3ECIA

Microtubule-associated protein 1 light chain 3 alpha isoform a (map1alc3)
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
112
structure length
112
Chain Sequence
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELVKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Microtubule-associated protein 1 light chain 3 alpha
publication title Human Autophagy-Related Protein LC3 A
rcsb
source organism Homo sapiens
molecule tags Apoptosis
total genus 32
structure length 112
sequence length 112
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02991 Atg8 Autophagy protein Atg8 ubiquitin like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 3eciA00
4G11A 2DZMA 2JZ3B 2UWQA 1WH3A 5IAAC 1WE6A 1Q5WB 4EZKA 3QJZA 1V80A 2K1FA 2DENB 2MBQA 1S1QB 2N7EA 2DZIA 2K8BA 2N9XA 2MRPA 4GIVA 3UF8A 2HTHA 3OAWA 2O6VA 2D11A 3W1SA 3VUXA 2JUOA 2KX3A 2UYZB 1TGZB 2DAFA 3L54A 1C3TA 3ZNHB 2MBBB 4HJKA 1E8WA 1M94A 1XT9B 1V49A 1WJNA 1V5TA 3PHXB 3KVFB 3ZKJC 2FIDA 3P2BA 3ZIMA 2BYEA 4CYEA 2XEWA 3B0AA 4DDID 4I6NB 4MSQB 2KKCA 5KHOA 4ANUA 5DPWA 4TQ1A 2BKRB 3TJPA 4DHZB 2CU1A 4BBNC 4II2B 4A3OA 4AJWA 3EC8A 5C1ZA 4PS3A 4XZ4A 1T0YA 2KQ7A 2ZZPB 1WGDA 3EHVA 2NCNA 5DPTA 2CR5A 4MH0E 2L8JA 3C0RB 4KIKA 3WA0A 1RRBA 2FCSA 2L3ZA 2N1VA 1WI0A 3NOBA 2PE9A 2KWCA 2CHXA 3NZSA 4W9EA 2HJ8A 1GUAB 3SDLC 4K81A 5IA7A 2BYVE 4MGKE 2KVRA 2ZVNA 1J8CA 2R2OA 2PE6B 4DBGA 2KX0A 4NJ6A 1WYWB 5FR6A 4GXBA 1GNUA 1WJUA 4DHJB 4K1RB 4M8NA 5HKHA 4LCDE 4ASWC 1R4MI 4F8CB 3PVLA 1E5WA 4MSMB 1KM7A 2LRUA 3A9KB 4ICUA 3RZFA 2KDFB 1XQQA 2NBUA 4GDKB 3PZDA 4PS8A 3U7DA 5LXHA 1ZGUB 4G0NB 4E3CA 2M8SA 4NAWB 2KC1A 5E6PA 4B6WA 2KTFA 4GSWA 3PREA 2LUEA 3ZLZA 1E7VA 3AI5A 3M63B 2IY0B 3H6NA 4KZCA 3BINA 2NBVB 4WWPA 3JSVB 4PYZA 3RT3B 1P1AA 2OOBB 5LLIA 1H8CA 4MEMA 2I1JA 2FNJB 4DWFA 3DDCB 2Y5BB 5GMVA 1U4AA 1WM3A 4IG7B 4BKGA 5JH5C 5J2RA 2ZJDA 2KWUB 2JVCA 4HVBA 1WIAA 4ANVA 1WM2A 3PRPB 4WJNA 4HCNB 3S2AA 4K7UA 3APFA 2M4NA 3BY4B 1X1MA 3HM3A 3L13A 4WQOB 2LGYA 3VVWB 1YIWA 4FBJB 5L83A 4A20A 1TTNA 1J19A 3SHQA 2LVOA 4FN2A 2GBJA 3QWZB 3PLVA 4HCPB 4I6PA 2M0XA 4W9FA 3ZRFA 2KNBA 3IFWB 2J7QB 3Q3FA 1PQSA 4BKTA 2JXXA 2J0JA 3ONSA 4IW0A 1R4NI 3MJWA 2KTRB 2YLMA 4EZJA 4G3XB 1F9JA 1UGMA 1LXDA 2MWSB 3PT2B 3AULA 3LJ3A 1Q0WB 2LVQA 3PGEA 3APCA 3ZUNA 2FCQA 1OGWA 2JF5A 3L17A 5J17A 2G4SA 3IVFA 5AZGA 2K6QA 2AWTA 1LFDA 2AL6A 4FADA 2V3SA 2JRIB 3M3JA 4EOYA 3KUCB 2C7NB 5KHQA 2BWFA 2W9NA 3R7RA 1E8XA 1G6JA 1HE8A 4F7ZA 3VTWA 4AOFA 3DBHI 2IY1B 1IP9A 4MJSA 1V86A 4GOCA 1WX8A 3V6EB 1I35A 4RM9A 2KK8A 2KN5A 4F1SA 2HD5B 2L00B 3RD2A 4P7IA 1P0RA 1YJ1A 1E7UA 4BOZB 2C7HA 3PSEB 2KXJA 1P3QU 1TBEA 1J0GA 1WZ0A 3VXWA 2DHZA 3UQAA 2O2VA 4IM0A 2L05A 1L2NA 1LQBA 2DZKA 2J0MA 3A9KA 4W9LA 2FIFA 2KDEB 2LRWA 5BO4B 4NAWA 4NJ7A 3QHTA 2KFKB 2M17A 5EDSA 3X23A 1RAXA 2DX5B 3ML9A 3R3MA 1UBQA 2AYOB 2KHWB 3RYTA 4M8MA 1WR1A 1D3ZA 2K8CA 3ZDMC 2MCNB 3U8ZA 4BFRA 5D6JB 2CHWA 1K8RB 1P9DU 2FUHB 3K9PB 3RULA 2L0FA 3KW5B 4MELA 2K25A 5JHBA 4YL8A 2KJRA 2KO3A 2KFJA 3ML8A 3K9OB 2LGDA 2FAZA 3AXCA 4EKUA 4LDTB 3L16A 4HDQA 3VTVA 4W9CA 3QA8A 4WJQA 2XK5A 2BF8B 1V9JA 1Y8RC 3DCGA 2BYFA 5TR5A 1Z5SB 2Z0EB 3KYCD 4W9IA 2G45B 4WWOA 5C23A 3R66C 4OVUA 3ZNGC 4ANWA 3GZNI 2D3GA 4JLCA 2HE7A 4E74A 5D2MB 1GC7A 2PEAA 2DYMA 2MBHA 2KZRA 2BGFA 2KTRA 3KYDD 4N9F4 3OJ3A 3VTUA 2DZJA 3IHPC 1TZ1A 3QAQA 4HK2A 4DK5A 3HIZA 1UBIA 2A5UA 2KMAA 3QQ8B 3ZRCA 4HWIB 4AP4C 1YX6B 4W9DA 1WMHB 3SD5A 1WXSA 2KQSA 1QZEA 2D07B 3LDZE 2AEHA 1V5OA 3A9JB 2KDBA 3JYUA 4XC2A 1WX7A 2ZEQA 1E90A 2LI5A 2O6VB 2C5LC 5DPRA 2IO3B 3B08A 4GU2A 2QHOA 4OVVA 4KDIC 2AL3A 4EZLA 3O65B 4DHJD 2KDIA 3OJ4B 4GB9A 1WXMA 4EEWA 1WZ3A 1NI2A 1Q1OA 1KOTA 3RZWC 1WJ4A 2LGXA 5JZEB 4JL9A 2N1WA 1MG8A 1IPGA 3H9DA 2R2QA 2G3QB 4MGIE 3SU8X 3ZO5B 4LJOB 4FLHA 4B9KA 4XX5A 4ZYNA 3I3TB 4ZDVA 2XBBC 4NNJB 1YQBA 1LM8B 2L7RA 2GBRA 3VUWA 3ECIA 1NDDA 2KLCA 1FXTB 3AU4A 2LVPA 3KUDB 3NS8A 3N30A 4WJOA 3DVNU 2JWZA 3NY5A 4PYUA 2WWZA 4B95A 4IC7B 1ISNA 3IG3A 4K7WA 1P98A 4KV2A 1WR6E 3UIOB 1WJ6A 2MA9B 3DPDA 2NVUI 5AZFA 4KSKC 4BVUC 3D32A 4RM8A 2GOWA 1WX9A 3DVNV 3R7QA 2JPHA 3A1QB 3VAWA 4W9GA 1EUVB 1E8YA 1UH6A 2ZPYA 4WAAA 3QCAA 1V81A 4BKSA 4A3PA 1VCBA 2CS4A 3KUZA 3DQVA 4IWOA 3ZTCA 5CHWA 2LXCA 3WANA 4W9JA 2KC2A 1IYFA 1WGGA 2LASA 2DAJA 4ZRIA 3VQIA 3VH4B 1C1YB 1WF9A 2JRHA 2GBMA 2RGFA 4KVGB 3N3KB 1GC6A 2RPQA 4MDKE 4X57B 4AJYB 2L76A 2NBWB 4ZRKA 3DBRI 3WIMA 3A33B 2VRRB 2MX2A 3W1YA 4HXDA 4FJVB 3ZDTA 4II3B 2K8HA 2MP2B 4GDKA 1A5RA 2RSUA 3CSTA 3M62B 3VHTC 1WXVA 3V61A 2YVCA 3EFUA 3U30A 3VFKA 5G55A 4MGYE 4FULA 1WMHA 4RMAA 2FCNA 2A4ZA 2WX0A 3DVGY 3QARA 4EUTA 2DYBA 2IYDB 3GOEA 4FJZA 3A9JA 2LWPA 3JVZX 3L08A 1SE9A 4BOSC 3PRZA 3JSVA 2LJ5A 4HPLB 3CF6E 3UINB 5AEKB 3ALBA 2LXAA 3WALA 1E8ZA 3A4SC 2CKHB 4W9HA 3UGBB 5L95C 2KLGA 2ASQA 4IUMB 3B1LX 4GN1A 3X0WA 3CSFA 3PS6A 3DOWA 4IM3A 3UQBA 5CHVC 1WGHA 1NBFC 3IBEA 4FHJA 2PJHA 2WDTB 5CX3A 4HDOA 4G50A 4WJPA 2MBOA 4FA6A 2NR2A 2JT4B 3JW0X 5J18A 2NPTB 3A4RA 3PRMB 3HK0A 4FJYA 2MW5A 2GMIC 3APDA 3PV1A 1CMXB 1GJZA 3OLMD 2JY6A 2KMCA 3NHEB 3NZUA 1KLVA 3W1SC 2N9PC 3V60A 2MBEA 4K7SA 2N9EB 3ZNID 3H7PB 3V6CB 5CHFA 4IWPA 2WX1A 1WGRA 2C7MB 4GDLB 2B3AA 3HHMA 3HM6X 3H1UA 3DBLI 1JRUA 4MJSB 4KDLB 3VUYA 1I42A 3TCAA 3MTNB 1S3SG 2GBKA 4JGHB 2RR9A 2V1YA 1EF1A 2DYOA 3QX1A 4URKA 1V6EA 2CHZA 2I1KA 2KJHB 4NQKE 2J0KA 2G4DB 3DVGX 1WGYA 4PS7A 5AZHA 4ICVA 1SIFA 2EMTA 4CHKA 3A1QA 1ZKHA 4GGQA 4LDTD 1OQYA 3VH3B 4J6IA 4TKNA 3RUIB 2N4FA 3ZVVA 4BKSD 3L10B 2K39A 2O2VB 4TUUA 3PHWB 4LJPB 4JQWC 1WE7A 3WAOA 3PLUA 1UD7A 2MSED 3WAMA 4ANXA 4BBNF 2MQJA 1GG3A 2OJRA 2IO2B 4E71A 1XD3B 2Z0DB 4I6LB 1V2YA 3TMPB 5E6NA 3T9LA 4NPNA 2REXA 2LD9A 1EO6A 3AU5A 2NS5A 1WRDB 2D10A 1H4RA 4M0WB 3ENEA 3KH0A 2Z59B 4TV3A 4ZRJA 3UIPB 5CTRC 1UELA 2L0TA 2MP2A 2ZNVC 4IWQA 1EF5A 2M1MA 3TBLD 4AWJA 4HPMB 4DHZE 2BKFA 2IO1B 5D7GA 4FHKA 5DPSA 3TIXA 2N7DA 3WAPA 3QC8B 4HLEA 2KOXA 2GBNA 2KFKA 3CMMB 4DDGD 2K6DB 3MHSD 3M95A 4KIKB 2ZPNA 5JHAA 4MGZE 1KJTA 2O6VD 4W9KA 2ZVOA 4NY0A 1WFYA 2EMSA 1WXAA 2EKEC 1OEYJ 1YX5B 1Z2MA 2XK5B 4EFOA 2KANA 2FCMA 3ZW3A 1OTRB 3RCZA 3L0WB 4IM2A 4KSLC 2ZCBA 4WWNA 3V62A 2IZVB 3PTFC 3ZNZB 3H7SA 4DXAB 2ZNVB 4AUQC 4GMVA 3N32A 3Q3JA 3QK0A 5D94A 1BT0A 4CO7A 1WY8A 1ZW7A 2MLBA 3TL5A 3ZTDA 5G2NA 2V4LA 2C60A 4KZ0A 5DCNA 1RLFA 2NPTA 3VDZA 2IBIB 2KJ6A 2RD0A 1YD8U 4TQ0A 2BPSA 2LZ6A 2D2QA 1OEYA 3DBSA 1UZXB 1L7YA 2JZZA 1AARA 1VD2A 4JIOU 2WYQA 3H7PA 2IO0B 1SGHA 3PPAA 5E6OA 2PPHA 2C9WB 2ZCCA 3EECA 4MM3A 3T8MA 4GDLA 4NQLB 2KD0A 2KWVB 3QIJA 1RFAA 5LXIB 2BWES
chains in the Genus database with same CATH superfamily
