1V86A

Solution structure of the ubiquitin domain from mouse d7wsu128e protein
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
95
structure length
95
Chain Sequence
GSSGSSGDAGGGVGKELVDLKIIWNKTKHDVKVPLDSTGSELKQKIHSITGLPPAMQKVMYKGLVPEDKTLREIKVTSGAKIMVVGSTISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the ubiquitin domain from mouse D7Wsu128e protein
rcsb
source organism Mus musculus
molecule tags Structural genomics, unknown function
molecule keywords DNA segment, Chr 7, Wayne State University 128, expressed
total genus 11
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2003-12-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 1v86A00
3M63B 4DBGA 3BINA 2MA9B 2M17A 4KDIC 3PZDA 5CTRC 4W9EA 1WJUA 1GJZA 2NPTA 3PPAA 2DYBA 2G4SA 3PSEB 3WALA 3GOEA 4ANXA 2C7MB 2JY6A 2KFJA 2FCSA 2KTRB 3B1LX 2KJ6A 4MDKE 3JW0X 2MLBA 1IP9A 2KX0A 2KXJA 3QCAA 1WF9A 2JRIB 4FULA 2CHWA 3RCZA 2KKCA 4DDID 3NZSA 1AARA 4E3CA 1WGYA 2K1FA 2MBOA 4EZJA 1BT0A 3ZO5B 4AJYB 2KC1A 1P9DU 3CSTA 1XD3B 3KYCD 2KDEB 3PGEA 2G3QB 4NQKE 2JWZA 3KW5B 3RZFA 4KV2A 3QX1A 4LJOB 4MGIE 3ZTDA 1E8WA 2MW5A 1YQBA 4K7WA 1OQYA 5LXIB 2KANA 3UQBA 1TBEA 1YIWA 1YX5B 3QIJA 2W9NA 4K81A 3JSVB 4HDOA 3H7PB 2ZPYA 2C7NB 2IBIB 1R4MI 1V49A 2KWCA 3PRMB 3WANA 2XEWA 1NBFC 3T8MA 4IWOA 2OOBB 5JZEB 2PE9A 3PHXB 2MCNB 4W9FA 1WJNA 1G6JA 2BYEA 3DBHI 1C1YB 1WM3A 4B95A 1UBIA 3KVFB 4RMAA 2BGFA 4WJPA 2BYFA 3DVGX 2O6VD 3T9LA 3ENEA 1WGHA 5IA7A 2UYZB 2A5UA 3M95A 2ZNVB 4A3OA 1ZW7A 2L7RA 4G50A 2CKHB 2RR9A 4URKA 2AEHA 5D7GA 5J17A 3VDZA 2KOXA 2D2QA 1LM8B 1J8CA 5E6OA 2MQJA 1WXVA 2ZEQA 1WXSA 1IPGA 4NPNA 2DHZA 3TL5A 1X1MA 5FR6A 3TMPB 3VUYA 2V4LA 2VRRB 3A1QB 2DENB 3W1YA 1UELA 3N3KB 3WAMA 3KH0A 4XZ4A 3IG3A 1Z2MA 3JYUA 2L00B 3NY5A 3NZUA 4HWIB 3A9JB 2GBKA 3UF8A 4K7UA 2PEAA 1A5RA 2K39A 4AUQC 1WI0A 2BWFA 3GZNI 3H7SA 4ICUA 4GDLA 4IM2A 5DPRA 4BFRA 2DAFA 4ICVA 3N32A 4GDLB 2FNJB 4PYUA 2FUHB 5LXHA 1RLFA 1L7YA 1WJ6A 3R66C 4CYEA 3JVZX 2LXAA 2NBUA 4ANWA 2KDBA 1E8XA 4W9IA 4EEWA 2KLGA 2D11A 2NBVB 2KVRA 4I6LB 3UIPB 4RM9A 2MX2A 4MEMA 2K6QA 3U30A 1ISNA 3PTFC 3DBSA 2BKFA 3ALBA 1JRUA 2AYOB 4W9LA 2K8CA 3OLMD 1WIAA 5G2NA 3VUXA 3VUWA 4DHZE 4OVVA 3OJ4B 3HM6X 1WGRA 2FIFA 4BOZB 1WE7A 2JRHA 4IWPA 3ZRFA 5KHQA 4OVUA 2K8BA 2KDIA 4IW0A 1WJ4A 3RULA 4AWJA 2A4ZA 4MGZE 4RM8A 4MSMB 3SD5A 4EFOA 5J18A 1V80A 4W9KA 3PS6A 3ZDTA 3B0AA 4ANVA 5TR5A 4KSLC 2YVCA 2D10A 2M4NA 2R2OA 3ZDMC 2C5LC 4DXAB 5AEKB 3H6NA 2IY0B 2K8HA 3AXCA 4BKTA 2N1WA 4M8NA 4WJQA 2DZJA 2I1JA 1P98A 3AULA 4KIKB 2J0JA 2HTHA 3L17A 3B08A 1GUAB 2L0FA 2Z0DB 4BOSC 2NS5A 4ZRIA 1V9JA 1GG3A 4MJSB 5AZFA 5G55A 2KMCA 4IUMB 4FJVB 5DCNA 1ZGUB 3EECA 1EUVB 4HCNB 2BPSA 4FLHA 2YLMA 3TCAA 1LFDA 1TTNA 1KJTA 2JZ3B 3EC8A 2MBQA 3ML9A 4FJYA 3BY4B 4G3XB 2K6DB 3W1SA 3R7QA 1F9JA 2LI5A 2LD9A 4AP4C 2DZMA 2KFKB 3M62B 1WX7A 1WY8A 5JHAA 5J2RA 4GU2A 2IZVB 3ZVVA 1QZEA 1WMHB 1U4AA 2NCNA 4LCDE 1E8ZA 3IHPC 1K8RB 4ANUA 1E7UA 4W9DA 5AZGA 3JSVA 3U8ZA 2NR2A 3PV1A 3PRZA 2LXCA 2FCMA 4GGQA 2DZIA 4EZKA 1GNUA 3DBLI 1J19A 4ASWC 4NAWA 4MH0E 2WX0A 3VH3B 1WXAA 2LRWA 2M1MA 4MGKE 4W9HA 4B9KA 3K9PB 1Q5WB 2L8JA 4ZDVA 1MG8A 3A33B 3DDCB 4XC2A 3U7DA 4TQ0A 2LWPA 2REXA 4DHZB 1OEYJ 1XQQA 2CS4A 2ZCCA 3P2BA 1V5TA 4GDKA 2LUEA 1E5WA 4FHJA 2WDTB 3IBEA 5EDSA 1SGHA 5GMVA 2HE7A 3LJ3A 5CHFA 3ZRCA 4DHJD 4PYZA 3VVWB 2KQSA 4TUUA 2LRUA 3AI5A 2ZCBA 4TKNA 4HLEA 2N9PC 2QHOA 4HVBA 2XBBC 3UIOB 1KLVA 4GOCA 2KN5A 3CF6E 3HHMA 2XK5B 3QQ8B 4M0WB 5IAAC 3VTUA 1GC7A 1WGDA 2CHXA 3MJWA 1I42A 1Q0WB 4KDLB 2ZVNA 3ZNZB 3L13A 4FA6A 3QHTA 3VXWA 4GN1A 3APCA 3OJ3A 2G45B 4B6WA 4F7ZA 3AU5A 4II2B 3A4RA 1S1QB 2N9XA 5LLIA 1YJ1A 2GBMA 3DCGA 3VAWA 4G0NB 3ZNGC 4BBNF 1E8YA 4NAWB 4MJSA 4P7IA 4DK5A 3VTVA 4KZ0A 4E71A 2IO1B 2WWZA 4IC7B 2BWES 1OTRB 4GSWA 2JZZA 4FN2A 2IYDB 2C9WB 2V3SA 4WJNA 2AL6A 4KIKA 2OJRA 3IFWB 2KJHB 3O65B 4NNJB 4TV3A 3PT2B 4TQ1A 3TIXA 3IVFA 5KHOA 4I6NB 3V61A 2ZNVC 2KFKA 3X0WA 1TGZB 4JLCA 1WYWB 2KZRA 2C7HA 1KM7A 3WA0A 4MSQB 5C23A 1D3ZA 1E90A 3NHEB 2XK5A 3UGBB 1ZKHA 3PHWB 4I6PA 3RD2A 1J0GA 3ZNHB 1WMHA 1P1AA 2DYMA 4FADA 3DQVA 2DYOA 1YD8U 4MGYE 1Q1OA 4EOYA 2MBEA 4NJ7A 3A9JA 4N9F4 1WH3A 2HD5B 2FIDA 2LASA 3QK0A 4HPMB 2AWTA 2JVCA 2K25A 4EZLA 2J7QB 2GBNA 2UWQA 1Z5SB 2KX3A 3DOWA 4PS3A 1P3QU 4LDTD 3C0RB 4GDKB 4F1SA 2CHZA 1EF1A 3KYDD 2PPHA 3KUDB 1OEYA 1WFYA 4HCPB 3RT3B 2BYVE 2NVUI 3HK0A 3NOBA 2KJRA 4FHKA 3QC8B 2LGDA 1I35A 3L0WB 4YL8A 3ZUNA 1L2NA 3V62A 2RGFA 1PQSA 1WX9A 5AZHA 3QWZB 3V60A 3Q3FA 2O2VB 3DVNV 3TBLD 1SE9A 4F8CB 2KMAA 4GMVA 1T0YA 1SIFA 4J6IA 1IYFA 5D94A 2D07B 2JXXA 1OGWA 4JQWC 2G4DB 3SHQA 2D3GA 3A4SC 2ASQA 4AOFA 1WGGA 2Y5BB 4EKUA 3M3JA 2DX5B 3UQAA 2J0KA 2EMSA 3PREA 4HJKA 3TJPA 2NPTB 4A3PA 3QARA 3VH4B 4BKSD 4IWQA 2IO0B 2EKEC 2KDFB 3V6CB 2IO2B 2LGYA 2KWVB 1KOTA 3V6EB 4CHKA 3K9OB 5CHVC 4IM3A 2M8SA 2O6VA 2N7DA 2KD0A 4XX5A 2O6VB 5E6NA 2Z59B 4DWFA 1V5OA 3QA8A 1UGMA 4BBNC 2N9EB 2C60A 4NQLB 5C1ZA 5L95C 2MP2A 2ZJDA 5JH5C 2MP2B 3A1QA 1YX6B 2KTRA 2BF8B 2MBHA 2JF5A 2KC2A 2FCNA 1WE6A 1HE8A 3D32A 4NJ6A 4WWPA 5BO4B 1WXMA 4DHJB 3VFKA 1WX8A 2EMTA 4II3B 3KUCB 2L05A 3HM3A 2N1VA 1LQBA 4W9CA 3VTWA 3SU8X 4DDGD 4EUTA 2HJ8A 3PRPB 4GXBA 4G11A 4ZRKA 2KNBA 3H9DA 2O2VA 5CX3A 1WM2A 2B3AA 2MWSB 1RRBA 3WIMA 2KTFA 3LDZE 5L83A 4W9GA 3APFA 2JPHA 3NS8A 4K1RB 3QJZA 2L3ZA 4KZCA 4W9JA 3L16A 1NDDA 5D6JB 1XT9B 3ZKJC 4E74A 3CMMB 1TZ1A 1WR6E 2DAJA 4MELA 3X23A 2LVQA 2CU1A 1UBQA 3PLVA 3L10B 5D2MB 2ZPNA 3Q3JA 5JHBA 3ZIMA 3W1SC 4LDTB 4MM3A 4JL9A 1WRDB 3L08A 3RUIB 3DVNU 3SDLC 5DPSA 3VHTC 4KSKC 3R7RA 1EF5A 1FXTB 1RFAA 4KVGB 1H8CA 2GBJA 3DBRI 1UD7A 2GBRA 1GC6A 2JUOA 1WZ3A 3ECIA 5DPTA 2KO3A 4WJOA 1WR1A 4NY0A 2MRPA 4HXDA 2N7EA 3ML8A 4WWOA 1NI2A 4JIOU 2KQ7A 3MTNB 3OAWA 2ZVOA 3AU4A 4GIVA 3ZTCA 4HPLB 2JT4B 2KK8A 3L54A 4IG7B 2RD0A 1VD2A 1M94A 5HKHA 4AJWA 2CR5A 3DVGY 4WQOB 1UZXB 1VCBA 2IY1B 3KUZA 2BKRB 4GB9A 4ZRJA 4IM0A 2J0MA 4K7SA 3S2AA 2LJ5A 2I1KA 3R3MA 1R4NI 3VQIA 4CO7A 2RSUA 4HK2A 3ZLZA 4PS8A 2WYQA 1V2YA 4ZYNA 2PE6B 2L0TA 3DPDA 2NBWB 2WX1A 2AL3A 5E6PA 3ZW3A 2Z0EB 1H4RA 3APDA 4BVUC 2KWUB 1S3SG 2LGXA 1E7VA 4WAAA 3A9KB 1UH6A 3RYTA 2LZ6A 3A9KA 3ONSA 3WAPA 2GMIC 4M8MA 2ZZPB 1P0RA 2IO3B 1V81A 3ZNID 3MHSD 3PVLA 2N4FA 3N30A 5CHWA 3HIZA 1V86A 2FAZA 2KLCA 5DPWA 3I3TB 3QAQA 4BKSA 2PJHA 2LVPA 4LJPB 4FJZA 1Y8RC 2L76A 2R2QA 4HDQA 3PLUA 3EHVA 1CMXB 4PS7A 4X57B 3RZWC 1EO6A 3UINB 4FBJB 3H7PA 1RAXA 1WZ0A 3H1UA 3EFUA 1LXDA 2MSED 4JGHB 2DZKA 3CSFA 2KHWB 2GOWA 1V6EA 2MBBB 2LVOA 2M0XA 4A20A 2FCQA 4WWNA 1C3TA 2V1YA 3WAOA 2RPQA 4BKGA
chains in the Genus database with same CATH superfamily
