2C7HA

Solution nmr structure of the dwnn domain from human rbbp6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GPLGSMSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dwnn, a Novel Ubiquitin-Like Domain, Implicates Rbbp6 in Mrna Processing and Ubiquitin-Like Pathways
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin-like protein
molecule keywords RETINOBLASTOMA-BINDING PROTEIN 6, ISOFORM 3
total genus 18
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08783 DWNN DWNN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c7hA00
3DBSA 4BVUC 3PREA 2G4DB 1WXSA 3I3TB 3QC8B 3QHTA 4FJZA 4JGHB 1WGYA 3VAWA 4ANVA 2N7DA 4IM2A 2KTFA 3OJ3A 1ZGUB 4GN1A 2KQ7A 4HK2A 4B6WA 3ALBA 3OAWA 4MDKE 2KHWB 4B95A 1NI2A 2LXCA 3LJ3A 2KVRA 2MWSB 2N1WA 4DXAB 2CHWA 2KNBA 4W9EA 3UINB 1E90A 1VD2A 1WE7A 1GNUA 4KDIC 1V49A 2OJRA 3A1QA 4GGQA 4MSQB 5AZHA 4DBGA 3L0WB 3PGEA 1GG3A 1K8RB 3A9JA 4NAWA 5L83A 2M8SA 4FJYA 3H1UA 4TQ0A 3UQBA 2RSUA 2DZIA 1V81A 2HD5B 3H9DA 2BWFA 2MBQA 3KW5B 2MCNB 1Z5SB 5DCNA 4A20A 2DX5B 3HHMA 2KJRA 3DBLI 2YVCA 3ZIMA 4WJPA 4PYZA 4HJKA 2GMIC 2ZPNA 3HK0A 1J8CA 4TUUA 2KANA 5D94A 1WRDB 1Q1OA 4W9HA 5JHBA 3ZO5B 3R7RA 4LDTD 2LD9A 1E8ZA 2DENB 4YL8A 2K6QA 1PQSA 4HVBA 2WYQA 1WGRA 3QK0A 2ZEQA 3JSVB 5C23A 4WWOA 4NPNA 4FULA 2MQJA 2KK8A 5KHOA 2KFKA 2BYVE 5AZFA 3DVGY 1WJNA 2LVQA 2DHZA 5DPRA 4MEMA 4PS8A 4BKSA 1TZ1A 3WA0A 2MLBA 4JIOU 4ZYNA 2FIDA 4AP4C 5DPWA 2IYDB 3CF6E 1UELA 4FJVB 2J0KA 1E5WA 2PJHA 2LRUA 1GC7A 5D7GA 3KYCD 4AWJA 3DVGX 3VHTC 1GC6A 2REXA 2KX3A 3A9KA 1E8WA 2JZ3B 3PPAA 2CKHB 1T0YA 4W9IA 1Q5WB 2DYMA 3VUXA 4EFOA 4IWPA 3H6NA 2AWTA 3ENEA 2L0FA 1QZEA 4RM8A 1ZW7A 1M94A 2J7QB 4LCDE 4W9JA 3UGBB 5J17A 5J2RA 1WX9A 3BY4B 2KQSA 3APFA 3R3MA 3DVNU 3PTFC 1GUAB 1L7YA 1LXDA 2K25A 4HWIB 4I6NB 3ZKJC 4KSKC 5LXHA 4M0WB 3PZDA 3X0WA 4KIKB 5C1ZA 2LXAA 2XEWA 4GMVA 2HJ8A 3RYTA 3ZVVA 2LGXA 2C7NB 3VTVA 2BPSA 2O2VA 3AU5A 2MBBB 4F8CB 1WF9A 3X23A 2O2VB 1EF5A 2KXJA 2MW5A 3QCAA 2G3QB 4NQLB 2EMSA 2N4FA 4KSLC 2FIFA 4E3CA 3DDCB 2WX1A 1MG8A 4ZDVA 4BKSD 3Q3FA 4K7UA 4P7IA 2IO3B 3IHPC 4ZRIA 4ANXA 3HM3A 3WIMA 1RAXA 3WAPA 1V2YA 4WWNA 4DHJB 4I6LB 3VFKA 1FXTB 1WR1A 5DPTA 2XK5B 4M8NA 2L3ZA 2Z0DB 1IYFA 2M1MA 3L10B 2CHZA 2XBBC 2KJHB 3VH3B 2ZVOA 4MELA 4BOSC 3PS6A 1RFAA 1UGMA 2C60A 2DYBA 4IW0A 4PS3A 4LJOB 2BWES 4GXBA 4II3B 1OTRB 1P98A 1WMHB 2GBKA 4KZ0A 1UBIA 5HKHA 2LZ6A 5JH5C 2KFJA 2KO3A 3KYDD 2O6VA 2MBOA 1NDDA 3WAMA 3RCZA 4TKNA 3UIPB 4ANWA 2KN5A 4NY0A 3RT3B 1U4AA 1UZXB 3A9JB 3NOBA 4GOCA 4NAWB 4DDGD 2MP2A 2QHOA 2FCQA 2G4SA 2NBUA 4NJ7A 2UYZB 3L17A 4WJQA 2LUEA 3AXCA 4HPLB 2C9WB 4MGZE 1WH3A 4TV3A 1WYWB 4ICVA 4MGKE 3W1YA 3QA8A 2KTRB 4HXDA 2D07B 2KWVB 3KUDB 4G3XB 2XK5A 3WANA 2LGDA 4RM9A 3VVWB 1Y8RC 1VCBA 4KDLB 5IAAC 4M8MA 1WX7A 1SGHA 3DBRI 4JLCA 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 1YQBA 2AL3A 2GBJA 2YLMA 4KIKA 1GJZA 3ZUNA 2RGFA 4W9CA 5DPSA 4K1RB 1WGDA 1V5OA 2DAJA 3RUIB 3OLMD 1WXAA 2CU1A 1YX5B 2R2QA 4RMAA 4W9FA 3RZFA 4BFRA 1XT9B 4MJSA 1NBFC 2ZNVC 4GDKA 4NJ6A 2PPHA 4EKUA 3M3JA 3IG3A 3QAQA 3PLVA 1WGHA 2PE6B 1EUVB 3CSFA 4IWOA 2LRWA 1A5RA 2FUHB 2IO1B 2ZZPB 4JL9A 3R66C 3NZSA 3D32A 3SHQA 4EZLA 2UWQA 3VH4B 4E74A 3C0RB 3R7QA 1WY8A 2A4ZA 1WJ4A 2W9NA 4G50A 4I6PA 4CYEA 2O6VD 3VQIA 4FADA 4DHZE 2I1KA 3TL5A 2D3GA 2NPTB 3H7PB 1WR6E 5J18A 4A3OA 1OEYA 5TR5A 4K7WA 3V6CB 2GBMA 3NS8A 3M62B 2NCNA 5G55A 2KKCA 2RR9A 5KHQA 1J19A 1RLFA 3O65B 3RZWC 2MSED 3K9PB 2KWCA 3A1QB 2IBIB 4K81A 2BF8B 5CTRC 3PVLA 3A4RA 1H4RA 1WFYA 2LWPA 2NBVB 3H7SA 2D11A 2LASA 4KZCA 3WAOA 2KWUB 5AZGA 1TTNA 2L00B 2J0MA 3ZNZB 1HE8A 3N30A 3MTNB 3W1SC 3K9OB 2KDFB 2Z0EB 2V4LA 4FHKA 4FN2A 3DBHI 1F9JA 2KMCA 1E8YA 3EFUA 1LFDA 1LM8B 2J0JA 4BKTA 5AEKB 3U8ZA 2C5LC 2NR2A 2WWZA 2KX0A 2JF5A 1C3TA 4LJPB 1Q0WB 2LVPA 4MSMB 3PT2B 1UBQA 1AARA 1YJ1A 3JVZX 2B3AA 4TQ1A 3TBLD 1P0RA 2K8BA 2MX2A 4X57B 2KDEB 2RD0A 3EC8A 4NQKE 3CMMB 3GZNI 2BKFA 3P2BA 1WZ0A 1S3SG 3L13A 3NY5A 1P9DU 3KUCB 2C7MB 4URKA 1UD7A 2LVOA 2K39A 2OOBB 3V61A 2JXXA 3PV1A 1IP9A 4MJSB 1E8XA 2KMAA 1WE6A 1I35A 2C7HA 2GOWA 1V80A 1WGGA 1V6EA 3M95A 3ZW3A 4CHKA 2ZCBA 4DWFA 4HCPB 3UIOB 4KV2A 3KH0A 3VUYA 3ZTDA 4EUTA 2PEAA 3SD5A 2FCMA 2N1VA 3HIZA 1EO6A 1R4MI 3KVFB 1WXMA 2KLGA 3ZLZA 2K8CA 5E6OA 4IC7B 2K1FA 4DHZB 3HM6X 1I42A 5CX3A 2Z59B 2MBHA 4FBJB 3N32A 1R4NI 3ML9A 2DZJA 1OQYA 1ZKHA 2K6DB 2G45B 5JZEB 1P1AA 4DHJD 2KOXA 5FR6A 1WXVA 3TCAA 3ZNGC 3JSVA 2VRRB 5EDSA 4GDLA 3T9LA 2KD0A 1D3ZA 2KFKB 2R2OA 3APDA 5CHWA 3TMPB 3LDZE 4EZJA 3BINA 1WIAA 4W9KA 2LI5A 1WZ3A 2GBNA 3DVNV 3A9KB 2MBEA 3Q3JA 5D2MB 1XQQA 2HE7A 4XX5A 2DZMA 1LQBA 1P3QU 2JVCA 2NS5A 2L0TA 1IPGA 4HDQA 1KOTA 5E6NA 5L95C 4XC2A 4ANUA 3CSTA 1ISNA 1C1YB 3L16A 2KC1A 2WX0A 3V6EB 1JRUA 4W9DA 1WX8A 2L8JA 2FCNA 3UF8A 1KM7A 2DAFA 2N9PC 4GB9A 4IUMB 3ZTCA 4EOYA 2M0XA 3UQAA 2BYEA 2LGYA 4PYUA 2BKRB 2JWZA 2NVUI 4GIVA 2AYOB 3TIXA 3QWZB 1H8CA 4MGIE 2AEHA 2JPHA 2HTHA 1YIWA 3B08A 4A3PA 4DK5A 3B0AA 3N3KB 2EMTA 4JQWC 4GDLB 2RPQA 2BGFA 2LJ5A 2JRIB 3PRMB 2D2QA 3PSEB 2CR5A 2JT4B 2KDIA 3NHEB 4K7SA 2GBRA 3PHXB 3RULA 1XD3B 3EECA 4EEWA 4KVGB 3GOEA 4HLEA 2N7EA 3B1LX 4IM0A 1OGWA 2L76A 4HCNB 4J6IA 4W9LA 3V60A 2N9XA 3DOWA 4MM3A 1L2NA 4F7ZA 3S2AA 4E71A 3DQVA 3ZDMC 3QIJA 4B9KA 3ZDTA 4PS7A 4F1SA 4ICUA 2N9EB 2BYFA 3KUZA 4XZ4A 2KTRA 3M63B 4G11A 2MA9B 3NZUA 2JZZA 3ZRFA 2ZJDA 3W1SA 3ML8A 2FNJB 1WI0A 4EZKA 3MJWA 1TBEA 4GSWA 4ASWC 2FAZA 2V3SA 3VXWA 2NBWB 4HDOA 5GMVA 4BOZB 2IY1B 4WAAA 4MH0E 4AJWA 2M4NA 3JYUA 4BBNF 2CS4A 3TJPA 2ZNVB 1CMXB 3L08A 3A33B 1KJTA 4NNJB 2ZPYA 4WJOA 2A5UA 2ASQA 4FA6A 1G6JA 1SIFA 1WMHA 1Z2MA 1YX6B 3PLUA 3IVFA 5LXIB 3VTWA 1J0GA 4GDKB 2KC2A 4WJNA 2AL6A 3ECIA 4OVUA 4BKGA 2Y5BB 2JUOA 1X1MA 3SDLC 3ZNHB 2IY0B 3IFWB 3VTUA 2MP2B 5BO4B 5CHFA 5D6JB 1TGZB 3APCA 3AULA 1S1QB 4W9GA 3IBEA 3ONSA 2NPTA 1SE9A 4IG7B 2IO2B 4LDTB 3U30A 3RD2A 3T8MA 4AJYB 3JW0X 3MHSD 3QX1A 4DDID 2MRPA 3PHWB 1WJ6A 4HPMB 3DPDA 3VDZA 4OVVA 5JHAA 2ZVNA 3H7PA 2IO0B 2IZVB 4FHJA 2FCSA 3L54A 4IM3A 4BBNC 1RRBA 1BT0A 2DYOA 2K8HA 2JRHA 3A4SC 1OEYJ 3ZRCA 1YD8U 2KDBA 3OJ4B 5IA7A 2M17A 2EKEC 5E6PA 3QJZA 1EF1A 4ZRJA 3VUWA 2O6VB 3U7DA 2L7RA 4G0NB 1WM3A 2CHXA 1E7UA 4N9F4 2D10A 3DCGA 2I1JA 4AOFA 4II2B 2KJ6A 3V62A 3AI5A 2JY6A 3EHVA 1E7VA 2DZKA 3QARA 1V9JA 4ZRKA 2KZRA 2V1YA 3AU4A 1V5TA 2ZCCA 3ZNID 4MGYE 1KLVA 2KLCA 2L05A 4GU2A 4IWQA 4AUQC 4WQOB 5CHVC 4WWPA 4CO7A 2PE9A 5LLIA 3WALA 3QQ8B 1UH6A 1WJUA 3PRZA 3SU8X 3PRPB
chains in the Genus database with same CATH superfamily
