3ECIA

Microtubule-associated protein 1 light chain 3 alpha isoform a (map1alc3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Apoptosis
molecule keywords Microtubule-associated protein 1 light chain 3 alpha
publication title Human Autophagy-Related Protein LC3 A
rcsb
source organism Homo sapiens
total genus 32
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3eciA00
2KC2A 2AWTA 3H9DA 2NVUI 3MJWA 2D3GA 2MWSB 2XBBC 3X23A 3ZUNA 5J2RA 4RMAA 2LXCA 5CX3A 4TUUA 3ZNGC 2AL3A 2BWES 3APDA 1P1AA 3VUYA 2W9NA 1WGHA 4WJOA 2KTFA 1P3QU 5E6NA 3U8ZA 2NCNA 3L08A 1OEYA 2C5LC 2DAJA 2NBVB 1VD2A 4WAAA 3GZNI 4MGKE 5LXHA 2B3AA 1OQYA 3QCAA 4IG7B 2N9XA 3QK0A 2LVPA 4FULA 4KZ0A 2DZMA 2IO1B 2KDFB 2NR2A 3GOEA 3ZO5B 3M63B 4GGQA 3PV1A 2KJHB 2MCNB 4DHZB 4FN2A 4ICUA 1NBFC 5JZEB 2MP2A 3JYUA 4W9EA 4DDGD 2D07B 4HK2A 1NI2A 2JPHA 2ASQA 3VHTC 2UYZB 4E3CA 3DVGY 4IC7B 5CHVC 1L2NA 1Y8RC 3NZSA 2KLGA 3PHXB 3CSTA 3KVFB 4II3B 3UQAA 3DPDA 1H4RA 4G50A 4GDLB 4W9DA 3K9PB 2L0FA 4HWIB 1OEYJ 4JIOU 4NJ6A 4W9CA 1WR1A 4CYEA 2KMCA 1WR6E 2FUHB 2ZPYA 4WWOA 2K8BA 5D2MB 2JXXA 3ZDMC 3NZUA 2G4SA 1C3TA 1Q5WB 2ZCCA 5JHAA 1E8YA 1UZXB 2AYOB 5IAAC 3V62A 1R4MI 2JT4B 1L7YA 4BBNC 2K25A 1A5RA 2BYFA 1UGMA 4IWOA 5AZHA 2DENB 2DX5B 4F7ZA 1WM3A 4E74A 4NJ7A 3DCGA 2ZNVB 4DBGA 3VTUA 4W9IA 2N1WA 3ECIA 4KVGB 2KX0A 4I6LB 5IA7A 3QX1A 2EKEC 2DHZA 2IY1B 1UBIA 2ZNVC 4DWFA 2RSUA 3PLVA 1D3ZA 1V49A 4MH0E 2GMIC 2IY0B 2L0TA 1V2YA 4ZRKA 5DPWA 3ZKJC 3L13A 4DHJB 4PS8A 1V81A 2LGYA 2LRWA 4EZJA 1GC7A 5DPRA 2FCSA 4MJSA 2NPTA 4AOFA 3JSVA 2RD0A 4AJWA 4WJNA 1V9JA 2D10A 1WI0A 1ZKHA 4AUQC 3VUXA 4AP4C 3VFKA 4DXAB 4WJPA 3VAWA 2GBNA 3T8MA 4K7WA 4URKA 1EUVB 4GB9A 2V3SA 1X1MA 2OOBB 3A1QA 1T0YA 3WAMA 1LFDA 3VTVA 2YLMA 3KYDD 4GXBA 4II2B 3ML8A 1P98A 1WMHB 1WZ0A 2MP2B 1TTNA 2OJRA 3VTWA 4E71A 4J6IA 4YL8A 2KQ7A 1GUAB 4ZRJA 3SHQA 5G2NA 1JRUA 1J19A 4NNJB 3RYTA 3PREA 2FCMA 4G0NB 3PLUA 1WM2A 4BKSD 1WXSA 3TBLD 4LDTD 2AEHA 3PHWB 3AU4A 3RUIB 2JUOA 4OVUA 3BY4B 4CHKA 3DBSA 2KVRA 3HK0A 5AZFA 4F8CB 3QWZB 4JQWC 3VH3B 4GU2A 1AARA 4HLEA 2KQSA 4HCNB 4NPNA 4FADA 3OJ3A 2Z0DB 5LLIA 2DYOA 2BYVE 1WIAA 3UINB 3VQIA 4KIKA 2L05A 3QA8A 4HDOA 4MSQB 2C7HA 4A20A 2KDEB 4BKTA 4TV3A 1GG3A 2HTHA 3PT2B 4NQKE 3X0WA 5EDSA 5J18A 2DAFA 2LD9A 3H7PA 3IBEA 1E8XA 5DCNA 2JVCA 4W9LA 3ZTDA 2KMAA 4HPMB 1E90A 4HXDA 2M17A 4BKSA 4EZLA 3A33B 4ZDVA 1RAXA 2LUEA 3CMMB 2KZRA 2MBQA 2MRPA 2FCQA 2LVOA 3NHEB 2BWFA 3DVGX 3UIPB 3ZIMA 3HM3A 3DBHI 4ANVA 1TZ1A 4MGIE 5HKHA 4KSLC 3EHVA 2IO0B 2MW5A 3KYCD 2CHZA 4PS3A 2JRIB 2C60A 2C7NB 4MJSB 1OTRB 4NAWB 3U7DA 4DDID 2V1YA 2A5UA 3JSVB 4ZRIA 4BOZB 2LI5A 3ZRCA 1NDDA 2CKHB 2ZVNA 4HPLB 1C1YB 5JHBA 3A9KB 1HE8A 1XQQA 2K1FA 4BBNF 2KJ6A 3RULA 4KDIC 2G45B 4W9JA 2Z0EB 4M8NA 1P9DU 3AULA 1FXTB 1IPGA 3MHSD 3R66C 2NS5A 3KH0A 2FIDA 2KANA 3A9JA 4X57B 2BF8B 4HVBA 2XK5A 1MG8A 4OVVA 3SD5A 4IWQA 4B9KA 2O2VA 5CTRC 2HE7A 4W9HA 3PRPB 1YX6B 2NBUA 4AJYB 4LJPB 3UGBB 3ENEA 2IO3B 3HIZA 2D2QA 3ZW3A 2LASA 3ZNHB 2ZEQA 1YIWA 1I42A 4IM3A 1Z5SB 2KX3A 2O6VA 2J7QB 3AI5A 3JW0X 2KFKA 2EMSA 3QARA 3U30A 2BPSA 2LGXA 3BINA 1WY8A 1UBQA 3ALBA 4RM9A 4FLHA 4KIKB 2ZVOA 1M94A 3KUCB 3I3TB 4DHZE 4FA6A 3D32A 3RD2A 3TMPB 1WGGA 2I1KA 3V6EB 3WA0A 4EKUA 2WDTB 3H7PB 2WX1A 3P2BA 5AZGA 2KFJA 4KZCA 2VRRB 5C1ZA 4WWNA 2Z59B 2ZPNA 3UF8A 2RR9A 2JZZA 4NQLB 4FBJB 4GDKA 3PRZA 5C23A 2KC1A 4ASWC 2V4LA 4LDTB 3R7QA 4IWPA 3ZTCA 5LXIB 3V60A 2N7EA 2N7DA 3DOWA 4ZYNA 2R2OA 2KN5A 2D11A 2KHWB 1CMXB 3N3KB 2GBMA 2HJ8A 2PPHA 2KOXA 4I6NB 4JGHB 1WFYA 3WALA 2DZJA 4MSMB 4GIVA 2KWCA 3QJZA 1GC6A 2KDIA 3QQ8B 5DPSA 1LQBA 4WWPA 1E8WA 5GMVA 2K6QA 2MX2A 3ZVVA 3DVNU 4N9F4 1E8ZA 3QIJA 2K8CA 3ZRFA 2LRUA 2IZVB 1Q0WB 2N1VA 2CR5A 3AU5A 3KW5B 3L10B 4MGYE 1WH3A 4K7UA 2GBKA 2LVQA 4BOSC 2XEWA 2MSED 3IVFA 3W1SA 4JL9A 2MBEA 4HJKA 1SGHA 3LDZE 3WIMA 2L76A 2MQJA 3NOBA 4LJOB 1G6JA 2XK5B 2FNJB 1J0GA 1OGWA 2KTRA 3PS6A 1YQBA 2CS4A 1WF9A 4ANXA 2J0MA 4BVUC 1BT0A 2L7RA 4XZ4A 3CF6E 2KO3A 3A4RA 4IM2A 2FCNA 5BO4B 3VXWA 3M62B 2K8HA 2LWPA 2QHOA 5JH5C 1KOTA 2L3ZA 1EO6A 3K9OB 3TJPA 3DQVA 1R4NI 3LJ3A 3WAOA 4EFOA 1V5OA 2J0KA 3DVNV 3VDZA 2HD5B 3B08A 1V5TA 4EOYA 4K81A 3RZWC 1IP9A 3ZNZB 1KM7A 5G55A 2GBJA 1V80A 2LGDA 1UD7A 3C0RB 4GN1A 4WQOB 5D6JB 3PSEB 1TBEA 3A4SC 3QHTA 4KDLB 4M8MA 3V61A 1WXMA 2Y5BB 3TIXA 3RZFA 2CU1A 3Q3FA 2R2QA 4EEWA 2A4ZA 1YD8U 1WX9A 3UIOB 1LXDA 1P0RA 4GDKB 1V6EA 4MDKE 3DBRI 2K6DB 3QAQA 4IUMB 3OJ4B 3ZNID 2DZKA 4LCDE 2KWVB 4MEMA 3WANA 3ML9A 4WJQA 2KKCA 3QC8B 2NPTB 1UELA 2DZIA 1WGRA 4PS7A 2PEAA 4BFRA 4MGZE 4DK5A 2M8SA 1WE6A 3EECA 1E5WA 2G4DB 4FJVB 2RGFA 2G3QB 3KUZA 3L0WB 4K1RB 2DYMA 1K8RB 3PPAA 2O6VD 4P7IA 3TL5A 1WGDA 3WAPA 1I35A 3SDLC 3ZLZA 2LJ5A 1KLVA 3A1QB 2CHWA 1V86A 4TQ1A 3RCZA 2AL6A 2IBIB 2IO2B 3AXCA 4KV2A 4A3PA 5CHFA 4I6PA 5TR5A 1WYWB 2UWQA 2C7MB 3PRMB 1EF5A 4FHKA 1WXVA 1U4AA 1ISNA 2PJHA 4F1SA 2KDBA 1XT9B 2JWZA 3L17A 1WMHA 1KJTA 4BKGA 1Q1OA 3N30A 2KJRA 1VCBA 2MLBA 1S1QB 3RT3B 1WZ3A 3DDCB 3W1SC 1J8CA 1WX8A 3APFA 1Z2MA 2RPQA 1WRDB 2LXAA 2KTRB 1PQSA 3PTFC 4GOCA 2MA9B 2GBRA 2ZJDA 4JLCA 5J17A 2ZCBA 1GJZA 1EF1A 2FIFA 1WX7A 3CSFA 1WE7A 1XD3B 2KXJA 4GSWA 2N9PC 4PYUA 1QZEA 4W9KA 2JZ3B 3H1UA 4NY0A 3W1YA 1H8CA 2PE9A 2L8JA 4TKNA 1RLFA 5E6OA 3V6CB 2IYDB 3H6NA 2KWUB 3HM6X 4ANUA 4FJYA 4RM8A 5L83A 2BKRB 3ZDTA 1WJNA 3HHMA 1ZGUB 2BGFA 2N9EB 3KUDB 3B0AA 2EMTA 4M0WB 4A3OA 2DYBA 2YVCA 4ANWA 5FR6A 2KNBA 4IM0A 3OAWA 2BKFA 2BYEA 3R3MA 3ONSA 1LM8B 4G3XB 1IYFA 4HCPB 2PE6B 2WYQA 4W9GA 2J0JA 2WWZA 3JVZX 4CO7A 3IFWB 3NS8A 4IW0A 3L16A 2JY6A 1WJ4A 1ZW7A 4MELA 4B6WA 4FHJA 1WGYA 5AEKB 3UQBA 4FJZA 2MBHA 1GNUA 1SE9A 3M95A 4B95A 2M1MA 5D7GA 2WX0A 4TQ0A 2M0XA 1RFAA 4NAWA 3VH4B 2L00B 4GMVA 2LZ6A 3EFUA 1RRBA 2CHXA 1WJ6A 3OLMD 4XC2A 2FAZA 3A9KA 1E7VA 4MM3A 1WJUA 2KLCA 2JRHA 3A9JB 3PGEA 2REXA 4ICVA 3APCA 3IHPC 3TCAA 3M3JA 1YX5B 1SIFA 2O2VB 3O65B 3PZDA 4G11A 4PYZA 2K39A 2I1JA 4XX5A 4AWJA 1WXAA 4EUTA 4EZKA 5L95C 2MBBB 2NBWB 3VVWB 1TGZB 3SU8X 4GDLA 5KHOA 3Q3JA 1UH6A 3PVLA 5DPTA 3T9LA 1YJ1A 2JF5A 2N4FA 2ZZPB 4DHJD 2M4NA 2O6VB 3EC8A 2KD0A 5E6PA 1E7UA 2KFKB 3B1LX 3DBLI 3NY5A 4KSKC 5CHWA 4K7SA 3L54A 5KHQA 3R7RA 2GOWA 4W9FA 3H7SA 2C9WB 3VUWA 4HDQA 1S3SG 3IG3A 2KK8A 3N32A 5D94A 3S2AA 1F9JA 3MTNB 2MBOA
chains in the Genus database with same CATH superfamily
