4WIPA

Dix domain of human dvl2
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
81
structure length
81
Chain Sequence
MGETKVIYHLDEEETPDLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Segment polarity protein dishevelled homolog DVL-2
publication title Ubiquitination of the Dishevelled DIX domain blocks its head-to-tail polymerization.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 16
structure length 81
sequence length 81
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2014-09-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00778 DIX DIX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.380 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 4wipA00
2D5GA 3PZ7A 1WSPA 4WIPA 3PZ8A
chains in the Genus database with same CATH superfamily
1E7VA 3P4RB 3DBSA 3RMKC 3HHMA 1YN5A 1JWUD 2LMCA 4XWTA 4AP4C 1TBEA 3AM9A 3RCZA 3UGBB 1J0GA 4C7ZA 2PKOA 3RNAC 4J6IA 2DAJA 2NBWB 2PVGC 2I2YA 2G4SA 4GGQA 4W9JA 4KZ0A 2N0SB 1E5WA 4DQOC 2K39A 4HEA1 3U30A 4GDLB 3TEXA 3QWZB 1B1ZA 4XDCA 3LB8C 2NMQA 2WGSA 3H9DA 4M01A 3UIPB 3N32A 2KKCA 3W1SC 1U4AA 3AE9B 5BYSA 2KK8A 2DBYA 3PVLA 5EE0A 1SE3A 1WGDA 3APCA 1CQVA 3DBHI 2KTRB 2K8CA 4ZYSA 2EELA 1L7YA 3NOBA 1I4GA 1K52A 4FHJA 4XZ4A 4ICVA 2KFJA 1V1PB 2MBHA 2N9EB 3QX1A 2IZVB 1TZ1A 4RMAA 3L08A 2KLGA 3W2DA 2GBJA 4FJVB 2MBEA 1XLQA 1BT0A 2N9XA 2NTSA 3Q3NC 1GG3A 1KM7A 1WI0A 3KW5B 2KNBA 2FIDA 2KFKB 1AWDA 3JSVB 3ETRA 1OQRA 3C19A 4OZBA 3PPAA 2HTHA 4YTPB 5D3IB 3IVFA 2R61A 4JL9A 3N20C 1V81A 4DXGA 3T9LA 4JIOU 5CTRC 4MDKE 1T0YA 4M02A 1WGYA 4EZLA 1LFDA 1OQYA 3DVNU 1GPXA 2CR5A 4II3B 2MEKA 1E0ZA 4PK1A 1VD2A 1AYFA 2OOBB 4JWSC 3I63C 4RGOS 2D3BA 1J7CA 3J9CA 5IAAC 1GB4A 5L83A 2K6DB 1TZOA 1CMXB 3N1XC 3EECA 4PS8A 4XDDA 1FRRA 1Y8RC 5E6OA 3Q8EA 2FCMA 2L3ZA 3N1YC 1F2RC 4LNOA 1HTOA 3ZDTA 5CHWA 3DOWA 5G5HA 2NS5A 2M8SA 3TUOA 3BYTB 3CF6E 1C3TA 2BWFA 5JZEB 3DHGC 1V9JA 1NDDA 4KKIA 1WGGA 1YQ3B 4A9AA 5H8YE 2AL6A 3ONSA 1L0VB 2K25A 1D5MC 4AS1A 5GMVA 1PYWD 4B0MA 2BGFA 1R4NB 2ZW0A 3ZQ4A 4PYUA 5T8IA 2MX2A 4AQ7A 4KV2A 3DBLI 1XCQL 2Y3AA 4W9GA 2O6VD 1WJ4A 1Z2MA 4OVUA 2D10A 2N9LA 2DYMA 4LNFA 4ITKA 4WJNA 1EWCA 4GSWA 4G0NB 4RGNA 3HK0A 1ROEA 2D11A 4O1NA 2HJ1A 1UZXB 3SHQA 1JWAD 3BY4B 4WWOA 1P9DU 3TBLD 4MM3A 2G3QB 2N4FA 4I6NB 3SFDB 1PGXA 2ZVNA 1ACCA 3O65B 3AU4A 3AN1A 4KVGB 3UIOB 3MTNB 3BVGA 3FAHA 2M56B 1TKGA 2MWSB 2KJ6A 2W3SA 5J2RA 2KMAA 1T0RC 4DK5A 2VZKB 3QK0A 3AE1B 4W9FA 2BYEA 3B1LX 3EUB2 2LVPA 4OZAA 1TTNA 1VZ6A 1YQBA 1FIQA 2L76A 2KVRA 2KDMA 1E90A 1WWTA 3M63B 3MC0B 3ZJUA 3A4SC 1TJEA 4LK0M 4A90A 3AV8A 2CS4A 2ZVOA 3IT6B 2DLBA 2WHIA 1TKEA 2D3AA 2DHZA 3EFUA 3R8BA 1WX8A 1C4CA 2NR2A 3MJWA 4AJYB 2R2OA 2W9NA 1J8CA 4HJKA 3N3KB 4Q2JA 1LO5D 2N1WA 1M94A 4KDLB 4HPLB 1NEKB 4C00A 3HUIA 4HK2A 4KZCA 3KUDB 2WXQA 4PS7A 2ZW1A 3ZVVA 3PHWB 3U4EG 2L7RA 3OJ4B 3AXCA 2Y5CA 1Q10A 2N7EA 2KQSA 1MVKA 2QILA 1JALA 1ZP0B 1IBXA 3IAM1 5HHDG 2EMTA 5J17A 2K1FA 3PRMB 4DBGA 3PGEA 2D07B 1OQQA 3L16A 3V60A 2WXLA 2KDBA 1LGRA 1UH6A 1YQ4B 3P2BA 2PJHA 3WAOA 1L4DB 3B0AA 1XT9B 1YMHE 3L4PA 2J4XA 3K9PB 2RDGA 3A9JA 2XK5B 1JWBD 1FFVA 2N7DA 3RNBC 5AZFA 2KDIA 1EU4A 3PT2B 4II2B 4MH8A 4YWGG 5IOIA 3WAPA 4I6PA 1PUTA 3I5JC 3UQBA 4WQMA 1WF9A 3MFGA 1T5XD 5IA7A 2L8JA 3KLSX 1C78A 1UGJA 2WDQB 1BMLC 2RR9A 2YLMA 2KVZA 4AJWA 5HI1A 3AE4B 1CJEA 4NY0A 5TSSA 2PE9A 2M1MA 1L2NA 3V05A 4IKGA 4URKA 2LUEA 1WGHA 3B2FA 3KUZA 3AEAB 1B9RA 3UQAA 3L13A 1ISNA 3IAS1 3CSTA 3TCAA 1K50A 1QILA 4HWIB 2WXGA 2MH7A 2MP2A 1F1HA 3OAWA 4YTNB 2FAZA 4MGZE 1P98A 2HJ8A 3NVYA 2KWDA 2ACZB 4B95A 4C4VB 2Y5PA 4KKJA 2PE6B 2WX1A 2VH2A 5AUKA 4YXDB 2JUOA 1GAQB 3DDCB 3TSSA 4A8XC 3A9KB 4TSSA 2KAJA 1ZKHA 3QIJA 4X57B 4MJSB 2KDFB 1P7EA 2O2VB 2FBWB 2RGFA 2K8HA 1VR9A 2VH1A 1JRUA 2IO1B 1L6VA 3EC8A 3DVGX 3PV1A 2K0PA 3M95A 2IJ0A 2MA9B 2K22A 3ML8A 4LDTD 4BFRA 3EA6A 3WCQA 1FRDA 5LNK1 2YVCA 3NY5A 4OVZA 1KLGD 1VJKA 2KQ4X 3ECIA 4YSZB 4YSXB 5G5GA 4IOIE 2NPTA 4NNJB 2KO3A 2KWVB 2BB5A 2N9KA 5J18A 4LNNA 4DDGD 2JF5A 2KJRA 3U8ZA 2KYWA 3NS1A 1QQRA 2HTME 4XX5A 3Q3FA 2ZPYA 2FUG1 2BWES 4HCPB 2KJHB 3GE8C 4TMAB 1G6JA 3MP9A 5D6JB 4ZRIA 2BTEA 1EO6A 1UF0A 1SJHD 1PFDA 4G50A 4L1BA 3ZW3A 3RD2A 2V4LA 2IO0B 3ZJTA 4M0WB 3AMZA 5G55A 1WGRA 2G4DB 2FUHB 2H88B 1SF0A 1ET6A 4W9IA 5KHQA 3LXFA 5EE3A 1FO4A 2JYTA 2PEAA 4K3BA 5BYQA 4ICUA 2LUMA 2JY6A 2G9HD 1XEEA 3KQ4A 2LI5A 4CHKA 3CSFA 4OZCA 2D2QA 5FKAC 2KMMA 4YL8A 1FPYA 3JW0X 3RUIB 3ZRCA 1RAXA 2AQ3B 3X0WA 4TKNA 4ZDVA 1P3QU 2LD9A 2GBMA 2V3SA 2OJWA 4TQ1A 4RF0A 2WDTB 4L2YA 2REXA 1UBIA 5E6JA 1E9MA 4RF1A 5JXVA 1I4HA 3Q3JA 4ZOHC 1BUIC 3MC8A 5D3DA 2AQ2B 1SB3C 1F77A 2BVCA 1VRAB 4FN2A 2PMVA 1OEYJ 3QARA 3V61A 4OHJA 5BO4B 3ZNGC 3WIMA 4L23A 1DYQA 2WU5B 1QOBA 4NPNA 1IYFA 1SIFA 3EGRA 1WR6E 2XNAC 2FCSA 3AE7B 4EEWA 1HA5A 4WWMA 4ASWC 1ZGUB 3KWLA 5FR3A 1A5RA 2JZZA 2HE7A 4BBNC 3H7SA 2AEHA 2YEPF 3U7DA 2M19A 1MHHE 1GUAB 2Y5BB 1XQQA 3RNFC 4XWWA 2WXOA 4PS3A 3Q8BA 4WWPA 4NAWA 3R66C 4W9EA 3CIRB 4IDIA 4LNKA 1EUVB 2DZMA 3E9SA 1ESFA 3SEBA 3HRDD 1L4ZB 1D3ZA 2AQ1B 1ZXHA 1WM3A 3Q69A 1C79A 3V6CB 3ZGZA 3HVDA 1R4MB 2I1KA 3T3OA 1YX6B 4N58A 1GB1A 1UGMA 3ZNZB 1WJNA 