2RDHA

Crystal structure of staphylococcal superantigen-like protein 11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
b'RSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREDNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Superantigen-like protein 11
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Toxin
total genus 58
structure length 185
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdhA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdhA01
1V1PB 1UUPA 1RF2D 1BCPF 4DXFA 1PRTC 3MC0B 1PRTB 2ICIA 1LTBD 4O1NA 1M4VA 1D5ZC 4RHRA 1GOZA 5TSSA 1HA5A 1LT3D 1ENFA 1JWSD 2AQ3B 5ELCA 4OHJA 1V1OA 1D5MC 1LTRD 2RDGA 4RGMA 1LTTD 1PRTD 1LTAD 1LTID 4BWGB 1PRTF 2J4XA 4RH6A 2Z8LA 1FNUA 4RHSA 1LO5D 4K6LA 1FNWA 1I4RA 1RD9D 1CT1D 1LT5D 2AQ2B 1SJHD 3URYA 3BZDB 1XTCD 3BVMA 2IPKD 3TSSA 1FGBD 1SE3A 2QEJC 1EEFD 1S5FD 1XXGA 4RGNA 3W2DA 1EFID 1UNSA 3OWEB 4DXGA 1CQVA 5FKAC 1QILA 3BVZA 5D3IB 2R61A 1CHQD 1YN4A 1LT6D 4C56C 1EEID 2XRSD 3EA6A 5ELDA 4Z9CB 1ET9A 1YN3A 4L6TB 4RGOS 1BXTA 1L0YB 4RCOA 2IJ0A 3DWAA 1SEBD 2AQ1B 1JWUD 2SEBD 1TS5A 2XRQD 1FNVA 1EWCA 1D5XC 3DWPA 3BYYB 1LTSD 1MD2D 2QILA 2TSSA 3R8BA 1L0XB 5D3DA 1HTLD 1I4HA 3EFXD 3BYTB 1DYQA 3R2IA 1PZJD 4ZYSA 1DJRD 1JCKB 1AN8A 1I4PA 2G9HD 1I4GA 1KLGD 1S5CD 3MFGA 5ELFA 2XNAC 3KLSX 5ELEA 1KLUD 1SBBB 1PYWD 1B44D 2RDHA 1SE2A 1EU3A 1KTKA 1LLRD 1STEA 2XN9C 2WV6D 1LT4D 1S5ED 1HQRD 1CK1A 4UDUC 5ELBA 3BVGA 1JR0D 2CHBD 1BCPD 1SE4A 1B1ZA 1D6EC 1JWMD 1EU4A 3CHBD 1ESFA 1PZKD 3O13A 1PTOC 3R2TA 1S5DD 4RGTA 1SJED 5FK9C 1TS2A 1TY0A 1PTOB 3SEBA 1S5BD 2NTTA 1TS3A 1SXTA 1ET6A 1TY2A 4NZLB 2NTSA 1F77A 1PTOD 4TSSA 1RCVD 4L63B 2O2LD 1I4XA 1PTOF 1JQYD 3V05A 1BCPC 3GP7A 1V1PA 1G8ZD 1I4QA 1FD7D 1T5XD 1PTOH 1BCPB 1HXYD 1PZID 1LTGD 3DWQA 1AW7A 1TS4A 1RDPD 5I4DA 1YN5A 4RFBA 1CHPD
chains in the Genus database with same CATH superfamily
2RF4A 4AQYL 3I3TB 2VRRB 3OOCA 4HLEA 1LABA 1HA6A 3NPPA 4KIKB 2EZVA 1VMCA 1AE2A 2BDOA 4PQXA 4NAMA 4OIKA 2KCNA 5TSSA 4JC0A 4ZUIA 4TQUS 5ELCA 3GTPB 2JYTA 3KLSA 5D65A 1PH3A 4NMZA 1XD3B 2BE5C 4IUPA 3AV8A 1QT9A 4ALPA 1KM7A 3NBHB 4WJ3M 4AJYB 3SK4A 2KCMA 3U9OA 1VQBA 3H0GH 2DY7A 1C76A 3W1BA 2JVCA 1OEYJ 1TXYA 5BMHA 1K83H 3HS0C 4G7ZC 1O78A 1Y1WH 2O4XA 1E90A 1MJEA 1A5RA 1TWGB 1WR6E 2AL3A 1U4MA 4WRDA 3OIQA 2OCEA 3SVMA 1IBKQ 3PHXB 2EJMA 1L2NA 3CXCA 3H6MA 4K8JA 5ELDA 3CPFA 2BGFA 4KKSA 2M17A 3AE8B 3VUWA 4RGOS 5FJ8H 1AEXA 4YWKA 1J5EL 2GI9A 2B2WC 1SFOH 4FXKC 1RFKA 5IA7A 5IP4D 1F9PA 4Y7NB 1K8GA 4US8A 2K8HA 5DLQE 4YTNB 4MDKE 2IY5B 1VDZA 3Q8CA 3NJTA 2E8GA 4FNFA 1MI0A 4S17A 1B3QA 1FNVA 4AQYQ 2N88A 3RMKC 1PFMA 2NS5A 5C0XJ 3AH7A 4EZKA 1QZGA 4JI8L 2C5CA 3A56A 4LFBL 4EZJA 1I6HB 3Q14C 5C3XA 5GAEC 1PGBA 1PH7A 2K14A 2GOWA 3SDZA 4DAVA 2NWGA 3ULPA 1G6ZA 1CSQA 2F3WA 4N9TA 1TKEA 1XCTL 2BWES 3C19A 3H3VH 3QWZB 2IGDA 3S2HH 1I4PA 2G9HD 2Z0EB 4MH0E 2K5VA 1QCBD 3J81L 1K53A 4NJCA 1WRIA 1O7YA 5IP7H 4A3DB 1V86A 2KK8A 2OEDA 1NCVA 2K5WA 2ATWA 1VD2A 2MGSA 1EYCA 4G4KA 2VW9A 3DQVA 2PZWA 4PT5A 2Z0DB 1HZBA 2ZPYA 4DK0A 3F1ZA 1EWYC 2WV6D 2K04A 4J1MA 4YTPB 1T0QC 4O0AA 4W9KA 2NVXB 3SR1A 5J2RA 1JWMD 1DOXA 3CMMB 2NVTH 2Z1CA 2YTYA 4MHEA 1J7AA 2EIFA 3C8YA 2PI2E 3G6EA 3S24A 1SE8A 3UGBB 2X6LA 3S17H 3DBRI 1YQBA 4A3FB 4JWSC 4B6WA 1ET6A 5T1IA 2LGIA 4WJPA 2IO1B 4I6LB 4R4TA 1GJZA 4CKBA 3PCOB 3UE1A 3RD2A 3GP7A 3KDFA 3T4AC 1UWXA 1Y8RC 2DAJA 3PS6A 4GDKB 4ZRIA 3A33B 4LTUA 3EFUA 2LXAA 3KYHC 4X57B 2EYJA 3GZNI 2I46A 2MSED 1HTOA 1L6VA 4GMVA 4LFBQ 3RCZA 5ISRA 5CV4A 3F2BA 2LMCA 1JJGA 1EWHA 3D4WA 3PHWB 2HTME 1PH1A 1EZ6A 1RF2D 2L05A 1A15A 4WIPA 1CTMA 3AEVA 2KJHB 5DPTA 3A9KA 4R4OA 2AWTA 3NUCA 4YWLA 4DWFA 1SYBA 3S2AA 5JXVA 4ASWC 1BNZA 5C4ZA 4M00A 5IODA 3K80C 1LTTD 1WVLA 1NUCA 1SR3A 4J8QA 2KZRA 4FO2A 1FNUA 4RHSA 1OQQA 5EE3A 2K9XA 3FPUB 3Q3OC 4CHKA 2CU3A 1I4RA 1RD9D 1NBFC 4FJYA 5HG2A 3URYA 2L32A 3PZ7A 5LHY1 2CQAA 3BZDB 1QOAA 5IYCG 3M63B 1DXMA 1P1AA 3TEHB 1F2MA 1UAPA 4DV5L 1UNSA 3M7GA 2KHWB 4X64L 1J7CA 4I7AA 1SYCA 4JX1C 2LRWA 3DHQA 3VYTA 4KSLC 5HKHA 2BYVE 3QOLA 4DK1A 1NVID 5IOIA 4QUCA 2JYOA 2A4ZA 2LD9A 4A3MH 3EROA 1ISNA 1E22A 4OO1I 2N9XA 3NG0A 3A5ZB 3M4PA 4XYOA 1II3A 1RKNA 2KX3A 3AB5A 3M3JA 4HVBA 2SEBD 1N5WA 3N30A 1EQQA 1I5FA 4EFOA 1NY4A 2Z0SA 3I73A 4JPSA 1CZPA 1XEEA 4FP5D 1G51A 2LEKA 1L0XB 1SYGA 3EFXD 4A4IA 2DN8A 2VQFL 4A3CH 3FAHA 3M62B 3ZO5B 2RPVA 3RZFA 3QWNA 3HK0A 1F1HA 2RSNA 1PUTA 3QCAA 1VQAA 5EKLA 1KC8C 2CWAA 2FAZA 4OX9L 2A5HA 1D1KA 1V43A 4LW1A 2XGTA 5C0XH 3I70A 1L7YA 1L1OC 4JI5Q 1SMXA 1PH5A 1HNXQ 2OOBB 2KHIA 5CX3A 3QJYA 3RLOA 1FCLA 3MC8A 4F1SA 4TRDA 4FYDA 1K0SA 1B1ZA 3LGJA 4ANUA 4HK2A 2BA1A 3LWEA 4OXPA 4X64Q 1L0WA 1XLOA 4WURA 4M1UB 2MPMA 3VR8B 2HD3A 2LMCB 1WGKA 5LLIA 2EQSA 3SGIA 2R93G 2WX1A 3KWLA 2RVLA 3A1QB 3KJPA 5EE0A 2JQOA 3S15B 1C4PA 4LUOA 3MHSD 4ARCA 1UGMA 2DENB 2CVRA 1WX9A 4KKIA 1JMLA 1L1OA 2EY2A 1V2YA 2PJHA 2O2LD 3S1RB 1RWSA 2XK5A 3AXCA 1ILQA 3P63A 5C5LA 5HFYA 2ZPNA 1Y8NB 4ZYNA 4I6PA 1X1MA 4DV7L 4RG1A 3H3VI 4W9EA 4HJ7A 3PO3H 3L3OC 3DMUA 3JC66 4L5RC 1RDPD 1U4LA 4UPAA 3WAMA 1FXTB 4OVUA 2WXHA 4HJGE 1CHPD 4ZDVA 2IL8A 3W3AA 4JVZA 2BW2A 1N5XA 3LDZE 