2RDHA

Crystal structure of staphylococcal superantigen-like protein 11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
RSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREDNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein 11
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 58
structure length 185
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdhA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdhA01
1FGBD 1M4VA 1KLGD 1UUPA 1I4XA 1SXTA 2RDGA 3KLSX 1TS4A 1T5XD 1RF2D 3BZDB 1CT1D 1HXYD 1I4HA 1YN4A 3BVMA 4NZLB 4RCOA 1RCVD 1F77A 1SE4A 2CHBD 4DXFA 2WV6D 3BYYB 1BCPB 1PTOF 1PZJD 1TY2A 1PZKD 2G9HD 1L0YB 1S5ED 1PYWD 1BXTA 4TSSA 1EEFD 1PRTC 5I4DA 1SE2A 1DJRD 1PRTD 1PTOH 5TSSA 3BYTB 2XN9C 1LTAD 5D3IB 1JCKB 1V1PB 3R2TA 1CQVA 3DWPA 1BCPD 4RGMA 1B1ZA 3BVGA 1YN3A 1I4QA 1FNUA 1D5XC 1SBBB 5ELDA 2AQ1B 4RH6A 1CHQD 1EEID 1QILA 4C56C 1PZID 1LTTD 4DXGA 4L63B 1KTKA 1PRTB 4L6TB 1I4PA 1KLUD 1GOZA 1ESFA 1LO5D 1S5CD 1TS2A 1LT6D 3TSSA 1I4GA 1SEBD 3GP7A 3DWQA 1CHPD 1UNSA 3MFGA 3SEBA 1CK1A 2NTTA 1BCPF 1DYQA 1JR0D 2XNAC 1MD2D 5FKAC 1HA5A 1RDPD 1TS3A 1EFID 1ET6A 4BWGB 1G8ZD 1I4RA 1B44D 1SJHD 1EU4A 2R61A 2Z8LA 5ELFA 4RFBA 1JWUD 4K6LA 1LTGD 1SE3A 1LTSD 5ELCA 2TSSA 3BVZA 3W2DA 1LLRD 1STEA 3R8BA 1EWCA 1V1PA 2NTSA 2SEBD 1JWSD 1YN5A 1TY0A 3EA6A 1PRTF 4UDUC 2XRSD 1PTOC 4Z9CB 1LT5D 5ELEA 5D3DA 1L0XB 1V1OA 2IJ0A 1HQRD 4RGTA 1D6EC 2QEJC 1ENFA 4RGNA 4RGOS 1D5ZC 3MC0B 1FD7D 3O13A 4RHRA 3URYA 1JWMD 1AN8A 2O2LD 3OWEB 3V05A 1LT4D 1PTOB 1SJED 1S5FD 2J4XA 4RHSA 1LTBD 1S5BD 4O1NA 2AQ2B 1AW7A 4OHJA 1LT3D 5FK9C 1FNWA 4ZYSA 1HTLD 1XXGA 1FNVA 2IPKD 3EFXD 3CHBD 1S5DD 1ET9A 1LTRD 2AQ3B 5ELBA 1PTOD 1XTCD 1EU3A 3R2IA 1LTID 1BCPC 1JQYD 1TS5A 2ICIA 3DWAA 1D5MC 2QILA 1RD9D 2XRQD 2RDHA
chains in the Genus database with same CATH superfamily
4CJ0B 3NVZA 4BA1I 1GC7A 2EY1A 1EWYC 1SIJA 2PE9A 4DK0A 2LGYA 3KDFA 1IBKQ 2K39A 2A6HC 1D2BA 1WTXA 1N32L 3DVNU 2BWFA 1L1OA 4LF5L 4RCOA 4Y7NH 2MX2A 3VH4B 4HVBA 2PQAB 3T4AC 4A3IB 2KTFA 2FINB 4GOCA 3WWVA 1BBWA 2KAJA 1XTDA 4IM0A 4C3JG 1PYWD 4PQXA 3RNUA 4XDCA 1E8YA 2A5HA 2WXPA 2VL6A 1TU2B 2ZXRA 1DJRD 2K1BA 2Q2HA 1GUAB 3H6NA 2NVUI 2XN9C 5IA7A 2M0AA 3VUYA 1B9NA 4DQOC 5FJ8H 4BXXH 5IYDG 4M0WB 1HHVA 2PZUA 5EBCA 4P7IA 1QVFA 4ZHPA 4W9CA 4X6AH 4DF7A 1VRAB 3AXCA 3DUZA 2F0UA 1SNDA 3RFZB 1GOZA 1WOCA 2CH4W 4WJ4A 3GZNI 5IYBG 2XK5A 2ZTCA 4IN3A 5IT9L 4EQNA 3PIOA 2R93G 1TWHB 1CHPD 1UNSA 3LX0A 3MFGA 2ZCCA 2P5ZX 3OHXC 2Y5PA 1Y8OB 3G71A 3K58A 3JW0X 5FLXc 3MVVA 4A3JG 4QUFA 4HJ9A 4YWMA 2K7VA 5IT9E 4B3ML 4IUUA 2ES2A 3NTIA 2Z4HA 1GC6A 1YI2A 1VZ7A 1SJHD 1KDBA 3BDLA 4W9KA 1EU4A 1A8VA 2KJ6A 2XBBC 3NZUA 2PTLA 1HZBA 3NG0A 3NY5A 3G7LA 4EFOA 4ARIA 3RNCC 5EE1A 3B08A 3HOWB 5LNK1 1YNND 5EBDA 2V3PA 4BY1H 4H7BA 4FXKC 1WGDA 2JX5A 2N9XA 2HTME 1E2WA 2LRWA 1LACA 1CZWA 1PRTF 2IX0A 2C7MB 1IBLL 1TT5B 3ZXVA 2KUMA 5C3WA 1SMYD 1NCVA 3AE2B 2UXDQ 1L0XB 1MSGA 3AMZA 4JPSA 1K53A 4W9JA 1EIGA 1IXRA 4HSPA 2LHEA 1IBKL 4MELA 4Y7NB 3CP0A 1GAQB 2F0HA 4X65Q 2H88B 2HCCA 1GJXA 3TBLD 1D5ZC 4DV1L 3A33B 2LVPA 3Q2AC 2Y0SB 2CW0D 3PZDA 2F0VA 2HHHQ 3S15H 1TXYA 1P8LA 5C44H 1F2ZA 1LM8B 3ZRCA 4MGIE 2XEWA 1ZE3D 4X62Q 4HIKA 1DXMA 4JBJA 3Q8CA 3MA2B 3AEVA 3QAQA 4A3PA 2KOLA 5AZHA 2CFMA 5FOBB 3RMKC 3ZXRA 1Y14B 1Y8PB 4G7OC 2IX3A 3IVFA 4LJOB 1Z6HA 4NJCA 4N8FA 1JOOA 2IY1B 2MJDA 1V43A 4YY3L 4WJOA 1OQYA 2Q8TA 1PGAA 3ND9A 1NE3A 5JVH3 4PZ7A 5I9PA 2LGSA 5CBEE 4MH8A 5DPTA 3KJPA 4ABNA 4ITKA 2ZJRA 4K0KL 3L54A 3DOWA 3Q8BA 3I3TB 5J18A 4LF6Q 3IAYA 1SXTA 3HOVG 5EE3A 2BE5D 5JAVA 3AEBB 5CV4A 3C19A 3S2HH 1SYBA 3TP8A 4BFRA 1DCZA 5C0XJ 4IPCA 3CXCA 2VQEQ 2KQ7A 3ZQ4A 4HCSA 3Q6BA 3FHWA 2WXOA 3NVVA 5D2MB 3M4QA 4GLSC 4TSSA 1PRTC 1N6ZA 4BY7H 3SFEB 1J6QA 3LWUA 1WRIA 3K6OA 1IYUA 4AYBB 3J80L 1OXUA 4E71A 1HFGA 4DKAC 2UU9Q 4KHVA 4BBRG 5IGFA 1U5KA 4FP5D 3SHLA 4CKBA 1O80A 3ERSX 2Q8RE 5D3IB 4EGVA 1WTWA 4BY1B 2FHTA 1QVCA 3DWPA 1E8WA 2OEDA 5KIXA 5CV6A 4DK5A 4GN5A 4EKUA 1AEXA 3MP9A 4A3OA 2FCSA 1I4QA 2NN6I 1I7HA 4CJ2C 1HTPA 3J80E 2HIXA 3W1GA 4EVOA 5GADC 1KDCA 1F9QA 1VQAA 1PRTB 2YU9H 1F9JA 1G6ZA 3U52E 1S5CD 5LLIA 1LXDA 3OIPA 2A6HD 2IBIB 1QJOA 2MO0A 2X6LA 3VDYA 1TWFH 2QDBA 3R3OA 4X3KA 4PYUA 4DUZQ 3S15B 5JZEB 2K28A 5C44B 2D07B 2JQOA 1F52A 5A35A 1VQ4A 5IGBA 3KUPA 1HH2P 2A68D 1WTRA 3V96A 1UWXA 2GA4B 1A5RA 4OWXB 3HOXG 2Z0DB 3KLRA 1N36Q 2RCFA 1L1OC 5KYIA 2DJGC 1WTHA 4HIDA 1GM5A 1V5OA 3RT3B 5C3JB 2ON8A 1V1PA 1C4QA 3CC4A 2LGIA 3AV8A 4KTAA 3Q14C 3TL5A 5IYCG 4LMQD 1X3EA 3MZ5A 1QOBA 5GQOA 4UDUC 4DV4Q 5HHDG 3OG5A 1IGDA 4GLAC 1HZ5A 2V4IB 1WGGA 4W9HA 1G291 3KDFB 4C4VB 2W55A 1YJJA 2K14A 4DK3C 1QZGA 3S2HB 2QC8A 3T51B 1OEYA 1L1OB 1VMCA 1UGJA 3WAMA 4Q5VA 1CQFA 3TP7A 2N9PC 1ASYA 2K04A 1R4NB 4BY7B 2ZEQA 1XMQQ 3L16A 1KLVA 4MSQB 1PMRA 2WB1E 4YWLA 5C0XI 2JA5H 1YHBA 4LLGM 2R7DA 3D8GA 2MEKA 1E5WA 4KY5A 1S5BD 4LUOA 3N9YC 4NJ7A 4NY0A 2UU9L 5IE8A 4LF9Q 1W6JA 1E0BA 1I6HH 3FILA 3R93A 2PQEA 1I50H 1O7ZA 1BDOA 3NBHA 3GTLB 1PFDA 3ZO5B 4XXEA 1BQQT 2CKZB 2YTVA 3KUDB 3ZNID 1BOSA 4GDKB 2YU9B 2PVOD 1JQYD 1SNQA 2R2OA 1XEEA 3PLVA 5L83A 2BBCA 1TGZB 1FJGQ 1UE7A 1JC7A 1TWFB 