1WSPA 4YT0B 4OVVA 2LFIA 2WXNA 4JPSA 5EDSA 3RZFA 4N6EB 2GI9A 1SXTA 4WJOA 1QLBB 2ZZPB 3R7RA 2ICIA 3PRPB 3MJ5A 1NYQA 3RULA 2GBRA 2D3CA 1GJZA 4K7UA 3AE6B 3E56A 1V2YA 2KANA 2MBQA 3R2TA 4LLGM 1VCBA 3MHSD 2LGYA 1I35A 1L6UA 2WU2B 3Q8FA 5HFYA 4JWUC 1FXAA 3HM3A 3H1UA 1A70A 1S1QB 1N60A 2N1VA 1Q5WB 4XGAB 2DYOA 2WXPA 3ZLZA 4W9LA 4UDUC 2EKIA 5DPSA 2JSVX 3PZ8A 3AE8B 2L32A 4NQLB 4RGTA 4ZRKA 3DBRI 5KHOA 3VH3B 1S3SG 1WGKA 2BQQA 4EZJA 2BS3B 3RT3B 2XBBC 3KH0A 3QAQA 2LASA 1JROA 3Q2AC 5IN7A 3CMMB 4IM0A 3VHTC 1QOGA 3BVZA 4ZRJA 2LGIA 3P4SB 3R2IA 3VUWA 3H7PA 4BVUC 3AI5A 2K6QA 1HE8A 3PO0A 4I6LB 1E8YA 4AWJA 1D4BA 5GXGB 1KJTA 2MBOA 3FC4A 3RFZB 2V0GA 3TIXA 2I1JA 1P0RA 3V62A 4EKUA 3VFKA 3ZO5B 2IGGA 2KTFA 3IBEA 3OG5A 4ANXA 1GNUA 2WYQA 4MSMB 2WXRA 4RNAA 4P16A 1TGZB 4LDTB 2B3AA 2J0MA 2RMMA 4MM3B 5IKCM 2GBKA 4C56C 3NZ3A 1WIAA 1RM6C 2CU1A 2WXKA 5H92C 2QSDA 4WURA 2FIFA 2WXHA 1QZEA 2LGXA 4GXBA 1K8RB 1JWSD 5CHVC 1J7AA 2KN4A 3V3XA 3VXWA 2IYDB 2CHXA 2LEKA 3A1QA 4WAFA 1VZ8A 1N5XA 3PZDA 1QT9A 3V6EB 2X38A 4DWFA 1F2RI 1H4RA 2LVQA 4WAAA 3BYYB 2KN5A 1EF5A 3BK1A 1UWMA 3VVWB 3M3JA 4BOSC 2JZ3B 3RNEC 3SDLC 3TEZA 4W9HA 3UI3A 1DGJA 3ABVB 2N7JA 1TS5A 2NVUI 2JVCA 1LM8B 4LJOB 2GB1A 3NHEB 5JHAA 2KLCA 1WZ0A 3DBHB 2LHEA 4KSKC 1V1OA 1E6EB 1KFYB 4ACFA 2WWZA 3VR9B 2IO2B 1ZE3D 2G45B 2A5UA 1E7UA 3X23A 4TV3A 4K81A 1JW9D 3VAWA 2C7HA 2KHWB 1WXSA 4JQWC 2INDC 5C3JB 4RCOA 4MSQB 2JRIB 2LWPA 2J53A 3ZRFA 3KWVA 3HM6X 1FM0D 4KSLC 3GZNI 1MHXA 1IBXB 3ZJVA 4HLEA 3QQ8B 3TJPA 2C7MB 3UF8A 3U2SC 4EFOA 1WX7A 2JXTA 3K9OB 4IG7B 4M8NA 4NJ6A 2DX5B 1WE6A 1N63A 1GC6A 3FILA 3TL5A 1UBQA 5IO9A 4GDKA 4CQNA 5E6PA 2JQRB 3A9JB 4DHZB 2KD0A 2IO3B 2KQ7A 2R2QA 2KT7A 5AZHA 1WMHA 2QHOA 2WXJA 4DHJD 4N59A 2WLBA 2J52A 1T6BX 2V3NA 3URYA 1UELA 2H89B 2WXIA 4MEMA 3ZXVA 2MRPA 4NJCA 1WXVA 1SEBD 2ZPNA 2BS4B 2W3RA 1OTRB 1XXGA 1Q1OA 5CHFA 1MG8A 5HG2A 3DWMA 3APDA 2RDHA 5FR6A 3ZNID 1AN8A 3ZNHB 5HKHA 1XLNA 2ON8A 4F1SA 5I4DA 2KXJA 2JXXA 2BBCA 4C7YA 1K51A 2KWUB 3I57A 5EE9A 4J3OD 4QAYA 3U7ZA 4A55A 2NBVB 2KX0A 2Z8LA 2V1YA 1XLPA 4NAMA 4DDID 3RZWC 1YJJA 1JWMD 1V5OA 2GLSA 3TEYA 2BYTA 2MP2B 3VRBB 2OHFA 3DBLB 4XYCA 4B6WA 3BIID 3ZXRA 1TS3A 2FCQA 4ANWA 3NJTA 3D32A 1MI0A 2MHJA 2K5PA 2AX5A 4N9F4 1FEHA 1VDVA 3DVGY 1VZ7A 4A3PA 5LXIB 2L1AA 4FADA 1V8CA 3LJ3A 4GN1A 4IWOA 3RYTA 4F7ZA 4E3CA 1DOIA 2L00B 2HDEA 2A4ZA 3LYYA 5D2MB 4XE0A 3NS8A 1QKZA 2DNFA 2M0XA 1VLBA 4BKSA 4EOYA 1UWXA 3DHIC 1R4MI 1WH3A 3SR6A 2PVOD 3EFCA 2BW2A 2G1EA 1PQSA 3L10B 4KIKA 4BOZB 1IUEA 1WYGA 2NPTB 2C7NB 4MT5A 5MPOA 4REZA 3P4QB 1CK1A 3ZIMA 1R7SA 5D7GA 2RDBC 2LRUA 1PGBA 4K7WA 4EZKA 1I4XA 2JRHA 2BYVE 5C23A 4WIPA 4W9KA 2L0FA 2D3GA 3P4PB 3VH4B 2IGHA 4YTMB 1SIJA 4E71A 4WJQA 1WY8A 3VUYA 4JX1C 1IGDA 4P6VF 2JT4B 3RN9C 1Q0WB 4W9DA 3QC8B 1OGWA 3AH7A 3R3MA 1NI2A 1BXTA 2L0TA 4MH0E 3IXSA 3AECB 1E8WA 1F52A 1WXQA 4FLHA 2L83A 3RNGC 3PHXB 4A6QA 1ZDVA 1YX5B 3ZTDA 5C2TB 2VRRB 1TKYA 4KGSA 1R4NI 1KLVA 2Z0EB 4ZYNA 3FKYA 3KVFB 3OJ3A 5AUIA 3NZSA 5BYRA 5BMIA 2J42A 5JH5C 4MGKE 3A4RA 1UUPA 3NVZA 2E6XA 1TY2A 3RPFC 1TIFA 3VTWA 4ANVA 2IPKD 1FCLA 5TR5A 3BWUD 4GU2A 3SU8X 1WRIA 3QCAA 3L0WB 1MJDA 2FCNA 2QMTA 1T0QC 2BKRB 2MBBB 3W5VB 2JYEA 1NVID 3W9CB 2RPVA 2PTLA 5E6NA 3ZTCA 2BT6A 4AOFA 1ZUD2 1N5WA 1WM2A 2QCZA 4EE2A 1C1YB 2V4IB 3QJZA 3AEGB 1NBFC 2GRIA 4BZAA 3QHTA 4JGHB 5LXHA 2LVOA 2KZRA 4NQKE 1YJ1A 1KLUD 1H8CA 3WANA 1TS4A 4B9KA 3PRZA 5D94A 4GDLA 4FULA 4A20A 2M17A 2BKFA 2BS2B 2DAFA 3L17A 4BKGA 2IGDA 2KC2A 1C9FA 4ZRPA 1ZW7A 3C0RB 1C4PA 2EMSA 2WP9B 1YNTE 1RWSA 2KTRA 1FMAD 4NAWB 2K9XA 3VTUA 2Z0DB 4ARIA 3B9JA 3P1MA 2WXFA 1I4RA 1TS2A 4JE3B 1V1PA 2J0KA 3BINA 3AB5A 4HVBA 1STEA 1I4QA 4XC2A 3I9V1 3SFEB 3H6NA 2C5LC 3ZYYX 1EU3A 2WDVB 1L0YB 2KFKA 3JSVA 4IM2A 3Q6BA 4G11A 3APFA 1WE7A 1FCCC 4DHJB 3H8HA 4BBNF 1AW7A 3NUHB 1ZPSA 3ENEA 1LQBA 4DHZE 2E3TA 4WJPA 1YJIA 1JQ4A 4HPMB 3JVZX 4HRSA 2JX5A 4YSYB 4BKSD 1HQRD 2QIEB 2ZCCA 1RFKA 1OEYA 2MJDA 4FBJB 4CYEA 3IHPC 2NBUA 1EF1A 3HVZA 2DZJA 1GOZA 3Q3MC 2NTTA 5L95C 2Z59B 3PZ7A 2V9HA 1L5PA 2M4NA 2WXMA 5DCNA 2MQJA 3N9YC 1V49A 3P42A 1IPGA 4RH6A 3C8YA 4KGTA 4P7IA 4W9CA 4RM9A 1E7PB 2Q5WD 1SE2A 2CJNA 1NI3A 4MACA 2MSED 1UD7A 4PT5A 1KF6B 2LXCA 1SSNA 1X1MA 3H7PB 4NJ7A 4WH4A 1TY0A 1KOTA 5DPTA 1F0ZA 2W82A 3SD5A 2ZEQA 4RGMA 2LJIA 1V80A 3DWGC 1JCKB 4HCNB 1FXIA 2SAKA 1YOVB 4M00A 2RPQA 2QDFA 2GMIC 4H2AA 1MFWA 3N1ZC 1K53A 2PIAA 3OLMD 3AEEB 2J0JA 3NG0A 4B0EA 1WXMA 2GOWA 1FXTB 3OWEB 1WJUA 3AE5B 3P63A 1N62A 1JRPA 4S17A 4ZHOA 2ASQA 1IP9A 2WQYB 3GP7A 3PREA 4FXCA 1YD8U 1DOYA 1FNWA 1N61A 2BB6A 3A1QB 2GBNA 1PDXA 3BK2A 4K7SA 1T3QA 4FA6A 3PTFC 3TEWA 1WRDB 1ET9A 1JMLA 2JZPA 2C60A 1WZ3A 1Z5SB 1XLOA 3AU5A 5JHBA 1KTKA 1WXAA 5LLIA 1XCTL 2D5GA 4A3OA 1SJED 2RD0A 5IP4D 2JWZA 2MJ3A 4LCDE 4M8MA 3S2AA 3MC9A 1AARA 3Q8AA 1PGAA 4HKQA 1P7FA 2ZCBA 2KX3A 4OW0A 1NYRA 1RRBA 2ZNVB 3DCGA 2FE8A 1I7HA 4GMVA 4HROA 1XO3A 3JYUA 1ZOYB 1LXDA 4C80A 4S0RA 4JLCA 2FNJB 4K3CA 2DENB 4IWPA 3GS2A 2XN9C 3AEBB 2LJ5A 4MGIE 4HPPA 4AUQC 4KGRA 1TT5B 4HDQA 3NVVA 3CWIA 2UYZB 3Q3OC 1GC7A 3PLUA 4ANUA 1I4PA 4FJYA 2WNMA 1F9JA 4K1RB 2INNE 4TUUA 3GE3C 1P1AA 3RI7C 2PPHA 