3H9DA

Crystal structure of trypanosoma brucei atg8
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
116
structure length
116
Chain Sequence
KDSKYKMSHTFESRQSDAAKVRERHPDRLPIICEKVYNSDIGELDRCKFLVPSDLTVGQFVSVLRKRVQLEAESALFVYTNDTVLPSSAQMADIYSKYKDEDGFLYMKYSGEATFG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords Microtubule-associated protein 1A/1B, light chain 3, putativ
publication title Trypanosoma brucei ATG8: structural insights into autophagic-like mechanisms in protozoa.
pubmed rcsb
source organism Trypanosoma brucei
total genus 32
structure length 116
sequence length 116
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3h9dA00
3QX1A 2K8CA 4E74A 4PS8A 3MJWA 3L10B 3AULA 1YX6B 2D10A 3JYUA 3V6CB 2J0MA 2O2VA 1LM8B 1WXSA 2V4LA 2V3SA 4DBGA 3GOEA 3H9DA 3RZFA 4KV2A 1GUAB 2DX5B 2L7RA 3EFUA 4HCPB 4HJKA 4N9F4 1L7YA 2Z59B 4EEWA 2KLCA 3V62A 1V86A 3U8ZA 2ZPNA 4GIVA 1RFAA 2KMCA 2IO2B 2O6VD 2XEWA 4HWIB 4B6WA 5KHQA 4JL9A 2KDIA 2AWTA 1PQSA 4TUUA 1WH3A 4HDQA 4DXAB 3EHVA 2MSED 2BYFA 3RULA 2WX0A 2KFKA 1HE8A 1T0YA 3TJPA 4MGZE 5J17A 3ZTCA 1V49A 5DPRA 2KO3A 2KTRB 4LJOB 1XT9B 1X1MA 1NI2A 4EOYA 1Y8RC 1LFDA 2ZPYA 2O2VB 5E6NA 2FCSA 4MGYE 5KHOA 3X0WA 2D07B 2KDFB 4GDLA 3R66C 2GBJA 2C7HA 3VUYA 2OOBB 4MSQB 3NY5A 4G3XB 5G55A 3DVGY 1YIWA 2GBKA 1WFYA 2KQ7A 1LXDA 3ALBA 2LZ6A 3EC8A 4ZDVA 2AEHA 1YJ1A 4MGKE 4W9LA 4AWJA 3VXWA 1GC7A 3D32A 3UF8A 3L0WB 4NPNA 3DBLI 4PS7A 3A1QA 4W9EA 3NS8A 2ZNVC 3L16A 2JY6A 5HKHA 1WGGA 4BFRA 2CR5A 2M17A 3AI5A 1OGWA 1IP9A 2J0KA 3R7RA 3TL5A 5G2NA 1FXTB 2KFKB 2JRIB 3DVNU 4MJSA 5D94A 4KIKA 3L08A 2MBOA 4ANWA 2BKRB 2LGDA 2KLGA 1E8YA 1WMHB 2FUHB 3PRZA 4GN1A 5J18A 1WX7A 2Z0DB 4GSWA 3RZWC 3ZNHB 4LDTD 1L2NA 3M95A 2PJHA 4OVUA 4FBJB 2KXJA 1P0RA 3PPAA 4GDLB 3JSVA 4FADA 1UGMA 4IM2A 2G4SA 2FCQA 4I6LB 2NS5A 2PE6B 3CF6E 2M8SA 3A33B 1Z2MA 4K7UA 4W9HA 2DZKA 3SU8X 2C60A 2GBNA 2KNBA 4TQ0A 1S3SG 3CMMB 3PGEA 2CKHB 4FHJA 2N1WA 1MG8A 3A1QB 4GMVA 2NBUA 3WAOA 2DHZA 4A3PA 4DK5A 2KZRA 2REXA 3ZRFA 1R4NI 5LXHA 2UWQA 1AARA 3RD2A 3APFA 5E6PA 2DZIA 2GMIC 2K25A 2NBVB 1P1AA 1YX5B 2LI5A 5AZFA 3W1YA 3HK0A 4BBNF 3UINB 5L83A 4ANXA 2N4FA 3NZUA 2KWCA 1LQBA 1WY8A 2NPTA 3IVFA 3ZO5B 3OJ3A 3HM6X 1H4RA 1U4AA 3QC8B 2DAFA 2IO0B 4M8NA 3JSVB 4EZKA 2J0JA 3QARA 3VUXA 5TR5A 3K9OB 4WWOA 2VRRB 3DVGX 4HVBA 4GXBA 2FAZA 2M0XA 2KVRA 2LRUA 1EF1A 4XC2A 2BYEA 3PHXB 4K81A 1Q0WB 4XX5A 3WANA 4MH0E 3RT3B 4K7SA 4FA6A 4GDKA 4NQLB 1C3TA 1VCBA 1RLFA 4K1RB 3ZW3A 2GOWA 2L76A 3A4RA 3M63B 3ONSA 4IM0A 3OLMD 3ZDTA 4ZRIA 3QJZA 3TMPB 1WGRA 3T8MA 3VHTC 1UELA 2ZEQA 3VTWA 3NOBA 3MHSD 3VH4B 2G4DB 2MW5A 3K9PB 2GBRA 4FJYA 3UQAA 1D3ZA 4FJZA 2NVUI 1G6JA 1I42A 2KMAA 3NHEB 4BKSA 1XD3B 1QZEA 2XK5A 4NJ7A 2M4NA 3LJ3A 4GU2A 1CMXB 1YD8U 4KVGB 1NBFC 2L8JA 4PS3A 3VH3B 1P9DU 2FCMA 2BWES 4WJOA 2LVQA 2N9PC 4LJPB 4DDID 3UQBA 1J0GA 3T9LA 1UBIA 4I6NB 2ZJDA 2MQJA 2R2OA 1H8CA 2JZZA 2DZJA 2JF5A 2Y5BB 4ANVA 4GDKB 2FIFA 2BWFA 5BO4B 4PYZA 1E8WA 2CHZA 3DQVA 2IBIB 2KD0A 4EKUA 1F9JA 4IG7B 3B1LX 4HPMB 1E8ZA 3WAMA 1WR1A 2PE9A 2EKEC 2LVOA 2AL3A 4K7WA 1P98A 3RUIB 4EZLA 1GG3A 2DYOA 3NZSA 4KZ0A 1WX9A 5C1ZA 3B0AA 3HM3A 1EUVB 3TCAA 1J8CA 2XK5B 2N7DA 4RM8A 3KUZA 4E71A 3SHQA 2N9XA 4G50A 1UH6A 2N1VA 3Q3JA 3VAWA 1V2YA 4G11A 4B9KA 4AUQC 2I1JA 2KK8A 2ZVNA 2R2QA 2JUOA 1ISNA 3DPDA 4GGQA 3ENEA 5LLIA 3DBSA 3IFWB 3VDZA 3TIXA 3CSFA 5DPTA 1S1QB 2PEAA 2PPHA 5FR6A 4ZRKA 4IWOA 2L05A 1P3QU 2KX0A 2JVCA 4FULA 4X57B 2MWSB 2KANA 2LVPA 4EFOA 2MX2A 1TBEA 2BPSA 5C23A 4F1SA 4BOZB 2FNJB 2LGYA 3PHWB 5CTRC 3IHPC 5E6OA 3DCGA 3PTFC 4BKGA 1OEYA 2CHWA 3DOWA 2KHWB 3L17A 3WA0A 3ZLZA 4WAAA 3UGBB 4FLHA 2IO1B 3ZTDA 1E7UA 1WXVA 1WXMA 4AJYB 4NNJB 3UIPB 2NCNA 3ZNGC 4HCNB 1WZ0A 1WGYA 2IO3B 3Q3FA 5IA7A 2KC2A 4F7ZA 2WWZA 2ZCCA 1VD2A 3PLVA 4WJNA 4OVVA 3APCA 3S2AA 1RRBA 2LXCA 1KLVA 2DYMA 3V61A 4CHKA 1OQYA 2N7EA 3H7PA 3ZDMC 3B08A 3AU5A 3VTVA 4KDIC 2MBHA 2DENB 3KUDB 2D2QA 3R7QA 2K8BA 3VQIA 3QK0A 4MJSB 2A5UA 4KIKB 2JZ3B 4DHZE 3CSTA 2JXXA 4GB9A 4ICUA 4PYUA 3U30A 1R4MI 3M3JA 3HHMA 2ZNVB 4P7IA 3PLUA 1TZ1A 4JGHB 2MBBB 2ZVOA 3HIZA 3H1UA 3TBLD 2QHOA 2KX3A 4URKA 2M1MA 3H6NA 5AEKB 1E90A 1BT0A 2L0TA 3DDCB 4DHJB 4DWFA 2W9NA 3MTNB 2UYZB 2IY0B 4J6IA 3OAWA 1UZXB 2ZCBA 4FJVB 3ZRCA 4BKSD 3WIMA 2CU1A 3KW5B 2MP2A 3A9JA 4M0WB 1WJ4A 2KQSA 4BBNC 3H7PB 2C7MB 1IPGA 2L0FA 2J7QB 4WWNA 4B95A 4JIOU 2MCNB 5EDSA 3IG3A 2MBEA 4KSLC 2YVCA 3IBEA 3PZDA 4XZ4A 2AL6A 2YLMA 5CHWA 1OEYJ 3U7DA 3ECIA 1WYWB 3PSEB 2NPTB 3PRPB 1ZGUB 4HXDA 3VUWA 4E3CA 1WE7A 3QWZB 1SIFA 3PREA 2IYDB 2LWPA 4ZYNA 2RPQA 2G3QB 2JT4B 2KTFA 3N30A 5CHFA 3ZVVA 1V5TA 1WI0A 3JW0X 4I6PA 1V81A 4HLEA 5JHAA 5JZEB 4JLCA 1YQBA 5DPWA 3ZUNA 2I1KA 4KZCA 2BYVE 1K8RB 2HD5B 2CS4A 5D2MB 3WALA 4ICVA 1RAXA 3A9JB 5JH5C 2MLBA 1V5OA 3AXCA 4TV3A 3RCZA 4DDGD 4WQOB 2K6QA 2KC1A 2KWUB 2N9EB 1JRUA 4TKNA 5JHBA 4W9JA 1C1YB 2FIDA 4EUTA 4BKTA 4EZJA 2WDTB 4IC7B 2D11A 3VTUA 2CHXA 1WE6A 2HJ8A 4FN2A 5D7GA 3QAQA 3W1SC 1WR6E 3BY4B 1UD7A 2KDEB 2LD9A 4RMAA 1WJNA 3PT2B 2C5LC 2LGXA 2NR2A 2C9WB 2OJRA 2HTHA 3UIOB 4W9FA 4MGIE 2D3GA 4II3B 3ZNZB 2RGFA 2DAJA 1ZW7A 3W1SA 4CYEA 4HK2A 1WMHA 4DHJD 3P2BA 1A5RA 4IUMB 4HDOA 1TGZB 2LRWA 1GNUA 3V6EB 1WZ3A 1Q5WB 1SGHA 3KVFB 3ZKJC 4F8CB 2JPHA 2BF8B 4IWQA 2NBWB 2O6VA 3ML8A 5IAAC 4IW0A 2AYOB 4DHZB 2ASQA 3DVNV 3ML9A 1WXAA 3L13A 3C0RB 1M94A 1V6EA 3KYCD 2BGFA 5J2RA 2BKFA 5AZHA 1GJZA 1E7VA 1WM2A 2LASA 4JQWC 4NJ6A 4W9DA 1WGHA 2DZMA 1E5WA 3A9KA 2RD0A 3L54A 1Z5SB 1SE9A 3R3MA 4MEMA 5AZGA 5GMVA 2C7NB 2KFJA 3WAPA 3DBRI 2RR9A 2B3AA 4II2B 3RYTA 3O65B 5L95C 3APDA 1OTRB 3GZNI 3DBHI 4MELA 2KOXA 3A4SC 4LCDE 2EMTA 3H7SA 1EO6A 1V80A 4AOFA 2MRPA 4WJPA 1KM7A 1IYFA 2WYQA 4MM3A 3ZNID 2O6VB 3VFKA 5LXIB 5DCNA 3EECA 3PRMB 2K39A 3SD5A 4WJQA 4CO7A 1KJTA 2V1YA 2XBBC 4W9CA 4A20A 2G45B 1EF5A 2L3ZA 2WX1A 4WWPA 2EMSA 1NDDA 3LDZE 1KOTA 2GBMA 1UBQA 2L00B 4NAWA 4RM9A 3PVLA 4G0NB 5D6JB 4MDKE 3A9KB 4FHKA 3M62B 4NQKE 4HPLB 1WRDB 4W9IA 3QA8A 1WX8A 2K6DB 3QCAA 2KJHB 2LUEA 4IM3A 1XQQA 2HE7A 1J19A 2KDBA 4ASWC 2MA9B 4ZRJA 3OJ4B 2DYBA 1WF9A 2FCNA 4AJWA 3AU4A 2RSUA 5DPSA 1ZKHA 2LXAA 1TTNA 1WJ6A 3V60A 4W9KA 4GOCA 3ZIMA 2IZVB 2KKCA 2A4ZA 3QIJA 4A3OA 4KDLB 4BVUC 2Z0EB 2K1FA 2IY1B 3KH0A 2JWZA 2MBQA 1V9JA 2KJ6A 4NY0A 2KN5A 4W9GA 3SDLC 2LJ5A 1GC6A 3QQ8B 4BOSC 1E8XA 3PS6A 3VVWB 1WGDA 3PV1A 4NAWB 3N3KB 2KJRA 3N32A 4ANUA 4KSKC 2ZZPB 3JVZX 1WIAA 3I3TB 1WM3A 3KYDD 4YL8A 1Q1OA 1I35A 3BINA 3QHTA 2JRHA 4AP4C 4LDTB 3KUCB 3X23A 2KTRA 4TQ1A 2K8HA 2MP2B 4IWPA 1WJUA 5CHVC 4M8MA 5CX3A 2KWVB 4MSMB
chains in the Genus database with same CATH superfamily
