4WIPA

Dix domain of human dvl2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MGETKVIYHLDEEETPDLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Segment polarity protein dishevelled homolog DVL-2
publication title Ubiquitination of the Dishevelled DIX domain blocks its head-to-tail polymerization.
pubmed doi rcsb
source organism Homo sapiens
total genus 16
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wipA00
2D5GA 1WSPA 3PZ7A 4WIPA 3PZ8A
chains in the Genus database with same CATH superfamily
1QQRA 3EGRA 4LK0M 3Q3FA 2IO3B 3SU8X 1KF6B 4HDOA 2D3BA 2WXLA 4JIOU 4ANXA 4HJKA 3RULA 4A6QA 2KYWA 4NAWA 3DBRB 3VVWB 1CJEA 2L83A 1WXMA 2D3AA 1FXTB 2JXTA 1ZXHA 3BIID 5GXGB 2INPE 2E6XA 2WQYB 3PZ8A 3AMZA 2V3NA 3BK1A 5D3IB 1E7VA 2C7MB 2G3QB 3WAOA 5JHBA 2RMMA 4RF0A 5CHFA 3Q3OC 2K5PA 3NVYA 3DOWA 1NBFC 2J0KA 2K39A 1FRDA 1F52A 2JXXA 3MHZA 3WIMA 5MPOA 3KW5B 3R3MA 3RYTA 2BS2B 3HUIA 1WRIA 2N7JA 1L4DB 3BINA 2WGSA 4JGHB 3ZIMA 1GB4A 1P9DU 2C5LC 3KUDB 2MCNB 2L0FA 3SFDB 3KWLA 3B9JA 4D2KA 3ZDTA 1H4RA 2PJHA 1ET9A 2KAJA 2MBBB 2WNMA 5G55A 1XLOA 4GDLB 4TMAB 3IXSA 1M94A 3NZUA 3DQVA 5IKCM 1UGMA 1MJDA 1WIAA 3QA8A 2L76A 3R66C 2L32A 2V3SA 2DNFA 3QIJA 1Q10A 1XLNA 2L00B 2KQ4X 1IP9A 4HWIB 2EKEC 2WDVB 5EE9A 4H2AA 2UYZB 2N7DA 2VH2A 2W54A 3M62B 1KLGD 1E0ZA 3PZDA 3RNGC 2K3UA 2KTRA 3H8HA 2WXQA 4M01A 5GMVA 1PGBA 3NVWA 4RGNA 1E7UA 2VZKD 3SFEB 2NBUA 1T5XD 2JY6A 3AECB 2L05A 3BVGA 4S17A 4HDQA 3IBEA 2NS5A 4PS7A 5LXHA 5L83A 5J17A 1YX5B 2X38A 3QX1A 1E10A 3L4PA 4WH4A 3AE5B 3ZTDA 1XEEA 1JROA 4HCPB 4MH8A 5JZEB 3B1LX 4REZA 4DBGA 2C9WB 2MW5A 5CX3A 1T0RC 2QSDA 2M1MA 2KLCA 3QAQA 5J2RA 4KX6B 1EO6A 5HG2A 4US8A 3I57A 3QCAA 2CU3A 1E8ZA 2INDC 1WX9A 2REXA 4C7ZA 4WJNA 2WP9B 4C4VA 3Q2AC 1T0SC 2XNAC 3QC8B 2LGSA 2WLBA 2PEAA 4KV2A 4ICUA 4WAFA 3DCGA 1LXDA 2M17A 4ZHOA 1E5WA 3KUCB 1WSPA 4LDTB 1OQRA 1WJ6A 4IG7B 2KC2A 1GOZA 2HDEA 2N9PC 1WZ0A 2DENB 3OLMD 1T0QC 2NBWB 3PPAA 1RWSA 1SXTA 3GP7A 2V4IB 2WHIA 3HRDD 3AEFB 2NCNA 4K3CA 4YWGG 1Q0WB 3PO0A 5D2MB 4ANVA 1QOFA 1GB1A 1ZXIA 1AW7A 2R2OA 4NJ7A 2PKOA 2INNE 4ICVA 3WAMA 2NPTA 3O65B 1GNUA 1D5XC 3NVZA 4YTPB 1DOXA 4WJOA 3W9CB 2WXHA 2Z59B 4DK5A 4YSZB 4HKQA 4IKGA 4ZRKA 3ETRA 2WXKA 3VH4B 1BXTA 3HIZA 2KO3A 1V5TA 4MT5A 3AE8B 4WJPA 2MLBA 4B95A 3ZXVA 1PYWD 3QHTA 1L4ZB 3Q3MC 1JRPA 4GDLA 1K51A 5C3JB 1JCKB 1TBEA 5JHAA 2NR2A 1VR9A 1KLVA 2KQSA 1L0YB 2Y5CA 4NJCA 3B2GA 4ARCA 4FULA 2DHZA 2L3ZA 2M0AA 1J8CA 2KMMA 1RFAA 3TJPA 4JX1C 2G1EA 3VDZA 1C79A 1KJTA 1YOVB 1P7FA 1K53A 1GPXA 3R8BA 1JMLA 1WMHB 1WYGA 1X1MA 3L13A 1SE4A 4AQ7A 1KFYB 2CS4A 4IM2A 2K8HA 1I7HA 4IM0A 1VCBA 4K81A 3BZDB 3QQ8B 4DHJB 1T3QA 1FPYA 2VH1A 3J9CA 3T8MA 1QLBB 2WX0A 4WJQA 4O1NA 1RM6C 1L2NA 1HE8A 1E9MA 1XXGA 1C4CA 2KK8A 2BBCA 3W5UB 2J42A 1CQVA 3VRBB 2ZPNA 2EMSA 1SBBB 2BYTA 2NTSA 2RPQA 4OHJA 3V60A 1ZDVA 4KSLC 5HKHA 4WWPA 2JRHA 1WXQA 3AE6B 2WXFA 2Y5PA 1RLFA 1I4RA 3AEEB 1EF1A 3A9KA 3JYUA 3ZNZB 4A3PA 4OVVA 2ZEQA 3ZNGC 4ANUA 1F2RC 2DZIA 1PGAA 3AE7B 3GE3C 2KHWB 1JWMD 1V80A 3KUZA 4I6NB 3AE9B 3P1MA 3UQBA 4N6EB 4IWPA 1TS5A 2D5GA 3HM6X 1ZW7A 3BK2A 2KJRA 4P6VF 2HTHA 4FLHA 3MTNB 4GGQA 1XO3A 3OG5A 4E3CA 2IO0B 5AUIA 2LUMA 2KDEB 3TL5A 2JQRB 4G3XB 3L16A 1WR1A 4M8MA 4YTNB 3CMMB 3RCZA 2BS3B 5C23A 2QDFA 3KLSX 2E3TA 3APFA 3OAWA 1SGHA 3DHGC 2AL3A 5EE0A 3UQAA 2HJ1A 4RF1A 4G0NB 1EUVB 2IY1B 3GB1A 2QJLA 3MFGA 3RMKC 1VRAB 3P4RB 2WXGA 4LNFA 1Q5WB 3H7PB 2JYTA 1I42A 4MDKE 5AZHA 3MC8A 2OJRA 3BVZA 2QCZA 3MJWA 3WALA 3ENEA 1E6EB 4ZRJA 1STEA 2BTEA 2KC1A 2KXJA 4NZLB 4FADA 2WXNA 1GJZA 2B3AA 2ZCBA 2AL6A 2K1FA 2PE9A 2MP2B 2IO1B 1UWMA 4DXFA 2BYVE 1I4PA 3IHPC 3Q14C 2ZVOA 4TSSA 4I6LB 2KN5A 1K52A 4HVBA 4N58A 2GBJA 3NG0A 3DHHC 4WWNA 3ZNID 4MJSA 3X0WA 3GOEA 4K7SA 1VLBA 3IG3A 1VZ6A 2KQ7A 4HJGE 4B0MA 3RNBC 2OEDA 2FCMA 1XT9B 3HM3A 2WU5B 2KVRA 2O6VD 2G9HD 3L17A 1UBIA 3Q69A 4GU2A 2JX5A 1PDXA 2DBYA 2KJHB 1WYWB 3VR9B 4C00A 4WQMA 2IZVB 2LEKA 4DXAB 1ACCA 2KX0A 2ZNVC 3VTUA 2K25A 4DDID 3ALBA 3Q8BA 4GSWA 3ZQ4A 3ZO5B 1F9JA 5CHWA 2FIDA 1RAXA 2CJOA 1WRDB 1NYRA 5IN7A 2GBNA 3N9YC 4LNOA 2KT7A 3SHQA 4AJWA 3DBLB 5HFYA 2BWFA 3PVLA 3I63C 1YNTE 2D11A 1TZOA 4ZHPA 1TKEA 3PHWB 3KQ4A 5BMHA 4YSYB 1IGCA 4US9A 4B6WA 3ZW3A 3WANA 4E71A 1TY2A 3APDA 4TV3A 1S1QB 4LNKA 2A4ZA 1WJNA 1HA5A 4YTMB 2LVOA 3A9JB 1V97A 4PYZA 2L7RA 1YJ1A 5IP4D 1XCQL 3AEBB 4B9KA 1P98A 3ZRCA 2B76B 1F77A 1L0VB 2XK5A 2DYMA 1F0ZA 1FXIA 3NJTA 3B2FA 2BYFA 2HD5B 2Z8LA 1YJIA 2CJNA 1J19A 3BY4B 3S2AA 2CR5A 4BFRA 3NVVA 2QIEB 1QILA 5E6JA 1ZGUB 2Y3AA 1TYGB 3VTVA 1M4VA 4OW0A 4HPMB 4KZCA 5AUKA 3ABVB 1XQQA 1ZUD2 2NMQA 2WDTB 2BVCA 1YQBA 4GB9A 3H9DA 5D6JB 2V4LA 3QK0A 2KZRA 1R4MI 1E8WA 3V3XA 4EKUA 1JRUA 2PTLA 3IT6B 3Q3JA 1YJJA 3VQIA 2UU7A 3H7PA 2QILA 4RFBA 4USAA 2EKIA 1DOYA 4GOCA 2GBRA 2IGHA 1R4MB 2LFIA 1EU4A 3MHSD 4KGSA 2DWQA 3ZXRA 4GDKA 1ENFA 4KIKA 1J0GA 2BF8B 3U7ZA 3BYTB 3KYCD 3GZNI 1UBQA 5DPRA 3VRAB 3RNAC 3N30A 1Z2MA 3ZUNA 4RM9A 2LHEA 4AP4C 2N1VA 2BGFA 5BMIA 2W3SA 3N20C 1IUEA 1TS2A 1OQQA 4FXCA 2D2QA 3RD2A 4HLEA 1YX6B 3BYYB 3TCAA 4BZAA 4OVUA 3VUYA 1AARA 3L10B 3GZNB 1SE2A 3P4PB 3R2IA 