2RDHA

Crystal structure of staphylococcal superantigen-like protein 11
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
191
structure length
185
Chain Sequence
RSQATQDLSEYYNRPYFDLRNLSGYREGNTVTFINHYQQTDVKLEGKDKDKIKDGNNENLDVFVVREDNNSIGGITKTNRTQHIDTVQNVNLLVSKSTGQHTTSVTSTNYSIYKEEISLKELDFKLRKHLIDKHDLYKTEPKDSKIRVTMKNGDFYTFELNKKLQTHRMGDVIDGRNIEKIEVNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords Superantigen-like protein 11
publication title The crystal structure of staphylococcal superantigen-like protein 11 in complex with sialyl Lewis X reveals the mechanism for cell binding and immune inhibition
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 58
structure length 185
sequence length 191
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2007-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02876 Stap_Strp_tox_C Staphylococcal/Streptococcal toxin, beta-grasp domain
A PF09199 SSL_OB Staphylococcal superantigen-like OB-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.110 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2rdhA02
3.10.20.120 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2rdhA01
4RHSA 4RGMA 1XXGA 1PRTB 3GP7A 3URYA 1AW7A 1BCPB 3EA6A 2XNAC 1BCPD 2TSSA 1KLGD 3MFGA 2R61A 2SEBD 1I4RA 1LT3D 2NTSA 1FGBD 2ICIA 1CT1D 2QEJC 1S5ED 2G9HD 1HXYD 1HTLD 5I4DA 3MC0B 1RCVD 1PZKD 1FNVA 4RFBA 1I4GA 1TS5A 1TS2A 2IPKD 4RHRA 1CQVA 3V05A 1EWCA 3BVGA 3OWEB 1YN5A 1EEID 1SE2A 3SEBA 1PTOH 1STEA 1ENFA 1HA5A 1LTID 1D6EC 1CHQD 4K6LA 3R2TA 1PRTF 1V1PB 1BCPF 1D5ZC 1SBBB 3BVMA 1LO5D 2CHBD 3DWAA 1B1ZA 5D3IB 1LTSD 1PZJD 4RH6A 3BYYB 1TY2A 1PTOC 3O13A 1PRTD 1I4QA 2RDGA 5ELEA 1JWMD 1V1OA 1M4VA 1EU4A 1DJRD 1JQYD 1PYWD 1UUPA 5TSSA 5D3DA 2RDHA 1SEBD 3R2IA 1KTKA 1CK1A 3DWQA 1LTAD 5ELCA 1HQRD 1I4HA 1FD7D 1GOZA 4L63B 1S5CD 1EEFD 1TS3A 4OHJA 1JWSD 2AQ3B 1LTTD 1LTGD 1LT5D 3TSSA 1LLRD 1QILA 2Z8LA 1D5MC 1UNSA 1PTOB 1DYQA 4TSSA 2AQ2B 1LTRD 4RGOS 1RDPD 2IJ0A 4DXFA 1SJHD 3CHBD 1LTBD 1CHPD 4NZLB 4RGNA 1S5DD 1G8ZD 3R8BA 5ELFA 1RD9D 5ELBA 1XTCD 4UDUC 2J4XA 1KLUD 1YN4A 1SJED 1L0XB 3BYTB 1T5XD 3EFXD 4L6TB 1PZID 2XRQD 4Z9CB 5ELDA 3DWPA 3W2DA 1EFID 1JR0D 1PTOF 2QILA 1TS4A 2AQ1B 4ZYSA 1LT6D 1PRTC 1ET6A 1I4PA 1TY0A 1BCPC 1JCKB 4RCOA 2NTTA 5FK9C 1ET9A 1LT4D 1FNUA 1BXTA 1FNWA 1PTOD 4BWGB 1B44D 1RF2D 1S5FD 1JWUD 2XRSD 1YN3A 1D5XC 2XN9C 1SXTA 1ESFA 3KLSX 1SE3A 5FKAC 4DXGA 1EU3A 1S5BD 3BVZA 1AN8A 2WV6D 1L0YB 2O2LD 4O1NA 1SE4A 1F77A 1V1PA 4RGTA 1MD2D 4C56C 3BZDB 1I4XA
chains in the Genus database with same CATH superfamily
1YIWA 2M0XA 5IWAQ 2G45B 3QOJA 3S2AA 2QDBA 3Q3NC 1BCPD 1K8AC 1KLGD 4NJ7A 5AZGA 5IGCA 4HJ7A 4JWSC 1HTLD 1HEZE 1NCVA 4BY1H 3RZDB 3NZ3A 3AE7B 3CF6E 3LB8C 3PVLA 1IHZA 3A56A 4A3IG 3VR3A 3A4SC 3Q3MC 3BVGA 2UXBL 1OXTA 1PFBA 4XTCS 4FLHA 3U2SC 4JI4L 2PLPA 2E3TA 4QQBX 1RYJA 1NJIC 2A69C 5EE1A 5C4JH 2QCZA 2MJDA 3L0WB 4IJHA 3J81E 4MH0E 1XCTL 3D3RA 3TS0A 4E3CA 3G4SA 2YU9H 1CUKA 2DGYA 4J8QA 3VR6A 1XLOA 2O4XA 3AEAB 1EOTA 4JI1L 3VVWB 1YNND 3CU7A 1Y8OB 5HGTA 1H95A 1MI0A 4NPNA 1CTMA 2ENBA 1DOYA 3BYYB 2I0QA 3P4SB 2F4VL 1G91A 2WXRA 2Q8TA 3WAOA 4D2KA 1I4QA 3GE3C 5DPSA 4MH8A 1IYJB 5M5YB 4IUUA 2R93G 3ZRFA 3GQBA 1T6BX 1WXSA 1UWMA 3MC8A 1M94A 2M4NA 1KNEA 3MZ5A 4N9F4 4TVAB 2GA4B 2KVRA 2P5ZX 5K36G 3U4ZA 1HH2P 1NBWA 2VY3A 3T1YL 1LTAD 3NHHA 1YJNA 1WTQA 3RNGC 3L3OC 4AQ7A 3RUZA 5FLMG 2ZEQA 5AJ3Q 1T5EA 4I6LB 1RODA 1HNWQ 3AFPA 4IM0A 3SK8A 1E22A 5KYIA 3NJTA 1GG3A 1N36L 1A2TA 2Z4IA 5JOBA 2K1BA 3HVZA 1E1TA 1LTGD 4EE2A 2PJHA 4ID6A 4XWTA 1F2MA 1GKHA 4IPGA 4DAVA 2BW2A 3AEGB 1WJUA 3EFCA 2EKIA 5BMGA 2I5MX 5JEAH 1F2RI 3TMPB 1E3PA 2DLBA 2VNUD 2XEWA 4DHJD 4A3KH 3HHMA 2OT2A 3GOEA 5AUKA 2N1WA 4LLGM 3UE0A 1L7YA 5E6PA 1LV9A 4C3HG 2AWTA 2JU6X 1HZ6A 1E8XA 1ILPA 1YITA 3WANA 1GUGA 3A74A 4FF2A 1Y8NB 2A6EC 1R4NB 4LF8L 4MM3A 2L12A 3T1HQ 3GS2A 4GMVA 3HFZB 3T3NA 3QQ8B 2KUMA 1XMOL 3J81c 1TY0A 3I2ZA 2IT1A 4PG3A 4RM9A 4YHHQ 1NI3A 3N30A 1FNUA 1PGXA 4A90A 2H5XA 1J7AA 3QR8A 5DPRA 3TN2A 5CV9A 4PYUA 3IL8A 4IM3A 1Q1EA 4O2DA 3WIMA 3S15B 4IWQA 1UEAB 2K5NA 2XN9C 1PFSA 1JE5A 2J7QB 4HVBA 1JWBD 2FUHB 4DA2A 3HKZE 1L0YB 4ZK9B 3H3VH 3RNCC 2OQ0A 1G6ZA 1XF5L 2F0JA 2KMCA 3HP3A 2OOBB 2NVYB 3W1BA 1TKEA 3CSTA 2DNCA 1CQFA 2Q8IB 1WTOA 1I4XA 2CHXA 1F9JA 1O78A 3DBLB 2KZRA 1WCMG 4A3DB 2IO3B 1TVXA 1QF6A 2KVZA 4OO1H 1DOIA 2PW7A 4XDCA 1R7SA 3GV3A 1Q10A 1HZ5A 4FNFA 2FCQA 4RWSC 2SNMA 1BBWA 3ALBA 3OG5A 4XE0A 2F3IA 2B3AA 4EEWA 2BWFA 5CGKA 3SGIA 4RHRA 3P75A 4XX5A 3BIID 1LGRA 4QL5A 1TBEA 1WJNA 5CBAE 3DBHI 1X55A 3HRZC 2IYDB 2NBUA 5C3EH 4JV5L 1HCZA 2KX0A 5E7NA 3AE4B 2ZTDA 1XT9B 4EZLA 2Z1CA 4IWOA 1FJGQ 3GTJB 2LKVA 3H0GB 5JJKA 2BBCA 5M3MH 3ND9A 1V43A 3R2TA 1Q90A 4G7HC 4JE3B 2F0GA 1VQIA 1A62A 1RM6C 4JC0A 2A5HA 4C3IH 1LM0A 1SYGA 3RR5A 3M85A 4LF7Q 4NXMQ 3BDLA 1EY9A 5CHWA 2QHOA 5M5XH 1M4VA 3S2HH 4XDDA 3PGEA 4A3OA 5L37A 2FIDA 3F8TA 1VF7A 1XPOA 2NVTH 1VQEA 1WR6E 1UWXA 3NVWA 5LXHA 1P1AA 4RA8A 1Q82C 1PH8A 1J5EL 1SYDA 2K01A 1I4HA 5GXGB 2F0VA 1FD7D 2AX5A 4W9GA 1QE6A 1ESRA 4WIPA 2FAZA 1HZAA 3P4QB 2YEPB 3HOUG 3HOWB 3EFUA 2HD5B 3DVGY 4P1CC 2OCEA 4LW1A 4JI7Q 1XPUA 3AECB 3B9JA 5JEAJ 1LACA 2F0TA 1IKLA 4DV4L 5J1ZA 