5G55A 3HOYG 2UUCQ 3H91A 1YNJC 2OEOA 5M5YH 1PDQA 1TWAH 2N1VA 5IY0A 2WIIB 3BVMA 2W82A 4EX5A 1C8CA 2L9HA 1ZUD2 3EGRA 3BIID 1O7LA 4X57B 1PZKD 3A4RA 1V9JA 4LFBQ 4XE0A 2R92G 4ZKCB 4YTNB 1IBXA 2BDNA 1WMHB 1LABA 1N33L 2WDVB 3BYTB 1N36L 2F0WA 4LNKA 4HAEA 3SK8A 3A9KA 1HNZL 2DZIA 2K5VA 3JAMi 3LXFA 3HIZA 4N9PA 1UF0A 4JIOU 5ELDA 2JA8G 3RNAC 2DZJA 1CHQD 4K5XA 1ENCA 4DV4L 1N62A 1SGHA 1EYAA 4XQNA 1SNOA 3C46A 4IJLA 2NCNA 3IFWB 3G48A 4L6TB 2KXJA 1LO5D 2J0KA 4K81A 1OXTA 1ZXTA 1JE5A 1UELA 2WFWA 3VHTC 4B9KA 4HKQA 4IFDH 3A74A 4H02A 3ULPA 4BKSA 4DHZB 4A3BG 1EQTA 1H8CA 3AQQA 2BTEA 5IYBH 3KYDD 3MTNB 3TP6A 4A3EG 1VQFA 2DLBA 3S1RH 1PH4A 1JRPA 2JA5B 4A3CG 3NENA 3P4QB 2IO1B 5CHVC 4LCDE 4OZBA 4XQQA 4BA2I 2KLGA 1AZPA 1I6HB 1I4RA 2LWPA 3PSIA 4LF9L 1EY4A 3I3CA 3BINA 1I50B 3BG3A 3H3VH 1J9OA 1PH5A 1EYGA 4FJVB 3M4YA 2WB1G 3PHWB 4JW0A 3S16H 2Z9HA 3L08A 3I4MB 4CDFC 4POGA 1WH3A 3K8AA 1EWCA 1WFQA 4JI1Q 3H09A 1FD6A 1KOTA 2XRSD 1VQLA 1FJGL 5M5YB 4R3DA 5C3EG 2PEAA 4XQJA 2DHZA 2I5LX 4JBKA 2AWNA 3VYTA 2BPSA 1TWAB 2JWZA 3Q3MC 2I46A 3EROA 3B1LX 5JJLA 4RGNA 4P6VF 4PMWA 2O2VB 1E2ZA 2QGQA 3O13A 2B29A 4TVAB 1L0WA 4X64Q 4JLCA 3J7YW 3I9V1 2KDEB 2KJRA 1EY5A 5IKCM 1Q81C 1QB5D 4AJYB 1F2LA 5IIFA 4DV0L 4B3RL 3X23A 2KDMA 1ILQA 2X69A 2KHIA 2OXPA 4C3HG 1K0SA 4LNIA 4WRDA 3A9JA 3DPDA 2GBNA 2VB2X 2ZTDA 5FK9C 3GTJB 3K5MA 1IYVA 4FA6A 5JHAA 1HTLD 3UDFA 3EHVA 3PUWA 3QO2A 1YJWA 1XPRA 1ZW7A 1JWBD 1VQMA 2AQ3B 2IGGA 4GS3A 4G3XB 3VRBB 2F0KA 3PO3H 4DPGA 1ASZA 2MBQA 2OHFA 3D3RA 3GV6A 3L13A 2G4SA 3D32A 3QJZA 4EZLA 2K8CA 1PFBA 1NY4A 3S17H 3RN9C 2MLBA 1MFWA 3OLMD 4R9WA 1I4XA 1SNPA 2DNFA 3HVZA 4RKBA 4LF7L 4NPSA 4W9IA 4W9LA 1I4HA 5AZFA 2R93B 3S1RB 4LNQA 1GUNA 3EIVA 1PVOA 4QIWE 1ZDXA 4S17A 5FR6A 4KKTA 4GNXC 4JPBW 1A62A 2A5UA 1EEFD 5DCNA 2BA1A 2FCMA 4A3FH 5LL6S 5FLXL 2M19A 1LGRA 3PT2B 5EE9A 3T1HQ 3S16B 2KN5A 4FO2A 1HUMA 1JCKB 1V1PB 2VZKB 3EJIA 1TQOA 1R9TH 1V81A 4CGYB 2LUMA 3AE8B 2RMMA 1PXUA 3Q3FA 2D11A 1MI0A 4JI1L 1LUZA 4GNXB 4B08A 1AWDA 1D5XC 1VD2A 3IRBA 5FLXE 2GBKA 2X6GA 1X6OA 1MG8A 4LF8Q 2L1BA 1KTKA 1N8RC 3AE6B 3NZ3A 4W9GA 4GN1A 1FFVA 3NBIA 4IURA 3N52A 5F2DA 1H9SA 1OO9B 1PLFA 3MFYA 2D2QA 1WCMG 3RLFA 3UIOB 2J7ZA 1PH3A 3VTWA 2KC1A 2K01A 3MXNA 1CSQA 3ER0A 1D3ZA 4A3MH 2VRRB 2WGSA 2DYMA 5D7GA 1MPEA 4JWSC 2M9VA 5CHWA 4GDLA 2D3AA 1CI3M 3M9BA 1QUQA 3EVQA 1C0AA 3VFKA 4D2KA 3STBD 3FMCA 4DK6C 1VQNA 2AMCB 2LMCA 2A69C 5ELFA 4E6IA 4DNTB 3G6JB 4AQYQ 2ZXPA 2GVAA 2D3BA 2UYZB 5KEEA 3PMFA 3AU4A 5M5XH 3APDA 3CPWA 4Q2JA 3PO3B 2QMTA 3TEZA 4M8NA 4UHVA 1XJVA 1KRHA 4BKTA 2SEBD 5M3MH 2HT1A 4XZ4A 4FHJA 4R4TA 3J80i 4YCWA 4QCLA 1E7PB 3CC2A 4A6QA 1F2MA 4RNAA 3S17B 4KX6B 4TKOB 4GZYC 2J7QB 3TREA 1EFWA 3I73A 4MSMB 4PYZA 1JJ2A 2K9XA 1ICWA 4P74A 3HS0C 2FUHB 4MHEA 2IT1A 5JPNC 1NAPA 1WD1A 2EYPA 1VQEA 1H9RA 2EYOA 2KBNA 5JEAJ 3TP5A 4NW2A 2V1YA 2LVOA 2JRIB 5CORA 3P4PB 2L7RA 2ZXOA 4GKJQ 5IWAQ 1VQBA 3VQIA 4R4IA 3D4WA 4XWWA 1VDZA 3ZJVA 3AI5A 1LT3D 4JI8Q 4DV6Q 1R9TB 1JRUA 2O5IC 2WWZA 2ASBA 1HZAA 2RDFA 2F0IA 4A55A 4JI6L 3A0JA 3R2IA 3K0YA 3DBHI 2YLMA 3HKZB 1N9WA 4RKLA 2ZT9C 4LF8L 4IWPA 2R3ZA 1RD9D 2PMZE 5EQ0A 3WOEA 3RD2A 4HRSA 1GHJA 1KLGD 1Z9FA 3DVGY 2QW7A 1U9RA 1OXVA 1UUPA 1E7UA 3PREA 2RDGA 3VR3A 1K73C 1FXAA 2GBJA 1BVSA 1IL8A 2NPTA 3TEHB 2RDBC 3APCA 2XWBB 4A3MB 2IO3B 1UAPA 3HOYH 2CR5A 5FLMH 4YTMB 3RN5A 1MHXA 4EE2A 1TY2A 2WX1A 5C4XH 2IL8A 2PZTA 4UPAA 1WD0A 2AL6A 3QIJA 1H9KA 4I6NB 2QEXA 4GOPC 1NUCA 3CW2C 5M5XB 1A70A 4FXDA 5M3MB 1B4OA 3ICEA 1ZP0B 2Y5CA 1YN3A 2L3ZA 4LDTD 4OL7A 3F2DA 2K1FA 3B0AA 1VCIA 1C1YB 4QB4A 2LKVA 3CCJA 3M4OH 1PGXA 2DAJA 1C77A 3QARA 4RG1A 4HJ7A 2CQAA 4HJ5A 3CSTA 3AEDB 4M8MA 2LXJA 5BN4A 3MXGA 3ML9A 2HDEA 4GOPB 4DUYQ 4A3KG 3SR1A 1I4GA 2F0DA 3GP7A 3OMGA 2EZVA 3CCLA 1XCQL 1L5PA 4MH0E 1F2RI 3GTGH 1ZGUB 2FAZA 2C5CA 4RWSC 3L2PA 1S3OA 2V4LA 3SD5A 2BH2A 5BR8Q 1WX9A 2MP2A 1HCZA 3DHIC 3IT6B 4NQLB 4NJ6A 4MJSA 1YNTE 3PV0A 2G9DA 4GKJL 3W5UB 2MP1A 1C79A 4F8MA 4A93G 4LFAL 4JI8L 2B2TA 3BZKA 2R61A 2LZ6A 4HDQA 4NAWB 3RZOH 1XLOA 1U4RA 1FYCA 1LTSD 1YNNC 5GROA 1IW7D 4FN2A 1YJ9A 4V190 4B6WA 4DDGD 1HR0Q 2N4FA 4DAMA 4OW0A 4JOIC 4BAXA 1TWCH 4LJZC 4L5RC 1UE6A 2F0OA 1YN5A 2IHEA 1TY0A 5CV9A 4FF3A 1Q10A 1WXVA 1SMYC 2QJLA 1BUVT 2BKFA 1XWEA 2RPQA 3M7NA 3P1HA 1SE8A 4XTCS 5BN5A 4MNOA 2LHDA 3KWLA 4GMVA 2B2UC 3GTPH 1ISNA 2D5GA 2MQJA 4ZYNA 1OTRB 1TT2A 3NELA 3ULLA 3HOYB 4GIVA 3SDZA 1D8LA 3ZJYC 4MT5A 3TDQA 4NNJB 4ZAIA 3SFDB 1EIHA 1ACCA 4A3GG 4APVA 5C4XB 4TV3A 2UU7A 1I35A 5DLQE 4BBNC 1WTVA 1SJED 2KFKA 3PRMB 5BO4B 5KNCA 4KIKA 4N6EB 1EWIA 3FKIG 2PMVA 4BOSC 1LTBD 3F2CA 1MHHE 2AQ2B 1AW7A 1F2YA 4OELB 2MBEA 4JI7L 3GB1A 2ICEC 2JE6I 2BS4B 3OJ4B 5EPLA 1A15A 1V86A 1RJTA 3QOJA 2W3SA 1OTCA 1WYDA 1QLBB 3M85A 3I4OA 3RUZA 4ZRIA 1MSHA 5ELBA 4OWWB 5LMNQ 3M4OB 1VLBA 3IBEA 2ZPNA 5E7NA 3NVYA 3H7SA 4HXDA 2N1WA 4POFA 1BMLC 2RQXA 4QJFA 1FGBD 4PK1A 1M4VA 3GTGB 3AEEB 1MBYA 1K0RA 4DR1L 1WXAA 2MWSB 2X38A 3ETRA 3MXNB 4DK1A 1H95A 3Q24A 1S1QB 4HPLB 2GI9A 3CF6E 4BKGA 1JROA 2EKEC 4GKKL 4JI4L 4B3SQ 1KD1C 4DAYA 1QZEA 4KK7A 3LWEA 1WF9A 3FPPA 4IOCA 1CM9A 2N88A 4DV2Q 1YJ1A 2R7FA 3KBXA 1WYGA 3BK1A 