2AWTA 3MJWA 4C80A 1N60A 2D3GA 2MWSB 3LYYA 2LXCA 2WGSA 3APDA 3VUYA 5HG2A 2KTFA 4B0MA 5E6NA 2CU3A 3U8ZA 2NCNA 5HFYA 4OZBA 2NBVB 1VD2A 1KF6B 1A70A 2BVCA 2KVZA 1OQYA 4IG7B 1ZDVA 2DZMA 2CJOA 2IO1B 3ZO5B 4LTUA 3P4QB 2FUG1 4QAYA 4YTNB 4A8XC 4ICUA 3ZJVA 4N58A 1NI3A 4MM3B 2D07B 4IC7B 4MACA 1Y8RC 1YQ3B 3KVFB 3UQAA 1T0RC 2WXIA 4GDLB 5EE0A 4J3OD 1OEYJ 4W9CA 2IJ0A 2KMCA 3WCQA 2G4SA 1Q5WB 5JHAA 2AYOB 2IGDA 3AE6B 3P42A 1JALA 1UGMA 2DX5B 1WM3A 4NJ7A 1VR9A 5HHDG 2KX0A 4A55A 4RNAA 3QX1A 2PMVA 4D2KA 1OQRA 2UU7A 1UBIA 3BZDB 1I4QA 2L0TA 3L13A 4EZJA 5DPRA 4MJSA 2ACZB 3JSVA 2RD0A 1V9JA 2M0AA 1ET6A 3T8MA 2K3UA 3A1QA 1T0YA 3WAMA 1LFDA 1VDVA 3KYDD 1P98A 4TMAB 1UWXA 3Q69A 2KQ7A 1PFDA 2FCMA 4G0NB 1WM2A 1QILA 1L0XB 2AEHA 2JXTA 2JUOA 4OVUA 5AZFA 4F8CB 4GU2A 1AARA 3BYTB 4NPNA 5LLIA 1L0YB 1ZE3D 3PZ7A 1NYRA 2C7HA 4BKTA 3ZXVA 1GG3A 4KKJA 5EDSA 3H7PA 4LLGM 1E8XA 2JVCA 3ZTDA 2V3PA 4HXDA 2ONQA 1WXQA 1RAXA 3CMMB 2QDFA 2IPKD 3UIPB 1NYQA 4ANVA 3KYCD 2HTME 2C7NB 2XN9C 2WXLA 3U7DA 4BOZB 3ZRCA 1NDDA 2TSSA 4HPLB 1C1YB 5JHBA 1SBBB 1QF6A 4BBNF 5IOIA 3RULA 2G45B 3MJ5A 4W9JA 3AULA 1IPGA 3R66C 2FIDA 2BF8B 4CQNA 2O2VA 1YX6B 2NBUA 2MH7A 2OJWA 4A6QA 2IO3B 2D2QA 2LASA 3ZNHB 3ZJTA 3HRDD 1C4AA 2O6VA 2J7QB 1R4MB 3OG5A 3AEGB 4FLHA 2W55A 4S0RA 2VRRB 5FKAC 4GDKA 3PRZA 1TZOA 2X8XX 4IWPA 3Q6BA 5I4DA 3DOWA 2R2OA 2DBYA 2KN5A 2D11A 1L4DB 2PPHA 1TYGB 1WFYA 3WALA 4MSMB 1L0VB 3TEWA 1ESFA 3QJZA 3AEBB 1LQBA 2K6QA 1ET9A 4N9F4 1Q0WB 3AU5A 4MGYE 3FAHA 4ZHOA 2MSED 3AE2B 5AUIA 1SGHA 2AX5A 2L76A 4PT5A 1AWDA 2RDHA 3BWUD 3PS6A 1TS5A 2L7RA 4IM2A 2FCNA 2VH1A 4BAXA 1IBXA 2L3ZA 1MHXA 3DQVA 1XF5L 3WAOA 1TJEA 4EFOA 3B08A 1V5TA 1IP9A 1KM7A 1DOIA 1TBEA 3A4SC 4KDLB 3V61A 2Y5BB 1PDXA 3BK2A 3EGRA 3KWLA 4EEWA 1YD8U 3EUB2 4MDKE 3DBHB 3OJ4B 3QC8B 2INCC 2Z8LA 4PS7A 1E5WA 2G4DB 4FJVB 2G3QB 1K8RB 3PPAA 1WGDA 1YN3A 3ZLZA 1KLVA 1SE3A 2CHWA 1V86A 4TQ1A 3AXCA 1NVID 4OW0A 2WNMA 2UWQA 2QC8A 1D5MC 1WXVA 1YN5A 1XT9B 2KWDA 3DWGC 2KT7A 2JWZA 1KJTA 1VCBA 3RT3B 3DDCB 1J8CA 4DXGA 2RPQA 2LXAA 1PQSA 2MA9B 2ZJDA 4ARIA 3MFGA 1GJZA 2SAKA 1WX7A 3CSFA 3B2FA 1F0ZA 4PYUA 4W9KA 2JZ3B 1HQRD 3V6CB 1C4PA 2IYDB 2LFIA 3VR8B 2QEJC 5L83A 2BKRB 3HHMA 1YN4A 1QT9A 2DYBA 5FR6A 1N61A 2CJNA 3OAWA 3Q8CA 3R3MA 2JU6X 4LNKA 1FFVA 4HCPB 2PVGC 2KN4A 2PLPA 1WGYA 2MBHA 1TY0A 1YOVB 3BYYB 1GNUA 1SE9A 3M95A 1E10A 4H2AA 1PYWD 1SXTA 3VH4B 4GMVA 1ZXIA 1AN8A 3A9KA 3AE7B 1F1HA 3A9JB 3PGEA 2D3CA 3N1ZC 1YX5B 4XX5A 1I35A 4G11A 2J42A 2NBWB 1FMAD 3NS1A 1JMLA 3BVGA 1TGZB 2I2YA 3Q3JA 1JROA 5DPTA 1WWTA 2ZZPB 2KD0A 3DBLI 4YWGG 4KSKC 1LO5D 4UDUC 3ZGZA 3R7RA 3H7SA 3IT6B 4HDQA 3Q2AC 3N32A 5BYQA 3NVVA 2XBBC 5HI1A 3ZUNA 3Q8BA 3R2TA 5G5HA 3ZNGC 1WSPA 1E9MA 1WGHA 1VLBA 3Q3OC 1BMLC 4XDCA 2VZKD 4RF0A 2BT6A 3GZNI 4MGKE 4C4VB 3AE9B 2LVPA 2JZPA 4LNNA 3AV8A 2NR2A 3GOEA 2HDEA 3PV1A 2KJHB 2NTTA 2MP2A 3AEAB 2I38A 1ROEA 1XO3A 1RFKA 1SB3C 2Y5PA 3DVGY 1I4RA 2PIAA 2KLGA 3PHXB 4RFBA 5EE3A 4W9DA 3R8BA 1HZ6A 4HWIB 4JIOU 2Q5WD 2WDVB 2K8BA 1E6EB 3U4EG 2JXXA 3ZDMC 3NZUA 3AM9A 1UZXB 3V62A 3I5JC 4N6EB 5BMGA 2JT4B 4YSZB 1CZPA 2K25A 4BBNC 2BYFA 3DCGA 1GB1A 4DBGA 4W9IA 4KVGB 4I6LB 2PW9A 2ZNVC 1D3ZA 5DPWA 1V2YA 2ON8A 4PS8A 2LGYA 1IGDA 2FCSA 2NPTA 4AOFA 3LXFA 3AEFB 5BYRA 1WI0A 3VUXA 1MJDA 2GLSA 4REZA 4WJPA 4K7WA 4GB9A 2OOBB 1PGXA 1YQ4B 3W5UB 1WMHB 1WZ0A 1YJIA 4Q2JA 3SHQA 2VZKB 5G2NA 4NNJB 3PREA 1F52A 4WIPA 2BTEA 1TS2A 4ACFA 2WQYB 4LDTD 3PHWB 3AU4A 4ZYSA 3NZ3A 4CHKA 3VH3B 4HLEA 4HCNB 2Z0DB 1JWAD 5GXGB 4L2YA 2DYOA 2BYVE 1WIAA 4KIKA 1QKZA 3QA8A 2Y5CA 3PT2B 4NQKE 3X0WA 5J18A 4AS1A 1GOZA 5DCNA 1QOAA 2KMAA 4HPMB 2M17A 1T0QC 1HEZE 3VRAB 4ZDVA 2MRPA 3NVWA 3NHEB 1WYGA 3NG0A 3HM3A 1TZ1A 4MGIE 2IO0B 2H88B 2CHZA 1TS3A 1JWMD 1V1OA 4MJSB 4A90A 3JSVB 2A5UA 3FC4A 2CKHB 2ZVNA 1KLUD 4S17A 1JQ4A 2K1FA 4KDIC 2WXGA 2K9XA 3KH0A 4HVBA 2XK5A 1MG4A 3U2SC 4B9KA 3FILA 5CTRC 4W9HA 4O1NA 4LJPB 3VR9B 3ZW3A 2ZEQA 1YIWA 4IM3A 1JW9D 2WU5B 2KFKA 1J7CA 2BPSA 3AE3B 4RM9A 3FKYA 3TUOA 3I3TB 4FA6A 1N5WA 3V6EB 1I7HA 2WP9B 2WDTB 3H7PB 2WX1A 1CJEA 5C1ZA 2ZPNA 3UF8A 4NQLB 1XLOA 4ASWC 2V4LA 4LDTB 3ZTCA 4L23A 2N7EA 2N7DA 4ZYNA 1HXYD 3U7ZA 1CMXB 2LEKA 1FD6A 3EFCA 2KOXA 4I6NB 4JGHB 2WLBA 2EELA 3T3NA 2WHIA 3QQ8B 4WWPA 5DPSA 1E8WA 2WXQA 5GMVA 1E8ZA 2MHJA 2JYEA 2K8CA 2LRUA 2N1VA 3L10B 3KW5B 2W82A 4K7UA 3IVFA 5FR3A 5AUKA 4XYCA 3RN9C 2MBEA 3LDZE 1R7SA 2WXMA 3PZ8A 1G6JA 1TT5B 2KTRA 4RGMA 1K52A 1YQBA 1STEA 1JCKB 2K8HA 4NAMA 2LWPA 1NEKB 2QHOA 1KOTA 2OEDA 3K9OB 1ZUD2 1C9FA 1R4NI 1KLGD 4JE3B 1V5OA 5IO9A 1EWYC 3VDZA 3RZWC 2FE8A 4MH8A 2LGDA 1UD7A 3PSEB 4DXFA 1SEBD 1WXMA 2WXPA 4L1BA 3U52E 2A4ZA 2IGHA 3RNAC 1WX9A 3UIOB 3T3OA 1LXDA 4GDKB 2K6DB 4IUMB 3ZNID 4YTMB 2DZKA 1JRPA 2BYTA 3E9SA 1WGRA 2HJ1A 2PEAA 2RPVA 4MGZE 1WE6A 3EECA 2KMMA 2RGFA 4K1RB 2RDBC 3KUZA 4P1CC 3DHGC 3SDLC 3RCZA 2INNE 2IBIB 5CHFA 1YMHE 2AQ2B 4KX6B 3TEXA 4I6PA 3PRMB 1EF5A 5C3JB 3GS2A 1U4AA 1EU3A 3AE1B 5EE1A 3L17A 1WGKA 1SJHD 2KDMA 3N30A 4BKGA 3DHHC 1WZ3A 1JWBD 1FXIA 1T5XD 5J17A 2ZCBA 1EF1A 2VH2A 2EKIA 2N0SB 1WE7A 2L52A 2N9PC 2K0PA 1QZEA 2K5PA 3W1YA 1HZ5A 1IBXB 1D6EC 4XWWA 3H6NA 2KWUB 3HM6X 1TKYA 4FJYA 2RDGA 2Y3AA 2DWQA 2N9EB 1SIJA 4M0WB 4ANWA 2KNBA 3HUIA 4RH6A 1IYFA 1ACCA 2WYQA 2J0JA 3IFWB 4IW0A 2ZW1A 3L16A 3L4PA 4B6WA 3I63C 4XC2A 3Q8FA 3OLMD 3AEDB 1SE4A 1UWMA 1L6VA 1GPXA 2REXA 1GAQB 2SEBD 3TCAA 3DHIC 3O65B 3PZDA 4EUTA 1FNVA 2WS3B 3NVYA 3AMZA 3VVWB 5KHOA 1UH6A 3T9LA 2N4FA 3R2IA 3EC8A 5E6PA 1E7UA 2G1EA 3BIID 3L54A 4KKIA 2BBCA 3VUWA 4HROA 1S3SG 3IG3A 3S2AA 3H8HA 1F9JA 1TKEA 2MBOA 3H9DA 2NVUI 2PVOD 4YXDB 1C4CA 2BW2A 2ICIA 1P1AA 4WJOA 3SFEB 3L08A 1OEYA 4R3DA 3AE4B 2C5LC 2DAJA 2YEPF 3ETRA 4WAAA 2B3AA 4FULA 4KZ0A 2KDFB 2JQRB 3GP7A 2E3TA 1UGJA 2MCNB 2DNFA 4FN2A 5JZEB 2INPE 4DQOC 1T6BX 1VZ8A 3JYUA 2YEPB 4XGAB 2JPHA 4LK0M 3VHTC 2AQ1B 4M02A 1L2NA 1XLPA 3NZSA 4II3B 2QJLA 4G50A 1JWUD 3K9PB 2WDQB 4NJ6A 4LNOA 1WR1A 4CYEA 1AW7A 4JWSC 1WR6E 1IUEA 1D5ZC 5D2MB 2G9HD 3J9CA 4RF1A 3TSSA 4LNIA 1R4MI 2WXRA 3MHZA 3W9CB 1A5RA 4IWOA 5AZHA 2DENB 3P4RB 4F7ZA 4E74A 2PTLA 2N1WA 1VZ6A 2EKEC 2IY1B 1DOXA 2RSUA 3PLVA 4IDIA 2GMIC 2IY0B 3Q14C 1I4XA 4ZRKA 1OFFA 1V81A 2LRWA 1GC7A 3N1YC 3OWEB 3ABVB 1UF0A 3MC0B 4AJWA 4WJNA 2D10A 4HEA1 4AUQC 1F2RI 4DXAB 1EUVB 2XNAC 3ML8A 1FNWA 2MP2B 2OJRA 3VTWA 4J6IA 1JRUA 1AYFA 1J19A 3RYTA 1TIFA 3PLUA 1WXSA 3IAS1 1FCLA 2W54A 3N20C 3AE5B 3BY4B 2KVRA 3HK0A 3QWZB 4JQWC 2KYWA 5IN7A 1MVKA 4FADA 3OJ3A 2L1AA 1FPYA 4WWMA 3UINB 3SEBA 2L05A 4HDOA 4MSQB 4C7ZA 4A20A 2KDEB 5BYSA 1PGAA 2LHEA 2DAFA 2LD9A 3IBEA 4W9LA 1QOFA 1E90A 3SFDB 1C76A 4BKSA 3A33B 2M56B 1N5XA 1FRDA 2KZRA 2MBQA 2FCQA 2LVOA 3AB5A 3DWMA 5TSSA 3ZIMA 1VJKA 3DBHI 1V1PB 2E6XA 4KSLC 3HVDA 1FEHA 2MW5A 3HVZA 4PS3A 1TKGA 2JRIB 4NAWB 2V1YA 4ZRIA 4C7YA 3BVMA 1XQQA 4MT5A 2Z0EB 3BK1A 1FXTB 4X57B 2KANA 3A9JA 2JYTA 3KQ4A 2J4XA 4IWQA 2HE7A 3PRPB 4AJYB 3UGBB 3ENEA 2WU2B 2KACA 4HPPA 3GB1A 1D5XC 2NMQA 1Z5SB 3JW0X 1P7EA 3QARA 3U30A 5JXVA 1WY8A 3ALBA 4KIKB 3B9JA 4WURA 3KUCB 2LGSA 2WXJA 3TMPB 3RD2A 2I1KA 3WA0A 4KZCA 2IDYA 5C2TB 2Z59B 2B76B 2RR9A 2JZZA 4FBJB 5C23A 3RFZB 2KC1A 5T8IA 4USAA 2KQ4X 3V05A 5LXIB 3V60A 2LHDA 1XLQA 2WXOA 2DZJA 1VZ7A 4GIVA 4OZAA 2KWCA 1XEEA 1GC6A 3RI7C 2MX2A 4C4VA 3DVNU 3QIJA 1K50A 1F2RC 2PKOA 3RNCC 3ZRFA 1C78A 3KWVA 2IZVB 3VRBB 2CR5A 3GE3C 1WH3A 5D3IB 2GBKA 4AQ7A 1V97A 2LVQA 2XEWA 4JL9A 2DLBA 2MQJA 4LJOB 1EU4A 1VRAB 2XK5B 1J0GA 4XE0A 2BB5A 4ZOHC 4M01A 1WF9A 4ANXA 4B0EA 4XZ4A 1I4PA 3AH7A 2KO3A 1PUTA 1QOGA 3VXWA 3M62B 2FBWB 4WAFA 4P6VF 3EA6A 3LJ3A 3C8YA 2J0KA 3DVNV 2HD5B 4K81A 3ZJUA 5G55A 2GBJA 1V80A 3TIXA 3QHTA 1ZDXA 3RZFA 3Q3FA 2R2QA 4NJCA 2WXFA 3DBRI 3QAQA 1QQRA 2KWVB 4MEMA 4HKZE 2DZIA 4ZHPA 1JWSD 4BFRA 4US8A 1RYJA 4BZAA 2DYMA 4P7IA 3TL5A 2O6VD 1LGRA 3A1QB 1T3QA 2AL6A 2IO2B 4A3PA 5TR5A 2WXNA 5H8YE 3B2GA 2PJHA 1ENFA 2X38A 1WMHA 1KH0A 3RNFC 1Q1OA 2KJRA 2MLBA 1S1QB 2LGIA 3W1SC 1F77A 3UI3A 1E0ZA 1WRDB 2KTRB 2GBRA 2KXJA 2QILA 1DYQA 4NY0A 2H89B 5BMIA 2L8JA 2M19A 1RLFA 5E6OA 4IKGA 3IAM1 4ANUA 4RM8A 4P1BC 1SE2A 1ZGUB 4ITKA 3PO0A 1SF0A 2EMTA 1Q10A 2YVCA 4RGOS 3ONSA 1LM8B 1KTKA 2WWZA 3NS8A 1K51A 1OQQA 3E56A 4HJGE 3BVZA 1DGJA 1L5PA 2WDRB 4B95A 1XCQL 4NZLB 2GB1A 5FK9C 2J52A 