2RDHA

Crystal structure of staphylococcal superantigen-like protein 11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
RSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREDNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
molecule keywords Superantigen-like protein 11
total genus 58
structure length 185
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdhA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdhA01
1SE2A 3O13A 2CHBD 1LT5D 2XRQD 1PRTB 1LT3D 3SEBA 1T5XD 1PTOH 4Z9CB 2XN9C 1FD7D 1FNVA 1BCPD 1I4QA 1V1OA 4L6TB 1LTTD 1EWCA 2IPKD 1SE3A 4RGOS 1L0XB 1PRTC 5ELCA 1PTOB 1EU3A 2R61A 3R2TA 3CHBD 1I4XA 1TS3A 1L0YB 1G8ZD 1QILA 1V1PA 3KLSX 5ELFA 5I4DA 3DWAA 2RDHA 1PRTD 1JCKB 2IJ0A 1CT1D 1KLGD 3BVZA 3URYA 3TSSA 4O1NA 1STEA 3BYYB 1PRTF 2RDGA 1FNWA 1ENFA 1LTRD 1XTCD 4OHJA 2J4XA 1CHPD 1D5XC 4DXFA 1YN5A 1DYQA 1PTOD 1HTLD 2SEBD 3R2IA 3GP7A 1S5BD 1D6EC 4NZLB 1YN3A 5D3IB 3W2DA 1I4PA 2ICIA 2G9HD 5TSSA 4K6LA 5ELEA 2AQ2B 1TS2A 1JWSD 1BXTA 1ESFA 1LTAD 1SJED 1V1PB 1LT4D 1PZID 1S5CD 1CK1A 4RGMA 1FNUA 1SE4A 1LO5D 1BCPB 2TSSA 1LTID 1JWMD 1PTOF 1F77A 4TSSA 1LT6D 1CHQD 1EEID 1JR0D 3EA6A 1SJHD 3R8BA 4ZYSA 1I4RA 1SXTA 4C56C 1LTGD 1S5DD 1DJRD 1KLUD 1D5MC 2NTTA 1HXYD 1XXGA 2QILA 1EEFD 4RGTA 1D5ZC 1RF2D 4RGNA 1I4GA 1I4HA 1ET9A 5D3DA 1TY0A 5FKAC 1SEBD 3V05A 1EU4A 1SBBB 1HA5A 3DWPA 1JQYD 3EFXD 1PYWD 1BCPF 2XRSD 4RH6A 1EFID 3BVMA 1ET6A 4UDUC 4BWGB 1B44D 1HQRD 1TS5A 1LTSD 1JWUD 1UUPA 1S5ED 1TY2A 1RDPD 1YN4A 1M4VA 3BZDB 1S5FD 3BYTB 2NTSA 4RHSA 1TS4A 1BCPC 1KTKA 1RD9D 5FK9C 3OWEB 2AQ1B 4RFBA 5ELBA 1GOZA 1CQVA 2Z8LA 2QEJC 2WV6D 1LTBD 3DWQA 4RHRA 1AN8A 3BVGA 1B1ZA 1PTOC 2O2LD 2AQ3B 1AW7A 1PZKD 1RCVD 3MC0B 2XNAC 1MD2D 1PZJD 1UNSA 1LLRD 4RCOA 4DXGA 4L63B 5ELDA 3MFGA 1FGBD
chains in the Genus database with same CATH superfamily
4WRDA 3T53B 2ZVOA 4XYQA 2H4OA 1SNCA 1VQJA 1K8RB 4MGZE 4HK2A 1MI2A 3AU7A 1N34L 2Y5BB 1EWHA 4HMJA 2LMCB 2NB0A 3AU5A 2CH4W 1T5XD 3IG3A 3QHTA 4LNQA 1Z7TA 4DAYB 3GTJH 5DPTA 4IWPA 4DR5Q 1B2TA 1GUNA 3FHWA 4HKZE 5M3FG 3DVNV 4A3JG 2IPKD 2PO4A 2VS1A 2NN6I 2WAQB 2L9HA 3C1FA 1HE8A 1Q10A 1LACA 1WR6E 3ULPA 1EUJA 5IE8A 1ZDVA 5M9OA 2F3IA 1WRDB 3DM1A 2NZHA 2O5JC 4TVAB 3S17B 3VYTA 1J8CA 1QILA 2MWSB 5IOIA 2DENB 4KHPL 4CDEC 2UXCQ 1JRUA 2KFKB 1P8LA 2YVCA 2VL6A 3J7ZC 3TSSA 1STEA 4YWKA 2F0EA 4K2KA 4DV4L 5AJ3L 1VZ8A 3J80i 5CTRC 5D2MB 2FE8A 1V2YA 2A5HA 4TKNA 3I4NB 2JYOA 4NJ7A 2JSOA 3T51B 2VUMH 1CM9A 1E2WA 4E3CA 3RMHA 4YSXB 4B9KA 4OHJA 3D3RA 5I6WA 1N6ZA 1N8RC 2M8SA 4DV5Q 1P7FA 1Y8RC 1PUTA 1VZ6A 4QIWE 3HOUH 1BO0A 4X62L 2R7ZB 4GLSC 3PUYA 2ZM6L 4IURA 1HZCA 3B1LX 3KF8B 2K5HA 3U4EG 2K28A 1MG8A 1YN3A 2MHJA 2NN6G 3W2DA 1I6HB 1SIFA 1WTQA 2DX5B 4K6LA 1FL0A 3NELA 5CV6A 2F0HA 2IX3A 1C77A 2IZVB 2KN4A 2ACZB 4RKLA 1MHHE 3VFKA 4MDKE 4XT1B 1CKMA 3QWNA 1VQ8A 4EOYA 5EAYA 3OAWA 1VQFA 5JEAG 1HTQA 4J6IA 3UIPB 5J22A 2VZKB 1LM8B 4RMAA 1BF4A 2BKFA 4KHZA 5KHQA 1KLUD 3T9LA 4X65Q 4ZDVA 3HOVH 4A55A 3TZUA 3K5MA 1I4HA 3PUWA 4TQUS 4OONA 1JW9D 4WWOA 3SHQA 1SBBB 3CCSA 3EFXD 1B50A 3ZDMC 2EJMA 1EIHA 4LF5Q 2EYHA 4JLCA 4B0EA 1Z5SB 1BDOA 1STAA 4A3DB 1C48A 1NYRA 5C0XI 2WXHA 3QX1A 3NRZA 4C4VB 4C00A 2LXCA 3NTIA 2X6LA 4IJHA 4C3IH 1DOLA 1KDBA 2WKCA 3F1ZA 4FJYA 3BS1A 1VQ6A 2ZPYA 4BKGA 4XX5A 3OLMD 2RHSB 2UUAQ 3T3NA 3D4WA 3G48A 1Q1EA 1ZXTA 2K1BA 3I4OA 2UU7A 1AN8A 3HOZB 4HCPB 4LNIA 3W1SC 2RVLA 4R4IA 3LNNA 3RNEC 4W9IA 3HOWH 3VHTC 4IPCA 5JOBA 2B8FA 5EDSA 5EBDA 3E9IA 4ZUJA 2MUYA 1H9SA 2EY5A 2F52A 2JUOA 2A68D 4L5RC 3Q3FA 2CWAA 4HEDA 5D6JB 3L2PA 3VVWB 4A3LG 3V3XA 2KLCA 1RTOA 1DOIA 4LF6L 3AE3B 5IT9E 3Q3MC 2CJOA 1EY4A 3B0AA 1F2ZA 3TP5A 3OPOA 1UE5A 4FXDA 2R93B 2E2HB 2VZKD 1YHQA 4DUYL 1FNVA 1BUVT 2B2VA 2D0OA 1ZP0B 3CPWA 1VCIA 4YT0B 5BO4B 2QF7A 1HFGA 1YIWA 5FJ8H 1STBA 4DV1Q 2MX2A 3MA2B 5BR8Q 4MZ9A 1ONLA 3NUCA 1VD2A 2ON8A 3DEOA 4TKOB 5I4DA 4C1NK 3RULA 4S3SA 2IJ0A 3URYA 2MHVA 3K5OA 4JOIC 1G51A 1X3QA 3HOXG 1DD2A 1X65A 1I6VC 2MA9B 4LFCQ 1XTDA 2V4LA 3IAS1 4GB9A 5FO7B 3G4SA 4GOPA 2CR5A 3P63A 2N4FA 1EWIA 3K58A 3RZDH 1WRIA 4LFBQ 3AYHB 2M17A 5D7GA 3KF6A 1EUVB 2WNMA 4R9WA 1BBXC 4DR2Q 5E4WC 3HEJA 5FOBB 4IUPA 1V43A 1IKLA 3CRLC 1WTXA 1MFWA 2D07B 3U7DA 4HJ8A 1MJDA 2WXQA 2A5UA 3PSEB 4BAXA 4OEMB 3DUZA 2KX3A 2QEXA 1E2ZA 4BXXH 1IW7C 1LO5D 3F2CA 1A6XA 1ZYRD 4ILWA 1JR0D 1R4NI 1KH0A 4EZKA 1Y1VB 5F2DA 1L2FA 4ZYNA 3B6YA 3MHZA 2L4NA 3M4QA 2G9DA 1S5DD 2UXDQ 3CCVA 5FO8B 2KANA 2IGHA 4NJCA 2PVGC 1X6OA 2IT1A 3J81c 3CSFA 5GMVA 1ZW7A 2MO1A 3FPPA 2JA5B 1Z9FA 4NMZA 1ET9A 5FKAC 1WM2A 3H0GB 3DMUA 1JQYD 3VTVA 2LUEA 5CMDA 1PH1A 2D3CA 3U2SC 4TV3A 3ZIMA 4C3JB 1B44D 4A3FH 1XMQQ 3OWFA 4LFBL 2JQRB 1T0SC 3RPFC 2SNMA 2QMTA 1IUEA 4HMIA 2HHHQ 1FO4A 3P20A 3ZGZA 3M9BA 2WU5B 5E1FA 4A3IH 2EDGA 5C4JB 4KHPQ 5IGFA 3MP9A 4ZRJA 3DBSA 4E6IA 2AHOB 1EY9A 2HCIA 3HK0A 4NP5A 3K9OB 4DK3C 3LX0A 3TEZA 3UDGA 5FLXc 3N32A 1A3TA 4GLAC 1I94Q 1PTOC 4AH6A 5BN4A 2N0SB 2LGYA 2K6DB 2ZXPA 1C7YA 3S16B 2BS2B 3NZSA 2F0DA 2VB3X 3TS0A 1VQMA 3H91A 2K0PA 2KJ6A 1RFAA 3Q6BA 4FJVB 4YHHQ 1XNQQ 5AJ3Q 4IM3A 4RAUC 4JYAQ 1WXMA 3BJUA 1V5TA 1YX5B 1S3SG 1VQHA 3GTGB 2Q5WD 2J53A 3NSWA 