3ECIA

Microtubule-associated protein 1 light chain 3 alpha isoform a (map1alc3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Human Autophagy-Related Protein LC3 A
rcsb
source organism Homo sapiens
molecule tags Apoptosis
molecule keywords Microtubule-associated protein 1 light chain 3 alpha
total genus 32
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3eciA00
2PEAA 1UD7A 1WJNA 3QAQA 1WYWB 4LJOB 4EZKA 3BY4B 2WWZA 4TV3A 3PRZA 2O6VA 1WY8A 1P1AA 4KSLC 3N3KB 1WXVA 2N4FA 1WJ4A 5HKHA 3VAWA 4YL8A 4GDLA 2ASQA 2FNJB 3VTWA 1TZ1A 2N7EA 2KXJA 2LVQA 1LQBA 4W9HA 2JUOA 4FN2A 2IBIB 3OJ3A 4KIKB 4HCPB 3ENEA 4BBNF 2J0KA 4K7SA 1GG3A 4EZJA 1YD8U 2LWPA 2ZPNA 2MSED 3KUCB 3VFKA 3QQ8B 5L95C 2K6QA 2KN5A 1WGYA 4ANWA 2KLCA 2ZVOA 4WWOA 3X23A 5DPWA 2GBNA 2BWFA 2K1FA 2HD5B 2KJHB 4G0NB 2ZJDA 4PS3A 4DDID 3CSFA 2JRIB 2BPSA 2KTRA 2LXCA 4ZDVA 1WF9A 4EOYA 4PYUA 5DPSA 3ZTCA 2JZZA 4W9IA 4ANVA 2A5UA 4BOZB 1VD2A 3IBEA 3K9PB 4EKUA 5E6OA 3EC8A 2N9EB 2K8BA 4DHJB 4GDLB 1J8CA 1WMHA 3MJWA 3H1UA 2KFJA 3RUIB 3WAOA 5D6JB 1AARA 1OEYA 3QHTA 4ANUA 3RD2A 3KUZA 2DZKA 1FXTB 4MGIE 2V3SA 3DBHI 3CMMB 4FHKA 5IA7A 1WJ6A 3D32A 3OAWA 1WFYA 3L17A 2MW5A 1SE9A 2L0TA 2YLMA 3BINA 2DYOA 2RR9A 3JYUA 4OVUA 3PHXB 1WR6E 2KK8A 3EFUA 1H4RA 2O6VD 3NHEB 3B08A 2N7DA 3ECIA 4WJOA 4B9KA 2LGYA 4MJSB 4W9CA 5EDSA 3HIZA 2UYZB 3DDCB 3EHVA 2HJ8A 3ZNGC 4ANXA 2L0FA 2AL3A 2DENB 2KC1A 1Y8RC 2KNBA 4E74A 2M17A 2NPTB 4PYZA 1U4AA 2KTRB 3PV1A 3WANA 1I35A 2KFKB 1GUAB 2XBBC 1EO6A 3B1LX 1K8RB 3HM3A 3KH0A 1WGDA 4JIOU 2L8JA 2NBUA 2IY0B 1OEYJ 1V49A 2IYDB 1V80A 2EMSA 2W9NA 3DBSA 4FJVB 4HLEA 1R4MI 5CHWA 2KDEB 2XEWA 2ZCCA 1E8WA 3PT2B 1V5OA 1BT0A 3QC8B 2MWSB 3ZDMC 5J17A 4K7WA 4K81A 1V9JA 4FBJB 1WJUA 3A4SC 4W9DA 2BGFA 1UBIA 2BYEA 2GBJA 3PREA 3RCZA 2L00B 1SIFA 3L10B 3VUYA 4LJPB 1R4NI 1XT9B 2AL6A 3SU8X 2KQSA 4TQ0A 3S2AA 4EFOA 4IWPA 3U8ZA 4K7UA 5CHFA 3RZWC 4NY0A 4M8MA 1WZ3A 2CS4A 1F9JA 4GDKA 3DQVA 3R7QA 2KWUB 3AU5A 4BKGA 4MSMB 1WE6A 3PZDA 5C23A 3V62A 4PS8A 1Z5SB 2NBWB 4HPMB 1NI2A 3VDZA 2J0MA 2KQ7A 2EKEC 1NBFC 1WE7A 3UINB 4ASWC 4M8NA 1I42A 1YX6B 4BKTA 3QK0A 2KVRA 2Z0DB 2WX1A 2LVPA 2Z0EB 1EUVB 1X1MA 2PE9A 4DBGA 4KSKC 1KLVA 1YX5B 4GU2A 5LXHA 1WM2A 2C9WB 3IHPC 1V86A 1WGRA 2XK5B 3IG3A 2FCSA 3W1SC 4WJPA 1P3QU 3CF6E 2HTHA 3PHWB 2CKHB 2KD0A 3L08A 2FAZA 4FA6A 5J2RA 2LUEA 5KHOA 4IM0A 3ALBA 3UGBB 4FLHA 4BKSA 3JSVA 3RYTA 4KIKA 4WQOB 2G45B 4DHZB 2GBRA 3NS8A 2MBBB 3VHTC 1Q0WB 2UWQA 2G3QB 4B6WA 2BF8B 3PTFC 5FR6A 3V61A 3VUWA 4FADA 2C7HA 3ML9A 4ZRKA 5LLIA 3V60A 3QWZB 3ZO5B 2DAFA 4P7IA 5KHQA 1C3TA 4MELA 4GB9A 4J6IA 2C5LC 4G3XB 3VTVA 3Q3FA 2KJ6A 1OQYA 2Z59B 2ZVNA 4I6PA 3IFWB 2VRRB 4EUTA 3SD5A 2WYQA 1E7VA 2YVCA 3MTNB 4X57B 4F8CB 2MBQA 3V6CB 3KYDD 4JLCA 3DBRI 5IAAC 2JXXA 4II3B 4JGHB 2LRUA 1WX8A 2JRHA 3OJ4B 4WJQA 3WAPA 4FJYA 1WI0A 3L13A 2LZ6A 2A4ZA 2REXA 4BKSD 5C1ZA 4GOCA 5AZFA 3DVNU 4IM2A 3ZRFA 4HVBA 1NDDA 4RMAA 5L83A 2OJRA 3QIJA 4HCNB 3AI5A 4HDOA 4DXAB 4FHJA 1SGHA 1IYFA 2LGDA 5BO4B 2KDFB 4KDIC 3SHQA 3VUXA 4AWJA 2D07B 4JQWC 2I1KA 3ZNZB 3R3MA 3JW0X 4URKA 2CU1A 4HJKA 4B95A 1WXMA 4RM8A 1KM7A 2BWES 3LDZE 4ZYNA 3NZUA 2LGXA 3QA8A 4MEMA 4OVVA 4KDLB 1YIWA 2FUHB 3ZNHB 3QCAA 3OLMD 3TL5A 4EEWA 1UH6A 4K1RB 1WMHB 1WRDB 2DHZA 2IZVB 2EMTA 2KFKA 2FIFA 1V5TA 2DZMA 1GC6A 1Q5WB 3QARA 3ZNID 5J18A 5JHBA 4NJ6A 2JWZA 3UIOB 1V6EA 1C1YB 1G6JA 2BKFA 3DVNV 3M62B 2J0JA 2D11A 3H7PB 5DPTA 4A20A 3UQAA 4DK5A 1L7YA 2KOXA 4NAWB 1WGGA 1RRBA 2KDBA 2ZZPB 4GMVA 2CHZA 3L16A 2NVUI 4GN1A 3A1QB 1ISNA 1A5RA 1L2NA 2KZRA 3SDLC 5JZEB 2RGFA 2AEHA 4BVUC 1EF5A 1J19A 2CHWA 1E5WA 3T9LA 2KKCA 1WX9A 4LDTB 1RFAA 1GJZA 2DAJA 1ZW7A 2WX0A 3V6EB 2KWVB 4GDKB 2AWTA 4HDQA 3CSTA 4RM9A 2LD9A 3C0RB 2GBMA 4W9GA 1E7UA 1WR1A 2K25A 2PJHA 1D3ZA 5TR5A 1E8XA 3A33B 1CMXB 4MGKE 4I6LB 3AULA 4ICVA 2PPHA 5G2NA 1TBEA 4EZLA 2DZIA 2M4NA 2PE6B 3DBLI 4HPLB 2MX2A 2ZNVC 3JVZX 3PRMB 4I6NB 4MDKE 3ZLZA 1JRUA 2WDTB 2M8SA 1WXSA 3H7PA 3A4RA 3WIMA 3A9KA 1T0YA 2C7NB 2MP2A 1MG8A 4NAWA 3DVGX 3VTUA 1V2YA 3TMPB 2KANA 4ZRJA 1WGHA 3A1QA 2KX0A 4HWIB 1E8ZA 4IC7B 3APCA 3TJPA 3PSEB 2RSUA 4BBNC 2IO0B 3KVFB 2NR2A 1Q1OA 4NQLB 4AOFA 1OGWA 2L3ZA 1ZGUB 2D3GA 3KYCD 2J7QB 2BYFA 3X0WA 2KLGA 1E8YA 4MH0E 4F7ZA 4W9KA 3H9DA 2MBOA 2LVOA 3UIPB 3PVLA 2KHWB 4FULA 1UZXB 2LASA 4NNJB 3PLVA 3PPAA 4IW0A 4MGYE 4MSQB 5DPRA 1YJ1A 2KMCA 4CYEA 3AXCA 4W9EA 3HK0A 1KJTA 1WM3A 2MBEA 4LCDE 3WAMA 2K6DB 4AUQC 2O6VB 3ZRCA 4ZRIA 2FCQA 2KX3A 4IM3A 2B3AA 3PS6A 2K39A 4NQKE 3TIXA 3N32A 4XC2A 1LM8B 1OTRB 3ZW3A 1P9DU 1VCBA 3L54A 3ZIMA 2JT4B 3RT3B 3AU4A 2MBHA 1IP9A 2MRPA 2I1JA 1YQBA 3H6NA 2JVCA 2CR5A 3W1SA 4W9JA 2G4DB 2IO2B 3ZDTA 4ICUA 2JF5A 2LJ5A 2NPTA 3R66C 5D94A 2DYMA 1IPGA 1M94A 3VXWA 2N1WA 1GC7A 3ML8A 2L76A 1PQSA 3EECA 2KDIA 3IVFA 3A9JA 3K9OB 2LI5A 1TGZB 3VH4B 4E71A 4M0WB 1H8CA 4CO7A 4XZ4A 3RZFA 2Y5BB 1WX7A 3Q3JA 2LRWA 4BFRA 3LJ3A 4XX5A 1J0GA 3PGEA 4WJNA 2KC2A 5JH5C 4DWFA 4IWQA 2V1YA 1RLFA 2NCNA 4A3OA 3MHSD 2R2QA 1Z2MA 2KTFA 4G50A 2O2VB 4GGQA 2MLBA 3VH3B 1EF1A 2RPQA 4NJ7A 2M1MA 4DHJD 4AJWA 3APDA 4TUUA 2IO1B 3DCGA 2HE7A 1LFDA 4E3CA 1UBQA 2JPHA 2D2QA 3JSVB 1UELA 2N9PC 1S3SG 3APFA 1S1QB 4JL9A 4KZCA 5DCNA 3NY5A 2QHOA 2MCNB 4BOSC 2KWCA 4IWOA 3T8MA 4AJYB 3QX1A 2N9XA 3KW5B 2KJRA 3QJZA 4MJSA 2NS5A 4HK2A 3A9JB 2GBKA 1ZKHA 5AEKB 5JHAA 5G55A 2GMIC 1WXAA 1WH3A 3H7SA 2DX5B 4W9LA 1WZ0A 5AZGA 2IO3B 5D7GA 2DZJA 4GXBA 3W1YA 4DHZE 4G11A 2O2VA 2K8CA 4IUMB 3WA0A 4KZ0A 1TTNA 3VVWB 1P0RA 2M0XA 3P2BA 2DYBA 3PLUA 1XQQA 2FCMA 3A9KB 4MM3A 2D10A 2MP2B 2AYOB 3HM6X 2L05A 4NPNA 3TCAA 1V81A 3TBLD 2ZPYA 3ZVVA 2GOWA 2MQJA 5E6PA 4TQ1A 4W9FA 2FIDA 2IY1B 4N9F4 3ONSA 4IG7B 4PS7A 3M63B 4MGZE 3DPDA 4WWPA 1LXDA 2R2OA 3GOEA 5D2MB 3M95A 5GMVA 3NZSA 1E90A 4WWNA 3KUDB 3PRPB 1RAXA 5E6NA 4LDTD 2C60A 1GNUA 3WALA 1KOTA 4HXDA 2C7MB 3DVGY 3VQIA 4A3PA 2KO3A 2L7RA 3L0WB 4KVGB 2CHXA 2OOBB 3UF8A 2LXAA 4WAAA 2BYVE 3R7RA 2JY6A 1HE8A 1QZEA 2V4LA 1XD3B 3HHMA 4TKNA 2JZ3B 4GIVA 2K8HA 2BKRB 4KV2A 3ZUNA 3NOBA 4GSWA 2XK5A 2MA9B 2RD0A 3DOWA 2KMAA 3I3TB 2ZNVB 2NBVB 3U30A 3ZKJC 2N1VA 4II2B 3ZTDA 5CX3A 4F1SA 5LXIB 3N30A 3GZNI 3RULA 1P98A 5CHVC 3B0AA 4CHKA 4FJZA 2G4SA 4DDGD 1WIAA 5AZHA 3U7DA 2FCNA 3O65B 3UQBA 1UGMA 2ZCBA 5CTRC 4AP4C 2ZEQA 3M3JA
chains in the Genus database with same CATH superfamily
