NENB 1V9JA 2VZKD 2V0GA 3DCGA 5BO4B 1U4AA 3URYA 1OQYA 1OGWA 2CS4A 4UDUC 2RD0A 2WDVB 1OQQA 1J7AA 3ZXVA 4LJOB 1TIFA 4G0NB 1FCCC 2FE8A 2KDBA 4OZCA 3ECIA 1Y56A 4W9CA 4MJSB 3S2AA 2Z8LA 1JRUA 3VQIA 1UWXA 2W82A 1XQQA 2BYVE 1C79A 1V8CA 2FUG1 4N59A 2KMMA 3VDZA 1SSNA 2FCSA 1TGZB 1YN5A 1WJUA 1WRIA 2L83A 2N9EB 2KWDA 2XK5A 3RD2A 1KLGD 1CMXB 1KJTA 2L32A 2KTFA 5HHDG 3UI3A 4GN1A 3BVMA 1WX8A 2DZJA 3QWZB 4N9F4 3VR8B 5HG2A 1NYRA 3AE5B 3FILB 2LUMA 2AL3A 2VH1A 4ACFA 2L76A 3LDZE 3PLVA 3V3XA 2JT4B 1XO3A 3APFA 3A1QB 2W55A 3WIMA 1ET6A 1S1QB 4US8A 2WXMA 2WXQA 2WHIA 1CK1A 1V1PA 2LGYA 2N7JA 4M00A 1YIWA 3AV8A 3TMPB 4P7IA 2Y5CA 2MBEA 3Q3OC 4B0EA 2ONQA 4KVGB 5TSSA 4E74A 4HVBA 3KYCD 3QAQA 2INNE 3AXCA 2EELA 2O6VB 1RFAA 5G5GA 2NBWB 1WR6E 2M56B 2BW2A 3N1XC 3PZ8A 1YJ1A 1MI0A 5J2RA 2G9HD 3A33B 2FUHB 5DCNA 1WJ4A 3ZDMC 2EKIA 3RT3B 3AN1A 1JCKB 1FNVA 1FXTB 1PUTA 3CWIA 1L0XB 3SFEB 4JLCA 1F2RI 4IDIA 4R3DA 4DXGA 2KANA 3E9SA 2ZW0A 2NCNA 3DBRB 3W9CB 3H8HA 3I63C 3GE3C 4A20A 5DPRA 2C9WB 1YQ4B 1FXAA 3P63A 3TEXA 5JZEB 4PS3A 5MPOA 2K9XA 4AJYB 4LNIA 1VR9A 4KIKB 5KHOA 1CZPA 2WDTB 2KWVB 4P1BC 2MJ3A 4PYUA 1DYQA 2IZVB 2KDEB 2PJHA 4N58A 4PS7A 4IG7B 4II3B 1ZPSA 4W9LA 3Q3FA 4GXBA 4GB9A 1VLBA 1WM2A 2GI9A 4HDOA 3CMMB 3KVFB 4FN2A 4J6IA 1L6VA 4NY0A 4YL8A 3Q3MC 5LXIB 1LM8B 3P4QB 1C77A 3MHZA 4LNNA 5D2MB 1KH0A 1D4BA 4XYCA 3AU4A 4F1SA 1JMLA 1TY0A 3IBEA 2NBVB 2BQQA 2MP2A 3SD5A 5BMHA 3ZJUA 1ZE3D 2LRWA 4XE0A 5BMGA 2L05A 2BYEA 1TTNA 3TL5A 5JHBA 3JSVA 5BMIA 4TQ1A 3HM6X 3X0WA 1MHXA 1SXTA 2FIDA 2O2VB 2W3RA 1ZGUB 4X57B 3W5UB 1K8RB 1E6EB 2YLMA 2RSUA 1OEYJ 2K22A 1XLPA 4KGRA 4BBNC 5E6PA 3RNGC 4RH6A 2KTRA 4IM2A 4JGHB 2DHZA 4MELA 3WA0A 2WDQB 4GDKA 2D3BA 1FXIA 4USAA 1BXTA 3ZNZB 4HPMB 4KKJA 3X23A 3EECA 2JUOA 2D07B 2IO0B 2WNMA 3C0RB 3WALA 2ON8A 4L1BA 4WWPA 2R2OA 3V60A 2DBYA 2ZZPB 3AEAB 4YWGG 4ZRQA 4YSZB 2RPQA 3ZNID 5G55A 3DBLB 1IBXA 4A90A 2HD5B 4RMAA 2WXPA 2LEKA 3L0WB 2IGHA 2JX5A 2LXAA 1WI0A 1ROEA 3DBHI 4NJCA 4XWTA 2K6QA 3ZYYX 1TYGB 1SIFA 3RFZB 1WGYA 5EE9A 1C9FA 4B6WA 2ZPYA 4GU2A 2REXA 2MBHA 3VTWA 4I6LB 3KUZA 5BYRA 3DBSA 2MW5A 4IM3A 1UH6A 1BUIC 1MVKA 1J7BA 4M0WA 2I1KA 1P7FA 3DVNU 4IWPA 3UIOB 1IGDA 2WLBA 4GDLB 4KDIC 1Q0WB 1DOIA 3IFWB 1TZOA 4NNJB 1YN4A 4AS1A 2JVCA 3UIPB 2KXJA 1TS3A 2C7NB 3Q6BA 1AWDA 1J0GA 1KLUD 4MH0E 3GB1A 2WQYB 2J0KA 4FULA 3RZFA 3J9CA 3N3KB 1TT5B 2KDFB 4MT5A 4W9GA 4C4VB 4M01A 1MPEA 1SGHA 3R66C 3Q14C 2KVZA 1C3TA 2M0XA 1R4MI 4ASWC 1R4MB 2L8JA 4DQOC 2PMVA 2VRRB 1YJJA 4B0MA 4PK1A 4ZHPA 1P9DU 1V5OA 1RWSA 4G3XB 4KX6B 2WXNA 3K9OB 3ETRA 1Q5WB 4GMVA 3DHIC 3VH4B 1I7HA 3NRZA 4WWOA 5HI1A 1I4QA 2BB5A 3PT2B 2WXHA 3Q69A 2OJWA 1T5XD 4YTMB 3AU5A 5JH5C 4IC7B 3RCZA 2A5UA 4LLGM 4DDID 1RYJA 2AQ1B 2RDHA 4BVUC 3H7PB 2HDEA 5E6OA 2WXGA 4EFOA 1WE6A 4MH8A 1LGRA 2NS5A 4JPSA 1XCQL 5LLIA 2MEKA 1JWBD 4TV3A 3W2DA 3ZKJC 1TS4A 3QK0A 3PREA 1V2YA 3VHTC 2IYDB 2J0MA 4G50A 1MFWA 4WWMA 2KT7A 2BWES 2GBRA 3AEDB 3O65B 5HKHA 1WZ3A 3GS2A 1QOAA 4MM3A 4HJGE 1WGHA 4HPLB 4LDTD 2RPVA 2BS3B 1GAQB 4HKZE 4FJVB 3ZRCA 2QEJC 2ACZB 3NY5A 1JW9D 1TY2A 3T3NA 3ZLZA 3RMKC 2PE6B 5LNK1 4CQNA 2C5LC 4S17A 3LXFA 1KOTA 3PTFC 5DPSA 3N30A 2LI5A 1F1HA 2LVOA 2RMMA 2G1EA 3GP7A 1TKEA 3AEBB 2Z0EB 4L23A 3H9DA 2KWCA 1FNUA 2WXLA 3ZVVA 3AEFB 3A9KA 4AUQC 1TKGA 2SAKA 1NYQA 3KQ4A 1LO5D 3KWVA 4GOCA 1WMHA 1N63A 4AJWA 3Q8FA 2GLSA 1I4PA 1D6EC 5G5HA 4IOIE 2DAJA 2Z59B 3OLMD 4BKGA 4WWNA 2WX0A 2QJLA 4DDGD 4CHKA 3IG3A 3BK2A 5FKAC 3SDLC 2KAJA 1PYWD 3NVWA 2YEPB 1E10A 3HVZA 3PLUA 3H1UA 4C56C 2LGIA 4RGMA 3MC9A 1CJEA 5BYSA 1SJED 2KZRA 1GB4A 3L4PA 4YXDB 3FC4A 1GUAB 3AE9B 4HJKA 1IP9A 2XNAC 4IWQA 4PS8A 2M0AA 3CIRB 3DWGC 2JXTA 3L17A 2BT6A 4I6NB 1ACCA 1NBFC 1P1AA 4HLEA 4DBGA 3UQAA 1L5PA 4MGYE 3BVGA 3U2SC 4N6EB 4US9A 2KACA 2C7MB 3BVZA 1T0QC 2IDYA 2H88B 1ET9A 5AEKB 2LASA 1WY8A 1B1ZA 4OVVA 3KWLA 3EFUA 1FNWA 3IVFA 2KQ4X 2ZCCA 2ZVNA 3BWUD 5IOIA 1L0VB 3AMZA 3VR9B 3TEZA 4NZLB 3RN9C 5C23A 3GE8C 2D3AA 4WAFA 3N20C 1UBQA 1MG8A 3V6EB 4EUTA 4MDKE 2G3QB 3A4SC 1G6JA 1KLVA 4W9IA 4URKA 1PGBA 3ZXRA 4ANUA 4OHJA 3L10B 4W9FA 1OQRA 2MQJA 3L16A 2NTSA 2LUEA 2V4IB 4PYZA 4W9EA 2MCNB 2UYZB 2VH2A 3AE2B 2IO3B 5L83A 1ZP0B 1WX9A 1ZDVA 5E6NA 1YNTE 2BBCA 4GLSC 3SEBA 1N5WA 4WURA 4FHKA 4JIOU 1C4CA 2DENB 4D2KA 3VUYA 2QCZA 5IAAC 2FBWB 1IGCA 3PS6A 2V4LA 2M19A 3A9JB 4NAMA 3MJWA 3IXSA 2MX2A 3OJ3A 2XK5B 4WH4A 1KRHA 2QDFA 2KX3A 5EE1A 2M4NA 2WU5B 5D3IB 3DVGX 4AOFA 3I5JC 1T3QA 2J0JA 2LGSA 4HEA1 3APDA 2INPE 4P16A 1AW7A 4E3CA 1WZ0A 3U8ZA 3SU8X 4WQOB 4BZAA 4WIPA 2HE7A 2PW9A 3LYYA 4HK2A 1N5XA 3I9V1 3HIZA 4W9JA 3Q8EA 4REZA 4P1CC 4NQLB 1V1PB 2BF8B 2NPTA 3WCQA 4EKUA 4ANXA 2GBKA 2UWQA 1UF0A 5TR5A 2LD9A 4ITKA 1DOXA 2MH7A 2D3GA 4W9DA 4K81A 3P4SB 4TQ0A 4HDQA 1TJEA 2DWQA 4C80A 3AE4B 2N9XA 2V1YA 2CU1A 2PEAA 1LXDA 3QQ8B 2C7HA 3AB5A 3QHTA 1JWUD 1L0YB 1ZXIA 4JL9A 2WXFA 2AEHA 3UGBB 4XWWA 4JWSC 3RYTA 1VJKA 2KC2A 2DZKA 5IO9A 1VZ8A 2WGSA 2LGXA 3ZW3A 3RI7C 2PTLA 2FIFA 2KK8A 3D32A 3DHGC 3PO0A 2ZNVC 1ZXHA 4QAYA 2NR2A 2KFKA 1WIAA 1TKYA 3RNBC 2N4FA 3AE1B 1V6EA 3KYDD 1SEBD 3ONSA 3QCAA 4NPNA 1VZ7A 2Y5PA 4BBNF 4DXAB 5FR6A 3PRZA 3HHMA 4NAWA 4MGKE 4A3PA 2IPKD 2INDC 1EF5A 2KQSA 1VZ6A 2KDMA 1YOVB 2Q5WD 2O2VA 2W3SA 3I3TB 4ZHOA 1YQ3B 2KMAA 2G4SA 2DZIA 3GOEA 2LHEA 1AARA 2JQRB 2V3PA 1MG4A 1YN3A 4IWOA 3DVNV 3NG0A 1WX7A 1P98A 2KJ6A 1YX6B 1V5TA 1C78A 1VD2A 3TUOA 2BKRB 2L1AA 4MEMA 4FJZA 4F7ZA 2MJEA 1WXQA 4FHJA 1E8XA 4LDTB 2ZJDA 3FKYA 5AUIA 1YJIA 3ZNGC 4HXDA 4MGZE 2D3CA 1EO6A 5D6JB 3H7SA 3JSVB 3TJPA 3AI5A 3MC0B 3IHPC 5EDSA 4HRSA 5T8IA 5IKCM 2XBBC 2FNJB 2MBBB 2YEPF 1DGJA 4C7YA 4RGTA 4TMAB 2M1MA 4RF0A 5C2TB 1WXVA 4FLHA 1M94A 2AX5A 1M4VA 3M63B 3PGEA 4MACA 2KTRB 2N1WA 4KZ0A 4BKSA 2LWPA 4GDKB 2L52A 1QILA 4ICUA 2GBMA 3ZUNA 3NZSA 3EC8A 3KUCB 1YD8U 3DBHB 1T0YA 5J18A 4IW0A 3Q3JA 3R7RA 4TKNA 2FCNA 3QJZA 2RDGA 2ZCBA 1V81A 5E6JA 2IJ0A 1D5ZC 2IY0B 1IBXB 4NQKE 3Q3NC 4KSKC 4LCDE 2FCQA 2G45B 4K7UA 2JZ3B 2WU2B 1I4XA 2LFIA 3AM9A 3U7ZA 4DHJB 4GGQA 2KVRA 1K52A 3RNEC 4YT0B 3Q8BA 4IKGA 4KZCA 4HCNB 4C4VA 2G4DB 4RGNA 4AQ7A 2JU6X 5JXVA 1NI3A 3ZIMA 1WGKA 3EHVA 3UQBA 5FK9C 1E0ZA 2V3SA 1TS2A 1X1MA 2ZW1A 1EUVB 