2C7HA

Solution nmr structure of the dwnn domain from human rbbp6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GPLGSMSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dwnn, a Novel Ubiquitin-Like Domain, Implicates Rbbp6 in Mrna Processing and Ubiquitin-Like Pathways
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin-like protein
molecule keywords RETINOBLASTOMA-BINDING PROTEIN 6, ISOFORM 3
total genus 18
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08783 DWNN DWNN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c7hA00
5CHWA 3KYCD 3V60A 4OVVA 2UWQA 3NZUA 4F8CB 3RZWC 3DOWA 3HM6X 1SE9A 4LCDE 1LFDA 3PS6A 5DPSA 4ASWC 2K8CA 1YJ1A 2WX1A 1WE7A 4TV3A 1ISNA 3TJPA 1C3TA 2CKHB 5KHOA 3ZUNA 5JHAA 2AWTA 4E3CA 4NY0A 4BOZB 2K39A 2WX0A 2NS5A 1R4NI 4HK2A 4DXAB 1WY8A 4TQ0A 2KX0A 2DZMA 1V49A 2JPHA 4FJVB 4IM2A 2Y5BB 3WANA 4DHJB 4PS3A 2B3AA 2KO3A 3QARA 3L54A 2FAZA 2OOBB 3ZDTA 4FN2A 3B1LX 4EUTA 2D10A 2BYEA 4K7SA 3ZRCA 1WMHB 3HHMA 4IW0A 2KWUB 3HK0A 3ZIMA 4WQOB 1YX6B 3K9PB 4ANVA 4F7ZA 2A4ZA 1WR6E 1WZ3A 4MGYE 5DCNA 1VCBA 2LVOA 1OEYA 4AJWA 4PS8A 3KUCB 1V81A 2JT4B 1WFYA 4WWNA 3VQIA 3AU4A 3PGEA 3QAQA 3PTFC 2KDFB 2AL6A 1TZ1A 4GDLB 1SGHA 2DZIA 2MBHA 2V3SA 2ZVNA 3QCAA 1Y8RC 3TBLD 2ZEQA 3AULA 4DDID 3ZW3A 1E5WA 1LQBA 2WYQA 3A1QA 2HE7A 1V86A 2IO2B 1I42A 4GDKB 4MH0E 4NAWB 1GNUA 3UGBB 5KHQA 4NJ6A 2MA9B 1NDDA 1C1YB 3PPAA 1J0GA 2KLGA 3VUYA 1H8CA 4MEMA 1WF9A 4XZ4A 4B95A 2BKFA 1UD7A 3W1YA 3ALBA 4JGHB 1J8CA 3R7QA 3DCGA 3VHTC 2MX2A 2KTRB 1WH3A 3KVFB 1X1MA 2RR9A 3H7SA 4FJYA 2D11A 2G45B 1GC7A 4LJPB 2LGXA 3A4RA 1OGWA 1ZW7A 1WZ0A 2FUHB 2LVPA 2O2VB 2LZ6A 2RPQA 1U4AA 4JLCA 2KD0A 4KSKC 3ML8A 2PE6B 4AWJA 3EHVA 1EUVB 3GZNI 1XQQA 3IHPC 3ONSA 4IG7B 3T8MA 4HVBA 3CSFA 1H4RA 3I3TB 5J17A 1OQYA 2KJ6A 3NHEB 3CSTA 4NQKE 3V6CB 3L0WB 2FCMA 4FADA 3UQBA 4HCNB 4CO7A 4G50A 3LJ3A 5LXHA 3T9LA 3PHXB 3A33B 2C9WB 3OJ3A 3PHWB 2W9NA 2N1WA 5JH5C 4WJOA 2M1MA 1YX5B 2BWFA 4M0WB 3APDA 2GBJA 5HKHA 2BPSA 1WGHA 2RSUA 2C7HA 3A1QB 3AI5A 4MDKE 4WJPA 3ZNHB 1WIAA 3R7RA 2DZKA 4KDIC 3TCAA 3BINA 2K8BA 2MP2B 4ICVA 4MGIE 5IAAC 3PLUA 3U30A 2MSED 3B0AA 3O65B 2ZCBA 2ZJDA 3JYUA 2LXCA 2ZNVB 2O6VA 4A3OA 3QQ8B 3N30A 5E6NA 1XT9B 1Q1OA 2KTRA 2FNJB 2GBNA 2RD0A 3RULA 3KUDB 3OAWA 4HLEA 4F1SA 4KZCA 3DVGX 1EF5A 2KLCA 3V61A 3A9JA 4LJOB 4ANUA 2V1YA 1GG3A 3DDCB 4HCPB 3BY4B 4PYZA 3UF8A 1TTNA 4I6NB 2IZVB 1SIFA 2C7MB 2KQSA 2GBRA 3VTVA 4IM3A 1RFAA 4AOFA 2BWES 1WM2A 1WJNA 3APFA 1E8XA 4BKSA 4DK5A 4MSMB 2HD5B 3UINB 3S2AA 3A4SC 2C60A 4EEWA 2N4FA 2NBWB 1Z2MA 2HTHA 3QIJA 3P2BA 2MW5A 2LRUA 3GOEA 3ZLZA 5CHVC 2GMIC 3DBHI 1WE6A 3L08A 4N9F4 2MCNB 3WAMA 2AEHA 1IP9A 3DBSA 4FA6A 3IVFA 2DX5B 2LJ5A 2ZVOA 3W1SC 1WX7A 4DHJD 4E74A 3KW5B 3JVZX 2DYMA 4NJ7A 2FCQA 3PZDA 1S3SG 2JVCA 2IY0B 2BKRB 2MBBB 3N3KB 3DQVA 3QJZA 4FLHA 1WX8A 3PREA 3C0RB 1WXSA 1HE8A 4WAAA 3NY5A 3QWZB 4JQWC 4G11A 1Q0WB 4WWPA 3CF6E 5DPTA 2ZPYA 4MGKE 2I1KA 2KZRA 4WJNA 4NAWA 2KFKA 3SDLC 3RUIB 1WXMA 4WJQA 1RLFA 5J2RA 1NBFC 2M17A 4JL9A 5LLIA 2JWZA 4EZKA 2QHOA 4PYUA 2JZZA 2VRRB 4HDQA 1EF1A 3NS8A 4NQLB 2FIFA 2XEWA 2K6QA 2L76A 3SU8X 3MJWA 1WR1A 1WX9A 5E6PA 2DYOA 3DVGY 2GOWA 