4PS8A 3MJWA 3L10B 3V6CB 1XCQL 1WXSA 4YTPB 1PFDA 2D3BA 3H9DA 1FRDA 1PDXA 1I4XA 4HJKA 1Y56A 1L6VA 2KLCA 3V62A 2YEPF 4JL9A 2VZKB 4N6EB 4TUUA 2INNE 2G1EA 4ZRPA 1T0YA 1EWYC 4MGZE 5J17A 1V49A 5DPRA 4LJOB 1XT9B 1NI2A 3P63A 3RPFC 4EOYA 3RNAC 4XDCA 2KDFB 2LHDA 3U7ZA 2HDEA 3MJ5A 1WFYA 1LXDA 1TS4A 2LZ6A 4W9LA 4AWJA 3L0WB 2LEKA 2IGHA 3LB8C 3L16A 3NS8A 5HKHA 1UUPA 1OGWA 3R7RA 4ZHOA 1YNTE 1FXTB 2G9HD 1ZE3D 4A55A 3DVNU 1WMHB 2LGDA 3PRZA 2H89B 2Z0DB 4GSWA 3B2FA 5C2TB 1FRRA 1L2NA 1VJKA 3M95A 2PJHA 4FBJB 3PPAA 1P0RA 3H8HA 1E7PB 3B2GA 2XN9C 4RGOS 2X8XX 3VRAB 2PE6B 1D5ZC 1Z2MA 2QSDA 1FPYA 4FHJA 2N1WA 4GMVA 2NBUA 2WDRB 1B1ZA 3APFA 2CJOA 2DZIA 2GMIC 2K25A 3FILA 3URYA 4BBNF 4LK0M 4P1BC 1LQBA 1WY8A 3IVFA 4RNAA 1H4RA 1U4AA 3QC8B 2DAFA 2K9XA 3ZXVA 2E6XA 3N1XC 4WWOA 1HTQA 4YXDB 2FAZA 3WANA 4K7SA 4K1RB 3ZW3A 2DLBA 3M63B 5IP4D 3GS2A 1PUTA 3TMPB 1VZ6A 3MFGA 2W55A 3VTWA 3UQAA 4FJZA 2NVUI 4ACFA 1R4MB 5HHDG 1L4ZB 2BS3B 3NHEB 2CU3A 2M4NA 3LJ3A 5G5HA 4QAYA 1K51A 1BMLC 1P9DU 3T3NA 4WJOA 2LVQA 4LJPB 2WXGA 1J0GA 3T9LA 2ZJDA 2MQJA 2Y5BB 4ANVA 3I5JC 3NVWA 4GDKB 2BWFA 1XCTL 3DHHC 4MACA 2CHZA 3W5UB 2IBIB 4J3OD 3R2IA 1LO5D 1F52A 2VH1A 4UDUC 2BTEA 2LVOA 2BB6A 3NZSA 3Q6BA 4C7ZA 4RM8A 3SHQA 4RF1A 3Q3JA 4B9KA 4AUQC 2I1JA 2JUOA 5T8IA 2PW9A 3VDZA 3TIXA 5FR6A 1TZOA 3Q8BA 4IWOA 4X57B 4EE2A 2MX2A 4XWTA 2WXJA 5C23A 4D2KA 2PMVA 2J52A 4BOZB 3P42A 5CTRC 4AQ7A 3KWLA 4BKGA 1OEYA 3WA0A 4FLHA 2CJNA 3ZTDA 1WXVA 1WXMA 3NVVA 2NCNA 2KC2A 2KN4A 2WU5B 1PGXA 3S2AA 2VH2A 1M4VA 2MBHA 3KUDB 4KGTA 3LXFA 3CSTA 2JXXA 4B0EA 2BYTA 3M3JA 3R2TA 1V8CA 1QILA 4JGHB 4XYCA 3H1UA 2KT7A 2KX3A 4DWFA 2L0TA 1AN8A 2QMTA 3N1ZC 1YOVB 3P4PB 3A9JA 4WWMA 1K53A 5FR3A 3GZNB 2J7QB 2L0FA 4M00A 5LNK1 2W3SA 2MBEA 3Q3MC 1L0XB 4S17A 2AL6A 2YLMA 1TKYA 1OEYJ 1RFKA 3ECIA 3PRPB 3VUWA 3CIRB 3QWZB 2LWPA 2JT4B 2KTFA 3EA6A 4JLCA 4HKQA 3ZJVA 1SE2A 3NG0A 3WALA 4ZHPA 3BYYB 2ACZB 5JH5C 4TV3A 1XLQA 3RCZA 1TS5A 1XEEA 4NJCA 2K6QA 1XLPA 2N9EB 2WXRA 5JHBA 4W9JA 1JCKB 2FIDA 4BKTA 4IC7B 2D11A 2CHXA 2HJ8A 1TKEA 3W1SC 2IGGA 2LD9A 2LGXA 2OJRA 1STEA 3AE8B 4MGIE 2D3GA 1VLBA 1VR9A 1QQRA 4CYEA 3V6EB 4F8CB 3MHZA 3ZKJC 5C3JB 1MHHE 2NBWB 3ABVB 5IAAC 2BT6A 2WXFA 3L13A 2WLBA 4HRSA 4RF0A 1K52A 4JQWC 5H92C 3A9KA 1E5WA 3L54A 4FXCA 5AZGA 5GMVA 2C7NB 3OG5A 2YEPB 1D5MC 5L95C 1OTRB 2KOXA 3U52E 1V80A 1EWCA 2WYQA 3ZNID 3EECA 3PRMB 4WJQA 2WXNA 4CO7A 2INDC 1EF5A 4WWPA 1TS2A 2L00B 3P4SB 4NAWA 3AE7B 1JMLA 3M62B 1K50A 1WX8A 3QCAA 2LUEA 1XQQA 4YSYB 1YJIA 2KDBA 2DYBA 2FCNA 3ZXRA 5IO9A 5HFYA 3V60A 4W9KA 4MM3B 3AE2B 2KKCA 3W5VB 3ZJTA 2AQ1B 4K3CA 1V9JA 4NY0A 2KN5A 3SDLC 1GC6A 3PS6A 1FIQA 1WGDA 3PV1A 3NRZA 4WH4A 3N3KB 2KJRA 3I3TB 1WM3A 4C4VB 4YL8A 3QHTA 1SE3A 3BVZA 3KUCB 3X23A 2WDQB 2K8CA 1C4CA 1E9MA 3GB1A 1LM8B 1TYGB 3GOEA 1JALA 1XO3A 1QOFA 1V1PB 3EFUA 4OW0A 1C4PA 1AW7A 3Q8AA 4PT5A 3T3OA 1SIJA 4GIVA 2KMCA 1EU3A 1WYGA 2O6VD 2DBYA 2AWTA 2WXKA 4YTNB 3VR9B 2Y5PA 1EM7A 1WH3A 3MC8A 2OHFA 1A70A 1FCCC 3DHIC 1ACCA 2WXPA 2BYFA 4HDQA 4DXAB 3RULA 2WX0A 4RGTA 2J53A 3ZTCA 1NYRA 2KO3A 2KTRB 1X1MA 2Z8LA 3P4RB 2ZPYA 2OJWA 5E6NA 4MGYE 3X0WA 2D07B 3R66C 2C7HA 3VUYA 4MSQB 3NY5A 3Q2AC 4G3XB 5G55A 1YIWA 3ALBA 1UWXA 2AEHA 1JROA 4ZDVA 1YJ1A 4O1NA 4W9EA 4BFRA 2M17A 5D3DA 5G2NA 1RYJA 3IT4B 4MJSA 4S0RA 3L08A 4OZBA 2FUHB 5J18A 2JSVX 1WX7A 3ZNHB 1ET9A 4L2YA 4WURA 3HUIA 1SB3C 4GDLB 2BBCA 1UGMA 4I6LB 2M8SA 3A33B 1KLGD 3NUHB 4W9HA 2DZKA 5I4DA 2KQ4X 4XE0A 2WXMA 3PGEA 2NTSA 3A1QB 4LNOA 3WAOA 4DK5A 4A3PA 3AV8A 2KZRA 2REXA 1R4NI 2NMQA 2UWQA 1VDVA 1MPEA 1YN3A 1QT9A 2M0AA 2GB1A 1OQRA 3HK0A 3W1YA 3UINB 5L83A 1NENB 3BK2A 3NZUA 3ZO5B 4YT0B 1HTOA 4M8NA 3JSVB 4EZKA 1V97A 3QARA 3VUXA 5TR5A 4YSZB 4RGMA 5IKCM 2M0XA 3N20C 3RNCC 1N60A 3RT3B 4GDKA 1VCBA 3HVZA 5H8YE 1P7EA 2GOWA 2L76A 4IM0A 3OLMD 3QJZA 3VHTC 1UELA 2IJ0A 3NZ3A 3Q8EA 3NOBA 2G4DB 2ZW1A 4HKZE 2M56B 4A6QA 3RMKC 1L6UA 4NJ7A 2KDMA 1I7HA 1YD8U 1NBFC 3VH3B 2FCMA 3TEZA 4CQNA 2BWES 2N9PC 1ZUD2 3E56A 4US9A 1H8CA 4ZRQA 2WXIA 5BO4B 3DQVA 2KD0A 1F9JA 4IG7B 4HPMB 1E8ZA 2KVZA 2PE9A 2AL3A 4K7WA 2L1AA 1KF6B 2WXHA 2DYOA 3AEFB 1JWBD 5C1ZA 3HM3A 1CJEA 3TCAA 2XK5B 1UGJA 3AM9A 2N9XA 4G50A 1V2YA 2D3CA 3I9V1 4G11A 2ZVNA 3AEDB 4TMAB 1VZ7A 4BAXA 3FKYA 1AWDA 2PEAA 4NZLB 5EE9A 2L05A 2D5GA 2JU6X 2KANA 1ZDXA 2WQYB 2FNJB 2H88B 3PHWB 5E6OA 3TUOA 4NNJB 3SR6A 1XXGA 1YQ4B 2WWZA 2ZCCA 3Q3OC 3APCA 1HZ5A 4WAFA 1KLVA 4OZAA 4CHKA 3BZDB 2KACA 2J42A 2TSSA 2K8BA 3VQIA 4MJSB 4GB9A 4PYUA 3NVZA 1HEZE 2ZNVB 2PLPA 2ZVOA 4YWGG 1QOAA 3H6NA 1E90A 4LNFA 3DDCB 2W9NA 4JX1C 3OAWA 1UZXB 2ZCBA 1TIFA 4BKSD 3WIMA 3KW5B 4C00A 1Q10A 4M0WB 1WJ4A 5JXVA 3H7PB 4A9AA 4ARCA 4M01A 2C7MB 4WWNA 4H2AA 2MCNB 1I4RA 2YVCA 2JYTA 2RMMA 1SXTA 1KTKA 3PSEB 3ZQ4A 4E3CA 1ZGUB 4HXDA 1WE7A 2IYDB 4ZYNA 2G3QB 3JW0X 4HLEA 2I1KA 4KZCA 1B9RA 2WU2B 4ICVA 1T0QC 4US8A 1XLNA 5AUKA 4K3BA 1TKGA 3AB5A 4WQOB 1JRUA 3AEAB 5EE0A 3TSSA 1C1YB 1WE6A 2B76B 3QAQA 4XWWA 1WR6E 2KDEB 3AN1A 3HRDD 4RMAA 2NR2A 3KQ4A 2HTHA 4W9FA 2DAJA 1AYFA 1A5RA 4HDOA 2LRWA 1GNUA 4P16A 1TT5B 3W9CB 1T5XD 3ML9A 2V3NA 4C80A 1M94A 1F2RC 1V6EA 3C19A 1E7VA 2LASA 3R3MA 1Z5SB 3AEGB 4OVZA 3AE9B 4II2B 2RR9A 3I63C 2QDFA 1SSNA 5EE1A 3O65B 4KGSA 4USAA 2K3UA 4MELA 2EMTA 1ZP0B 5HG2A 2MRPA 4WJPA 3AECB 4MM3A 2JYEA 2O6VB 5LXIB 2V0GA 1N61A 2K39A 2WXQA 1ROEA 3SFDB 5FK9C 1CQVA 2LFIA 2GBMA 2PVGC 4MDKE 1JRPA 4FHKA 4NQKE 1WRDB 4A90A 2V4IB 2K6DB 4C4VA 4IM3A 2VZKD 3OJ4B 1JWSD 3PZ7A 1WF9A 2PKOA 1N5XA 2LXAA 3ZIMA 1I4GA 4IKGA 2QJLA 1V1PA 2K1FA 1I4PA 2IY1B 2LJ5A 3QQ8B 1WSPA 4GLSC 4ANUA 1T0SC 1C9FA 3KYDD 1I35A 1R4NB 2DNFA 2KTRA 4TQ1A 3AH7A 2K8HA 1WJUA 2LUMA 2KWVB 4MSMB 4E74A 2D10A 2L52A 3JYUA 2MH7A 1FO4A 2J0MA 4DBGA 1VZ8A 4KV2A 1GUAB 3RNBC 2JQRB 2L7RA 2Z59B 4EEWA 4REZA 2ZPNA 1QOGA 2XEWA 4HWIB 4B6WA 5G5GA 2W54A 1IGDA 3PO0A 3DWMA 4YSXB 2R61A 3C8YA 2KMMA 1Y8RC 1LFDA 1NYQA 2O2VB 4LLGM 2FCSA 5KHOA 4GDLA 2GBJA 3Q69A 3DVGY 1SEBD 2GBKA 2KQ7A 3EC8A 2IPKD 3EGRA 1L5PA 4MGKE 3D32A 3UF8A 5BMIA 4NPNA 4PS7A 3A1QA 2JY6A 1WGGA 2CR5A 3AI5A 1IP9A 2J0KA 1CZPA 2KFKB 1KLUD 2Q5WD 4ANWA 4C7YA 4GN1A 2KLGA 4P6VF 3AEBB 1FNVA 1DOIA 1QLBB 2KXJA 3JSVA 4FADA 2FCQA 3R8BA 2C60A 2GBNA 1S3SG 3CMMB 2HJ1A 2CKHB 4RCOA 2DHZA 4DXGA 1RWSA 3ZRFA 1GB1A 5LXHA 1OQQA 3MC0B 1P1AA 1YX5B 3ZYYX 5D3IB 3Q3NC 2NPTA 2AQ3B 1YN5A 2BS2B 4HVBA 4GXBA 2KVRA 1GPXA 1EF1A 4XC2A 3PHXB 4K81A 1Q0WB 4MH0E 4FA6A 4NQLB 1C3TA 2MEKA 3A4RA 3ONSA 3ZDTA 3T8MA 2KWDA 2MW5A 3K9PB 4FJYA 1D3ZA 4R3DA 1G6JA 2ON8A 2KMAA 1XD3B 1QZEA 2XK5A 2L83A 2ICIA 4GU2A 1ZDVA 4KVGB 2L8JA 1J7CA 3IT6B 3IAM1 4DDID 3UQBA 4I6NB 4OZCA 2I2YA 3NVYA 2DZJA 2JF5A 1GAQB 2FIFA 4PYZA 1E8WA 4EKUA 3B1LX 3ZGZA 1FMAD 1F77A 3WAMA 4C56C 4B0MA 1P98A 3RUIB 4EZLA 1L0YB 1GG3A 4KZ0A 2BS4B 5IN7A 3B0AA 1J8CA 2PTLA 4E71A 1UH6A 2N1VA 3SFEB 3RNGC 1N6ZA 2R2QA 1YN4A 4GGQA 2INCC 1FCLA 3IFWB 4RGNA 1T3QA 5DPTA 1S1QB 2PPHA 4ZRKA 2KX0A 3UI3A 1WRIA 2IDYA 3BYTB 4F1SA 3WCQA 1R7SA 3VRBB 3PTFC 2CHWA 3DWGC 4WAAA 3AE3B 2IO1B 3UIPB 2RPVA 2KAJA 3ZNGC 4HCNB 4DQOC 2IO3B 5IA7A 1V1OA 5BMHA 3PLVA 4WJNA 1RRBA 2LXCA 2DYMA 4M0WA 2PVOD 1OQYA 2N7EA 2SEBD 3H7PA 3ZDMC 3B08A 1YMHE 3AU5A 4KDIC 2SAKA 3R7QA 3QK0A 2A5UA 2JZ3B 3U30A 2GRIA 4LNKA 3NS1A 3HHMA 4P7IA 1TZ1A 2MBBB 3HIZA 4XGAB 3TBLD 2LJIA 1VRAB 1BXTA 1BT0A 4L23A 3MTNB 2UYZB 4J6IA 4FJVB 3ZRCA 1C79A 4JWUC 1UNSA 2MP2A 3AE1B 4BBNC 1IPGA 4HJGE 2ONQA 4KSLC 3IBEA 2JZPA 3PZDA 5E6JA 1WYWB 1WXQA 2NPTB 1SIFA 3PREA 1KRHA 1UF0A 5CHFA 3NJTA 3N30A 1OFFA 4PK1A 4L1BA 5JHAA 1YQBA 5BMGA 5DPWA 2BYVE 2HD5B 3FAHA 2CS4A 2N9LA 5D2MB 2MLBA 1V5OA 3U2SC 1WGKA 4DDGD 2KC1A 4TKNA 2MHJA 4N59A 4EZJA 2WDTB 3AE6B 1T6BX 5D7GA 2IGDA 1ZXIA 3BY4B 3PZ8A 1UD7A 2WP9B 5IOIA 3PT2B 2RDBC 3N1YC 5TSSA 2BW2A 4II3B 2UU7A 1NVID 1ZW7A 3W1SA 2W3RA 2JX5A 4DHJD 3P2BA 2E3TA 4IUMB 1TGZB 1P7FA 1Q5WB 1SGHA 2JPHA 2BF8B 2O6VA 3ML8A 4HROA 4IW0A 4KKIA 1FM0D 3DVNV 3C0RB 4KKJA 3KYCD 2BGFA 2BKFA 5AZHA 3CWIA 3I57A 4W9DA 2XNAC 1LGRA 1WGHA 2RD0A 2Y3AA 1SE9A 3RNFC 3WAPA 3DBRI 2B3AA 1PYWD 