2VH1A 3SR6A 2MA9B 2M17A 3ZGZA 4NZLB 1WJUA 2NPTA 1VLBA 2DYBA 4US9A 3WALA 3GOEA 4ZRPA 4J3OD 2KTRB 4PT5A 4PK1A 3IT6B 3JW0X 4OHJA 1LO5D 1IP9A 2KX0A 4C56C 4YXDB 4RCOA 2CHWA 3EFCA 1F1HA 3ZO5B 2KC1A 1P9DU 1QT9A 2G3QB 3RZFA 1P7FA 3QX1A 4LJOB 5HI1A 1KRHA 3ABVB 1XXGA 3UQBA 1TBEA 2WXMA 4HDOA 3H7PB 3WANA 2CJOA 3AMZA 1G6JA 2BYEA 2BYFA 3ENEA 3IAS1 2KACA 4HPPA 2WHIA 4L23A 1ZW7A 4URKA 2CKHB 2RR9A 2BYTA 2QILA 2SEBD 1FEHA 1J8CA 1OFFA 2MQJA 1WXVA 4NPNA 2MJ3A 3TMPB 2HDEA 2V4LA 3AE2B 3W1YA 1DOIA 1QILA 3NVYA 3NY5A 2HJ1A 2GBKA 3UF8A 4AUQC 1T0QC 4ICVA 3AE9B 5BMIA 5IKCM 3JVZX 1VZ8A 2LXAA 2NBUA 3MC8A 1QOBA 3UIPB 1SSNA 1ISNA 3PTFC 2BKFA 2AYOB 1V8CA 2K8CA 1VR9A 4DHZE 2H88B 4OVVA 3OJ4B 1WGRA 2FIFA 1ROEA 2MJEA 1WJ4A 2ICIA 1PUTA 3ZXRA 2I2YA 3Q8CA 5J18A 4IKGA 1IBXB 4ANVA 4KSLC 2YVCA 2M4NA 3ZDMC 2K8HA 4HKQA 1XLQA 2JWUA 4KIKB 4HJGE 2NS5A 1GG3A 3DHGC 1YN4A 1ZGUB 1PGXA 1R4NB 1N6ZA 5FK9C 2JZ3B 3ML9A 4N59A 2IGHA 1F9JA 2LI5A 1I4XA 1UF0A 3M62B 1WX7A 2WXNA 2R61A 4YSYB 3P1MA 5J2RA 1C77A 2IZVB 1WMHB 1U4AA 4W9DA 2H89B 2J52A 2WGSA 2NR2A 1WRIA 2LXCA 1GNUA 4WQMA 2BW2A 4NAWA 2WX0A 2Y5PA 4ACFA 3NG0A 2K9XA 1HTQA 2L8JA 2QEJC 1MG8A 4XC2A 4TQ0A 2CS4A 3FILB 2LUEA 3IBEA 5EDSA 5GMVA 3GB1A 2HE7A 3VVWB 2KQSA 4TUUA 4N58A 3DBLB 2ZCBA 2JYTA 2XBBC 4R3DA 3Q6BA 4XWTA 5AUKA 1CJEA 1GC7A 1GPXA 1WGDA 4KDLB 3APCA 2G45B 4F7ZA 2GBMA 3DCGA 2IJ0A 4NAWB 4MJSA 4IC7B 2WXIA 4FN2A 2C9WB 1BUIC 2AL6A 4KIKA 3J9CA 1KF6B 4REZA 2KJHB 2GLSA 4QAYA 4NNJB 3TIXA 3RFZB 3IVFA 5KHOA 3X0WA 4JLCA 1WYWB 2KZRA 4MSQB 3P63A 4I6PA 3ZNHB 4C7ZA 1P1AA 2LHEA 2J4XA 3GP7A 1YD8U 4MGYE 3U52E 3N1XC 2MBEA 1MHHE 3GS2A 1VZ6A 3A9JA 2PVOD 2LHDA 4N9F4 1WH3A 1XLPA 2LASA 3QK0A 2KDMA 2JVCA 2PMVA 4EZLA 2GBNA 5HG2A 3RNBC 1JWUD 1K51A 1EF1A 3KYDD 2PPHA 1OEYA 4GLSC 2BYVE 2NVUI 2OHFA 4FHKA 5BMHA 3L0WB 3V62A 2G9HD 5AZHA 1ZDVA 2JSVX 3Q3FA 3V60A 3HUIA 4A90A 2KAJA 5D94A 2D07B 4JQWC 2D3GA 2V4IB 2ASQA 4AOFA 2Y5BB 2ZW1A 2J0KA 4HJKA 2AX5A 2NPTB 1SJED 4IWQA 1SJHD 4L1BA 2LGYA 1VZ7A 3AEDB 4IM3A 1AWDA 3UI3A 4XX5A 2O6VB 3R2IA 2N9EB 2C60A 5C1ZA 2MP2A 2ZJDA 4HRSA 3A1QA 1YX6B 2BF8B 2KC2A 4NJ6A 1N62A 1HE8A 2M0AA 3D32A 5BO4B 3W5VB 2EELA 1TS3A 2EMTA 2L05A 1PFDA 2N1VA 1LQBA 2BT6A 1GAQB 4GXBA 2HJ8A 1JALA 3PRPB 4G11A 1NYQA 5CX3A 2B3AA 2KTFA 3LDZE 2JPHA 1JW9D 2XNAC 3QJZA 4KZCA 4HKZE 3DHHC 3ZKJC 1PGAA 4MELA 2Z8LA 3TEYA 3PLVA 3L10B 1L4ZB 3MC9A 2QMTA 3RUIB 3SDLC 2AQ2B 4XGAB 3R7RA 1T6BX 1RFAA 2GBRA 2KO3A 1WR1A 4NY0A 4HXDA 4WWOA 4LNFA 4D2KA 1HXYD 1WYGA 4GIVA 1YN3A 3AU4A 2G1EA 3ZTCA 1VD2A 5HKHA 3B9JA 2LGSA 3DVGY 1NVID 5G5GA 3DBRB 1TT5B 1YN5A 4LNNA 4YSXB 4PS8A 1OQRA 2WYQA 4M01A 2WX1A 4Q2JA 4BVUC 2LGXA 4JE3B 3RYTA 3A9KA 2PKOA 2WXPA 3WAPA 3U7ZA 3ZNID 3HVDA 1V86A 3ZJUA 3I3TB 3QAQA 4LJPB 4FJZA 2R2QA 3W2DA 3EHVA 1J7AA 1CMXB 4PS7A 3I63C 1RAXA 2D5GA 2MSED 2MBBB 1V6EA 1TS5A 2FCQA 1D5XC 3M63B 4RF1A 1V1OA 4KDIC 3PZDA 5CTRC 1FFUA 4W9EA 1NENB 3PPAA 2G4SA 3PSEB 2NMQA 3RNAC 2C7MB 2FCSA 4JWUC 1RYJA 2KJ6A 2MLBA 1N5WA 1WF9A 2JRIB 3BK1A 3RCZA 2ON8A 2L83A 1AARA 4E3CA 1WGYA 2K1FA 4EZJA 1BT0A 3CSTA 2KDEB 3PGEA 1F2RI 4NQKE 3KW5B 1P7EA 4MGIE 3ZTDA 2MW5A 1I4HA 1RFKA 1YX5B 3QIJA 2W9NA 4TMAB 2C7NB 1NBFC 3T8MA 4IWOA 2PE9A 4KKIA 2MCNB 1YQ3B 1WJNA 4MACA 3DBHI 3KVFB 4WJPA 3T3OA 3T9LA 1ENFA 4G50A 3VDZA 4RF0A 3Q69A 1JROA 5E6OA 2LEKA 3RNGC 2VRRB 1UELA 3N3KB 3WAMA 1MI0A 2N7JA 4XZ4A 1SIJA 1XEEA 2D3BA 3A9JB 3R2TA 4HWIB 2GB1A 1BMLC 2K39A 1WI0A 3GZNI 5DPRA 4GDLB 5LXHA 1F2RC 1RLFA 3R66C 3CWIA 2KDBA 2N0SB 4W9IA 1D5ZC 2E3TA 4OZCA 2NBVB 3Q3OC 1XCTL 4MEMA 1TZOA 2JX5A 2PLPA 3RMKC 1TIFA 2VH2A 2V9HA 2RPVA 1FCLA 1JWSD 2K8BA 2WXHA 4YT0B 4MGZE 4MSMB 1V80A 4W9KA 3B0AA 4C4VB 2BVCA 2D10A 4DXAB 4BKTA 2N1WA 4WJQA 4YWGG 3L17A 3B08A 1GUAB 1FIQA 1C4AA 5AZFA 2L1AA 4YTMB 4FJVB 4HEA1 5DCNA 3EECA 1EUVB 4OZAA 2INPE 2W55A 1LFDA 4G3XB 3W1SA 2K6DB 5H92C 1FPYA 3IHPC 1YJJA 1CZPA 2FCMA 1JRPA 1EU4A 1AYFA 1MPEA 4ASWC 2KWDA 1JWAD 4MH0E 3V05A 3AEAB 1WXAA 2LRWA 4W9HA 3RPFC 4KKJA 1Q5WB 5TSSA 4H2AA 3A33B 3U7DA 1OEYJ 2ZCCA 3NZ3A 4WIPA 2PIAA 1LGRA 5BYQA 1FRDA 2PVGC 4DHJD 4PYZA 4L2YA 1QOAA 3GE8C 4TKNA 2N9PC 2QHOA 1ACCA 2KN5A 3CF6E 3HHMA 3QQ8B 4M0WB 5IAAC 1V1PB 1I42A 1Q0WB 3C19A 3L13A 4FA6A 2D3AA 3VXWA 3A4RA 3VAWA 3ZNGC 4BBNF 1E8YA 4MT5A 4GSWA 2JZZA 1ZUD2 3O65B 4TV3A 3PZ7A 4ARCA 2ZNVC 5C23A 1E90A 3NHEB 1STEA 4M0WA 1ZKHA 2MEKA 2UU7A 4OZBA 1L6UA 1Q1OA 4EOYA 4NJ7A 2HD5B 3B2FA 2WU2B 3VR9B 2I38A 4XDDA 2K0PA 2K25A 3EA6A 4PS3A 1P3QU 5T8IA 4LDTD 3C0RB 4GDKB 4F1SA 3RT3B 1WFYA 3HK0A 3NOBA 1R4MB 1HEZE 3PZ8A 2LGDA 4YTNB 4YL8A 2RGFA 1PQSA 1ZXHA 3QWZB 1T0SC 3DVNV 1CQVA 3TBLD 2RDHA 4J6IA 3AE6B 1FNUA 4A6QA 1OGWA 2JXXA 3LXFA 2DX5B 1PDXA 4BZAA 4A3PA 2INNE 1E7PB 4BKSD 3T3NA 2IGDA 2KQ4X 3V6EB 3IAM1 2FBWB 5CHVC 4NAMA 2O6VA 3KLSX 1V5OA 4NQLB 4OW0A 2OEDA 4OVZA 5JH5C 2QJLA 2K3UA 2KTRA 2KMMA 3DHIC 1C79A 3BVMA 1WXMA 2JZPA 3TSSA 1EU3A 1ET6A 1WX8A 3Q2AC 3KUCB 4B0EA 3ETRA 4DDGD 3W9CB 2AQ1B 1N5XA 4ZRKA 3H9DA 3Q8FA 4W9GA 3Q8AA 4K1RB 3Q3NC 1ZE3D 2KN4A 1XT9B 4CQNA 2V3NA 4E74A 3CMMB 3X23A 4RFBA 4BAXA 1UBQA 2ZPNA 4JWSC 3W1SC 4LDTB 1WRDB 3DVNU 5G5HA 5DPSA 1KLUD 4KSKC 2MJDA 4KVGB 2YEPF 1WZ3A 5DPTA 3MP9A 1V97A 1F77A 2N7EA 2KQ7A 3MTNB 3P4SB 3OAWA 3RI7C 2KK8A 3L54A 3Q8BA 2RD0A 2CR5A 2BKRB 4GB9A 3S2AA 2LJ5A 2I1KA 4NJCA 1JMLA 1V2YA 2L52A 4C00A 2L0TA 2NBWB 1FM0D 5E6PA 2Z0EB 1H4RA 2QCZA 3APDA 3TEXA 4WAAA 1E7VA 3A9KB 4LK0M 1VRAB 1NEKB 3ONSA 4M8MA 5C3JB 2WXGA 1FFVA 4MH8A 2W82A 3HIZA 1ZDXA 4ZYSA 1ZXIA 1K53A 5IP4D 4KX6B 3UINB 3BYTB 2WXJA 3H1UA 2DNFA 2KHWB 3AE5B 2GOWA 2M0XA 2D3CA 3NJTA 4A20A 4WWNA 3WCQA 3WAOA 4DBGA 3BINA 1GJZA 4ANXA 2JY6A 2INDC 4MDKE 1GB4A 4MM3B 3U4EG 3QCAA 4FULA 2X8XX 4DDID 1SF0A 1L0YB 3DWGC 3P42A 1KLGD 2WXKA 3KYCD 3OWEB 1ZOYB 4LLGM 5E6JA 1E8WA 2LJIA 3OG5A 2KANA 2N9KA 4K81A 3JSVB 2INCC 2ZPYA 5D3IB 2IBIB 1XCQL 1V49A 1R4MI 4AQ7A 1NI3A 1WXQA 2OOBB 3PHXB 1C1YB 4WAFA 4B95A 4HROA 1A70A 3DVGX 2O6VD 2WU5B 3M95A 2ZNVB 2L7RA 2YEPB 2KOXA 1QKZA 2M56B 2ZEQA 1WXSA 1IPGA 2DHZA 3TL5A 1FNVA 2N9LA 5FR6A 3VUYA 3BVZA 3DBHB 3KH0A 3MC0B 1Z2MA 3JYUA 1A5RA 2FE8A 2BWFA 4IM2A 1C4CA 4GDLA 2DAFA 2FNJB 3Q8EA 2FUHB 1KTKA 3AB5A 3GE3C 1WJ6A 4CYEA 1E8XA 4C80A 4EEWA 5JXVA 2KLGA 3NUHB 2D11A 2KVRA 3MHZA 2LMCA 4RM9A 1Q10A 2MX2A 2K6QA 2M19A 3U30A 2WS3B 2RDBC 3DBSA 3ALBA 1JRUA 4W9LA 2WXQA 2WP9B 3OLMD 5G2NA 3VUXA 3VUWA 1MFWA 2QDFA 4BOZB 2JRHA 3NRZA 4IWPA 3ZRFA 4RGTA 4OVUA 4IW0A 4TSSA 1PYWD 4DXGA 2A4ZA 4N6EB 3SD5A 4EFOA 1SBBB 1PGBA 3ZDTA 5TR5A 4KGRA 1UWMA 1ZP0B 4B0MA 2C5LC 5AEKB 2IY0B 1UUPA 3AXCA 4M8NA 2I1JA 1P98A 3AULA 2J0JA 2HTHA 2W3SA 3IT4B 1D4BA 3AM9A 3SEBA 2L0FA 2Z0DB 2NTSA 1V9JA 3BZDB 1FCCC 2DBYA 5G55A 1FD6A 3O13A 4HCNB 1XF5L 2YLMA 3TCAA 1KH0A 1KJTA 3EC8A 2MBQA 3BY4B 5GXGB 2J53A 3KWVA 3R7QA 4AP4C 2DZMA 2KFKB 1VDVA 4GU2A 3ZVVA 2FUG1 1QZEA 2NCNA 4K3CA 4LCDE 4ANUA 1K8RB 1E7UA 3DWMA 3U8ZA 3AH7A 4GGQA 4EZKA 3DBLI 1JQ4A 1MVKA 1J19A 3E56A 4C4VA 1HTOA 5I4DA 3N20C 3VH3B 3E9SA 2M1MA 3RN9C 4B9KA 1M4VA 4KGTA 4JPSA 1XQQA 2KYWA 1V5TA 5CHFA 1L0VB 3ZRCA 1RWSA 4HLEA 3BVGA 2QC8A 1TYGB 1KLVA 5FKAC 1XLOA 2Y3AA 2XK5B 2CHXA 3MJWA 3ZNZB 1ESFA 3QHTA 4GN1A 3OJ3A 4B6WA 4II2B 2BTEA 1GOZA 1S1QB 2N9XA 1YJ1A 5LLIA 4G0NB 4P7IA 2WQYB 4DK5A 3VTVA 4KZ0A 3W5UB 3BYYB 4E71A 2WWZA 3RNFC 1DYQA 1OTRB 3TEWA 2IYDB 1C76A 4WJNA 2OJRA 3NVVA 3PT2B 4TQ1A 1FRRA 1TKYA 1RM6C 4A8XC 2C7HA 4XE0A 3WA0A 2XK5A 3UGBB 3PHWB 1WMHA 3AECB 4FADA 1J7CA 4RGNA 1ET9A 3VR8B 2DYOA 4XYCA 1TJEA 1MHXA 2FIDA 5EE3A 4HPMB 2MH7A 2AWTA 2WXOA 1Z5SB 2IGGA 3DOWA 3Q3MC 2CHZA 2LGIA 4HCPB 2W3RA 5FR3A 2KJRA 1I4QA 3QC8B 5IO9A 3ZUNA 3KQ4A 1WX9A 2BB5A 2JQRB 2O2VB 1QOGA 1SE9A 2K22A 4GMVA 1T0YA 5H8YE 1SIFA 1IYFA 4YSZB 1TY2A 2G4DB 4LTUA 3A4SC 1WGGA 4EKUA 3M3JA 2EMSA 3PREA 4ARIA 1YJIA 3QARA 3VH4B 4JX1C 4WWMA 2IO0B 3V6CB 4CHKA 3FAHA 3Q14C 3CIRB 5IN7A 2K5PA 2Z59B 2RDGA 1UGMA 3QA8A 3LYYA 4O1NA 2FCNA 4WWPA 3H8HA 1E9MA 2MHJA 3VFKA 4II3B 3HM3A 3VTWA 4EUTA 1J7BA 1L6VA 2KNBA 2WDVB 2O2VA 2BBCA 2BS4B 3WIMA 2V0GA 2EKIA 