4AUQC 2A69D 1HZ9A 4LUOA 4DV0Q 3H1UA 3S2HB 4ME5A 4LCDE 2NVQH 2IHFA 3I72A 3LYYA 3VDZA 4HLEA 4MHEA 1XLPA 2C9WB 1EZ8A 5LMNQ 2K75A 2A6ED 4KKJA 3RNFC 4Z9CB 3PREA 1Q82C 4A3GB 1DGJA 1N60A 3ZJUA 1EYDA 5ELCA 1WE6A 3FKIB 3QB3A 1TS3A 1UWXA 1X54A 1OTCA 1PGBA 2KMCA 3I5JC 5CBAE 3SR1A 2B3AA 1K83B 5ELFA 2M2LA 3SK5A 4A3KH 2WP9B 4JC0A 2LHDA 2WXFA 3CRKC 1A2UA 3I73A 1K50A 2LFIA 3BYYB 1TGZB 1EQVA 2MEKA 2I07B 2LXKA 2J0MA 1YQBA 2DGYA 3VYSA 2JE6I 1BKBA 2KZRA 2RKSA 1NSNS 1WTPA 2WXJA 1HUNA 3KYDD 3MJWA 1OXUA 1R4MB 4JIOU 4QAYA 2O6VD 3A9JA 4M8MA 1KNEA 5L95C 1DOYA 2XBBC 1VJKA 2IBIB 4DDGD 5G5HA 4BY7H 2DYOA 3AEGB 1BVSA 1E6EB 2W55A 3PQIA 5IYBG 1P0RA 2PI2E 1U4RA 3QG1A 5CX3A 4FNFA 4W9GA 2B2WA 5J17A 4F7XA 1TT5B 2K6QA 1PFDA 4KY5A 2I46A 4DR1Q 1WXQA 1B9RA 2C7NB 1H8CA 3NJTA 2M1MA 3ENEA 3E5SA 2OOBB 2ZW0A 2K03A 2MH7A 1DOKA 3K7AH 4GN5A 3J7AV 1LTGD 2L12A 3UQBA 4JI3L 1NBWA 2WX1A 1SNPA 2HTHA 1WI0A 2KC1A 4ZK9B 4KDIC 2XGTA 5M5XB 1C78A 4LF8Q 2LASA 4I6NB 2B2TA 3MEFA 4ABNA 1RRBA 2KWUB 1H9SB 5BN3A 1O78A 2A68C 4GDKB 4P75A 3DVGY 2JN4A 5LMUQ 2MBHA 3JAME 3IXSA 3KDFA 5CGKA 3VR8B 3ONSA 3S2HH 1LUZA 1HZ6A 5AZFA 4H02A 3GTMH 2WB1B 2AL6A 3TEYA 4M0WA 5IT9L 4QF4A 4ZCKA 2FINB 1BCPC 1RODA 5IP9G 1RD9D 3SDLC 3PHWB 4CKCA 4EE2A 3CU7A 4IUVA 4REZA 2N3SA 4KJOA 4POGA 4YTNB 3HG9A 5IWAL 3KYCD 3L0WB 1GNUA 1C8CA 2MP2A 3KYHC 3CKIB 1ASYA 3M7GA 2JEBI 3EBEA 1P98A 2SOBA 1VQ9A 4B3TL 1ICFB 3PSIA 2JXMB 5K5PA 2VQFQ 2F1MA 2LS01 3SK6A 4IOCA 2JJQA 1HTOA 1JWAD 4LF4L 3Q3NC 4WJWA 1BNZA 4KGRA 3IRBA 2ZJPA 3NWSA 3W1GA 2GOWA 2K32A 2EMTA 1QZEA 1IYUA 4DR2L 4GLXA 3GTPB 2W82A 4DV5L 2HCCA 1TWAH 2UUBL 1BBUA 3TQYA 4B95A 2Q8RE 4C2MH 1FCLA 1LT3D 2ZM6Q 1ZKHA 4A4IA 4XDCA 2M0AA 2KWVB 4OW0A 2DY7A 2Q2IA 4BBRB 1CJEA 5CORA 4BY1G 1JT8A 2REXA 2PZWA 3IAM1 2O2VA 2WXNA 3FKIH 1S3OA 4BKTA 2LHEA 2NPTB 2NZOA 1VZ7A 4H2AA 5C3JB 2KOLA 2KLGA 2MQHA 4HEA1 1KOTA 1EWCA 3SVMA 2W3RA 5LMUL 3RNUA 4IFDJ 1MVKA 1EU3A 1KFYB 3SXHA 1S4ZA 3CHBD 4A76A 4W9DA 2C7HA 1QE6A 2A6EC 3NENA 2F0KA 5C5LA 4AQYL 3DLLA 2LI5A 2NBUA 4KHVA 5LMNW 3U52E 3D0FA 2LRWA 1KLGD 1LYLA 2WIIB 2NMQA 1WVLA 3K7AB 1OEYA 4L5QA 2PQAA 2WXKA 4ANXA 1W6KA 1N32L 1CZPA 2XIWA 1LTRD 3IT6B 2QW7A 4KY6A 3B2FA 1H9MA 4IQZA 1CHPD 3FAHA 2OHFA 1XO3A 2B8GA 1J19A 2FXQA 2J0JA 3D32A 4NZLB 3KWVA 3T1YQ 2CVRA 4AIMA 2HQEA 3P7JA 1CZGA 2F3WA 1TS2A 3AEVA 4IN3A 1J7AA 2FIFA 1EM7A 3MXNA 1TYGB 1TWGH 3NWTA 2GBRA 5GXGB 4OXPA 3I63C 1LTAD 5FO9B 4EZLA 1YNXA 3MTNB 1E2VA 1XX8A 4GIVA 3E3XA 3OYYA 1YNND 1JMLA 3D6WA 2BKRB 2QCPX 1U4PA 3Q2AC 3HGBA 1XNRQ 5HI1A 2SNSA 4ACFA 3GV3A 3SGIA 2EMSA 2KHWB 1U4LA 2NZ1D 3OTOL 3VR2A 5HGQA 3AE9B 3RZWC 1ZYRC 5H8YE 3ZJTA 4IG7B 3HOZG 3DWPA 3FDTA 2QSDA 4OO1H 5C5MA 1STNA 3EROA 3AULA 2AWOA 2KKCA 2BCOA 3VR3A 4C2MB 3I57A 5E6JA 1IBXA 4A3CH 1LTSD 4ZKCB 4IFDG 2JXXA 2BBCA 4KDLB 3VH3B 1CUKA 3WANA 4JI5L 3RR5A 1UE1A 4WORA 2O6VB 3M63B 2Z1CA 3ZYYX 5M3MG 1ZEQX 5CV9A 5BYSA 1LTBD 3H15A 3S2DH 3C8YA 4CO7A 3A8JE 2A8VA 4AJWA 2K5PA 2Q8TA 4NDXA 1SYBA 4X66L 2L11A 5JJZA 3HOYB 4MTNA 2ZTDA 2LJIA 1VF7A 4ANUA 1UNSA 1R4MI 1WYGA 1TBEA 1QG7A 2LWPA 1T0YA 1WCMB 3SK4A 5C2TB 1NEKB 3ULLA 2R6GA 5FLMG 2KTRB 2I2YA 2IX0A 4WURA 4NXMQ 1XJVA 4X3TA 2FNJB 3PO3G 2MGSA 4JI7L 2JP1A 3J7AF 2JWZA 3PUZA 1L5PA 5EGTA 1F0ZA 3E9SA 3Q8DA 1TTNA 4N9TA 1EY6A 1FD7D 2E2IH 4C3JH 2BOSA 1NVID 2L05A 2W54A 1TKGA 2VXWA 1FXIA 4LF9L 3MFYA 4DR1L 3GO5A 2MP1A 1DCZA 1IBML 1ACCA 2E5LQ 3U7ZA 4JI0L 3JW0X 5DM73 3QOJA 3EECA 3IL8A 1KDAA 1V1PA 5M3FH 4DV2Q 3STBC 2E76C 4L5SA 4NW2A 3TEXA 4L8JA 1WOCA 4QGUA 2D11A 2D62A 4O1NA 1ML0D 1EQTA 5IT9c 1WF9A 3A9JB 5LXIB 2K05A 4LF8L 2O5IC 4R8NA 1HRJA 4W9CA 4HIOA 1ZXHA 2KJRA 2KJHB 1K0SA 1P1AA 3UE0A 5C44G 3MTSA 4WQMA 1HNXL 1N5XA 2LGXA 4HSVA 1K28A 4HR7B 3PIO3 4HPPA 1NY4A 4XIGS 3WA0A 3NQTA 1A3UA 1B3QA 1I5FA 1QZHA 2X38A 4AOFA 1G6JA 4TRDA 1NYQA 2A4ZA 3CCRA 2F0NA 4RNAA 1XPOA 3BK2A 1EO6A 5ELEA 3AEFB 4DUYQ 2JA8H 2NVXB 5IGEA 4JI4Q 2RR9A 4N58A 1E22A 5C4JH 4IUMB 1VQOA 4BY7G 3HP3A 3I3TB 3J80E 4JX1C 3S24A 1BCPB 1JALA 2BS3B 2QC8A 2K6AA 2ZXOA 1PTOF 3JAMc 1R4NB 1K83H 3TCAA 1STYA 1SXTA 4KSKC 4ZQ3A 3ZNHB 5NUCA 3S1QB 3L10B 3GTMB 5LL6S 4KLKA 4YHHL 4I6PA 4M02A 3RNGC 4P71A 1EEFD 1A2TA 3HOVG 3OJ3A 2KX0A 5T1GA 3L4PA 2HT1A 4J15A 5ELNA 3V05A 2ZVNA 4KI0A 1WTVA 4BBNC 5DAUA 3VR4A 1HR0Q 2KA7A 4BWGB 2HDLA 1X1MA 4BKSA 1HNZL 4BBRH 3RD2A 1WWTA 4LUVA 1JB7A 4KJNA 1BT0A 1SF0A 4BBNF 1KAAA 4HIKA 5CV4A 1RL2A 4K3CA 1TWAB 4QUCA 3TS2A 3C0RB 4LTUA 2PQEA 1G2TA 4GNXC 5ELBA 3VR9B 1N61A 3ABVB 4JE3B 4B6WA 4B3RL 3JAML 2R7DA 3T16A 4TQ1A 3EN2A 5CBEE 4XT3B 4HSPA 2F0GA 2F0IA 4RMFA 2EZVA 1YZ6A 1SNQA 1AW7A 1C4CA 1XMOQ 3MHBA 2OT2A 1RIPA 4A93B 4BOSC 1AYFA 4YWMA 3PMFA 2ZTCA 2PEAA 4URKA 4DK6C 1EL0A 1X3GA 3WAPA 3K57A 1D3ZA 3UQAA 4ALPA 1GUAB 4IKGA 4OELB 2L83A 4NKLA 2WDVB 2D0PA 2RA4A 5KYLA 4A3FB 1WX9A 4NQLB 1BR9A 4A3DG 2LGSA 5JAVA 4D2KA 1EY7A 5KNBA 4YCUA 2K8CA 2K4KA 4A3DH 2KD0A 4US8A 1VMCA 3DQVA 1H9JA 2G3QB 1IYVA 1D8LA 1I4QA 2KQSA 1UAPA 4GOCA 3W5OA 3M62B 1RHPA 4FXGC 1O7ZA 1XD3B 2VRRB 3R66C 3CW2C 2D2CC 2N9LA 3EVQA 4OGQC 1MHXA 4WAAA 4YIJA 2PMVA 1I94L 2RDHA 3AH7A 1PRTD 3K80C 1B70B 1KRTA 1SFOB 4QCLA 2FBWB 2QJLA 5CHFA 