3RYTA 1IUEA 3APDA 1JWMD 3DBHI 3A4SC 2BB5A 1J7AA 4LCDE 1DOYA 1ZPSA 3SD5A 4W9CA 3VR8B 2WXLA 1I4QA 3J9CA 1GB4A 2G45B 2L3ZA 2WX1A 1KOTA 1NDDA 3LDZE 4YTMB 1ZOYB 1UBQA 4RM9A 4G0NB 5MPOA 1DOXA 3RI7C 2V9HA 4ASWC 2MA9B 1L4DB 3AU4A 2RSUA 5DPSA 1ZKHA 2FE8A 4GOCA 3RFZB 2IZVB 3QIJA 4BVUC 2Z0EB 2QILA 3KH0A 2JWZA 2MBQA 1HXYD 1D6EC 4W9GA 1L0VB 3N32A 4KSKC 2ZZPB 5FKAC 4ZYSA 3BINA 3Q8FA 4BZAA 1XLOA 2MP2B 2EELA 3TEXA 3QX1A 3FC4A 3AULA 1YX6B 2O2VA 2V4LA 2V3SA 3RZFA 2DX5B 4HCPB 4N9F4 1L7YA 1IGCA 4NAMA 1QKZA 1V86A 3U8ZA 1RFAA 2IO2B 1TS3A 2MJEA 4JWSC 5KHQA 1EU4A 4LTUA 2KDIA 3V05A 1SJHD 1NEKB 1PQSA 3EHVA 2MSED 1IBXB 2EKIA 3TJPA 2KFKA 1HE8A 3DHGC 4MH8A 2RDGA 1PGBA 4JE3B 2J4XA 5BYQA 2OOBB 1F0ZA 1J7BA 2QCZA 1CK1A 3GE3C 3VXWA 1GC7A 3DBLI 2ZNVC 3AE4B 1MFWA 1N63A 3TL5A 3ETRA 2JRIB 2W82A 5D94A 4KIKA 2MBOA 2BKRB 1E8YA 3HVDA 1QOBA 3RZWC 1C78A 3OWEB 4LDTD 5GXGB 4OVUA 4IM2A 2G4SA 1YQ3B 4DXFA 2NS5A 4ZOHC 2V3PA 3CF6E 2BQQA 4ARIA 4K7UA 3SU8X 2KNBA 4TQ0A 1MG8A 1KH0A 1AARA 3RD2A 5E6PA 2JWUA 1E10A 3B9JA 2RDHA 2NBVB 4JPSA 2LI5A 3RNEC 5AZFA 1SBBB 3IXSA 4ANXA 2N4FA 2KWCA 2X38A 2N7JA 3OJ3A 3HM6X 2LGIA 2IO0B 2K22A 2J0JA 3K9OB 2VRRB 3DVGX 1C77A 2LRUA 1JWUD 2BYEA 2Y5CA 1PGAA 4XX5A 1RLFA 2LHEA 1WWTA 4ZRIA 5BYSA 1WGRA 1FD6A 2ZEQA 3FILB 3MHSD 3VH4B 2GBRA 1I42A 1HQRD 4BKSA 4OHJA 2D3AA 1CMXB 3E9SA 4PS3A 1GOZA 1DYQA 1UBIA 5AUIA 2R2OA 2JZZA 2AQ2B 5EE3A 1HA5A 4IDIA 3O13A 2NTTA 1WR1A 2EKEC 1T0RC 1ENFA 1FNWA 2M19A 2INPE 1WX9A 1EUVB 2JXTA 2N7DA 4N58A 3KUZA 1E0ZA 1SE4A 3VAWA 2KK8A 2DWQA 1ISNA 3DPDA 3ENEA 5LLIA 4RFBA 3DBSA 2WHIA 3CSFA 1F2RI 1P3QU 4FULA 2JVCA 2MWSB 1BUIC 2LVPA 4EFOA 1TBEA 2BPSA 1JW9D 4WQMA 2HTME 2LGYA 2WNMA 4RH6A 3IHPC 3DCGA 3DOWA 3L17A 2KHWB 3ZLZA 3UGBB 1JQ4A 1NI3A 4AJYB 1E7UA 1WZ0A 1WGYA 2MJDA 3Q3FA 4F7ZA 1VD2A 3Q8CA 3BVMA 4OVVA 4HPPA 2GI9A 3V61A 1SF0A 3VTVA 3ZJUA 2DENB 2D2QA 1MJDA 2WXOA 4KIKB 4KGRA 4DHZE 4ICUA 3AEEB 1R4MI 3BVGA 3Q14C 3PLUA 2KYWA 2QHOA 4URKA 1FFUA 2M1MA 5AEKB 2GLSA 5BYRA 4DHJB 1I4HA 2QEJC 2IY0B 3U4EG 3DBRB 2CU1A 1D4BA 3GP7A 2KQSA 4WIPA 1TJEA 1MVKA 1F1HA 4XDDA 3DBHB 3MC9A 4B95A 4JIOU 5EDSA 3IG3A 3V3XA 4XZ4A 5CHWA 1C4AA 3U7DA 3ZVVA 2RPQA 4IOIE 1V5TA 1WI0A 4I6PA 1V81A 2LGSA 1FXIA 5JZEB 1DGJA 4LNNA 3ZUNA 1K8RB 4TSSA 3TEYA 1N62A 1RAXA 3A9JB 3AXCA 3L4PA 2QIEB 3AE5B 2KWUB 4EUTA 3P4QB 3VTUA 4FN2A 1FFVA 2N9KA 3GE8C 1HZ6A 3P1MA 1FNUA 1WJNA 2AX5A 2C5LC 2C9WB 3UIOB 4M02A 3ZNZB 2RGFA 2WDVB 3KLSX 1MHXA 4HK2A 1WMHA 1D5XC 3MP9A 1WZ3A 3TEWA 4AS1A 3KVFB 4Q2JA 2QC8A 4IWQA 2AYOB 4DHZB 2ASQA 2I38A 1ESFA 1WXAA 5J2RA 3N9YC 3EUB2 1UWMA 1GJZA 1JWAD 1WM2A 4NJ6A 1E6EB 2DZMA 2L32A 4MEMA 2PIAA 1FXAA 2KFJA 4KX6B 4MT5A 4P1CC 1FEHA 2MJ3A 4HEA1 4A8XC 3GZNI 2N0SB 2LMCA 2BVCA 2FBWB 3H7SA 5HI1A 1EO6A 4AOFA 1QF6A 1KM7A 1IYFA 1SJED 3VFKA 5DCNA 1KJTA 2V1YA 1MI0A 2XBBC 4A20A 4ITKA 2EMSA 3BK1A 3PVLA 5D6JB 3A9KB 1N5WA 3DBLB 2FUG1 4HPLB 2OEDA 4W9IA 2K0PA 3QA8A 1YJJA 2KJHB 3KWVA 2WGSA 2HE7A 1J19A 1TY0A 4ZRJA 4AJWA 1ET6A 1TY2A 3AMZA 2ZW0A 1TTNA 1WJ6A 1ZXHA 4A3OA 3BIID 1XF5L 2A4ZA 4KDLB 1RM6C 3BWUD 2WS3B 3LYYA 2KJ6A 3IAS1 1E8XA 4BOSC 3VVWB 4NAWB 1MG4A 4LNIA 3JVZX 3SEBA 1WIAA 1KFYB 2K5PA 3W2DA 1IBXA 3EFCA 1C76A 1Q1OA 2JRHA 4AP4C 4LDTB 4IWPA 5CHVC 4M8MA 5CX3A 3RN9C
chains in the Genus database with same CATH topology
3QX1A 2K8CA 4E74A 4PS8A 3MJWA 3L10B 3AULA 1YX6B 2D10A 3JYUA 3V6CB 2J0MA 2O2VA 1LM8B 1WXSA 2V4LA 2V3SA 4DBGA 3GOEA 3H9DA 3RZFA 4KV2A 1GUAB 2DX5B 2L7RA 3EFUA 4HCPB 4HJKA 4N9F4 1L7YA 2Z59B 4EEWA 2KLCA 3V62A 1V86A 3U8ZA 2ZPNA 4GIVA 1RFAA 2KMCA 2IO2B 2O6VD 2XEWA 4HWIB 4B6WA 5KHQA 4JL9A 2KDIA 2AWTA 1PQSA 4TUUA 1WH3A 4HDQA 4DXAB 3EHVA 2MSED 2BYFA 3RULA 2WX0A 2KFKA 1HE8A 1T0YA 3TJPA 4MGZE 5J17A 3ZTCA 1V49A 5DPRA 2KO3A 2KTRB 4LJOB 1XT9B 1X1MA 1NI2A 4EOYA 1Y8RC 1LFDA 2ZPYA 2O2VB 5E6NA 2FCSA 4MGYE 5KHOA 3X0WA 2D07B 2KDFB 4GDLA 3R66C 2GBJA 2C7HA 3VUYA 2OOBB 4MSQB 3NY5A 4G3XB 5G55A 3DVGY 1YIWA 2GBKA 1WFYA 2KQ7A 1LXDA 3ALBA 2LZ6A 3EC8A 4ZDVA 2AEHA 1YJ1A 4MGKE 4W9LA 4AWJA 3VXWA 1GC7A 3D32A 3UF8A 3L0WB 4NPNA 3DBLI 4PS7A 3A1QA 4W9EA 3NS8A 2ZNVC 3L16A 2JY6A 5HKHA 1WGGA 4BFRA 2CR5A 2M17A 3AI5A 1OGWA 1IP9A 2J0KA 3R7RA 3TL5A 5G2NA 1FXTB 2KFKB 2JRIB 3DVNU 4MJSA 5D94A 4KIKA 3L08A 2MBOA 4ANWA 2BKRB 2LGDA 2KLGA 1E8YA 1WMHB 2FUHB 3PRZA 4GN1A 5J18A 1WX7A 2Z0DB 4GSWA 3RZWC 3ZNHB 4LDTD 1L2NA 3M95A 2PJHA 4OVUA 4FBJB 2KXJA 1P0RA 3PPAA 4GDLB 3JSVA 4FADA 1UGMA 4IM2A 2G4SA 2FCQA 4I6LB 2NS5A 2PE6B 3CF6E 2M8SA 3A33B 1Z2MA 4K7UA 4W9HA 2DZKA 3SU8X 2C60A 2GBNA 2KNBA 4TQ0A 1S3SG 3CMMB 3PGEA 2CKHB 4FHJA 2N1WA 1MG8A 3A1QB 4GMVA 2NBUA 3WAOA 2DHZA 4A3PA 4DK5A 2KZRA 2REXA 3ZRFA 1R4NI 5LXHA 2UWQA 1AARA 3RD2A 3APFA 5E6PA 2DZIA 2GMIC 2K25A 2NBVB 1P1AA 1YX5B 2LI5A 5AZFA 3W1YA 3HK0A 4BBNF 3UINB 5L83A 4ANXA 2N4FA 3NZUA 2KWCA 1LQBA 1WY8A 2NPTA 3IVFA 3ZO5B 3OJ3A 3HM6X 1H4RA 1U4AA 3QC8B 2DAFA 2IO0B 4M8NA 3JSVB 4EZKA 2J0JA 3QARA 3VUXA 5TR5A 3K9OB 4WWOA 2VRRB 3DVGX 4HVBA 4GXBA 2FAZA 2M0XA 2KVRA 2LRUA 1EF1A 4XC2A 2BYEA 3PHXB 4K81A 1Q0WB 4XX5A 3WANA 4MH0E 3RT3B 4K7SA 4FA6A 4GDKA 4NQLB 1C3TA 1VCBA 1RLFA 4K1RB 3ZW3A 2GOWA 2L76A 3A4RA 3M63B 3ONSA 4IM0A 3OLMD 3ZDTA 4ZRIA 3QJZA 3TMPB 1WGRA 3T8MA 3VHTC 1UELA 2ZEQA 3VTWA 3NOBA 3MHSD 3VH4B 2G4DB 2MW5A 3K9PB 2GBRA 4FJYA 3UQAA 1D3ZA 4FJZA 2NVUI 1G6JA 1I42A 2KMAA 3NHEB 4BKSA 1XD3B 1QZEA 2XK5A 4NJ7A 2M4NA 3LJ3A 4GU2A 1CMXB 1YD8U 4KVGB 1NBFC 2L8JA 4PS3A 3VH3B 1P9DU 2FCMA 2BWES 4WJOA 2LVQA 2N9PC 4LJPB 4DDID 3UQBA 1J0GA 3T9LA 1UBIA 4I6NB 2ZJDA 2MQJA 2R2OA 1H8CA 2JZZA 2DZJA 2JF5A 2Y5BB 4ANVA 4GDKB 2FIFA 2BWFA 5BO4B 4PYZA 1E8WA 2CHZA 3DQVA 2IBIB 2KD0A 4EKUA 1F9JA 4IG7B 3B1LX 4HPMB 1E8ZA 3WAMA 1WR1A 2PE9A 2EKEC 2LVOA 2AL3A 4K7WA 1P98A 3RUIB 4EZLA 1GG3A 2DYOA 3NZSA 4KZ0A 1WX9A 5C1ZA 3B0AA 3HM3A 1EUVB 3TCAA 1J8CA 2XK5B 2N7DA 4RM8A 3KUZA 4E71A 3SHQA 2N9XA 4G50A 1UH6A 2N1VA 3Q3JA 3VAWA 1V2YA 4G11A 4B9KA 4AUQC 2I1JA 2KK8A 2ZVNA 2R2QA 2JUOA 1ISNA 3DPDA 4GGQA 3ENEA 5LLIA 3DBSA 3IFWB 3VDZA 3TIXA 3CSFA 5DPTA 1S1QB 2PEAA 2PPHA 5FR6A 4ZRKA 4IWOA 2L05A 1P3QU 2KX0A 2JVCA 4FULA 4X57B 2MWSB 2KANA 2LVPA 4EFOA 2MX2A 1TBEA 2BPSA 5C23A 4F1SA 4BOZB 2FNJB 2LGYA 3PHWB 5CTRC 3IHPC 5E6OA 3DCGA 3PTFC 4BKGA 1OEYA 2CHWA 3DOWA 2KHWB 3L17A 3WA0A 3ZLZA 4WAAA 3UGBB 4FLHA 2IO1B 3ZTDA 1E7UA 1WXVA 1WXMA 4AJYB 4NNJB 3UIPB 2NCNA 3ZNGC 4HCNB 1WZ0A 1WGYA 2IO3B 3Q3FA 5IA7A 2KC2A 4F7ZA 2WWZA 2ZCCA 1VD2A 3PLVA 4WJNA 4OVVA 3APCA 3S2AA 1RRBA 2LXCA 1KLVA 2DYMA 3V61A 4CHKA 1OQYA 2N7EA 3H7PA 3ZDMC 3B08A 3AU5A 3VTVA 4KDIC 2MBHA 2DENB 3KUDB 2D2QA 3R7QA 2K8BA 3VQIA 3QK0A 4MJSB 2A5UA 4KIKB 2JZ3B 4DHZE 3CSTA 2JXXA 4GB9A 4ICUA 4PYUA 3U30A 1R4MI 3M3JA 3HHMA 2ZNVB 4P7IA 3PLUA 1TZ1A 4JGHB 2MBBB 2ZVOA 3HIZA 3H1UA 3TBLD 2QHOA 2KX3A 4URKA 2M1MA 3H6NA 5AEKB 1E90A 1BT0A 2L0TA 3DDCB 4DHJB 4DWFA 2W9NA 3MTNB 2UYZB 2IY0B 4J6IA 3OAWA 1UZXB 2ZCBA 4FJVB 3ZRCA 4BKSD 3WIMA 2CU1A 3KW5B 2MP2A 3A9JA 4M0WB 1WJ4A 2KQSA 4BBNC 3H7PB 2C7MB 1IPGA 2L0FA 2J7QB 4WWNA 4B95A 4JIOU 2MCNB 5EDSA 3IG3A 2MBEA 4KSLC 2YVCA 3IBEA 3PZDA 4XZ4A 2AL6A 2YLMA 5CHWA 1OEYJ 3U7DA 3ECIA 1WYWB 3PSEB 2NPTB 3PRPB 1ZGUB 4HXDA 3VUWA 4E3CA 1WE7A 3QWZB 1SIFA 3PREA 2IYDB 2LWPA 4ZYNA 2RPQA 2G3QB 2JT4B 2KTFA 3N30A 5CHFA 3ZVVA 1V5TA 1WI0A 3JW0X 4I6PA 1V81A 4HLEA 5JHAA 5JZEB 4JLCA 1YQBA 