1ZGUB 1FIQA 2C9OA 3TBIB 1HUNA 1FEHA 1LXDA 5J17A 3I4LA 2DHZA 3HZXA 2ICIA 4O1NA 3M4QA 1D5ZC 1OFFA 4KGTA 4OX9Q 4M8NA 2SNSA 1Y14B 3FC4A 4CKCA 4HDQA 2HDMA 4CQNA 2YTVA 1DZ1A 5NUCA 2ENBA 4BAXA 1GJXA 3DM3A 2PE6B 1LO5D 2N7DA 3I4OA 3CMAA 3E9IA 3MTNB 3VTUA 2L0TA 2L9HA 2PCFB 5IGBA 4BBRG 2V9HA 4K7SA 5A2QL 1X3GA 1XTCD 2UWQA 5CHWA 3HKSA 1X3QA 3T56B 4HCPB 2KJRA 3NS1A 4IPCA 4YIJA 1I50H 1H9MA 2B63G 2HD5B 5IYBH 2V3SA 4K81A 3ZTDA 4OWTB 2HIXA 5I2XA 1E7UA 2CU1A 2DYBA 4RAUC 2DJFC 1WX8A 1EEID 2NR2A 1EY5A 3ZDTA 4DK6C 3HGBA 1OTCA 2G9DA 2LJIA 5TR5A 4QCLA 4POFA 1GD7A 1EYDA 3FPPA 4GN5A 1AZPA 1XO3A 1EIYB 3VQIA 4DV7Q 1KRTA 3MHBA 1Q7YC 2KXJA 1TWFH 4A3GB 1WGRA 4KTAA 1SNCA 3L4PA 1D8LA 2BTEA 1SNPA 2AL6A 1NDDA 3KF6A 2BDNA 2JT4B 3MJ5A 3Q8BA 3W1SC 2D0OA 1N8RC 1M1KC 4TQ1A 3I63C 5BMGA 3QIAA 3D8GA 2KLCA 4A3EB 4BXXG 3CCUA 1WTQA 1DYQA 3GTLH 2N1WA 2IT1A 5C44G 1KIXA 5EE1A 4YXDB 1NTGA 3AEDB 2NVYH 4YHHL 4OWWB 2MW5A 3HOYB 1EUJA 4H44C 5A35A 4L23A 3KUDB 5LMNW 4GKJL 4X3UA 1WOCA 5J39A 4LF7Q 4B3RL 3HEJA 2A6ED 3CU7A 1G91A 2PTLA 5D2MB 1Y1VB 1TTNA 2BYEA 5C23A 2ZEQA 1KTKA 1FFUA 2KBNA 2MA9B 2QC8A 1L1OB 3QO2A 1N36L 1VQDA 1N33L 2R93B 5FLMH 2XK5B 4JW0A 3JYUA 3HFZB 1E7VA 4B3TL 2E74C 2E76C 4JI4Q 2F0JA 1D6EC 4DV1L 2ZJPA 2J52A 3AULA 2L83A 3NRZA 2IX0A 3J80L 4ID6A 4E6IA 2F0HA 3DLLA 2KECA 3A55A 3L17A 3PO2G 4HMIA 2KMMA 1YHBA 4EE2A 4B9WA 3L0WB 1OXUA 2D5DA 4TQ0A 3M3YB 4ZRQA 1BR9A 1SXTA 5BYSA 3B2FA 3MWYW 3GS2A 3CQZB 2RHSB 2BPSA 5IN7A 3V05A 5M3FB 3TP7A 1WYDA 3S16B 1F2LA 1MSGA 1V9JA 3L10B 4GIVA 4B0EA 4JLCA 2RBMA 3KFUA 3H7PB 3VYRA 1R9TB 5C0XI 1B2TA 3H8HA 3E6ZX 4IUQA 1FMAD 4NAWA 3RFZB 1U4PA 1QG7A 4G57A 4C2MB 1HHVA 4N8FA 3PZ8A 4KDIC 2PMZB 3MZ5A 3VHTC 4LFCL 5IGDA 3HRDD 2DJGC 3K6OA 4BBRB 2AEHA 3IAM1 1Q3LA 2DZJA 4N58A 3KK7A 3S14H 4B3RQ 4DKAC 1LTRD 3EJIA 4GNXC 3AE6B 4IPGA 2INCC 1FFVA 3JAMi 2B63B 4LUZA 4WJOA 2GMIC 2JA7H 1E8ZA 2KDMA 3K9PB 4ZRKA 2F0GA 1NENB 1E5WA 3R3MA 4KGSA 2OWOA 4B3TQ 2SDFA 3ZXRA 2DUDA 3ZNHB 4M0WB 2MP2A 3PO3G 4DV1Q 3L9AX 3AQQA 4HXDA 3AE3B 1GB4A 4XQNA 3GTPH 3GE3C 5BO4B 5J18A 3KJOA 5GROA 3AE1B 3NY5A 5E4WC 2CW0D 2F3IA 5C3WA 4DR1L 2BKRB 1MHWC 2QHOA 4IALA 3QK0A 3V62A 1MGSA 2WB1G 1H8CA 1UD7A 3GTKB 1NEKB 4ACFA 1TVXA 1STNA 2OQKA 4UY8C 1LTLA 4JYAL 2WP9B 3H9DA 1ET9A 1J7BA 1LM8B 2NPTB 4P71A 4WJ4A 2KACA 2G3QB 5IWAL 2IW3A 1HH2P 1SAPA 2L1AA 4MTKA 1XTDA 3MXGA 2N3SA 3DDCB 1B9MA 5C44B 2KEEA 3N1ZC 1Z5SB 1JWUD 4LF6L 4KGRA 1GUTA 4DR4L 4L5SA 3PRPB 1F2YA 4W9CA 4LF8Q 3U58A 1NJIC 2K50A 2XVSA 4IM0A 3HKZG 1F2RC 4KK7A 1YHAA 4Y7NH 4LFCQ 1HTLD 1SE9A 5IYBG 2NZHA 3VRAB 2A6EC 4XXEA 4C80A 4P72A 1OXSC 1BUIC 1GNUA 4GOCA 5DNFA 1IZ6A 1L5PA 4MELA 1PH8A 2A69D 1KLGD 2KUMA 2KX0A 2RSOA 1EL0A 2LXJA 2KWUB 3PO2B 1P7FA 2FIFA 3HP3A 4RKBA 5EKKA 1ZE3D 2D2QA 3F2DA 5HGTA 3N6RA 5DPWA 5JHBA 1ZP0B 1NR2A 3JAME 2K52A 4DR1Q 3CHBD 4X6AH 1OO9B 2YTXA 1JE5A 2E3TA 4AS1A 4A3DH 3ECIA 4KZ0A 2CH4W 5IGGA 4JYAQ 2KCCA 1HJPA 1HNZL 2PQAA 2E2HB 3FMCA 1WMHB 1Q1BA 1HZ5A 1EY8A 2EELA 3IG3A 1F9QA 4HSVA 2WXMA 3AM9A 4IC7B 2G5DA 3D6WA 4JI7Q 2LVOA 5BYQA 2I5HA 2LVQA 1TS3A 3Q24A 1R4PB 5IWAQ 1FVIA 1A2UA 4ULLA 3RNUA 2NVXH 1HTPA 3I4MG 1RLFA 2SAKA 2LY7A 2Q2IA 3UI2A 1DOYA 4GLSC 3VH4B 1WJNA 2M56B 2EYOA 4J3OD 2K1BA 4LF6Q 1VR9A 2WDVB 5C3EG 2V3NA 3VR9B 1T5XD 5I6YA 3P20A 3JAMc 1N34Q 4DR4Q 3KQ4A 3GTQB 1B53A 2DNCA 2HIVA 3S2DB 4NPNA 4DHZE 3B6YA 4A3FH 4RFBA 4DDGD 1P9DU 3Q3NC 4M01A 4C7ZA 2LHEA 4KLKA 3T16A 5M9OA 2MP2B 4BFRA 2LWPA 2VZKD 2EMSA 3PZDA 3P7JA 3CCEA 4A3JG 4BA1I 1VDVA 3AN1A 4BKTA 2AQ3B 3OMCA 1QZHA 1AYFA 1WSPA 1JWBD 4HKZE 2REXA 4A3KB 4GNXB 2L8JA 3M85A 1JQ4A 3PSIA 2CW0C 1Y56A 3CCSA 1S72A 5JVG3 1CQFA 1SJHD 2ASBA 3TEWA 2PW5A 2XWBB 1HRJA 2EYHA 5ELNA 3A7LA 3MXNA 3L2PA 5AZGA 5BMIA 3TP6A 1EEFD 2MLBA 4RGNA 5JAVA 1HNZQ 2C5LC 2JZZA 2LFIA 3OHXC 3CAMA 3EGRA 3K7AB 4JPBW 1N9WA 4HR7B 1E24A 4KHZA 4QL5A 4JI2Q 4DV3L 4WJWA 1YN4A 3T3OA 2WKDA 2BYFA 1I42A 2QEXA 3CP0A 4ME5A 5EDSA 2LASA 2JXXA 2KJ6A 3ZKJC 2CCZA 4L6TB 2RDBC 4C3JB 3RZOB 2NCNA 4G0NB 2L0FA 3HKZB 1TT2A 4IWPA 1CSPA 2E75C 4NW2A 1YI2A 2AQ1B 5C4JB 3PF4A 1AP0A 3A4RA 4LDTD 4NP5A 3NELA 4C1NI 1SIFA 2O6VA 3STBD 4Q2JA 2L7RA 2ICEC 2Q8TA 2FBWB 4PS8A 1EZ8A 2A69C 2FCMA 3ZGZA 4F87A 1XT9B 4CBVA 2L76A 3NZ3A 4JWUC 1J8IA 4GSWA 4ZOHC 1ZDXA 4C4VA 4MGIE 1EQVA 3IBEA 1RHPA 4WJNA 3J9CA 2BVCA 2K5HA 2F0FA 3UDGA 4NDXA 2R2OA 3PUVA 2BBCA 1QUQA 1VS0A 1VQ9A 2CS4A 3ZDMC 4IO9A 2N9PC 1GHKA 2YLMA 4FADA 3AFPA 3SE0A 5KNDA 1VQ8A 4DR7L 3FILB 3I57A 1Y8PB 3PV1A 4K0KQ 3AU5A 5HGQA 2KT7A 2OT2A 2XN9C 1FD6A 1WF9A 3KBXA 2XBBC 2LSSA 4APVA 5EBDA 4DAPA 1HQRD 2N1VA 3C0RB 5FLXE 2EJGC 3P75A 1SE4A 1GC6A 3I4MB 4YTMB 1YNXA 2F0EA 2HCCA 4RM9A 2I07B 1YMHE 3I9V1 4HTHA 2ONQA 2PYKA 3Q23A 5CV8A 3K7UC 2F1MA 5C3EB 2Z4HA 2FFKB 4B9XA 3KH0A 4GOPA 2HQLA 2NN6G 4EGVA 4ZKBB 3RN2A 4R4CA 4C3IB 2MBQA 4K8IA 1P0RA 2JK8A 2Q8RE 2BKFA 1F77A 4DPGA 1OTRB 3AEFB 2IDYA 4A6QA 4ANWA 1B7YB 1XCQL 3GB1A 2L15A 2NMQA 1MVKA 1QOHA 2JE6I 1RL2A 2MBOA 2RPQA 5FLXc 4K3BA 3CIRB 1TS4A 1X6OA 4OEMB 3S15H 4IN3A 2D10A 3P2BA 2JYEA 2HQEA 5F2DA 2NB0A 2PPBC 3R66C 3EVQA 1WXMA 1OQRA 3X23A 1TWAH 3S1RH 1X55A 2INNE 5DCNA 4XWWA 4A3DG 4JG2A 1UE1A 