1YNNC 1VCBA 1C3TA 2AX5A 3ALBA 2VW9A 1F52A 3TP8A 1Y8OB 4NAMA 3Q8CA 1PH7A 4JVZA 1XEEA 4CHTB 5M5WB 4OIKA 4LK1C 4JI5Q 2IL8A 3U9SA 1V8QA 2A6HD 2KCCA 4DR4Q 4DXFA 2B2YC 3M3YB 3T13A 1OQRA 1MGSA 5JH5C 1IBXB 3BK1A 1T9HA 2F4IA 2KQ3A 1Q8KA 1S5BD 1D6EC 4LNFA 1C9OA 3A55A 4YWGG 3ML9A 5IYCG 4IOIE 2K14A 4LNKA 3JSVA 3Q8AA 1EIFA 5IYDG 4JI6L 4C3IB 2CU3A 3RUZA 4LK0M 4C3HB 1HZ5A 2HTME 2K3UA 3K0YA 3PO3H 1YJ9A 4CJ2C 2G5DA 2TSSA 3I4NH 2NR2A 4PT5A 4IWQA 3BZKA 2F0OA 2K04A 1O7YA 2N7JA 1RTNA 3AFQA 3CC7A 4C56C 3GD7A 2EY6A 1I3QH 2YTVA 2WAQE 5HGTA 2OXPA 4UPAA 1AP0A 1I7HA 4GXBA 4QQBX 1UZXB 3DBLB 2GN5A 4RGNA 2WACA 1P7EA 2K39A 5D3DA 4ZUIA 1F9JA 2MW5A 2A6HC 1WY8A 5CV7A 1A62A 3J7A5 3BVMA 3W1YA 1F9QA 1UF0A 1RWSA 4HJ9A 4FF1A 4PYUA 1U5KA 4HN7A 1E24A 5E7NA 2IWHA 3V96A 1VQ7A 4RA8A 3I91A 3AE2B 4DV2L 2J0KA 1TS4A 3A7LA 5C4XB 1SNDA 2LVPA 1A8VA 2A19A 4NPSA 4QMGA 5JPMC 1PH9A 3ERSX 2Q2TA 4DR6L 4ULLA 1QUQA 2QEJC 3HOWB 1NAPA 3DVNU 1TT2A 1CKNA 2F0WA 4OX9L 3U4VA 2Z4IA 4G11A 3G7LA 2BGFA 3QJYA 2F4VQ 2JA6H 2F0PA 3HOXH 4W9HA 1WI5A 4RG1A 4DXGA 4YY3Q 3VRAB 1QVCA 4LF7Q 1MSGA 5JZEB 2Y0SB 1UGJA 4X3SA 2QCZA 4A20A 2WXGA 4K5WA 4PZ7A 3PVLA 4LNNA 1GJZA 4R3DA 3N3KB 4A3IB 2OTJA 4TMAB 1Q90A 4NJ6A 2HIXA 5EPKA 5IP7G 4B3SL 4JI1L 4GKJL 4HROA 1E8XA 1YQ4B 4S0RA 2CKZB 5CHWA 5KHOA 4Y7NB 3N1YC 2K5DA 1BCPD 2VNUD 4RF1A 1F1HA 2A1AA 3RUIB 1SE3A 5JHAA 2AWNA 2K5NA 2IO0B 1QOAA 2LUMA 3DBRB 4ZOHC 4OO1I 5J39A 1E9MA 3AE1B 1V8CA 4PS8A 3J80L 3K81C 4WFN3 1GO3E 4NAWA 2K8BA 4LJZC 1NJIC 4JI2L 4P7IA 4W9LA 1UBIA 1G2SA 1RAXA 3K7UC 2NVYB 3D6CA 4NXNQ 1EF1A 3ER0A 4YTPB 4R4QA 2ZJQA 2WFWA 4Q0FA 1HZAA 4CDDC 3HUIA 2QHOA 3GTPH 4HCSA 3BIID 3PIP3 2N1VA 2HHHL 1C4PA 4LDTB 5IYCH 3E9HA 2P5ZX 1DZ1A 2X6GA 1L6UA 2KVZA 3QAQA 2VQFL 3VQIA 1SSOA 3MVVA 4HCEA 1L7YA 4KMUC 1ILPA 1VQGA 5KGUA 3A33B 3GP7A 3WOFA 3L7ZC 3PZ8A 3TL5A 4DXAB 2IW3A 2ICIA 1NNXA 3NXWA 4DV6Q 1KLVA 4JI8L 2JT4B 2JWUA 3FKIG 1JWBD 3DHIC 1YMHE 4KY7A 3FKYA 2BA0A 3VXWA 2EY2A 5HY6A 3X3NA 1GUTA 1ZKOA 3KUCB 1SAPA 2L00B 3UF8A 3CP0A 1JOKA 1JWMD 2YV5A 4RWSC 4BBSB 2BDNA 3HM6X 1IPGA 1E7PB 4IJLA 4HWIB 4FF4A 3I3CA 3KQ4A 1TKEA 1ENCA 3OMGA 1DOXA 3KW5B 2JY6A 4F88A 2W9NA 4QUFA 4A3BH 3NOBA 2JSVX 3OSOA 4APVA 3ZTCA 1D5ZC 4WJNA 2INDC 4RM8A 3TMEA 2BYEA 3GOEA 1Y56A 1WGHA 1TY0A 1UBQA 2DAFA 2A74C 3GE3C 1WH3A 5GAGC 2GRIA 2UXCL 3QJZA 5M5XH 1OO9B 2GBJA 3Q8BA 1EFID 2AUJD 2KCMA 1PDQA 5M5WH 4XWWA 1KIXA 3D8GA 2YYZA 2PW9A 4XYCA 2MSED 1B53A 4QIWB 1TS5A 1TVXA 4KD3A 1K8OA 2WYQA 3R3MA 1UUPA 2O4XA 4EQNA 4L2YA 4YSYB 4DN4M 2C7MB 5C4ZA 2I5HA 2B29A 3AMZA 2QDBA 3D31A 1E1OA 2OQ0A 3FVQA 1UH6A 2KDEB 4KGTA 3K59A 4KK7A 5G55A 4TQ0A 4C80A 2SAKA 1VRAB 2KHIA 3KUDB 4DA2A 1FEHA 3A8IE 3T4AC 1FRRA 3ZVVA 4KV6A 4O0AA 3IAYA 1CSQA 1LABA 2L55A 4K0KQ 2GBMA 2WS3B 3AFPA 2K33A 5C6AA 2L7RA 4FF2A 4WH4A 2C35B 3P42A 4WJOA 4A3BG 1TWFH 3I56A 3WWVA 4BS9A 2N8NA 4QJFA 1IYFA 2N88A 3AV8A 1JJGA 3QIJA 4G3XB 4R4OA 5C0XG 1V5OA 1XF5L 3UINB 1TIFA 4LFAQ 3NVWA 1SB3C 4DNTB 3SE0A 2EY1A 3SEBA 2M9VA 4IALA 5T8IA 3MHSD 2ZNVB 4HTHA 1EYAA 2NWGA 3TP7A 3M7NA 5JJIA 3CCLA 1DGSA 2BH2A 3I8ZA 1D2BA 2KVMA 4EX5A 3S17H 2CU1A 1UELA 5C3XA 3RLOA 5IIFA 4DV7L 2Q2HA 2N9KA 3NZUA 2D3GA 4GOPC 1IBLL 2E3TA 2MP2B 5FR6A 2IO3B 2KUMA 4OZBA 3WALA 3Q24A 1C1YB 1CKNB 4AP4C 3GZNI 3RD4A 3UGBB 3RN9C 2XWJB 3KBGA 3KF8A 1HEZE 2ICEC 1JCKB 3Q8FA 2ZPNA 4DQOC 2MJ8A 5D65A 3F2DA 2RQXA 2DJFC 3BVZA 3CQZH 2NBVB 3N1ZC 3ZW3A 2JZZA 5BYQA 3V60A 2RDGA 4MSQB 2MPMA 1ENFA 4G4KA 2BT6A 4G7HC 3EJIA 4K0KL 3HZXA 3LGJA 3AN1A 1FIQA 3E56A 5BMIA 4AYBE 2WDTB 1K3BC 2BTEA 1II3A 1AZPA 1YNTE 1YI2A 5M3MH 4P1CC 4Y7NH 2YEPF 2ENBA 3EFCA 2CW0C 5IWAQ 2OJRA 3BY4B 2UU9L 2R7ZH 3S15H 4ZRQA 3UDIA 2PJHA 2LY7A 4W9EA 4A3OA 1PXUA 1FXTB 4MH0E 1SJED 4KKSA 1ZE3D 3U4ZA 1WJNA 2K5QA 1Q81C 5JPNC 4TSSA 4JWSC 1PGAA 1K0RA 4K8JA 5DM63 3C2PA 2KXJA 5EE9A 4ICUA 2EYPA 5KNCA 2NTTA 2YU9B 1BOSA 4US9A 1IBLQ 2JA6B 2R92B 4DR3Q 1RF2D 1TWFB 3A9KB 2F03A 4KVGB 2H88B 4PZ6A 3U8ZA 1VS0A 2JEAI 1HJPA 4A3JH 5JXVA 5AEKB 2KHJA 3X0WA 3VDYA 3KF6B 1VQIA 4RH6A 1A0IA 4JOIA 1HCZA 1Y1WB 2L76A 4A3EH 3AXCA 2ZT9C 3S2AA 1OXVA 5C4XH 2IDYA 1JWUD 1Q46A 4BA2I 1SGHA 3PT2B 3ZUNA 1VR9A 1WX7A 2NTSA 1Q5WB 1L6VA 3M4YA 1HNXQ 2VY3A 3A0JA 1U4MA 4DAMA 2E8GA 2EPBA 3OWEB 5M3FB 3PO0A 4DR7Q 4NQKE 1B9MA 2WAQG 3SDZA 1YQ3B 3OW7A 1J6QA 3GZNB 2CQAA 4YL8A 5C3EB 1FVIA 1N32Q 1M1KC 5HFYA 2CHXA 4IWOA 4LFCL 1WGGA 1SLJA 1C79A 3KDFB 1M8AA 2I1KA 1RYJA 3U30A 2JRIB 5CC4A 3PIOA 5DPRA 4WIPA 1FYCA 2EYFA 3KLRA 1YNJD 4XDXA 3AB5A 1L2NA 4M00A 1FRDA 4HIDA 1F2YA 2B63B 2DNCA 2KCNA 2OF1A 2PW5A 1LT5D 3P75A 2M19A 4BXXG 4A3MG 2AMCB 1W6JA 1MSHA 2CS4A 4A3MH 3HOXB 1OGWA 4P72A 1PTOH 2KOXA 3J81i 5M3MB 3H94A 2FUHB 3GS2A 2K50A 1GPXA 2JU6X 3KLSA 1PH4A 3J81j 3Q69A 3R2TA 1YITA 2AKWB 4GDLA 1F2RI 3VR5A 2Y3AA 1VQPA 4YTMB 2D5GA 2KT7A 1AARA 2DLBA 5L37A 5A35A 4EKUA 2FMMA 1FD6A 2BF8B 4FO2A 3HVZA 1GVPA 2KTRA 4JPSA 4U673 4ARIA 4IDIA 4ICVA 4C3IG 2C9OA 4X64L 3DHQA 2X8XX 1Y8PB 5KEEA 4M1UB 1GD7A 1TWCH 3AM9A 3DHGC 4WJQA 3RNBC 1FNWA 4C4VA 3L9AX 4K7WA 5A2QE 2GBNA 3VH4B 3TJPA 2CJNA 4RF0A 1L1OC 1Y1VG 3I70A 2Z6BA 3TEHB 3PZ7A 2PPBC 1R7SA 4HAEA 3K5NA 5EE1A 4R1JA 