2ZZPB 3ECIA 1E90A 3PV1A 1E8YA 3ZDMC 2NVUI 1P9DU 4MJSB 1V2YA 2EMSA 2YVCA 4GDKA 5LXIB 2IO3B 1RRBA 2L0TA 3DPDA 2FIDA 4YL8A 3RD2A 2L7RA 1LXDA 4DDGD 4DHZE 2MP2A 2LRWA 1UH6A 1VD2A 4GN1A 1F9JA 2R2OA 4KDLB 1FXTB 2O6VB 4B9KA 3PRZA 3UQAA 3SHQA 4RM8A 3M62B 2DZJA 3PLVA 1OEYJ 4KSLC 3JW0X 3AXCA 2KN5A 4IM0A 5CTRC 2J0MA 2LWPA 2YLMA 4GDLA 4HPLB 3TIXA 3RCZA 4AUQC 2NR2A 4ANXA 2N7DA 3ZTDA 2BF8B 2DAJA 2KMCA 3H6NA 2DHZA 3HM3A 3RYTA 2FCNA 2KC2A 1GUAB 2DYBA 1K8RB 2MWSB 2L0FA 1UZXB 1UELA 2LXAA 3KUZA 4MGZE 2Z0EB 4BBNF 2JRHA 2DAFA 4AJYB 2K25A 4URKA 4GIVA 2KDIA 3VH4B 1M94A 3A9KA 2REXA 1ZGUB 3U8ZA 3ZKJC 2N9PC 3X0WA 5GMVA 4IUMB 1WGYA 2CHXA 2LUEA 3CMMB 2IY1B 4IC7B 5G2NA 1CMXB 5L95C 3H7PA 3PVLA 2RGFA 4GGQA 4HXDA 3RT3B 3VFKA 4W9JA 2KNBA 4II3B 4MJSA 5C23A 3ZNZB 3PT2B 4RMAA 5AEKB 4NNJB 5AZFA 3VUWA 2N9EB 4XX5A 5TR5A 1R4MI 3MHSD 1WGGA 2M4NA 4XC2A 4DWFA 2L05A 4GOCA 4W9DA 2KJHB 1UBIA 3H9DA 3JSVA 5G55A 1WJUA 3UIPB 1EO6A 2IBIB 3V6EB 4HWIB 1WRDB 3DBLI 4IWQA 1P3QU 2G3QB 2M8SA 3LDZE 3MTNB 1YQBA 4HDOA 4JIOU 5D6JB 4IWPA 2IYDB 2UYZB 4EZJA 4LDTB 1GC6A 4TQ1A 2J7QB 5DPRA 3VXWA 4PS7A 4M8MA 2Z0DB 2J0JA 2LVQA 4KVGB 3QK0A 2MLBA 4HJKA 5JHBA 4ANWA 2OJRA 3VAWA 4B6WA 1Q5WB 3DVNV 4TUUA 4BKTA 4X57B 2L3ZA 3NZSA 4NPNA 4FBJB 5AZGA 4BFRA 4GU2A 4GXBA 2KHWB 2HJ8A 1G6JA 2J0KA 2KXJA 3Q3FA 3WAOA 1UGMA 2KK8A 1LM8B 4IWOA 3VTUA 1WI0A 2JUOA 2KQ7A 2D2QA 1V5OA 2EMTA 2ZPNA 3SD5A 3W1SA 3M95A 5L83A 5C1ZA 3IBEA 1KOTA 1S1QB 4EZLA 1L7YA 4W9GA 1P0RA 3RZFA 3HIZA 4ICUA 4RM9A 1KM7A 4I6LB 1ZKHA 3Q3JA 1V6EA 4EFOA 4HPMB 1BT0A 4K7WA 2KJRA 3QX1A 2KWVB 5E6OA 3ZRFA 3JSVB 2KC1A 4KIKA 4ZRJA 2C7NB 4I6PA 4AP4C 3WALA 4OVUA 2KANA 3DVNU 3AU5A 4A3PA 4MM3A 3QHTA 1D3ZA 1YD8U 1YIWA 3H7PB 4W9CA 3ENEA 4BKGA 2L8JA 1E8WA 2KMAA 2LGDA 2PJHA 1WXAA 3KH0A 2KFJA 3M63B 2Z59B 2DENB 4MSQB 2V4LA 2K8HA 4GB9A 2MBEA 3ZVVA 2ZNVC 3R66C 4II2B 4K81A 3ML9A 1P98A 2CU1A 2XK5A 2CS4A 1WJ6A 5DPWA 3OJ4B 3VDZA 5BO4B 3N32A 2KDBA 4CYEA 4KV2A 1WGRA 2O6VD 2PEAA 2KOXA 2WDTB 2R2QA 3EFUA 2PPHA 4BBNC 1KJTA 2LD9A 4P7IA 5D7GA 2A5UA 3PRPB 4GMVA 4DHZB 3EC8A 2D3GA 2CHZA 2O2VA 3APCA 3VTWA 1TGZB 2N1VA 2KWCA 2KTFA 3EECA 4K1RB 3ZTCA 1T0YA 1NI2A 2WWZA 4MELA 3X23A 5D94A 2IO1B 2MRPA 5AZHA 1E8ZA 2D07B 4WWOA 3UIOB 3TMPB 1Z5SB 3NOBA 2EKEC 3K9OB 1TBEA 2KFKB 2NBVB 4FJZA 3VH3B 2KVRA 4EOYA 2G4SA 2K1FA 1J19A 4FHJA 1GJZA 1IPGA 4ZYNA 1JRUA 1XD3B 2JRIB 4E71A 1I35A 3V62A 2LI5A 5FR6A 3ZO5B 2IO0B 4G0NB 2MQJA 3L10B 1WGDA 4M8NA 2C5LC 4A20A 2KKCA 4ZDVA 3ZNID 4GSWA 3KYDD 2KDEB 4W9EA 2LGYA 2ZCCA 3IFWB 3L13A 4J6IA 3PRMB 2CHWA 4W9KA 2JXXA 3ZNGC 5EDSA 2LASA 4ZRIA 1WXVA 2CR5A 1AARA 4W9HA 1KLVA 2NPTA 4KZ0A 4ZRKA 3M3JA 2G4DB 4TKNA 2JZ3B 2JY6A 3B08A 2XBBC 3WAPA 4W9IA 3R3MA 1WMHA 2BYFA 1L2NA 2GBMA 2NBUA 1WYWB 3L16A 4K7UA 2NCNA 4BKSD 1MG8A 2M0XA 3A9KB 1WM3A 2JF5A 3U7DA 2N7EA 3QC8B 3QA8A 2AL3A 4FHKA 5CHFA 4LDTD 3IG3A 2BGFA 3L17A 4W9FA 3H1UA 4W9LA 3WA0A 3TL5A 4EKUA 2N9XA 4G3XB 1P1AA 4CHKA 1PQSA 4BOSC 2MBQA 2ASQA 1A5RA 2NPTB 3PSEB 1V9JA 4BVUC 2PE9A 3VVWB 1V80A 2XK5B 1RAXA 2BYVE 4KIKB 5IA7A 3D32A 5J18A 4DBGA 3VUXA 2KX3A 3WIMA 2L00B 4FULA 2FCSA 2AYOB 2MBOA 1QZEA 1UBQA 3A9JB 2K6DB 5CX3A 5D2MB 2I1JA 5JZEB 1IYFA 1WJ4A 2GBKA 1OTRB 1V5TA 1E7UA 3OLMD 3DBRI 1E7VA