5DPWA 3ZUNA 2I1KA 4KZCA 2BYVE 1K8RB 2HD5B 2CS4A 5D2MB 3WALA 4ICVA 1RAXA 3A9JB 5JH5C 2MLBA 1V5OA 3AXCA 4TV3A 3RCZA 4DDGD 4WQOB 2K6QA 2KC1A 2KWUB 2N9EB 1JRUA 4TKNA 5JHBA 4W9JA 1C1YB 2FIDA 4EUTA 4BKTA 4EZJA 2WDTB 4IC7B 2D11A 3VTUA 2CHXA 1WE6A 2HJ8A 4FN2A 5D7GA 3QAQA 3W1SC 1WR6E 3BY4B 1UD7A 2KDEB 2LD9A 4RMAA 1WJNA 3PT2B 2C5LC 2LGXA 2NR2A 2C9WB 2OJRA 2HTHA 3UIOB 4W9FA 4MGIE 2D3GA 4II3B 3ZNZB 2RGFA 2DAJA 1ZW7A 3W1SA 4CYEA 4HK2A 1WMHA 4DHJD 3P2BA 1A5RA 4IUMB 4HDOA 1TGZB 2LRWA 1GNUA 3V6EB 1WZ3A 1Q5WB 1SGHA 3KVFB 3ZKJC 4F8CB 2JPHA 2BF8B 4IWQA 2NBWB 2O6VA 3ML8A 5IAAC 4IW0A 2AYOB 4DHZB 2ASQA 3DVNV 3ML9A 1WXAA 3L13A 3C0RB 1M94A 1V6EA 3KYCD 2BGFA 5J2RA 2BKFA 5AZHA 1GJZA 1E7VA 1WM2A 2LASA 4JQWC 4NJ6A 4W9DA 1WGHA 2DZMA 1E5WA 3A9KA 2RD0A 3L54A 1Z5SB 1SE9A 3R3MA 4MEMA 5AZGA 5GMVA 2C7NB 2KFJA 3WAPA 3DBRI 2RR9A 2B3AA 4II2B 3RYTA 3O65B 5L95C 3APDA 1OTRB 3GZNI 3DBHI 4MELA 2KOXA 3A4SC 4LCDE 2EMTA 3H7SA 1EO6A 1V80A 4AOFA 2MRPA 4WJPA 1KM7A 1IYFA 2WYQA 4MM3A 3ZNID 2O6VB 3VFKA 5LXIB 5DCNA 3EECA 3PRMB 2K39A 3SD5A 4WJQA 4CO7A 1KJTA 2V1YA 2XBBC 4W9CA 4A20A 2G45B 1EF5A 2L3ZA 2WX1A 4WWPA 2EMSA 1NDDA 3LDZE 1KOTA 2GBMA 1UBQA 2L00B 4NAWA 4RM9A 3PVLA 4G0NB 5D6JB 4MDKE 3A9KB 4FHKA 3M62B 4NQKE 4HPLB 1WRDB 4W9IA 3QA8A 1WX8A 2K6DB 3QCAA 2KJHB 2LUEA 4IM3A 1XQQA 2HE7A 1J19A 2KDBA 4ASWC 2MA9B 4ZRJA 3OJ4B 2DYBA 1WF9A 2FCNA 4AJWA 3AU4A 2RSUA 5DPSA 1ZKHA 2LXAA 1TTNA 1WJ6A 3V60A 4W9KA 4GOCA 3ZIMA 2IZVB 2KKCA 2A4ZA 3QIJA 4A3OA 4KDLB 4BVUC 2Z0EB 2K1FA 2IY1B 3KH0A 2JWZA 2MBQA 1V9JA 2KJ6A 4NY0A 2KN5A 4W9GA 3SDLC 2LJ5A 1GC6A 3QQ8B 4BOSC 1E8XA 3PS6A 3VVWB 1WGDA 3PV1A 4NAWB 3N3KB 2KJRA 3N32A 4ANUA 4KSKC 2ZZPB 3JVZX 1WIAA 3I3TB 1WM3A 3KYDD 4YL8A 1Q1OA 1I35A 3BINA 3QHTA 2JRHA 4AP4C 4LDTB 3KUCB 3X23A 2KTRA 4TQ1A 2K8HA 2MP2B 4IWPA 1WJUA 5CHVC 4M8MA 5CX3A 2KWVB 4MSMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QX1 A;  2K8C A;  4E74 A;  4PS8 A;  3MJW A;  3L10 B;  3AUL A;  1YX6 B;  2D10 A;  3JYU A;  3V6C B;  2J0M A;  2O2V A;  1LM8 B;  1WXS A;  2V4L A;  2V3S A;  4DBG A;  3GOE A;  3H9D A;  3RZF A;  4KV2 A;  1GUA B;  2DX5 B;  2L7R A;  3EFU A;  4HCP B;  4HJK A;  4N9F 4;  1L7Y A;  2Z59 B;  4EEW A;  2KLC A;  3V62 A;  1V86 A;  3U8Z A;  2ZPN A;  4GIV A;  1RFA A;  2KMC A;  2IO2 B;  2O6V D;  2XEW A;  4HWI B;  4B6W A;  5KHQ A;  4JL9 A;  2KDI A;  2AWT A;  1PQS A;  4TUU A;  1WH3 A;  4HDQ A;  4DXA B;  3EHV A;  2MSE D;  2BYF A;  3RUL A;  2WX0 A;  2KFK A;  1HE8 A;  1T0Y A;  3TJP A;  4MGZ E;  5J17 A;  3ZTC A;  1V49 A;  5DPR A;  2KO3 A;  2KTR B;  4LJO B;  1XT9 B;  1X1M A;  1NI2 A;  4EOY A;  1Y8R C;  1LFD A;  2ZPY A;  2O2V B;  5E6N A;  2FCS A;  4MGY E;  5KHO A;  3X0W A;  2D07 B;  2KDF B;  4GDL A;  3R66 C;  2GBJ A;  2C7H A;  3VUY A;  2OOB B;  4MSQ B;  3NY5 A;  4G3X B;  5G55 A;  3DVG Y;  1YIW A;  2GBK A;  1WFY A;  2KQ7 A;  1LXD A;  3ALB A;  2LZ6 A;  3EC8 A;  4ZDV A;  2AEH A;  1YJ1 A;  4MGK E;  4W9L A;  4AWJ A;  3VXW A;  1GC7 A;  3D32 A;  3UF8 A;  3L0W B;  4NPN A;  3DBL I;  4PS7 A;  3A1Q A;  4W9E A;  3NS8 A;  2ZNV C;  3L16 A;  2JY6 A;  5HKH A;  1WGG A;  4BFR A;  2CR5 A;  2M17 A;  3AI5 A;  1OGW A;  1IP9 A;  2J0K A;  3R7R A;  3TL5 A;  5G2N A;  1FXT B;  2KFK B;  2JRI B;  3DVN U;  4MJS A;  5D94 A;  4KIK A;  3L08 A;  2MBO A;  4ANW A;  2BKR B;  2LGD A;  2KLG A;  1E8Y A;  1WMH B;  2FUH B;  3PRZ A;  4GN1 A;  5J18 A;  1WX7 A;  2Z0D B;  4GSW A;  3RZW C;  3ZNH B;  4LDT D;  1L2N A;  3M95 A;  2PJH A;  4OVU A;  4FBJ B;  2KXJ A;  1P0R A;  3PPA A;  4GDL B;  3JSV A;  4FAD A;  1UGM A;  4IM2 A;  2G4S A;  2FCQ A;  4I6L B;  2NS5 A;  2PE6 B;  3CF6 E;  2M8S A;  3A33 B;  1Z2M A;  4K7U A;  4W9H A;  2DZK A;  3SU8 X;  2C60 A;  2GBN A;  2KNB A;  4TQ0 A;  1S3S G;  3CMM B;  3PGE A;  2CKH B;  4FHJ A;  2N1W A;  1MG8 A;  3A1Q B;  4GMV A;  2NBU A;  3WAO A;  2DHZ A;  4A3P A;  4DK5 A;  2KZR A;  2REX A;  3ZRF A;  1R4N I;  5LXH A;  2UWQ A;  1AAR A;  3RD2 A;  3APF A;  5E6P A;  2DZI A;  2GMI C;  2K25 A;  2NBV B;  1P1A A;  1YX5 B;  2LI5 A;  5AZF A;  3W1Y A;  3HK0 A;  4BBN F;  3UIN B;  5L83 A;  4ANX A;  2N4F A;  3NZU A;  2KWC A;  1LQB A;  1WY8 A;  2NPT A;  3IVF A;  3ZO5 B;  3OJ3 A;  3HM6 X;  1H4R A;  1U4A A;  3QC8 B;  2DAF A;  2IO0 B;  4M8N A;  3JSV B;  4EZK A;  2J0J A;  3QAR A;  3VUX A;  5TR5 A;  3K9O B;  4WWO A;  2VRR B;  3DVG X;  4HVB A;  4GXB A;  2FAZ A;  2M0X A;  2KVR A;  2LRU A;  1EF1 A;  4XC2 A;  2BYE A;  3PHX B;  4K81 A;  1Q0W B;  4XX5 A;  3WAN A;  4MH0 E;  3RT3 B;  4K7S A;  4FA6 A;  4GDK A;  4NQL B;  1C3T A;  1VCB A;  1RLF A;  4K1R B;  3ZW3 A;  2GOW A;  2L76 A;  3A4R A;  3M63 B;  3ONS A;  4IM0 A;  3OLM D;  3ZDT A;  4ZRI A;  3QJZ A;  3TMP B;  1WGR A;  3T8M A;  3VHT C;  1UEL A;  2ZEQ A;  3VTW A;  3NOB A;  3MHS D;  3VH4 B;  2G4D B;  2MW5 A;  3K9P B;  2GBR A;  4FJY A;  3UQA A;  1D3Z A;  4FJZ A;  2NVU I;  1G6J A;  1I42 A;  2KMA A;  3NHE B;  4BKS A;  1XD3 B;  1QZE A;  2XK5 A;  4NJ7 A;  2M4N A;  3LJ3 A;  4GU2 A;  1CMX B;  1YD8 U;  4KVG B;  1NBF C;  2L8J A;  4PS3 A;  3VH3 B;  1P9D U;  2FCM A;  2BWE S;  4WJO A;  2LVQ A;  2N9P C;  4LJP B;  4DDI D;  3UQB A;  1J0G A;  3T9L A;  1UBI A;  4I6N B;  2ZJD A;  2MQJ A;  2R2O A;  1H8C A;  2JZZ A;  2DZJ A;  2JF5 A;  2Y5B B;  4ANV A;  4GDK B;  2FIF A;  2BWF A;  5BO4 B;  4PYZ A;  1E8W A;  2CHZ A;  3DQV A;  2IBI B;  2KD0 A;  4EKU A;  1F9J A;  4IG7 B;  3B1L X;  4HPM B;  1E8Z A;  3WAM A;  1WR1 A;  2PE9 A;  2EKE C;  2LVO A;  2AL3 A;  4K7W A;  1P98 A;  3RUI B;  4EZL A;  1GG3 A;  2DYO A;  3NZS A;  4KZ0 A;  1WX9 A;  5C1Z A;  3B0A A;  3HM3 A;  1EUV B;  3TCA A;  1J8C A;  2XK5 B;  2N7D A;  4RM8 A;  3KUZ A;  4E71 A;  3SHQ A;  2N9X A;  4G50 A;  1UH6 A;  2N1V A;  3Q3J A;  3VAW A;  1V2Y A;  4G11 A;  4B9K A;  4AUQ C;  2I1J A;  2KK8 A;  2ZVN A;  2R2Q A;  2JUO A;  1ISN A;  3DPD A;  4GGQ A;  3ENE A;  5LLI A;  3DBS A;  3IFW B;  3VDZ A;  3TIX A;  3CSF A;  5DPT A;  1S1Q B;  2PEA A;  2PPH A;  5FR6 A;  4ZRK A;  4IWO A;  2L05 A;  1P3Q U;  2KX0 A;  2JVC A;  4FUL A;  4X57 B;  2MWS B;  2KAN A;  2LVP A;  4EFO A;  2MX2 A;  1TBE A;  2BPS A;  5C23 A;  4F1S A;  4BOZ B;  2FNJ B;  2LGY A;  3PHW B;  5CTR C;  3IHP C;  5E6O A;  3DCG A;  3PTF C;  4BKG A;  1OEY A;  2CHW A;  3DOW A;  2KHW B;  3L17 A;  3WA0 A;  3ZLZ A;  4WAA A;  3UGB B;  4FLH A;  2IO1 B;  3ZTD A;  1E7U A;  1WXV A;  1WXM A;  4AJY B;  4NNJ B;  3UIP B;  2NCN A;  3ZNG C;  4HCN B;  1WZ0 A;  1WGY A;  2IO3 B;  3Q3F A;  5IA7 A;  2KC2 A;  4F7Z A;  2WWZ A;  2ZCC A;  1VD2 A;  3PLV A;  4WJN A;  4OVV A;  3APC A;  3S2A A;  1RRB A;  2LXC A;  1KLV A;  2DYM A;  3V61 A;  4CHK A;  1OQY A;  2N7E A;  3H7P A;  3ZDM C;  3B08 A;  3AU5 A;  3VTV A;  4KDI C;  2MBH A;  2DEN B;  3KUD B;  2D2Q A;  3R7Q A;  2K8B A;  3VQI A;  3QK0 A;  4MJS B;  2A5U A;  4KIK B;  2JZ3 B;  4DHZ E;  3CST A;  2JXX A;  4GB9 A;  4ICU A;  4PYU A;  3U30 A;  1R4M I;  3M3J A;  3HHM A;  2ZNV B;  4P7I A;  3PLU A;  1TZ1 A;  4JGH B;  2MBB B;  2ZVO A;  3HIZ A;  3H1U A;  3TBL D;  2QHO A;  2KX3 A;  4URK A;  2M1M A;  3H6N A;  5AEK B;  1E90 A;  1BT0 A;  2L0T A;  3DDC B;  4DHJ B;  4DWF A;  2W9N A;  3MTN B;  2UYZ B;  2IY0 B;  4J6I A;  3OAW A;  1UZX B;  2ZCB A;  4FJV B;  3ZRC A;  4BKS D;  3WIM A;  2CU1 A;  3KW5 B;  2MP2 