2HTME 2M0XA 5D94A 3APCA 3ZYYX 3B0AA 2H89B 4XDDA 3W5VB 4XX5A 2WYQA 2DZMA 5EE1A 1HQRD 2W82A 3TEWA 1TIFA 2WXOA 2PLPA 5AZGA 2XEWA 4BBNF 5TSSA 2LXAA 3W1SC 2LI5A 4A20A 4JPSA 4YSXB 2LRWA 2BB6A 2KMCA 4JWUC 5LXIB 1LO5D 4KKJA 4NQLB 4DQOC 4ZOHC 2GLSA 2ON8A 3AV8A 1J7AA 4EFOA 1V49A 1NYQA 5I4DA 2LGDA 1WM3A 3BWUD 1YQ3B 1OTRB 2A5UA 2LVPA 4KKIA 4W9JA 3ZJTA 3AB5A 3NZSA 2J0JA 2VZKB 1F2RI 2BYEA 4J3OD 2N9LA 4DDGD 3RFZB 1E8XA 2Z0DB 3W2DA 3GE8C 3C8YA 3URYA 3GS2A 1Q1OA 1KOTA 1ROEA 1TZ1A 4EE2A 4G50A 3U2SC 3V61A 3MC9A 4HPPA 5BYRA 3DWMA 5D7GA 4HCNB 1D6EC 3DVGY 1OEYJ 1QZEA 2BKRB 1WZ3A 1IYFA 3UINB 2LWPA 4R3DA 1A5RA 3A9JA 3VR8B 1EWYC 4PS8A 1ZE3D 3T3OA 4M00A 1OFFA 2DLBA 4IM3A 3EC8A 2LHDA 2J52A 4M0WB 1T0YA 4FN2A 3I9V1 2NVUI 5BYQA 4RMAA 3PV1A 1L6VA 2ZZPB 2C7HA 4IDIA 4HRSA 3VTWA 4ZYNA 3ZLZA 1T6BX 4RGTA 1OGWA 4EZKA 1Z5SB 4L2YA 1AWDA 1FNUA 3SEBA 3LJ3A 5FR3A 4GN1A 3AXCA 3QWZB 3NUHB 1HZ6A 1GC6A 4WWOA 3AE1B 3WCQA 1D4BA 2YVCA 5DPTA 5IOIA 2FCSA 2IO2B 2PIAA 4W9FA 5LLIA 1SE3A 3RZWC 3N1YC 3FC4A 1MHHE 1DGJA 1N60A 3ZJUA 2IYDB 1P0RA 3KYDD 4BOZB 2WXPA 3U4EG 4Q2JA 1PGXA 3EECA 4LNNA 2AEHA 3M63B 1FFVA 1E7PB 2R61A 3AULA 4LCDE 2WDQB 2MBOA 4TQ1A 5G5GA 4AUQC 2QMTA 4NY0A 2RPVA 1VZ7A 1YN3A 4J6IA 2K9XA 2YEPF 2JZZA 3MJ5A 1TS3A 1KM7A 1SIJA 1WJUA 2D3CA 1BT0A 1IPGA 1A70A 2FCNA 2CKHB 2LMCA 4W9HA 2IGDA 3RNCC 1D5ZC 3PRPB 1P7EA 1RFKA 1YD8U 2AQ3B 1SJED 4MM3B 1C77A 2D10A 4MGYE 5BMGA 1SEBD 3IT4B 1BUIC 3Q8AA 4IOIE 1JALA 3HVZA 4K7UA 2LJIA 3DDCB 1TGZB 3I5JC 5EDSA 2VRRB 1GAQB 2BQQA 2GMIC 2MH7A 4E74A 4LLGM 2LRUA 1SSNA 5IO9A 2MSED 1UELA 3AU5A 4XDCA 1CZPA 2NTTA 1V1PB 3NOBA 4C56C 1V86A 2HJ8A 2RDBC 3A4RA 2TSSA 1FO4A 3DPDA 4AS1A 3Q8EA 4HROA 3AEGB 2IDYA 2KX3A 3DBHI 4RM8A 1H8CA 3TEYA 5H92C 1QT9A 4NAWB 2WDRB 2V3PA 3AE2B 5T8IA 1HXYD 2GI9A 3FKYA 4YXDB 3CSFA 5HHDG 3NY5A 4II3B 2OOBB 4F1SA 2SAKA 1V1OA 1FD6A 1WGGA 1R7SA 2O2VB 1WE6A 4YL8A 5KHOA 4P1CC 2JF5A 2Y5BB 2MEKA 1VDVA 4MEMA 2PPHA 1QOGA 4G11A 2W3RA 4K7WA 2MBHA 4K3BA 4HK2A 4IUMB 2AYOB 2KKCA 2W55A 1N5WA 3R2TA 4MH0E 3T3NA 1I4HA 2JRIB 1JWAD 3PTFC 1HZ5A 4UDUC 3UI3A 3P4QB 4BKSA 2G4DB 4NJ6A 1IGDA 5KHQA 4IWQA 3PRZA 2AX5A 2RDHA 2UWQA 2ASQA 1V5OA 3A1QB 4CHKA 2K6DB 3N3KB 2KN4A 3PGEA 4XE0A 2FBWB 4TQ0A 2CHXA 4XYCA 3QARA 4HXDA 3TSSA 2JT4B 2QHOA 2KWDA 2IGGA 2KFKB 1I35A 1NI3A 2ZW0A 1U4AA 1JWBD 1WGDA 3RPFC 3SR6A 5LNK1 4KZ0A 4BBNC 2J0MA 3N32A 4KGRA 3V6EB 5G2NA 4DHZE 1SE9A 1UUPA 3EFCA 2KTRB 3AE3B 1MG4A 1WX8A 2FCQA 2HE7A 3BVMA 4DHZB 2XN9C 1TKYA 1J7CA 2JPHA 3L0WB 4M02A 2SEBD 1JWSD 3FAHA 2OJWA 3AE4B 2BPSA 2CU1A 3DVNU 4F8CB 2IPKD 3VUWA 5C2TB 1MI0A 1WF9A 4OZCA 1J7BA 1D3ZA 4RH6A 1WMHA 1MHXA 1TTNA 4S0RA 1E90A 4OZAA 2KANA 4GLSC 4ZRQA 2JZPA 1N62A 5AEKB 3CSTA 3R7QA 2KNBA 4BAXA 1WY8A 2G4SA 3NS1A 3L08A 4KVGB 2MX2A 3PT2B 2KDBA 2ZVNA 2DYOA 2KJ6A 1L0XB 3CIRB 4NNJB 4MM3A 4W9GA 3JW0X 3PLUA 2LASA 3RI7C 3ZGZA 4C4VB 4KGTA 2J7QB 2LVQA 2W9NA 1UH6A 3I3TB 2O6VB 1D5MC 5H8YE 3WAPA 2GB1A 4W9DA 3A33B 3RNFC 2JZ3B 3RUIB 3KWVA 5AZFA 2WU2B 2I1KA 3ZKJC 2KDMA 3NRZA 4BKGA 2WXRA 3DWGC 1TJEA 3RNEC 2WX1A 3DVNV 2KMAA 4RGMA 1VZ8A 4FHKA 3M3JA 3WA0A 1C78A 1WGHA 2K8CA 1QOBA 4MSMB 2MJ3A 2Q5WD 3V62A 4A8XC 3SD5A 1IBXB 4WURA 1LM8B 2M8SA 2N0SB 2DZKA 2O2VA 2NPTB 2WWZA 4L1BA 5FK9C 1LQBA 1WH3A 3H1UA 3AH7A 3U7DA 4RGOS 4WWMA 4MACA 1WFYA 4OZBA 1ISNA 1Y56A 3ONSA 1UF0A 2INCC 2GBKA 3E56A 2KACA 4DXGA 2KDFB 3Q8FA 1V81A 1B1ZA 2I2YA 1GC7A 3ML8A 2PE6B 2DZJA 4M8NA 4JL9A 3PHXB 4FJZA 1SB3C 3A1QA 4LTUA 4NAMA 3B08A 2L0TA 1NI2A 1TT5B 4I6PA 1EF5A 2JSVX 4RCOA 1XD3B 2MP2A 2I38A 1YIWA 1TKGA 2BW2A 4B0EA 1FNVA 2KFKA 4JE3B 3V05A 2JVCA 2H88B 2V1YA 2RR9A 3AU4A 4MGIE 1OEYA 1QOAA 5L95C 1CMXB 2K8BA 2RGFA 3DBSA 3IFWB 1C4AA 1WI0A 2KWCA 2JYEA 2N7EA 2KFJA 3E9SA 3TEZA 2PMVA 1K50A 4ACFA 3EA6A 3P4SB 4TKNA 1KRHA 2MA9B 2RSUA 3X23A 3K9OB 1WXSA 1MPEA 4JWSC 4LDTD 2LXCA 1R4NI 2BWES 4TUUA 4C7YA 1MVKA 5DPSA 3C19A 4W9LA 1C76A 3NS8A 1NDDA 2WXIA 4IW0A 3FILB 2R2QA 3D32A 2D07B 4FJVB 1WJ4A 1SJHD 1R4NB 3A9KB 1FNWA 2FUG1 1DYQA 1V2YA 2DAFA 2M4NA 2LGXA 1C3TA 1LFDA 1WGKA 3AEDB 2N1WA 3RT3B 3PS6A 3M95A 2GOWA 3VFKA 3W1SA 3V6CB 3TUOA 3H7SA 1XLPA 3RN9C 1P1AA 4BKSD 5HI1A 3PZ7A 4FHJA 2O6VA 1SIFA 4KDLB 2L1AA 5JH5C 2KWVB 2KTFA 1HEZE 4CO7A 4XGAB 1RRBA 4HEA1 1RYJA 2CHZA 4EEWA 3AEAB 1ZP0B 1PFDA 5E6PA 3L54A 4LJPB 5C1ZA 1I4QA 5E6NA 1NENB 3ZJVA 2MJEA 2OHFA 2MQJA 1LGRA 1SF0A 3UF8A 4WQOB 4PK1A 1JQ4A 1C4PA 1C1YB 1E8YA 3PRMB 1FCCC 4A3OA 2Z0EB 2BKFA 2DX5B 1MG8A 3EFUA 1UNSA 3IVFA 1B9RA 4HKZE 2KLGA 1IBXA 1EU3A 2LZ6A 3TIXA 3OWEB 1TY0A 4ZRPA 2EMTA 1N61A 4ANWA 1UZXB 3U52E 2M56B 1I4XA 1K8RB 1NVID 2PW9A 1YN5A 2RDGA 2KDIA 2ZCCA 1JW9D 2C7NB 3QJZA 1FCLA 4MGZE 1UGJA 4II2B 2MRPA 2KD0A 3CF6E 2MHJA 3EHVA 2FE8A 4DHJD 4FBJB 1N6ZA 2DAJA 1BMLC 4JQWC 2J4XA 3TBLD 1ESFA 4IC7B 3JSVB 4MSQB 4MJSB 4BOSC 1VJKA 4ARIA 1QF6A 2LGYA 2FUHB 1UWXA 4CYEA 1P3QU 4KDIC 4HPLB 4MGKE 2I1JA 2KVZA 2C60A 2WS3B 1G6JA 1FRRA 3UGBB 3DHIC 4PT5A 2ZW1A 3AI5A 4NQKE 1S3SG 2LJ5A 4P7IA 3OJ4B 3VUXA 2AQ1B 2MJDA 4W9EA 4YT0B 4XWTA 1FFUA 2KOXA 1AYFA 4AOFA 1HTQA 2L52A 1YN4A 2ACZB 1OQYA 2L8JA 2PVGC 1MFWA 3Q6BA 3IAM1 3R7RA 