chains in the Genus database with same CATH superfamily
3V60A 4OVVA 2JWUA 1SE9A 3PS6A 1PGAA 1SJHD 2WX1A 3TJPA 4KGSA 5KHOA 4N59A 2WX0A 3NVVA 4L23A 4TQ0A 2DZMA 2JPHA 3NVZA 2B3AA 2KO3A 1E7PB 2Y5CA 2WU2B 2W55A 3ZDTA 3B1LX 2D10A 3FC4A 1WMHB 3HHMA 4IW0A 4ZOHC 1TJEA 2KWUB 2K22A 3K9PB 2A4ZA 1VCBA 4AJWA 1UUPA 2RMMA 4K3BA 5HG2A 1WFYA 4WWNA 3VQIA 2AL6A 1EWCA 2WP9B 1SGHA 2MBHA 2V3SA 3QCAA 3TBLD 1Y8RC 4ZHPA 2IDYA 3ZW3A 2WS3B 1WGKA 3AM9A 4GDKB 4NAWB 1GNUA 3UGBB 3ZQ4A 4M01A 1HZ6A 4JX1C 3PPAA 1J0GA 2KLGA 1AYFA 4MEMA 1WF9A 4MT5A 4B95A 3W1YA 3ZGZA 1GB4A 1V1PB 2QJLA 3KVFB 2LJIA 4Q2JA 2FUHB 1GPXA 2LZ6A 3I5JC 1ZDVA 1EUVB 2AQ2B 3GZNI 1VJKA 3IHPC 4IG7B 3CSFA 2KJ6A 2JZPA 2FCMA 1VZ7A 2JSVX 1KFYB 1FM0D 2VH2A 3T9LA 1UNSA 4KGRA 2W9NA 4YSXB 4WJOA 4DQOC 1OQQA 2M0AA 3A1QB 4MDKE 2C7HA 2D5GA 3DBHB 5H92C 4KDIC 5MPOA 4ICVA 5IAAC 3VR8B 4YTMB 3AEGB 2MSED 3O65B 5E6JA 2ZNVB 3N30A 2WLBA 4OZCA 1WRIA 4LNIA 2ZW0A 2IZVB 1SIFA 1I7HA 1WM2A 1WJNA 2IPKD 2PMVA 4H2AA 1JRPA 4MSMB 3UINB 4EEWA 3A4SC 1QILA 2LHEA 2R61A 2HTHA 2FUG1 3AE9B 1NYQA 2MW5A 3ZLZA 4YXDB 4N9F4 1IP9A 4FA6A 3W1SC 2V4IB 4DHJD 3NVYA 2V3NA 3AN1A 4NJ7A 2FCQA 2JVCA 1PFDA 3QJZA 4YTNB 1WXSA 1HE8A 4XDCA 4MGKE 5EE0A 2K9XA 2JWZA 4EZKA 1C9FA 4AS1A 2XEWA 2DYOA 2ZZPB 2J4XA 1C79A 3ECIA 3PV1A 2NVUI 3O13A 5JXVA 2KMMA 2IO3B 3IT4B 3DHIC 3HUIA 4DDGD 2MP2A 1VD2A 2R2OA 2BS2B 4B9KA 2O6VB 1N60A 1XLOA 3SHQA 4RM8A 3JW0X 3AXCA 5IOIA 2J0MA 4GDLA 3TIXA 3RCZA 1MJDA 2DAJA 2KMCA 2KC2A 2J53A 1FXIA 1GUAB 1FCCC 2LEKA 4NZLB 2Z0EB 2JRHA 1JWMD 4FXCA 4GIVA 3A9KA 3ZKJC 3X0WA 5GMVA 4IUMB 1F2RI 2W54A 2IY1B 5L95C 3H7PA 3PVLA 1EM7A 1EWYC 1SXTA 4II3B 1FMAD 1YN3A 1L6VA 1UF0A 1MHHE 1F52A 1TKGA 2D3BA 2X38A 5AZFA 3VUWA 2N9EB 1R4MI 1J7CA 3MHSD 4DWFA 4RNAA 1PGXA 2L05A 3Q8FA 4W9DA 1E6EB 3H9DA 4CQNA 2IBIB 1P3QU 3MTNB 1YQBA 1ESFA 4EZJA 3V05A 5BMGA 4HRSA 2J7QB 3VXWA 1YJIA 1HXYD 4HJKA 3C19A 5JHBA 5FR3A 2OJRA 3VAWA 3LYYA 4X57B 1IGDA 3GZNB 4JE3B 4FBJB 1JQ4A 2KXJA 1I4RA 1UGMA 2KK8A 4IWOA 3VTUA 4US8A 3SD5A 2D2QA 2EMTA 5L83A 3I57A 3M95A 1S1QB 3DBLB 4RM9A 1KM7A 1UGJA 4ZRPA 3Q3JA 4A90A 1XCTL 3BVGA 5E6OA 2BQQA 3JSVB 2KC1A 2C7NB 4AP4C 3WALA 3H7PB 1XLQA 3ENEA 1KLGD 1JWSD 2L8JA 2WXPA 3RNEC 5EE9A 4II2B 2EELA 1V1OA 3T3NA 3OJ4B 4A8XC 3BZDB 1WGRA 1T5XD 2WDTB 3AEBB 1KJTA 4HJGE 4DHZB 3EC8A 2D3GA 3B2GA 3APCA 3VTWA 2KTFA 4O1NA 4MELA 5D94A 1E8ZA 2D07B 3TMPB 1Z5SB 2KFKB 3VH3B 2IGDA 3DWMA 4IOIE 1SE2A 1JWAD 2MQJA 1FFUA 4A20A 4GSWA 4W9EA 2ZCCA 4W9KA 2LASA 2CR5A 1KLVA 1YMHE 2JY6A 3BVMA 3WAPA 1WMHA 3VR9B 2RDBC 2JXTA 4USAA 3N1YC 2QCZA 1L2NA 2GRIA 2N7JA 1F2RC 1RYJA 3AE5B 4US9A 3QC8B 2UU7A 2Y5PA 4LDTD 3IG3A 3DBRB 1IGCA 2LGSA 4W9FA 3H1UA 1ET6A 4EKUA 2HJ1A 3B9JA 1GB1A 1PQSA 2SAKA 1A5RA 2PLPA 3VVWB 2XK5B 1RAXA 3D32A 4DBGA 3VUXA 4FULA 1QZEA 1QT9A 2K6DB 2WXJA 1IYFA 3PZ8A 2K0PA 5BMHA 3OLMD 4S17A 3KYCD 3NZUA 3SFDB 1YJ1A 1UWXA 2MJ3A 2QDFA 2CKHB 3ZUNA 4DXAB 5I4DA 4IM2A 2JYEA 2DNFA 4FJVB 4JWUC 4K7SA 1P7EA 2RDHA 4C80A 1WZ3A 3KLSX 1T6BX 1ET9A 1J7AA 3V3XA 2OHFA 1A70A 2EKIA 1STEA 1SSNA 1E5WA 2WYQA 3A1QA 3Q3NC 1C4AA 4MH0E 2JQRB 4YT0B 1KF6B 3ALBA 1R4NB 4JGHB 1J8CA 3VHTC 