5L83A 3NS8A 4UDUC 2L3ZA 4W9JA 3L16A 5D6JB 3AEFB 2DAJA 2LVQA 1FXAA 2WXLA 3AEEB 4P1BC 2WNMA 1TS2A 1FXIA 5C2TB 3Q3JA 1Y56A 3ZIMA 1MG4A 1YOVB 3DBRI 2GRIA 2JUOA 3ECIA 3NS1A 2MRPA 1I7HA 1DGJA 1NI2A 2BS3B 3BWUD 1WWTA 4HPLB 4LNKA 1M94A 4M02A 2PW9A 4WQOB 1UZXB 1VCBA 2IY1B 3KUZA 5EE9A 2J0MA 4K7SA 4CO7A 1TY0A 2BQQA 4RGOS 2PE6B 3DPDA 2AL3A 2JYEA 4P16A 2IO3B 1V81A 3MHSD 3PVLA 3N30A 5DPWA 2KLCA 1L5PA 3PO0A 4BKSA 3ZJVA 2LVPA 4HDQA 3PLUA 3P4QB 4EE2A 3AEBB 3H7PA 1WZ0A 3EFUA 1LXDA 4JGHB 2DZKA 3CSFA 2L32A 2CJNA 3AE3B 2CU3A 1C3TA 3IXSA 2RPQA 1R7SA 3I9V1 2LFIA 2WXRA 4S0RA 1WGKA 3AE7B 4XWWA 1N61A 3NVWA 1TKGA 2KFJA 3B1LX 1I4PA 3AE8B 2KXJA 3AE4B 2KKCA 3BIID 3NZSA 2MBOA 2V3PA 3VRBB 4AJYB 4ZHPA 1XD3B 2JWZA 4KV2A 3P4PB 1YQBA 4K7WA 1OQYA 5LNK1 5LXIB 1I4RA 1YIWA 3ZQ4A 2KWCA 1NYRA 3PRMB 1IBXA 2XEWA 1QF6A 5JZEB 4W9FA 1HQRD 1WM3A 1UBIA 4LNIA 4RMAA 2BGFA 4A55A 1WGHA 3N1YC 5IA7A 2UYZB 3BK2A 1CK1A 2A5UA 4A3OA 3AN1A 2GI9A 1K50A 1N60A 1QOFA 2AEHA 5D7GA 4DXFA 5J17A 2D2QA 1LM8B 3I5JC 1BXTA 1X1MA 1YQ4B 2B76B 3TEZA 1GB1A 3A1QB 2DENB 1T3QA 3IG3A 2L00B 1SB3C 3NZUA 4K7UA 2PEAA 4ICUA 4BFRA 3H7SA 3N32A 4PYUA 2ONQA 1L7YA 3N9YC 4ANWA 3SFEB 1IGCA 4P1CC 4I6LB 4ITKA 1UGJA 1JWMD 3GZNB 1WIAA 3KWLA 3HM6X 3L4PA 1WE7A 1XO3A 5KHQA 2KDIA 3RULA 4AWJA 4RM8A 1TS4A 3EGRA 3PS6A 5HHDG 2HTME 4KGSA 2R2OA 3H6NA 5AUIA 3AEGB 2WDQB 1E0ZA 2DZJA 1EWYC 1ZPSA 3FILA 4BOSC 3N1ZC 4ZRIA 1C4PA 4MJSB 1XLNA 2KMCA 4IUMB 1JWBD 2WLBA 2BPSA 1N63A 4FLHA 1F0ZA 1TTNA 4FJYA 3FKYA 4K3BA 2LD9A 1WY8A 5JHAA 2WXFA 1HZ5A 1VJKA 1E8ZA 5AZGA 2KVZA 3JSVA 3PV1A 1C78A 3PRZA 4AS1A 3LB8C 2SAKA 2DZIA 4FXCA 4MGKE 2ACZB 3K9PB 3AV8A 4ZDVA 3C8YA 3DDCB 2LWPA 2REXA 2W54A 4DHZB 3P2BA 4GDKA 1E5WA 1YNTE 4FHJA 2WDTB 1SGHA 5D3DA 1B1ZA 3LJ3A 2LRUA 2DWQA 3AI5A 4HVBA 3UIOB 4GOCA 4YTPB 4DQOC 5IOIA 1B9RA 3VTUA 1L0XB 1SE3A 3FC4A 2ZVNA 1KFYB 4ZRQA 2BB6A 3AU5A 1SE4A 2J42A 3R8BA 4ZHOA 2IO1B 1E10A 1FMAD 2BWES 2V3SA 4IOIE 3V3XA 3IFWB 2JXTA 4A9AA 5MPOA 1WSPA 4I6NB 3RNCC 3V61A 2KFKA 1TGZB 1KM7A 3EUB2 1D3ZA 1V1PA 2QIEB 3RD2A 1J0GA 2DYMA 1MJDA 3DQVA 3P4RB 4LNOA 1HZ6A 5BMGA 3B2GA 1AN8A 1QQRA 3MJ5A 2OJWA 1YMHE 2E6XA 2J7QB 2IDYA 2UWQA 5EE0A 2KX3A 1SEBD 4US8A 1OQQA 4P6VF 4M00A 3KUDB 3TUOA 2VZKB 2AQ3B 2X38A 1I35A 1DOYA 1L2NA 1EM7A 1D6EC 3U2SC 4F8CB 2KMAA 1UWXA 3ZJTA 2PTLA 2KT7A 3SHQA 3UQAA 3TJPA 4XDCA 4RH6A 2KDFB 2EKEC 2IO2B 2KWVB 4WH4A 1KOTA 3K9OB 1FNWA 2M8SA 1E6EB 2N7DA 2KD0A 5E6NA 4DWFA 5BYRA 4BBNC 1DOXA 5L95C 2BS2B 2MP2B 2MBHA 3AE1B 2JF5A 1WE6A 4DHJB 4W9CA 3SU8X 4C7YA 1F52A 1WM2A 2MWSB 1QLBB 1RRBA 2VZKD 3APFA 4RGMA 1NDDA 2XN9C 1SE2A 1TZ1A 1WR6E 1K52A 2NTTA 2CU1A 1C9FA 5D2MB 3I57A 1FO4A 5JHBA 4MM3A 3HVZA 4JL9A 3L08A 1D5MC 3VHTC 1EF5A 1FXTB 2TSSA 2GBJA 1H8CA 4USAA 1UD7A 1GC6A 1AW7A 4WURA 1IUEA 4WJOA 1I4GA 3ML8A 4JIOU 3MFGA 3NVZA 3RNEC 2ZVOA 3ZYYX 4IG7B 2JT4B 5HFYA 3VRAB 1JCKB 4AJWA 1TKEA 4RNAA 2WDRB 4ZRJA 4IM0A 3R3MA 1T5XD 1R4NI 3VQIA 2RSUA 4HK2A 5EE1A 3ZLZA 4ZOHC 1IGDA 2RMMA 4ZYNA 3ZW3A 1T0RC 2KWUB 1S3SG 1UH6A 2LZ6A 4IDIA 2GMIC 1HA5A 2ZZPB 1P0RA 1EWCA 2N4FA 5CHWA 4S17A 2FAZA 2LUMA 2PJHA 3URYA 3HRDD 1Y8RC 2L76A 2JU6X 2QSDA 1SXTA 2Y5CA 3ZXVA 4X57B 5BYSA 3RZWC 1EO6A 4FBJB 2DLBA 1UNSA 2LVOA 1L4DB 2Q5WD 2V1YA 3SFDB 2ZW0A 2IPKD 4BKGA
chains in the Genus database with same CATH topology
3M63B 4DBGA 3BINA 2MA9B 2M17A 4KDIC 3PZDA 5CTRC 4W9EA 1WJUA 1GJZA 2NPTA 3PPAA 2DYBA 2G4SA 3PSEB 3WALA 3GOEA 4ANXA 2C7MB 2JY6A 2KFJA 2FCSA 2KTRB 3B1LX 2KJ6A 4MDKE 3JW0X 2MLBA 1IP9A 2KX0A 2KXJA 3QCAA 1WF9A 2JRIB 4FULA 2CHWA 3RCZA 2KKCA 4DDID 3NZSA 1AARA 4E3CA 1WGYA 2K1FA 2MBOA 4EZJA 1BT0A 3ZO5B 4AJYB 2KC1A 1P9DU 3CSTA 1XD3B 3KYCD 2KDEB 3PGEA 2G3QB 4NQKE 2JWZA 3KW5B 3RZFA 4KV2A 3QX1A 4LJOB 4MGIE 3ZTDA 1E8WA 2MW5A 1YQBA 4K7WA 1OQYA 5LXIB 2KANA 3UQBA 1TBEA 1YIWA 1YX5B 3QIJA 2W9NA 4K81A 3JSVB 4HDOA 3H7PB 2ZPYA 2C7NB 2IBIB 1R4MI 1V49A 2KWCA 3PRMB 3WANA 2XEWA 1NBFC 3T8MA 4IWOA 2OOBB 5JZEB 2PE9A 3PHXB 2MCNB 4W9FA 1WJNA 1G6JA 2BYEA 3DBHI 1C1YB 1WM3A 4B95A 1UBIA 3KVFB 4RMAA 2BGFA 4WJPA 2BYFA 3DVGX 2O6VD 3T9LA 3ENEA 1WGHA 5IA7A 2UYZB 2A5UA 3M95A 2ZNVB 4A3OA 1ZW7A 2L7RA 4G50A 2CKHB 2RR9A 4URKA 2AEHA 5D7GA 5J17A 3VDZA 2KOXA 2D2QA 1LM8B 1J8CA 5E6OA 2MQJA 1WXVA 2ZEQA 1WXSA 1IPGA 4NPNA 2DHZA 3TL5A 1X1MA 5FR6A 3TMPB 3VUYA 2V4LA 2VRRB 3A1QB 2DENB 3W1YA 1UELA 3N3KB 3WAMA 3KH0A 4XZ4A 3IG3A 1Z2MA 3JYUA 2L00B 3NY5A 3NZUA 4HWIB 3A9JB 2GBKA 3UF8A 4K7UA 2PEAA 1A5RA 2K39A 4AUQC 1WI0A 2BWFA 3GZNI 3H7SA 4ICUA 4GDLA 4IM2A 5DPRA 4BFRA 2DAFA 4ICVA 3N32A 4GDLB 2FNJB 4PYUA 2FUHB 5LXHA 1RLFA 1L7YA 1WJ6A 3R66C 4CYEA 3JVZX 2LXAA 2NBUA 4ANWA 2KDBA 1E8XA 4W9IA 4EEWA 2KLGA 2D11A 2NBVB 2KVRA 4I6LB 3UIPB 4RM9A 2MX2A 4MEMA 2K6QA 3U30A 1ISNA 3PTFC 3DBSA 2BKFA 3ALBA 1JRUA 2AYOB 4W9LA 2K8CA 3OLMD 1WIAA 5G2NA 3VUXA 3VUWA 4DHZE 4OVVA 3OJ4B 3HM6X 1WGRA 2FIFA 4BOZB 1WE7A 2JRHA 4IWPA 3ZRFA 5KHQA 4OVUA 2K8BA 2KDIA 4IW0A 1WJ4A 3RULA 4AWJA 2A4ZA 4MGZE 4RM8A 4MSMB 3SD5A 4EFOA 5J18A 1V80A 4W9KA 3PS6A 3ZDTA 3B0AA 4ANVA 5TR5A 4KSLC 2YVCA 2D10A 2M4NA 2R2OA 3ZDMC 2C5LC 4DXAB 5AEKB 3H6NA 2IY0B 2K8HA 3AXCA 4BKTA 2N1WA 4M8NA 4WJQA 2DZJA 2I1JA 1P98A 3AULA 4KIKB 2J0JA 2HTHA 3L17A 3B08A 1GUAB 2L0FA 2Z0DB 4BOSC 2NS5A 4ZRIA 1V9JA 1GG3A 4MJSB 5AZFA 5G55A 2KMCA 4IUMB 4FJVB 5DCNA 1ZGUB 3EECA 1EUVB 4HCNB 2BPSA 4FLHA 2YLMA 3TCAA 1LFDA 1TTNA 1KJTA 2JZ3B 3EC8A 2MBQA 3ML9A 4FJYA 3BY4B 4G3XB 2K6DB 3W1SA 3R7QA 1F9JA 2LI5A 2LD9A 4AP4C 2DZMA 2KFKB 3M62B 1WX7A 1WY8A 5JHAA 5J2RA 4GU2A 2IZVB 3ZVVA 1QZEA 1WMHB 1U4AA 2NCNA 4LCDE 1E8ZA 3IHPC 1K8RB 4ANUA 1E7UA 4W9DA 5AZGA 3JSVA 3U8ZA 2NR2A 3PV1A 3PRZA 2LXCA 2FCMA 4GGQA 2DZIA 4EZKA 1GNUA 3DBLI 1J19A 4ASWC 4NAWA 4MH0E 2WX0A 3VH3B 1WXAA 2LRWA 2M1MA 4MGKE 4W9HA 4B9KA 3K9PB 1Q5WB 2L8JA 4ZDVA 1MG8A 3A33B 3DDCB 4XC2A 3U7DA 4TQ0A 2LWPA 2REXA 4DHZB 1OEYJ 1XQQA 2CS4A 2ZCCA 3P2BA 1V5TA 4GDKA 2LUEA 1E5WA 4FHJA 2WDTB 3IBEA 5EDSA 1SGHA 5GMVA 2HE7A 3LJ3A 5CHFA 3ZRCA 4DHJD 4PYZA 3VVWB 2KQSA 4TUUA 2LRUA 3AI5A 2ZCBA 4TKNA 4HLEA 2N9PC 2QHOA 4HVBA 2XBBC 3UIOB 1KLVA 4GOCA 2KN5A 3CF6E 3HHMA 2XK5B 3QQ8B 4M0WB 5IAAC 3VTUA 1GC7A 1WGDA 2CHXA 3MJWA 1I42A 1Q0WB 4KDLB 2ZVNA 3ZNZB 3L13A 4FA6A 3QHTA 3VXWA 4GN1A 3APCA 3OJ3A 2G45B 4B6WA 4F7ZA 3AU5A 4II2B 3A4RA 1S1QB 2N9XA 5LLIA 1YJ1A 2GBMA 3DCGA 3VAWA 4G0NB 3ZNGC 4BBNF 1E8YA 4NAWB 4MJSA 4P7IA 4DK5A 3VTVA 4KZ0A 4E71A 2IO1B 2WWZA 4IC7B 2BWES 1OTRB 4GSWA 2JZZA 4FN2A 2IYDB 2C9WB 2V3SA 4WJNA 2AL6A 4KIKA 2OJRA 3IFWB 2KJHB 3O65B 4NNJB 4TV3A 3PT2B 4TQ1A 3TIXA 3IVFA 5KHOA 4I6NB 3V61A 2ZNVC 2KFKA 3X0WA 1TGZB 4JLCA 1WYWB 2KZRA 2C7HA 1KM7A 3WA0A 4MSQB 5C23A 1D3ZA 1E90A 3NHEB 2XK5A 3UGBB 1ZKHA 3PHWB 4I6PA 3RD2A 1J0GA 3ZNHB 1WMHA 1P1AA 2DYMA 4FADA 3DQVA 2DYOA 1YD8U 4MGYE 1Q1OA 4EOYA 2MBEA 4NJ7A 3A9JA 4N9F4 1WH3A 2HD5B 2FIDA 2LASA 3QK0A 4HPMB 2AWTA 2JVCA 2K25A 4EZLA 2J7QB 2GBNA 2UWQA 1Z5SB 2KX3A 3DOWA 4PS3A 1P3QU 4LDTD 3C0RB 4GDKB 4F1SA 2CHZA 1EF1A 3KYDD 2PPHA 3KUDB 1OEYA 1WFYA 4HCPB 3RT3B 2BYVE 2NVUI 3HK0A 3NOBA 2KJRA 4FHKA 3QC8B 2LGDA 1I35A 3L0WB 4YL8A 3ZUNA 1L2NA 3V62A 2RGFA 1PQSA 1WX9A 5AZHA 3QWZB 3V60A 3Q3FA 2O2VB 3DVNV 3TBLD 1SE9A 4F8CB 2KMAA 4GMVA 1T0YA 1SIFA 4J6IA 1IYFA 5D94A 2D07B 2JXXA 1OGWA 4JQWC 2G4DB 3SHQA 2D3GA 3A4SC 2ASQA 4AOFA 1WGGA 2Y5BB 4EKUA 3M3JA 2DX5B 3UQAA 