2BF8B 4DXAB 2INPE 2YEPB 1D5XC 1DOXA 2HD5B 2MJEA 4F8CB 4IC7B 1V6EA 2OJRA 3FILB 3RNCC 1SGHA 1ZXIA 2PLPA 4ZRQA 4GDKB 5BMGA 1RFAA 3U52E 3T3NA 4GLSC 4IUMB 4WWNA 2WS3B 3AEFB 1HTQA 4FJZA 1J7BA 1WMHB 1SBBB 1HXYD 2UWQA 2MCNB 4R3DA 3ZKJC 1FFUA 1RYJA 2W54A 1XD3B 1MG4A 3ZUNA 3VUXA 2NCNA 2CHWA 4P1BC 2XK5A 4KDIC 2MW5A 1HEZE 3AULA 2X8XX 3W1SA 5AZGA 3LDZE 2CKHB 2AYOB 1V86A 2V3PA 2KC1A 2JU6X 2QJLA 4KX6B 2MLBA 2QEJC 1CZPA 2LGSA 2IY0B 2KDEB 3KUCB 2ZJDA 5FK9C 3DBRB 1MPEA 2LGDA 1SE4A 2WDRB 4EUTA 2AL3A 2EKEC 1FNVA 5CX3A 2CU3A 2IY1B 3NRZA 1J19A 2N9PC 1HZ6A 4RM8A 4IM3A 1YN3A 2JWUA 2XEWA 2DYBA 3AEDB 3WA0A 1N6ZA 1WR1A 1WYWB 3WAMA 2L05A 2DZKA 3ML9A 4G3XB 1KRHA 3B2GA 1M4VA 5DPRA 4P1CC 2I38A 3B08A 2KWCA 3IG3A 4LJPB 3KYDD 3W1YA 2KOXA 1HZ5A 4HJGE 1C76A 2RSUA 3M62B 3R7QA 4C4VA 2B76B 5G2NA 3IFWB 4RFBA 1Y56A 3GB1A 1WJ6A 4HDOA 1V5TA 1E8XA 3VTVA 3A9KA 3WALA 3EHVA 4MJSA 1YIWA 5DPWA 2O2VA 2K3UA 3MHZA 4ZHPA 2UU7A 3DVNV 2LXAA 4KIKB 3I3TB 4US9A 3NZUA 3VRAB 2CJOA 4DXFA 1D5ZC 2TSSA 3PS6A 4MELA 3VDZA 1C77A 1V97A 3ZDMC 1IGCA 2CHZA 1TYGB 3PLVA 1QF6A 3DQVA 4GIVA 2PW9A 3NVWA 1E10A 2DWQA 2QC8A 4CO7A 3VQIA 4PYZA 1FD6A 1ZDXA 1OFFA 2LHDA 5C1ZA 2BPSA 3ALBA 2W55A 3VR8B 3A33B 1I42A 5BMHA 5EE1A 4GB9A 2BYFA 4GOCA 1UNSA 1KH0A 3Q8CA 1T0SC 2K8BA 2VZKD 4MGYE 4ARCA 5AEKB 1XF5L 2ONQA 3HIZA 1EWYC 1EM7A 2M0AA 3TMPB 4BAXA 4NZLB 3BVMA 2AWTA 3UINB 4HXDA 1E8ZA 1QOFA 2KMCA 4TQ0A 4LTUA 3N30A 3DHHC 2ZNVC 2KACA 4D2KA 4LNIA 2O6VB 2O6VA 2LRWA 4IWQA 3GZNB 4USAA 4M0WA 1WFYA 3Q14C 3QA8A 4BKTA 3GOEA 3IT4B 3BZDB 1C4AA 1ENFA 3O13A 3T8MA 1D6EC 2INCC 3AE3B 2IDYA 4HKZE 2DZIA 2JPHA 1WX9A 2WX0A 1YN4A 2C9WB 1SE9A 4E74A 4WQOB 1NENB 1L0XB 1RLFA 2SEBD 4US8A 2IBIB 1FNUA 3W5UB 3DPDA 4IW0A 3KYCD 4FHKA 2J7QB 2L52A 2LZ6A 3AE2B 2OEDA 1QOAA 3L54A 3PSEB
chains in the Genus database with same CATH topology
1SE2A 1P7EA 2CJNA 1NI3A 3P4RB 5C3JB 4RCOA 2FBWB 1YN5A 1JWUD 2LMCA 4MACA 4PT5A 4XWTA 1KF6B 3AM9A 2J53A 3KWVA 1VR9A 4C7ZA 2PKOA 1FM0D 1SSNA 2PVGC 1MHXA 2I2YA 1L6VA 1IBXB 2K0PA 3ZJVA 2N0SB 2IJ0A 2K22A 4WH4A 1TY0A 3EA6A 3WCQA 1FRDA 5LNK1 4DQOC 4HEA1 1F0ZA 3U2SC 2W82A 4GDLB 4OVZA 2JXTA 3TEXA 1B1ZA 4XDCA 3LB8C 2NMQA 1KLGD 1VJKA 2KQ4X 4RGMA 2LJIA 4YSZB 4YSXB 3DWGC 1N63A 1JCKB 5G5GA 3AE9B 1FXIA 2SAKA 3FILA 5BYSA 4IOIE 2DBYA 4H2AA 2BB5A 4CQNA 5EE0A 2N9KA 1SE3A 1K53A 2JQRB 2PIAA 1CQVA 3AEEB 4B0EA 2EELA 4ZYSA 1I4GA 3OWEB 1K52A 3AE5B 3P63A 2WXJA 1N62A 1JRPA 3NS1A 1QQRA 4N59A 2WLBA 4ZHOA 2J52A 1V1PB 2HTME 2WQYB 1T6BX 2V3NA 2FUG1 3URYA 3GP7A 2H89B 4TMAB 2WXIA 3MP9A 2BTEA 4NJCA 4FXCA 3W2DA 1DOYA 1SEBD 1SJHD 2BS4B 1PFDA 2W3RA 1XLQA 4L1BA 1FNWA 1N61A 1XXGA 2NTSA 5HG2A 3DWMA 2RDHA 2BB6A 1AN8A 1PDXA 3BK2A 1T3QA 1AWDA 3ZJTA 1XLNA 2ON8A 3AMZA 3ETRA 3TEWA 1OQRA 4OZBA 5I4DA 1ET9A 1JMLA 4YTPB 2JZPA 5D3IB 2R61A 2BBCA 4C7YA 2H88B 1K51A 1SF0A 3I57A 5EE9A 4J3OD 1ET6A 3U7ZA 4DXGA 4A55A 1XLOA 1KTKA 3LXFA 5EE3A 2JYTA 1XCTL 1FO4A 2D5GA 5BYQA 1SJED 2Z8LA 1XLPA 2MJ3A 2LUMA 4NAMA 2G9HD 1XEEA 3KQ4A 1PGAA 3Q8AA 1YJJA 1JWMD 4OZCA 3TEYA 1P7FA 2BYTA 4HKQA 1GPXA 3VRBB 2MEKA 4OW0A 1NYRA 2OHFA 2FE8A 1E0ZA 1AYFA 2KMMA 5FKAC 1I7HA 3BIID 4HROA 1XO3A 1TS3A 4JWSC 2AQ3B 4RGOS 3J9CA 1J7CA 1MI0A 1ZOYB 1GB4A 4C80A 2K5PA 2AX5A 1TZOA 1FEHA 1VDVA 4TQ1A 4XDDA 1FRRA 4RF0A 3GS2A 2XN9C 4L2YA 3AEBB 1VZ7A 5E6JA 1E9MA 4RF1A 5JXVA 1I4HA 4KGRA 3Q8EA 3NVVA 2L1AA 1V8CA 4ZOHC 1BUIC 1F2RC 3CWIA 5D3DA 2AQ2B 1SB3C 1DOIA 1I4PA 1F77A 5G5HA 3TUOA 1VRAB 2HDEA 3BYTB 3LYYA 4XE0A 2WNMA 2PMVA 1QKZA 4OHJA 2INNE 4L23A 1DYQA 1VLBA 2WU5B 4KKIA 1YQ3B 1UWXA 3SR6A 4A9AA 2PVOD 5H8YE 1QOBA 2INPE 3EGRA 2YEPB 2XNAC 1D5XC 2BW2A 3AE7B 1DOXA 2G1EA 1L0VB 2MJEA 1D5MC 1HA5A 4WWMA 4AS1A 1PYWD 4B0MA 1IUEA 3FILB 3KWLA 1WYGA 2ZW0A 4MT5A 3ZQ4A 5FR3A 5MPOA 4REZA 1ZXIA 2PLPA 4ZRQA 5T8IA 4GDKB 4AQ7A 5BMGA 3P4QB 1XCQL 3U52E 3T3NA 1CK1A 2Y3AA 1R7SA 4GLSC 5D7GA 2WS3B 3AEFB 1PGBA 1J7BA 1SBBB 2YEPF 2N9LA 1HXYD 2DYMA 1I4XA 2M19A 4ITKA 4WIPA 4R3DA 1FFUA 1MHHE 3P4PB 1EWCA 1RYJA 2IGHA 4RGNA 2W54A 1ROEA 4YTMB 1SIJA 4XWWA 4O1NA 2WXOA 3Q8BA 4JX1C 1HEZE 1IGDA 1JWAD 4P6VF 3W1SA 3CIRB 4IDIA 2V3PA 2JU6X 3E9SA 2QJLA 3AH7A 1ESFA 4KX6B 2QEJC 3SEBA 3HRDD 1L4ZB 1CZPA 3SFDB 2AQ1B 1ZXHA 1PGXA 3Q69A 1C79A 3ZGZA 1ACCA 1BXTA 3HVDA 5FK9C 3T3OA 3IXSA 3AECB 1WXQA 4N58A 1GB1A 1MPEA 1SE4A 3AN1A 2L83A 3BVGA 2WDRB 3FAHA 1FNVA 1WSPA 2M56B 4YT0B 1TKGA 4A6QA 1ZDVA 2CU3A 2LFIA 3NRZA 2WXNA 4JPSA 1HZ6A 4N6EB 5C2TB 2W3SA 2GI9A 1YN3A 1TKYA 1SXTA 2JWUA 4KGSA 2VZKB 1QLBB 3AE1B 3AEDB 5AUIA 3EUB2 5BYRA 4OZAA 5BMIA 2ICIA 1KRHA 1VZ6A 2J42A 3MJ5A 1NYQA 3B2GA 1UUPA 3NVZA 1FIQA 2E6XA 1TY2A 1M4VA 3RPFC 2KDMA 2I38A 2IPKD 1WWTA 3AE6B 1FCLA 3E56A 3BWUD 3MC0B 1WRIA 3ZJUA 3R2TA 1TJEA 4LLGM 4LK0M 4A90A 3AV8A 3IT6B 1HZ5A 2DLBA 4A8XC 1L6UA 4HJGE 1C76A 2WU2B 2QMTA 3Q8FA 1TKEA 5HFYA 4JWUC 1FXAA 3W5VB 3R8BA 2JYEA 1C4CA 2B76B 1A70A 1NVID 3W9CB 4RFBA 1Y56A 2RPVA 3GB1A 1N60A 2PTLA 2DYOA 2WXPA 2BT6A 4UDUC 2EKIA 1ZUD2 1N5WA 4EE2A 4Q2JA 1LO5D 2JSVX 3PZ8A 2V4IB 2L32A 3AE8B 3AEGB 1NEKB 3HUIA 4RGTA 2GRIA 2K3UA 3MHZA 4ZHPA 1WGKA 2WXQA 2ZW1A 3U4EG 2BS3B 2Y5CA 1Q10A 1JROA 4US9A 1KLUD 1MVKA 