1L0VB 1XXGA 1DYQA 2RR9A 2W3RA 4LJPB 3P63A 2G45B 2LGXA 4LTUA 2LVPA 2YEPF 2KD0A 2PE6B 3EHVA 1XQQA 2OJWA 1XLNA 4HVBA 1SEBD 3CSTA 4NQKE 4HCNB 4CO7A 4G50A 2ZW1A 3DHHC 3PHWB 1FO4A 3PO0A 1PYWD 1QKZA 3AE7B 2M1MA 1YX5B 1PGBA 1I4PA 2GBJA 5HKHA 3AI5A 1SB3C 1WIAA 4KGTA 1N62A 2WXGA 2WXFA 3BINA 4M00A 2ZJDA 3QQ8B 1XT9B 2RD0A 1V8CA 2GBNA 4OVZA 1EF5A 2KLCA 3A9JA 4ANUA 1GG3A 4PYZA 2C7MB 2KQSA 1I4HA 2GBRA 4AOFA 1RFAA 3APFA 1E8XA 4WAFA 4DK5A 2C60A 3QIJA 1Z2MA 4KKIA 3P2BA 1D5XC 2M56B 5GXGB 2LRUA 1IBXB 3WAMA 5LNK1 1C76A 1OFFA 2AEHA 1FIQA 1NENB 4HEA1 2DX5B 2LJ5A 4E74A 3JVZX 2IY0B 3DQVA 3PREA 3C0RB 3FILB 4N58A 2WXRA 1KRHA 2WXIA 3CF6E 4WJNA 5IKCM 2V3PA 4WJQA 1RLFA 2BB5A 2M17A 4JL9A 5LLIA 4PYUA 2VRRB 4NQLB 2K6QA 1GOZA 3DVGY 3AH7A 1E90A 1ZOYB 1E8YA 3ZDMC 1P9DU 3TUOA 3DPDA 3RD2A 1PUTA 2L7RA 3RFZB 1LXDA 4PT5A 4C56C 1UH6A 3AE3B 4KDLB 4C7ZA 1FXTB 1TY2A 3PRZA 3UQAA 1FPYA 2DZJA 3PLVA 1T0SC 1R4MB 3RNGC 4IM0A 5CTRC 3W5UB 4HPLB 2RPVA 2N7DA 1FNWA 3R8BA 1K50A 3HM3A 3RYTA 2MWSB 3KUZA 4BBNF 4N6EB 3KQ4A 2K25A 3VH4B 1TS5A 2CHXA 2LUEA 1VDVA 3CMMB 3IAS1 2WDVB 2WXNA 2RGFA 1FEHA 4GGQA 4HXDA 3VFKA 4W9JA 1K53A 2KNBA 5IN7A 2MH7A 4P1BC 3PT2B 4RMAA 3HVDA 4NNJB 4XX5A 5TR5A 1FD6A 2M4NA 3RMKC 3Q8AA 1V1PA 2INPE 4GOCA 2H89B 5G55A 3UIPB 1YJJA 5BYQA 1EO6A 4HWIB 1WRDB 4R3DA 3LDZE 4HDOA 4ZRQA 2IYDB 4OZAA 1SF0A 4J3OD 3FAHA 3ZXRA 2D3CA 4M8MA 4KVGB 2LVQA 1SE3A 3QK0A 1QLBB 2MLBA 1CJEA 3DVNV 2ONQA 3Q3MC 1XF5L 2ICIA 2L3ZA 4GU2A 4GXBA 2KHWB 2WQYB 2XN9C 2WXOA 1LM8B 2L83A 3UI3A 2KQ7A 2ZPNA 3RZFA 3HIZA 4ICUA 2E3TA 4I6LB 1ZKHA 3MFGA 4K7WA 3QX1A 2JX5A 2KWVB 3CIRB 3ZRFA 3Q2AC 2I38A 4KIKA 1BXTA 4OVUA 3DHGC 2PKOA 3QHTA 2WU5B 4BKGA 1HA5A 1WXAA 1N61A 3P1MA 2KFJA 2Z59B 2DENB 2V4LA 4GB9A 3R66C 4REZA 2IGGA 3ML9A 1P98A 2CS4A 1WJ6A 3MC0B 3N32A 4KV2A 2PEAA 1TS4A 2R2QA 4IKGA 3TSSA 1L6UA 4MH8A 4LNKA 4P16A 5D7GA 3GE8C 4GMVA 1KTKA 3N1XC 2PW9A 3NUHB 1AW7A 3U2SC 4K1RB 3ZTCA 4MM3B 1NI2A 1T0YA 1E10A 3E56A 4RFBA 4WWOA 2INCC 3SR6A 2EKEC 2QSDA 1TBEA 2NBVB 3DWGC 4FJZA 2KVRA 1IUEA 2OEDA 3IT6B 4ZYNA 1XD3B 4E71A 1I35A 3V62A 2LI5A 4G0NB 3U4EG 3L10B 3ZNID 4D2KA 1E0ZA 2LGYA 3L13A 4J6IA 3ZJTA 3ZNGC 3BYYB 1AARA 1VR9A 4KZ0A 4WURA 2G4DB 1YNTE 4TKNA 2VZKD 2WGSA 4YTPB 2JZ3B 3VRAB 1D5ZC 1P7FA 2WDRB 3EFCA 4K3CA 3L16A 2NCNA 1NI3A 1ZXHA 1MG8A 2YEPB 1DOYA 1WM3A 2WXKA 2N9XA 4BOSC 2QC8A 2ASQA 4MACA 4BVUC 1V9JA 1V80A 4A6QA 4KIKB 5J18A 1ROEA 3P4PB 3RNBC 3L4PA 1FRDA 2AYOB 5CX3A 5JZEB 1WJ4A 1NEKB 2G1EA 2G9HD 1OTRB 1E7UA 1E7VA 2UWQA 5T8IA 4F8CB 2BTEA 3RZWC 3DOWA 1XLPA 2K8CA 1WE7A 4TV3A 1ISNA 4WWMA 1C3TA 3W5VB 2AWTA 2QEJC 4EE2A 1DOXA 2JYTA 2TSSA 2NS5A 3TEZA 4HK2A 3Q6BA 2KX0A 4YSZB 3WANA 4PS3A 3QARA 3L54A 2OOBB 3MHZA 3AB5A 4FN2A 2RDGA 4EUTA 2BYEA 1QOAA 4NJCA 1FNUA 3HK0A 3ZIMA 4WQOB 1YX6B 4F7ZA 1ZUD2 5AUIA 2LVOA 1OEYA 4PS8A 1ZXIA 3PGEA 3QAQA 3PTFC 2KDFB 1CK1A 3LXFA 3RI7C 1VLBA 1XEEA 4C4VB 2ZEQA 3AULA 4DDID 2DLBA 3EA6A 1LQBA 2HE7A 2IO2B 5KHQA 1N63A 4PK1A 2MA9B 1NDDA 4WIPA 3VUYA 4YWGG 1N6ZA 1RM6C 4XZ4A 1UD7A 3R7QA 2MX2A 1WH3A 1GC7A 3A4RA 2J52A 2RPQA 1ZPSA 4JLCA 4KSKC 3ML8A 4AWJA 4LK0M 4DXFA 3T8MA 3I3TB 3RPFC 2LUMA 1OQYA 5HHDG 3NHEB 3V6CB 3L0WB 3UQBA 1WSPA 