2UWQA 1FXIA 3Q3OC 1WE6A 3BVGA 2MBQA 1ZUD2 2MRPA 3W1SA 2DAFA 1BXTA 4YTMB 3L54A 1C3TA 2L83A 3ZNHB 1KH0A 1SEBD 1M94A 1XT9B 1WJNA 3PHXB 3KVFB 2FIDA 3GS2A 1QQRA 1N61A 2KKCA 4LNKA 5KHOA 2CU1A 2WDQB 3FKYA 2KQ7A 2CR5A 4KIKA 4BZAA 2FCSA 2L3ZA 1YJJA 2PE9A 2CHXA 4W9EA 1IUEA 1K50A 2ZVNA 3BYYB 2PE6B 4NJ6A 1GNUA 1I4GA 5HKHA 4M8NA 5BYSA 3ZJUA 4ASWC 5T8IA 1OQRA 3A9KB 5FKAC 4ZRQA 1XQQA 2RDHA 5BYRA 1B9RA 4G0NB 2KC1A 2OHFA 3HRDD 3VRAB 4KZCA 1QOBA 3BINA 1WXQA 2KN4A 2NBVB 3JSVB 1TS3A 2BVCA 3ZGZA 2FNJB 5GMVA 2ZJDA 4HVBA 5IKCM 1WGKA 3APFA 3BY4B 1CQVA 1X1MA 4WQMA 4WQOB 2LGYA 1YIWA 3SHQA 3DHGC 4FN2A 2PW9A 3ONSA 3MJWA 3FILA 4N59A 2MWSB 2QSDA 1Q0WB 2LVQA 3ZUNA 1SXTA 3SFDB 2G4SA 3IVFA 1RFKA 1FCCC 4L23A 2J53A 1C4AA 2V3SA 2B76B 1D6EC 4R3DA 2W9NA 3R7RA 4C80A 3AE8B 4AOFA 3AEDB 1EWCA 5E6JA 4OW0A 2IY1B 2W3SA 3RNEC 1V86A 3GE8C 4GOCA 4B0MA 2L00B 2WU5B 2AQ3B 1PYWD 2FUG1 1YJIA 1P3QU 3VXWA 3J9CA 1ZE3D 1F52A 1OFFA 2DHZA 4M01A 5C2TB 2O2VA 4ZYSA 2L05A 3PZ8A 2DZKA 4W9LA 2KDEB 4RF0A 5BO4B 1CK1A 4NAWA 4NJ7A 2X8XX 2DX5B 3NVVA 3V3XA 2AYOB 4YSXB 2D3CA 4M0WA 3RYTA 1WR1A 2MCNB 3R8BA 5TSSA 2HTME 2KYWA 5IN7A 3KW5B 4MELA 3IXSA 2LGDA 1F77A 3AXCA 2BW2A 2XK5A 1Y8RC 3DCGA 2BYFA 1EU3A 2G1EA 2G45B 2WQYB 5C23A 4JE3B 1DGJA 2WNMA 4ANWA 2D3GA 2HE7A 4E74A 3I9V1 3N20C 3FC4A 3RNBC 2BGFA 3OJ3A 4JWSC 3VTUA 2DZJA 1TZ1A 4HK2A 3HIZA 1SJHD 2GI9A 5G5HA 3ZRCA 2PTLA 1WMHB 2KQSA 2BT6A 2D07B 3MC9A 3A9JB 2WXFA 2KDBA 3AB5A 3N1ZC 2LI5A 2C5LC 3B08A 3HUIA 5FK9C 5EE1A 2V4IB 1XCTL 2QHOA 3LYYA 4KDIC 3VR9B 4DHJD 1XCQL 2KDIA 2KAJA 3P4SB 3I57A 1I4RA 2H89B 2G3QB 4HKQA 3ZO5B 4CQNA 4LNOA 2LGSA 4FLHA 2V3NA 4ZYNA 1L4ZB 3VUWA 5EE9A 4JPSA 5IP4D 4WAFA 3NS8A 2DWQA 4YXDB 3P1MA 4B95A 1ISNA 4BAXA 4K7WA 1P98A 4RGTA 4D2KA 2GOWA 3DVNV 4XDDA 3R7QA 3A1QB 3V05A 3NJTA 4NAMA 3AN1A 1V81A 4BKSA 4A3PA 2CS4A 4IWOA 3ZTCA 2LXCA 4JX1C 4EE2A 4W9JA 1NENB 4ZRIA 3VQIA 3VH4B 1C1YB 1UNSA 4IKGA 1DYQA 4ZRKA 2VRRB 4HXDA 1F0ZA 3ZDTA 4II3B 2K8HA 1WRIA 2MP2B 3M62B 4MGYE 4FULA 4RMAA 3Q8FA 3DVGY 2W3RA 2D3AA 4FJZA 1ZXHA 3PRZA 1C4CA 3JSVA 2LJ5A 3UINB 4W9HA 1K53A 3GZNB 2ASQA 3B1LX 3BWUD 3X0WA 1CZPA 1I7HA 5CHVC 4HDOA 2MBOA 3AE6B 2JT4B 3P4QB 3JW0X 1MHHE 1TS5A 2NPTB 3A4RA 4FJYA 2MW5A 1FNWA 1CMXB 3DHHC 3GB1A 3NHEB 3W2DA 2JQRB 4ARCA 2MBEA 2N9EB 1UUPA 4IWPA 2WX1A 2AQ1B 2B3AA 1I4PA 4ZRPA 3DBLI 4C7ZA 1JRUA 2EKIA 4MJSB 4S0RA 4KDLB 3TCAA 3AM9A 1FM0D 1K52A 2RR9A 4LLGM 1C76A 4P1BC 2G4DB 5AZHA 3LB8C 2EMTA 1HZ5A 4TKNA 3RUIB 2AQ2B 2N4FA 2SAKA 1ZP0B 3PHWB 3SEBA 3WAOA 3WCQA 3WAMA 4QAYA 4A9AA 1XD3B 2Z0DB 3T3NA 1AN8A 2BS4B 2YEPB 3AE4B 1WRDB 1H4RA 3EGRA 4TV3A 4IWQA 4AWJA 4GLSC 2IO1B 4RNAA 4FHKA 2KOXA 1VZ8A 2K6DB 3MHSD 4KIKB 4YSYB 2ZW0A 2ZVOA 2GLSA 2EKEC 2KMMA 4P1CC 2FCMA 2RDBC 1XEEA 3H7SA 3Q3JA 5D94A 1N6ZA 3ZTDA 2LFIA 5G2NA 2V4LA 2C60A 1KRHA 5DCNA 3DWMA 3W5VB 2IBIB 2KJ6A 1YD8U 1EWYC 2LZ6A 5D3DA 3AEEB 1OEYA 2IGGA 1SSNA 1VJKA 1UZXB 4NJCA 1HZ6A 1AARA 2Z8LA 3H7PA 2JX5A 2ZCCA 3FAHA 2CU3A 2WXPA 1KLGD 4G11A 1FO4A 2JZ3B 1WH3A 1S1QB 3UF8A 2UYZB 2WXOA 1TGZB 2TSSA 1K51A 4HJKA 1V5TA 1V1OA 1IGDA 3FILB 3B0AA 3RPFC 4MSQB 5DPWA 4TQ1A 2BKRB 3Q8AA 2QILA 2N9LA 4BBNC 4II2B 4AJWA 4PS3A 4XZ4A 3AEBB 1T0YA 1J7AA 2FBWB 1WGDA 3EHVA 1PFDA 4MH0E 2L8JA 1L5PA 1RRBA 1EU4A 3NOBA 2KWCA 3NZSA 4K81A 4UDUC 5IA7A 3AE2B 1ACCA 4MH8A 3N9YC 3NVYA 1STEA 2KX0A 3MP9A 1SJED 4GXBA 1WJUA 3NS1A 4LCDE 3N1YC 3PVLA 4MSMB 3Q3MC 3RZFA 5JXVA 3PZDA 4NAWB 2JZPA 5E6PA 2KTFA 4REZA 1C4PA 2E6XA 3RT3B 2OOBB 5LLIA 1H8CA 4KKJA 3DDCB 2Y5BB 5JH5C 2KWUB 3PRPB 2LMCA 4K7UA 2VZKD 2K0PA 4A20A 1J19A 2LVOA 5BMGA 2M0XA 4BKTA 1PQSA 2JXXA 4IW0A 1R4NI 2YLMA 4RF1A 1F9JA 1UGMA 1LXDA 4H2AA 3LJ3A 3APCA 2FCQA 1OGWA 1SE2A 2AL6A 3M3JA 4EOYA 3KUCB 2C7NB 1HE8A 3AECB 1ESFA 3N1XC 2BS3B 4YT0B 1FEHA 3BYTB 3KWLA 4MJSA 5BYQA 1C79A 1IP9A 1WX8A 1I35A 2KK8A 2HD5B 3RD2A 3Q8CA 2X38A 1P0RA 3Q14C 3PSEB 1TBEA 1WZ0A 1HEZE 1UGJA 1AWDA 3UQAA 1L2NA 1LQBA 2J0MA 4HROA 3AEGB 1N5WA 2L1AA 1I4HA 2KFKB 3X23A 4LTUA 2K8CA 3U8ZA 4BFRA 4A90A 1SE3A 5D6JB 2ICIA 1K8RB 1P9DU 2FUHB 5JHBA 4YL8A 2KJRA 1FRDA 2KO3A 2KFJA 1E7PB 3L16A 3VTVA 2QDFA 5D3IB 4WJQA 2BF8B 2NTSA 1V9JA 5TR5A 4KGRA 1GB4A 4S17A 2WLBA 4OVUA 4JLCA 1GC7A 2KZRA 3ZXRA 2Y5PA 4DK5A 2ONQA 1JWMD 4AP4C 4W9DA 1CJEA 3SD5A 1WXSA 3LDZE 1FPYA 4XC2A 2IGHA 1JMLA 2R61A 2O6VB 2D3BA 2INPE 1HA5A 3TSSA 1AYFA 4GB9A 1WXMA 1N63A 5BMHA 1Q1OA 3RZWC 4KKIA 2D5GA 2N9KA 1QF6A 4HJGE 1MG8A 1IPGA 3RI7C 4B9KA 1TY2A 4XX5A 5LNK1 1L6UA 1E6EB 4C4VA 1YQBA 5IO9A 2RDGA 3SFEB 1GAQB 3AU4A 2LVPA 3KUDB 3DVNU 4PYUA 3ZYYX 4IC7B 3IG3A 1QKZA 2MA9B 2NVUI 5AZFA 4BVUC 1RYJA 1WX9A 4P6VF 2I2YA 2JWUA 1EUVB 1QOFA 4ITKA 1VCBA 3KUZA 2LJIA 2KC2A 3BVMA 1WGGA 1IYFA 2JRHA 3AV8A 2GBMA 4MDKE 3VRBB 4L1BA 3P4PB 2CJNA 3C19A 4A8XC 4LNIA 5EE0A 2MX2A 3VHTC 1WXVA 3PZ7A 3V61A 3EFUA 4J3OD 2VH2A 2LEKA 1HTQA 3L08A 4BOSC 4HPLB 2MEKA 2LXAA 1E8ZA 1ET9A 5L95C 3RFZB 3Q69A 1D4BA 4GN1A 1R4MB 1DOIA 4IM3A 1NBFC 1V1PB 5CX3A 3AE5B 3R2TA 4MACA 2GRIA 1TYGB 2MHJA 1B1ZA 2PKOA 5J18A 3IAM1 3PRMB 1GJZA 3OLMD 2JY6A 2WXGA 2N9PC 1LGRA 3H7PB 5CHFA 2PIAA 4OZBA 3HHMA 3MFGA 3URYA 1XLPA 1I42A 3P63A 2QMTA 3AEFB 2DYOA 2KJHB 3UIOB 1UWXA 2J0KA 3DVGX 1WGYA 1A70A 2J4XA 4ICVA 4LDTD 2QIEB 4J6IA 3PLUA 3LXFA 4ANXA 4I6LB 1V2YA 4LNFA 4NPNA 4TMAB 2LD9A 3MJ5A 2E3TA 2WXQA 3ENEA 1T3QA 2Z59B 3UIPB 3B2FA 3TBLD 2ZNVC 1EF5A 4YTNB 2ON8A 5EE3A 3TIXA 3QC8B 2KFKA 2BS2B 4DDGD 3DHIC 3M95A 3TEXA 2EMSA 1WXAA 4EFOA 2PVGC 3W9CB 2BTEA 1OTRB 3L0WB 4KSLC 3ETRA 2ZCBA 3V62A 1J7CA 3NVZA 1M4VA 4WH4A 3QK0A 3B2GA 1WY8A 1ZW7A 4HKZE 3AH7A 1TT5B 4Q2JA 2KACA 1RLFA 3VDZA 2BPSA 2D2QA 2JZZA 1VD2A 2WYQA 1F2RI 2C9WB 4GDLA 2K3UA 2WXLA 2HDEA 1ZDXA 1GOZA 1YOVB 2K5PA 1FNVA 5I4DA 1V80A 2K1FA 4RGOS 2DZIA 2RMMA 3OAWA 2O6VA 4M00A 3RNAC 2JUOA 2KX3A 1KF6B 4RGNA 3U7ZA 4ZOHC 1XO3A 1V49A 2KQ4X 1VRAB 3ZKJC 2JXTA 3P2BA 3ZIMA 2BYEA 1L0XB 4O1NA 4CYEA 2XEWA 1HQRD 2IGDA 4DDID 4I6NB 2QEJC 2EELA 3U4EG 4ANUA 3TJPA 2SEBD 4A3OA 3EC8A 4ZHOA 3MC0B 4M02A 2NCNA 2Y5CA 2N1VA 1WI0A 3AE3B 3RN9C 1FNUA 1GUAB 3SDLC 2BYVE 4MGKE 2MJ3A 2KVRA 2R2OA 4DBGA 1WYWB 1YQ4B 4DHJB 1R4MI 4F8CB 2JYTA 1E5WA 2KDFB 2NBUA 4GDKB 5LXHA 4PS8A 1JWAD 1ZGUB 4B6WA 3PREA 2LUEA 1E7VA 2IY0B 3BK1A 3H6NA 4WWPA 5BMIA 1VR9A 2I1JA 3NUHB 4DWFA 3AEAB 2WXRA 1U4AA 1WM3A 4BKGA 1MJDA 1WIAA 4MT5A 4LK0M 1WM2A 4WJNA 1AW7A 3L13A 1YN3A 1T0RC 3VVWB 1JQ4A 1PUTA 3QWZB 3NG0A 2MH7A 4HCPB 3ZJTA 4W9FA 3ZRFA 2KNBA 3IFWB 2LUMA 3Q3FA 1V1PA 2WP9B 1PGXA 1MPEA 3L17A 5J17A 5AZGA 2AWTA 1LFDA 1VZ6A 4FADA 2JRIB 5KHQA 1FFVA 2BWFA 4NZLB 4USAA 1E8XA 1G6JA 1JWBD 1JWSD 1QOGA 2XNAC 3V6EB 3Q3NC 4ZHPA 2PVOD 3Q8EA 4F1SA 1WWTA 4KGTA 4P7IA 1VLBA 1E7UA 4BOZB 1UWMA 3ABVB 1J0GA 1FIQA 3O13A 2FIFA 5AUIA 1TKYA 3U52E 4C4VB 2MJDA 1GB1A 1UBQA 1MHXA 2KHWB 4M8MA 1TS4A 1E9MA 3RNGC 2ACZB 2CHWA 3RULA 2CJOA 3K9OB 4AQ7A 4HDQA 4W9CA 3QA8A 1Z5SB 2Z0EB 1WYGA 4W9IA 2K22A 3GZNI 3AMZA 1MVKA 3RMKC 2KTRA 3KYDD 4N9F4 3IHPC 3QAQA 2A5UA 2KMAA 3QQ8B 1N5XA 1R7SA 2DBYA 1QZEA 1D5MC 2AEHA 2WHIA 3JYUA 1UF0A 3KLSX 5DPRA 1Q10A 2LHEA 4GU2A 4WURA 4EZLA 3O65B 3OJ4B 1WZ3A 1RWSA 1KOTA 4ARIA 2WS3B 1WJ4A 2LGXA 3E9SA 3H9DA 2R2QA 1PDXA 4MGIE 3SU8X 4LJOB 2YEPF 4ZDVA 2IPKD 2N0SB 1LM8B 2GBRA 3ECIA 1NDDA 2KLCA 2K9XA 3N30A 4WJOA 3NY5A 1QT9A 4KV2A 1WR6E 1N60A 3Q6BA 3HVZA 4KSKC 3D32A 4RM8A 1ROEA 3VAWA 1E8YA 1UH6A 2ZPYA 2PLPA 3QCAA 2NTTA 2V0GA 1L0YB 4OZCA 3DQVA 5CHWA 4C00A 4K3BA 1IBXA 1IGCA 3DWGC 2LASA 2DAJA 1WF9A 4X57B 5GXGB 1HXYD 3N3KB 5AUKA 2L76A 2KVZA 3WIMA 3W1YA 4FJVB 4GDKA 2RSUA 2YVCA 3U30A 3VFKA 1DOYA 5FR3A 2INDC 2WX0A 1C77A 1XLOA 3QARA 4WIPA 4EUTA 2IYDB 1YN5A 2LWPA 1SE9A 1TKEA 1E0ZA 3CF6E 2INNE 5AEKB 3ALBA 3ZJVA 3WALA 3A4SC 3UGBB 1FRRA 4IUMB 3CSFA 1ZXIA 1P7FA 3UQBA 2L32A 1WGHA 3IBEA 4FHJA 2PJHA 4G50A 4FA6A 1F1HA 4AS1A 3HK0A 1YN4A 2GMIC 3APDA 1SBBB 2KMCA 3NZUA 4XGAB 1KFYB 1WGRA 2C7MB 4GDLB 3H1UA 4WWMA 1JW9D 3MTNB 1S3SG 2GBKA 4URKA 2V1YA 3QX1A 1V6EA 2I1KA 4NQKE 4L2YA 1Y56A 4GGQA 3TEYA 2VZKB 3VH3B 3ZVVA 4P16A 4RH6A 1JALA 