2IGDA 4M0WB 4RNAA 1WYGA 3B2FA 1NDDA 1C76A 2AYOB 3B1LX 2H89B 1GC6A 2BWFA 2VZKB 4DWFA 3IT4B 3CSFA 4A9AA 4MSQB 1MJDA 1WF9A 3GZNI 1L4ZB 1UNSA 2K5PA 3T3OA 1D3ZA 4LNOA 1YQBA 5D7GA 1I4HA 2QSDA 2CHWA 3AEEB 2BYTA 4EZJA 1XEEA 2AQ3B 2JXXA 4BOZB 2FAZA 3V62A 2C60A 2BS2B 3EA6A 2R2QA 1WXAA 3H7PA 1FPYA 4XDDA 2M8SA 2NTTA 3AH7A 1OFFA 3PZ7A 4F8CB 2J4XA 5D3DA 4K7SA 1S3SG 1F9JA 5IP4D 4W9HA 1WWTA 3ML9A 1C1YB 3U4EG 2JPHA 1XF5L 1KTKA 1C4AA 3P4PB 4B9KA 4GSWA 2MBQA 2W9NA 4OZBA 1Z5SB 4C00A 2MSED 1K53A 1P3QU 4MSMB 3HVDA 1B9RA 3NVVA 3TSSA 2AL6A 1AYFA 1V80A 3ENEA 4Q2JA 1FCLA 1E9MA 1L7YA 1SBBB 1UZXB 3ZNHB 3NUHB 1N60A 4ZYSA 1L6UA 5CHVC 3ZTDA 3IAM1 1L2NA 1RFKA 1WGGA 5EE3A 5FR3A 2EKEC 1WH3A 1SE2A 1FO4A 1GC7A 3R2TA 2L0TA 2DYMA 2BPSA 4RFBA 2IO1B 3PVLA 4A55A 2KWUB 4FADA 4M8MA 4MM3B 3VRAB 3QA8A 4KV2A 2QIEB 3BYYB 1V97A 3P42A 2RDBC 1PGAA 2N9PC 3FAHA 5G2NA 3TCAA 2GMIC 3MHSD 2N9LA 4ZRKA 1JWSD 4K1RB 2N7EA 3P1MA 2INCC 1J19A 1QLBB 3MP9A 2EMTA 1ISNA 5EE0A 3TBLD 4K3CA 1E7PB 3MJ5A 1WGRA 2JWZA 5GMVA 2DZMA 3W1SC 1A5RA 4WJOA 2PVOD 1EU3A 1LQBA 3A9KB 3MFGA 3ZJVA 4BKSD 3N9YC 2J7QB 4OVZA 3B08A 4EE2A 3VUWA 4NJ6A 2OOBB 1WMHB 3NHEB 1N61A 1TBEA 3WAPA 5AZFA 5C3JB 1CQVA 1ZDXA 2KX0A 4LJPB 1JQ4A 1I35A 3TIXA 3ZO5B 2HJ1A 1NVID 1E7VA 3MC8A 2K39A 4WQMA 2RGFA 2KLCA 1STEA 5KHQA 4OZAA 2FCMA 1E7UA 3A4RA 3L13A 3AECB 1N6ZA 3ALBA 3CF6E 4WJQA 3DVGY 1XLOA 3DPDA 1UELA 2V9HA 3JVZX 4JX1C 2OEDA 4NJ7A 2D2QA 1FIQA 4A3OA 4MJSA 3QX1A 3JYUA 4YSYB 2CR5A 1YMHE 1NI2A 4XC2A 2GOWA 1JWMD 3ZQ4A 3ZRFA 1XLNA 2QC8A 4IUMB 2KMCA 3BK1A 3EGRA 3W5VB 4C7ZA 1FFUA 1L4DB 2KOXA 3M95A 2B76B 4P6VF 2WDRB 3Q8AA 4EZKA 2LJ5A 4WAAA 2D11A 1ENFA 1F0ZA 3FILA 1R4NI 1R4NB 1IUEA 3U7DA 1RM6C 3OJ4B 3OG5A 1JALA 4EZLA 3L08A 2JWUA 2IY1B 3A9JA 1NEKB 1IPGA 3NVYA 3A1QA 1SF0A 1HEZE 2RR9A 2IBIB 1R7SA 4K7WA 1WM3A 1SJHD 3IAS1 1VCBA 2KYWA 4OVUA 1WYWB 4M02A 2GBNA 3KW5B 4E71A 3KLSX 3BZDB 2DAFA 2L0FA 2HTHA 4RCOA 5DPWA 1EWCA 1HE8A 1UBIA 2O6VA 4RM9A 3DOWA 2L7RA 4WJNA 4DHZB 1EU4A 3I57A 2MRPA 1P7EA 1E8WA 1D5XC 1FRRA 3ZTCA 4HPPA 1N62A 1WSPA 2NVUI 4FXCA 3APCA 2WXJA 1WJ6A 1HZ5A 1HZ6A 2JSVX 2K8HA 2WS3B 4EEWA 3W1SA 2AWTA 3BIID 3HUIA 2KKCA 2KFJA 2R61A 4W9KA 4IM0A 3V61A 4J3OD 4OW0A 4RM8A 4RGOS 2LHDA 1KM7A 2CJNA 1ESFA 2BS4B 3ML8A 1I4GA 1XD3B 2JY6A 4KIKA 1WXMA 1XXGA 2JRHA 4XX5A 3BY4B 4FBJB 4A8XC 2BB6A 4K3BA 1VDVA 1SB3C 3RULA 2PVGC 1J7CA 2NPTB 2V3NA 2X38A 3DBRI 4ANVA 2JRIB 2EMSA 3DQVA 4DK5A 2J53A 1KF6B 1HA5A
chains in the Genus database with same CATH topology
2BWES 2ZCBA 2GBRA 3O65B 4LJOB 5HKHA 1WZ3A 3MTNB 1V81A 4G0NB 4MM3A 2KNBA 4LDTD 1WGHA 4HPLB 3W1YA 2KDBA 3M3JA 2Y5BB 3ECIA 2IY0B 4W9CA 4MJSB 3S2AA 1J8CA 4FJVB 4NQKE 1JRUA 3VQIA 3ZRCA 5CX3A 4G11A 4KSKC 4LCDE 2FCQA 2G45B 1XQQA 3NY5A 4K7UA 2JZ3B 2HJ8A 3T9LA 1XT9B 3ZLZA 2BYVE 2PE6B 4DHJB 4GGQA 2C5LC 5JHAA 1KOTA 4AP4C 1WE7A 3VDZA 2KVRA 3NZUA 3PTFC 4XZ4A 1V86A 2FCSA 5DPSA 1TGZB 3N30A 4KZCA 4HCNB 2G4DB 2LI5A 2LVOA 1WJUA 2N9EB 3ZIMA 2XK5A 2Z0EB 3H9DA 2KWCA 3RD2A 3EHVA 1CMXB 3UQBA 1KJTA 2V3SA 4BKTA 3ZVVA 1X1MA 2KTFA 1EUVB 3A9KA 2K8BA 4AUQC 5IA7A 2KFKB 4GN1A 3PHXB 4M0WB 3OAWA 1WX8A 2MLBA 1H4RA 2DZJA 3QWZB 2PPHA 4GOCA 4N9F4 1WMHA 4AJWA 1NDDA 1E5WA 2AYOB 2KQ7A 3B1LX 1GC6A 2LGDA 4I6PA 2BWFA 4ANWA 4DWFA 1QZEA 2AL3A 3VAWA 2N1VA 4FA6A 2WWZA 3CSFA 1WJNA 3PV1A 5CHWA 4MSQB 3VXWA 3QC8B 4GIVA 2DAJA 2Z59B 3OLMD 4BKGA 2L76A 3LDZE 4WWNA 1WFYA 1WF9A 3PLVA 1RAXA 3GZNI 3RZWC 2JT4B 2WX0A 1ZW7A 4NAWB 4DDGD 1D3ZA 3APFA 4CHKA 2JZZA 3IG3A 1Q1OA 2MP2B 1YQBA 3A1QB 5D7GA 3SDLC 3WIMA 1S1QB 2CHWA 2K25A 5C1ZA 2LGYA 4EZJA 1YIWA 2ZVOA 3PRMB 2JXXA 4JQWC 4BOZB 3TMPB 2FAZA 4P7IA 3V62A 2C60A 4ANVA 2MBEA 3PLUA 2R2QA 3H1UA 1WXAA 3H7PA 5DPTA 5CTRC 2BKFA 2M8SA 4KVGB 4E74A 3LJ3A 1BT0A 4HVBA 2KZRA 3KYCD 3QAQA 4F8CB 3AXCA 1GUAB 4K7SA 4HJKA 1IP9A 1S3SG 4IWQA 1F9JA 2YVCA 4PS8A 2O6VB 2M17A 1RFAA 3L17A 2NBWB 4W9HA 1WR6E 3ML9A 1YJ1A 4I6NB 1C1YB 5J2RA 2JPHA 3A33B 4WJPA 2FUHB 5DCNA 1NBFC 1P1AA 4HLEA 2NBUA 1WJ4A 4DBGA 3ZDMC 3UQAA 1ZKHA 4B9KA 4MGYE 3RT3B 4GSWA 2MBQA 1FXTB 2W9NA 2BYFA 1Z5SB 2MSED 2LRUA 4JLCA 1P3QU 4MSMB 3DBLI 3R3MA 2C7MB 2ZPNA 2KANA 3JW0X 5LXHA 2NCNA 4KDLB 2AL6A 1V80A 4A20A 5DPRA 3ENEA 5AEKB 4GDLA 2LASA 1TZ1A 1WY8A 2C9WB 2WYQA 2LZ6A 4OVVA 1RLFA 1H8CA 1L7YA 3EFUA 3IVFA 1UZXB 5JZEB 4PS3A 2CKHB 3ZNHB 2ZCCA 2ZVNA 4FJYA 4AJYB 1E8ZA 1GG3A 3M62B 4KIKB 5CHVC 5KHOA 3ZTDA 1L2NA 2WDTB 2KWVB 1WGGA 4PYUA 2QHOA 2EKEC 1WH3A 5C23A 3K9PB 2IZVB 2KDEB 2PJHA 1UD7A 1UBQA 3HK0A 4PS7A 1MG8A 3V6EB 4EUTA 4MDKE 2G3QB 4IG7B 3A4SC 1G6JA 1KLVA 4ZRJA 4W9IA 4II3B 1GC7A 4TUUA 4W9LA 4URKA 2L0TA 2DYMA 3Q3FA 4MGIE 4GXBA 4GB9A 2BPSA 5AZGA 1WM2A 2OJRA 2IO1B 4HDOA 4ANUA 3CMMB 3KVFB 3PVLA 4FN2A 4J6IA 1WGDA 3L10B 2BGFA 2KWUB 4W9FA 4FADA 4NY0A 4YL8A 4M8MA 2MQJA 3L16A 2O6VD 5LXIB 1UGMA 3QA8A 2K6DB 1LM8B 2LUEA 4PYZA 4KV2A 4W9EA 2MCNB 2UYZB 5D2MB 2KD0A 2IO3B 3AU4A 2N9PC 4F1SA 5L83A 5G2NA 3IBEA 4CO7A 3TCAA 1WX9A 2GMIC 3MHSD 2NBVB 5E6NA 4ZRKA 2KO3A 4K1RB 2N7EA 3KUDB 2MP2A 4FHKA 4JIOU 3SD5A 2LRWA 2DENB 2DX5B 1J19A 2L05A 2BYEA 3VUYA 5IAAC 1TTNA 3PS6A 4HCPB 2EMTA 2V4LA 3TL5A 1ISNA 1RRBA 1YX5B 2N7DA 5JHBA 3A9JB 3TBLD 3JSVA 1P0RA 4TQ1A 1WGRA 2B3AA 3MJWA 2JWZA 2MX2A 3OJ3A 5GMVA 2XK5B 3HM6X 3T8MA 3X0WA 2DZMA 3W1SC 1A5RA 4WJOA 3HM3A 2FIDA 2O2VB 2GBJA 1ZGUB 4X57B 1LQBA 3A9KB 2KX3A 1K8RB 2KC1A 4BKSD 2YLMA 3B0AA 2M4NA 2RSUA 4AOFA 3DVGX 2J7QB 3B08A 1OEYJ 3VUWA 4NJ6A 4BBNC 2OOBB 1WMHB 2J0JA 3V6CB 3NHEB 5E6PA 2ZNVB 1TBEA 3APDA 2KN5A 2PE9A 2KTRA 4IM2A 5AZFA 3WAPA 3VTVA 4JGHB 2DYBA 4E3CA 5AZHA 2KX0A 1WZ0A 2DHZA 4LJPB 4MELA 3SU8X 4WQOB 3U8ZA 3WA0A 4GDKA 3TIXA 1GNUA 3ZDTA 1I35A 2KHWB 3ZNZB 2HE7A 4HPMB 2DYOA 4HK2A 3X23A 3ZO5B 3EECA 2JUOA 4AWJA 3HIZA 1E7VA 2D07B 2K39A 3PRPB 2IO0B 2RGFA 4W9JA 2KLCA 3R7QA 5KHQA 2FCMA 3C0RB 1E7UA 4NQLB 3WALA 3A4RA 2ASQA 2BF8B 2L3ZA 3L13A 2NPTA 4EKUA 4WWPA 4ANXA 2JF5A 2R2OA 3AULA 3V60A 2GBKA 3ALBA 2ZZPB 3CF6E 2UWQA 3DVGY 4WJQA 5D94A 5TR5A 3DPDA 2LD9A 1UELA 2RPQA 3CSTA 4CYEA 2KDIA 4HWIB 2D10A 2D3GA 3JVZX 4W9DA 3ZNID 4K81A 4ZDVA 4NJ7A 5G55A 2D2QA 4TQ0A 4A3OA 4HDQA 4MJSA 3UF8A 2N9XA 3QX1A 2HD5B 2V1YA 3JYUA 