3BZKA 3MXNB 4GN3B 1Z7TA 3T1HL 1WE6A 3APDA 1N62A 1ASZA 1FR3A 3DHIC 4IDIA 1M4VA 2MNAA 4RHRA 5CV6A 5LMUL 1WX7A 2DBYA 1LT3D 4ICVA 4OZBA 4POGA 1N6ZA 1JWSD 2D3CA 4WJQA 3K5OA 4OHJA 4DR7Q 2EMTA 2RDGA 5JVH3 1E8YA 2MQJA 3EHVA 5IGFA 1WXQA 1LTAD 2KVRA 1KXLA 3LXFA 5DAUA 2CJOA 1E7PB 4XDDA 2R92G 4P7IA 1BOSA 3LNNA 5K5PA 4P2CB 2PI2A 3CCMA 4JBMA 3NHHA 2N9LA 3KW5B 1S4ZA 3NBIA 4MIUA 1TQOA 5IYCH 1S40A 4PZ7A 4BY1B 2IPKD 2JJQA 2L12A 5H1SE 4A3FG 3V6CB 1XXGA 4E74A 2PIAA 4C1NK 4DXGA 1E8WA 1MHHE 4DV2Q 3CF6E 4JE3B 4KD3A 2ZTCA 3CMEA 1YIJA 5IYDH 2QDBA 2KHJA 2CFMA 3IRBA 4HCSA 4NXNQ 4ANXA 3RNBC 3J7A5 4AJWA 3KF8A 4DV4L 1MSHA 4GN4B 4H0LC 1E8XA 3STBC 4NY0A 3VTWA 2PLPA 4YSZB 1U0LA 2OF1A 1XLNA 3OLMD 1P16A 1EIGA 1LQBA 3U30A 2ZXOA 2XRQD 2LJ5A 4HIOA 4YSXB 1PVOA 2K6QA 3T53B 1U9RA 1HR0Q 1IYVA 1K73C 3PMFA 1P98A 1GXDC 3AEEB 3T1HQ 5D3DA 1RRBA 3GTGB 2FMMA 2K3UA 4YWMA 4ABNA 1IHZA 2KLGA 2FJ2A 4KI0A 4H7BA 1IGDA 2K05A 3W5UB 5JPNC 3WANA 1T0SC 4QJFA 5COYA 4EVOA 1A70A 1F52A 2HT1A 5HURA 4AWJA 4DNRB 1B50A 5G55A 1BBXC 4C7YA 1S5ED 1TWCB 2C35B 1GM5A 2EDGA 1HR0W 1JR0D 3HOYH 2Y5PA 3NOBA 3VTVA 4IUMB 1SLJA 4Y52H 4URKA 1EQTA 2MO1A 1B4OA 1OXVA 2V1CC 4IJHA 3J81i 2UUCL 1IW7D 3ETRA 1Y1VH 4MGZE 3LYYA 4W9JA 1TS2A 3R3OA 3TMEA 4DV4Q 4IFDG 4FXDA 2R93H 1N61A 2KKCA 4K5WA 3PLVA 3RT3B 3P42A 2UUBL 1WD0A 1LGRA 1V5OA 3U4VA 2K6AA 2MBBB 3APFA 1FRDA 2Y0SB 4DU9A 3J81j 4HWIB 1FO4A 1WTHA 4L63B 3NHEB 3U7ZA 1L6UA 1WCMB 3CC7A 2WACA 3UDIA 1ZUD2 3AE5B 4IW0A 1I4QA 1STHA 5IP9G 4PMCA 1DONA 4ITKA 5E4XA 3ICEA 3V96A 3TZDA 2VH2A 4PMBA 2K5DA 3RNFC 5I4DA 3M3YH 2H1EA 2PO4A 4GLXA 2VZKB 4C3HG 1V49A 3CQZH 3IHPC 3BWUD 4FF2A 1MHXA 2F0MA 1FXAA 3TP5A 5M3FH 1JJ2A 2DNFA 4PNYA 4JI1L 2R92B 2J0KA 3S16H 3TQYA 1R4QB 2RD0A 3IT4B 1VLBA 2IX3A 1UZXB 1J5EQ 2L3ZA 1R9TH 3OW2A 3VUYA 5CR3A 1PRTD 2MBHA 1XJVA 3J7ZC 4C2MH 1HZ6A 4HEA1 3KF8B 3TZUA 1EIHA 1S3SG 2IO2B 2B3GA 3IVFA 2AQ2B 3VYSA 2QJLA 2WXRA 4BBRH 2K25A 2W3SA 3UIPB 1JB3A 3BVMA 3PGZA 4DAYA 4JI8Q 1NE3A 2QEJC 2CWPA 1QF6A 5EAYA 1VJKA 2B63H 4UAIA 3QR8A 3W2DA 3SXHA 2BH8A 1ML0D 4DQOC 2PNHA 4EEWA 1PFBA 1QILA 3NE5B 2UUBQ 3WWVA 4P75A 4G7OC 3MC9A 4U68A 2MJEA 3PUYA 2WAQG 5BN5A 2WXIA 2RCFA 4P1CC 3RNGC 4DAMA 3T3NA 3CRLC 4V190 4L2YA 4LDTB 2ZXRA 2UXDL 2J53A 1STAA 5KHOA 3ZNZB 4XQJA 1A3TA 3IFWB 3U52E 4PMWA 4U673 5I6WA 4NQKE 4CDDC 1VZ8A 1TIID 3RI7C 1VQFA 1IKLA 4D2KA 4XDCA 3AEGB 5D7GA 1E3PA 2HDEA 2GA4B 4KKUA 4AYBB 1VQNA 4JI1Q 3DBLB 4R4QA 1Q90A 3AECB 4BXXH 3ULJA 1PGAA 1VCIA 2KNBA 1G2SA 1GO3E 2LFNA 5GADC 4NJ6A 4WAFA 1PZJD 4LJZC 4ZRZA 5C44H 1IBML 1NI2A 5L37A 1WZ3A 1XMOL 5IYDG 1JCKB 1PH6A 3IFTA 2M1MA 1T9HA 2PVOD 5I9OA 1QVFA 1A2TA 2EY5A 2VQEL 2JZ3B 3DEOA 1YJNA 3D6CA 4KHVA 3PO0A 1T0YA 1KLVA 1LFDA 2X69A 2BB6A 3N1YC 1N63A 4ODGA 3OYYA 4GN1A 1LLRD 2PEAA 5FO7B 2JRIB 1SSNA 5CGKA 3B08A 4XYCA 4J6HA 3TMPB 1BCPD 4A3IG 4DA2A 5C3JB 5CMDA 2OXPA 4HAEA 4RCNA 1V6EA 3DXJC 4EZLA 1A62A 1EY7A 3P4SB 3PO2H 4ME3A 4ZRPA 4OO1G 3D4RA 3EBEA 3C1FA 5EKIA 4A3GG 4XWTA 4K14A 3BY4B 5D6JB 2UXDQ 2NTSA 4C3HB 1S1QB 4BKGA 1G8ZD 3MFYA 2QCPX 4A3EG 5FR6A 1UEAB 3RZWC 2NZ1D 4CJ2C 1C48A 2I38A 2OQ0A 4DUZL 4QIWE 1YQ4B 3H91A 2AWNA 3D32A 4V0BA 5MPOA 1SNOA 3IKJA 3NWTA 3KDFB 4A3BB 1VZ6A 1GUWA 3X3NA 3HOYG 2Q2HA 4X66L 4DV5Q 1XNQL 1TGZB 3H1UA 1WE7A 1H9SA 2JWZA 3ML8A 3QA8A 4I6NB 1IBMQ 1PRTC 4NJ7A 1XMOQ 3CKIB 3HVZA 4DAYB 1Y1VG 1C1YB 2LGYA 4WH4A 3GTQH 2JA9A 4DR3L 3S2DH 1EYGA 3W9CB 5DM73 4X65L 2JWUA 3DBRB 3MJWA 3PGEA 1TBEA 1E6EB 2B8FA 5DM63 3SFEB 4B3ML 4K7WA 1EY6A 3T13A 3A9KB 3DCGA 4OVZA 1G291 2KYWA 1PRTF 2SOBA 4RH6A 4HROA 4PS7A 3ZNGC 3IT6B 3FEWX 3FVQA 1AARA 1KH0A 4JGHB 2JX5A 3SU8X 2KDIA 4RF0A 4YCVA 2WAQB 3GZNB 1RYJA 4LNIA 3TSSA 1JB7A 4M02A 1H9KA 1SE3A 3HOXB 2OEOA 3R93A 3UIOB 2YEPF 4YWGG 4A3KH 2VQFQ 1W3SA 5FKAC 1PH9A 5M3FG 3QIJA 3K5NA 2O2VA 2M2LA 1ENCA 1DGSA 2XIWA 4C56C 4DDID 4B08A 3H15A 1C79A 5H92C 3NVWA 2EXDA 3D0FA 4FXGC 2ZM6L 2JA5B 1FL0A 2HE7A 1JICA 4F7XA 1EQRA 2MWSB 1E9MA 4IZ8A 4DUZQ 3PT2B 4Q0FA 3N9YC 5I9PA 5LXIB 1ONLA 2HCIA 4DGZA 1WH3A 2WDTB 3MVVA 1D1IA 4X66Q 1IYUA 3ZRFA 4B9KA 1FXIA 1PXUA 2Y3AA 4DHJD 2QILA 1YEZA 2DGYA 5JJZA 1UWVA 1TKGA 3R8BA 1ICFB 1DD2A 1I4HA 5KNBA 3A5UA 1SIJA 2IY1B 4X65Q 5CYUA 3HOZB 1E1OA 5C4JH 1UWMA 1W6JA 1YVCA 5JJIA 1JROA 3TP8A 2BCOA 2NUCA 3GV6A 3VR4A 1RIPA 4B3MQ 2ZZPB 4A3OA 1C3TA 1GUNA 3MFGA 4A3IB 4IUNA 4NB3A 3TRZA 3U50C 1VQGA 2D5GA 3N20C 1EF5A 1SBBB 2BYTA 3QB3A 2RDHA 2QGQA 2D3BA 3NS8A 1EU3A 2AHOB 3D3RA 2JN4A 3NVZA 2IO3B 4XQQA 1KAWA 3K58A 1IL8A 4ZK9B 4K2LA 3L13A 2CHBD 2PNRC 2VZAA 1UBIA 4LCDE 1R4NI 3GDEA 2N49A 4GKKL 5FK9C 1QKZA 1SSOA 3AI5A 2NBWB 1ZYRD 2D62A 2HHHL 1LACA 3H0GB 5KRUA 2ZM6Q 1H9SB 1UE6A 1CZWA 3M4YA 4IM2A 1V81A 1V97A 2W82A 3MXPA 4IKGA 1H9RA 2L1BA 1H95A 2MHJA 3I4MH 1NR4A 3RLNA 5GAGC 4TKNA 1I4XA 3HRZC 3L16A 3N3KB 1V1PA 1X32A 4MT5A 5C3EH 2KMAA 1QB5D 3J80i 3V60A 1JRPA 4C3IH 1XQQA 3ER0A 1BO0A 3P1HA 3QX1A 3ABVB 3AU7A 1SFOB 1UUPA 1ZXHA 2A6HD 3GO5A 3KLWA 4DXFA 2KTRA 4R4IA 1ESRA 2B2VA 2A68D 2F0UA 1I7HA 4YY3L 5G2NA 1F2ZA 2ZJDA 4AOFA 3W1GA 3WAOA 1PRTB 2RA4A 5AFWA 2NVUI 4E71A 1WJUA 4A3JH 2FUG1 3HOWB 5IE8A 5EQ0A 5CHVC 1YQ3B 1V1OA 3K5MA 2AUKA 1YX5B 