3RZFA 1WE7A 3P42A 3H6NA 5D3DA 1PQSA 2J53A 4P16A 1HTOA 2DYBA 3ZVVA 2WXMA 3SDLC 3DVGX 2ZNVB 1ZOYB 3AM9A 3P2BA 4XWWA 1C9FA 2RD0A 3UIOB 3VH3B 4F7ZA 4JLCA 1FXAA 2N4FA 1V9JA 2JU6X 3PREA 3FILA 1NEKB 1L7YA 2FAZA 3OJ3A 3LB8C 3TEXA 2N9EB 2MBEA 5TR5A 3ZDMC 2QC8A 1PUTA 2YLMA 1ET6A 3O13A 4KSKC 1YMHE 5JXVA 2LGIA 3K9PB 1L6UA 1ZDXA 3IAS1 2X8XX 2GRIA 3DBHB 3HVDA 4A9AA 4FA6A 1UD7A 2WXJA 2XK5B 4ZRIA 4DWFA 1XLQA 4XZ4A 4A55A 4WAAA 4EOYA 2K22A 2K0PA 4AWJA 3Q3NC 2NBVB 1YQ4B 1CK1A 1KH0A 3KH0A 4MELA 4LNIA 3JVZX 1V8CA 5FR6A 3Q8CA 1XCTL 1Y8RC 4IWOA 4ITKA 2KWUB 1FMAD 3UIPB 5BYSA 2AWTA 5CTRC 1EM7A 3AN1A 5EE3A 5G5HA 2K6QA 2ZJDA 4M0WA 2JUOA 3T9LA 2EELA 2IJ0A 1DOIA 3ML9A 1WXVA 4BKTA 4FJYA 4P1BC 2N9KA 2M19A 1FIQA 3U8ZA 4C80A 1TS4A 3ZRFA 3HK0A 1ZPSA 3CWIA 1FM0D 4EZJA 2ZPYA 4ZDVA 5E6OA 1FEHA 1WGYA 1WXAA 1WGRA 3HHMA 5CHVC 2PVOD 2LD9A 4EUTA 1WM2A 1XF5L 5DPWA 2LUEA 4GDKB 4KIKB 1EWCA 3ZNHB 1I4GA 2QEJC 4XC2A 5IAAC 1KLUD 2N9XA 2IBIB 4GMVA 4N9F4 2BS4B 1KTKA 3N1ZC 2V0GA 3C0RB 1AN8A 5BO4B 3VXWA 1V6EA 4URKA 1F1HA 2YEPB 2D3GA 2FNJB 4ASWC 4X57B 4NPNA 2ONQA 3JSVA 4RNAA 4L23A 3LYYA 4EZLA 3NZ3A 2XBBC 1WR6E 3N1XC 2AQ2B 4BVUC 1WX7A 2CHWA 2JWUA 3W1YA 2G45B 1WWTA 3PLVA 1QKZA 2BT6A 4PYUA 3P63A 2V9HA 3A4SC 3MP9A 3EUB2 1VD2A 3ECIA 4W9CA 4W9IA 4ZYSA 3ZTCA 3LDZE 1JWUD 3KVFB 3PSEB 3TMPB 1N5XA 3VAWA 4OVZA 2GBMA 3LXFA 3VHTC 2FIFA 3DBLI 3NHEB 5J18A 2MBQA 1N63A 2ICIA 4N59A 1GUAB 1L5PA 3U30A 4A90A 1GG3A 2MWSB 4K1RB 4W9KA 5DCNA 5FKAC 4CQNA 4WIPA 4GIVA 1ZKHA 5IA7A 4PS3A 2IY0B 2JWZA 3DBRI 3MC0B 4LJOB 4GXBA 4QAYA 1V1PA 2BB5A 4AJYB
chains in the Genus database with same CATH topology
1QQRA 3EGRA 5EE0A 4LK0M 1MPEA 1KF6B 4JWSC 4RF1A 2PIAA 2WXLA 1SE3A 3GB1A 2QJLA 3FC4A 1MHHE 1DGJA 1N60A 3MFGA 3ZJUA 1VRAB 4A6QA 3P4RB 2WXGA 4C7YA 1MVKA 1C76A 2JYTA 1CJEA 2WXPA 2L83A 3U4EG 4Q2JA 3BVZA 1PGXA 2WXIA 1FFVA 2JXTA 1E7PB 3FILB 1E6EB 2R61A 1ZXHA 1STEA 3BIID 5GXGB 2INPE 2E6XA 2WDQB 2BTEA 2WQYB 1SJHD 3PZ8A 3AMZA 2V3NA 3BK1A 4NZLB 5D3IB 4TQ1A 1FNWA 2FUG1 1DYQA 2RMMA 5G5GA 2WXNA 2QMTA 4RF0A 2RPVA 1VZ7A 1YN3A 1WGKA 2K9XA 2K5PA 3AEDB 3NVYA 2YEPF 3MJ5A 1TS3A 1FRDA 3W1SA 1SIJA 3MHZA 3TUOA 1UWMA 4DXFA 1XLPA 5MPOA 1I4PA 1A70A 5HI1A 2LMCA 3PZ7A 4TSSA 2BS2B 2IGDA 3HUIA 1K52A 1WRIA 1D5ZC 2N7JA 1L4DB 2L1AA 4N58A 1P7EA 1RFKA 2AQ3B 1GB4A 1SJED 1HEZE 4MM3B 1C77A 3SFDB 4HEA1 5BMGA 1SEBD 3IT4B 1BUIC 3Q8AA 4IOIE 1VLBA 1JALA 3B9JA 3KWLA 1RYJA 3HVZA 4D2KA 2LJIA 1VZ6A 1ET9A 2KAJA 1GAQB 2MH7A 3AEAB 4HJGE 4LLGM 1SSNA 1ZP0B 1PFDA 2WNMA 4B0MA 1XLOA 4XDCA 1I4QA 4GDLB 4TMAB 1CZPA 2NTTA 1NENB 2OEDA 1V1PB 3IXSA 4C56C 2WU5B 3ZJVA 2MJEA 2G9HD 2TSSA 1FO4A 2OHFA 1SF0A 3Q69A 4AS1A 1C4PA 3Q8EA 1JQ4A 4HROA 3AEGB 2IDYA 2JX5A 1PDXA 2DBYA 2L32A 1FCCC 1Q10A 1XLNA 3TEYA 3VR9B 2KQ4X 4WQMA 5H92C 1B9RA 1UNSA 2LEKA 5EE9A 2WDVB 1ACCA 4HKZE 1QT9A 4NAWB 2WDRB 4H2AA 2V3PA 3AE2B 1IBXA 3Q8BA 1EU3A 3OWEB 3ZQ4A 1TY0A 2W54A 4ZRPA 5T8IA 1KLGD 1N61A 1HXYD 2GI9A 1E0ZA 4YXDB 2CJOA 3U52E 5HHDG 2M56B 1I4XA 1NYRA 2K3UA 1NVID 3N9YC 2SAKA 2PW9A 1V1OA 1YN5A 2RDGA 3H8HA 2WXQA 1JW9D 5HFYA 1FD6A 1R7SA 1FCLA 1PGBA 1UGJA 1YNTE 3NVWA 4RGNA 1TZOA 2VZKD 2MEKA 4ZHPA 3SFEB 1TKEA 3KQ4A 1T5XD 1VDVA 5BMHA 4YSYB 1IGCA 2FE8A 3AECB 4US9A 1QOGA 3BVGA 2W3RA 1BMLC 2J4XA 1TY2A 1ESFA 2X38A 1E10A 3L4PA 2W55A 4WH4A 3AE5B 1VJKA 1HA5A 1N5WA 3R2TA 3T3NA 1I4HA 4ARIA 1QF6A 1JWAD 4YTMB 1UWXA 1HZ5A 1XEEA 4UDUC 3UI3A 1V97A 3P4QB 1JROA 4MH8A 2WS3B 1FRRA 1XCQL 3AEBB 4REZA 2B76B 1IGDA 4PT5A 1F77A 2ZW1A 1L0VB 2AX5A 2RDHA 2QSDA 2DYMA 1F0ZA 1FXIA 2AQ1B 2MJDA 4KX6B 5HG2A 4US8A 3I57A 2KN4A 3B2FA 2CU3A 2Z8LA 1YJIA 4XE0A 4YT0B 2FBWB 4XWTA 1FFUA 4TQ0A 1AYFA 2CJNA 3TSSA 2L52A 4C7ZA 2KWDA 3NVVA 1YN4A 1QILA 2IGGA 2QIEB 2WP9B 5E6JA 1NI3A 2ACZB 2ZW0A 2XNAC 2Y3AA 1TYGB 1JWBD 1M4VA 2WLBA 3RPFC 4OW0A 2PVGC 3SR6A 5LNK1 4WAFA 3IAM1 3ABVB 5AUKA 4ZHOA 1ZUD2 1WSPA 2NMQA 1OQRA 3P42A 4KGRA 5D3DA 2J53A 4P16A 1UUPA 2WXMA 3V3XA 3AE3B 3BVMA 1GOZA 2PTLA 3IT6B 2HDEA 2XN9C 1TKYA 1J7CA 2SEBD 1ZOYB 3AM9A 1JWSD 3FAHA 4XWWA 3AE4B 1RWSA 1SXTA 1C9FA 3GP7A 2V4IB 3HRDD 1YJJA 3VQIA 2IPKD 3AEFB 1FXAA 2QILA 4RFBA 4USAA 5C2TB 1MI0A 2EKIA 1DOYA 4YWGG 2JU6X 2IGHA 2LFIA 1NEKB 3FILA 4OZCA 1J7BA 1EU4A 3PO0A 4KGSA 1QOFA 3LB8C 4RH6A 1GB1A 2DWQA 3TEXA 1MHXA 1ENFA 1ZXIA 4OZAA 1PUTA 4GLSC 1AW7A 3U7ZA 2PKOA 3BYTB 1ET6A 3VRAB 3O13A 2INNE 1YMHE 4ZRQA 5JXVA 2JZPA 2LGIA 1N62A 1L6UA 1D5XC 1ZDXA 3IAS1 3NVZA 4YTPB 2GRIA 1DOXA 2LHEA 3HVDA 3NS1A 4A9AA 2WXJA 3W9CB 5BMIA 2W3SA 2WXHA 1XLQA 1IUEA 1TS2A 1OQQA 4FXCA 2DYOA 4A55A 2K22A 2K0PA 4YSZB 3BYYB 1YQ4B 1CK1A 4HKQA 4IKGA 1KH0A 3ETRA 1L0XB 2WXKA 1SE2A 3CIRB 1BXTA 3P4PB 3R2IA 2HTME 1V8CA 3Q8CA 3ZYYX 4MT5A 1XCTL 3AE8B 3ZGZA 2H89B 4ITKA 4XDDA 1FMAD 5BYSA 4KGTA 3W5VB 1EM7A 3AN1A 1D5MC 1PYWD 1L4ZB 5EE3A 5H8YE 1JRPA 1K51A 5EE1A 5G5HA 2GB1A 4M0WA 1HQRD 2W82A 3TEWA 5C3JB 1JCKB 2WXOA 2EELA 2PLPA 1VR9A 2IJ0A 5TSSA 1DOIA 4JPSA 4YSXB 1L0YB 3KWVA 2Y5CA 4NJCA 2WU2B 3B2GA 2BB6A 4ARCA 2N9KA 2M19A 2KDMA 1FIQA 4JWUC 4C80A 1TS4A 3NRZA 1LO5D 2M0AA 4KKJA 1ZPSA 3CWIA 1FM0D 2KMMA 2WXRA 1TJEA 3DWGC 4ZOHC 