3LJ3A 3ZJUA 3RN9C 3MJ5A 3A33B 1D6EC 2V0GA 3OJ3A 2BB6A 2N1WA 3APDA 2BPSA 3ZNHB 4QAYA 2DZKA 3ZYYX 4HKZE 4MGIE 3PLUA 3B0AA 2ZCBA 4XGAB 3JYUA 2LXCA 2O6VA 3Q8CA 5E6NA 1Q1OA 4KX6B 2FNJB 3RULA 1QOBA 4B0MA 3AE6B 4F1SA 3Q3OC 3V61A 4LJOB 2V1YA 3WCQA 3DDCB 4HCPB 3BY4B 3FILA 4I6NB 3AE2B 2QMTA 5TSSA 2KYWA 4LNOA 2KACA 2HD5B 3S2AA 2N4FA 1VZ8A 2NBWB 1MVKA 3GOEA 2GMIC 1JWUD 1WE6A 3KWLA 2MCNB 5H8YE 3IVFA 1WX7A 1LO5D 2DYMA 1OQRA 1S3SG 2BKRB 3N3KB 4C7YA 2L32A 4WAAA 3NY5A 3QWZB 4JQWC 1Q0WB 4WWPA 5DPTA 2ZPYA 4NAWA 3AMZA 4XWTA 3RUIB 2MJDA 4A9AA 3NJTA 2QHOA 3BK1A 2JZZA 3NS8A 2FIFA 1WR1A 5E6PA 1XCQL 2GOWA 1EU4A 3ZJVA 3I63C 4GDKA 1MPEA 1RRBA 1CZPA 4A55A 1EU3A 4YL8A 5HFYA 4DHZE 2SEBD 2LRWA 3AEDB 1F9JA 5BMIA 3MP9A 4GLSC 2KN5A 2KN4A 4ANXA 2BF8B 3H6NA 4JWSC 2DHZA 2MHJA 2FCNA 1HQRD 1UZXB 1FXAA 4URKA 1HTQA 2LMCA 4OZBA 2REXA 1MG4A 2HDEA 1TZOA 1CMXB 2AX5A 1QF6A 1AN8A 3TEWA 1FRRA 2AQ3B 2INNE 4MJSA 1VZ6A 3P4RB 3ZNZB 2N9LA 1YOVB 4LLGM 2BT6A 1WGGA 4XC2A 4OW0A 2NMQA 1NVID 2KJHB 1UBIA 2CJOA 3JSVA 1I4GA 3V6EB 3DBLI 4IWQA 5D6JB 5C2TB 4IWPA 1L5PA 4LDTB 2D3AA 4TQ1A 5DPRA 3IAM1 3R2TA 5EE1A 4TUUA 4L2YA 4HPPA 3AEAB 1DGJA 3NZSA 4NPNA 4BFRA 3Q69A 2W82A 1LGRA 3J9CA 2HJ8A 1G6JA 2J0KA 3Q3FA 1WI0A 3GP7A 2JUOA 1V5OA 3W1SA 4YSYB 1KOTA 2LFIA 3IBEA 2FBWB 4W9GA 1P0RA 5AUKA 1HTOA 1V6EA 1N5XA 1BT0A 4IDIA 1B9RA 2N0SB 4ZHOA 1BMLC 3U7ZA 4I6PA 2KANA 4MM3A 1D3ZA 1YIWA 3NVWA 1E8WA 1QOGA 3KH0A 3M63B 4HROA 2KAJA 4MSQB 3ZVVA 4K81A 2XK5A 2Z8LA 2N9KA 1ZDXA 2KDBA 1IBXA 4WH4A 2O6VD 2KOXA 3EFUA 2PPHA 2LD9A 2WNMA 2H88B 2BBCA 2HTME 2Q5WD 2CHZA 1ZP0B 3EECA 2WWZA 3X23A 2QILA 5AZHA 3BVZA 3UIOB 3R2IA 3NOBA 3K9OB 4ITKA 3TEYA 4EOYA 3BYTB 3OG5A 2K1FA 4FHJA 4ACFA 1HEZE 1IPGA 3GE3C 2JRIB 4ARCA 2ACZB 2IO0B 3E9SA 4M8NA 5G5HA 2C5LC 2KKCA 4ZDVA 3KYDD 2KDEB 3PZ7A 3PRMB 2CHWA 2JXXA 1WXVA 2NPTA 4ZRKA 1MI0A 1RWSA 3B08A 2XBBC 1M4VA 1F1HA 4P6VF 4RGOS 2PVGC 3VRBB 4BAXA 2BYFA 4RCOA 4K7UA 2GBMA 1WYWB 2NBUA 1T3QA 3ETRA 4BKSD 4LNNA 2JF5A 2N7EA 1PDXA 3QA8A 2AL3A 4FHKA 1NYRA 5CHFA 5EE3A 4RF0A 3T3OA 2BGFA 3WA0A 4W9LA 3TL5A 1QOFA 1P1AA 4CHKA 2MBQA 3MC8A 2NPTB 3SFEB 5IA7A 3WIMA 2L00B 4WQMA 3B2FA 3N20C 2MBOA 1UBQA 5D2MB 2DWQA 3DBRI 1TT5B 3PHXB 5CHWA 1YQ3B 3HM6X 4LCDE 1LFDA 5DPSA 4ASWC 5JHAA 4E3CA 1SE4A 4NY0A 4BOZB 2K39A 1R4NI 1WY8A 2BS4B 3AEFB 3HVZA 1V49A 4RGMA 2Y5BB 4DHJB 3GS2A 1TY0A 3URYA 3ZXVA 2FAZA 4AQ7A 3Q14C 3ZRCA 4XE0A 4UDUC 4ANVA 3SEBA 1WR6E 3NG0A 4MGYE 5DCNA 3NZ3A 3KUCB 1V81A 5G5GA 2JT4B 4BZAA 3AU4A 2WXQA 1TZ1A 4GDLB 2DZIA 2ZVNA 3NRZA 1VRAB 1D5MC 1C78A 1V86A 2IJ0A 1I42A 1F77A 4NJ6A 2WXMA 3P4QB 1FCLA 2CU3A 1C1YB 1H8CA 4TMAB 2BKFA 3EGRA 3DCGA 2ON8A 2KTRB 1QQRA 5BYRA 1X1MA 3H7SA 4FJYA 2D11A 1OGWA 1I4XA 1ZW7A 1WZ0A 2O2VB 1U4AA 1TKEA 5HI1A 3ONSA 1ACCA 1H4RA 2NTTA 3BK2A 5J17A 4XWWA 3FKYA 1T0RC 4FADA 5LXHA 2J42A 2C9WB 3H8HA 3AE4B 5JH5C 2FE8A 1DOIA 1CQVA 2BWFA 4M0WB 2KQ4X 2PVOD 1WGHA 2RSUA 4WJPA 3N1ZC 3BWUD 3R7RA 1Y56A 3HRDD 1JMLA 3TCAA 5IP4D 2K8BA 2MP2B 1C4CA 3U30A 4RGNA 2I2YA 2L52A 1C77A 1HZ5A 1KLUD 4A3OA 2WHIA 4L1BA 2CJNA 2KTRA 1AWDA 3KUDB 3OAWA 2NTSA 4HLEA 4KZCA 3DVGX 4RH6A 3AE8B 3UF8A 2BVCA 1TTNA 1ENFA 3VTVA 4IM3A 2BWES 1L0XB 2XNAC 