3GTKB 1OTRB 1BOSA 3H9DA 2WFWA 2BB6A 1DYQA 2ID0A 2C7HA 5D6JB 2KMAA 4B3TQ 3EUB2 2Y5CA 5D7GA 2V3SA 3Q8AA 5M3FB 4DR7L 5DNFA 4C1NK 4DUYL 1PH9A 5A2QL 4F8CB 1WX9A 5H1SE 3AMUA 2GBKA 4RMAA 1WJJA 4PMWA 1KQSA 4BVUC 2K7VA 4IOIE 1WXVA 3BDOA 4WFN3 1DGSA 3R8BA 4FP5D 2HIVA 2WXOA 3JC66 1FD6A 1YNJC 2R7DA 1IL2A 4A3JG 1XD3B 1YN4A 2O5JC 1F2ZA 4JGHB 2OWOA 1G291 2G9DA 3I4OA 3Q8FA 1ZXIA 3PO3G 5HGQA 2QDFA 3HOYH 4K7UA 3RZDH 3RUIB 2JYTA 1LT6D 3RD4A 1I4PA 4F87A 3L4PA 4KV2A 1ET9A 1LT4D 4GN4B 3TP8A 1XLPA 1PQSA 4C7ZA 3PF4A 2WU5B 2L8JA 1RF2D 1S5FD 2PNHA 3KYDD 4WJPA 3RULA 1J8CA 2O6VA 4KDLB 5C5MA 2BYEA 5LMUQ 1EU3A 2J52A 3PHXB 1OGWA 2K52A 2K1FA 4EFOA 3V6EB 4OZAA 4OWWB 3JYUA 3SFEB 3ICEA 3V3XA 4UP8A 2V4LA 4JYAL 5LMNQ 3I3TB 4F7ZA 4FXKC 2OF1A 1WTWA 2RBMA 4BOZB 3DUZA 1I42A 1BBXC 1IKMA 3PF5A 5HURA 2PW5A 2PE9A 4GLSC 4GN1A 4GLVB 1M1KC 2B63H 2IGGA 1AW7A 1ZYRD 2WNMA 2INDC 3NK9A 3IBEA 1IBMQ 3VYSA 2R2QA 1I4RA 2NTSA 4BBSG 2ICIA 1CT1D 5I4DA 1W3SA 4B3RQ 4NDXA 2NZ1D 4M01A 1R4PB 2B2YA 1I4GA 4LNOA 4F88A 4X62Q 1MSHA 5HY6A 2JA7B 1VZ6A 2KOXA 5D2MB 3JSVA 3RT3B 3ZNGC 2BF8B 2MNAA 4H44C 1EWCA 4GKKL 1GC6A 3HOVG 2DBYA 1SYBA 1EYAA 2B29A 5C4HA 1ENFA 2KVMA 3E0JA 3AE8B 1CHQD 2G4SA 1A3VA 1PYSB 4IW0A 1MHXA 1T0RC 3VR4A 2BKFA 4I7ZC 3ETRA 3M3JA 1I5FA 3T56B 4WWNA 1F2YA 3DWAA 4LCDE 3ZGZA 5I9OA 4GSWA 5LMNW 3BK2A 1N63A 1A3UA 1VF5C 2D3AA 1II3A 2WAQB 3BG3A 1Z7TA 2FMCA 5EAYA 3B0AA 1HE8A 2KTFA 1STNA 3HOZG 2D2CC 2RDHA 1N34L 3N20C 3NUCA 1UE5A 3C2PA 4FXCA 4XQNA 2N8NA 4Q5VA 1LM8B 4JIOU 2DX5B 4KMUC 3RLOA 2DHZA 2CU1A 4WH4A 4K0KL 1SSOA 2EJGC 3Q2AC 3D4DA 3H15A 4LF6Q 3Q69A 3L16A 3VA7A 4KHVA 4GN3B 4PV1C 4DV3Q 4NY0A 1UNSA 3ULLA 1X3PA 3H6NA 1WXQA 1I7HA 3KJOA 1QCBD 2DZKA 2KN5A 4XWWA 2PZWA 3A9JA 5DCNA 1U4AA 1VQ8A 2NVYH 3K57A 2KT7A 2KK8A 3B6YA 3CP0A 4YL8A 3KVFB 4JX1C 3HEJA 1UE6A 1ICWA 1O80A 2IJ0A 4P6VF 1VMPA 1CHPD 5E1FA 2UUCL 4RMFA 1NMFA 2KQ3A 2F0DA 1TKWB 5C4XG 1KFYB 3I4NH 3EGRA 2C5CA 1RD9D 3H3VI 2J4XA 4DV0Q 2M19A 3U8ZA 2CKZB 4M8MA 3QX1A 1O7ZA 1S1QB 2PVOD 4BY7B 1PZID 2B2UA 5EE0A 5IODA 5HHDG 3NHEB 1VCBA 5IP7G 1QT9A 1CSPA 1TS4A 3NXWA 5F2DA 2WQYB 3AE6B 1SMYC 3JAMi 4BKSD 1EYDA 2UUBQ 1C4CA 2YLMA 2FCNA 1R4QB 2FJ2A 1CSQA 1C4QA 2B8GA 3K58A 1XEEA 3K5OA 1V80A 1SGHA 3GTJH 3H0GH 2ZW1A 5J22A 3QJZA 2WXJA 2MQHA 2CW0C 5J39A 1KHIA 1ZDXA 1L5PA 1S5BD 4HSVA 5KYLA 2I46A 2SDFA 3A5UA 4QF4A 2GB1A 1VMCA 4A3FG 5IWAL 2F3VA 1TIFA 3ZKJC 4HJ5A 1N60A 1X3GA 1UEBA 2IX3A 2H89B 2VZKD 2A6ED 1YX6B 4HCNB 2VZAA 1FCLA 3GTQB 4MSQB 1V2YA 4LDTD 1PRTB 3C1EA 2M0AA 1BCPB 4QMGA 3W1GA 1LXDA 2D9UA 2UWQA 2R61A 2QEJC 1N6ZA 1TJEA 3M4QA 3J80E 2M8SA 1TS2A 3T53B 2ZCBA 4EZJA 1V5OA 4II2B 2JQOA 3C8YA 2PTLA 4LK0M 5FR3A 1GB1A 3QOLA 3OWEB 2RHQB 4YCVA 1YOVB 1QOGA 3GTKH 5JPNC 2DAFA 3L17A 2HTME 2ZXOA 1DOLA 1E2ZA 2WYQA 2Y5PA 4KJOA 3DLLA 3PS6A 3TZUA 4C3JH 5M3FH 3KLWA 4DV6Q 4PS8A 1Y14B 3TJPA 3AB9A 1Q3LA 5EDSA 1LO5D 3P4RB 1AEXA 3M7GA 2KNBA 1FL0A 5C1ZA 2KEEA 4RH6A 2WKDA 4R9WA 5FO7B 2G1EA 1YMHE 1PTOC 4K5WA 2GRIA 2LVPA 4R4CA 4P71A 4L5TA 3VYRA 2MH7A 5LL6X 3TUOA 1GUNA 2K32A 4MN3A 4DDGD 5AJ3L 1HNWL 1KIXA 3CCMA 3S17B 2BS3B 3A0JA 4JI0L 1IP9A 2IW3A 5IYDG 3ZVVA 1KTKA 4WAFA 3N3KB 5C3JB 1P9DU 2WWZA 1HQRD 4XDXA 3ZYYX 1GUWA 5CHVC 5IKCM 2NS5A 3B08A 2AQ3B 4B3MQ 3SHLA 4YTNB 3PZ8A 3RLFA 4OGQC 2FINB 5DAUA 1UGJA 4KGSA 4ZRPA 1YJ9A 4ZYNA 3UI3A 4XIGS 4HMIA 4AYBG 4JWUC 1XLNA 5I6YA 4IOCA 1QUQB 1W2BA 2O2VB 4FF4A 2LHDA 4GNXB 1SROA 4ALPA 5IO9A 2L4NA 2KHIA 4RM8A 4DHJB 5H8YE 2L15A 4PS7A 2OHFA 5E6OA 3KWLA 1IW7D 4ZQ3A 5ELNA 4PYZA 1Q81C 1JROA 2WINB 3F1ZA 2CQAA 4FXDA 2BA0A 1H9SB 1ZXHA 3T1HL 2YEPF 2K9XA 3QARA 4AOFA 4IKGA 2R92B 4P74A 2K3UA 2YV5A 3K0XA 2L00B 3DCGA 3P1HA 4Y52H 1XYIA 2EY6A 4GU2A 2IHEA 3EFXD 3VUWA 3GV6A 4YHHL 3S16H 2BGFA 1S4ZA 2F0EA 2WB1B 4G7ZC 5IYBG 3ZXRA 1N5XA 4FA6A 3DWPA 1JICA 4H02A 5CBEE 1UAPA 3PIOA 2PI2A 5BN4A 2EJFC 1PV4A 2NN6I 2IZVB 3NBIA 5EPKA 1M90C 1HUMA 4A3LG 1MHHE 1SB3C 4NQKE 3SDLC 2NB0A 5BYRA 3CF5A 2QCPX 4L5QA 1VQBA 4HCPB 1FNWA 3OPOA 4DQOC 1YJWA 2AHOB 1D5XC 1H9MA 2E74C 4OZCA 1ESFA 3KLSX 4EGVA 4A3GG 2YTYA 1HQMC 2NWGA 4WQMA 1E5WA 2LFNA 2F0OA 2IY1B 2OJWA 2N4FA 3RD2A 2V9HA 1WE6A 3KUCB 1V9PA 1YNJD 5J18A 2RSNA 2DYBA 3L2PA 1YEZA 3ZUNA 5COYA 1HZ9A 1TR5A 4DFAA 4HSPA 2QW7A 1L6VA 2EJMA 5J3BA 3PLUA 3QA8A 1HFNA 2Y0SB 1C78A 3F2CA 4OZBA 1IBLQ 4GOPC 3IRBA 2JT4B 1I6VC 1X65A 1WMHB 2E2HH 1DONA 3D4WA 4I65A 3M3YB 1WZ3A 1BF4A 2L05A 1R4NI 3JAML 2N9LA 2WXLA 3UE1A 5LNK1 2F0SA 1NSNS 2XIWA 1EEID 3ZJVA 2V1CC 2VQFQ 1EY4A 5JPMC 4DV1Q 4S17A 1BO0A 2B2WA 2EPBA 5E4WC 3RN5A 4LF7L 5CV5A 4NXML 1F0ZA 1YIJA 4DR5L 3BVMA 3HVDA 2ZNVC 2PQAB 3DBSA 1EZ6A 1K28A 2B76B 4A3EG 2O2VA 1QUQA 1B9MA 4LUZA 1WM3A 2WDTB 3O13A 3FPUB 2LJ5A 3LNNA 1X1MA 4GDKB 4DV5Q 2R93H 4ZCKA 3SR1A 2JA8G 3CKIB 2MP2A 4HCSA 4BY7H 1R9TH 2WGSA 2EOTA 2BA1A 4A93H 2Q2UA 5K36H 2D3GA 4DWFA 1H9SA 5MPOA 4JBJA 2UUAQ 1KRSA 3PV1A 4JI7L 1UF0A 3DBLI 2L9HA 3CCSA 5FLMH 4HPLB 1XPRA 1ISNA 1A3TA 5BN5A 1ZDVA 2J0KA 1SE9A 4X65Q 4M1UB 1B9RA 4B3TL 3CPFA 2J7ZA 3VH3B 1LTTD 1E7UA 2V3NA 1NAPA 3CC7A 1LLRD 2K5WA 2EE1A 2MHJA 2PMZB 3DBRB 4KZCA 2LY7A 3DMUA 5JHBA 3M4OH 1FRDA 1E7VA 3V61A 1STGA 1A6XA 4CJ2C 1DXMA 2K6QA 1C77A 3TP7A 3NTIA 2K25A 2D10A 3VUXA 4DR6Q 2HIXA 4KY5A 4NZLB 5AEKB 2I2YA 