2PEAA 1UD7A 3QAQA 4TV3A 3PRZA 2O6VA 4GLSC 2N4FA 1MG4A 4GDLA 2ASQA 2LUMA 1PGBA 3VTWA 1LQBA 2IBIB 4KIKB 2WXQA 3ENEA 2GB1A 2X38A 1MJDA 1GG3A 3AEEB 1XCQL 2MSED 3KUCB 2DBYA 3RFZB 2QSDA 3QQ8B 2IDYA 1GB1A 4WWOA 2K1FA 2HD5B 4G0NB 2JRIB 1GB4A 5DPSA 4BZAA 1LGRA 4BOZB 4H2AA 4KKIA 4KKJA 2KVZA 4M01A 3MJWA 5BYRA 5HI1A 4ANUA 3DBHI 1WJ6A 3OAWA 3N1ZC 1WR6E 2KK8A 3EFUA 1H4RA 2WQYB 2QMTA 4WJOA 4B9KA 4W9CA 2ZW0A 5EE9A 4US9A 2NPTB 3WANA 5D3DA 3IT4B 3KWVA 2XBBC 4RGTA 4IDIA 2BB6A 3KH0A 4XDDA 4HLEA 2W9NA 1V80A 4FJVB 1R4MI 2IGDA 3PT2B 1E8WA 2ONQA 4K7WA 5JXVA 2BGFA 4MACA 2L00B 1SIFA 4LJPB 2AL6A 4EFOA 4DXFA 5CHFA 4NY0A 4OHJA 3DQVA 2KWUB 3P4RB 5BMHA 3AEGB 3PO0A 4PS8A 4HPMB 4IOIE 2KQ7A 3NVYA 4ASWC 3ZJTA 1L6UA 3W2DA 4BKTA 3QK0A 2KVRA 2WX1A 2LVPA 3RMKC 3GS2A 4GU2A 1WM2A 1V86A 2XK5B 2WXKA 4C80A 3CF6E 2HTHA 2CKHB 4RCOA 4K3CA 1GOZA 4WWMA 3JSVA 4WQOB 4DHZB 3VHTC 2MBBB 2UWQA 2BF8B 3VUWA 3V61A 1I7HA 3V60A 2BBCA 1KH0A 1R4NB 4P7IA 2SEBD 4MELA 2C5LC 2WXHA 1OQYA 1TS3A 1BMLC 3RNEC 2WYQA 3FC4A 2JYEA 3MTNB 4F8CB 2MBQA 5IAAC 2JXXA 2I38A 3VR8B 4WJQA 4FJYA 1WI0A 3L13A 5AZFA 2N7JA 1PFDA 1ZP0B 3ZRFA 3BVGA 2LGDA 1N5XA 5BO4B 2KDFB 3SHQA 3VUXA 2D07B 2I1KA 3ZNZB 3R3MA 4OW0A 3PZ7A 1YNTE 4B95A 1WXMA 3NZUA 3QA8A 4OVVA 4KDLB 3FKYA 3R8BA 1UH6A 1WRDB 3BZDB 2IZVB 1N5WA 3QARA 4LNIA 4C56C 1MFWA 2WXMA 4B0EA 1FEHA 1C77A 3DVNV 2D11A 1K50A 3H7PB 1DOYA 2ZZPB 2KDBA 4RF0A 2CHZA 2OJWA 4GN1A 2KZRA 2WNMA 3OG5A 4BVUC 1J19A 1E5WA 2KWVB 3PZ8A 2AWTA 2KT7A 3LYYA 4RM9A 2WXLA 2HTME 1E9MA 1E7UA 2K25A 3I9V1 1T0SC 3RNAC 4RGMA 4P16A 3BVMA 2M4NA 3P42A 3JVZX 4MDKE 1JRUA 2E3TA 4AS1A 3Q2AC 2H89B 4NAWA 1V2YA 3DHIC 3A1QA 1E8ZA 2H88B 3KVFB 3BYYB 1OGWA 1E8YA 3U4EG 3FILA 1PDXA 3W5VB 2MBOA 2LVOA 1HTOA 1ZXIA 4N6EB 1UZXB 3P4SB 4BAXA 4ZHPA 1WWTA 3KWLA 3PPAA 4MGYE 4RNAA 4CYEA 1XO3A 3AXCA 4W9EA 1KJTA 1WM3A 3WAMA 4ZRIA 2KX3A 2PIAA 5HG2A 3N32A 4XC2A 2QEJC 1YN3A 3ZW3A 1P9DU 1VCBA 4YTPB 3ZIMA 3HUIA 3H6NA 1L0XB 2I1JA 1MVKA 2G4DB 3Q8CA 2LJ5A 1FFVA 4L2YA 4OZAA 1KLUD 3IVFA 4OZCA 1FM0D 4E71A 3AE3B 1JWAD 3Q3JA 1WX7A 2LRWA 3LJ3A 1J0GA 2NCNA 2N0SB 2O2VB 4A90A 1KLGD 4NJ7A 2M1MA 4TUUA 3Q3NC 4DXGA 3NVVA 2CJOA 2JPHA 1S3SG 1S1QB 1YMHE 3NY5A 1F52A 2QCZA 2W82A 1FRRA 1VRAB 2KJRA 3A9JB 1D6EC 1BUIC 4WAFA 2GMIC 1YOVB 3H7SA 2DX5B 4A55A 5D7GA 4DHZE 2Y5CA 4XWTA 1QKZA 5LNK1 1ZE3D 1P0RA 2M0XA 2DYBA 2INNE 1DOIA 2L52A 2L05A 3ZQ4A 4US8A 2MH7A 1YN5A 1ENFA 2MQJA 5E6PA 4TQ1A 4W9FA 1GPXA 4N9F4 3ONSA 4IG7B 4WWPA 1TKYA 5GMVA 1LXDA 3NZSA 1E90A 3AE7B 1QOAA 1RAXA 5E6NA 1GNUA 2VH1A 3WALA 2C7MB 3DVGY 3VQIA 4WIPA 1FIQA 2L7RA 2OOBB 3EUB2 2LXAA 4LNKA 2BYVE 4P6VF 1QZEA 3HHMA 1J7CA 2K8HA 3ZUNA 2WXOA 3NOBA 2RD0A 3DOWA 4R3DA 2ZNVB 3U30A 4YTNB 1CZPA 5CX3A 4F1SA 3DHGC 3GZNI 5CHVC 1L0YB 4FJZA 4A8XC 1PGXA 1WIAA 4YXDB 4USAA 3U7DA 1UGMA 5CTRC 1HXYD 3BY4B 3NRZA 2BVCA 4KSLC 1WJ4A 5HKHA 1JWSD 3B2FA 1TZ1A 2N7EA 2FBWB 3OJ3A 1IBXB 4K7SA 3U2SC 3CWIA 2K6QA 1WGYA 3HRDD 3NJTA 2KLCA 2GBNA 4PS3A 4DDID 1AN8A 2LXCA 4EOYA 4ARCA 2A5UA 3W5UB 1VD2A 3IBEA 3K9PB 4EKUA 3EC8A 4DHJB 4GDLB 5MPOA 3RUIB 3WAOA 1AARA 1FXTB 3AE4B 2KMMA 5IA7A 3CMMB 3D32A 3L17A 2YLMA 4OVUA 3PHXB 3NHEB 4WQMA 2MHJA 2M0AA 5EDSA 3ZNGC 3DDCB 4ARIA 5EE1A 2DENB 1Y8RC 1JRPA 2JZPA 3P63A 4N59A 1QOFA 2J53A 4JIOU 1V49A 1FMAD 5CHWA 1L5PA 3QC8B 1HZ5A 2MWSB 5J17A 2LEKA 4K81A 1V9JA 3A4SC 1XCTL 2BYEA 2GBJA 4A9AA 3VUYA 2M56B 1R4NI 1XT9B 2BS4B 3SU8X 3S2AA 4K7UA 4M8MA 4C4VB 2CS4A 2WDRB 3AU5A 4BKGA 3VRBB 1N6ZA 4MT5A 4ZYSA 1I4QA 2L32A 1NI2A 2J0MA 2EKEC 1WE7A 3UINB 1FPYA 4M8NA 4ZOHC 3Q6BA 3AEBB 5AUIA 1DYQA 4DBGA 4KSKC 1YX5B 3IHPC 1WGRA 2Q5WD 3IG3A 4WJPA 1JCKB 1VR9A 3ALBA 2L1AA 2E6XA 2C7HA 3RNBC 1V8CA 1E10A 2DAFA 4JPSA 1C3TA 3GE8C 1NYRA 2W54A 4HEA1 2ZVNA 2Z59B 5G5HA 1L4DB 4I6PA 1NVID 3U7ZA 2VRRB 4LTUA 3SD5A 1UUPA 1XEEA 4X57B 1ET6A 1ZUD2 4JGHB 3OJ4B 1C76A 2A4ZA 3DVNU 1F2RI 1NDDA 1TS5A 5L83A 2OJRA 4HCNB 3AI5A 4YSZB 2QC8A 4HDOA 4FHJA 1ROEA 1IYFA 3U52E 1PGAA 4KDIC 2NMQA 1YN4A 2KDMA 4JQWC 2BQQA 4URKA 3MC0B 4RM8A 4XDCA 2LGXA 4MEMA 3SFEB 2FUHB 3ZNHB 2K0PA 3QCAA 3OLMD 3VR9B 2DHZA 2FIFA 2DZMA 1GC6A 1Q5WB 5JHBA 1B1ZA 4NJ6A 1RYJA 2W3SA 1JW9D 2VZKD 5DPTA 4A20A 3TUOA 2KOXA 1WGGA 3P4PB 1KRHA 2KAJA 1ACCA 1MHHE 4AQ7A 1WXQA 5FKAC 2KKCA 4LDTB 4LK0M 2DAJA 1F0ZA 4WH4A 2WX0A 3AECB 4GDKB 2DLBA 1EU4A 1TS2A 2W3RA 3CSTA 2D3AA 4W9GA 1SIJA 1WR1A 2PJHA 1D5XC 1NYQA 3AULA 3P1MA 2BT6A 5BMGA 2ZNVC 2WDTB 3MC8A 3H7PA 2PW9A 1T0YA 1MG8A 3Q8FA 3ZGZA 3VTUA 3TMPB 2KANA 1M4VA 4HWIB 1GAQB 4YTMB 2RSUA 4BBNC 2IO0B 1SE3A 2NR2A 4ZRPA 3VRAB 2D3BA 3X0WA 3TEYA 3I57A 3NUHB 4MH0E 4F7ZA 4W9KA 2WHIA 3CIRB 2FE8A 4IW0A 4MSQB 3MP9A 4NAMA 2K6DB 4FXCA 2FCQA 4IM3A 1QOGA 2B3AA 2CU3A 1LM8B 1OTRB 3L4PA 2LGSA 3L54A 2VH2A 2MRPA 2WLBA 2AQ2B 2CR5A 4W9JA 3Q69A 2RDHA 2IO2B 3ZDTA 5D94A 2R61A 2EELA 3ML8A 3R2TA 3EECA 2JWUA 3K9OB 4HKZE 1H8CA 4CO7A 4XZ4A 4BFRA 4XX5A 1JWMD 4WJNA 1JWBD 4DWFA 2D3CA 4A3OA 3MHSD 4KGSA 1Z2MA 1OQRA 4ZHOA 1EF1A 2RPQA 1IBXA 3MC9A 2TSSA 1QOBA 5IKCM 1LFDA 3OWEB 1UBQA 3TEWA 3JSVB 1UELA 2N9PC 1NENB 3APFA 4RGNA 1L0VB 5DCNA 3ZXVA 5E6JA 4AJYB 2N9XA 2PVOD 3QJZA 4MJSA 2NS5A 1UWMA 2GRIA 2GBKA 3EFCA 5AEKB 3Q14C 1WXAA 4CQNA 1WZ0A 2SAKA 2LHDA 1T0RC 2IO3B 3B2GA 4RGOS 1RFKA 1XXGA 2MJDA 2O2VA 2K8CA 4IUMB 3WA0A 1TTNA 5GXGB 2J4XA 3P2BA 2BS3B 2FCMA 1YQ3B 2KACA 2D10A 2AYOB 4NPNA 1SB3C 3TCAA 1CQVA 1V81A 2ZPYA 2GOWA 2MEKA 1VLBA 3DPDA 1WRIA 3PRPB 1FRDA 1C4CA 4LDTD 1OFFA 2KO3A 4KVGB 3UF8A 3C19A 5BYSA 4KGRA 2JZ3B 4GIVA 2BKRB 5H92C 1I4HA 2WXFA 3EGRA 3AEDB 2NBVB 2JU6X 1UWXA 3ZKJC 1HQRD 4C4VA 3GZNB 1SF0A 4Q2JA 2ZCBA 4NJCA 1WJNA 3I63C 4PK1A 1EM7A 4EZKA 2GLSA 2W55A 1WY8A 1EWYC 1P1AA 3N3KB 1AWDA 3EA6A 1V1OA 1V1PA 2KXJA 2NTSA 2JUOA 2PVGC 4FN2A 1FD6A 4HCPB 5AUKA 4BBNF 1QF6A 3N9YC 1ET9A 4B0MA 1CK1A 1YD8U 2LWPA 4LNFA 1P7FA 3DBRB 4ANWA 2ZVOA 3X23A 2BWFA 2ZJDA 1FXAA 2BB5A 2BPSA 2KTRA 4ZDVA 1C9FA 3DHHC 2JZZA 4W9IA 2X8XX 3SFDB 1FNUA 5E6OA 2ON8A 4S0RA 3T3NA 2K8BA 3NVZA 1J8CA 5D6JB 1TY0A 3RD2A 2DZKA 4MGIE 3WCQA 2V3SA 3IAS1 4YWGG 1WFYA 2MW5A 2L0TA 3SEBA 3O13A 2O6VD 5FR3A 3B08A 2N7DA 3ECIA 2WP9B 2LGYA 4MJSB 2UYZB 3EHVA 4ANXA 2L0FA 2AL3A 2B76B 2KC1A 2KNBA 2INCC 2M17A 1UNSA 5FK9C 3J9CA 2IPKD 3AE5B 1I35A 1I4XA 1KFYB 2ACZB 4M02A 3B1LX 1TJEA 1KTKA 4XYCA 1WGDA 2L8JA 2NBUA 1OEYJ 2K22A 3DBSA 3NS1A 1C4AA 2KDEB 2XEWA 2ZCCA 3MHZA 3Q8AA 1K51A 3ZDMC 3AE9B 1ZPSA 3N1YC 4FBJB 4M00A 1T0QC 3U8ZA 1F9JA 4GDKA 3V3XA 4MSMB 1WE6A 2LGIA 3UI3A 5C23A 3V62A 3VDZA 1NBFC 3BYTB 2WS3B 1YX6B 2CJNA 3E9SA 2PE9A 2V4IB 1KLVA 1T5XD 2FCSA 3W1SC 1P3QU 4P1BC 5J2RA 3E56A 3KLSX 3B9JA 2LUEA 5IOIA 5KHOA 4IM0A 3UGBB 4FLHA 2WXIA 1T3QA 4BKSA 2J52A 3RYTA 1F2RC 1IUEA 2G45B 1RM6C 3NS8A 2G3QB 4B6WA 3PTFC 4FADA 2M19A 1HEZE 3AE1B 3BK2A 3QWZB 4NZLB 3VTVA 3Q3FA 1FXIA 2KJ6A 3RN9C 4K3BA 1K52A 2XN9C 3AEFB 1TYGB 3V6CB 1QT9A 4JE3B 4II3B 3WAPA 2JRHA 2LZ6A 2REXA 4BKSD 4IM2A 1MHXA 2DWQA 4HVBA 5G5GA 1JWUD 2BYTA 1SGHA 1YQ4B 1I4RA 4YSYB 3LXFA 3JW0X 2J42A 4JWUC 4HJKA 1VZ8A 3ZJVA 1ZDXA 1MPEA 3LDZE 4RFBA 4HROA 3TEXA 2KFKA 2QDFA 2EMTA 3AE2B 1QLBB 1V5TA 5J18A 3ZNID 3RNFC 4YT0B 1V6EA 1C1YB 1G6JA 2BKFA 2J0JA 1L7YA 1RRBA 1Y56A 4GMVA 2AX5A 2NVUI 3L16A 3ZJUA 1L2NA 2RGFA 2AEHA 1EF5A 2CHWA 3T9LA 1RFAA 1GJZA 1ZW7A 2LD9A 3C0RB 2GBMA 3MJ5A 1SE4A 1D3ZA 2K9XA 1F77A 3A33B 1CMXB 4MGKE 2MJEA 4HRSA 1R7SA 2PPHA 4MH8A 4D2KA 5G2NA 2QILA 4EZLA 1OQQA 2PE6B 4HPLB 2MX2A 3PRMB 4I6NB 2M8SA 1IGCA 1WGKA 3A4RA 3WIMA 3IXSA 1STEA 1C79A 2KX0A 1Q1OA 4NQLB 3AMZA 2KLGA 1FO4A 3H9DA 2K3UA 1UF0A 2IGHA 2KHWB 4NNJB 5IP4D 3PLVA 1NEKB 4RH6A 5DPRA 1YJ1A 1UGJA 2HDEA 3IAM1 2WDVB 3ZRCA 3AN1A 3PS6A 2K39A 4NQKE 1N62A 1B9RA 3NG0A 3DBLB 1IP9A 3Q3MC 4ICUA 2JF5A 3MFGA 2NPTA 3AEAB 1I4GA 2DYMA 1IPGA 1M94A 3VXWA 1L4ZB 2L76A 2KDIA 4LNOA 2Y5BB 2WXPA 5C3JB 1RLFA 1JALA 2HJ1A 2KTFA 4GGQA 3VH3B 2MLBA 3HVDA 4AJWA 2IO1B 3DCGA 2ZW1A 2LMCA 3C8YA 4E3CA 5I4DA 4JL9A 2QHOA 2MCNB 4BOSC 2KWCA 3QX1A 3KW5B 1VZ6A 5IO9A 2NTTA 1WH3A 1N61A 1BXTA 1DOXA 5AZGA 1VDVA 2DZJA 4GXBA 3T3OA 4G11A 4KZ0A 1TT5B 2GI9A 2PTLA 3VVWB 4HKQA 3PLUA 4REZA 3A9KB 4MM3A 2MP2B 3TBLD 3ZVVA 1WYGA 2RDBC 2I2YA 1QQRA 2FIDA 1ZDVA 3M63B 4MGZE 3GOEA 1R4MB 5D2MB 4WWNA 3KUDB 2WDQB 2KYWA 1KOTA 4HXDA 2WXRA 3AE6B 3L0WB 3ABVB 2D5GA 