4BVUC 5G5HA 1WXSA 4KX6B 1FIQA 1WGYA 1MVKA 1QKZA 4GN1A 4HK2A 4B95A 1NI2A 1GAQB 3Q8FA 4B0MA 2KVRA 2N1WA 2KNBA 4OZAA 1FCLA 2MEKA 1T0QC 2V4IB 1NI3A 3DWGC 5L83A 2INDC 2FBWB 2WU5B 4MACA 5HG2A 3RNGC 2DZIA 2HD5B 2MBQA 3RNEC 5DCNA 1KF6B 3HHMA 2KJRA 3DBLI 2GRIA 1EWYC 3AE9B 1J8CA 3NVZA 5T8IA 5D94A 1MI0A 1Q1OA 4MH8A 3ZO5B 3R2TA 4LDTD 2K6QA 4NPNA 5KHOA 1SF0A 5E6JA 1TZ1A 2MLBA 4JIOU 4AP4C 2INCC 5DPWA 1KLUD 2LRUA 1GC7A 3AN1A 2H88B 2V9HA 2KX3A 1SXTA 1JROA 3ENEA 1QZEA 3UGBB 5J2RA 5J17A 4W9JA 1XCQL 3BY4B 1C79A 1JMLA 2QCZA 3Q69A 1PUTA 1GUAB 1L7YA 1LXDA 2WGSA 1CJEA 4KIKB 4JPSA 2UU7A 2DWQA 4LNIA 3X23A 1EF5A 2G3QB 3O13A 4E3CA 3DDCB 1MG8A 3Q3FA 4K7UA 3BVGA 1N62A 5D3DA 4ZRIA 4C7YA 1QT9A 2EELA 3AE3B 5DPTA 1CK1A 4M8NA 4CQNA 1T0RC 2ZVOA 4MELA 3FKYA 2QEJC 1UGMA 2DYBA 1PYWD 4LJOB 4GXBA 3OG5A 5HHDG 1UBIA 2KFJA 2D3AA 2MJEA 4P6VF 1NDDA 3WAMA 3UIPB 3VR9B 4NY0A 2I38A 4K3BA 4NJ7A 3L17A 1XLPA 4BAXA 2C9WB 4MGZE 4ZOHC 1WYWB 3W1YA 3QA8A 4HXDA 4OVZA 4G3XB 2WXJA 2LGDA 3VVWB 1Y8RC 4YTNB 1L4DB 1SGHA 3DBRI 4JLCA 3FILA 4KKJA 2YLMA 3ZUNA 4W9CA 4K1RB 1WGDA 3I9V1 3OLMD 2R2QA 1XT9B 2JXTA 1NBFC 4EKUA 2IPKD 3QAQA 1WGHA 2BQQA 3R2IA 3CSFA 1TS4A 2IO1B 2ZZPB 4JL9A 3R66C 4M01A 1WY8A 2W9NA 1WJ4A 1ZE3D 3I57A 1YOVB 2O6VD 3VQIA 1N6ZA 2I1KA 3TL5A 1WR6E 4A3OA 2VH1A 4K7WA 3U4EG 2NCNA 3MJ5A 2KKCA 1J19A 4A55A 2GI9A 3K9PB 4K81A 2BF8B 5CTRC 3H7SA 1QQRA 2V0GA 2D5GA 3ZNZB 3N30A 3W1SC 2V4LA 2LGSA 3BYYB 4YTMB 3EFUA 2KDMA 2C5LC 2NR2A 2WWZA 2KX0A 1Q0WB 3N20C 5BMIA 2J42A 1YJ1A 3MHZA 2K8BA 3P4SB 4NAMA 4C4VB 3CMMB 1WRIA 3HRDD 3GZNI 2N7JA 3NY5A 4ZHOA 4URKA 2IGGA 3V61A 2PVGC 1IP9A 2KMAA 3VRAB 3ZXVA 1YMHE 3ZW3A 4DWFA 4OW0A 2PEAA 2PVOD 2KACA 3LB8C 5IP4D 1I42A 1ET9A 1LGRA 4N58A 2DZJA 4FXCA 2G45B 1DOYA 1P1AA 5FR6A 3GB1A 5EDSA 2KD0A 3APDA 3Q3OC 1FXAA 1D5XC 1WZ3A 3DVNV 2MBEA 4WIPA 3P63A 3IXSA 1IPGA 1T0SC 2BW2A 5BMGA 1KOTA 3B9JA 5L95C 4TSSA 1C1YB 2K5PA 2WX0A 3V6EB 1WX8A 2AX5A 1KM7A 3ZTCA 4IUMB 3UQAA 2BYEA 1H8CA 2L83A 3BIID 2HTHA 3B08A 3B0AA 3Q6BA 2K3UA 1MPEA 2RPQA 2ZW1A 1T3QA 2D2QA 2WXMA 3IT6B 2JT4B 4K7SA 1FCCC 1R4MB 1XD3B 4KGRA 3GOEA 2WDVB 1L2NA 4HCNB 4W9LA 3V60A 3MC8A 4F7ZA 4E71A 3AE7B 1YQ3B 1UWMA 1Y56A 3QIJA 1DYQA 2M0AA 4ICUA 2BYFA 3TUOA 3M63B 4G11A 3ZRFA 2ZJDA 3W1SA 4EZKA 1TBEA 1D5MC 1AN8A 4HDOA 5GMVA 1UNSA 5TSSA 1EU3A 4AJWA 4BBNF 3JYUA 3RFZB 4MT5A 2J4XA 1QOFA 2A5UA 4FA6A 2I2YA 5LXIB 2KC2A 4RCOA 2DNFA 2Y5BB 3SDLC 3ZJUA 3ZNHB 2IY0B 3IFWB 1JWSD 1ZXHA 5CHFA 1ZPSA 5D6JB 1PGAA 3AE4B 1TGZB 2CU3A 4AJYB 2IO2B 3JW0X 3QX1A 4DDID 2MRPA 1AW7A 4OZCA 2XNAC 4YTPB 4OVVA 5EE9A 3B2GA 1L0VB 2IO0B 2IZVB 2FCSA 4FHJA 4IM3A 4XWTA 1N5WA 1RRBA 2JRHA 4H2AA 3N1YC 2KDBA 3AEBB 1YN4A 3QJZA 1EF1A 1E7UA 3V62A 1UWXA 2KZRA 2V1YA 2ZCCA 5BYQA 4L2YA 1J7BA 1WGKA 2BB5A 2PE9A 5LLIA 3WALA 1IGDA 3GE8C 3SU8X 3TEWA 3PRPB 2V3PA 3I3TB 3VAWA 4ANVA 4IM2A 3OJ3A 1ZGUB 1C4PA 5G5GA 2R61A 5IO9A 3ZXRA 2KHWB 3HUIA 4B0EA 3W2DA 2CHWA 1WE7A 1GNUA 1TS5A 4KDIC 1V49A 2OJRA 1VJKA 4GGQA 1C4CA 3L0WB 3PGEA 1JALA 1SB3C 3N1ZC 4KGTA 3AECB 2M8SA 4P16A 4FJYA 3RNBC 4K3CA 3UQBA 2MCNB 3H9DA 2Q5WD 4ARCA 4KGSA 1QOGA 1QOBA 4WJPA 1HXYD 2KANA 5C3JB 2X38A 2RPVA 2WXQA 1YJIA 2DENB 2WYQA 1YNTE 4FULA 1V1PA 1VZ7A 2KK8A 3DVGY 1WJNA 2LVQA 4PS8A 1NENB 4BKSA 3OWEB 2FIDA 2Y3AA 4ZYNA 3CF6E 4FJVB 5D7GA 2PJHA 3KYCD 3DWMA 3VHTC 2NTSA 1QLBB 2JZ3B 2Y5CA 1T0YA 4EFOA 1SE4A 2DYMA 4RM8A 4LCDE 2MH7A 1E9MA 1AWDA 3TEXA 2OEDA 1MG4A 3PTFC 1E10A 2QDFA 3ZKJC 4M0WB 3PZDA 1VR9A 4GMVA 2HJ8A 2LGXA 2C7NB 1TIFA 3AU5A 3N9YC 2MW5A 3QCAA 3W5UB 4KSLC 2WX1A 4ZDVA 4BKSD 3MC0B 4P7IA 2IO3B 3IHPC 4ANXA 4WWNA 4DHJB 3VFKA 1FXTB 1I4QA 3URYA 2CHZA 1HTOA 4BOSC 1L6UA 3PS6A 4IW0A 3RPFC 1P98A 3ZJTA 5AUIA 5JH5C 1R7SA 2O6VA 2MBOA 3H8HA 2KT7A 3NOBA 4NAWB 2PKOA 2MP2A 2BB6A 2WS3B 1IGCA 2UYZB 4AS1A 4WJQA 2LUEA 4LK0M 4ICVA 2BBCA 2KTRB 2D07B 3KWLA 4JX1C 2SEBD 3KUDB 4A8XC 2RMMA 3Q8BA 3U2SC 1WX7A 2E3TA 1MJDA 3L4PA 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 1F1HA 2EKIA 2JZPA 2RGFA 2B76B 1IBXA 3RZFA 4NJ6A 4RH6A 3LYYA 3PLVA 2BYTA 2LRWA 1A5RA 2WLBA 2FUHB 3VH4B 5FKAC 2A4ZA 1K53A 3UI3A 3IAS1 1FFVA 4FADA 5J18A 5TR5A 2N9LA 4WWMA 3NS8A 3V6CB 1JQ4A 1RLFA 2ACZB 2MSED 3EA6A 3A1QB 3PVLA 4ZRPA 1D5ZC 1WFYA 3U52E 3WCQA 2KWUB 5AZGA 2L00B 2J0MA 1FEHA 1PFDA 3AB5A 3K9OB 2J53A 4FN2A 2KMCA 1E8YA 1LFDA 1D6EC 5AEKB 4LJPB 2MJDA 2LVPA 4MSMB 3SEBA 3NVVA 3IAM1 1TKGA 3AE6B 2BKFA 3DBHB 3L13A 3KUCB 2WHIA 2K39A 2VZKB 1XCTL 3DHHC 4MJSB 1E8XA 2INPE 2PLPA 4XDDA 1QOAA 2C7HA 1V80A 1WGGA 2WXPA 4CHKA 3ZTDA 3SD5A 2N1VA 3HIZA 4XWWA 1FO4A 3P4RB 2KLGA 4IC7B 3AE2B 1VRAB 3TSSA 2LHDA 1R4NI 3ML9A 5GXGB 1FNUA 2BS3B 2PIAA 3TEYA 4L23A 3ZNGC 3J9CA 3JSVA 2W54A 3T9LA 1KFYB 1D3ZA 3RN9C 3LDZE 1TS2A 4EZJA 1WIAA 2AQ3B 3A9KB 1VLBA 1XQQA 2DZMA 2L0TA 5FK9C 4HDQA 2IJ0A 2PTLA 2RDGA 1ISNA 2KC1A 3B2FA 2MJ3A 4GB9A 2L1AA 4P1BC 1RM6C 2LHEA 4IDIA 4PYUA 2NVUI 1ZUD2 2JWZA 4GIVA 2AYOB 3TIXA 4MGIE 2AEHA 2KYWA 1GOZA 1YIWA 4DK5A 4D2KA 4YSZB 2BGFA 2LJ5A 1FD6A 2JRIB 3PRMB 4RF1A 2CR5A 1CQVA 3NHEB 3LXFA 3EECA 2N7EA 4REZA 1T6BX 4J6IA 1F77A 1FXIA 3ZDMC 2WQYB 3ZDTA 4RGTA 4F1SA 2WNMA 2MA9B 3BVZA 1N60A 2NTTA 3ML8A 2JX5A 2LEKA 4S17A 1V1OA 2NBWB 2V3SA 3DBLB 4BOZB 4WAAA 4MH0E 2M4NA 2CS4A 4WAFA 1N5XA 1RWSA 3TJPA 2ZNVB 1CMXB 2ZPYA 4WJOA 3ZYYX 1AYFA 1SIFA 1Z2MA 2K0PA 1YX6B 3PLUA 3IVFA 1J0GA 2KAJA 3GZNB 4OVUA 2RDHA 2JUOA 1X1MA 5IKCM 5H92C 2MP2B 3AEGB 5IOIA 4W9GA 3IBEA 1SE9A 2AQ2B 3T8MA 3AE5B 2MHJA 3PHWB 3VDZA 2Y5PA 3IT4B 5JHAA 3L54A 4BBNC 1BT0A 3A4SC 1HZ6A 2BS4B 2YEPB 3N1XC 2EKEC 4HKZE 4TMAB 3U7DA 4G0NB 2CHXA 4N9F4 2D10A 2I1JA 4AOFA 4II2B 3AI5A 1E7VA 2DZKA 2CJNA 3AU4A 1V5TA 4MGYE 2WXNA 2KLCA 2L05A 4IWQA 4WQOB 5CHVC 3RNFC 1OFFA 4IOIE 1TZOA 1UH6A 3FC4A 1YN3A 1SBBB 3DBSA 3PREA 3QC8B 3BVMA 4FJZA 2N7DA 2IDYA 3CIRB 4B6WA 1MHHE 3ALBA 1EM7A 3LJ3A 4RGMA 4DXAB 1E90A 1VD2A 2QSDA 3A1QA 4MSQB 4DBGA 1GG3A 1K52A 1K8RB 4NAWA 3NVWA 1L0YB 1FNWA 2RSUA 4MM3B 1V81A 2GB1A 4BZAA 2DX5B 2G1EA 2YVCA 2N9KA 3HK0A 2JSVX 2FE8A 1PGXA 3P4QB 2D3CA 4W9HA 3R7RA 1FRDA 4RGOS 1WGRA 2ZEQA 3JSVB 5C23A 2K9XA 3MFGA 2BYVE 2DHZA 5DPRA 4MEMA 2W3RA 3WA0A 1XLOA 2IYDB 3PO0A 1UELA 1E5WA 4AWJA 1GC6A 2REXA 1E8WA 2ICIA 3VUXA 4IWPA 3ABVB 3H6NA 3Q2AC 1ZW7A 3VR8B 4ITKA 2KQSA 1DOIA 1NVID 4JWUC 5D3IB 4US8A 3AM9A 5FR3A 1ESFA 4HWIB 4I6NB 5LXHA 1JWBD 1E7PB 2W55A 3EFCA 5C1ZA 4ARIA 2XEWA 1HZ5A 3ZVVA 3VTVA 2MBBB 4F8CB 2O2VB 2KXJA 5EE1A 3CWIA 1I4GA 1KTKA 2FIFA 1C9FA 4JWSC 3HM3A 3WIMA 1UF0A 4NZLB 4I6LB 1ACCA 2XK5B 4C56C 2L3ZA 3Q8AA 2Z0DB 3AH7A 2M1MA 3Q8CA 1FM0D 1PGBA 2XBBC 2KJHB 3BZDB 1K51A 1TJEA 3VH3B 1RFAA 2C60A 1XEEA 1TT5B 1N63A 2QIEB 2BWES 3SR6A 4KZ0A 5HKHA 2KO3A 4HROA 3RCZA 4N59A 4TKNA 1XF5L 1Q10A 2X8XX 2KN5A 3RT3B 4GOCA 3A9JB 3W9CB 2AQ1B 3V3XA 2FCQA 2G4SA 4YSYB 4TV3A 4MGKE 2W82A 1DGJA 2KWVB 2JWUA 4M8MA 2RDBC 1R4NB 2WP9B 2AL3A 2XN9C 1GJZA 4WQMA 5DPSA 1V5OA 4AQ7A 4W9FA 2CU1A 1YX5B 4BFRA 4MJSA 4P1CC 2ZNVC 4GDKA 2PPHA 2PMVA 3M3JA 3IG3A 2V3NA 1V97A 2PE6B 5BYSA 1EUVB 1WYGA 4IWOA 1I4PA 3AV8A 2VZKD 3BK2A 2UWQA 4E74A 3I63C 3R7QA 1L0XB 4I6PA 2JQRB 4G50A 4CYEA 4DHZE 2D3BA 2D3GA 2NPTB 3H7PB 1OEYA 3E9SA 2RR9A 5KHQA 3RZWC 2DLBA 2IBIB 1GB4A 1H4RA 2LWPA 4A9AA 2NBVB 2LASA 4KZCA 3WAOA 2KMMA 4QAYA 1TY2A 3MTNB 2WU2B 4FHKA 3DBHI 2ONQA 1JWUD 2OHFA 4BKTA 2JF5A 1C3TA 1P7EA 2BT6A 3PT2B 1UBQA 1AARA 3JVZX 1YN5A 2HTME 3KQ4A 2L52A 4PT5A 1SJHD 1ZP0B 4TQ1A 2B3AA 1P0RA 2MX2A 4X57B 3EC8A 4NQKE 3P2BA 1WZ0A 1JWMD 1P9DU 2C7MB 2LVOA 3PV1A 2M19A 1HEZE 2GOWA 1V6EA 2ZCBA 4HCPB 3UIOB 1TYGB 1WXMA 3ZLZA 5E6OA 3NVYA 2IGHA 4DHZB 1I4RA 4FBJB 3N32A 1OQYA 1ZKHA 2K6DB 3FILB 4M02A 4DXGA 2KOXA 2WXIA 1WXVA 2VRRB 4GDLA 3NZ3A 5CHWA 3TMPB 3BINA 4W9KA 5D2MB 3Q3JA 1ENFA 1JRPA 2HE7A 4XE0A 2N0SB 1PDXA 3GS2A 1LQBA 4IKGA 1SE2A 1P3QU 4R3DA 2NS5A 2YEPF 1NYRA 4JE3B 3C8YA 2L32A 1A70A 4XC2A 3CSTA 3DBRB 1VDVA 2KN4A 4HEA1 5MPOA 5AUKA 1K50A 2DAFA 4EOYA 1SIJA 2M0XA 2LGYA 2BKRB 3QWZB 1ROEA 2JPHA 4US9A 4XDCA 3N3KB 1I4XA 1VZ8A 2IGDA 4JQWC 4XGAB 2KWDA 4GDLB 5BMHA 3AEFB 1UUPA 3PSEB 2KDIA 3RULA 4A6QA 3E56A 4KVGB 3NG0A 3B1LX 