4YSZB 1SB3C 4LJPB 2W82A 4YTPB 2IO2B 4E71A 3GE3C 5E6NA 3T9LA 3TEZA 1TS2A 2REXA 1MG4A 3AU5A 2JYEA 2NS5A 2D10A 1SE4A 3KH0A 5CTRC 4HPMB 5D7GA 1SF0A 2N7DA 4DQOC 4HLEA 3DBHB 1XXGA 2OEDA 5JHAA 4W9KA 1WFYA 1OEYJ 1Z2MA 2KANA 3ZW3A 4WWNA 4DXAB 2ZNVB 3T3OA 2I38A 2QCZA 3N32A 1BMLC 3PO0A 3TL5A 4XE0A 1ET6A 1NYRA 3EA6A 1L6VA 3DBSA 2KWDA 4N6EB 1L7YA 1JROA 2IO0B 4RCOA 5E6OA 2PPHA 3EECA 3T8MA 4MM3A 3U2SC 4NQLB 1PGBA 2KD0A 5LXIB 2XN9C 2BWES 1T0QC 2DZMA 4A55A 5IAAC 1Q5WB 4EZKA 1GPXA 3QJZA 2DENB 2N7EA 3ZXVA 2K8BA 2N9XA 4GIVA 2HTHA 2D11A 3VUXA 2NMQA 1D5ZC 1J7BA 1L4DB 1VZ7A 4XWTA 2MBBB 1E8WA 1YNTE 3P4RB 1JCKB 3C8YA 1OQQA 2BQQA 3DBLB 4OHJA 3SR6A 4DHZB 1DOXA 3Q8BA 5HHDG 4OZAA 5C1ZA 2ZZPB 5DPTA 5MPOA 3VR8B 2MJEA 3C0RB 3WA0A 1FD6A 1VDVA 2HJ8A 1NEKB 1ENFA 1I4XA 1ZOYB 2RPVA 1J8CA 5FR6A 4K1RB 1KM7A 1V97A 2LRUA 4ICUA 3U7DA 1JWUD 4E3CA 2M8SA 2IJ0A 4GSWA 3ZLZA 2WDRB 3EUB2 3AI5A 5C3JB 3M63B 4PYZA 1YMHE 1P1AA 3RNFC 4MEMA 1T6BX 2J42A 4IG7B 5J2RA 2JVCA 1F2RC 2WDVB 5G5GA 3W5UB 2Q5WD 4ANVA 1YQ3B 4HCNB 2L52A 3S2AA 1FCLA 1BUIC 3MC8A 2M4NA 3HM3A 2M0AA 4FBJB 5L83A 3NVWA 2WXKA 1TTNA 2LGIA 2GBJA 1T0SC 3PLVA 4I6PA 3DBRB 4DXFA 2J7QB 2J0JA 3RNCC 1NYQA 2KTRB 4EZJA 4G3XB 3PT2B 2Y3AA 3AULA 3PGEA 3R2IA 2JF5A 1NVID 1WSPA 1XLNA 5H8YE 2K6QA 4ACFA 2IDYA 4F7ZA 3VTWA 4US8A 3I5JC 1HTOA 3DBHI 4RM9A 1FXAA 2KN5A 1LO5D 1YJ1A 3Q2AC 2C7HA 2KXJA 1QLBB 2WU2B 3NRZA 4IM0A 3A9KA 3TEWA 2LRWA 2WXNA 3NZ3A 2JU6X 3QHTA 5EDSA 2M17A 2QJLA 1RAXA 3ML9A 3R3MA 1KTKA 3GP7A 1D3ZA 3ZDMC 3TUOA 2BB5A 3BZDB 2WGSA 3K9PB 2L0FA 2K25A 3ML8A 1JRPA 2FAZA 4HPPA 3BVZA 1MFWA 4EKUA 4LDTB 3AE9B 3KWVA 5H92C 1IBXB 3AE7B 3KYCD 4WWOA 1C9FA 3R66C 3MHZA 1E10A 5HFYA 3ZNGC 1C78A 2H88B 5D2MB 2PEAA 2V3PA 2DYMA 2MBHA 3UI3A 4DXGA 1UBIA 4HWIB 1YX6B 2WXMA 1V5OA 2PMVA 1WX7A 3OWEB 2ZEQA 1E90A 2IO3B 5IOIA 4XWWA 1T5XD 4RGMA 4OVVA 4TSSA 1R4NB 4K3CA 2AL3A 1TZOA 4EEWA 3AE1B 1NI2A 3EFCA 4YWGG 4B0EA 5JZEB 4JL9A 2N1WA 3CIRB 2N7JA 1QILA 4C56C 2WXHA 4C7YA 2DLBA 1FFUA 3I3TB 1FMAD 2XBBC 4NNJB 2L7RA 4KGSA 1FXTB 2BBCA 1ZDVA 2JWZA 2WWZA 2GB1A 2WXJA 1WJ6A 3DPDA 1RM6C 3P42A 4FXCA 2JPHA 4W9GA 4WAAA 4RFBA 3WANA 2J52A 2M19A 2HJ1A 2RGFA 4KVGB 4AJYB 1GC6A 2RPQA 3E56A 2NBWB 3DBRI 2WXIA 1NI3A 4A6QA 3A33B 1A5RA 3CSTA 2M56B 3HVDA 5G55A 3BK2A 5HI1A 1WMHA 1L0VB 2FCNA 1XF5L 2A4ZA 2INCC 2DYBA 1TY0A 4IOIE 3GOEA 3A9JA 2G9HD 3JVZX 2BB6A 2AX5A 1XLQA 2JSVX 3ZQ4A 4US9A 2CKHB 2KLGA 3IT4B 3PS6A 3DOWA 2WDTB 2VH1A 1N62A 4WJPA 2NR2A 1MI0A 5HG2A 2FE8A 2DNFA 4PT5A 3PV1A 1ZPSA 3CWIA 1KLVA 2QC8A 1EM7A 3W1SC 3V60A 4K7SA 3ZNID 1PGAA 3V6CB 3I63C 4MM3B 1SIJA 3HM6X 1TJEA 3BIID 3VUYA 4PK1A 2ZW1A 4JGHB 1EF1A 2CHZA 4PS7A 1SIFA 4XYCA 4CHKA 3A1QA 1ZKHA 1OQYA 4BKSD 3L10B 2K39A 1TIFA 4OVZA 2O2VB 3IT6B 4TUUA 4JQWC 1QOAA 1WE7A 2KDMA 1UD7A 2MSED 2BYTA 4BBNF 2MQJA 1GG3A 2OJRA 3TMPB 4N58A 4JWUC 1EO6A 2W54A 2V9HA 4M0WB 2OJWA 4ZRJA 1UELA 2L0TA 2MP2A 4HRSA 4KX6B 2M1MA 4DHZE 2BKFA 2UU7A 5DPSA 3B9JA 3WAPA 2GBNA 3CMMB 1P7EA 2ZPNA 2LHDA 4MGZE 1KJTA 2O6VD 4IDIA 4NY0A 3OG5A 2KT7A 4HEA1 1YX5B 2XK5B 3RCZA 4IM2A 3IAS1 2IZVB 3PTFC 3ZNZB 4AUQC 4GMVA 4LNNA 1BT0A 3H8HA 4CO7A 2MLBA 1TKGA 4KZ0A 1KLUD 1V8CA 1I4QA 2NPTA 1D5XC 2W55A 2RD0A 4TQ0A 4JIOU 3PPAA 1SGHA 4XDCA 3KQ4A 3L4PA 2KWVB 3QIJA 1RFAA
chains in the Genus database with same CATH topology
4G11A 2DZMA 2JZ3B 2UWQA 1WH3A 5IAAC 1WE6A 1Q5WB 4EZKA 3QJZA 1V80A 2K1FA 2DENB 2MBQA 1S1QB 2N7EA 2DZIA 2K8BA 2N9XA 2MRPA 4GIVA 3UF8A 2HTHA 3OAWA 2O6VA 2D11A 3W1SA 3VUXA 2JUOA 2KX3A 2UYZB 1TGZB 2DAFA 3L54A 1C3TA 3ZNHB 2MBBB 4HJKA 1E8WA 1M94A 1XT9B 1V49A 1WJNA 1V5TA 3PHXB 3KVFB 3ZKJC 2FIDA 3P2BA 3ZIMA 2BYEA 4CYEA 2XEWA 3B0AA 4DDID 4I6NB 4MSQB 2KKCA 5KHOA 4ANUA 5DPWA 4TQ1A 2BKRB 3TJPA 4DHZB 2CU1A 4BBNC 4II2B 4A3OA 4AJWA 3EC8A 5C1ZA 4PS3A 4XZ4A 1T0YA 2KQ7A 2ZZPB 1WGDA 3EHVA 2NCNA 5DPTA 2CR5A 4MH0E 2L8JA 3C0RB 4KIKA 3WA0A 1RRBA 2FCSA 2L3ZA 2N1VA 1WI0A 3NOBA 2PE9A 2KWCA 2CHXA 3NZSA 4W9EA 2HJ8A 1GUAB 3SDLC 4K81A 5IA7A 2BYVE 4MGKE 2KVRA 2ZVNA 1J8CA 2R2OA 2PE6B 4DBGA 2KX0A 4NJ6A 1WYWB 5FR6A 4GXBA 1GNUA 1WJUA 4DHJB 4K1RB 4M8NA 5HKHA 4LCDE 4ASWC 1R4MI 4F8CB 3PVLA 1E5WA 4MSMB 1KM7A 2LRUA 3A9KB 4ICUA 3RZFA 2KDFB 1XQQA 2NBUA 4GDKB 3PZDA 4PS8A 3U7DA 5LXHA 1ZGUB 4G0NB 4E3CA 2M8SA 4NAWB 2KC1A 5E6PA 4B6WA 2KTFA 4GSWA 3PREA 2LUEA 3ZLZA 1E7VA 3AI5A 3M63B 2IY0B 3H6NA 4KZCA 3BINA 2NBVB 4WWPA 3JSVB 4PYZA 3RT3B 1P1AA 2OOBB 5LLIA 1H8CA 4MEMA 2I1JA 2FNJB 4DWFA 3DDCB 2Y5BB 5GMVA 1U4AA 1WM3A 4IG7B 4BKGA 5JH5C 5J2RA 2ZJDA 2KWUB 2JVCA 4HVBA 1WIAA 4ANVA 1WM2A 3PRPB 4WJNA 4HCNB 3S2AA 4K7UA 3APFA 2M4NA 3BY4B 1X1MA 3HM3A 3L13A 4WQOB 2LGYA 3VVWB 1YIWA 4FBJB 5L83A 4A20A 1TTNA 1J19A 3SHQA 2LVOA 4FN2A 2GBJA 3QWZB 3PLVA 4HCPB 4I6PA 2M0XA 4W9FA 3ZRFA 2KNBA 3IFWB 2J7QB 3Q3FA 1PQSA 4BKTA 2JXXA 2J0JA 3ONSA 4IW0A 1R4NI 3MJWA 2KTRB 2YLMA 4EZJA 4G3XB 1F9JA 1UGMA 1LXDA 2MWSB 3PT2B 3AULA 3LJ3A 1Q0WB 2LVQA 3PGEA 3APCA 3ZUNA 2FCQA 1OGWA 2JF5A 3L17A 5J17A 2G4SA 3IVFA 5AZGA 2K6QA 2AWTA 1LFDA 2AL6A 4FADA 2V3SA 2JRIB 3M3JA 4EOYA 3KUCB 2C7NB 5KHQA 2BWFA 2W9NA 3R7RA 1E8XA 1G6JA 1HE8A 4F7ZA 3VTWA 4AOFA 3DBHI 2IY1B 1IP9A 4MJSA 1V86A 4GOCA 1WX8A 3V6EB 1I35A 4RM9A 2KK8A 2KN5A 4F1SA 2HD5B 2L00B 3RD2A 4P7IA 1P0RA 1YJ1A 1E7UA 4BOZB 2C7HA 3PSEB 2KXJA 1P3QU 1TBEA 1J0GA 1WZ0A 3VXWA 2DHZA 3UQAA 2O2VA 4IM0A 2L05A 1L2NA 1LQBA 2DZKA 2J0MA 3A9KA 4W9LA 2FIFA 2KDEB 2LRWA 5BO4B 4NAWA 4NJ7A 3QHTA 2KFKB 2M17A 5EDSA 3X23A 1RAXA 2DX5B 3ML9A 3R3MA 1UBQA 2AYOB 2KHWB 3RYTA 4M8MA 1WR1A 1D3ZA 2K8CA 3ZDMC 2MCNB 3U8ZA 4BFRA 5D6JB 2CHWA 1K8RB 1P9DU 2FUHB 3K9PB 3RULA 2L0FA 3KW5B 4MELA 2K25A 5JHBA 4YL8A 2KJRA 2KO3A 2KFJA 3ML8A 3K9OB 2LGDA 2FAZA 3AXCA 4EKUA 4LDTB 3L16A 4HDQA 3VTVA 4W9CA 3QA8A 4WJQA 2XK5A 2BF8B 1V9JA 1Y8RC 3DCGA 2BYFA 5TR5A 1Z5SB 2Z0EB 3KYCD 4W9IA 2G45B 4WWOA 5C23A 3R66C 4OVUA 3ZNGC 4ANWA 3GZNI 2D3GA 4JLCA 2HE7A 4E74A 5D2MB 1GC7A 2PEAA 2DYMA 2MBHA 2KZRA 2BGFA 2KTRA 3KYDD 4N9F4 3OJ3A 3VTUA 2DZJA 3IHPC 1TZ1A 3QAQA 4HK2A 4DK5A 3HIZA 1UBIA 2A5UA 2KMAA 3QQ8B 3ZRCA 4HWIB 4AP4C 1YX6B 4W9DA 1WMHB 3SD5A 1WXSA 2KQSA 1QZEA 2D07B 3LDZE 2AEHA 1V5OA 3A9JB 2KDBA 3JYUA 4XC2A 1WX7A 2ZEQA 1E90A 2LI5A 2O6VB 2C5LC 5DPRA 2IO3B 3B08A 4GU2A 2QHOA 4OVVA 4KDIC 2AL3A 4EZLA 3O65B 4DHJD 2KDIA 3OJ4B 4GB9A 1WXMA 4EEWA 1WZ3A 1NI2A 1Q1OA 1KOTA 3RZWC 1WJ4A 2LGXA 5JZEB 4JL9A 2N1WA 1MG8A 1IPGA 3H9DA 2R2QA 2G3QB 4MGIE 3SU8X 3ZO5B 4LJOB 4FLHA 4B9KA 4XX5A 4ZYNA 3I3TB 4ZDVA 2XBBC 4NNJB 1YQBA 1LM8B 2L7RA 2GBRA 3VUWA 3ECIA 1NDDA 2KLCA 1FXTB 3AU4A 2LVPA 3KUDB 3NS8A 3N30A 4WJOA 3DVNU 2JWZA 3NY5A 4PYUA 2WWZA 4B95A 4IC7B 1ISNA 3IG3A 4K7WA 1P98A 4KV2A 1WR6E 3UIOB 1WJ6A 2MA9B 3DPDA 2NVUI 5AZFA 4KSKC 4BVUC 3D32A 4RM8A 2GOWA 1WX9A 3DVNV 3R7QA 2JPHA 3A1QB 3VAWA 4W9GA 1EUVB 1E8YA 1UH6A 2ZPYA 4WAAA 3QCAA 1V81A 4BKSA 4A3PA 1VCBA 2CS4A 3KUZA 3DQVA 4IWOA 3ZTCA 5CHWA 2LXCA 3WANA 4W9JA 2KC2A 1IYFA 1WGGA 2LASA 2DAJA 4ZRIA 3VQIA 3VH4B 1C1YB 1WF9A 2JRHA 2GBMA 2RGFA 4KVGB 3N3KB 1GC6A 2RPQA 4MDKE 4X57B 4AJYB 2L76A 2NBWB 4ZRKA 3DBRI 3WIMA 3A33B 2VRRB 2MX2A 3W1YA 4HXDA 4FJVB 3ZDTA 4II3B 2K8HA 2MP2B 4GDKA 1A5RA 2RSUA 3CSTA 3M62B 3VHTC 1WXVA 3V61A 2YVCA 3EFUA 3U30A 3VFKA 5G55A 4MGYE 4FULA 1WMHA 4RMAA 2FCNA 2A4ZA 2WX0A 3DVGY 3QARA 4EUTA 2DYBA 2IYDB 3GOEA 4FJZA 3A9JA 2LWPA 3JVZX 3L08A 1SE9A 4BOSC 3PRZA 3JSVA 2LJ5A 4HPLB 3CF6E 3UINB 5AEKB 3ALBA 2LXAA 3WALA 1E8ZA 3A4SC 2CKHB 4W9HA 3UGBB 5L95C 2KLGA 2ASQA 4IUMB 3B1LX 4GN1A 3X0WA 3CSFA 3PS6A 3DOWA 4IM3A 3UQBA 5CHVC 1WGHA 1NBFC 3IBEA 4FHJA 2PJHA 2WDTB 5CX3A 4HDOA 4G50A 4WJPA 2MBOA 4FA6A 2NR2A 2JT4B 3JW0X 5J18A 2NPTB 3A4RA 3PRMB 3HK0A 4FJYA 2MW5A 2GMIC 3APDA 3PV1A 1CMXB 1GJZA 3OLMD 2JY6A 2KMCA 3NHEB 3NZUA 1KLVA 3W1SC 2N9PC 3V60A 2MBEA 4K7SA 2N9EB 3ZNID 3H7PB 3V6CB 5CHFA 4IWPA 2WX1A 1WGRA 2C7MB 4GDLB 2B3AA 3HHMA 3HM6X 3H1UA 3DBLI 1JRUA 4MJSB 4KDLB 3VUYA 1I42A 3TCAA 3MTNB 1S3SG 2GBKA 4JGHB 2RR9A 2V1YA 1EF1A 2DYOA 3QX1A 4URKA 1V6EA 2CHZA 2I1KA 2KJHB 4NQKE 2J0KA 2G4DB 3DVGX 1WGYA 4PS7A 5AZHA 4ICVA 1SIFA 2EMTA 4CHKA 3A1QA 1ZKHA 4GGQA 4LDTD 1OQYA 3VH3B 4J6IA 4TKNA 3RUIB 2N4FA 3ZVVA 4BKSD 3L10B 2K39A 2O2VB 4TUUA 3PHWB 4LJPB 4JQWC 1WE7A 3WAOA 3PLUA 1UD7A 2MSED 3WAMA 4ANXA 4BBNF 2MQJA 1GG3A 2OJRA 2IO2B 4E71A 1XD3B 2Z0DB 4I6LB 1V2YA 3TMPB 5E6NA 3T9LA 4NPNA 2REXA 2LD9A 1EO6A 3AU5A 2NS5A 1WRDB 2D10A 1H4RA 4M0WB 3ENEA 3KH0A 2Z59B 4TV3A 4ZRJA 3UIPB 5CTRC 1UELA 2L0TA 2MP2A 2ZNVC 4IWQA 1EF5A 2M1MA 3TBLD 4AWJA 4HPMB 4DHZE 2BKFA 2IO1B 5D7GA 4FHKA 5DPSA 3TIXA 2N7DA 3WAPA 3QC8B 4HLEA 2KOXA 2GBNA 2KFKA 3CMMB 4DDGD 2K6DB 3MHSD 3M95A 4KIKB 2ZPNA 5JHAA 4MGZE 1KJTA 2O6VD 4W9KA 2ZVOA 4NY0A 1WFYA 2EMSA 1WXAA 2EKEC 1OEYJ 1YX5B 1Z2MA 2XK5B 4EFOA 2KANA 2FCMA 3ZW3A 1OTRB 3RCZA 3L0WB 4IM2A 4KSLC 2ZCBA 4WWNA 3V62A 2IZVB 3PTFC 3ZNZB 3H7SA 4DXAB 2ZNVB 4AUQC 4GMVA 3N32A 3Q3JA 3QK0A 5D94A 1BT0A 4CO7A 1WY8A 1ZW7A 2MLBA 3TL5A 3ZTDA 5G2NA 2V4LA 2C60A 4KZ0A 5DCNA 1RLFA 2NPTA 3VDZA 2IBIB 2KJ6A 2RD0A 1YD8U 4TQ0A 2BPSA 2LZ6A 2D2QA 1OEYA 3DBSA 1UZXB 1L7YA 2JZZA 1AARA 1VD2A 4JIOU 2WYQA 3H7PA 2IO0B 1SGHA 3PPAA 5E6OA 2PPHA 2C9WB 2ZCCA 3EECA 4MM3A 3T8MA 4GDLA 4NQLB 2KD0A 2KWVB 3QIJA 1RFAA 5LXIB 2BWES
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G11 A;  2DZM A;  2JZ3 B;  2UWQ A;  1WH3 A;  5IAA C;  1WE6 A;  1Q5W B;  4EZK A;  3QJZ A;  1V80 A;  2K1F A;  2DEN B;  2MBQ A;  1S1Q B;  2N7E A;  2DZI A;  2K8B A;  2N9X A;  2MRP A;  4GIV A;  3UF8 A;  2HTH A;  3OAW A;  2O6V A;  2D11 A;  3W1S A;  3VUX A;  2JUO A;  2KX3 A;  2UYZ B;  1TGZ B;  2DAF A;  3L54 A;  1C3T A;  3ZNH B;  2MBB B;  4HJK A;  1E8W A;  1M94 A;  1XT9 B;  1V49 A;  1WJN A;  1V5T A;  3PHX B;  3KVF B;  3ZKJ C;  2FID A;  3P2B A;  3ZIM A;  2BYE A;  4CYE A;  2XEW A;  3B0A A;  4DDI D;  4I6N B;  4MSQ B;  2KKC A;  5KHO A;  4ANU A;  5DPW A;  4TQ1 A;  2BKR B;  3TJP A;  4DHZ B;  2CU1 A;  4BBN C;  4II2 B;  4A3O A;  4AJW A;  3EC8 A;  5C1Z A;  4PS3 A;  4XZ4 A;  1T0Y A;  2KQ7 A;  2ZZP B;  1WGD A;  3EHV A;  2NCN A;  5DPT A;  2CR5 A;  4MH0 E;  2L8J A;  3C0R B;  4KIK A;  3WA0 A;  1RRB A;  2FCS A;  2L3Z A;  2N1V A;  1WI0 A;  3NOB A;  2PE9 A;  2KWC A;  2CHX A;  3NZS A;  4W9E A;  2HJ8 A;  1GUA B;  3SDL C;  4K81 A;  5IA7 A;  2BYV E;  4MGK E;  2KVR A;  2ZVN A;  1J8C A;  2R2O A;  2PE6 B;  4DBG A;  2KX0 A;  4NJ6 A;  1WYW B;  5FR6 A;  4GXB A;  1GNU A;  1WJU A;  4DHJ B;  4K1R B;  4M8N A;  5HKH A;  4LCD E;  4ASW C;  1R4M I;  4F8C B;  3PVL A;  1E5W A;  4MSM B;  1KM7 A;  2LRU A;  3A9K B;  4ICU A;  3RZF A;  2KDF B;  1XQQ A;  2NBU A;  4GDK B;  3PZD A;  4PS8 A;  3U7D A;  5LXH A;  1ZGU B;  4G0N B;  4E3C A;  2M8S A;  4NAW B;  2KC1 A;  5E6P A;  4B6W A;  2KTF A;  4GSW A;  3PRE A;  2LUE A;  3ZLZ A;  1E7V A;  3AI5 A;  3M63 B;  2IY0 B;  3H6N A;  4KZC A;  3BIN A;  2NBV B;  4WWP A;  3JSV B;  4PYZ A;  3RT3 B;  1P1A A;  2OOB B;  5LLI A;  1H8C A;  4MEM A;  2I1J A;  2FNJ B;  4DWF A;  3DDC B;  2Y5B B;  5GMV A;  1U4A A;  1WM3 A;  4IG7 B;  4BKG A;  5JH5 C;  5J2R A;  2ZJD A;  2KWU B;  2JVC A;  4HVB A;  1WIA A;  4ANV A;  1WM2 A;  3PRP B;  4WJN A;  4HCN B;  3S2A A;  4K7U A;  3APF A;  2M4N A;  3BY4 B;  1X1M A;  3HM3 A;  3L13 A;  4WQO B;  2LGY A;  3VVW B;  1YIW A;  4FBJ B;  5L83 A;  4A20 A;  1TTN A;  1J19 A;  3SHQ A;  2LVO A;  4FN2 A;  2GBJ A;  3QWZ B;  3PLV A;  4HCP B;  4I6P A;  2M0X A;  4W9F A;  3ZRF A;  2KNB A;  3IFW B;  2J7Q B;  3Q3F A;  1PQS A;  4BKT A;  2JXX A;  2J0J A;  3ONS A;  4IW0 A;  1R4N I;  3MJW A;  2KTR B;  2YLM A;  4EZJ A;  4G3X B;  1F9J A;  1UGM A;  1LXD A;  2MWS B;  3PT2 B;  3AUL A;  3LJ3 A;  1Q0W B;  2LVQ A;  3PGE A;  3APC A;  3ZUN A;  2FCQ A;  1OGW A;  2JF5 A;  3L17 A;  5J17 A;  2G4S A;  3IVF A;  5AZG A;  2K6Q A;  2AWT A;  1LFD A;  2AL6 A;  4FAD A;  2V3S A;  2JRI B;  3M3J A;  4EOY A;  3KUC B;  2C7N B;  5KHQ A;  2BWF A;  2W9N A;  3R7R A;  1E8X A;  1G6J A;  1HE8 A;  4F7Z A;  3VTW A;  4AOF A;  3DBH I;  2IY1 B;  1IP9 A;  4MJS A;  1V86 A;  4GOC A;  1WX8 A;  3V6E B;  1I35 A;  4RM9 A;  2KK8 A;  2KN5 A;  4F1S A;  2HD5 B;  2L00 B;  3RD2 A;  4P7I A;  1P0R A;  1YJ1 A;  1E7U A;  4BOZ B;  2C7H A;  3PSE B;  2KXJ A;  1P3Q U;  1TBE A;  1J0G A;  1WZ0 A;  3VXW A;  2DHZ A;  3UQA A;  2O2V A;  4IM0 A;  2L05 A;  1L2N A;  1LQB A;  2DZK A;  2J0M A;  3A9K A;  4W9L A;  2FIF A;  2KDE B;  2LRW A;  5BO4 B;  4NAW A;  4NJ7 A;  3QHT A;  2KFK B;  2M17 A;  5EDS A;  3X23 A;  1RAX A;  2DX5 B;  3ML9 A;  3R3M A;  1UBQ A;  2AYO B;  2KHW B;  3RYT A;  4M8M A;  1WR1 A;  1D3Z A;  2K8C A;  3ZDM C;  2MCN B;  3U8Z A;  4BFR A;  5D6J B;  2CHW A;  1K8R B;  1P9D U;  2FUH B;  3K9P B;  3RUL A;  2L0F A;  3KW5 B;  4MEL A;  2K25 A;  5JHB A;  4YL8 A;  2KJR A;  2KO3 A;  2KFJ A;  3ML8 A;  3K9O B;  2LGD A;  2FAZ A;  3AXC A;  4EKU A;  4LDT B;  3L16 A;  4HDQ A;  3VTV A;  4W9C A;  3QA8 A;  4WJQ A;  2XK5 A;  2BF8 B;  1V9J A;  1Y8R C;  3DCG A;  2BYF A;  5TR5 A;  1Z5S B;  2Z0E B;  3KYC D;  4W9I A;  2G45 B;  4WWO A;  5C23 A;  3R66 C;  4OVU A;  3ZNG C;  4ANW A;  3GZN I;  2D3G A;  4JLC A;  2HE7 A;  4E74 A;  5D2M B;  1GC7 A;  2PEA A;  2DYM A;  2MBH A;  2KZR A;  2BGF A;  2KTR A;  3KYD D;  4N9F 4;  3OJ3 A;  3VTU A;  2DZJ A;  3IHP C;  1TZ1 A;  3QAQ A;  4HK2 A;  4DK5 A;  3HIZ A;  1UBI A;  2A5U A;  2KMA A;  3QQ8 B;  3ZRC A;  4HWI B;  4AP4 C;  1YX6 B;  4W9D A;  1WMH B;  3SD5 A;  1WXS A;  2KQS A;  1QZE A;  2D07 B;  3LDZ E;  2AEH A;  1V5O A;  3A9J B;  2KDB A;  3JYU A;  4XC2 A;  1WX7 A;  2ZEQ A;  1E90 A;  2LI5 A;  2O6V B;  2C5L C;  5DPR A;  2IO3 B;  3B08 A;  4GU2 A;  2QHO A;  4OVV A;  4KDI C;  2AL3 A;  4EZL A;  3O65 B;  4DHJ D;  2KDI A;  3OJ4 B;  4GB9 A;  1WXM A;  4EEW A;  1WZ3 A;  1NI2 A;  1Q1O A;  1KOT A;  3RZW C;  1WJ4 A;  2LGX A;  5JZE B;  4JL9 A;  2N1W A;  1MG8 A;  1IPG A;  3H9D A;  2R2Q A;  2G3Q B;  4MGI E;  3SU8 X;  3ZO5 B;  4LJO B;  4FLH A;  4B9K A;  4XX5 A;  4ZYN A;  3I3T B;  4ZDV A;  2XBB C;  4NNJ B;  1YQB A;  1LM8 B;  2L7R A;  2GBR A;  3VUW A;  3ECI A;  1NDD A;  2KLC A;  1FXT B;  3AU4 A;  2LVP A;  3KUD B;  3NS8 A;  3N30 A;  4WJO A;  3DVN U;  2JWZ A;  3NY5 A;  4PYU A;  2WWZ A;  4B95 A;  4IC7 B;  1ISN A;  3IG3 A;  4K7W A;  1P98 A;  4KV2 A;  1WR6 E;  3UIO B;  1WJ6 A;  2MA9 B;  3DPD A;  2NVU I;  5AZF A;  4KSK C;  4BVU C;  3D32 A;  4RM8 A;  2GOW A;  1WX9 A;  3DVN V;  3R7Q A;  2JPH A;  3A1Q B;  3VAW A;  4W9G A;  1EUV B;  1E8Y A;  1UH6 A;  2ZPY A;  4WAA A;  3QCA A;  1V81 A;  4BKS A;  4A3P A;  1VCB A;  2CS4 A;  3KUZ A;  3DQV A;  4IWO A;  3ZTC A;  5CHW A;  2LXC A;  3WAN A;  4W9J A;  2KC2 A;  1IYF A;  1WGG A;  2LAS A;  2DAJ A;  4ZRI