4WAAA 3R7RA 4P1CC 2V4LA 1XD3B 5BYQA 4KV2A 3BIID 4GSWA 4ITKA 4EE2A 2MA9B 2KMAA 2N1VA 4II2B 1FCCC 1XLOA 4XWWA 4CHKA 1P98A 1F1HA 3B0AA 4DDGD 3O65B 3AH7A 2YEPB 2ZEQA 4AP4C 1WYWB 4LJOB 2WWZA 2WGSA 4N58A 4M0WA 3AE8B 1WXVA 3BVZA 3VAWA 3Q3OC 1FNWA 4YL8A 2FNJB 4PT5A 4JX1C 1RWSA 2LVQA 4W9HA 4LLGM 1JMLA 2J0KA 4EZJA 2YEPF 2ZPNA 3VFKA 4OVZA 1ZXHA 5L95C 2KN5A 1N63A 1YJJA 1HZ6A 5DPWA 1A5RA 2KJHB 1LO5D 3CSFA 1WF9A 1FFUA 2OEDA 4PYUA 3ZTCA 4ANVA 2ICIA 2MJ3A 2N9EB 3GE3C 1WMHA 3H1UA 2KFJA 1V1PB 1OEYA 3QHTA 3KUZA 1FCLA 4FHKA 3JYUA 1SE9A 3BINA 2DYOA 2RR9A 2JYTA 1EWCA 4OZBA 2Y3AA 2JXTA 3FILB 3HIZA 2N9KA 2HJ8A 5TSSA 2G9HD 4A6QA 4E74A 2WU5B 1IGDA 2K5PA 4C7ZA 1CJEA 4RF1A 4PYZA 1U4AA 2KTRB 3PV1A 2KFKB 1GUAB 3LB8C 1EO6A 1NI3A 4KX6B 1K8RB 3HM3A 4ZRQA 2L83A 1TY2A 2IY0B 4O1NA 2IYDB 2LFIA 2EMSA 1SJHD 2WXGA 1V5OA 1BT0A 2WXNA 1WJUA 4W9DA 1UBIA 3RCZA 3PREA 3L10B 4TSSA 2BW2A 2KQSA 4TQ0A 4IWPA 3RZWC 1V97A 4KGTA 1WZ3A 2LHEA 3R7QA 3PZDA 1D4BA 4TMAB 1Z5SB 2NBWB 2QIEB 3ETRA 1I42A 1C78A 2Z0DB 1HTQA 3N20C 1TZOA 1SJED 2Z0EB 5BMIA 1EUVB 1X1MA 1D5ZC 5LXHA 2C9WB 4ACFA 4LNNA 1MI0A 3PHWB 3L08A 2KD0A 1SXTA 2FAZA 4FA6A 3DBHB 5D3IB 4HJGE 4KIKA 1TKGA 2KQ4X 2GBRA 1Q0WB 5FR6A 3ML9A 4ZRKA 5LLIA 3ZO5B 5KHQA 3DWMA 1XLNA 4GB9A 4J6IA 4G3XB 1VJKA 2QJLA 3IFWB 4EUTA 1ESFA 1E7VA 2YVCA 2V3PA 3KYDD 4JLCA 3DBRI 1TKEA 1WX8A 2LRUA 2UU7A 1Q10A 5C1ZA 4GOCA 1WSPA 1XLQA 3Q8BA 3R2IA 4RMAA 3NZ3A 3QIJA 1L6VA 4DXAB 1P7EA 1EU3A 1DGJA 4AWJA 1E7PB 4C7YA 2CU1A 2DNFA 3SR6A 2FUG1 3DWGC 1KM7A 2BWES 4ZYNA 4S17A 1YIWA 3TL5A 4EEWA 4K1RB 1WMHB 2N9LA 1E6EB 4JWSC 2WXJA 1PUTA 2JWZA 3AM9A 3UIOB 3M62B 5EE0A 3UQAA 4DK5A 4NAWB 2BTEA 3A1QB 1ISNA 3SDLC 5JZEB 3URYA 2V3NA 2KWDA 4XGAB 1WX9A 4C00A 2IGGA 3V6EB 4HDQA 4L23A 1XLPA 3GP7A 4WURA 2RMMA 5TR5A 2BS2B 2V9HA 1E8XA 3TEZA 5H8YE 4I6LB 4ICVA 1TBEA 2DZIA 2AQ3B 1AW7A 3DBLI 3ZLZA 4UDUC 1WXSA 1TIFA 3A9KA 1ZOYB 2C7NB 2KN4A 2MP2A 3DVGX 3HVZA 1J7BA 3BWUD 4ZRJA 1T6BX 1WGHA 1SBBB 4IC7B 3APCA 3TJPA 3PSEB 4L1BA 5IN7A 4AOFA 2PKOA 2L3ZA 2RDGA 1ZGUB 5T8IA 2D3GA 3KYCD 2J7QB 2BYFA 3TSSA 3P4QB 3UIPB 1A70A 3PVLA 4FULA 1E0ZA 2LASA 2EKIA 3KQ4A 3FAHA 2KMCA 3HK0A 2MBEA 4LCDE 5HFYA 4AUQC 2O6VB 3RI7C 2PLPA 3TIXA 2JQRB 1AYFA 3AB5A 2JT4B 3RT3B 3AU4A 2MBHA 1YQBA 2JVCA 3W1SA 1J7AA 3R66C 1JQ4A 2N1WA 1KF6B 1GC7A 1PQSA 3A9JA 5HHDG 2LI5A 1TGZB 3VH4B 4M0WB 1XF5L 3N1XC 3RZFA 2XNAC 3PGEA 3IT6B 2KC2A 5JH5C 4IWQA 2V1YA 1N60A 2INPE 2R2QA 2AQ1B 4G50A 1HA5A 4DQOC 2V0GA 4DHJD 3APDA 2Y5PA 2HE7A 4HPPA 2D2QA 4KZCA 4YSXB 4IWOA 3T8MA 3RPFC 3V05A 1C4PA 4QAYA 4HK2A 1TS4A 3AV8A 1ZKHA 5JHAA 5G55A 3I5JC 4W9LA 4IKGA 1QILA 4XE0A 3RNCC 2OHFA 3W1YA 1JROA 1XQQA 2Z8LA 3GB1A 1VZ7A 3HM6X 2WU2B 3ZYYX 3W9CB 3ZXRA 2JX5A 2IY1B 4PS7A 2R2OA 1I4PA 3M95A 5EE3A 2G1EA 2C60A 4A3PA 1FNVA 3H8HA 2CHXA 1SSNA 3BK1A 2JY6A 4TKNA 1HE8A 1K53A 2RPVA 2VZKB 3RNGC 2XK5A 2IJ0A 3I3TB 2LJIA 4MM3B 1SEBD 2INDC 1D5MC 2JSVX 3ZTDA 4J3OD 1SE2A 5LXIB 3N30A 3RULA 2G4SA 3Q8EA 2PMVA 5AZHA 3NVWA 2FCNA 5C2TB 3UQBA 1YJIA 1PYWD 3M3JA
chains in the Genus database with same CATH topology
2PEAA 1UD7A 1WJNA 3QAQA 1WYWB 4LJOB 4EZKA 3BY4B 2WWZA 4TV3A 3PRZA 2O6VA 1WY8A 1P1AA 4KSLC 3N3KB 1WXVA 2N4FA 1WJ4A 5HKHA 3VAWA 4YL8A 4GDLA 2ASQA 2FNJB 3VTWA 1TZ1A 2N7EA 2KXJA 2LVQA 1LQBA 4W9HA 2JUOA 4FN2A 2IBIB 3OJ3A 4KIKB 4HCPB 3ENEA 4BBNF 2J0KA 4K7SA 1GG3A 4EZJA 1YD8U 2LWPA 2ZPNA 2MSED 3KUCB 3VFKA 3QQ8B 5L95C 2K6QA 2KN5A 1WGYA 4ANWA 2KLCA 2ZVOA 4WWOA 3X23A 5DPWA 2GBNA 2BWFA 2K1FA 2HD5B 2KJHB 4G0NB 2ZJDA 4PS3A 4DDID 3CSFA 2JRIB 2BPSA 2KTRA 2LXCA 4ZDVA 1WF9A 4EOYA 4PYUA 5DPSA 3ZTCA 2JZZA 4W9IA 4ANVA 2A5UA 4BOZB 1VD2A 3IBEA 3K9PB 4EKUA 5E6OA 3EC8A 2N9EB 2K8BA 4DHJB 4GDLB 1J8CA 1WMHA 3MJWA 3H1UA 2KFJA 3RUIB 3WAOA 5D6JB 1AARA 1OEYA 3QHTA 4ANUA 3RD2A 3KUZA 2DZKA 1FXTB 4MGIE 2V3SA 3DBHI 3CMMB 4FHKA 5IA7A 1WJ6A 3D32A 3OAWA 1WFYA 3L17A 2MW5A 1SE9A 2L0TA 2YLMA 3BINA 2DYOA 2RR9A 3JYUA 4OVUA 3PHXB 1WR6E 2KK8A 3EFUA 1H4RA 2O6VD 3NHEB 3B08A 2N7DA 3ECIA 4WJOA 4B9KA 2LGYA 4MJSB 4W9CA 5EDSA 3HIZA 2UYZB 3DDCB 3EHVA 2HJ8A 3ZNGC 4ANXA 2L0FA 2AL3A 2DENB 2KC1A 1Y8RC 2KNBA 4E74A 2M17A 2NPTB 4PYZA 1U4AA 2KTRB 3PV1A 3WANA 1I35A 2KFKB 1GUAB 2XBBC 1EO6A 3B1LX 1K8RB 3HM3A 3KH0A 1WGDA 4JIOU 2L8JA 2NBUA 2IY0B 1OEYJ 1V49A 2IYDB 1V80A 2EMSA 2W9NA 3DBSA 4FJVB 4HLEA 1R4MI 5CHWA 2KDEB 2XEWA 2ZCCA 1E8WA 3PT2B 1V5OA 1BT0A 3QC8B 2MWSB 3ZDMC 5J17A 4K7WA 4K81A 1V9JA 4FBJB 1WJUA 3A4SC 4W9DA 2BGFA 1UBIA 2BYEA 2GBJA 3PREA 3RCZA 2L00B 1SIFA 3L10B 3VUYA 4LJPB 1R4NI 1XT9B 2AL6A 3SU8X 2KQSA 4TQ0A 3S2AA 4EFOA 4IWPA 3U8ZA 4K7UA 5CHFA 3RZWC 4NY0A 4M8MA 1WZ3A 2CS4A 1F9JA 4GDKA 3DQVA 3R7QA 2KWUB 3AU5A 4BKGA 4MSMB 1WE6A 3PZDA 5C23A 3V62A 4PS8A 1Z5SB 2NBWB 4HPMB 1NI2A 3VDZA 2J0MA 2KQ7A 2EKEC 1NBFC 1WE7A 3UINB 4ASWC 4M8NA 1I42A 1YX6B 4BKTA 3QK0A 2KVRA 2Z0DB 2WX1A 2LVPA 2Z0EB 1EUVB 1X1MA 2PE9A 4DBGA 4KSKC 1KLVA 1YX5B 4GU2A 5LXHA 1WM2A 2C9WB 3IHPC 1V86A 1WGRA 2XK5B 3IG3A 2FCSA 3W1SC 4WJPA 1P3QU 3CF6E 2HTHA 3PHWB 2CKHB 2KD0A 3L08A 2FAZA 4FA6A 5J2RA 2LUEA 5KHOA 4IM0A 3ALBA 3UGBB 4FLHA 4BKSA 3JSVA 3RYTA 4KIKA 4WQOB 2G45B 4DHZB 2GBRA 3NS8A 2MBBB 3VHTC 1Q0WB 2UWQA 2G3QB 4B6WA 2BF8B 3PTFC 5FR6A 3V61A 3VUWA 4FADA 2C7HA 3ML9A 4ZRKA 5LLIA 3V60A 3QWZB 3ZO5B 2DAFA 4P7IA 5KHQA 1C3TA 4MELA 4GB9A 4J6IA 2C5LC 4G3XB 3VTVA 3Q3FA 2KJ6A 1OQYA 2Z59B 2ZVNA 4I6PA 3IFWB 2VRRB 4EUTA 3SD5A 2WYQA 1E7VA 2YVCA 3MTNB 4X57B 4F8CB 2MBQA 3V6CB 3KYDD 4JLCA 3DBRI 5IAAC 2JXXA 4II3B 4JGHB 2LRUA 1WX8A 2JRHA 3OJ4B 4WJQA 3WAPA 4FJYA 1WI0A 3L13A 2LZ6A 2A4ZA 2REXA 4BKSD 5C1ZA 4GOCA 5AZFA 3DVNU 4IM2A 3ZRFA 4HVBA 1NDDA 4RMAA 5L83A 2OJRA 3QIJA 4HCNB 3AI5A 4HDOA 4DXAB 4FHJA 1SGHA 1IYFA 2LGDA 5BO4B 2KDFB 4KDIC 3SHQA 3VUXA 4AWJA 2D07B 4JQWC 2I1KA 3ZNZB 3R3MA 3JW0X 4URKA 2CU1A 4HJKA 4B95A 1WXMA 4RM8A 1KM7A 2BWES 3LDZE 4ZYNA 3NZUA 2LGXA 3QA8A 4MEMA 4OVVA 4KDLB 1YIWA 2FUHB 3ZNHB 3QCAA 3OLMD 3TL5A 4EEWA 1UH6A 4K1RB 1WMHB 1WRDB 2DHZA 2IZVB 2EMTA 2KFKA 2FIFA 1V5TA 2DZMA 1GC6A 1Q5WB 3QARA 3ZNID 5J18A 5JHBA 4NJ6A 2JWZA 3UIOB 1V6EA 1C1YB 1G6JA 2BKFA 3DVNV 3M62B 2J0JA 2D11A 3H7PB 5DPTA 4A20A 3UQAA 4DK5A 1L7YA 2KOXA 4NAWB 1WGGA 1RRBA 2KDBA 2ZZPB 4GMVA 2CHZA 3L16A 2NVUI 4GN1A 3A1QB 1ISNA 1A5RA 1L2NA 2KZRA 3SDLC 5JZEB 2RGFA 2AEHA 4BVUC 1EF5A 1J19A 2CHWA 1E5WA 3T9LA 2KKCA 1WX9A 4LDTB 1RFAA 1GJZA 2DAJA 1ZW7A 2WX0A 3V6EB 2KWVB 4GDKB 2AWTA 4HDQA 3CSTA 4RM9A 2LD9A 3C0RB 2GBMA 4W9GA 1E7UA 1WR1A 2K25A 2PJHA 1D3ZA 5TR5A 1E8XA 3A33B 1CMXB 4MGKE 4I6LB 3AULA 4ICVA 2PPHA 5G2NA 1TBEA 4EZLA 2DZIA 2M4NA 2PE6B 3DBLI 4HPLB 2MX2A 2ZNVC 3JVZX 3PRMB 4I6NB 4MDKE 3ZLZA 1JRUA 2WDTB 2M8SA 1WXSA 3H7PA 3A4RA 3WIMA 3A9KA 1T0YA 2C7NB 2MP2A 1MG8A 4NAWA 3DVGX 3VTUA 1V2YA 3TMPB 2KANA 4ZRJA 1WGHA 3A1QA 2KX0A 4HWIB 1E8ZA 4IC7B 3APCA 3TJPA 3PSEB 2RSUA 4BBNC 2IO0B 3KVFB 2NR2A 1Q1OA 4NQLB 4AOFA 1OGWA 2L3ZA 1ZGUB 2D3GA 3KYCD 2J7QB 2BYFA 3X0WA 2KLGA 1E8YA 4MH0E 4F7ZA 4W9KA 3H9DA 2MBOA 2LVOA 3UIPB 3PVLA 2KHWB 4FULA 1UZXB 2LASA 4NNJB 3PLVA 3PPAA 4IW0A 4MGYE 4MSQB 5DPRA 1YJ1A 2KMCA 4CYEA 3AXCA 4W9EA 3HK0A 1KJTA 1WM3A 2MBEA 4LCDE 3WAMA 2K6DB 4AUQC 2O6VB 3ZRCA 4ZRIA 2FCQA 2KX3A 4IM3A 2B3AA 3PS6A 2K39A 4NQKE 3TIXA 3N32A 4XC2A 1LM8B 1OTRB 3ZW3A 1P9DU 1VCBA 3L54A 3ZIMA 2JT4B 3RT3B 