1L0YB 4CQNA 1QOAA 4KDIC 3AFPA 1CKNB 1F1HA 2F4VQ 4PZ8A 3NP8A 2K6DB 2KACA 3RZOB 2ZCBA 1UEBA 2WAQE 2FFKB 5FO9B 5JVG3 3EFUA 1U0LA 2XGTA 1FRDA 3RUIB 4J6HA 5I6YA 1Y1VH 1CQVA 4DR3Q 2MHJA 1TWCB 3JVZX 2KCTA 1L6VA 1GG3A 1HR0L 3GD7A 5IP9G 3ECIA 1WGKA 3IKJA 2ID0A 1ZKOA 1DOKA 1EEID 3TEWA 3KBGA 2E2HH 2WXIA 3VRAB 4L63B 3GTPB 3CCUA 1XNQQ 4ANXA 1KABA 3ZUNA 5BMHA 3CAMA 1JW9D 5J17A 4NXMQ 1EIFA 2L0TA 4A4IA 3NZSA 3DWQA 1N34Q 1NYQA 2R2QA 2RBMA 1PV4A 4P16A 4P2CB 1WGYA 2B39A 1BBUA 3P20A 2PJHA 1WJ4A 3GZNB 2ASQA 4FXCA 1EUVB 3PGZA 5LMNW 3M4PA 2A68C 1JB7A 2V3NA 2ENBA 1TS3A 4DV3Q 4EQ5A 1C78A 3HOZH 3VR8B 2G45B 3K9PB 1YOVB 3S1QB 1JORA 2I5HA 1E9MA 1JWUD 1E10A 4Q0FA 4XYOA 1VJKA 4CKEA 2WXRA 1X55A 4K7WA 3F2BA 3QA8A 1JWSD 4P1BC 5JJZA 4YHHQ 4GLXA 3W5VB 2BW2A 2WACA 2ZVNA 4WWMA 1SYDA 3Q3JA 4FHKA 1V1OA 1A3TA 2K5NA 5KYLA 2UUAQ 4C3IG 2PW7A 1Y1WH 4MTNA 4ZKBB 2MA9B 5KHQA 5EAYA 2QEJC 2NN6H 3EUB2 2AWTA 2GRIA 3HG9A 4KVGB 1IP9A 3SK4A 3B2GA 1FD7D 3HGBA 3MAQA 2FBWB 3TJPA 2JT4B 1GXDC 2L4NA 2HQLA 2B2YC 3AYHB 3ERQA 5G5GA 4FXGC 2E5LQ 5HY6A 5ELNA 2FIDA 2Z6BA 2Q8IB 2GBMA 5K36H 2WYQA 2OT2A 3NQTA 1MVKA 1Y1VB 1GUTA 3A54A 2BT6A 4F7XA 3CSFA 4DR7L 3UGBB 1BO0A 1HQMC 3I91A 4DR3L 1HNWL 4NB3A 4KD3A 4WFN3 5LXIB 1YVCA 2E2HB 4IO9A 2WAQG 2C9OA 3NK9A 1QOHA 1I5FA 3VVWB 2F0PA 2LXCA 3DHHC 3WAOA 2PLPA 3N30A 2G3QB 4KZCA 2I07B 2DBYA 3LGJA 3HEJA 3A1QB 4NXML 3PUXA 1ONLA 1TS4A 1T5XD 1EM7A 3OIQA 3PCOB 2HJ1A 1SAPA 2C5LC 3CF5A 1G51A 1UE5A 3CU7A 4KSKC 4NZLB 2JEAI 3AN1A 3WDNA 4QL5A 3I4NH 2K3UA 4MACA 3KF8B 1L2FA 4IALA 4KN7C 3CC7A 2MBBB 1H9MA 3HOZB 3DEOA 4RCNA 4DV3L 1FEHA 5KHOA 2DWQA 5J2RA 3G4SA 3OTOQ 4G4KA 5IOCA 1YHQA 1I94Q 1TTNA 3ITPA 3QIAA 2N9EB 3HZXA 5C0XH 3QHTA 1K3RA 2WX0A 4NXNQ 4IM2A 3A5UA 1Y1WB 3AULA 2KQ3A 3C1EA 4HIOA 4OIKA 2REXA 1G6PA 4OWTB 2NVQH 2M4NA 3NTKA 4DA2A 3KVFB 2DYOA 4JI0Q 4KV6A 2KLCA 3BZCA 5JH5C 3UDXA 4DV5Q 1AARA 3VAWA 4E3CA 5LXHA 2MO1A 2OQ0A 3VTUA 4N58A 3Q3OC 1AZQA 2CHXA 2F0GA 1WTOA 4P72A 4DR6Q 3I7FA 4BVUC 5J22A 3GTLH 4RFBA 3L0WB 1Y8NB 1U4MA 5NUCA 1P16A 1L2NA 2TSSA 3Q8DA 1QKZA 4KKIA 3TN2A 1B53A 1HE8A 3R8BA 2UXDL 1FRRA 2L1AA 4II2B 4TQ0A 5EDSA 1I42A 2NTSA 1DOMA 4ICUA 3V6EB 4PT5A 3W1SA 1IGCA 3RI7C 2EMSA 3BJUA 4Z9CB 3GO5A 1FIQA 4X65L 3SR6A 5ELEA 3QQ8B 4FULA 5C2TB 1HQRD 2UWQA 5AEKB 2Q5WD 2MBHA 2HHHL 2L05A 4ZLTF 1OQQA 3S2AA 1XD3B 1S3SG 4OZAA 5IGEA 1P98A 4X66Q 3I4NB 2WU5B 1XF5L 4X62L 4JC0A 4A8XC 1JWMD 4XYCA 1M90C 3VTVA 1EYDA 3EQLC 2JXMB 2MJ3A 1K8OA 3CWIA 4P71A 1S5FD 4LNFA 1FMAD 1O7YA 3OTOL 1XLPA 1AP0A 4GSWA 1Y8RC 1A2TA 5JEAG 3T1YQ 4IOAA 4LNNA 3ND8A 2VW9A 1DOXA 3QX1A 2JXXA 1KM7A 3PF5A 1E90A 4KGSA 1RODA 2E8GA 4IUPA 3AE9B 2K52A 2MJEA 4OO1H 2IX1A 2BWES 4LF6L 3QK0A 1P3QU 4BS9A 2LGDA 3RCZA 2AWOA 4TKNA 3S1MH 5C5MA 2K4KA 2NVQB 2EPBA 5I9OA 1WJ6A 1EZ8A 1QT9A 5IP7G 2VQEL 5FO7B 3J7A5 4YCUA 1B8AA 1S72A 1YN4A 2QCZA 1DGJA 2NUCA 3KUCB 2D5DA 1Q1OA 4F88A 1X3GA 1F77A 3BS1A 4DV5L 1KJTA 2IY0B 1G2SA 1RL2A 4KHPL 3ZTDA 5LMUQ 4MM3A 3BU2A 1SE2A 3I70A 1NVID 3N32A 2K0PA 2PW5A 3AU7A 3H0GH 1WTPA 2ATWA 5D65A 2PKOA 3I4MH 1L0VB 3TZUA 4EZJA 2MNAA 3RR5A 2XK5B 4C1NI 2E2DC 2J0MA 2HDLA 2RPVA 1HRJA 1UE1A 3U2SC 2Y5BB 3DDCB 2L0FA 4RH6A 2QA4A 3EBEA 4HPPA 3N1XC 2EYLA 4XDXA 3HHMA 3L7ZC 3V62A 4DUZL 5M3FH 3TQYA 4NMZA 1GB4A 3TCAA 1LT6D 1A2UA 2F0TA 4H44C 3NWTA 2KTRA 2VZAA 2D10A 5HGQA 1WJJA 2RVLA 4JYAQ 2KZRA 4KZ0A 1HTQA 4X66L 4A76A 1B3AA 1B70B 2MGSA 3KW5B 2WXKA 1AYFA 1MJCA 2JA7G 4WORA 2JA6G 4H13C 3WAPA 2A8VA 4U68A 1WWTA 1JR0D 2INCC 3KYHC 2WXLA 4C1NK 5FKAC 4LJPB 4PS7A 4UP7A 4K8IA 1K9MC 3NEMA 4C3JH 3STBC 1YJNA 1UWVA 3GTJH 1WZ3A 5IGCA 4JV5Q 3R3MA 2YTXA 1X1MA 3Q6SA 4BBSG 2DGYA 3RPFC 3OYYA 1SN8A 3I8ZA 1WE7A 4N59A 1C9FA 1LTLA 3S14H 1WR6E 2BF8B 4R4OA 1C4PA 5IYDH 2OOBB 3UDIA 5KNBA 4DDID 3W2DA 1EF5A 3GS2A 2K33A 2K5HA 5E4WC 1S40A 1KH0A 2N55A 1TBEA 1WXSA 2L32A 3P1MA 2RHSB 4M00A 4NPNA 4PS3A 1FO4A 3S1MB 2EJFC 1UBQA 2B3AA 3TIXA 3ZIMA 5JHBA 1XMOQ 4RMFA 2CH4A 2B63G 5AUKA 2JK8A 1WZ0A 2FJ2A 2KK8A 1TJEA 1L6UA 2JEBI 2R93H 3CCEA 1ENFA 1XMQL 1KF6B 2JYTA 2KD0A 1DZ1A 4HJKA 2AUJD 5HFYA 2K5QA 2FIFA 1CTMA 3OW7A 1GUWA 4A3DG 4A3JH 2FXQA 3OWEB 3HOUG 4YT0B 5IO9A 4RA8A 3JYUA 1LT4D 2IY5B 4KMUC 3W5OA 5LMUL 1TKEA 4P73A 1QOGA 3H0GB 2WKCA 1F0ZA 4CDCC 2CWPA 2AL3A 1SNCA 3NHEB 2NS5A 2O6VA 1E6EB 4NKLA 2KQ4X 4II3B 1KNEA 3S9WA 2IPKD 1EIYB 2MH7A 2A1AA 3OJ3A 2A19A 2PNHA 1S5DD 1LTRD 2F3VA 5CR3A 2DNCA 2KVZA 1XTCD 2Z0EB 2UUCL 4IFDJ 4JX1C 3L3OC 5M3FB 4JL9A 3UQBA 2MHVA 3J81c 1YNXA 2XRQD 2LRUA 4ILWA 4KJOA 1PQSA 1QQRA 1QWYA 1LQBA 4YSXB 3KWVA 3T53B 2KECA 1NR4A 2JJQA 2Y0SE 3DBRI 3TZDA 4ANVA 4JI2Q 1XX8A 2INNE 4F7ZA 3V2TA 2B2VA 3PRZA 4LFBL 3NTHA 2CHBD 1STGA 4C3JB 1CKMA 1C7YA 3A7LA 1PZJD 1GVPA 3FPUB 4JVZA 3K7AH 3L9AX 4A3IG 4IWQA 2UXBQ 4CDEC 4I6PA 2EY5A 3S14B 2WXHA 1C4AA 3W9CB 3FKYA 4HK2A 4Y52H 4ZRPA 1ESRA 5AJ3Q 1CZGA 1MIUA 2M1MA 4K7SA 4HCEA 1FNUA 3DVNV 1WRDB 1D7QA 2NVTB 1Y56A 2BYVE 1NR2A 2DYBA 3SXHA 4WJPA 5I2YA 3GV3A 1X3PA 2EOTA 2GVBA 4AP4C 1CKOA 1Q1BA 1K50A 1BR9A 3ENEA 2Q2TA 1HA6A 1NNXA 2JYEA 3PZ7A 4WURA 1STBA 1T0SC 3HOVH 5JJIA 5T1GA 5DNFA 3TS2A 2N7DA 3SEBA 1E22A 4A3JB 1SYCA 3SDLC 4A3LG 