2J0KA 2EMSA 3PREA 4HJKA 3TJPA 2NPTB 4A3PA 3QARA 3VH4B 4BKSD 4IWQA 2IO0B 2EKEC 2KDFB 3V6CB 2IO2B 2LGYA 2KWVB 1KOTA 3V6EB 4CHKA 3K9OB 5CHVC 4IM3A 2M8SA 2O6VA 2N7DA 2KD0A 4XX5A 2O6VB 5E6NA 2Z59B 4DWFA 1V5OA 3QA8A 1UGMA 4BBNC 2N9EB 2C60A 4NQLB 5C1ZA 5L95C 2MP2A 2ZJDA 5JH5C 2MP2B 3A1QA 1YX6B 2KTRA 2BF8B 2MBHA 2JF5A 2KC2A 2FCNA 1WE6A 1HE8A 3D32A 4NJ6A 4WWPA 5BO4B 1WXMA 4DHJB 3VFKA 1WX8A 2EMTA 4II3B 3KUCB 2L05A 3HM3A 2N1VA 1LQBA 4W9CA 3VTWA 3SU8X 4DDGD 4EUTA 2HJ8A 3PRPB 4GXBA 4G11A 4ZRKA 2KNBA 3H9DA 2O2VA 5CX3A 1WM2A 2B3AA 2MWSB 1RRBA 3WIMA 2KTFA 3LDZE 5L83A 4W9GA 3APFA 2JPHA 3NS8A 4K1RB 3QJZA 2L3ZA 4KZCA 4W9JA 3L16A 1NDDA 5D6JB 1XT9B 3ZKJC 4E74A 3CMMB 1TZ1A 1WR6E 2DAJA 4MELA 3X23A 2LVQA 2CU1A 1UBQA 3PLVA 3L10B 5D2MB 2ZPNA 3Q3JA 5JHBA 3ZIMA 3W1SC 4LDTB 4MM3A 4JL9A 1WRDB 3L08A 3RUIB 3DVNU 3SDLC 5DPSA 3VHTC 4KSKC 3R7RA 1EF5A 1FXTB 1RFAA 4KVGB 1H8CA 2GBJA 3DBRI 1UD7A 2GBRA 1GC6A 2JUOA 1WZ3A 3ECIA 5DPTA 2KO3A 4WJOA 1WR1A 4NY0A 2MRPA 4HXDA 2N7EA 3ML8A 4WWOA 1NI2A 4JIOU 2KQ7A 3MTNB 3OAWA 2ZVOA 3AU4A 4GIVA 3ZTCA 4HPLB 2JT4B 2KK8A 3L54A 4IG7B 2RD0A 1VD2A 1M94A 5HKHA 4AJWA 2CR5A 3DVGY 4WQOB 1UZXB 1VCBA 2IY1B 3KUZA 2BKRB 4GB9A 4ZRJA 4IM0A 2J0MA 4K7SA 3S2AA 2LJ5A 2I1KA 3R3MA 1R4NI 3VQIA 4CO7A 2RSUA 4HK2A 3ZLZA 4PS8A 2WYQA 1V2YA 4ZYNA 2PE6B 2L0TA 3DPDA 2NBWB 2WX1A 2AL3A 5E6PA 3ZW3A 2Z0EB 1H4RA 3APDA 4BVUC 2KWUB 1S3SG 2LGXA 1E7VA 4WAAA 3A9KB 1UH6A 3RYTA 2LZ6A 3A9KA 3ONSA 3WAPA 2GMIC 4M8MA 2ZZPB 1P0RA 2IO3B 1V81A 3ZNID 3MHSD 3PVLA 2N4FA 3N30A 5CHWA 3HIZA 1V86A 2FAZA 2KLCA 5DPWA 3I3TB 3QAQA 4BKSA 2PJHA 2LVPA 4LJPB 4FJZA 1Y8RC 2L76A 2R2QA 4HDQA 3PLUA 3EHVA 1CMXB 4PS7A 4X57B 3RZWC 1EO6A 3UINB 4FBJB 3H7PA 1RAXA 1WZ0A 3H1UA 3EFUA 1LXDA 2MSED 4JGHB 2DZKA 3CSFA 2KHWB 2GOWA 1V6EA 2MBBB 2LVOA 2M0XA 4A20A 2FCQA 4WWNA 1C3TA 2V1YA 3WAOA 2RPQA 4BKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M63 B;  4DBG A;  3BIN A;  2MA9 B;  2M17 A;  4KDI C;  3PZD A;  5CTR C;  4W9E A;  1WJU A;  1GJZ A;  2NPT A;  3PPA A;  2DYB A;  2G4S A;  3PSE B;  3WAL A;  3GOE A;  4ANX A;  2C7M B;  2JY6 A;  2KFJ A;  2FCS A;  2KTR B;  3B1L X;  2KJ6 A;  4MDK E;  3JW0 X;  2MLB A;  1IP9 A;  2KX0 A;  2KXJ A;  3QCA A;  1WF9 A;  2JRI B;  4FUL A;  2CHW A;  3RCZ A;  2KKC A;  4DDI D;  3NZS A;  1AAR A;  4E3C A;  1WGY A;  2K1F A;  2MBO A;  4EZJ A;  1BT0 A;  3ZO5 B;  4AJY B;  2KC1 A;  1P9D U;  3CST A;  1XD3 B;  3KYC D;  2KDE B;  3PGE A;  2G3Q B;  4NQK E;  2JWZ A;  3KW5 B;  3RZF A;  4KV2 A;  3QX1 A;  4LJO B;  4MGI E;  3ZTD A;  1E8W A;  2MW5 A;  1YQB A;  4K7W A;  1OQY A;  5LXI B;  2KAN A;  3UQB A;  1TBE A;  1YIW A;  1YX5 B;  3QIJ A;  2W9N A;  4K81 A;  3JSV B;  4HDO A;  3H7P B;  2ZPY A;  2C7N B;  2IBI B;  1R4M I;  1V49 A;  2KWC A;  3PRM B;  3WAN A;  2XEW A;  1NBF C;  3T8M A;  4IWO A;  2OOB B;  5JZE B;  2PE9 A;  3PHX B;  2MCN B;  4W9F A;  1WJN A;  1G6J A;  2BYE A;  3DBH I;  1C1Y B;  1WM3 A;  4B95 A;  1UBI A;  3KVF B;  4RMA A;  2BGF A;  4WJP A;  2BYF A;  3DVG X;  2O6V D;  3T9L A;  3ENE A;  1WGH A;  5IA7 A;  2UYZ B;  2A5U A;  3M95 A;  2ZNV B;  4A3O A;  1ZW7 A;  2L7R A;  4G50 A;  2CKH B;  2RR9 A;  4URK A;  2AEH A;  5D7G A;  5J17 A;  3VDZ A;  2KOX A;  2D2Q A;  1LM8 B;  1J8C A;  5E6O A;  2MQJ A;  1WXV A;  2ZEQ A;  1WXS A;  1IPG A;  4NPN A;  2DHZ A;  3TL5 A;  1X1M A;  5FR6 A;  3TMP B;  3VUY A;  2V4L A;  2VRR B;  3A1Q B;  2DEN B;  3W1Y A;  1UEL A;  3N3K B;  3WAM A;  3KH0 A;  4XZ4 A;  3IG3 A;  1Z2M A;  3JYU A;  2L00 B;  3NY5 A;  3NZU A;  4HWI B;  3A9J B;  2GBK A;  3UF8 A;  4K7U A;  2PEA A;  1A5R A;  2K39 A;  4AUQ C;  1WI0 A;  2BWF A;  3GZN I;  3H7S A;  4ICU A;  4GDL A;  4IM2 A;  5DPR A;  4BFR A;  2DAF A;  4ICV A;  3N32 A;  4GDL B;  2FNJ B;  4PYU A;  2FUH B;  5LXH A;  1RLF A;  1L7Y A;  1WJ6 A;  3R66 C;  4CYE A;  3JVZ X;  2LXA A;  2NBU A;  4ANW A;  2KDB A;  1E8X A;  4W9I A;  4EEW A;  2KLG A;  2D11 A;  2NBV B;  2KVR A;  4I6L B;  3UIP B;  4RM9 A;  2MX2 A;  4MEM A;  2K6Q A;  3U30 A;  1ISN A;  3PTF C;  3DBS A;  2BKF A;  3ALB A;  1JRU A;  2AYO B;  4W9L A;  2K8C A;  3OLM D;  1WIA A;  5G2N A;  3VUX A;  3VUW A;  4DHZ E;  4OVV A;  3OJ4 B;  3HM6 X;  1WGR A;  2FIF A;  4BOZ B;  1WE7 A;  2JRH A;  4IWP A;  3ZRF A;  5KHQ A;  4OVU A;  2K8B A;  2KDI A;  4IW0 A;  1WJ4 A;  3RUL A;  4AWJ A;  2A4Z A;  4MGZ E;  4RM8 A;  4MSM B;  3SD5 A;  4EFO A;  5J18 A;  1V80 A;  4W9K A;  3PS6 A;  3ZDT A;  3B0A A;  4ANV A;  5TR5 A;  4KSL C;  2YVC A;  2D10 A;  2M4N A;  2R2O A;  3ZDM C;  2C5L C;  4DXA B;  5AEK B;  3H6N A;  2IY0 B;  2K8H A;  3AXC A;  4BKT A;  2N1W A;  4M8N A;  4WJQ A;  2DZJ A;  2I1J A;  1P98 A;  3AUL A;  4KIK B;  2J0J A;  2HTH A;  3L17 A;  3B08 A;  1GUA B;  2L0F A;  2Z0D B;  4BOS C;  2NS5 A;  4ZRI A;  1V9J A;  1GG3 A;  4MJS B;  5AZF A;  5G55 A;  2KMC A;  4IUM B;  4FJV B;  5DCN A;  1ZGU B;  3EEC A;  1EUV B;  4HCN B;  2BPS A;  4FLH A;  2YLM A;  3TCA A;  1LFD A;  1TTN A;  1KJT A;  2JZ3 B;  3EC8 A;  2MBQ A;  3ML9 A;  4FJY A;  3BY4 B;  4G3X B;  2K6D B;  3W1S A;  3R7Q A;  1F9J A;  2LI5 A;  2LD9 A;  4AP4 C;  2DZM A;  2KFK B;  3M62 B;  1WX7 A;  1WY8 A;  5JHA A;  5J2R A;  4GU2 A;  2IZV B;  3ZVV A;  1QZE A;  1WMH B;  1U4A A;  2NCN A;  4LCD E;  1E8Z A;  3IHP C;  1K8R B;  4ANU A;  1E7U A;  4W9D A;  5AZG A;  3JSV A;  3U8Z A;  2NR2 A;  3PV1 A;  3PRZ A;  2LXC A;  2FCM A;  4GGQ A;  2DZI A;  4EZK A;  1GNU A;  3DBL I;  1J19 A;  4ASW C;  4NAW A;  4MH0 E;  2WX0 A;  3VH3 B;  1WXA A;  2LRW A;  2M1M A;  4MGK E;  4W9H A;  4B9K A;  3K9P B;  1Q5W B;  2L8J A;  4ZDV A;  1MG8 A;  3A33 B;  3DDC B;  4XC2 A;  3U7D A;  4TQ0 A;  2LWP A;  2REX A;  4DHZ B;  1OEY J;  1XQQ A;  2CS4 A;  2ZCC A;  3P2B A;  1V5T A;  4GDK A;  2LUE A;  1E5W A;  4FHJ A;  2WDT B;  3IBE A;  5EDS A;  1SGH A;  5GMV A;  2HE7 A;  3LJ3 A;  5CHF A;  3ZRC A;  4DHJ D;  4PYZ A;  3VVW B;  2KQS A;  4TUU A;  2LRU A;  3AI5 A;  2ZCB A;  4TKN A;  4HLE A;  2N9P C;  2QHO A;  4HVB A;  2XBB C;  3UIO B;  1KLV A;  4GOC A;  2KN5 A;  3CF6 E;  3HHM A;  2XK5 B;  3QQ8 B;  4M0W B;  5IAA C;  3VTU A;  1GC7 A;  1WGD A;  2CHX A;  3MJW A;  1I42 A;  1Q0W B;  4KDL B;  2ZVN A;  3ZNZ B;  3L13 A;  4FA6 A;  3QHT A;  3VXW A;  4GN1 A;  3APC A;  3OJ3 A;  2G45 B;  4B6W A;  4F7Z A;  3AU5 A;  4II2 B;  3A4R A;  1S1Q B;  2N9X A;  5LLI A;  1YJ1 A;  2GBM A;  3DCG A;  3VAW A;  4G0N B;  3ZNG C;  4BBN F;  1E8Y A;  4NAW B;  4MJS A;  4P7I A;  4DK5 A;  3VTV A;  4KZ0 A;  4E71 A;  2IO1 B;  2WWZ A;  4IC7 B;  2BWE S;  1OTR B;  4GSW A;  2JZZ A;  4FN2 A;  2IYD B;  2C9W B;  2V3S A;  4WJN A;  2AL6 A;  4KIK A;  2OJR A;  3IFW B;  2KJH B;  3O65 B;  4NNJ B;  4TV3 A;  3PT2 B;  4TQ1 A;  3TIX A;  3IVF A;  5KHO A;  4I6N B;  3V61 A;  2ZNV C;  2KFK A;  3X0W A;  1TGZ B;  4JLC A;  1WYW B;  2KZR A;  2C7H A;  1KM7 A;  3WA0 A;  4MSQ B;  5C23 A;  1D3Z A;  1E90 A;  3NHE B;  2XK5 A;  3UGB B;  1ZKH A;  3PHW B;  4I6P A;  3RD2 A;  1J0G A;  3ZNH B;  1WMH A;  1P1A A;  2DYM A;  4FAD A;  3DQV A;  2DYO A;  1YD8 U;  4MGY E;  1Q1O A;  4EOY A;  2MBE A;  4NJ7 A;  3A9J A;  4N9F 4;  1WH3 A;  2HD5 B;  2FID A;  2LAS A;  3QK0 A;  4HPM B;  2AWT A;  2JVC A;  2K25 A;  4EZL A;  2J7Q B;  2GBN A;  2UWQ A;  1Z5S B;  2KX3 A;  3DOW A;  4PS3 A;  1P3Q U;  4LDT D;  3C0R B;  