3AU4A 2MBHA 1IP9A 2MRPA 2I1JA 1YQBA 3H6NA 2JVCA 2CR5A 3W1SA 4W9JA 2G4DB 2IO2B 3ZDTA 4ICUA 2JF5A 2LJ5A 2NPTA 3R66C 5D94A 2DYMA 1IPGA 1M94A 3VXWA 2N1WA 1GC7A 3ML8A 2L76A 1PQSA 3EECA 2KDIA 3IVFA 3A9JA 3K9OB 2LI5A 1TGZB 3VH4B 4E71A 4M0WB 1H8CA 4CO7A 4XZ4A 3RZFA 2Y5BB 1WX7A 3Q3JA 2LRWA 4BFRA 3LJ3A 4XX5A 1J0GA 3PGEA 4WJNA 2KC2A 5JH5C 4DWFA 4IWQA 2V1YA 1RLFA 2NCNA 4A3OA 3MHSD 2R2QA 1Z2MA 2KTFA 4G50A 2O2VB 4GGQA 2MLBA 3VH3B 1EF1A 2RPQA 4NJ7A 2M1MA 4DHJD 4AJWA 3APDA 4TUUA 2IO1B 3DCGA 2HE7A 1LFDA 4E3CA 1UBQA 2JPHA 2D2QA 3JSVB 1UELA 2N9PC 1S3SG 3APFA 1S1QB 4JL9A 4KZCA 5DCNA 3NY5A 2QHOA 2MCNB 4BOSC 2KWCA 4IWOA 3T8MA 4AJYB 3QX1A 2N9XA 3KW5B 2KJRA 3QJZA 4MJSA 2NS5A 4HK2A 3A9JB 2GBKA 1ZKHA 5AEKB 5JHAA 5G55A 2GMIC 1WXAA 1WH3A 3H7SA 2DX5B 4W9LA 1WZ0A 5AZGA 2IO3B 5D7GA 2DZJA 4GXBA 3W1YA 4DHZE 4G11A 2O2VA 2K8CA 4IUMB 3WA0A 4KZ0A 1TTNA 3VVWB 1P0RA 2M0XA 3P2BA 2DYBA 3PLUA 1XQQA 2FCMA 3A9KB 4MM3A 2D10A 2MP2B 2AYOB 3HM6X 2L05A 4NPNA 3TCAA 1V81A 3TBLD 2ZPYA 3ZVVA 2GOWA 2MQJA 5E6PA 4TQ1A 4W9FA 2FIDA 2IY1B 4N9F4 3ONSA 4IG7B 4PS7A 3M63B 4MGZE 3DPDA 4WWPA 1LXDA 2R2OA 3GOEA 5D2MB 3M95A 5GMVA 3NZSA 1E90A 4WWNA 3KUDB 3PRPB 1RAXA 5E6NA 4LDTD 2C60A 1GNUA 3WALA 1KOTA 4HXDA 2C7MB 3DVGY 3VQIA 4A3PA 2KO3A 2L7RA 3L0WB 4KVGB 2CHXA 2OOBB 3UF8A 2LXAA 4WAAA 2BYVE 3R7RA 2JY6A 1HE8A 1QZEA 2V4LA 1XD3B 3HHMA 4TKNA 2JZ3B 4GIVA 2K8HA 2BKRB 4KV2A 3ZUNA 3NOBA 4GSWA 2XK5A 2MA9B 2RD0A 3DOWA 2KMAA 3I3TB 2ZNVB 2NBVB 3U30A 3ZKJC 2N1VA 4II2B 3ZTDA 5CX3A 4F1SA 5LXIB 3N30A 3GZNI 3RULA 1P98A 5CHVC 3B0AA 4CHKA 4FJZA 2G4SA 4DDGD 1WIAA 5AZHA 3U7DA 2FCNA 3O65B 3UQBA 1UGMA 2ZCBA 5CTRC 4AP4C 2ZEQA 3M3JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PEA A;  1UD7 A;  1WJN A;  3QAQ A;  1WYW B;  4LJO B;  4EZK A;  3BY4 B;  2WWZ A;  4TV3 A;  3PRZ A;  2O6V A;  1WY8 A;  1P1A A;  4KSL C;  3N3K B;  1WXV A;  2N4F A;  1WJ4 A;  5HKH A;  3VAW A;  4YL8 A;  4GDL A;  2ASQ A;  2FNJ B;  3VTW A;  1TZ1 A;  2N7E A;  2KXJ A;  2LVQ A;  1LQB A;  4W9H A;  2JUO A;  4FN2 A;  2IBI B;  3OJ3 A;  4KIK B;  4HCP B;  3ENE A;  4BBN F;  2J0K A;  4K7S A;  1GG3 A;  4EZJ A;  1YD8 U;  2LWP A;  2ZPN A;  2MSE D;  3KUC B;  3VFK A;  3QQ8 B;  5L95 C;  2K6Q A;  2KN5 A;  1WGY A;  4ANW A;  2KLC A;  2ZVO A;  4WWO A;  3X23 A;  5DPW A;  2GBN A;  2BWF A;  2K1F A;  2HD5 B;  2KJH B;  4G0N B;  2ZJD A;  4PS3 A;  4DDI D;  3CSF A;  2JRI B;  2BPS A;  2KTR A;  2LXC A;  4ZDV A;  1WF9 A;  4EOY A;  4PYU A;  5DPS A;  3ZTC A;  2JZZ A;  4W9I A;  4ANV A;  2A5U A;  4BOZ B;  1VD2 A;  3IBE A;  3K9P B;  4EKU A;  5E6O A;  3EC8 A;  2N9E B;  2K8B A;  4DHJ B;  4GDL B;  1J8C A;  1WMH A;  3MJW A;  3H1U A;  2KFJ A;  3RUI B;  3WAO A;  5D6J B;  1AAR A;  1OEY A;  3QHT A;  4ANU A;  3RD2 A;  3KUZ A;  2DZK A;  1FXT B;  4MGI E;  2V3S A;  3DBH I;  3CMM B;  4FHK A;  5IA7 A;  1WJ6 A;  3D32 A;  3OAW A;  1WFY A;  3L17 A;  2MW5 A;  1SE9 A;  2L0T A;  2YLM A;  3BIN A;  2DYO A;  2RR9 A;  3JYU A;  4OVU A;  3PHX B;  1WR6 E;  2KK8 A;  3EFU A;  1H4R A;  2O6V D;  3NHE B;  3B08 A;  2N7D A;  3ECI A;  4WJO A;  4B9K A;  2LGY A;  4MJS B;  4W9C A;  5EDS A;  3HIZ A;  2UYZ B;  3DDC B;  3EHV A;  2HJ8 A;  3ZNG C;  4ANX A;  2L0F A;  2AL3 A;  2DEN B;  2KC1 A;  1Y8R C;  2KNB A;  4E74 A;  2M17 A;  2NPT B;  4PYZ A;  1U4A A;  2KTR B;  3PV1 A;  3WAN A;  1I35 A;  2KFK B;  1GUA B;  2XBB C;  1EO6 A;  3B1L X;  1K8R B;  3HM3 A;  3KH0 A;  1WGD A;  4JIO U;  2L8J A;  2NBU A;  2IY0 B;  1OEY J;  1V49 A;  2IYD B;  1V80 A;  2EMS A;  2W9N A;  3DBS A;  4FJV B;  4HLE A;  1R4M I;  5CHW A;  2KDE B;  2XEW A;  2ZCC A;  1E8W A;  3PT2 B;  1V5O A;  1BT0 A;  3QC8 B;  2MWS B;  3ZDM C;  5J17 A;  4K7W A;  4K81 A;  1V9J A;  4FBJ B;  1WJU A;  3A4S C;  4W9D A;  2BGF A;  1UBI A;  2BYE A;  2GBJ A;  3PRE A;  3RCZ A;  2L00 B;  1SIF A;  3L10 B;  3VUY A;  4LJP B;  1R4N I;  1XT9 B;  2AL6 A;  3SU8 X;  2KQS A;  4TQ0 A;  3S2A A;  4EFO A;  4IWP A;  3U8Z A;  4K7U A;  5CHF A;  3RZW C;  4NY0 A;  4M8M A;  1WZ3 A;  2CS4 A;  1F9J A;  4GDK A;  3DQV A;  3R7Q A;  2KWU B;  3AU5 A;  4BKG A;  4MSM B;  1WE6 A;  3PZD A;  5C23 A;  3V62 A;  4PS8 A;  1Z5S B;  2NBW B;  4HPM B;  1NI2 A;  3VDZ A;  2J0M A;  2KQ7 A;  2EKE C;  1NBF C;  1WE7 A;  3UIN B;  4ASW C;  4M8N A;  1I42 A;  1YX6 B;  4BKT A;  3QK0 A;  2KVR A;  2Z0D B;  2WX1 A;  2LVP A;  2Z0E B;  1EUV B;  1X1M A;  2PE9 A;  4DBG A;  4KSK C;  1KLV A;  1YX5 B;  4GU2 A;  5LXH A;  1WM2 A;  2C9W B;  3IHP C;  1V86 A;  1WGR A;  2XK5 B;  3IG3 A;  2FCS A;  3W1S C;  4WJP A;  1P3Q U;  3CF6 E;  2HTH A;  3PHW B;  2CKH B;  2KD0 A;  3L08 A;  2FAZ A;  4FA6 A;  5J2R A;  2LUE A;  5KHO A;  4IM0 A;  3ALB A;  3UGB B;  4FLH A;  4BKS A;  3JSV A;  3RYT A;  4KIK A;  4WQO B;  2G45 B;  4DHZ B;  2GBR A;  3NS8 A;  2MBB B;  3VHT C;  1Q0W B;  2UWQ A;  2G3Q B;  4B6W A;  2BF8 B;  3PTF C;  5FR6 A;  3V61 A;  3VUW A;  4FAD A;  2C7H A;  3ML9 A;  4ZRK A;  5LLI A;  3V60 A;  3QWZ B;  3ZO5 B;  2DAF A;  4P7I A;  5KHQ A;  1C3T A;  4MEL A;  4GB9 A;  4J6I A;  2C5L C;  4G3X B;  3VTV A;  3Q3F A;  2KJ6 A;  1OQY A;  2Z59 B;  2ZVN A;  4I6P A;  3IFW B;  2VRR B;  4EUT A;  3SD5 A;  2WYQ A;  1E7V A;  2YVC A;  3MTN B;  4X57 B;  4F8C B;  2MBQ A;  3V6C B;  3KYD D;  4JLC A;  3DBR I;  5IAA C;  2JXX A;  4II3 B;  4JGH B;  2LRU A;  1WX8 A;  2JRH A;  3OJ4 B;  4WJQ A;  3WAP A;  4FJY A;  1WI0 A;  3L13 A;  2LZ6 A;  2A4Z A;  2REX A;  4BKS D;  5C1Z A;  4GOC A;  5AZF A;  3DVN U;  4IM2 A;  3ZRF A;  4HVB A;  1NDD A;  4RMA A;  5L83 A;  2OJR A;  3QIJ A;  4HCN B;  3AI5 A;  4HDO A;  4DXA B;  4FHJ A;  1SGH A;  1IYF A;  2LGD A;  5BO4 B;  2KDF B;  4KDI C;  3SHQ A;  3VUX A;  4AWJ A;  2D07 B;  4JQW C;  2I1K A;  3ZNZ B;  3R3M A;  3JW0 X;  4URK A;  2CU1 A;  4HJK A;  4B95 A;  1WXM A;  4RM8 A;  1KM7 A;  2BWE S;  3LDZ E;  4ZYN A;  3NZU A;  2LGX A;  3QA8 A;  4MEM A;  4OVV A;  4KDL B;  1YIW A;  2FUH B;  3ZNH B;  3QCA A;  3OLM D;  3TL5 A;  4EEW A;  1UH6 A;  4K1R B;  1WMH B;  1WRD B;  2DHZ A;  2IZV B;  2EMT A;  2KFK A;  2FIF A;  1V5T A;  2DZM A;  1GC6 A;  1Q5W B;  3QAR A;  3ZNI D;  5J18 A;  5JHB A;  4NJ6 A;  2JWZ A;  3UIO B;  1V6E A;  1C1Y B;  1G6J A;  2BKF A;  3DVN V;  3M62 B;  2J0J A;  2D11 A;  3H7P B;  5DPT A;  4A20 A;  3UQA A;  4DK5 A;  1L7Y A;  2KOX A;  4NAW B;  1WGG A;  1RRB A;  2KDB A;  2ZZP B;  4GMV A;  2CHZ A;  3L16 A;  2NVU I;  4GN1 A;  3A1Q B;  1ISN A;  1A5R A;  1L2N A;  2KZR A;  3SDL C;  5JZE B;  2RGF A;  2AEH A;  4BVU C;  1EF5 A;  1J19 A;  2CHW A;  1E5W A;  3T9L A;  2KKC A;  1WX9 A;  4LDT B;  1RFA A;  1GJZ A;  2DAJ A;  1ZW7 A;  2WX0 A;  3V6E B;  2KWV B;  4GDK B;  2AWT A;  4HDQ A;  3CST A;  4RM9 A;  2LD9 A;  3C0R B;  2GBM A;  4W9G A;  1E7U A;  1WR1 A;  2K25 A;  2PJH A;  1D3Z A;  5TR5 A;  1E8X A;  3A33 B;  1CMX B;  4MGK E;  4I6L B;  3AUL A;  4ICV A;  2PPH A;  5G2N A;  1TBE A;  4EZL A;  2DZI A;  2M4N A;  2PE6 B;  3DBL I;  4HPL B;  2MX2 A;  2ZNV C;  3JVZ X;  3PRM B;  4I6N B;  4MDK E;  3ZLZ A;  1JRU A;  2WDT B;  2M8S A;  1WXS A;  3H7P A;  3A4R A;  3WIM A;  3A9K A;  1T0Y A;  2C7N B;  2MP2 A;  1MG8 A;  4NAW A;  3DVG X;  3VTU A;  1V2Y A;  3TMP B;  2KAN A;  4ZRJ A;  1WGH A;  3A1Q A;  2KX0 A;  4HWI B;  1E8Z A;  4IC7 B;  3APC A;  