4BKSA 2Y3AA 2WXLA 1Q10A 1N5WA 5CHVC 1MHXA 2KVZA 3DBHI 3L08A 3DBSA 2ZVOA 3KW5B 5FKAC 3KWVA 5D3DA 4ZYSA 3PZDA 1JALA 2MBBB 1BUIC 4FLHA 1WX8A 1C4PA 4G11A 3P42A 4KKJA 2I1KA 2KZRA 3MC9A 2KFKA 3SDLC 1WXMA 1JROA 5J2RA 3P4SB 1NBFC 4RGTA 5D3IB 3AE1B 4HDQA 5FK9C 1EF1A 1ZE3D 2L76A 3SU8X 3MJWA 1WX9A 4HKQA 2V9HA 3GB1A 1L4DB 4MJSB 1V2YA 2EMSA 2YVCA 5LXIB 2L0TA 2FIDA 4TSSA 1RFKA 2JU6X 4RF1A 4GN1A 1JCKB 3IXSA 2E6XA 4DXGA 3M62B 1OEYJ 4KSLC 3LB8C 2LWPA 2YLMA 4JPSA 4AUQC 2NR2A 3ZTDA 4S0RA 4NAMA 2DYBA 1K8RB 3Q8EA 2L0FA 4LNFA 2LXAA 1UELA 4MGZE 2DAFA 4AJYB 2BW2A 2KDIA 3W9CB 1TIFA 4B0EA 1M94A 1ZGUB 2MJEA 3U8ZA 2N9PC 1WGYA 4C4VA 4IC7B 5G2NA 2L1AA 3EUB2 2BYTA 3RT3B 5C23A 1YQ4B 4XYCA 2QIEB 2VZKB 5AEKB 4M02A 3BIID 1FNVA 3U52E 2LGIA 1WJUA 1FFVA 2G3QB 2M8SA 4JIOU 3NS1A 2UYZB 3I9V1 1GC6A 3Q8BA 1K51A 3AEEB 4PS7A 2Z0DB 2J0JA 2K5PA 4ANWA 4B6WA 1SJED 1Q5WB 4BKTA 2IGHA 1J7BA 5AZGA 3N9YC 3C8YA 2KT7A 3WAOA 5C3JB 5C1ZA 4EZLA 1L7YA 2BS3B 1TS2A 4EFOA 4HPMB 2KJRA 4ZRJA 1TS3A 1I4QA 3DVNU 3AU5A 1JW9D 4A3PA 5BYSA 4XDDA 1YD8U 2B76B 4W9CA 2KDMA 1YN4A 2KMAA 1SBBB 1WXQA 4P1CC 2LGDA 2PJHA 1XO3A 2K8HA 2MBEA 2ZNVC 2CU1A 5DPWA 3VDZA 2VH1A 5BO4B 4CYEA 2DBYA 1B1ZA 4BBNC 2PTLA 4P7IA 3PRPB 2A5UA 3AV8A 2X8XX 2O2VA 3RNAC 1TGZB 2N1VA 2KWCA 3RNFC 1KH0A 2IO1B 2MRPA 1TKYA 1V97A 2G4SA 1J19A 1F0ZA 2W3SA 1GJZA 2K3UA 1JRUA 2GLSA 1R7SA 5FR6A 3ZO5B 1WGDA 1SIJA 3IFWB 3CWIA 5EDSA 4ZRIA 4ARIA 1L0YB 2M19A 4W9HA 2KWDA 4C00A 3M3JA 1D4BA 1JWBD 4W9IA 3R3MA 3W2DA 1WWTA 2PIAA 2INDC 2M0XA 3A9KB 3U7DA 2WDQB 1UWMA 1K52A 3AECB 4OHJA 3L17A 2LHDA 4G3XB 1MFWA 3ABVB 3OWEB 2GI9A 1WYGA 5IO9A 1TYGB 3PSEB 2WXHA 2PE9A 1E9MA 2BYVE 2MEKA 2KX3A 2GB1A 1YN5A 1T0QC 1GAQB 2FCSA 4M0WA 2AQ1B 3A9JB 3RNCC 2I1JA 2GBKA 3TEXA 1L4ZB 1V5TA
chains in the Genus database with same CATH topology
5CHWA 3KYCD 3V60A 4OVVA 2UWQA 3NZUA 4F8CB 3RZWC 3DOWA 3HM6X 1SE9A 4LCDE 1LFDA 3PS6A 5DPSA 4ASWC 2K8CA 1YJ1A 2WX1A 1WE7A 4TV3A 1ISNA 3TJPA 1C3TA 2CKHB 5KHOA 3ZUNA 5JHAA 2AWTA 4E3CA 4NY0A 4BOZB 2K39A 2WX0A 2NS5A 1R4NI 4HK2A 4DXAB 1WY8A 4TQ0A 2KX0A 2DZMA 1V49A 2JPHA 4FJVB 4IM2A 2Y5BB 3WANA 4DHJB 4PS3A 2B3AA 2KO3A 3QARA 3L54A 2FAZA 2OOBB 3ZDTA 4FN2A 3B1LX 4EUTA 2D10A 2BYEA 4K7SA 3ZRCA 1WMHB 3HHMA 4IW0A 2KWUB 3HK0A 3ZIMA 4WQOB 1YX6B 3K9PB 4ANVA 4F7ZA 2A4ZA 1WR6E 1WZ3A 4MGYE 5DCNA 1VCBA 2LVOA 1OEYA 4AJWA 4PS8A 3KUCB 1V81A 2JT4B 1WFYA 4WWNA 3VQIA 3AU4A 3PGEA 3QAQA 3PTFC 2KDFB 2AL6A 1TZ1A 4GDLB 1SGHA 2DZIA 2MBHA 2V3SA 2ZVNA 3QCAA 1Y8RC 3TBLD 2ZEQA 3AULA 4DDID 3ZW3A 1E5WA 1LQBA 2WYQA 3A1QA 2HE7A 1V86A 2IO2B 1I42A 4GDKB 4MH0E 4NAWB 1GNUA 3UGBB 5KHQA 4NJ6A 2MA9B 1NDDA 1C1YB 3PPAA 1J0GA 2KLGA 3VUYA 1H8CA 4MEMA 1WF9A 4XZ4A 4B95A 2BKFA 1UD7A 3W1YA 3ALBA 4JGHB 1J8CA 3R7QA 3DCGA 3VHTC 2MX2A 2KTRB 1WH3A 3KVFB 1X1MA 2RR9A 3H7SA 4FJYA 2D11A 2G45B 1GC7A 4LJPB 2LGXA 3A4RA 1OGWA 1ZW7A 1WZ0A 2FUHB 2LVPA 2O2VB 2LZ6A 2RPQA 1U4AA 4JLCA 2KD0A 4KSKC 3ML8A 2PE6B 4AWJA 3EHVA 1EUVB 3GZNI 1XQQA 3IHPC 3ONSA 4IG7B 3T8MA 4HVBA 3CSFA 1H4RA 3I3TB 5J17A 1OQYA 2KJ6A 3NHEB 3CSTA 4NQKE 3V6CB 3L0WB 2FCMA 4FADA 3UQBA 4HCNB 4CO7A 4G50A 3LJ3A 5LXHA 3T9LA 3PHXB 3A33B 2C9WB 3OJ3A 3PHWB 2W9NA 