4LDTB 4YWKA 3AU5A 2BS2B 3MHSD 2HDMA 2KQSA 3P42A 2E3TA 4KV2A 2H1EA 2C7HA 5EPJA 4AYBE 4FJYA 4RM9A 3SHQA 4C00A 2I2YA 1ZYRD 2EY6A 2VB3X 2PZWA 1A63A 4KKUA 2K5DA 3CMMB 1F9SA 1N63A 2BKRB 2Z8LA 4BBRH 3VXWA 1XCTL 1FL0A 1H4RA 1IW7C 1EY9A 4KHPQ 1SE3A 1YZ6A 4DNRB 1Y69U 3PO0A 3X0WA 1QE6A 3J7ZC 1R4PB 1IHZA 2JYOA 3RULA 3HM3A 1XQQA 4HEA1 3GDEA 2AKWB 3HOWG 1UD7A 3AE3B 4DV7Q 2VUMG 1K3BC 1VDVA 3UDGA 4LF4Q 4K5VA 2A73B 4OX9Q 4IFDI 1C3TA 1HZ9A 3L10B 3U7DA 2J52A 2IJ0A 4X64L 3AE4B 2PCFB 3VR6A 3GTQH 1A6XA 2KC2A 2ALYB 1YQ3B 4JI2L 3MEFA 4A20A 1VQIA 2EXZA 4DR2Q 2O4XA 3FILB 1QG7A 2EDGA 1Z5SB 4MM3B 3K7AB 2XIWA 3NBHB 2IGHA 4NQKE 4DBGA 1O7IA 2WU2B 4J1MA 2Y0SG 4M01A 3R66C 2J4XA 1MI2A 3H3VI 5ELOA 2UXBL 1PFMA 4HN7A 2M17A 3V6CB 4B95A 4NAMA 3HOXH 1YX6B 1C9OA 3PPAA 5CTRC 4K2LA 2NBUA 1UZXB 1GB1A 5AJ3L 4C7ZA 3DQVA 1W3SA 1LM0A 3CHBD 5FJ8G 3K57A 4BXXG 2Z6KA 1NDDA 4ZUJA 5JEAH 3GOEA 2I1KA 3K9OB 5IYCH 3GQBA 2EXDA 2KENA 3DWAA 3P75A 2KHSA 2YEPF 5DPRA 3VDZA 4I7ZC 4CYEA 3HOVB 2L55A 4OIJA 2KEDA 1SFOH 1Z47A 1U4PA 3DBHB 2K25A 3AB5A 3G6EA 1Q1EA 2N78A 1QCBD 2KCMA 4FLHA 1J19A 2MCNB 1IBXB 2E76C 1Q0WB 2DUDA 5C3XA 1SE4A 3SVMA 3DBLB 4TRDA 3A9KB 1PTOF 2OF1A 3T1HL 4GGQA 1S5ED 4YIJA 2IGDA 1N5WA 4BBRB 3J7AV 2UXCQ 4EEWA 1RWSA 2JZ3B 3ZDMC 1PTOH 3NSWA 1XT9B 4M8AA 1EOVA 3HFZB 2LXAA 3F2UA 4WJQA 2Z4IA 1WYWB 1NMGA 4O2DA 3AE5B 4AYBG 1VR9A 2NVYB 1QVGA 5AZGA 3PQIA 4BY1G 1PFNA 1WE6A 4IZ8A 1VF5C 1WSPA 2JRHA 2WDQB 2AQ1B 4DV7L 3MJ5A 4HCPB 4HJGE 2ZW0A 1V2YA 1F2RC 1A3VA 4R4CA 1II3A 2HD5B 4S0RA 3GTQB 3AM9A 2I5MX 2ONQA 2B8FA 2EYHA 3A8JE 4M0WA 3ZJTA 2YV5A 1KDAA 3HRZC 3W3AA 2KHWB 2V3SA 3C8YA 2EE1A 2K32A 2QDLA 1J5EQ 3L17A 1FM0D 4DR2L 3LDZE 1SDFA 2NTTA 2I0QA 1BCPF 1R4MB 3SE0A 1YJIA 2WNMA 3A56A 2K05A 4AQYL 3FRPB 3OSOA 3K5LA 3HOXB 2JA6H 5C5LA 2R92H 2Y3AA 2KYWA 2E2JH 2N8NA 2BVCA 4JK1C 3H9DA 4L1BA 1Q86C 2XSCA 4QF4A 1I3QH 1VQGA 4K6LA 4AH6A 4DU9A 2LFIA 3T3NA 1QNUA 1TIFA 2ZM6Q 1K8GA 3DXJC 3PF4A 1TWGB 1WGHA 5AFWA 2ZJPA 3AEAB 2JA8H 3KLSA 1SFOB 1PTOC 1L4DB 2IYDB 2YEPB 1YIJA 1NBWA 2BOSA 1OFFA 1TZOA 4PS8A 1MKHA 2QKIC 1CA6A 4DHZE 4TQ1A 1HNXQ 4P75A 1D6EC 3VA5A 2CU3A 5KRUA 3A9JB 4RGOS 4A3BH 3AH7A 3VUWA 3VYUA 4JBMA 1K8MA 5IWAL 4WQMA 3MC0B 4RHRA 4A3EH 4TQUS 5TR5A 4DV6L 4UY8C 4A3CH 3M3YB 3MC9A 1VMPA 1PTOB 3Q69A 2KX3A 3UINB 2UXCL 3ZRFA 4M1UB 4BY7G 2L0CA 1IYFA 4DXAB 3S1NB 4IC7B 4XT3B 1D1IA 3KH0A 1FNWA 2JA9A 1U4LA 3M95A 2KVRA 1OXXK 3APFA 2WXJA 4L8JA 3N1YC 1H9JA 1PFSA 2WDRB 4XX5A 2NVXH 4LWCA 4JQWC 3CPFA 1V5TA 4REZA 5HG2A 3RNBC 1MGSA 2N0SB 3QWNA 3N20C 4AWJA 4XIGS 2EJMA 5I2XA 2LY7A 1BCPC 4LTUA 5EE0A 5M3FG 1ZOYB 1QNKA 2ICIA 1JT8A 2ZTEA 5G2NA 3V3XA 3OOCA 1PYBA 2J0TD 2VQFQ 4RAUC 3C2PA 1XO3A 2GBRA 2JPHA 5C3EH 3DCGA 3FDTA 3M3JA 3K5OA 1X65A 5DM73 3CCSA 2ZNVC 3PS6A 1EL0A 4WWPA 2KDBA 2NYZD 2IZVB 2NBWB 1J5EL 2WS3B 3ULJA 1HPCA 2E74C 2EMTA 4US9A 4UAIA 4DXFA 2R7ZG 2FMMA 4L5QA 1BCPB 2JA6B 4QAYA 2N7EA 1MJDA 2PIAA 2R92B 2G9HD 3CRLC 2E2JB 2H89B 1W2BA 1BKBA 4C3HH 5AUIA 3B6YA 1N32Q 3ZNGC 3S1QH 5CC4A 4LF5Q 1I3QB 3MHZA 3E3XA 5TSSA 1RAXA 2ZNVB 3LJ3A 2L83A 1IZ6A 2DZKA 4MN3A 3KJOA 2B3GA 4ZK9B 2JA8B 1CSPA 1H9SB 4FDBA 3VYRA 1B1ZA 1YBYA 3I90A 3Q22A 1BUIC 4G11A 1VS0A 2K50A 3FC4A 4KKSA 4DUYL 3D6WA 1O78A 2V1CC 4K7UA 1LTTD 1WM2A 3CMEA 2JQRB 3U58A 3E9SA 4KGTA 3T13A 4MEMA 1EZ6A 1HNXL 5BR8L 4GDLB 4A3BB 2F4IA 3E9IA 1QUQB 2MUYA 3A5ZB 5BYSA 2MPMA 5LL6X 1G91A 4A3EB 1WJNA 3V60A 4G57A 1CK1A 2LMCB 3PLUA 4BKSD 1WI0A 5C4ZA 3CKIB 1YITA 1JJGA 3R7QA 4I7AA 4ULLA 1SSOA 3M7GA 4K14A 4R1JA 2OJWA 2KMMA 2M2LA 1V8CA 3AECB 4HDOA 4MGYE 1EFID 4HKZE 5IP4D 1M1KC 1AE3A 2JA5G 1G8ZD 4G7HC 1PGBA 4J3OD 4DHJD 4DR5Q 2WB1B 3U9SA 1V6EA 3MHBA 2N9LA 1TKWB 2NVXB 1LTGD 2IW3A 4MIUA 4HROA 4MGZE 3U9OA 3BVZA 1LLRD 4L2YA 5I6WA 1NBFC 2SOBA 2M00A 2KT7A 3UI2A 5C3EB 2CVRA 1Q5WB 4XYQA 2VQFL 1L4ZB 1EYCA 3QJYA 5DPWA 4E74A 2IDYA 2D0PA 2KCNA 3PUVA 4FF4A 3W1BA 2W3RA 4LK0M 1IBLQ 1J8CA 1WCMH 1RYJA 2L11A 4FNFA 4CJ1B 1CJEA 2I1JA 1B3QA 4WWOA 4K6DA 4KJNA 1K8RB 3N3KB 5DM63 3PIP3 2NBFA 3BWUD 4C3HB 3WALA 3KF6A 5CMDA 4PMBA 4C4VA 4O42A 1QZHA 4IWOA 1X9NA 1SR3A 4USAA 2KO3A 4DV1Q 1EQRA 3NUCA 3J81E 3RN2A 1ILPA 2VH2A 3PV1A 5LMNL 1CA5A 2K22A 2KDIA 5BN3A 4HMIA 1P7FA 4H0LC 2RHQB 4KLKA 4FF1A 1N61A 3VUXA 2RSUA 3E5SA 1A0IA 1PTOD 5G3LF 2NPTB 1VQ7A 2K8BA 2Z59B 4KGRA 3S2DB 2KJHB 1SF0A 4EZKA 1X32A 1C76A 5A2QL 1EF1A 4FJZA 4KD4A 2RDHA 1T5EA 2N49A 4B3SL 2XWJB 4YY3Q 1TIID 3PTFC 4HJAA 1SYEA 4PV1C 3HM6X 3ZLZA 4DV2L 4IFDG 2BCOA 1ML0D 5CV7A 2M8SA 3IAM1 4GDKA 4GB9A 5G5HA 1FVIA 3RZWC 4K0KQ 5A2QE 2F4VL 4WWNA 2B2WA 1RTNA 4LAAA 4W9FA 3BDCA 3D4DA 5BYRA 1Q8IA 3QG1A 5T8IA 2BYTA 1Q90A 4K3CA 1KL9A 1JOKA 1BXTA 2HD3A 3J81j 2N3SA 2WXGA 3PVLA 2NB0A 4URKA 4DR5L 2PPBC 3HVDA 4ICVA 1E2VA 2XVSA 4NDXA 2V0GA 3SU8X 1LTAD 2O5JC 3U50C 3RZFA 3EC8A 1P7EA 2OWOA 2B2TC 1U4AA 1BCPD 1BT0A 1ZXHA 2JWUA 4IG7B 3HKZE 1XNQL 2D62A 4WQOB 4DFAA 2JZZA 2F3WA 5IAAC 4WAFA 4PZ6A 1WMHA 2DJFC 1N34L 2LFNA 2MP2B 5HKHA 2VUMB 1BF4A 1TS2A 3X3NA 4O0AA 1J7BA 1WCMB 2RR9A 4MJSB 4OZCA 1WVLA 4MZ9A 1GUGA 5FO8B 3U4EG 1SEBD 3NRZA 1UH6A 4W9DA 1KHIA 3DEPA 1DOIA 3GE8C 4LNOA 2HE7A 4ME3A 4OGQC 4OXPA 1YQBA 