2PVGC 4C3HH 4R8NA 1CI3M 1NTGA 3AU5A 4ZRJA 1JB7A 3ML8A 3KWVA 1VQDA 2KWUB 3DVNU 4UHVA 3A54A 4UAIA 1KLUD 4DK1A 3K81C 1CM9A 2LZ6A 2JA9A 1ZKHA 5C44G 4Z9CB 2JF5A 3P1MA 1EFID 1GXDC 4OEMB 2D2QA 1XCQL 2RCFA 5C3EB 1JCKB 1SIFA 5LMUL 1MBYA 1SNDA 1L0VB 5KEEA 1CMXB 2L1AA 5I6WA 3AQQA 4BWGB 5M3MB 4X64Q 1B44D 1YN3A 1UBIA 1L1OB 3S1RH 5LMNL 1CA6A 4H2AA 5CHFA 3RMHA 2BS4B 3ITPA 2KFJA 1QOFA 2E76C 2WV6D 3SDZA 2JVCA 1U4PA 2PKOA 5M9OA 3WOEA 1T0YA 4O1NA 5M5XB 3B2GA 2ZM6Q 3ZJTA 3S2HB 2KCNA 1GHJA 3UGBB 3I3CA 2PQAA 4XT1B 1IBML 2A68C 2Z4HA 3H91A 2E5LQ 4A3BG 1QKZA 1WY8A 4B3RL 3S17H 3DPDA 1SN8A 3BS1A 1N61A 4NW2A 1TKGA 2G4DB 4X62L 1SMYD 2AMCB 2N49A 3EA6A 2KJRA 2XNAC 1N8RC 3DOWA 3K8AA 4HJ8A 4HJ9A 1YVCA 3L9AX 4CBVA 4DK0A 3J7AV 1LTLA 1FGBD 4IQZA 2WACA 3MC0B 4IALA 3C19A 3ECIA 1K9MC 4JI5Q 4B6WA 1VQ7A 1QZEA 3AI5A 5D94A 1JB3A 2CW0D 4JK1C 3I72A 1N9WA 2TMPA 4WJWA 1X3EA 4G57A 4DV2Q 1IBXA 4DN4M 3HGBA 2KBNA 1S40A 4FHJA 1FM0D 3UQAA 3B1LX 1KL9A 1PFDA 3AN1A 1PRTF 2LWPA 3HKZG 3ZJYC 3S1MB 1J19A 1BCPF 1D5ZC 1BKBA 1TT5B 5ISRA 2MUYA 4IPHA 3P2BA 4BKGA 4N8FA 3MEHA 4PZ6A 2MJ3A 4WORA 4PMCA 3DHQA 4JOIA 3HM3A 5E6NA 4HXDA 4BFRA 1PRTD 2OXPA 2RF4A 2R92H 1MI2A 4K2LA 2VUMB 2K8CA 2UU9Q 2UYZB 5CYUA 4WJ3M 4FF3A 1Y56A 3S1QH 2QKIC 4LWCA 1PA6A 1D7QA 2N0SB 4W9HA 3HOYB 4XC2A 5D3DA 1AWDA 3S14B 4LF6L 2DJFC 2IX0A 2R3ZA 3R2IA 3KF6A 5C0XH 3X3NA 4WQOB 4DV3L 3WCQA 2F0FA 2ACZB 4GLXA 2NVQH 3HOUH 1K52A 1Y1VG 1Y1WB 2I1KA 3GTMB 4B0EA 3I7FA 1YNXA 1MIUA 5FJ8H 3V96A 2PCFB 2HJ1A 1NDDA 4ZRZA 4JW0A 2A74C 5DEHA 1T0SC 1WYGA 3DXJC 2G5DA 4BBRH 3FKIB 3RYTA 4DV0L 2DYOA 4JVZA 2JA5H 1OFFA 3KJPA 2JWUA 4QGUA 1SJHD 2B63B 4CGYB 3CIRB 1XQQA 1UH6A 1NY4A 1E0ZA 2KEDA 1V81A 2HJ8A 4A3JH 3CSFA 1XTCD 3IAS1 2RCNA 3CRLC 2UUBL 3KDFB 5IA7A 1MJEA 1L0XB 1Y8PB 3BYTB 3D6CA 3PO3H 2CHWA 3Q14C 3S1NH 3QJYA 5ELDA 3X23A 3M3YH 3OJ3A 2ZJQA 1WFQA 1VQLA 3N32A 1YQ3B 2AUJD 3TCAA 2JPHA 2YVCA 1QZGA 1YJ1A 2VQEQ 4NXNQ 2L32A 3ZNZB 1EWYC 3K5MA 3PO2H 5T1IA 4DHZB 3CPWA 4LF5Q 4XYOA 2ASBA 5EPLA 3VAWA 3HKSA 1KF6B 1OEYJ 2RMMA 2JRIB 1VQ4A 1BUIC 2Q8RE 4J15A 4KD4A 1ONLA 1STAA 4OX9Q 2NZOA 3R7QA 1MJCA 2KWCA 2B2VA 1KD1C 2VZKB 5TR5A 3RI7C 5FLXL 4C56C 3NELA 3BZDB 1WIAA 4K7WA 4LDTB 3MAQA 4L8JA 3Q23A 3RZOH 1T0QC 2KTRB 3ULPA 1B70B 1TWFB 1XXGA 3HOXB 2WIIB 3LGJA 2KDMA 1VD2A 1YNTE 1KRTA 1JRPA 2JSOA 1TZ1A 3GZNB 1QG7A 3MFGA 2KLCA 4DNTB 1PH3A 2XWJB 1LT3D 1Y69U 3J9CA 3I57A 2K33A 4HCEA 1PH5A 1VQKA 3IAYA 4IFDJ 3M63B 1RCVD 3ZW3A 3N6RA 2ALYB 5CX3A 2WXNA 1Q1BA 3VUYA 1IPGA 3IFDA 4DV6L 3HOVH 2JY6A 3RCZA 2PW9A 4IDIA 2CHZA 1L6UA 2JA6H 1GJXA 1BMLC 2A19A 3IHPC 1PVOA 3S9WA 1HA5A 3V2TA 2CQOA 3GTOH 1AFPA 1C4AA 1EO6A 2PO4A 3H7PB 3LDZE 4GIVA 3SR6A 4E71A 4JG2A 4JI3Q 1CZPA 3VYUA 2G3QB 2BH2A 1STYA 5EKLA 1YHAA 3I91A 4LF4L 4CDFC 3Q3JA 3WA0A 3I4NB 4WWMA 1JW9D 3PREA 4K3BA 3ML9A 4U68A 4ZOHC 2X69A 3I56A 2F4IA 2HHHQ 4MDKE 2N9XA 1PLFA 3IG3A 1Q86C 1I94Q 1AP0A 1QOAA 3ENEA 1I3QH 2N88A 1P8LA 5C0XJ 2MO0A 4B3ML 2K04A 4AJYB 2WAQE 3NZSA 4HLEA 4ME3A 4LFBL 2LSSA 3RNBC 4B08A 1VZ7A 3PSEB 2EMSA 2GN5A 2QEXA 4BKSA 4HAEA 2JZZA 1S72A 2F0LA 4A3CG 2C60A 3NVZA 1KABA 2KDFB 2GVBA 3I4MG 3IFTA 2CKHB 4WWOA 3EROA 2E6XA 3K9PB 3MXPA 2JYEA 4IPCA 3OLMD 2EDGA 3R3OA 1VJKA 1CKMA 1RL2A 5EQ0A 3PIO3 1RDPD 1H9KA 5K5PA 2LXKA 5BO4B 1J9OA 4LFAQ 4M0WB 3ZTCA 2Q2HA 5E6JA 1K3BC 5DM73 3AEDB 2IGDA 2CS4A 2CH4A 3OSOA 2KMMA 4CHTB 1C7YA 1T5XD 2LGXA 3LXFA 5BR8L 2Z6KA 1QLBB 2KA7A 2KTRA 3PO0A 2PMVA 3A8JE 3PZDA 4YIJA 2F0WA 1DOXA 5H92C 4A4IA 5EBDA 1N62A 4MIUA 3HG9A 4A3MB 5FK9C 2GBNA 3PUXA 4PZ7A 1XTDA 1OQQA 5EPJA 3TMEA 3Q3FA 4C3JB 3UDGA 4FADA 4BY1G 1G6PA 4YXDB 1GJZA 2B2YC 3S1MH 4CDCC 3P7JA 1RHPA 4LMQD 1EZ8A 3VTWA 1PH4A 4ANWA 4IFDI 3NZUA 1OXXK 4A3FH 3N1XC 3B2FA 3OHXC 4FXGC 3D4RA 2IY5B 3FILB 2XGTA 3KQ4A 2V4DA 3T4AC 1Q7YC 3MEFA 2M2LA 5C3WA 3R3MA 4KSLC 2VUMH 2V4IB 3ONAB 1SE4A 1WWTA 1IBLL 2NMQA 3BY4B 1VQCA 1MG8A 4BKTA 4LJOB 5KNBA 5CV4A 1IBKQ 2DY7A 1O7IA 1X3QA 4X3SA 5IGGA 3S14H 2L5TA 3KOJA 1NUCA 3I63C 1HUNA 1R4MB 2KD0A 2LVOA 3K7UC 1Q46A 2FNJB 5I2XA 4OVUA 2VL6A 4IJLA 3BINA 3T3OA 4WJNA 2PI2E 2FXQA 2VQFL 4X57B 4JBMA 1KH0A 1PZKD 1Y1WH 4FHKA 4DNRB 1A70A 4ZDVA 3GTMH 3SK5A 3TEHB 2BS2B 1EQRA 1IUEA 5I9PA 5DPTA 1NEKB 4YSZB 3TBIB 3D32A 4A8XC 5C0XI 3PUVA 4RNAA 1WJ6A 5LL6S 2M17A 1LTID 1U4LA 1A0IA 1GO3E 2KDIA 3KLSA 4LFCL 3EVQA 3FKIH 4DV5L 1JMLA 4CKBA 2DN8A 2JP1A 2D3CA 4GXBA 4B9WA 3CC2A 2C7MB 2L7RA 3NUHB 4XYCA 1NBFC 3K6OA 1EIFA 3KFUA 5AZFA 4AJWA 3NRZA 5JEAG 2W55A 1XNRL 5IP9G 2WS3B 2UUAL 5DLQE 4MGKE 1LYLA 1K0RA 1V1OA 3I5JC 3ZQ4A 3S16B 4A3KG 2GI9A 2C7NB 4X65L 3K59A 3CD6A 1K50A 1TKYA 3MWYW 3P4PB 1QQRA 4NJ6A 3QB3A 2L11A 2FMMA 1KDBA 1TWAH 4JI8Q 2BCOA 3DWQA 3OW2A 4YY3Q 4S0RA 2HDEA 3N9YC 3RN2A 3NEMA 4CJ0B 4A20A 1WGKA 3E9HA 3GDEA 5IGBA 4DR4Q 5CV7A 3P20A 3D8GA 4KI0A 1PH2A 4BAXA 2B2UC 1Q8KA 2VS1A 4XQQA 5KIXA 1N33L 2IDYA 2MW5A 3TSSA 1X3FA 4AQYQ 5BYSA 1TIID 3SK6A 1ZP0B 2M1MA 3DEPA 4HMJA 4HN7A 5C6AA 4DR6L 1WSPA 1X54A 1HR0Q 2JWZA 4DAYB 3KUZA 1J7CA 3PHWB 4HJGE 3RNUA 2AQ2B 1LTRD 2Q2TA 2WXHA 4W9DA 1BVSA 4A75A 4IZ8A 1J6QA 4LUVA 2IWHA 2KLGA 4DDID 2BWES 5G55A 2BH8A 2R7FA 1IZ6A 1TWFH 3HOXH 1MPEA 5IIFA 2PEAA 3FILA 2NBVB 1EY0A 4O0AA 1TZOA 3W5OA 3IAM1 4NP5A 1VLBA 2WDVB 2RPQA 4FJZA 1K8GA 