1QOGA 2QILA 3BVZA 3VRAB 2CJOA 2LGIA 3P4SB 3R2IA 4DXFA 1D5ZC 1JALA 2TSSA 1ZP0B 1C77A 1V97A 1IBXA 1IGCA 3IAM1 1TS4A 1TYGB 5HHDG 1QF6A 3PO0A 1D4BA 5GXGB 1OQQA 3FC4A 3RFZB 2PW9A 3NVWA 1E10A 2WXLA 2V0GA 2DWQA 2BS2B 1YQ4B 3VQIA 2IGGA 1L4DB 1FD6A 2IGDA 3L4PA 1YMHE 1C9FA 1ZDXA 1OFFA 2J4XA 2LHDA 4ZRPA 2W55A 1C4PA 2RDGA 2WP9B 1YNTE 3VR8B 1RWSA 2WXRA 4RNAA 4P16A 1JWBD 5BMHA 1FMAD 4NAWB 2K9XA 5EE1A 4ARIA 1FFVA 1UNSA 1KH0A 3Q8CA 2VZKD 3B9JA 4ARCA 2RMMA 4MM3B 2WXFA 3P1MA 1XF5L 1I4RA 2ONQA 1TS2A 3NZ3A 4JE3B 1V1PA 4C56C 1RM6C 1EU4A 2WXKA 1EWYC 4MH8A 1EM7A 5H92C 2M0AA 2QSDA 3AB5A 4WURA 4YWGG 4NZLB 2WXHA 1STEA 3BVMA 1I4QA 1PUTA 1QOFA 4TQ0A 4LTUA 3I9V1 1JWSD 3SFEB 1J7AA 2KN4A 3V3XA 2KACA 4WQMA 3ZYYX 4D2KA 3MFGA 2LEKA 4WAFA 1EU3A 2WDVB 1VZ8A 1T5XD 1N5XA 1L0YB 3KLSX 4USAA 1QT9A 1C78A 1UGJA 2WDQB 4M0WA 1BMLC 2X38A 3IT4B 5HI1A 1FCCC 1F2RI 3AE4B 3H8HA 1AW7A 3BZDB 1C4AA 1CJEA 1ENFA 1ZPSA 3NUHB 3BYYB 3O13A 5TSSA 1D6EC 3AE3B 2E3TA 3V05A 3BK1A 1YJIA 1UWMA 4IKGA 2IDYA 3TEZA 1JQ4A 3B2FA 3AEAB 4HRSA 2JX5A 4HKZE 4YSYB 1B9RA 3UI3A 1DGJA 3ABVB 1HQRD 3IAS1 2N7JA 2QIEB 1YN4A 1TS5A 1K50A 1QILA 1RFKA 2WXGA 2GB1A 1NENB 2MH7A 2MJDA 4YTNB 1L0XB 4US8A 2SEBD 1FNUA 2LHEA 3NVYA 3HVZA 1GOZA 3W5UB 1V1OA 2NTTA 2KWDA 2ACZB 3PZ7A 1L5PA 2WXMA 1E6EB 2Y5PA 1KFYB 3VR9B 4KKJA 3N9YC 1ZE3D 2L52A 3P42A 4RH6A 3AE2B 3C8YA 2OEDA 1QOAA 4KGTA 5AUKA 4YXDB 1E7PB 1GAQB 2Q5WD 3TSSA 1JW9D 4TSSA 2KAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5G A;  3PZ7 A;  1WSP A;  4WIP A;  3PZ8 A; 
#chains in the Genus database with same CATH topology
 1E7V A;  3P4R B;  3DBS A;  3RMK C;  3HHM A;  1YN5 A;  1JWU D;  2LMC A;  4XWT A;  4AP4 C;  1TBE A;  3AM9 A;  3RCZ A;  3UGB B;  1J0G A;  4C7Z A;  2PKO A;  3RNA C;  4J6I A;  2DAJ A;  2NBW B;  2PVG C;  2I2Y A;  2G4S A;  4GGQ A;  4W9J A;  4KZ0 A;  2N0S B;  1E5W A;  4DQO C;  2K39 A;  4HEA 1;  3U30 A;  4GDL B;  3TEX A;  3QWZ B;  1B1Z A;  4XDC A;  3LB8 C;  2NMQ A;  2WGS A;  3H9D A;  4M01 A;  3UIP B;  3N32 A;  2KKC A;  3W1S C;  1U4A A;  3AE9 B;  5BYS A;  2KK8 A;  2DBY A;  3PVL A;  5EE0 A;  1SE3 A;  1WGD A;  3APC A;  1CQV A;  3DBH I;  2KTR B;  2K8C A;  4ZYS A;  2EEL A;  1L7Y A;  3NOB A;  1I4G A;  1K52 A;  4FHJ A;  4XZ4 A;  4ICV A;  2KFJ A;  1V1P B;  2MBH A;  2N9E B;  3QX1 A;  2IZV B;  1TZ1 A;  4RMA A;  3L08 A;  2KLG A;  3W2D A;  2GBJ A;  4FJV B;  2MBE A;  1XLQ A;  1BT0 A;  2N9X A;  2NTS A;  3Q3N C;  1GG3 A;  1KM7 A;  1WI0 A;  3KW5 B;  2KNB A;  2FID A;  2KFK B;  1AWD A;  3JSV B;  3ETR A;  1OQR A;  3C19 A;  4OZB A;  3PPA A;  2HTH A;  4YTP B;  5D3I B;  3IVF A;  2R61 A;  4JL9 A;  3N20 C;  1V81 A;  4DXG A;  3T9L A;  4JIO U;  5CTR C;  4MDK E;  1T0Y A;  4M02 A;  1WGY A;  4EZL A;  1LFD A;  1OQY A;  3DVN U;  1GPX A;  2CR5 A;  4II3 B;  2MEK A;  1E0Z A;  4PK1 A;  1VD2 A;  1AYF A;  2OOB B;  4JWS C;  3I63 C;  4RGO S;  2D3B A;  1J7C A;  3J9C A;  5IAA C;  1GB4 A;  5L83 A;  2K6D B;  1TZO A;  1CMX B;  3N1X C;  3EEC A;  4PS8 A;  4XDD A;  1FRR A;  1Y8R C;  5E6O A;  3Q8E A;  2FCM A;  2L3Z A;  3N1Y C;  1F2R C;  4LNO A;  1HTO A;  3ZDT A;  5CHW A;  3DOW A;  5G5H A;  2NS5 A;  2M8S A;  3TUO A;  3BYT B;  3CF6 E;  1C3T A;  2BWF A;  5JZE B;  3DHG C;  1V9J A;  1NDD A;  4KKI A;  1WGG A;  1YQ3 B;  4A9A A;  5H8Y E;  2AL6 A;  3ONS A;  1L0V B;  2K25 A;  1D5M C;  4AS1 A;  5GMV A;  1PYW D;  4B0M A;  2BGF A;  1R4N B;  2ZW0 A;  3ZQ4 A;  4PYU A;  5T8I A;  2MX2 A;  4AQ7 A;  4KV2 A;  3DBL I;  1XCQ L;  2Y3A A;  4W9G A;  2O6V D;  1WJ4 A;  1Z2M A;  4OVU A;  2D10 A;  2N9L A;  2DYM A;  4LNF A;  4ITK A;  4WJN A;  1EWC A;  4GSW A;  4G0N B;  4RGN A;  3HK0 A;  1ROE A;  2D11 A;  4O1N A;  2HJ1 A;  1UZX B;  3SHQ A;  1JWA D;  3BY4 B;  4WWO A;  1P9D U;  3TBL D;  4MM3 A;  2G3Q B;  2N4F A;  4I6N B;  3SFD B;  1PGX A;  2ZVN A;  1ACC A;  3O65 B;  3AU4 A;  3AN1 A;  4KVG B;  3UIO B;  3MTN B;  3BVG A;  3FAH A;  2M56 B;  1TKG A;  2MWS B;  2KJ6 A;  2W3S A;  5J2R A;  2KMA A;  1T0R C;  4DK5 A;  2VZK B;  3QK0 A;  3AE1 B;  4W9F A;  2BYE A;  3B1L X;  3EUB 2;  2LVP A;  4OZA A;  1TTN A;  1VZ6 A;  1YQB A;  1FIQ A;  2L76 A;  2KVR A;  2KDM A;  1E90 A;  1WWT A;  3M63 B;  3MC0 B;  3ZJU A;  3A4S C;  1TJE A;  4LK0 M;  4A90 A;  3AV8 A;  2CS4 A;  2ZVO A;  3IT6 B;  2DLB A;  2WHI A;  1TKE A;  2D3A A;  2DHZ A;  3EFU A;  3R8B A;  1WX8 A;  1C4C A;  2NR2 A;  3MJW A;  4AJY B;  2R2O A;  2W9N A;  1J8C A;  4HJK A;  3N3K B;  4Q2J A;  1LO5 D;  2N1W A;  1M94 A;  4KDL B;  4HPL B;  1NEK B;  4C00 A;  3HUI A;  4HK2 A;  4KZC A;  3KUD B;  2WXQ A;  4PS7 A;  2ZW1 A;  3ZVV A;  3PHW B;  3U4E G;  2L7R A;  3OJ4 B;  3AXC A;  2Y5C A;  1Q10 A;  2N7E A;  2KQS A;  1MVK A;  2QIL A;  1JAL A;  1ZP0 B;  1IBX A;  3IAM 1;  5HHD G;  2EMT A;  5J17 A;  2K1F A;  3PRM B;  4DBG A;  3PGE A;  2D07 B;  1OQQ A;  3L16 A;  3V60 A;  2WXL A;  2KDB A;  1LGR A;  1UH6 A;  1YQ4 B;  3P2B A;  2PJH A;  3WAO A;  1L4D B;  3B0A A;  1XT9 B;  1YMH E;  3L4P A;  2J4X A;  3K9P B;  2RDG A;  3A9J A;  2XK5 B;  1JWB D;  1FFV A;  2N7D A;  3RNB C;  5AZF A;  2KDI A;  1EU4 A;  3PT2 B;  4II2 B;  4MH8 A;  