A;  3A9J A;  4M0W B;  1WJ4 A;  2KQS A;  4BBN C;  3H7P B;  2C7M B;  1IPG A;  2L0F A;  2J7Q B;  4WWN A;  4B95 A;  4JIO U;  2MCN B;  5EDS A;  3IG3 A;  2MBE A;  4KSL C;  2YVC A;  3IBE A;  3PZD A;  4XZ4 A;  2AL6 A;  2YLM A;  5CHW A;  1OEY J;  3U7D A;  3ECI A;  1WYW B;  3PSE B;  2NPT B;  3PRP B;  1ZGU B;  4HXD A;  3VUW A;  4E3C A;  1WE7 A;  3QWZ B;  1SIF A;  3PRE A;  2IYD B;  2LWP A;  4ZYN A;  2RPQ A;  2G3Q B;  2JT4 B;  2KTF A;  3N30 A;  5CHF A;  3ZVV A;  1V5T A;  1WI0 A;  3JW0 X;  4I6P A;  1V81 A;  4HLE A;  5JHA A;  5JZE B;  4JLC A;  1YQB A;  5DPW A;  3ZUN A;  2I1K A;  4KZC A;  2BYV E;  1K8R B;  2HD5 B;  2CS4 A;  5D2M B;  3WAL A;  4ICV A;  1RAX A;  3A9J B;  5JH5 C;  2MLB A;  1V5O A;  3AXC A;  4TV3 A;  3RCZ A;  4DDG D;  4WQO B;  2K6Q A;  2KC1 A;  2KWU B;  2N9E B;  1JRU A;  4TKN A;  5JHB A;  4W9J A;  1C1Y B;  2FID A;  4EUT A;  4BKT A;  4EZJ A;  2WDT B;  4IC7 B;  2D11 A;  3VTU A;  2CHX A;  1WE6 A;  2HJ8 A;  4FN2 A;  5D7G A;  3QAQ A;  3W1S C;  1WR6 E;  3BY4 B;  1UD7 A;  2KDE B;  2LD9 A;  4RMA A;  1WJN A;  3PT2 B;  2C5L C;  2LGX A;  2NR2 A;  2C9W B;  2OJR A;  2HTH A;  3UIO B;  4W9F A;  4MGI E;  2D3G A;  4II3 B;  3ZNZ B;  2RGF A;  2DAJ A;  1ZW7 A;  3W1S A;  4CYE A;  4HK2 A;  1WMH A;  4DHJ D;  3P2B A;  1A5R A;  4IUM B;  4HDO A;  1TGZ B;  2LRW A;  1GNU A;  3V6E B;  1WZ3 A;  1Q5W B;  1SGH A;  3KVF B;  3ZKJ C;  4F8C B;  2JPH A;  2BF8 B;  4IWQ A;  2NBW B;  2O6V A;  3ML8 A;  5IAA C;  4IW0 A;  2AYO B;  4DHZ B;  2ASQ A;  3DVN V;  3ML9 A;  1WXA A;  3L13 A;  3C0R B;  1M94 A;  1V6E A;  3KYC D;  2BGF A;  5J2R A;  2BKF A;  5AZH A;  1GJZ A;  1E7V A;  1WM2 A;  2LAS A;  4JQW C;  4NJ6 A;  4W9D A;  1WGH A;  2DZM A;  1E5W A;  3A9K A;  2RD0 A;  3L54 A;  1Z5S B;  1SE9 A;  3R3M A;  4MEM A;  5AZG A;  5GMV A;  2C7N B;  2KFJ A;  3WAP A;  3DBR I;  2RR9 A;  2B3A A;  4II2 B;  3RYT A;  3O65 B;  5L95 C;  3APD A;  1OTR B;  3GZN I;  3DBH I;  4MEL A;  2KOX A;  3A4S C;  4LCD E;  2EMT A;  3H7S A;  1EO6 A;  1V80 A;  4AOF A;  2MRP A;  4WJP A;  1KM7 A;  1IYF A;  2WYQ A;  4MM3 A;  3ZNI D;  2O6V B;  3VFK A;  5LXI B;  5DCN A;  3EEC A;  3PRM B;  2K39 A;  3SD5 A;  4WJQ A;  4CO7 A;  1KJT A;  2V1Y A;  2XBB C;  4W9C A;  4A20 A;  2G45 B;  1EF5 A;  2L3Z A;  2WX1 A;  4WWP A;  2EMS A;  1NDD A;  3LDZ E;  1KOT A;  2GBM A;  1UBQ A;  2L00 B;  4NAW A;  4RM9 A;  3PVL A;  4G0N B;  5D6J B;  4MDK E;  3A9K B;  4FHK A;  3M62 B;  4NQK E;  4HPL B;  1WRD B;  4W9I A;  3QA8 A;  1WX8 A;  2K6D B;  3QCA A;  2KJH B;  2LUE A;  4IM3 A;  1XQQ A;  2HE7 A;  1J19 A;  2KDB A;  4ASW C;  2MA9 B;  4ZRJ A;  3OJ4 B;  2DYB A;  1WF9 A;  2FCN A;  4AJW A;  3AU4 A;  2RSU A;  5DPS A;  1ZKH A;  2LXA A;  1TTN A;  1WJ6 A;  3V60 A;  4W9K A;  4GOC A;  3ZIM A;  2IZV B;  2KKC A;  2A4Z A;  3QIJ A;  4A3O A;  4KDL B;  4BVU C;  2Z0E B;  2K1F A;  2IY1 B;  3KH0 A;  2JWZ A;  2MBQ A;  1V9J A;  2KJ6 A;  4NY0 A;  2KN5 A;  4W9G A;  3SDL C;  2LJ5 A;  1GC6 A;  3QQ8 B;  4BOS C;  1E8X A;  3PS6 A;  3VVW B;  1WGD A;  3PV1 A;  4NAW B;  3N3K B;  2KJR A;  3N32 A;  4ANU A;  4KSK C;  2ZZP B;  3JVZ X;  1WIA A;  3I3T B;  1WM3 A;  3KYD D;  4YL8 A;  1Q1O A;  1I35 A;  3BIN A;  3QHT A;  2JRH A;  4AP4 C;  4LDT B;  3KUC B;  3X23 A;  2KTR A;  4TQ1 A;  2K8H A;  2MP2 B;  4IWP A;  1WJU A;  5CHV C;  4M8M A;  5CX3 A;  2KWV B;  4MSM B; 
#chains in the Genus database with same CATH topology
 4PS8 A;  3MJW A;  3L10 B;  3V6C B;  1XCQ L;  1WXS A;  4YTP B;  1PFD A;  2D3B A;  3H9D A;  1FRD A;  1PDX A;  1I4X A;  4HJK A;  1Y56 A;  1L6V A;  2KLC A;  3V62 A;  2YEP F;  4JL9 A;  2VZK B;  4N6E B;  4TUU A;  2INN E;  2G1E A;  4ZRP A;  1T0Y A;  1EWY C;  4MGZ E;  5J17 A;  1V49 A;  5DPR A;  4LJO B;  1XT9 B;  1NI2 A;  3P63 A;  3RPF C;  4EOY A;  3RNA C;  4XDC A;  2KDF B;  2LHD A;  3U7Z A;  2HDE A;  3MJ5 A;  1WFY A;  1LXD A;  1TS4 A;  2LZ6 A;  4W9L A;  4AWJ A;  3L0W B;  2LEK A;  2IGH A;  3LB8 C;  3L16 A;  3NS8 A;  5HKH A;  1UUP A;  1OGW A;  3R7R A;  4ZHO A;  1YNT E;  1FXT B;  2G9H D;  1ZE3 D;  4A55 A;  3DVN U;  1WMH B;  2LGD A;  3PRZ A;  2H89 B;  2Z0D B;  4GSW A;  3B2F A;  5C2T B;  1FRR A;  1L2N A;  1VJK A;  3M95 A;  2PJH A;  4FBJ B;  3PPA A;  1P0R A;  3H8H A;  1E7P B;  3B2G A;  2XN9 C;  4RGO S;  2X8X X;  3VRA B;  2PE6 B;  1D5Z C;  1Z2M A;  2QSD A;  1FPY A;  4FHJ A;  2N1W A;  4GMV A;  2NBU A;  2WDR B;  1B1Z A;  3APF A;  2CJO A;  2DZI A;  2GMI C;  2K25 A;  3FIL A;  3URY A;  4BBN F;  4LK0 M;  4P1B C;  1LQB A;  1WY8 A;  3IVF A;  4RNA A;  1H4R A;  1U4A A;  3QC8 B;  2DAF A;  2K9X A;  3ZXV A;  2E6X A;  3N1X C;  4WWO A;  1HTQ A;  4YXD B;  2FAZ A;  3WAN A;  4K7S A;  4K1R B;  3ZW3 A;  2DLB A;  3M63 B;  5IP4 D;  3GS2 A;  1PUT A;  3TMP B;  1VZ6 A;  3MFG A;  2W55 A;  3VTW A;  3UQA A;  4FJZ A;  2NVU I;  4ACF A;  1R4M B;  5HHD G;  1L4Z B;  2BS3 B;  3NHE B;  2CU3 A;  2M4N A;  3LJ3 A;  5G5H A;  4QAY A;  1K51 A;  1BML C;  1P9D U;  3T3N A;  4WJO A;  2LVQ A;  4LJP B;  2WXG A;  1J0G A;  3T9L A;  2ZJD A;  2MQJ A;  2Y5B B;  4ANV A;  3I5J C;  3NVW A;  4GDK B;  2BWF A;  1XCT L;  3DHH C;  4MAC A;  2CHZ A;  3W5U B;  2IBI B;  4J3O D;  3R2I A;  1LO5 D;  1F52 A;  2VH1 A;  4UDU C;  2BTE A;  2LVO A;  2BB6 A;  3NZS A;  3Q6B A;  4C7Z A;  4RM8 A;  3SHQ A;  4RF1 A;  3Q3J A;  4B9K A;  4AUQ C;  2I1J A;  2JUO A;  5T8I A;  2PW9 A;  3VDZ A;  3TIX A;  5FR6 A;  1TZO A;  3Q8B A;  4IWO A;  4X57 B;  4EE2 A;  2MX2 A;  4XWT A;  2WXJ A;  5C23 A;  4D2K A;  2PMV A;  2J52 A;  4BOZ B;  3P42 A;  5CTR C;  4AQ7 A;  3KWL A;  4BKG A;  1OEY A;  3WA0 A;  4FLH A;  2CJN A;  3ZTD A;  1WXV A;  1WXM A;  3NVV A;  2NCN A;  2KC2 A;  2KN4 A;  2WU5 B;  1PGX A;  3S2A A;  2VH2 A;  1M4V A;  2MBH A;  3KUD B;  4KGT A;  3LXF A;  3CST A;  2JXX A;  4B0E A;  2BYT A;  3M3J A;  3R2T A;  1V8C A;  1QIL A;  4JGH B;  4XYC A;  3H1U A;  2KT7 A;  2KX3 A;  4DWF A;  2L0T A;  1AN8 A;  2QMT A;  3N1Z C;  1YOV B;  3P4P B;  3A9J A;  4WWM A;  1K53 A;  5FR3 A;  3GZN B;  2J7Q B;  2L0F A;  4M00 A;  5LNK 1;  2W3S A;  2MBE A;  3Q3M C;  1L0X B;  4S17 A;  2AL6 A;  2YLM A;  1TKY A;  1OEY J;  1RFK A;  3ECI A;  3PRP B;  3VUW A;  3CIR B;  3QWZ B;  2LWP A;  2JT4 B;  2KTF A;  3EA6 A;  4JLC A;  4HKQ A;  3ZJV A;  1SE2 A;  3NG0 A;  3WAL A;  4ZHP A;  3BYY B;  2ACZ B;  5JH5 C;  4TV3 A;  1XLQ A;  3RCZ A;  1TS5 A;  1XEE A;  4NJC A;  2K6Q A;  1XLP A;  2N9E B;  2WXR A;  5JHB A;  4W9J A;  1JCK B;  2FID A;  4BKT A;  4IC7 B;  2D11 A;  2CHX A;  2HJ8 A;  1TKE A;  3W1S C;  2IGG A;  2LD9 A;  2LGX A;  2OJR A;  1STE A;  3AE8 B;  4MGI E;  2D3G A;  1VLB A;  1VR9 A;  1QQR A;  4CYE A;  3V6E B;  4F8C B;  3MHZ A;  3ZKJ C;  5C3J B;  1MHH E;  2NBW B;  3ABV B;  5IAA C;  2BT6 A;  2WXF A;  3L13 A;  2WLB A;  4HRS A;  4RF0 A;  1K52 A;  4JQW C;  5H92 C;  3A9K A;  1E5W A;  3L54 A;  4FXC A;  5AZG A;  5GMV A;  2C7N B;  3OG5 A;  2YEP B;  1D5M C;  5L95 C;  1OTR B;  2KOX A;  3U52 E;  1V80 A;  1EWC A;  2WYQ A;  3ZNI D;  3EEC A;  3PRM B;  4WJQ A;  2WXN A;  4CO7 A;  2IND C;  1EF5 A;  4WWP A;  1TS2 A;  2L00 B;  3P4S B;  4NAW A;  3AE7 B;  1JML A;  3M62 B;  1K50 A;  1WX8 A;  3QCA A;  2LUE A;  1XQQ A;  4YSY B;  1YJI A;  2KDB A;  2DYB A;  2FCN A;  3ZXR A;  5IO9 A;  5HFY A;  3V60 A;  4W9K A;  4MM3 B;  3AE2 