2A69D 4L6TB 4K2KA 2E2HB 2GBRA 2KDBA 3DVGX 3RZFA 4DBGA 2HTHA 1EOVA 4X64L 1BDOA 1PMRA 3PIP3 1XMQQ 4A3LH 1MFWA 1ILQA 3I9V1 4OO1G 2WB1E 4PZ8A 1FEHA 4BZAA 2KOLA 1TT2A 4B0MA 2PZUA 3AFQA 1QOBA 2V0GA 1MSGA 4LK1C 2PPBC 4ZAIA 2XRSD 1FXIA 2IHFA 4EX5A 3E0EA 2ZM6L 1SE3A 4A3GH 3ZNID 3V60A 1V6EA 4BXXG 4KN7C 4HWIB 5D65A 2ONQA 2DAJA 3H8HA 3DBRI 2E5LL 2O2LD 1F2RC 2A73B 4TMAB 3TRZA 2R93B 3MHSD 3J7AF 3TP5A 2LASA 3DM1A 3VHTC 1WX7A 1R9TB 4ANVA 3DWGC 4A93B 2BDNA 1C9FA 2KQ7A 4DAMA 4C3IG 1E7PB 1WFYA 3ERQA 2ZJDA 3U4VA 2IO2B 3I55A 1TWHB 2EMTA 4OO1I 3Q24A 4LNKA 4DV2L 2ZPNA 4ACFA 2R6GA 2EYLA 2Y0SE 3A7LA 2IBIB 3QG1A 2F4VQ 3RNAC 1EY8A 2R7ZG 1SE2A 1HA6A 3M4OB 2GBJA 4QCLA 5E3FA 2CWAA 1A63A 1GVPA 2ZT9C 1DCZA 2YYZA 3UIOB 1QOHA 1Z9FA 3MFYA 4K6LA 4JI2Q 3IT6B 3QCAA 2F0QA 2J53A 2L0TA 5IOIA 4N8X1 4N9TA 2UU9L 4A3EH 3TIXA 4H0LC 5HI1A 1G51A 3NE5B 4KLKA 1B9NA 3NWTA 5D3IB 5J2RA 1WOCA 3JAMc 3Q22A 4HKQA 1M8AA 4C3HB 3A8IE 4DAYA 4KHZA 1FYCA 1RTNA 3TDQA 3DWMA 2ON8A 4LNNA 1ACCA 3VR2A 3I73A 2JA8H 4HJKA 4REZA 1UZXB 2ZZPB 5M5WH 4HIMA 4BBNC 4P73A 1ZPSA 2CCZA 2NUCA 3U7ZA 1AH9A 4KY7A 3AEEB 3SXHA 3NSWA 4A3MH 2MBBB 4FULA 4H13C 1PGAA 3T8MA 3I4LA 4IM2A 2RQXA 3S1RB 1YI2A 3QAQA 1VQ6A 3E9SA 4HIKA 3L54A 3DHGC 3GB1A 1PTOB 4K8JA 2F0PA 2J0TD 1C0AA 1YD8U 5KRUA 4Y7NH 3RZWC 2RSOA 2PYKA 2PMZE 3M95A 3U4EG 3KUDB 1T3QA 2YTVA 2JZPA 2N55A 3A9KB 4EZKA 1WCMB 3CHBD 2Z0SA 2E2IB 4DV7Q 5IP4D 2HQLA 5ELBA 3BK1A 5GAGC 4R4IA 1YJJA 4UP7A 3BU2A 3AU7A 4NAWB 2VRRB 3F2DA 3FAHA 4I7AA 3GO5A 3M9BA 4E6IA 2VQEL 4NXNL 1YNNC 2K4KA 3K0YA 2F0KA 3CMEA 2PQEA 2NN6G 3U52E 1IYUA 2B63G 4LF5L 1IYFA 3ULJA 2WXIA 1F9PA 5IYCG 3GTLH 2W3RA 2WLBA 1C4PA 2ES2A 1YQ4B 1AE3A 2X8XX 2RDBC 1CFMA 1QB5D 2EYHA 4OX9L 4BA2I 3MXGA 4UPAA 2Y3AA 1JWUD 2EY5A 4RG1A 2DZIA 2FE8A 5JJIA 3MXNB 3LJ3A 1EIHA 5KGUA 4DKAC 5JJLA 4KD3A 1XLQA 1UE1A 3J80i 1VRAB 3A8KE 3EN2A 1V49A 1JOOA 1I6HB 4LNIA 2DYMA 4F7XA 5EE3A 2C9OA 2BPSA 3S1QB 1Z2MA 4JV5Q 3DM3A 4A3BH 4LJPB 1JC7A 2INNE 2KECA 2NCNA 2BOSA 3U50C 2XWBB 1IYVA 2CVRA 3HOUB 2NVQB 5JJZA 2L0FA 3APFA 4IUMB 2K5DA 4ZLTF 3QC8B 1OTCA 4L5RC 3ZTDA 2HDMA 2LVQA 2R2OA 2GOWA 3A4RA 4G0NB 4M8AA 3KF8B 1YHQA 3V05A 1Z5SB 3MXUA 5AFWA 4JI3L 2A4ZA 1CA5A 3IVFA 3JVZX 1WH3A 2C35B 2VXWA 2B2TA 4K7SA 3ERSX 4IURA 4EOYA 1E1OA 4KGTA 4IOAA 4BBRB 1L4DB 2JX5A 1J5EQ 5HG2A 5JHAA 2JA5B 1WE7A 3D31A 2HHHL 1C9OA 4RCNA 1I94L 4KHPQ 1RFAA 3M4YA 1OEYA 1UD7A 3D0FA 1XJVA 2AWOA 4L1BA 2QGQA 4GOPB 4A3JB 2Z0DB 5GQOA 1JE4A 4CDDC 4JPSA 2FUG1 3IXSA 1DJRD 3PO3B 1WR1A 3VQIA 3S1NB 2ZW0A 2J42A 4C1NI 1FJGL 4QIWB 5T1GA 3PTFC 4A3IH 1PHJA 4A3DG 3HZXA 5ELCA 4DUYQ 4YWGG 1CKOA 4MACA 3SE0A 4XYQA 4L63B 1VQ5A 3KK7A 1S5CD 4NAWA 3GZNI 2JYOA 4DPGA 2EIFA 2JSVX 1PH6A 3N1YC 1WGHA 3PO2B 4W9KA 1EY6A 2MBQA 4RKLA 2ZNVB 3OMCA 3EHVA 4B9KA 1L2NA 1H9JA 5BMIA 1D2BA 3W1YA 3PQIA 1WTVA 4RF1A 1XWEA 1JOKA 3H6MA 2L76A 4GNXA 1WVLA 4LFAL 2LHEA 4WJOA 1CKNB 2K8BA 1WYWB 2ICEC 3L0OA 4KGRA 3H0GG 2MPMA 5IY0A 1BQQT 3FDTA 3MXNA 1SF0A 1JRUA 3RFZB 3RZOB 4Q0FA 1O7LA 4R8IA 4RGNA 1V8QA 1C48A 4LUOA 1WF9A 4UDUC 1EQTA 1TWHH 3PV0A 4FBJB 4GDLB 4C4VB 1P3QU 1JALA 1UWVA 4KX6B 3Q6SA 2JN4A 2RGFA 2MA9B 2H88B 1H9RA 2JXTA 3HOVB 4ZYSA 2FFKB 2KCTA 3W3AA 2VW9A 4RCOA 2JA6B 5KNDA 3NOBA 1AE2A 4AP4C 2NR2A 4AWJA 5EE9A 3GTOB 1V8CA 2A8VA 1EF5A 3HOWG 1S3OA 3G48A 3PUWA 4X66Q 4M00A 3CWIA 3KF8A 3QWZB 1SE8A 5FKAC 1AZPA 1DD2A 4DXGA 2PIAA 4HK2A 2SOBA 5IE8A 2XK5B 3J7YW 5AZHA 2J0MA 1IBKL 4DHZE 1U9RA 3GTGB 4AUQC 4XQJA 3DHIC 1N5WA 1SDFA 5M3FG 2F52A 1QNKA 3VDZA 1NYRA 1I3QB 5GADC 3MC9A 3KBXA 4RGMA 1ZOYB 3X0WA 2EXDA 4KKSA 1NR4A 4GOPA 3H3VC 2FCMA 4KVGB 4JPBW 4KIKB 4JOIC 1QVCA 1VS0A 4QUCA 5IT9L 3CCLA 1WMHA 2LRWA 2MBOA 5CV6A 1S5ED 2WXKA 2E2DC 3AE2B 4JCVE 4B9XA 4OVVA 4ITKA 3GTPB 2ZXRA 1EL0A 1SR3A 4MGYE 3VH4B 2CWPA 4M8NA 4F1SA 1J7BA 1PTOH 3H09A 5EGTA 2LGYA 1F9SA 1F2LA 2ZXPA 4U673 2L52A 5C4ZA 3NBHB 1D6EC 1UBQA 4FJYA 1PUTA 1N34Q 5CORA 4MTNA 1OXVA 4TQ0A 1SBBB 1MHWC 3TREA 3S2DB 1XNQQ 3SFDB 3J80L 5C4XB 1WCMH 4K0KQ 1B1ZA 3WAPA 2XSCA 2Z9HA 1LQBA 3AEFB 3WALA 2HCIA 2E2IH 3STBC 1W6JA 2H4OA 3WWVA 3HK0A 3PZ7A 4GDKA 4OELB 2KFKB 2J0JA 4YY3L 3E56A 3EECA 3ER0A 4NJCA 4DR4L 2QA4A 1GB4A 1MVKA 1NMGA 4OIKA 1ZUD2 2HE7A 1VQMA 4POGA 4AQYL 2JJQA 3F2BA 5A35A 4OHJA 5A2QE 1R4MI 1SLJA 1EYGA 3E9IA 3KUPA 2JEAI 3FHWA 3UQBA 1ML0D 3MHZA 1ENCA 3T9LA 3AH7A 1ZYRC 4FYDA 3VA5A 4J6HA 4DUZQ 4YCUA 5DM63 4HEDA 2JA7G 4A3CH 4N59A 1D5MC 1SYEA 3PPAA 4TQ1A 3CXCA 1HTQA 4ZRKA 4A3FB 2YTXA 1FRRA 1K83H 4TSSA 3VRBB 1YJIA 2MJ8A 1A2UA 5IGDA 3L08A 1I6HH 4B3SQ 3M4PA 1TQOA 1YX5B 4J6IA 1WGGA 1STHA 4W9EA 3NTHA 2XK5A 3W1SA 2KC2A 1Z6HA 1U0LA 4US9A 3J7A5 5CR3A 3CRKC 4KKJA 1XMQL 4QJFA 2V3PA 5IAAC 1C3TA 3I70A 3EJIA 1GNUA 2XBBC 1B8AA 2WAQG 2B2VC 4L5SA 2GMIC 1N32Q 3ONSA 4MM3B 2I07B 3NP8A 3OJ4B 1PTOF 4X3TA 2ZVNA 1DM0B 4ILWA 1JJGA 3P63A 2JK8A 4J3OD 4KIKA 3CCRA 2F0UA 3BWUD 1YBYA 5EBCA 3UDFA 1QVFA 3RLNA 2XTIA 1NI2A 1PTOD 1ZW7A 5FO8B 3UDXA 2NZHA 4HPPA 1L2FA 2N7EA 1L1OA 1B53A 1G2TA 1VQHA 2RVLA 2X38A 2PPHA 4KZ0A 3PSIA 4S3SA 3HUIA 2FIFA 3PLVA 4DK5A 3QWNA 1OQRA 3PGZA 4JBWA 4HKZE 3RMKC 3NBHA 4A9AA 3CCEA 3AM9A 4XGAB 3AE3B 4ZRQA 4BA1I 1OO9B 1RTOA 4GB9A 2QMTA 1F77A 4RGTA 5G5GA 5FO9B 4DGZA 4IPDA 4EQOA 1NNXA 3K7AH 1TWAB 