4YWG G;  5IOI A;  3WAP A;  4I6P A;  1PUT A;  3I5J C;  3UQB A;  4WQM A;  1WF9 A;  3MFG A;  1T5X D;  5IA7 A;  2L8J A;  3KLS X;  1C78 A;  1UGJ A;  2WDQ B;  1BML C;  2RR9 A;  2YLM A;  2KVZ A;  4AJW A;  5HI1 A;  3AE4 B;  1CJE A;  4NY0 A;  5TSS A;  2PE9 A;  2M1M A;  1L2N A;  3V05 A;  4IKG A;  4URK A;  2LUE A;  1WGH A;  3B2F A;  3KUZ A;  3AEA B;  1B9R A;  3UQA A;  3L13 A;  1ISN A;  3IAS 1;  3CST A;  3TCA A;  1K50 A;  1QIL A;  4HWI B;  2WXG A;  2MH7 A;  2MP2 A;  1F1H A;  3OAW A;  4YTN B;  2FAZ A;  4MGZ E;  1P98 A;  2HJ8 A;  3NVY A;  2KWD A;  2ACZ B;  4B95 A;  4C4V B;  2Y5P A;  4KKJ A;  2PE6 B;  2WX1 A;  2VH2 A;  5AUK A;  4YXD B;  2JUO A;  1GAQ B;  3DDC B;  3TSS A;  4A8X C;  3A9K B;  4TSS A;  2KAJ A;  1ZKH A;  3QIJ A;  4X57 B;  4MJS B;  2KDF B;  1P7E A;  2O2V B;  2FBW B;  2RGF A;  2K8H A;  1VR9 A;  2VH1 A;  1JRU A;  2IO1 B;  1L6V A;  3EC8 A;  3DVG X;  3PV1 A;  2K0P A;  3M95 A;  2IJ0 A;  2MA9 B;  2K22 A;  3ML8 A;  4LDT D;  4BFR A;  3EA6 A;  3WCQ A;  1FRD A;  5LNK 1;  2YVC A;  3NY5 A;  4OVZ A;  1KLG D;  1VJK A;  2KQ4 X;  3ECI A;  4YSZ B;  4YSX B;  5G5G A;  4IOI E;  2NPT A;  4NNJ B;  2KO3 A;  2KWV B;  2BB5 A;  2N9K A;  5J18 A;  4LNN A;  4DDG D;  2JF5 A;  2KJR A;  3U8Z A;  2KYW A;  3NS1 A;  1QQR A;  2HTM E;  4XX5 A;  3Q3F A;  2ZPY A;  2FUG 1;  2BWE S;  4HCP B;  2KJH B;  3GE8 C;  4TMA B;  1G6J A;  3MP9 A;  5D6J B;  4ZRI A;  2BTE A;  1EO6 A;  1UF0 A;  1SJH D;  1PFD A;  4G50 A;  4L1B A;  3ZW3 A;  3RD2 A;  2V4L A;  2IO0 B;  3ZJT A;  4M0W B;  3AMZ A;  5G55 A;  1WGR A;  2G4D B;  2FUH B;  2H88 B;  1SF0 A;  1ET6 A;  4W9I A;  5KHQ A;  3LXF A;  5EE3 A;  1FO4 A;  2JYT A;  2PEA A;  4K3B A;  5BYQ A;  4ICU A;  2LUM A;  2JY6 A;  2G9H D;  1XEE A;  3KQ4 A;  2LI5 A;  4CHK A;  3CSF A;  4OZC A;  2D2Q A;  5FKA C;  2KMM A;  4YL8 A;  1FPY A;  3JW0 X;  3RUI B;  3ZRC A;  1RAX A;  2AQ3 B;  3X0W A;  4TKN A;  4ZDV A;  1P3Q U;  2LD9 A;  2GBM A;  2V3S A;  2OJW A;  4TQ1 A;  4RF0 A;  2WDT B;  4L2Y A;  2REX A;  1UBI A;  5E6J A;  1E9M A;  4RF1 A;  5JXV A;  1I4H A;  3Q3J A;  4ZOH C;  1BUI C;  3MC8 A;  5D3D A;  2AQ2 B;  1SB3 C;  1F77 A;  2BVC A;  1VRA B;  4FN2 A;  2PMV A;  1OEY J;  3QAR A;  3V61 A;  4OHJ A;  5BO4 B;  3ZNG C;  3WIM A;  4L23 A;  1DYQ A;  2WU5 B;  1QOB A;  4NPN A;  1IYF A;  1SIF A;  3EGR A;  1WR6 E;  2XNA C;  2FCS A;  3AE7 B;  4EEW A;  1HA5 A;  4WWM A;  4ASW C;  1ZGU B;  3KWL A;  5FR3 A;  1A5R A;  2JZZ A;  2HE7 A;  4BBN C;  3H7S A;  2AEH A;  2YEP F;  3U7D A;  2M19 A;  1MHH E;  1GUA B;  2Y5B B;  1XQQ A;  3RNF C;  4XWW A;  2WXO A;  4PS3 A;  3Q8B A;  4WWP A;  4NAW A;  3R66 C;  4W9E A;  3CIR B;  4IDI A;  4LNK A;  1EUV B;  2DZM A;  3E9S A;  1ESF A;  3SEB A;  3HRD D;  1L4Z B;  1D3Z A;  2AQ1 B;  1ZXH A;  1WM3 A;  3Q69 A;  1C79 A;  3V6C B;  3ZGZ A;  3HVD A;  1R4M B;  2I1K A;  3T3O A;  1YX6 B;  4N58 A;  1GB1 A;  1UGM A;  3ZNZ B;  1WJN A;  1WSP A;  4YT0 B;  4OVV A;  2LFI A;  2WXN A;  4JPS A;  5EDS A;  3RZF A;  4N6E B;  2GI9 A;  1SXT A;  4WJO A;  1QLB B;  2ZZP B;  3R7R A;  2ICI A;  3PRP B;  3MJ5 A;  1NYQ A;  3RUL A;  2GBR A;  2D3C A;  1GJZ A;  4K7U A;  3AE6 B;  3E56 A;  1V2Y A;  2KAN A;  2MBQ A;  3R2T A;  4LLG M;  1VCB A;  3MHS D;  2LGY A;  1I35 A;  1L6U A;  2WU2 B;  3Q8F A;  5HFY A;  4JWU C;  1FXA A;  3HM3 A;  3H1U A;  1A70 A;  1S1Q B;  1N60 A;  2N1V A;  1Q5W B;  4XGA B;  2DYO A;  2WXP A;  3ZLZ A;  4W9L A;  4UDU C;  2EKI A;  5DPS A;  2JSV X;  3PZ8 A;  3AE8 B;  2L32 A;  4NQL B;  4RGT A;  4ZRK A;  3DBR I;  5KHO A;  3VH3 B;  1S3S G;  1WGK A;  2BQQ A;  4EZJ A;  2BS3 B;  3RT3 B;  2XBB C;  3KH0 A;  3QAQ A;  2LAS A;  1JRO A;  3Q2A C;  5IN7 A;  3CMM B;  4IM0 A;  3VHT C;  1QOG A;  3BVZ A;  4ZRJ A;  2LGI A;  3P4S B;  3R2I A;  3VUW A;  3H7P A;  4BVU C;  3AI5 A;  2K6Q A;  1HE8 A;  3PO0 A;  4I6L B;  1E8Y A;  4AWJ A;  1D4B A;  5GXG B;  1KJT A;  2MBO A;  3FC4 A;  3RFZ B;  2V0G A;  3TIX A;  2I1J A;  1P0R A;  3V62 A;  4EKU A;  3VFK A;  3ZO5 B;  2IGG A;  2KTF A;  3IBE A;  3OG5 A;  4ANX A;  1GNU A;  2WYQ A;  4MSM B;  2WXR A;  4RNA A;  4P16 A;  1TGZ B;  4LDT B;  2B3A A;  2J0M A;  2RMM A;  4MM3 B;  5IKC M;  2GBK A;  4C56 C;  3NZ3 A;  1WIA A;  1RM6 C;  2CU1 A;  2WXK A;  5H92 C;  2QSD A;  4WUR A;  2FIF A;  2WXH A;  1QZE A;  2LGX A;  4GXB A;  1K8R B;  1JWS D;  5CHV C;  1J7A A;  2KN4 A;  3V3X A;  3VXW A;  2IYD B;  2CHX A;  2LEK A;  3A1Q A;  4WAF A;  1VZ8 A;  1N5X A;  3PZD A;  1QT9 A;  3V6E B;  2X38 A;  4DWF A;  1F2R I;  1H4R A;  2LVQ A;  4WAA A;  3BYY B;  2KN5 A;  1EF5 A;  3BK1 A;  1UWM A;  3VVW B;  3M3J A;  4BOS C;  2JZ3 B;  3RNE C;  3SDL C;  3TEZ A;  4W9H A;  3UI3 A;  1DGJ A;  3ABV B;  2N7J A;  1TS5 A;  2NVU I;  2JVC A;  1LM8 B;  4LJO B;  2GB1 A;  3NHE B;  5JHA A;  2KLC A;  1WZ0 A;  3DBH B;  2LHE A;  4KSK C;  1V1O A;  1E6E B;  1KFY B;  4ACF A;  2WWZ A;  3VR9 B;  2IO2 B;  1ZE3 D;  2G45 B;  2A5U A;  1E7U A;  3X23 A;  4TV3 A;  4K81 A;  1JW9 D;  3VAW A;  2C7H A;  2KHW B;  1WXS A;  4JQW C;  2IND C;  5C3J B;  4RCO A;  4MSQ B;  2JRI B;  2LWP A;  2J53 A;  3ZRF A;  3KWV A;  3HM6 X;  1FM0 D;  