4IM0A 1OGWA 2L76A 2N9XA 3DOWA 3BYTB 1B9RA 1L4ZB 3DQVA 4B9KA 1F2RC 4PS7A 1KRHA 1BMLC 2N9EB 2KTRA 3NZUA 2JZZA 1WI0A 4LLGM 3MJWA 1WWTA 2NMQA 2FAZA 4OHJA 3A33B 1KJTA 4NNJB 2ASQA 1WMHA 1FRRA 2WXKA 3AEDB 2QJLA 1FFUA 3VTWA 3ZJVA 5JXVA 1E0ZA 3ECIA 1L5PA 4BKGA 5I4DA 3VTUA 3FAHA 1WSPA 3APCA 3AULA 1S1QB 4LNKA 2NPTA 4IG7B 3MHSD 2KVZA 2WXLA 3DPDA 2ZVNA 3W5VB 1HTQA 3Q14C 4M0WA 2K8HA 1FMAD 1RYJA 1OEYJ 3OJ4B 5IA7A 2M17A 4KKIA 3BK1A 2WXHA 4ZRJA 3VUWA 2O6VB 2L7RA 1ZOYB 3EHVA 2W3SA 1TY0A 1T5XD 3HVZA 4GU2A 4XYCA 2G4DB 3ZQ4A 1ZDVA 3QHTA 4JGHB 1STEA 2KTFA 3KLSX 2KQ7A 3NS1A 3DHIC 3OAWA 4MDKE 4HPPA 3MC9A 2LXCA 2M56B 2MWSB 1SEBD 4W9EA 2BTEA 3NUHB 3UINB 1OQRA 1C4AA 5AZHA 4YSXB 4C00A 3A9JA 3AEAB 3H1UA 4TQ0A 2BWFA 3KW5B 1Z5SB 5HFYA 4A20A 1IUEA 4L1BA 3U7ZA 3ZIMA 4PYZA 4HJKA 2GMIC 2ZPNA 4TUUA 4S0RA 1E6EB 1WRDB 3R8BA 1MFWA 3T3NA 3AE1B 2ZW0A 5JHBA 4HRSA 2LJIA 2LD9A 1E8ZA 4YL8A 1PQSA 4HVBA 3PZ8A 3QK0A 4WWOA 2MQJA 4NJCA 2KFKA 5AZFA 4C80A 1SJED 2J0KA 3DVGX 3A9KA 3PPAA 2CKHB 4W9IA 1Q5WB 3NJTA 3RNCC 2AWTA 2L0FA 1F0ZA 1M94A 2J7QB 1EU4A 3AE8B 1WX9A 2GLSA 3APFA 3R3MA 1NEKB 3DVNU 2LUMA 4USAA 4GLSC 3GE3C 1KH0A 2K25A 4KSKC 3EUB2 3X0WA 2LXAA 3RYTA 2BPSA 2O2VA 3P1MA 1C78A 1WF9A 4NQLB 2EMSA 2N4FA 4EE2A 1CZPA 3RI7C 1L6VA 1KLGD 1JWAD 2BVCA 1RAXA 3WAPA 1V2YA 2K22A 1WR1A 1VZ6A 2JYTA 1IYFA 3L10B 1C76A 3DHGC 1XLQA 4PS3A 1WXQA 1V8CA 1QILA 4II3B 1OTRB 2VH2A 1WMHB 2GBKA 2LZ6A 3KYDD 5LNK1 2WXOA 3ETRA 4ANWA 1U4AA 1UZXB 2DBYA 1HA5A 4DDGD 2QHOA 4C7ZA 2NBUA 2BS2B 3AXCA 4HPLB 4RNAA 1WH3A 1NYQA 4WURA 1SSNA 2QMTA 1DOXA 2XK5A 3WANA 4RM9A 1VCBA 4KDLB 5IAAC 3RNAC 5EE0A 3TEZA 3SFEB 1YQBA 2GBJA 4KIKA 2H89B 1J7AA 2DAJA 1YQ4B 3RUIB 1WXAA 4RMAA 5BYRA 1F52A 4RGNA 2Z8LA 1N61A 2G9HD 4UDUC 3NZSA 4ZRQA 3D32A 3SHQA 4EZLA 3C0RB 3BWUD 4ZHPA 1YJJA 2GBMA 3M62B 4LNOA 5G55A 3O65B 2PW9A 1D4BA 1HQRD 2KWCA 1LO5D 3NRZA 1GPXA 3A4RA 2D11A 2OJWA 1TTNA 2JU6X 4RF0A 1HE8A 1I4HA 3ZGZA 1FPYA 2KDFB 2Z0EB 4YWGG 1F9JA 1LM8B 2J0JA 3U8ZA 2HJ1A 4J3OD 3TBLD 2QILA 2KDEB 2RD0A 3MP9A 1SE3A 4C4VA 2CJOA 1S3SG 2KQ4X 4M00A 1UD7A 2OOBB 2JXXA 2JYEA 1WE6A 1I35A 2INNE 3M95A 4WH4A 4KV2A 1UGJA 3KH0A 3VUYA 4EUTA 2LGIA 2FCMA 3KWVA 1MHXA 1EO6A 1R4MI 3HVDA 3KVFB 2K8CA 4Q2JA 1J7CA 2K1FA 3HM6X 5IN7A 5CX3A 2Z59B 2MBHA 2E6XA 1TS3A 3RMKC 4PK1A 1TKYA 5JZEB 4DHJD 1XXGA 3TCAA 1C77A 2SAKA 1BUIC 2KFKB 2R2OA 1P7FA 2LI5A 2GBNA 4XX5A 2JVCA 4LTUA 4OZBA 5E6NA 1XLNA 4ANUA 2QC8A 3C19A 3L16A 3SFDB 1FNVA 4W9DA 1JRUA 2L8JA 2FCNA 3UF8A 2N9PC 2LFIA 4ZYSA 2HDEA 3P42A 4A3PA 1I7HA 2EMTA 1ET6A 1V1PB 1TKEA 3V05A 3I5JC 2J52A 4LNNA 1ZXIA 2GBRA 3PHXB 4EEWA 4LNFA 4RFBA 4HLEA 3VRBB 4MM3A 3Q3NC 3S2AA 4DXFA 4O1NA 2WXRA 1XO3A 4XZ4A 3KUZA 3Q8EA 3AEEB 1BXTA 5C2TB 1B1ZA 1M4VA 4HJGE 3AMZA 2FNJB 2WDQB 4GSWA 4ASWC 3GP7A 1EWCA 3VXWA 4ACFA 2IY1B 4N6EB 5H8YE 5EE3A 2WXFA 3L08A 5HI1A 1F2RI 1G6JA 2WDRB 2FUG1 1JCKB 4GDKB 4WJNA 2AL6A 4DQOC 3PZ7A 2TSSA 1ZDXA 5BO4B 3ONSA 4YT0B 4LDTB 3U30A 3RD2A 2WXGA 3P4PB 1WJ6A 4HPMB 4HKQA 3H7PA 1RFKA 3T3OA 2DYOA 3Q3MC 2ON8A 3ZRCA 1YD8U 5E6PA 1IBXB 3EGRA 4YXDB 1WM3A 1QF6A 3DCGA 1OQQA 2KJ6A 2JY6A 1JW9D 4A90A 2LMCA 3QARA 1V9JA 4ZRKA 3ZNID 1KLVA 1GB1A 4AUQC 4WWPA 4CO7A 3QQ8B 1WJUA 3PRZA
chains in the Genus database with same CATH topology
3DBSA 4BVUC 3PREA 2G4DB 1WXSA 3I3TB 3QC8B 3QHTA 4FJZA 4JGHB 1WGYA 3VAWA 4ANVA 2N7DA 4IM2A 2KTFA 3OJ3A 1ZGUB 4GN1A 2KQ7A 4HK2A 4B6WA 3ALBA 3OAWA 4MDKE 2KHWB 4B95A 1NI2A 2LXCA 3LJ3A 2KVRA 2MWSB 2N1WA 4DXAB 2CHWA 2KNBA 4W9EA 3UINB 1E90A 1VD2A 1WE7A 1GNUA 4KDIC 1V49A 2OJRA 3A1QA 4GGQA 4MSQB 5AZHA 4DBGA 3L0WB 3PGEA 1GG3A 1K8RB 3A9JA 4NAWA 5L83A 2M8SA 4FJYA 3H1UA 4TQ0A 3UQBA 2RSUA 2DZIA 1V81A 2HD5B 3H9DA 2BWFA 2MBQA 3KW5B 2MCNB 1Z5SB 5DCNA 4A20A 2DX5B 3HHMA 2KJRA 3DBLI 2YVCA 3ZIMA 4WJPA 4PYZA 4HJKA 2GMIC 2ZPNA 3HK0A 1J8CA 4TUUA 2KANA 5D94A 1WRDB 1Q1OA 4W9HA 5JHBA 3ZO5B 3R7RA 4LDTD 2LD9A 1E8ZA 2DENB 4YL8A 2K6QA 1PQSA 4HVBA 2WYQA 1WGRA 3QK0A 2ZEQA 3JSVB 5C23A 4WWOA 4NPNA 4FULA 2MQJA 2KK8A 5KHOA 2KFKA 2BYVE 5AZFA 3DVGY 1WJNA 2LVQA 2DHZA 5DPRA 4MEMA 4PS8A 4BKSA 1TZ1A 3WA0A 2MLBA 4JIOU 4ZYNA 2FIDA 4AP4C 5DPWA 2IYDB 3CF6E 1UELA 4FJVB 2J0KA 1E5WA 2PJHA 2LRUA 1GC7A 5D7GA 3KYCD 4AWJA 3DVGX 3VHTC 1GC6A 2REXA 2KX3A 3A9KA 1E8WA 2JZ3B 3PPAA 2CKHB 1T0YA 4W9IA 1Q5WB 2DYMA 3VUXA 4EFOA 4IWPA 3H6NA 2AWTA 3ENEA 2L0FA 1QZEA 4RM8A 1ZW7A 1M94A 2J7QB 4LCDE 4W9JA 3UGBB 5J17A 5J2RA 1WX9A 3BY4B 2KQSA 3APFA 3R3MA 3DVNU 3PTFC 1GUAB 1L7YA 1LXDA 2K25A 4HWIB 4I6NB 3ZKJC 4KSKC 5LXHA 4M0WB 3PZDA 3X0WA 4KIKB 5C1ZA 2LXAA 2XEWA 4GMVA 2HJ8A 3RYTA 3ZVVA 2LGXA 2C7NB 3VTVA 2BPSA 2O2VA 3AU5A 2MBBB 4F8CB 1WF9A 3X23A 2O2VB 1EF5A 2KXJA 2MW5A 3QCAA 2G3QB 4NQLB 2EMSA 2N4FA 4KSLC 2FIFA 4E3CA 3DDCB 2WX1A 1MG8A 4ZDVA 4BKSD 3Q3FA 4K7UA 4P7IA 2IO3B 3IHPC 4ZRIA 4ANXA 3HM3A 3WIMA 1RAXA 3WAPA 1V2YA 4WWNA 4DHJB 4I6LB 3VFKA 1FXTB 1WR1A 5DPTA 2XK5B 4M8NA 2L3ZA 2Z0DB 1IYFA 2M1MA 3L10B 2CHZA 2XBBC 2KJHB 3VH3B 2ZVOA 4MELA 4BOSC 3PS6A 1RFAA 1UGMA 2C60A 2DYBA 4IW0A 4PS3A 4LJOB 2BWES 4GXBA 4II3B 1OTRB 1P98A 1WMHB 2GBKA 4KZ0A 1UBIA 5HKHA 2LZ6A 5JH5C 2KFJA 2KO3A 3KYDD 2O6VA 2MBOA 1NDDA 3WAMA 3RCZA 4TKNA 3UIPB 4ANWA 2KN5A 4NY0A 3RT3B 1U4AA 1UZXB 3A9JB 3NOBA 4GOCA 4NAWB 4DDGD 2MP2A 2QHOA 2FCQA 2G4SA 2NBUA 4NJ7A 2UYZB 3L17A 4WJQA 2LUEA 3AXCA 4HPLB 2C9WB 4MGZE 1WH3A 4TV3A 1WYWB 4ICVA 4MGKE 3W1YA 3QA8A 2KTRB 4HXDA 2D07B 2KWVB 3KUDB 4G3XB 2XK5A 3WANA 2LGDA 4RM9A 3VVWB 1Y8RC 1VCBA 4KDLB 5IAAC 4M8MA 1WX7A 1SGHA 3DBRI 4JLCA 5G2NA 4FLHA 2WDTB 1V86A 1WM2A 1YQBA 2AL3A 2GBJA 2YLMA 4KIKA 1GJZA 3ZUNA 2RGFA 4W9CA 5DPSA 4K1RB 1WGDA 1V5OA 2DAJA 3RUIB 3OLMD 1WXAA 2CU1A 1YX5B 2R2QA 4RMAA 4W9FA 3RZFA 4BFRA 1XT9B 4MJSA 1NBFC 2ZNVC 4GDKA 4NJ6A 2PPHA 4EKUA 3M3JA 3IG3A 3QAQA 3PLVA 1WGHA 2PE6B 1EUVB 3CSFA 4IWOA 2LRWA 1A5RA 2FUHB 2IO1B 2ZZPB 4JL9A 3R66C 3NZSA 3D32A 3SHQA 4EZLA 2UWQA 3VH4B 4E74A 3C0RB 3R7QA 1WY8A 2A4ZA 1WJ4A 2W9NA 4G50A 4I6PA 4CYEA 2O6VD 3VQIA 4FADA 4DHZE 2I1KA 3TL5A 2D3GA 2NPTB 3H7PB 1WR6E 5J18A 4A3OA 1OEYA 5TR5A 4K7WA 3V6CB 2GBMA 3NS8A 3M62B 2NCNA 5G55A 2KKCA 2RR9A 5KHQA 1J19A 1RLFA 3O65B 3RZWC 2MSED 3K9PB 2KWCA 3A1QB 2IBIB 4K81A 2BF8B 5CTRC 3PVLA 3A4RA 1H4RA 1WFYA 2LWPA 2NBVB 3H7SA 2D11A 2LASA 4KZCA 3WAOA 2KWUB 5AZGA 1TTNA 2L00B 2J0MA 3ZNZB 1HE8A 3N30A 3MTNB 3W1SC 3K9OB 2KDFB 2Z0EB 2V4LA 4FHKA 4FN2A 3DBHI 1F9JA 2KMCA 1E8YA 3EFUA 1LFDA 1LM8B 2J0JA 4BKTA 5AEKB 3U8ZA 2C5LC 2NR2A 2WWZA 2KX0A 2JF5A 1C3TA 4LJPB 1Q0WB 2LVPA 4MSMB 3PT2B 1UBQA 1AARA 1YJ1A 3JVZX 2B3AA 4TQ1A 3TBLD 1P0RA 2K8BA 2MX2A 4X57B 2KDEB 2RD0A 3EC8A 4NQKE 3CMMB 3GZNI 2BKFA 3P2BA 1WZ0A 1S3SG 3L13A 3NY5A 1P9DU 3KUCB 2C7MB 4URKA 1UD7A 2LVOA 2K39A 2OOBB 3V61A 2JXXA 3PV1A 1IP9A 4MJSB 1E8XA 2KMAA 1WE6A 1I35A 2C7HA 2GOWA 1V80A 1WGGA 1V6EA 3M95A 3ZW3A 4CHKA 2ZCBA 4DWFA 4HCPB 3UIOB 4KV2A 3KH0A 3VUYA 3ZTDA 4EUTA 2PEAA 3SD5A 2FCMA 2N1VA 3HIZA 1EO6A 1R4MI 3KVFB 1WXMA 2KLGA 3ZLZA 2K8CA 5E6OA 4IC7B 2K1FA 4DHZB 3HM6X 1I42A 5CX3A 2Z59B 2MBHA 4FBJB 3N32A 1R4NI 3ML9A 2DZJA 1OQYA 1ZKHA 2K6DB 2G45B 5JZEB 1P1AA 4DHJD 2KOXA 5FR6A 1WXVA 3TCAA 3ZNGC 3JSVA 2VRRB 5EDSA 4GDLA 3T9LA 2KD0A 1D3ZA 2KFKB 2R2OA 3APDA 5CHWA 3TMPB 3LDZE 4EZJA 3BINA 1WIAA 4W9KA 2LI5A 1WZ3A 2GBNA 3DVNV 3A9KB 2MBEA 3Q3JA 5D2MB 1XQQA 2HE7A 4XX5A 2DZMA 1LQBA 1P3QU 