3TJP A;  3PSE B;  2RSU A;  4BBN C;  2IO0 B;  3KVF B;  2NR2 A;  1Q1O A;  4NQL B;  4AOF A;  1OGW A;  2L3Z A;  1ZGU B;  2D3G A;  3KYC D;  2J7Q B;  2BYF A;  3X0W A;  2KLG A;  1E8Y A;  4MH0 E;  4F7Z A;  4W9K A;  3H9D A;  2MBO A;  2LVO A;  3UIP B;  3PVL A;  2KHW B;  4FUL A;  1UZX B;  2LAS A;  4NNJ B;  3PLV A;  3PPA A;  4IW0 A;  4MGY E;  4MSQ B;  5DPR A;  1YJ1 A;  2KMC A;  4CYE A;  3AXC A;  4W9E A;  3HK0 A;  1KJT A;  1WM3 A;  2MBE A;  4LCD E;  3WAM A;  2K6D B;  4AUQ C;  2O6V B;  3ZRC A;  4ZRI A;  2FCQ A;  2KX3 A;  4IM3 A;  2B3A A;  3PS6 A;  2K39 A;  4NQK E;  3TIX A;  3N32 A;  4XC2 A;  1LM8 B;  1OTR B;  3ZW3 A;  1P9D U;  1VCB A;  3L54 A;  3ZIM A;  2JT4 B;  3RT3 B;  3AU4 A;  2MBH A;  1IP9 A;  2MRP A;  2I1J A;  1YQB A;  3H6N A;  2JVC A;  2CR5 A;  3W1S A;  4W9J A;  2G4D B;  2IO2 B;  3ZDT A;  4ICU A;  2JF5 A;  2LJ5 A;  2NPT A;  3R66 C;  5D94 A;  2DYM A;  1IPG A;  1M94 A;  3VXW A;  2N1W A;  1GC7 A;  3ML8 A;  2L76 A;  1PQS A;  3EEC A;  2KDI A;  3IVF A;  3A9J A;  3K9O B;  2LI5 A;  1TGZ B;  3VH4 B;  4E71 A;  4M0W B;  1H8C A;  4CO7 A;  4XZ4 A;  3RZF A;  2Y5B B;  1WX7 A;  3Q3J A;  2LRW A;  4BFR A;  3LJ3 A;  4XX5 A;  1J0G A;  3PGE A;  4WJN A;  2KC2 A;  5JH5 C;  4DWF A;  4IWQ A;  2V1Y A;  1RLF A;  2NCN A;  4A3O A;  3MHS D;  2R2Q A;  1Z2M A;  2KTF A;  4G50 A;  2O2V B;  4GGQ A;  2MLB A;  3VH3 B;  1EF1 A;  2RPQ A;  4NJ7 A;  2M1M A;  4DHJ D;  4AJW A;  3APD A;  4TUU A;  2IO1 B;  3DCG A;  2HE7 A;  1LFD A;  4E3C A;  1UBQ A;  2JPH A;  2D2Q A;  3JSV B;  1UEL A;  2N9P C;  1S3S G;  3APF A;  1S1Q B;  4JL9 A;  4KZC A;  5DCN A;  3NY5 A;  2QHO A;  2MCN B;  4BOS C;  2KWC A;  4IWO A;  3T8M A;  4AJY B;  3QX1 A;  2N9X A;  3KW5 B;  2KJR A;  3QJZ A;  4MJS A;  2NS5 A;  4HK2 A;  3A9J B;  2GBK A;  1ZKH A;  5AEK B;  5JHA A;  5G55 A;  2GMI C;  1WXA A;  1WH3 A;  3H7S A;  2DX5 B;  4W9L A;  1WZ0 A;  5AZG A;  2IO3 B;  5D7G A;  2DZJ A;  4GXB A;  3W1Y A;  4DHZ E;  4G11 A;  2O2V A;  2K8C A;  4IUM B;  3WA0 A;  4KZ0 A;  1TTN A;  3VVW B;  1P0R A;  2M0X A;  3P2B A;  2DYB A;  3PLU A;  1XQQ A;  2FCM A;  3A9K B;  4MM3 A;  2D10 A;  2MP2 B;  2AYO B;  3HM6 X;  2L05 A;  4NPN A;  3TCA A;  1V81 A;  3TBL D;  2ZPY A;  3ZVV A;  2GOW A;  2MQJ A;  5E6P A;  4TQ1 A;  4W9F A;  2FID A;  2IY1 B;  4N9F 4;  3ONS A;  4IG7 B;  4PS7 A;  3M63 B;  4MGZ E;  3DPD A;  4WWP A;  1LXD A;  2R2O A;  3GOE A;  5D2M B;  3M95 A;  5GMV A;  3NZS A;  1E90 A;  4WWN A;  3KUD B;  3PRP B;  1RAX A;  5E6N A;  4LDT D;  2C60 A;  1GNU A;  3WAL A;  1KOT A;  4HXD A;  2C7M B;  3DVG Y;  3VQI A;  4A3P A;  2KO3 A;  2L7R A;  3L0W B;  4KVG B;  2CHX A;  2OOB B;  3UF8 A;  2LXA A;  4WAA A;  2BYV E;  3R7R A;  2JY6 A;  1HE8 A;  1QZE A;  2V4L A;  1XD3 B;  3HHM A;  4TKN A;  2JZ3 B;  4GIV A;  2K8H A;  2BKR B;  4KV2 A;  3ZUN A;  3NOB A;  4GSW A;  2XK5 A;  2MA9 B;  2RD0 A;  3DOW A;  2KMA A;  3I3T B;  2ZNV B;  2NBV B;  3U30 A;  3ZKJ C;  2N1V A;  4II2 B;  3ZTD A;  5CX3 A;  4F1S A;  5LXI B;  3N30 A;  3GZN I;  3RUL A;  1P98 A;  5CHV C;  3B0A A;  4CHK A;  4FJZ A;  2G4S A;  4DDG D;  1WIA A;  5AZH A;  3U7D A;  2FCN A;  3O65 B;  3UQB A;  1UGM A;  2ZCB A;  5CTR C;  4AP4 C;  2ZEQ A;  3M3J A; 
#chains in the Genus database with same CATH topology
 2PEA A;  1UD7 A;  3QAQ A;  4TV3 A;  3PRZ A;  2O6V A;  4GLS C;  2N4F A;  1MG4 A;  4GDL A;  2ASQ A;  2LUM A;  1PGB A;  3VTW A;  1LQB A;  2IBI B;  4KIK B;  2WXQ A;  3ENE A;  2GB1 A;  2X38 A;  1MJD A;  1GG3 A;  3AEE B;  1XCQ L;  2MSE D;  3KUC B;  2DBY A;  3RFZ B;  2QSD A;  3QQ8 B;  2IDY A;  1GB1 A;  4WWO A;  2K1F A;  2HD5 B;  4G0N B;  2JRI B;  1GB4 A;  5DPS A;  4BZA A;  1LGR A;  4BOZ B;  4H2A A;  4KKI A;  4KKJ A;  2KVZ A;  4M01 A;  3MJW A;  5BYR A;  5HI1 A;  4ANU A;  3DBH I;  1WJ6 A;  3OAW A;  3N1Z C;  1WR6 E;  2KK8 A;  3EFU A;  1H4R A;  2WQY B;  2QMT A;  4WJO A;  4B9K A;  4W9C A;  2ZW0 A;  5EE9 A;  4US9 A;  2NPT B;  3WAN A;  5D3D A;  3IT4 B;  3KWV A;  2XBB C;  4RGT A;  4IDI A;  2BB6 A;  3KH0 A;  4XDD A;  4HLE A;  2W9N A;  1V80 A;  4FJV B;  1R4M I;  2IGD A;  3PT2 B;  1E8W A;  2ONQ A;  4K7W A;  5JXV A;  2BGF A;  4MAC A;  2L00 B;  1SIF A;  4LJP B;  2AL6 A;  4EFO A;  4DXF A;  5CHF A;  4NY0 A;  4OHJ A;  3DQV A;  2KWU B;  3P4R B;  5BMH A;  3AEG B;  3PO0 A;  4PS8 A;  4HPM B;  4IOI E;  2KQ7 A;  3NVY A;  4ASW C;  3ZJT A;  1L6U A;  3W2D A;  4BKT A;  3QK0 A;  2KVR A;  2WX1 A;  2LVP A;  3RMK C;  3GS2 A;  4GU2 A;  1WM2 A;  1V86 A;  2XK5 B;  2WXK A;  4C80 A;  3CF6 E;  2HTH A;  2CKH B;  4RCO A;  4K3C A;  1GOZ A;  4WWM A;  3JSV A;  4WQO B;  4DHZ B;  3VHT C;  2MBB B;  2UWQ A;  2BF8 B;  3VUW A;  3V61 A;  1I7H A;  3V60 A;  2BBC A;  1KH0 A;  1R4N B;  4P7I A;  2SEB D;  4MEL A;  2C5L C;  2WXH A;  1OQY A;  1TS3 A;  1BML C;  3RNE C;  2WYQ A;  3FC4 A;  2JYE A;  3MTN B;  4F8C B;  2MBQ A;  5IAA C;  2JXX A;  2I38 A;  3VR8 B;  4WJQ A;  4FJY A;  1WI0 A;  3L13 A;  5AZF A;  2N7J A;  1PFD A;  1ZP0 B;  3ZRF A;  3BVG A;  2LGD A;  1N5X A;  5BO4 B;  2KDF B;  3SHQ A;  3VUX A;  2D07 B;  2I1K A;  3ZNZ B;  3R3M A;  4OW0 A;  3PZ7 A;  1YNT E;  4B95 A;  1WXM A;  3NZU A;  3QA8 A;  4OVV A;  4KDL B;  3FKY A;  3R8B A;  1UH6 A;  1WRD B;  3BZD B;  2IZV B;  1N5W A;  3QAR A;  4LNI A;  4C56 C;  1MFW A;  2WXM A;  4B0E A;  1FEH A;  1C77 A;  3DVN V;  2D11 A;  1K50 A;  3H7P B;  1DOY A;  2ZZP B;  2KDB A;  4RF0 A;  2CHZ A;  2OJW A;  4GN1 A;  2KZR A;  2WNM A;  3OG5 A;  4BVU C;  1J19 A;  1E5W A;  2KWV B;  3PZ8 A;  2AWT A;  2KT7 A;  3LYY A;  4RM9 A;  2WXL A;  2HTM E;  1E9M A;  1E7U A;  2K25 A;  3I9V 1;  1T0S C;  3RNA C;  4RGM A;  4P16 A;  3BVM A;  2M4N A;  3P42 A;  3JVZ X;  4MDK E;  1JRU A;  2E3T A;  4AS1 A;  3Q2A C;  2H89 B;  4NAW A;  1V2Y A;  3DHI C;  3A1Q A;  1E8Z A;  2H88 B;  3KVF B;  3BYY B;  1OGW A;  1E8Y A;  3U4E G;  3FIL A;  1PDX A;  3W5V B;  2MBO A;  2LVO A;  1HTO A;  1ZXI A;  4N6E B;  1UZX B;  3P4S B;  4BAX A;  4ZHP A;  1WWT A;  3KWL A;  3PPA A;  4MGY E;  4RNA A;  4CYE A;  1XO3 A;  3AXC A;  4W9E A;  1KJT A;  1WM3 A;  3WAM A;  4ZRI A;  2KX3 A;  2PIA A;  5HG2 A;  3N32 A;  4XC2 A;  2QEJ C;  1YN3 A;  3ZW3 A;  1P9D U;  1VCB A;  4YTP B;  3ZIM A;  3HUI A;  3H6N A;  1L0X B;  2I1J A;  1MVK A;  2G4D B;  3Q8C A;  2LJ5 A;  1FFV A;  4L2Y A;  4OZA A;  1KLU D;  3IVF A;  4OZC A;  1FM0 D;  4E71 A;  3AE3 B;  1JWA D;  3Q3J A;  1WX7 A;  2LRW A;  3LJ3 A;  1J0G A;  2NCN A;  2N0S B;  2O2V B;  4A90 A;  1KLG D;  4NJ7 A;  2M1M A;  4TUU A;  3Q3N C;  4DXG A;  3NVV A;  2CJO A;  2JPH A;  1S3S G;  1S1Q B;  1YMH E;  3NY5 A;  1F52 A;  2QCZ A;  2W82 A;  1FRR A;  1VRA B;  2KJR A;  3A9J B;  1D6E C;  1BUI C;  4WAF A;  2GMI C;  1YOV B;  3H7S A;  2DX5 B;  4A55 A;  5D7G A;  4DHZ E;  2Y5C A;  4XWT A;  1QKZ A;  5LNK 1;  1ZE3 D;  1P0R A;  2M0X A;  2DYB A;  2INN E;  1DOI A;  2L52 A;  2L05 A;  3ZQ4 A;  4US8 A;  2MH7 A;  1YN5 A;  1ENF A;  2MQJ A;  5E6P A;  4TQ1 A;  4W9F A;  1GPX A;  4N9F 4;  3ONS A;  4IG7 B;  4WWP A;  1TKY A;  5GMV A;  1LXD A;  3NZS A;  1E90 A;  3AE7 B;  1QOA A;  1RAX A;  5E6N A;  1GNU A;  2VH1 A;  3WAL A;  2C7M B;  3DVG Y;  3VQI A;  4WIP A;  1FIQ A;  2L7R A;  2OOB B;  3EUB 2;  2LXA A;  4LNK A;  2BYV E;  4P6V F;  1QZE A;  3HHM A;  