4KSL C;  3GZN I;  1MHX A;  1IBX B;  3ZJV A;  4HLE A;  3QQ8 B;  3TJP A;  2C7M B;  3UF8 A;  3U2S C;  4EFO A;  1WX7 A;  2JXT A;  3K9O B;  4IG7 B;  4M8N A;  4NJ6 A;  2DX5 B;  1WE6 A;  1N63 A;  1GC6 A;  3FIL A;  3TL5 A;  1UBQ A;  5IO9 A;  4GDK A;  4CQN A;  5E6P A;  2JQR B;  3A9J B;  4DHZ B;  2KD0 A;  2IO3 B;  2KQ7 A;  2R2Q A;  2KT7 A;  5AZH A;  1WMH A;  2QHO A;  2WXJ A;  4DHJ D;  4N59 A;  2WLB A;  2J52 A;  1T6B X;  2V3N A;  3URY A;  1UEL A;  2H89 B;  2WXI A;  4MEM A;  3ZXV A;  2MRP A;  4NJC A;  1WXV A;  1SEB D;  2ZPN A;  2BS4 B;  2W3R A;  1OTR B;  1XXG A;  1Q1O A;  5CHF A;  1MG8 A;  5HG2 A;  3DWM A;  3APD A;  2RDH A;  5FR6 A;  3ZNI D;  1AN8 A;  3ZNH B;  5HKH A;  1XLN A;  2ON8 A;  4F1S A;  5I4D A;  2KXJ A;  2JXX A;  2BBC A;  4C7Y A;  1K51 A;  2KWU B;  3I57 A;  5EE9 A;  4J3O D;  4QAY A;  3U7Z A;  4A55 A;  2NBV B;  2KX0 A;  2Z8L A;  2V1Y A;  1XLP A;  4NAM A;  4DDI D;  3RZW C;  1YJJ A;  1JWM D;  1V5O A;  2GLS A;  3TEY A;  2BYT A;  2MP2 B;  3VRB B;  2OHF A;  3DBL B;  4XYC A;  4B6W A;  3BII D;  3ZXR A;  1TS3 A;  2FCQ A;  4ANW A;  3NJT A;  3D32 A;  1MI0 A;  2MHJ A;  2K5P A;  2AX5 A;  4N9F 4;  1FEH A;  1VDV A;  3DVG Y;  1VZ7 A;  4A3P A;  5LXI B;  2L1A A;  4FAD A;  1V8C A;  3LJ3 A;  4GN1 A;  4IWO A;  3RYT A;  4F7Z A;  4E3C A;  1DOI A;  2L00 B;  2HDE A;  2A4Z A;  3LYY A;  5D2M B;  4XE0 A;  3NS8 A;  1QKZ A;  2DNF A;  2M0X A;  1VLB A;  4BKS A;  4EOY A;  1UWX A;  3DHI C;  1R4M I;  1WH3 A;  3SR6 A;  2PVO D;  3EFC A;  2BW2 A;  2G1E A;  1PQS A;  3L10 B;  4KIK A;  4BOZ B;  1IUE A;  1WYG A;  2NPT B;  2C7N B;  4MT5 A;  5MPO A;  4REZ A;  3P4Q B;  1CK1 A;  3ZIM A;  1R7S A;  5D7G A;  2RDB C;  2LRU A;  1PGB A;  4K7W A;  4EZK A;  1I4X A;  2JRH A;  2BYV E;  5C23 A;  4WIP A;  4W9K A;  2L0F A;  2D3G A;  3P4P B;  3VH4 B;  2IGH A;  4YTM B;  1SIJ A;  4E71 A;  4WJQ A;  1WY8 A;  3VUY A;  4JX1 C;  1IGD A;  4P6V F;  2JT4 B;  3RN9 C;  1Q0W B;  4W9D A;  3QC8 B;  1OGW A;  3AH7 A;  3R3M A;  1NI2 A;  1BXT A;  2L0T A;  4MH0 E;  3IXS A;  3AEC B;  1E8W A;  1F52 A;  1WXQ A;  4FLH A;  2L83 A;  3RNG C;  3PHX B;  4A6Q A;  1ZDV A;  1YX5 B;  3ZTD A;  5C2T B;  2VRR B;  1TKY A;  4KGS A;  1R4N I;  1KLV A;  2Z0E B;  4ZYN A;  3FKY A;  3KVF B;  3OJ3 A;  5AUI A;  3NZS A;  5BYR A;  5BMI A;  2J42 A;  5JH5 C;  4MGK E;  3A4R A;  1UUP A;  3NVZ A;  2E6X A;  1TY2 A;  3RPF C;  1TIF A;  3VTW A;  4ANV A;  2IPK D;  1FCL A;  5TR5 A;  3BWU D;  4GU2 A;  3SU8 X;  1WRI A;  3QCA A;  3L0W B;  1MJD A;  2FCN A;  2QMT A;  1T0Q C;  2BKR B;  2MBB B;  3W5V B;  2JYE A;  1NVI D;  3W9C B;  2RPV A;  2PTL A;  5E6N A;  3ZTC A;  2BT6 A;  4AOF A;  1ZUD 2;  1N5W A;  1WM2 A;  2QCZ A;  4EE2 A;  1C1Y B;  2V4I B;  3QJZ A;  3AEG B;  1NBF C;  2GRI A;  4BZA A;  3QHT A;  4JGH B;  5LXH A;  2LVO A;  2KZR A;  4NQK E;  1YJ1 A;  1KLU D;  1H8C A;  3WAN A;  1TS4 A;  4B9K A;  3PRZ A;  5D94 A;  4GDL A;  4FUL A;  4A20 A;  2M17 A;  2BKF A;  2BS2 B;  2DAF A;  3L17 A;  4BKG A;  2IGD A;  2KC2 A;  1C9F A;  4ZRP A;  1ZW7 A;  3C0R B;  1C4P A;  2EMS A;  2WP9 B;  1YNT E;  1RWS A;  2KTR A;  1FMA D;  4NAW B;  2K9X A;  3VTU A;  2Z0D B;  4ARI A;  3B9J A;  3P1M A;  2WXF A;  1I4R A;  1TS2 A;  4JE3 B;  1V1P A;  2J0K A;  3BIN A;  3AB5 A;  4HVB A;  1STE A;  1I4Q A;  4XC2 A;  3I9V 1;  3SFE B;  3H6N A;  2C5L C;  3ZYY X;  1EU3 A;  2WDV B;  1L0Y B;  2KFK A;  3JSV A;  4IM2 A;  3Q6B A;  4G11 A;  3APF A;  1WE7 A;  1FCC C;  4DHJ B;  3H8H A;  4BBN F;  1AW7 A;  3NUH B;  1ZPS A;  3ENE A;  1LQB A;  4DHZ E;  2E3T A;  4WJP A;  1YJI A;  1JQ4 A;  4HPM B;  3JVZ X;  4HRS A;  2JX5 A;  4YSY B;  4BKS D;  1HQR D;  2QIE B;  2ZCC A;  1RFK A;  1OEY A;  2MJD A;  4FBJ B;  4CYE A;  3IHP C;  2NBU A;  1EF1 A;  3HVZ A;  2DZJ A;  1GOZ A;  3Q3M C;  2NTT A;  5L95 C;  2Z59 B;  3PZ7 A;  2V9H A;  1L5P A;  2M4N A;  2WXM A;  5DCN A;  2MQJ A;  3N9Y C;  1V49 A;  3P42 A;  1IPG A;  4RH6 A;  3C8Y A;  4KGT A;  4P7I A;  4W9C A;  4RM9 A;  1E7P B;  2Q5W D;  1SE2 A;  2CJN A;  1NI3 A;  4MAC A;  2MSE D;  1UD7 A;  4PT5 A;  1KF6 B;  2LXC A;  1SSN A;  1X1M A;  3H7P B;  4NJ7 A;  4WH4 A;  1TY0 A;  1KOT A;  5DPT A;  1F0Z A;  2W82 A;  3SD5 A;  2ZEQ A;  4RGM A;  2LJI A;  1V80 A;  3DWG C;  1JCK B;  4HCN B;  1FXI A;  2SAK A;  1YOV B;  4M00 A;  2RPQ A;  2QDF A;  2GMI C;  4H2A A;  1MFW A;  3N1Z C;  1K53 A;  2PIA A;  3OLM D;  3AEE B;  2J0J A;  3NG0 A;  4B0E A;  1WXM A;  2GOW A;  1FXT B;  3OWE B;  1WJU A;  3AE5 B;  3P63 A;  1N62 A;  1JRP A;  4S17 A;  4ZHO A;  2ASQ A;  1IP9 A;  2WQY B;  3GP7 A;  3PRE A;  4FXC A;  1YD8 U;  1DOY A;  1FNW A;  1N61 A;  2BB6 A;  3A1Q B;  2GBN A;  1PDX A;  3BK2 A;  4K7S A;  1T3Q A;  4FA6 A;  3PTF C;  3TEW A;  1WRD B;  1ET9 A;  1JML A;  2JZP A;  2C60 A;  1WZ3 A;  1Z5S B;  1XLO A;  3AU5 A;  5JHB A;  1KTK A;  1WXA A;  5LLI A;  1XCT L;  2D5G A;  4A3O A;  1SJE D;  2RD0 A;  5IP4 D;  2JWZ A;  2MJ3 A;  4LCD E;  4M8M A;  3S2A A;  3MC9 A;  1AAR A;  3Q8A A;  1PGA A;  4HKQ A;  1P7F A;  2ZCB A;  2KX3 A;  4OW0 A;  1NYR A;  1RRB A;  2ZNV B;  3DCG A;  2FE8 A;  1I7H A;  4GMV A;  4HRO A;  1XO3 A;  