4JBKA 3PTFC 3D4DA 1X3FA 3FPUB 2KMMA 5D3IB 1I4PA 1I3QB 4A3JB 1VQNA 2ZNVC 4K3BA 1O7IA 1E0ZA 3F2BA 3T56B 3CMEA 1OQQA 2ATWA 1C76A 3EFUA 5GROA 3DOWA 2NCNA 5I9OA 5IYDH 4XQJA 1LXDA 1FNUA 4A3LH 1C4QA 3PO2B 4KIKB 1KD1C 1A63A 1CHQD 4GDKA 4BVUC 2FFKB 2DZIA 5K36H 4AQYQ 3OJ4B 1E7VA 5M5YH 4W9FA 4DK1A 4DV7Q 2KWDA 2N7EA 3QK0A 2HUGA 4FXCA 4RGTA 1L1OA 5GQOA 1EWYC 3PF5A 4FJZA 4AJYB 1TIID 2D3AA 2JK8A 2YEPB 1GB4A 1T3QA 4IUNA 1BQQT 5FLXE 1HH2P 5C3EH 3MEHA 4DV3L 1JJCB 4DBGA 3ND8A 4JI1Q 1EQRA 4DK5A 2E5LL 4GN1A 1LQBA 1NBFC 4BZAA 3SD5A 2EE1A 1M4VA 3MXNB 2CHWA 2JF5A 3ZJVA 2E2JH 2Z0SA 3MXGA 2JX5A 3VUXA 2R93G 4OWXB 1E0BA 4X62Q 2AQ1B 1GC6A 2M56B 1X56A 1B4OA 2FIDA 4DV1L 2M0XA 3V62A 2Z8LA 5KNDA 1Y69U 2KFKA 3HOUG 1Y1WH 1QUQB 3BVGA 1Q0WB 2ZTEA 3DVGX 2IX1A 3ICEA 4JGHB 4K8IA 1PH5A 3PGEA 3NHEB 4LAAA 1QVFA 3Q3OC 4E74A 2BS4B 2INPE 4AYBG 1HFNA 2R92H 2PE6B 1JB3A 1PGXA 2INNE 3VTWA 3ULJA 2VH1A 4MEMA 4HIMA 2LXJA 1VQ5A 1FGBD 1FJGL 2VUMB 2N7DA 3Q22A 3O13A 3CWIA 2OJWA 5IGCA 1PRTB 1L0WA 3S1NH 3B2GA 3DHHC 1YOVB 3MXPA 5G3LD 4ZKBB 4GKKQ 1VMPA 3PF4A 1PDXA 3L54A 5J1ZA 2L8JA 1TR5A 1PYBA 3DXJC 3CMAA 2CH4A 3E0JA 3TMPB 2XN9C 3BDOA 3E0EA 3UDFA 1WM3A 2KMAA 1V1OA 4LNOA 3S15B 2KHSA 4IOAA 1N36L 1UD7A 1SMYC 1QZGA 4DV3Q 4BKSD 2O2VB 2NVUI 3UI3A 1YJNA 1V1QA 2OEDA 4KIKA 2HIVA 2ID0A 1B3AA 3H7SA 3QA8A 1JC7A 5IP4D 4A93G 2V3SA 4B3MQ 3RZFA 1Z6HA 4WWMA 3GTJB 3A54A 3JSVB 4M01A 1GUGA 3I4MG 4O2DA 4XDDA 3ITPA 3NVYA 4LF4Q 4K81A 5E6OA 3LWEA 3S14H 2VB2X 1IGCA 4N9F4 1V49A 2L0CA 1XLQA 4GSWA 3NE5B 4CDFC 2HD5B 3AE4B 3H09A 2JA5G 4WQOB 2KEDA 3WAOA 3VUWA 1PTOD 1HTLD 2N49A 4YWLA 4A6QA 1E3PA 3R2IA 3QARA 3HKZG 1Q3LA 4DUZL 2N78A 4CBVA 2W3SA 4UY8C 4HPMB 4HXDA 3L13A 3BU2A 4OVZA 5EE0A 3X23A 4USAA 1GG3A 1EY5A 1AE2A 2CQOA 1BXTA 2Z9HA 4EGVA 1ISNA 3LDZE 3BG3A 1QCBD 2BYTA 3NHHA 3G6JB 1GXDC 1PZID 1VQCA 4RGMA 1TKYA 3I4NG 3TUOA 2B76B 2WXRA 2PE9A 1F77A 2LFNA 2Q8IB 4HJ7A 3GTKB 1V86A 2LEKA 4OZCA 1I50H 4DNIA 3QQ8B 5ISRA 5E6NA 4MIUA 3QIAA 3GTLH 1KM7A 1WD1A 2CWPA 2QDLA 1D5MC 1ILQA 4CJ1B 5BR8L 3V2TA 3AE8B 1V9JA 1FR3A 4M8NA 5I6YA 4L5TA 1KXLA 3NZ3A 2EELA 5IGGA 1EU4A 4XXEA 3ZO5B 1K51A 3AECB 4A93H 3CC4A 3NBHB 1E8YA 1PYWD 1WTHA 1VQLA 4Y52H 4GNXA 3STBD 1MJEA 3AI5A 3CCMA 5EKKA 3X3MA 1VQKA 2JPHA 3T1HL 5CV5A 4HDQA 3ZKJC 2DJGC 1E7ZA 1R9TB 3L17A 5IN7A 1WYDA 1YN4A 2Z6KC 2V4IB 1WGDA 4I7AA 4DU9A 5EBCA 1M94A 4C3HG 2AEHA 2D5DA 2Y5CA 2PLPA 3JYUA 2EYMA 1O7LA 3L0OA 3G71A 5IYBH 3T1YL 1QOFA 3ZNID 3I7FA 1QVGA 1PA6A 2BQQA 3PRZA 2UXBQ 2IY1B 5DLQE 1Q1BA 1E8ZA 2E2IB 2PTLA 1U0LA 2ZCCA 1EY0A 2CW0D 2J7ZA 2O6VA 3DBRI 1PZJD 3N52A 1VLBA 3IBEA 5LLIA 3NS8A 2EIFA 1WX8A 4HRSA 2KDFB 3O65B 1HHVA 2NVQB 2BW2A 2NPTA 3IFTA 3JVZX 5DCNA 1SNMA 2JA9A 2WQYB 2WXLA 4II3B 2EVBA 4DR4L 3RZOB 4C3JG 2EYOA 1UGMA 4FHKA 2V9HA 2FMCA 1WCMH 3ZRCA 3C19A 5C23A 4EFOA 3H9DA 4HJGE 1EIGA 2A73B 4PQXA 1FFVA 3A9KA 1OQYA 2PMZB 2ZEQA 4K5VA 4HJKA 3CC2A 2G1EA 5IAAC 4L6TB 1LTTD 2NVXH 2JA8B 2OQKA 1KL9A 1Q12A 3ZNZB 1LFDA 1QWYA 3NTKA 2FAZA 2MBQA 1F9PA 3OTOQ 1TWHB 3NPPA 2AYOB 4ZAIA 3ECIA 5J3BA 1STHA 3MZ5A 1Q86C 3Q6SA 3DWAA 1V97A 4IFDI 2B2YA 4FN2A 1CA6A 2IO1B 2LZ6A 1YEZA 1XT9B 3DBHB 5HG2A 5IKCM 1XNQL 1PRTF 2L0FA 3BDCA 1UWMA 4PV1C 1VQEA 4A3IG 2ES2A 1N5WA 1NCVA 4Q5VA 1FPYA 3C1EA 1ZDXA 2WXOA 1H95A 1CMXB 3L08A 4DAVA 4LF5L 2MJEA 3HIZA 1J5EQ 1YJJA 1OXTA 3RLNA 1WZ3A 2KNBA 4A3GG 2R92G 4E71A 2UWQA 1EZ6A 1OXXK 5DPWA 2RSOA 3CAMA 2AQ2B 5KYIA 1XPUA 2PI2A 3QOLA 3HM3A 1HR0W 1E5WA 2UUCL 3IHPC 4OVUA 4BY1H 3QC8B 2E75C 3S1MH 1V1PB 2JZPA 1UEBA 1Y1WG 4LWCA 1IBMQ 2KECA 2R2QA 2Z4HA 3ERQA 1TWGB 3S1RH 1PQSA 4MNOA 2DZKA 2FCQA 1XCTL 1EEID 4ZRZA 4PMBA 4DFAA 4LUZA 3CCJA 1WTWA 2F0LA 3PPAA 5AUIA 4DAYA 4JG2A 3OHXC 1WMHB 3NUHB 2EQSA 2UUBQ 1JE4A 4LMQD 4V0BA 1WE7A 2WGSA 2BPSA 2R7FA 2N55A 2PW7A 2MFIA 4XE0A 2F0QA 2MO0A 3A7AB 4FBJB 2F0JA 4GMVA 3ZXRA 3RFZB 3HOYG 1BCPF 1AEXA 2XRSD 1N34Q 3OMCA 4PZ8A 4DHJB 1NR4A 4EQPA 4IFDH 1HNWQ 1HQRD 2QGQA 4H0LC 2KEEA 3PRMB 4XQQA 4A3EG 3AB9A 1AZQA 2WX0A 4JL9A 3GTQH 4ZHOA 1JMCA 2WINB 4IUUA 4BY1B 3M4OB 1E1TA 3Q23A 5H1SE 5I2YA 2SDFA 4RFBA 3ZLZA 1V6EA 1WR1A 4YCWA 2DBYA 3NK9A 1SFOH 2JA7H 2IY5B 2I5LX 4FLHA 1YNJC 3H0GG 2UU9Q 2PCFB 1X9NA 1PYSB 2LSSA 4B3ML 1QOGA 2IGDA 2LJ5A 3W9CB 1WGKA 4GOPB 3D4RA 3S1QH 4H44C 1SYDA 4M0WB 4EQ5A 2ZJDA 1B8AA 1DXMA 4RCOA 3H7PB 1IKMA 3QO2A 3AE6B 2DNEA 1PFBA 2NYZD 4CYEA 3N9YC 2R3ZA 3LJ3A 5ELDA 4G7ZC 3BWUD 3J7YW 3M85A 1J7BA 2K1FA 3HRDD 4FDBA 3HHMA 1KAWA 2Y5PA 2CHBD 4DPGA 4H7BA 2WWZA 3PHXB 3PUVA 2JRHA 1JE5A 2K5VA 4F8MA 5CYUA 1HR0L 2WB1G 1WXSA 5IY0A 4IW0A 3ZQ4A 5GADC 2I0QA 2WLBA 4KX6B 2IY0B 4A9AA 3UE1A 1A5RA 2PNRC 2GMIC 3NVVA 4LW1A 2GVAA 3AE5B 4IZ8A 3GQBA 1TKWB 2Y0SE 1G91A 1PRTC 2N1WA 1C0AA 2KJXA 2UXDL 4GDLB 1I35A 1V9PA 3RMKC 4KN7C 1L0YB 1P3QU 4WWNA 4KZCA 1G8ZD 5T1IA 3Q0AA 1K8GA 3N30A 3NY5A 2RD0A 3I4LA 3GTKH 5E6PA 1YBYA 2XK5B 2EYLA 4X65L 1CI3M 4KTAA 5TR5A 2K7VA 2WP8J 3PCOB 5A2QL 2Z59B 4A3KB 3A4RA 4R8IA 2MQJA 3S1RB 3T3OA 1WZ0A 3PO2G 4M8AA 3J80c 1CSPA 1IL2A 3ZTDA 1VDZA 2MRPA 2RSUA 2LRUA 5G3LF 2KWCA 3KFUA 4JYAL 4A75A 3VRBB 1PMRA 2L32A 2G4DB 1JQ4A 5JVH3 4DDID 2G9HD 2H89B 4MSMB 2HDEA 4TUUA 2LGIA 