A;  3VQI A;  3VH4 B;  1C1Y B;  1WF9 A;  2JRH A;  2GBM A;  2RGF A;  4KVG B;  3N3K B;  1GC6 A;  2RPQ A;  4MDK E;  4X57 B;  4AJY B;  2L76 A;  2NBW B;  4ZRK A;  3DBR I;  3WIM A;  3A33 B;  2VRR B;  2MX2 A;  3W1Y A;  4HXD A;  4FJV B;  3ZDT A;  4II3 B;  2K8H A;  2MP2 B;  4GDK A;  1A5R A;  2RSU A;  3CST A;  3M62 B;  3VHT C;  1WXV A;  3V61 A;  2YVC A;  3EFU A;  3U30 A;  3VFK A;  5G55 A;  4MGY E;  4FUL A;  1WMH A;  4RMA A;  2FCN A;  2A4Z A;  2WX0 A;  3DVG Y;  3QAR A;  4EUT A;  2DYB A;  2IYD B;  3GOE A;  4FJZ A;  3A9J A;  2LWP A;  3JVZ X;  3L08 A;  1SE9 A;  4BOS C;  3PRZ A;  3JSV A;  2LJ5 A;  4HPL B;  3CF6 E;  3UIN B;  5AEK B;  3ALB A;  2LXA A;  3WAL A;  1E8Z A;  3A4S C;  2CKH B;  4W9H A;  3UGB B;  5L95 C;  2KLG A;  2ASQ A;  4IUM B;  3B1L X;  4GN1 A;  3X0W A;  3CSF A;  3PS6 A;  3DOW A;  4IM3 A;  3UQB A;  5CHV C;  1WGH A;  1NBF C;  3IBE A;  4FHJ A;  2PJH A;  2WDT B;  5CX3 A;  4HDO A;  4G50 A;  4WJP A;  2MBO A;  4FA6 A;  2NR2 A;  2JT4 B;  3JW0 X;  5J18 A;  2NPT B;  3A4R A;  3PRM B;  3HK0 A;  4FJY A;  2MW5 A;  2GMI C;  3APD A;  3PV1 A;  1CMX B;  1GJZ A;  3OLM D;  2JY6 A;  2KMC A;  3NHE B;  3NZU A;  1KLV A;  3W1S C;  2N9P C;  3V60 A;  2MBE A;  4K7S A;  2N9E B;  3ZNI D;  3H7P B;  3V6C B;  5CHF A;  4IWP A;  2WX1 A;  1WGR A;  2C7M B;  4GDL B;  2B3A A;  3HHM A;  3HM6 X;  3H1U A;  3DBL I;  1JRU A;  4MJS B;  4KDL B;  3VUY A;  1I42 A;  3TCA A;  3MTN B;  1S3S G;  2GBK A;  4JGH B;  2RR9 A;  2V1Y A;  1EF1 A;  2DYO A;  3QX1 A;  4URK A;  1V6E A;  2CHZ A;  2I1K A;  2KJH B;  4NQK E;  2J0K A;  2G4D B;  3DVG X;  1WGY A;  4PS7 A;  5AZH A;  4ICV A;  1SIF A;  2EMT A;  4CHK A;  3A1Q A;  1ZKH A;  4GGQ A;  4LDT D;  1OQY A;  3VH3 B;  4J6I A;  4TKN A;  3RUI B;  2N4F A;  3ZVV A;  4BKS D;  3L10 B;  2K39 A;  2O2V B;  4TUU A;  3PHW B;  4LJP B;  4JQW C;  1WE7 A;  3WAO A;  3PLU A;  1UD7 A;  2MSE D;  3WAM A;  4ANX A;  4BBN F;  2MQJ A;  1GG3 A;  2OJR A;  2IO2 B;  4E71 A;  1XD3 B;  2Z0D B;  4I6L B;  1V2Y A;  3TMP B;  5E6N A;  3T9L A;  4NPN A;  2REX A;  2LD9 A;  1EO6 A;  3AU5 A;  2NS5 A;  1WRD B;  2D10 A;  1H4R A;  4M0W B;  3ENE A;  3KH0 A;  2Z59 B;  4TV3 A;  4ZRJ A;  3UIP B;  5CTR C;  1UEL A;  2L0T A;  2MP2 A;  2ZNV C;  4IWQ A;  1EF5 A;  2M1M A;  3TBL D;  4AWJ A;  4HPM B;  4DHZ E;  2BKF A;  2IO1 B;  5D7G A;  4FHK A;  5DPS A;  3TIX A;  2N7D A;  3WAP A;  3QC8 B;  4HLE A;  2KOX A;  2GBN A;  2KFK A;  3CMM B;  4DDG D;  2K6D B;  3MHS D;  3M95 A;  4KIK B;  2ZPN A;  5JHA A;  4MGZ E;  1KJT A;  2O6V D;  4W9K A;  2ZVO A;  4NY0 A;  1WFY A;  2EMS A;  1WXA A;  2EKE C;  1OEY J;  1YX5 B;  1Z2M A;  2XK5 B;  4EFO A;  2KAN A;  2FCM A;  3ZW3 A;  1OTR B;  3RCZ A;  3L0W B;  4IM2 A;  4KSL C;  2ZCB A;  4WWN A;  3V62 A;  2IZV B;  3PTF C;  3ZNZ B;  3H7S A;  4DXA B;  2ZNV B;  4AUQ C;  4GMV A;  3N32 A;  3Q3J A;  3QK0 A;  5D94 A;  1BT0 A;  4CO7 A;  1WY8 A;  1ZW7 A;  2MLB A;  3TL5 A;  3ZTD A;  5G2N A;  2V4L A;  2C60 A;  4KZ0 A;  5DCN A;  1RLF A;  2NPT A;  3VDZ A;  2IBI B;  2KJ6 A;  2RD0 A;  1YD8 U;  4TQ0 A;  2BPS A;  2LZ6 A;  2D2Q A;  1OEY A;  3DBS A;  1UZX B;  1L7Y A;  2JZZ A;  1AAR A;  1VD2 A;  4JIO U;  2WYQ A;  3H7P A;  2IO0 B;  1SGH A;  3PPA A;  5E6O A;  2PPH A;  2C9W B;  2ZCC A;  3EEC A;  4MM3 A;  3T8M A;  4GDL A;  4NQL B;  2KD0 A;  2KWV B;  3QIJ A;  1RFA A;  5LXI B;  2BWE S; 
#chains in the Genus database with same CATH topology
 2UWQ A;  1FXI A;  3Q3O C;  1WE6 A;  3BVG A;  2MBQ A;  1ZUD 2;  2MRP A;  3W1S A;  2DAF A;  1BXT A;  4YTM B;  3L54 A;  1C3T A;  2L83 A;  3ZNH B;  1KH0 A;  1SEB D;  1M94 A;  1XT9 B;  1WJN A;  3PHX B;  3KVF B;  2FID A;  3GS2 A;  1QQR A;  1N61 A;  2KKC A;  4LNK A;  5KHO A;  2CU1 A;  2WDQ B;  3FKY A;  2KQ7 A;  2CR5 A;  4KIK A;  4BZA A;  2FCS A;  2L3Z A;  1YJJ A;  2PE9 A;  2CHX A;  4W9E A;  1IUE A;  1K50 A;  2ZVN A;  3BYY B;  2PE6 B;  4NJ6 A;  1GNU A;  1I4G A;  5HKH A;  4M8N A;  5BYS A;  3ZJU A;  4ASW C;  5T8I A;  1OQR A;  3A9K B;  5FKA C;  4ZRQ A;  1XQQ A;  2RDH A;  5BYR A;  1B9R A;  4G0N B;  2KC1 A;  2OHF A;  3HRD D;  3VRA B;  4KZC A;  1QOB A;  3BIN A;  1WXQ A;  2KN4 A;  2NBV B;  3JSV B;  1TS3 A;  2BVC A;  3ZGZ A;  2FNJ B;  5GMV A;  2ZJD A;  4HVB A;  5IKC M;  1WGK A;  3APF A;  3BY4 B;  1CQV A;  1X1M A;  4WQM A;  4WQO B;  2LGY A;  1YIW A;  3SHQ A;  3DHG C;  4FN2 A;  2PW9 A;  3ONS A;  3MJW A;  3FIL A;  4N59 A;  2MWS B;  2QSD A;  1Q0W B;  2LVQ A;  3ZUN A;  1SXT A;  3SFD B;  2G4S A;  3IVF A;  1RFK A;  1FCC C;  4L23 A;  2J53 A;  1C4A A;  2V3S A;  2B76 B;  1D6E C;  4R3D A;  2W9N A;  3R7R A;  4C80 A;  3AE8 B;  4AOF A;  3AED B;  1EWC A;  5E6J A;  4OW0 A;  2IY1 B;  2W3S A;  3RNE C;  1V86 A;  3GE8 C;  4GOC A;  4B0M A;  2L00 B;  2WU5 B;  2AQ3 B;  1PYW D;  2FUG 1;  1YJI A;  1P3Q U;  3VXW A;  3J9C A;  1ZE3 D;  1F52 A;  1OFF A;  2DHZ A;  4M01 A;  5C2T B;  2O2V A;  4ZYS A;  2L05 A;  3PZ8 A;  2DZK A;  4W9L A;  2KDE B;  4RF0 A;  5BO4 B;  1CK1 A;  4NAW A;  4NJ7 A;  2X8X X;  2DX5 B;  3NVV A;  3V3X A;  2AYO B;  4YSX B;  2D3C A;  4M0W A;  3RYT A;  1WR1 A;  2MCN B;  3R8B A;  5TSS A;  2HTM E;  2KYW A;  5IN7 A;  3KW5 B;  4MEL A;  3IXS A;  2LGD A;  1F77 A;  3AXC A;  2BW2 A;  2XK5 A;  1Y8R C;  3DCG A;  2BYF A;  1EU3 A;  2G1E A;  2G45 B;  2WQY B;  5C23 A;  4JE3 B;  1DGJ A;  2WNM A;  4ANW A;  2D3G A;  2HE7 A;  4E74 A;  3I9V 1;  3N20 C;  3FC4 A;  3RNB C;  2BGF A;  3OJ3 A;  4JWS C;  3VTU A;  2DZJ A;  1TZ1 A;  4HK2 A;  3HIZ A;  1SJH D;  2GI9 A;  5G5H A;  3ZRC A;  2PTL A;  1WMH B;  2KQS A;  2BT6 A;  2D07 B;  3MC9 A;  3A9J B;  2WXF A;  2KDB A;  3AB5 A;  3N1Z C;  2LI5 A;  2C5L C;  3B08 A;  3HUI A;  5FK9 C;  5EE1 A;  2V4I B;  1XCT L;  2QHO A;  3LYY A;  4KDI C;  3VR9 B;  4DHJ D;  1XCQ L;  2KDI A;  2KAJ A;  3P4S B;  3I57 A;  1I4R A;  2H89 B;  2G3Q B;  4HKQ A;  3ZO5 B;  4CQN A;  4LNO A;  2LGS A;  4FLH A;  2V3N A;  4ZYN A;  1L4Z B;  3VUW A;  5EE9 A;  4JPS A;  5IP4 D;  4WAF A;  3NS8 A;  2DWQ A;  4YXD B;  3P1M A;  4B95 A;  1ISN A;  4BAX A;  4K7W A;  1P98 A;  4RGT A;  4D2K A;  2GOW A;  3DVN V;  4XDD A;  3R7Q A;  3A1Q B;  3V05 A;  3NJT A;  4NAM A;  3AN1 A;  1V81 A;  4BKS A;  4A3P A;  2CS4 A;  4IWO A;  3ZTC A;  2LXC A;  4JX1 C;  4EE2 A;  4W9J A;  1NEN B;  4ZRI A;  3VQI A;  3VH4 B;  1C1Y B;  1UNS A;  4IKG A;  1DYQ A;  4ZRK A;  2VRR B;  4HXD A;  1F0Z A;  3ZDT A;  4II3 B;  2K8H A;  1WRI A;  2MP2 B;  3M62 B;  4MGY E;  4FUL A;  4RMA A;  3Q8F A;  3DVG Y;  2W3R A;  2D3A A;  4FJZ A;  1ZXH A;  3PRZ A;  1C4C A;  3JSV A;  2LJ5 A;  3UIN B;  4W9H A;  1K53 A;  3GZN B;  2ASQ A;  3B1L X;  3BWU D;  3X0W A;  1CZP A;  1I7H A;  5CHV C;  4HDO A;  2MBO A;  3AE6 B;  2JT4 B;  3P4Q B;  3JW0 X;  1MHH E;  1TS5 A;  2NPT B;  3A4R A;  4FJY A;  2MW5 A;  1FNW A;  1CMX B;  3DHH C;  3GB1 A;  3NHE B;  3W2D A;  2JQR B;  4ARC A;  2MBE A;  2N9E B;  1UUP A;  4IWP A;  2WX1 A;  2AQ1 B;  2B3A A;  1I4P A;  4ZRP A;  3DBL I;  4C7Z A;  1JRU A;  2EKI A;  4MJS B;  4S0R A;  4KDL B;  3TCA A;  3AM9 A;  1FM0 D;  1K52 A;  2RR9 A;  4LLG M;  1C76 A;  4P1B C;  2G4D B;  5AZH A;  3LB8 C;  2EMT A;  1HZ5 A;  4TKN A;  3RUI B;  2AQ2 B;  2N4F A;  2SAK A;  1ZP0 B;  3PHW B;  3SEB A;  3WAO A;  3WCQ A;  3WAM A;  4QAY A;  4A9A A;  1XD3 B;  2Z0D B;  3T3N A;  