2JVCA 2NS5A 2L0TA 1IPGA 4HDQA 1KOTA 5E6NA 5L95C 4XC2A 4ANUA 3CSTA 1ISNA 1C1YB 3L16A 2KC1A 2WX0A 3V6EB 1JRUA 4W9DA 1WX8A 2L8JA 2FCNA 3UF8A 1KM7A 2DAFA 2N9PC 4GB9A 4IUMB 3ZTCA 4EOYA 2M0XA 3UQAA 2BYEA 2LGYA 4PYUA 2BKRB 2JWZA 2NVUI 4GIVA 2AYOB 3TIXA 3QWZB 1H8CA 4MGIE 2AEHA 2JPHA 2HTHA 1YIWA 3B08A 4A3PA 4DK5A 3B0AA 3N3KB 2EMTA 4JQWC 4GDLB 2RPQA 2BGFA 2LJ5A 2JRIB 3PRMB 2D2QA 3PSEB 2CR5A 2JT4B 2KDIA 3NHEB 4K7SA 2GBRA 3PHXB 3RULA 1XD3B 3EECA 4EEWA 4KVGB 3GOEA 4HLEA 2N7EA 3B1LX 4IM0A 1OGWA 2L76A 4HCNB 4J6IA 4W9LA 3V60A 2N9XA 3DOWA 4MM3A 1L2NA 4F7ZA 3S2AA 4E71A 3DQVA 3ZDMC 3QIJA 4B9KA 3ZDTA 4PS7A 4F1SA 4ICUA 2N9EB 2BYFA 3KUZA 4XZ4A 2KTRA 3M63B 4G11A 2MA9B 3NZUA 2JZZA 3ZRFA 2ZJDA 3W1SA 3ML8A 2FNJB 1WI0A 4EZKA 3MJWA 1TBEA 4GSWA 4ASWC 2FAZA 2V3SA 3VXWA 2NBWB 4HDOA 5GMVA 4BOZB 2IY1B 4WAAA 4MH0E 4AJWA 2M4NA 3JYUA 4BBNF 2CS4A 3TJPA 2ZNVB 1CMXB 3L08A 3A33B 1KJTA 4NNJB 2ZPYA 4WJOA 2A5UA 2ASQA 4FA6A 1G6JA 1SIFA 1WMHA 1Z2MA 1YX6B 3PLUA 3IVFA 5LXIB 3VTWA 1J0GA 4GDKB 2KC2A 4WJNA 2AL6A 3ECIA 4OVUA 4BKGA 2Y5BB 2JUOA 1X1MA 3SDLC 3ZNHB 2IY0B 3IFWB 3VTUA 2MP2B 5BO4B 5CHFA 5D6JB 1TGZB 3APCA 3AULA 1S1QB 4W9GA 3IBEA 3ONSA 2NPTA 1SE9A 4IG7B 2IO2B 4LDTB 3U30A 3RD2A 3T8MA 4AJYB 3JW0X 3MHSD 3QX1A 4DDID 2MRPA 3PHWB 1WJ6A 4HPMB 3DPDA 3VDZA 4OVVA 5JHAA 2ZVNA 3H7PA 2IO0B 2IZVB 4FHJA 2FCSA 3L54A 4IM3A 4BBNC 1RRBA 1BT0A 2DYOA 2K8HA 2JRHA 3A4SC 1OEYJ 3ZRCA 1YD8U 2KDBA 3OJ4B 5IA7A 2M17A 2EKEC 5E6PA 3QJZA 1EF1A 4ZRJA 3VUWA 2O6VB 3U7DA 2L7RA 4G0NB 1WM3A 2CHXA 1E7UA 4N9F4 2D10A 3DCGA 2I1JA 4AOFA 4II2B 2KJ6A 3V62A 3AI5A 2JY6A 3EHVA 1E7VA 2DZKA 3QARA 1V9JA 4ZRKA 2KZRA 2V1YA 3AU4A 1V5TA 2ZCCA 3ZNID 4MGYE 1KLVA 2KLCA 2L05A 4GU2A 4IWQA 4AUQC 4WQOB 5CHVC 4WWPA 4CO7A 2PE9A 5LLIA 3WALA 3QQ8B 1UH6A 1WJUA 3PRZA 3SU8X 3PRPB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DBS A;  4BVU C;  3PRE A;  2G4D B;  1WXS A;  3I3T B;  3QC8 B;  3QHT A;  4FJZ A;  4JGH B;  1WGY A;  3VAW A;  4ANV A;  2N7D A;  4IM2 A;  2KTF A;  3OJ3 A;  1ZGU B;  4GN1 A;  2KQ7 A;  4HK2 A;  4B6W A;  3ALB A;  3OAW A;  4MDK E;  2KHW B;  4B95 A;  1NI2 A;  2LXC A;  3LJ3 A;  2KVR A;  2MWS B;  2N1W A;  4DXA B;  2CHW A;  2KNB A;  4W9E A;  3UIN B;  1E90 A;  1VD2 A;  1WE7 A;  1GNU A;  4KDI C;  1V49 A;  2OJR A;  3A1Q A;  4GGQ A;  4MSQ B;  5AZH A;  4DBG A;  3L0W B;  3PGE A;  1GG3 A;  1K8R B;  3A9J A;  4NAW A;  5L83 A;  2M8S A;  4FJY A;  3H1U A;  4TQ0 A;  3UQB A;  2RSU A;  2DZI A;  1V81 A;  2HD5 B;  3H9D A;  2BWF A;  2MBQ A;  3KW5 B;  2MCN B;  1Z5S B;  5DCN A;  4A20 A;  2DX5 B;  3HHM A;  2KJR A;  3DBL I;  2YVC A;  3ZIM A;  4WJP A;  4PYZ A;  4HJK A;  2GMI C;  2ZPN A;  3HK0 A;  1J8C A;  4TUU A;  2KAN A;  5D94 A;  1WRD B;  1Q1O A;  4W9H A;  5JHB A;  3ZO5 B;  3R7R A;  4LDT D;  2LD9 A;  1E8Z A;  2DEN B;  4YL8 A;  2K6Q A;  1PQS A;  4HVB A;  2WYQ A;  1WGR A;  3QK0 A;  2ZEQ A;  3JSV B;  5C23 A;  4WWO A;  4NPN A;  4FUL A;  2MQJ A;  2KK8 A;  5KHO A;  2KFK A;  2BYV E;  5AZF A;  3DVG Y;  1WJN A;  2LVQ A;  2DHZ A;  5DPR A;  4MEM A;  4PS8 A;  4BKS A;  1TZ1 A;  3WA0 A;  2MLB A;  4JIO U;  4ZYN A;  2FID A;  4AP4 C;  5DPW A;  2IYD B;  3CF6 E;  1UEL A;  4FJV B;  2J0K A;  1E5W A;  2PJH A;  2LRU A;  1GC7 A;  5D7G A;  3KYC D;  4AWJ A;  3DVG X;  3VHT C;  1GC6 A;  2REX A;  2KX3 A;  3A9K A;  1E8W A;  2JZ3 B;  3PPA A;  2CKH B;  1T0Y A;  4W9I A;  1Q5W B;  2DYM A;  3VUX A;  4EFO A;  4IWP A;  3H6N A;  2AWT A;  3ENE A;  2L0F A;  1QZE A;  4RM8 A;  1ZW7 A;  1M94 A;  2J7Q B;  4LCD E;  4W9J A;  3UGB B;  5J17 A;  5J2R A;  1WX9 A;  3BY4 B;  2KQS A;  3APF A;  3R3M A;  3DVN U;  3PTF C;  1GUA B;  1L7Y A;  1LXD A;  2K25 A;  4HWI B;  4I6N B;  3ZKJ C;  4KSK C;  5LXH A;  4M0W B;  3PZD A;  3X0W A;  4KIK B;  5C1Z A;  2LXA A;  2XEW A;  4GMV A;  2HJ8 A;  3RYT A;  3ZVV A;  2LGX A;  2C7N B;  3VTV A;  2BPS A;  2O2V A;  3AU5 A;  2MBB B;  4F8C B;  1WF9 A;  3X23 A;  2O2V B;  1EF5 A;  2KXJ A;  2MW5 A;  3QCA A;  2G3Q B;  4NQL B;  2EMS A;  2N4F A;  4KSL C;  2FIF A;  4E3C A;  3DDC B;  2WX1 A;  1MG8 A;  4ZDV A;  4BKS D;  3Q3F A;  4K7U A;  4P7I A;  2IO3 B;  3IHP C;  4ZRI A;  4ANX A;  3HM3 A;  3WIM A;  1RAX A;  3WAP A;  1V2Y A;  4WWN A;  4DHJ B;  4I6L B;  3VFK A;  1FXT B;  1WR1 A;  5DPT A;  2XK5 B;  4M8N A;  2L3Z A;  2Z0D B;  1IYF A;  2M1M A;  3L10 B;  2CHZ A;  2XBB C;  2KJH B;  3VH3 B;  2ZVO A;  4MEL A;  4BOS C;  3PS6 A;  1RFA A;  1UGM A;  2C60 A;  2DYB A;  4IW0 A;  4PS3 A;  4LJO B;  2BWE S;  4GXB A;  4II3 B;  1OTR B;  1P98 A;  1WMH B;  2GBK A;  4KZ0 A;  1UBI A;  5HKH A;  2LZ6 A;  5JH5 C;  2KFJ A;  2KO3 A;  3KYD D;  2O6V A;  2MBO A;  1NDD A;  3WAM A;  3RCZ A;  4TKN A;  3UIP B;  4ANW A;  2KN5 A;  4NY0 A;  3RT3 B;  1U4A A;  1UZX B;  3A9J B;  3NOB A;  4GOC A;  4NAW B;  4DDG D;  2MP2 A;  2QHO A;  2FCQ A;  2G4S A;  2NBU A;  4NJ7 A;  2UYZ B;  3L17 A;  4WJQ A;  2LUE A;  3AXC A;  4HPL B;  2C9W B;  4MGZ E;  1WH3 A;  4TV3 A;  1WYW B;  4ICV A;  4MGK E;  3W1Y A;  3QA8 A;  2KTR B;  4HXD A;  2D07 B;  2KWV B;  3KUD B;  4G3X B;  2XK5 A;  3WAN A;  2LGD A;  4RM9 A;  3VVW B;  1Y8R C;  1VCB A;  4KDL B;  5IAA C;  4M8M A;  1WX7 A;  1SGH A;  3DBR I;  4JLC A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  1YQB A;  2AL3 A;  2GBJ A;  2YLM A;  4KIK A;  1GJZ A;  3ZUN A;  2RGF A;  4W9C A;  5DPS A;  4K1R B;  1WGD A;  1V5O A;  2DAJ A;  3RUI B;  3OLM D;  1WXA A;  2CU1 A;  1YX5 B;  2R2Q A;  4RMA A;  4W9F A;  3RZF A;  4BFR A;  1XT9 B;  4MJS A;  1NBF C;  2ZNV C;  4GDK A;  4NJ6 A;  2PPH A;  4EKU A;  3M3J A;  3IG3 A;  3QAQ A;  3PLV A;  1WGH A;  2PE6 B;  1EUV B;  3CSF A;  4IWO A;  2LRW A;  1A5R A;  2FUH B;  2IO1 B;  2ZZP B;  4JL9 A;  3R66 C;  3NZS A;  3D32 A;  3SHQ A;  4EZL A;  2UWQ A;  3VH4 B;  4E74 A;  3C0R B;  3R7Q A;  1WY8 A;  2A4Z A;  1WJ4 A;  2W9N A;  4G50 A;  4I6P A;  4CYE A;  2O6V D;  3VQI A;  4FAD A;  4DHZ E;  2I1K A;  3TL5 A;  2D3G A;  2NPT B;  3H7P B;  1WR6 E;  5J18 A;  4A3O A;  1OEY A;  5TR5 A;  4K7W A;  3V6C B;  2GBM A;  3NS8 A;  3M62 B;  2NCN A;  5G55 A;  2KKC A;  2RR9 A;  5KHQ A;  1J19 A;  1RLF A;  3O65 B;  3RZW C;  2MSE D;  3K9P B;  2KWC A;  3A1Q B;  2IBI B;  4K81 A;  2BF8 B;  5CTR C;  3PVL A;  3A4R A;  1H4R A;  1WFY A;  2LWP A;  2NBV B;  3H7S A;  2D11 A;  2LAS A;  4KZC A;  3WAO A;  2KWU B;  5AZG A;  1TTN A;  2L00 B;  2J0M A;  3ZNZ B;  1HE8 A;  3N30 A;  3MTN B;  3W1S C;  3K9O B;  2KDF B;  2Z0E B;  2V4L A;  4FHK A;  4FN2 A;  3DBH I;  1F9J A;  2KMC A;  1E8Y A;  3EFU A;  1LFD A;  1LM8 B;  2J0J A;  4BKT A;  5AEK B;  3U8Z A;  2C5L C;  2NR2 A;  2WWZ A;  2KX0 A;  2JF5 A;  1C3T A;  4LJP B;  1Q0W B;  2LVP A;  4MSM B;  3PT2 B;  1UBQ A;  1AAR A;  1YJ1 A;  3JVZ X;  2B3A A;  4TQ1 A;  3TBL D;  1P0R A;  2K8B A;  2MX2 A;  4X57 B;  2KDE B;  2RD0 A;  3EC8 A;  4NQK E;  3CMM B;  3GZN I;  2BKF A;  3P2B A;  1WZ0 A;  1S3S G;  3L13 A;  3NY5 A;  1P9D U;  3KUC B;  2C7M B;  4URK A;  1UD7 A;  2LVO A;  2K39 A;  2OOB B;  3V61 A;  2JXX A;  3PV1 A;  1IP9 A;  4MJS B;  1E8X A;  2KMA A;  1WE6 A;  1I35 A;  2C7H A;  2GOW A;  1V80 A;  1WGG A;  1V6E A;  3M95 A;  3ZW3 A;  4CHK A;  2ZCB A;  4DWF A;  4HCP B;  3UIO B;  4KV2 A;  3KH0 A;  3VUY A;  3ZTD A;  4EUT A;  2PEA A;  3SD5 A;  2FCM A;  2N1V A;  3HIZ A;  1EO6 A;  1R4M I;  3KVF B;  1WXM A;  2KLG A;  3ZLZ A;  2K8C A;  5E6O A;  4IC7 B;  2K1F A;  4DHZ B;  3HM6 X;  1I42 A;  5CX3 A;  2Z59 B;  2MBH A;  4FBJ B;  3N32 A;  1R4N I;  3ML9 A;  2DZJ A;  1OQY A;  1ZKH A;  2K6D B;  2G45 B;  5JZE B;  1P1A A;  4DHJ D;  2KOX A;  5FR6 A;  1WXV A;  3TCA A;  3ZNG C;  3JSV A;  2VRR B;  5EDS A;  4GDL A;  3T9L A;  2KD0 A;  1D3Z A;  2KFK B;  2R2O A;  3APD A;  5CHW A;  3TMP B;  3LDZ E;  4EZJ A;  3BIN A;  1WIA A;  4W9K A;  2LI5 A;  1WZ3 A;  2GBN A;  3DVN V;  3A9K B;  2MBE A;  3Q3J A;  5D2M B;  1XQQ A;  2HE7 A;  4XX5 A;  2DZM A;  1LQB A;  1P3Q U;  2JVC A;  2NS5 A;  2L0T A;  1IPG A;  4HDQ A;  1KOT A;  5E6N A;  5L95 C;  4XC2 A;  4ANU A;  3CST A;  1ISN A;  1C1Y B;  3L16 A;  2KC1 A;  2WX0 A;  3V6E B;  1JRU A;  4W9D A;  1WX8 A;  2L8J A;  2FCN A;  3UF8 A;  1KM7 A;  2DAF A;  2N9P C;  4GB9 A;  4IUM B;  3ZTC A;  4EOY A;  2M0X A;  3UQA A;  2BYE A;  2LGY A;  4PYU A;  2BKR B;  2JWZ A;  2NVU I;  4GIV A;  2AYO B;  3TIX A;  3QWZ B;  1H8C A;  4MGI E;  2AEH A;  2JPH A;  2HTH A;  1YIW A;  3B08 A;  4A3P A;  4DK5 A;  3B0A A;  3N3K B;  2EMT A;  4JQW C;  4GDL B;  2RPQ A;  2BGF A;  2LJ5 A;  2JRI B;  3PRM B;  2D2Q A;  3PSE B;  2CR5 A;  2JT4 B;  2KDI A;  3NHE B;  4K7S A;  2GBR A;  3PHX B;  3RUL A;  1XD3 B;  3EEC A;  4EEW A;  4KVG B;  3GOE A;  4HLE A;  2N7E A;  3B1L X;  4IM0 A;  1OGW A;  2L76 A;  4HCN B;  4J6I A;  4W9L A;  3V60 A;  2N9X A;  3DOW A;  4MM3 A;  1L2N A;  4F7Z A;  3S2A A;  4E71 A;  3DQV A;  3ZDM C;  3QIJ A;  4B9K A;  3ZDT A;  4PS7 A;  4F1S A;  4ICU A;  2N9E B;  2BYF A;  3KUZ A;  4XZ4 A;  2KTR A;  3M63 B;  4G11 A;  2MA9 B;  3NZU A;  2JZZ A;  3ZRF A;  2ZJD A;  3W1S A;  3ML8 A;  2FNJ B;  1WI0 A;  4EZK A;  3MJW A;  1TBE A;  4GSW A;  4ASW C;  2FAZ A;  2V3S A;  3VXW A;  2NBW B;  4HDO A;  5GMV A;  4BOZ B;  2IY1 B;  4WAA A;  4MH0 E;  4AJW A;  2M4N A;  3JYU A;  4BBN F;  2CS4 A;  3TJP A;  2ZNV B;  1CMX B;  3L08 A;  3A33 B;  1KJT A;  4NNJ B;  2ZPY A;  4WJO A;  2A5U A;  2ASQ A;  4FA6 A;  1G6J A;  1SIF A;  1WMH A;  1Z2M A;  1YX6 B;  3PLU A;  3IVF A;  5LXI B;  3VTW A;  1J0G A;  4GDK B;  2KC2 A;  4WJN A;  2AL6 A;  3ECI A;  4OVU A;  4BKG A;  2Y5B B;  2JUO A;  1X1M A;  3SDL C;  3ZNH B;  2IY0 B;  3IFW B;  3VTU A;  2MP2 B;  5BO4 B;  5CHF A;  5D6J B;  1TGZ B;  3APC A;  3AUL A;  1S1Q B;  4W9G A;  3IBE A;  3ONS A;  2NPT A;  1SE9 A;  4IG7 B;  2IO2 B;  4LDT B;  3U30 A;  3RD2 A;  3T8M A;  4AJY B;  3JW0 X;  3MHS D;  3QX1 A;  4DDI D;  2MRP A;  3PHW B;  1WJ6 A;  4HPM B;  3DPD A;  3VDZ A;  4OVV A;  5JHA A;  2ZVN A;  3H7P A;  2IO0 B;  2IZV B;  4FHJ A;  2FCS A;  3L54 A;  4IM3 A;  4BBN C;  1RRB A;  1BT0 A;  2DYO A;  2K8H A;  2JRH A;  3A4S C;  1OEY J;  3ZRC A;  1YD8 U;  2KDB A;  3OJ4 B;  5IA7 A;  2M17 A;  2EKE C;  5E6P A;  3QJZ A;  1EF1 A;  4ZRJ A;  3VUW A;  2O6V B;  3U7D A;  2L7R A;  4G0N B;  1WM3 A;  2CHX A;  1E7U A;  4N9F 4;  2D10 A;  3DCG A;  2I1J A;  4AOF A;  4II2 B;  2KJ6 A;  3V62 A;  3AI5 A;  2JY6 A;  3EHV A;  1E7V A;  2DZK A;  3QAR A;  1V9J A;  4ZRK A;  2KZR A;  2V1Y A;  3AU4 A;  1V5T A;  2ZCC A;  3ZNI D;  4MGY E;  1KLV A;  2KLC A;  2L05 A;  4GU2 A;  4IWQ A;  4AUQ C;  4WQO B;  5CHV C;  4WWP A;  4CO7 A;  2PE9 A;  5LLI A;  3WAL A;  3QQ8 B;  1UH6 A;  1WJU A;  3PRZ A;  3SU8 X;  3PRP B; 
#chains in the Genus database with same CATH topology
 4BVU C;  5G5H A;  1WXS A;  4KX6 B;  1FIQ A;  1WGY A;  1MVK A;  1QKZ A;  4GN1 A;  4HK2 A;  4B95 A;  1NI2 A;  1GAQ B;  3Q8F A;  4B0M A;  2KVR A;  2N1W A;  2KNB A;  4OZA A;  1FCL A;  2MEK A;  1T0Q C;  2V4I B;  1NI3 A;  3DWG C;  5L83 A;  2IND C;  2FBW B;  2WU5 B;  4MAC A;  5HG2 A;  3RNG C;  2DZI A;  2HD5 B;  2MBQ A;  3RNE C;  5DCN A;  1KF6 B;  3HHM A;  2KJR A;  3DBL I;  2GRI A;  1EWY C;  3AE9 B;  1J8C A;  3NVZ A;  5T8I A;  5D94 A;  1MI0 A;  1Q1O A;  4MH8 A;  3ZO5 B;  3R2T A;  4LDT D;  2K6Q A;  4NPN A;  5KHO A;  1SF0 A;  5E6J A;  1TZ1 A;  2MLB A;  4JIO U;  4AP4 C;  2INC C;  5DPW A;  1KLU D;  2LRU A;  1GC7 A;  3AN1 A;  2H88 B;  2V9H A;  2KX3 A;  1SXT A;  1JRO A;  3ENE A;  1QZE A;  3UGB B;  5J2R A;  5J17 A;  4W9J A;  1XCQ L;  3BY4 B;  1C79 A;  1JML A;  2QCZ A;  3Q69 A;  1PUT A;  1GUA B;  1L7Y A;  1LXD A;  2WGS A;  1CJE A;  4KIK B;  4JPS A;  2UU7 A;  2DWQ A;  4LNI A;  3X23 A;  1EF5 A;  2G3Q B;  3O13 A;  4E3C A;  3DDC B;  1MG8 A;  3Q3F A;  4K7U A;  3BVG A;  1N62 A;  5D3D A;  4ZRI A;  4C7Y A;  1QT9 A;  2EEL A;  3AE3 B;  5DPT A;  1CK1 A;  4M8N A;  4CQN A;  1T0R C;  2ZVO A;  4MEL A;  3FKY A;  2QEJ C;  1UGM A;  2DYB A;  1PYW D;  4LJO B;  4GXB A;  3OG5 A;  5HHD G;  1UBI A;  2KFJ A;  2D3A A;  2MJE A;  4P6V F;  1NDD A;  3WAM A;  3UIP B;  3VR9 B;  4NY0 A;  2I38 A;  4K3B A;  4NJ7 A;  3L17 A;  1XLP A;  4BAX A;  2C9W B;  4MGZ E;  4ZOH C;  1WYW B;  3W1Y A;  3QA8 A;  4HXD A;  4OVZ A;  4G3X B;  2WXJ A;  2LGD A;  3VVW B;  1Y8R C;  4YTN B;  1L4D B;  1SGH A;  3DBR I;  4JLC A;  3FIL A;  4KKJ A;  2YLM A;  3ZUN A;  4W9C A;  4K1R B;  1WGD A;  3I9V 1;  3OLM D;  2R2Q A;  1XT9 B;  2JXT A;  1NBF C;  4EKU A;  2IPK D;  3QAQ A;  1WGH A;  2BQQ A;  3R2I A;  3CSF A;  1TS4 A;  2IO1 B;  2ZZP B;  4JL9 A;  3R66 C;  4M01 A;  1WY8 A;  2W9N A;  1WJ4 A;  1ZE3 D;  3I57 A;  1YOV B;  2O6V D;  3VQI A;  1N6Z A;  2I1K A;  3TL5 A;  1WR6 E;  4A3O A;  2VH1 A;  4K7W A;  3U4E G;  2NCN A;  3MJ5 A;  2KKC A;  1J19 A;  4A55 A;  2GI9 A;  3K9P B;  4K81 A;  2BF8 B;  5CTR C;  3H7S A;  1QQR A;  2V0G A;  2D5G A;  3ZNZ B;  3N30 A;  3W1S C;  2V4L A;  2LGS A;  3BYY B;  4YTM B;  3EFU A;  2KDM A;  2C5L C;  2NR2 A;  2WWZ A;  2KX0 A;  1Q0W B;  3N20 C;  5BMI A;  2J42 A;  1YJ1 A;  3MHZ A;  2K8B A;  3P4S B;  4NAM A;  4C4V B;  3CMM B;  1WRI A;  3HRD D;  3GZN I;  2N7J A;  3NY5 A;  4ZHO A;  4URK A;  2IGG A;  3V61 A;  2PVG C;  1IP9 A;  2KMA A;  3VRA B;  3ZXV A;  1YMH E;  3ZW3 A;  4DWF A;  4OW0 A;  2PEA A;  2PVO D;  2KAC A;  3LB8 C;  5IP4 D;  1I42 A;  1ET9 A;  1LGR A;  4N58 A;  2DZJ A;  4FXC A;  2G45 B;  1DOY A;  1P1A A;  5FR6 A;  3GB1 A;  5EDS A;  2KD0 A;  3APD A;  3Q3O C;  1FXA A;  1D5X C;  1WZ3 A;  3DVN V;  2MBE A;  4WIP A;  3P63 A;  3IXS A;  1IPG A;  1T0S C;  2BW2 A;  5BMG A;  1KOT A;  3B9J A;  5L95 C;  4TSS A;  1C1Y B;  2K5P A;  2WX0 A;  3V6E B;  1WX8 A;  2AX5 A;  1KM7 A;  3ZTC A;  4IUM B;  3UQA A;  2BYE A;  1H8C A;  2L83 A;  3BII D;  2HTH A;  3B08 A;  3B0A A;  3Q6B A;  2K3U A;  1MPE A;  2RPQ A;  2ZW1 A;  1T3Q A;  2D2Q A;  2WXM A;  3IT6 B;  2JT4 B;  4K7S A;  1FCC C;  1R4M B;  1XD3 B;  4KGR A;  3GOE A;  2WDV B;  1L2N A;  4HCN B;  4W9L A;  3V60 A;  3MC8 A;  4F7Z A;  4E71 A;  3AE7 B;  1YQ3 B;  1UWM A;  1Y56 A;  3QIJ A;  1DYQ A;  2M0A A;  4ICU A;  2BYF A;  3TUO A;  3M63 B;  4G11 A;  3ZRF A;  2ZJD A;  3W1S A;  4EZK A;  1TBE A;  1D5M C;  1AN8 A;  4HDO A;  5GMV A;  1UNS A;  5TSS A;  1EU3 A;  4AJW A;  4BBN F;  3JYU A;  3RFZ B;  4MT5 A;  2J4X A;  1QOF A;  2A5U A;  4FA6 A;  2I2Y A;  5LXI B;  2KC2 A;  4RCO A;  2DNF A;  2Y5B B;  3SDL C;  3ZJU A;  3ZNH B;  2IY0 B;  3IFW B;  1JWS D;  1ZXH A;  5CHF A;  1ZPS A;  5D6J B;  1PGA A;  3AE4 B;  1TGZ B;  2CU3 A;  4AJY B;  2IO2 B;  3JW0 X;  3QX1 A;  4DDI D;  2MRP A;  1AW7 A;  4OZC A;  2XNA C;  4YTP B;  4OVV A;  5EE9 A;  