4J1MA 1NMFA 5I9PA 3PZDA 4HDOA 2BE5D 4B9WA 1EY8A 1K8MA 2XTIA 4XYOA 3P4RB 3M4OH 5EKIA 5LHY1 1MKHA 3CXCA 5BYRA 1SE4A 4KKUA 5EPLA 1ENAA 2BYVE 1E7UA 4ZHPA 2HD3A 1FM0D 3CPFA 3KLWA 2DZMA 4X3UA 2TMPA 2VH2A 1R4QB 3KJPA 3RN2A 3V61A 4MGYE 3FP9A 2VQEL 1GUSA 2LD9A 4PS3A 1PH2A 2HJ8A 2F3VA 1I4GA 1RFKA 3K9PB 1IZ6A 1XLOA 1SYCA 5HHDG 2K8HA 4MGIE 2A69C 2IYDB 4JI7Q 1ET6A 1X3PA 4LF9Q 3KH0A 2KN5A 3QCAA 3DEPA 3SR6A 3MJ5A 4RM9A 1RDPD 5AZGA 5C44H 2ZW1A 3I4MH 3ML8A 2EKEC 3BZDB 4RHSA 1S5FD 1C9FA 4JI8Q 2KCTA 2VUMG 5FK9C 3DBHI 1LV9A 2B39A 5KRUA 4HJ5A 2XWBB 4A3FG 1I42A 3P2BA 1HQMC 1HPCA 2CHZA 3K0XA 1X3EA 4GZYC 1VF5C 4R4TA 2ZCBA 2LVQA 3P1HA 3A1QB 3J81E 4A3GH 3IFWB 1RCVD 2JA7B 2L1AA 1XNRL 1MD2D 4JBMA 1Y8NB 4X3KA 2YLMA 4CGYB 3RT3B 3AEBB 1U9RA 5IGBA 4HPLB 1CA5A 1WJUA 1GHJA 4J8QA 4MACA 3KOJA 2PQAB 2RBMA 4IPGA 1SE8A 3GTQB 3JC66 1QJOA 5EPJA 1WGRA 2L5TA 1PVOA 4OIJA 1WTOA 2RSNA 1AE3A 1PFNA 1SMYD 3IFDA 3H6NA 4G0NB 4PMCA 5C44B 4J3OD 4OL7A 1SROA 2DN8A 1WTRA 5IO9A 4AWJA 4AS1A 5DPSA 5AZHA 1N33Q 2OEOA 3ZJYC 5H92C 1RJTA 4HJAA 2I5MX 1KQSA 1FXAA 3GV6A 5LL6X 3RZDB 1S72A 1KDCA 2R61A 1HTPA 1Q8IA 2F0UA 3RNAC 4POFA 2NVTB 2Q2UA 3CF5A 1IW7D 3CCQA 1BBWA 5AFWA 4CQNA 5EE3A 4X6AH 2MNAA 2RCFA 4JPBW 3S2DB 1KJTA 4PK1A 4ZRPA 3A8KE 2BB5A 1CT1D 2F0FA 3S1MB 3AQQA 3H3VC 4BBRG 4UP9A 2UUAL 1NENB 2FJ2A 4NY0A 1X32A 3VTUA 1GUOA 1TZOA 3ZRFA 1FGUA 1BUIC 3Q8EA 1YJ1A 3GE8C 5BN5A 4A3PA 4XTCS 4JK1C 1K73C 3KUPA 2FUG1 2WDQB 2JYEA 5G5GA 4MH8A 4EVOA 3H0GH 4H13C 4L23A 3IKJA 1UE7A 2QKIC 3AE7B 4IC7B 4P16A 1L0VB 2IGGA 4YY3L 3FEWX 4LFAL 3RCZA 4ASWC 2XK5A 3ETRA 2LKVA 3VA5A 3TN2A 1MG4A 3W5UB 1ZGUB 1Q1OA 2B2UA 4JV5Q 1WFYA 4OX9Q 5JEAJ 4F87A 1NTGA 2E6XA 1TJEA 4GN3B 5K36G 1AFPA 4MN3A 3TRZA 4GKKL 4B3TQ 5FR3A 3Q3JA 1P9DU 4K6DA 4C7ZA 1CK1A 1WJJA 2B2WC 2C60A 5JEAH 3S14B 4N6EB 1QKZA 3K6OA 4K5XA 2ASQA 3R8BA 2BWES 3H8HA 1C4AA 3DWGC 4PS7A 1JROA 4DHZB 5C4XG 4QY7A 3GTGH 2BA1A 1XXGA 4FVMA 4KKIA 3I55A 2H1EA 3HRZC 2DYMA 4EUTA 3HFZB 2JQOA 3F8TA 3HOYH 1SRUA 1SSNA 1XCQL 3S16H 3GB1A 1F9SA 2L1BA 4DNRB 4LDTD 1GM5A 3UIOB 1SMXA 2H5XA 2PZUA 1WIAA 1NI3A 1PFSA 5EKLA 2V3NA 4LLGM 3SFEB 1CTMA 3OIQA 4IUTA 4JCVE 1TY2A 3SHLA 3PIPA 4JV5L 3RYTA 1JICA 4JW0A 1L4DB 2LGDA 2EYJA 1B7YB 3I9V1 1M90C 3WIMA 5IOCA 2K22A 4P2CB 1GOZA 5J2RA 1OEYJ 3M3JA 2AWTA 2WV6D 3KK7A 4RHRA 3DWQA 3FRPB 3ND9A 5E3FA 1WGYA 2V1CC 2RPVA 2GB1A 5BMGA 2I38A 4ARCA 4W9KA 2KENA 4ANVA 2O2LD 2PZTA 1A15A 4IPDA 5GAHC 2EJGC 2JZ3B 3HOVB 4N8FA 3N1XC 4XC2A 1LLRD 1OXSC 1MIUA 2WKDA 3PGZA 4PG3A 4DV4Q 1WJ6A 1GUWA 2D2QA 2PIAA 4GU2A 1PH8A 1STGA 2VZAA 4GN4B 2MJ3A 5GAEC 3ZNGC 1YVCA 4Q2JA 5IA7A 1SE2A 4DV6L 1XPRA 2DY8A 1SDFA 2GI9A 2UYZB 5C1ZA 2BVCA 3RI7C 2NBWB 4IPHA 3LXFA 2K5WA 4N9PA 4O42A 2V4DA 1XMQL 1HNZQ 1WMHA 1QOHA 1SYFA 1A3VA 4K14A 3UDXA 2KVRA 5DEHA 1T6BX 1I6HH 1TXYA 5HKHA 1HZBA 3NG0A 4QB4A 3NVZA 2L0TA 3Q14C 2ALYB 3HOUB 1PTOB 1VQDA 4DR7L 3KWLA 3OW2A 4N59A 1EF5A 2MCNB 1K3RA 1WCMG 3W5VB 1SIJA 3GTLB 4BFRA 4HVBA 1KRSA 4B3RQ 1XQQA 2F0TA 4P6VF 2Z6KA 1EFWA 1JOQA 3KLSX 1OFFA 3DWMA 2KDMA 1LTLA 2X69A 3U50C 3FMCA 2RPQA 2NS5A 3SFDB 1MI0A 4OWTB 3G6EA 4JI3Q 3C3LA 5M5YB 3JAMi 1Y14B 4V190 3KBXA 1JOOA 2GLSA 1PLFA 2HDMA 1LM0A 2JYTA 1YD8U 5FJ8G 2UXBL 3R3OA 2J0TD 3BDLA 3TREA 3H3VH 2DWQA 5IP9H 1H4RA 4F1SA 3SK8A 2K25A 1NI2A 2J4XA 3AEDB 3MC8A 3CCEA 4FHJA 1DM0B 1RLFA 3DDCB 3NS1A 4MJSB 4DV0L 5DNFA 1HNWL 4ZRKA 2KO3A 1GKHA 1D1IA 3WAMA 2B3GA 4NAWB 1T0QC 4CKEA 3BZCA 1D1KA 2YTXA 4A90A 3DBLI 1KABA 1CQFA 4FULA 4MTKA 1L1OB 5G2NA 1ESFA 2PKOA 4MELA 3RN5A 2E2JB 4F7ZA 4WWPA 2E2HH 2RF4A 1WFQA 1JJ2A 1WXVA 3A5ZB 2WDRB 1PH6A 1N33L 1LTID 4GLVB 3B9JA 3DPDA 3IVFA 3NP8A 3H3VI 3I4MB 3HOWG 1YJIA 2DAJA 1SJHD 2FCSA 2G4SA 3J81L 1AWDA 2RDBC 2F4VL 3ZXVA 4YXDB 2R7ZG 3I90A 2HQLA 2AUKA 1KC8C 1DJRD 4DK0A 1XYIA 4UP7A 1FCCC 1WYWB 2EKIA 1O80A 3TBLD 4ZLTF 4JI0Q 4B9XA 4LF6Q 1YX6B 4EQOA 2B2UC 1W3SA 1UWVA 1NMGA 1WD0A 4PNYA 3SU8X 1K52A 4BY7B 1UE6A 2B2VC 2J52A 3HKZB 2K9XA 3FC4A 1YJWA 1CZWA 2F0VA 3E6ZX 4K2LA 2B2TC 1J5EL 3EIVA 3S1NB 2KAJA 3PS6A 4AQ7A 1G291 1J8IA 3P1MA 1TQOA 1SNOA 4K1RB 1ZOYB 2JXTA 4KZ0A 4P1BC 1XLNA 3PUXA 3BYTB 2ASBA 1F2RC 4W9JA 3RZOH 4MT5A 4WJ4A 3PV1A 2MBOA 4JI6Q 3V6CB 4B0MA 4NXNL 5LNK1 4II2B 4NPNA 2XSCA 1ROEA 1V80A 3RNCC 2XVSA 3CSTA 4FADA 2WB1E 4DGZA 2JA5H 4FXKC 1D7QA 1DOMA 2D10A 3NTHA 1ICWA 3DM3A 2V3PA 3MC0B 3MC9A 2J7QB 1N63A 2ONQA 2XNAC 1DONA 3WDNA 1A70A 2DZJA 4ZRIA 5FLXL 4A8XC 1IP9A 4JBJA 1SYEA 1IL8A 2CFMA 5D94A 5MPOA 1Y1VH 3HS0C 1U4AA 2V0GA 3OOCA 3F2UA 3TP6A 4WAFA 4DR3L 2C5LC 3MFGA 5FLMH 4XQNA 3IT4B 5HURA 3VR6A 5C0XH 5JJKA 3HKZE 2PYKA 4ME3A 4NB3A 3KJOA 4DWFA 1QQRA 3L3OC 1Z47A 4C7YA 3R7QA 3A74A 5COYA 3MXUA 4IO9A 3C46A 1HA6A 3R93A 4XGAB 1L4ZB 1S40A 1X55A 4HKQA 1IHZA 3ONAB 1R9TH 3WOEA 2KQ7A 3KUZA 2EXZA 2NBFA 4RCNA 4A3KG 4G50A 1GB1A 3W1SA 2F0MA 4FF3A 2DUDA 1YIJA 4RKBA 1PFMA 4RGOS 1L0XB 3NBIA 4DHZE 3H7PA 4X57B 1IYJB 2DYBA 4C1NI 2RMMA 3A56A 2ZZPB 4YSZB 2M4NA 3PO2H 1J0GA 2KACA 3K5LA 4BBSH 4GGQA 2MLBA 4A3CG 2Z0DB 2BYFA 1I50B 2LXAA 4DR6Q 3M4PA 1UEAB 1QNUA 2KBNA 3PLUA 4K7UA 2V1YA 4GS3A 2KFJA 3KVFB 1NDDA 4G7OC 1AH9A 1XTCD 4QL5A 2N9EB 3U58A 2YTYA 