5D7GA 2WX0A 1RFAA 3CIRB 2LZ6A 1RRBA 2CHXA 2FAZA 1E7VA 4MM3A 3APCA 3KLSX 3RMKC 3M3JA 1B1ZA 1FM0D 2O2VB 4PYZA 2K39A 1WXAA 5L95C 2MBBB 3AE8B 2BS4B 3IT4B 3NRZA 3SU8X 4GDLA 3PVLA 2QSDA 1YJ1A 4DHJD 2O6VB 3NY5A 3B1LX 3AECB 2JSVX 5CHWA 1KRHA 4JPSA 4OHJA 5KHQA 3NJTA 2KK8A 5D94A 4ZRPA 5G5GA 3MTNB 3IXSA 2KC2A 4OVZA 5J2RA 3X23A 2L83A 2RMMA 4YT0B 4RMAA 5CX3A 5BMHA 4TUUA 2AL3A 2BWES 2W9NA 1P3QU 3RNGC 2LJIA 5LXHA 3QCAA 2N9XA 3QK0A 4FXCA 1M4VA 3ZYYX 3M63B 5EE9A 4GGQA 4DHZB 1MHHE 1FRRA 1NBFC 4RCOA 3MC9A 3I9V1 4KGSA 4W9EA 4DDGD 3AN1A 4HK2A 1NI2A 4P16A 2ASQA 2UYZB 3RNEC 4E3CA 5CHVC 2W3RA 3CSTA 3N1XC 3DPDA 1H4RA 2L0FA 1MI0A 2FUHB 2ZPYA 4WWOA 2MJEA 2V3NA 2NTSA 1C3TA 2ZCCA 4K3CA 1E8YA 1EM7A 5IAAC 1MFWA 1EWCA 1L7YA 4GLSC 3ZXRA 2ZNVB 3MC8A 3VTUA 3ECIA 1QOBA 5IA7A 2DHZA 4DWFA 1V49A 4MH0E 1YJJA 3ZKJC 3TEYA 4DHJB 4HRSA 3Q8EA 1HTOA 4US9A 3P4PB 1ZPSA 3MP9A 5IP4D 3SR6A 1ZKHA 1KFYB 4AP4C 1XLNA 2GBNA 3VAWA 1UUPA 4URKA 4JX1C 2N7JA 2V3SA 1X1MA 1V8CA 3VTVA 3W2DA 2YLMA 4GXBA 4II2B 1SSNA 5MPOA 1TTNA 1K53A 5E6JA 4E71A 4YL8A 2K22A 1GUAB 1WRIA 4ZRJA 1C77A 4BKSD 1FCCC 3TBLD 5IKCM 2BS3B 2V9HA 3DBLB 3RUIB 1N63A 3DBSA 2KQSA 1SJED 1D4BA 3N9YC 1FFUA 3VQIA 3Q3NC 4TV3A 2HTHA 3P63A 4C56C 4EZLA 2LUEA 4M0WA 1Y56A 3GZNB 2BWFA 3DVGX 4OZCA 5HKHA 1QLBB 3EHVA 1L4ZB 2C60A 1OTRB 2QCZA 3Q3MC 4DDID 2LI5A 2WXKA 3A9KB 1ZP0B 4YSYB 1HE8A 2GRIA 4IOIE 2KJ6A 3LB8C 4M8NA 1P9DU 2LUMA 3MHSD 2NS5A 4JWUC 4XWTA 1MG8A 4OVVA 4ZRQA 3SD5A 2AQ3B 1RWSA 3HIZA 1I42A 1ZOYB 2GI9A 4RGTA 1RM6C 2KX3A 3AI5A 2EMSA 2LGXA 3BINA 1UBQA 1T0SC 2ZVOA 1M94A 3RNBC 4DHZE 3D32A 4EKUA 1WGGA 4HKQA 5AZGA 3P2BA 2KFJA 2D3AA 4WWNA 1ZXHA 2OHFA 1GB4A 4KGRA 2QIEB 1E7PB 3R7QA 1FO4A 2MEKA 2KHWB 2MJ3A 3N3KB 2GBMA 2HJ8A 1IGCA 2N9LA 2D3BA 1PGBA 1N62A 4M00A 2L32A 2KDIA 3ZVVA 2QMTA 3P1MA 3ZQ4A 3AEEB 4BOSC 3W1SA 1CK1A 1L6UA 3P4SB 4HJKA 3WIMA 2LMCA 1XCTL 4WH4A 3NOBA 3URYA 4YSXB 2JWUA 3C19A 2FNJB 1OGWA 3Q8AA 1J7BA 2CS4A 4BVUC 1TY2A 2J0MA 4PK1A 1BT0A 3CF6E 3A4RA 5BO4B 5LNK1 5JH5C 1EO6A 3TJPA 2BS2B 4LNFA 4EOYA 5H92C 3ZNZB 4WQOB 3C0RB 1BUIC 4GN1A 5D6JB 4M8MA 4EE2A 1FNUA 2J53A 2CU1A 4N59A 1P0RA 1V6EA 3DBRB 4RGNA 4LCDE 3WANA 3ML9A 4WJQA 2KKCA 1BXTA 2NPTB 1UELA 1J7AA 1C79A 2R61A 4DK5A 1XXGA 2M8SA 1I4GA 1N6ZA 2V4IB 4XDDA 3VFKA 3L0WB 3WAPA 1FXAA 3O13A 4C00A 2LJ5A 1UNSA 4A9AA 4KV2A 3I57A 1HTQA 1WYWB 2C7MB 4FHKA 1ISNA 4F1SA 2KDBA 1WX8A 3APFA 1B9RA 1Z2MA 2D5GA 2INDC 4GOCA 3PTFC 4JLCA 2FIFA 1XD3B 4GSWA 3H1UA 2BB6A 1DOYA 1H8CA 2PE9A 4YTPB 1NENB 2IGGA 4TKNA 2WXHA 4K3BA 3ZDTA 1WJNA 2BGFA 3KUDB 2JX5A 3B0AA 4A3OA 2N9KA 3RPFC 1TS4A 4IM0A 2BKFA 2BYEA 4KGTA 3V3XA 3NVZA 4G3XB 2PE6B 2W3SA 1I4HA 4TSSA 4W9GA 4WQMA 3JVZX 4CO7A 2JY6A 1WJ4A 3NUHB 1ZW7A 4MELA 4FHJA 5AEKB 3UQBA 1CQVA 1V1PA 4FJZA 2M1MA 5D3DA 4TQ0A 2M0XA 4NAWA 1FIQA 2L00B 3EFUA 1WJ6A 1P7FA 3CWIA 2MJDA 2ZW0A 1WJUA 1YNTE 2JRHA 2KLCA 2BQQA 4ICVA 3IHPC 3FILB 1SIFA 3TEZA 1HA5A 4EZKA 4AWJA 2I1JA 2V0GA 3GE8C 2JF5A 2M4NA 1R4NB 2KFKB 4ARCA 2KAJA 4K7SA 2GOWA 4W9FA 2C9WB 1MPEA 3W5VB
chains in the Genus database with same CATH topology
2KC2A 2AWTA 3H9DA 2NVUI 3MJWA 2D3GA 2MWSB 2XBBC 3X23A 3ZUNA 5J2RA 4RMAA 2LXCA 5CX3A 4TUUA 3ZNGC 2AL3A 2BWES 3APDA 1P1AA 3VUYA 2W9NA 1WGHA 4WJOA 2KTFA 1P3QU 5E6NA 3U8ZA 2NCNA 3L08A 1OEYA 2C5LC 2DAJA 2NBVB 1VD2A 4WAAA 3GZNI 4MGKE 5LXHA 2B3AA 1OQYA 3QCAA 4IG7B 2N9XA 3QK0A 2LVPA 4FULA 4KZ0A 2DZMA 2IO1B 2KDFB 2NR2A 3GOEA 3ZO5B 3M63B 4GGQA 3PV1A 2KJHB 2MCNB 4DHZB 4FN2A 4ICUA 1NBFC 5JZEB 2MP2A 3JYUA 4W9EA 4DDGD 2D07B 4HK2A 1NI2A 2JPHA 2ASQA 3VHTC 2UYZB 4E3CA 3DVGY 4IC7B 5CHVC 1L2NA 1Y8RC 3NZSA 2KLGA 3PHXB 3CSTA 3KVFB 4II3B 3UQAA 3DPDA 1H4RA 4G50A 4GDLB 4W9DA 3K9PB 2L0FA 4HWIB 1OEYJ 4JIOU 4NJ6A 4W9CA 1WR1A 4CYEA 2KMCA 1WR6E 2FUHB 2ZPYA 4WWOA 2K8BA 5D2MB 2JXXA 3ZDMC 3NZUA 2G4SA 1C3TA 1Q5WB 2ZCCA 5JHAA 1E8YA 1UZXB 2AYOB 5IAAC 3V62A 1R4MI 2JT4B 1L7YA 4BBNC 2K25A 1A5RA 2BYFA 1UGMA 4IWOA 5AZHA 2DENB 2DX5B 4F7ZA 1WM3A 4E74A 4NJ7A 3DCGA 2ZNVB 4DBGA 3VTUA 4W9IA 2N1WA 3ECIA 4KVGB 2KX0A 4I6LB 5IA7A 3QX1A 2EKEC 2DHZA 2IY1B 1UBIA 2ZNVC 4DWFA 2RSUA 3PLVA 1D3ZA 1V49A 4MH0E 2GMIC 2IY0B 2L0TA 1V2YA 4ZRKA 5DPWA 3ZKJC 3L13A 4DHJB 4PS8A 1V81A 2LGYA 2LRWA 4EZJA 1GC7A 5DPRA 2FCSA 4MJSA 2NPTA 4AOFA 3JSVA 2RD0A 4AJWA 4WJNA 1V9JA 2D10A 1WI0A 1ZKHA 4AUQC 3VUXA 4AP4C 3VFKA 4DXAB 4WJPA 3VAWA 2GBNA 3T8MA 4K7WA 4URKA 1EUVB 4GB9A 2V3SA 1X1MA 2OOBB 3A1QA 1T0YA 3WAMA 1LFDA 3VTVA 2YLMA 3KYDD 4GXBA 4II2B 3ML8A 1P98A 1WMHB 1WZ0A 2MP2B 1TTNA 2OJRA 3VTWA 4E71A 4J6IA 4YL8A 2KQ7A 1GUAB 4ZRJA 3SHQA 5G2NA 1JRUA 1J19A 4NNJB 3RYTA 3PREA 2FCMA 4G0NB 3PLUA 1WM2A 4BKSD 1WXSA 3TBLD 4LDTD 2AEHA 3PHWB 3AU4A 3RUIB 2JUOA 4OVUA 3BY4B 4CHKA 3DBSA 2KVRA 3HK0A 5AZFA 4F8CB 3QWZB 4JQWC 3VH3B 4GU2A 1AARA 4HLEA 2KQSA 4HCNB 4NPNA 4FADA 3OJ3A 2Z0DB 5LLIA 2DYOA 2BYVE 1WIAA 3UINB 3VQIA 4KIKA 2L05A 3QA8A 4HDOA 4MSQB 2C7HA 4A20A 2KDEB 4BKTA 4TV3A 1GG3A 2HTHA 3PT2B 4NQKE 3X0WA 5EDSA 5J18A 2DAFA 2LD9A 3H7PA 3IBEA 1E8XA 5DCNA 2JVCA 4W9LA 3ZTDA 2KMAA 4HPMB 1E90A 4HXDA 2M17A 4BKSA 4EZLA 3A33B 4ZDVA 1RAXA 2LUEA 3CMMB 2KZRA 2MBQA 2MRPA 2FCQA 2LVOA 3NHEB 2BWFA 3DVGX 3UIPB 3ZIMA 3HM3A 3DBHI 4ANVA 1TZ1A 4MGIE 5HKHA 4KSLC 3EHVA 2IO0B 2MW5A 3KYCD 2CHZA 4PS3A 2JRIB 2C60A 2C7NB 4MJSB 1OTRB 4NAWB 3U7DA 4DDID 2V1YA 2A5UA 3JSVB 4ZRIA 4BOZB 2LI5A 3ZRCA 1NDDA 2CKHB 2ZVNA 4HPLB 1C1YB 5JHBA 3A9KB 1HE8A 1XQQA 2K1FA 4BBNF 2KJ6A 3RULA 4KDIC 2G45B 4W9JA 2Z0EB 4M8NA 1P9DU 3AULA 1FXTB 1IPGA 3MHSD 3R66C 2NS5A 3KH0A 2FIDA 2KANA 3A9JA 4X57B 2BF8B 4HVBA 2XK5A 1MG8A 4OVVA 3SD5A 4IWQA 4B9KA 2O2VA 5CTRC 2HE7A 4W9HA 3PRPB 1YX6B 2NBUA 4AJYB 4LJPB 3UGBB 3ENEA 2IO3B 3HIZA 2D2QA 3ZW3A 2LASA 3ZNHB 2ZEQA 1YIWA 1I42A 4IM3A 1Z5SB 2KX3A 2O6VA 2J7QB 3AI5A 3JW0X 2KFKA 2EMSA 3QARA 3U30A 2BPSA 2LGXA 3BINA 1WY8A 1UBQA 3ALBA 4RM9A 4FLHA 4KIKB 2ZVOA 1M94A 3KUCB 3I3TB 4DHZE 4FA6A 3D32A 3RD2A 3TMPB 1WGGA 2I1KA 3V6EB 3WA0A 4EKUA 2WDTB 3H7PB 2WX1A 3P2BA 5AZGA 2KFJA 4KZCA 2VRRB 5C1ZA 4WWNA 2Z59B 2ZPNA 3UF8A 2RR9A 2JZZA 4NQLB 4FBJB 4GDKA 3PRZA 5C23A 2KC1A 4ASWC 2V4LA 4LDTB 3R7QA 4IWPA 3ZTCA 5LXIB 3V60A 2N7EA 2N7DA 3DOWA 4ZYNA 2R2OA 2KN5A 2D11A 2KHWB 1CMXB 3N3KB 2GBMA 2HJ8A 2PPHA 2KOXA 4I6NB 4JGHB 1WFYA 3WALA 2DZJA 4MSMB 4GIVA 2KWCA 3QJZA 1GC6A 2KDIA 3QQ8B 5DPSA 1LQBA 4WWPA 1E8WA 5GMVA 2K6QA 2MX2A 3ZVVA 3DVNU 4N9F4 1E8ZA 3QIJA 2K8CA 3ZRFA 2LRUA 2IZVB 1Q0WB 2N1VA 2CR5A 3AU5A 3KW5B 3L10B 4MGYE 1WH3A 4K7UA 2GBKA 2LVQA 4BOSC 2XEWA 2MSED 3IVFA 3W1SA 4JL9A 2MBEA 4HJKA 1SGHA 3LDZE 3WIMA 2L76A 2MQJA 3NOBA 4LJOB 1G6JA 2XK5B 2FNJB 1J0GA 1OGWA 2KTRA 3PS6A 1YQBA 2CS4A 1WF9A 4ANXA 2J0MA 4BVUC 1BT0A 2L7RA 4XZ4A 3CF6E 2KO3A 3A4RA 4IM2A 2FCNA 5BO4B 3VXWA 3M62B 2K8HA 2LWPA 2QHOA 5JH5C 1KOTA 2L3ZA 1EO6A 3K9OB 3TJPA 3DQVA 1R4NI 3LJ3A 3WAOA 4EFOA 1V5OA 2J0KA 3DVNV 3VDZA 2HD5B 3B08A 1V5TA 4EOYA 4K81A 3RZWC 1IP9A 3ZNZB 1KM7A 5G55A 2GBJA 1V80A 2LGDA 1UD7A 3C0RB 4GN1A 4WQOB 5D6JB 3PSEB 1TBEA 3A4SC 3QHTA 4KDLB 4M8MA 3V61A 1WXMA 2Y5BB 3TIXA 3RZFA 2CU1A 3Q3FA 2R2QA 4EEWA 2A4ZA 1YD8U 1WX9A 3UIOB 1LXDA 1P0RA 4GDKB 1V6EA 4MDKE 3DBRI 2K6DB 3QAQA 4IUMB 3OJ4B 3ZNID 2DZKA 4LCDE 2KWVB 4MEMA 3WANA 3ML9A 4WJQA 2KKCA 3QC8B 2NPTB 1UELA 2DZIA 1WGRA 4PS7A 2PEAA 4BFRA 4MGZE 4DK5A 2M8SA 1WE6A 