2N1WA 5JH5C 4WJOA 2M1MA 1YX5B 2BWFA 4M0WB 3APDA 2GBJA 5HKHA 2BPSA 1WGHA 2RSUA 2C7HA 3A1QB 3AI5A 4MDKE 4WJPA 3ZNHB 1WIAA 3R7RA 2DZKA 4KDIC 3TCAA 3BINA 2K8BA 2MP2B 4ICVA 4MGIE 5IAAC 3PLUA 3U30A 2MSED 3B0AA 3O65B 2ZCBA 2ZJDA 3JYUA 2LXCA 2ZNVB 2O6VA 4A3OA 3QQ8B 3N30A 5E6NA 1XT9B 1Q1OA 2KTRA 2FNJB 2GBNA 2RD0A 3RULA 3KUDB 3OAWA 4HLEA 4F1SA 4KZCA 3DVGX 1EF5A 2KLCA 3V61A 3A9JA 4LJOB 4ANUA 2V1YA 1GG3A 3DDCB 4HCPB 3BY4B 4PYZA 3UF8A 1TTNA 4I6NB 2IZVB 1SIFA 2C7MB 2KQSA 2GBRA 3VTVA 4IM3A 1RFAA 4AOFA 2BWES 1WM2A 1WJNA 3APFA 1E8XA 4BKSA 4DK5A 4MSMB 2HD5B 3UINB 3S2AA 3A4SC 2C60A 4EEWA 2N4FA 2NBWB 1Z2MA 2HTHA 3QIJA 3P2BA 2MW5A 2LRUA 3GOEA 3ZLZA 5CHVC 2GMIC 3DBHI 1WE6A 3L08A 4N9F4 2MCNB 3WAMA 2AEHA 1IP9A 3DBSA 4FA6A 3IVFA 2DX5B 2LJ5A 2ZVOA 3W1SC 1WX7A 4DHJD 4E74A 3KW5B 3JVZX 2DYMA 4NJ7A 2FCQA 3PZDA 1S3SG 2JVCA 2IY0B 2BKRB 2MBBB 3N3KB 3DQVA 3QJZA 4FLHA 1WX8A 3PREA 3C0RB 1WXSA 1HE8A 4WAAA 3NY5A 3QWZB 4JQWC 4G11A 1Q0WB 4WWPA 3CF6E 5DPTA 2ZPYA 4MGKE 2I1KA 2KZRA 4WJNA 4NAWA 2KFKA 3SDLC 3RUIB 1WXMA 4WJQA 1RLFA 5J2RA 1NBFC 2M17A 4JL9A 5LLIA 2JWZA 4EZKA 2QHOA 4PYUA 2JZZA 2VRRB 4HDQA 1EF1A 3NS8A 4NQLB 2FIFA 2XEWA 2K6QA 2L76A 3SU8X 3MJWA 1WR1A 1WX9A 5E6PA 2DYOA 3DVGY 2GOWA 2ZZPB 3ECIA 1E90A 3PV1A 1E8YA 3ZDMC 2NVUI 1P9DU 4MJSB 1V2YA 2EMSA 2YVCA 4GDKA 5LXIB 2IO3B 1RRBA 2L0TA 3DPDA 2FIDA 4YL8A 3RD2A 2L7RA 1LXDA 4DDGD 4DHZE 2MP2A 2LRWA 1UH6A 1VD2A 4GN1A 1F9JA 2R2OA 4KDLB 1FXTB 2O6VB 4B9KA 3PRZA 3UQAA 3SHQA 4RM8A 3M62B 2DZJA 3PLVA 1OEYJ 4KSLC 3JW0X 3AXCA 2KN5A 4IM0A 5CTRC 2J0MA 2LWPA 2YLMA 4GDLA 4HPLB 3TIXA 3RCZA 4AUQC 2NR2A 4ANXA 2N7DA 3ZTDA 2BF8B 2DAJA 2KMCA 3H6NA 2DHZA 3HM3A 3RYTA 2FCNA 2KC2A 1GUAB 2DYBA 1K8RB 2MWSB 2L0FA 1UZXB 1UELA 2LXAA 3KUZA 4MGZE 2Z0EB 4BBNF 2JRHA 2DAFA 4AJYB 2K25A 4URKA 4GIVA 2KDIA 3VH4B 1M94A 3A9KA 2REXA 1ZGUB 3U8ZA 3ZKJC 2N9PC 3X0WA 5GMVA 4IUMB 1WGYA 2CHXA 2LUEA 3CMMB 2IY1B 4IC7B 5G2NA 1CMXB 5L95C 3H7PA 3PVLA 2RGFA 4GGQA 4HXDA 3RT3B 3VFKA 4W9JA 2KNBA 4II3B 4MJSA 5C23A 3ZNZB 3PT2B 4RMAA 5AEKB 4NNJB 5AZFA 3VUWA 2N9EB 4XX5A 5TR5A 1R4MI 3MHSD 1WGGA 2M4NA 4XC2A 4DWFA 2L05A 4GOCA 4W9DA 2KJHB 1UBIA 3H9DA 3JSVA 5G55A 1WJUA 3UIPB 1EO6A 2IBIB 3V6EB 4HWIB 1WRDB 3DBLI 4IWQA 1P3QU 2G3QB 2M8SA 3LDZE 3MTNB 1YQBA 4HDOA 4JIOU 5D6JB 4IWPA 2IYDB 2UYZB 4EZJA 4LDTB 1GC6A 4TQ1A 2J7QB 5DPRA 3VXWA 4PS7A 4M8MA 2Z0DB 2J0JA 2LVQA 4KVGB 3QK0A 2MLBA 4HJKA 5JHBA 4ANWA 2OJRA 3VAWA 4B6WA 1Q5WB 3DVNV 4TUUA 4BKTA 4X57B 2L3ZA 3NZSA 4NPNA 4FBJB 5AZGA 4BFRA 4GU2A 4GXBA 2KHWB 2HJ8A 1G6JA 2J0KA 2KXJA 3Q3FA 3WAOA 1UGMA 2KK8A 1LM8B 4IWOA 3VTUA 1WI0A 2JUOA 2KQ7A 2D2QA 1V5OA 2EMTA 2ZPNA 3SD5A 3W1SA 3M95A 5L83A 5C1ZA 3IBEA 1KOTA 1S1QB 4EZLA 1L7YA 4W9GA 1P0RA 3RZFA 3HIZA 4ICUA 4RM9A 1KM7A 4I6LB 1ZKHA 3Q3JA 1V6EA 4EFOA 4HPMB 1BT0A 4K7WA 2KJRA 3QX1A 2KWVB 5E6OA 3ZRFA 3JSVB 2KC1A 4KIKA 4ZRJA 2C7NB 4I6PA 4AP4C 3WALA 4OVUA 2KANA 3DVNU 3AU5A 4A3PA 4MM3A 3QHTA 1D3ZA 1YD8U 1YIWA 3H7PB 4W9CA 3ENEA 4BKGA 2L8JA 1E8WA 2KMAA 2LGDA 2PJHA 1WXAA 3KH0A 2KFJA 3M63B 2Z59B 2DENB 4MSQB 2V4LA 2K8HA 4GB9A 2MBEA 3ZVVA 2ZNVC 3R66C 4II2B 4K81A 3ML9A 1P98A 2CU1A 2XK5A 2CS4A 1WJ6A 5DPWA 3OJ4B 3VDZA 5BO4B 3N32A 