4GDK B;  4F1S A;  2CHZ A;  1EF1 A;  3KYD D;  2PPH A;  3KUD B;  1OEY A;  1WFY A;  4HCP B;  3RT3 B;  2BYV E;  2NVU I;  3HK0 A;  3NOB A;  2KJR A;  4FHK A;  3QC8 B;  2LGD A;  1I35 A;  3L0W B;  4YL8 A;  3ZUN A;  1L2N A;  3V62 A;  2RGF A;  1PQS A;  1WX9 A;  5AZH A;  3QWZ B;  3V60 A;  3Q3F A;  2O2V B;  3DVN V;  3TBL D;  1SE9 A;  4F8C B;  2KMA A;  4GMV A;  1T0Y A;  1SIF A;  4J6I A;  1IYF A;  5D94 A;  2D07 B;  2JXX A;  1OGW A;  4JQW C;  2G4D B;  3SHQ A;  2D3G A;  3A4S C;  2ASQ A;  4AOF A;  1WGG A;  2Y5B B;  4EKU A;  3M3J A;  2DX5 B;  3UQA A;  2J0K A;  2EMS A;  3PRE A;  4HJK A;  3TJP A;  2NPT B;  4A3P A;  3QAR A;  3VH4 B;  4BKS D;  4IWQ A;  2IO0 B;  2EKE C;  2KDF B;  3V6C B;  2IO2 B;  2LGY A;  2KWV B;  1KOT A;  3V6E B;  4CHK A;  3K9O B;  5CHV C;  4IM3 A;  2M8S A;  2O6V A;  2N7D A;  2KD0 A;  4XX5 A;  2O6V B;  5E6N A;  2Z59 B;  4DWF A;  1V5O A;  3QA8 A;  1UGM A;  4BBN C;  2N9E B;  2C60 A;  4NQL B;  5C1Z A;  5L95 C;  2MP2 A;  2ZJD A;  5JH5 C;  2MP2 B;  3A1Q A;  1YX6 B;  2KTR A;  2BF8 B;  2MBH A;  2JF5 A;  2KC2 A;  2FCN A;  1WE6 A;  1HE8 A;  3D32 A;  4NJ6 A;  4WWP A;  5BO4 B;  1WXM A;  4DHJ B;  3VFK A;  1WX8 A;  2EMT A;  4II3 B;  3KUC B;  2L05 A;  3HM3 A;  2N1V A;  1LQB A;  4W9C A;  3VTW A;  3SU8 X;  4DDG D;  4EUT A;  2HJ8 A;  3PRP B;  4GXB A;  4G11 A;  4ZRK A;  2KNB A;  3H9D A;  2O2V A;  5CX3 A;  1WM2 A;  2B3A A;  2MWS B;  1RRB A;  3WIM A;  2KTF A;  3LDZ E;  5L83 A;  4W9G A;  3APF A;  2JPH A;  3NS8 A;  4K1R B;  3QJZ A;  2L3Z A;  4KZC A;  4W9J A;  3L16 A;  1NDD A;  5D6J B;  1XT9 B;  3ZKJ C;  4E74 A;  3CMM B;  1TZ1 A;  1WR6 E;  2DAJ A;  4MEL A;  3X23 A;  2LVQ A;  2CU1 A;  1UBQ A;  3PLV A;  3L10 B;  5D2M B;  2ZPN A;  3Q3J A;  5JHB A;  3ZIM A;  3W1S C;  4LDT B;  4MM3 A;  4JL9 A;  1WRD B;  3L08 A;  3RUI B;  3DVN U;  3SDL C;  5DPS A;  3VHT C;  4KSK C;  3R7R A;  1EF5 A;  1FXT B;  1RFA A;  4KVG B;  1H8C A;  2GBJ A;  3DBR I;  1UD7 A;  2GBR A;  1GC6 A;  2JUO A;  1WZ3 A;  3ECI A;  5DPT A;  2KO3 A;  4WJO A;  1WR1 A;  4NY0 A;  2MRP A;  4HXD A;  2N7E A;  3ML8 A;  4WWO A;  1NI2 A;  4JIO U;  2KQ7 A;  3MTN B;  3OAW A;  2ZVO A;  3AU4 A;  4GIV A;  3ZTC A;  4HPL B;  2JT4 B;  2KK8 A;  3L54 A;  4IG7 B;  2RD0 A;  1VD2 A;  1M94 A;  5HKH A;  4AJW A;  2CR5 A;  3DVG Y;  4WQO B;  1UZX B;  1VCB A;  2IY1 B;  3KUZ A;  2BKR B;  4GB9 A;  4ZRJ A;  4IM0 A;  2J0M A;  4K7S A;  3S2A A;  2LJ5 A;  2I1K A;  3R3M A;  1R4N I;  3VQI A;  4CO7 A;  2RSU A;  4HK2 A;  3ZLZ A;  4PS8 A;  2WYQ A;  1V2Y A;  4ZYN A;  2PE6 B;  2L0T A;  3DPD A;  2NBW B;  2WX1 A;  2AL3 A;  5E6P A;  3ZW3 A;  2Z0E B;  1H4R A;  3APD A;  4BVU C;  2KWU B;  1S3S G;  2LGX A;  1E7V A;  4WAA A;  3A9K B;  1UH6 A;  3RYT A;  2LZ6 A;  3A9K A;  3ONS A;  3WAP A;  2GMI C;  4M8M A;  2ZZP B;  1P0R A;  2IO3 B;  1V81 A;  3ZNI D;  3MHS D;  3PVL A;  2N4F A;  3N30 A;  5CHW A;  3HIZ A;  1V86 A;  2FAZ A;  2KLC A;  5DPW A;  3I3T B;  3QAQ A;  4BKS A;  2PJH A;  2LVP A;  4LJP B;  4FJZ A;  1Y8R C;  2L76 A;  2R2Q A;  4HDQ A;  3PLU A;  3EHV A;  1CMX B;  4PS7 A;  4X57 B;  3RZW C;  1EO6 A;  3UIN B;  4FBJ B;  3H7P A;  1RAX A;  1WZ0 A;  3H1U A;  3EFU A;  1LXD A;  2MSE D;  4JGH B;  2DZK A;  3CSF A;  2KHW B;  2GOW A;  1V6E A;  2MBB B;  2LVO A;  2M0X A;  4A20 A;  2FCQ A;  4WWN A;  1C3T A;  2V1Y A;  3WAO A;  2RPQ A;  4BKG A; 
#chains in the Genus database with same CATH topology
 2VH1 A;  3SR6 A;  2MA9 B;  2M17 A;  3ZGZ A;  4NZL B;  1WJU A;  2NPT A;  1VLB A;  2DYB A;  4US9 A;  3WAL A;  3GOE A;  4ZRP A;  4J3O D;  2KTR B;  4PT5 A;  4PK1 A;  3IT6 B;  3JW0 X;  4OHJ A;  1LO5 D;  1IP9 A;  2KX0 A;  4C56 C;  4YXD B;  4RCO A;  2CHW A;  3EFC A;  1F1H A;  3ZO5 B;  2KC1 A;  1P9D U;  1QT9 A;  2G3Q B;  3RZF A;  1P7F A;  3QX1 A;  4LJO B;  5HI1 A;  1KRH A;  3ABV B;  1XXG A;  3UQB A;  1TBE A;  2WXM A;  4HDO A;  3H7P B;  3WAN A;  2CJO A;  3AMZ A;  1G6J A;  2BYE A;  2BYF A;  3ENE A;  3IAS 1;  2KAC A;  4HPP A;  2WHI A;  4L23 A;  1ZW7 A;  4URK A;  2CKH B;  2RR9 A;  2BYT A;  2QIL A;  2SEB D;  1FEH A;  1J8C A;  1OFF A;  2MQJ A;  1WXV A;  4NPN A;  2MJ3 A;  3TMP B;  2HDE A;  2V4L A;  3AE2 B;  3W1Y A;  1DOI A;  1QIL A;  3NVY A;  3NY5 A;  2HJ1 A;  2GBK A;  3UF8 A;  4AUQ C;  1T0Q C;  4ICV A;  3AE9 B;  5BMI A;  5IKC M;  3JVZ X;  1VZ8 A;  2LXA A;  2NBU A;  3MC8 A;  1QOB A;  3UIP B;  1SSN A;  1ISN A;  3PTF C;  2BKF A;  2AYO B;  1V8C A;  2K8C A;  1VR9 A;  4DHZ E;  2H88 B;  4OVV A;  3OJ4 B;  1WGR A;  2FIF A;  1ROE A;  2MJE A;  1WJ4 A;  2ICI A;  1PUT A;  3ZXR A;  2I2Y A;  3Q8C A;  5J18 A;  4IKG A;  1IBX B;  4ANV A;  4KSL C;  2YVC A;  2M4N A;  3ZDM C;  2K8H A;  4HKQ A;  1XLQ A;  2JWU A;  4KIK B;  4HJG E;  2NS5 A;  1GG3 A;  3DHG C;  1YN4 A;  1ZGU B;  1PGX A;  1R4N B;  1N6Z A;  5FK9 C;  2JZ3 B;  3ML9 A;  4N59 A;  2IGH A;  1F9J A;  2LI5 A;  1I4X A;  1UF0 A;  3M62 B;  1WX7 A;  2WXN A;  2R61 A;  4YSY B;  3P1M A;  5J2R A;  1C77 A;  2IZV B;  1WMH B;  1U4A A;  4W9D A;  2H89 B;  2J52 A;  2WGS A;  2NR2 A;  1WRI A;  2LXC A;  1GNU A;  4WQM A;  2BW2 A;  4NAW A;  2WX0 A;  2Y5P A;  4ACF A;  3NG0 A;  2K9X A;  1HTQ A;  2L8J A;  2QEJ C;  1MG8 A;  4XC2 A;  4TQ0 A;  2CS4 A;  3FIL B;  2LUE A;  3IBE A;  5EDS A;  5GMV A;  3GB1 A;  2HE7 A;  3VVW B;  2KQS A;  4TUU A;  4N58 A;  3DBL B;  2ZCB A;  2JYT A;  2XBB C;  4R3D A;  3Q6B A;  4XWT A;  5AUK A;  1CJE A;  1GC7 A;  1GPX A;  1WGD A;  4KDL B;  3APC A;  2G45 B;  4F7Z A;  2GBM A;  3DCG A;  2IJ0 A;  4NAW B;  4MJS A;  4IC7 B;  2WXI A;  4FN2 A;  2C9W B;  1BUI C;  2AL6 A;  4KIK A;  3J9C A;  1KF6 B;  4REZ A;  2KJH B;  2GLS A;  4QAY A;  4NNJ B;  3TIX A;  3RFZ B;  3IVF A;  5KHO A;  3X0W A;  4JLC A;  1WYW B;  2KZR A;  4MSQ B;  3P63 A;  4I6P A;  3ZNH B;  4C7Z A;  1P1A A;  2LHE A;  2J4X A;  3GP7 A;  1YD8 U;  4MGY E;  3U52 E;  3N1X C;  2MBE A;  1MHH E;  3GS2 A;  1VZ6 A;  3A9J A;  2PVO D;  2LHD A;  4N9F 4;  1WH3 A;  1XLP A;  2LAS A;  3QK0 A;  2KDM A;  2JVC A;  2PMV A;  4EZL A;  2GBN A;  5HG2 A;  3RNB C;  1JWU D;  1K51 A;  1EF1 A;  3KYD D;  2PPH A;  1OEY A;  4GLS C;  2BYV E;  2NVU I;  2OHF A;  4FHK A;  5BMH A;  3L0W B;  3V62 A;  2G9H D;  5AZH A;  1ZDV A;  2JSV X;  3Q3F A;  3V60 A;  3HUI A;  4A90 A;  2KAJ A;  5D94 A;  2D07 B;  4JQW C;  2D3G A;  2V4I B;  2ASQ A;  4AOF A;  2Y5B B;  2ZW1 A;  2J0K A;  4HJK A;  2AX5 A;  2NPT B;  1SJE D;  4IWQ A;  1SJH D;  4L1B A;  2LGY A;  1VZ7 A;  3AED B;  4IM3 A;  1AWD A;  3UI3 A;  4XX5 A;  2O6V B;  3R2I A;  2N9E B;  2C60 A;  5C1Z A;  2MP2 A;  2ZJD A;  4HRS A;  3A1Q A;  1YX6 B;  2BF8 B;  2KC2 A;  4NJ6 A;  1N62 A;  1HE8 A;  2M0A A;  3D32 A;  5BO4 B;  3W5V B;  2EEL A;  1TS3 A;  2EMT A;  2L05 A;  1PFD A;  2N1V A;  1LQB A;  2BT6 A;  1GAQ B;  4GXB A;  2HJ8 A;  1JAL A;  3PRP B;  4G11 A;  1NYQ A;  5CX3 A;  2B3A A;  2KTF A;  3LDZ E;  2JPH A;  1JW9 D;  2XNA C;  3QJZ A;  4KZC A;  4HKZ E;  3DHH C;  3ZKJ C;  1PGA A;  4MEL A;  2Z8L A;  3TEY A;  3PLV A;  3L10 B;  1L4Z B;  3MC9 A;  2QMT A;  3RUI B;  3SDL C;  2AQ2 B;  4XGA B;  3R7R A;  1T6B X;  1RFA A;  2GBR A;  2KO3 A;  1WR1 A;  4NY0 A;  4HXD A;  4WWO A;  4LNF A;  4D2K A;  1HXY D;  1WYG A;  4GIV A;  1YN3 A;  3AU4 A;  2G1E A;  3ZTC A;  1VD2 A;  5HKH A;  3B9J A;  2LGS A;  3DVG Y;  