4AH6A 4FN2A 3NZSA 4A76A 1N60A 1QOGA 2K32A 2IY0B 4JBJA 2KOLA 3E9HA 3RZDB 1OEYA 2XWJB 5KYIA 3R7QA 2RQXA 3V2TA 2RDFA 3I90A 2MJ3A 2YEPB 1CT1D 1B8AA 4G11A 3VVWB 2O5JC 1B9NA 4KJOA 2F0DA 4QF4A 1R7SA 2G4SA 1QE6A 5IGCA 4OZAA 3VXWA 1GVPA 4N8X1 4BZAA 3L7ZC 4GKKQ 2RMMA 3U7DA 2PMVA 4KKJA 4KN4C 1MJCA 1UE5A 3KWVA 2HHHQ 4K5XA 1ZOYB 2KC2A 4YHHQ 3DBHB 1OXTA 1QJOA 4CO7A 5HHDG 1XLPA 4QY7A 3SD5A 4GKJQ 4BY1H 1K50A 3RUZA 4BOZB 2NVTB 1L0YB 4PK1A 4RCOA 4DV6L 1N36Q 1N33Q 3ZQ4A 3TN2A 2C7MB 4AUQC 2JF5A 2EJFC 2V3PA 4DXAB 1PHJA 2FMCA 2PVGC 3ONAB 5M3MG 4HJ9A 2LZ6A 3HM6X 2ES2A 3S1NB 1UF0A 4YY3Q 1E0BA 4NNJB 2EYMA 1YX6B 1WD1A 3EQLC 4UP7A 4A3KG 2CKZB 4XZ4A 2V1YA 3KF6B 1BBWA 1EIFA 4NKLA 2W54A 2UXBL 3EN2A 3UDXA 2F0WA 5DEHA 2O6VD 4ILWA 4N6EB 2J7ZA 1KOTA 1SROA 5IOCA 1B44D 4IFDJ 1YIWA 1TWGH 1YNND 3HOUB 3GTGH 1E2ZA 4LJOB 3IAS1 2N8NA 3JAML 4ANVA 2GBKA 4EKUA 1FYCA 4LUVA 4RA8A 4QQBX 1EOTA 3S9WA 2PW9A 1NSNS 1HCZA 3JSVA 1J9OA 2V4DA 4OL7A 4JCVE 4C3JG 3TL5A 3RNEC 4REZA 2K28A 4DNIA 2LRUA 3BDOA 4S3SA 3DVNU 2CHWA 3SK8A 2NN6H 5AUKA 4X3SA 2BA0A 2D3GA 3ZYYX 4GB9A 3VFKA 2KTRB 2LHDA 4P73A 1TWCH 1CKNA 2VL6A 4A9AA 1VQOA 2DZMA 3F2UA 2B2TC 3RYTA 1JALA 2N9KA 3DHGC 2A6HC 1I6HH 2MCNB 1FD7D 2WXNA 2A68C 5FR3A 1WI5A 1BBUA 1PZID 2KDBA 2QMTA 1ENAA 1LTGD 1FJGL 3Q69A 3Q3MC 1AW7A 1V8QA 1T3QA 4M8MA 1R4MI 4IUTA 3TIXA 3MP9A 3PQIA 1YZ6A 1I94L 4FDBA 2Z6KC 2QF7A 4PYUA 3OWFA 1QVCA 4BY7B 3PIO3 4IG7B 2XSCA 2JXMB 1RJTA 4ARIA 3Q3JA 1U5KA 1MI2A 2PPHA 1QQRA 1PDXA 1IP9A 3QOJA 2D07B 4NAWB 1VQLA 2B2TA 3N32A 4OW0A 3I2ZA 1TIFA 1PH2A 2PW7A 1UH6A 4EUTA 5KHQA 1HNWL 1K3BC 3MEFA 4KV6A 1WTOA 1JJCB 2FCSA 3JVZX 4KY6A 2EYPA 1DCZA 4K6LA 1EM7A 2R92H 2AYOB 4DHZB 3WDNA 2LVPA 2D9UA 2Z6KA 1TKWB 4EQNA 3E5SA 3LX0A 2MJDA 1DM0B 1H4RA 2KJXA 1WR1A 1K8RB 1UELA 4C3IG 2NBUA 4N9F4 4W9HA 2QDLA 1C8CA 1WTWA 2J7QB 2J42A 5GMVA 3M95A 3VA5A 3I4NB 2M00A 1VQ6A 1D7QA 4WWNA 4HPMB 1NMFA 3KYDD 1IGCA 2JY6A 3BIID 3W5VB 3DVNV 3EECA 4P6VF 1EYAA 2XRSD 1G6PA 3EA6A 1WYWB 3VR2A 2FCNA 2MP1A 2V0GA 5M3MB 4B3SL 1KFYB 2N7JA 3Q2AC 1L2FA 4HIMA 2HTHA 1TZ1A 2KFKA 2Z4IA 2EOTA 3PV0A 1FJGQ 1JOKA 3VR6A 2C60A 3N52A 3AEAB 1DOKA 3QQ8B 1RM6C 1U4RA 2UUAL 4PZ8A 5CBAE 2PKOA 2R7ZG 5J1ZA 3BYYB 4FVMA 2KQ3A 5HI1A 2K1FA 2IHFA 5CORA 5M5WB 3DUZA 2C7HA 4ZYSA 2N0SB 4CKEA 1YNNC 2VY3A 1DJRD 1H9JA 2KWCA 1CA5A 2EPBA 4RWSC 1STYA 3TDQA 4ZLTF 1UBQA 5ELFA 4BY1G 3FDTA 1HNWQ 1C4CA 2F3VA 1WJ4A 1XLQA 2FNJB 5KIXA 2WXPA 3IXSA 2E5LL 2IX1A 4FF1A 3I56A 1KLUD 2KVMA 2JUOA 3K0XA 5JJKA 4XE0A 4DUYL 2KC1A 1MG4A 1PH4A 2WB1E 1WGGA 2KO3A 3OAWA 5FLXL 1TU2B 5JJLA 4GDLA 1WTXA 3M7NA 1V8CA 4H2AA 1CK1A 3K8AA 4YL8A 2F0KA 4N9PA 4CDEC 2OTJA 3LWUA 3MA2B 3HUIA 1PMRA 1P8LA 3T9LA 1VQHA 1N32L 1ROEA 2JSVX 4IFDH 3A4SC 4GU2A 1I6VC 1X56A 4B3SQ 2ZJQA 1IUEA 1SNDA 5CHFA 2ZXPA 1WFQA 2MBEA 4NZLB 1GB1A 4GOPC 1X65A 1PTOD 2UXCL 2PQAB 1JQYD 3G7LA 3Q8DA 3HKZE 4HN7A 2NVQB 1B9RA 5IP9H 1C4AA 4MSQB 1YJ1A 2O5IC 2N55A 2KA7A 3WA0A 3DWQA 2NBVB 2JA8B 2OJWA 2IHEA 3CCRA 3RD4A 4KIKA 5E6OA 4KY5A 4USAA 4LK1C 3I55A 1E10A 5E7NA 4ZHOA 4C3HH 1QVGA 2FINB 1BT0A 1MFWA 5G5GA 3CRKC 4LF4L 1ZXTA 5J22A 1DOLA 3ULLA 2E2IB 3I8ZA 3MC0B 4DV3Q 3F2CA 4HDOA 5IAAC 4OIJA 4R8NA 3UQAA 3A8JE 1K8OA 1GKHA 3CCJA 1LUZA 3AYHB 2FXQA 3NBHA 3NQIA 3E9SA 2E5LQ 1LYLA 4A3BH 2WLBA 1D5MC 2D2CC 2R7FA 4WWMA 3HOVG 1KNEA 3ITPA 3NVVA 1LTID 2MJ8A 4R8IA 1YOVB 3GTMB 1YJJA 2NN6I 3QC8B 1WTVA 3B1LX 3X0WA 1K8MA 3T1YL 2JA6G 2F4IA 4X3TA 2IZVB 4FXCA 2Q5WD 3ZVVA 5IY0A 2DY8A 1ZDVA 4RMAA 2BH2A 4FJZA 2UU9L 2JZPA 5IO9A 4A75A 2PZUA 2Y0SG 1N32Q 2F0VA 4B95A 1WCMG 1VQEA 4JBKA 4JI0L 1A6XA 2WU5B 2DZKA 3VAWA 1JE4A 4UP9A 1D3ZA 2WX0A 2RSUA 4XC2A 4JK1C 4WORA 4Z9CB 4BS9A 2UXCQ 2R7ZB 1VRAB 2KFJA 4DBGA 3E0JA 1Q8IA 4ZCKA 3IL8A 3SR6A 4KKTA 2QSDA 3CC2A 3L08A 4DF7A 3ONSA 2C9WB 4OONA 4W9IA 1ZXIA 1SEBD 2FHTA 5CV5A 3PRZA 2E6XA 1D2BA 2W55A 1TS5A 1XPOA 5JHAA 2LXCA 1W6KA 1EF1A 3K9OB 4LF4Q 4MNOA 2GVAA 1LTSD 2JA5H 4YCUA 4MEMA 1JOQA 1K28A 3BZCA 4GDLB 3A8IE 1XPUA 2R3ZA 2O6VB 3O65B 3R2IA 1FPYA 3ZRCA 2IBIB 1SN8A 1QNUA 4WQMA 1IBKL 1BUVT 2BS4B 3PRMB 3TEZA 3F8TA 5H8YE 2HJ8A 2EKIA 3RNCC 1QOFA 3RLFA 3KLSX 4C4VB 1VQ5A 1KNAA 2H88B 1XX8A 3N1XC 4W9GA 3U4ZA 5LL6X 2NYZD 3DVGX 3L0OA 3CD6A 1QUQB 1EY9A 1STEA 1DOMA 2K03A 3KLRA 2AX5A 3D4DA 5M5XB 4A8XC 4ZQ3A 2D11A 4MGKE 2HDLA 4A3IH 5E6JA 3NUHB 4A3LH 1F9RA 4JI0Q 2JA7B 3TEXA 1PTOC 3R7RA 2DX5B 3OG5A 5E6NA 3SK6A 4OO1H 5KGUA 5LMUQ 1NI3A 1WWTA 4GDKA 2LGXA 5AJ3L 4A3GH 2ZW0A 2CKHB 3ZW3A 1RFAA 1WI0A 1EO6A 2KMCA 5D94A 2F0TA 3A8KE 4DV0L 4ZKCB 5FO8B 3VUXA 1KRSA 2NZOA 4AYBG 1F0ZA 1HZ9A 4P16A 1PTOF 3U2SC 5E1FA 4GOPB 4DK3C 4A3EH 2ZT9C 2H5XA 2K75A 3ZLZA 3SFDB 2MX2A 1Q86C 3BG3A 1VMPA 2I5LX 3K81C 4IPHA 1KABA 5BN3A 4I7ZC 2LUMA 2L11A 3DBLI 2KOXA 5IGEA 3HOVB 2KVZA 3PVLA 1HPCA 1WM2A 1CA6A 1J19A 2F03A 2WNMA 1HUMA 3NVYA 3LB8C 2JA6B 5EGTA 4JV5L 3MXUA 1HEZE 1HA5A 2K01A 4DFAA 1A3UA 1X3EA 1WXSA 3VDZA 4DR5L 2KDEB 1IL2A 4HIDA 1JRUA 3CSFA 4HRSA 1ICWA 4HKQA 1QZEA 2XEWA 4IFDI 3PSEB 2F0NA 2L55A 5BR8L 3D31A 1K8AC 3UQBA 3FKIB 1VQ4A 4KN7C 3HOWH 4BBSB 1E7ZA 2K6DB 2LI5A 1VQ7A 2KWDA 2V4LA 3ZNID 1A3VA 3DM1A 4PV1C 3PUXA 5FO9B 3Q0AA 1VQPA 1M90C 