3B2G A;  1L0V B;  2IO0 B;  2IZV B;  2FCS A;  4FHJ A;  4IM3 A;  4XWT A;  1N5W A;  1RRB A;  2JRH A;  4H2A A;  3N1Y C;  2KDB A;  3AEB B;  1YN4 A;  3QJZ A;  1EF1 A;  1E7U A;  3V62 A;  1UWX A;  2KZR A;  2V1Y A;  2ZCC A;  5BYQ A;  4L2Y A;  1J7B A;  1WGK A;  2BB5 A;  2PE9 A;  5LLI A;  3WAL A;  1IGD A;  3GE8 C;  3SU8 X;  3TEW A;  3PRP B;  2V3P A;  3I3T B;  3VAW A;  4ANV A;  4IM2 A;  3OJ3 A;  1ZGU B;  1C4P A;  5G5G A;  2R61 A;  5IO9 A;  3ZXR A;  2KHW B;  3HUI A;  4B0E A;  3W2D A;  2CHW A;  1WE7 A;  1GNU A;  1TS5 A;  4KDI C;  1V49 A;  2OJR A;  1VJK A;  4GGQ A;  1C4C A;  3L0W B;  3PGE A;  1JAL A;  1SB3 C;  3N1Z C;  4KGT A;  3AEC B;  2M8S A;  4P16 A;  4FJY A;  3RNB C;  4K3C A;  3UQB A;  2MCN B;  3H9D A;  2Q5W D;  4ARC A;  4KGS A;  1QOG A;  1QOB A;  4WJP A;  1HXY D;  2KAN A;  5C3J B;  2X38 A;  2RPV A;  2WXQ A;  1YJI A;  2DEN B;  2WYQ A;  1YNT E;  4FUL A;  1V1P A;  1VZ7 A;  2KK8 A;  3DVG Y;  1WJN A;  2LVQ A;  4PS8 A;  1NEN B;  4BKS A;  3OWE B;  2FID A;  2Y3A A;  4ZYN A;  3CF6 E;  4FJV B;  5D7G A;  2PJH A;  3KYC D;  3DWM A;  3VHT C;  2NTS A;  1QLB B;  2JZ3 B;  2Y5C A;  1T0Y A;  4EFO A;  1SE4 A;  2DYM A;  4RM8 A;  4LCD E;  2MH7 A;  1E9M A;  1AWD A;  3TEX A;  2OED A;  1MG4 A;  3PTF C;  1E10 A;  2QDF A;  3ZKJ C;  4M0W B;  3PZD A;  1VR9 A;  4GMV A;  2HJ8 A;  2LGX A;  2C7N B;  1TIF A;  3AU5 A;  3N9Y C;  2MW5 A;  3QCA A;  3W5U B;  4KSL C;  2WX1 A;  4ZDV A;  4BKS D;  3MC0 B;  4P7I A;  2IO3 B;  3IHP C;  4ANX A;  4WWN A;  4DHJ B;  3VFK A;  1FXT B;  1I4Q A;  3URY A;  2CHZ A;  1HTO A;  4BOS C;  1L6U A;  3PS6 A;  4IW0 A;  3RPF C;  1P98 A;  3ZJT A;  5AUI A;  5JH5 C;  1R7S A;  2O6V A;  2MBO A;  3H8H A;  2KT7 A;  3NOB A;  4NAW B;  2PKO A;  2MP2 A;  2BB6 A;  2WS3 B;  1IGC A;  2UYZ B;  4AS1 A;  4WJQ A;  2LUE A;  4LK0 M;  4ICV A;  2BBC A;  2KTR B;  2D07 B;  3KWL A;  4JX1 C;  2SEB D;  3KUD B;  4A8X C;  2RMM A;  3Q8B A;  3U2S C;  1WX7 A;  2E3T A;  1MJD A;  3L4P A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  1F1H A;  2EKI A;  2JZP A;  2RGF A;  2B76 B;  1IBX A;  3RZF A;  4NJ6 A;  4RH6 A;  3LYY A;  3PLV A;  2BYT A;  2LRW A;  1A5R A;  2WLB A;  2FUH B;  3VH4 B;  5FKA C;  2A4Z A;  1K53 A;  3UI3 A;  3IAS 1;  1FFV A;  4FAD A;  5J18 A;  5TR5 A;  2N9L A;  4WWM A;  3NS8 A;  3V6C B;  1JQ4 A;  1RLF A;  2ACZ B;  2MSE D;  3EA6 A;  3A1Q B;  3PVL A;  4ZRP A;  1D5Z C;  1WFY A;  3U52 E;  3WCQ A;  2KWU B;  5AZG A;  2L00 B;  2J0M A;  1FEH A;  1PFD A;  3AB5 A;  3K9O B;  2J53 A;  4FN2 A;  2KMC A;  1E8Y A;  1LFD A;  1D6E C;  5AEK B;  4LJP B;  2MJD A;  2LVP A;  4MSM B;  3SEB A;  3NVV A;  3IAM 1;  1TKG A;  3AE6 B;  2BKF A;  3DBH B;  3L13 A;  3KUC B;  2WHI A;  2K39 A;  2VZK B;  1XCT L;  3DHH C;  4MJS B;  1E8X A;  2INP E;  2PLP A;  4XDD A;  1QOA A;  2C7H A;  1V80 A;  1WGG A;  2WXP A;  4CHK A;  3ZTD A;  3SD5 A;  2N1V A;  3HIZ A;  4XWW A;  1FO4 A;  3P4R B;  2KLG A;  4IC7 B;  3AE2 B;  1VRA B;  3TSS A;  2LHD A;  1R4N I;  3ML9 A;  5GXG B;  1FNU A;  2BS3 B;  2PIA A;  3TEY A;  4L23 A;  3ZNG C;  3J9C A;  3JSV A;  2W54 A;  3T9L A;  1KFY B;  1D3Z A;  3RN9 C;  3LDZ E;  1TS2 A;  4EZJ A;  1WIA A;  2AQ3 B;  3A9K B;  1VLB A;  1XQQ A;  2DZM A;  2L0T A;  5FK9 C;  4HDQ A;  2IJ0 A;  2PTL A;  2RDG A;  1ISN A;  2KC1 A;  3B2F A;  2MJ3 A;  4GB9 A;  2L1A A;  4P1B C;  1RM6 C;  2LHE A;  4IDI A;  4PYU A;  2NVU I;  1ZUD 2;  2JWZ A;  4GIV A;  2AYO B;  3TIX A;  4MGI E;  2AEH A;  2KYW A;  1GOZ A;  1YIW A;  4DK5 A;  4D2K A;  4YSZ B;  2BGF A;  2LJ5 A;  1FD6 A;  2JRI B;  3PRM B;  4RF1 A;  2CR5 A;  1CQV A;  3NHE B;  3LXF A;  3EEC A;  2N7E A;  4REZ A;  1T6B X;  4J6I A;  1F77 A;  1FXI A;  3ZDM C;  2WQY B;  3ZDT A;  4RGT A;  4F1S A;  2WNM A;  2MA9 B;  3BVZ A;  1N60 A;  2NTT A;  3ML8 A;  2JX5 A;  2LEK A;  4S17 A;  1V1O A;  2NBW B;  2V3S A;  3DBL B;  4BOZ B;  4WAA A;  4MH0 E;  2M4N A;  2CS4 A;  4WAF A;  1N5X A;  1RWS A;  3TJP A;  2ZNV B;  1CMX B;  2ZPY A;  4WJO A;  3ZYY X;  1AYF A;  1SIF A;  1Z2M A;  2K0P A;  1YX6 B;  3PLU A;  3IVF A;  1J0G A;  2KAJ A;  3GZN B;  4OVU A;  2RDH A;  2JUO A;  1X1M A;  5IKC M;  5H92 C;  2MP2 B;  3AEG B;  5IOI A;  4W9G A;  3IBE A;  1SE9 A;  2AQ2 B;  3T8M A;  3AE5 B;  2MHJ A;  3PHW B;  3VDZ A;  2Y5P A;  3IT4 B;  5JHA A;  3L54 A;  4BBN C;  1BT0 A;  3A4S C;  1HZ6 A;  2BS4 B;  2YEP B;  3N1X C;  2EKE C;  4HKZ E;  4TMA B;  3U7D A;  4G0N B;  2CHX A;  4N9F 4;  2D10 A;  2I1J A;  4AOF A;  4II2 B;  3AI5 A;  1E7V A;  2DZK A;  2CJN A;  3AU4 A;  1V5T A;  4MGY E;  2WXN A;  2KLC A;  2L05 A;  4IWQ A;  4WQO B;  5CHV C;  3RNF C;  1OFF A;  4IOI E;  1TZO A;  1UH6 A;  3FC4 A;  1YN3 A;  1SBB B;  3DBS A;  3PRE A;  3QC8 B;  3BVM A;  4FJZ A;  2N7D A;  2IDY A;  3CIR B;  4B6W A;  1MHH E;  3ALB A;  1EM7 A;  3LJ3 A;  4RGM A;  4DXA B;  1E90 A;  1VD2 A;  2QSD A;  3A1Q A;  4MSQ B;  4DBG A;  1GG3 A;  1K52 A;  1K8R B;  4NAW A;  3NVW A;  1L0Y B;  1FNW A;  2RSU A;  4MM3 B;  1V81 A;  2GB1 A;  4BZA A;  2DX5 B;  2G1E A;  2YVC A;  2N9K A;  3HK0 A;  2JSV X;  2FE8 A;  1PGX A;  3P4Q B;  2D3C A;  4W9H A;  3R7R A;  1FRD A;  4RGO S;  1WGR A;  2ZEQ A;  3JSV B;  5C23 A;  2K9X A;  3MFG A;  2BYV E;  2DHZ A;  5DPR A;  4MEM A;  2W3R A;  3WA0 A;  1XLO A;  2IYD B;  3PO0 A;  1UEL A;  1E5W A;  4AWJ A;  1GC6 A;  2REX A;  1E8W A;  2ICI A;  3VUX A;  4IWP A;  3ABV B;  3H6N A;  3Q2A C;  1ZW7 A;  3VR8 B;  4ITK A;  2KQS A;  1DOI A;  1NVI D;  4JWU C;  5D3I B;  4US8 A;  3AM9 A;  5FR3 A;  1ESF A;  4HWI B;  4I6N B;  5LXH A;  1JWB D;  1E7P B;  2W55 A;  3EFC A;  5C1Z A;  4ARI A;  2XEW A;  1HZ5 A;  3ZVV A;  3VTV A;  2MBB B;  4F8C B;  2O2V B;  2KXJ A;  5EE1 A;  3CWI A;  1I4G A;  1KTK A;  2FIF A;  1C9F A;  4JWS C;  3HM3 A;  3WIM A;  1UF0 A;  4NZL B;  4I6L B;  1ACC A;  2XK5 B;  4C56 C;  2L3Z A;  3Q8A A;  2Z0D B;  3AH7 A;  2M1M A;  3Q8C A;  1FM0 D;  1PGB A;  2XBB C;  2KJH B;  3BZD B;  1K51 A;  1TJE A;  3VH3 B;  1RFA A;  2C60 A;  1XEE A;  1TT5 B;  1N63 A;  2QIE B;  2BWE S;  3SR6 A;  4KZ0 A;  5HKH A;  2KO3 A;  4HRO A;  3RCZ A;  4N59 A;  4TKN A;  1XF5 L;  1Q10 A;  2X8X X;  2KN5 A;  3RT3 B;  4GOC A;  3A9J B;  3W9C B;  2AQ1 B;  3V3X A;  2FCQ A;  2G4S A;  4YSY B;  4TV3 A;  4MGK E;  2W82 A;  1DGJ A;  2KWV B;  2JWU A;  4M8M A;  2RDB C;  1R4N B;  2WP9 B;  2AL3 A;  2XN9 C;  1GJZ A;  4WQM A;  5DPS A;  1V5O A;  4AQ7 A;  4W9F A;  2CU1 A;  1YX5 B;  4BFR A;  4MJS A;  4P1C C;  2ZNV C;  4GDK A;  2PPH A;  2PMV A;  3M3J A;  3IG3 A;  2V3N A;  1V97 A;  2PE6 B;  5BYS A;  1EUV B;  1WYG A;  4IWO A;  1I4P A;  3AV8 A;  2VZK D;  3BK2 A;  2UWQ A;  4E74 A;  3I63 C;  3R7Q A;  1L0X B;  4I6P A;  2JQR B;  4G50 A;  4CYE A;  4DHZ E;  2D3B A;  2D3G A;  2NPT B;  3H7P B;  1OEY A;  3E9S A;  2RR9 A;  5KHQ A;  3RZW C;  2DLB A;  2IBI B;  1GB4 A;  1H4R A;  2LWP A;  4A9A A;  2NBV B;  2LAS A;  4KZC A;  3WAO A;  2KMM A;  4QAY A;  1TY2 A;  3MTN B;  2WU2 B;  4FHK A;  3DBH I;  2ONQ A;  1JWU D;  2OHF A;  4BKT A;  2JF5 A;  1C3T A;  1P7E A;  2BT6 A;  3PT2 B;  1UBQ A;  1AAR A;  3JVZ X;  1YN5 A;  2HTM E;  3KQ4 A;  2L52 A;  4PT5 A;  1SJH D;  1ZP0 B;  4TQ1 A;  2B3A A;  1P0R A;  2MX2 A;  4X57 B;  3EC8 A;  4NQK E;  3P2B A;  1WZ0 A;  1JWM D;  1P9D U;  2C7M B;  2LVO A;  3PV1 A;  2M19 