1AN8 A;  2BS4 B;  2YEP B;  3AE4 B;  1WRD B;  1H4R A;  3EGR A;  4TV3 A;  4IWQ A;  4AWJ A;  4GLS C;  2IO1 B;  4RNA A;  4FHK A;  2KOX A;  1VZ8 A;  2K6D B;  3MHS D;  4KIK B;  4YSY B;  2ZW0 A;  2ZVO A;  2GLS A;  2EKE C;  2KMM A;  4P1C C;  2FCM A;  2RDB C;  1XEE A;  3H7S A;  3Q3J A;  5D94 A;  1N6Z A;  3ZTD A;  2LFI A;  5G2N A;  2V4L A;  2C60 A;  1KRH A;  5DCN A;  3DWM A;  3W5V B;  2IBI B;  2KJ6 A;  1YD8 U;  1EWY C;  2LZ6 A;  5D3D A;  3AEE B;  1OEY A;  2IGG A;  1SSN A;  1VJK A;  1UZX B;  4NJC A;  1HZ6 A;  1AAR A;  2Z8L A;  3H7P A;  2JX5 A;  2ZCC A;  3FAH A;  2CU3 A;  2WXP A;  1KLG D;  4G11 A;  1FO4 A;  2JZ3 B;  1WH3 A;  1S1Q B;  3UF8 A;  2UYZ B;  2WXO A;  1TGZ B;  2TSS A;  1K51 A;  4HJK A;  1V5T A;  1V1O A;  1IGD A;  3FIL B;  3B0A A;  3RPF C;  4MSQ B;  5DPW A;  4TQ1 A;  2BKR B;  3Q8A A;  2QIL A;  2N9L A;  4BBN C;  4II2 B;  4AJW A;  4PS3 A;  4XZ4 A;  3AEB B;  1T0Y A;  1J7A A;  2FBW B;  1WGD A;  3EHV A;  1PFD A;  4MH0 E;  2L8J A;  1L5P A;  1RRB A;  1EU4 A;  3NOB A;  2KWC A;  3NZS A;  4K81 A;  4UDU C;  5IA7 A;  3AE2 B;  1ACC A;  4MH8 A;  3N9Y C;  3NVY A;  1STE A;  2KX0 A;  3MP9 A;  1SJE D;  4GXB A;  1WJU A;  3NS1 A;  4LCD E;  3N1Y C;  3PVL A;  4MSM B;  3Q3M C;  3RZF A;  5JXV A;  3PZD A;  4NAW B;  2JZP A;  5E6P A;  2KTF A;  4REZ A;  1C4P A;  2E6X A;  3RT3 B;  2OOB B;  5LLI A;  1H8C A;  4KKJ A;  3DDC B;  2Y5B B;  5JH5 C;  2KWU B;  3PRP B;  2LMC A;  4K7U A;  2VZK D;  2K0P A;  4A20 A;  1J19 A;  2LVO A;  5BMG A;  2M0X A;  4BKT A;  1PQS A;  2JXX A;  4IW0 A;  1R4N I;  2YLM A;  4RF1 A;  1F9J A;  1UGM A;  1LXD A;  4H2A A;  3LJ3 A;  3APC A;  2FCQ A;  1OGW A;  1SE2 A;  2AL6 A;  3M3J A;  4EOY A;  3KUC B;  2C7N B;  1HE8 A;  3AEC B;  1ESF A;  3N1X C;  2BS3 B;  4YT0 B;  1FEH A;  3BYT B;  3KWL A;  4MJS A;  5BYQ A;  1C79 A;  1IP9 A;  1WX8 A;  1I35 A;  2KK8 A;  2HD5 B;  3RD2 A;  3Q8C A;  2X38 A;  1P0R A;  3Q14 C;  3PSE B;  1TBE A;  1WZ0 A;  1HEZ E;  1UGJ A;  1AWD A;  3UQA A;  1L2N A;  1LQB A;  2J0M A;  4HRO A;  3AEG B;  1N5W A;  2L1A A;  1I4H A;  2KFK B;  3X23 A;  4LTU A;  2K8C A;  3U8Z A;  4BFR A;  4A90 A;  1SE3 A;  5D6J B;  2ICI A;  1K8R B;  1P9D U;  2FUH B;  5JHB A;  4YL8 A;  2KJR A;  1FRD A;  2KO3 A;  2KFJ A;  1E7P B;  3L16 A;  3VTV A;  2QDF A;  5D3I B;  4WJQ A;  2BF8 B;  2NTS A;  1V9J A;  5TR5 A;  4KGR A;  1GB4 A;  4S17 A;  2WLB A;  4OVU A;  4JLC A;  1GC7 A;  2KZR A;  3ZXR A;  2Y5P A;  4DK5 A;  2ONQ A;  1JWM D;  4AP4 C;  4W9D A;  1CJE A;  3SD5 A;  1WXS A;  3LDZ E;  1FPY A;  4XC2 A;  2IGH A;  1JML A;  2R61 A;  2O6V B;  2D3B A;  2INP E;  1HA5 A;  3TSS A;  1AYF A;  4GB9 A;  1WXM A;  1N63 A;  5BMH A;  1Q1O A;  3RZW C;  4KKI A;  2D5G A;  2N9K A;  1QF6 A;  4HJG E;  1MG8 A;  1IPG A;  3RI7 C;  4B9K A;  1TY2 A;  4XX5 A;  5LNK 1;  1L6U A;  1E6E B;  4C4V A;  1YQB A;  5IO9 A;  2RDG A;  3SFE B;  1GAQ B;  3AU4 A;  2LVP A;  3KUD B;  3DVN U;  4PYU A;  3ZYY X;  4IC7 B;  3IG3 A;  1QKZ A;  2MA9 B;  2NVU I;  5AZF A;  4BVU C;  1RYJ A;  1WX9 A;  4P6V F;  2I2Y A;  2JWU A;  1EUV B;  1QOF A;  4ITK A;  1VCB A;  3KUZ A;  2LJI A;  2KC2 A;  3BVM A;  1WGG A;  1IYF A;  2JRH A;  3AV8 A;  2GBM A;  4MDK E;  3VRB B;  4L1B A;  3P4P B;  2CJN A;  3C19 A;  4A8X C;  4LNI A;  5EE0 A;  2MX2 A;  3VHT C;  1WXV A;  3PZ7 A;  3V61 A;  3EFU A;  4J3O D;  2VH2 A;  2LEK A;  1HTQ A;  3L08 A;  4BOS C;  4HPL B;  2MEK A;  2LXA A;  1E8Z A;  1ET9 A;  5L95 C;  3RFZ B;  3Q69 A;  1D4B A;  4GN1 A;  1R4M B;  1DOI A;  4IM3 A;  1NBF C;  1V1P B;  5CX3 A;  3AE5 B;  3R2T A;  4MAC A;  2GRI A;  1TYG B;  2MHJ A;  1B1Z A;  2PKO A;  5J18 A;  3IAM 1;  3PRM B;  1GJZ A;  3OLM D;  2JY6 A;  2WXG A;  2N9P C;  1LGR A;  3H7P B;  5CHF A;  2PIA A;  4OZB A;  3HHM A;  3MFG A;  3URY A;  1XLP A;  1I42 A;  3P63 A;  2QMT A;  3AEF B;  2DYO A;  2KJH B;  3UIO B;  1UWX A;  2J0K A;  3DVG X;  1WGY A;  1A70 A;  2J4X A;  4ICV A;  4LDT D;  2QIE B;  4J6I A;  3PLU A;  3LXF A;  4ANX A;  4I6L B;  1V2Y A;  4LNF A;  4NPN A;  4TMA B;  2LD9 A;  3MJ5 A;  2E3T A;  2WXQ A;  3ENE A;  1T3Q A;  2Z59 B;  3UIP B;  3B2F A;  3TBL D;  2ZNV C;  1EF5 A;  4YTN B;  2ON8 A;  5EE3 A;  3TIX A;  3QC8 B;  2KFK A;  2BS2 B;  4DDG D;  3DHI C;  3M95 A;  3TEX A;  2EMS A;  1WXA A;  4EFO A;  2PVG C;  3W9C B;  2BTE A;  1OTR B;  3L0W B;  4KSL C;  3ETR A;  2ZCB A;  3V62 A;  1J7C A;  3NVZ A;  1M4V A;  4WH4 A;  3QK0 A;  3B2G A;  1WY8 A;  1ZW7 A;  4HKZ E;  3AH7 A;  1TT5 B;  4Q2J A;  2KAC A;  1RLF A;  3VDZ A;  2BPS A;  2D2Q A;  2JZZ A;  1VD2 A;  2WYQ A;  1F2R I;  2C9W B;  4GDL A;  2K3U A;  2WXL A;  2HDE A;  1ZDX A;  1GOZ A;  1YOV B;  2K5P A;  1FNV A;  5I4D A;  1V80 A;  2K1F A;  4RGO S;  2DZI A;  2RMM A;  3OAW A;  2O6V A;  4M00 A;  3RNA C;  2JUO A;  2KX3 A;  1KF6 B;  4RGN A;  3U7Z A;  4ZOH C;  1XO3 A;  1V49 A;  2KQ4 X;  1VRA B;  3ZKJ C;  2JXT A;  3P2B A;  3ZIM A;  2BYE A;  1L0X B;  4O1N A;  4CYE A;  2XEW A;  1HQR D;  2IGD A;  4DDI D;  4I6N B;  2QEJ C;  2EEL A;  3U4E G;  4ANU A;  3TJP A;  2SEB D;  4A3O A;  3EC8 A;  4ZHO A;  3MC0 B;  4M02 A;  2NCN A;  2Y5C A;  2N1V A;  1WI0 A;  3AE3 B;  3RN9 C;  1FNU A;  1GUA B;  3SDL C;  2BYV E;  4MGK E;  2MJ3 A;  2KVR A;  2R2O A;  4DBG A;  1WYW B;  1YQ4 B;  4DHJ B;  1R4M I;  4F8C B;  2JYT A;  1E5W A;  2KDF B;  2NBU A;  4GDK B;  5LXH A;  4PS8 A;  1JWA D;  1ZGU B;  4B6W A;  3PRE A;  2LUE A;  1E7V A;  2IY0 B;  3BK1 A;  3H6N A;  4WWP A;  5BMI A;  1VR9 A;  2I1J A;  3NUH B;  4DWF A;  3AEA B;  2WXR A;  1U4A A;  1WM3 A;  4BKG A;  1MJD A;  1WIA A;  4MT5 A;  4LK0 M;  1WM2 A;  4WJN A;  1AW7 A;  3L13 A;  1YN3 A;  1T0R C;  3VVW B;  1JQ4 A;  1PUT A;  3QWZ B;  3NG0 A;  2MH7 A;  4HCP B;  3ZJT A;  4W9F A;  3ZRF A;  2KNB A;  3IFW B;  2LUM A;  3Q3F A;  1V1P A;  2WP9 B;  1PGX A;  1MPE A;  3L17 A;  5J17 A;  5AZG A;  2AWT A;  1LFD A;  1VZ6 A;  4FAD A;  2JRI B;  5KHQ A;  1FFV A;  2BWF A;  4NZL B;  4USA A;  1E8X A;  1G6J A;  1JWB D;  1JWS D;  1QOG A;  2XNA C;  3V6E B;  3Q3N C;  4ZHP A;  2PVO D;  3Q8E A;  4F1S A;  1WWT A;  4KGT A;  4P7I A;  1VLB A;  1E7U A;  4BOZ B;  1UWM A;  3ABV B;  1J0G A;  1FIQ A;  3O13 A;  2FIF A;  5AUI A;  1TKY A;  3U52 E;  4C4V B;  2MJD A;  1GB1 A;  1UBQ A;  1MHX A;  2KHW B;  4M8M A;  1TS4 A;  1E9M A;  3RNG C;  2ACZ B;  2CHW A;  3RUL A;  2CJO A;  3K9O B;  4AQ7 A;  4HDQ A;  4W9C A;  3QA8 A;  1Z5S B;  2Z0E B;  1WYG A;  4W9I A;  2K22 A;  3GZN I;  3AMZ A;  1MVK A;  3RMK C;  2KTR A;  3KYD D;  4N9F 4;  3IHP C;  3QAQ A;  2A5U A;  2KMA A;  3QQ8 B;  1N5X A;  1R7S A;  2DBY A;  1QZE A;  1D5M C;  2AEH A;  2WHI A;  3JYU A;  1UF0 A;  3KLS X;  5DPR A;  1Q10 A;  2LHE A;  4GU2 A;  4WUR A;  4EZL A;  3O65 B;  3OJ4 B;  1WZ3 A;  1RWS A;  1KOT A;  4ARI A;  2WS3 B;  1WJ4 A;  2LGX A;  3E9S A;  3H9D A;  2R2Q A;  1PDX A;  4MGI E;  3SU8 X;  4LJO B;  2YEP F;  4ZDV A;  2IPK D;  2N0S B;  1LM8 B;  2GBR A;  3ECI A;  1NDD A;  2KLC A;  2K9X A;  3N30 A;  4WJO A;  3NY5 A;  1QT9 A;  4KV2 A;  1WR6 E;  1N60 A;  3Q6B A;  3HVZ A;  4KSK C;  3D32 A;  4RM8 A;  1ROE A;  3VAW A;  1E8Y A;  1UH6 A;  2ZPY A;  2PLP A;  3QCA A;  2NTT A;  2V0G A;  1L0Y B;  4OZC A;  3DQV A;  5CHW A;  4C00 A;  4K3B A;  1IBX A;  1IGC A;  3DWG C;  2LAS A;  2DAJ A;  1WF9 A;  4X57 B;  5GXG B;  