B;  2KKC A;  3W5V B;  3ZJT A;  2AQ1 B;  4K3C A;  1V9J A;  4NY0 A;  2KN5 A;  3SDL C;  1GC6 A;  3PS6 A;  1FIQ A;  1WGD A;  3PV1 A;  3NRZ A;  4WH4 A;  3N3K B;  2KJR A;  3I3T B;  1WM3 A;  4C4V B;  4YL8 A;  3QHT A;  1SE3 A;  3BVZ A;  3KUC B;  3X23 A;  2WDQ B;  2K8C A;  1C4C A;  1E9M A;  3GB1 A;  1LM8 B;  1TYG B;  3GOE A;  1JAL A;  1XO3 A;  1QOF A;  1V1P B;  3EFU A;  4OW0 A;  1C4P A;  1AW7 A;  3Q8A A;  4PT5 A;  3T3O A;  1SIJ A;  4GIV A;  2KMC A;  1EU3 A;  1WYG A;  2O6V D;  2DBY A;  2AWT A;  2WXK A;  4YTN B;  3VR9 B;  2Y5P A;  1EM7 A;  1WH3 A;  3MC8 A;  2OHF A;  1A70 A;  1FCC C;  3DHI C;  1ACC A;  2WXP A;  2BYF A;  4HDQ A;  4DXA B;  3RUL A;  2WX0 A;  4RGT A;  2J53 A;  3ZTC A;  1NYR A;  2KO3 A;  2KTR B;  1X1M A;  2Z8L A;  3P4R B;  2ZPY A;  2OJW A;  5E6N A;  4MGY E;  3X0W A;  2D07 B;  3R66 C;  2C7H A;  3VUY A;  4MSQ B;  3NY5 A;  3Q2A C;  4G3X B;  5G55 A;  1YIW A;  3ALB A;  1UWX A;  2AEH A;  1JRO A;  4ZDV A;  1YJ1 A;  4O1N A;  4W9E A;  4BFR A;  2M17 A;  5D3D A;  5G2N A;  1RYJ A;  3IT4 B;  4MJS A;  4S0R A;  3L08 A;  4OZB A;  2FUH B;  5J18 A;  2JSV X;  1WX7 A;  3ZNH B;  1ET9 A;  4L2Y A;  4WUR A;  3HUI A;  1SB3 C;  4GDL B;  2BBC A;  1UGM A;  4I6L B;  2M8S A;  3A33 B;  1KLG D;  3NUH B;  4W9H A;  2DZK A;  5I4D A;  2KQ4 X;  4XE0 A;  2WXM A;  3PGE A;  2NTS A;  3A1Q B;  4LNO A;  3WAO A;  4DK5 A;  4A3P A;  3AV8 A;  2KZR A;  2REX A;  1R4N I;  2NMQ A;  2UWQ A;  1VDV A;  1MPE A;  1YN3 A;  1QT9 A;  2M0A A;  2GB1 A;  1OQR A;  3HK0 A;  3W1Y A;  3UIN B;  5L83 A;  1NEN B;  3BK2 A;  3NZU A;  3ZO5 B;  4YT0 B;  1HTO A;  4M8N A;  3JSV B;  4EZK A;  1V97 A;  3QAR A;  3VUX A;  5TR5 A;  4YSZ B;  4RGM A;  5IKC M;  2M0X A;  3N20 C;  3RNC C;  1N60 A;  3RT3 B;  4GDK A;  1VCB A;  3HVZ A;  5H8Y E;  1P7E A;  2GOW A;  2L76 A;  4IM0 A;  3OLM D;  3QJZ A;  3VHT C;  1UEL A;  2IJ0 A;  3NZ3 A;  3Q8E A;  3NOB A;  2G4D B;  2ZW1 A;  4HKZ E;  2M56 B;  4A6Q A;  3RMK C;  1L6U A;  4NJ7 A;  2KDM A;  1I7H A;  1YD8 U;  1NBF C;  3VH3 B;  2FCM A;  3TEZ A;  4CQN A;  2BWE S;  2N9P C;  1ZUD 2;  3E56 A;  4US9 A;  1H8C A;  4ZRQ A;  2WXI A;  5BO4 B;  3DQV A;  2KD0 A;  1F9J A;  4IG7 B;  4HPM B;  1E8Z A;  2KVZ A;  2PE9 A;  2AL3 A;  4K7W A;  2L1A A;  1KF6 B;  2WXH A;  2DYO A;  3AEF B;  1JWB D;  5C1Z A;  3HM3 A;  1CJE A;  3TCA A;  2XK5 B;  1UGJ A;  3AM9 A;  2N9X A;  4G50 A;  1V2Y A;  2D3C A;  3I9V 1;  4G11 A;  2ZVN A;  3AED B;  4TMA B;  1VZ7 A;  4BAX A;  3FKY A;  1AWD A;  2PEA A;  4NZL B;  5EE9 A;  2L05 A;  2D5G A;  2JU6 X;  2KAN A;  1ZDX A;  2WQY B;  2FNJ B;  2H88 B;  3PHW B;  5E6O A;  3TUO A;  4NNJ B;  3SR6 A;  1XXG A;  1YQ4 B;  2WWZ A;  2ZCC A;  3Q3O C;  3APC A;  1HZ5 A;  4WAF A;  1KLV A;  4OZA A;  4CHK A;  3BZD B;  2KAC A;  2J42 A;  2TSS A;  2K8B A;  3VQI A;  4MJS B;  4GB9 A;  4PYU A;  3NVZ A;  1HEZ E;  2ZNV B;  2PLP A;  2ZVO A;  4YWG G;  1QOA A;  3H6N A;  1E90 A;  4LNF A;  3DDC B;  2W9N A;  4JX1 C;  3OAW A;  1UZX B;  2ZCB A;  1TIF A;  4BKS D;  3WIM A;  3KW5 B;  4C00 A;  1Q10 A;  4M0W B;  1WJ4 A;  5JXV A;  3H7P B;  4A9A A;  4ARC A;  4M01 A;  2C7M B;  4WWN A;  4H2A A;  2MCN B;  1I4R A;  2YVC A;  2JYT A;  2RMM A;  1SXT A;  1KTK A;  3PSE B;  3ZQ4 A;  4E3C A;  1ZGU B;  4HXD A;  1WE7 A;  2IYD B;  4ZYN A;  2G3Q B;  3JW0 X;  4HLE A;  2I1K A;  4KZC A;  1B9R A;  2WU2 B;  4ICV A;  1T0Q C;  4US8 A;  1XLN A;  5AUK A;  4K3B A;  1TKG A;  3AB5 A;  4WQO B;  1JRU A;  3AEA B;  5EE0 A;  3TSS A;  1C1Y B;  1WE6 A;  2B76 B;  3QAQ A;  4XWW A;  1WR6 E;  2KDE B;  3AN1 A;  3HRD D;  4RMA A;  2NR2 A;  3KQ4 A;  2HTH A;  4W9F A;  2DAJ A;  1AYF A;  1A5R A;  4HDO A;  2LRW A;  1GNU A;  4P16 A;  1TT5 B;  3W9C B;  1T5X D;  3ML9 A;  2V3N A;  4C80 A;  1M94 A;  1F2R C;  1V6E A;  3C19 A;  1E7V A;  2LAS A;  3R3M A;  1Z5S B;  3AEG B;  4OVZ A;  3AE9 B;  4II2 B;  2RR9 A;  3I63 C;  2QDF A;  1SSN A;  5EE1 A;  3O65 B;  4KGS A;  4USA A;  2K3U A;  4MEL A;  2EMT A;  1ZP0 B;  5HG2 A;  2MRP A;  4WJP A;  3AEC B;  4MM3 A;  2JYE A;  2O6V B;  5LXI B;  2V0G A;  1N61 A;  2K39 A;  2WXQ A;  1ROE A;  3SFD B;  5FK9 C;  1CQV A;  2LFI A;  2GBM A;  2PVG C;  4MDK E;  1JRP A;  4FHK A;  4NQK E;  1WRD B;  4A90 A;  2V4I B;  2K6D B;  4C4V A;  4IM3 A;  2VZK D;  3OJ4 B;  1JWS D;  3PZ7 A;  1WF9 A;  2PKO A;  1N5X A;  2LXA A;  3ZIM A;  1I4G A;  4IKG A;  2QJL A;  1V1P A;  2K1F A;  1I4P A;  2IY1 B;  2LJ5 A;  3QQ8 B;  1WSP A;  4GLS C;  4ANU A;  1T0S C;  1C9F A;  3KYD D;  1I35 A;  1R4N B;  2DNF A;  2KTR A;  4TQ1 A;  3AH7 A;  2K8H A;  1WJU A;  2LUM A;  2KWV B;  4MSM B;  4E74 A;  2D10 A;  2L52 A;  3JYU A;  2MH7 A;  1FO4 A;  2J0M A;  4DBG A;  1VZ8 A;  4KV2 A;  1GUA B;  3RNB C;  2JQR B;  2L7R A;  2Z59 B;  4EEW A;  4REZ A;  2ZPN A;  1QOG A;  2XEW A;  4HWI B;  4B6W A;  5G5G A;  2W54 A;  1IGD A;  3PO0 A;  3DWM A;  4YSX B;  2R61 A;  3C8Y A;  2KMM A;  1Y8R C;  1LFD A;  1NYQ A;  2O2V B;  4LLG M;  2FCS A;  5KHO A;  4GDL A;  2GBJ A;  3Q69 A;  3DVG Y;  1SEB D;  2GBK A;  2KQ7 A;  3EC8 A;  2IPK D;  3EGR A;  1L5P A;  4MGK E;  3D32 A;  3UF8 A;  5BMI A;  4NPN A;  4PS7 A;  3A1Q A;  2JY6 A;  1WGG A;  2CR5 A;  3AI5 A;  1IP9 A;  2J0K A;  1CZP A;  2KFK B;  1KLU D;  2Q5W D;  4ANW A;  4C7Y A;  4GN1 A;  2KLG A;  4P6V F;  3AEB B;  1FNV A;  1DOI A;  1QLB B;  2KXJ A;  3JSV A;  4FAD A;  2FCQ A;  3R8B A;  2C60 A;  2GBN A;  1S3S G;  3CMM B;  2HJ1 A;  2CKH B;  4RCO A;  2DHZ A;  4DXG A;  1RWS A;  3ZRF A;  1GB1 A;  5LXH A;  1OQQ A;  3MC0 B;  1P1A A;  1YX5 B;  3ZYY X;  5D3I B;  3Q3N C;  2NPT A;  2AQ3 B;  1YN5 A;  2BS2 B;  4HVB A;  4GXB A;  2KVR A;  1GPX A;  1EF1 A;  4XC2 A;  3PHX B;  4K81 A;  1Q0W B;  4MH0 E;  4FA6 A;  4NQL B;  1C3T A;  2MEK A;  3A4R A;  3ONS A;  3ZDT A;  3T8M A;  2KWD A;  2MW5 A;  3K9P B;  4FJY A;  1D3Z A;  4R3D A;  1G6J A;  2ON8 A;  2KMA A;  1XD3 B;  1QZE A;  2XK5 A;  2L83 A;  2ICI A;  4GU2 A;  1ZDV A;  4KVG B;  2L8J A;  1J7C A;  3IT6 B;  3IAM 1;  4DDI D;  3UQB A;  4I6N B;  4OZC A;  2I2Y A;  3NVY A;  2DZJ A;  2JF5 A;  1GAQ B;  2FIF A;  4PYZ A;  1E8W A;  4EKU A;  3B1L X;  3ZGZ A;  1FMA D;  1F77 A;  3WAM A;  4C56 C;  4B0M A;  1P98 A;  3RUI B;  4EZL A;  1L0Y B;  1GG3 A;  4KZ0 A;  2BS4 B;  5IN7 A;  3B0A A;  1J8C A;  2PTL A;  4E71 A;  1UH6 A;  2N1V A;  3SFE B;  3RNG C;  1N6Z A;  2R2Q A;  1YN4 A;  4GGQ A;  2INC C;  1FCL A;  3IFW B;  4RGN A;  1T3Q A;  5DPT A;  1S1Q B;  2PPH A;  4ZRK A;  2KX0 A;  3UI3 A;  1WRI A;  2IDY A;  3BYT B;  4F1S A;  3WCQ A;  1R7S A;  3VRB B;  3PTF C;  2CHW A;  3DWG C;  4WAA A;  3AE3 B;  2IO1 B;  3UIP B;  2RPV A;  2KAJ A;  3ZNG C;  4HCN B;  4DQO C;  2IO3 B;  5IA7 A;  1V1O A;  5BMH A;  3PLV A;  4WJN A;  1RRB A;  2LXC A;  2DYM A;  4M0W A;  2PVO D;  1OQY A;  2N7E A;  2SEB D;  3H7P A;  3ZDM C;  3B08 A;  1YMH E;  3AU5 A;  4KDI C;  2SAK A;  3R7Q A;  3QK0 A;  2A5U A;  2JZ3 B;  3U30 A;  2GRI A;  4LNK A;  3NS1 A;  3HHM A;  4P7I A;  1TZ1 A;  2MBB B;  3HIZ A;  4XGA B;  3TBL D;  2LJI A;  1VRA B;  1BXT A;  1BT0 A;  4L23 A;  3MTN B;  2UYZ B;  4J6I A;  4FJV B;  3ZRC A;  1C79 A;  4JWU C;  1UNS A;  2MP2 A;  3AE1 B;  4BBN C;  1IPG A;  4HJG E;  2ONQ A;  4KSL C;  3IBE A;  2JZP A;  3PZD A;  5E6J A;  1WYW B;  1WXQ A;  2NPT B;  1SIF A;  3PRE A;  1KRH A;  1UF0 