1J7C A;  2K8H A;  3ZUN A;  2WXO A;  3NOB A;  2RD0 A;  3DOW A;  4R3D A;  2ZNV B;  3U30 A;  4YTN B;  1CZP A;  5CX3 A;  4F1S A;  3DHG C;  3GZN I;  5CHV C;  1L0Y B;  4FJZ A;  4A8X C;  1PGX A;  1WIA A;  4YXD B;  4USA A;  3U7D A;  1UGM A;  5CTR C;  1HXY D;  3BY4 B;  3NRZ A;  2BVC A;  4KSL C;  1WJ4 A;  5HKH A;  1JWS D;  3B2F A;  1TZ1 A;  2N7E A;  2FBW B;  3OJ3 A;  1IBX B;  4K7S A;  3U2S C;  3CWI A;  2K6Q A;  1WGY A;  3HRD D;  3NJT A;  2KLC A;  2GBN A;  4PS3 A;  4DDI D;  1AN8 A;  2LXC A;  4EOY A;  4ARC A;  2A5U A;  3W5U B;  1VD2 A;  3IBE A;  3K9P B;  4EKU A;  3EC8 A;  4DHJ B;  4GDL B;  5MPO A;  3RUI B;  3WAO A;  1AAR A;  1FXT B;  3AE4 B;  2KMM A;  5IA7 A;  3CMM B;  3D32 A;  3L17 A;  2YLM A;  4OVU A;  3PHX B;  3NHE B;  4WQM A;  2MHJ A;  2M0A A;  5EDS A;  3ZNG C;  3DDC B;  4ARI A;  5EE1 A;  2DEN B;  1Y8R C;  1JRP A;  2JZP A;  3P63 A;  4N59 A;  1QOF A;  2J53 A;  4JIO U;  1V49 A;  1FMA D;  5CHW A;  1L5P A;  3QC8 B;  1HZ5 A;  2MWS B;  5J17 A;  2LEK A;  4K81 A;  1V9J A;  3A4S C;  1XCT L;  2BYE A;  2GBJ A;  4A9A A;  3VUY A;  2M56 B;  1R4N I;  1XT9 B;  2BS4 B;  3SU8 X;  3S2A A;  4K7U A;  4M8M A;  4C4V B;  2CS4 A;  2WDR B;  3AU5 A;  4BKG A;  3VRB B;  1N6Z A;  4MT5 A;  4ZYS A;  1I4Q A;  2L32 A;  1NI2 A;  2J0M A;  2EKE C;  1WE7 A;  3UIN B;  1FPY A;  4M8N A;  4ZOH C;  3Q6B A;  3AEB B;  5AUI A;  1DYQ A;  4DBG A;  4KSK C;  1YX5 B;  3IHP C;  1WGR A;  2Q5W D;  3IG3 A;  4WJP A;  1JCK B;  1VR9 A;  3ALB A;  2L1A A;  2E6X A;  2C7H A;  3RNB C;  1V8C A;  1E10 A;  2DAF A;  4JPS A;  1C3T A;  3GE8 C;  1NYR A;  2W54 A;  4HEA 1;  2ZVN A;  2Z59 B;  5G5H A;  1L4D B;  4I6P A;  1NVI D;  3U7Z A;  2VRR B;  4LTU A;  3SD5 A;  1UUP A;  1XEE A;  4X57 B;  1ET6 A;  1ZUD 2;  4JGH B;  3OJ4 B;  1C76 A;  2A4Z A;  3DVN U;  1F2R I;  1NDD A;  1TS5 A;  5L83 A;  2OJR A;  4HCN B;  3AI5 A;  4YSZ B;  2QC8 A;  4HDO A;  4FHJ A;  1ROE A;  1IYF A;  3U52 E;  1PGA A;  4KDI C;  2NMQ A;  1YN4 A;  2KDM A;  4JQW C;  2BQQ A;  4URK A;  3MC0 B;  4RM8 A;  4XDC A;  2LGX A;  4MEM A;  3SFE B;  2FUH B;  3ZNH B;  2K0P A;  3QCA A;  3OLM D;  3VR9 B;  2DHZ A;  2FIF A;  2DZM A;  1GC6 A;  1Q5W B;  5JHB A;  1B1Z A;  4NJ6 A;  1RYJ A;  2W3S A;  1JW9 D;  2VZK D;  5DPT A;  4A20 A;  3TUO A;  2KOX A;  1WGG A;  3P4P B;  1KRH A;  2KAJ A;  1ACC A;  1MHH E;  4AQ7 A;  1WXQ A;  5FKA C;  2KKC A;  4LDT B;  4LK0 M;  2DAJ A;  1F0Z A;  4WH4 A;  2WX0 A;  3AEC B;  4GDK B;  2DLB A;  1EU4 A;  1TS2 A;  2W3R A;  3CST A;  2D3A A;  4W9G A;  1SIJ A;  1WR1 A;  2PJH A;  1D5X C;  1NYQ A;  3AUL A;  3P1M A;  2BT6 A;  5BMG A;  2ZNV C;  2WDT B;  3MC8 A;  3H7P A;  2PW9 A;  1T0Y A;  1MG8 A;  3Q8F A;  3ZGZ A;  3VTU A;  3TMP B;  2KAN A;  1M4V A;  4HWI B;  1GAQ B;  4YTM B;  2RSU A;  4BBN C;  2IO0 B;  1SE3 A;  2NR2 A;  4ZRP A;  3VRA B;  2D3B A;  3X0W A;  3TEY A;  3I57 A;  3NUH B;  4MH0 E;  4F7Z A;  4W9K A;  2WHI A;  3CIR B;  2FE8 A;  4IW0 A;  4MSQ B;  3MP9 A;  4NAM A;  2K6D B;  4FXC A;  2FCQ A;  4IM3 A;  1QOG A;  2B3A A;  2CU3 A;  1LM8 B;  1OTR B;  3L4P A;  2LGS A;  3L54 A;  2VH2 A;  2MRP A;  2WLB A;  2AQ2 B;  2CR5 A;  4W9J A;  3Q69 A;  2RDH A;  2IO2 B;  3ZDT A;  5D94 A;  2R61 A;  2EEL A;  3ML8 A;  3R2T A;  3EEC A;  2JWU A;  3K9O B;  4HKZ E;  1H8C A;  4CO7 A;  4XZ4 A;  4BFR A;  4XX5 A;  1JWM D;  4WJN A;  1JWB D;  4DWF A;  2D3C A;  4A3O A;  3MHS D;  4KGS A;  1Z2M A;  1OQR A;  4ZHO A;  1EF1 A;  2RPQ A;  1IBX A;  3MC9 A;  2TSS A;  1QOB A;  5IKC M;  1LFD A;  3OWE B;  1UBQ A;  3TEW A;  3JSV B;  1UEL A;  2N9P C;  1NEN B;  3APF A;  4RGN A;  1L0V B;  5DCN A;  3ZXV A;  5E6J A;  4AJY B;  2N9X A;  2PVO D;  3QJZ A;  4MJS A;  2NS5 A;  1UWM A;  2GRI A;  2GBK A;  3EFC A;  5AEK B;  3Q14 C;  1WXA A;  4CQN A;  1WZ0 A;  2SAK A;  2LHD A;  1T0R C;  2IO3 B;  3B2G A;  4RGO S;  1RFK A;  1XXG A;  2MJD A;  2O2V A;  2K8C A;  4IUM B;  3WA0 A;  1TTN A;  5GXG B;  2J4X A;  3P2B A;  2BS3 B;  2FCM A;  1YQ3 B;  2KAC A;  2D10 A;  2AYO B;  4NPN A;  1SB3 C;  3TCA A;  1CQV A;  1V81 A;  2ZPY A;  2GOW A;  2MEK A;  1VLB A;  3DPD A;  1WRI A;  3PRP B;  1FRD A;  1C4C A;  4LDT D;  1OFF A;  2KO3 A;  4KVG B;  3UF8 A;  3C19 A;  5BYS A;  4KGR A;  2JZ3 B;  4GIV A;  2BKR B;  5H92 C;  1I4H A;  2WXF A;  3EGR A;  3AED B;  2NBV B;  2JU6 X;  1UWX A;  3ZKJ C;  1HQR D;  4C4V A;  3GZN B;  1SF0 A;  4Q2J A;  2ZCB A;  4NJC A;  1WJN A;  3I63 C;  4PK1 A;  1EM7 A;  4EZK A;  2GLS A;  2W55 A;  1WY8 A;  1EWY C;  1P1A A;  3N3K B;  1AWD A;  3EA6 A;  1V1O A;  1V1P A;  2KXJ A;  2NTS A;  2JUO A;  2PVG C;  4FN2 A;  1FD6 A;  4HCP B;  5AUK A;  4BBN F;  1QF6 A;  3N9Y C;  1ET9 A;  4B0M A;  1CK1 A;  1YD8 U;  2LWP A;  4LNF A;  1P7F A;  3DBR B;  4ANW A;  2ZVO A;  3X23 A;  2BWF A;  2ZJD A;  1FXA A;  2BB5 A;  2BPS A;  2KTR A;  4ZDV A;  1C9F A;  3DHH C;  2JZZ A;  4W9I A;  2X8X X;  3SFD B;  1FNU A;  5E6O A;  2ON8 A;  4S0R A;  3T3N A;  2K8B A;  3NVZ A;  1J8C A;  5D6J B;  1TY0 A;  3RD2 A;  2DZK A;  4MGI E;  3WCQ A;  2V3S A;  3IAS 1;  4YWG G;  1WFY A;  2MW5 A;  2L0T A;  3SEB A;  3O13 A;  2O6V D;  5FR3 A;  3B08 A;  2N7D A;  3ECI A;  2WP9 B;  2LGY A;  4MJS B;  2UYZ B;  3EHV A;  4ANX A;  2L0F A;  2AL3 A;  2B76 B;  2KC1 A;  2KNB A;  2INC C;  2M17 A;  1UNS A;  5FK9 C;  3J9C A;  2IPK D;  3AE5 B;  1I35 A;  1I4X A;  1KFY B;  2ACZ B;  4M02 A;  3B1L X;  1TJE A;  1KTK A;  4XYC A;  1WGD A;  2L8J A;  2NBU A;  1OEY J;  2K22 A;  3DBS A;  3NS1 A;  1C4A A;  2KDE B;  2XEW A;  2ZCC A;  3MHZ A;  3Q8A A;  1K51 A;  3ZDM C;  3AE9 B;  1ZPS A;  3N1Y C;  4FBJ B;  4M00 A;  1T0Q C;  3U8Z A;  1F9J A;  4GDK A;  3V3X A;  4MSM B;  1WE6 A;  2LGI A;  3UI3 A;  5C23 A;  3V62 A;  3VDZ A;  1NBF C;  3BYT B;  2WS3 B;  1YX6 B;  2CJN A;  3E9S A;  2PE9 A;  2V4I B;  1KLV A;  1T5X D;  2FCS A;  3W1S C;  1P3Q U;  4P1B C;  5J2R A;  3E56 A;  3KLS X;  3B9J A;  2LUE A;  5IOI A;  5KHO A;  4IM0 A;  3UGB B;  4FLH A;  2WXI A;  1T3Q A;  4BKS A;  2J52 A;  3RYT A;  1F2R C;  1IUE A;  2G45 B;  1RM6 C;  3NS8 A;  2G3Q B;  4B6W A;  3PTF C;  4FAD A;  2M19 A;  1HEZ E;  3AE1 B;  3BK2 A;  3QWZ B;  4NZL B;  3VTV A;  3Q3F A;  1FXI A;  2KJ6 A;  3RN9 C;  4K3B A;  1K52 A;  2XN9 C;  3AEF B;  1TYG B;  3V6C B;  1QT9 A;  4JE3 B;  4II3 B;  3WAP A;  2JRH A;  2LZ6 A;  2REX A;  4BKS D;  4IM2 A;  1MHX A;  2DWQ A;  4HVB A;  5G5G A;  1JWU D;  2BYT A;  1SGH A;  1YQ4 B;  1I4R A;  4YSY B;  3LXF A;  3JW0 X;  2J42 A;  4JWU C;  4HJK A;  1VZ8 A;  3ZJV A;  1ZDX A;  1MPE A;  3LDZ E;  4RFB A;  4HRO A;  3TEX A;  2KFK A;  2QDF A;  2EMT A;  3AE2 B;  1QLB B;  1V5T A;  5J18 A;  3ZNI D;  3RNF C;  4YT0 B;  1V6E A;  1C1Y B;  1G6J A;  2BKF A;  2J0J A;  1L7Y A;  1RRB A;  1Y56 A;  4GMV A;  2AX5 A;  2NVU I;  3L16 A;  3ZJU A;  1L2N A;  2RGF A;  2AEH A;  1EF5 A;  2CHW A;  3T9L A;  1RFA A;  1GJZ A;  1ZW7 A;  2LD9 A;  3C0R B;  2GBM A;  3MJ5 A;  1SE4 A;  1D3Z A;  2K9X A;  1F77 A;  3A33 B;  1CMX B;  4MGK E;  2MJE A;  4HRS A;  1R7S A;  2PPH A;  4MH8 A;  4D2K A;  5G2N A;  2QIL A;  4EZL A;  1OQQ A;  2PE6 B;  4HPL B;  2MX2 A;  3PRM B;  4I6N B;  2M8S A;  1IGC A;  1WGK A;  3A4R A;  3WIM A;  3IXS A;  1STE A;  1C79 A;  2KX0 A;  1Q1O A;  4NQL B;  3AMZ A;  2KLG A;  1FO4 A;  3H9D A;  2K3U