4DQOC 4JX1C 2G1EA 1FEHA 2ON8A 3AV8A 1J7AA 1C79A 1NYQA 5I4DA 1P7FA 1K53A 2PVOD 4RGMA 1GPXA 3BWUD 1YQ3B 1VZ8A 4KKIA 3R8BA 1JMLA 1XF5L 4GDKB 1C78A 1WYGA 3ZJTA 1SE4A 1EWCA 3AB5A 1QOBA 4AQ7A 1I4GA 2MJ3A 2QEJC 1KFYB 2VZKB 1KLUD 1F2RI 2Q5WD 4A8XC 1I7HA 1IBXB 4WURA 4J3OD 2N9LA 3BZDB 2N0SB 4L1BA 5FK9C 3RFZB 1T3QA 2BS4B 1KTKA 3J9CA 1QLBB 3W2DA 3AH7A 3C8YA 3URYA 3GS2A 2V0GA 1AN8A 4O1NA 1RM6C 4RGOS 4WWMA 1ROEA 4MACA 4EE2A 1E9MA 1XXGA 3U2SC 4OZBA 1C4CA 2BBCA 5BYRA 1Y56A 3W5UB 2J42A 2YEPB 3DWMA 5D7GA 1CQVA 1D6EC 3VRBB 3E56A 2KACA 4DXGA 2ONQA 4RNAA 3Q8FA 1SBBB 4L23A 2BYTA 2NTSA 4OHJA 3LYYA 1B1ZA 2I2YA 1ZDVA 4R3DA 3NZ3A 2AQ2B 3VR8B 1WXQA 2JWUA 2WXFA 2Y5PA 3AE6B 1EWYC 1WWTA 1ZE3D 1I4RA 3AEEB 3T3OA 2DLBA 1OFFA 1QKZA 2BT6A 3P63A 2LHDA 2J52A 1SB3C 3MP9A 3EUB2 4LTUA 4NAMA 1F2RC 3I9V1 4ZYSA 1PGAA 2JSVX 3AE7B 5BYQA 4RCOA 1JWMD 1JWUD 1L6VA 3AE9B 2I38A 1TKGA 2BW2A 3P1MA 4B0EA 1FNVA 4N6EB 1TS5A 2D5GA 4IDIA 1N5XA 4JE3B 3V05A 3BK2A 4OVZA 3LXFA 4HRSA 2H88B 4P6VF 1T6BX 4RGTA 1XO3A 1QOAA 1N63A 2ICIA 5AUIA 4L2YA 4N59A 2LUMA 1L5PA 2JQRB 1AWDA 4A90A 1FNUA 3SEBA 5FR3A 1C4AA 5FKAC 4CQNA 2JYEA 4YTNB 4WIPA 3E9SA 2BS3B 3NUHB 1HZ6A 3TEZA 2PMVA 1K50A 3MC0B 3EA6A 3KLSX 2E3TA 1V1PA 2BB5A 3P4SB 3AE1B 1KRHA 3WCQA 1D4BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5G A;  1WSP A;  3PZ7 A;  4WIP A;  3PZ8 A; 
#chains in the Genus database with same CATH topology
 1QQR A;  3EGR A;  4LK0 M;  3Q3F A;  2IO3 B;  3SU8 X;  1KF6 B;  4HDO A;  2D3B A;  2WXL A;  4JIO U;  4ANX A;  4HJK A;  3RUL A;  4A6Q A;  2KYW A;  4NAW A;  3DBR B;  3VVW B;  1CJE A;  2L83 A;  1WXM A;  2D3A A;  1FXT B;  2JXT A;  1ZXH A;  3BII D;  5GXG B;  2INP E;  2E6X A;  2WQY B;  3PZ8 A;  3AMZ A;  2V3N A;  3BK1 A;  5D3I B;  1E7V A;  2C7M B;  2G3Q B;  3WAO A;  5JHB A;  2RMM A;  4RF0 A;  5CHF A;  3Q3O C;  2K5P A;  3NVY A;  3DOW A;  1NBF C;  2J0K A;  2K39 A;  1FRD A;  1F52 A;  2JXX A;  3MHZ A;  3WIM A;  5MPO A;  3KW5 B;  3R3M A;  3RYT A;  2BS2 B;  3HUI A;  1WRI A;  2N7J A;  1L4D B;  3BIN A;  2WGS A;  4JGH B;  3ZIM A;  1GB4 A;  1P9D U;  2C5L C;  3KUD B;  2MCN B;  2L0F A;  3SFD B;  3KWL A;  3B9J A;  4D2K A;  3ZDT A;  1H4R A;  2PJH A;  1ET9 A;  2KAJ A;  2MBB B;  2WNM A;  5G55 A;  1XLO A;  4GDL B;  4TMA B;  3IXS A;  1M94 A;  3NZU A;  3DQV A;  5IKC M;  1UGM A;  1MJD A;  1WIA A;  3QA8 A;  2L76 A;  3R66 C;  2L32 A;  2V3S A;  2DNF A;  3QIJ A;  1Q10 A;  1XLN A;  2L00 B;  2KQ4 X;  1IP9 A;  4HWI B;  2EKE C;  2WDV B;  5EE9 A;  4H2A A;  2UYZ B;  2N7D A;  2VH2 A;  2W54 A;  3M62 B;  1KLG D;  1E0Z A;  3PZD A;  3RNG C;  2K3U A;  2KTR A;  3H8H A;  2WXQ A;  4M01 A;  5GMV A;  1PGB A;  3NVW A;  4RGN A;  1E7U A;  2VZK D;  3SFE B;  2NBU A;  1T5X D;  2JY6 A;  3AEC B;  2L05 A;  3BVG A;  4S17 A;  4HDQ A;  3IBE A;  2NS5 A;  4PS7 A;  5LXH A;  5L83 A;  5J17 A;  1YX5 B;  2X38 A;  3QX1 A;  1E10 A;  3L4P A;  4WH4 A;  3AE5 B;  3ZTD A;  1XEE A;  1JRO A;  4HCP B;  4MH8 A;  5JZE B;  3B1L X;  4REZ A;  4DBG A;  2C9W B;  2MW5 A;  5CX3 A;  1T0R C;  2QSD A;  2M1M A;  2KLC A;  3QAQ A;  5J2R A;  4KX6 B;  1EO6 A;  5HG2 A;  4US8 A;  3I57 A;  3QCA A;  2CU3 A;  1E8Z A;  2IND C;  1WX9 A;  2REX A;  4C7Z A;  4WJN A;  2WP9 B;  4C4V A;  3Q2A C;  1T0S C;  2XNA C;  3QC8 B;  2LGS A;  2WLB A;  2PEA A;  4KV2 A;  4ICU A;  4WAF A;  3DCG A;  1LXD A;  2M17 A;  4ZHO A;  1E5W A;  3KUC B;  1WSP A;  4LDT B;  1OQR A;  1WJ6 A;  4IG7 B;  2KC2 A;  1GOZ A;  2HDE A;  2N9P C;  1WZ0 A;  2DEN B;  3OLM D;  1T0Q C;  2NBW B;  3PPA A;  1RWS A;  1SXT A;  3GP7 A;  2V4I B;  2WHI A;  3HRD D;  3AEF B;  2NCN A;  4K3C A;  4YWG G;  1Q0W B;  3PO0 A;  5D2M B;  4ANV A;  1QOF A;  1GB1 A;  1ZXI A;  1AW7 A;  2R2O A;  4NJ7 A;  2PKO A;  2INN E;  4ICV A;  3WAM A;  2NPT A;  3O65 B;  1GNU A;  1D5X C;  3NVZ A;  4YTP B;  1DOX A;  4WJO A;  3W9C B;  2WXH A;  2Z59 B;  4DK5 A;  4YSZ B;  4HKQ A;  4IKG A;  4ZRK A;  3ETR A;  2WXK A;  3VH4 B;  1BXT A;  3HIZ A;  2KO3 A;  1V5T A;  4MT5 A;  3AE8 B;  4WJP A;  2MLB A;  4B95 A;  3ZXV A;  1PYW D;  3QHT A;  1L4Z B;  3Q3M C;  1JRP A;  4GDL A;  1K51 A;  5C3J B;  1JCK B;  1TBE A;  5JHA A;  2NR2 A;  1VR9 A;  1KLV A;  2KQS A;  1L0Y B;  2Y5C A;  4NJC A;  3B2G A;  4ARC A;  4FUL A;  2DHZ A;  2L3Z A;  2M0A A;  1J8C A;  2KMM A;  1RFA A;  3TJP A;  4JX1 C;  2G1E A;  3VDZ A;  1C79 A;  1KJT A;  1YOV B;  1P7F A;  1K53 A;  1GPX A;  3R8B A;  1JML A;  1WMH B;  1WYG A;  1X1M A;  3L13 A;  1SE4 A;  4AQ7 A;  1KFY B;  2CS4 A;  4IM2 A;  2K8H A;  1I7H A;  4IM0 A;  1VCB A;  4K81 A;  3BZD B;  3QQ8 B;  4DHJ B;  1T3Q A;  1FPY A;  2VH1 A;  3J9C A;  3T8M A;  1QLB B;  2WX0 A;  4WJQ A;  4O1N A;  1RM6 C;  1L2N A;  1HE8 A;  1E9M A;  1XXG A;  1C4C A;  2KK8 A;  2BBC A;  3W5U B;  2J42 A;  1CQV A;  3VRB B;  2ZPN A;  2EMS A;  1SBB B;  2BYT A;  2NTS A;  2RPQ A;  4OHJ A;  3V60 A;  1ZDV A;  4KSL C;  5HKH A;  4WWP A;  2JRH A;  1WXQ A;  3AE6 B;  2WXF A;  2Y5P A;  1RLF A;  1I4R A;  3AEE B;  1EF1 A;  3A9K A;  3JYU A;  3ZNZ B;  4A3P A;  4OVV A;  2ZEQ A;  3ZNG C;  4ANU A;  1F2R C;  2DZI