2L00B 2CU1A 2PEAA 1LXDA 1GJZA 3QQ8B 2C7HA 2CR5A 4RMAA 3QHTA 1NI2A 4XC2A 2GOWA 2I1JA 3L0WB 3KH0A 2LXAA 1WI0A 4JL9A 3DBHI 2LVQA 4KSLC 2AEHA 4DHZE 3UGBB 3ZRFA 3VVWB 3P2BA 3VUXA 3RYTA 2K6QA 3RUIB 4IUMB 2KC2A 1SE9A 2DZKA 2KMCA 1SIFA 2KOXA 1WGYA 2LGXA 3ZW3A 4BFRA 5L95C 4B6WA 2ZPYA 3M95A 2REXA 4GU2A 2MBHA 3VTWA 4I6LB 3N32A 1Z2MA 5CHFA 3WANA 3KUZA 3PPAA 2MWSB 1PQSA 3DBSA 2FIFA 2KK8A 2MW5A 3D32A 4IM3A 1UH6A 2ZNVC 3NS8A 2NR2A 1OTRB 2KFKA 3DDCB 4B95A 2KJRA 1WIAA 2I1KA 3BINA 4EZKA 2LJ5A 2N4FA 4WAAA 2CHXA 3DVNU 4IWPA 1V6EA 3UIOB 2D11A 2LXCA 3KYDD 4GDLB 2MA9B 3ONSA 5J17A 1R4NI 4KDIC 3QCAA 3U7DA 1Q0WB 2XEWA 4NPNA 1IYFA 2KJHB 4ICVA 3IFWB 3OJ4B 3PSEB 3H6NA 4BBNF 4DXAB 4NNJB 5FR6A 4EZLA 3VFKA 3L08A 2JVCA 3PRZA 3UIPB 2KXJA 3HHMA 4NAWA 2C7NB 2IY1B 4MGKE 3A9JA 4A3PA 1IPGA 1J0GA 1WXSA 3A1QA 1EF5A 1OEYA 2KQSA 2ZEQA 4MH0E 1EF1A 4II2B 2J0KA 4FULA 3RZFA 2RR9A 2IBIB 2O2VA 4K7WA 1WM3A 3N3KB 2KDFB 4W9GA 1VCBA 3I3TB 3NOBA 2KMAA 2G4SA 1SGHA 2DZIA 3GOEA 4OVUA 3R66C 1WYWB 1AARA 1C3TA 4IWOA 2M0XA 2GBNA 3DVNV 1R4MI 1WX7A 3KW5B 2L8JA 4ASWC 4E71A 1P98A 2KJ6A 1YX6B 4ZRIA 1V5TA 2DAFA 1WR1A 1VD2A 2L0FA 2VRRB 2HTHA 1E8YA 2BKRB 3QARA 4MEMA 4FJZA 5DPWA 1P9DU 1HE8A 1V5OA 1UBIA 4F7ZA 3VH3B 2O6VA 4EOYA 2MBOA 1E8XA 4FHJA 4G3XB 4RM9A 3DOWA 4LDTB 2ZJDA 2WX1A 3K9OB 3ZNGC 2L7RA 4ZYNA 2KLGA 4BOSC 4M8NA 1Q5WB 4GMVA 4WJNA 4HXDA 4MGZE 3VH4B 1EO6A 1Y8RC 3VTUA 4DHZB 2Z0DB 2MRPA 5D6JB 4WWOA 1E8WA 3H7SA 3JSVB 3TJPA 3U30A 3AI5A 3IHPC 3PT2B 3QIJA 5EDSA 3PHWB 3ZTCA 2NVUI 2A4ZA 3APCA 4DHJD 2CHZA 2XBBC 3AU5A 3SHQA 2FNJB 2MBBB 5JH5C 4IC7B 1WJ6A 3RCZA 2IO2B 2M1MA 2A5UA 2K8HA 1WRDB 4EEWA 4DDID 1WXVA 3WAMA 2K1FA 4FLHA 3W1SA 3UINB 2AWTA 4BVUC 2KKCA 1M94A 2KFJA 1LFDA 3H7PB 3M63B 4W9KA 2LVPA 4IM0A 5E6OA 3PGEA 3V61A 2KTRB 1V49A 4EFOA 4RM8A 2N1WA 4KZ0A 4BKSA 3L54A 1KM7A 2LWPA 1WE6A 3ML8A 4GDKB 1XD3B 2JY6A 4KIKA 2K8CA 1WXMA 4ICUA 2GBMA 3PZDA 2JRHA 4XX5A 3NZSA 3ZUNA 1I42A 3WAOA 1E90A 3BY4B 3EC8A 3KUCB 4FBJB 2NS5A 1YD8U 1V9JA 5LLIA 1T0YA 5J18A 3RULA 4IW0A 3DCGA 5BO4B 3Q3JA 1U4AA 2NPTB 3R7RA 4TV3A 1OQYA 3ZKJC 3QK0A 1OGWA 2CS4A 2JRIB 2RD0A 2EMSA 3DBRI 3PREA 4TKNA 1V2YA 2FCNA 3DQVA 3VHTC 3QJZA 2IYDB 2J0MA 4G50A 4DK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BWE S;  2ZCB A;  2GBR A;  3O65 B;  4LJO B;  5HKH A;  1WZ3 A;  3MTN B;  1V81 A;  4G0N B;  4MM3 A;  2KNB A;  4LDT D;  1WGH A;  4HPL B;  3W1Y A;  2KDB A;  3M3J A;  2Y5B B;  3ECI A;  2IY0 B;  4W9C A;  4MJS B;  3S2A A;  1J8C A;  4FJV B;  4NQK E;  1JRU A;  3VQI A;  3ZRC A;  5CX3 A;  4G11 A;  4KSK C;  4LCD E;  2FCQ A;  2G45 B;  1XQQ A;  3NY5 A;  4K7U A;  2JZ3 B;  2HJ8 A;  3T9L A;  1XT9 B;  3ZLZ A;  2BYV E;  2PE6 B;  4DHJ B;  4GGQ A;  2C5L C;  5JHA A;  1KOT A;  4AP4 C;  1WE7 A;  3VDZ A;  2KVR A;  3NZU A;  3PTF C;  4XZ4 A;  1V86 A;  2FCS A;  5DPS A;  1TGZ B;  3N30 A;  4KZC A;  4HCN B;  2G4D B;  2LI5 A;  2LVO A;  1WJU A;  2N9E B;  3ZIM A;  2XK5 A;  2Z0E B;  3H9D A;  2KWC A;  3RD2 A;  3EHV A;  1CMX B;  3UQB A;  1KJT A;  2V3S A;  4BKT A;  3ZVV A;  1X1M A;  2KTF A;  1EUV B;  3A9K A;  2K8B A;  4AUQ C;  5IA7 A;  2KFK B;  4GN1 A;  3PHX B;  4M0W B;  3OAW A;  1WX8 A;  2MLB A;  1H4R A;  2DZJ A;  3QWZ B;  2PPH A;  4GOC A;  4N9F 4;  1WMH A;  4AJW A;  1NDD A;  1E5W A;  2AYO B;  2KQ7 A;  3B1L X;  1GC6 A;  2LGD A;  4I6P A;  2BWF A;  4ANW A;  4DWF A;  1QZE A;  2AL3 A;  3VAW A;  2N1V A;  4FA6 A;  2WWZ A;  3CSF A;  1WJN A;  3PV1 A;  5CHW A;  4MSQ B;  3VXW A;  3QC8 B;  4GIV A;  2DAJ A;  2Z59 B;  3OLM D;  4BKG A;  2L76 A;  3LDZ E;  4WWN A;  1WFY A;  1WF9 A;  3PLV A;  1RAX A;  3GZN I;  3RZW C;  2JT4 B;  2WX0 A;  1ZW7 A;  4NAW B;  4DDG D;  1D3Z A;  3APF A;  4CHK A;  2JZZ A;  3IG3 A;  1Q1O A;  2MP2 B;  1YQB A;  3A1Q B;  5D7G A;  3SDL C;  3WIM A;  1S1Q B;  2CHW A;  2K25 A;  5C1Z A;  2LGY A;  4EZJ A;  1YIW A;  2ZVO A;  3PRM B;  2JXX A;  4JQW C;  4BOZ B;  3TMP B;  2FAZ A;  4P7I A;  3V62 A;  2C60 A;  4ANV A;  2MBE A;  3PLU A;  2R2Q A;  3H1U A;  1WXA A;  3H7P A;  5DPT A;  5CTR C;  2BKF A;  2M8S A;  4KVG B;  4E74 A;  3LJ3 A;  1BT0 A;  4HVB A;  2KZR A;  3KYC D;  3QAQ A;  4F8C B;  3AXC A;  1GUA B;  4K7S A;  4HJK A;  1IP9 A;  1S3S G;  4IWQ A;  1F9J A;  2YVC A;  4PS8 A;  2O6V B;  2M17 A;  1RFA A;  3L17 A;  2NBW B;  4W9H A;  1WR6 E;  3ML9 A;  1YJ1 A;  4I6N B;  1C1Y B;  5J2R A;  2JPH A;  3A33 B;  4WJP A;  2FUH B;  5DCN A;  1NBF C;  1P1A A;  4HLE A;  2NBU A;  1WJ4 A;  4DBG A;  3ZDM C;  3UQA A;  1ZKH A;  4B9K A;  4MGY E;  3RT3 B;  4GSW A;  2MBQ A;  1FXT B;  2W9N A;  2BYF A;  1Z5S B;  2MSE D;  2LRU A;  4JLC A;  1P3Q U;  4MSM B;  3DBL I;  3R3M A;  2C7M B;  2ZPN A;  2KAN A;  3JW0 X;  5LXH A;  2NCN A;  4KDL B;  2AL6 A;  1V80 A;  4A20 A;  5DPR A;  3ENE A;  5AEK B;  4GDL A;  2LAS A;  1TZ1 A;  1WY8 A;  2C9W B;  2WYQ A;  2LZ6 A;  4OVV A;  1RLF A;  1H8C A;  1L7Y A;  3EFU A;  3IVF A;  1UZX B;  5JZE B;  4PS3 A;  2CKH B;  3ZNH B;  2ZCC A;  2ZVN A;  4FJY A;  4AJY B;  1E8Z A;  1GG3 A;  3M62 B;  4KIK B;  5CHV C;  5KHO A;  3ZTD A;  1L2N A;  2WDT B;  2KWV B;  1WGG A;  4PYU A;  2QHO A;  2EKE C;  1WH3 A;  5C23 A;  3K9P B;  2IZV B;  2KDE B;  2PJH A;  1UD7 A;  1UBQ A;  3HK0 A;  4PS7 A;  1MG8 A;  3V6E B;  4EUT A;  4MDK E;  2G3Q B;  4IG7 B;  3A4S C;  1G6J A;  1KLV A;  4ZRJ A;  4W9I A;  4II3 B;  1GC7 A;  4TUU A;  4W9L A;  4URK A;  2L0T A;  2DYM A;  3Q3F A;  4MGI E;  4GXB A;  4GB9 A;  2BPS A;  5AZG A;  1WM2 A;  2OJR A;  2IO1 B;  4HDO A;  4ANU A;  3CMM B;  3KVF B;  3PVL A;  4FN2 A;  4J6I A;  1WGD A;  3L10 B;  2BGF A;  2KWU B;  4W9F A;  4FAD A;  4NY0 A;  4YL8 A;  4M8M A;  2MQJ A;  3L16 A;  2O6V D;  5LXI B;  1UGM A;  3QA8 A;  2K6D B;  1LM8 B;  2LUE A;  4PYZ A;  4KV2 A;  4W9E A;  2MCN B;  2UYZ B;  5D2M B;  2KD0 A;  2IO3 B;  3AU4 A;  2N9P C;  4F1S A;  5L83 A;  5G2N A;  3IBE A;  4CO7 A;  3TCA A;  1WX9 A;  2GMI C;  3MHS D;  2NBV B;  5E6N A;  4ZRK A;  2KO3 A;  4K1R B;  2N7E A;  3KUD B;  2MP2 A;  4FHK A;  4JIO U;  3SD5 A;  2LRW A;  2DEN B;  2DX5 B;  1J19 A;  2L05 A;  2BYE A;  3VUY A;  5IAA C;  1TTN A;  3PS6 A;  4HCP B;  2EMT A;  