3EECA 1E5WA 2G4DB 4FJVB 2RGFA 2G3QB 3KUZA 3L0WB 4K1RB 2DYMA 1K8RB 3PPAA 2O6VD 4P7IA 3TL5A 1WGDA 3WAPA 1I35A 3SDLC 3ZLZA 2LJ5A 1KLVA 3A1QB 2CHWA 1V86A 4TQ1A 3RCZA 2AL6A 2IBIB 2IO2B 3AXCA 4KV2A 4A3PA 5CHFA 4I6PA 5TR5A 1WYWB 2UWQA 2C7MB 3PRMB 1EF5A 4FHKA 1WXVA 1U4AA 1ISNA 2PJHA 4F1SA 2KDBA 1XT9B 2JWZA 3L17A 1WMHA 1KJTA 4BKGA 1Q1OA 3N30A 2KJRA 1VCBA 2MLBA 1S1QB 3RT3B 1WZ3A 3DDCB 3W1SC 1J8CA 1WX8A 3APFA 1Z2MA 2RPQA 1WRDB 2LXAA 2KTRB 1PQSA 3PTFC 4GOCA 2MA9B 2GBRA 2ZJDA 4JLCA 5J17A 2ZCBA 1GJZA 1EF1A 2FIFA 1WX7A 3CSFA 1WE7A 1XD3B 2KXJA 4GSWA 2N9PC 4PYUA 1QZEA 4W9KA 2JZ3B 3H1UA 4NY0A 3W1YA 1H8CA 2PE9A 2L8JA 4TKNA 1RLFA 5E6OA 3V6CB 2IYDB 3H6NA 2KWUB 3HM6X 4ANUA 4FJYA 4RM8A 5L83A 2BKRB 3ZDTA 1WJNA 3HHMA 1ZGUB 2BGFA 2N9EB 3KUDB 3B0AA 2EMTA 4M0WB 4A3OA 2DYBA 2YVCA 4ANWA 5FR6A 2KNBA 4IM0A 3OAWA 2BKFA 2BYEA 3R3MA 3ONSA 1LM8B 4G3XB 1IYFA 4HCPB 2PE6B 2WYQA 4W9GA 2J0JA 2WWZA 3JVZX 4CO7A 3IFWB 3NS8A 4IW0A 3L16A 2JY6A 1WJ4A 1ZW7A 4MELA 4B6WA 4FHJA 1WGYA 5AEKB 3UQBA 4FJZA 2MBHA 1GNUA 1SE9A 3M95A 4B95A 2M1MA 5D7GA 2WX0A 4TQ0A 2M0XA 1RFAA 4NAWA 3VH4B 2L00B 4GMVA 2LZ6A 3EFUA 1RRBA 2CHXA 1WJ6A 3OLMD 4XC2A 2FAZA 3A9KA 1E7VA 4MM3A 1WJUA 2KLCA 2JRHA 3A9JB 3PGEA 2REXA 4ICVA 3APCA 3IHPC 3TCAA 3M3JA 1YX5B 1SIFA 2O2VB 3O65B 3PZDA 4G11A 4PYZA 2K39A 2I1JA 4XX5A 4AWJA 1WXAA 4EUTA 4EZKA 5L95C 2MBBB 2NBWB 3VVWB 1TGZB 3SU8X 4GDLA 5KHOA 3Q3JA 1UH6A 3PVLA 5DPTA 3T9LA 1YJ1A 2JF5A 2N4FA 2ZZPB 4DHJD 2M4NA 2O6VB 3EC8A 2KD0A 5E6PA 1E7UA 2KFKB 3B1LX 3DBLI 3NY5A 4KSKC 5CHWA 4K7SA 3L54A 5KHQA 3R7RA 2GOWA 4W9FA 3H7SA 2C9WB 3VUWA 4HDQA 1S3SG 3IG3A 2KK8A 3N32A 5D94A 3S2AA 1F9JA 3MTNB 2MBOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KC2 A;  2AWT A;  3H9D A;  2NVU I;  3MJW A;  2D3G A;  2MWS B;  2XBB C;  3X23 A;  3ZUN A;  5J2R A;  4RMA A;  2LXC A;  5CX3 A;  4TUU A;  3ZNG C;  2AL3 A;  2BWE S;  3APD A;  1P1A A;  3VUY A;  2W9N A;  1WGH A;  4WJO A;  2KTF A;  1P3Q U;  5E6N A;  3U8Z A;  2NCN A;  3L08 A;  1OEY A;  2C5L C;  2DAJ A;  2NBV B;  1VD2 A;  4WAA A;  3GZN I;  4MGK E;  5LXH A;  2B3A A;  1OQY A;  3QCA A;  4IG7 B;  2N9X A;  3QK0 A;  2LVP A;  4FUL A;  4KZ0 A;  2DZM A;  2IO1 B;  2KDF B;  2NR2 A;  3GOE A;  3ZO5 B;  3M63 B;  4GGQ A;  3PV1 A;  2KJH B;  2MCN B;  4DHZ B;  4FN2 A;  4ICU A;  1NBF C;  5JZE B;  2MP2 A;  3JYU A;  4W9E A;  4DDG D;  2D07 B;  4HK2 A;  1NI2 A;  2JPH A;  2ASQ A;  3VHT C;  2UYZ B;  4E3C A;  3DVG Y;  4IC7 B;  5CHV C;  1L2N A;  1Y8R C;  3NZS A;  2KLG A;  3PHX B;  3CST A;  3KVF B;  4II3 B;  3UQA A;  3DPD A;  1H4R A;  4G50 A;  4GDL B;  4W9D A;  3K9P B;  2L0F A;  4HWI B;  1OEY J;  4JIO U;  4NJ6 A;  4W9C A;  1WR1 A;  4CYE A;  2KMC A;  1WR6 E;  2FUH B;  2ZPY A;  4WWO A;  2K8B A;  5D2M B;  2JXX A;  3ZDM C;  3NZU A;  2G4S A;  1C3T A;  1Q5W B;  2ZCC A;  5JHA A;  1E8Y A;  1UZX B;  2AYO B;  5IAA C;  3V62 A;  1R4M I;  2JT4 B;  1L7Y A;  4BBN C;  2K25 A;  1A5R A;  2BYF A;  1UGM A;  4IWO A;  5AZH A;  2DEN B;  2DX5 B;  4F7Z A;  1WM3 A;  4E74 A;  4NJ7 A;  3DCG A;  2ZNV B;  4DBG A;  3VTU A;  4W9I A;  2N1W A;  3ECI A;  4KVG B;  2KX0 A;  4I6L B;  5IA7 A;  3QX1 A;  2EKE C;  2DHZ A;  2IY1 B;  1UBI A;  2ZNV C;  4DWF A;  2RSU A;  3PLV A;  1D3Z A;  1V49 A;  4MH0 E;  2GMI C;  2IY0 B;  2L0T A;  1V2Y A;  4ZRK A;  5DPW A;  3ZKJ C;  3L13 A;  4DHJ B;  4PS8 A;  1V81 A;  2LGY A;  2LRW A;  4EZJ A;  1GC7 A;  5DPR A;  2FCS A;  4MJS A;  2NPT A;  4AOF A;  3JSV A;  2RD0 A;  4AJW A;  4WJN A;  1V9J A;  2D10 A;  1WI0 A;  1ZKH A;  4AUQ C;  3VUX A;  4AP4 C;  3VFK A;  4DXA B;  4WJP A;  3VAW A;  2GBN A;  3T8M A;  4K7W A;  4URK A;  1EUV B;  4GB9 A;  2V3S A;  1X1M A;  2OOB B;  3A1Q A;  1T0Y A;  3WAM A;  1LFD A;  3VTV A;  2YLM A;  3KYD D;  4GXB A;  4II2 B;  3ML8 A;  1P98 A;  1WMH B;  1WZ0 A;  2MP2 B;  1TTN A;  2OJR A;  3VTW A;  4E71 A;  4J6I A;  4YL8 A;  2KQ7 A;  1GUA B;  4ZRJ A;  3SHQ A;  5G2N A;  1JRU A;  1J19 A;  4NNJ B;  3RYT A;  3PRE A;  2FCM A;  4G0N B;  3PLU A;  1WM2 A;  4BKS D;  1WXS A;  3TBL D;  4LDT D;  2AEH A;  3PHW B;  3AU4 A;  3RUI B;  2JUO A;  4OVU A;  3BY4 B;  4CHK A;  3DBS A;  2KVR A;  3HK0 A;  5AZF A;  4F8C B;  3QWZ B;  4JQW C;  3VH3 B;  4GU2 A;  1AAR A;  4HLE A;  2KQS A;  4HCN B;  4NPN A;  4FAD A;  3OJ3 A;  2Z0D B;  5LLI A;  2DYO A;  2BYV E;  1WIA A;  3UIN B;  3VQI A;  4KIK A;  2L05 A;  3QA8 A;  4HDO A;  4MSQ B;  2C7H A;  4A20 A;  2KDE B;  4BKT A;  4TV3 A;  1GG3 A;  2HTH A;  3PT2 B;  4NQK E;  3X0W A;  5EDS A;  5J18 A;  2DAF A;  2LD9 A;  3H7P A;  3IBE A;  1E8X A;  5DCN A;  2JVC A;  4W9L A;  3ZTD A;  2KMA A;  4HPM B;  1E90 A;  4HXD A;  2M17 A;  4BKS A;  4EZL A;  3A33 B;  4ZDV A;  1RAX A;  2LUE A;  3CMM B;  2KZR A;  2MBQ A;  2MRP A;  2FCQ A;  2LVO A;  3NHE B;  2BWF A;  3DVG X;  3UIP B;  3ZIM A;  3HM3 A;  3DBH I;  4ANV A;  1TZ1 A;  4MGI E;  5HKH A;  4KSL C;  3EHV A;  2IO0 B;  2MW5 A;  3KYC D;  2CHZ A;  4PS3 A;  2JRI B;  2C60 A;  2C7N B;  4MJS B;  1OTR B;  4NAW B;  3U7D A;  4DDI D;  2V1Y A;  2A5U A;  3JSV B;  4ZRI A;  4BOZ B;  2LI5 A;  3ZRC A;  1NDD A;  2CKH B;  2ZVN A;  4HPL B;  1C1Y B;  5JHB A;  3A9K B;  1HE8 A;  1XQQ A;  2K1F A;  4BBN F;  2KJ6 A;  3RUL A;  4KDI C;  2G45 B;  4W9J A;  2Z0E B;  4M8N A;  1P9D U;  3AUL A;  1FXT B;  1IPG A;  3MHS D;  3R66 C;  2NS5 A;  3KH0 A;  2FID A;  2KAN A;  3A9J A;  4X57 B;  2BF8 B;  4HVB A;  2XK5 A;  1MG8 A;  4OVV A;  3SD5 A;  4IWQ A;  4B9K A;  2O2V A;  5CTR C;  2HE7 A;  4W9H A;  3PRP B;  1YX6 B;  2NBU A;  4AJY B;  4LJP B;  3UGB B;  3ENE A;  2IO3 B;  3HIZ A;  2D2Q A;  3ZW3 A;  2LAS A;  3ZNH B;  2ZEQ A;  1YIW A;  1I42 A;  4IM3 A;  1Z5S B;  2KX3 A;  2O6V A;  2J7Q B;  3AI5 A;  3JW0 X;  2KFK A;  2EMS A;  3QAR A;  3U30 A;  2BPS A;  2LGX A;  3BIN A;  1WY8 A;  1UBQ A;  3ALB A;  4RM9 A;  4FLH A;  4KIK B;  2ZVO A;  1M94 A;  3KUC B;  3I3T B;  4DHZ E;  4FA6 A;  3D32 A;  3RD2 A;  3TMP B;  1WGG A;  2I1K A;  3V6E B;  3WA0 A;  4EKU A;  2WDT B;  3H7P B;  2WX1 A;  3P2B A;  5AZG A;  2KFJ A;  4KZC A;  2VRR B;  5C1Z A;  4WWN A;  2Z59 B;  2ZPN A;  3UF8 A;  2RR9 A;  2JZZ A;  4NQL B;  4FBJ B;  4GDK A;  3PRZ A;  5C23 A;  2KC1 A;  4ASW C;  2V4L A;  4LDT B;  3R7Q A;  4IWP A;  3ZTC A;  5LXI B;  3V60 A;  2N7E A;  2N7D A;  3DOW A;  4ZYN A;  2R2O A;  2KN5 A;  2D11 A;  2KHW B;  1CMX B;  3N3K B;  2GBM A;  2HJ8 A;  2PPH A;  2KOX A;  4I6N B;  4JGH B;  1WFY A;  3WAL A;  2DZJ A;  4MSM B;  4GIV A;  2KWC A;  3QJZ A;  1GC6 A;  2KDI A;  3QQ8 B;  5DPS A;  1LQB A;  4WWP A;  1E8W A;  5GMV A;  2K6Q A;  2MX2 A;  3ZVV A;  3DVN U;  4N9F 4;  1E8Z A;  3QIJ A;  2K8C A;  3ZRF A;  2LRU A;  2IZV B;  1Q0W B;  2N1V A;  2CR5 A;  3AU5 A;  3KW5 B;  3L10 B;  4MGY E;  1WH3 A;  4K7U A;  2GBK A;  2LVQ A;  4BOS C;  2XEW A;  2MSE D;  3IVF A;  3W1S A;  4JL9 A;  2MBE A;  4HJK A;  1SGH A;  3LDZ E;  3WIM A;  2L76 A;  2MQJ A;  3NOB A;  4LJO B;  1G6J A;  2XK5 B;  2FNJ B;  1J0G A;  1OGW A;  2KTR A;  3PS6 A;  1YQB A;  2CS4 A;  1WF9 A;  4ANX A;  2J0M A;  4BVU C;  1BT0 A;  2L7R A;  4XZ4 A;  3CF6 E;  2KO3 A;  3A4R A;  4IM2 A;  2FCN A;  5BO4 B;  3VXW A;  3M62 B;  2K8H A;  2LWP A;  2QHO A;  5JH5 C;  1KOT A;  2L3Z A;  1EO6 A;  3K9O B;  3TJP A;  3DQV A;  1R4N I;  3LJ3 