3HKSA 2WKDA 4HLEA 2PO4A 4U673 2BYEA 2X8XX 3CQZH 1X56A 4IPGA 4WJWA 3L4PA 3K5NA 2BA0A 4IQZA 1RRBA 1XLQA 4HCNB 3RLOA 1SYFA 3QOLA 4X3TA 2QDFA 4DNIA 2JY6A 1FR3A 2HIVA 4K5WA 4IM3A 1FCLA 4YHHL 1ICFB 2YYZA 1K52A 4L5TA 1NENB 1WXQA 3UIPB 3DBSA 4MDKE 4WAAA 2KX0A 3WIMA 1SB3C 2UUAL 2JP1A 2ZVOA 1C4CA 2ZW1A 3PO3G 2KCCA 5C4HA 1SMXA 5EKLA 2EKIA 3N6RA 2RSOA 2KDFB 5CV5A 3DWGC 5KGUA 2FE8A 2BGFA 5C6AA 5M9OA 2INDC 4KKJA 2KWCA 1Q82C 1FGUA 4X3SA 4MTKA 4A3KH 1BBXC 4RGTA 1IPGA 2KFKB 4KIKB 1K8AC 1E8ZA 4AOFA 1GHKA 1UWMA 3PRPB 3AB9A 5GAHC 1LFDA 3OAWA 3I4LA 3MC8A 2E5LL 4KHZA 3AE1B 3LYYA 3I2ZA 2LUEA 4QUCA 4ZUIA 2KVMA 1P1AA 2KWVB 3TUOA 3PUZA 2GLSA 2L12A 2LJ5A 4QIWB 3RYTA 3D4RA 1RLFA 2SNSA 4A93H 4A3FG 3IT4B 3AE7B 3PSEB 2O2VA 3E0JA 3QCAA 1D1KA 1R4QB 3F8TA 3T9LA 4EOYA 3PIPA 1VQ5A 2C60A 2WXQA 1ET9A 2I38A 2B76B 1EU3A 2BS3B 2NZOA 1LTID 3C1FA 2OTJA 1J0GA 1HTOA 1SLJA 1TS5A 1AE2A 5FR3A 4DAYB 5E6OA 2QILA 3HKZG 2OCEA 2G1EA 5J3BA 4N9F4 4JE3B 3IG3A 4P1CC 1ZEQX 1CFMA 2RCNA 1RFKA 4B0MA 1RIPA 2AUKA 1KRTA 1JALA 2K5PA 2N9KA 1EY8A 3CQZB 4EQOA 4K2KA 1KQSA 4A3GH 1RCVD 1HEZE 4R4QA 3M63B 2WV6D 4A3MG 2KJXA 2Q2UA 1I94L 3E56A 2YVCA 4IUQA 1VZ8A 4IDIA 3FKIH 2K03A 1FPYA 2R7ZH 3T16A 5E1FA 2NWGA 2PPHA 3U4ZA 4F87A 4IUNA 4NXNL 2GOWA 1NI2A 3RNFC 2J42A 3NUHB 1STHA 3Q8AA 4AS1A 3BVGA 5COYA 1N33Q 1E24A 4F1SA 1WX8A 1D4BA 5M3MG 3FAHA 4JGHB 4IJHA 1HZCA 4C56C 1HNZQ 2OQKA 3TS0A 4A3KB 2BDOA 4JI0L 2AX5A 2MW5A 1Q46A 4GXBA 4JWUC 3SK5A 1Q3LA 2L00B 3O65B 3PGEA 4OVZA 3TEYA 4HMJA 3VYSA 3H6MA 2JVCA 3A7AB 3P4SB 1KAAA 1E8XA 1PUTA 3EFCA 5DPSA 4GNXA 1JWAD 3KF6B 5EPKA 3T8MA 3IL8A 2PYKA 2VY3A 3PUYA 2CS4A 3UI3A 2LSSA 2KA7A 4GLVB 3DM3A 3VR5A 1SIFA 2BB5A 2GB1A 1DYQA 4XT1B 2LVQA 4DR6L 3NWSA 2WXFA 1C48A 3CRKC 4A93B 1GUSA 1NSNS 1ZYRC 4RF0A 1K28A 4AIMA 3NS1A 2R6GA 4JI5Q 4BWGB 2D9UA 3CCVA 4YXDB 2PVGC 4LUZA 5E3FA 4C2MH 2PI2E 3A55A 2B2WC 3S24A 2NZ1D 1RKNA 3VA7A 3VR9B 2WP8J 4OEMB 2JXTA 1KC8C 1YQ4B 3AEGB 4RM8A 2VH1A 1PYSB 4ANWA 1STEA 2A6EC 2B8GA 5IP9H 2G5DA 3Q23A 1DONA 5MPOA 1XPUA 4YWGG 2V9HA 2KHJA 2CWAA 4RMAA 1NTGA 3EA6A 3TMEA 3DHQA 4DR4Q 5JXVA 2K5WA 3ZVVA 3K81C 1ZDVA 5JJKA 2D3GA 4CHKA 2PMZB 3IFTA 1R4NI 3ZTCA 4DAVA 4A3GB 3CMAA 2GMIC 3F1ZA 1GPXA 3U30A 5G3LD 5BMGA 2KNBA 1STNA 1G2TA 3CCQA 4IPHA 5FLMG 4HIMA 2LI5A 3PO2G 2EVBA 1SYGA 1VF7A 3RNEC 3FKIB 4DGZA 3T1YL 1IKLA 1Q7YC 2JSOA 1JE4A 2R7ZB 5C4XG 3P4RB 4R8IA 1JICA 5J39A 4QMGA 3T3OA 5KNDA 5ISRA 4ID6A 4HEDA 1XPOA 1JJCB 4FYDA 1EO6A 3HK0A 4I6LB 4O1NA 4N9TA 4FADA 3NVWA 5HI1A 3X3MA 4DV0Q 4B3RQ 1FNVA 1IKMA 1T0QC 1WR1A 3EFXD 3ONAB 2MJ8A 1DOLA 4ZRZA 1B9RA 1SRUA 2VS1A 1PHJA 1EUJA 2NVTH 3N1ZC 1V1QA 4GN4B 5D14A 1KIXA 3A4SC 3V61A 4A90A 4L5SA 1MHWC 3UE1A 2F0SA 4N8X1 4PMCA 3JSVA 4YL8A 1QOFA 3ABVB 4R8NA 5C4JH 4XC2A 1RFAA 3FP9A 2MRPA 3CIRB 4RF1A 4A9AA 1T3QA 3L0OA 5EGTA 4C3IH 3UF8A 1DM0B 5T1IA 4FBJB 1STYA 1RF2D 3K80C 3BZDB 1CT1D 3TRZA 4HPMB 4B9WA 3QR8A 3C3LA 2PE6B 3JAMc 1MG4A 1V9PA 2Z1CA 3MWYW 5L95C 3TBIB 2KANA 4LF7Q 3DBRB 2LJIA 4JI5L 2BB6A 4C2MB 1YMHE 5I4DA 3J81i 2K6AA 3H7PA 1PRTD 3CCMA 4IW0A 2AEHA 1GD7A 2G4DB 4OO1I 1FFUA 4AJWA 4RGMA 4ODGA 5DAUA 2EJGC 1XNRQ 4WH4A 1IBMQ 1SBBB 4ZQ3A 2KMAA 4PG3A 2CJOA 4DR4L 2RKSA 1PH1A 1WGRA 1PZID 2J0JA 4JYAL 2NMQA 4K3BA 4XWTA 1V97A 1I4PA 2E6XA 1KLUD 2F03A 3W1SC 2RF4A 2C7NB 3LNNA 4JCVE 1EQQA 4OVUA 3I55A 2WDTB 1PH8A 3QWZB 3P7JA 1PDXA 2HTHA 2KFJA 1SNMA 2JF5A 3FVQA 4ZRQA 4GN3B 4JV5L 4KDLB 1NMFA 2FCQA 2LD9A 1CMXB 2XNAC 3GTKH 1MD2D 3RNGC 1DOYA 1J8IA 1DD2A 4GOPA 3ZDTA 3ALBA 3OPOA 4ZHOA 5HURA 3GE3C 1JB3A 3I57A 1OEYJ 1K83H 5GMVA 2WHIA 3E0EA 1VQKA 3J7AF 2J53A 2WXMA 1GUOA 4JG2A 2FUG1 3R7RA 2HCIA 4AUQC 1V49A 1XMOL 1X3QA 2F0LA 1TKYA 4W9EA 3KK7A 3RMHA 1HZ6A 1SSNA 3U8ZA 3P63A 5C4JB 3MTSA 5IT9c 3RZDH 1NYRA 4ACFA 2BH8A 2JU6X 3P2BA 4ARCA 2Z0SA 4B0EA 4C3IB 2DNEA 4UP9A 3DWMA 1OQRA 5D3DA 4NAWA 3WCQA 3OW2A 2RGFA 2D0OA 2CHWA 4S3SA 4OVVA 4KN4C 2JZPA 3Q3NC 4H2AA 1TVXA 5LHY1 4ZCKA 3H3VC 1WM3A 1M94A 1ZPSA 4XDDA 2F3IA 1JQ4A 2AHOB 2EIFA 1UGMA 3DMUA 3UE0A 3URYA 2ACZB 1X54A 2EYMA 2JN4A 5L37A 5IODA 2RA4A 2LASA 2CQOA 3BK2A 4K1RB 1VQJA 2KWUB 4X3UA 5EKKA 3KFUA 1XXGA 2PW9A 2A6ED 1OGWA 3RD4A 2NVYH 4JOIA 1YIWA 2W54A 1R7SA 1Y1VG 2WAQB 1Q8KA 3CD6A 5JPMC 1GJZA 2AYOB 1XNRL 2FMCA 1IBML 2A4ZA 1T0YA 4WIPA 1S4ZA 3E6ZX 1P0RA 4CHTB 1CUKA 4QGUA 1VQOA 1BNZA 1IYJB 2B2UA 4KI0A 3I56A 1E0ZA 5E4XA 5H8YE 1L7YA 3SK6A 2H5XA 5CV8A 5K5PA 4JI6Q 2CU1A 2N7JA 4J6IA 4ZOHC 1TZ1A 3UQAA 3A8IE 4XGAB 3KLSX 4J8QA 4ZRKA 3GTMH 2INPE 3B2FA 1YNJD 4ME5A 1JMLA 3WANA 4GU2A 3GTKB 3KQ4A 3K7UC 3OMCA 2IO2B 2MSED 2EYFA 3BYYB 4CDDC 2E2IH 5E6PA 4YSZB 4HTHA 4DWFA 3SGIA 3D0FA 3I5JC 1K83B 2RD0A 1GNUA 3HOZG 1SE9A 4BZAA 2IO0B 1E1OA 2D2CC 1V80A 3IAS1 1YHAA 3H15A 4CKCA 3U7ZA 1TWGH 2W9NA 2OJRA 1WIAA 2LEKA 3MJWA 2KTRB 1KFYB 4G0NB 3RZDB 2DN8A 1CKNA 3Q0AA 3KOJA 1J7CA 1X3FA 2CKHB 4WJNA 1VQ8A 5IGDA 2C9WB 3VR2A 4DXGA 1VQHA 2DY7A 4TUUA 1KNAA 3KLWA 3H8HA 3NS8A 1Z2MA 2L52A 3EECA 2PI2A 5IP7H 2M56B 1F9PA 1Y1WG 1YX5B 2NN6G 3OWFA 4IUMB 5HGTA 5C1ZA 2K75A 4QQBX 2JUOA 3M3YH 2MFIA 1WI5A 3J80c 2KKCA 4IUVA 1DGSA 1KAWA 3S1NH 1AH9A 2PQAA 1N5XA 3WA0A 1B44D 5K36G 4LFCQ 