2V4L A;  3TL5 A;  1ISN A;  1RRB A;  1YX5 B;  2N7D A;  5JHB A;  3A9J B;  3TBL D;  3JSV A;  1P0R A;  4TQ1 A;  1WGR A;  2B3A A;  3MJW A;  2JWZ A;  2MX2 A;  3OJ3 A;  5GMV A;  2XK5 B;  3HM6 X;  3T8M A;  3X0W A;  2DZM A;  3W1S C;  1A5R A;  4WJO A;  3HM3 A;  2FID A;  2O2V B;  2GBJ A;  1ZGU B;  4X57 B;  1LQB A;  3A9K B;  2KX3 A;  1K8R B;  2KC1 A;  4BKS D;  2YLM A;  3B0A A;  2M4N A;  2RSU A;  4AOF A;  3DVG X;  2J7Q B;  3B08 A;  1OEY J;  3VUW A;  4NJ6 A;  4BBN C;  2OOB B;  1WMH B;  2J0J A;  3V6C B;  3NHE B;  5E6P A;  2ZNV B;  1TBE A;  3APD A;  2KN5 A;  2PE9 A;  2KTR A;  4IM2 A;  5AZF A;  3WAP A;  3VTV A;  4JGH B;  2DYB A;  4E3C A;  5AZH A;  2KX0 A;  1WZ0 A;  2DHZ A;  4LJP B;  4MEL A;  3SU8 X;  4WQO B;  3U8Z A;  3WA0 A;  4GDK A;  3TIX A;  1GNU A;  3ZDT A;  1I35 A;  2KHW B;  3ZNZ B;  2HE7 A;  4HPM B;  2DYO A;  4HK2 A;  3X23 A;  3ZO5 B;  3EEC A;  2JUO A;  4AWJ A;  3HIZ A;  1E7V A;  2D07 B;  2K39 A;  3PRP B;  2IO0 B;  2RGF A;  4W9J A;  2KLC A;  3R7Q A;  5KHQ A;  2FCM A;  3C0R B;  1E7U A;  4NQL B;  3WAL A;  3A4R A;  2ASQ A;  2BF8 B;  2L3Z A;  3L13 A;  2NPT A;  4EKU A;  4WWP A;  4ANX A;  2JF5 A;  2R2O A;  3AUL A;  3V60 A;  2GBK A;  3ALB A;  2ZZP B;  3CF6 E;  2UWQ A;  3DVG Y;  4WJQ A;  5D94 A;  5TR5 A;  3DPD A;  2LD9 A;  1UEL A;  2RPQ A;  3CST A;  4CYE A;  2KDI A;  4HWI B;  2D10 A;  2D3G A;  3JVZ X;  4W9D A;  3ZNI D;  4K81 A;  4ZDV A;  4NJ7 A;  5G55 A;  2D2Q A;  4TQ0 A;  4A3O A;  4HDQ A;  4MJS A;  3UF8 A;  2N9X A;  3QX1 A;  2HD5 B;  2V1Y A;  3JYU A;  2L00 B;  2CU1 A;  2PEA A;  1LXD A;  1GJZ A;  3QQ8 B;  2C7H A;  2CR5 A;  4RMA A;  3QHT A;  1NI2 A;  4XC2 A;  2GOW A;  2I1J A;  3L0W B;  3KH0 A;  2LXA A;  1WI0 A;  4JL9 A;  3DBH I;  2LVQ A;  4KSL C;  2AEH A;  4DHZ E;  3UGB B;  3ZRF A;  3VVW B;  3P2B A;  3VUX A;  3RYT A;  2K6Q A;  3RUI B;  4IUM B;  2KC2 A;  1SE9 A;  2DZK A;  2KMC A;  1SIF A;  2KOX A;  1WGY A;  2LGX A;  3ZW3 A;  4BFR A;  5L95 C;  4B6W A;  2ZPY A;  3M95 A;  2REX A;  4GU2 A;  2MBH A;  3VTW A;  4I6L B;  3N32 A;  1Z2M A;  5CHF A;  3WAN A;  3KUZ A;  3PPA A;  2MWS B;  1PQS A;  3DBS A;  2FIF A;  2KK8 A;  2MW5 A;  3D32 A;  4IM3 A;  1UH6 A;  2ZNV C;  3NS8 A;  2NR2 A;  1OTR B;  2KFK A;  3DDC B;  4B95 A;  2KJR A;  1WIA A;  2I1K A;  3BIN A;  4EZK A;  2LJ5 A;  2N4F A;  4WAA A;  2CHX A;  3DVN U;  4IWP A;  1V6E A;  3UIO B;  2D11 A;  2LXC A;  3KYD D;  4GDL B;  2MA9 B;  3ONS A;  5J17 A;  1R4N I;  4KDI C;  3QCA A;  3U7D A;  1Q0W B;  2XEW A;  4NPN A;  1IYF A;  2KJH B;  4ICV A;  3IFW B;  3OJ4 B;  3PSE B;  3H6N A;  4BBN F;  4DXA B;  4NNJ B;  5FR6 A;  4EZL A;  3VFK A;  3L08 A;  2JVC A;  3PRZ A;  3UIP B;  2KXJ A;  3HHM A;  4NAW A;  2C7N B;  2IY1 B;  4MGK E;  3A9J A;  4A3P A;  1IPG A;  1J0G A;  1WXS A;  3A1Q A;  1EF5 A;  1OEY A;  2KQS A;  2ZEQ A;  4MH0 E;  1EF1 A;  4II2 B;  2J0K A;  4FUL A;  3RZF A;  2RR9 A;  2IBI B;  2O2V A;  4K7W A;  1WM3 A;  3N3K B;  2KDF B;  4W9G A;  1VCB A;  3I3T B;  3NOB A;  2KMA A;  2G4S A;  1SGH A;  2DZI A;  3GOE A;  4OVU A;  3R66 C;  1WYW B;  1AAR A;  1C3T A;  4IWO A;  2M0X A;  2GBN A;  3DVN V;  1R4M I;  1WX7 A;  3KW5 B;  2L8J A;  4ASW C;  4E71 A;  1P98 A;  2KJ6 A;  1YX6 B;  4ZRI A;  1V5T A;  2DAF A;  1WR1 A;  1VD2 A;  2L0F A;  2VRR B;  2HTH A;  1E8Y A;  2BKR B;  3QAR A;  4MEM A;  4FJZ A;  5DPW A;  1P9D U;  1HE8 A;  1V5O A;  1UBI A;  4F7Z A;  3VH3 B;  2O6V A;  4EOY A;  2MBO A;  1E8X A;  4FHJ A;  4G3X B;  4RM9 A;  3DOW A;  4LDT B;  2ZJD A;  2WX1 A;  3K9O B;  3ZNG C;  2L7R A;  4ZYN A;  2KLG A;  4BOS C;  4M8N A;  1Q5W B;  4GMV A;  4WJN A;  4HXD A;  4MGZ E;  3VH4 B;  1EO6 A;  1Y8R C;  3VTU A;  4DHZ B;  2Z0D B;  2MRP A;  5D6J B;  4WWO A;  1E8W A;  3H7S A;  3JSV B;  3TJP A;  3U30 A;  3AI5 A;  3IHP C;  3PT2 B;  3QIJ A;  5EDS A;  3PHW B;  3ZTC A;  2NVU I;  2A4Z A;  3APC A;  4DHJ D;  2CHZ A;  2XBB C;  3AU5 A;  3SHQ A;  2FNJ B;  2MBB B;  5JH5 C;  4IC7 B;  1WJ6 A;  3RCZ A;  2IO2 B;  2M1M A;  2A5U A;  2K8H A;  1WRD B;  4EEW A;  4DDI D;  1WXV A;  3WAM A;  2K1F A;  4FLH A;  3W1S A;  3UIN B;  2AWT A;  4BVU C;  2KKC A;  1M94 A;  2KFJ A;  1LFD A;  3H7P B;  3M63 B;  4W9K A;  2LVP A;  4IM0 A;  5E6O A;  3PGE A;  3V61 A;  2KTR B;  1V49 A;  4EFO A;  4RM8 A;  2N1W A;  4KZ0 A;  4BKS A;  3L54 A;  1KM7 A;  2LWP A;  1WE6 A;  3ML8 A;  4GDK B;  1XD3 B;  2JY6 A;  4KIK A;  2K8C A;  1WXM A;  4ICU A;  2GBM A;  3PZD A;  2JRH A;  4XX5 A;  3NZS A;  3ZUN A;  1I42 A;  3WAO A;  1E90 A;  3BY4 B;  3EC8 A;  3KUC B;  4FBJ B;  2NS5 A;  1YD8 U;  1V9J A;  5LLI A;  1T0Y A;  5J18 A;  3RUL A;  4IW0 A;  3DCG A;  5BO4 B;  3Q3J A;  1U4A A;  2NPT B;  3R7R A;  4TV3 A;  1OQY A;  3ZKJ C;  3QK0 A;  1OGW A;  2CS4 A;  2JRI B;  2RD0 A;  2EMS A;  3DBR I;  3PRE A;  4TKN A;  1V2Y A;  2FCN A;  3DQV A;  3VHT C;  3QJZ A;  2IYD B;  2J0M A;  4G50 A;  4DK5 A; 
#chains in the Genus database with same CATH topology
 5HFY A;  1Q10 A;  3MTN B;  3IT6 B;  2KNB A;  1F52 A;  2JYE A;  3W1Y A;  3M3J A;  2Y5B B;  1J8C A;  3SFD B;  1GOZ A;  5CX3 A;  1UWM A;  4G11 A;  3N1Y C;  2HJ8 A;  3T9L A;  1XT9 B;  1V1O A;  1JRO A;  3RNC C;  5JHA A;  4AP4 C;  1WE7 A;  3NZU A;  4XZ4 A;  1V86 A;  1TS5 A;  3E56 A;  2TSS A;  3TEY A;  1XCT L;  3AE6 B;  5BYQ A;  3ABV B;  4BKT A;  3VRB B;  3EUB 2;  3P4R B;  2IGG A;  2K8B A;  4RF1 A;  5IA7 A;  2KFK B;  3PHX B;  5I4D A;  3OAW A;  3ZGZ A;  2MLB A;  1H4R A;  2PPH A;  2KQ7 A;  1E5W A;  2LGD A;  4I6P A;  4ANW A;  1QZE A;  3VAW A;  1SE3 A;  2N1V A;  1QT9 A;  4FA6 A;  2WWZ A;  1WJN A;  3AEG B;  3PV1 A;  5CHW A;  4LTU A;  3VXW A;  3QC8 B;  3N1Z C;  4GIV A;  1QOB A;  1WFY A;  2GRI A;  1RAX A;  2PKO A;  3RZW C;  3AE3 B;  2E3T A;  1ZW7 A;  4NAW B;  3NZ3 A;  2JZZ A;  1Q1O A;  2MP2 B;  2K25 A;  3SR6 A;  5C1Z A;  3TEW A;  2ZVO A;  3PRM B;  4JQW C;  2JYT A;  2K0P A;  3DHH C;  1HTQ A;  3Q8C A;  5DPT A;  5CTR C;  2BKF A;  4HKQ A;  3LJ3 A;  1BT0 A;  4JWU C;  2DNF A;  2YVC A;  2M17 A;  2WP9 B;  4ZRP A;  4WJP A;  4LNK A;  2NBU A;  1ZKH A;  3RPF C;  2BYF A;  2LRU A;  3NS1 A;  3DBL I;  3R3M A;  2ZPN A;  4BAX A;  