A;  5CHF A;  3NJT A;  3N30 A;  1OFF A;  4PK1 A;  4L1B A;  5JHA A;  1YQB A;  5BMG A;  5DPW A;  2BYV E;  2HD5 B;  3FAH A;  2CS4 A;  2N9L A;  5D2M B;  2MLB A;  1V5O A;  3U2S C;  1WGK A;  4DDG D;  2KC1 A;  4TKN A;  2MHJ A;  4N59 A;  4EZJ A;  2WDT B;  3AE6 B;  1T6B X;  5D7G A;  2IGD A;  1ZXI A;  3BY4 B;  3PZ8 A;  1UD7 A;  2WP9 B;  5IOI A;  3PT2 B;  2RDB C;  3N1Y C;  5TSS A;  2BW2 A;  4II3 B;  2UU7 A;  1NVI D;  1ZW7 A;  3W1S A;  2W3R A;  2JX5 A;  4DHJ D;  3P2B A;  2E3T A;  4IUM B;  1TGZ B;  1P7F A;  1Q5W B;  1SGH A;  2JPH A;  2BF8 B;  2O6V A;  3ML8 A;  4HRO A;  4IW0 A;  4KKI A;  1FM0 D;  3DVN V;  3C0R B;  4KKJ A;  3KYC D;  2BGF A;  2BKF A;  5AZH A;  3CWI A;  3I57 A;  4W9D A;  2XNA C;  1LGR A;  1WGH A;  2RD0 A;  2Y3A A;  1SE9 A;  3RNF C;  3WAP A;  3DBR I;  2B3A A;  1PYW D;  3RYT A;  1IUE A;  3APD A;  1JWM D;  3DBH I;  3A4S C;  2BB5 A;  1J7A A;  4LCD E;  1DOY A;  1ZPS A;  3SD5 A;  4W9C A;  3VR8 B;  2WXL A;  1I4Q A;  3J9C A;  1GB4 A;  2G45 B;  2L3Z A;  2WX1 A;  1KOT A;  1NDD A;  3LDZ E;  4YTM B;  1ZOY B;  1UBQ A;  4RM9 A;  4G0N B;  5MPO A;  1DOX A;  3RI7 C;  2V9H A;  4ASW C;  2MA9 B;  1L4D B;  3AU4 A;  2RSU A;  5DPS A;  1ZKH A;  2FE8 A;  4GOC A;  3RFZ B;  2IZV B;  3QIJ A;  4BVU C;  2Z0E B;  2QIL A;  3KH0 A;  2JWZ A;  2MBQ A;  1HXY D;  1D6E C;  4W9G A;  1L0V B;  3N32 A;  4KSK C;  2ZZP B;  5FKA C;  4ZYS A;  3BIN A;  3Q8F A;  4BZA A;  1XLO A;  2MP2 B;  2EEL A;  3TEX A;  3QX1 A;  3FC4 A;  3AUL A;  1YX6 B;  2O2V A;  2V4L A;  2V3S A;  3RZF A;  2DX5 B;  4HCP B;  4N9F 4;  1L7Y A;  1IGC A;  4NAM A;  1QKZ A;  1V86 A;  3U8Z A;  1RFA A;  2IO2 B;  1TS3 A;  2MJE A;  4JWS C;  5KHQ A;  1EU4 A;  4LTU A;  2KDI A;  3V05 A;  1SJH D;  1NEK B;  1PQS A;  3EHV A;  2MSE D;  1IBX B;  2EKI A;  3TJP A;  2KFK A;  1HE8 A;  3DHG C;  4MH8 A;  2RDG A;  1PGB A;  4JE3 B;  2J4X A;  5BYQ A;  2OOB B;  1F0Z A;  1J7B A;  2QCZ A;  1CK1 A;  3GE3 C;  3VXW A;  1GC7 A;  3DBL I;  2ZNV C;  3AE4 B;  1MFW A;  1N63 A;  3TL5 A;  3ETR A;  2JRI B;  2W82 A;  5D94 A;  4KIK A;  2MBO A;  2BKR B;  1E8Y A;  3HVD A;  1QOB A;  3RZW C;  1C78 A;  3OWE B;  4LDT D;  5GXG B;  4OVU A;  4IM2 A;  2G4S A;  1YQ3 B;  4DXF A;  2NS5 A;  4ZOH C;  2V3P A;  3CF6 E;  2BQQ A;  4ARI A;  4K7U A;  3SU8 X;  2KNB A;  4TQ0 A;  1MG8 A;  1KH0 A;  1AAR A;  3RD2 A;  5E6P A;  2JWU A;  1E10 A;  3B9J A;  2RDH A;  2NBV B;  4JPS A;  2LI5 A;  3RNE C;  5AZF A;  1SBB B;  3IXS A;  4ANX A;  2N4F A;  2KWC A;  2X38 A;  2N7J A;  3OJ3 A;  3HM6 X;  2LGI A;  2IO0 B;  2K22 A;  2J0J A;  3K9O B;  2VRR B;  3DVG X;  1C77 A;  2LRU A;  1JWU D;  2BYE A;  2Y5C A;  1PGA A;  4XX5 A;  1RLF A;  2LHE A;  1WWT A;  4ZRI A;  5BYS A;  1WGR A;  1FD6 A;  2ZEQ A;  3FIL B;  3MHS D;  3VH4 B;  2GBR A;  1I42 A;  1HQR D;  4BKS A;  4OHJ A;  2D3A A;  1CMX B;  3E9S A;  4PS3 A;  1GOZ A;  1DYQ A;  1UBI A;  5AUI A;  2R2O A;  2JZZ A;  2AQ2 B;  5EE3 A;  1HA5 A;  4IDI A;  3O13 A;  2NTT A;  1WR1 A;  2EKE C;  1T0R C;  1ENF A;  1FNW A;  2M19 A;  2INP E;  1WX9 A;  1EUV B;  2JXT A;  2N7D A;  4N58 A;  3KUZ A;  1E0Z A;  1SE4 A;  3VAW A;  2KK8 A;  2DWQ A;  1ISN A;  3DPD A;  3ENE A;  5LLI A;  4RFB A;  3DBS A;  2WHI A;  3CSF A;  1F2R I;  1P3Q U;  4FUL A;  2JVC A;  2MWS B;  1BUI C;  2LVP A;  4EFO A;  1TBE A;  2BPS A;  1JW9 D;  4WQM A;  2HTM E;  2LGY A;  2WNM A;  4RH6 A;  3IHP C;  3DCG A;  3DOW A;  3L17 A;  2KHW B;  3ZLZ A;  3UGB B;  1JQ4 A;  1NI3 A;  4AJY B;  1E7U A;  1WZ0 A;  1WGY A;  2MJD A;  3Q3F A;  4F7Z A;  1VD2 A;  3Q8C A;  3BVM A;  4OVV A;  4HPP A;  2GI9 A;  3V61 A;  1SF0 A;  3VTV A;  3ZJU A;  2DEN B;  2D2Q A;  1MJD A;  2WXO A;  4KIK B;  4KGR A;  4DHZ E;  4ICU A;  3AEE B;  1R4M I;  3BVG A;  3Q14 C;  3PLU A;  2KYW A;  2QHO A;  4URK A;  1FFU A;  2M1M A;  5AEK B;  2GLS A;  5BYR A;  4DHJ B;  1I4H A;  2QEJ C;  2IY0 B;  3U4E G;  3DBR B;  2CU1 A;  1D4B A;  3GP7 A;  2KQS A;  4WIP A;  1TJE A;  1MVK A;  1F1H A;  4XDD A;  3DBH B;  3MC9 A;  4B95 A;  4JIO U;  5EDS A;  3IG3 A;  3V3X A;  4XZ4 A;  5CHW A;  1C4A A;  3U7D A;  3ZVV A;  2RPQ A;  4IOI E;  1V5T A;  1WI0 A;  4I6P A;  1V81 A;  2LGS A;  1FXI A;  5JZE B;  1DGJ A;  4LNN A;  3ZUN A;  1K8R B;  4TSS A;  3TEY A;  1N62 A;  1RAX A;  3A9J B;  3AXC A;  3L4P A;  2QIE B;  3AE5 B;  2KWU B;  4EUT A;  3P4Q B;  3VTU A;  4FN2 A;  1FFV A;  2N9K A;  3GE8 C;  1HZ6 A;  3P1M A;  1FNU A;  1WJN A;  2AX5 A;  2C5L C;  2C9W B;  3UIO B;  4M02 A;  3ZNZ B;  2RGF A;  2WDV B;  3KLS X;  1MHX A;  4HK2 A;  1WMH A;  1D5X C;  3MP9 A;  1WZ3 A;  3TEW A;  4AS1 A;  3KVF B;  4Q2J A;  2QC8 A;  4IWQ A;  2AYO B;  4DHZ B;  2ASQ A;  2I38 A;  1ESF A;  1WXA A;  5J2R A;  3N9Y C;  3EUB 2;  1UWM A;  1GJZ A;  1JWA D;  1WM2 A;  4NJ6 A;  1E6E B;  2DZM A;  2L32 A;  4MEM A;  2PIA A;  1FXA A;  2KFJ A;  4KX6 B;  4MT5 A;  4P1C C;  1FEH A;  2MJ3 A;  4HEA 1;  4A8X C;  3GZN I;  2N0S B;  2LMC A;  2BVC A;  2FBW B;  3H7S A;  5HI1 A;  1EO6 A;  4AOF A;  1QF6 A;  1KM7 A;  1IYF A;  1SJE D;  3VFK A;  5DCN A;  1KJT A;  2V1Y A;  1MI0 A;  2XBB C;  4A20 A;  4ITK A;  2EMS A;  3BK1 A;  3PVL A;  5D6J B;  3A9K B;  1N5W A;  3DBL B;  2FUG 1;  4HPL B;  2OED A;  4W9I A;  2K0P A;  3QA8 A;  1YJJ A;  2KJH B;  3KWV A;  2WGS A;  2HE7 A;  1J19 A;  1TY0 A;  4ZRJ A;  4AJW A;  1ET6 A;  1TY2 A;  3AMZ A;  2ZW0 A;  1TTN A;  1WJ6 A;  1ZXH A;  4A3O A;  3BII D;  1XF5 L;  2A4Z A;  4KDL B;  1RM6 C;  3BWU D;  2WS3 B;  3LYY A;  2KJ6 A;  3IAS 1;  1E8X A;  4BOS C;  3VVW B;  4NAW B;  1MG4 A;  4LNI A;  3JVZ X;  3SEB A;  1WIA A;  1KFY B;  2K5P A;  3W2D A;  1IBX A;  3EFC A;  1C76 A;  1Q1O A;  2JRH A;  4AP4 C;  4LDT B;  4IWP A;  5CHV C;  4M8M A;  5CX3 A;  3RN9 C; 
#chains in the Genus database with same CATH homology
 3QX1 A;  2K8C A;  4E74 A;  4PS8 A;  3MJW A;  3L10 B;  3AUL A;  1YX6 B;  2D10 A;  3JYU A;  3V6C B;  2J0M A;  2O2V A;  1LM8 B;  1WXS A;  2V4L A;  2V3S A;  4DBG A;  3GOE A;  3H9D A;  3RZF A;  4KV2 A;  1GUA B;  2DX5 B;  2L7R A;  3EFU A;  4HCP B;  4HJK A;  4N9F 4;  1L7Y A;  2Z59 B;  4EEW A;  2KLC A;  3V62 A;  1V86 A;  3U8Z A;  2ZPN A;  4GIV A;  1RFA A;  2KMC A;  2IO2 B;  2O6V D;  2XEW A;  4HWI B;  4B6W A;  5KHQ A;  4JL9 A;  2KDI A;  2AWT A;  1PQS A;  4TUU A;  1WH3 A;  4HDQ A;  4DXA B;  3EHV A;  2MSE D;  2BYF A;  3RUL A;  2WX0 A;  2KFK A;  1HE8 A;  1T0Y A;  3TJP A;  4MGZ E;  5J17 A;  3ZTC A;  1V49 A;  5DPR A;  2KO3 A;  2KTR B;  4LJO B;  1XT9 B;  1X1M A;  1NI2 A;  4EOY A;  1Y8R C;  1LFD A;  2ZPY A;  2O2V B;  5E6N A;  2FCS A;  4MGY E;  5KHO A;  3X0W A;  2D07 B;  2KDF B;  4GDL A;  3R66 C;  2GBJ A;  2C7H A;  3VUY A;  2OOB B;  4MSQ B;  3NY5 A;  4G3X B;  5G55 A;  3DVG Y;  1YIW A;  2GBK A;  1WFY A;  2KQ7 A;  1LXD A;  3ALB A;  2LZ6 A;  3EC8 A;  4ZDV A;  2AEH A;  1YJ1 A;  4MGK E;  4W9L A;  4AWJ A;  3VXW A;  1GC7 A;  3D32 A;  3UF8 A;  3L0W B;  4NPN A;  3DBL I;  4PS7 A;  3A1Q A;  4W9E A;  3NS8 A;  2ZNV C;  3L16 A;  2JY6 A;  5HKH A;  1WGG A;  4BFR A;  2CR5 A;  2M17 A;  3AI5 A;  1OGW A;  1IP9 A;  2J0K A;  3R7R A;  3TL5 A;  5G2N A;  1FXT B;  2KFK B;  2JRI B;  3DVN U;  4MJS A;  5D94 A;  4KIK A;  3L08 A;  2MBO A;  4ANW A;  2BKR B;  2LGD A;  2KLG A;  1E8Y A;  1WMH B;  2FUH B;  3PRZ A;  4GN1 A;  5J18 A;  1WX7 A;  2Z0D