3H1UA 1VQDA 2SNMA 3B9JA 4A3FB 2CJNA 4J15A 2HQEA 2RSNA 3H94A 2WLBA 5ELCA 1T9HA 4LF4L 2KOXA 4PNYA 1PA6A 4OX9L 4LFAQ 1RHPA 2V4DA 1ROEA 3JSVB 4C7YA 2KWDA 1PH2A 4HJ8A 3PHXB 3HRDD 2OTLA 3NHHA 3HUIA 1SROA 4DHJB 1VCBA 2NR2A 1VQPA 1N60A 4LK1C 2LXKA 3LB8C 3ZYYX 1B9MA 3GTMB 1E7ZA 1WXMA 2QHOA 1VQ6A 3IHPC 1NI3A 2EYJA 1HUNA 5C44G 4LW1A 1Z7TA 2IWHA 4C80A 2O6VB 2E2IB 1WJUA 2JA7H 2FNJB 3DBLI 3C0RB 3ZNZB 1AN8A 3WOFA 1E1TA 2O2LD 4IPDA 3DM1A 3I4NG 4G50A 2B2VC 4F8CB 3H7PB 2DENB 5GAEC 3V05A 2VNUD 5CX3A 3FEWX 3J9CA 4RHSA 1FXTB 3PO2H 4YTPB 1HJPA 1KRSA 1W6KA 1VQCA 5M5WH 1V8QA 4BBSH 3TEXA 1TR5A 2UUBQ 1RM6C 1T6BX 5C23A 3T56B 2ZZPB 3NOBA 4EQPA 3NJTA 5CBAE 3DLLA 1NJIC 1PH7A 4YCVA 1JOQA 5C0XG 4DN4M 4JI7Q 1WTQA 2BYFA 1D5MC 3JC66 1XYIA 3GTOH 2WQYB 4HSVA 2WP9B 2A74C 2EY2A 4A75A 2B63H 4BBNF 3ZJUA 3MXPA 3W1YA 3HP3A 5IGGA 1JMCA 1HFNA 4YSYB 1HXYD 3NQIA 2QF7A 4NP5A 4BOZB 2VZKD 1QF6A 2SDFA 1R4MI 4CO7A 2B2YA 1I6VC 4QY7A 4A3DH 1YD8U 4B3TQ 4DR1Q 1WY8A 3HOUH 1TYGB 3A1QA 2QSDA 5GXGB 4ANUA 4JI3Q 4DAPA 1B2TA 4LUVA 4GKKQ 4JI4Q 4UP8A 4LFCL 4HR7B 1EOTA 3IFDA 2DZMA 5EJWA 5J1ZA 2QCPX 2WXNA 1IL2A 3AFQA 2TMPA 4V0BA 2YTYA 3R2TA 3KF8A 3KYCD 2F0MA 3NXWA 3PIO3 2PNRC 1FXIA 4KY7A 2FCNA 4EUTA 3IXSA 4OONA 1ZKHA 1B7YB 1QILA 2F0EA 1E3PA 1EQVA 1EY0A 2Q2IA 3Q8EA 2K8HA 3E9HA 3VR4A 1ESFA 4M02A 2L8JA 2F0NA 1K51A 3BY4B 2CHZA 3TSSA 2EQSA 1B50A 3D6CA 2JA7B 2BQQA 5CHFA 3ZW3A 2KN4A 1PH9A 5H1SE 4ZRJA 2E75C 4US8A 3AEFB 3PZ8A 4TMAB 5CGKA 3QB3A 2F1MA 3DHGC 1P9DU 1HA5A 3ZKJC 1OXSC 2LS01 5CYUA 3PO2B 3K59A 1RDPD 2C35B 2CW0C 2JSVX 5M5WB 4BBSB 4A3IH 1ET6A 2D3CA 1Q12A 2ZM6L 3CCRA 3TMPB 2IHFA 2UUBL 2L15A 2L76A 2F0QA 2A69D 3DVGX 4KSLC 2KEEA 2QIEB 2F0JA 2M0XA 1EY6A 3S2DH 4L23A 3RLNA 5BYQA 2ZPYA 3GTOB 3NE5B 4OO1G 2F52A 4G7ZC 3I72A 1ZXIA 2Z6KC 3U4VA 1GKHA 5JOBA 1PH6A 2B63B 2L5TA 3NPPA 1A3UA 2MQHA 3A8KE 1LT5D 4FVMA 1NEKB 4IKGA 3MXUA 2XTIA 4K8JA 3VH3B 1F9RA 1WX7A 5GAGC 1M8AA 1E7VA 3QC8B 2LGXA 5D6JB 5H92C 1G6JA 4A3DB 2DAFA 4HWIB 5E6NA 5IOIA 3HOUB 2SAKA 4A3LH 5DEHA 3D31A 1CZPA 1IUEA 1EY7A 1TWHH 1RTOA 2BE5C 1MJEA 2CCZA 4B3TL 1UBIA 1UEAB 2KMCA 3ONSA 2EELA 5IN7A 4JBWA 2VXWA 2WINB 1EWHA 1AFPA 3ZGZA 4IOIE 4JI3L 3AMUA 4WJ3M 2HUGA 1YEZA 3JAML 4B3MQ 1KXLA 1WFYA 2HJ8A 3KUZA 4ALPA 4IUTA 5EKIA 1HR0W 1LYLA 3BDOA 4OHJA 1TKGA 2DX5B 5E6JA 2GN5A 2ZJDA 2O6VD 4ZYSA 1ENAA 3H0GG 2MBOA 1VQ9A 4AQ7A 4ZDVA 1XLNA 3I4MG 2DY8A 2ZJQA 1T0RC 3EN2A 2F0FA 2H4OA 4I65A 3JAME 1STAA 3Q8FA 5D94A 2NBVB 1GO3E 4CBVA 1J7AA 4KY6A 4DR7Q 2K6QA 1FCCC 1LV9A 4B9XA 4FF2A 3HOWH 2VUMH 3ZNHB 1HNWQ 3I63C 1VZ6A 4MGKE 3MEHA 5BMIA 3M62B 3J81L 2NZHA 3K0XA 3ML8A 4ASWC
chains in the Genus database with same CATH topology
4CJ0B 3NVZA 4BA1I 1SIJA 2EY1A 1EWYC 4DK0A 2A6HC 1D2BA 1WTXA 4RCOA 3T4AC 4A3IB 2FINB 2KAJA 4C3JG 1PYWD 4PQXA 4XDCA 2A5HA 2WXPA 1TU2B 2ZXRA 1DJRD 2K1BA 2XN9C 2M0AA 1B9NA 4DQOC 1HHVA 2PZUA 5EBCA 4ZHPA 4DF7A 1VRAB 3DUZA 2F0UA 1SNDA 3RFZB 1GOZA 4IN3A 5IT9L 4EQNA 1TWHB 1CHPD 1UNSA 3LX0A 3MFGA 3OHXC 2Y5PA 1Y8OB 3K58A 3MVVA 4QUFA 2K7VA 5IT9E 4IUUA 3NTIA 2Z4HA 1VZ7A 1SJHD 1KDBA 3BDLA 1EU4A 2PTLA 4ARIA 3G7LA 5EE1A 3HOWB 5LNK1 1YNND 5EBDA 2V3PA 4H7BA 4FXKC 2JX5A 2HTME 1E2WA 1LACA 1CZWA 1PRTF 2IX0A 2KUMA 5C3WA 1SMYD 1NCVA 3AE2B 3AMZA 1L0XB 1MSGA 4JPSA 1K53A 1EIGA 4HSPA 2LHEA 4Y7NB 1GAQB 2F0HA 2H88B 2HCCA 1GJXA 1D5ZC 2Y0SB 2CW0D 2F0VA 1F2ZA 1ZE3D 1DXMA 3Q8CA 3MA2B 2KOLA 5FOBB 1Y8PB 4G7OC 2IX3A 1Z6HA 4NJCA 1JOOA 2MJDA 1V43A 2Q8TA 1PGAA 3ND9A 5JVH3 5I9PA 5CBEE 4MH8A 4ABNA 4ITKA 3Q8BA 3IAYA 1SXTA 5EE3A 2BE5D 5JAVA 3AEBB 5CV4A 1SYBA 3TP8A 1DCZA 5C0XJ 3ZQ4A 4HCSA 2WXOA 3NVVA 4GLSC 4TSSA 1PRTC 3SFEB 1WRIA 3LWUA 3K6OA 1IYUA 4AYBB 3J80L 1OXUA 1HFGA 4KHVA 5IGFA 4FP5D 3SHLA 4CKBA 1O80A 5D3IB 2Q8RE 4EGVA 2OEDA 1WTWA 4BY1B 2FHTA 3DWPA 5KIXA 5CV6A 1AEXA 3MP9A 1I4QA 2NN6I 1I7HA 4CJ2C 1HTPA 3J80E 4EVOA 1KDCA 1F9QA 1PRTB 1G6ZA 3U52E 1S5CD 3OIPA 2A6HD 1QJOA 2X6LA 2QDBA 3R3OA 4X3KA 3S15B 2K28A 5C44B 5A35A 5IGBA 3KUPA 2A68D 1WTRA 3V96A 1UWXA 2GA4B 3KLRA 5KYIA 5C3JB 2ON8A 1V1PA 1C4QA 2LGIA 3AV8A 4KTAA 4LMQD 3MZ5A 1QOBA 4UDUC 5HHDG 1IGDA 1HZ5A 2V4IB 1G291 2W55A 1YJJA 3S2HB 3T51B 1VMCA 1UGJA 4Q5VA 1CQFA 3TP7A 2K04A 4BY7B 1PMRA 5C0XI 4LLGM 3D8GA 2MEKA 4KY5A 1S5BD 3N9YC 1W6JA 1E0BA 3FILA 3R93A 2PQEA 1O7ZA 1BDOA 3NBHA 3GTLB 1PFDA 4XXEA 1BQQT 1BOSA 4GDKB 2YU9B 2PVOD 1JQYD 1SNQA 1XEEA 2BBCA 1JC7A 1TWFB 3H91A 1YNJC 2OEOA 1PDQA 2WIIB 3BVMA 2W82A 1C8CA 2L9HA 1ZUD2 3EGRA 3BIID 1O7LA 1PZKD 4XE0A 4ZKCB 4YTNB 1IBXA 2BDNA 2WDVB 1LABA 3BYTB 2F0WA 4HAEA 3SK8A 3LXFA 4N9PA 5ELDA 1CHQD 4K5XA 1ENCA 1N62A 1EYAA 4XQNA 1SNOA 3C46A 4L6TB 1LO5D 1OXTA 1ZXTA 4HKQA 4IFDH 1EQTA 2BTEA 3TP6A 2DLBA 1JRPA 2JA5B 3P4QB 4OZBA 4XQQA 4BA2I 1AZPA 1I6HB 1I4RA 1EY4A 3I3CA 1I50B 3BG3A 1J9OA 3M4YA 3I4MB 1EWCA 3H09A 1FD6A 2XRSD 5M5YB 4R3DA 4XQJA 2AWNA 3VYTA 1TWAB 2I46A 3EROA 4RGNA 4P6VF 4PMWA 1E2ZA 3O13A 3J7YW 3I9V1 1EY5A 1QB5D 1F2LA 5IIFA 2KDMA 1ILQA 2X69A 2OXPA 4C3HG 4WRDA 2VB2X 5FK9C 3GTJB 3K5MA 1IYVA 1HTLD 3PUWA 3QO2A 1JWBD 2IGGA 2AQ3B 3VRBB 2F0KA 2OHFA 3D3RA 3GV6A 1PFBA 4R9WA 1I4XA 1SNPA 3HVZA 4RKBA 1I4HA 2R93B 3S1RB 