4KK7A 2K6DB 3OTOQ 3MJ5A 1B3QA 3VR8B 2B39A 2TSSA 4HR7B 4X6AH 1STBA 2KFKA 4K5VA 5C3XA 1HNZQ 4PS3A 3UF8A 4KKTA 4BY7G 4RFBA 2IX1A 2EVBA 4A93G 4AYBB 4JI2L 3CMMB 1WTXA 1JWAD 2KAJA 2KC1A 3DHHC 3MTSA 1GUTA 2KHJA 3SEBA 4DK3C 3SHQA 2RHSB 3HS0C 3C3LA 1WZ0A 1KAAA 4JI0Q 2LEKA 1FVIA 3S24A 2EY2A 3M7NA 1V1PB 1IGDA 1SSNA 2DZJA 1SIJA 3K5LA 4N6EB 1K8RB 2NVXH 2WXFA 3J81i 5CMDA 2LD9A 1IGCA 1K73C 4PK1A 2WX1A 2K03A 5I2YA 5IP9H 3U58A 4GKJQ 2MEKA 1TU2B 3FPPA 4BBSH 2KJXA 2JRHA 1O7YA 2LGSA 4IUPA 1PYWD 1D8LA 1UUPA 4FDBA 5TSSA 4P7IA 1WRDB 2WHIA 1TWGB 3OIPA 5DPWA 1PDQA 1ROEA 3MP9A 4ARCA 2KHWB 1GOZA 3F2UA 4ME5A 2BYTA 1TS3A 1P7FA 1FCCC 1JWSD 4X3KA 1QWYA 2KKCA 4WAAA 2QF7A 2EYFA 2Z6KC 4PQXA 3AEBB 4A3GB 2D11A 2HDLA 1GUOA 4K81A 1X6OA 1E2WA 5KHOA 4AS1A 2PE6B 3GTGH 3VR5A 5LHY1 2RKSA 4DF7A 4DV7L 2X6LA 1ZGUB 1MKHA 2RPVA 2KQSA 1GHKA 5FR6A 3T13A 4RGOS 5HKHA 4YSXB 5KHQA 3HOZH 4L23A 4NNJB 3O65B 2HD3A 2XVSA 2K5HA 2ZTCA 2FHTA 2Q2IA 1JT8A 2LXCA 4FJVB 4F8MA 1EFWA 2E2JB 1A5RA 3KDFA 4MZ9A 3TZDA 4K6DA 2KX3A 4KDIC 1HZCA 1JR0D 2BE5C 4IUQA 4NAMA 2UU7A 4NB3A 2EYJA 2K75A 1SNQA 3GTPH 3CW2C 2MRPA 4IG7B 3VXWA 4CQNA 3BDCA 5CC4A 4QUFA 3SD5A 2F0MA 1Q1OA 2BDOA 2OEOA 1BXTA 1ZKOA 4B95A 1JQ4A 3CQZB 2I1JA 3FRPB 4USAA 5G2NA 1JJCB 2O6VB 4A3EB 1WTPA 4BXXH 4IFDG 2NBWB 1Z47A 2JZ3B 3S2DH 5NUCA 3IKJA 5C4XH 1C76A 4GN5A 1WM2A 3V62A 3ZNHB 1UELA 2AUKA 2CFMA 1SFOB 1HNXQ 1FIQA 2QIEB 3RNEC 4QAYA 5J17A 2JA8B 1YQBA 2Q5WD 1B2TA 1V1PA 3NS8A 3PUYA 4YCWA 2KDEB 1ASZA 4EQNA 5M5WB 2WP8J 3SVMA 2RR9A 5IP7H 2AEHA 1VQJA 4HDOA 2OEDA 2UXDQ 4IUVA 2KO3A 4DR5Q 4V190 2UXCQ 4DAPA 2R92G 1IW7C 2SEBD 4LF9Q 1EF1A 4I6PA 1P16A 2G9HD 1Q12A 1ZXTA 3N52A 4LJZC 4EKUA 3VTVA 2E8GA 2WB1G 4G4KA 4K8IA 2L1BA 2D5GA 2K50A 3JSVB 1H8CA 4ARIA 2R7ZH 5AUIA 1EWIA 4MGZE 2I5HA 4GLAC 5C0XG 1QZHA 1WI0A 3T16A 4Y7NB 5D14A 4A55A 4L2YA 1MGSA 4KHPL 3H7PA 1GD7A 4HJAA 4P16A 3ZLZA 1C1YB 2MP1A 3PRMB 4N9PA 4GS3A 3QK0A 1NE3A 1EUJA 3FKYA 3G6JB 1KDCA 4RAUC 2KYWA 2PNRC 3TEXA 5FJ8G 1KLVA 1BBUA 2VH2A 3UDIA 2OTLA 1VQNA 2KJHB 4W9CA 3ZO5B 4A6QA 4A3PA 4BBRG 5C44B 1OQYA 1G6JA 4CKEA 1EYCA 1I50H 2HQEA 3A55A 2JE6I 4DV1L 2JA5G 2JXXA 1X32A 3PCOB 5FOBB 2F0HA 3FMCA 4DR3Q 2K05A 3R66C 2Y5BB 1RRBA 4HROA 4ANUA 4DXAB 5L95C 1B50A 3GTLB 2F0IA 4DR2Q 3ZRCA 1PFNA 2Y0SG 4JL9A 2N3SA 1LABA 1WXMA 3FVQA 4JI6Q 3FC4A 2O5IC 1HPCA 1EIGA 3QHTA 2NYZD 2GBMA 2D5DA 3QO2A 1MG4A 4OW0A 3X3MA 2A68D 5GROA 1Q0WB 4P72A 4A76A 1D4BA 4DR1Q 3CAMA 3ZJUA 3A33B 5IGEA 3K5NA 3K80C 3STBD 2KXJA 3A9JB 3VFKA 3K9OB 4V0BA 1LFDA 3MA2B 1S3SG 3PO2G 3PRPB 1E2VA 1KC8C 2KENA 4R3DA 4A3BB 4P1BC 5JXVA 3J81L 3MJWA 1P98A 4M0WA 5IYDH 2EELA 5C23A 5ELFA 2H1EA 2LUEA 1QVGA 2KQ4X 2WXMA 4ZHPA 3CCVA 1K3RA 1WX8A 5M5YH 1WGYA 3TEZA 3Q3OC 1K53A 3G7LA 1BT0A 2IO0B 2XRQD 1VQ9A 2INPE 2N7DA 2NN6H 3W2DA 1E8ZA 3AB5A 3OYYA 3AE9B 1W6KA 5CTRC 2QDLA 4P2CB 4X66L 2C9WB 2FCSA 1ET6A 5IYCH 2W54A 1K0SA 2Z59B 1NR2A 3U9OA 3OAWA 4G3XB 2A1AA 3A5ZB 2KACA 4MJSB 4CYEA 3HKZB 3TQYA 2KHSA 2LI5A 1CZWA 4W9FA 2HUGA 1HFGA 2M00A 4ASWC 3PRZA 3AXCA 3BVZA 1JORA 2EYPA 4W9JA 4OVZA 2JA6G 2JXMB 1VQOA 1XX8A 4IUNA 1U4MA 2HCCA 1E10A 4DNIA 1K51A 2EYOA 2FBWB 3JAME 1ENAA 2QSDA 1MD2D 2GLSA 3LWUA 3VYTA 2K5QA 5IYBH 4Q2JA 2EQSA 3E3XA 1NENB 1L0WA 3Q8EA 1VQGA 4RHSA 1I35A 4A3IB 2EZVA 2WDRB 4HEA1 4ZKCB 1C8CA 2K14A 3D6WA 1TWGH 4R4OA 3SU8X 4W9IA 3C0RB 1VQAA 2AYOB 2LRUA 4IWPA 2BQQA 2Z0EB 1Y1VB 1Q5WB 2D0PA 2RDGA 3AEVA 4YSYB 1RIPA 2PZTA 3KW5B 1IL8A 3AU4A 4GDLA 1PH7A 2IY0B 4AIMA 5LXIB 4XXEA 4ANXA 2EKEC 2NPTB 2IPKD 3I8ZA 2KANA 2QJLA 2EXZA 1EQQA 1CQVA 4YTPB 4LAAA 1FR3A 1YN5A 1HR0W 2V1YA 3KYHC 5C3EG 5JVH3 1XNQL 1EM7A 2CU3A 2WX0A 2F0NA 4UP9A 2WU2B 2JEBI 3A1QB 3W5VB 4URKA 1VDZA 2RA4A 4KJNA 3N1ZC 5M3MG 4HRSA 3S15H 2UXBQ 5JVG3 2IL8A 1NYQA 1KOTA 3NTKA 4NKLA 4JI4Q 4YT0B 2F3WA 4HIDA 4II3B 2M56B 3UINB 2BYFA 1LTSD 2ZCCA 2MBHA 3IFWB 1V97A 1TY2A 2LMCB 4JI5L 4EUTA 4KKUA 1FMAD 3SK4A 4UY8C 2E2JH 4R4QA 4JI1Q 1GAQB 3DEOA 1CJEA 3TL5A 4HIOA 4H7BA 3UI2A 3Q8BA 4A3DH 1Q8IA 4IN3A 1U4RA 3WOFA 1F1HA 1CK1A 2OTJA 3UIPB 4DUZL 2MLBA 4OIJA 4QIWE 1EEFD 4MT5A 5EJWA 3V6CB 4MHEA 1KM7A 3CQZH 2BKRB 4CKCA 5GAHC 2WP9B 4HPMB 2LGIA 4ZUIA 3T1YQ 1CZGA 4WJ4A 1TWCB 4B3SL 4DU9A 1P0RA 5BMHA 3TBLD 2D62A 4J1MA 4FVMA 2KWVB 3VRAB 1N36Q 1SFOH 4MJSA 1F9QA 3C46A 2I5LX 2BB5A 1SYFA 4TKNA 1KNAA 4ZUJA 3KYCD 1E24A 3RN9C 2A6HC 4LNQA 5G5HA 4DXFA 2EYMA 1GUSA 1LTBD 2X6GA 1RJTA 3TP6A 4DK6C 5IT9E 1N32L 1DZ1A 1G8ZD 2F1MA 5EKIA 2WDQB 4PT5A 1V1QA 3NY5A 4TRDA 4BS9A 2VUMG 3U30A 1EWHA 4WJQA 2KN4A 2IO1B 1A15A 1EQVA 1B7YB 2DUDA 3DBHB 3EC8A 3VR9B 1SMXA 1V9JA 3ZIMA 1J0GA 3HOYG 4C2MB 2BT6A 1PRTC 1T9HA 2N1VA 2LXJA 4XZ4A 1BCPC 1FO4A 3HM6X 2AKWB 3I90A 3APDA 4LF8Q 1GPXA 2KCMA 3R93A 3HOWH 1TYGB 2NPTA 1Y1WG 1XMOQ 4HDQA 2N9EB 1HZBA 3OOCA 2M9VA 2E75C 2B8FA 2VH1A 1OXSC 1RKNA 3A1QA 1UE7A 3BJUA 4CO7A 3E5SA 2B2TC 4ZKBB 3OTOL 2NBFA 1D3ZA 1EIYB 3MVVA 1HHVA 1VQPA 1A8VA 3FKIG 5C44H 5HFYA 1KDAA 3KH0A 3H1UA 1HNZL 4ABNA 3DQVA 2MWSB 2BE5D 1SNMA 3GP7A 1WXAA 2ASQA 2LMCA 2INCC 2K5PA 1DOKA 3AMZA 1E9MA 3EBEA 4KV6A 3NS1A 5KNCA 1AARA 1U5KA 4LF4Q 3AE1B 3CMAA 2K5VA 3QIAA 2RSUA 1HXYD 1E90A 4OWTB 2WXQA 5JAVA 1E0BA 2VB2X 3LYYA 4G50A 4YWLA 3CC4A 2O6VD 1K83B 3I4MB 2MO1A 2K0PA 3FP9A 4GOCA 1RWSA 