1NVI D;  5G5G A;  3DBR B;  1TT5 B;  1YN5 A;  4LNN A;  4YSX B;  4PS8 A;  1OQR A;  2WYQ A;  4M01 A;  2WX1 A;  4Q2J A;  4BVU C;  2LGX A;  4JE3 B;  3RYT A;  3A9K A;  2PKO A;  2WXP A;  3WAP A;  3U7Z A;  3ZNI D;  3HVD A;  1V86 A;  3ZJU A;  3I3T B;  3QAQ A;  4LJP B;  4FJZ A;  2R2Q A;  3W2D A;  3EHV A;  1J7A A;  1CMX B;  4PS7 A;  3I63 C;  1RAX A;  2D5G A;  2MSE D;  2MBB B;  1V6E A;  1TS5 A;  2FCQ A;  1D5X C;  3M63 B;  4RF1 A;  1V1O A;  4KDI C;  3PZD A;  5CTR C;  1FFU A;  4W9E A;  1NEN B;  3PPA A;  2G4S A;  3PSE B;  2NMQ A;  3RNA C;  2C7M B;  2FCS A;  4JWU C;  1RYJ A;  2KJ6 A;  2MLB A;  1N5W A;  1WF9 A;  2JRI B;  3BK1 A;  3RCZ A;  2ON8 A;  2L83 A;  1AAR A;  4E3C A;  1WGY A;  2K1F A;  4EZJ A;  1BT0 A;  3CST A;  2KDE B;  3PGE A;  1F2R I;  4NQK E;  3KW5 B;  1P7E A;  4MGI E;  3ZTD A;  2MW5 A;  1I4H A;  1RFK A;  1YX5 B;  3QIJ A;  2W9N A;  4TMA B;  2C7N B;  1NBF C;  3T8M A;  4IWO A;  2PE9 A;  4KKI A;  2MCN B;  1YQ3 B;  1WJN A;  4MAC A;  3DBH I;  3KVF B;  4WJP A;  3T3O A;  3T9L A;  1ENF A;  4G50 A;  3VDZ A;  4RF0 A;  3Q69 A;  1JRO A;  5E6O A;  2LEK A;  3RNG C;  2VRR B;  1UEL A;  3N3K B;  3WAM A;  1MI0 A;  2N7J A;  4XZ4 A;  1SIJ A;  1XEE A;  2D3B A;  3A9J B;  3R2T A;  4HWI B;  2GB1 A;  1BML C;  2K39 A;  1WI0 A;  3GZN I;  5DPR A;  4GDL B;  5LXH A;  1F2R C;  1RLF A;  3R66 C;  3CWI A;  2KDB A;  2N0S B;  4W9I A;  1D5Z C;  2E3T A;  4OZC A;  2NBV B;  3Q3O C;  1XCT L;  4MEM A;  1TZO A;  2JX5 A;  2PLP A;  3RMK C;  1TIF A;  2VH2 A;  2V9H A;  2RPV A;  1FCL A;  1JWS D;  2K8B A;  2WXH A;  4YT0 B;  4MGZ E;  4MSM B;  1V80 A;  4W9K A;  3B0A A;  4C4V B;  2BVC A;  2D10 A;  4DXA B;  4BKT A;  2N1W A;  4WJQ A;  4YWG G;  3L17 A;  3B08 A;  1GUA B;  1FIQ A;  1C4A A;  5AZF A;  2L1A A;  4YTM B;  4FJV B;  4HEA 1;  5DCN A;  3EEC A;  1EUV B;  4OZA A;  2INP E;  2W55 A;  1LFD A;  4G3X B;  3W1S A;  2K6D B;  5H92 C;  1FPY A;  3IHP C;  1YJJ A;  1CZP A;  2FCM A;  1JRP A;  1EU4 A;  1AYF A;  1MPE A;  4ASW C;  2KWD A;  1JWA D;  4MH0 E;  3V05 A;  3AEA B;  1WXA A;  2LRW A;  4W9H A;  3RPF C;  4KKJ A;  1Q5W B;  5TSS A;  4H2A A;  3A33 B;  3U7D A;  1OEY J;  2ZCC A;  3NZ3 A;  4WIP A;  2PIA A;  1LGR A;  5BYQ A;  1FRD A;  2PVG C;  4DHJ D;  4PYZ A;  4L2Y A;  1QOA A;  3GE8 C;  4TKN A;  2N9P C;  2QHO A;  1ACC A;  2KN5 A;  3CF6 E;  3HHM A;  3QQ8 B;  4M0W B;  5IAA C;  1V1P B;  1I42 A;  1Q0W B;  3C19 A;  3L13 A;  4FA6 A;  2D3A A;  3VXW A;  3A4R A;  3VAW A;  3ZNG C;  4BBN F;  1E8Y A;  4MT5 A;  4GSW A;  2JZZ A;  1ZUD 2;  3O65 B;  4TV3 A;  3PZ7 A;  4ARC A;  2ZNV C;  5C23 A;  1E90 A;  3NHE B;  1STE A;  4M0W A;  1ZKH A;  2MEK A;  2UU7 A;  4OZB A;  1L6U A;  1Q1O A;  4EOY A;  4NJ7 A;  2HD5 B;  3B2F A;  2WU2 B;  3VR9 B;  2I38 A;  4XDD A;  2K0P A;  2K25 A;  3EA6 A;  4PS3 A;  1P3Q U;  5T8I A;  4LDT D;  3C0R B;  4GDK B;  4F1S A;  3RT3 B;  1WFY A;  3HK0 A;  3NOB A;  1R4M B;  1HEZ E;  3PZ8 A;  2LGD A;  4YTN B;  4YL8 A;  2RGF A;  1PQS A;  1ZXH A;  3QWZ B;  1T0S C;  3DVN V;  1CQV A;  3TBL D;  2RDH A;  4J6I A;  3AE6 B;  1FNU A;  4A6Q A;  1OGW A;  2JXX A;  3LXF A;  2DX5 B;  1PDX A;  4BZA A;  4A3P A;  2INN E;  1E7P B;  4BKS D;  3T3N A;  2IGD A;  2KQ4 X;  3V6E B;  3IAM 1;  2FBW B;  5CHV C;  4NAM A;  2O6V A;  3KLS X;  1V5O A;  4NQL B;  4OW0 A;  2OED A;  4OVZ A;  5JH5 C;  2QJL A;  2K3U A;  2KTR A;  2KMM A;  3DHI C;  1C79 A;  3BVM A;  1WXM A;  2JZP A;  3TSS A;  1EU3 A;  1ET6 A;  1WX8 A;  3Q2A C;  3KUC B;  4B0E A;  3ETR A;  4DDG D;  3W9C B;  2AQ1 B;  1N5X A;  4ZRK A;  3H9D A;  3Q8F A;  4W9G A;  3Q8A A;  4K1R B;  3Q3N C;  1ZE3 D;  2KN4 A;  1XT9 B;  4CQN A;  2V3N A;  4E74 A;  3CMM B;  3X23 A;  4RFB A;  4BAX A;  1UBQ A;  2ZPN A;  4JWS C;  3W1S C;  4LDT B;  1WRD B;  3DVN U;  5G5H A;  5DPS A;  1KLU D;  4KSK C;  2MJD A;  4KVG B;  2YEP F;  1WZ3 A;  5DPT A;  3MP9 A;  1V97 A;  1F77 A;  2N7E A;  2KQ7 A;  3MTN B;  3P4S B;  3OAW A;  3RI7 C;  2KK8 A;  3L54 A;  3Q8B A;  2RD0 A;  2CR5 A;  2BKR B;  4GB9 A;  3S2A A;  2LJ5 A;  2I1K A;  4NJC A;  1JML A;  1V2Y A;  2L52 A;  4C00 A;  2L0T A;  2NBW B;  1FM0 D;  5E6P A;  2Z0E B;  1H4R A;  2QCZ A;  3APD A;  3TEX A;  4WAA A;  1E7V A;  3A9K B;  4LK0 M;  1VRA B;  1NEK B;  3ONS A;  4M8M A;  5C3J B;  2WXG A;  1FFV A;  4MH8 A;  2W82 A;  3HIZ A;  1ZDX A;  4ZYS A;  1ZXI A;  1K53 A;  5IP4 D;  4KX6 B;  3UIN B;  3BYT B;  2WXJ A;  3H1U A;  2DNF A;  2KHW B;  3AE5 B;  2GOW A;  2M0X A;  2D3C A;  3NJT A;  4A20 A;  4WWN A;  3WCQ A;  3WAO A;  4DBG A;  3BIN A;  1GJZ A;  4ANX A;  2JY6 A;  2IND C;  4MDK E;  1GB4 A;  4MM3 B;  3U4E G;  3QCA A;  4FUL A;  2X8X X;  4DDI D;  1SF0 A;  1L0Y B;  3DWG C;  3P42 A;  1KLG D;  2WXK A;  3KYC D;  3OWE B;  1ZOY B;  4LLG M;  5E6J A;  1E8W A;  2LJI A;  3OG5 A;  2KAN A;  2N9K A;  4K81 A;  3JSV B;  2INC C;  2ZPY A;  5D3I B;  2IBI B;  1XCQ L;  1V49 A;  1R4M I;  4AQ7 A;  1NI3 A;  1WXQ A;  2OOB B;  3PHX B;  1C1Y B;  4WAF A;  4B95 A;  4HRO A;  1A70 A;  3DVG X;  2O6V D;  2WU5 B;  3M95 A;  2ZNV B;  2L7R A;  2YEP B;  2KOX A;  1QKZ A;  2M56 B;  2ZEQ A;  1WXS A;  1IPG A;  2DHZ A;  3TL5 A;  1FNV A;  2N9L A;  5FR6 A;  3VUY A;  3BVZ A;  3DBH B;  3KH0 A;  3MC0 B;  1Z2M A;  3JYU A;  1A5R A;  2FE8 A;  2BWF A;  4IM2 A;  1C4C A;  4GDL A;  2DAF A;  2FNJ B;  3Q8E A;  2FUH B;  1KTK A;  3AB5 A;  3GE3 C;  1WJ6 A;  4CYE A;  1E8X A;  4C80 A;  4EEW A;  5JXV A;  2KLG A;  3NUH B;  2D11 A;  2KVR A;  3MHZ A;  2LMC A;  4RM9 A;  1Q10 A;  2MX2 A;  2K6Q A;  2M19 A;  3U30 A;  2WS3 B;  2RDB C;  3DBS A;  3ALB A;  1JRU A;  4W9L A;  2WXQ A;  2WP9 B;  3OLM D;  5G2N A;  3VUX A;  3VUW A;  1MFW A;  2QDF A;  4BOZ B;  2JRH A;  3NRZ A;  4IWP A;  3ZRF A;  4RGT A;  4OVU A;  4IW0 A;  4TSS A;  1PYW D;  4DXG A;  2A4Z A;  4N6E B;  3SD5 A;  4EFO A;  1SBB B;  1PGB A;  3ZDT A;  5TR5 A;  4KGR A;  1UWM A;  1ZP0 B;  4B0M A;  2C5L C;  5AEK B;  2IY0 B;  1UUP A;  3AXC A;  4M8N A;  2I1J A;  1P98 A;  3AUL A;  2J0J A;  2HTH A;  2W3S A;  3IT4 B;  1D4B A;  3AM9 A;  3SEB A;  2L0F A;  2Z0D B;  2NTS A;  1V9J A;  3BZD B;  1FCC C;  2DBY A;  5G55 A;  1FD6 A;  3O13 A;  4HCN B;  1XF5 L;  2YLM A;  3TCA A;  1KH0 A;  1KJT A;  3EC8 A;  2MBQ A;  3BY4 B;  5GXG B;  2J53 A;  3KWV A;  3R7Q A;  4AP4 C;  2DZM A;  2KFK B;  1VDV A;  4GU2 A;  3ZVV A;  2FUG 1;  1QZE A;  2NCN A;  4K3C A;  4LCD E;  4ANU A;  1K8R B;  1E7U A;  3DWM A;  3U8Z A;  3AH7 A;  4GGQ A;  4EZK A;  3DBL I;  1JQ4 A;  1MVK A;  1J19 A;  3E56 A;  4C4V A;  1HTO A;  5I4D A;  3N20 C;  3VH3 B;  3E9S A;  2M1M A;  3RN9 C;  4B9K A;  1M4V A;  4KGT A;  4JPS A;  1XQQ A;  2KYW A;  1V5T A;  5CHF A;  1L0V B;  3ZRC A;  1RWS A;  4HLE A;  3BVG A;  2QC8 A;  1TYG B;  1KLV A;  5FKA C;  1XLO A;  2Y3A A;  2XK5 B;  2CHX A;  3MJW A;  3ZNZ B;  1ESF A;  3QHT A;  4GN1 A;  3OJ3 A;  4B6W A;  4II2 B;  2BTE A;  1GOZ A;  1S1Q B;  2N9X A;  1YJ1 A;  5LLI A;  4G0N B;  4P7I A;  2WQY B;  4DK5 A;  3VTV A;  4KZ0 A;  3W5U B;  3BYY B;  4E71 A;  2WWZ A;  3RNF C;  1DYQ A;  1OTR B;  3TEW A;  2IYD B;  1C76 A;  4WJN A;  2OJR A;  3NVV A;  3PT2 B;  4TQ1 A;  1FRR A;  1TKY A;  1RM6 C;  4A8X C;  2C7H A;  4XE0 A;  3WA0 A;  2XK5 A;  3UGB B;  3PHW B;  1WMH A;  3AEC B;  4FAD A;  1J7C A;  4RGN A;  1ET9 A;  3VR8 B;  2DYO A;  