1GUNA 1ZDXA 4KKTA 1EEFD 2BA1A 5LL6S 5FLXL 2M19A 5EE9A 3S16B 4FO2A 1HUMA 1JCKB 1V1PB 2VZKB 3EJIA 1TQOA 4CGYB 2LUMA 3AE8B 2RMMA 1PXUA 1MI0A 4B08A 1AWDA 1D5XC 5FLXE 2X6GA 2L1BA 1KTKA 3AE6B 3NZ3A 1FFVA 3NBIA 4IURA 3N52A 5F2DA 1H9SA 1OO9B 1PLFA 3MFYA 3RLFA 2J7ZA 2K01A 3MXNA 2DYMA 5D7GA 1MPEA 2M9VA 1CI3M 3EVQA 4D2KA 3FMCA 2LMCA 2A69C 5ELFA 4E6IA 4DNTB 3G6JB 2ZXPA 5KEEA 3PMFA 4Q2JA 3PO3B 2QMTA 3TEZA 1KRHA 2SEBD 4QCLA 1E7PB 4A6QA 1F2MA 4RNAA 3S17B 4KX6B 4TKOB 4GZYC 3I73A 2K9XA 1ICWA 3HS0C 4MHEA 2IT1A 5JPNC 1NAPA 1WD1A 2EYPA 1H9RA 5JEAJ 2EYOA 3TP5A 4NW2A 5CORA 3P4PB 2ZXOA 3VQIA 3ZJVA 3D4WA 4XWWA 1VDZA 1LT3D 1R9TB 2O5IC 2RDFA 2F0IA 4A55A 3R2IA 3K0YA 3HKZB 4RKLA 2ZT9C 2R3ZA 1RD9D 5EQ0A 3WOEA 4HRSA 1GHJA 1KLGD 1U9RA 1OXVA 1UUPA 2RDGA 3VR3A 1FXAA 1IL8A 2XWBB 4A3MB 1UAPA 4YTMB 1MHXA 4EE2A 1TY2A 2IL8A 2PZTA 1WD0A 1H9KA 1NUCA 5M5XB 1A70A 4FXDA 5M3MB 1B4OA 1ZP0B 2Y5CA 1YN3A 4OL7A 1VCIA 4QB4A 2LKVA 1PGXA 1C77A 2CQAA 3AEDB 5BN4A 3MXGA 2HDEA 3SR1A 1I4GA 2F0DA 3GP7A 3OMGA 2EZVA 1XCQL 1L5PA 1F2RI 2C5CA 4RWSC 1HCZA 3IT6B 1YNTE 3PV0A 2G9DA 3W5UB 2MP1A 1C79A 4F8MA 2B2TA 2R61A 4NAWB 1XLOA 1U4RA 1FYCA 1LTSD 1YNNC 1IW7D 4V190 4OW0A 4LJZC 2F0OA 1YN5A 4FF3A 1TY0A 5CV9A 1Q10A 2QJLA 1SMYC 1BUVT 1XWEA 3M7NA 3P1HA 4XTCS 5BN5A 2LHDA 3KWLA 2B2UC 2D5GA 1TT2A 3HOYB 3SDZA 4MT5A 3TDQA 4ZAIA 3SFDB 1EIHA 1ACCA 5C4XB 1WTVA 1SJED 5KNCA 4N6EB 2PMVA 1LTBD 1MHHE 2AQ2B 1AW7A 1F2YA 3GB1A 2ICEC 2JE6I 2BS4B 5EPLA 1A15A 1RJTA 3QOJA 2W3SA 1QLBB 3M85A 3RUZA 1MSHA 5ELBA 1VLBA 3M4OB 3NVYA 1BMLC 2RQXA 1FGBD 1M4VA 3GTGB 3AEEB 1MBYA 2X38A 3ETRA 4DK1A 3Q24A 2GI9A 1JROA 4DAYA 4KK7A 3LWEA 3FPPA 1CM9A 2N88A 3KBXA 1WYGA 3BK1A 1L0YB 4CQNA 1QOAA 3NP8A 2KACA 3RZOB 2FFKB 5FO9B 5JVG3 1FRDA 4J6HA 5I6YA 1CQVA 1TWCB 1L6VA 3GD7A 1WGKA 3IKJA 2ID0A 1ZKOA 1DOKA 1EEID 3TEWA 3KBGA 2WXIA 3VRAB 4L63B 3GTPB 1KABA 5BMHA 1JW9D 3DWQA 1NYQA 2RBMA 4P16A 4P2CB 2B39A 3P20A 4FXCA 2A68C 2V3NA 2ENBA 1TS3A 1C78A 3VR8B 3S1QB 1JORA 1E9MA 1JWUD 1E10A 4Q0FA 4XYOA 1VJKA 4CKEA 2WXRA 1JWSD 3W5VB 5JJZA 2BW2A 2WACA 4WWMA 1SYDA 1V1OA 1A3TA 5KYLA 4C3IG 2PW7A 4ZKBB 2QEJC 2NN6H 3EUB2 2GRIA 3HG9A 3SK4A 3B2GA 1FD7D 3HGBA 3MAQA 2FBWB 1GXDC 2L4NA 2B2YC 3ERQA 5G5GA 4FXGC 2Q8IB 5K36H 2OT2A 3NQTA 1MVKA 1Y1VB 1GUTA 3A54A 2BT6A 4F7XA 1BO0A 1HQMC 3I91A 4KD3A 4WFN3 2E2HB 2C9OA 3NK9A 1QOHA 2F0PA 2PLPA 2I07B 2DBYA 3HEJA 3PUXA 1ONLA 1TS4A 1T5XD 1EM7A 3OIQA 1SAPA 3CU7A 4NZLB 2JEAI 3AN1A 3WDNA 2K3UA 4MACA 4IALA 4KN7C 1H9MA 3HOZB 3DEOA 4RCNA 1FEHA 2DWQA 4G4KA 5IOCA 3ITPA 3QIAA 3HZXA 5C0XH 1Y1WB 2KQ3A 3C1EA 4OIKA 3NTKA 4DA2A 2DYOA 4KV6A 4N58A 1AZQA 2F0GA 1WTOA 5J22A 4RFBA 1Y8NB 1U4MA 5NUCA 2TSSA 1QKZA 4KKIA 3TN2A 1B53A 3R8BA 1FRRA 2L1AA 4TQ0A 2NTSA 1DOMA 4PT5A 3W1SA 1IGCA 4Z9CB 3GO5A 1FIQA 3SR6A 5ELEA 5C2TB 1HQRD 2Q5WD 4ZLTF 1OQQA 4OZAA 5IGEA 3I4NB 2WU5B 1XF5L 4A8XC 1JWMD 1EYDA 3EQLC 2JXMB 2MJ3A 1K8OA 3CWIA 1S5FD 1FMAD 1O7YA 1XLPA 1AP0A 1A2TA 5JEAG 3ND8A 1DOXA 4KGSA 1RODA 4IUPA 3AE9B 2MJEA 4OO1H 2IX1A 4BS9A 2AWOA 5C5MA 2NVQB 2EPBA 5I9OA 1EZ8A 1QT9A 5FO7B 1YN4A 1DGJA 2NUCA 2D5DA 4F88A 1F77A 3BS1A 1G2SA 1SE2A 3I70A 1NVID 2K0PA 2PW5A 3AU7A 1WTPA 5D65A 2PKOA 1L0VB 3TZUA 4C1NI 2E2DC 2HDLA 2RPVA 1HRJA 3U2SC 4RH6A 2EYLA 4XDXA 3L7ZC 1GB4A 4NMZA 1LT6D 1A2UA 2F0TA 4H44C 3NWTA 2RVLA 1B3AA 2MGSA 2WXKA 1AYFA 4WORA 4H13C 4U68A 1WWTA 1JR0D 2WXLA 4C1NK 5FKAC 4K8IA 5IGCA 3Q6SA 3RPFC 3I8ZA 4N59A 1C9FA 1C4PA 5KNBA 3W2DA 3GS2A 2K33A 5E4WC 1KH0A 2N55A 2L32A 3P1MA 1FO4A 3S1MB 2EJFC 5AUKA 2FJ2A 1TJEA 1L6UA 2JEBI 1ENFA 1KF6B 2JYTA 1DZ1A 2AUJD 5HFYA 2K5QA 1CTMA 3OW7A 1GUWA 3OWEB 4YT0B 4RA8A 1LT4D 4KMUC 1TKEA 1QOGA 3H0GB 2WKCA 1F0ZA 1SNCA 1E6EB 4NKLA 2KQ4X 1KNEA 3S9WA 2IPKD 2MH7A 1S5DD 1LTRD 2F3VA 5CR3A 2DNCA 1XTCD 4IFDJ 4JX1C 3L3OC 5M3FB 2MHVA 2XRQD 4ILWA 4KJOA 1QQRA 1QWYA 4YSXB 3KWVA 3T53B 2KECA 1NR4A 3TZDA 1XX8A 2INNE 3V2TA 2B2VA 3NTHA 2CHBD 1STGA 4C3JB 3A7LA 1PZJD 3FPUB 3L9AX 2EY5A 3S14B 2WXHA 1C4AA 3W9CB 4ZRPA 1ESRA 1CZGA 4HCEA 1FNUA 2NVTB 1Y56A 1NR2A 3SXHA 5I2YA 3GV3A 1X3PA 2EOTA 1Q1BA 1K50A 1BR9A 1HA6A 2JYEA 3PZ7A 4WURA 1STBA 5T1GA 5DNFA 3SEBA 4A3JB 1SYCA 2BS2B 2HDMA 3P42A 2E3TA 2H1EA 5EPJA 2I2YA 1ZYRD 2EY6A 2VB3X 2PZWA 4KKUA 2K5DA 1F9SA 1N63A 2Z8LA 1XCTL 1IW7C 1EY9A 1SE3A 4DNRB 1Y69U 3PO0A 1QE6A 1R4PB 1IHZA 2JYOA 4HEA1 3AE3B 1VDVA 4K5VA 2A73B 4IFDI 2J52A 2IJ0A 3AE4B 2PCFB 3VR6A 1A6XA 1YQ3B 2EXZA 3FILB 2O4XA 1QG7A 2EDGA 4MM3B 3K7AB 2XIWA 2IGHA 2WU2B 4J1MA 2J4XA 1MI2A 1PFMA 4HN7A 4NAMA 4K2LA 1GB1A 4C7ZA 3CHBD 3K57A 4ZUJA 5JEAH 3GQBA 2YEPF 3DWAA 3P75A 2KHSA 4I7ZC 3HOVB 2L55A 4OIJA 2KEDA 1Z47A 1U4PA 3AB5A 1Q1EA 1QCBD 1IBXB 2E76C 5C3XA 1SE4A 3SVMA 4TRDA 1PTOF 2OF1A 1S5ED 4YIJA 2IGDA 1N5WA 4BBRB 3J7AV 1RWSA 1PTOH 3NSWA 4M8AA 3F2UA 2Z4IA 3AE5B 1VR9A 2NVYB 1PFNA 4IZ8A 1VF5C 1WSPA 3MJ5A 2WDQB 2AQ1B 4HJGE 2ZW0A 1F2RC 1A3VA 1II3A 3GTQB 3AM9A 2ONQA 2B8FA 2EYHA 3A8JE 4M0WA 3ZJTA 3HRZC 1KDAA 3W3AA 3C8YA 2EE1A 2K32A 1FM0D 1SDFA 2NTTA 1BCPF 3SE0A 1YJIA 2WNMA 3A56A 2K05A 3FRPB 3OSOA 3K5LA 3HOXB 5C5LA 2Y3AA 4JK1C 4L1BA 2XSCA 4QF4A 4K6LA 4DU9A 2LFIA 3T3NA 1QNUA 3DXJC 1TWGB 