4ICUA 3OIQA 4WWPA 5IT9c 4WRDA 3APCA 1K8OA 1P7EA 2BVCA 1UGMA 2B2WC 4GKJL 4OONA 4LFBQ 4GZYC 4BOSC 3Q6BA 5CV8A 3AYHB 3GD7A 2CJOA 2AL3A 1JMCA 3T51B 1LUZA 3EIVA 1GM5A 5ELEA 4K1RB 4GNXC 2LGDA 3H7SA 3TEWA 1WD0A 3NQIA 1MJDA 2MP2B 1JQYD 2N7JA 4YWMA 4MNOA 3J7ZC 1WYDA 2WXGA 3ABVB 2DY8A 2CJNA 5C2TB 2LFIA 1FPYA 4GGQA 3HOXG 1XO3A 3JW0X 3J80c 4M02A 5E4XA 1PYBA 4G11A 1BR9A 3W5UB 5ELOA 1D1KA 1ASYA 1QNUA 4X3UA 4BY1B 2KWDA 1PXUA 1YHBA 4P75A 4EVOA 3L13A 4US8A 1LT5D 4KTAA 2JA7H 4LTUA 2ZTEA 2D3BA 5BR8Q 2W9NA 5C4JB 3P42A 4R1JA 2D07B 4C00A 4FO2A 3L10B 4PMBA 1TTNA 2YU9B 4WURA 3G6EA 1DGJA 3NG0A 3DDCB 4DV4Q 1HJPA 2CH4W 1J8IA 3A9KA 3ZDTA 1BUVT 4RF0A 2K28A 2L55A 3K7AB 2MGSA 1E8WA 1TGZB 1S5DD 4JBKA 2KCCA 1WTHA 4FF1A 5EKKA 4DR7Q 1ICFB 3NPPA 3BZCA 4OXPA 3I4NG 3RPFC 1SYCA 3CCQA 1Y1VH 3NENA 4NPSA 3NVVA 1WGDA 2LXAA 4AH6A 1X56A 3R7RA 4NMZA 1RFKA 3Q8CA 2QILA 1KXLA 2SAKA 1HTOA 3AULA 1FGUA 4NQLB 3ZXVA 2K6AA 1VR9A 2NTTA 3PT2B 5IN7A 5FLXE 1SRUA 4IUTA 5LLIA 2CR5A 2A5UA 1HNXL 3HIZA 1HTPA 3WAMA 1SXTA 2DENB 2ZVOA 3LWEA 3GE8C 4E74A 2HT1A 2AWNA 1L4ZB 1GC7A 2NVXB 2RDFA 4KY6A 3NQTA 3NWSA 1C79A 4QY7A 5GMVA 3W9CB 4APVA 4MSMB 3L7ZC 2W3SA 1FFVA 2BTEA 1E6EB 4BBSB 2UXDL 1Y8RC 4HTHA 4O42A 3CCJA 4A3KB 1KRHA 1H4RA 2UXCL 1DOMA 4MGIE 5BYQA 3FEWX 2ZJPA 4JLCA 2K8HA 5JZEB 4LF9L 4CJ1B 4KSKC 1WI5A 3URYA 3AE5B 1K8MA 4FN2A 2Z6BA 2LS01 5BN3A 3OWFA 4JYAQ 4G7OC 4LFCQ 3CCUA 3WDNA 2WXPA 4ZRIA 3E6ZX 1AZQA 2OJRA 4OL7A 2VB3X 1JOQA 1G2SA 2I38A 2N9PC 1FNVA 1KJTA 4C80A 1TS5A 4EQ5A 1ZE3D 1EUVB 2KJ6A 1PFMA 5T8IA 3TEYA 4K5XA 1XNRQ 3EQLC 1WTRA 1TWCH 1F52A 4C7YA 1IBXB 1PH1A 3TS2A 3NVYA 1D1IA 1STEA 3BZKA 4A3MG 4AYBE 4N58A 1EY7A 2MCNB 2W82A 3OMGA 2MFIA 3QIJA 4C3JG 1YZ6A 1B3AA 3A7AB 4GKKQ 4KN4C 4EQPA 2MX2A 1VZ8A 2CHBD 2GVAA 1TXYA 3HOZB 3C1FA 1X9NA 1PZJD 1AYFA 2JQRB 4TKOB 3KLRA 4DR3L 1JWMD 1N33Q 2L3ZA 1B4OA 3Q0AA 1HRJA 4DR2L 1FXAA 4K3CA 1EU4A 1JJ2A 1RLFA 2N78A 4JI6L 2C5LC 1V5TA 3OW7A 1RAXA 4PNYA 3GTQH 2WKCA 1WRIA 1SEBD 3Q8DA 5FLXc 1E8YA 2IGHA 2ZPYA 4C2MH 1PDXA 3W1SC 3J81j 3KF6B 4OWXB 2MJEA 3ND8A 4IO9A 2N9KA 3LX0A 3MHBA 4DR1L 2DNFA 2MHVA 1WJ4A 2D0OA 2ATWA 5IGFA 4ICVA 4ODGA 4TV3A 1WGRA 2Z8LA 1QILA 4RKBA 2REXA 3VTUA 1SNOA 5G3LF 2MQJA 2DNEA 3H94A 4I6NB 1V86A 3RNFC 2B3GA 1CKNA 2RD0A 1NVID 4K14A 4JI8L 1WD1A 5G3LD 2AL6A 2DWQA 4C3IB 1L1OC 3PMFA 4ULLA 4MEMA 3AV8A 1VCIA 3KBGA 3PIPA 2MSED 2QC8A 2DZMA 5L83A 1SNCA 2K22A 3M62B 4C4VA 1SJED 1SNPA 2EY1A 4MTKA 4JQWC 4TUUA 3IT4B 2UUCQ 1EY5A 2NVTB 1HR0L 3U9SA 1VDVA 2MBEA 2ZJRA 2AQ1B 4CHKA 2R7ZB 1F9RA 2LJIA 1OXUA 1E7ZA 5GAEC 1GUAB 3ZDMC 4LNFA 4XT3B 3I4MH 3MTNB 3PUZA 5IOCA 4CDEC 4BBNF 1VQFA 2SNSA 3G71A 1FFUA 1BNZA 4IFDH 2A6HD 1QJOA 3U7DA 1PGBA 2F03A 4TQUS 4YWKA 1AN8A 5JH5C 4POFA 4YTMB 4W9LA 2L83A 2BYVE 4KKIA 1KAWA 4R4TA 2LUMA 1IXRA 1SAPA 3VDYA 2DJGC 4ZHOA 4QB4A 2L0CA 2K39A 1ZEQX 2NVUI 3DVNV 3HRDD 1FXTB 2JUOA 1I50B 5C5LA 4IC7B 2OQKA 4MELA
chains in the Genus database with same CATH topology
3QOJA 2QDBA 1BCPD 1KLGD 5IGCA 4JWSC 1HTLD 1HEZE 1NCVA 3RZDB 3NZ3A 3AE7B 3LB8C 1IHZA 3A56A 3VR3A 3BVGA 3U2SC 1OXTA 1PFBA 4XTCS 2PLPA 2E3TA 1RYJA 2A69C 5EE1A 2MJDA 3J81E 1XCTL 3D3RA 4J8QA 3VR6A 1XLOA 2O4XA 3AEAB 1EOTA 1YNND 3CU7A 1Y8OB 5HGTA 1MI0A 1CTMA 2ENBA 1DOYA 3BYYB 3P4SB 1G91A 2WXRA 2Q8TA 4D2KA 1I4QA 4MH8A 5M5YB 4IUUA 3GQBA 1T6BX 1UWMA 1KNEA 3MZ5A 2GA4B 5K36G 1LTAD 3NHHA 1WTQA 3L3OC 4AQ7A 3RUZA 1T5EA 1RODA 3SK8A 5KYIA 1A2TA 2Z4IA 5JOBA 2K1BA 3HVZA 1LTGD 4EE2A 4ID6A 4XWTA 1F2MA 4DAVA 2BW2A 3AEGB 2EKIA 5BMGA 5JEAH 1F2RI 2DLBA 2VNUD 2OT2A 5AUKA 4LLGM 1LV9A 4C3HG 2JU6X 1HZ6A 1ILPA 1GUGA 4FF2A 1Y8NB 2A6EC 2L12A 3GS2A 3T3NA 2KUMA 1TY0A 2IT1A 1NI3A 1FNUA 1PGXA 4A90A 1J7AA 3TN2A 5CV9A 3IL8A 1Q1EA 3S15B 1UEAB 2XN9C 1JWBD 4DA2A 4ZK9B 1L0YB 1G6ZA 1XF5L 2F0JA 3HP3A 2NVYB 1TKEA 2DNCA 1CQFA 2Q8IB 1WTOA 1I4XA 1O78A 4A3DB 1TVXA 1QF6A 4OO1H 1DOIA 2PW7A 4XDCA 1R7SA 3GV3A 1Q10A 1HZ5A 4FNFA 4RWSC 2SNMA 4XE0A 5CGKA 4RHRA 3P75A 3BIID 5CBAE 3HRZC 1HCZA 3AE4B 2Z1CA 3GTJB 2LKVA 3H0GB 2BBCA 3ND9A 1V43A 3R2TA 1Q90A 4G7HC 4JE3B 2F0GA 1RM6C 2A5HA 1SYGA 3M85A 3BDLA 1EY9A 1M4VA 4XDDA 1VF7A 1UWXA 3NVWA 4RA8A 1SYDA 2K01A 1I4HA 5GXGB 2F0VA 1FD7D 2AX5A 1QE6A 1ESRA 4WIPA 3P4QB 2YEPB 3HOWB 3AECB 3B9JA 5JEAJ 1LACA 2F0TA 1IKLA 5J1ZA 3GTKB 1BOSA 2BB6A 1DYQA 2ID0A 3EUB2 2Y5CA 5D7GA 3Q8AA 5M3FB 5DNFA 4C1NK 5A2QL 3AMUA 4PMWA 2K7VA 4IOIE 3BDOA 4WFN3 3R8BA 4FP5D 2WXOA 1FD6A 1YNJC 1YN4A 2O5JC 1F2ZA 1G291 2G9DA 3Q8FA 1ZXIA 2JYTA 1LT6D 3RD4A 1I4PA 4F87A 3L4PA 1ET9A 1LT4D 3TP8A 1XLPA 4C7ZA 2WU5B 1RF2D 1S5FD 5C5MA 1EU3A 2J52A 4OZAA 3SFEB 3V3XA 4FXKC 2OF1A 1WTWA 2RBMA 3DUZA 1BBXC 1IKMA 5HURA 2PW5A 4GLSC 2IGGA 1AW7A 1ZYRD 2WNMA 3NK9A 3VYSA 1I4RA 2NTSA 2ICIA 1CT1D 5I4DA 4NDXA 2NZ1D 1R4PB 2B2YA 1I4GA 4F88A 1MSHA 2JA7B 1VZ6A 4H44C 1EWCA 2DBYA 1SYBA 1EYAA 5C4HA 1ENFA 2KVMA 3E0JA 3AE8B 1CHQD 1A3VA 1MHXA 3ETRA 3VR4A 4I7ZC 3T56B 1F2YA 3DWAA 3ZGZA 5I9OA 3BK2A 1N63A 1A3UA 1VF5C 1II3A 2WAQB 3BG3A 1Z7TA 2FMCA 1STNA 2D2CC 2RDHA 3NUCA 3C2PA 4FXCA 4XQNA 4Q5VA 4KMUC 4WH4A 1SSOA 2EJGC 3D4DA 3Q69A 3VA7A 4KHVA 4PV1C 1UNSA 1X3PA 1WXQA 1I7HA 1QCBD 4XWWA 2PZWA 3K57A 4JX1C 3HEJA 1ICWA 1O80A 2IJ0A 4P6VF 1VMPA 1CHPD 5E1FA 4ZOHC 2KQ3A 2F0DA 1TKWB 