A;  3WAO A;  4EFO A;  1V5O A;  2J0K A;  3DVN V;  3VDZ A;  2HD5 B;  3B08 A;  1V5T A;  4EOY A;  4K81 A;  3RZW C;  1IP9 A;  3ZNZ B;  1KM7 A;  5G55 A;  2GBJ A;  1V80 A;  2LGD A;  1UD7 A;  3C0R B;  4GN1 A;  4WQO B;  5D6J B;  3PSE B;  1TBE A;  3A4S C;  3QHT A;  4KDL B;  4M8M A;  3V61 A;  1WXM A;  2Y5B B;  3TIX A;  3RZF A;  2CU1 A;  3Q3F A;  2R2Q A;  4EEW A;  2A4Z A;  1YD8 U;  1WX9 A;  3UIO B;  1LXD A;  1P0R A;  4GDK B;  1V6E A;  4MDK E;  3DBR I;  2K6D B;  3QAQ A;  4IUM B;  3OJ4 B;  3ZNI D;  2DZK A;  4LCD E;  2KWV B;  4MEM A;  3WAN A;  3ML9 A;  4WJQ A;  2KKC A;  3QC8 B;  2NPT B;  1UEL A;  2DZI A;  1WGR A;  4PS7 A;  2PEA A;  4BFR A;  4MGZ E;  4DK5 A;  2M8S A;  1WE6 A;  3EEC A;  1E5W A;  2G4D B;  4FJV B;  2RGF A;  2G3Q B;  3KUZ A;  3L0W B;  4K1R B;  2DYM A;  1K8R B;  3PPA A;  2O6V D;  4P7I A;  3TL5 A;  1WGD A;  3WAP A;  1I35 A;  3SDL C;  3ZLZ A;  2LJ5 A;  1KLV A;  3A1Q B;  2CHW A;  1V86 A;  4TQ1 A;  3RCZ A;  2AL6 A;  2IBI B;  2IO2 B;  3AXC A;  4KV2 A;  4A3P A;  5CHF A;  4I6P A;  5TR5 A;  1WYW B;  2UWQ A;  2C7M B;  3PRM B;  1EF5 A;  4FHK A;  1WXV A;  1U4A A;  1ISN A;  2PJH A;  4F1S A;  2KDB A;  1XT9 B;  2JWZ A;  3L17 A;  1WMH A;  1KJT A;  4BKG A;  1Q1O A;  3N30 A;  2KJR A;  1VCB A;  2MLB A;  1S1Q B;  3RT3 B;  1WZ3 A;  3DDC B;  3W1S C;  1J8C A;  1WX8 A;  3APF A;  1Z2M A;  2RPQ A;  1WRD B;  2LXA A;  2KTR B;  1PQS A;  3PTF C;  4GOC A;  2MA9 B;  2GBR A;  2ZJD A;  4JLC A;  5J17 A;  2ZCB A;  1GJZ A;  1EF1 A;  2FIF A;  1WX7 A;  3CSF A;  1WE7 A;  1XD3 B;  2KXJ A;  4GSW A;  2N9P C;  4PYU A;  1QZE A;  4W9K A;  2JZ3 B;  3H1U A;  4NY0 A;  3W1Y A;  1H8C A;  2PE9 A;  2L8J A;  4TKN A;  1RLF A;  5E6O A;  3V6C B;  2IYD B;  3H6N A;  2KWU B;  3HM6 X;  4ANU A;  4FJY A;  4RM8 A;  5L83 A;  2BKR B;  3ZDT A;  1WJN A;  3HHM A;  1ZGU B;  2BGF A;  2N9E B;  3KUD B;  3B0A A;  2EMT A;  4M0W B;  4A3O A;  2DYB A;  2YVC A;  4ANW A;  5FR6 A;  2KNB A;  4IM0 A;  3OAW A;  2BKF A;  2BYE A;  3R3M A;  3ONS A;  1LM8 B;  4G3X B;  1IYF A;  4HCP B;  2PE6 B;  2WYQ A;  4W9G A;  2J0J A;  2WWZ A;  3JVZ X;  4CO7 A;  3IFW B;  3NS8 A;  4IW0 A;  3L16 A;  2JY6 A;  1WJ4 A;  1ZW7 A;  4MEL A;  4B6W A;  4FHJ A;  1WGY A;  5AEK B;  3UQB A;  4FJZ A;  2MBH A;  1GNU A;  1SE9 A;  3M95 A;  4B95 A;  2M1M A;  5D7G A;  2WX0 A;  4TQ0 A;  2M0X A;  1RFA A;  4NAW A;  3VH4 B;  2L00 B;  4GMV A;  2LZ6 A;  3EFU A;  1RRB A;  2CHX A;  1WJ6 A;  3OLM D;  4XC2 A;  2FAZ A;  3A9K A;  1E7V A;  4MM3 A;  1WJU A;  2KLC A;  2JRH A;  3A9J B;  3PGE A;  2REX A;  4ICV A;  3APC A;  3IHP C;  3TCA A;  3M3J A;  1YX5 B;  1SIF A;  2O2V B;  3O65 B;  3PZD A;  4G11 A;  4PYZ A;  2K39 A;  2I1J A;  4XX5 A;  4AWJ A;  1WXA A;  4EUT A;  4EZK A;  5L95 C;  2MBB B;  2NBW B;  3VVW B;  1TGZ B;  3SU8 X;  4GDL A;  5KHO A;  3Q3J A;  1UH6 A;  3PVL A;  5DPT A;  3T9L A;  1YJ1 A;  2JF5 A;  2N4F A;  2ZZP B;  4DHJ D;  2M4N A;  2O6V B;  3EC8 A;  2KD0 A;  5E6P A;  1E7U A;  2KFK B;  3B1L X;  3DBL I;  3NY5 A;  4KSK C;  5CHW A;  4K7S A;  3L54 A;  5KHQ A;  3R7R A;  2GOW A;  4W9F A;  3H7S A;  2C9W B;  3VUW A;  4HDQ A;  1S3S G;  3IG3 A;  2KK8 A;  3N32 A;  5D94 A;  3S2A A;  1F9J A;  3MTN B;  2MBO A; 
#chains in the Genus database with same CATH topology
 2AWT A;  3MJW A;  4C80 A;  1N60 A;  2D3G A;  2MWS B;  3LYY A;  2LXC A;  2WGS A;  3APD A;  3VUY A;  5HG2 A;  2KTF A;  4B0M A;  5E6N A;  2CU3 A;  3U8Z A;  2NCN A;  5HFY A;  4OZB A;  2NBV B;  1VD2 A;  1KF6 B;  1A70 A;  2BVC A;  2KVZ A;  1OQY A;  4IG7 B;  1ZDV A;  2DZM A;  2CJO A;  2IO1 B;  3ZO5 B;  4LTU A;  3P4Q B;  2FUG 1;  4QAY A;  4YTN B;  4A8X C;  4ICU A;  3ZJV A;  4N58 A;  1NI3 A;  4MM3 B;  2D07 B;  4IC7 B;  4MAC A;  1Y8R C;  1YQ3 B;  3KVF B;  3UQA A;  1T0R C;  2WXI A;  4GDL B;  5EE0 A;  4J3O D;  1OEY J;  4W9C A;  2IJ0 A;  2KMC A;  3WCQ A;  2G4S A;  1Q5W B;  5JHA A;  2AYO B;  2IGD A;  3AE6 B;  3P42 A;  1JAL A;  1UGM A;  2DX5 B;  1WM3 A;  4NJ7 A;  1VR9 A;  5HHD G;  2KX0 A;  4A55 A;  4RNA A;  3QX1 A;  2PMV A;  4D2K A;  1OQR A;  2UU7 A;  1UBI A;  3BZD B;  1I4Q A;  2L0T A;  3L13 A;  4EZJ A;  5DPR A;  4MJS A;  2ACZ B;  3JSV A;  2RD0 A;  1V9J A;  2M0A A;  1ET6 A;  3T8M A;  2K3U A;  3A1Q A;  1T0Y A;  3WAM A;  1LFD A;  1VDV A;  3KYD D;  1P98 A;  4TMA B;  1UWX A;  3Q69 A;  2KQ7 A;  1PFD A;  2FCM A;  4G0N B;  1WM2 A;  1QIL A;  1L0X B;  2AEH A;  2JXT A;  2JUO A;  4OVU A;  5AZF A;  4F8C B;  4GU2 A;  1AAR A;  3BYT B;  4NPN A;  5LLI A;  1L0Y B;  1ZE3 D;  3PZ7 A;  1NYR A;  2C7H A;  4BKT A;  3ZXV A;  1GG3 A;  4KKJ A;  5EDS A;  3H7P A;  4LLG M;  1E8X A;  2JVC A;  3ZTD A;  2V3P A;  4HXD A;  2ONQ A;  1WXQ A;  1RAX A;  3CMM B;  2QDF A;  2IPK D;  3UIP B;  1NYQ A;  4ANV A;  3KYC D;  2HTM E;  2C7N B;  2XN9 C;  2WXL A;  3U7D A;  4BOZ B;  3ZRC A;  1NDD A;  2TSS A;  4HPL B;  1C1Y B;  5JHB A;  1SBB B;  1QF6 A;  4BBN F;  5IOI A;  3RUL A;  2G45 B;  3MJ5 A;  4W9J A;  3AUL A;  1IPG A;  3R66 C;  2FID A;  2BF8 B;  4CQN A;  2O2V A;  1YX6 B;  2NBU A;  2MH7 A;  2OJW A;  4A6Q A;  2IO3 B;  2D2Q A;  2LAS A;  3ZNH B;  3ZJT A;  3HRD D;  1C4A A;  2O6V A;  2J7Q B;  1R4M B;  3OG5 A;  3AEG B;  4FLH A;  2W55 A;  4S0R A;  2VRR B;  5FKA C;  4GDK A;  3PRZ A;  1TZO A;  2X8X X;  4IWP A;  3Q6B A;  5I4D A;  3DOW A;  2R2O A;  2DBY A;  2KN5 A;  2D11 A;  1L4D B;  2PPH A;  1TYG B;  1WFY A;  3WAL A;  4MSM B;  1L0V B;  3TEW A;  1ESF A;  3QJZ A;  3AEB B;  1LQB A;  2K6Q A;  1ET9 A;  4N9F 4;  1Q0W B;  3AU5 A;  4MGY E;  3FAH A;  4ZHO A;  2MSE D;  3AE2 B;  5AUI A;  1SGH A;  2AX5 A;  2L76 A;  4PT5 A;  1AWD A;  2RDH A;  3BWU D;  3PS6 A;  1TS5 A;  2L7R A;  4IM2 A;  2FCN A;  2VH1 A;  4BAX A;  1IBX A;  2L3Z A;  1MHX A;  3DQV A;  1XF5 L;  3WAO A;  1TJE A;  4EFO A;  3B08 A;  1V5T A;  1IP9 A;  1KM7 A;  1DOI A;  1TBE A;  3A4S C;  4KDL B;  3V61 A;  2Y5B B;  1PDX A;  3BK2 A;  3EGR A;  3KWL A;  4EEW A;  1YD8 U;  3EUB 2;  4MDK E;  3DBH B;  3OJ4 B;  3QC8 B;  2INC C;  2Z8L A;  4PS7 A;  1E5W A;  2G4D B;  4FJV B;  2G3Q B;  1K8R B;  3PPA A;  1WGD A;  1YN3 A;  3ZLZ A;  1KLV A;  1SE3 A;  2CHW A;  1V86 A;  4TQ1 A;  3AXC A;  1NVI D;  4OW0 A;  2WNM A;  2UWQ A;  2QC8 A;  1D5M C;  1WXV A;  1YN5 A;  1XT9 B;  2KWD A;  3DWG C;  2KT7 A;  2JWZ A;  1KJT A;  1VCB A;  3RT3 B;  3DDC B;  1J8C A;  4DXG A;  2RPQ A;  2LXA A;  1PQS A;  2MA9 B;  2ZJD A;  4ARI A;  3MFG A;  1GJZ A;  2SAK A;  1WX7 A;  3CSF A;  3B2F A;  1F0Z A;  4PYU A;  4W9K A;  2JZ3 B;  1HQR D;  3V6C B;  1C4P A;  2IYD B;  2LFI A;  3VR8 B;  2QEJ C;  5L83 A;  2BKR B;  3HHM A;  1YN4 A;  1QT9 A;  2DYB A;  5FR6 A;  1N61 A;  2CJN A;  3OAW A;  3Q8C A;  3R3M A;  2JU6 X;  4LNK A;  1FFV A;  4HCP B;  2PVG C;  2KN4 A;  2PLP A;  1WGY A;  2MBH A;  1TY0 A;  1YOV B;  3BYY B;  1GNU A;  1SE9 A;  3M95 A;  1E10 A;  4H2A A;  1PYW D;  1SXT A;  3VH4 B;  4GMV A;  1ZXI A;  1AN8 A;  3A9K A;  3AE7 B;  1F1H A;  3A9J B;  3PGE A;  2D3C A;  3N1Z C;  1YX5 B;  4XX5 A;  1I35 A;  4G11 A;  2J42 A;  2NBW B;  1FMA D;  3NS1 A;  1JML A;  3BVG A;  1TGZ B;  2I2Y A;  3Q3J A;  1JRO A;  5DPT A;  1WWT A;  2ZZP B;  2KD0 A;  3DBL I;  4YWG G;  4KSK C;  1LO5 D;  4UDU C;  3ZGZ A;  3R7R A;  3H7S A;  3IT6 B;  4HDQ A;  3Q2A C;  3N32 A;  