3JYU A;  1ZOY B;  1LXD A;  4C80 A;  4S0R A;  4JLC A;  2FNJ B;  4K3C A;  2DEN B;  4IWP A;  3GS2 A;  2XN9 C;  3AEB B;  2LJ5 A;  4MGI E;  4HPP A;  4AUQ C;  4KGR A;  1TT5 B;  4HDQ A;  3NVV A;  3CWI A;  2UYZ B;  3Q3O C;  1GC7 A;  3PLU A;  4ANU A;  1I4P A;  4FJY A;  2WNM A;  1F9J A;  4K1R B;  2INN E;  4TUU A;  3GE3 C;  1P1A A;  3RI7 C;  2PPH A;  2BF8 B;  4DXA B;  2INP E;  2YEP B;  1D5X C;  1DOX A;  2HD5 B;  2MJE A;  4F8C B;  4IC7 B;  1V6E A;  2OJR A;  3FIL B;  3RNC C;  1SGH A;  1ZXI A;  2PLP A;  4ZRQ A;  4GDK B;  5BMG A;  1RFA A;  3U52 E;  3T3N A;  4GLS C;  4IUM B;  4WWN A;  2WS3 B;  3AEF B;  1HTQ A;  4FJZ A;  1J7B A;  1WMH B;  1SBB B;  1HXY D;  2UWQ A;  2MCN B;  4R3D A;  3ZKJ C;  1FFU A;  1RYJ A;  2W54 A;  1XD3 B;  1MG4 A;  3ZUN A;  3VUX A;  2NCN A;  2CHW A;  4P1B C;  2XK5 A;  4KDI C;  2MW5 A;  1HEZ E;  3AUL A;  2X8X X;  3W1S A;  5AZG A;  3LDZ E;  2CKH B;  2AYO B;  1V86 A;  2V3P A;  2KC1 A;  2JU6 X;  2QJL A;  4KX6 B;  2MLB A;  2QEJ C;  1CZP A;  2LGS A;  2IY0 B;  2KDE B;  3KUC B;  2ZJD A;  5FK9 C;  3DBR B;  1MPE A;  2LGD A;  1SE4 A;  2WDR B;  4EUT A;  2AL3 A;  2EKE C;  1FNV A;  5CX3 A;  2CU3 A;  2IY1 B;  3NRZ A;  1J19 A;  2N9P C;  1HZ6 A;  4RM8 A;  4IM3 A;  1YN3 A;  2JWU A;  2XEW A;  2DYB A;  3AED B;  3WA0 A;  1N6Z A;  1WR1 A;  1WYW B;  3WAM A;  2L05 A;  2DZK A;  3ML9 A;  4G3X B;  1KRH A;  3B2G A;  1M4V A;  5DPR A;  4P1C C;  2I38 A;  3B08 A;  2KWC A;  3IG3 A;  4LJP B;  3KYD D;  3W1Y A;  2KOX A;  1HZ5 A;  4HJG E;  1C76 A;  2RSU A;  3M62 B;  3R7Q A;  4C4V A;  2B76 B;  5G2N A;  3IFW B;  4RFB A;  1Y56 A;  3GB1 A;  1WJ6 A;  4HDO A;  1V5T A;  1E8X A;  3VTV A;  3A9K A;  3WAL A;  3EHV A;  4MJS A;  1YIW A;  5DPW A;  2O2V A;  2K3U A;  3MHZ A;  4ZHP A;  2UU7 A;  3DVN V;  2LXA A;  4KIK B;  3I3T B;  4US9 A;  3NZU A;  3VRA B;  2CJO A;  4DXF A;  1D5Z C;  2TSS A;  3PS6 A;  4MEL A;  3VDZ A;  1C77 A;  1V97 A;  3ZDM C;  1IGC A;  2CHZ A;  1TYG B;  3PLV A;  1QF6 A;  3DQV A;  4GIV A;  2PW9 A;  3NVW A;  1E10 A;  2DWQ A;  2QC8 A;  4CO7 A;  3VQI A;  4PYZ A;  1FD6 A;  1ZDX A;  1OFF A;  2LHD A;  5C1Z A;  2BPS A;  3ALB A;  2W55 A;  3VR8 B;  3A33 B;  1I42 A;  5BMH A;  5EE1 A;  4GB9 A;  2BYF A;  4GOC A;  1UNS A;  1KH0 A;  3Q8C A;  1T0S C;  2K8B A;  2VZK D;  4MGY E;  4ARC A;  5AEK B;  1XF5 L;  2ONQ A;  3HIZ A;  1EWY C;  1EM7 A;  2M0A A;  3TMP B;  4BAX A;  4NZL B;  3BVM A;  2AWT A;  3UIN B;  4HXD A;  1E8Z A;  1QOF A;  2KMC A;  4TQ0 A;  4LTU A;  3N30 A;  3DHH C;  2ZNV C;  2KAC A;  4D2K A;  4LNI A;  2O6V B;  2O6V A;  2LRW A;  4IWQ A;  3GZN B;  4USA A;  4M0W A;  1WFY A;  3Q14 C;  3QA8 A;  4BKT A;  3GOE A;  3IT4 B;  3BZD B;  1C4A A;  1ENF A;  3O13 A;  3T8M A;  1D6E C;  2INC C;  3AE3 B;  2IDY A;  4HKZ E;  2DZI A;  2JPH A;  1WX9 A;  2WX0 A;  1YN4 A;  2C9W B;  1SE9 A;  4E74 A;  4WQO B;  1NEN B;  1L0X B;  1RLF A;  2SEB D;  4US8 A;  2IBI B;  1FNU A;  3W5U B;  3DPD A;  4IW0 A;  3KYC D;  4FHK A;  2J7Q B;  2L52 A;  2LZ6 A;  3AE2 B;  2OED A;  1QOA A;  3L54 A;  3PSE B; 
#chains in the Genus database with same CATH homology
 1SE2 A;  1P7E A;  2CJN A;  1NI3 A;  3P4R B;  5C3J B;  4RCO A;  2FBW B;  1YN5 A;  1JWU D;  2LMC A;  4MAC A;  4PT5 A;  4XWT A;  1KF6 B;  3AM9 A;  2J53 A;  3KWV A;  1VR9 A;  4C7Z A;  2PKO A;  1FM0 D;  1SSN A;  2PVG C;  1MHX A;  2I2Y A;  1L6V A;  1IBX B;  2K0P A;  3ZJV A;  2N0S B;  2IJ0 A;  2K22 A;  4WH4 A;  1TY0 A;  3EA6 A;  3WCQ A;  1FRD A;  5LNK 1;  4DQO C;  4HEA 1;  1F0Z A;  3U2S C;  2W82 A;  4GDL B;  4OVZ A;  2JXT A;  3TEX A;  1B1Z A;  4XDC A;  3LB8 C;  2NMQ A;  1KLG D;  1VJK A;  2KQ4 X;  4RGM A;  2LJI A;  4YSZ B;  4YSX B;  3DWG C;  1N63 A;  1JCK B;  5G5G A;  3AE9 B;  1FXI A;  2SAK A;  3FIL A;  5BYS A;  4IOI E;  2DBY A;  4H2A A;  2BB5 A;  4CQN A;  5EE0 A;  2N9K A;  1SE3 A;  1K53 A;  2JQR B;  2PIA A;  1CQV A;  3AEE B;  4B0E A;  2EEL A;  4ZYS A;  1I4G A;  3OWE B;  1K52 A;  3AE5 B;  3P63 A;  2WXJ A;  1N62 A;  1JRP A;  3NS1 A;  1QQR A;  4N59 A;  2WLB A;  4ZHO A;  2J52 A;  1V1P B;  2HTM E;  2WQY B;  1T6B X;  2V3N A;  2FUG 1;  3URY A;  3GP7 A;  2H89 B;  4TMA B;  2WXI A;  3MP9 A;  2BTE A;  4NJC A;  4FXC A;  3W2D A;  1DOY A;  1SEB D;  1SJH D;  2BS4 B;  1PFD A;  2W3R A;  1XLQ A;  4L1B A;  1FNW A;  1N61 A;  1XXG A;  2NTS A;  5HG2 A;  3DWM A;  2RDH A;  2BB6 A;  1AN8 A;  1PDX A;  3BK2 A;  1T3Q A;  1AWD A;  3ZJT A;  1XLN A;  2ON8 A;  3AMZ A;  3ETR A;  3TEW A;  1OQR A;  4OZB A;  5I4D A;  1ET9 A;  1JML A;  4YTP B;  2JZP A;  5D3I B;  2R61 A;  2BBC A;  4C7Y A;  2H88 B;  1K51 A;  1SF0 A;  3I57 A;  5EE9 A;  4J3O D;  1ET6 A;  3U7Z A;  4DXG A;  4A55 A;  1XLO A;  1KTK A;  3LXF A;  5EE3 A;  2JYT A;  1XCT L;  1FO4 A;  2D5G A;  5BYQ A;  1SJE D;  2Z8L A;  1XLP A;  2MJ3 A;  2LUM A;  4NAM A;  2G9H D;  1XEE A;  3KQ4 A;  1PGA A;  3Q8A A;  1YJJ A;  1JWM D;  4OZC A;  3TEY A;  1P7F A;  2BYT A;  4HKQ A;  1GPX A;  3VRB B;  2MEK A;  4OW0 A;  1NYR A;  2OHF A;  2FE8 A;  1E0Z A;  1AYF A;  2KMM A;  5FKA C;  1I7H A;  3BII D;  4HRO A;  1XO3 A;  1TS3 A;  4JWS C;  2AQ3 B;  4RGO S;  3J9C A;  1J7C