A;  1PGA A;  3AE7 B;  3GE3 C;  2KHW B;  1JWM D;  1V80 A;  3KUZ A;  4I6N B;  3AE9 B;  3P1M A;  3UQB A;  4N6E B;  4IWP A;  1TS5 A;  2D5G A;  3HM6 X;  1ZW7 A;  3BK2 A;  2KJR A;  4P6V F;  2HTH A;  4FLH A;  3MTN B;  4GGQ A;  1XO3 A;  3OG5 A;  4E3C A;  2IO0 B;  5AUI A;  2LUM A;  2KDE B;  3TL5 A;  2JQR B;  4G3X B;  3L16 A;  1WR1 A;  4M8M A;  4YTN B;  3CMM B;  3RCZ A;  2BS3 B;  5C23 A;  2QDF A;  3KLS X;  2E3T A;  3APF A;  3OAW A;  1SGH A;  3DHG C;  2AL3 A;  5EE0 A;  3UQA A;  2HJ1 A;  4RF1 A;  4G0N B;  1EUV B;  2IY1 B;  3GB1 A;  2QJL A;  3MFG A;  3RMK C;  1VRA B;  3P4R B;  2WXG A;  4LNF A;  1Q5W B;  3H7P B;  2JYT A;  1I42 A;  4MDK E;  5AZH A;  3MC8 A;  2OJR A;  3BVZ A;  2QCZ A;  3MJW A;  3WAL A;  3ENE A;  1E6E B;  4ZRJ A;  1STE A;  2BTE A;  2KC1 A;  2KXJ A;  4NZL B;  4FAD A;  2WXN A;  1GJZ A;  2B3A A;  2ZCB A;  2AL6 A;  2K1F A;  2PE9 A;  2MP2 B;  2IO1 B;  1UWM A;  4DXF A;  2BYV E;  1I4P A;  3IHP C;  3Q14 C;  2ZVO A;  4TSS A;  4I6L B;  2KN5 A;  1K52 A;  4HVB A;  4N58 A;  2GBJ A;  3NG0 A;  3DHH C;  4WWN A;  3ZNI D;  4MJS A;  3X0W A;  3GOE A;  4K7S A;  1VLB A;  3IG3 A;  1VZ6 A;  2KQ7 A;  4HJG E;  4B0M A;  3RNB C;  2OED A;  2FCM A;  1XT9 B;  3HM3 A;  2WU5 B;  2KVR A;  2O6V D;  2G9H D;  3L17 A;  1UBI A;  3Q69 A;  4GU2 A;  2JX5 A;  1PDX A;  2DBY A;  2KJH B;  1WYW B;  3VR9 B;  4C00 A;  4WQM A;  2IZV B;  2LEK A;  4DXA B;  1ACC A;  2KX0 A;  2ZNV C;  3VTU A;  2K25 A;  4DDI D;  3ALB A;  3Q8B A;  4GSW A;  3ZQ4 A;  3ZO5 B;  1F9J A;  5CHW A;  2FID A;  1RAX A;  2CJO A;  1WRD B;  1NYR A;  5IN7 A;  2GBN A;  3N9Y C;  4LNO A;  2KT7 A;  3SHQ A;  4AJW A;  3DBL B;  5HFY A;  2BWF A;  3PVL A;  3I63 C;  1YNT E;  2D11 A;  1TZO A;  4ZHP A;  1TKE A;  3PHW B;  3KQ4 A;  5BMH A;  4YSY B;  1IGC A;  4US9 A;  4B6W A;  3ZW3 A;  3WAN A;  4E71 A;  1TY2 A;  3APD A;  4TV3 A;  1S1Q B;  4LNK A;  2A4Z A;  1WJN A;  1HA5 A;  4YTM B;  2LVO A;  3A9J B;  1V97 A;  4PYZ A;  2L7R A;  1YJ1 A;  5IP4 D;  1XCQ L;  3AEB B;  4B9K A;  1P98 A;  3ZRC A;  2B76 B;  1F77 A;  1L0V B;  2XK5 A;  2DYM A;  1F0Z A;  1FXI A;  3NJT A;  3B2F A;  2BYF A;  2HD5 B;  2Z8L A;  1YJI A;  2CJN A;  1J19 A;  3BY4 B;  3S2A A;  2CR5 A;  4BFR A;  3NVV A;  2QIE B;  1QIL A;  5E6J A;  1ZGU B;  2Y3A A;  1TYG B;  3VTV A;  1M4V A;  4OW0 A;  4HPM B;  4KZC A;  5AUK A;  3ABV B;  1XQQ A;  1ZUD 2;  2NMQ A;  2WDT B;  2BVC A;  1YQB A;  4GB9 A;  3H9D A;  5D6J B;  2V4L A;  3QK0 A;  2KZR A;  1R4M I;  1E8W A;  3V3X A;  4EKU A;  1JRU A;  2PTL A;  3IT6 B;  3Q3J A;  1YJJ A;  3VQI A;  2UU7 A;  3H7P A;  2QIL A;  4RFB A;  4USA A;  2EKI A;  1DOY A;  4GOC A;  2GBR A;  2IGH A;  1R4M B;  2LFI A;  1EU4 A;  3MHS D;  4KGS A;  2DWQ A;  3ZXR A;  4GDK A;  1ENF A;  4KIK A;  1J0G A;  2BF8 B;  3U7Z A;  3BYT B;  3KYC D;  3GZN I;  1UBQ A;  5DPR A;  3VRA B;  3RNA C;  3N30 A;  1Z2M A;  3ZUN A;  4RM9 A;  2LHE A;  4AP4 C;  2N1V A;  2BGF A;  5BMI A;  2W3S A;  3N20 C;  1IUE A;  1TS2 A;  1OQQ A;  4FXC A;  2D2Q A;  3RD2 A;  4HLE A;  1YX6 B;  3BYY B;  3TCA A;  4BZA A;  4OVU A;  3VUY A;  1AAR A;  3L10 B;  3GZN B;  1SE2 A;  3P4P B;  3R2I A;  2HTM E;  2M0X A;  5D94 A;  3APC A;  3ZYY X;  3B0A A;  2H89 B;  4XDD A;  3W5V B;  4XX5 A;  2WYQ A;  2DZM A;  5EE1 A;  1HQR D;  2W82 A;  3TEW A;  1TIF A;  2WXO A;  2PLP A;  5AZG A;  2XEW A;  4BBN F;  5TSS A;  2LXA A;  3W1S C;  2LI5 A;  4A20 A;  4JPS A;  4YSX B;  2LRW A;  2BB6 A;  2KMC A;  4JWU C;  5LXI B;  1LO5 D;  4KKJ A;  4NQL B;  4DQO C;  4ZOH C;  2GLS A;  2ON8 A;  3AV8 A;  1J7A A;  4EFO A;  1V49 A;  1NYQ A;  5I4D A;  2LGD A;  1WM3 A;  3BWU D;  1YQ3 B;  1OTR B;  2A5U A;  2LVP A;  4KKI A;  4W9J A;  3ZJT A;  3AB5 A;  3NZS A;  2J0J A;  2VZK B;  1F2R I;  2BYE A;  4J3O D;  2N9L A;  4DDG D;  3RFZ B;  1E8X A;  2Z0D B;  3W2D A;  3GE8 C;  3C8Y A;  3URY A;  3GS2 A;  1Q1O A;  1KOT A;  1ROE A;  1TZ1 A;  4EE2 A;  4G50 A;  3U2S C;  3V61 A;  3MC9 A;  4HPP A;  5BYR A;  3DWM A;  5D7G A;  4HCN B;  1D6E C;  3DVG Y;  1OEY J;  1QZE A;  2BKR B;  1WZ3 A;  1IYF A;  3UIN B;  2LWP A;  4R3D A;  1A5R A;  3A9J A;  3VR8 B;  1EWY C;  4PS8 A;  1ZE3 D;  3T3O A;  4M00 A;  1OFF A;  2DLB A;  4IM3 A;  3EC8 A;  2LHD A;  2J52 A;  4M0W B;  1T0Y A;  4FN2 A;  3I9V 1;  2NVU I;  5BYQ A;  4RMA A;  3PV1 A;  1L6V A;  2ZZP B;  2C7H A;  4IDI A;  4HRS A;  3VTW A;  4ZYN A;  3ZLZ A;  1T6B X;  4RGT A;  1OGW A;  4EZK A;  1Z5S B;  4L2Y A;  1AWD A;  1FNU A;  3SEB A;  3LJ3 A;  5FR3 A;  4GN1 A;  3AXC A;  3QWZ B;  3NUH B;  1HZ6 A;  1GC6 A;  4WWO A;  3AE1 B;  3WCQ A;  1D4B A;  2YVC A;  5DPT A;  5IOI A;  2FCS A;  2IO2 B;  2PIA A;  4W9F A;  5LLI A;  1SE3 A;  3RZW C;  3N1Y C;  3FC4 A;  1MHH E;  1DGJ A;  1N60 A;  3ZJU A;  2IYD B;  1P0R A;  3KYD D;  4BOZ B;  2WXP A;  3U4E G;  4Q2J A;  1PGX A;  3EEC A;  4LNN A;  2AEH A;  3M63 B;  1FFV A;  1E7P B;  2R61 A;  3AUL A;  4LCD E;  2WDQ B;  2MBO A;  4TQ1 A;  5G5G A;  4AUQ C;  2QMT A;  4NY0 A;  2RPV A;  1VZ7 A;  1YN3 A;  4J6I A;  2K9X A;  2YEP F;  2JZZ A;  3MJ5 A;  1TS3 A;  1KM7 A;  1SIJ A;  1WJU A;  2D3C A;  