2N0S B;  3JW0 X;  5LXH A;  4KDL B;  4GDL A;  1TZ1 A;  2WYQ A;  2LZ6 A;  3O13 A;  1RLF A;  3NVZ A;  1H8C A;  1BML C;  2CKH B;  1PDX A;  4FJY A;  1E8Z A;  1GG3 A;  3M62 B;  1HXY D;  2QHO A;  3K9P B;  1UD7 A;  3HK0 A;  2MJD A;  2OHF A;  3C8Y A;  3EFC A;  1T6B X;  4ZRJ A;  4L2Y A;  2XN9 C;  4TUU A;  1GB1 A;  4MGI E;  5AZG A;  2OJR A;  2J42 A;  1WGD A;  2BGF A;  2O6V D;  1UGM A;  2K6D B;  3RNA C;  2DLB A;  1QQR A;  2KD0 A;  2SEB D;  1C4P A;  5GXG B;  2GB1 A;  4CO7 A;  4DXF A;  2WXO A;  4PT5 A;  2KO3 A;  4HRO A;  3KUD B;  3HRD D;  2JZP A;  1PGX A;  2DX5 B;  3GZN B;  4HCP B;  1RRB A;  1YX5 B;  2N7D A;  1P0R A;  2K3U A;  2B3A A;  4KGT A;  3T8M A;  3HM3 A;  4ZOH C;  2GBJ A;  2KC1 A;  2WXK A;  3B0A A;  2I38 A;  1D5M C;  4ARC A;  1T0S C;  3Q2A C;  3V6C B;  1FM0 D;  2ZNV B;  2KN5 A;  2PE9 A;  3VTV A;  2DYB A;  5AZH A;  2I2Y A;  1T0R C;  3NJT A;  1GNU A;  3ZDT A;  2KHW B;  4H2A A;  2UU7 A;  3R8B A;  2DYO A;  1JRP A;  2D5G A;  3OWE B;  4AWJ A;  3U52 E;  5H92 C;  4LK0 M;  2WXR A;  3PRP B;  3R7Q A;  1ZOY B;  3AE7 B;  2ASQ A;  2L3Z A;  2JF5 A;  3AUL A;  5D94 A;  1MHH E;  3CST A;  4CYE A;  1FFV A;  2KDI A;  3B9J A;  4HWI B;  2D10 A;  2N9K A;  4ZDV A;  2HTM E;  3UF8 A;  4YSX B;  2L00 B;  1GJZ A;  1EWY C;  3LB8 C;  2Y3A A;  1K51 A;  2I1J A;  1VRA B;  3AE8 B;  2KN4 A;  3KH0 A;  1HTO A;  3DWM A;  2LVQ A;  4KSL C;  4DHZ E;  1XLQ A;  1FRD A;  3VVW B;  3P2B A;  4XDC A;  3VUX A;  3RUI B;  1EM7 A;  1SE9 A;  5IN7 A;  2LMC A;  4BFR A;  1PFD A;  5L95 C;  3N32 A;  1Z2M A;  5CHF A;  3WAN A;  2NMQ A;  3PPA A;  2MWS B;  1PQS A;  2BVC A;  2QIL A;  3B2G A;  3NS8 A;  1OTR B;  3DDC B;  4S0R A;  4B95 A;  2KJR A;  3BIN A;  4JE3 B;  2CHX A;  2E6X A;  2LXC A;  2MA9 B;  5J17 A;  1IYF A;  2XEW A;  1SIJ A;  2KJH B;  4ICV A;  3PSE B;  3H6N A;  1KFY B;  3VFK A;  4ARI A;  1QOG A;  2PIA A;  1UUP A;  4KKI A;  1HQR D;  1WXS A;  1ZUD 2;  2ZEQ A;  1OEY A;  5AUK A;  1EF1 A;  4II2 B;  1K50 A;  1SE4 A;  1A70 A;  4KGS A;  1F2R C;  3NOB A;  3R2I A;  2BTE A;  1QKZ A;  3ZJT A;  1JWA D;  2MHJ A;  4ZRI A;  4YTN B;  1WR1 A;  1UGJ A;  1E8Y A;  3QAR A;  1QOF A;  1QF6 A;  3VH3 B;  1GPX A;  4EOY A;  2MBO A;  2WX1 A;  5H8Y E;  4ZYN A;  2KLG A;  4BOS C;  4M8N A;  2ICI A;  1Y8R C;  3VTU A;  2J52 A;  1FMA D;  1FEH A;  2Z0D B;  4A6Q A;  1AN8 A;  2QMT A;  2CU3 A;  3U30 A;  4O1N A;  3QIJ A;  3PHW B;  1F77 A;  2A4Z A;  4DHJ D;  2CHZ A;  3RNF C;  2X8X X;  3SHQ A;  4LNF A;  2W54 A;  2IO2 B;  2AQ2 B;  1FD6 A;  3C19 A;  2LJI A;  1WRD B;  3WAM A;  2K1F A;  4XGA B;  3UIN B;  1LFD A;  4YTP B;  2LVP A;  1V49 A;  4TSS A;  2CJO A;  1DOY A;  2WXI A;  3L54 A;  3BYT B;  2K8C A;  1I4R A;  3PZD A;  1I42 A;  3WAO A;  1E90 A;  2PLP A;  3V05 A;  1NEN B;  1V9J A;  2VZK D;  2V0G A;  3DCG A;  5BO4 B;  1U4A A;  3URY A;  1OQY A;  1OGW A;  2CS4 A;  4UDU C;  2RD0 A;  2WDV B;  1OQQ A;  1J7A A;  3ZXV A;  4LJO B;  1TIF A;  4G0N B;  1FCC C;  2FE8 A;  2KDB A;  4OZC A;  3ECI A;  1Y56 A;  4W9C A;  4MJS B;  3S2A A;  2Z8L A;  1JRU A;  3VQI A;  1UWX A;  2W82 A;  1XQQ A;  2BYV E;  1C79 A;  1V8C A;  2FUG 1;  4N59 A;  2KMM A;  3VDZ A;  1SSN A;  2FCS A;  1TGZ B;  1YN5 A;  1WJU A;  1WRI A;  2L83 A;  2N9E B;  2KWD A;  2XK5 A;  3RD2 A;  1KLG D;  1CMX B;  1KJT A;  2L32 A;  2KTF A;  5HHD G;  3UI3 A;  4GN1 A;  3BVM A;  1WX8 A;  2DZJ A;  3QWZ B;  4N9F 4;  3VR8 B;  5HG2 A;  1NYR A;  3AE5 B;  3FIL B;  2LUM A;  2AL3 A;  2VH1 A;  4ACF A;  2L76 A;  3LDZ E;  3PLV A;  3V3X A;  2JT4 B;  1XO3 A;  3APF A;  3A1Q B;  2W55 A;  3WIM A;  1ET6 A;  1S1Q B;  4US8 A;  2WXM A;  2WXQ A;  2WHI A;  1CK1 A;  1V1P A;  2LGY A;  2N7J A;  4M00 A;  1YIW A;  3AV8 A;  3TMP B;  4P7I A;  2Y5C A;  2MBE A;  3Q3O C;  4B0E A;  2ONQ A;  4KVG B;  5TSS A;  4E74 A;  4HVB A;  3KYC D;  3QAQ A;  2INN E;  3AXC A;  2EEL A;  2O6V B;  1RFA A;  5G5G A;  2NBW B;  1WR6 E;  2M56 B;  2BW2 A;  3N1X C;  3PZ8 A;  1YJ1 A;  1MI0 A;  5J2R A;  2G9H D;  3A33 B;  2FUH B;  5DCN A;  1WJ4 A;  3ZDM C;  2EKI A;  3RT3 B;  3AN1 A;  1JCK B;  1FNV A;  1FXT B;  1PUT A;  3CWI A;  1L0X B;  3SFE B;  4JLC A;  1F2R I;  4IDI A;  4R3D A;  4DXG A;  2KAN A;  3E9S A;  2ZW0 A;  2NCN A;  3DBR B;  3W9C B;  3H8H A;  3I63 C;  3GE3 C;  4A20 A;  5DPR A;  2C9W B;  1YQ4 B;  1FXA A;  3P63 A;  3TEX A;  5JZE B;  4PS3 A;  5MPO A;  2K9X A;  4AJY B;  4LNI A;  1VR9 A;  4KIK B;  5KHO A;  1CZP A;  2WDT B;  2KWV B;  4P1B C;  2MJ3 A;  4PYU A;  1DYQ A;  2IZV B;  2KDE B;  2PJH A;  4N58 A;  4PS7 A;  4IG7 B;  4II3 B;  1ZPS A;  4W9L A;  3Q3F A;  4GXB A;  4GB9 A;  1VLB A;  1WM2 A;  2GI9 A;  4HDO A;  3CMM B;  3KVF B;  4FN2 A;  4J6I A;  1L6V A;  4NY0 A;  4YL8 A;  3Q3M C;  5LXI B;  1LM8 B;  3P4Q B;  1C77 A;  3MHZ A;  4LNN A;  5D2M B;  1KH0 A;  1D4B A;  4XYC A;  3AU4 A;  4F1S A;  1JML A;  1TY0 A;  3IBE A;  2NBV B;  2BQQ A;  2MP2 A;  3SD5 A;  5BMH A;  3ZJU A;  1ZE3 D;  2LRW A;  4XE0 A;  5BMG A;  2L05 A;  2BYE A;  1TTN A;  3TL5 A;  5JHB A;  3JSV A;  5BMI A;  4TQ1 A;  3HM6 X;  3X0W A;  1MHX A;  1SXT A;  2FID A;  2O2V B;  2W3R A;  1ZGU B;  4X57 B;  3W5U B;  1K8R B;  1E6E B;  2YLM A;  2RSU A;  1OEY J;  2K22 A;  1XLP A;  4KGR A;  4BBN C;  5E6P A;  3RNG C;  4RH6 A;  2KTR A;  4IM2 A;  4JGH B;  2DHZ A;  4MEL A;  3WA0 A;  2WDQ B;  4GDK A;  2D3B A;  1FXI A;  4USA A;  1BXT A;  3ZNZ B;  4HPM B;  4KKJ A;  3X23 A;  3EEC A;  2JUO A;  2D07 B;  2IO0 B;  2WNM A;  3C0R B;  3WAL A;  2ON8 A;  4L1B A;  4WWP A;  2R2O A;  3V60 A;  2DBY A;  2ZZP B;  3AEA B;  4YWG G;  4ZRQ A;  4YSZ B;  2RPQ A;  3ZNI D;  5G55 A;  3DBL B;  1IBX A;  4A90 A;  2HD5 B;  4RMA A;  2WXP A;  2LEK A;  3L0W B;  2IGH A;  2JX5 A;  2LXA A;  1WI0 A;  1ROE A;  3DBH I;  4NJC A;  4XWT A;  2K6Q A;  3ZYY X;  1TYG B;  1SIF A;  3RFZ B;  1WGY A;  5EE9 A;  1C9F A;  4B6W A;  2ZPY A;  4GU2 A;  2REX A;  2MBH A;  3VTW A;  4I6L B;  3KUZ A;  5BYR A;  3DBS A;  2MW5 A;  4IM3 A;  1UH6 A;  1BUI C;  1MVK A;  1J7B A;  4M0W A;  2I1K A;  1P7F A;  3DVN U;  4IWP A;  3UIO B;  1IGD A;  2WLB A;  4GDL B;  4KDI C;  1Q0W B;  1DOI A;  3IFW B;  1TZO A;  