5BYQ A;  3NVV A;  2XBB C;  5HI1 A;  3ZUN A;  3Q8B A;  3R2T A;  5G5H A;  3ZNG C;  1WSP A;  1E9M A;  1WGH A;  1VLB A;  3Q3O C;  1BML C;  4XDC A;  2VZK D;  4RF0 A;  2BT6 A;  3GZN I;  4MGK E;  4C4V B;  3AE9 B;  2LVP A;  2JZP A;  4LNN A;  3AV8 A;  2NR2 A;  3GOE A;  2HDE A;  3PV1 A;  2KJH B;  2NTT A;  2MP2 A;  3AEA B;  2I38 A;  1ROE A;  1XO3 A;  1RFK A;  1SB3 C;  2Y5P A;  3DVG Y;  1I4R A;  2PIA A;  2KLG A;  3PHX B;  4RFB A;  5EE3 A;  4W9D A;  3R8B A;  1HZ6 A;  4HWI B;  4JIO U;  2Q5W D;  2WDV B;  2K8B A;  1E6E B;  3U4E G;  2JXX A;  3ZDM C;  3NZU A;  3AM9 A;  1UZX B;  3V62 A;  3I5J C;  4N6E B;  5BMG A;  2JT4 B;  4YSZ B;  1CZP A;  2K25 A;  4BBN C;  2BYF A;  3DCG A;  1GB1 A;  4DBG A;  4W9I A;  4KVG B;  4I6L B;  2PW9 A;  2ZNV C;  1D3Z A;  5DPW A;  1V2Y A;  2ON8 A;  4PS8 A;  2LGY A;  1IGD A;  2FCS A;  2NPT A;  4AOF A;  3LXF A;  3AEF B;  5BYR A;  1WI0 A;  3VUX A;  1MJD A;  2GLS A;  4REZ A;  4WJP A;  4K7W A;  4GB9 A;  2OOB B;  1PGX A;  1YQ4 B;  3W5U B;  1WMH B;  1WZ0 A;  1YJI A;  4Q2J A;  3SHQ A;  2VZK B;  5G2N A;  4NNJ B;  3PRE A;  1F52 A;  4WIP A;  2BTE A;  1TS2 A;  4ACF A;  2WQY B;  4LDT D;  3PHW B;  3AU4 A;  4ZYS A;  3NZ3 A;  4CHK A;  3VH3 B;  4HLE A;  4HCN B;  2Z0D B;  1JWA D;  5GXG B;  4L2Y A;  2DYO A;  2BYV E;  1WIA A;  4KIK A;  1QKZ A;  3QA8 A;  2Y5C A;  3PT2 B;  4NQK E;  3X0W A;  5J18 A;  4AS1 A;  1GOZ A;  5DCN A;  1QOA A;  2KMA A;  4HPM B;  2M17 A;  1T0Q C;  1HEZ E;  3VRA B;  4ZDV A;  2MRP A;  3NVW A;  3NHE B;  1WYG A;  3NG0 A;  3HM3 A;  1TZ1 A;  4MGI E;  2IO0 B;  2H88 B;  2CHZ A;  1TS3 A;  1JWM D;  1V1O A;  4MJS B;  4A90 A;  3JSV B;  2A5U A;  3FC4 A;  2CKH B;  2ZVN A;  1KLU D;  4S17 A;  1JQ4 A;  2K1F A;  4KDI C;  2WXG A;  2K9X A;  3KH0 A;  4HVB A;  2XK5 A;  1MG4 A;  3U2S C;  4B9K A;  3FIL A;  5CTR C;  4W9H A;  4O1N A;  4LJP B;  3VR9 B;  3ZW3 A;  2ZEQ A;  1YIW A;  4IM3 A;  1JW9 D;  2WU5 B;  2KFK A;  1J7C A;  2BPS A;  3AE3 B;  4RM9 A;  3FKY A;  3TUO A;  3I3T B;  4FA6 A;  1N5W A;  3V6E B;  1I7H A;  2WP9 B;  2WDT B;  3H7P B;  2WX1 A;  1CJE A;  5C1Z A;  2ZPN A;  3UF8 A;  4NQL B;  1XLO A;  4ASW C;  2V4L A;  4LDT B;  3ZTC A;  4L23 A;  2N7E A;  2N7D A;  4ZYN A;  1HXY D;  3U7Z A;  1CMX B;  2LEK A;  1FD6 A;  3EFC A;  2KOX A;  4I6N B;  4JGH B;  2WLB A;  2EEL A;  3T3N A;  2WHI A;  3QQ8 B;  4WWP A;  5DPS A;  1E8W A;  2WXQ A;  5GMV A;  1E8Z A;  2MHJ A;  2JYE A;  2K8C A;  2LRU A;  2N1V A;  3L10 B;  3KW5 B;  2W82 A;  4K7U A;  3IVF A;  5FR3 A;  5AUK A;  4XYC A;  3RN9 C;  2MBE A;  3LDZ E;  1R7S A;  2WXM A;  3PZ8 A;  1G6J A;  1TT5 B;  2KTR A;  4RGM A;  1K52 A;  1YQB A;  1STE A;  1JCK B;  2K8H A;  4NAM A;  2LWP A;  1NEK B;  2QHO A;  1KOT A;  2OED A;  3K9O B;  1ZUD 2;  1C9F A;  1R4N I;  1KLG D;  4JE3 B;  1V5O A;  5IO9 A;  1EWY C;  3VDZ A;  3RZW C;  2FE8 A;  4MH8 A;  2LGD A;  1UD7 A;  3PSE B;  4DXF A;  1SEB D;  1WXM A;  2WXP A;  4L1B A;  3U52 E;  2A4Z A;  2IGH A;  3RNA C;  1WX9 A;  3UIO B;  3T3O A;  1LXD A;  4GDK B;  2K6D B;  4IUM B;  3ZNI D;  4YTM B;  2DZK A;  1JRP A;  2BYT A;  3E9S A;  1WGR A;  2HJ1 A;  2PEA A;  2RPV A;  4MGZ E;  1WE6 A;  3EEC A;  2KMM A;  2RGF A;  4K1R B;  2RDB C;  3KUZ A;  4P1C C;  3DHG C;  3SDL C;  3RCZ A;  2INN E;  2IBI B;  5CHF A;  1YMH E;  2AQ2 B;  4KX6 B;  3TEX A;  4I6P A;  3PRM B;  1EF5 A;  5C3J B;  3GS2 A;  1U4A A;  1EU3 A;  3AE1 B;  5EE1 A;  3L17 A;  1WGK A;  1SJH D;  2KDM A;  3N30 A;  4BKG A;  3DHH C;  1WZ3 A;  1JWB D;  1FXI A;  1T5X D;  5J17 A;  2ZCB A;  1EF1 A;  2VH2 A;  2EKI A;  2N0S B;  1WE7 A;  2L52 A;  2N9P C;  2K0P A;  1QZE A;  2K5P A;  3W1Y A;  1HZ5 A;  1IBX B;  1D6E C;  4XWW A;  3H6N A;  2KWU B;  3HM6 X;  1TKY A;  4FJY A;  2RDG A;  2Y3A A;  2DWQ A;  2N9E B;  1SIJ A;  4M0W B;  4ANW A;  2KNB A;  3HUI A;  4RH6 A;  1IYF A;  1ACC A;  2WYQ A;  2J0J A;  3IFW B;  4IW0 A;  2ZW1 A;  3L16 A;  3L4P A;  4B6W A;  3I63 C;  4XC2 A;  3Q8F A;  3OLM D;  3AED B;  1SE4 A;  1UWM A;  1L6V A;  1GPX A;  2REX A;  1GAQ B;  2SEB D;  3TCA A;  3DHI C;  3O65 B;  3PZD A;  4EUT A;  1FNV A;  2WS3 B;  3NVY A;  3AMZ A;  3VVW B;  5KHO A;  1UH6 A;  3T9L A;  2N4F A;  3R2I A;  3EC8 A;  5E6P A;  1E7U A;  2G1E A;  3BII D;  3L54 A;  4KKI A;  2BBC A;  3VUW A;  4HRO A;  1S3S G;  3IG3 A;  3S2A A;  3H8H A;  1F9J A;  1TKE A;  2MBO A;  3H9D A;  2NVU I;  2PVO D;  4YXD B;  1C4C A;  2BW2 A;  2ICI A;  1P1A A;  4WJO A;  3SFE B;  3L08 A;  1OEY A;  4R3D A;  3AE4 B;  2C5L C;  2DAJ A;  2YEP F;  3ETR A;  4WAA A;  2B3A A;  4FUL A;  4KZ0 A;  2KDF B;  2JQR B;  3GP7 A;  2E3T A;  1UGJ A;  2MCN B;  2DNF A;  4FN2 A;  5JZE B;  2INP E;  4DQO C;  1T6B X;  1VZ8 A;  3JYU A;  2YEP B;  4XGA B;  2JPH A;  4LK0 M;  3VHT C;  2AQ1 B;  4M02 A;  1L2N A;  1XLP A;  3NZS A;  4II3 B;  2QJL A;  4G50 A;  1JWU D;  3K9P B;  2WDQ B;  4NJ6 A;  4LNO A;  1WR1 A;  4CYE A;  1AW7 A;  4JWS C;  1WR6 E;  1IUE A;  1D5Z C;  5D2M B;  2G9H D;  3J9C A;  4RF1 A;  3TSS A;  4LNI A;  1R4M I;  2WXR A;  3MHZ A;  3W9C B;  1A5R A;  4IWO A;  5AZH A;  2DEN B;  3P4R B;  4F7Z A;  4E74 A;  2PTL A;  2N1W A;  1VZ6 A;  2EKE C;  2IY1 B;  1DOX A;  2RSU A;  3PLV A;  4IDI A;  2GMI C;  2IY0 B;  3Q14 C;  1I4X A;  4ZRK A;  1OFF A;  1V81 A;  2LRW A;  1GC7 A;  3N1Y C;  3OWE B;  3ABV B;  1UF0 A;  3MC0 B;  4AJW A;  4WJN A;  2D10 A;  4HEA 1;  4AUQ C;  1F2R I;  4DXA B;  1EUV B;  2XNA C;  3ML8 A;  1FNW A;  2MP2 B;  2OJR A;  3VTW A;  4J6I A;  1JRU A;  1AYF A;  1J19 A;  3RYT A;  1TIF A;  3PLU A;  1WXS A;  3IAS 1;  1FCL A;  2W54 A;  3N20 C;  3AE5 B;  3BY4 B;  2KVR A;  3HK0 A;  3QWZ B;  4JQW C;  2KYW A;  5IN7 A;  1MVK A;  4FAD A;  3OJ3 A;  2L1A A;  1FPY A;  4WWM A;  3UIN B;  3SEB A;  2L05 A;  4HDO A;  4MSQ B;  4C7Z A;  4A20 A;  2KDE B;  5BYS A;  1PGA A;  2LHE A;  2DAF A;  2LD9 A;  3IBE A;  4W9L A;  1QOF A;  1E90 A;  3SFD B;  1C76 A;  4BKS A;  3A33 B;  2M56 B;  1N5X A;  1FRD A;  2KZR A;  2MBQ A;  2FCQ A;  2LVO A;  3AB5 A;  3DWM A;  5TSS A;  3ZIM A;  1VJK A;  3DBH I;  1V1P B;  2E6X A;  4KSL C;  3HVD A;  1FEH A;  2MW5 A;  3HVZ A;  4PS3 A;  1TKG A;  2JRI B;  4NAW B;  2V1Y A;  4ZRI A;  4C7Y A;  3BVM A;  1XQQ A;  4MT5 A;  2Z0E B;  3BK1 A;  1FXT B;  4X57 B;  2KAN A;  3A9J A;  2JYT A;  3KQ4 A;  2J4X A;  4IWQ A;  2HE7 A;  3PRP B;  4AJY B;  3UGB B;  3ENE A;  2WU2 B;  2KAC A;  4HPP A;  3GB1 A;  1D5X C;  2NMQ A;  1Z5S B;  3JW0 X;  1P7E A;  3QAR A;  3U30 A;  5JXV A;  1WY8 A;  3ALB A;  4KIK B;  3B9J A;  4WUR A;  3KUC B;  2LGS A;  2WXJ A;  3TMP B;  3RD2 A;  2I1K A;  3WA0 A;  4KZC A;  2IDY A;  5C2T B;  2Z59 B;  2B76 B;  2RR9 A;  2JZZ A;  4FBJ B;  5C23 A;  3RFZ B;  2KC1 A;  5T8I A;  4USA A;  2KQ4 X;  3V05 A;  5LXI B;  3V60 A;  2LHD A;  1XLQ A;  2WXO A;  2DZJ A;  1VZ7 A;  4GIV A;  4OZA A;  2KWC A;  1XEE A;  1GC6 A;  3RI7 C;  2MX2 A;  4C4V A;  3DVN U;  3QIJ A;  1K50 A;  1F2R C;  2PKO A;  3RNC C;  3ZRF A;  1C78 A;  3KWV A;  2IZV B;  3VRB B;  2CR5 A;  3GE3 C;  1WH3 A;  5D3I B;  2GBK A;  4AQ7 A;  1V97 A;  2LVQ A;  2XEW A;  4JL9 A;  2DLB A;  2MQJ A;  4LJO B;  1EU4 A;  1VRA B;  2XK5 B;  1J0G A;  4XE0 A;  2BB5 A;  4ZOH C;  4M01 A;  1WF9 A;  4ANX A;  4B0E A;  4XZ4 A;  1I4P A;  3AH7 A;  2KO3 A;  1PUT A;  