3HKSA 4KV2A 3W3AA 1YN5A 1H9KA 4MM3A 2PPHA 4EZJA 2E74C 3T1HQ 2R93H 3NEMA 1XWEA 4B3SQ 4UAIA 5IODA 3S9WA 4GKJQ 1JORA 1Z2MA 2DHZA 2G45B 1WXAA 2L52A 2JA8G 4XWTA 4KSLC 3UI2A 2KDBA 2WHIA 1VQ4A 3N20C 2M00A 1TWCB 3PV0A 1SYGA 3OIPA 4I65A 3VYUA 1GAQB 3V6EB 5L83A 5CV8A 2CKHB 4DHJD 4F8CB 3EUB2 2BWFA 3AMUA 4DAPA 1LT6D 2INCC 4GNXB 3LB8C 4LJOB 3CF6E 3HVDA 1G6ZA 4ZYSA 3MWYW 2WXMA 1I4RA 1XMOL 1T5EA 3DCGA 2GBKA 4CHKA 3R7RA 2WXIA 1MHWC 2QILA 2BDOA 3HOZH 3QWZB 5LMNL 2QA4A 2KDIA 4A3BB 2LMCA 2N9PC 4WJPA 2YU9H 2RGFA 3EC8A 3FILA 2L3ZA 2HJ1A 4KD4A 3TDQA 4KN4C 2JA7G 4JWUC 3ZDTA 4MM3B 2OTLA 1MBYA 1PH3A 4DUZQ 4ID6A 1ZXIA 1VQAA 3NQIA 5C3WA 1T0RC 3EGRA 4EEWA 3AEAB 3PLVA 1CFMA 5AUKA 1WJ4A 2B63G 4OVVA 4P73A 3VYRA 4OZAA 3A1QA 3EQLC 1CQVA 4U68A 4BBSG 1N62A 4G57A 5JJLA 5BMHA 1B1ZA 1E90A 1NUCA 5EJWA 1EIYB 2AQ3B 4MJSA 4L1BA 1PZKD 4IM2A 3CIRB 3GDEA 4UHVA 2KQ4X 2D9UA 5EQ0A 3A5UA 4DKAC 2VQEQ 4WJ3M 1QNKA 1ZUD2 3VAWA 5IP7H 1QT9A 4DF7A 1E10A 1NR2A 1OTRB 2KC2A 3B08A 1WSPA 4ANWA 1NE3A 1KHIA 1N9WA 1YHBA 2XRQD 3FILB 3J9CA 1W2BA 4HCNB 3U9OA 1QB5D 4A3EB 1ESRA 1S1QB 2E2DC 3OG5A 1TZ1A 3L16A 2GVBA 2CCZA 3W1BA 5JVG3 3PRPB 2RCNA 3N6RA 3AU4A 1EQQA 2N9XA 1MPEA 1RKNA 5E4XA 3M95A 4S17A 4J6HA 1EOVA 1VQBA 5ELOA 1PV4A 1TWHH 2UUCQ 2K01A 3AEEB 2HE7A 3TEWA 1V81A 2MBBB 1I4XA 2Y0SG 4NNJB 4PYZA 3GTOB 3TBIB 1PHJA 1CKOA 4FP5D 1GC7A 2ZJRA 1KF6B 4X66Q 2K52A 5C4HA 1EOTA 1YHAA 5KIXA 2MJDA 3P4SB 2PMZE 3VUYA 4FYDA 1FFUA 2PNHA 3P4PB 4C3HH 1RM6C 1EYCA 2FHTA 1QLBB 5JHBA 1FMAD 2JA6G 4OWWB 4K7SA 2B63H 1SE9A 2FCNA 1K53A 4CDCC 3A4SC 4ITKA 1D5XC 1Q7YC 1JRPA 1DYQA 2JVCA 3CCUA 1D4BA 5I2XA 2SEBD 5J18A 4UP8A 3NBHA 2WU2B 1KRHA 1QOBA 3M3YH 1F2LA 1FJGQ 3QR8A 5TSSA 5CHVC 1F2MA 1SR3A 4NXML 2C5CA 1JWSD 1H9RA 3H6MA 3MAQA 1N36Q 3CD6A 1GJXA 4BOZB 2Z0EB 3CQZB 4LJPB 1LT4D 1LGRA 4P74A 1S5CD 1B9NA 2F0SA 5LXHA 1IBKQ 4N8X1 1MJCA 4IUQA 2PVOD 4I7ZC 5D14A 4XZ4A 3EA6A 2LVOA 1F9RA 4JQWC 5C3EG 4JBWA 4I6LB 2NVYH 3CMMB 2EXDA 1HXYD 2RHQB 4LF7L 2QDFA 4MGKE 2EJFC 1IXRA 1SN8A 3I2ZA 1KNAA 4BA1I 2R2OA 2XEWA 1HUMA 4B08A 4R4CA 1SEBD 1ASZA 3TIXA 3APFA 1HA5A 2IHEA 3P4QB 1TU2B 4OO1G 4CJ0B 4KGSA 2AL3A 2L15A 4UDUC 2BB6A 1J9OA 2OCEA 2QIEB 2KK8A 1QF6A 3TZDA 4AYBB 2OWOA 3PO3B 4A3MB 1S5ED 1ZPSA 2D3BA 3APCA 3EHVA 4DR5L 1BMLC 3BINA 3K8AA 4ODGA 4PMWA 2EOTA 3LWUA 4IM0A 1E8WA 1R4PB 2BE5C 2I1JA 3RLFA 1KTKA 1G6PA 5CR3A 4JI2Q 4FA6A 1K9MC 1P16A 2FCMA 3T8MA 3APDA 4X64Q 4CKBA 2NVTH 1IBKL 1EYGA 2DNFA 2ZXRA 5C0XJ 3GTOH 2BH8A 4YCVA 1IGDA 2MBEA 4JI4L 2RDFA 2KTFA 2NN6H 2WXPA 1VDVA 1GHKA 1K8AC 4L63B 2NUCA 1J7CA 4KKTA 2J42A 2IO2B 3WCQA 3VA7A 2KYWA 2GA4B 5IGDA
chains in the Genus database with same CATH topology
4WRDA 3T53B 4XYQA 2H4OA 1SNCA 1MI2A 3AU7A 1EWHA 4HMJA 2LMCB 2NB0A 1T5XD 1Z7TA 1B2TA 1GUNA 4HKZE 2IPKD 2PO4A 2WAQB 2NN6I 3C1FA 2L9HA 1Q10A 1LACA 1ZDVA 5M9OA 3DM1A 2O5JC 3S17B 3VYTA 1QILA 3TSSA 1STEA 2F0EA 4K2KA 1VZ8A 2FE8A 2A5HA 3I4NB 2JYOA 4YSXB 2JSOA 3T51B 1CM9A 1E2WA 3RMHA 4OHJA 3D3RA 5I6WA 1P7FA 1PUTA 1VZ6A 4GLSC 1BO0A 2R7ZB 3PUYA 4IURA 3U4EG 2K28A 1YN3A 2NN6G 3W2DA 1I6HB 1WTQA 4K6LA 5CV6A 2F0HA 2IX3A 1C77A 2KN4A 2ACZB 4RKLA 1MHHE 4XT1B 3QWNA 5JEAG 5J22A 2VZKB 1BF4A 4KHZA 1KLUD 4A55A 3TZUA 3K5MA 1I4HA 3PUWA 4TQUS 1JW9D 1SBBB 3EFXD 1B50A 2EJMA 1EIHA 2EYHA 4B0EA 1BDOA 1STAA 4A3DB 1C48A 1NYRA 5C0XI 2WXHA 3NRZA 3NTIA 2X6LA 1DOLA 1KDBA 2WKCA 3BS1A 3T3NA 3D4WA 1Q1EA 1ZXTA 2K1BA 1AN8A 3HOZB 2RVLA 3LNNA 5JOBA 2B8FA 5EBDA 4ZUJA 2MUYA 1H9SA 2EY5A 2A68D 4HEDA 3V3XA 1RTOA 1DOIA 3AE3B 5IT9E 2CJOA 1EY4A 1F2ZA 3TP5A 3OPOA 4FXDA 2E2HB 2R93B 2VZKD 1FNVA 1BUVT 2B2VA 1ZP0B 1VCIA 4YT0B 2QF7A 1HFGA 1STBA 3MA2B 1ONLA 3NUCA 2ON8A 3DEOA 4TKOB 5I4DA 4C1NK 4S3SA 2IJ0A 3URYA 2MHVA 3K5OA 1X3QA 1DD2A 1I6VC 3IAS1 5FO7B 3P63A 3K58A 1WRIA 5D7GA 2WNMA 4R9WA 1BBXC 5E4WC 3HEJA 5FOBB 4IUPA 1V43A 1IKLA 3CRLC 1WTXA 2WXQA 3DUZA 1E2ZA 1IW7C 1LO5D 1A6XA 1ZYRD 4ILWA 1JR0D 1KH0A 1Y1VB 5F2DA 3MHZA 2L4NA 2G9DA 1S5DD 5FO8B 2IGHA 4NJCA 2PVGC 2IT1A 3FPPA 2JA5B 4NMZA 1ET9A 5FKAC 3H0GB 3DMUA 1JQYD 5CMDA 3U2SC 4C3JB 1B44D 3RPFC 3OWFA 2JQRB 2SNMA 2QMTA 1IUEA 4HMIA 1FO4A 3P20A 3ZGZA 2WU5B 5E1FA 2EDGA 5C4JB 5IGFA 3MP9A 4E6IA 1EY9A 2HCIA 4NP5A 3LX0A 3TEZA 1A3TA 1PTOC 5BN4A 2N0SB 2ZXPA 3S16B 2BS2B 4GDLB 2F0DA 2VB3X 2K0PA 3H91A 4RAUC 3GTGB 2Q5WD 2J53A 3NSWA 2A69D 3S2HB 4ME5A 3I72A 3LYYA 4MHEA 1XLPA 1EZ8A 2A6ED 4KKJA 4Z9CB 4A3GB 1DGJA 1N60A 3ZJUA 1EYDA 5ELCA 3FKIB 3QB3A 1TS3A 1UWXA 1PGBA 5CBAE 3SR1A 1K83B 5ELFA 2M2LA 3SK5A 2WP9B 2LHDA 2WXFA 3CRKC 1A2UA 3I73A 1K50A 2LFIA 3BYYB 1EQVA 2MEKA 2I07B 3VYSA 2JE6I 2RKSA 1NSNS 1WTPA 2WXJA 1HUNA 1OXUA 1KNEA 1DOYA 1VJKA 5G5HA 2DYOA 3AEGB 1E6EB 2W55A 1U4RA 3QG1A 4FNFA 2B2WA 4F7XA 1PFDA 4KY5A 2I46A 1WXQA 1B9RA 3E5SA 2ZW0A 2K03A 2MH7A 1DOKA 3J7AV 1LTGD 2L12A 1SNPA 4ZK9B 1C78A 5M5XB 2B2TA 4ABNA 1H9SB 5BN3A 1O78A 2A68C 4GDKB 3IXSA 3JAME 3VR8B 5CGKA 1HZ6A 2WB1B 3TEYA 4M0WA 5IT9L 4QF4A 2FINB 1BCPC 1RODA 1RD9D 4CKCA 4EE2A 3CU7A 4IUVA 4REZA 4KJOA 4YTNB 3HG9A 1C8CA 3CKIB 3M7GA 2JEBI 2SOBA 2J52A 2JXMB 5K5PA 2F1MA 2LS01 3SK6A 1JWAD 4WJWA 1BNZA 4KGRA 3NWSA 2K32A 1IYUA 3GTPB 2W82A 