4FHKA 1S5FD 3GTOB 1QWYA 1STBA 1W2BA 2QW7A 4UP8A 1RTOA 4I65A 1PFDA 2M19A 3A54A 3RZDH 4P1BC 5AJ3Q 2TMPA 4DN4M 3AB9A 3ZJVA 1C9FA 2G45B 5JEAG 3HG9A 4DV0Q 2VUMB 2B2WA 1T0RC 4CYEA 3MTSA 3H09A 2KWVB 2RCNA 2Y0SE 4A3BG 2VH1A 3KUZA 1ILPA 1GG3A 2LUEA 2IJ0A 4IOIE 4BA2I 4OELB 4F8CB 2HJ1A 1GUAB 1NBWA 1CI3M 3CC4A 2Q2UA 4A93G 5C4XG 5T8IA 1G6JA 1M8AA 3PIOA 2M8SA 2INDC 1K52A 4KDLB 2UUCQ 3OSOA 4JV5Q 2AWOA 1KQSA 2RGFA 3RNAC 1I35A 2YYZA 2F0OA 3I5JC 5JOBA 4DR5Q 3I91A 3UDFA 1B3AA 2IGGA 1TYGB 1Z2MA 2WFWA 2K4KA 3S1NH 1UGJA 3J81E 4LJPB 3HOXG 2Q8IB 1EWIA 2MFIA 1KL9A 5BR8Q 5JPMC 4X3KA 4FULA 3BU2A 4LK0M 2A8VA 3PUWA 4GZYC 2A73B 3P4RB 1EUVB 4IWOA 3OJ4B 4KD4A 3GTKH 2QDFA 2UYZB 4II2B 3NTHA 4MZ9A 5EBCA 3BVGA 5GAHC 1OGWA 3BINA 4HCNB 1PLFA 2WKCA 4YCWA 1HFGA 2DNEA 3A1QA 3DBSA 2JA5G 1S5DD 3E56A 1SYDA 3Q8FA 4L1BA 4JI6L 3HOUH 1TY0A 1RODA 1PTOB 1XNRL 1Y8OB 2B3AA 3HIZA 4WWPA 4AIMA 3HM3A 3UE0A 2M0AA 2WDQB 3J81c 1M94A 2DYOA 1V9PA 4O2DA 1TY2A 4EX5A 2LXKA 2JPHA 4JI3L 2JEAI 2MH7A 4L5QA 2D0PA 2C7NB 4HJ5A 2K8CA 1E0ZA 4JI5L 3J7AF 4R9WA 4F8MA 3NQTA 1HNXL 1IW7C 1X3FA 3HOZG 4ZRJA 4QMGA 1I3QB 3NSWA 3QARA 2XTIA 3QAQA 2CQOA 5AEKB 3ZXVA 4GGQA 1IBXA 4AYBE 3ND8A 1CKMA 3OIPA 2QA4A 4A3LG 4JBWA 1ASYA 3P1MA 3AFQA 2ALYB 1MG8A 1LTBD 1GOZA 1BF4A 3P4PB 2LKVA 2B2UC 1ENFA 1TR5A 4FBJB 3H6NA 4RGMA 5AZFA 1DOIA 2ZW1A 4BY7H 1NNXA 2YU9B 1TWHB 2H89B 2B76B 3SHLA 1T5EA 4QIWB 2ZCBA 1SNMA 1PA6A 3U9SA 4HIKA 4ZHPA 3NP8A 3JW0X 2L00B 2E2HH 2GB1A 4LF9L 3J7AV 1Q5WB 3H0GG 3S1QB 3CF5A 1K9MC 3I7FA 1Y1WG 3ENEA 3RR5A 4JI6Q 1XNRQ 1EFID 3GOEA 2Q2TA 2KN4A 1YNJD 2M0XA 3I72A 2B2UA 3M4OB 4BKSD 1AE3A 1VCBA 1LT6D 3PF5A 4A93B 5C4XB 4HMJA 2EXZA 2KQ4X 2VQEQ 1EOVA 4JI3Q 4CDFC 1SDFA 1YN3A 1KDCA 3V61A 4LNOA 5FJ8G 2L5TA 3I4NH 1X3PA 2WWZA 5IKCM 1KDBA 3S1MB 5M5YB 4KMUC 3QJZA 3H3VC 3DPDA 3KUPA 5EPLA 3B0AA 4XYQA 3TBLD 1CJEA 3AE2B 3ML9A 2K8BA 3HOWG 5M3MH 1LV9A 4Q5VA 3EFCA 3WALA 1OXXK 2BOSA 4IPDA 3M9BA 4KJNA 1Q1OA 5EJWA 2BQQA 3DVGY 3EUB2 4GLAC 4YT0B 4A20A 2LS01 3G48A 3BYTB 2OHFA 3V6EB 5BN4A 1KAAA 2ZNVC 4IQZA 5C1ZA 3VR5A 5AUIA 1AN8A 2PZTA 1PFSA 2FE8A 2A5UA 4A55A 1TWAB 2MHVA 1O80A 5ELEA 5IP7G 1ZPSA 5LMNL 2JQRB 1PYWD 2K5QA 2ZCCA 4HPPA 4NPSA 5M5WH 4K7UA 1SE2A 5JZEB 4LF9Q 2GLSA 3K7AH 4P74A 1ZW7A 5K36H 1EY4A 2EKEC 1Q12A 1PDQA 1YJWA 2VXWA 5KNCA 5ELBA 2WAQE 4LF5L 1XNQQ 5CTRC 4J6IA 2Z9HA 2EVBA 2CHZA 1EU4A 4OZCA 2AMCB 3O13A 2E2JB 2IWHA 4C3JH 3RZOH 3A9JA 4MTNA 1SJED 4RGTA 3GTJB 5LL6S 1A63A 5DPSA 1SGHA 1FCCC 3DBHI 4M8AA 4DR3Q 1D4BA 2K5NA 3QHTA 2IO0B 4KZCA 1UE7A 3H94A 1IBXB 4X62L 5IIFA 2ID0A 4QUFA 1WY8A 5DPRA 4J15A 1Q10A 3H7PA 2X6GA 2MEKA 2RR9A 1BMLC 1KDAA 1BCPC 4LF7L 1NYRA 2Y5BB 2J0MA 3B9JA 3VDYA 1Y69U 5KEEA 1KHIA 1A8VA 2B39A 4F7ZA 4CDCC 2B8GA 4AP4C 2GBRA 2K0PA 4II3B 2F0LA 1DGJA 1VF5C 4GLVB 4JI4L 3C3LA 4H13C 2Y5CA 1BCPF 5G3LD 4FF3A 1JMCA 3P4QB 1K3RA 3U4EG 2NVQH 3GD7A 5FOBB 1GPXA 3HVDA 3C1EA 3VH3B 3HOUG 1C4QA 1IBLL 1XWEA 2JA8H 2B2VC 4WWOA 2EY1A 4ZAIA 1CZGA 2WHIA 3BK1A 5D14A 2W3RA 1BKBA 2KDFB 3PTFC 1B70B 1PGXA 1K83B 5LMNQ 1NMGA 1RAXA 2F0IA 2VB2X 1Y1WB 3K0YA 3PIPA 4M0WA 4BVUC 4BWGB 3PLUA 2BWFA 1V80A 3PPAA 5E6PA 4HSPA 2MQHA 2Z8LA 4LFAL 1FM0D 3K59A 2LGSA 1VQIA 2E2IH 3KVFB 1WTRA 1YNJC 1LT5D 2ZJRA 4LF5Q 1CKOA 2I0QA 3UI3A 1HQMC 5EPJA 4FF4A 4MJSA 4WQOB 2N9EB 4G3XB 3MAQA 2FUHB 3LJ3A 4K3CA 2N4FA 3W1YA 5A2QE 2CH4A 2R7DA 4WAAA 2NPTA 4XGAB 3RULA 3OWEB 1XMQL 3GTMH 3TEYA 2M9VA 1X9NA 4X62Q 2CJNA 4E3CA 3X3MA 4IUUA 5D3IB 1SF0A 4L5TA 2L52A 2I1JA 2KQSA 4OGQC 1E2VA 4TV3A 1J8CA 1C7YA 4XTCS 1YITA 4TMAB 3SHQA 4PZ6A 2GBNA 1HE8A 3HHMA 3ZUNA 3VR3A 1WFYA 2O2VB 4BY7G 4LMQD 3CSTA 4A3MG 2AKWB 4QAYA 3S14B 4K5VA 4BKSA 3B2GA 1ZEQX 1WGHA 2OTLA 3W1SA 4LNFA 1YJIA 2B2YC 3E3XA 1JC7A 4LNNA 2EYLA 4NXML 2FCQA 3S2HB 4IWQA 4KX6B 1S3OA 5CV9A 1EWCA 2R7ZH 3T8MA 4IM3A 1MD2D 2TSSA 5I2YA 3J7YW 1IBLQ 1GHJA 1WRDB 4A3CG 3ERQA 2BT6A 2F0PA 2IYDB 1P3QU 2Z59B 2ZTEA 3A9JB 4HEDA 5LXHA 2GBJA 2WGSA 2A1AA 2ZNVB 4K2KA 4TVAB 4LFAQ 2PE9A 4IOAA 5GQOA 1SB3C 4UHVA 2EE1A 2XNAC 4RMFA 4G7HC 3RN5A 5C0XG 3C46A 3AMUA 1T6BX 1QNKA 2HUGA 3I4NG 5L83A 1VF7A 4HCEA 3AE9B 3ZJTA 2B2YA 3E0EA 3CWIA 4RF1A 2BB5A 3CCLA 1Q81C 2A74C 2H4OA 3BDLA 1C77A 2OJRA 5IT9L 2I1KA 1AZQA 3S17B 1YNTE 1WMHA 4QGUA 3RN9C 3CW2C 1XMQQ 5C2TB 1Q46A 4LF8L 1Q8KA 3TS0A 4MACA 1JOOA 1AFPA 3J80E 2B29A 4MN3A 2FIDA 2PMZE 1AH9A 1S5BD 3OTOL 5M5XH 1MIUA 3TS2A 2LGDA 1XF5L 4JOIC 3FHWA 1NYQA 1J6QA 2M4NA 4B0MA 1L4DB 2JP1A 3VA7A 1MKHA 1JORA 1BQQT 5EPKA 4R3DA 4EQPA 4NXMQ 3GE8C 2WU2B 4JQWC 1BCPB 1HXYD 3A0JA 1HFNA 4NQLB 1XYIA 4G50A 1Z9FA 5J3BA 5K36G 1F9SA 1ZYRC 3WOEA 5IT9E 4PG3A 1V1PB 1Q82C 1U4AA 2W9NA 3J80c 3ZJYC 2K22A 2WXFA 1R4NB 2SNMA 1C78A 2L4NA 5G3LF 4MJSB 2KN5A 4W9DA 3WAPA 5L95C 1IXRA 3UF8A 4GNXA 4JOIA 3H7SA 3AE4B 1FRRA 3AMZA 5G5HA 1YBYA 3PUZA 2CR5A 4JI7L 1UEBA 1WYGA 2GBMA 3HOVH 1SMYD 1SYEA 4DV6Q 2DYMA 3G6JB 4C00A 3KYCD 2J4XA 1JWAD 2MUYA 2PQEA 4MM3A 5JEAJ 4KSKC 1TJEA 3RPFC 1HTQA 1Q0WB 3RMHA 3IFDA 3KBGA 4DNTB 5IT9c 5CV7A 2JA6H 2L0CA 4IUVA 4XT1B 1N34L 3DOWA 3CCVA 1C0AA 3CPWA 5HY6A 2YVCA 4OWXB 2ON8A 1FGBD 1C9OA 3ND9A 4DR2L 2ZVOA 4EQ5A 3APCA 2NBFA 4A3MB 5E3FA 2DWQA 3EIVA 