1KFYB 3EGRA 2C5CA 1RD9D 2J4XA 2M19A 1O7ZA 2PVOD 4BY7B 1PZID 2B2UA 5EE0A 5IODA 5HHDG 1QT9A 3AE6B 1TS4A 5F2DA 3NXWA 2WQYB 1SMYC 1EYDA 1C4CA 1R4QB 2FJ2A 1C4QA 2B8GA 3K58A 1XEEA 3K5OA 2ZW1A 5J22A 2WXJA 5J39A 2CW0C 1ZDXA 1L5PA 1S5BD 4HSVA 5KYLA 2I46A 2SDFA 4QF4A 2GB1A 1VMCA 2F3VA 1N60A 2IX3A 2H89B 2VZKD 2A6ED 1FCLA 3GTQB 1PRTB 3C1EA 2M0AA 1BCPB 4QMGA 2D9UA 2R61A 2QEJC 1TJEA 3J80E 1TS2A 3T53B 4LK0M 5FR3A 1GB1A 3C8YA 2PTLA 3QOLA 3OWEB 1QOGA 5JPNC 2HTME 2ZXOA 1DOLA 1E2ZA 2Y5PA 4KJOA 3TZUA 3AB9A 1Q3LA 1LO5D 3P4RB 1AEXA 3M7GA 2KEEA 4RH6A 2WKDA 4R9WA 5FO7B 2G1EA 1YMHE 1PTOC 4K5WA 2GRIA 3VYRA 2MH7A 5LL6X 3TUOA 1GUNA 2K32A 4MN3A 3S17B 2BS3B 2IW3A 1KTKA 4WAFA 5C3JB 1HQRD 4XDXA 3ZYYX 1GUWA 2AQ3B 3SHLA 4YTNB 3PZ8A 3RLFA 4OGQC 2FINB 5DAUA 1UGJA 4KGSA 4ZRPA 3UI3A 4XIGS 4HMIA 4JWUC 1XLNA 5I6YA 4FF4A 2LHDA 2L4NA 5H8YE 2OHFA 3KWLA 1IW7D 4ZQ3A 1JROA 2WINB 2CQAA 4FXDA 2BA0A 1H9SB 1ZXHA 2YEPF 2K9XA 4IKGA 2R92B 2K3UA 3P1HA 1XYIA 2EY6A 3EFXD 3GV6A 1S4ZA 2F0EA 2WB1B 4G7ZC 1N5XA 3DWPA 1JICA 5CBEE 1UAPA 5BN4A 2EJFC 2NN6I 3NBIA 5EPKA 1MHHE 1HUMA 1SB3C 2NB0A 5BYRA 2QCPX 1FNWA 3OPOA 4DQOC 1D5XC 1H9MA 2E74C 4OZCA 1ESFA 3KLSX 4EGVA 1HQMC 2NWGA 2LFNA 2F0OA 1YNJD 2RSNA 5COYA 1TR5A 4DFAA 4HSPA 1L6VA 2EJMA 1HFNA 2Y0SB 1C78A 4OZBA 1I6VC 1DONA 3D4WA 4I65A 3M3YB 1BF4A 2N9LA 3JAML 2WXLA 5LNK1 2F0SA 1NSNS 2XIWA 1EEID 3ZJVA 1EY4A 5JPMC 1BO0A 2B2WA 2EPBA 5E4WC 5CV5A 1F0ZA 3BVMA 3HVDA 1EZ6A 2B76B 1B9MA 3O13A 3FPUB 3LNNA 4GDKB 3SR1A 3CKIB 4HCSA 2EOTA 2BA1A 5K36H 1H9SA 5MPOA 2L9HA 1A3TA 5BN5A 1ZDVA 4M1UB 1B9RA 2J7ZA 1LTTD 2V3NA 1NAPA 1LLRD 2K5WA 2EE1A 2PMZB 2LY7A 3DMUA 1FRDA 1STGA 1A6XA 4CJ2C 1DXMA 1C77A 3TP7A 3NTIA 4KY5A 4NZLB 2I2YA 2PVGC 4R8NA 1CI3M 3KWVA 3A54A 4UAIA 1KLUD 4DK1A 1CM9A 4Z9CB 3P1MA 1EFID 1GXDC 1XCQL 5C3EB 1JCKB 1L0VB 1MBYA 1SNDA 5KEEA 2L1AA 5I6WA 4BWGB 5M3MB 1B44D 1YN3A 1CA6A 4H2AA 3RMHA 2BS4B 3ITPA 1QOFA 2E76C 2WV6D 3SDZA 1U4PA 2PKOA 5M9OA 3WOEA 4O1NA 5M5XB 3B2GA 3ZJTA 3S2HB 2KCNA 1GHJA 3I3CA 4XT1B 2A68C 2Z4HA 3H91A 1QKZA 3BS1A 1N61A 4NW2A 1TKGA 1SMYD 3EA6A 2XNAC 4CBVA 3L9AX 4DK0A 3J7AV 1FGBD 4IQZA 2WACA 3MC0B 4IALA 1JB3A 2CW0D 4JK1C 3I72A 2TMPA 4WJWA 1IBXA 4G57A 4DN4M 3HGBA 1FM0D 1PFDA 3AN1A 1PRTF 3S1MB 1BCPF 1D5ZC 5ISRA 2MUYA 3MEHA 2MJ3A 4WORA 4PMCA 3DHQA 1PRTD 2OXPA 2VUMB 1MI2A 4K2LA 5CYUA 4FF3A 1Y56A 2QKIC 2N0SB 3HOYB 5D3DA 1AWDA 3S14B 2IX0A 2R3ZA 3R2IA 5C0XH 3X3NA 3WCQA 2F0FA 2ACZB 1K52A 1Y1WB 3GTMB 4B0EA 3V96A 2PCFB 4ZRZA 2A74C 5DEHA 1WYGA 3DXJC 3FKIB 2DYOA 1OFFA 2JWUA 1SJHD 2B63B 4CGYB 3CIRB 1E0ZA 2KEDA 3IAS1 1XTCD 3CRLC 1L0XB 1Y8PB 3BYTB 3D6CA 3QJYA 5ELDA 1YQ3B 2AUJD 2L32A 1EWYC 3K5MA 5T1IA 4XYOA 5EPLA 1KF6B 2RMMA 1BUIC 2Q8RE 4KD4A 1ONLA 1STAA 2B2VA 2VZKB 5FLXL 4C56C 3BZDB 3MAQA 4L8JA 3Q23A 1XXGA 1TWFB 3HOXB 2WIIB 2KDMA 1YNTE 1JRPA 2JSOA 1QG7A 3MFGA 4DNTB 2XWJB 1LT3D 1Y69U 3J9CA 3I57A 2K33A 4HCEA 3IAYA 4IFDJ 1RCVD 3N6RA 2WXNA 1Q1BA 3IFDA 2PW9A 4IDIA 1L6UA 1GJXA 1BMLC 3S9WA 1HA5A 3V2TA 1AFPA 1C4AA 3SR6A 2PO4A 1CZPA 3VYUA 1STYA 5EKLA 3I91A 3I4NB 4WWMA 1JW9D 4U68A 2X69A 2F4IA 1PLFA 1AP0A 1QOAA 2N88A 5C0XJ 2K04A 4B08A 1VZ7A 4HAEA 2F0LA 3NVZA 1KABA 3IFTA 3EROA 2E6XA 3MXPA 2JYEA 2EDGA 3R3OA 1VJKA 3PIO3 5EQ0A 1RDPD 1H9KA 5K5PA 1J9OA 5E6JA 5DM73 3AEDB 2IGDA 3OSOA 2KMMA 4CHTB 3LXFA 1T5XD 1QLBB 2KA7A 3PO0A 2PMVA 3A8JE 4YIJA 2F0WA 1DOXA 5H92C 5EBDA 1N62A 4MIUA 3HG9A 4A3MB 5FK9C 3PUXA 1OQQA 5EPJA 3TMEA 4C3JB 4YXDB 2B2YC 3P7JA 1RHPA 4LMQD 1EZ8A 4IFDI 1OXXK 3B2FA 3OHXC 4FXGC 3D4RA 3FILB 3KQ4A 4WQMA 2V4DA 3T4AC 2M2LA 5C3WA 2V4IB 3ONAB 1SE4A 1WWTA 2NMQA 5KNBA 5CV4A 2DY7A 1X3QA 4X3SA 5IGGA 2L5TA 1NUCA 1HUNA 5I2XA 3T3OA 1KH0A 1PZKD 4DNRB 1A70A 3SK5A 2BS2B 1IUEA 5I9PA 4YSZB 1NEKB 3TBIB 4A8XC 5C0XI 3PUVA 4RNAA 5LL6S 1LTID 1U4LA 3KLSA 3EVQA 1JMLA 4CKBA 2DN8A 2JP1A 4B9WA 3NUHB 3K6OA 3NRZA 5JEAG 2W55A 2WS3B 3ZQ4A 1V1OA 3S16B 2GI9A 3K59A 1K50A 1TKYA 3MWYW 3P4PB 1QQRA 2L11A 3QB3A 2FMMA 1KDBA 2BCOA 3DWQA 2HDEA 3N9YC 4CJ0B 1WGKA 5IGBA 5CV7A 3P20A 3D8GA 4KI0A 2B2UC 4XQQA 5KIXA 2IDYA 5BYSA 3TSSA 1TIID 3SK6A 1ZP0B 3DEPA 4HMJA 4HN7A 5C6AA 1WSPA 1J7CA 4HJGE 2AQ2B 1LTRD 2WXHA 4IZ8A 2IWHA 1MPEA 5IIFA 3FILA 1EY0A 1TZOA 3IAM1 4NP5A 1VLBA 2WDVB 2E2HB 2A69D 4L6TB 4K2KA 1BDOA 1PMRA 3PIP3 1ILQA 3I9V1 4OO1G 1FEHA 2KOLA 1TT2A 4B0MA 2PZUA 1QOBA 2V0GA 1MSGA 4LK1C 2PPBC 4ZAIA 2XRSD 1FXIA 1SE3A 4KN7C 5D65A 2ONQA 3H8HA 2O2LD 1F2RC 2A73B 4TMAB 2R93B 3J7AF 3TP5A 3DM1A 1R9TB 3DWGC 4A93B 2BDNA 1C9FA 4C3IG 1E7PB 3ERQA 1TWHB 4OO1I 3Q24A 2R6GA 2EYLA 3A7LA 3QG1A 1EY8A 1HA6A 1SE2A 3M4OB 4QCLA 5E3FA 2ZT9C 1DCZA 2YYZA 1QOHA 3MFYA 4K6LA 3IT6B 2F0QA 2J53A 4N9TA 4H0LC 5HI1A 3NE5B 5D3IB 1B9NA 3NWTA 3Q22A 4HKQA 1M8AA 4C3HB 3A8IE 4DAYA 4KHZA 1FYCA 1RTNA 3TDQA 3DWMA 2ON8A 1ACCA 3VR2A 3I73A 4REZA 1ZPSA 2NUCA 3U7ZA 3AEEB 4KY7A 3SXHA 3NSWA 4H13C 1PGAA 3I4LA 2RQXA 3S1RB 3E9SA 3GB1A 1PTOB 4K8JA 2F0PA 2J0TD 5KRUA 2RSOA 2PYKA 3U4EG 1T3QA 2JZPA 2N55A 1WCMB 3CHBD 2E2IB 5ELBA 3BK1A 1YJJA 4NAWB 3AU7A 3FAHA 3GO5A 4E6IA 1YNNC 3K0YA 2F0KA 2PQEA 2NN6G 3U52E 1IYUA 2WXIA 1F9PA 2WLBA 2W3RA 1C4PA 1YQ4B 1CFMA 1QB5D 2EYHA 4BA2I 3MXGA 2Y3AA 1JWUD 2EY5A 2FE8A 1EIHA 5KGUA 1XLQA 4KD3A 1VRAB 3A8KE 1JOOA 1I6HB 