2HCCA 1FCLA 2Q8RE 1LT3D 4XDCA 2M0AA 4OW0A 2DY7A 4BBRB 1CJEA 5CORA 3IAM1 2PZWA 2WXNA 2LHEA 4H2AA 1VZ7A 5C3JB 2KOLA 4HEA1 1EWCA 3SVMA 2W3RA 4IFDJ 1MVKA 1EU3A 1KFYB 3SXHA 1S4ZA 3CHBD 1QE6A 2A6EC 2F0KA 5C5LA 4KHVA 3U52E 1KLGD 2WIIB 2NMQA 1WVLA 3K7AB 2WXKA 1W6KA 1CZPA 2XIWA 1LTRD 3IT6B 4KY6A 3B2FA 1H9MA 4IQZA 1CHPD 3FAHA 2OHFA 1XO3A 2B8GA 4NZLB 3KWVA 2CVRA 2HQEA 3P7JA 1CZGA 2F3WA 1TS2A 4IN3A 1J7AA 1EM7A 3MXNA 1TYGB 3NWTA 5GXGB 1LTAD 5FO9B 1E2VA 1XX8A 1JMLA 1YNND 3D6WA 2QCPX 1U4PA 3HGBA 5HI1A 2SNSA 3GV3A 1U4LA 2NZ1D 3VR2A 3AE9B 1ZYRC 5H8YE 3ZJTA 3DWPA 3FDTA 2QSDA 4OO1H 5C5MA 1STNA 3EROA 2AWOA 2BCOA 3VR3A 4C2MB 3I57A 5E6JA 1IBXA 1LTSD 4ZKCB 4IFDG 2BBCA 4WORA 2Z1CA 3ZYYX 1ZEQX 5CV9A 5BYSA 1LTBD 3C8YA 3A8JE 2K5PA 2Q8TA 4NDXA 1SYBA 2L11A 5JJZA 3HOYB 2LJIA 1VF7A 1UNSA 1WYGA 1QG7A 1WCMB 3SK4A 5C2TB 1NEKB 2R6GA 2I2YA 2IX0A 4WURA 4X3TA 2MGSA 2JP1A 3J7AF 3PUZA 1L5PA 5EGTA 1F0ZA 3E9SA 4N9TA 1EY6A 1FD7D 2BOSA 1NVID 2W54A 1TKGA 2VXWA 1FXIA 3MFYA 3GO5A 2MP1A 1DCZA 1ACCA 3U7ZA 5DM73 3QOJA 3IL8A 1KDAA 1V1PA 2E76C 4NW2A 3TEXA 4L8JA 2D62A 4O1NA 1ML0D 1EQTA 2K05A 2O5IC 4R8NA 1HRJA 1ZXHA 3MTSA 4WQMA 1N5XA 4HSVA 4HR7B 3PIO3 4XIGS 3NQTA 1A3UA 2X38A 4TRDA 1NYQA 2F0NA 4RNAA 3BK2A 5ELEA 3AEFB 2NVXB 4N58A 5IGEA 3HP3A 3J80E 4JX1C 1BCPB 1JALA 2BS3B 2K6AA 2ZXOA 1PTOF 1STYA 1SXTA 4ZQ3A 5NUCA 3S1QB 3GTMB 5LL6S 1EEFD 1A2TA 5T1GA 3L4PA 3V05A 4KI0A 1WTVA 5DAUA 3VR4A 2KA7A 4BWGB 2HDLA 1WWTA 4KJNA 1SF0A 1KAAA 5CV4A 1TWAB 4QUCA 4LTUA 2PQEA 1G2TA 5ELBA 3VR9B 1N61A 3ABVB 4JE3B 3JAML 3T16A 4TQ1A 5CBEE 4XT3B 4HSPA 2F0GA 2F0IA 2EZVA 1SNQA 1AW7A 1C4CA 4A93B 3MHBA 2OT2A 1AYFA 3PMFA 1EL0A 3K57A 4IKGA 2L83A 4NKLA 2WDVB 2RA4A 5KYLA 4A3FB 1BR9A 5JAVA 4D2KA 1EY7A 5KNBA 4US8A 1VMCA 1H9JA 1IYVA 1I4QA 1UAPA 1RHPA 4FXGC 1O7ZA 2D2CC 2N9LA 3EVQA 4OGQC 1MHXA 4YIJA 2PMVA 2RDHA 3AH7A 1PRTD 1SFOB 2FBWB 4QCLA 2QJLA 1YNNC 2AX5A 3TP8A 1Y8OB 4NAMA 3Q8CA 1XEEA 4CHTB 5M5WB 4OIKA 4LK1C 2IL8A 3U9SA 1V8QA 2A6HD 2KCCA 3M3YB 4DXFA 2B2YC 3T13A 1OQRA 1MGSA 1IBXB 3BK1A 2F4IA 2KQ3A 1S5BD 1D6EC 3A55A 4YWGG 4IOIE 3Q8AA 2CU3A 4C3IB 3RUZA 4LK0M 4C3HB 1HZ5A 2HTME 2K3UA 3K0YA 4CJ2C 2TSSA 4PT5A 2F0OA 2K04A 1O7YA 2N7JA 1RTNA 4C56C 3GD7A 2EY6A 5HGTA 1I7HA 2OXPA 1AP0A 4RGNA 2WACA 1P7EA 5D3DA 4ZUIA 2A6HC 5CV7A 3BVMA 1F9QA 1RWSA 4FF1A 4HN7A 3V96A 2IWHA 4RA8A 3I91A 3AE2B 1TS4A 3A7LA 5C4XB 1SNDA 5JPMC 4QMGA 4ULLA 2QEJC 3HOWB 1NAPA 1TT2A 2F0WA 2Z4IA 3G7LA 3QJYA 2F0PA 3VRAB 4DXGA 1MSGA 2Y0SB 1UGJA 4X3SA 2WXGA 4K5WA 4R3DA 4A3IB 4TMAB 1Q90A 5EPKA 4HROA 1YQ4B 4Y7NB 4RF1A 2K5DA 1BCPD 2VNUD 1SE3A 2AWNA 1QOAA 2LUMA 4ZOHC 4OO1I 5J39A 1E9MA 3AE1B 1V8CA 3J80L 4WFN3 4LJZC 1G2SA 2NVYB 3D6CA 4YTPB 4Q0FA 3HUIA 4HCSA 3BIID 3PIP3 1C4PA 1DZ1A 1L6UA 2X6GA 3VQIA 1SSOA 3MVVA 4HCEA 4KMUC 1ILPA 3PZ8A 5KGUA 3GP7A 3WOFA 3L7ZC 2IW3A 2ICIA 3NXWA 2JWUA 1JWBD 1YMHE 4KY7A 2BA0A 2EY2A 3X3NA 1GUTA 1ZKOA 1SAPA 1JOKA 1JWMD 4RWSC 4BBSB 2BDNA 1E7PB 4FF4A 3I3CA 3KQ4A 1TKEA 1ENCA 3OMGA 1DOXA 4F88A 4QUFA 2JSVX 3OSOA 1D5ZC 3TMEA 1Y56A 1TY0A 2A74C 2GRIA 1OO9B 3Q8BA 1EFID 2AUJD 4XWWA 1PDQA 3D8GA 2YYZA 2PW9A 1B53A 4QIWB 1TS5A 1TVXA 4KD3A 1K8OA 3W9CB 4L2YA 1UUPA 2O4XA 4EQNA 4YSYB 4DN4M 5C4ZA 3AMZA 2QDBA 3D31A 3FVQA 4KGTA 3K59A 4KK7A 4TQ0A 4C80A 2SAKA 1VRAB 4DA2A 1FEHA 3A8IE 3T4AC 1FRRA 4KV6A 3IAYA 1LABA 2L55A 2WS3B 2K33A 5C6AA 4FF2A 4WH4A 3P42A 4BS9A 2N88A 3AV8A 5C0XG 1XF5L 3NVWA 1SB3C 4DNTB 3SE0A 2EY1A 3SEBA 2M9VA 4IALA 5T8IA 4HTHA 1EYAA 2NWGA 3TP7A 3M7NA 3I8ZA 1D2BA 2KVMA 5C3XA 5IIFA 2N9KA 2E3TA 2KUMA 4OZBA 3Q24A 3RD4A 2XWJB 3KBGA 3KF8A 1HEZE 2ICEC 1JCKB 3Q8FA 4DQOC 2MJ8A 5D65A 2RQXA 3BVZA 5BYQA 2RDGA 2MPMA 1ENFA 4G4KA 2BT6A 4G7HC 3EJIA 3HZXA 3AN1A 1FIQA 3E56A 5BMIA 2BTEA 1II3A 1AZPA 1YNTE 2YEPF 2ENBA 2CW0C 4ZRQA 2LY7A 1PXUA 1SJED 4KKSA 1ZE3D 2K5QA 5JPNC 4TSSA 4JWSC 1PGAA 4K8JA 5DM63 3C2PA 5EE9A 2EYPA 5KNCA 2NTTA 2YU9B 1BOSA 4US9A 2JA6B 2R92B 1RF2D 1TWFB 2F03A 2H88B 2JEAI 5JXVA 4RH6A 1Y1WB 1HCZA 2ZT9C 1OXVA 2IDYA 1JWUD 4BA2I 1VR9A 2NTSA 1L6VA 3M4YA 1U4MA 3PO0A 3OWEB 2EPBA 5M3FB 1B9MA 3SDZA 1YQ3B 3OW7A 2CQAA 5C3EB 5HFYA 1C79A 1M8AA 1RYJA 5CC4A 4WIPA 1FYCA 2EYFA 3KLRA 1YNJD 4XDXA 3AB5A 1FRDA 1F2YA 2B63B 2DNCA 2KCNA 2OF1A 2PW5A 1LT5D 3P75A 2M19A 1W6JA 1MSHA 3HOXB 1PTOH 5M3MB 3H94A 3GS2A 1GPXA 2JU6X 3KLSA 3Q69A 3R2TA 1F2RI 3VR5A 2Y3AA 4YTMB 2D5GA 2DLBA 5A35A 2FMMA 1FD6A 4FO2A 3HVZA 4JPSA 4U673 4ARIA 4IDIA 4C3IG 2C9OA 3DHQA 1Y8PB 5KEEA 4M1UB 3AM9A 1FNWA 3L9AX 5A2QE 2CJNA 4RF0A 3I70A 3PZ7A 2PPBC 1R7SA 4HAEA 3K5NA 5EE1A 3D4DA 3FPUB 2KMMA 5D3IB 1I4PA 1I3QB 4A3JB 1E0ZA 3T56B 1OQQA 1C76A 5I9OA 4XQJA 1FNUA 1C4QA 3PO2B 1CHQD 2FFKB 5K36H 4DK1A 2KWDA 2HUGA 4FXCA 4RGTA 1EWYC 1TIID 2YEPB 1GB4A 1T3QA 4IUNA 1BQQT 5FLXE 3MEHA 3ND8A 2EE1A 1M4VA 3ZJVA 2JX5A 3MXGA 1E0BA 2AQ1B 2M56B 1B4OA 2Z8LA 5KNDA 1Y69U 3BVGA 2IX1A 4K8IA 4LAAA 2BS4B 2INPE 1HFNA 1JB3A 1PGXA 2INNE 2VUMB 1FGBD 3Q22A 3O13A 3CWIA 5IGCA 1PRTB 3B2GA 3MXPA 5G3LD 4ZKBB 1PDXA 1VMPA 5J1ZA 1TR5A 3DXJC 3E0JA 2XN9C 3BDOA 1V1OA 3S15B 2KHSA 1SMYC 3UI3A 2OEDA 2ID0A 1B3AA 1JC7A 1Z6HA 4WWMA 3GTJB 3A54A 1GUGA 4XDDA 3ITPA 