1QOG A;  3VXW A;  3M62 B;  2FBW B;  4WAF A;  4P6V F;  3EA6 A;  3LJ3 A;  3C8Y A;  2J0K A;  3DVN V;  2HD5 B;  4K81 A;  3ZJU A;  5G55 A;  2GBJ A;  1V80 A;  3TIX A;  3QHT A;  1ZDX A;  3RZF A;  3Q3F A;  2R2Q A;  4NJC A;  2WXF A;  3DBR I;  3QAQ A;  1QQR A;  2KWV B;  4MEM A;  4HKZ E;  2DZI A;  4ZHP A;  1JWS D;  4BFR A;  4US8 A;  1RYJ A;  4BZA A;  2DYM A;  4P7I A;  3TL5 A;  2O6V D;  1LGR A;  3A1Q B;  1T3Q A;  2AL6 A;  2IO2 B;  4A3P A;  5TR5 A;  2WXN A;  5H8Y E;  3B2G A;  2PJH A;  1ENF A;  2X38 A;  1WMH A;  1KH0 A;  3RNF C;  1Q1O A;  2KJR A;  2MLB A;  1S1Q B;  2LGI A;  3W1S C;  1F77 A;  3UI3 A;  1E0Z A;  1WRD B;  2KTR B;  2GBR A;  2KXJ A;  2QIL A;  1DYQ A;  4NY0 A;  2H89 B;  5BMI A;  2L8J A;  2M19 A;  1RLF A;  5E6O A;  4IKG A;  3IAM 1;  4ANU A;  4RM8 A;  4P1B C;  1SE2 A;  1ZGU B;  4ITK A;  3PO0 A;  1SF0 A;  2EMT A;  1Q10 A;  2YVC A;  4RGO S;  3ONS A;  1LM8 B;  1KTK A;  2WWZ A;  3NS8 A;  1K51 A;  1OQQ A;  3E56 A;  4HJG E;  3BVZ A;  1DGJ A;  1L5P A;  2WDR B;  4B95 A;  1XCQ L;  4NZL B;  2GB1 A;  5FK9 C;  2J52 A;  5D7G A;  2WX0 A;  1RFA A;  3CIR B;  2LZ6 A;  1RRB A;  2CHX A;  2FAZ A;  1E7V A;  4MM3 A;  3APC A;  3KLS X;  3RMK C;  3M3J A;  1B1Z A;  1FM0 D;  2O2V B;  4PYZ A;  2K39 A;  1WXA A;  5L95 C;  2MBB B;  3AE8 B;  2BS4 B;  3IT4 B;  3NRZ A;  3SU8 X;  4GDL A;  3PVL A;  2QSD A;  1YJ1 A;  4DHJ D;  2O6V B;  3NY5 A;  3B1L X;  3AEC B;  2JSV X;  5CHW A;  1KRH A;  4JPS A;  4OHJ A;  5KHQ A;  3NJT A;  2KK8 A;  5D94 A;  4ZRP A;  5G5G A;  3MTN B;  3IXS A;  2KC2 A;  4OVZ A;  5J2R A;  3X23 A;  2L83 A;  2RMM A;  4YT0 B;  4RMA A;  5CX3 A;  5BMH A;  4TUU A;  2AL3 A;  2BWE S;  2W9N A;  1P3Q U;  3RNG C;  2LJI A;  5LXH A;  3QCA A;  2N9X A;  3QK0 A;  4FXC A;  1M4V A;  3ZYY X;  3M63 B;  5EE9 A;  4GGQ A;  4DHZ B;  1MHH E;  1FRR A;  1NBF C;  4RCO A;  3MC9 A;  3I9V 1;  4KGS A;  4W9E A;  4DDG D;  3AN1 A;  4HK2 A;  1NI2 A;  4P16 A;  2ASQ A;  2UYZ B;  3RNE C;  4E3C A;  5CHV C;  2W3R A;  3CST A;  3N1X C;  3DPD A;  1H4R A;  2L0F A;  1MI0 A;  2FUH B;  2ZPY A;  4WWO A;  2MJE A;  2V3N A;  2NTS A;  1C3T A;  2ZCC A;  4K3C A;  1E8Y A;  1EM7 A;  5IAA C;  1MFW A;  1EWC A;  1L7Y A;  4GLS C;  3ZXR A;  2ZNV B;  3MC8 A;  3VTU A;  3ECI A;  1QOB A;  5IA7 A;  2DHZ A;  4DWF A;  1V49 A;  4MH0 E;  1YJJ A;  3ZKJ C;  3TEY A;  4DHJ B;  4HRS A;  3Q8E A;  1HTO A;  4US9 A;  3P4P B;  1ZPS A;  3MP9 A;  5IP4 D;  3SR6 A;  1ZKH A;  1KFY B;  4AP4 C;  1XLN A;  2GBN A;  3VAW A;  1UUP A;  4URK A;  4JX1 C;  2N7J A;  2V3S A;  1X1M A;  1V8C A;  3VTV A;  3W2D A;  2YLM A;  4GXB A;  4II2 B;  1SSN A;  5MPO A;  1TTN A;  1K53 A;  5E6J A;  4E71 A;  4YL8 A;  2K22 A;  1GUA B;  1WRI A;  4ZRJ A;  1C77 A;  4BKS D;  1FCC C;  3TBL D;  5IKC M;  2BS3 B;  2V9H A;  3DBL B;  3RUI B;  1N63 A;  3DBS A;  2KQS A;  1SJE D;  1D4B A;  3N9Y C;  1FFU A;  3VQI A;  3Q3N C;  4TV3 A;  2HTH A;  3P63 A;  4C56 C;  4EZL A;  2LUE A;  4M0W A;  1Y56 A;  3GZN B;  2BWF A;  3DVG X;  4OZC A;  5HKH A;  1QLB B;  3EHV A;  1L4Z B;  2C60 A;  1OTR B;  2QCZ A;  3Q3M C;  4DDI D;  2LI5 A;  2WXK A;  3A9K B;  1ZP0 B;  4YSY B;  1HE8 A;  2GRI A;  4IOI E;  2KJ6 A;  3LB8 C;  4M8N A;  1P9D U;  2LUM A;  3MHS D;  2NS5 A;  4JWU C;  4XWT A;  1MG8 A;  4OVV A;  4ZRQ A;  3SD5 A;  2AQ3 B;  1RWS A;  3HIZ A;  1I42 A;  1ZOY B;  2GI9 A;  4RGT A;  1RM6 C;  2KX3 A;  3AI5 A;  2EMS A;  2LGX A;  3BIN A;  1UBQ A;  1T0S C;  2ZVO A;  1M94 A;  3RNB C;  4DHZ E;  3D32 A;  4EKU A;  1WGG A;  4HKQ A;  5AZG A;  3P2B A;  2KFJ A;  2D3A A;  4WWN A;  1ZXH A;  2OHF A;  1GB4 A;  4KGR A;  2QIE B;  1E7P B;  3R7Q A;  1FO4 A;  2MEK A;  2KHW B;  2MJ3 A;  3N3K B;  2GBM A;  2HJ8 A;  1IGC A;  2N9L A;  2D3B A;  1PGB A;  1N62 A;  4M00 A;  2L32 A;  2KDI A;  3ZVV A;  2QMT A;  3P1M A;  3ZQ4 A;  3AEE B;  4BOS C;  3W1S A;  1CK1 A;  1L6U A;  3P4S B;  4HJK A;  3WIM A;  2LMC A;  1XCT L;  4WH4 A;  3NOB A;  3URY A;  4YSX B;  2JWU A;  3C19 A;  2FNJ B;  1OGW A;  3Q8A A;  1J7B A;  2CS4 A;  4BVU C;  1TY2 A;  2J0M A;  4PK1 A;  1BT0 A;  3CF6 E;  3A4R A;  5BO4 B;  5LNK 1;  5JH5 C;  1EO6 A;  3TJP A;  2BS2 B;  4LNF A;  4EOY A;  5H92 C;  3ZNZ B;  4WQO B;  3C0R B;  1BUI C;  4GN1 A;  5D6J B;  4M8M A;  4EE2 A;  1FNU A;  2J53 A;  2CU1 A;  4N59 A;  1P0R A;  1V6E A;  3DBR B;  4RGN A;  4LCD E;  3WAN A;  3ML9 A;  4WJQ A;  2KKC A;  1BXT A;  2NPT B;  1UEL A;  1J7A A;  1C79 A;  2R61 A;  4DK5 A;  1XXG A;  2M8S A;  1I4G A;  1N6Z A;  2V4I B;  4XDD A;  3VFK A;  3L0W B;  3WAP A;  1FXA A;  3O13 A;  4C00 A;  2LJ5 A;  1UNS A;  4A9A A;  4KV2 A;  3I57 A;  1HTQ A;  1WYW B;  2C7M B;  4FHK A;  1ISN A;  4F1S A;  2KDB A;  1WX8 A;  3APF A;  1B9R A;  1Z2M A;  2D5G A;  2IND C;  4GOC A;  3PTF C;  4JLC A;  2FIF A;  1XD3 B;  4GSW A;  3H1U A;  2BB6 A;  1DOY A;  1H8C A;  2PE9 A;  4YTP B;  1NEN B;  2IGG A;  4TKN A;  2WXH A;  4K3B A;  3ZDT A;  1WJN A;  2BGF A;  3KUD B;  2JX5 A;  3B0A A;  4A3O A;  2N9K A;  3RPF C;  1TS4 A;  4IM0 A;  2BKF A;  2BYE A;  4KGT A;  3V3X A;  3NVZ A;  4G3X B;  2PE6 B;  2W3S A;  1I4H A;  4TSS A;  4W9G A;  4WQM A;  3JVZ X;  4CO7 A;  2JY6 A;  1WJ4 A;  3NUH B;  1ZW7 A;  4MEL A;  4FHJ A;  5AEK B;  3UQB A;  1CQV A;  1V1P A;  4FJZ A;  2M1M A;  5D3D A;  4TQ0 A;  2M0X A;  4NAW A;  1FIQ A;  2L00 B;  3EFU A;  1WJ6 A;  1P7F A;  3CWI A;  2MJD A;  2ZW0 A;  1WJU A;  1YNT E;  2JRH A;  2KLC A;  2BQQ A;  4ICV A;  3IHP C;  3FIL B;  1SIF A;  3TEZ A;  1HA5 A;  4EZK A;  4AWJ A;  2I1J A;  2V0G A;  3GE8 C;  2JF5 A;  2M4N A;  1R4N B;  2KFK B;  4ARC A;  2KAJ A;  4K7S A;  2GOW A;  4W9F A;  2C9W B;  1MPE A;  3W5V B; 
#chains in the Genus database with same CATH homology
 2KC2 A;  2AWT A;  3H9D A;  2NVU I;  3MJW A;  2D3G A;  2MWS B;  2XBB C;  3X23 A;  3ZUN A;  5J2R A;  4RMA A;  2LXC A;  5CX3 A;  4TUU A;  3ZNG C;  2AL3 A;  2BWE S;  3APD A;  1P1A A;  3VUY A;  2W9N A;  1WGH A;  4WJO A;  2KTF A;  1P3Q U;  5E6N A;  3U8Z A;  2NCN A;  3L08 A;  1OEY A;  2C5L C;  2DAJ A;  2NBV B;  1VD2 A;  4WAA A;  3GZN I;  4MGK E;  5LXH A;  2B3A A;  1OQY A;  3QCA A;  4IG7 B;  2N9X A;  3QK0 A;  2LVP A;  4FUL A;  4KZ0 A;  2DZM A;  2IO1 B;  2KDF B;  2NR2 A;  3GOE A;  3ZO5 B;  3M63 B;  4GGQ A;  3PV1 A;  2KJH B;  2MCN B;  4DHZ B;  4FN2 A;  4ICU A;  1NBF C;  5JZE B;  2MP2 A;  3JYU A;  4W9E A;  4DDG D;  2D07 B;  4HK2 A;  1NI2 A;  2JPH A;  2ASQ A;  3VHT C;  2UYZ B;  4E3C A;  3DVG Y;  4IC7 B;  5CHV C;  1L2N A;  1Y8R C;  3NZS A;  2KLG A;  3PHX B;  3CST A;  3KVF B;  4II3 B;  3UQA A;  3DPD A;  1H4R A;  4G50 A;  4GDL B;  4W9D A;  3K9P B;  2L0F A;  4HWI B;  1OEY J;  4JIO U;  4NJ6 A;  4W9C A;  1WR1 A;  4CYE A;  2KMC A;  1WR6 E;  2FUH B;  2ZPY A;  4WWO A;  2K8B A;  5D2M B;  2JXX A;  3ZDM C;  3NZU A;  2G4S A;  1C3T A;  1Q5W B;  2ZCC A;  5JHA A;  1E8Y A;  1UZX B;  2AYO B;  5IAA C;  3V62 A;  1R4M I;  2JT4 B;  1L7Y A;  4BBN C;  2K25 A;  1A5R A;  2BYF A;  1UGM A;  4IWO A;  5AZH A;  2DEN B;  2DX5 B;  4F7Z A;  1WM3 A;  4E74 A;  4NJ7 A;  3DCG A;  2ZNV B;  4DBG A;  3VTU A;  4W9I A;  2N1W A;  3ECI A;  4KVG B;  2KX0 A;  4I6L B;  5IA7 A;  3QX1 A;  2EKE C;  2DHZ A;  2IY1 B;  1UBI A;  2ZNV C;  4DWF A;  2RSU A;  3PLV A;  1D3Z A;  1V49 A;  4MH0 E;  2GMI