1BT0 A;  1IPG A;  1A70 A;  2FCN A;  2CKH B;  2LMC A;  4W9H A;  2IGD A;  3RNC C;  1D5Z C;  3PRP B;  1P7E A;  1RFK A;  1YD8 U;  2AQ3 B;  1SJE D;  4MM3 B;  1C77 A;  2D10 A;  4MGY E;  5BMG A;  1SEB D;  3IT4 B;  1BUI C;  3Q8A A;  4IOI E;  1JAL A;  3HVZ A;  4K7U A;  2LJI A;  3DDC B;  1TGZ B;  3I5J C;  5EDS A;  2VRR B;  1GAQ B;  2BQQ A;  2GMI C;  2MH7 A;  4E74 A;  4LLG M;  2LRU A;  1SSN A;  5IO9 A;  2MSE D;  1UEL A;  3AU5 A;  4XDC A;  1CZP A;  2NTT A;  1V1P B;  3NOB A;  4C56 C;  1V86 A;  2HJ8 A;  2RDB C;  3A4R A;  2TSS A;  1FO4 A;  3DPD A;  4AS1 A;  3Q8E A;  4HRO A;  3AEG B;  2IDY A;  2KX3 A;  3DBH I;  4RM8 A;  1H8C A;  3TEY A;  5H92 C;  1QT9 A;  4NAW B;  2WDR B;  2V3P A;  3AE2 B;  5T8I A;  1HXY D;  2GI9 A;  3FKY A;  4YXD B;  3CSF A;  5HHD G;  3NY5 A;  4II3 B;  2OOB B;  4F1S A;  2SAK A;  1V1O A;  1FD6 A;  1WGG A;  1R7S A;  2O2V B;  1WE6 A;  4YL8 A;  5KHO A;  4P1C C;  2JF5 A;  2Y5B B;  2MEK A;  1VDV A;  4MEM A;  2PPH A;  1QOG A;  4G11 A;  2W3R A;  4K7W A;  2MBH A;  4K3B A;  4HK2 A;  4IUM B;  2AYO B;  2KKC A;  2W55 A;  1N5W A;  3R2T A;  4MH0 E;  3T3N A;  1I4H A;  2JRI B;  1JWA D;  3PTF C;  1HZ5 A;  4UDU C;  3UI3 A;  3P4Q B;  4BKS A;  2G4D B;  4NJ6 A;  1IGD A;  5KHQ A;  4IWQ A;  3PRZ A;  2AX5 A;  2RDH A;  2UWQ A;  2ASQ A;  1V5O A;  3A1Q B;  4CHK A;  2K6D B;  3N3K B;  2KN4 A;  3PGE A;  4XE0 A;  2FBW B;  4TQ0 A;  2CHX A;  4XYC A;  3QAR A;  4HXD A;  3TSS A;  2JT4 B;  2QHO A;  2KWD A;  2IGG A;  2KFK B;  1I35 A;  1NI3 A;  2ZW0 A;  1U4A A;  1JWB D;  1WGD A;  3RPF C;  3SR6 A;  5LNK 1;  4KZ0 A;  4BBN C;  2J0M A;  3N32 A;  4KGR A;  3V6E B;  5G2N A;  4DHZ E;  1SE9 A;  1UUP A;  3EFC A;  2KTR B;  3AE3 B;  1MG4 A;  1WX8 A;  2FCQ A;  2HE7 A;  3BVM A;  4DHZ B;  2XN9 C;  1TKY A;  1J7C A;  2JPH A;  3L0W B;  4M02 A;  2SEB D;  1JWS D;  3FAH A;  2OJW A;  3AE4 B;  2BPS A;  2CU1 A;  3DVN U;  4F8C B;  2IPK D;  3VUW A;  5C2T B;  1MI0 A;  1WF9 A;  4OZC A;  1J7B A;  1D3Z A;  4RH6 A;  1WMH A;  1MHX A;  1TTN A;  4S0R A;  1E90 A;  4OZA A;  2KAN A;  4GLS C;  4ZRQ A;  2JZP A;  1N62 A;  5AEK B;  3CST A;  3R7Q A;  2KNB A;  4BAX A;  1WY8 A;  2G4S A;  3NS1 A;  3L08 A;  4KVG B;  2MX2 A;  3PT2 B;  2KDB A;  2ZVN A;  2DYO A;  2KJ6 A;  1L0X B;  3CIR B;  4NNJ B;  4MM3 A;  4W9G A;  3JW0 X;  3PLU A;  2LAS A;  3RI7 C;  3ZGZ A;  4C4V B;  4KGT A;  2J7Q B;  2LVQ A;  2W9N A;  1UH6 A;  3I3T B;  2O6V B;  1D5M C;  5H8Y E;  3WAP A;  2GB1 A;  4W9D A;  3A33 B;  3RNF C;  2JZ3 B;  3RUI B;  3KWV A;  5AZF A;  2WU2 B;  2I1K A;  3ZKJ C;  2KDM A;  3NRZ A;  4BKG A;  2WXR A;  3DWG C;  1TJE A;  3RNE C;  2WX1 A;  3DVN V;  2KMA A;  4RGM A;  1VZ8 A;  4FHK A;  3M3J A;  3WA0 A;  1C78 A;  1WGH A;  2K8C A;  1QOB A;  4MSM B;  2MJ3 A;  2Q5W D;  3V62 A;  4A8X C;  3SD5 A;  1IBX B;  4WUR A;  1LM8 B;  2M8S A;  2N0S B;  2DZK A;  2O2V A;  2NPT B;  2WWZ A;  4L1B A;  5FK9 C;  1LQB A;  1WH3 A;  3H1U A;  3AH7 A;  3U7D A;  4RGO S;  4WWM A;  4MAC A;  1WFY A;  4OZB A;  1ISN A;  1Y56 A;  3ONS A;  1UF0 A;  2INC C;  2GBK A;  3E56 A;  2KAC A;  4DXG A;  2KDF B;  3Q8F A;  1V81 A;  1B1Z A;  2I2Y A;  1GC7 A;  3ML8 A;  2PE6 B;  2DZJ A;  4M8N A;  4JL9 A;  3PHX B;  4FJZ A;  1SB3 C;  3A1Q A;  4LTU A;  4NAM A;  3B08 A;  2L0T A;  1NI2 A;  1TT5 B;  4I6P A;  1EF5 A;  2JSV X;  4RCO A;  1XD3 B;  2MP2 A;  2I38 A;  1YIW A;  1TKG A;  2BW2 A;  4B0E A;  1FNV A;  2KFK A;  4JE3 B;  3V05 A;  2JVC A;  2H88 B;  2V1Y A;  2RR9 A;  3AU4 A;  4MGI E;  1OEY A;  1QOA A;  5L95 C;  1CMX B;  2K8B A;  2RGF A;  3DBS A;  3IFW B;  1C4A A;  1WI0 A;  2KWC A;  2JYE A;  2N7E A;  2KFJ A;  3E9S A;  3TEZ A;  2PMV A;  1K50 A;  4ACF A;  3EA6 A;  3P4S B;  4TKN A;  1KRH A;  2MA9 B;  2RSU A;  3X23 A;  3K9O B;  1WXS A;  1MPE A;  4JWS C;  4LDT D;  2LXC A;  1R4N I;  2BWE S;  4TUU A;  4C7Y A;  1MVK A;  5DPS A;  3C19 A;  4W9L A;  1C76 A;  3NS8 A;  1NDD A;  2WXI A;  4IW0 A;  3FIL B;  2R2Q A;  3D32 A;  2D07 B;  4FJV B;  1WJ4 A;  1SJH D;  1R4N B;  3A9K B;  1FNW A;  2FUG 1;  1DYQ A;  1V2Y A;  2DAF A;  2M4N A;  2LGX A;  1C3T A;  1LFD A;  1WGK A;  3AED B;  2N1W A;  3RT3 B;  3PS6 A;  3M95 A;  2GOW A;  3VFK A;  3W1S A;  3V6C B;  3TUO A;  3H7S A;  1XLP A;  3RN9 C;  1P1A A;  4BKS D;  5HI1 A;  3PZ7 A;  4FHJ A;  2O6V A;  1SIF A;  4KDL B;  2L1A A;  5JH5 C;  2KWV B;  2KTF A;  1HEZ E;  4CO7 A;  4XGA B;  1RRB A;  4HEA 1;  1RYJ A;  2CHZ A;  4EEW A;  3AEA B;  1ZP0 B;  1PFD A;  5E6P A;  3L54 A;  4LJP B;  5C1Z A;  1I4Q A;  5E6N A;  1NEN B;  3ZJV A;  2MJE A;  2OHF A;  2MQJ A;  1LGR A;  1SF0 A;  3UF8 A;  4WQO B;  4PK1 A;  1JQ4 A;  1C4P A;  1C1Y B;  1E8Y A;  3PRM B;  1FCC C;  4A3O A;  2Z0E B;  2BKF A;  2DX5 B;  1MG8 A;  3EFU A;  1UNS A;  3IVF A;  1B9R A;  4HKZ E;  2KLG A;  1IBX A;  1EU3 A;  2LZ6 A;  3TIX A;  3OWE B;  1TY0 A;  4ZRP A;  2EMT A;  1N61 A;  4ANW A;  1UZX B;  3U52 E;  2M56 B;  1I4X A;  1K8R B;  1NVI D;  2PW9 A;  1YN5 A;  2RDG A;  2KDI A;  2ZCC A;  1JW9 D;  2C7N B;  3QJZ A;  1FCL A;  4MGZ E;  1UGJ A;  4II2 B;  2MRP A;  2KD0 A;  3CF6 E;  2MHJ A;  3EHV