2DYMA 4F7XA 5EE3A 2C9OA 3S1QB 1JC7A 2INNE 2KECA 2BOSA 2XWBB 1IYVA 2CVRA 3HOUB 2NVQB 5JJZA 2K5DA 4ZLTF 2HDMA 4M8AA 3V05A 3MXUA 5AFWA 1CA5A 2VXWA 2B2TA 4IURA 4KGTA 1L4DB 4BBRB 2JX5A 5HG2A 2JA5B 3D31A 4RCNA 3M4YA 2AWOA 4L1BA 4A3JB 1JE4A 4JPSA 2FUG1 3IXSA 1DJRD 3PO3B 3VQIA 3S1NB 2ZW0A 2J42A 4C1NI 4QIWB 5T1GA 3HZXA 5ELCA 4YWGG 4MACA 3SE0A 4XYQA 4L63B 3KK7A 1S5CD 2JYOA 2JSVX 3PO2B 1EY6A 4RKLA 3OMCA 1H9JA 5BMIA 1D2BA 1WTVA 4RF1A 1XWEA 1JOKA 3H6MA 1WVLA 2LHEA 4KGRA 2ICEC 2MPMA 1BQQT 3FDTA 3MXNA 1SF0A 3RFZB 3RZOB 4Q0FA 1O7LA 4R8IA 4RGNA 1V8QA 1C48A 4UDUC 1EQTA 3PV0A 1JALA 4KX6B 3Q6SA 2H88B 1H9RA 2JXTA 3HOVB 4ZYSA 2FFKB 3W3AA 4RCOA 2JA6B 5KNDA 5EE9A 3GTOB 1V8CA 3PUWA 3CWIA 3KF8A 5FKAC 1AZPA 1DD2A 2PIAA 4DXGA 2SOBA 3J7YW 1U9RA 3GTGB 4XQJA 1N5WA 1SDFA 1QNKA 1NYRA 1I3QB 4RGMA 3KBXA 1ZOYB 4KKSA 1NR4A 3H3VC 5IT9L 4QUCA 5CV6A 1S5ED 2WXKA 2E2DC 3AE2B 4B9XA 4ITKA 3GTPB 2ZXRA 1EL0A 1J7BA 1PTOH 3H09A 5EGTA 1F9SA 1F2LA 2ZXPA 4U673 2L52A 5C4ZA 1D6EC 1PUTA 5CORA 1OXVA 4TQ0A 1SBBB 3S2DB 3SFDB 3J80L 5C4XB 1B1ZA 2XSCA 3AEFB 2HCIA 1W6JA 2H4OA 3PZ7A 3E56A 4NJCA 1GB4A 1MVKA 4OIKA 1ZUD2 5A35A 4OHJA 5A2QE 3KUPA 2JEAI 1ML0D 3MHZA 1ENCA 3AH7A 1ZYRC 4FYDA 3VA5A 4J6HA 4N59A 5DM63 4HEDA 4TQ1A 1D5MC 1SYEA 4A3FB 1FRRA 3VRBB 4TSSA 1YJIA 2MJ8A 1A2UA 5IGDA 1TQOA 1STHA 3NTHA 3W1SA 1Z6HA 4US9A 5CR3A 3CRKC 4KKJA 2V3PA 3I70A 3EJIA 2B2VC 4MM3B 2I07B 3NP8A 1PTOF 4X3TA 1DM0B 4ILWA 4J3OD 3P63A 2F0UA 3BWUD 5EBCA 1PTOD 5FO8B 1B53A 1G2TA 2RVLA 2X38A 4S3SA 3HUIA 3QWNA 1OQRA 4JBWA 4HKZE 5HFYA 3NBHA 4A9AA 3AM9A 4ZRQA 3AE3B 4BA1I 1OO9B 1RTOA 2QMTA 1F77A 4RGTA 5G5GA 5FO9B 4DGZA 4EQOA 1TWAB 4KK7A 3MJ5A 3VR8B 2B39A 2TSSA 4HR7B 1STBA 4K5VA 5C3XA 4KKTA 4RFBA 2IX1A 2EVBA 4AYBB 1WTXA 1JWAD 2KAJA 3MTSA 1GUTA 3SEBA 3HS0C 3C3LA 1KAAA 2LEKA 2EY2A 3M7NA 1V1PB 1IGDA 1SSNA 1SIJA 3K5LA 4N6EB 2WXFA 5CMDA 1IGCA 2K03A 5I2YA 2MEKA 1TU2B 3FPPA 2KJXA 1O7YA 4IUPA 1PYWD 1UUPA 5TSSA 1TWGB 3OIPA 1PDQA 1ROEA 3MP9A 4ARCA 1GOZA 3F2UA 4ME5A 2BYTA 1TS3A 1P7FA 1FCCC 1JWSD 4X3KA 1QWYA 2QF7A 2EYFA 4PQXA 3AEBB 4A3GB 2HDLA 1GUOA 1E2WA 4AS1A 3VR5A 5LHY1 2RKSA 4DF7A 2X6LA 2RPVA 1GHKA 3T13A 4RGOS 4YSXB 4L23A 2XVSA 2FHTA 4F8MA 2E2JB 3TZDA 4K6DA 1JR0D 2BE5C 4IUQA 4NAMA 2EYJA 1SNQA 4CQNA 3BDCA 5CC4A 4QUFA 2F0MA 2BDOA 2OEOA 1BXTA 1ZKOA 1JQ4A 3CQZB 3FRPB 4USAA 4A3EB 1WTPA 4IFDG 1Z47A 5NUCA 3IKJA 1C76A 2AUKA 1SFOB 1FIQA 2QIEB 2JA8B 2Q5WD 1B2TA 1V1PA 3PUYA 4EQNA 5M5WB 2WP8J 3SVMA 2OEDA 4IUVA 4V190 4DAPA 1IW7C 2SEBD 2G9HD 1Q12A 1ZXTA 3N52A 4LJZC 4G4KA 4K8IA 2L1BA 2D5GA 4ARIA 5AUIA 5C0XG 3T16A 4Y7NB 5D14A 4A55A 4L2YA 1MGSA 4P16A 2MP1A 4N9PA 3G6JB 1KDCA 4RAUC 2PNRC 3TEXA 4A6QA 5C44B 4CKEA 1EYCA 2HQEA 3A55A 2JE6I 4GDLB 1X32A 5FOBB 2F0HA 3FMCA 2K05A 4HROA 1B50A 3GTLB 2F0IA 1PFNA 1LABA 3FVQA 3FC4A 2O5IC 1HPCA 2NYZD 2D5DA 3QO2A 4OW0A 3X3MA 2A68D 1D4BA 3ZJUA 5IGEA 3K5NA 4V0BA 3MA2B 1E2VA 4R3DA 4A3BB 5JXVA 3J81L 4M0WA 2EELA 5ELFA 2H1EA 2KQ4X 2WXMA 4ZHPA 3TEZA 1K53A 3G7LA 2XRQD 2INPE 2NN6H 3W2DA 3AE9B 3AB5A 1W6KA 4P2CB 2W54A 1ET6A 1NR2A 3U9OA 2KACA 3HKZB 2KHSA 1CZWA 2HUGA 1HFGA 2M00A 3BVZA 1JORA 2EYPA 4OVZA 2JXMB 1XX8A 4IUNA 1U4MA 2HCCA 1E10A 1K51A 2FBWB 2EYOA 3JAME 1ENAA 2QSDA 1MD2D 3LWUA 3VYTA 2K5QA 4Q2JA 1NENB 3Q8EA 4RHSA 4A3IB 2EZVA 2WDRB 4HEA1 4ZKCB 1C8CA 3D6WA 1Y1VB 2RDGA 4YSYB 2PZTA 1IL8A 4XXEA 2QJLA 2IPKD 3I8ZA 2EXZA 1CQVA 4YTPB 4LAAA 1FR3A 1YN5A 5JVH3 2CU3A 1EM7A 2F0NA 2WU2B 2JEBI 3W5VB 1VDZA 2RA4A 4KJNA 4HRSA 5JVG3 2IL8A 1NYQA 3NTKA 4NKLA 4YT0B 2F3WA 2M56B 1LTSD 1V97A 1TY2A 2LMCB 4KKUA 1FMAD 3SK4A 1GAQB 3DEOA 1CJEA 4H7BA 3UI2A 3Q8BA 1Q8IA 4IN3A 1U4RA 3WOFA 1CK1A 4OIJA 4MT5A 1EEFD 5EJWA 4MHEA 4CKCA 2WP9B 2LGIA 4ZUIA 1CZGA 1TWCB 4DU9A 5BMHA 2D62A 4J1MA 4FVMA 3VRAB 1F9QA 3C46A 2BB5A 1SYFA 1KNAA 4ZUJA 2A6HC 5G5HA 4DXFA 2EYMA 1GUSA 1LTBD 2X6GA 1RJTA 3TP6A 5IT9E 1DZ1A 1G8ZD 2F1MA 5EKIA 2WDQB 4PT5A 4TRDA 4BS9A 1EWHA 2KN4A 1A15A 1EQVA 3VR9B 4C2MB 2BT6A 1PRTC 1BCPC 1FO4A 3I90A 1GPXA 3R93A 1TYGB 3OOCA 2M9VA 2E75C 2B8FA 1OXSC 1RKNA 3E5SA 2B2TC 4ZKBB 2NBFA 3MVVA 1HHVA 1KDAA 4ABNA 2BE5D 1SNMA 3GP7A 2LMCA 2K5PA 1DOKA 3AMZA 1E9MA 4KV6A 3NS1A 5KNCA 3AE1B 3QIAA 1HXYD 2WXQA 5JAVA 1E0BA 2VB2X 3LYYA 1K83B 3I4MB 2K0PA 1RWSA 3OIQA 4WRDA 1K8OA 1P7EA 2B2WC 4GZYC 5CV8A 3GD7A 2CJOA 3T51B 5ELEA 3TEWA 1WD0A 3NQIA 1JQYD 2N7JA 3ABVB 2WXGA 2DY8A 2CJNA 5C2TB 2LFIA 1XO3A 5E4XA 1BR9A 3W5UB 1D1KA 2KWDA 1QNUA 4X3UA 4BY1B 1PXUA 4EVOA 4US8A 1LT5D 4KTAA 4LTUA 5C4JB 3P42A 4FO2A 4PMBA 2YU9B 4WURA 1DGJA 1J8IA 1BUVT 4RF0A 2K28A 2L55A 3K7AB 2MGSA 1S5DD 4FF1A 2KCCA 5EKKA 3NPPA 3RPFC 1SYCA 3NVVA 4NMZA 1RFKA 3Q8CA 2QILA 2SAKA 2K6AA 1VR9A 2NTTA 5FLXE 4IUTA 1HTPA 1SXTA 3LWEA 2AWNA 1L4ZB 2NVXB 2RDFA 4KY6A 3NQTA 3NWSA 1C79A 3W9CB 3L7ZC 2W3SA 1FFVA 2BTEA 1E6EB 4BBSB 4HTHA 4O42A 4A3KB 1KRHA 5BYQA 1DOMA 3FEWX 4CJ1B 3URYA 3AE5B 1K8MA 2LS01 5BN3A 3OWFA 4G7OC 3WDNA 2WXPA 3E6ZX 1AZQA 4OL7A 2VB3X 1JOQA 1G2SA 2I38A 1FNVA 4C80A 1TS5A 1ZE3D 3TEYA 1PFMA 5T8IA 4K5XA 3EQLC 1WTRA 4C7YA 1IBXB 3NVYA 1D1IA 1STEA 4N58A 1EY7A 2W82A 3OMGA 4C3JG 3A7AB 1B3AA 4KN4C 4EQPA 1VZ8A 2CHBD 3HOZB 3C1FA 1PZJD 1AYFA 2JQRB 4TKOB 3KLRA 1JWMD 1B4OA 3Q0AA 1HRJA 1FXAA 1EU4A 3OW7A 4PNYA 2WKCA