5AFWA 3AEAB 3KLSA 1SFOB 1PTOC 1L4DB 2YEPB 2BOSA 1OFFA 1TZOA 2QKIC 1CA6A 4TQ1A 1D6EC 3VA5A 2CU3A 5KRUA 4RGOS 3AH7A 3VYUA 1K8MA 4WQMA 3MC0B 4RHRA 4TQUS 3M3YB 1VMPA 1PTOB 3Q69A 4M1UB 2L0CA 3S1NB 4XT3B 1D1IA 1FNWA 1U4LA 1OXXK 2WXJA 4L8JA 1H9JA 2WDRB 4REZA 5HG2A 1MGSA 2N0SB 3QWNA 4XIGS 5I2XA 2EJMA 2LY7A 1BCPC 4LTUA 5EE0A 1ZOYB 1QNKA 2ICIA 3V3XA 3OOCA 3C2PA 2J0TD 4RAUC 1XO3A 3FDTA 3K5OA 5DM73 1EL0A 2NYZD 2WS3B 1HPCA 2E74C 4US9A 4UAIA 4DXFA 2FMMA 1BCPB 2JA6B 2PIAA 2R92B 2G9HD 3CRLC 2E2JB 2H89B 5AUIA 5CC4A 1I3QB 3MHZA 5TSSA 2L83A 4MN3A 4ZK9B 2JA8B 1H9SB 3VYRA 3Q22A 1B1ZA 3I90A 1BUIC 3FC4A 4KKSA 3D6WA 1O78A 1LTTD 2JQRB 3E9SA 4KGTA 3T13A 1EZ6A 4GDLB 4A3BB 2F4IA 2MUYA 5BYSA 2MPMA 5LL6X 1G91A 4A3EB 4G57A 1CK1A 2LMCB 5C4ZA 3CKIB 4ULLA 1SSOA 3M7GA 4K14A 3AECB 2KMMA 2M2LA 1V8CA 1EFID 4HKZE 1G8ZD 4G7HC 1PGBA 4J3OD 2WB1B 3U9SA 3MHBA 2N9LA 1TKWB 2NVXB 1LTGD 2IW3A 4MIUA 4HROA 3U9OA 3BVZA 1LLRD 4L2YA 5I6WA 2SOBA 2M00A 3UI2A 5C3EB 2CVRA 4XYQA 1L4ZB 1EYCA 3QJYA 2IDYA 2KCNA 4FF4A 3PUVA 2W3RA 4LK0M 1RYJA 2L11A 4FNFA 4CJ1B 1CJEA 4K6DA 4KJNA 5DM63 3PIP3 2NBFA 3BWUD 4C3HB 5CMDA 4PMBA 4O42A 4USAA 3NUCA 3J81E 1ILPA 1CA5A 2K22A 5BN3A 4HMIA 1P7FA 4H0LC 4FF1A 1N61A 3E5SA 1PTOD 5G3LF 4KGRA 3S2DB 1SF0A 1X32A 1C76A 5A2QL 4KD4A 2RDHA 1T5EA 2XWJB 1TIID 1SYEA 4PV1C 4IFDG 2BCOA 1ML0D 5CV7A 3IAM1 5G5HA 5A2QE 2B2WA 1RTNA 4LAAA 5BYRA 3BDCA 3D4DA 1Q8IA 3QG1A 5T8IA 2BYTA 1Q90A 1JOKA 1BXTA 2WXGA 2NB0A 2PPBC 3HVDA 1E2VA 2XVSA 4NDXA 2V0GA 1LTAD 2O5JC 1P7EA 2JWUA 2B2TC 1BCPD 1ZXHA 2D62A 4DFAA 2F3WA 4WAFA 2LFNA 2VUMB 1BF4A 1TS2A 3X3NA 1J7BA 1WCMB 4OZCA 1WVLA 5FO8B 1GUGA 3U4EG 1SEBD 3NRZA 3DEPA 1DOIA 4OGQC 2WKDA 2PO4A 4U673 4WJWA 3L4PA 3K5NA 2BA0A 4IQZA 1XLQA 1SYFA 3QOLA 4X3TA 1FR3A 4K5WA 1FCLA 1WXQA 2YYZA 1K52A 1NENB 1SB3C 2JP1A 1C4CA 2ZW1A 2KCCA 5C4HA 5EKLA 2EKIA 3N6RA 2RSOA 5CV5A 3DWGC 5KGUA 2FE8A 5C6AA 5M9OA 4KKJA 4X3SA 1BBXC 4RGTA 1GHKA 1UWMA 3AB9A 3I4LA 4KHZA 3AE1B 3LYYA 4QUCA 4ZUIA 2KVMA 3TUOA 3PUZA 2L12A 4QIWB 3D4RA 2SNSA 3IT4B 3AE7B 3E0JA 1D1KA 1R4QB 2WXQA 1ET9A 2I38A 2B76B 1EU3A 2BS3B 1LTID 3C1FA 1TS5A 5FR3A 2QILA 2G1EA 4JE3B 1ZEQX 1CFMA 1RFKA 4B0MA 2AUKA 1JALA 2K5PA 2N9KA 1EY8A 3CQZB 4EQOA 4K2KA 1HEZE 1RCVD 2WV6D 2KJXA 3E56A 4IUQA 1VZ8A 4IDIA 2K03A 3T16A 5E1FA 2NWGA 4F87A 4IUNA 2J42A 3NUHB 1STHA 3Q8AA 4AS1A 3BVGA 5COYA 1D4BA 3FAHA 4C56C 4A3KB 2BDOA 2AX5A 4JWUC 3SK5A 1Q3LA 4OVZA 3TEYA 4HMJA 3VYSA 3H6MA 3A7AB 3P4SB 1KAAA 1PUTA 1JWAD 5EPKA 3IL8A 2PYKA 3PUYA 3UI3A 3VR5A 2KA7A 2BB5A 3ABVB 2WXFA 4JWSC 2GB1A 1DYQA 4XT1B 3NWSA 1C48A 3CRKC 4A93B 1GUSA 1NSNS 1ZYRC 4RF0A 3NS1A 2R6GA 4BWGB 2D9UA 4YXDB 2PVGC 5E3FA 3A55A 2B2WC 3VA7A 2NZ1D 1RKNA 3VR9B 2WP8J 2JXTA 1YQ4B 3AEGB 5MPOA 1STEA 2A6EC 2B8GA 3Q23A 1DONA 4YWGG 3EA6A 3TMEA 3DHQA 5JXVA 2K5WA 1ZDVA 2PMZB 3IFTA 4DAVA 4A3GB 1GPXA 5G3LD 5BMGA 1STNA 1G2TA 2EVBA 1SYGA 1VF7A 3FKIB 4DGZA 1IKLA 2JSOA 1JE4A 2R7ZB 3P4RB 4R8IA 1JICA 5J39A 4QMGA 3T3OA 5KNDA 5ISRA 4ID6A 4HEDA 4FYDA 4O1NA 4N9TA 3NVWA 5HI1A 3X3MA 1IKMA 1FNVA 3EFXD 3ONAB 2MJ8A 1DOLA 4ZRZA 1B9RA 5D14A 4A90A 2F0SA 4PMCA 1QOFA 4R8NA 3CIRB 4RF1A 4A9AA 1T3QA 5EGTA 1DM0B 5T1IA 1STYA 1RF2D 3BZDB 1CT1D 4B9WA 3C3LA 2Z1CA 3MWYW 3TBIB 2LJIA 2BB6A 4C2MB 1YMHE 5I4DA 2K6AA 1PRTD 4OO1I 1FFUA 4RGMA 4ODGA 5DAUA 2EJGC 4WH4A 1SBBB 4ZQ3A 2CJOA 2RKSA 1PZID 2NMQA 4XWTA 1V97A 1I4PA 2E6XA 1KLUD 2F03A 3LNNA 3P7JA 1PDXA 1SNMA 3FVQA 4ZRQA 2XNAC 1DOYA 1MD2D 1J8IA 1DD2A 3OPOA 4ZHOA 5HURA 1JB3A 3I57A 2J53A 3J7AF 2WXMA 1GUOA 2FUG1 2HCIA 1TKYA 1X3QA 2F0LA 3KK7A 3RMHA 1HZ6A 1SSNA 3P63A 5C4JB 3MTSA 1NYRA 2JU6X 4ARCA 4B0EA 4C3IB 2DNEA 3DWMA 1OQRA 5D3DA 3WCQA 4S3SA 4KN4C 2JZPA 4H2AA 1TVXA 5LHY1 1ZPSA 3H3VC 4XDDA 1JQ4A 3DMUA 3URYA 2ACZB 2EYMA 5IODA 2RA4A 3BK2A 4X3UA 5EKKA 1XXGA 2PW9A 2A6ED 3RD4A 2W54A 1R7SA 2WAQB 5JPMC 2FMCA 4WIPA 1S4ZA 3E6ZX 4CHTB 1BNZA 2B2UA 4KI0A 1E0ZA 5E4XA 5H8YE 2N7JA 3SK6A 5CV8A 5K5PA 4ZOHC 3A8IE 3KLSX 4J8QA 2INPE 3B2FA 1YNJD 4ME5A 1JMLA 3GTKB 3KQ4A 3OMCA 2EYFA 3BYYB 4YSZB 4HTHA 1K83B 2D2CC 3IAS1 4CKCA 2LEKA 1KFYB 3RZDB 2DN8A 3Q0AA 1J7CA 5IGDA 3VR2A 4DXGA 2DY7A 1KNAA 3H8HA 2L52A 2M56B 1F9PA 2NN6G 3OWFA 5HGTA 4IUVA 1N5XA 1B44D 5K36G 2SNMA 3B9JA 4A3FB 2CJNA 2HQEA 2RSNA 3H94A 2WLBA 5ELCA 4PNYA 1RHPA 2V4DA 1ROEA 4C7YA 2KWDA 3HRDD 3NHHA 3HUIA 1N60A 4LK1C 3LB8C 3ZYYX 1B9MA 3GTMB 1NI3A 2EYJA 1HUNA 1Z7TA 2IWHA 4C80A 2E2IB 1AN8A 3WOFA 2O2LD 3DM1A 2B2VC 3V05A 2VNUD 3FEWX 3J9CA 4RHSA 4YTPB 3TEXA 1W6KA 1V8QA 1TR5A 1RM6C 1T6BX 3T56B 4EQPA 5CBAE 1JOQA 5C0XG 4DN4M 1WTQA 1D5MC 1XYIA 2WQYB 4HSVA 2WP9B 2A74C 2EY2A 3ZJUA 3MXPA 3HP3A 5IGGA 1HFNA 4YSYB 1HXYD 3NQIA 2QF7A 4NP5A 1QF6A 2VZKD 2SDFA 2B2YA 1I6VC 1TYGB 5GXGB 2QSDA 4DAPA 1B2TA 4HR7B 1EOTA 3IFDA 5EJWA 5J1ZA 2QCPX 2WXNA 4V0BA 2TMPA 3R2TA 3KF8A 2F0MA 3NXWA 3PIO3 2PNRC 1FXIA 4KY7A 3IXSA 1QILA 2F0EA 1EQVA 1EY0A 3Q8EA 3VR4A 1ESFA 2F0NA 1K51A 3TSSA 1B50A 3D6CA 2JA7B 2KN4A 2E75C 4US8A 3AEFB 3PZ8A 4TMAB 5CGKA 3QB3A 2F1MA 1HA5A 1OXSC 2LS01 5CYUA 3PO2B 3K59A 1RDPD 2JSVX 2CW0C 5M5WB 4BBSB 1ET6A 1Q12A 2F0QA 2A69D 2KEEA 2QIEB 2F0JA 1EY6A 4L23A 5BYQA 3GTOB