4NNJ B;  1YN4 A;  4AS1 A;  2JVC A;  3UIP B;  2KXJ A;  1TS3 A;  2C7N B;  3Q6B A;  1AWD A;  1J0G A;  1KLU D;  4MH0 E;  3GB1 A;  2WQY B;  2J0K A;  4FUL A;  3RZF A;  3J9C A;  3N3K B;  1TT5 B;  2KDF B;  4MT5 A;  4W9G A;  4C4V B;  4M01 A;  1MPE A;  1SGH A;  3R66 C;  3Q14 C;  2KVZ A;  1C3T A;  2M0X A;  1R4M I;  4ASW C;  1R4M B;  2L8J A;  4DQO C;  2PMV A;  2VRR B;  1YJJ A;  4B0M A;  4PK1 A;  4ZHP A;  1P9D U;  1V5O A;  1RWS A;  4G3X B;  4KX6 B;  2WXN A;  3K9O B;  3ETR A;  1Q5W B;  4GMV A;  3DHI C;  3VH4 B;  1I7H A;  3NRZ A;  4WWO A;  5HI1 A;  1I4Q A;  2BB5 A;  3PT2 B;  2WXH A;  3Q69 A;  2OJW A;  1T5X D;  4YTM B;  3AU5 A;  5JH5 C;  4IC7 B;  3RCZ A;  2A5U A;  4LLG M;  4DDI D;  1RYJ A;  2AQ1 B;  2RDH A;  4BVU C;  3H7P B;  2HDE A;  5E6O A;  2WXG A;  4EFO A;  1WE6 A;  4MH8 A;  1LGR A;  2NS5 A;  4JPS A;  1XCQ L;  5LLI A;  2MEK A;  1JWB D;  4TV3 A;  3W2D A;  3ZKJ C;  1TS4 A;  3QK0 A;  3PRE A;  1V2Y A;  3VHT C;  2IYD B;  2J0M A;  4G50 A;  1MFW A;  4WWM A;  2KT7 A;  2BWE S;  2GBR A;  3AED B;  3O65 B;  5HKH A;  1WZ3 A;  3GS2 A;  1QOA A;  4MM3 A;  4HJG E;  1WGH A;  4HPL B;  4LDT D;  2RPV A;  2BS3 B;  1GAQ B;  4HKZ E;  4FJV B;  3ZRC A;  2QEJ C;  2ACZ B;  3NY5 A;  1JW9 D;  1TY2 A;  3T3N A;  3ZLZ A;  3RMK C;  2PE6 B;  5LNK 1;  4CQN A;  2C5L C;  4S17 A;  3LXF A;  1KOT A;  3PTF C;  5DPS A;  3N30 A;  2LI5 A;  1F1H A;  2LVO A;  2RMM A;  2G1E A;  3GP7 A;  1TKE A;  3AEB B;  2Z0E B;  4L23 A;  3H9D A;  2KWC A;  1FNU A;  2WXL A;  3ZVV A;  3AEF B;  3A9K A;  4AUQ C;  1TKG A;  2SAK A;  1NYQ A;  3KQ4 A;  1LO5 D;  3KWV A;  4GOC A;  1WMH A;  1N63 A;  4AJW A;  3Q8F A;  2GLS A;  1I4P A;  1D6E C;  5G5H A;  4IOI E;  2DAJ A;  2Z59 B;  3OLM D;  4BKG A;  4WWN A;  2WX0 A;  2QJL A;  4DDG D;  4CHK A;  3IG3 A;  3BK2 A;  5FKA C;  3SDL C;  2KAJ A;  1PYW D;  3NVW A;  2YEP B;  1E10 A;  3HVZ A;  3PLU A;  3H1U A;  4C56 C;  2LGI A;  4RGM A;  3MC9 A;  1CJE A;  5BYS A;  1SJE D;  2KZR A;  1GB4 A;  3L4P A;  4YXD B;  3FC4 A;  1GUA B;  3AE9 B;  4HJK A;  1IP9 A;  2XNA C;  4IWQ A;  4PS8 A;  2M0A A;  3CIR B;  3DWG C;  2JXT A;  3L17 A;  2BT6 A;  4I6N B;  1ACC A;  1NBF C;  1P1A A;  4HLE A;  4DBG A;  3UQA A;  1L5P A;  4MGY E;  3BVG A;  3U2S C;  4N6E B;  4US9 A;  2KAC A;  2C7M B;  3BVZ A;  1T0Q C;  2IDY A;  2H88 B;  1ET9 A;  5AEK B;  2LAS A;  1WY8 A;  1B1Z A;  4OVV A;  3KWL A;  3EFU A;  1FNW A;  3IVF A;  2KQ4 X;  2ZCC A;  2ZVN A;  3BWU D;  5IOI A;  1L0V B;  3AMZ A;  3VR9 B;  3TEZ A;  4NZL B;  3RN9 C;  5C23 A;  3GE8 C;  2D3A A;  4WAF A;  3N20 C;  1UBQ A;  1MG8 A;  3V6E B;  4EUT A;  4MDK E;  2G3Q B;  3A4S C;  1G6J A;  1KLV A;  4W9I A;  4URK A;  1PGB A;  3ZXR A;  4ANU A;  4OHJ A;  3L10 B;  4W9F A;  1OQR A;  2MQJ A;  3L16 A;  2NTS A;  2LUE A;  2V4I B;  4PYZ A;  4W9E A;  2MCN B;  2UYZ B;  2VH2 A;  3AE2 B;  2IO3 B;  5L83 A;  1ZP0 B;  1WX9 A;  1ZDV A;  5E6N A;  1YNT E;  2BBC A;  4GLS C;  3SEB A;  1N5W A;  4WUR A;  4FHK A;  4JIO U;  1C4C A;  2DEN B;  4D2K A;  3VUY A;  2QCZ A;  5IAA C;  2FBW B;  1IGC A;  3PS6 A;  2V4L A;  2M19 A;  3A9J B;  4NAM A;  3MJW A;  3IXS A;  2MX2 A;  3OJ3 A;  2XK5 B;  4WH4 A;  1KRH A;  2QDF A;  2KX3 A;  5EE1 A;  2M4N A;  2WU5 B;  5D3I B;  3DVG X;  4AOF A;  3I5J C;  1T3Q A;  2J0J A;  2LGS A;  4HEA 1;  3APD A;  2INP E;  4P16 A;  1AW7 A;  4E3C A;  1WZ0 A;  3U8Z A;  3SU8 X;  4WQO B;  4BZA A;  4WIP A;  2HE7 A;  2PW9 A;  3LYY A;  4HK2 A;  1N5X A;  3I9V 1;  3HIZ A;  4W9J A;  3Q8E A;  4REZ A;  4P1C C;  4NQL B;  1V1P B;  2BF8 B;  2NPT A;  3WCQ A;  4EKU A;  4ANX A;  2GBK A;  2UWQ A;  1UF0 A;  5TR5 A;  2LD9 A;  4ITK A;  1DOX A;  2MH7 A;  2D3G A;  4W9D A;  4K81 A;  3P4S B;  4TQ0 A;  4HDQ A;  1TJE A;  2DWQ A;  4C80 A;  3AE4 B;  2N9X A;  2V1Y A;  2CU1 A;  2PEA A;  1LXD A;  3QQ8 B;  2C7H A;  3AB5 A;  3QHT A;  1JWU D;  1L0Y B;  1ZXI A;  4JL9 A;  2WXF A;  2AEH A;  3UGB B;  4XWW A;  4JWS C;  3RYT A;  1VJK A;  2KC2 A;  2DZK A;  5IO9 A;  1VZ8 A;  2WGS A;  2LGX A;  3ZW3 A;  3RI7 C;  2PTL A;  2FIF A;  2KK8 A;  3D32 A;  3DHG C;  3PO0 A;  2ZNV C;  1ZXH A;  4QAY A;  2NR2 A;  2KFK A;  1WIA A;  1TKY A;  3RNB C;  2N4F A;  3AE1 B;  1V6E A;  3KYD D;  1SEB D;  3ONS A;  3QCA A;  4NPN A;  1VZ7 A;  2Y5P A;  4BBN F;  4DXA B;  5FR6 A;  3PRZ A;  3HHM A;  4NAW A;  4MGK E;  4A3P A;  2IPK D;  2IND C;  1EF5 A;  2KQS A;  1VZ6 A;  2KDM A;  1YOV B;  2Q5W D;  2O2V A;  2W3S A;  3I3T B;  4ZHO A;  1YQ3 B;  2KMA A;  2G4S A;  2DZI A;  3GOE A;  2LHE A;  1AAR A;  2JQR B;  2V3P A;  1MG4 A;  1YN3 A;  4IWO A;  3DVN V;  3NG0 A;  1WX7 A;  1P98 A;  2KJ6 A;  1YX6 B;  1V5T A;  1C78 A;  1VD2 A;  3TUO A;  2BKR B;  2L1A A;  4MEM A;  4FJZ A;  4F7Z A;  2MJE A;  1WXQ A;  4FHJ A;  1E8X A;  4LDT B;  2ZJD A;  3FKY A;  5AUI A;  1YJI A;  3ZNG C;  4HXD A;  4MGZ E;  2D3C A;  1EO6 A;  5D6J B;  3H7S A;  3JSV B;  3TJP A;  3AI5 A;  3MC0 B;  3IHP C;  5EDS A;  4HRS A;  5T8I A;  5IKC M;  2XBB C;  2FNJ B;  2MBB B;  2YEP F;  1DGJ A;  4C7Y A;  4RGT A;  4TMA B;  2M1M A;  4RF0 A;  5C2T B;  1WXV A;  4FLH A;  1M94 A;  2AX5 A;  1M4V A;  3M63 B;  3PGE A;  4MAC A;  2KTR B;  2N1W A;  4KZ0 A;  4BKS A;  2LWP A;  4GDK B;  2L52 A;  1QIL A;  4ICU A;  2GBM A;  3ZUN A;  3NZS A;  3EC8 A;  3KUC B;  1YD8 U;  3DBH B;  1T0Y A;  5J18 A;  4IW0 A;  3Q3J A;  3R7R A;  4TKN A;  2FCN A;  3QJZ A;  2RDG A;  2ZCB A;  1V81 A;  5E6J A;  2IJ0 A;  1D5Z C;  2IY0 B;  1IBX B;  4NQK E;  3Q3N C;  4KSK C;  4LCD E;  2FCQ A;  2G45 B;  4K7U A;  2JZ3 B;  2WU2 B;  1I4X A;  2LFI A;  3AM9 A;  3U7Z A;  4DHJ B;  4GGQ A;  2KVR A;  1K52 A;  3RNE C;  4YT0 B;  3Q8B A;  4IKG A;  4KZC A;  4HCN B;  4C4V A;  2G4D B;  4RGN A;  4AQ7 A;  2JU6 X;  5JXV A;  1NI3 A;  3ZIM A;  1WGK A;  3EHV A;  3UQB A;  5FK9 C;  1E0Z A;  2V3S A;  1TS2 A;  1X1M A;  2ZW1 A;  1EUV B;  2IGD A;  4M0W B;  4RNA A;  1WYG A;  3B2F A;  1NDD A;  1C76 A;  2AYO B;  3B1L X;  2H89 B;  1GC6 A;  2BWF A;  2VZK B;  4DWF A;  3IT4 B;  3CSF A;  4A9A A;  4MSQ B;  1MJD A;  1WF9 A;  3GZN I;  1L4Z B;  1UNS A;  2K5P A;  3T3O A;  1D3Z A;  4LNO A;  1YQB A;  5D7G A;  1I4H