A;  2FE8 A;  4DHJ D;  4FBJ B;  1N6Z A;  2DAJ A;  1BML C;  4JQW C;  2J4X A;  3TBL D;  1ESF A;  4IC7 B;  3JSV B;  4MSQ B;  4MJS B;  4BOS C;  1VJK A;  4ARI A;  1QF6 A;  2LGY A;  2FUH B;  1UWX A;  4CYE A;  1P3Q U;  4KDI C;  4HPL B;  4MGK E;  2I1J A;  2KVZ A;  2C60 A;  2WS3 B;  1G6J A;  1FRR A;  3UGB B;  3DHI C;  4PT5 A;  2ZW1 A;  3AI5 A;  4NQK E;  1S3S G;  2LJ5 A;  4P7I A;  3OJ4 B;  3VUX A;  2AQ1 B;  2MJD A;  4W9E A;  4YT0 B;  4XWT A;  1FFU A;  2KOX A;  1AYF A;  4AOF A;  1HTQ A;  2L52 A;  1YN4 A;  2ACZ B;  1OQY A;  2L8J A;  2PVG C;  1MFW A;  3Q6B A;  3IAM 1;  3R7R A;  3RZF A;  1WE7 A;  3P42 A;  3H6N A;  5D3D A;  1PQS A;  2J53 A;  4P16 A;  1HTO A;  2DYB A;  3ZVV A;  2WXM A;  3SDL C;  3DVG X;  2ZNV B;  1ZOY B;  3AM9 A;  3P2B A;  4XWW A;  1C9F A;  2RD0 A;  3UIO B;  3VH3 B;  4F7Z A;  4JLC A;  1FXA A;  2N4F A;  1V9J A;  2JU6 X;  3PRE A;  3FIL A;  1NEK B;  1L7Y A;  2FAZ A;  3OJ3 A;  3LB8 C;  3TEX A;  2N9E B;  2MBE A;  5TR5 A;  3ZDM C;  2QC8 A;  1PUT A;  2YLM A;  1ET6 A;  3O13 A;  4KSK C;  1YMH E;  5JXV A;  2LGI A;  3K9P B;  1L6U A;  1ZDX A;  3IAS 1;  2X8X X;  2GRI A;  3DBH B;  3HVD A;  4A9A A;  4FA6 A;  1UD7 A;  2WXJ A;  2XK5 B;  4ZRI A;  4DWF A;  1XLQ A;  4XZ4 A;  4A55 A;  4WAA A;  4EOY A;  2K22 A;  2K0P A;  4AWJ A;  3Q3N C;  2NBV B;  1YQ4 B;  1CK1 A;  1KH0 A;  3KH0 A;  4MEL A;  4LNI A;  3JVZ X;  1V8C A;  5FR6 A;  3Q8C A;  1XCT L;  1Y8R C;  4IWO A;  4ITK A;  2KWU B;  1FMA D;  3UIP B;  5BYS A;  2AWT A;  5CTR C;  1EM7 A;  3AN1 A;  5EE3 A;  5G5H A;  2K6Q A;  2ZJD A;  4M0W A;  2JUO A;  3T9L A;  2EEL A;  2IJ0 A;  1DOI A;  3ML9 A;  1WXV A;  4BKT A;  4FJY A;  4P1B C;  2N9K A;  2M19 A;  1FIQ A;  3U8Z A;  4C80 A;  1TS4 A;  3ZRF A;  3HK0 A;  1ZPS A;  3CWI A;  1FM0 D;  4EZJ A;  2ZPY A;  4ZDV A;  5E6O A;  1FEH A;  1WGY A;  1WXA A;  1WGR A;  3HHM A;  5CHV C;  2PVO D;  2LD9 A;  4EUT A;  1WM2 A;  1XF5 L;  5DPW A;  2LUE A;  4GDK B;  4KIK B;  1EWC A;  3ZNH B;  1I4G A;  2QEJ C;  4XC2 A;  5IAA C;  1KLU D;  2N9X A;  2IBI B;  4GMV A;  4N9F 4;  2BS4 B;  1KTK A;  3N1Z C;  2V0G A;  3C0R B;  1AN8 A;  5BO4 B;  3VXW A;  1V6E A;  4URK A;  1F1H A;  2YEP B;  2D3G A;  2FNJ B;  4ASW C;  4X57 B;  4NPN A;  2ONQ A;  3JSV A;  4RNA A;  4L23 A;  3LYY A;  4EZL A;  3NZ3 A;  2XBB C;  1WR6 E;  3N1X C;  2AQ2 B;  4BVU C;  1WX7 A;  2CHW A;  2JWU A;  3W1Y A;  2G45 B;  1WWT A;  3PLV A;  1QKZ A;  2BT6 A;  4PYU A;  3P63 A;  2V9H A;  3A4S C;  3MP9 A;  3EUB 2;  1VD2 A;  3ECI A;  4W9C A;  4W9I A;  4ZYS A;  3ZTC A;  3LDZ E;  1JWU D;  3KVF B;  3PSE B;  3TMP B;  1N5X A;  3VAW A;  4OVZ A;  2GBM A;  3LXF A;  3VHT C;  2FIF A;  3DBL I;  3NHE B;  5J18 A;  2MBQ A;  1N63 A;  2ICI A;  4N59 A;  1GUA B;  1L5P A;  3U30 A;  4A90 A;  1GG3 A;  2MWS B;  4K1R B;  4W9K A;  5DCN A;  5FKA C;  4CQN A;  4WIP A;  4GIV A;  1ZKH A;  5IA7 A;  4PS3 A;  2IY0 B;  2JWZ A;  3DBR I;  3MC0 B;  4LJO B;  4GXB A;  4QAY A;  1V1P A;  2BB5 A;  4AJY B; 
#chains in the Genus database with same CATH homology
 1QQR A;  3EGR A;  5EE0 A;  4LK0 M;  1MPE A;  1KF6 B;  4JWS C;  4RF1 A;  2PIA A;  2WXL A;  1SE3 A;  3GB1 A;  2QJL A;  3FC4 A;  1MHH E;  1DGJ A;  1N60 A;  3MFG A;  3ZJU A;  1VRA B;  4A6Q A;  3P4R B;  2WXG A;  4C7Y A;  1MVK A;  1C76 A;  2JYT A;  1CJE A;  2WXP A;  2L83 A;  3U4E G;  4Q2J A;  3BVZ A;  1PGX A;  2WXI A;  1FFV A;  2JXT A;  1E7P B;  3FIL B;  1E6E B;  2R61 A;  1ZXH A;  1STE A;  3BII D;  5GXG B;  2INP E;  2E6X A;  2WDQ B;  2BTE A;  2WQY B;  1SJH D;  3PZ8 A;  3AMZ A;  2V3N A;  3BK1 A;  4NZL B;  5D3I B;  4TQ1 A;  1FNW A;  2FUG 1;  1DYQ A;  2RMM A;  5G5G A;  2WXN A;  2QMT A;  4RF0 A;  2RPV A;  1VZ7 A;  1YN3 A;  1WGK A;  2K9X A;  2K5P A;  3AED B;  3NVY A;  2YEP F;  3MJ5 A;  1TS3 A;  1FRD A;  3W1S A;  1SIJ A;  3MHZ A;  3TUO A;  1UWM A;  4DXF A;  1XLP A;  5MPO A;  1I4P A;  1A70 A;  5HI1 A;  2LMC A;  3PZ7 A;  4TSS A;  2BS2 B;  2IGD A;  3HUI A;  1K52 A;  1WRI A;  1D5Z C;  2N7J A;  1L4D B;  2L1A A;  4N58 A;  1P7E A;  1RFK A;  2AQ3 B;  1GB4 A;  1SJE D;  1HEZ E;  4MM3 B;  1C77 A;  3SFD B;  4HEA 1;  5BMG A;  1SEB D;  3IT4 B;  1BUI C;  3Q8A A;  4IOI E;  1VLB A;  1JAL A;  3B9J A;  3KWL A;  1RYJ A;  3HVZ A;  4D2K A;  2LJI A;  1VZ6 A;  1ET9 A;  2KAJ A;  1GAQ B;  2MH7 A;  3AEA B;  4HJG E;  4LLG M;  1SSN A;  1ZP0 B;  1PFD A;  2WNM A;  4B0M A;  1XLO A;  4XDC A;  1I4Q A;  4GDL B;  4TMA B;  1CZP A;  2NTT A;  1NEN B;  2OED A;  1V1P B;  3IXS A;  4C56 C;  2WU5 B;  3ZJV A;  2MJE A;  2G9H D;  2TSS A;  1FO4 A;  2OHF A;  1SF0 A;  3Q69 A;  4AS1 A;  1C4P A;  3Q8E A;  1JQ4 A;  4HRO A;  3AEG B;  2IDY A;  2JX5 A;  1PDX A;  2DBY A;  2L32 A;  1FCC C;  1Q10 A;  1XLN A;  3TEY A;  3VR9 B;  2KQ4 X;  4WQM A;  5H92 C;  1B9R A;  1UNS A;  2LEK A;  5EE9 A;  2WDV B;  1ACC A;  4HKZ E;  1QT9 A;  4NAW B;  2WDR B;  4H2A A;  2V3P A;  3AE2 B;  1IBX A;  3Q8B A;  1EU3 A;  3OWE B;  3ZQ4 A;  1TY0 A;  2W54 A;  4ZRP A;  5T8I A;  1KLG D;  1N61 A;  1HXY D;  2GI9 A;  1E0Z A;  4YXD B;  2CJO A;  3U52 E;  5HHD G;  2M56 B;  1I4X A;  1NYR A;  