3Q8AA 3C2PA 1WCMH 1WTPA 4CHTB 4FLHA 3SDLC 2AUJD 1F2RI 2UXBQ 3BVZA 3OTOQ 2JSOA 3NEMA 3SK5A 1CFMA 3WCQA 3NTIA 2WS3B 3FKIH 4JL9A 3BJUA 4BBSH 3K5LA 1WXVA 2JA8G 1SNQA 4CGYB 3GTOH 1YD8U 4RKLA 2WXKA 4LNKA 3BK2A 4DR6L 1PFNA 1STGA 2WP8J 1KJTA 3T51B 1G2TA 1Z47A 2VUMH 2CHXA 2A19A 1PYSB 5KYLA 2F52A 2YV5A 2GVBA 1E2WA 3DWPA 2WYQA 4K1RB 1QOBA 5AZHA 1WGDA 2JRHA 2EYFA 4IURA 1GAQB 1WZ0A 2VB3X 3EC8A 3FILA 1A0IA 4JI2L 1L4ZB 4US9A 1YHQA 2QKIC 4LLGM 1CUKA 1S5CD 1EY0A 4XX5A 3IAYA 4QB4A 1TKYA 1OQYA 4BOSC 2G4DB 4TKOB 2MO0A 1JT8A 1MJDA 3W5OA 5FLMG 2ZVNA 4DHJB 1HZCA 1I94Q 4DR2Q 2KD0A 3NXWA 1LT4D 1GC7A 4UDUC 2KQ7A 5EE9A 2Z6BA 4PS3A 5T1GA 1ESFA 1PZKD 3L54A 3DWGC 4A90A 1AWDA 2F0SA 3ERSX 1O7IA 4XIGS 2ZTDA 2VNUD 3SEBA 3PO3B 4A3PA 3JSVB 1MBYA 1LM0A 2X38A 3GQBA 2JEBI 1GUGA 5BYRA 1BVSA 2JU6X 4KV2A 3TREA 4TSSA 1RCVD 2J0TD 3BS1A 4DR6Q 2QIEB 3DHHC 1WXAA 4RNAA 4JIOU 2WB1B 3FRPB 5LNK1 1ZKOA 3NK9A 1O7LA 4L8JA 1PTOH 1CKNB 4K0KL 3Q6BA 3GV3A 4MH8A 1O7ZA 1YN5A 1ZKHA 4MM3B 2WDRB 1JW9D 1F9JA 3WIMA 3ZJUA 3FKYA 4KY7A 1SRUA 1SMYC 2N78A 2WXOA 3UINB 2GN5A 2WQYB 3QG1A 2DZIA 1WIAA 2IGHA 2K5PA 4HPLB 4HJ8A 1HZAA 1MPEA 2GRIA 2KANA 3ALBA 3ZIMA 1I3QH 3FP9A 3TJPA 1RTNA 3AEBB 3A74A 3KOJA 2E2DC 2JXTA 2RHQB 4OVVA 1I50B 1P7EA 2DLBA 4W9FA 1ACCA 2JA7G 2MRPA 2X8XX 1E1TA 5C5MA 1VZ7A 1SYFA 1NAPA 3Q22A 1FNWA 5GXGB 2UUAQ 4XT3B 1Z6HA 4KVGB 3DWMA 4FA6A 3U8ZA 1CM9A 3A7AB 4R1JA 1EFWA 1VQKA 1R4MB 3NTKA 2BE5D 1WM3A 2BS3B 4GXBA 1IYFA 2BS2B 3ZTCA 1VQCA 2YU9H 1TWHH 1WGYA 4XDXA 4GS3A 1CQVA 5CBEE 1TWFB 3G4SA 2R61A 1XPRA 1CHQD 1TT5B 5JEAH 2WXQA 3MEHA 2J0JA 2KCTA 1VQJA 2KHSA 1V1QA 5C6AA 4CJ0B 4K6DA 4IOCA 3S1QH 1TZOA 4HJAA 4KHPL 2F4VL 4FHJA 4WFN3 3NENA 4LNQA 1BXTA 2ASQA 1CMXB 4S0RA 4LWCA 4DUYQ 2G1EA 2WXJA 1GUSA 2K33A 3DWAA 1YJ9A 3GTLB 3MHZA 2F0QA 3V3XA 3M4OH 1BDOA 2KEDA 1KF6B 1V5TA 1X54A 3OMGA 5C4XH 4A93H 2NVYB 4RM8A 1D5XC 2KFKB 2R6GA 1PYBA 3DEPA 5CC4A 3Q8EA 4EOYA 2INPE 2V4IB 4CJ1B 1K0RA 3CCQA 3S1MH 5M5YH 4DK5A 1WJJA 4MGYE 3Q6SA 4FJVB 3TUOA 4DV2L 2WXLA 3NZUA 3FKIG 4NXNL 3AE7B 1I4GA 1KRHA 3TCAA 4BBSG 2I2YA 2KTFA 2KENA 2RKSA 2BF8B 4F88A 3HOXH 2DAFA 2K39A 4MSMB 3AU4A 2R2QA 1PV4A 2ACZB 3NWSA 3G71A 4YSYB 4A3JB 1Q1EA 1IPGA 2WIIB 2KAJA 4AQ7A 2VUMG 3BDCA 1L0VB 4PYZA 1PQSA 3OPOA 1IKMA 2QCZA 4HJKA 2K7VA 4H02A 5C4HA 1HR0L 3R2TA 4BBNC 2I5MX 1VQMA 2EY6A 4KHPQ 2D3AA 2F4VQ 2N7EA 1QLBB 2NTTA 2UU7A 4N59A 1KD1C 3VYUA 1J0GA 3OW7A 3Q3FA 4LAAA 3PREA 4ZUJA 1K51A 3VRBB 4O42A 2E2JH 3K57A 5ELOA 4BBNF 3GTJH 3OJ3A 3WOFA 3T1YQ 3I3CA 4IJLA 3PIP3 1WJ6A 2WXGA 1GUOA 3HOZH 4TUUA 4W9LA 2UU9Q 3KUCB 5JH5C 1FGUA 1IYJB 2VS1A 4ICUA 3RUIB 4EQOA 2WINB 2P5ZX
chains in the Genus database with same CATH topology
3OOCA 1LABA 1HA6A 3NPPA 2EZVA 1VMCA 2BDOA 4NAMA 4PQXA 4OIKA 2KCNA 5TSSA 4ZUIA 4TQUS 5ELCA 3GTPB 2JYTA 3KLSA 5D65A 4NMZA 2BE5C 4IUPA 3AV8A 1QT9A 3SK4A 3U9OA 1C76A 2DY7A 5BMHA 3HS0C 4G7ZC 1O78A 2O4XA 1TWGB 1U4MA 4WRDA 3OIQA 3SVMA 2EJMA 3H6MA 4K8JA 5ELDA 4KKSA 3AE8B 4RGOS 1AEXA 2GI9A 2B2WC 4FXKC 1RFKA 1F9PA 4Y7NB 4US8A 4YTNB 1VDZA 3Q8CA 4FNFA 1MI0A 1FNVA 2N88A 1PFMA 5C0XJ 3AH7A 2C5CA 3A56A 1I6HB 5C3XA 1PGBA 3SDZA 4DAVA 2NWGA 1G6ZA 1TKEA 2F3WA 4N9TA 1XCTL 2IGDA 1I4PA 2G9HD 3J81L 1QCBD 1K53A 4NJCA 1WRIA 1O7YA 4A3DB 2OEDA 1NCVA 2K5WA 2MGSA 1EYCA 4G4KA 4PT5A 2PZWA 4DK0A 1EWYC 2WV6D 2K04A 4J1MA 4YTPB 2NVXB 3SR1A 1JWMD 1DOXA 2Z1CA 4MHEA 1J7AA 3C8YA 2X6LA 4A3FB 4JWSC 1ET6A 5T1IA 2LGIA 4CKBA 3GP7A 3T4AC 4GDKB 1UWXA 4LTUA 2EYJA 2I46A 1L6VA 5ISRA 5CV4A 2LMCA 1EWHA 3D4WA 2HTME 1EZ6A 1RF2D 4WIPA 1A15A 1CTMA 3NUCA 1SYBA 5JXVA 1BNZA 5C4ZA 5IODA 1LTTD 1WVLA 1NUCA 4J8QA 4FO2A 1FNUA 4RHSA 1OQQA 5EE3A 2K9XA 3FPUB 2CU3A 1I4RA 1RD9D 5HG2A 3URYA 2L32A 3PZ7A 5LHY1 2CQAA 3BZDB 1QOAA 1DXMA 1F2MA 1UAPA 1UNSA 3M7GA 1J7CA 1SYCA 4JX1C 3DHQA 3VYTA 3QOLA 4DK1A 1NVID 4QUCA 2JYOA 3EROA 4OO1I 4XYOA 1II3A 1RKNA 3AB5A 2SEBD 1N5WA 3I73A 4JPSA 1CZPA 1XEEA 4FP5D 2LEKA 1L0XB 1SYGA 3EFXD 3FAHA 2DN8A 2RPVA 3QWNA 2RSNA 1PUTA 5EKLA 2A5HA 1D1KA 1V43A 5C0XH 3I70A 3QJYA 1FCLA 4TRDA 4FYDA 1B1ZA 2BA1A 3LWEA 1XLOA 4WURA 4M1UB 2MPMA 3VR8B 2LMCB 1WGKA 5EE0A 3KWLA 2RVLA 3S15B 1C4PA 4ARCA 2CVRA 4KKIA 1JMLA 2EY2A 2O2LD 3S1RB 1RWSA 1ILQA 3P63A 5C5LA 5HFYA 1Y8NB 3L3OC 3DMUA 1RDPD 1U4LA 2WXHA 4HJGE 1CHPD 2IL8A 3W3AA 2BW2A 1N5XA 1FIQA 2C9OA 3TBIB 1HUNA 1FEHA 3I4LA 3HZXA 2ICIA 4O1NA 1D5ZC 1OFFA 4KGTA 2SNSA 3FC4A 4CKCA 2HDMA 4CQNA 1DZ1A 5NUCA 2ENBA 1GJXA 1LO5D 2L9HA 2PCFB 5IGBA 5A2QL 1XTCD 1X3QA 3T56B 3NS1A 4YIJA 1H9MA 5I2XA 4RAUC 1EEID 1EY5A 3HGBA 2G9DA 2LJIA 4QCLA 1AZPA 3FPPA 1EYDA 1XO3A 3VQIA 3MHBA 4A3GB 4KTAA 1SNCA 3L4PA 2BTEA 1SNPA 2BDNA 3MJ5A 3Q8BA 4TQ1A 5BMGA 3QIAA 3D8GA 4A3EB 1WTQA 1DYQA 2IT1A 5EE1A 4YXDB 3AEDB 3HOYB 4L23A 4H44C 5A35A 4X3UA 5J39A 3HEJA 2A6ED 3CU7A 1G91A 2PTLA 1Y1VB 1KTKA 1FFUA 3QO2A 2R93B 2E74C 2E76C 2F0JA 1D6EC 2J52A 3NRZA 2L83A 2IX0A 3J80L 4ID6A 4E6IA 2F0HA 2KECA 3A55A 4HMIA 2KMMA 4EE2A 4B9WA 1OXUA 2D5DA 4TQ0A 3M3YB 4ZRQA 1BR9A 1SXTA 5BYSA 3B2FA 3MWYW 3GS2A 3CQZB 3V05A 5M3FB 3TP7A 3S16B 1F2LA 1MSGA 4B0EA 2RBMA 3VYRA 1R9TB 5C0XI 1B2TA 3H8HA 3E6ZX 4IUQA 1FMAD 3RFZB 1U4PA 