1HXY D;  3N3K B;  5AUK A;  2L76 A;  2KVZ A;  3WIM A;  3W1Y A;  4FJV B;  4GDK A;  2RSU A;  2YVC A;  3U30 A;  3VFK A;  1DOY A;  5FR3 A;  2IND C;  2WX0 A;  1C77 A;  1XLO A;  3QAR A;  4WIP A;  4EUT A;  2IYD B;  1YN5 A;  2LWP A;  1SE9 A;  1TKE A;  1E0Z A;  3CF6 E;  2INN E;  5AEK B;  3ALB A;  3ZJV A;  3WAL A;  3A4S C;  3UGB B;  1FRR A;  4IUM B;  3CSF A;  1ZXI A;  1P7F A;  3UQB A;  2L32 A;  1WGH A;  3IBE A;  4FHJ A;  2PJH A;  4G50 A;  4FA6 A;  1F1H A;  4AS1 A;  3HK0 A;  1YN4 A;  2GMI C;  3APD A;  1SBB B;  2KMC A;  3NZU A;  4XGA B;  1KFY B;  1WGR A;  2C7M B;  4GDL B;  3H1U A;  4WWM A;  1JW9 D;  3MTN B;  1S3S G;  2GBK A;  4URK A;  2V1Y A;  3QX1 A;  1V6E A;  2I1K A;  4NQK E;  4L2Y A;  1Y56 A;  4GGQ A;  3TEY A;  2VZK B;  3VH3 B;  3ZVV A;  4P16 A;  4RH6 A;  1JAL A;  4YSZ B;  1SB3 C;  4LJP B;  2W82 A;  4YTP B;  2IO2 B;  4E71 A;  3GE3 C;  5E6N A;  3T9L A;  3TEZ A;  1TS2 A;  2REX A;  1MG4 A;  3AU5 A;  2JYE A;  2NS5 A;  2D10 A;  1SE4 A;  3KH0 A;  5CTR C;  4HPM B;  5D7G A;  1SF0 A;  2N7D A;  4DQO C;  4HLE A;  3DBH B;  1XXG A;  2OED A;  5JHA A;  4W9K A;  1WFY A;  1OEY J;  1Z2M A;  2KAN A;  3ZW3 A;  4WWN A;  4DXA B;  2ZNV B;  3T3O A;  2I38 A;  2QCZ A;  3N32 A;  1BML C;  3PO0 A;  3TL5 A;  4XE0 A;  1ET6 A;  1NYR A;  3EA6 A;  1L6V A;  3DBS A;  2KWD A;  4N6E B;  1L7Y A;  1JRO A;  2IO0 B;  4RCO A;  5E6O A;  2PPH A;  3EEC A;  3T8M A;  4MM3 A;  3U2S C;  4NQL B;  1PGB A;  2KD0 A;  5LXI B;  2XN9 C;  2BWE S;  1T0Q C;  2DZM A;  4A55 A;  5IAA C;  1Q5W B;  4EZK A;  1GPX A;  3QJZ A;  2DEN B;  2N7E A;  3ZXV A;  2K8B A;  2N9X A;  4GIV A;  2HTH A;  2D11 A;  3VUX A;  2NMQ A;  1D5Z C;  1J7B A;  1L4D B;  1VZ7 A;  4XWT A;  2MBB B;  1E8W A;  1YNT E;  3P4R B;  1JCK B;  3C8Y A;  1OQQ A;  2BQQ A;  3DBL B;  4OHJ A;  3SR6 A;  4DHZ B;  1DOX A;  3Q8B A;  5HHD G;  4OZA A;  5C1Z A;  2ZZP B;  5DPT A;  5MPO A;  3VR8 B;  2MJE A;  3C0R B;  3WA0 A;  1FD6 A;  1VDV A;  2HJ8 A;  1NEK B;  1ENF A;  1I4X A;  1ZOY B;  2RPV A;  1J8C A;  5FR6 A;  4K1R B;  1KM7 A;  1V97 A;  2LRU A;  4ICU A;  3U7D A;  1JWU D;  4E3C A;  2M8S A;  2IJ0 A;  4GSW A;  3ZLZ A;  2WDR B;  3EUB 2;  3AI5 A;  5C3J B;  3M63 B;  4PYZ A;  1YMH E;  1P1A A;  3RNF C;  4MEM A;  1T6B X;  2J42 A;  4IG7 B;  5J2R A;  2JVC A;  1F2R C;  2WDV B;  5G5G A;  3W5U B;  2Q5W D;  4ANV A;  1YQ3 B;  4HCN B;  2L52 A;  3S2A A;  1FCL A;  1BUI C;  3MC8 A;  2M4N A;  3HM3 A;  2M0A A;  4FBJ B;  5L83 A;  3NVW A;  2WXK A;  1TTN A;  2LGI A;  2GBJ A;  1T0S C;  3PLV A;  4I6P A;  3DBR B;  4DXF A;  2J7Q B;  2J0J A;  3RNC C;  1NYQ A;  2KTR B;  4EZJ A;  4G3X B;  3PT2 B;  2Y3A A;  3AUL A;  3PGE A;  3R2I A;  2JF5 A;  1NVI D;  1WSP A;  1XLN A;  5H8Y E;  2K6Q A;  4ACF A;  2IDY A;  4F7Z A;  3VTW A;  4US8 A;  3I5J C;  1HTO A;  3DBH I;  4RM9 A;  1FXA A;  2KN5 A;  1LO5 D;  1YJ1 A;  3Q2A C;  2C7H A;  2KXJ A;  1QLB B;  2WU2 B;  3NRZ A;  4IM0 A;  3A9K A;  3TEW A;  2LRW A;  2WXN A;  3NZ3 A;  2JU6 X;  3QHT A;  5EDS A;  2M17 A;  2QJL A;  1RAX A;  3ML9 A;  3R3M A;  1KTK A;  3GP7 A;  1D3Z A;  3ZDM C;  3TUO A;  2BB5 A;  3BZD B;  2WGS A;  3K9P B;  2L0F A;  2K25 A;  3ML8 A;  1JRP A;  2FAZ A;  4HPP A;  3BVZ A;  1MFW A;  4EKU A;  4LDT B;  3AE9 B;  3KWV A;  5H92 C;  1IBX B;  3AE7 B;  3KYC D;  4WWO A;  1C9F A;  3R66 C;  3MHZ A;  1E10 A;  5HFY A;  3ZNG C;  1C78 A;  2H88 B;  5D2M B;  2PEA A;  2V3P A;  2DYM A;  2MBH A;  3UI3 A;  4DXG A;  1UBI A;  4HWI B;  1YX6 B;  2WXM A;  1V5O A;  2PMV A;  1WX7 A;  3OWE B;  2ZEQ A;  1E90 A;  2IO3 B;  5IOI A;  4XWW A;  1T5X D;  4RGM A;  4OVV A;  4TSS A;  1R4N B;  4K3C A;  2AL3 A;  1TZO A;  4EEW A;  3AE1 B;  1NI2 A;  3EFC A;  4YWG G;  4B0E A;  5JZE B;  4JL9 A;  2N1W A;  3CIR B;  2N7J A;  1QIL A;  4C56 C;  2WXH A;  4C7Y A;  2DLB A;  1FFU A;  3I3T B;  1FMA D;  2XBB C;  4NNJ B;  2L7R A;  4KGS A;  1FXT B;  2BBC A;  1ZDV A;  2JWZ A;  2WWZ A;  2GB1 A;  2WXJ A;  1WJ6 A;  3DPD A;  1RM6 C;  3P42 A;  4FXC A;  2JPH A;  4W9G A;  4WAA A;  4RFB A;  3WAN A;  2J52 A;  2M19 A;  2HJ1 A;  2RGF A;  4KVG B;  4AJY B;  1GC6 A;  2RPQ A;  3E56 A;  2NBW B;  3DBR I;  2WXI A;  1NI3 A;  4A6Q A;  3A33 B;  1A5R A;  3CST A;  2M56 B;  3HVD A;  5G55 A;  3BK2 A;  5HI1 A;  1WMH A;  1L0V B;  2FCN A;  1XF5 L;  2A4Z A;  2INC C;  2DYB A;  1TY0 A;  4IOI E;  3GOE A;  3A9J A;  2G9H D;  3JVZ X;  2BB6 A;  2AX5 A;  1XLQ A;  2JSV X;  3ZQ4 A;  4US9 A;  2CKH B;  2KLG A;  3IT4 B;  3PS6 A;  3DOW A;  2WDT B;  2VH1 A;  1N62 A;  4WJP A;  2NR2 A;  1MI0 A;  5HG2 A;  2FE8 A;  2DNF A;  4PT5 A;  3PV1 A;  1ZPS A;  3CWI A;  1KLV A;  2QC8 A;  1EM7 A;  3W1S C;  3V60 A;  4K7S A;  3ZNI D;  1PGA A;  3V6C B;  3I63 C;  4MM3 B;  1SIJ A;  3HM6 X;  1TJE A;  3BII D;  3VUY A;  4PK1 A;  2ZW1 A;  4JGH B;  1EF1 A;  2CHZ A;  4PS7 A;  1SIF A;  4XYC A;  4CHK A;  3A1Q A;  1ZKH A;  1OQY A;  4BKS D;  3L10 B;  2K39 A;  1TIF A;  4OVZ A;  2O2V B;  3IT6 B;  4TUU A;  4JQW C;  1QOA A;  1WE7 A;  2KDM A;  1UD7 A;  2MSE D;  2BYT A;  4BBN F;  2MQJ A;  1GG3 A;  2OJR A;  3TMP B;  4N58 A;  4JWU C;  1EO6 A;  2W54 A;  2V9H A;  4M0W B;  2OJW A;  4ZRJ A;  1UEL A;  2L0T A;  2MP2 A;  4HRS A;  4KX6 B;  2M1M A;  4DHZ E;  2BKF A;  2UU7 A;  5DPS A;  3B9J A;  3WAP A;  2GBN A;  3CMM B;  1P7E A;  2ZPN A;  2LHD A;  4MGZ E;  1KJT A;  2O6V D;  4IDI A;  4NY0 A;  3OG5 A;  2KT7 A;  4HEA 1;  1YX5 B;  2XK5 B;  3RCZ A;  4IM2 A;  3IAS 1;  2IZV B;  3PTF C;  3ZNZ B;  4AUQ C;  4GMV A;  4LNN A;  1BT0 A;  3H8H A;  4CO7 A;  2MLB A;  1TKG A;  4KZ0 A;  1KLU D;  1V8C A;  1I4Q A;  2NPT A;  1D5X C;  2W55 A;  2RD0 A;  4TQ0 A;  4JIO U;  3PPA A;  1SGH A;  4XDC A;  3KQ4 A;  3L4P A;  2KWV B;  3QIJ A;  1RFA A; 
#chains in the Genus database with same CATH homology
 4G11 A;  2DZM A;  2JZ3 B;  2UWQ A;  1WH3 A;  5IAA C;  1WE6 A;  1Q5W B;  4EZK A;  3QJZ A;  1V80 A;  2K1F A;  2DEN B;  2MBQ A;  1S1Q B;  2N7E A;  2DZI A;  2K8B A;  2N9X A;  2MRP A;  4GIV A;  3UF8 A;  2HTH A;  3OAW A;  2O6V A;  2D11 A;  3W1S A;  3VUX A;  2JUO A;  2KX3 A;  2UYZ B;  1TGZ B;  2DAF A;  3L54 A;  1C3T A;  3ZNH B;  2MBB B;  4HJK A;  1E8W A;  1M94 A;  1XT9 B;  1V49 A;  1WJN A;  1V5T A;  3PHX B;  3KVF B;  3ZKJ C;  2FID A;  3P2B A;  3ZIM A;  2BYE A;  4CYE A;  2XEW A;  3B0A A;  4DDI D;  4I6N B;  4MSQ B;  2KKC A;  5KHO A;  4ANU A;  5DPW A;  4TQ1 A;  2BKR B;  3TJP A;  4DHZ B;  2CU1 A;  4BBN C;  4II2 B;  4A3O A;  4AJW A;  3EC8 A;  5C1Z A;  4PS3 A;  4XZ4 A;  1T0Y A;  2KQ7 A;  2ZZP B;  1WGD A;  3EHV A;  2NCN A;  5DPT A;  2CR5 A;  4MH0 E;  2L8J A;  3C0R B;  4KIK A;  3WA0 A;  1RRB A;  2FCS A;  2L3Z A;  2N1V A;  1WI0 A;  3NOB A;  2PE9 A;  2KWC A;  2CHX A;  3NZS A;  4W9E A;  2HJ8 A;  1GUA B;  3SDL C;  4K81 A;  5IA7 A;  2BYV E;  4MGK E;  2KVR A;  2ZVN A;  1J8C A;  2R2O A;  2PE6 B;  4DBG A;  2KX0 A;  4NJ6 A;  1WYW B;  5FR6 A;  4GXB A;  1GNU A;  1WJU A;  4DHJ B;  4K1R B;  4M8N A;  5HKH A;  4LCD E;  4ASW C;  1R4M I;  4F8C B;  3PVL A;  1E5W A;  4MSM B;  1KM7 A;  2LRU A;  3A9K B;  4ICU A;  3RZF A;  2KDF B;  1XQQ A;  2NBU A;  4GDK B;  3PZD A;  4PS8 A;  3U7D A;  5LXH A;  1ZGU B;  4G0N B;  4E3C A;  2M8S A;  4NAW B;  2KC1 A;  5E6P A;  4B6W A;  2KTF A;  4GSW A;  3PRE A;  2LUE A;  3ZLZ A;  1E7V A;  3AI5 A;  3M63 