A;  2QSD A;  2CHW A;  3AEE B;  2BYT A;  4EZJ A;  1XEE A;  2AQ3 B;  2JXX A;  4BOZ B;  2FAZ A;  3V62 A;  2C60 A;  2BS2 B;  3EA6 A;  2R2Q A;  1WXA A;  3H7P A;  1FPY A;  4XDD A;  2M8S A;  2NTT A;  3AH7 A;  1OFF A;  3PZ7 A;  4F8C B;  2J4X A;  5D3D A;  4K7S A;  1S3S G;  1F9J A;  5IP4 D;  4W9H A;  1WWT A;  3ML9 A;  1C1Y B;  3U4E G;  2JPH A;  1XF5 L;  1KTK A;  1C4A A;  3P4P B;  4B9K A;  4GSW A;  2MBQ A;  2W9N A;  4OZB A;  1Z5S B;  4C00 A;  2MSE D;  1K53 A;  1P3Q U;  4MSM B;  3HVD A;  1B9R A;  3NVV A;  3TSS A;  2AL6 A;  1AYF A;  1V80 A;  3ENE A;  4Q2J A;  1FCL A;  1E9M A;  1L7Y A;  1SBB B;  1UZX B;  3ZNH B;  3NUH B;  1N60 A;  4ZYS A;  1L6U A;  5CHV C;  3ZTD A;  3IAM 1;  1L2N A;  1RFK A;  1WGG A;  5EE3 A;  5FR3 A;  2EKE C;  1WH3 A;  1SE2 A;  1FO4 A;  1GC7 A;  3R2T A;  2L0T A;  2DYM A;  2BPS A;  4RFB A;  2IO1 B;  3PVL A;  4A55 A;  2KWU B;  4FAD A;  4M8M A;  4MM3 B;  3VRA B;  3QA8 A;  4KV2 A;  2QIE B;  3BYY B;  1V97 A;  3P42 A;  2RDB C;  1PGA A;  2N9P C;  3FAH A;  5G2N A;  3TCA A;  2GMI C;  3MHS D;  2N9L A;  4ZRK A;  1JWS D;  4K1R B;  2N7E A;  3P1M A;  2INC C;  1J19 A;  1QLB B;  3MP9 A;  2EMT A;  1ISN A;  5EE0 A;  3TBL D;  4K3C A;  1E7P B;  3MJ5 A;  1WGR A;  2JWZ A;  5GMV A;  2DZM A;  3W1S C;  1A5R A;  4WJO A;  2PVO D;  1EU3 A;  1LQB A;  3A9K B;  3MFG A;  3ZJV A;  4BKS D;  3N9Y C;  2J7Q B;  4OVZ A;  3B08 A;  4EE2 A;  3VUW A;  4NJ6 A;  2OOB B;  1WMH B;  3NHE B;  1N61 A;  1TBE A;  3WAP A;  5AZF A;  5C3J B;  1CQV A;  1ZDX A;  2KX0 A;  4LJP B;  1JQ4 A;  1I35 A;  3TIX A;  3ZO5 B;  2HJ1 A;  1NVI D;  1E7V A;  3MC8 A;  2K39 A;  4WQM A;  2RGF A;  2KLC A;  1STE A;  5KHQ A;  4OZA A;  2FCM A;  1E7U A;  3A4R A;  3L13 A;  3AEC B;  1N6Z A;  3ALB A;  3CF6 E;  4WJQ A;  3DVG Y;  1XLO A;  3DPD A;  1UEL A;  2V9H A;  3JVZ X;  4JX1 C;  2OED A;  4NJ7 A;  2D2Q A;  1FIQ A;  4A3O A;  4MJS A;  3QX1 A;  3JYU A;  4YSY B;  2CR5 A;  1YMH E;  1NI2 A;  4XC2 A;  2GOW A;  1JWM D;  3ZQ4 A;  3ZRF A;  1XLN A;  2QC8 A;  4IUM B;  2KMC A;  3BK1 A;  3EGR A;  3W5V B;  4C7Z A;  1FFU A;  1L4D B;  2KOX A;  3M95 A;  2B76 B;  4P6V F;  2WDR B;  3Q8A A;  4EZK A;  2LJ5 A;  4WAA A;  2D11 A;  1ENF A;  1F0Z A;  3FIL A;  1R4N I;  1R4N B;  1IUE A;  3U7D A;  1RM6 C;  3OJ4 B;  3OG5 A;  1JAL A;  4EZL A;  3L08 A;  2JWU A;  2IY1 B;  3A9J A;  1NEK B;  1IPG A;  3NVY A;  3A1Q A;  1SF0 A;  1HEZ E;  2RR9 A;  2IBI B;  1R7S A;  4K7W A;  1WM3 A;  1SJH D;  3IAS 1;  1VCB A;  2KYW A;  4OVU A;  1WYW B;  4M02 A;  2GBN A;  3KW5 B;  4E71 A;  3KLS X;  3BZD B;  2DAF A;  2L0F A;  2HTH A;  4RCO A;  5DPW A;  1EWC A;  1HE8 A;  1UBI A;  2O6V A;  4RM9 A;  3DOW A;  2L7R A;  4WJN A;  4DHZ B;  1EU4 A;  3I57 A;  2MRP A;  1P7E A;  1E8W A;  1D5X C;  1FRR A;  3ZTC A;  4HPP A;  1N62 A;  1WSP A;  2NVU I;  4FXC A;  3APC A;  2WXJ A;  1WJ6 A;  1HZ5 A;  1HZ6 A;  2JSV X;  2K8H A;  2WS3 B;  4EEW A;  3W1S A;  2AWT A;  3BII D;  3HUI A;  2KKC A;  2KFJ A;  2R61 A;  4W9K A;  4IM0 A;  3V61 A;  4J3O D;  4OW0 A;  4RM8 A;  4RGO S;  2LHD A;  1KM7 A;  2CJN A;  1ESF A;  2BS4 B;  3ML8 A;  1I4G A;  1XD3 B;  2JY6 A;  4KIK A;  1WXM A;  1XXG A;  2JRH A;  4XX5 A;  3BY4 B;  4FBJ B;  4A8X C;  2BB6 A;  4K3B A;  1VDV A;  1SB3 C;  3RUL A;  2PVG C;  1J7C A;  2NPT B;  2V3N A;  2X38 A;  3DBR I;  4ANV A;  2JRI B;  2EMS A;  3DQV A;  4DK5 A;  2J53 A;  1KF6 B;  1HA5 A; 
#chains in the Genus database with same CATH homology
 2BWE S;  2ZCB A;  2GBR A;  3O65 B;  4LJO B;  5HKH A;  1WZ3 A;  3MTN B;  1V81 A;  4G0N B;  4MM3 A;  2KNB A;  4LDT D;  1WGH A;  4HPL B;  3W1Y A;  2KDB A;  3M3J A;  2Y5B B;  3ECI A;  2IY0 B;  4W9C A;  4MJS B;  3S2A A;  1J8C A;  4FJV B;  4NQK E;  1JRU A;  3VQI A;  3ZRC A;  5CX3 A;  4G11 A;  4KSK C;  4LCD E;  2FCQ A;  2G45 B;  1XQQ A;  3NY5 A;  4K7U A;  2JZ3 B;  2HJ8 A;  3T9L A;  1XT9 B;  3ZLZ A;  2BYV E;  2PE6 B;  4DHJ B;  4GGQ A;  2C5L C;  5JHA A;  1KOT A;  4AP4 C;  1WE7 A;  3VDZ A;  2KVR A;  3NZU A;  3PTF C;  4XZ4 A;  1V86 A;  2FCS A;  5DPS A;  1TGZ B;  3N30 A;  4KZC A;  4HCN B;  2G4D B;  2LI5 A;  2LVO A;  1WJU A;  2N9E B;  3ZIM A;  2XK5 A;  2Z0E B;  3H9D A;  2KWC A;  3RD2 A;  3EHV A;  1CMX B;  3UQB A;  1KJT A;  2V3S A;  4BKT A;  3ZVV A;  1X1M A;  2KTF A;  1EUV B;  3A9K A;  2K8B A;  4AUQ C;  5IA7 A;  2KFK B;  4GN1 A;  3PHX B;  4M0W B;  3OAW A;  1WX8 A;  2MLB A;  1H4R A;  2DZJ A;  3QWZ B;  2PPH A;  4GOC A;  4N9F 4;  1WMH A;  4AJW A;  1NDD A;  1E5W A;  2AYO B;  2KQ7 A;  3B1L X;  1GC6 A;  2LGD A;  4I6P A;  2BWF A;  4ANW A;  4DWF A;  1QZE A;  2AL3 A;  3VAW A;  2N1V A;  4FA6 A;  2WWZ A;  3CSF A;  1WJN A;  3PV1 A;  5CHW A;  4MSQ B;  3VXW A;  3QC8 B;  4GIV A;  2DAJ A;  2Z59 B;  3OLM D;  4BKG A;  2L76 A;  3LDZ E;  4WWN A;  1WFY A;  1WF9 A;  3PLV A;  1RAX A;  3GZN I;  3RZW C;  2JT4 B;  2WX0 A;  1ZW7 A;  4NAW B;  4DDG D;  1D3Z A;  3APF A;  4CHK A;  2JZZ A;  3IG3 A;  1Q1O A;  2MP2 B;  1YQB A;  3A1Q B;  5D7G A;  3SDL C;  3WIM A;  1S1Q B;  2CHW A;  2K25 A;  5C1Z A;  2LGY A;  4EZJ A;  1YIW A;  2ZVO A;  3PRM B;  2JXX A;  4JQW C;  4BOZ B;  3TMP B;  2FAZ A;  4P7I A;  3V62 A;  2C60 A;  4ANV A;  2MBE A;  3PLU A;  2R2Q A;  3H1U A;  1WXA A;  3H7P A;  5DPT A;  5CTR C;  2BKF A;  2M8S A;  4KVG B;  4E74 A;  3LJ3 A;  1BT0 A;  4HVB A;  2KZR A;  3KYC D;  3QAQ A;  4F8C B;  3AXC A;  1GUA B;  4K7S A;  4HJK A;  1IP9 A;  1S3S G;  4IWQ A;  1F9J A;  2YVC A;  4PS8 A;  2O6V B;  2M17 A;  1RFA A;  3L17 A;  2NBW B;  4W9H A;  1WR6 E;  3ML9 A;  1YJ1 A;  4I6N B;  1C1Y B;  5J2R A;  2JPH A;  3A33 B;  4WJP A;  2FUH B;  5DCN A;  1NBF C;  1P1A A;  4HLE A;  2NBU A;  1WJ4 A;  4DBG A;  3ZDM C;  3UQA A;  1ZKH A;  4B9K A;  4MGY E;  3RT3 B;  4GSW A;  2MBQ A;  1FXT B;  2W9N A;  2BYF A;  1Z5S B;  2MSE D;  2LRU A;  4JLC A;  1P3Q U;  4MSM B;  3DBL I;  3R3M A;  2C7M B;  2ZPN A;  2KAN A;  3JW0 X;  5LXH A;  2NCN A;  4KDL B;  2AL6 A;  1V80 A;  4A20 A;  5DPR A;  3ENE A;  5AEK B;  4GDL A;  2LAS A;  1TZ1 A;  1WY8 A;  2C9W B;  2WYQ A;  2LZ6 A;  4OVV A;  1RLF A;  1H8C A;  1L7Y A;  3EFU A;  3IVF A;  1UZX B;  5JZE B;  4PS3 