4XYC A;  1TJE A;  1MHX A;  2FID A;  5EE3 A;  4HPM B;  2MH7 A;  2AWT A;  2WXO A;  1Z5S B;  2IGG A;  3DOW A;  3Q3M C;  2CHZ A;  2LGI A;  4HCP B;  2W3R A;  5FR3 A;  2KJR A;  1I4Q A;  3QC8 B;  5IO9 A;  3ZUN A;  3KQ4 A;  1WX9 A;  2BB5 A;  2JQR B;  2O2V B;  1QOG A;  1SE9 A;  2K22 A;  4GMV A;  1T0Y A;  5H8Y E;  1SIF A;  1IYF A;  4YSZ B;  1TY2 A;  2G4D B;  4LTU A;  3A4S C;  1WGG A;  4EKU A;  3M3J A;  2EMS A;  3PRE A;  4ARI A;  1YJI A;  3QAR A;  3VH4 B;  4JX1 C;  4WWM A;  2IO0 B;  3V6C B;  4CHK A;  3FAH A;  3Q14 C;  3CIR B;  5IN7 A;  2K5P A;  2Z59 B;  2RDG A;  1UGM A;  3QA8 A;  3LYY A;  4O1N A;  2FCN A;  4WWP A;  3H8H A;  1E9M A;  2MHJ A;  3VFK A;  4II3 B;  3HM3 A;  3VTW A;  4EUT A;  1J7B A;  1L6V A;  2KNB A;  2WDV B;  2O2V A;  2BBC A;  2BS4 B;  3WIM A;  2V0G A;  2EKI A;  5L83 A;  3NS8 A;  4UDU C;  2L3Z A;  4W9J A;  3L16 A;  5D6J B;  3AEF B;  2DAJ A;  2LVQ A;  1FXA A;  2WXL A;  3AEE B;  4P1B C;  2WNM A;  1TS2 A;  1FXI A;  5C2T B;  3Q3J A;  1Y56 A;  3ZIM A;  1MG4 A;  1YOV B;  3DBR I;  2GRI A;  2JUO A;  3ECI A;  3NS1 A;  2MRP A;  1I7H A;  1DGJ A;  1NI2 A;  2BS3 B;  3BWU D;  1WWT A;  4HPL B;  4LNK A;  1M94 A;  4M02 A;  2PW9 A;  4WQO B;  1UZX B;  1VCB A;  2IY1 B;  3KUZ A;  5EE9 A;  2J0M A;  4K7S A;  4CO7 A;  1TY0 A;  2BQQ A;  4RGO S;  2PE6 B;  3DPD A;  2AL3 A;  2JYE A;  4P16 A;  2IO3 B;  1V81 A;  3MHS D;  3PVL A;  3N30 A;  5DPW A;  2KLC A;  1L5P A;  3PO0 A;  4BKS A;  3ZJV A;  2LVP A;  4HDQ A;  3PLU A;  3P4Q B;  4EE2 A;  3AEB B;  3H7P A;  1WZ0 A;  3EFU A;  1LXD A;  4JGH B;  2DZK A;  3CSF A;  2L32 A;  2CJN A;  3AE3 B;  2CU3 A;  1C3T A;  3IXS A;  2RPQ A;  1R7S A;  3I9V 1;  2LFI A;  2WXR A;  4S0R A;  1WGK A;  3AE7 B;  4XWW A;  1N61 A;  3NVW A;  1TKG A;  2KFJ A;  3B1L X;  1I4P A;  3AE8 B;  2KXJ A;  3AE4 B;  2KKC A;  3BII D;  3NZS A;  2MBO A;  2V3P A;  3VRB B;  4AJY B;  4ZHP A;  1XD3 B;  2JWZ A;  4KV2 A;  3P4P B;  1YQB A;  4K7W A;  1OQY A;  5LNK 1;  5LXI B;  1I4R A;  1YIW A;  3ZQ4 A;  2KWC A;  1NYR A;  3PRM B;  1IBX A;  2XEW A;  1QF6 A;  5JZE B;  4W9F A;  1HQR D;  1WM3 A;  1UBI A;  4LNI A;  4RMA A;  2BGF A;  4A55 A;  1WGH A;  3N1Y C;  5IA7 A;  2UYZ B;  3BK2 A;  1CK1 A;  2A5U A;  4A3O A;  3AN1 A;  2GI9 A;  1K50 A;  1N60 A;  1QOF A;  2AEH A;  5D7G A;  4DXF A;  5J17 A;  2D2Q A;  1LM8 B;  3I5J C;  1BXT A;  1X1M A;  1YQ4 B;  2B76 B;  3TEZ A;  1GB1 A;  3A1Q B;  2DEN B;  1T3Q A;  3IG3 A;  2L00 B;  1SB3 C;  3NZU A;  4K7U A;  2PEA A;  4ICU A;  4BFR A;  3H7S A;  3N32 A;  4PYU A;  2ONQ A;  1L7Y A;  3N9Y C;  4ANW A;  3SFE B;  1IGC A;  4P1C C;  4I6L B;  4ITK A;  1UGJ A;  1JWM D;  3GZN B;  1WIA A;  3KWL A;  3HM6 X;  3L4P A;  1WE7 A;  1XO3 A;  5KHQ A;  2KDI A;  3RUL A;  4AWJ A;  4RM8 A;  1TS4 A;  3EGR A;  3PS6 A;  5HHD G;  2HTM E;  4KGS A;  2R2O A;  3H6N A;  5AUI A;  3AEG B;  2WDQ B;  1E0Z A;  2DZJ A;  1EWY C;  1ZPS A;  3FIL A;  4BOS C;  3N1Z C;  4ZRI A;  1C4P A;  4MJS B;  1XLN A;  2KMC A;  4IUM B;  1JWB D;  2WLB A;  2BPS A;  1N63 A;  4FLH A;  1F0Z A;  1TTN A;  4FJY A;  3FKY A;  4K3B A;  2LD9 A;  1WY8 A;  5JHA A;  2WXF A;  1HZ5 A;  1VJK A;  1E8Z A;  5AZG A;  2KVZ A;  3JSV A;  3PV1 A;  1C78 A;  3PRZ A;  4AS1 A;  3LB8 C;  2SAK A;  2DZI A;  4FXC A;  4MGK E;  2ACZ B;  3K9P B;  3AV8 A;  4ZDV A;  3C8Y A;  3DDC B;  2LWP A;  2REX A;  2W54 A;  4DHZ B;  3P2B A;  4GDK A;  1E5W A;  1YNT E;  4FHJ A;  2WDT B;  1SGH A;  5D3D A;  1B1Z A;  3LJ3 A;  2LRU A;  2DWQ A;  3AI5 A;  4HVB A;  3UIO B;  4GOC A;  4YTP B;  4DQO C;  5IOI A;  1B9R A;  3VTU A;  1L0X B;  1SE3 A;  3FC4 A;  2ZVN A;  1KFY B;  4ZRQ A;  2BB6 A;  3AU5 A;  1SE4 A;  2J42 A;  3R8B A;  4ZHO A;  2IO1 B;  1E10 A;  1FMA D;  2BWE S;  2V3S A;  4IOI E;  3V3X A;  3IFW B;  2JXT A;  4A9A A;  5MPO A;  1WSP A;  4I6N B;  3RNC C;  3V61 A;  2KFK A;  1TGZ B;  1KM7 A;  3EUB 2;  1D3Z A;  1V1P A;  2QIE B;  3RD2 A;  1J0G A;  2DYM A;  1MJD A;  3DQV A;  3P4R B;  4LNO A;  1HZ6 A;  5BMG A;  3B2G A;  1AN8 A;  1QQR A;  3MJ5 A;  2OJW A;  1YMH E;  2E6X A;  2J7Q B;  2IDY A;  2UWQ A;  5EE0 A;  2KX3 A;  1SEB D;  4US8 A;  1OQQ A;  4P6V F;  4M00 A;  3KUD B;  3TUO A;  2VZK B;  2AQ3 B;  2X38 A;  1I35 A;  1DOY A;  1L2N A;  1EM7 A;  1D6E C;  3U2S C;  4F8C B;  2KMA A;  1UWX A;  3ZJT A;  2PTL A;  2KT7 A;  3SHQ A;  3UQA A;  3TJP A;  4XDC A;  4RH6 A;  2KDF B;  2EKE C;  2IO2 B;  2KWV B;  4WH4 A;  1KOT A;  3K9O B;  1FNW A;  2M8S A;  1E6E B;  2N7D A;  2KD0 A;  5E6N A;  4DWF A;  5BYR A;  4BBN C;  1DOX A;  5L95 C;  2BS2 B;  2MP2 B;  2MBH A;  3AE1 B;  2JF5 A;  1WE6 A;  4DHJ B;  4W9C A;  3SU8 X;  4C7Y A;  1F52 A;  1WM2 A;  2MWS B;  1QLB B;  1RRB A;  2VZK D;  3APF A;  4RGM A;  1NDD A;  2XN9 C;  1SE2 A;  1TZ1 A;  1WR6 E;  1K52 A;  2NTT A;  2CU1 A;  1C9F A;  5D2M B;  3I57 A;  1FO4 A;  5JHB A;  4MM3 A;  3HVZ A;  4JL9 A;  3L08 A;  1D5M C;  3VHT C;  1EF5 A;  1FXT B;  2TSS A;  2GBJ A;  1H8C A;  4USA A;  1UD7 A;  1GC6 A;  1AW7 A;  4WUR A;  1IUE A;  4WJO A;  1I4G A;  3ML8 A;  4JIO U;  3MFG A;  3NVZ A;  3RNE C;  2ZVO A;  3ZYY X;  4IG7 B;  2JT4 B;  5HFY A;  3VRA B;  1JCK B;  4AJW A;  1TKE A;  4RNA A;  2WDR B;  4ZRJ A;  4IM0 A;  3R3M A;  1T5X D;  1R4N I;  3VQI A;  2RSU A;  4HK2 A;  5EE1 A;  3ZLZ A;  4ZOH C;  1IGD A;  2RMM A;  4ZYN A;  3ZW3 A;  1T0R C;  2KWU B;  1S3S G;  1UH6 A;  2LZ6 A;  4IDI A;  2GMI C;  1HA5 A;  2ZZP B;  1P0R A;  1EWC A;  2N4F A;  5CHW A;  4S17 A;  2FAZ A;  2LUM A;  2PJH A;  3URY A;  3HRD D;  1Y8R C;  2L76 A;  2JU6 X;  2QSD A;  1SXT A;  2Y5C A;  3ZXV A;  4X57 B;  5BYS A;  3RZW C;  1EO6 A;  4FBJ B;  2DLB A;  1UNS A;  2LVO A;  1L4D B;  2Q5W D;  2V1Y A;  3SFD B;  2ZW0 A;  2IPK D;  4BKG A; 
#chains in the Genus database with same CATH homology
 3M63 B;  4DBG A;  3BIN A;  2MA9 B;  2M17 A;  4KDI C;  3PZD A;  5CTR C;  4W9E A;  1WJU A;  1GJZ A;  2NPT A;  3PPA A;  2DYB A;  2G4S A;  3PSE B;  3WAL A;  3GOE A;  4ANX A;  2C7M B;  2JY6 A;  2KFJ A;  2FCS A;  2KTR B;  3B1L X;  2KJ6 A;  4MDK E;  3JW0 X;  2MLB A;  1IP9 A;  2KX0 A;  2KXJ A;  3QCA A;  1WF9 A;  2JRI B;  4FUL A;  2CHW A;  3RCZ A;  2KKC A;  4DDI D;  3NZS A;  1AAR A;  4E3C A;  1WGY A;  2K1F A;  2MBO A;  4EZJ A;  1BT0 A;  3ZO5 B;  4AJY B;  2KC1 A;  1P9D U;  3CST A;  1XD3 B;  3KYC D;  2KDE B;  3PGE A;  2G3Q B;  4NQK E;  2JWZ A;  3KW5 B;  3RZF A;  4KV2 A;  3QX1 A;  4LJO B;  4MGI E;  3ZTD A;  1E8W A;  2MW5 A;  1YQB A;  4K7W A;  1OQY A;  5LXI B;  2KAN A;  3UQB A;  1TBE A;  1YIW A;  1YX5 B;  3QIJ A;  2W9N A;  4K81 A;  3JSV B;  4HDO A;  3H7P B;  2ZPY A;  2C7N B;  2IBI B;  1R4M I;  1V49 A;  2KWC A;  3PRM B;  3WAN A;  2XEW A;  1NBF C;  3T8M A;  4IWO A;  2OOB B;  5JZE B;  2PE9 A;  3PHX B;  2MCN B;  4W9F A;  1WJN A;  1G6J A;  2BYE A;  3DBH I;  1C1Y B;  1WM3 A;  4B95 A;  1UBI A;  3KVF B;  4RMA A;  2BGF A;  4WJP A;  2BYF A;  3DVG X;  2O6V D;  3T9L A;  3ENE A;  1WGH A;  5IA7 A;  2UYZ B;  2A5U A;  3M95 A;  2ZNV B;  4A3O A;  1ZW7 A;  2L7R A;  4G50 A;  2CKH B;  2RR9 A;  4URK A;  2AEH A;  5D7G A;  5J17 A;  3VDZ A;  2KOX A;  2D2Q A;  1LM8 B;  1J8C A;  5E6O A;  2MQJ A;  1WXV A;  2ZEQ A;  1WXS A;  1IPG A;  4NPN A;  2DHZ A;  3TL5 A;  1X1M A;  5FR6 A;  3TMP B;  3VUY A;  2V4L A;  2VRR B;  3A1Q B;  2DEN B;  3W1Y