A;  1MI0 A;  1ZOY B;  1GB4 A;  4C80 A;  2K5P A;  2AX5 A;  1TZO A;  1FEH A;  1VDV A;  4TQ1 A;  4XDD A;  1FRR A;  4RF0 A;  3GS2 A;  2XN9 C;  4L2Y A;  3AEB B;  1VZ7 A;  5E6J A;  1E9M A;  4RF1 A;  5JXV A;  1I4H A;  4KGR A;  3Q8E A;  3NVV A;  2L1A A;  1V8C A;  4ZOH C;  1BUI C;  1F2R C;  3CWI A;  5D3D A;  2AQ2 B;  1SB3 C;  1DOI A;  1I4P A;  1F77 A;  5G5H A;  3TUO A;  1VRA B;  2HDE A;  3BYT B;  3LYY A;  4XE0 A;  2WNM A;  2PMV A;  1QKZ A;  4OHJ A;  2INN E;  4L23 A;  1DYQ A;  1VLB A;  2WU5 B;  4KKI A;  1YQ3 B;  1UWX A;  3SR6 A;  4A9A A;  2PVO D;  5H8Y E;  1QOB A;  2INP E;  3EGR A;  2YEP B;  2XNA C;  1D5X C;  2BW2 A;  3AE7 B;  1DOX A;  2G1E A;  1L0V B;  2MJE A;  1D5M C;  1HA5 A;  4WWM A;  4AS1 A;  1PYW D;  4B0M A;  1IUE A;  3FIL B;  3KWL A;  1WYG A;  2ZW0 A;  4MT5 A;  3ZQ4 A;  5FR3 A;  5MPO A;  4REZ A;  1ZXI A;  2PLP A;  4ZRQ A;  5T8I A;  4GDK B;  4AQ7 A;  5BMG A;  3P4Q B;  1XCQ L;  3U52 E;  3T3N A;  1CK1 A;  2Y3A A;  1R7S A;  4GLS C;  5D7G A;  2WS3 B;  3AEF B;  1PGB A;  1J7B A;  1SBB B;  2YEP F;  2N9L A;  1HXY D;  2DYM A;  1I4X A;  2M19 A;  4ITK A;  4WIP A;  4R3D A;  1FFU A;  1MHH E;  3P4P B;  1EWC A;  1RYJ A;  2IGH A;  4RGN A;  2W54 A;  1ROE A;  4YTM B;  1SIJ A;  4XWW A;  4O1N A;  2WXO A;  3Q8B A;  4JX1 C;  1HEZ E;  1IGD A;  1JWA D;  4P6V F;  3W1S A;  3CIR B;  4IDI A;  2V3P A;  2JU6 X;  3E9S A;  2QJL A;  3AH7 A;  1ESF A;  4KX6 B;  2QEJ C;  3SEB A;  3HRD D;  1L4Z B;  1CZP A;  3SFD B;  2AQ1 B;  1ZXH A;  1PGX A;  3Q69 A;  1C79 A;  3ZGZ A;  1ACC A;  1BXT A;  3HVD A;  5FK9 C;  3T3O A;  3IXS A;  3AEC B;  1WXQ A;  4N58 A;  1GB1 A;  1MPE A;  1SE4 A;  3AN1 A;  2L83 A;  3BVG A;  2WDR B;  3FAH A;  1FNV A;  1WSP A;  2M56 B;  4YT0 B;  1TKG A;  4A6Q A;  1ZDV A;  2CU3 A;  2LFI A;  3NRZ A;  2WXN A;  4JPS A;  1HZ6 A;  4N6E B;  5C2T B;  2W3S A;  2GI9 A;  1YN3 A;  1TKY A;  1SXT A;  2JWU A;  4KGS A;  2VZK B;  1QLB B;  3AE1 B;  3AED B;  5AUI A;  3EUB 2;  5BYR A;  4OZA A;  5BMI A;  2ICI A;  1KRH A;  1VZ6 A;  2J42 A;  3MJ5 A;  1NYQ A;  3B2G A;  1UUP A;  3NVZ A;  1FIQ A;  2E6X A;  1TY2 A;  1M4V A;  3RPF C;  2KDM A;  2I38 A;  2IPK D;  1WWT A;  3AE6 B;  1FCL A;  3E56 A;  3BWU D;  3MC0 B;  1WRI A;  3ZJU A;  3R2T A;  1TJE A;  4LLG M;  4LK0 M;  4A90 A;  3AV8 A;  3IT6 B;  1HZ5 A;  2DLB A;  4A8X C;  1L6U A;  4HJG E;  1C76 A;  2WU2 B;  2QMT A;  3Q8F A;  1TKE A;  5HFY A;  4JWU C;  1FXA A;  3W5V B;  3R8B A;  2JYE A;  1C4C A;  2B76 B;  1A70 A;  1NVI D;  3W9C B;  4RFB A;  1Y56 A;  2RPV A;  3GB1 A;  1N60 A;  2PTL A;  2DYO A;  2WXP A;  2BT6 A;  4UDU C;  2EKI A;  1ZUD 2;  1N5W A;  4EE2 A;  4Q2J A;  1LO5 D;  2JSV X;  3PZ8 A;  2V4I B;  2L32 A;  3AE8 B;  3AEG B;  1NEK B;  3HUI A;  4RGT A;  2GRI A;  2K3U A;  3MHZ A;  4ZHP A;  1WGK A;  2WXQ A;  2ZW1 A;  3U4E G;  2BS3 B;  2Y5C A;  1Q10 A;  1JRO A;  4US9 A;  1KLU D;  1MVK A;  1QOG A;  2QIL A;  3BVZ A;  3VRA B;  2CJO A;  2LGI A;  3P4S B;  3R2I A;  4DXF A;  1D5Z C;  1JAL A;  2TSS A;  1ZP0 B;  1C77 A;  1V97 A;  1IBX A;  1IGC A;  3IAM 1;  1TS4 A;  1TYG B;  5HHD G;  1QF6 A;  3PO0 A;  1D4B A;  5GXG B;  1OQQ A;  3FC4 A;  3RFZ B;  2PW9 A;  3NVW A;  1E10 A;  2WXL A;  2V0G A;  2DWQ A;  2BS2 B;  1YQ4 B;  3VQI A;  2IGG A;  1L4D B;  1FD6 A;  2IGD A;  3L4P A;  1YMH E;  1C9F A;  1ZDX A;  1OFF A;  2J4X A;  2LHD A;  4ZRP A;  2W55 A;  1C4P A;  2RDG A;  2WP9 B;  1YNT E;  3VR8 B;  1RWS A;  2WXR A;  4RNA A;  4P16 A;  1JWB D;  5BMH A;  1FMA D;  4NAW B;  2K9X A;  5EE1 A;  4ARI A;  1FFV A;  1UNS A;  1KH0 A;  3Q8C A;  2VZK D;  3B9J A;  4ARC A;  2RMM A;  4MM3 B;  2WXF A;  3P1M A;  1XF5 L;  1I4R A;  2ONQ A;  1TS2 A;  3NZ3 A;  4JE3 B;  1V1P A;  4C56 C;  1RM6 C;  1EU4 A;  2WXK A;  1EWY C;  4MH8 A;  1EM7 A;  5H92 C;  2M0A A;  2QSD A;  3AB5 A;  4WUR A;  4YWG G;  4NZL B;  2WXH A;  1STE A;  3BVM A;  1I4Q A;  1PUT A;  1QOF A;  4TQ0 A;  4LTU A;  3I9V 1;  1JWS D;  3SFE B;  1J7A A;  2KN4 A;  3V3X A;  2KAC A;  4WQM A;  3ZYY X;  4D2K A;  3MFG A;  2LEK A;  4WAF A;  1EU3 A;  2WDV B;  1VZ8 A;  1T5X D;  1N5X A;  1L0Y B;  3KLS X;  4USA A;  1QT9 A;  1C78 A;  1UGJ A;  2WDQ B;  4M0W A;  1BML C;  2X38 A;  3IT4 B;  5HI1 A;  1FCC C;  1F2R I;  3AE4 B;  3H8H A;  1AW7 A;  3BZD B;  1C4A A;  1CJE A;  1ENF A;  1ZPS A;  3NUH B;  3BYY B;  3O13 A;  5TSS A;  1D6E C;  3AE3 B;  2E3T A;  3V05 A;  3BK1 A;  1YJI A;  1UWM A;  4IKG A;  2IDY A;  3TEZ A;  1JQ4 A;  3B2F A;  3AEA B;  4HRS A;  2JX5 A;  4HKZ E;  4YSY B;  1B9R A;  3UI3 A;  1DGJ A;  3ABV B;  1HQR D;  3IAS 1;  2N7J A;  2QIE B;  1YN4 A;  1TS5 A;  1K50 A;  1QIL A;  1RFK A;  2WXG A;  2GB1 A;  1NEN B;  2MH7 A;  2MJD A;  4YTN B;  1L0X B;  4US8 A;  2SEB D;  1FNU A;  2LHE A;  3NVY A;  3HVZ A;  1GOZ A;  3W5U B;  1V1O A;  2NTT A;  2KWD A;  2ACZ B;  3PZ7 A;  1L5P A;  2WXM A;  1E6E B;  2Y5P A;  1KFY B;  3VR9 B;  4KKJ A;  3N9Y C;  1ZE3 D;  2L52 A;  3P42 A;  4RH6 A;  3AE2 B;  3C8Y A;  2OED A;  1QOA A;  4KGT A;  5AUK A;  4YXD B;  1E7P B;  1GAQ B;  2Q5W D;  3TSS A;  1JW9 D;  4TSS A;  2KAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...