1QG7A 4G57A 4C2MB 1HHVA 3PZ8A 2PMZB 3MZ5A 5IGDA 3HRDD 3K6OA 4BBRB 3IAM1 1Q3LA 4N58A 3KK7A 1LTRD 3EJIA 3AE6B 1FFVA 2B63B 2KDMA 2F0GA 1NENB 4KGSA 2SDFA 3L9AX 3AE3B 1GB4A 4XQNA 3AE1B 5E4WC 2CW0D 5C3WA 4IALA 1MGSA 3GTKB 1NEKB 1TVXA 1STNA 2WP9B 1ET9A 1J7BA 2KACA 2IW3A 1SAPA 2L1AA 3MXGA 1B9MA 5C44B 2KEEA 1JWUD 4KGRA 1GUTA 1F2YA 2XVSA 1F2RC 4KK7A 1HTLD 3VRAB 2A6EC 4XXEA 4C80A 1BUIC 1OXSC 5DNFA 1L5PA 2A69D 1KLGD 2KUMA 2RSOA 1EL0A 3PO2B 1P7FA 3HP3A 4RKBA 5EKKA 1ZE3D 5HGTA 3N6RA 1ZP0B 1NR2A 3JAME 3CHBD 1OO9B 2E3TA 4AS1A 5IGGA 2KCCA 2E2HB 3FMCA 1Q1BA 1HZ5A 1EY8A 2EELA 1F9QA 4HSVA 2WXMA 3AM9A 5BYQA 3D6WA 1TS3A 3Q24A 1R4PB 2SAKA 1A2UA 4ULLA 1HTPA 2LY7A 3UI2A 1DOYA 4GLSC 2M56B 2EYOA 4J3OD 2K1BA 2WDVB 1VR9A 3VR9B 2V3NA 1T5XD 5I6YA 3P20A 1D4BA 3GTQB 1B53A 2DNCA 3S2DB 4RFBA 4C7ZA 2LHEA 3T16A 5M9OA 2VZKD 3P7JA 1VDVA 4BA1I 3AN1A 2AQ3B 3OMCA 1AYFA 1WSPA 1JWBD 4HKZE 4A3KB 3M85A 1JQ4A 2CW0C 1Y56A 5JVG3 1CQFA 1SJHD 3TEWA 2PW5A 2XWBB 1HRJA 2EYHA 5BMIA 3A7LA 3MXNA 3TP6A 1EEFD 4RGNA 5JAVA 2LFIA 3OHXC 3EGRA 3K7AB 4HR7B 4KHZA 1YN4A 4WJWA 3T3OA 2WKDA 4ME5A 4L6TB 4C3JB 3RZOB 3HKZB 1TT2A 2E75C 4NW2A 2AQ1B 5C4JB 1AP0A 4NP5A 4C1NI 4Q2JA 2ICEC 2Q8TA 2FBWB 3ZGZA 1EZ8A 2A69C 4F87A 4CBVA 3NZ3A 4JWUC 1J8IA 4ZOHC 1ZDXA 1EQVA 1RHPA 3J9CA 2F0FA 4NDXA 3PUVA 2BBCA 1GHKA 3SE0A 5KNDA 3FILB 3I57A 1Y8PB 2OT2A 2XN9C 1FD6A 3KBXA 5EBDA 4DAPA 1HQRD 5FLXE 2EJGC 3P75A 1SE4A 3I4MB 4YTMB 2F0EA 2HCCA 2I07B 1YMHE 3I9V1 4HTHA 2ONQA 2PYKA 3Q23A 5CV8A 2F1MA 5C3EB 2Z4HA 2FFKB 4B9XA 4EGVA 2NN6G 4ZKBB 4C3IB 4K8IA 2Q8RE 1F77A 3AEFB 2IDYA 4A6QA 1XCQL 3GB1A 2NMQA 1MVKA 1QOHA 2JE6I 3CIRB 1TS4A 4IN3A 2JYEA 2HQEA 5F2DA 2NB0A 2PPBC 3EVQA 1OQRA 2INNE 4XWWA 1Z7TA 4IDIA 1N62A 1FR3A 1M4VA 4OZBA 4RHRA 5CV6A 2DBYA 1LT3D 1JWSD 3K5OA 4OHJA 2RDGA 5JVH3 5IGFA 1WXQA 1LTAD 3LXFA 5DAUA 2CJOA 1E7PB 4XDDA 1BOSA 3LNNA 5K5PA 4P2CB 2N9LA 4FXCA 3NHHA 1S4ZA 3NBIA 4MIUA 1TQOA 4BY1B 2IPKD 2L12A 1XXGA 2PIAA 4C1NK 4DXGA 1MHHE 4JE3B 4KD3A 2QDBA 4HCSA 3KF8A 1MSHA 4H0LC 2PLPA 4YSZB 2OF1A 1XLNA 1EIGA 2ZXOA 2XRQD 4YSXB 3T53B 1U9RA 1IYVA 3PMFA 1GXDC 3AEEB 5D3DA 3GTGB 2FMMA 2K3UA 4ABNA 1IHZA 2FJ2A 4KI0A 4H7BA 1IGDA 2K05A 3W5UB 5JPNC 5COYA 4EVOA 1A70A 5HURA 4DNRB 1B50A 1BBXC 4C7YA 1S5ED 1TWCB 2Y5PA 2EDGA 1JR0D 1EQTA 3ETRA 1B4OA 1OXVA 1IW7D 3LYYA 1TS2A 3R3OA 3TMEA 4IFDG 4FXDA 1N61A 4K5WA 3P42A 1WD0A 2K6AA 1FRDA 2Y0SB 4DU9A 4L63B 3U7ZA 1L6UA 1WCMB 2WACA 1ZUD2 3AE5B 1I4QA 1STHA 1DONA 4PMCA 4ITKA 5E4XA 3V96A 3TZDA 4PMBA 2K5DA 5I4DA 2H1EA 2PO4A 2VZKB 4C3HG 3BWUD 4FF2A 1MHXA 2F0MA 1FXAA 3TP5A 4PNYA 2R92B 3IT4B 1R4QB 1VLBA 2IX3A 5CR3A 1PRTD 1HZ6A 4HEA1 3TZUA 1EIHA 2AQ2B 3VYSA 2QJLA 2WXRA 2W3SA 1JB3A 3BVMA 4DAYA 2QEJC 1QF6A 1VJKA 4UAIA 3W2DA 3SXHA 1ML0D 4DQOC 1PFBA 1QILA 3NE5B 4G7OC 4U68A 2MJEA 3PUYA 5BN5A 2WXIA 3T3NA 3CRLC 4V190 4L2YA 2ZXRA 2J53A 1STAA 4XQJA 1A3TA 3U52E 4PMWA 4U673 5I6WA 1VZ8A 1TIID 1IKLA 4D2KA 4XDCA 3AEGB 5D7GA 2HDEA 2GA4B 4KKUA 4AYBB 1Q90A 3AECB 1PGAA 1VCIA 1G2SA 2LFNA 4WAFA 1PZJD 4LJZC 4ZRZA 1JCKB 3IFTA 2PVOD 5I9OA 1A2TA 2EY5A 3DEOA 3D6CA 4KHVA 3PO0A 2BB6A 2X69A 1N63A 4ODGA 1LLRD 5FO7B 1SSNA 5CGKA 4J6HA 1BCPD 4DA2A 5C3JB 5CMDA 2OXPA 4HAEA 4RCNA 3DXJC 1EY7A 3P4SB 4ZRPA 4OO1G 3D4RA 3C1FA 5EKIA 4XWTA 4K14A 2NTSA 4C3HB 1G8ZD 3MFYA 2QCPX 1UEAB 2NZ1D 4CJ2C 1C48A 2I38A 1YQ4B 3H91A 2AWNA 4V0BA 5MPOA 1SNOA 3IKJA 3NWTA 4A3BB 1VZ6A 2ACZB 1GUWA 3X3NA 1H9SA 1PRTC 3CKIB 3HVZA 4WH4A 3W9CB 5DM73 2JWUA 1E6EB 2B8FA 5DM63 3SFEB 1EY6A 3T13A 4OVZA 1G291 1PRTF 2SOBA 4RH6A 4HROA 3IT6B 3FEWX 3FVQA 1KH0A 2JX5A 4RF0A 2WAQB 1RYJA 3TSSA 1H9KA 1SE3A 3HOXB 2OEOA 3R93A 2YEPF 4YWGG 5FKAC 3K5NA 2M2LA 1ENCA 2XIWA 4C56C 4B08A 1C79A 5H92C 3NVWA 4FXGC 2JA5B 1JICA 4F7XA 1E9MA 4IZ8A 4Q0FA 3N9YC 5I9PA 1ONLA 2HCIA 4DGZA 3MVVA 1D1IA 1IYUA 1FXIA 1PXUA 2Y3AA 2QILA 5JJZA 1TKGA 3R8BA 1DD2A 1I4HA 5KNBA 1SIJA 5CYUA 3HOZB 1UWMA 1W6JA 1JROA 3TP8A 2BCOA 2NUCA 3GV6A 3VR4A 1GUNA 3MFGA 4A3IB 4IUNA 2D5GA 1SBBB 2BYTA 3QB3A 2RDHA 1EU3A 3D3RA 3NVZA 4XQQA 3K58A 1IL8A 4ZK9B 4K2LA 2CHBD 2PNRC 5FK9C 1QKZA 1SSOA 1ZYRD 2D62A 1LACA 3H0GB 5KRUA 1H9SB 1CZWA 3M4YA 1V97A 2W82A 3MXPA 4IKGA 1H9RA 2L1BA 1NR4A 1I4XA 3HRZC 1V1PA 1X32A 4MT5A 1QB5D 1JRPA 1BO0A 3P1HA 3ABVB 3AU7A 1SFOB 1UUPA 1ZXHA 2A6HD 3GO5A 4DXFA 1I7HA 1ESRA 2B2VA 2A68D 2F0UA 1F2ZA 1PRTB 2RA4A 5AFWA 2FUG1 3HOWB 5EQ0A 1YQ3B 1V1OA 3K5MA 2AUKA 1N60A 1QOGA 2K32A 3RZDB 2KOLA 2XWJB 5KYIA 2RQXA 3V2TA 2RDFA 3I90A 2MJ3A 2YEPB 1CT1D 2O5JC 1B9NA 4KJOA 2F0DA 4QF4A 1R7SA 4OZAA 1QE6A 5IGCA 3L7ZC 2RMMA 2PMVA 4KKJA 4KN4C 3KWVA 4K5XA 1ZOYB 1OXTA 1QJOA 5HHDG 1XLPA 1K50A 3RUZA 2NVTB 1L0YB 4RCOA 3ZQ4A 3TN2A 2EJFC 2V3PA 2FMCA 2PVGC 3ONAB 3S1NB 1E0BA 2EYMA 1WD1A 3EQLC 2W54A 4NKLA 2F0WA 5DEHA 4ILWA 4N6EB 2J7ZA 5IOCA 1B44D 4IFDJ 3HOUB 1YNND 1E2ZA 3IAS1 3JAML 1FYCA 4RA8A 1EOTA 3S9WA 2PW9A 1NSNS 1HCZA 1J9OA 2V4DA 4OL7A 4C3JG 4REZA 2K28A 3BDOA 4S3SA 3SK8A 2NN6H 5AUKA 4X3SA 2BA0A 3ZYYX 2LHDA 4A9AA 3F2UA 2B2TC 1JALA 2N9KA 2A6HC 1FD7D 2WXNA 2A68C 5FR3A 1PZID 2QMTA 1ENAA 1LTGD 3Q69A 1AW7A 1V8QA 1T3QA 4IUTA 3MP9A 2QF7A 3OWFA 4BY7B 3PIO3 2XSCA 2JXMB 