A;  2CKH B;  3ZNH B;  2ZCC A;  2ZVN A;  4FJY A;  4AJY B;  1E8Z A;  1GG3 A;  3M62 B;  4KIK B;  5CHV C;  5KHO A;  3ZTD A;  1L2N A;  2WDT B;  2KWV B;  1WGG A;  4PYU A;  2QHO A;  2EKE C;  1WH3 A;  5C23 A;  3K9P B;  2IZV B;  2KDE B;  2PJH A;  1UD7 A;  1UBQ A;  3HK0 A;  4PS7 A;  1MG8 A;  3V6E B;  4EUT A;  4MDK E;  2G3Q B;  4IG7 B;  3A4S C;  1G6J A;  1KLV A;  4ZRJ A;  4W9I A;  4II3 B;  1GC7 A;  4TUU A;  4W9L A;  4URK A;  2L0T A;  2DYM A;  3Q3F A;  4MGI E;  4GXB A;  4GB9 A;  2BPS A;  5AZG A;  1WM2 A;  2OJR A;  2IO1 B;  4HDO A;  4ANU A;  3CMM B;  3KVF B;  3PVL A;  4FN2 A;  4J6I A;  1WGD A;  3L10 B;  2BGF A;  2KWU B;  4W9F A;  4FAD A;  4NY0 A;  4YL8 A;  4M8M A;  2MQJ A;  3L16 A;  2O6V D;  5LXI B;  1UGM A;  3QA8 A;  2K6D B;  1LM8 B;  2LUE A;  4PYZ A;  4KV2 A;  4W9E A;  2MCN B;  2UYZ B;  5D2M B;  2KD0 A;  2IO3 B;  3AU4 A;  2N9P C;  4F1S A;  5L83 A;  5G2N A;  3IBE A;  4CO7 A;  3TCA A;  1WX9 A;  2GMI C;  3MHS D;  2NBV B;  5E6N A;  4ZRK A;  2KO3 A;  4K1R B;  2N7E A;  3KUD B;  2MP2 A;  4FHK A;  4JIO U;  3SD5 A;  2LRW A;  2DEN B;  2DX5 B;  1J19 A;  2L05 A;  2BYE A;  3VUY A;  5IAA C;  1TTN A;  3PS6 A;  4HCP B;  2EMT A;  2V4L A;  3TL5 A;  1ISN A;  1RRB A;  1YX5 B;  2N7D A;  5JHB A;  3A9J B;  3TBL D;  3JSV A;  1P0R A;  4TQ1 A;  1WGR A;  2B3A A;  3MJW A;  2JWZ A;  2MX2 A;  3OJ3 A;  5GMV A;  2XK5 B;  3HM6 X;  3T8M A;  3X0W A;  2DZM A;  3W1S C;  1A5R A;  4WJO A;  3HM3 A;  2FID A;  2O2V B;  2GBJ A;  1ZGU B;  4X57 B;  1LQB A;  3A9K B;  2KX3 A;  1K8R B;  2KC1 A;  4BKS D;  2YLM A;  3B0A A;  2M4N A;  2RSU A;  4AOF A;  3DVG X;  2J7Q B;  3B08 A;  1OEY J;  3VUW A;  4NJ6 A;  4BBN C;  2OOB B;  1WMH B;  2J0J A;  3V6C B;  3NHE B;  5E6P A;  2ZNV B;  1TBE A;  3APD A;  2KN5 A;  2PE9 A;  2KTR A;  4IM2 A;  5AZF A;  3WAP A;  3VTV A;  4JGH B;  2DYB A;  4E3C A;  5AZH A;  2KX0 A;  1WZ0 A;  2DHZ A;  4LJP B;  4MEL A;  3SU8 X;  4WQO B;  3U8Z A;  3WA0 A;  4GDK A;  3TIX A;  1GNU A;  3ZDT A;  1I35 A;  2KHW B;  3ZNZ B;  2HE7 A;  4HPM B;  2DYO A;  4HK2 A;  3X23 A;  3ZO5 B;  3EEC A;  2JUO A;  4AWJ A;  3HIZ A;  1E7V A;  2D07 B;  2K39 A;  3PRP B;  2IO0 B;  2RGF A;  4W9J A;  2KLC A;  3R7Q A;  5KHQ A;  2FCM A;  3C0R B;  1E7U A;  4NQL B;  3WAL A;  3A4R A;  2ASQ A;  2BF8 B;  2L3Z A;  3L13 A;  2NPT A;  4EKU A;  4WWP A;  4ANX A;  2JF5 A;  2R2O A;  3AUL A;  3V60 A;  2GBK A;  3ALB A;  2ZZP B;  3CF6 E;  2UWQ A;  3DVG Y;  4WJQ A;  5D94 A;  5TR5 A;  3DPD A;  2LD9 A;  1UEL A;  2RPQ A;  3CST A;  4CYE A;  2KDI A;  4HWI B;  2D10 A;  2D3G A;  3JVZ X;  4W9D A;  3ZNI D;  4K81 A;  4ZDV A;  4NJ7 A;  5G55 A;  2D2Q A;  4TQ0 A;  4A3O A;  4HDQ A;  4MJS A;  3UF8 A;  2N9X A;  3QX1 A;  2HD5 B;  2V1Y A;  3JYU A;  2L00 B;  2CU1 A;  2PEA A;  1LXD A;  1GJZ A;  3QQ8 B;  2C7H A;  2CR5 A;  4RMA A;  3QHT A;  1NI2 A;  4XC2 A;  2GOW A;  2I1J A;  3L0W B;  3KH0 A;  2LXA A;  1WI0 A;  4JL9 A;  3DBH I;  2LVQ A;  4KSL C;  2AEH A;  4DHZ E;  3UGB B;  3ZRF A;  3VVW B;  3P2B A;  3VUX A;  3RYT A;  2K6Q A;  3RUI B;  4IUM B;  2KC2 A;  1SE9 A;  2DZK A;  2KMC A;  1SIF A;  2KOX A;  1WGY A;  2LGX A;  3ZW3 A;  4BFR A;  5L95 C;  4B6W A;  2ZPY A;  3M95 A;  2REX A;  4GU2 A;  2MBH A;  3VTW A;  4I6L B;  3N32 A;  1Z2M A;  5CHF A;  3WAN A;  3KUZ A;  3PPA A;  2MWS B;  1PQS A;  3DBS A;  2FIF A;  2KK8 A;  2MW5 A;  3D32 A;  4IM3 A;  1UH6 A;  2ZNV C;  3NS8 A;  2NR2 A;  1OTR B;  2KFK A;  3DDC B;  4B95 A;  2KJR A;  1WIA A;  2I1K A;  3BIN A;  4EZK A;  2LJ5 A;  2N4F A;  4WAA A;  2CHX A;  3DVN U;  4IWP A;  1V6E A;  3UIO B;  2D11 A;  2LXC A;  3KYD D;  4GDL B;  2MA9 B;  3ONS A;  5J17 A;  1R4N I;  4KDI C;  3QCA A;  3U7D A;  1Q0W B;  2XEW A;  4NPN A;  1IYF A;  2KJH B;  4ICV A;  3IFW B;  3OJ4 B;  3PSE B;  3H6N A;  4BBN F;  4DXA B;  4NNJ B;  5FR6 A;  4EZL A;  3VFK A;  3L08 A;  2JVC A;  3PRZ A;  3UIP B;  2KXJ A;  3HHM A;  4NAW A;  2C7N B;  2IY1 B;  4MGK E;  3A9J A;  4A3P A;  1IPG A;  1J0G A;  1WXS A;  3A1Q A;  1EF5 A;  1OEY A;  2KQS A;  2ZEQ A;  4MH0 E;  1EF1 A;  4II2 B;  2J0K A;  4FUL A;  3RZF A;  2RR9 A;  2IBI B;  2O2V A;  4K7W A;  1WM3 A;  3N3K B;  2KDF B;  4W9G A;  1VCB A;  3I3T B;  3NOB A;  2KMA A;  2G4S A;  1SGH A;  2DZI A;  3GOE A;  4OVU A;  3R66 C;  1WYW B;  1AAR A;  1C3T A;  4IWO A;  2M0X A;  2GBN A;  3DVN V;  1R4M I;  1WX7 A;  3KW5 B;  2L8J A;  4ASW C;  4E71 A;  1P98 A;  2KJ6 A;  1YX6 B;  4ZRI A;  1V5T A;  2DAF A;  1WR1 A;  1VD2 A;  2L0F A;  2VRR B;  2HTH A;  1E8Y A;  2BKR B;  3QAR A;  4MEM A;  4FJZ A;  5DPW A;  1P9D U;  1HE8 A;  1V5O A;  1UBI A;  4F7Z A;  3VH3 B;  2O6V A;  4EOY A;  2MBO A;  1E8X A;  4FHJ A;  4G3X B;  4RM9 A;  3DOW A;  4LDT B;  2ZJD A;  2WX1 A;  3K9O B;  3ZNG C;  2L7R A;  4ZYN A;  2KLG A;  4BOS C;  4M8N A;  1Q5W B;  4GMV A;  4WJN A;  4HXD A;  4MGZ E;  3VH4 B;  1EO6 A;  1Y8R C;  3VTU A;  4DHZ B;  2Z0D B;  2MRP A;  5D6J B;  4WWO A;  1E8W A;  3H7S A;  3JSV B;  3TJP A;  3U30 A;  3AI5 A;  3IHP C;  3PT2 B;  3QIJ A;  5EDS A;  3PHW B;  3ZTC A;  2NVU I;  2A4Z A;  3APC A;  4DHJ D;  2CHZ A;  2XBB C;  3AU5 A;  3SHQ A;  2FNJ B;  2MBB B;  5JH5 C;  4IC7 B;  1WJ6 A;  3RCZ A;  2IO2 B;  2M1M A;  2A5U A;  2K8H A;  1WRD B;  4EEW A;  4DDI D;  1WXV A;  3WAM A;  2K1F A;  4FLH A;  3W1S A;  3UIN B;  2AWT A;  4BVU C;  2KKC A;  1M94 A;  2KFJ A;  1LFD A;  3H7P B;  3M63 B;  4W9K A;  2LVP A;  4IM0 A;  5E6O A;  3PGE A;  3V61 A;  2KTR B;  1V49 A;  4EFO A;  4RM8 A;  2N1W A;  4KZ0 A;  4BKS A;  3L54 A;  1KM7 A;  2LWP A;  1WE6 A;  3ML8 A;  4GDK B;  1XD3 B;  2JY6 A;  4KIK A;  2K8C A;  1WXM A;  4ICU A;  2GBM A;  3PZD A;  2JRH A;  4XX5 A;  3NZS A;  3ZUN A;  1I42 A;  3WAO A;  1E90 A;  3BY4 B;  3EC8 A;  3KUC B;  4FBJ B;  2NS5 A;  1YD8 U;  1V9J A;  5LLI A;  1T0Y A;  5J18 A;  3RUL A;  4IW0 A;  3DCG A;  5BO4 B;  3Q3J A;  1U4A A;  2NPT B;  3R7R A;  4TV3 A;  1OQY A;  3ZKJ C;  3QK0 A;  1OGW A;  2CS4 A;  2JRI B;  2RD0 A;  2EMS A;  3DBR I;  3PRE A;  4TKN A;  1V2Y A;  2FCN A;  3DQV A;  3VHT C;  3QJZ A;  2IYD B;  2J0M A;  4G50 A;  4DK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...