A;  1UEL A;  3N3K B;  3WAM A;  3KH0 A;  4XZ4 A;  3IG3 A;  1Z2M A;  3JYU A;  2L00 B;  3NY5 A;  3NZU A;  4HWI B;  3A9J B;  2GBK A;  3UF8 A;  4K7U A;  2PEA A;  1A5R A;  2K39 A;  4AUQ C;  1WI0 A;  2BWF A;  3GZN I;  3H7S A;  4ICU A;  4GDL A;  4IM2 A;  5DPR A;  4BFR A;  2DAF A;  4ICV A;  3N32 A;  4GDL B;  2FNJ B;  4PYU A;  2FUH B;  5LXH A;  1RLF A;  1L7Y A;  1WJ6 A;  3R66 C;  4CYE A;  3JVZ X;  2LXA A;  2NBU A;  4ANW A;  2KDB A;  1E8X A;  4W9I A;  4EEW A;  2KLG A;  2D11 A;  2NBV B;  2KVR A;  4I6L B;  3UIP B;  4RM9 A;  2MX2 A;  4MEM A;  2K6Q A;  3U30 A;  1ISN A;  3PTF C;  3DBS A;  2BKF A;  3ALB A;  1JRU A;  2AYO B;  4W9L A;  2K8C A;  3OLM D;  1WIA A;  5G2N A;  3VUX A;  3VUW A;  4DHZ E;  4OVV A;  3OJ4 B;  3HM6 X;  1WGR A;  2FIF A;  4BOZ B;  1WE7 A;  2JRH A;  4IWP A;  3ZRF A;  5KHQ A;  4OVU A;  2K8B A;  2KDI A;  4IW0 A;  1WJ4 A;  3RUL A;  4AWJ A;  2A4Z A;  4MGZ E;  4RM8 A;  4MSM B;  3SD5 A;  4EFO A;  5J18 A;  1V80 A;  4W9K A;  3PS6 A;  3ZDT A;  3B0A A;  4ANV A;  5TR5 A;  4KSL C;  2YVC A;  2D10 A;  2M4N A;  2R2O A;  3ZDM C;  2C5L C;  4DXA B;  5AEK B;  3H6N A;  2IY0 B;  2K8H A;  3AXC A;  4BKT A;  2N1W A;  4M8N A;  4WJQ A;  2DZJ A;  2I1J A;  1P98 A;  3AUL A;  4KIK B;  2J0J A;  2HTH A;  3L17 A;  3B08 A;  1GUA B;  2L0F A;  2Z0D B;  4BOS C;  2NS5 A;  4ZRI A;  1V9J A;  1GG3 A;  4MJS B;  5AZF A;  5G55 A;  2KMC A;  4IUM B;  4FJV B;  5DCN A;  1ZGU B;  3EEC A;  1EUV B;  4HCN B;  2BPS A;  4FLH A;  2YLM A;  3TCA A;  1LFD A;  1TTN A;  1KJT A;  2JZ3 B;  3EC8 A;  2MBQ A;  3ML9 A;  4FJY A;  3BY4 B;  4G3X B;  2K6D B;  3W1S A;  3R7Q A;  1F9J A;  2LI5 A;  2LD9 A;  4AP4 C;  2DZM A;  2KFK B;  3M62 B;  1WX7 A;  1WY8 A;  5JHA A;  5J2R A;  4GU2 A;  2IZV B;  3ZVV A;  1QZE A;  1WMH B;  1U4A A;  2NCN A;  4LCD E;  1E8Z A;  3IHP C;  1K8R B;  4ANU A;  1E7U A;  4W9D A;  5AZG A;  3JSV A;  3U8Z A;  2NR2 A;  3PV1 A;  3PRZ A;  2LXC A;  2FCM A;  4GGQ A;  2DZI A;  4EZK A;  1GNU A;  3DBL I;  1J19 A;  4ASW C;  4NAW A;  4MH0 E;  2WX0 A;  3VH3 B;  1WXA A;  2LRW A;  2M1M A;  4MGK E;  4W9H A;  4B9K A;  3K9P B;  1Q5W B;  2L8J A;  4ZDV A;  1MG8 A;  3A33 B;  3DDC B;  4XC2 A;  3U7D A;  4TQ0 A;  2LWP A;  2REX A;  4DHZ B;  1OEY J;  1XQQ A;  2CS4 A;  2ZCC A;  3P2B A;  1V5T A;  4GDK A;  2LUE A;  1E5W A;  4FHJ A;  2WDT B;  3IBE A;  5EDS A;  1SGH A;  5GMV A;  2HE7 A;  3LJ3 A;  5CHF A;  3ZRC A;  4DHJ D;  4PYZ A;  3VVW B;  2KQS A;  4TUU A;  2LRU A;  3AI5 A;  2ZCB A;  4TKN A;  4HLE A;  2N9P C;  2QHO A;  4HVB A;  2XBB C;  3UIO B;  1KLV A;  4GOC A;  2KN5 A;  3CF6 E;  3HHM A;  2XK5 B;  3QQ8 B;  4M0W B;  5IAA C;  3VTU A;  1GC7 A;  1WGD A;  2CHX A;  3MJW A;  1I42 A;  1Q0W B;  4KDL B;  2ZVN A;  3ZNZ B;  3L13 A;  4FA6 A;  3QHT A;  3VXW A;  4GN1 A;  3APC A;  3OJ3 A;  2G45 B;  4B6W A;  4F7Z A;  3AU5 A;  4II2 B;  3A4R A;  1S1Q B;  2N9X A;  5LLI A;  1YJ1 A;  2GBM A;  3DCG A;  3VAW A;  4G0N B;  3ZNG C;  4BBN F;  1E8Y A;  4NAW B;  4MJS A;  4P7I A;  4DK5 A;  3VTV A;  4KZ0 A;  4E71 A;  2IO1 B;  2WWZ A;  4IC7 B;  2BWE S;  1OTR B;  4GSW A;  2JZZ A;  4FN2 A;  2IYD B;  2C9W B;  2V3S A;  4WJN A;  2AL6 A;  4KIK A;  2OJR A;  3IFW B;  2KJH B;  3O65 B;  4NNJ B;  4TV3 A;  3PT2 B;  4TQ1 A;  3TIX A;  3IVF A;  5KHO A;  4I6N B;  3V61 A;  2ZNV C;  2KFK A;  3X0W A;  1TGZ B;  4JLC A;  1WYW B;  2KZR A;  2C7H A;  1KM7 A;  3WA0 A;  4MSQ B;  5C23 A;  1D3Z A;  1E90 A;  3NHE B;  2XK5 A;  3UGB B;  1ZKH A;  3PHW B;  4I6P A;  3RD2 A;  1J0G A;  3ZNH B;  1WMH A;  1P1A A;  2DYM A;  4FAD A;  3DQV A;  2DYO A;  1YD8 U;  4MGY E;  1Q1O A;  4EOY A;  2MBE A;  4NJ7 A;  3A9J A;  4N9F 4;  1WH3 A;  2HD5 B;  2FID A;  2LAS A;  3QK0 A;  4HPM B;  2AWT A;  2JVC A;  2K25 A;  4EZL A;  2J7Q B;  2GBN A;  2UWQ A;  1Z5S B;  2KX3 A;  3DOW A;  4PS3 A;  1P3Q U;  4LDT D;  3C0R B;  4GDK B;  4F1S A;  2CHZ A;  1EF1 A;  3KYD D;  2PPH A;  3KUD B;  1OEY A;  1WFY A;  4HCP B;  3RT3 B;  2BYV E;  2NVU I;  3HK0 A;  3NOB A;  2KJR A;  4FHK A;  3QC8 B;  2LGD A;  1I35 A;  3L0W B;  4YL8 A;  3ZUN A;  1L2N A;  3V62 A;  2RGF A;  1PQS A;  1WX9 A;  5AZH A;  3QWZ B;  3V60 A;  3Q3F A;  2O2V B;  3DVN V;  3TBL D;  1SE9 A;  4F8C B;  2KMA A;  4GMV A;  1T0Y A;  1SIF A;  4J6I A;  1IYF A;  5D94 A;  2D07 B;  2JXX A;  1OGW A;  4JQW C;  2G4D B;  3SHQ A;  2D3G A;  3A4S C;  2ASQ A;  4AOF A;  1WGG A;  2Y5B B;  4EKU A;  3M3J A;  2DX5 B;  3UQA A;  2J0K A;  2EMS A;  3PRE A;  4HJK A;  3TJP A;  2NPT B;  4A3P A;  3QAR A;  3VH4 B;  4BKS D;  4IWQ A;  2IO0 B;  2EKE C;  2KDF B;  3V6C B;  2IO2 B;  2LGY A;  2KWV B;  1KOT A;  3V6E B;  4CHK A;  3K9O B;  5CHV C;  4IM3 A;  2M8S A;  2O6V A;  2N7D A;  2KD0 A;  4XX5 A;  2O6V B;  5E6N A;  2Z59 B;  4DWF A;  1V5O A;  3QA8 A;  1UGM A;  4BBN C;  2N9E B;  2C60 A;  4NQL B;  5C1Z A;  5L95 C;  2MP2 A;  2ZJD A;  5JH5 C;  2MP2 B;  3A1Q A;  1YX6 B;  2KTR A;  2BF8 B;  2MBH A;  2JF5 A;  2KC2 A;  2FCN A;  1WE6 A;  1HE8 A;  3D32 A;  4NJ6 A;  4WWP A;  5BO4 B;  1WXM A;  4DHJ B;  3VFK A;  1WX8 A;  2EMT A;  4II3 B;  3KUC B;  2L05 A;  3HM3 A;  2N1V A;  1LQB A;  4W9C A;  3VTW A;  3SU8 X;  4DDG D;  4EUT A;  2HJ8 A;  3PRP B;  4GXB A;  4G11 A;  4ZRK A;  2KNB A;  3H9D A;  2O2V A;  5CX3 A;  1WM2 A;  2B3A A;  2MWS B;  1RRB A;  3WIM A;  2KTF A;  3LDZ E;  5L83 A;  4W9G A;  3APF A;  2JPH A;  3NS8 A;  4K1R B;  3QJZ A;  2L3Z A;  4KZC A;  4W9J A;  3L16 A;  1NDD A;  5D6J B;  1XT9 B;  3ZKJ C;  4E74 A;  3CMM B;  1TZ1 A;  1WR6 E;  2DAJ A;  4MEL A;  3X23 A;  2LVQ A;  2CU1 A;  1UBQ A;  3PLV A;  3L10 B;  5D2M B;  2ZPN A;  3Q3J A;  5JHB A;  3ZIM A;  3W1S C;  4LDT B;  4MM3 A;  4JL9 A;  1WRD B;  3L08 A;  3RUI B;  3DVN U;  3SDL C;  5DPS A;  3VHT C;  4KSK C;  3R7R A;  1EF5 A;  1FXT B;  1RFA A;  4KVG B;  1H8C A;  2GBJ A;  3DBR I;  1UD7 A;  2GBR A;  1GC6 A;  2JUO A;  1WZ3 A;  3ECI A;  5DPT A;  2KO3 A;  4WJO A;  1WR1 A;  4NY0 A;  2MRP A;  4HXD A;  2N7E A;  3ML8 A;  4WWO A;  1NI2 A;  4JIO U;  2KQ7 A;  3MTN B;  3OAW A;  2ZVO A;  3AU4 A;  4GIV A;  3ZTC A;  4HPL B;  2JT4 B;  2KK8 A;  3L54 A;  4IG7 B;  2RD0 A;  1VD2 A;  1M94 A;  5HKH A;  4AJW A;  2CR5 A;  3DVG Y;  4WQO B;  1UZX B;  1VCB A;  2IY1 B;  3KUZ A;  2BKR B;  4GB9 A;  4ZRJ A;  4IM0 A;  2J0M A;  4K7S A;  3S2A A;  2LJ5 A;  2I1K A;  3R3M A;  1R4N I;  3VQI A;  4CO7 A;  2RSU A;  4HK2 A;  3ZLZ A;  4PS8 A;  2WYQ A;  1V2Y A;  4ZYN A;  2PE6 B;  2L0T A;  3DPD A;  2NBW B;  2WX1 A;  2AL3 A;  5E6P A;  3ZW3 A;  2Z0E B;  1H4R A;  3APD A;  4BVU C;  2KWU B;  1S3S G;  2LGX A;  1E7V A;  4WAA A;  3A9K B;  1UH6 A;  3RYT A;  2LZ6 A;  3A9K A;  3ONS A;  3WAP A;  2GMI C;  4M8M A;  2ZZP B;  1P0R A;  2IO3 B;  1V81 A;  3ZNI D;  3MHS D;  3PVL A;  2N4F A;  3N30 A;  5CHW A;  3HIZ A;  1V86 A;  2FAZ A;  2KLC A;  5DPW A;  3I3T B;  3QAQ A;  4BKS A;  2PJH A;  2LVP A;  4LJP B;  4FJZ A;  1Y8R C;  2L76 A;  2R2Q A;  4HDQ A;  3PLU A;  3EHV A;  1CMX B;  4PS7 A;  4X57 B;  3RZW C;  1EO6 A;  3UIN B;  4FBJ B;  3H7P A;  1RAX A;  1WZ0 A;  3H1U A;  3EFU A;  1LXD A;  2MSE D;  4JGH B;  2DZK A;  3CSF A;  2KHW B;  2GOW A;  1V6E A;  2MBB B;  2LVO A;  2M0X A;  4A20 A;  2FCQ A;  4WWN A;  1C3T A;  2V1Y A;  3WAO A;  2RPQ A;  4BKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...