2K3U A;  1NVI D;  3N9Y C;  2SAK A;  2PW9 A;  1V1O A;  1YN5 A;  2RDG A;  3H8H A;  2WXQ A;  1JW9 D;  5HFY A;  1FD6 A;  1R7S A;  1FCL A;  1PGB A;  1UGJ A;  1YNT E;  3NVW A;  4RGN A;  1TZO A;  2VZK D;  2MEK A;  4ZHP A;  3SFE B;  1TKE A;  3KQ4 A;  1T5X D;  1VDV A;  5BMH A;  4YSY B;  1IGC A;  2FE8 A;  3AEC B;  4US9 A;  1QOG A;  3BVG A;  2W3R A;  1BML C;  2J4X A;  1TY2 A;  1ESF A;  2X38 A;  1E10 A;  3L4P A;  2W55 A;  4WH4 A;  3AE5 B;  1VJK A;  1HA5 A;  1N5W A;  3R2T A;  3T3N A;  1I4H A;  4ARI A;  1QF6 A;  1JWA D;  4YTM B;  1UWX A;  1HZ5 A;  1XEE A;  4UDU C;  3UI3 A;  1V97 A;  3P4Q B;  1JRO A;  4MH8 A;  2WS3 B;  1FRR A;  1XCQ L;  3AEB B;  4REZ A;  2B76 B;  1IGD A;  4PT5 A;  1F77 A;  2ZW1 A;  1L0V B;  2AX5 A;  2RDH A;  2QSD A;  2DYM A;  1F0Z A;  1FXI A;  2AQ1 B;  2MJD A;  4KX6 B;  5HG2 A;  4US8 A;  3I57 A;  2KN4 A;  3B2F A;  2CU3 A;  2Z8L A;  1YJI A;  4XE0 A;  4YT0 B;  2FBW B;  4XWT A;  1FFU A;  4TQ0 A;  1AYF A;  2CJN A;  3TSS A;  2L52 A;  4C7Z A;  2KWD A;  3NVV A;  1YN4 A;  1QIL A;  2IGG A;  2QIE B;  2WP9 B;  5E6J A;  1NI3 A;  2ACZ B;  2ZW0 A;  2XNA C;  2Y3A A;  1TYG B;  1JWB D;  1M4V A;  2WLB A;  3RPF C;  4OW0 A;  2PVG C;  3SR6 A;  5LNK 1;  4WAF A;  3IAM 1;  3ABV B;  5AUK A;  4ZHO A;  1ZUD 2;  1WSP A;  2NMQ A;  1OQR A;  3P42 A;  4KGR A;  5D3D A;  2J53 A;  4P16 A;  1UUP A;  2WXM A;  3V3X A;  3AE3 B;  3BVM A;  1GOZ A;  2PTL A;  3IT6 B;  2HDE A;  2XN9 C;  1TKY A;  1J7C A;  2SEB D;  1ZOY B;  3AM9 A;  1JWS D;  3FAH A;  4XWW A;  3AE4 B;  1RWS A;  1SXT A;  1C9F A;  3GP7 A;  2V4I B;  3HRD D;  1YJJ A;  3VQI A;  2IPK D;  3AEF B;  1FXA A;  2QIL A;  4RFB A;  4USA A;  5C2T B;  1MI0 A;  2EKI A;  1DOY A;  4YWG G;  2JU6 X;  2IGH A;  2LFI A;  1NEK B;  3FIL A;  4OZC A;  1J7B A;  1EU4 A;  3PO0 A;  4KGS A;  1QOF A;  3LB8 C;  4RH6 A;  1GB1 A;  2DWQ A;  3TEX A;  1MHX A;  1ENF A;  1ZXI A;  4OZA A;  1PUT A;  4GLS C;  1AW7 A;  3U7Z A;  2PKO A;  3BYT B;  1ET6 A;  3VRA B;  3O13 A;  2INN E;  1YMH E;  4ZRQ A;  5JXV A;  2JZP A;  2LGI A;  1N62 A;  1L6U A;  1D5X C;  1ZDX A;  3IAS 1;  3NVZ A;  4YTP B;  2GRI A;  1DOX A;  2LHE A;  3HVD A;  3NS1 A;  4A9A A;  2WXJ A;  3W9C B;  5BMI A;  2W3S A;  2WXH A;  1XLQ A;  1IUE A;  1TS2 A;  1OQQ A;  4FXC A;  2DYO A;  4A55 A;  2K22 A;  2K0P A;  4YSZ B;  3BYY B;  1YQ4 B;  1CK1 A;  4HKQ A;  4IKG A;  1KH0 A;  3ETR A;  1L0X B;  2WXK A;  1SE2 A;  3CIR B;  1BXT A;  3P4P B;  3R2I A;  2HTM E;  1V8C A;  3Q8C A;  3ZYY X;  4MT5 A;  1XCT L;  3AE8 B;  3ZGZ A;  2H89 B;  4ITK A;  4XDD A;  1FMA D;  5BYS A;  4KGT A;  3W5V B;  1EM7 A;  3AN1 A;  1D5M C;  1PYW D;  1L4Z B;  5EE3 A;  5H8Y E;  1JRP A;  1K51 A;  5EE1 A;  5G5H A;  2GB1 A;  4M0W A;  1HQR D;  2W82 A;  3TEW A;  5C3J B;  1JCK B;  2WXO A;  2EEL A;  2PLP A;  1VR9 A;  2IJ0 A;  5TSS A;  1DOI A;  4JPS A;  4YSX B;  1L0Y B;  3KWV A;  2Y5C A;  4NJC A;  2WU2 B;  3B2G A;  2BB6 A;  4ARC A;  2N9K A;  2M19 A;  2KDM A;  1FIQ A;  4JWU C;  4C80 A;  1TS4 A;  3NRZ A;  1LO5 D;  2M0A A;  4KKJ A;  1ZPS A;  3CWI A;  1FM0 D;  2KMM A;  2WXR A;  1TJE A;  3DWG C;  4ZOH C;  4DQO C;  4JX1 C;  2G1E A;  1FEH A;  2ON8 A;  3AV8 A;  1J7A A;  1C79 A;  1NYQ A;  5I4D A;  1P7F A;  1K53 A;  2PVO D;  4RGM A;  1GPX A;  3BWU D;  1YQ3 B;  1VZ8 A;  4KKI A;  3R8B A;  1JML A;  1XF5 L;  4GDK B;  1C78 A;  1WYG A;  3ZJT A;  1SE4 A;  1EWC A;  3AB5 A;  1QOB A;  4AQ7 A;  1I4G A;  2MJ3 A;  2QEJ C;  1KFY B;  2VZK B;  1KLU D;  1F2R I;  2Q5W D;  4A8X C;  1I7H A;  1IBX B;  4WUR A;  4J3O D;  2N9L A;  3BZD B;  2N0S B;  4L1B A;  5FK9 C;  3RFZ B;  1T3Q A;  2BS4 B;  1KTK A;  3J9C A;  1QLB B;  3W2D A;  3AH7 A;  3C8Y A;  3URY A;  3GS2 A;  2V0G A;  1AN8 A;  4O1N A;  1RM6 C;  4RGO S;  4WWM A;  1ROE A;  4MAC A;  4EE2 A;  1E9M A;  1XXG A;  3U2S C;  4OZB A;  1C4C A;  2BBC A;  5BYR A;  1Y56 A;  3W5U B;  2J42 A;  2YEP B;  3DWM A;  5D7G A;  1CQV A;  1D6E C;  3VRB B;  3E56 A;  2KAC A;  4DXG A;  2ONQ A;  4RNA A;  3Q8F A;  1SBB B;  4L23 A;  2BYT A;  2NTS A;  4OHJ A;  3LYY A;  1B1Z A;  2I2Y A;  1ZDV A;  4R3D A;  3NZ3 A;  2AQ2 B;  3VR8 B;  1WXQ A;  2JWU A;  2WXF A;  2Y5P A;  3AE6 B;  1EWY C;  1WWT A;  1ZE3 D;  1I4R A;  3AEE B;  3T3O A;  2DLB A;  1OFF A;  1QKZ A;  2BT6 A;  3P63 A;  2LHD A;  2J52 A;  1SB3 C;  3MP9 A;  3EUB 2;  4LTU A;  4NAM A;  1F2R C;  3I9V 1;  4ZYS A;  1PGA A;  2JSV X;  3AE7 B;  5BYQ A;  4RCO A;  1JWM D;  1JWU D;  1L6V A;  3AE9 B;  2I38 A;  1TKG A;  2BW2 A;  3P1M A;  4B0E A;  1FNV A;  4N6E B;  1TS5 A;  2D5G A;  4IDI A;  1N5X A;  4JE3 B;  3V05 A;  3BK2 A;  4OVZ A;  3LXF A;  4HRS A;  2H88 B;  4P6V F;  1T6B X;  4RGT A;  1XO3 A;  1QOA A;  1N63 A;  2ICI A;  5AUI A;  4L2Y A;  4N59 A;  2LUM A;  1L5P A;  2JQR B;  1AWD A;  4A90 A;  1FNU A;  3SEB A;  5FR3 A;  1C4A A;  5FKA C;  4CQN A;  2JYE A;  4YTN B;  4WIP A;  3E9S A;  2BS3 B;  3NUH B;  1HZ6 A;  3TEZ A;  2PMV A;  1K50 A;  3MC0 B;  3EA6 A;  3KLS X;  2E3T A;  1V1P A;  2BB5 A;  3P4S B;  3AE1 B;  1KRH A;  3WCQ A;  1D4B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...