A;  1HEZ E;  2GOW A;  1V6E A;  2ZCB A;  4HCP B;  3UIO B;  1TYG B;  1WXM A;  3ZLZ A;  5E6O A;  3NVY A;  2IGH A;  4DHZ B;  1I4R A;  4FBJ B;  3N32 A;  1OQY A;  1ZKH A;  2K6D B;  3FIL B;  4M02 A;  4DXG A;  2KOX A;  2WXI A;  1WXV A;  2VRR B;  4GDL A;  3NZ3 A;  5CHW A;  3TMP B;  3BIN A;  4W9K A;  5D2M B;  3Q3J A;  1ENF A;  1JRP A;  2HE7 A;  4XE0 A;  2N0S B;  1PDX A;  3GS2 A;  1LQB A;  4IKG A;  1SE2 A;  1P3Q U;  4R3D A;  2NS5 A;  2YEP F;  1NYR A;  4JE3 B;  3C8Y A;  2L32 A;  1A70 A;  4XC2 A;  3CST A;  3DBR B;  1VDV A;  2KN4 A;  4HEA 1;  5MPO A;  5AUK A;  1K50 A;  2DAF A;  4EOY A;  1SIJ A;  2M0X A;  2LGY A;  2BKR B;  3QWZ B;  1ROE A;  2JPH A;  4US9 A;  4XDC A;  3N3K B;  1I4X A;  1VZ8 A;  2IGD A;  4JQW C;  4XGA B;  2KWD A;  4GDL B;  5BMH A;  3AEF B;  1UUP A;  3PSE B;  2KDI A;  3RUL A;  4A6Q A;  3E56 A;  4KVG B;  3NG0 A;  3B1L X;  4IM0 A;  1OGW A;  2L76 A;  2N9X A;  3DOW A;  3BYT B;  1B9R A;  1L4Z B;  3DQV A;  4B9K A;  1F2R C;  4PS7 A;  1KRH A;  1BML C;  2N9E B;  2KTR A;  3NZU A;  2JZZ A;  1WI0 A;  4LLG M;  3MJW A;  1WWT A;  2NMQ A;  2FAZ A;  4OHJ A;  3A33 B;  1KJT A;  4NNJ B;  2ASQ A;  1WMH A;  1FRR A;  2WXK A;  3AED B;  2QJL A;  1FFU A;  3VTW A;  3ZJV A;  5JXV A;  1E0Z A;  3ECI A;  1L5P A;  4BKG A;  5I4D A;  3VTU A;  3FAH A;  1WSP A;  3APC A;  3AUL A;  1S1Q B;  4LNK A;  2NPT A;  4IG7 B;  3MHS D;  2KVZ A;  2WXL A;  3DPD A;  2ZVN A;  3W5V B;  1HTQ A;  3Q14 C;  4M0W A;  2K8H A;  1FMA D;  1RYJ A;  1OEY J;  3OJ4 B;  5IA7 A;  2M17 A;  4KKI A;  3BK1 A;  2WXH A;  4ZRJ A;  3VUW A;  2O6V B;  2L7R A;  1ZOY B;  3EHV A;  2W3S A;  1TY0 A;  1T5X D;  3HVZ A;  4GU2 A;  4XYC A;  2G4D B;  3ZQ4 A;  1ZDV A;  3QHT A;  4JGH B;  1STE A;  2KTF A;  3KLS X;  2KQ7 A;  3NS1 A;  3DHI C;  3OAW A;  4MDK E;  4HPP A;  3MC9 A;  2LXC A;  2M56 B;  2MWS B;  1SEB D;  4W9E A;  2BTE A;  3NUH B;  3UIN B;  1OQR A;  1C4A A;  5AZH A;  4YSX B;  4C00 A;  3A9J A;  3AEA B;  3H1U A;  4TQ0 A;  2BWF A;  3KW5 B;  1Z5S B;  5HFY A;  4A20 A;  1IUE A;  4L1B A;  3U7Z A;  3ZIM A;  4PYZ A;  4HJK A;  2GMI C;  2ZPN A;  4TUU A;  4S0R A;  1E6E B;  1WRD B;  3R8B A;  1MFW A;  3T3N A;  3AE1 B;  2ZW0 A;  5JHB A;  4HRS A;  2LJI A;  2LD9 A;  1E8Z A;  4YL8 A;  1PQS A;  4HVB A;  3PZ8 A;  3QK0 A;  4WWO A;  2MQJ A;  4NJC A;  2KFK A;  5AZF A;  4C80 A;  1SJE D;  2J0K A;  3DVG X;  3A9K A;  3PPA A;  2CKH B;  4W9I A;  1Q5W B;  3NJT A;  3RNC C;  2AWT A;  2L0F A;  1F0Z A;  1M94 A;  2J7Q B;  1EU4 A;  3AE8 B;  1WX9 A;  2GLS A;  3APF A;  3R3M A;  1NEK B;  3DVN U;  2LUM A;  4USA A;  4GLS C;  3GE3 C;  1KH0 A;  2K25 A;  4KSK C;  3EUB 2;  3X0W A;  2LXA A;  3RYT A;  2BPS A;  2O2V A;  3P1M A;  1C78 A;  1WF9 A;  4NQL B;  2EMS A;  2N4F A;  4EE2 A;  1CZP A;  3RI7 C;  1L6V A;  1KLG D;  1JWA D;  2BVC A;  1RAX A;  3WAP A;  1V2Y A;  2K22 A;  1WR1 A;  1VZ6 A;  2JYT A;  1IYF A;  3L10 B;  1C76 A;  3DHG C;  1XLQ A;  4PS3 A;  1WXQ A;  1V8C A;  1QIL A;  4II3 B;  1OTR B;  2VH2 A;  1WMH B;  2GBK A;  2LZ6 A;  3KYD D;  5LNK 1;  2WXO A;  3ETR A;  4ANW A;  1U4A A;  1UZX B;  2DBY A;  1HA5 A;  4DDG D;  2QHO A;  4C7Z A;  2NBU A;  2BS2 B;  3AXC A;  4HPL B;  4RNA A;  1WH3 A;  1NYQ A;  4WUR A;  1SSN A;  2QMT A;  1DOX A;  2XK5 A;  3WAN A;  4RM9 A;  1VCB A;  4KDL B;  5IAA C;  3RNA C;  5EE0 A;  3TEZ A;  3SFE B;  1YQB A;  2GBJ A;  4KIK A;  2H89 B;  1J7A A;  2DAJ A;  1YQ4 B;  3RUI B;  1WXA A;  4RMA A;  5BYR A;  1F52 A;  4RGN A;  2Z8L A;  1N61 A;  2G9H D;  4UDU C;  3NZS A;  4ZRQ A;  3D32 A;  3SHQ A;  4EZL A;  3C0R B;  3BWU D;  4ZHP A;  1YJJ A;  2GBM A;  3M62 B;  4LNO A;  5G55 A;  3O65 B;  2PW9 A;  1D4B A;  1HQR D;  2KWC A;  1LO5 D;  3NRZ A;  1GPX A;  3A4R A;  2D11 A;  2OJW A;  1TTN A;  2JU6 X;  4RF0 A;  1HE8 A;  1I4H A;  3ZGZ A;  1FPY A;  2KDF B;  2Z0E B;  4YWG G;  1F9J A;  1LM8 B;  2J0J A;  3U8Z A;  2HJ1 A;  4J3O D;  3TBL D;  2QIL A;  2KDE B;  2RD0 A;  3MP9 A;  1SE3 A;  4C4V A;  2CJO A;  1S3S G;  2KQ4 X;  4M00 A;  1UD7 A;  2OOB B;  2JXX A;  2JYE A;  1WE6 A;  1I35 A;  2INN E;  3M95 A;  4WH4 A;  4KV2 A;  1UGJ A;  3KH0 A;  3VUY A;  4EUT A;  2LGI A;  2FCM A;  3KWV A;  1MHX A;  1EO6 A;  1R4M I;  3HVD A;  3KVF B;  2K8C A;  4Q2J A;  1J7C A;  2K1F A;  3HM6 X;  5IN7 A;  5CX3 A;  2Z59 B;  2MBH A;  2E6X A;  1TS3 A;  3RMK C;  4PK1 A;  1TKY A;  5JZE B;  4DHJ D;  1XXG A;  3TCA A;  1C77 A;  2SAK A;  1BUI C;  2KFK B;  2R2O A;  1P7F A;  2LI5 A;  2GBN A;  4XX5 A;  2JVC A;  4LTU A;  4OZB A;  5E6N A;  1XLN A;  4ANU A;  2QC8 A;  3C19 A;  3L16 A;  3SFD B;  1FNV A;  4W9D A;  1JRU A;  2L8J A;  2FCN A;  3UF8 A;  2N9P C;  2LFI A;  4ZYS A;  2HDE A;  3P42 A;  4A3P A;  1I7H A;  2EMT A;  1ET6 A;  1V1P B;  1TKE A;  3V05 A;  3I5J C;  2J52 A;  4LNN A;  1ZXI A;  2GBR A;  3PHX B;  4EEW A;  4LNF A;  4RFB A;  4HLE A;  3VRB B;  4MM3 A;  3Q3N C;  3S2A A;  4DXF A;  4O1N A;  2WXR A;  1XO3 A;  4XZ4 A;  3KUZ A;  3Q8E A;  3AEE B;  1BXT A;  5C2T B;  1B1Z A;  1M4V A;  4HJG E;  3AMZ A;  2FNJ B;  2WDQ B;  4GSW A;  4ASW C;  3GP7 A;  1EWC A;  3VXW A;  4ACF A;  2IY1 B;  4N6E B;  5H8Y E;  5EE3 A;  2WXF A;  3L08 A;  5HI1 A;  1F2R I;  1G6J A;  2WDR B;  2FUG 1;  1JCK B;  4GDK B;  4WJN A;  2AL6 A;  4DQO C;  3PZ7 A;  2TSS A;  1ZDX A;  5BO4 B;  3ONS A;  4YT0 B;  4LDT B;  3U30 A;  3RD2 A;  2WXG A;  3P4P B;  1WJ6 A;  4HPM B;  4HKQ A;  3H7P A;  1RFK A;  3T3O A;  2DYO A;  3Q3M C;  2ON8 A;  3ZRC A;  1YD8 U;  5E6P A;  1IBX B;  3EGR A;  4YXD B;  1WM3 A;  1QF6 A;  3DCG A;  1OQQ A;  2KJ6 A;  2JY6 A;  1JW9 D;  4A90 A;  2LMC A;  3QAR A;  1V9J A;  4ZRK A;  3ZNI D;  1KLV A;  1GB1 A;  4AUQ C;  4WWP A;  4CO7 A;  3QQ8 B;  1WJU A;  3PRZ A; 
#chains in the Genus database with same CATH homology
 3DBS A;  4BVU C;  3PRE A;  2G4D B;  1WXS A;  3I3T B;  3QC8 B;  3QHT A;  4FJZ A;  4JGH B;  1WGY A;  3VAW A;  4ANV A;  2N7D A;  4IM2 A;  2KTF A;  3OJ3 A;  1ZGU B;  4GN1 A;  2KQ7 A;  4HK2 A;  4B6W A;  3ALB A;  3OAW A;  4MDK E;  2KHW B;  4B95 A;  1NI2 A;  2LXC A;  3LJ3 A;  2KVR A;  2MWS B;  2N1W A;  4DXA B;  2CHW A;  2KNB A;  4W9E A;  3UIN B;  1E90 A;  1VD2 A;  1WE7 A;  1GNU A;  4KDI C;  1V49 A;  2OJR A;  3A1Q A;  4GGQ A;  4MSQ B;  5AZH A;  4DBG A;  3L0W B;  3PGE A;  1GG3 A;  1K8R B;  3A9J A;  4NAW A;  5L83 A;  2M8S A;  4FJY A;  3H1U A;  4TQ0 A;  3UQB A;  2RSU A;  2DZI A;  1V81 A;  2HD5 B;  3H9D A;  2BWF A;  2MBQ A;  3KW5 B;  2MCN B;  1Z5S B;  5DCN A;  4A20 A;  2DX5 B;  3HHM A;  2KJR A;  3DBL I;  2YVC A;  3ZIM A;  4WJP A;  4PYZ A;  4HJK A;  2GMI C;  2ZPN A;  3HK0 A;  1J8C A;  4TUU A;  2KAN A;  5D94 A;  1WRD B;  1Q1O A;  4W9H A;  5JHB A;  3ZO5 B;  3R7R A;  4LDT D;  2LD9 A;  1E8Z A;  2DEN B;  4YL8 A;  2K6Q A;  1PQS A;  4HVB A;  2WYQ A;  1WGR A;  3QK0 A;  2ZEQ A;  3JSV B;  5C23 A;  4WWO A;  4NPN A;  4FUL A;  2MQJ A;  2KK8 A;  5KHO A;  2KFK A;  2BYV E;  5AZF A;  3DVG Y;  1WJN A;  2LVQ A;  2DHZ A;  5DPR A;  4MEM A;  4PS8 A;  4BKS A;  1TZ1 A;  3WA0 A;  2MLB A;  4JIO U;  4ZYN A;  2FID A;  4AP4 C;  5DPW A;  2IYD B;  3CF6 E;  1UEL A;  4FJV B;  2J0K A;  1E5W A;  2PJH A;  2LRU A;  1GC7 A;  5D7G A;  3KYC D;  4AWJ A;  3DVG X;  3VHT C;  1GC6 A;  2REX A;  2KX3 A;  3A9K A;  1E8W A;  2JZ3 B;  3PPA A;  2CKH B;  1T0Y A;  