A;  1UF0 A;  2IGH A;  2KHW B;  4NNJ B;  5IP4 D;  3PLV A;  1NEK B;  4RH6 A;  5DPR A;  1YJ1 A;  1UGJ A;  2HDE A;  3IAM 1;  2WDV B;  3ZRC A;  3AN1 A;  3PS6 A;  2K39 A;  4NQK E;  1N62 A;  1B9R A;  3NG0 A;  3DBL B;  1IP9 A;  3Q3M C;  4ICU A;  2JF5 A;  3MFG A;  2NPT A;  3AEA B;  1I4G A;  2DYM A;  1IPG A;  1M94 A;  3VXW A;  1L4Z B;  2L76 A;  2KDI A;  4LNO A;  2Y5B B;  2WXP A;  5C3J B;  1RLF A;  1JAL A;  2HJ1 A;  2KTF A;  4GGQ A;  3VH3 B;  2MLB A;  3HVD A;  4AJW A;  2IO1 B;  3DCG A;  2ZW1 A;  2LMC A;  3C8Y A;  4E3C A;  5I4D A;  4JL9 A;  2QHO A;  2MCN B;  4BOS C;  2KWC A;  3QX1 A;  3KW5 B;  1VZ6 A;  5IO9 A;  2NTT A;  1WH3 A;  1N61 A;  1BXT A;  1DOX A;  5AZG A;  1VDV A;  2DZJ A;  4GXB A;  3T3O A;  4G11 A;  4KZ0 A;  1TT5 B;  2GI9 A;  2PTL A;  3VVW B;  4HKQ A;  3PLU A;  4REZ A;  3A9K B;  4MM3 A;  2MP2 B;  3TBL D;  3ZVV A;  1WYG A;  2RDB C;  2I2Y A;  1QQR A;  2FID A;  1ZDV A;  3M63 B;  4MGZ E;  3GOE A;  1R4M B;  5D2M B;  4WWN A;  3KUD B;  2WDQ B;  2KYW A;  1KOT A;  4HXD A;  2WXR A;  3AE6 B;  3L0W B;  3ABV B;  2D5G A;  4WAA A;  3R7R A;  4P1C C;  2V4L A;  1XD3 B;  5BYQ A;  4KV2 A;  3BII D;  4GSW A;  4ITK A;  4EE2 A;  2MA9 B;  2KMA A;  2N1V A;  4II2 B;  1FCC C;  1XLO A;  4XWW A;  4CHK A;  1P98 A;  1F1H A;  3B0A A;  4DDG D;  3O65 B;  3AH7 A;  2YEP B;  2ZEQ A;  4AP4 C;  1WYW B;  4LJO B;  2WWZ A;  2WGS A;  4N58 A;  4M0W A;  3AE8 B;  1WXV A;  3BVZ A;  3VAW A;  3Q3O C;  1FNW A;  4YL8 A;  2FNJ B;  4PT5 A;  4JX1 C;  1RWS A;  2LVQ A;  4W9H A;  4LLG M;  1JML A;  2J0K A;  4EZJ A;  2YEP F;  2ZPN A;  3VFK A;  4OVZ A;  1ZXH A;  5L95 C;  2KN5 A;  1N63 A;  1YJJ A;  1HZ6 A;  5DPW A;  1A5R A;  2KJH B;  1LO5 D;  3CSF A;  1WF9 A;  1FFU A;  2OED A;  4PYU A;  3ZTC A;  4ANV A;  2ICI A;  2MJ3 A;  2N9E B;  3GE3 C;  1WMH A;  3H1U A;  2KFJ A;  1V1P B;  1OEY A;  3QHT A;  3KUZ A;  1FCL A;  4FHK A;  3JYU A;  1SE9 A;  3BIN A;  2DYO A;  2RR9 A;  2JYT A;  1EWC A;  4OZB A;  2Y3A A;  2JXT A;  3FIL B;  3HIZ A;  2N9K A;  2HJ8 A;  5TSS A;  2G9H D;  4A6Q A;  4E74 A;  2WU5 B;  1IGD A;  2K5P A;  4C7Z A;  1CJE A;  4RF1 A;  4PYZ A;  1U4A A;  2KTR B;  3PV1 A;  2KFK B;  1GUA B;  3LB8 C;  1EO6 A;  1NI3 A;  4KX6 B;  1K8R B;  3HM3 A;  4ZRQ A;  2L83 A;  1TY2 A;  2IY0 B;  4O1N A;  2IYD B;  2LFI A;  2EMS A;  1SJH D;  2WXG A;  1V5O A;  1BT0 A;  2WXN A;  1WJU A;  4W9D A;  1UBI A;  3RCZ A;  3PRE A;  3L10 B;  4TSS A;  2BW2 A;  2KQS A;  4TQ0 A;  4IWP A;  3RZW C;  1V97 A;  4KGT A;  1WZ3 A;  2LHE A;  3R7Q A;  3PZD A;  1D4B A;  4TMA B;  1Z5S B;  2NBW B;  2QIE B;  3ETR A;  1I42 A;  1C78 A;  2Z0D B;  1HTQ A;  3N20 C;  1TZO A;  1SJE D;  2Z0E B;  5BMI A;  1EUV B;  1X1M A;  1D5Z C;  5LXH A;  2C9W B;  4ACF A;  4LNN A;  1MI0 A;  3PHW B;  3L08 A;  2KD0 A;  1SXT A;  2FAZ A;  4FA6 A;  3DBH B;  5D3I B;  4HJG E;  4KIK A;  1TKG A;  2KQ4 X;  2GBR A;  1Q0W B;  5FR6 A;  3ML9 A;  4ZRK A;  5LLI A;  3ZO5 B;  5KHQ A;  3DWM A;  1XLN A;  4GB9 A;  4J6I A;  4G3X B;  1VJK A;  2QJL A;  3IFW B;  4EUT A;  1ESF A;  1E7V A;  2YVC A;  2V3P A;  3KYD D;  4JLC A;  3DBR I;  1TKE A;  1WX8 A;  2LRU A;  2UU7 A;  1Q10 A;  5C1Z A;  4GOC A;  1WSP A;  1XLQ A;  3Q8B A;  3R2I A;  4RMA A;  3NZ3 A;  3QIJ A;  1L6V A;  4DXA B;  1P7E A;  1EU3 A;  1DGJ A;  4AWJ A;  1E7P B;  4C7Y A;  2CU1 A;  2DNF A;  3SR6 A;  2FUG 1;  3DWG C;  1KM7 A;  2BWE S;  4ZYN A;  4S17 A;  1YIW A;  3TL5 A;  4EEW A;  4K1R B;  1WMH B;  2N9L A;  1E6E B;  4JWS C;  2WXJ A;  1PUT A;  2JWZ A;  3AM9 A;  3UIO B;  3M62 B;  5EE0 A;  3UQA A;  4DK5 A;  4NAW B;  2BTE A;  3A1Q B;  1ISN A;  3SDL C;  5JZE B;  3URY A;  2V3N A;  2KWD A;  4XGA B;  1WX9 A;  4C00 A;  2IGG A;  3V6E B;  4HDQ A;  4L23 A;  1XLP A;  3GP7 A;  4WUR A;  2RMM A;  5TR5 A;  2BS2 B;  2V9H A;  1E8X A;  3TEZ A;  5H8Y E;  4I6L B;  4ICV A;  1TBE A;  2DZI A;  2AQ3 B;  1AW7 A;  3DBL I;  3ZLZ A;  4UDU C;  1WXS A;  1TIF A;  3A9K A;  1ZOY B;  2C7N B;  2KN4 A;  2MP2 A;  3DVG X;  3HVZ A;  1J7B A;  3BWU D;  4ZRJ A;  1T6B X;  1WGH A;  1SBB B;  4IC7 B;  3APC A;  3TJP A;  3PSE B;  4L1B A;  5IN7 A;  4AOF A;  2PKO A;  2L3Z A;  2RDG A;  1ZGU B;  5T8I A;  2D3G A;  3KYC D;  2J7Q B;  2BYF A;  3TSS A;  3P4Q B;  3UIP B;  1A70 A;  3PVL A;  4FUL A;  1E0Z A;  2LAS A;  2EKI A;  3KQ4 A;  3FAH A;  2KMC A;  3HK0 A;  2MBE A;  4LCD E;  5HFY A;  4AUQ C;  2O6V B;  3RI7 C;  2PLP A;  3TIX A;  2JQR B;  1AYF A;  3AB5 A;  2JT4 B;  3RT3 B;  3AU4 A;  2MBH A;  1YQB A;  2JVC A;  3W1S A;  1J7A A;  3R66 C;  1JQ4 A;  2N1W A;  1KF6 B;  1GC7 A;  1PQS A;  3A9J A;  5HHD G;  2LI5 A;  1TGZ B;  3VH4 B;  4M0W B;  1XF5 L;  3N1X C;  3RZF A;  2XNA C;  3PGE A;  3IT6 B;  2KC2 A;  5JH5 C;  4IWQ A;  2V1Y A;  1N60 A;  2INP E;  2R2Q A;  2AQ1 B;  4G50 A;  1HA5 A;  4DQO C;  2V0G A;  4DHJ D;  3APD A;  2Y5P A;  2HE7 A;  4HPP A;  2D2Q A;  4KZC A;  4YSX B;  4IWO A;  3T8M A;  3RPF C;  3V05 A;  1C4P A;  4QAY A;  4HK2 A;  1TS4 A;  3AV8 A;  1ZKH A;  5JHA A;  5G55 A;  3I5J C;  4W9L A;  4IKG A;  1QIL A;  4XE0 A;  3RNC C;  2OHF A;  3W1Y A;  1JRO A;  1XQQ A;  2Z8L A;  3GB1 A;  1VZ7 A;  3HM6 X;  2WU2 B;  3ZYY X;  3W9C B;  3ZXR A;  2JX5 A;  2IY1 B;  4PS7 A;  2R2O A;  1I4P A;  3M95 A;  5EE3 A;  2G1E A;  2C60 A;  4A3P A;  1FNV A;  3H8H A;  2CHX A;  1SSN A;  3BK1 A;  2JY6 A;  4TKN A;  1HE8 A;  1K53 A;  2RPV A;  2VZK B;  3RNG C;  2XK5 A;  2IJ0 A;  3I3T B;  2LJI A;  4MM3 B;  1SEB D;  2IND C;  1D5M C;  2JSV X;  3ZTD A;  4J3O D;  1SE2 A;  5LXI B;  3N30 A;  3RUL A;  2G4S A;  3Q8E A;  2PMV A;  5AZH A;  3NVW A;  2FCN A;  5C2T B;  3UQB A;  1YJI A;  1PYW D;  3M3J A; 
#chains in the Genus database with same CATH homology
 2PEA A;  1UD7 A;  1WJN A;  3QAQ A;  1WYW B;  4LJO B;  4EZK A;  3BY4 B;  2WWZ A;  4TV3 A;  3PRZ A;  2O6V A;  1WY8 A;  1P1A A;  4KSL C;  3N3K B;  1WXV A;  2N4F A;  1WJ4 A;  5HKH A;  3VAW A;  4YL8 A;  4GDL A;  2ASQ A;  2FNJ B;  3VTW A;  1TZ1 A;  2N7E A;  2KXJ A;  2LVQ A;  1LQB A;  4W9H A;  2JUO A;  4FN2 A;  2IBI B;  3OJ3 A;  4KIK B;  4HCP B;  3ENE A;  4BBN F;  2J0K A;  4K7S A;  1GG3 A;  4EZJ A;  1YD8 U;  2LWP A;  2ZPN A;  2MSE D;  3KUC B;  3VFK A;  3QQ8 B;  5L95 C;  2K6Q A;  2KN5 A;  1WGY A;  4ANW A;  2KLC A;  2ZVO A;  4WWO A;  3X23 A;  5DPW A;  2GBN A;  2BWF A;  2K1F A;  2HD5 B;  2KJH B;  4G0N B;  2ZJD A;  4PS3 A;  4DDI D;  3CSF A;  2JRI B;  2BPS A;  2KTR A;  2LXC A;  4ZDV A;  1WF9 A;  4EOY A;  4PYU A;  5DPS A;  3ZTC A;  2JZZ A;  4W9I A;  4ANV A;  2A5U A;  4BOZ B;  1VD2 A;  3IBE A;  3K9P B;  4EKU A;  5E6O A;  3EC8 A;  2N9E B;  2K8B A;  4DHJ B;  4GDL B;  1J8C A;  1WMH A;  3MJW A;  3H1U A;  2KFJ A;  3RUI B;  3WAO A;  5D6J B;  1AAR A;  1OEY A;  3QHT A;  4ANU A;  3RD2 A;  3KUZ A;  2DZK A;  1FXT B;  4MGI E;  2V3S A;  3DBH I;  3CMM B;  4FHK A;  5IA7 A;  1WJ6 A;  3D32 A;  3OAW A;  1WFY A;  3L17 A;  2MW5 A;  1SE9 A;  2L0T A;  2YLM A;  3BIN A;  2DYO A;  2RR9 A;  3JYU A;  4OVU A;  3PHX B;  1WR6 E;  2KK8 A;  3EFU A;  1H4R A;  2O6V D;  3NHE B;  3B08 A;  2N7D A;  3ECI A;  4WJO A;  4B9K A;  2LGY A;  4MJS B;  4W9C A;  5EDS A;  3HIZ A;  2UYZ B;  3DDC B;  3EHV A;  2HJ8 A;  3ZNG C;  4ANX A;  2L0F A;  2AL3 A;  2DEN B;  2KC1 A;  1Y8R C;  2KNB A;  4E74 