C;  2IY0 B;  2L0T A;  1V2Y A;  4ZRK A;  5DPW A;  3ZKJ C;  3L13 A;  4DHJ B;  4PS8 A;  1V81 A;  2LGY A;  2LRW A;  4EZJ A;  1GC7 A;  5DPR A;  2FCS A;  4MJS A;  2NPT A;  4AOF A;  3JSV A;  2RD0 A;  4AJW A;  4WJN A;  1V9J A;  2D10 A;  1WI0 A;  1ZKH A;  4AUQ C;  3VUX A;  4AP4 C;  3VFK A;  4DXA B;  4WJP A;  3VAW A;  2GBN A;  3T8M A;  4K7W A;  4URK A;  1EUV B;  4GB9 A;  2V3S A;  1X1M A;  2OOB B;  3A1Q A;  1T0Y A;  3WAM A;  1LFD A;  3VTV A;  2YLM A;  3KYD D;  4GXB A;  4II2 B;  3ML8 A;  1P98 A;  1WMH B;  1WZ0 A;  2MP2 B;  1TTN A;  2OJR A;  3VTW A;  4E71 A;  4J6I A;  4YL8 A;  2KQ7 A;  1GUA B;  4ZRJ A;  3SHQ A;  5G2N A;  1JRU A;  1J19 A;  4NNJ B;  3RYT A;  3PRE A;  2FCM A;  4G0N B;  3PLU A;  1WM2 A;  4BKS D;  1WXS A;  3TBL D;  4LDT D;  2AEH A;  3PHW B;  3AU4 A;  3RUI B;  2JUO A;  4OVU A;  3BY4 B;  4CHK A;  3DBS A;  2KVR A;  3HK0 A;  5AZF A;  4F8C B;  3QWZ B;  4JQW C;  3VH3 B;  4GU2 A;  1AAR A;  4HLE A;  2KQS A;  4HCN B;  4NPN A;  4FAD A;  3OJ3 A;  2Z0D B;  5LLI A;  2DYO A;  2BYV E;  1WIA A;  3UIN B;  3VQI A;  4KIK A;  2L05 A;  3QA8 A;  4HDO A;  4MSQ B;  2C7H A;  4A20 A;  2KDE B;  4BKT A;  4TV3 A;  1GG3 A;  2HTH A;  3PT2 B;  4NQK E;  3X0W A;  5EDS A;  5J18 A;  2DAF A;  2LD9 A;  3H7P A;  3IBE A;  1E8X A;  5DCN A;  2JVC A;  4W9L A;  3ZTD A;  2KMA A;  4HPM B;  1E90 A;  4HXD A;  2M17 A;  4BKS A;  4EZL A;  3A33 B;  4ZDV A;  1RAX A;  2LUE A;  3CMM B;  2KZR A;  2MBQ A;  2MRP A;  2FCQ A;  2LVO A;  3NHE B;  2BWF A;  3DVG X;  3UIP B;  3ZIM A;  3HM3 A;  3DBH I;  4ANV A;  1TZ1 A;  4MGI E;  5HKH A;  4KSL C;  3EHV A;  2IO0 B;  2MW5 A;  3KYC D;  2CHZ A;  4PS3 A;  2JRI B;  2C60 A;  2C7N B;  4MJS B;  1OTR B;  4NAW B;  3U7D A;  4DDI D;  2V1Y A;  2A5U A;  3JSV B;  4ZRI A;  4BOZ B;  2LI5 A;  3ZRC A;  1NDD A;  2CKH B;  2ZVN A;  4HPL B;  1C1Y B;  5JHB A;  3A9K B;  1HE8 A;  1XQQ A;  2K1F A;  4BBN F;  2KJ6 A;  3RUL A;  4KDI C;  2G45 B;  4W9J A;  2Z0E B;  4M8N A;  1P9D U;  3AUL A;  1FXT B;  1IPG A;  3MHS D;  3R66 C;  2NS5 A;  3KH0 A;  2FID A;  2KAN A;  3A9J A;  4X57 B;  2BF8 B;  4HVB A;  2XK5 A;  1MG8 A;  4OVV A;  3SD5 A;  4IWQ A;  4B9K A;  2O2V A;  5CTR C;  2HE7 A;  4W9H A;  3PRP B;  1YX6 B;  2NBU A;  4AJY B;  4LJP B;  3UGB B;  3ENE A;  2IO3 B;  3HIZ A;  2D2Q A;  3ZW3 A;  2LAS A;  3ZNH B;  2ZEQ A;  1YIW A;  1I42 A;  4IM3 A;  1Z5S B;  2KX3 A;  2O6V A;  2J7Q B;  3AI5 A;  3JW0 X;  2KFK A;  2EMS A;  3QAR A;  3U30 A;  2BPS A;  2LGX A;  3BIN A;  1WY8 A;  1UBQ A;  3ALB A;  4RM9 A;  4FLH A;  4KIK B;  2ZVO A;  1M94 A;  3KUC B;  3I3T B;  4DHZ E;  4FA6 A;  3D32 A;  3RD2 A;  3TMP B;  1WGG A;  2I1K A;  3V6E B;  3WA0 A;  4EKU A;  2WDT B;  3H7P B;  2WX1 A;  3P2B A;  5AZG A;  2KFJ A;  4KZC A;  2VRR B;  5C1Z A;  4WWN A;  2Z59 B;  2ZPN A;  3UF8 A;  2RR9 A;  2JZZ A;  4NQL B;  4FBJ B;  4GDK A;  3PRZ A;  5C23 A;  2KC1 A;  4ASW C;  2V4L A;  4LDT B;  3R7Q A;  4IWP A;  3ZTC A;  5LXI B;  3V60 A;  2N7E A;  2N7D A;  3DOW A;  4ZYN A;  2R2O A;  2KN5 A;  2D11 A;  2KHW B;  1CMX B;  3N3K B;  2GBM A;  2HJ8 A;  2PPH A;  2KOX A;  4I6N B;  4JGH B;  1WFY A;  3WAL A;  2DZJ A;  4MSM B;  4GIV A;  2KWC A;  3QJZ A;  1GC6 A;  2KDI A;  3QQ8 B;  5DPS A;  1LQB A;  4WWP A;  1E8W A;  5GMV A;  2K6Q A;  2MX2 A;  3ZVV A;  3DVN U;  4N9F 4;  1E8Z A;  3QIJ A;  2K8C A;  3ZRF A;  2LRU A;  2IZV B;  1Q0W B;  2N1V A;  2CR5 A;  3AU5 A;  3KW5 B;  3L10 B;  4MGY E;  1WH3 A;  4K7U A;  2GBK A;  2LVQ A;  4BOS C;  2XEW A;  2MSE D;  3IVF A;  3W1S A;  4JL9 A;  2MBE A;  4HJK A;  1SGH A;  3LDZ E;  3WIM A;  2L76 A;  2MQJ A;  3NOB A;  4LJO B;  1G6J A;  2XK5 B;  2FNJ B;  1J0G A;  1OGW A;  2KTR A;  3PS6 A;  1YQB A;  2CS4 A;  1WF9 A;  4ANX A;  2J0M A;  4BVU C;  1BT0 A;  2L7R A;  4XZ4 A;  3CF6 E;  2KO3 A;  3A4R A;  4IM2 A;  2FCN A;  5BO4 B;  3VXW A;  3M62 B;  2K8H A;  2LWP A;  2QHO A;  5JH5 C;  1KOT A;  2L3Z A;  1EO6 A;  3K9O B;  3TJP A;  3DQV A;  1R4N I;  3LJ3 A;  3WAO A;  4EFO A;  1V5O A;  2J0K A;  3DVN V;  3VDZ A;  2HD5 B;  3B08 A;  1V5T A;  4EOY A;  4K81 A;  3RZW C;  1IP9 A;  3ZNZ B;  1KM7 A;  5G55 A;  2GBJ A;  1V80 A;  2LGD A;  1UD7 A;  3C0R B;  4GN1 A;  4WQO B;  5D6J B;  3PSE B;  1TBE A;  3A4S C;  3QHT A;  4KDL B;  4M8M A;  3V61 A;  1WXM A;  2Y5B B;  3TIX A;  3RZF A;  2CU1 A;  3Q3F A;  2R2Q A;  4EEW A;  2A4Z A;  1YD8 U;  1WX9 A;  3UIO B;  1LXD A;  1P0R A;  4GDK B;  1V6E A;  4MDK E;  3DBR I;  2K6D B;  3QAQ A;  4IUM B;  3OJ4 B;  3ZNI D;  2DZK A;  4LCD E;  2KWV B;  4MEM A;  3WAN A;  3ML9 A;  4WJQ A;  2KKC A;  3QC8 B;  2NPT B;  1UEL A;  2DZI A;  1WGR A;  4PS7 A;  2PEA A;  4BFR A;  4MGZ E;  4DK5 A;  2M8S A;  1WE6 A;  3EEC A;  1E5W A;  2G4D B;  4FJV B;  2RGF A;  2G3Q B;  3KUZ A;  3L0W B;  4K1R B;  2DYM A;  1K8R B;  3PPA A;  2O6V D;  4P7I A;  3TL5 A;  1WGD A;  3WAP A;  1I35 A;  3SDL C;  3ZLZ A;  2LJ5 A;  1KLV A;  3A1Q B;  2CHW A;  1V86 A;  4TQ1 A;  3RCZ A;  2AL6 A;  2IBI B;  2IO2 B;  3AXC A;  4KV2 A;  4A3P A;  5CHF A;  4I6P A;  5TR5 A;  1WYW B;  2UWQ A;  2C7M B;  3PRM B;  1EF5 A;  4FHK A;  1WXV A;  1U4A A;  1ISN A;  2PJH A;  4F1S A;  2KDB A;  1XT9 B;  2JWZ A;  3L17 A;  1WMH A;  1KJT A;  4BKG A;  1Q1O A;  3N30 A;  2KJR A;  1VCB A;  2MLB A;  1S1Q B;  3RT3 B;  1WZ3 A;  3DDC B;  3W1S C;  1J8C A;  1WX8 A;  3APF A;  1Z2M A;  2RPQ A;  1WRD B;  2LXA A;  2KTR B;  1PQS A;  3PTF C;  4GOC A;  2MA9 B;  2GBR A;  2ZJD A;  4JLC A;  5J17 A;  2ZCB A;  1GJZ A;  1EF1 A;  2FIF A;  1WX7 A;  3CSF A;  1WE7 A;  1XD3 B;  2KXJ A;  4GSW A;  2N9P C;  4PYU A;  1QZE A;  4W9K A;  2JZ3 B;  3H1U A;  4NY0 A;  3W1Y A;  1H8C A;  2PE9 A;  2L8J A;  4TKN A;  1RLF A;  5E6O A;  3V6C B;  2IYD B;  3H6N A;  2KWU B;  3HM6 X;  4ANU A;  4FJY A;  4RM8 A;  5L83 A;  2BKR B;  3ZDT A;  1WJN A;  3HHM A;  1ZGU B;  2BGF A;  2N9E B;  3KUD B;  3B0A A;  2EMT A;  4M0W B;  4A3O A;  2DYB A;  2YVC A;  4ANW A;  5FR6 A;  2KNB A;  4IM0 A;  3OAW A;  2BKF A;  2BYE A;  3R3M A;  3ONS A;  1LM8 B;  4G3X B;  1IYF A;  4HCP B;  2PE6 B;  2WYQ A;  4W9G A;  2J0J A;  2WWZ A;  3JVZ X;  4CO7 A;  3IFW B;  3NS8 A;  4IW0 A;  3L16 A;  2JY6 A;  1WJ4 A;  1ZW7 A;  4MEL A;  4B6W A;  4FHJ A;  1WGY A;  5AEK B;  3UQB A;  4FJZ A;  2MBH A;  1GNU A;  1SE9 A;  3M95 A;  4B95 A;  2M1M A;  5D7G A;  2WX0 A;  4TQ0 A;  2M0X A;  1RFA A;  4NAW A;  3VH4 B;  2L00 B;  4GMV A;  2LZ6 A;  3EFU A;  1RRB A;  2CHX A;  1WJ6 A;  3OLM D;  4XC2 A;  2FAZ A;  3A9K A;  1E7V A;  4MM3 A;  1WJU A;  2KLC A;  2JRH A;  3A9J B;  3PGE A;  2REX A;  4ICV A;  3APC A;  3IHP C;  3TCA A;  3M3J A;  1YX5 B;  1SIF A;  2O2V B;  3O65 B;  3PZD A;  4G11 A;  4PYZ A;  2K39 A;  2I1J A;  4XX5 A;  4AWJ A;  1WXA A;  4EUT A;  4EZK A;  5L95 C;  2MBB B;  2NBW B;  3VVW B;  1TGZ B;  3SU8 X;  4GDL A;  5KHO A;  3Q3J A;  1UH6 A;  3PVL A;  5DPT A;  3T9L A;  1YJ1 A;  2JF5 A;  2N4F A;  2ZZP B;  4DHJ D;  2M4N A;  2O6V B;  3EC8 A;  2KD0 A;  5E6P A;  1E7U A;  2KFK B;  3B1L X;  3DBL I;  3NY5 A;  4KSK C;  5CHW A;  4K7S A;  3L54 A;  5KHQ A;  3R7R A;  2GOW A;  4W9F A;  3H7S A;  2C9W B;  3VUW A;  4HDQ A;  1S3S G;  3IG3 A;  2KK8 A;  3N32 A;  5D94 A;  3S2A A;  1F9J A;  3MTN B;  2MBO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...