4W9I A;  1Q5W B;  2DYM A;  3VUX A;  4EFO A;  4IWP A;  3H6N A;  2AWT A;  3ENE A;  2L0F A;  1QZE A;  4RM8 A;  1ZW7 A;  1M94 A;  2J7Q B;  4LCD E;  4W9J A;  3UGB B;  5J17 A;  5J2R A;  1WX9 A;  3BY4 B;  2KQS A;  3APF A;  3R3M A;  3DVN U;  3PTF C;  1GUA B;  1L7Y A;  1LXD A;  2K25 A;  4HWI B;  4I6N B;  3ZKJ C;  4KSK C;  5LXH A;  4M0W B;  3PZD A;  3X0W A;  4KIK B;  5C1Z A;  2LXA A;  2XEW A;  4GMV A;  2HJ8 A;  3RYT A;  3ZVV A;  2LGX A;  2C7N B;  3VTV A;  2BPS A;  2O2V A;  3AU5 A;  2MBB B;  4F8C B;  1WF9 A;  3X23 A;  2O2V B;  1EF5 A;  2KXJ A;  2MW5 A;  3QCA A;  2G3Q B;  4NQL B;  2EMS A;  2N4F A;  4KSL C;  2FIF A;  4E3C A;  3DDC B;  2WX1 A;  1MG8 A;  4ZDV A;  4BKS D;  3Q3F A;  4K7U A;  4P7I A;  2IO3 B;  3IHP C;  4ZRI A;  4ANX A;  3HM3 A;  3WIM A;  1RAX A;  3WAP A;  1V2Y A;  4WWN A;  4DHJ B;  4I6L B;  3VFK A;  1FXT B;  1WR1 A;  5DPT A;  2XK5 B;  4M8N A;  2L3Z A;  2Z0D B;  1IYF A;  2M1M A;  3L10 B;  2CHZ A;  2XBB C;  2KJH B;  3VH3 B;  2ZVO A;  4MEL A;  4BOS C;  3PS6 A;  1RFA A;  1UGM A;  2C60 A;  2DYB A;  4IW0 A;  4PS3 A;  4LJO B;  2BWE S;  4GXB A;  4II3 B;  1OTR B;  1P98 A;  1WMH B;  2GBK A;  4KZ0 A;  1UBI A;  5HKH A;  2LZ6 A;  5JH5 C;  2KFJ A;  2KO3 A;  3KYD D;  2O6V A;  2MBO A;  1NDD A;  3WAM A;  3RCZ A;  4TKN A;  3UIP B;  4ANW A;  2KN5 A;  4NY0 A;  3RT3 B;  1U4A A;  1UZX B;  3A9J B;  3NOB A;  4GOC A;  4NAW B;  4DDG D;  2MP2 A;  2QHO A;  2FCQ A;  2G4S A;  2NBU A;  4NJ7 A;  2UYZ B;  3L17 A;  4WJQ A;  2LUE A;  3AXC A;  4HPL B;  2C9W B;  4MGZ E;  1WH3 A;  4TV3 A;  1WYW B;  4ICV A;  4MGK E;  3W1Y A;  3QA8 A;  2KTR B;  4HXD A;  2D07 B;  2KWV B;  3KUD B;  4G3X B;  2XK5 A;  3WAN A;  2LGD A;  4RM9 A;  3VVW B;  1Y8R C;  1VCB A;  4KDL B;  5IAA C;  4M8M A;  1WX7 A;  1SGH A;  3DBR I;  4JLC A;  5G2N A;  4FLH A;  2WDT B;  1V86 A;  1WM2 A;  1YQB A;  2AL3 A;  2GBJ A;  2YLM A;  4KIK A;  1GJZ A;  3ZUN A;  2RGF A;  4W9C A;  5DPS A;  4K1R B;  1WGD A;  1V5O A;  2DAJ A;  3RUI B;  3OLM D;  1WXA A;  2CU1 A;  1YX5 B;  2R2Q A;  4RMA A;  4W9F A;  3RZF A;  4BFR A;  1XT9 B;  4MJS A;  1NBF C;  2ZNV C;  4GDK A;  4NJ6 A;  2PPH A;  4EKU A;  3M3J A;  3IG3 A;  3QAQ A;  3PLV A;  1WGH A;  2PE6 B;  1EUV B;  3CSF A;  4IWO A;  2LRW A;  1A5R A;  2FUH B;  2IO1 B;  2ZZP B;  4JL9 A;  3R66 C;  3NZS A;  3D32 A;  3SHQ A;  4EZL A;  2UWQ A;  3VH4 B;  4E74 A;  3C0R B;  3R7Q A;  1WY8 A;  2A4Z A;  1WJ4 A;  2W9N A;  4G50 A;  4I6P A;  4CYE A;  2O6V D;  3VQI A;  4FAD A;  4DHZ E;  2I1K A;  3TL5 A;  2D3G A;  2NPT B;  3H7P B;  1WR6 E;  5J18 A;  4A3O A;  1OEY A;  5TR5 A;  4K7W A;  3V6C B;  2GBM A;  3NS8 A;  3M62 B;  2NCN A;  5G55 A;  2KKC A;  2RR9 A;  5KHQ A;  1J19 A;  1RLF A;  3O65 B;  3RZW C;  2MSE D;  3K9P B;  2KWC A;  3A1Q B;  2IBI B;  4K81 A;  2BF8 B;  5CTR C;  3PVL A;  3A4R A;  1H4R A;  1WFY A;  2LWP A;  2NBV B;  3H7S A;  2D11 A;  2LAS A;  4KZC A;  3WAO A;  2KWU B;  5AZG A;  1TTN A;  2L00 B;  2J0M A;  3ZNZ B;  1HE8 A;  3N30 A;  3MTN B;  3W1S C;  3K9O B;  2KDF B;  2Z0E B;  2V4L A;  4FHK A;  4FN2 A;  3DBH I;  1F9J A;  2KMC A;  1E8Y A;  3EFU A;  1LFD A;  1LM8 B;  2J0J A;  4BKT A;  5AEK B;  3U8Z A;  2C5L C;  2NR2 A;  2WWZ A;  2KX0 A;  2JF5 A;  1C3T A;  4LJP B;  1Q0W B;  2LVP A;  4MSM B;  3PT2 B;  1UBQ A;  1AAR A;  1YJ1 A;  3JVZ X;  2B3A A;  4TQ1 A;  3TBL D;  1P0R A;  2K8B A;  2MX2 A;  4X57 B;  2KDE B;  2RD0 A;  3EC8 A;  4NQK E;  3CMM B;  3GZN I;  2BKF A;  3P2B A;  1WZ0 A;  1S3S G;  3L13 A;  3NY5 A;  1P9D U;  3KUC B;  2C7M B;  4URK A;  1UD7 A;  2LVO A;  2K39 A;  2OOB B;  3V61 A;  2JXX A;  3PV1 A;  1IP9 A;  4MJS B;  1E8X A;  2KMA A;  1WE6 A;  1I35 A;  2C7H A;  2GOW A;  1V80 A;  1WGG A;  1V6E A;  3M95 A;  3ZW3 A;  4CHK A;  2ZCB A;  4DWF A;  4HCP B;  3UIO B;  4KV2 A;  3KH0 A;  3VUY A;  3ZTD A;  4EUT A;  2PEA A;  3SD5 A;  2FCM A;  2N1V A;  3HIZ A;  1EO6 A;  1R4M I;  3KVF B;  1WXM A;  2KLG A;  3ZLZ A;  2K8C A;  5E6O A;  4IC7 B;  2K1F A;  4DHZ B;  3HM6 X;  1I42 A;  5CX3 A;  2Z59 B;  2MBH A;  4FBJ B;  3N32 A;  1R4N I;  3ML9 A;  2DZJ A;  1OQY A;  1ZKH A;  2K6D B;  2G45 B;  5JZE B;  1P1A A;  4DHJ D;  2KOX A;  5FR6 A;  1WXV A;  3TCA A;  3ZNG C;  3JSV A;  2VRR B;  5EDS A;  4GDL A;  3T9L A;  2KD0 A;  1D3Z A;  2KFK B;  2R2O A;  3APD A;  5CHW A;  3TMP B;  3LDZ E;  4EZJ A;  3BIN A;  1WIA A;  4W9K A;  2LI5 A;  1WZ3 A;  2GBN A;  3DVN V;  3A9K B;  2MBE A;  3Q3J A;  5D2M B;  1XQQ A;  2HE7 A;  4XX5 A;  2DZM A;  1LQB A;  1P3Q U;  2JVC A;  2NS5 A;  2L0T A;  1IPG A;  4HDQ A;  1KOT A;  5E6N A;  5L95 C;  4XC2 A;  4ANU A;  3CST A;  1ISN A;  1C1Y B;  3L16 A;  2KC1 A;  2WX0 A;  3V6E B;  1JRU A;  4W9D A;  1WX8 A;  2L8J A;  2FCN A;  3UF8 A;  1KM7 A;  2DAF A;  2N9P C;  4GB9 A;  4IUM B;  3ZTC A;  4EOY A;  2M0X A;  3UQA A;  2BYE A;  2LGY A;  4PYU A;  2BKR B;  2JWZ A;  2NVU I;  4GIV A;  2AYO B;  3TIX A;  3QWZ B;  1H8C A;  4MGI E;  2AEH A;  2JPH A;  2HTH A;  1YIW A;  3B08 A;  4A3P A;  4DK5 A;  3B0A A;  3N3K B;  2EMT A;  4JQW C;  4GDL B;  2RPQ A;  2BGF A;  2LJ5 A;  2JRI B;  3PRM B;  2D2Q A;  3PSE B;  2CR5 A;  2JT4 B;  2KDI A;  3NHE B;  4K7S A;  2GBR A;  3PHX B;  3RUL A;  1XD3 B;  3EEC A;  4EEW A;  4KVG B;  3GOE A;  4HLE A;  2N7E A;  3B1L X;  4IM0 A;  1OGW A;  2L76 A;  4HCN B;  4J6I A;  4W9L A;  3V60 A;  2N9X A;  3DOW A;  4MM3 A;  1L2N A;  4F7Z A;  3S2A A;  4E71 A;  3DQV A;  3ZDM C;  3QIJ A;  4B9K A;  3ZDT A;  4PS7 A;  4F1S A;  4ICU A;  2N9E B;  2BYF A;  3KUZ A;  4XZ4 A;  2KTR A;  3M63 B;  4G11 A;  2MA9 B;  3NZU A;  2JZZ A;  3ZRF A;  2ZJD A;  3W1S A;  3ML8 A;  2FNJ B;  1WI0 A;  4EZK A;  3MJW A;  1TBE A;  4GSW A;  4ASW C;  2FAZ A;  2V3S A;  3VXW A;  2NBW B;  4HDO A;  5GMV A;  4BOZ B;  2IY1 B;  4WAA A;  4MH0 E;  4AJW A;  2M4N A;  3JYU A;  4BBN F;  2CS4 A;  3TJP A;  2ZNV B;  1CMX B;  3L08 A;  3A33 B;  1KJT A;  4NNJ B;  2ZPY A;  4WJO A;  2A5U A;  2ASQ A;  4FA6 A;  1G6J A;  1SIF A;  1WMH A;  1Z2M A;  1YX6 B;  3PLU A;  3IVF A;  5LXI B;  3VTW A;  1J0G A;  4GDK B;  2KC2 A;  4WJN A;  2AL6 A;  3ECI A;  4OVU A;  4BKG A;  2Y5B B;  2JUO A;  1X1M A;  3SDL C;  3ZNH B;  2IY0 B;  3IFW B;  3VTU A;  2MP2 B;  5BO4 B;  5CHF A;  5D6J B;  1TGZ B;  3APC A;  3AUL A;  1S1Q B;  4W9G A;  3IBE A;  3ONS A;  2NPT A;  1SE9 A;  4IG7 B;  2IO2 B;  4LDT B;  3U30 A;  3RD2 A;  3T8M A;  4AJY B;  3JW0 X;  3MHS D;  3QX1 A;  4DDI D;  2MRP A;  3PHW B;  1WJ6 A;  4HPM B;  3DPD A;  3VDZ A;  4OVV A;  5JHA A;  2ZVN A;  3H7P A;  2IO0 B;  2IZV B;  4FHJ A;  2FCS A;  3L54 A;  4IM3 A;  4BBN C;  1RRB A;  1BT0 A;  2DYO A;  2K8H A;  2JRH A;  3A4S C;  1OEY J;  3ZRC A;  1YD8 U;  2KDB A;  3OJ4 B;  5IA7 A;  2M17 A;  2EKE C;  5E6P A;  3QJZ A;  1EF1 A;  4ZRJ A;  3VUW A;  2O6V B;  3U7D A;  2L7R A;  4G0N B;  1WM3 A;  2CHX A;  1E7U A;  4N9F 4;  2D10 A;  3DCG A;  2I1J A;  4AOF A;  4II2 B;  2KJ6 A;  3V62 A;  3AI5 A;  2JY6 A;  3EHV A;  1E7V A;  2DZK A;  3QAR A;  1V9J A;  4ZRK A;  2KZR A;  2V1Y A;  3AU4 A;  1V5T A;  2ZCC A;  3ZNI D;  4MGY E;  1KLV A;  2KLC A;  2L05 A;  4GU2 A;  4IWQ A;  4AUQ C;  4WQO B;  5CHV C;  4WWP A;  4CO7 A;  2PE9 A;  5LLI A;  3WAL A;  3QQ8 B;  1UH6 A;  1WJU A;  3PRZ A;  3SU8 X;  3PRP B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...