B;  4GSW A;  3RZW C;  3ZNH B;  4LDT D;  1L2N A;  3M95 A;  2PJH A;  4OVU A;  4FBJ B;  2KXJ A;  1P0R A;  3PPA A;  4GDL B;  3JSV A;  4FAD A;  1UGM A;  4IM2 A;  2G4S A;  2FCQ A;  4I6L B;  2NS5 A;  2PE6 B;  3CF6 E;  2M8S A;  3A33 B;  1Z2M A;  4K7U A;  4W9H A;  2DZK A;  3SU8 X;  2C60 A;  2GBN A;  2KNB A;  4TQ0 A;  1S3S G;  3CMM B;  3PGE A;  2CKH B;  4FHJ A;  2N1W A;  1MG8 A;  3A1Q B;  4GMV A;  2NBU A;  3WAO A;  2DHZ A;  4A3P A;  4DK5 A;  2KZR A;  2REX A;  3ZRF A;  1R4N I;  5LXH A;  2UWQ A;  1AAR A;  3RD2 A;  3APF A;  5E6P A;  2DZI A;  2GMI C;  2K25 A;  2NBV B;  1P1A A;  1YX5 B;  2LI5 A;  5AZF A;  3W1Y A;  3HK0 A;  4BBN F;  3UIN B;  5L83 A;  4ANX A;  2N4F A;  3NZU A;  2KWC A;  1LQB A;  1WY8 A;  2NPT A;  3IVF A;  3ZO5 B;  3OJ3 A;  3HM6 X;  1H4R A;  1U4A A;  3QC8 B;  2DAF A;  2IO0 B;  4M8N A;  3JSV B;  4EZK A;  2J0J A;  3QAR A;  3VUX A;  5TR5 A;  3K9O B;  4WWO A;  2VRR B;  3DVG X;  4HVB A;  4GXB A;  2FAZ A;  2M0X A;  2KVR A;  2LRU A;  1EF1 A;  4XC2 A;  2BYE A;  3PHX B;  4K81 A;  1Q0W B;  4XX5 A;  3WAN A;  4MH0 E;  3RT3 B;  4K7S A;  4FA6 A;  4GDK A;  4NQL B;  1C3T A;  1VCB A;  1RLF A;  4K1R B;  3ZW3 A;  2GOW A;  2L76 A;  3A4R A;  3M63 B;  3ONS A;  4IM0 A;  3OLM D;  3ZDT A;  4ZRI A;  3QJZ A;  3TMP B;  1WGR A;  3T8M A;  3VHT C;  1UEL A;  2ZEQ A;  3VTW A;  3NOB A;  3MHS D;  3VH4 B;  2G4D B;  2MW5 A;  3K9P B;  2GBR A;  4FJY A;  3UQA A;  1D3Z A;  4FJZ A;  2NVU I;  1G6J A;  1I42 A;  2KMA A;  3NHE B;  4BKS A;  1XD3 B;  1QZE A;  2XK5 A;  4NJ7 A;  2M4N A;  3LJ3 A;  4GU2 A;  1CMX B;  1YD8 U;  4KVG B;  1NBF C;  2L8J A;  4PS3 A;  3VH3 B;  1P9D U;  2FCM A;  2BWE S;  4WJO A;  2LVQ A;  2N9P C;  4LJP B;  4DDI D;  3UQB A;  1J0G A;  3T9L A;  1UBI A;  4I6N B;  2ZJD A;  2MQJ A;  2R2O A;  1H8C A;  2JZZ A;  2DZJ A;  2JF5 A;  2Y5B B;  4ANV A;  4GDK B;  2FIF A;  2BWF A;  5BO4 B;  4PYZ A;  1E8W A;  2CHZ A;  3DQV A;  2IBI B;  2KD0 A;  4EKU A;  1F9J A;  4IG7 B;  3B1L X;  4HPM B;  1E8Z A;  3WAM A;  1WR1 A;  2PE9 A;  2EKE C;  2LVO A;  2AL3 A;  4K7W A;  1P98 A;  3RUI B;  4EZL A;  1GG3 A;  2DYO A;  3NZS A;  4KZ0 A;  1WX9 A;  5C1Z A;  3B0A A;  3HM3 A;  1EUV B;  3TCA A;  1J8C A;  2XK5 B;  2N7D A;  4RM8 A;  3KUZ A;  4E71 A;  3SHQ A;  2N9X A;  4G50 A;  1UH6 A;  2N1V A;  3Q3J A;  3VAW A;  1V2Y A;  4G11 A;  4B9K A;  4AUQ C;  2I1J A;  2KK8 A;  2ZVN A;  2R2Q A;  2JUO A;  1ISN A;  3DPD A;  4GGQ A;  3ENE A;  5LLI A;  3DBS A;  3IFW B;  3VDZ A;  3TIX A;  3CSF A;  5DPT A;  1S1Q B;  2PEA A;  2PPH A;  5FR6 A;  4ZRK A;  4IWO A;  2L05 A;  1P3Q U;  2KX0 A;  2JVC A;  4FUL A;  4X57 B;  2MWS B;  2KAN A;  2LVP A;  4EFO A;  2MX2 A;  1TBE A;  2BPS A;  5C23 A;  4F1S A;  4BOZ B;  2FNJ B;  2LGY A;  3PHW B;  5CTR C;  3IHP C;  5E6O A;  3DCG A;  3PTF C;  4BKG A;  1OEY A;  2CHW A;  3DOW A;  2KHW B;  3L17 A;  3WA0 A;  3ZLZ A;  4WAA A;  3UGB B;  4FLH A;  2IO1 B;  3ZTD A;  1E7U A;  1WXV A;  1WXM A;  4AJY B;  4NNJ B;  3UIP B;  2NCN A;  3ZNG C;  4HCN B;  1WZ0 A;  1WGY A;  2IO3 B;  3Q3F A;  5IA7 A;  2KC2 A;  4F7Z A;  2WWZ A;  2ZCC A;  1VD2 A;  3PLV A;  4WJN A;  4OVV A;  3APC A;  3S2A A;  1RRB A;  2LXC A;  1KLV A;  2DYM A;  3V61 A;  4CHK A;  1OQY A;  2N7E A;  3H7P A;  3ZDM C;  3B08 A;  3AU5 A;  3VTV A;  4KDI C;  2MBH A;  2DEN B;  3KUD B;  2D2Q A;  3R7Q A;  2K8B A;  3VQI A;  3QK0 A;  4MJS B;  2A5U A;  4KIK B;  2JZ3 B;  4DHZ E;  3CST A;  2JXX A;  4GB9 A;  4ICU A;  4PYU A;  3U30 A;  1R4M I;  3M3J A;  3HHM A;  2ZNV B;  4P7I A;  3PLU A;  1TZ1 A;  4JGH B;  2MBB B;  2ZVO A;  3HIZ A;  3H1U A;  3TBL D;  2QHO A;  2KX3 A;  4URK A;  2M1M A;  3H6N A;  5AEK B;  1E90 A;  1BT0 A;  2L0T A;  3DDC B;  4DHJ B;  4DWF A;  2W9N A;  3MTN B;  2UYZ B;  2IY0 B;  4J6I A;  3OAW A;  1UZX B;  2ZCB A;  4FJV B;  3ZRC A;  4BKS D;  3WIM A;  2CU1 A;  3KW5 B;  2MP2 A;  3A9J A;  4M0W B;  1WJ4 A;  2KQS A;  4BBN C;  3H7P B;  2C7M B;  1IPG A;  2L0F A;  2J7Q B;  4WWN A;  4B95 A;  4JIO U;  2MCN B;  5EDS A;  3IG3 A;  2MBE A;  4KSL C;  2YVC A;  3IBE A;  3PZD A;  4XZ4 A;  2AL6 A;  2YLM A;  5CHW A;  1OEY J;  3U7D A;  3ECI A;  1WYW B;  3PSE B;  2NPT B;  3PRP B;  1ZGU B;  4HXD A;  3VUW A;  4E3C A;  1WE7 A;  3QWZ B;  1SIF A;  3PRE A;  2IYD B;  2LWP A;  4ZYN A;  2RPQ A;  2G3Q B;  2JT4 B;  2KTF A;  3N30 A;  5CHF A;  3ZVV A;  1V5T A;  1WI0 A;  3JW0 X;  4I6P A;  1V81 A;  4HLE A;  5JHA A;  5JZE B;  4JLC A;  1YQB A;  5DPW A;  3ZUN A;  2I1K A;  4KZC A;  2BYV E;  1K8R B;  2HD5 B;  2CS4 A;  5D2M B;  3WAL A;  4ICV A;  1RAX A;  3A9J B;  5JH5 C;  2MLB A;  1V5O A;  3AXC A;  4TV3 A;  3RCZ A;  4DDG D;  4WQO B;  2K6Q A;  2KC1 A;  2KWU B;  2N9E B;  1JRU A;  4TKN A;  5JHB A;  4W9J A;  1C1Y B;  2FID A;  4EUT A;  4BKT A;  4EZJ A;  2WDT B;  4IC7 B;  2D11 A;  3VTU A;  2CHX A;  1WE6 A;  2HJ8 A;  4FN2 A;  5D7G A;  3QAQ A;  3W1S C;  1WR6 E;  3BY4 B;  1UD7 A;  2KDE B;  2LD9 A;  4RMA A;  1WJN A;  3PT2 B;  2C5L C;  2LGX A;  2NR2 A;  2C9W B;  2OJR A;  2HTH A;  3UIO B;  4W9F A;  4MGI E;  2D3G A;  4II3 B;  3ZNZ B;  2RGF A;  2DAJ A;  1ZW7 A;  3W1S A;  4CYE A;  4HK2 A;  1WMH A;  4DHJ D;  3P2B A;  1A5R A;  4IUM B;  4HDO A;  1TGZ B;  2LRW A;  1GNU A;  3V6E B;  1WZ3 A;  1Q5W B;  1SGH A;  3KVF B;  3ZKJ C;  4F8C B;  2JPH A;  2BF8 B;  4IWQ A;  2NBW B;  2O6V A;  3ML8 A;  5IAA C;  4IW0 A;  2AYO B;  4DHZ B;  2ASQ A;  3DVN V;  3ML9 A;  1WXA A;  3L13 A;  3C0R B;  1M94 A;  1V6E A;  3KYC D;  2BGF A;  5J2R A;  2BKF A;  5AZH A;  1GJZ A;  1E7V A;  1WM2 A;  2LAS A;  4JQW C;  4NJ6 A;  4W9D A;  1WGH A;  2DZM A;  1E5W A;  3A9K A;  2RD0 A;  3L54 A;  1Z5S B;  1SE9 A;  3R3M A;  4MEM A;  5AZG A;  5GMV A;  2C7N B;  2KFJ A;  3WAP A;  3DBR I;  2RR9 A;  2B3A A;  4II2 B;  3RYT A;  3O65 B;  5L95 C;  3APD A;  1OTR B;  3GZN I;  3DBH I;  4MEL A;  2KOX A;  3A4S C;  4LCD E;  2EMT A;  3H7S A;  1EO6 A;  1V80 A;  4AOF A;  2MRP A;  4WJP A;  1KM7 A;  1IYF A;  2WYQ A;  4MM3 A;  3ZNI D;  2O6V B;  3VFK A;  5LXI B;  5DCN A;  3EEC A;  3PRM B;  2K39 A;  3SD5 A;  4WJQ A;  4CO7 A;  1KJT A;  2V1Y A;  2XBB C;  4W9C A;  4A20 A;  2G45 B;  1EF5 A;  2L3Z A;  2WX1 A;  4WWP A;  2EMS A;  1NDD A;  3LDZ E;  1KOT A;  2GBM A;  1UBQ A;  2L00 B;  4NAW A;  4RM9 A;  3PVL A;  4G0N B;  5D6J B;  4MDK E;  3A9K B;  4FHK A;  3M62 B;  4NQK E;  4HPL B;  1WRD B;  4W9I A;  3QA8 A;  1WX8 A;  2K6D B;  3QCA A;  2KJH B;  2LUE A;  4IM3 A;  1XQQ A;  2HE7 A;  1J19 A;  2KDB A;  4ASW C;  2MA9 B;  4ZRJ A;  3OJ4 B;  2DYB A;  1WF9 A;  2FCN A;  4AJW A;  3AU4 A;  2RSU A;  5DPS A;  1ZKH A;  2LXA A;  1TTN A;  1WJ6 A;  3V60 A;  4W9K A;  4GOC A;  3ZIM A;  2IZV B;  2KKC A;  2A4Z A;  3QIJ A;  4A3O A;  4KDL B;  4BVU C;  2Z0E B;  2K1F A;  2IY1 B;  3KH0 A;  2JWZ A;  2MBQ A;  1V9J A;  2KJ6 A;  4NY0 A;  2KN5 A;  4W9G A;  3SDL C;  2LJ5 A;  1GC6 A;  3QQ8 B;  4BOS C;  1E8X A;  3PS6 A;  3VVW B;  1WGD A;  3PV1 A;  4NAW B;  3N3K B;  2KJR A;  3N32 A;  4ANU A;  4KSK C;  2ZZP B;  3JVZ X;  1WIA A;  3I3T B;  1WM3 A;  3KYD D;  4YL8 A;  1Q1O A;  1I35 A;  3BIN A;  3QHT A;  2JRH A;  4AP4 C;  4LDT B;  3KUC B;  3X23 A;  2KTR A;  4TQ1 A;  2K8H A;  2MP2 B;  4IWP A;  1WJU A;  5CHV C;  4M8M A;  5CX3 A;  2KWV B;  4MSM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...