A;  2M17 A;  2NPT B;  4PYZ A;  1U4A A;  2KTR B;  3PV1 A;  3WAN A;  1I35 A;  2KFK B;  1GUA B;  2XBB C;  1EO6 A;  3B1L X;  1K8R B;  3HM3 A;  3KH0 A;  1WGD A;  4JIO U;  2L8J A;  2NBU A;  2IY0 B;  1OEY J;  1V49 A;  2IYD B;  1V80 A;  2EMS A;  2W9N A;  3DBS A;  4FJV B;  4HLE A;  1R4M I;  5CHW A;  2KDE B;  2XEW A;  2ZCC A;  1E8W A;  3PT2 B;  1V5O A;  1BT0 A;  3QC8 B;  2MWS B;  3ZDM C;  5J17 A;  4K7W A;  4K81 A;  1V9J A;  4FBJ B;  1WJU A;  3A4S C;  4W9D A;  2BGF A;  1UBI A;  2BYE A;  2GBJ A;  3PRE A;  3RCZ A;  2L00 B;  1SIF A;  3L10 B;  3VUY A;  4LJP B;  1R4N I;  1XT9 B;  2AL6 A;  3SU8 X;  2KQS A;  4TQ0 A;  3S2A A;  4EFO A;  4IWP A;  3U8Z A;  4K7U A;  5CHF A;  3RZW C;  4NY0 A;  4M8M A;  1WZ3 A;  2CS4 A;  1F9J A;  4GDK A;  3DQV A;  3R7Q A;  2KWU B;  3AU5 A;  4BKG A;  4MSM B;  1WE6 A;  3PZD A;  5C23 A;  3V62 A;  4PS8 A;  1Z5S B;  2NBW B;  4HPM B;  1NI2 A;  3VDZ A;  2J0M A;  2KQ7 A;  2EKE C;  1NBF C;  1WE7 A;  3UIN B;  4ASW C;  4M8N A;  1I42 A;  1YX6 B;  4BKT A;  3QK0 A;  2KVR A;  2Z0D B;  2WX1 A;  2LVP A;  2Z0E B;  1EUV B;  1X1M A;  2PE9 A;  4DBG A;  4KSK C;  1KLV A;  1YX5 B;  4GU2 A;  5LXH A;  1WM2 A;  2C9W B;  3IHP C;  1V86 A;  1WGR A;  2XK5 B;  3IG3 A;  2FCS A;  3W1S C;  4WJP A;  1P3Q U;  3CF6 E;  2HTH A;  3PHW B;  2CKH B;  2KD0 A;  3L08 A;  2FAZ A;  4FA6 A;  5J2R A;  2LUE A;  5KHO A;  4IM0 A;  3ALB A;  3UGB B;  4FLH A;  4BKS A;  3JSV A;  3RYT A;  4KIK A;  4WQO B;  2G45 B;  4DHZ B;  2GBR A;  3NS8 A;  2MBB B;  3VHT C;  1Q0W B;  2UWQ A;  2G3Q B;  4B6W A;  2BF8 B;  3PTF C;  5FR6 A;  3V61 A;  3VUW A;  4FAD A;  2C7H A;  3ML9 A;  4ZRK A;  5LLI A;  3V60 A;  3QWZ B;  3ZO5 B;  2DAF A;  4P7I A;  5KHQ A;  1C3T A;  4MEL A;  4GB9 A;  4J6I A;  2C5L C;  4G3X B;  3VTV A;  3Q3F A;  2KJ6 A;  1OQY A;  2Z59 B;  2ZVN A;  4I6P A;  3IFW B;  2VRR B;  4EUT A;  3SD5 A;  2WYQ A;  1E7V A;  2YVC A;  3MTN B;  4X57 B;  4F8C B;  2MBQ A;  3V6C B;  3KYD D;  4JLC A;  3DBR I;  5IAA C;  2JXX A;  4II3 B;  4JGH B;  2LRU A;  1WX8 A;  2JRH A;  3OJ4 B;  4WJQ A;  3WAP A;  4FJY A;  1WI0 A;  3L13 A;  2LZ6 A;  2A4Z A;  2REX A;  4BKS D;  5C1Z A;  4GOC A;  5AZF A;  3DVN U;  4IM2 A;  3ZRF A;  4HVB A;  1NDD A;  4RMA A;  5L83 A;  2OJR A;  3QIJ A;  4HCN B;  3AI5 A;  4HDO A;  4DXA B;  4FHJ A;  1SGH A;  1IYF A;  2LGD A;  5BO4 B;  2KDF B;  4KDI C;  3SHQ A;  3VUX A;  4AWJ A;  2D07 B;  4JQW C;  2I1K A;  3ZNZ B;  3R3M A;  3JW0 X;  4URK A;  2CU1 A;  4HJK A;  4B95 A;  1WXM A;  4RM8 A;  1KM7 A;  2BWE S;  3LDZ E;  4ZYN A;  3NZU A;  2LGX A;  3QA8 A;  4MEM A;  4OVV A;  4KDL B;  1YIW A;  2FUH B;  3ZNH B;  3QCA A;  3OLM D;  3TL5 A;  4EEW A;  1UH6 A;  4K1R B;  1WMH B;  1WRD B;  2DHZ A;  2IZV B;  2EMT A;  2KFK A;  2FIF A;  1V5T A;  2DZM A;  1GC6 A;  1Q5W B;  3QAR A;  3ZNI D;  5J18 A;  5JHB A;  4NJ6 A;  2JWZ A;  3UIO B;  1V6E A;  1C1Y B;  1G6J A;  2BKF A;  3DVN V;  3M62 B;  2J0J A;  2D11 A;  3H7P B;  5DPT A;  4A20 A;  3UQA A;  4DK5 A;  1L7Y A;  2KOX A;  4NAW B;  1WGG A;  1RRB A;  2KDB A;  2ZZP B;  4GMV A;  2CHZ A;  3L16 A;  2NVU I;  4GN1 A;  3A1Q B;  1ISN A;  1A5R A;  1L2N A;  2KZR A;  3SDL C;  5JZE B;  2RGF A;  2AEH A;  4BVU C;  1EF5 A;  1J19 A;  2CHW A;  1E5W A;  3T9L A;  2KKC A;  1WX9 A;  4LDT B;  1RFA A;  1GJZ A;  2DAJ A;  1ZW7 A;  2WX0 A;  3V6E B;  2KWV B;  4GDK B;  2AWT A;  4HDQ A;  3CST A;  4RM9 A;  2LD9 A;  3C0R B;  2GBM A;  4W9G A;  1E7U A;  1WR1 A;  2K25 A;  2PJH A;  1D3Z A;  5TR5 A;  1E8X A;  3A33 B;  1CMX B;  4MGK E;  4I6L B;  3AUL A;  4ICV A;  2PPH A;  5G2N A;  1TBE A;  4EZL A;  2DZI A;  2M4N A;  2PE6 B;  3DBL I;  4HPL B;  2MX2 A;  2ZNV C;  3JVZ X;  3PRM B;  4I6N B;  4MDK E;  3ZLZ A;  1JRU A;  2WDT B;  2M8S A;  1WXS A;  3H7P A;  3A4R A;  3WIM A;  3A9K A;  1T0Y A;  2C7N B;  2MP2 A;  1MG8 A;  4NAW A;  3DVG X;  3VTU A;  1V2Y A;  3TMP B;  2KAN A;  4ZRJ A;  1WGH A;  3A1Q A;  2KX0 A;  4HWI B;  1E8Z A;  4IC7 B;  3APC A;  3TJP A;  3PSE B;  2RSU A;  4BBN C;  2IO0 B;  3KVF B;  2NR2 A;  1Q1O A;  4NQL B;  4AOF A;  1OGW A;  2L3Z A;  1ZGU B;  2D3G A;  3KYC D;  2J7Q B;  2BYF A;  3X0W A;  2KLG A;  1E8Y A;  4MH0 E;  4F7Z A;  4W9K A;  3H9D A;  2MBO A;  2LVO A;  3UIP B;  3PVL A;  2KHW B;  4FUL A;  1UZX B;  2LAS A;  4NNJ B;  3PLV A;  3PPA A;  4IW0 A;  4MGY E;  4MSQ B;  5DPR A;  1YJ1 A;  2KMC A;  4CYE A;  3AXC A;  4W9E A;  3HK0 A;  1KJT A;  1WM3 A;  2MBE A;  4LCD E;  3WAM A;  2K6D B;  4AUQ C;  2O6V B;  3ZRC A;  4ZRI A;  2FCQ A;  2KX3 A;  4IM3 A;  2B3A A;  3PS6 A;  2K39 A;  4NQK E;  3TIX A;  3N32 A;  4XC2 A;  1LM8 B;  1OTR B;  3ZW3 A;  1P9D U;  1VCB A;  3L54 A;  3ZIM A;  2JT4 B;  3RT3 B;  3AU4 A;  2MBH A;  1IP9 A;  2MRP A;  2I1J A;  1YQB A;  3H6N A;  2JVC A;  2CR5 A;  3W1S A;  4W9J A;  2G4D B;  2IO2 B;  3ZDT A;  4ICU A;  2JF5 A;  2LJ5 A;  2NPT A;  3R66 C;  5D94 A;  2DYM A;  1IPG A;  1M94 A;  3VXW A;  2N1W A;  1GC7 A;  3ML8 A;  2L76 A;  1PQS A;  3EEC A;  2KDI A;  3IVF A;  3A9J A;  3K9O B;  2LI5 A;  1TGZ B;  3VH4 B;  4E71 A;  4M0W B;  1H8C A;  4CO7 A;  4XZ4 A;  3RZF A;  2Y5B B;  1WX7 A;  3Q3J A;  2LRW A;  4BFR A;  3LJ3 A;  4XX5 A;  1J0G A;  3PGE A;  4WJN A;  2KC2 A;  5JH5 C;  4DWF A;  4IWQ A;  2V1Y A;  1RLF A;  2NCN A;  4A3O A;  3MHS D;  2R2Q A;  1Z2M A;  2KTF A;  4G50 A;  2O2V B;  4GGQ A;  2MLB A;  3VH3 B;  1EF1 A;  2RPQ A;  4NJ7 A;  2M1M A;  4DHJ D;  4AJW A;  3APD A;  4TUU A;  2IO1 B;  3DCG A;  2HE7 A;  1LFD A;  4E3C A;  1UBQ A;  2JPH A;  2D2Q A;  3JSV B;  1UEL A;  2N9P C;  1S3S G;  3APF A;  1S1Q B;  4JL9 A;  4KZC A;  5DCN A;  3NY5 A;  2QHO A;  2MCN B;  4BOS C;  2KWC A;  4IWO A;  3T8M A;  4AJY B;  3QX1 A;  2N9X A;  3KW5 B;  2KJR A;  3QJZ A;  4MJS A;  2NS5 A;  4HK2 A;  3A9J B;  2GBK A;  1ZKH A;  5AEK B;  5JHA A;  5G55 A;  2GMI C;  1WXA A;  1WH3 A;  3H7S A;  2DX5 B;  4W9L A;  1WZ0 A;  5AZG A;  2IO3 B;  5D7G A;  2DZJ A;  4GXB A;  3W1Y A;  4DHZ E;  4G11 A;  2O2V A;  2K8C A;  4IUM B;  3WA0 A;  4KZ0 A;  1TTN A;  3VVW B;  1P0R A;  2M0X A;  3P2B A;  2DYB A;  3PLU A;  1XQQ A;  2FCM A;  3A9K B;  4MM3 A;  2D10 A;  2MP2 B;  2AYO B;  3HM6 X;  2L05 A;  4NPN A;  3TCA A;  1V81 A;  3TBL D;  2ZPY A;  3ZVV A;  2GOW A;  2MQJ A;  5E6P A;  4TQ1 A;  4W9F A;  2FID A;  2IY1 B;  4N9F 4;  3ONS A;  4IG7 B;  4PS7 A;  3M63 B;  4MGZ E;  3DPD A;  4WWP A;  1LXD A;  2R2O A;  3GOE A;  5D2M B;  3M95 A;  5GMV A;  3NZS A;  1E90 A;  4WWN A;  3KUD B;  3PRP B;  1RAX A;  5E6N A;  4LDT D;  2C60 A;  1GNU A;  3WAL A;  1KOT A;  4HXD A;  2C7M B;  3DVG Y;  3VQI A;  4A3P A;  2KO3 A;  2L7R A;  3L0W B;  4KVG B;  2CHX A;  2OOB B;  3UF8 A;  2LXA A;  4WAA A;  2BYV E;  3R7R A;  2JY6 A;  1HE8 A;  1QZE A;  2V4L A;  1XD3 B;  3HHM A;  4TKN A;  2JZ3 B;  4GIV A;  2K8H A;  2BKR B;  4KV2 A;  3ZUN A;  3NOB A;  4GSW A;  2XK5 A;  2MA9 B;  2RD0 A;  3DOW A;  2KMA A;  3I3T B;  2ZNV B;  2NBV B;  3U30 A;  3ZKJ C;  2N1V A;  4II2 B;  3ZTD A;  5CX3 A;  4F1S A;  5LXI B;  3N30 A;  3GZN I;  3RUL A;  1P98 A;  5CHV C;  3B0A A;  4CHK A;  4FJZ A;  2G4S A;  4DDG D;  1WIA A;  5AZH A;  3U7D A;  2FCN A;  3O65 B;  3UQB A;  1UGM A;  2ZCB A;  5CTR C;  4AP4 C;  2ZEQ A;  3M3J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...