B;  2IY0 B;  3H6N A;  4KZC A;  3BIN A;  2NBV B;  4WWP A;  3JSV B;  4PYZ A;  3RT3 B;  1P1A A;  2OOB B;  5LLI A;  1H8C A;  4MEM A;  2I1J A;  2FNJ B;  4DWF A;  3DDC B;  2Y5B B;  5GMV A;  1U4A A;  1WM3 A;  4IG7 B;  4BKG A;  5JH5 C;  5J2R A;  2ZJD A;  2KWU B;  2JVC A;  4HVB A;  1WIA A;  4ANV A;  1WM2 A;  3PRP B;  4WJN A;  4HCN B;  3S2A A;  4K7U A;  3APF A;  2M4N A;  3BY4 B;  1X1M A;  3HM3 A;  3L13 A;  4WQO B;  2LGY A;  3VVW B;  1YIW A;  4FBJ B;  5L83 A;  4A20 A;  1TTN A;  1J19 A;  3SHQ A;  2LVO A;  4FN2 A;  2GBJ A;  3QWZ B;  3PLV A;  4HCP B;  4I6P A;  2M0X A;  4W9F A;  3ZRF A;  2KNB A;  3IFW B;  2J7Q B;  3Q3F A;  1PQS A;  4BKT A;  2JXX A;  2J0J A;  3ONS A;  4IW0 A;  1R4N I;  3MJW A;  2KTR B;  2YLM A;  4EZJ A;  4G3X B;  1F9J A;  1UGM A;  1LXD A;  2MWS B;  3PT2 B;  3AUL A;  3LJ3 A;  1Q0W B;  2LVQ A;  3PGE A;  3APC A;  3ZUN A;  2FCQ A;  1OGW A;  2JF5 A;  3L17 A;  5J17 A;  2G4S A;  3IVF A;  5AZG A;  2K6Q A;  2AWT A;  1LFD A;  2AL6 A;  4FAD A;  2V3S A;  2JRI B;  3M3J A;  4EOY A;  3KUC B;  2C7N B;  5KHQ A;  2BWF A;  2W9N A;  3R7R A;  1E8X A;  1G6J A;  1HE8 A;  4F7Z A;  3VTW A;  4AOF A;  3DBH I;  2IY1 B;  1IP9 A;  4MJS A;  1V86 A;  4GOC A;  1WX8 A;  3V6E B;  1I35 A;  4RM9 A;  2KK8 A;  2KN5 A;  4F1S A;  2HD5 B;  2L00 B;  3RD2 A;  4P7I A;  1P0R A;  1YJ1 A;  1E7U A;  4BOZ B;  2C7H A;  3PSE B;  2KXJ A;  1P3Q U;  1TBE A;  1J0G A;  1WZ0 A;  3VXW A;  2DHZ A;  3UQA A;  2O2V A;  4IM0 A;  2L05 A;  1L2N A;  1LQB A;  2DZK A;  2J0M A;  3A9K A;  4W9L A;  2FIF A;  2KDE B;  2LRW A;  5BO4 B;  4NAW A;  4NJ7 A;  3QHT A;  2KFK B;  2M17 A;  5EDS A;  3X23 A;  1RAX A;  2DX5 B;  3ML9 A;  3R3M A;  1UBQ A;  2AYO B;  2KHW B;  3RYT A;  4M8M A;  1WR1 A;  1D3Z A;  2K8C A;  3ZDM C;  2MCN B;  3U8Z A;  4BFR A;  5D6J B;  2CHW A;  1K8R B;  1P9D U;  2FUH B;  3K9P B;  3RUL A;  2L0F A;  3KW5 B;  4MEL A;  2K25 A;  5JHB A;  4YL8 A;  2KJR A;  2KO3 A;  2KFJ A;  3ML8 A;  3K9O B;  2LGD A;  2FAZ A;  3AXC A;  4EKU A;  4LDT B;  3L16 A;  4HDQ A;  3VTV A;  4W9C A;  3QA8 A;  4WJQ A;  2XK5 A;  2BF8 B;  1V9J A;  1Y8R C;  3DCG A;  2BYF A;  5TR5 A;  1Z5S B;  2Z0E B;  3KYC D;  4W9I A;  2G45 B;  4WWO A;  5C23 A;  3R66 C;  4OVU A;  3ZNG C;  4ANW A;  3GZN I;  2D3G A;  4JLC A;  2HE7 A;  4E74 A;  5D2M B;  1GC7 A;  2PEA A;  2DYM A;  2MBH A;  2KZR A;  2BGF A;  2KTR A;  3KYD D;  4N9F 4;  3OJ3 A;  3VTU A;  2DZJ A;  3IHP C;  1TZ1 A;  3QAQ A;  4HK2 A;  4DK5 A;  3HIZ A;  1UBI A;  2A5U A;  2KMA A;  3QQ8 B;  3ZRC A;  4HWI B;  4AP4 C;  1YX6 B;  4W9D A;  1WMH B;  3SD5 A;  1WXS A;  2KQS A;  1QZE A;  2D07 B;  3LDZ E;  2AEH A;  1V5O A;  3A9J B;  2KDB A;  3JYU A;  4XC2 A;  1WX7 A;  2ZEQ A;  1E90 A;  2LI5 A;  2O6V B;  2C5L C;  5DPR A;  2IO3 B;  3B08 A;  4GU2 A;  2QHO A;  4OVV A;  4KDI C;  2AL3 A;  4EZL A;  3O65 B;  4DHJ D;  2KDI A;  3OJ4 B;  4GB9 A;  1WXM A;  4EEW A;  1WZ3 A;  1NI2 A;  1Q1O A;  1KOT A;  3RZW C;  1WJ4 A;  2LGX A;  5JZE B;  4JL9 A;  2N1W A;  1MG8 A;  1IPG A;  3H9D A;  2R2Q A;  2G3Q B;  4MGI E;  3SU8 X;  3ZO5 B;  4LJO B;  4FLH A;  4B9K A;  4XX5 A;  4ZYN A;  3I3T B;  4ZDV A;  2XBB C;  4NNJ B;  1YQB A;  1LM8 B;  2L7R A;  2GBR A;  3VUW A;  3ECI A;  1NDD A;  2KLC A;  1FXT B;  3AU4 A;  2LVP A;  3KUD B;  3NS8 A;  3N30 A;  4WJO A;  3DVN U;  2JWZ A;  3NY5 A;  4PYU A;  2WWZ A;  4B95 A;  4IC7 B;  1ISN A;  3IG3 A;  4K7W A;  1P98 A;  4KV2 A;  1WR6 E;  3UIO B;  1WJ6 A;  2MA9 B;  3DPD A;  2NVU I;  5AZF A;  4KSK C;  4BVU C;  3D32 A;  4RM8 A;  2GOW A;  1WX9 A;  3DVN V;  3R7Q A;  2JPH A;  3A1Q B;  3VAW A;  4W9G A;  1EUV B;  1E8Y A;  1UH6 A;  2ZPY A;  4WAA A;  3QCA A;  1V81 A;  4BKS A;  4A3P A;  1VCB A;  2CS4 A;  3KUZ A;  3DQV A;  4IWO A;  3ZTC A;  5CHW A;  2LXC A;  3WAN A;  4W9J A;  2KC2 A;  1IYF A;  1WGG A;  2LAS A;  2DAJ A;  4ZRI A;  3VQI A;  3VH4 B;  1C1Y B;  1WF9 A;  2JRH A;  2GBM A;  2RGF A;  4KVG B;  3N3K B;  1GC6 A;  2RPQ A;  4MDK E;  4X57 B;  4AJY B;  2L76 A;  2NBW B;  4ZRK A;  3DBR I;  3WIM A;  3A33 B;  2VRR B;  2MX2 A;  3W1Y A;  4HXD A;  4FJV B;  3ZDT A;  4II3 B;  2K8H A;  2MP2 B;  4GDK A;  1A5R A;  2RSU A;  3CST A;  3M62 B;  3VHT C;  1WXV A;  3V61 A;  2YVC A;  3EFU A;  3U30 A;  3VFK A;  5G55 A;  4MGY E;  4FUL A;  1WMH A;  4RMA A;  2FCN A;  2A4Z A;  2WX0 A;  3DVG Y;  3QAR A;  4EUT A;  2DYB A;  2IYD B;  3GOE A;  4FJZ A;  3A9J A;  2LWP A;  3JVZ X;  3L08 A;  1SE9 A;  4BOS C;  3PRZ A;  3JSV A;  2LJ5 A;  4HPL B;  3CF6 E;  3UIN B;  5AEK B;  3ALB A;  2LXA A;  3WAL A;  1E8Z A;  3A4S C;  2CKH B;  4W9H A;  3UGB B;  5L95 C;  2KLG A;  2ASQ A;  4IUM B;  3B1L X;  4GN1 A;  3X0W A;  3CSF A;  3PS6 A;  3DOW A;  4IM3 A;  3UQB A;  5CHV C;  1WGH A;  1NBF C;  3IBE A;  4FHJ A;  2PJH A;  2WDT B;  5CX3 A;  4HDO A;  4G50 A;  4WJP A;  2MBO A;  4FA6 A;  2NR2 A;  2JT4 B;  3JW0 X;  5J18 A;  2NPT B;  3A4R A;  3PRM B;  3HK0 A;  4FJY A;  2MW5 A;  2GMI C;  3APD A;  3PV1 A;  1CMX B;  1GJZ A;  3OLM D;  2JY6 A;  2KMC A;  3NHE B;  3NZU A;  1KLV A;  3W1S C;  2N9P C;  3V60 A;  2MBE A;  4K7S A;  2N9E B;  3ZNI D;  3H7P B;  3V6C B;  5CHF A;  4IWP A;  2WX1 A;  1WGR A;  2C7M B;  4GDL B;  2B3A A;  3HHM A;  3HM6 X;  3H1U A;  3DBL I;  1JRU A;  4MJS B;  4KDL B;  3VUY A;  1I42 A;  3TCA A;  3MTN B;  1S3S G;  2GBK A;  4JGH B;  2RR9 A;  2V1Y A;  1EF1 A;  2DYO A;  3QX1 A;  4URK A;  1V6E A;  2CHZ A;  2I1K A;  2KJH B;  4NQK E;  2J0K A;  2G4D B;  3DVG X;  1WGY A;  4PS7 A;  5AZH A;  4ICV A;  1SIF A;  2EMT A;  4CHK A;  3A1Q A;  1ZKH A;  4GGQ A;  4LDT D;  1OQY A;  3VH3 B;  4J6I A;  4TKN A;  3RUI B;  2N4F A;  3ZVV A;  4BKS D;  3L10 B;  2K39 A;  2O2V B;  4TUU A;  3PHW B;  4LJP B;  4JQW C;  1WE7 A;  3WAO A;  3PLU A;  1UD7 A;  2MSE D;  3WAM A;  4ANX A;  4BBN F;  2MQJ A;  1GG3 A;  2OJR A;  2IO2 B;  4E71 A;  1XD3 B;  2Z0D B;  4I6L B;  1V2Y A;  3TMP B;  5E6N A;  3T9L A;  4NPN A;  2REX A;  2LD9 A;  1EO6 A;  3AU5 A;  2NS5 A;  1WRD B;  2D10 A;  1H4R A;  4M0W B;  3ENE A;  3KH0 A;  2Z59 B;  4TV3 A;  4ZRJ A;  3UIP B;  5CTR C;  1UEL A;  2L0T A;  2MP2 A;  2ZNV C;  4IWQ A;  1EF5 A;  2M1M A;  3TBL D;  4AWJ A;  4HPM B;  4DHZ E;  2BKF A;  2IO1 B;  5D7G A;  4FHK A;  5DPS A;  3TIX A;  2N7D A;  3WAP A;  3QC8 B;  4HLE A;  2KOX A;  2GBN A;  2KFK A;  3CMM B;  4DDG D;  2K6D B;  3MHS D;  3M95 A;  4KIK B;  2ZPN A;  5JHA A;  4MGZ E;  1KJT A;  2O6V D;  4W9K A;  2ZVO A;  4NY0 A;  1WFY A;  2EMS A;  1WXA A;  2EKE C;  1OEY J;  1YX5 B;  1Z2M A;  2XK5 B;  4EFO A;  2KAN A;  2FCM A;  3ZW3 A;  1OTR B;  3RCZ A;  3L0W B;  4IM2 A;  4KSL C;  2ZCB A;  4WWN A;  3V62 A;  2IZV B;  3PTF C;  3ZNZ B;  3H7S A;  4DXA B;  2ZNV B;  4AUQ C;  4GMV A;  3N32 A;  3Q3J A;  3QK0 A;  5D94 A;  1BT0 A;  4CO7 A;  1WY8 A;  1ZW7 A;  2MLB A;  3TL5 A;  3ZTD A;  5G2N A;  2V4L A;  2C60 A;  4KZ0 A;  5DCN A;  1RLF A;  2NPT A;  3VDZ A;  2IBI B;  2KJ6 A;  2RD0 A;  1YD8 U;  4TQ0 A;  2BPS A;  2LZ6 A;  2D2Q A;  1OEY A;  3DBS A;  1UZX B;  1L7Y A;  2JZZ A;  1AAR A;  1VD2 A;  4JIO U;  2WYQ A;  3H7P A;  2IO0 B;  1SGH A;  3PPA A;  5E6O A;  2PPH A;  2C9W B;  2ZCC A;  3EEC A;  4MM3 A;  3T8M A;  4GDL A;  4NQL B;  2KD0 A;  2KWV B;  3QIJ A;  1RFA A;  5LXI B;  2BWE S; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...