3NVYA 3LWEA 1IGCA 2VB2X 2L0CA 1XLQA 3NE5B 3AE4B 3H09A 2KEDA 1PTOD 1HTLD 4A6QA 3R2IA 1Q3LA 4CBVA 2W3SA 4OVZA 5EE0A 4USAA 1EY5A 1BXTA 4EGVA 3BG3A 1QCBD 2BYTA 3NHHA 3G6JB 1GXDC 1PZID 4RGMA 1TKYA 3TUOA 2B76B 2WXRA 1F77A 2LFNA 2Q8IB 3GTKB 2LEKA 4OZCA 5ISRA 4MIUA 3QIAA 1WD1A 1D5MC 1ILQA 4CJ1B 3AE8B 3V2TA 1FR3A 5I6YA 3NZ3A 2EELA 5IGGA 1EU4A 4XXEA 1K51A 3AECB 1PYWD 5EKKA 3X3MA 5CV5A 1R9TB 1YN4A 2V4IB 4DU9A 5EBCA 4C3HG 2D5DA 2Y5CA 2PLPA 2EYMA 1O7LA 1QOFA 1Q1BA 2E2IB 2PTLA 1EY0A 2CW0D 2J7ZA 1PZJD 3N52A 1VLBA 4HRSA 1HHVA 2NVQB 2BW2A 3IFTA 1SNMA 2WXLA 2WQYB 2EVBA 3RZOB 4C3JG 2EYOA 2FMCA 4HJGE 1EIGA 2A73B 4PQXA 1FFVA 2PMZB 4K5VA 2G1EA 4L6TB 1LTTD 2JA8B 1Q12A 1QWYA 3NTKA 1F9PA 1TWHB 3NPPA 4ZAIA 1STHA 3MZ5A 3Q6SA 3DWAA 1V97A 4IFDI 2B2YA 1CA6A 5HG2A 1PRTF 3BDCA 1UWMA 4PV1C 1ZDXA 1N5WA 1NCVA 4Q5VA 3C1EA 2WXOA 4DAVA 2MJEA 1YJJA 1OXTA 1EZ6A 1OXXK 2RSOA 5KYIA 2AQ2B 3QOLA 2E75C 1V1PB 2JZPA 2KECA 2Z4HA 3ERQA 1TWGB 2PKOA 4C7ZA 1XCTL 1EEID 4ZRZA 4PMBA 4DFAA 1WTWA 2F0LA 5AUIA 4DAYA 3OHXC 3NUHB 1JE4A 4LMQD 4V0BA 2N55A 2PW7A 4XE0A 2F0QA 3A7AB 2F0JA 3RFZB 1BCPF 1AEXA 2XRSD 3OMCA 1NR4A 4EQPA 4IFDH 1HQRD 4H0LC 2KEEA 4XQQA 3AB9A 1AZQA 4ZHOA 4BY1B 2WINB 4IUUA 3M4OB 3Q23A 5I2YA 2SDFA 4RFBA 2DBYA 3NK9A 1YNJC 1QOGA 2PCFB 2IGDA 1WGKA 3D4RA 4H44C 1SYDA 1DXMA 4RCOA 1IKMA 3QO2A 3AE6B 2DNEA 1PFBA 2NYZD 3N9YC 2R3ZA 5ELDA 4G7ZC 3BWUD 3J7YW 3M85A 1J7BA 3HRDD 2Y5PA 2CHBD 4H7BA 3PUVA 4F8MA 5CYUA 3ZQ4A 2WLBA 4KX6B 4A9AA 2PNRC 3NVVA 3AE5B 4IZ8A 3GQBA 1TKWB 1G91A 1PRTC 2KJXA 4KN7C 1L0YB 1G8ZD 5T1IA 3Q0AA 3I4LA 2EYLA 1CI3M 4KTAA 2K7VA 2WP8J 5A2QL 4A3KB 4R8IA 3S1RB 3T3OA 4M8AA 1VDZA 5G3LF 3VRBB 1PMRA 2L32A 1JQ4A 5JVH3 2G9HD 2H89B 2HDEA 2LGIA 4J1MA 5I9PA 2BE5D 4B9WA 1EY8A 1K8MA 3P4RB 4XYOA 5EKIA 5LHY1 5BYRA 1SE4A 4KKUA 5EPLA 1ENAA 4ZHPA 1FM0D 4X3UA 2TMPA 1R4QB 1GUSA 2F3VA 1I4GA 1RFKA 1XLOA 1SYCA 5HHDG 2A69C 1ET6A 1X3PA 3DEPA 3SR6A 3MJ5A 1RDPD 2ZW1A 3BZDB 4RHSA 1S5FD 1C9FA 5FK9C 1LV9A 2B39A 5KRUA 2XWBB 1HQMC 1HPCA 4GZYC 1VF5C 3P1HA 3J81E 1RCVD 2JA7B 2L1AA 1MD2D 1Y8NB 4X3KA 4CGYB 3AEBB 1U9RA 5IGBA 1CA5A 1GHJA 4J8QA 4MACA 2RBMA 3GTQB 1QJOA 5EPJA 2L5TA 4OIJA 1WTOA 2RSNA 1PFNA 1SMYD 3IFDA 4PMCA 5C44B 4J3OD 4OL7A 2DN8A 1WTRA 4AS1A 2OEOA 5H92C 1RJTA 1FXAA 3GV6A 5LL6X 3RZDB 1KDCA 2R61A 1HTPA 1Q8IA 2F0UA 2NVTB 1IW7D 5AFWA 4CQNA 5EE3A 3S2DB 4ZRPA 3A8KE 2BB5A 1CT1D 2F0FA 3S1MB 3H3VC 1NENB 2FJ2A 1X32A 1GUOA 1TZOA 1BUIC 3Q8EA 5BN5A 4XTCS 4JK1C 2WDQB 3KUPA 2FUG1 5G5GA 2JYEA 4MH8A 4EVOA 4H13C 4L23A 3IKJA 2QKIC 3AE7B 4P16A 1L0VB 2IGGA 3FEWX 3ETRA 2LKVA 3VA5A 3TN2A 3W5UB 2B2UA 2E6XA 5JEAJ 4F87A 1TJEA 5K36G 1AFPA 4MN3A 5FR3A 4K6DA 1CK1A 2B2WC 5JEAH 3S14B 4N6EB 1QKZA 3K6OA 4K5XA 3R8BA 3H8HA 1C4AA 3DWGC 1JROA 2BA1A 1XXGA 4FVMA 4KKIA 2H1EA 3HRZC 2DYMA 1SSNA 1XCQL 3GB1A 1F9SA 2L1BA 4DNRB 2PZUA 1NI3A 5EKLA 2V3NA 4LLGM 3SFEB 1CTMA 3OIQA 4IUTA 1TY2A 3SHLA 1JICA 1L4DB 2EYJA 3I9V1 5IOCA 2K22A 4P2CB 1GOZA 2WV6D 3KK7A 4RHRA 3DWQA 3FRPB 3ND9A 5E3FA 2RPVA 2GB1A 5BMGA 2I38A 4ARCA 2O2LD 2PZTA 1A15A 2EJGC 3HOVB 1LLRD 1OXSC 2WKDA 1GUWA 2PIAA 1STGA 2MJ3A 4Q2JA 1SE2A 2DY8A 1SDFA 2GI9A 3LXFA 2K5WA 4N9PA 4O42A 2V4DA 1QOHA 1SYFA 1A3VA 4K14A 5DEHA 1T6BX 4QB4A 3NVZA 3HOUB 1PTOB 3KWLA 4N59A 3W5VB 1SIJA 3GTLB 2F0TA 4P6VF 1JOQA 3KLSX 1OFFA 3DWMA 2KDMA 2X69A 3FMCA 3SFDB 1MI0A 3C3LA 5M5YB 4V190 3KBXA 1JOOA 2JYTA 1PLFA 2HDMA 2DWQA 3R3OA 2J0TD 3BDLA 3SK8A 2J4XA 3AEDB 1DM0B 3NS1A 5DNFA 1D1IA 4NAWB 4CKEA 1D1KA 4A90A 1KABA 1CQFA 1ESFA 2E2JB 2WDRB 1LTID 3B9JA 3NP8A 3I4MB 1YJIA 1SJHD 3J81L 1AWDA 4YXDB 3I90A 2AUKA 1DJRD 4DK0A 1XYIA 1FCCC 2EKIA 1O80A 4ZLTF 4B9XA 4EQOA 2B2UC 1WD0A 4PNYA 1K52A 4BY7B 2B2VC 2K9XA 3HKZB 3FC4A 1CZWA 2F0VA 3E6ZX 4K2LA 2B2TC 3S1NB 2KAJA 4AQ7A 1G291 1J8IA 3P1MA 1TQOA 1SNOA 1ZOYB 2JXTA 1XLNA 3PUXA 3BYTB 1F2RC 4MT5A 4B0MA 5LNK1 2XSCA 1ROEA 2XVSA 4DGZA 4FXKC 1DOMA 3NTHA 1ICWA 2V3PA 3MC0B 1N63A 2ONQA 2XNAC 1DONA 3WDNA 1A70A 4A8XC 5FLXL 1SYEA 1IL8A 5MPOA 3HS0C 2V0GA 3OOCA 3F2UA 3TP6A 4WAFA 3MFGA 4XQNA 3IT4B 5HURA 3VR6A 5C0XH 2PYKA 4C7YA 1QQRA 3L3OC 1Z47A 5COYA 3MXUA 3C46A 1HA6A 3R93A 1L4ZB 4HKQA 1IHZA 3ONAB 3WOEA 2EXZA 2NBFA 4RCNA 1GB1A 3W1SA 2F0MA 4FF3A 4RKBA 1PFMA 4RGOS 1L0XB 3NBIA 4C1NI 2RMMA 3A56A 4YSZB 2KACA 3K5LA 1I50B 1UEAB 1QNUA 4G7OC 1XTCD 3W3AA 1YN5A 1H9KA 2E74C 1XWEA 4UAIA 5IODA 3S9WA 2L52A 1JORA 4XWTA 3UI2A 2M00A 1TWCB 3PV0A 1SYGA 3OIPA 4I65A 3VYUA 1GAQB 5CV8A 3EUB2 3AMUA 4DAPA 1LT6D 3LB8C 3HVDA 1G6ZA 4ZYSA 3MWYW 2WXMA 1I4RA 1T5EA 2WXIA 2QILA 2BDOA 2LMCA 4A3BB 3FILA 4KD4A 3TDQA 4KN4C 4JWUC 4MM3B 1MBYA 4ID6A 1ZXIA 3NQIA 5C3WA 3EGRA 3AEAB 1CFMA 5AUKA 3VYRA 4OZAA 3EQLC 1CQVA 4U68A 1N62A 4G57A 5BMHA 1B1ZA 4L1BA 1NUCA 5EJWA 2AQ3B 1PZKD 3CIRB 2KQ4X 2D9UA 5EQ0A 1QNKA 1ZUD2 1QT9A 4DF7A 1E10A 1NR2A 1WSPA 3FILB 2XRQD 3J9CA 3U9OA 1QB5D 4A3EB 1ESRA 2E2DC 5JVG3 3N6RA 1MPEA 1RKNA 5E4XA 4J6HA 2K01A 3AEEB 3TEWA 1I4XA 3GTOB 3TBIB 4FP5D 1KF6B 5C4HA 1EOTA 5KIXA 2MJDA 3P4SB 4FYDA 1FFUA 3P4PB 1RM6C 1EYCA 2FHTA 1QLBB 1FMAD 1K53A 4ITKA 1D5XC 1JRPA 1DYQA 1D4BA 5I2XA 2SEBD 3NBHA 2WU2B 1KRHA 1QOBA 1F2LA 5TSSA 1F2