1RJTA 4ARIA 1MI2A 1QQRA 1PDXA 3QOJA 4NAWB 2B2TA 4OW0A 2PW7A 4KV6A 1WTOA 4KY6A 2EYPA 1DCZA 4K6LA 1EM7A 3WDNA 2D9UA 1TKWB 4EQNA 3E5SA 3LX0A 2MJDA 1DM0B 1FO4A 2KJXA 4C3IG 1C8CA 1WTWA 2J42A 3VA5A 3I4NB 2M00A 1IGCA 3BIID 3W5VB 4P6VF 1EYAA 2XRSD 3EA6A 2V0GA 3VR2A 2MP1A 5M3MB 1KFYB 2N7JA 2Z4IA 2EOTA 3PV0A 1JOKA 3VR6A 3N52A 3AEAB 1DOKA 1RM6C 1U4RA 5CBAE 2PKOA 5J1ZA 3BYYB 4FVMA 2KQ3A 5HI1A 5CORA 5M5WB 3DUZA 4ZYSA 2N0SB 4CKEA 1YNNC 1DJRD 1H9JA 1CA5A 2EPBA 4RWSC 1STYA 3TDQA 4ZLTF 5ELFA 3KQ4A 3FDTA 1C4CA 1XLQA 2F3VA 2WXPA 5KIXA 3IXSA 2IX1A 4FF1A 1KLUD 2KVMA 4XE0A 5FLXL 1TU2B 1WTXA 3M7NA 1V8CA 4H2AA 1CK1A 2F0KA 4N9PA 3LWUA 3MA2B 3HUIA 1PMRA 1ROEA 2JSVX 4IFDH 1I6VC 1IUEA 1SNDA 2ZXPA 4NZLB 1GB1A 1PTOD 1JQYD 3G7LA 4HN7A 2NVQB 1B9RA 1C4AA 2O5IC 2N55A 2KA7A 3DWQA 2JA8B 3RD4A 4KY5A 4USAA 4LK1C 1E10A 4ZHOA 2FINB 5G5GA 3CRKC 1ZXTA 5J22A 1DOLA 2E2IB 3I8ZA 3MC0B 4OIJA 4R8NA 3A8JE 1K8OA 3E9SA 3NQIA 3NBHA 2WLBA 4WWMA 1D5MC 2D2CC 1KNEA 3ITPA 3NVVA 1LTID 2MJ8A 4R8IA 3GTMB 1YJJA 2NN6I 1WTVA 1K8MA 2F4IA 4X3TA 2Q5WD 2DY8A 1ZDVA 2JZPA 2PZUA 2F0VA 1A6XA 2WU5B 1JE4A 4JK1C 4WORA 4Z9CB 4BS9A 2R7ZB 1VRAB 3E0JA 1Q8IA 3IL8A 3SR6A 4KKTA 2QSDA 4DF7A 1ZXIA 1SEBD 2FHTA 5CV5A 2E6XA 1D2BA 2W55A 1TS5A 1W6KA 1LTSD 1JOQA 4GDLB 3A8IE 2R3ZA 3R2IA 4WQMA 1QNUA 1BUVT 2BS4B 3TEZA 5H8YE 2EKIA 1QOFA 3RLFA 3KLSX 1KNAA 2H88B 1XX8A 5LL6X 2NYZD 2AX5A 1EY9A 1STEA 1DOMA 2K03A 3KLRA 3D4DA 5M5XB 4A8XC 4ZQ3A 2HDLA 5E6JA 3NUHB 1F9RA 2JA7B 3TEXA 1PTOC 3SK6A 4OO1H 5KGUA 1NI3A 1WWTA 2ZW0A 2F0TA 3A8KE 4ZKCB 5FO8B 1F0ZA 4P16A 1PTOF 3U2SC 5E1FA 2ZT9C 3SFDB 3BG3A 1VMPA 1KABA 5BN3A 4I7ZC 2LUMA 2L11A 5IGEA 3HOVB 1HPCA 1CA6A 2WNMA 2F03A 1HUMA 3NVYA 3LB8C 2JA6B 5EGTA 3MXUA 1HEZE 1HA5A 2K01A 4DFAA 1A3UA 4HRSA 4HKQA 1ICWA 4IFDI 2F0NA 2L55A 3D31A 3FKIB 4KN7C 4BBSB 2KWDA 1A3VA 3DM1A 4PV1C 3PUXA 5FO9B 3Q0AA 1S5FD 3GTOB 1QWYA 1STBA 1PFDA 1RTOA 4I65A 2M19A 3A54A 2TMPA 4DN4M 3AB9A 3ZJVA 1C9FA 5JEAG 3HG9A 2VUMB 2B2WA 3MTSA 3H09A 1ILPA 2IJ0A 4IOIE 4BA2I 1CI3M 5T8IA 1M8AA 1K52A 3OSOA 2AWOA 2YYZA 2F0OA 5JOBA 3I91A 1B3AA 2IGGA 1TYGB 1UGJA 3J81E 2Q8IB 5JPMC 4X3KA 4LK0M 4GZYC 3PUWA 3P4RB 2A73B 4KD4A 3NTHA 5EBCA 3BVGA 1PLFA 2WKCA 1HFGA 2DNEA 1S5DD 3E56A 1SYDA 3Q8FA 4L1BA 1TY0A 1RODA 1PTOB 1Y8OB 2M0AA 2WDQB 2DYOA 1TY2A 2JEAI 2MH7A 1E0ZA 3J7AF 4R9WA 4F8MA 3NQTA 1IW7C 4QMGA 1I3QB 3NSWA 1IBXA 3ND8A 3OIPA 4JBWA 3P1MA 1LTBD 1GOZA 1BF4A 3P4PB 2LKVA 2B2UC 1ENFA 1TR5A 4RGMA 1DOIA 2ZW1A 2YU9B 1TWHB 2H89B 2B76B 3SHLA 1T5EA 4QIWB 1SNMA 3U9SA 4ZHPA 3NP8A 2GB1A 3J7AV 3S1QB 1EFID 2KN4A 1YNJD 3I72A 2B2UA 3M4OB 1LT6D 4A93B 5C4XB 4HMJA 2EXZA 2KQ4X 1SDFA 1YN3A 1KDCA 2L5TA 1X3PA 1KDBA 3S1MB 5M5YB 4KMUC 3H3VC 3KUPA 5EPLA 4XYQA 1CJEA 3AE2B 1LV9A 4Q5VA 1OXXK 2BOSA 4KJNA 4YT0B 5EJWA 3EUB2 2LS01 2OHFA 3BYTB 5BN4A 1KAAA 4IQZA 3VR5A 5AUIA 1AN8A 2PZTA 2FE8A 4A55A 1TWAB 2MHVA 1O80A 5ELEA 1ZPSA 2JQRB 1PYWD 2K5QA 1SE2A 5K36H 1EY4A 1Q12A 1PDQA 5KNCA 2VXWA 5ELBA 4OZCA 2EVBA 1EU4A 3O13A 2E2JB 2IWHA 4RGTA 1SJED 3GTJB 5LL6S 1FCCC 4M8AA 3H94A 1IBXB 5IIFA 2ID0A 4QUFA 1Q10A 2X6GA 2MEKA 1BMLC 1KDAA 1BCPC 1NYRA 3B9JA 1Y69U 5KEEA 2B39A 2B8GA 2K0PA 2F0LA 1DGJA 1VF5C 3C3LA 4H13C 2Y5CA 1BCPF 5G3LD 4FF3A 3P4QB 3U4EG 3GD7A 5FOBB 1GPXA 3HVDA 3C1EA 1C4QA 1XWEA 2B2VC 2EY1A 4ZAIA 1CZGA 3BK1A 5D14A 2W3RA 1PGXA 1K83B 4M0WA 2F0IA 2VB2X 1Y1WB 3K0YA 4BWGB 4HSPA 1FM0D 2Z8LA 3K59A 1WTRA 1YNJC 1LT5D 3UI3A 1HQMC 5EPJA 4FF4A 3MAQA 5A2QE 3OWEB 3TEYA 2M9VA 2CJNA 3X3MA 4IUUA 5D3IB 1SF0A 2L52A 4OGQC 1E2VA 4XTCS 4TMAB 3VR3A 4LMQD 4K5VA 3B2GA 1ZEQX 3W1SA 1YJIA 2B2YC 1JC7A 2EYLA 4KX6B 3S2HB 5CV9A 1EWCA 1MD2D 2TSSA 5I2YA 3J7YW 1GHJA 3ERQA 2BT6A 2F0PA 4HEDA 4K2KA 1SB3C 2EE1A 2XNAC 3AMUA 4G7HC 3C46A 5C0XG 1T6BX 1QNKA 2HUGA 3ZJTA 1VF7A 4HCEA 3AE9B 2B2YA 3CWIA 4RF1A 2BB5A 2A74C 2H4OA 3BDLA 1C77A 5IT9L 1AZQA 3S17B 1YNTE 5C2TB 4MACA 1JOOA 1AFPA 3J80E 4MN3A 1S5BD 1XF5L 1NYQA 4B0MA 1L4DB 2JP1A 3VA7A 1JORA 1BQQT 5EPKA 4R3DA 4EQPA 2WU2B 1BCPB 1HXYD 1HFNA 1XYIA 5K36G 1F9SA 1ZYRC 3WOEA 5IT9E 1V1PB 2K22A 2WXFA 2SNMA 1C78A 2L4NA 5G3LF 3AE4B 1FRRA 3AMZA 5G5HA 3PUZA 1WYGA 1SMYD 1SYEA 2DYMA 3G6JB 2J4XA 1JWAD 2MUYA 2PQEA 5JEAJ 3RPFC 1TJEA 3RMHA 3IFDA 3KBGA 4DNTB 5CV7A 2L0CA 4IUVA 4XT1B 2ON8A 1FGBD 3ND9A 2NBFA 4A3MB 5E3FA 2DWQA 3Q8AA 3C2PA 1WTPA 4CHTB 2AUJD 1F2RI 3BVZA 2JSOA 3SK5A 1CFMA 3WCQA 3NTIA 2WS3B 3K5LA 1SNQA 4CGYB 4RKLA 2WXKA 3BK2A 1PFNA 1STGA 2WP8J 3T51B 1G2TA 1Z47A 5KYLA 1E2WA 3DWPA 1QOBA 2EYFA 4IURA 1GAQB 2VB3X 3FILA 1L4ZB 4US9A 2QKIC 4LLGM 1S5CD 1EY0A 3IAYA 4QB4A 1TKYA 4TKOB 3NXWA 1LT4D 4UDUC 5EE9A 5T1GA 1ESFA 1PZKD 4A90A 3DWGC 1AWDA 2F0SA 4XIGS 2VNUD 3SEBA 3PO3B 1MBYA 2X38A 3GQBA 2JEBI 1GUGA 5BYRA 2JU6X 4TSSA 1RCVD 2J0TD 3BS1A 2QIEB 4RNAA 2WB1B 3FRPB 5LNK1 1ZKOA 3NK9A 1O7LA 4L8JA 1PTOH 3GV3A 4MH8A 1O7ZA 1YN5A 4MM3B 2WDRB 1JW9D 3ZJUA 4KY7A 1SMYC 2WXOA 2WQYB 3QG1A 2K5PA 2IGHA 1MPEA 2GRIA 1RTNA 3AEBB 2E2DC 2JXTA 1I50B 1P7EA 2DLBA 1ACCA 5C5MA 1VZ7A 1SYFA 1NAPA 3Q22A 1FNWA 5GXGB 4XT3B 1Z6HA 3DWMA 1CM9A 3A7AB 2BS3B 3NTKA 2BE5D 2BS2B 4XDXA 1CQVA 5CBEE 1TWFB 2WXQA 2R61A 1CHQD 5JEAH 3MEHA 4CJ0B