2KDBA 4CYEA 4KV2A 1WGRA 2O6VD 2PEAA 2KOXA 2WDTB 2R2QA 3EFUA 2PPHA 4BBNC 1KJTA 2LD9A 4P7IA 5D7GA 2A5UA 3PRPB 4GMVA 4DHZB 3EC8A 2D3GA 2CHZA 2O2VA 3APCA 3VTWA 1TGZB 2N1VA 2KWCA 2KTFA 3EECA 4K1RB 3ZTCA 1T0YA 1NI2A 2WWZA 4MELA 3X23A 5D94A 2IO1B 2MRPA 5AZHA 1E8ZA 2D07B 4WWOA 3UIOB 3TMPB 1Z5SB 3NOBA 2EKEC 3K9OB 1TBEA 2KFKB 2NBVB 4FJZA 3VH3B 2KVRA 4EOYA 2G4SA 2K1FA 1J19A 4FHJA 1GJZA 1IPGA 4ZYNA 1JRUA 1XD3B 2JRIB 4E71A 1I35A 3V62A 2LI5A 5FR6A 3ZO5B 2IO0B 4G0NB 2MQJA 3L10B 1WGDA 4M8NA 2C5LC 4A20A 2KKCA 4ZDVA 3ZNID 4GSWA 3KYDD 2KDEB 4W9EA 2LGYA 2ZCCA 3IFWB 3L13A 4J6IA 3PRMB 2CHWA 4W9KA 2JXXA 3ZNGC 5EDSA 2LASA 4ZRIA 1WXVA 2CR5A 1AARA 4W9HA 1KLVA 2NPTA 4KZ0A 4ZRKA 3M3JA 2G4DB 4TKNA 2JZ3B 2JY6A 3B08A 2XBBC 3WAPA 4W9IA 3R3MA 1WMHA 2BYFA 1L2NA 2GBMA 2NBUA 1WYWB 3L16A 4K7UA 2NCNA 4BKSD 1MG8A 2M0XA 3A9KB 1WM3A 2JF5A 3U7DA 2N7EA 3QC8B 3QA8A 2AL3A 4FHKA 5CHFA 4LDTD 3IG3A 2BGFA 3L17A 4W9FA 3H1UA 4W9LA 3WA0A 3TL5A 4EKUA 2N9XA 4G3XB 1P1AA 4CHKA 1PQSA 4BOSC 2MBQA 2ASQA 1A5RA 2NPTB 3PSEB 1V9JA 4BVUC 2PE9A 3VVWB 1V80A 2XK5B 1RAXA 2BYVE 4KIKB 5IA7A 3D32A 5J18A 4DBGA 3VUXA 2KX3A 3WIMA 2L00B 4FULA 2FCSA 2AYOB 2MBOA 1QZEA 1UBQA 3A9JB 2K6DB 5CX3A 5D2MB 2I1JA 5JZEB 1IYFA 1WJ4A 2GBKA 1OTRB 1V5TA 1E7UA 3OLMD 3DBRI 1E7VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CHW A;  3KYC D;  3V60 A;  4OVV A;  2UWQ A;  3NZU A;  4F8C B;  3RZW C;  3DOW A;  3HM6 X;  1SE9 A;  4LCD E;  1LFD A;  3PS6 A;  5DPS A;  4ASW C;  2K8C A;  1YJ1 A;  2WX1 A;  1WE7 A;  4TV3 A;  1ISN A;  3TJP A;  1C3T A;  2CKH B;  5KHO A;  3ZUN A;  5JHA A;  2AWT A;  4E3C A;  4NY0 A;  4BOZ B;  2K39 A;  2WX0 A;  2NS5 A;  1R4N I;  4HK2 A;  4DXA B;  1WY8 A;  4TQ0 A;  2KX0 A;  2DZM A;  1V49 A;  2JPH A;  4FJV B;  4IM2 A;  2Y5B B;  3WAN A;  4DHJ B;  4PS3 A;  2B3A A;  2KO3 A;  3QAR A;  3L54 A;  2FAZ A;  2OOB B;  3ZDT A;  4FN2 A;  3B1L X;  4EUT A;  2D10 A;  2BYE A;  4K7S A;  3ZRC A;  1WMH B;  3HHM A;  4IW0 A;  2KWU B;  3HK0 A;  3ZIM A;  4WQO B;  1YX6 B;  3K9P B;  4ANV A;  4F7Z A;  2A4Z A;  1WR6 E;  1WZ3 A;  4MGY E;  5DCN A;  1VCB A;  2LVO A;  1OEY A;  4AJW A;  4PS8 A;  3KUC B;  1V81 A;  2JT4 B;  1WFY A;  4WWN A;  3VQI A;  3AU4 A;  3PGE A;  3QAQ A;  3PTF C;  2KDF B;  2AL6 A;  1TZ1 A;  4GDL B;  1SGH A;  2DZI A;  2MBH A;  2V3S A;  2ZVN A;  3QCA A;  1Y8R C;  3TBL D;  2ZEQ A;  3AUL A;  4DDI D;  3ZW3 A;  1E5W A;  1LQB A;  2WYQ A;  3A1Q A;  2HE7 A;  1V86 A;  2IO2 B;  1I42 A;  4GDK B;  4MH0 E;  4NAW B;  1GNU A;  3UGB B;  5KHQ A;  4NJ6 A;  2MA9 B;  1NDD A;  1C1Y B;  3PPA A;  1J0G A;  2KLG A;  3VUY A;  1H8C A;  4MEM A;  1WF9 A;  4XZ4 A;  4B95 A;  2BKF A;  1UD7 A;  3W1Y A;  3ALB A;  4JGH B;  1J8C A;  3R7Q A;  3DCG A;  3VHT C;  2MX2 A;  2KTR B;  1WH3 A;  3KVF B;  1X1M A;  2RR9 A;  3H7S A;  4FJY A;  2D11 A;  2G45 B;  1GC7 A;  4LJP B;  2LGX A;  3A4R A;  1OGW A;  1ZW7 A;  1WZ0 A;  2FUH B;  2LVP A;  2O2V B;  2LZ6 A;  2RPQ A;  1U4A A;  4JLC A;  2KD0 A;  4KSK C;  3ML8 A;  2PE6 B;  4AWJ A;  3EHV A;  1EUV B;  3GZN I;  1XQQ A;  3IHP C;  3ONS A;  4IG7 B;  3T8M A;  4HVB A;  3CSF A;  1H4R A;  3I3T B;  5J17 A;  1OQY A;  2KJ6 A;  3NHE B;  3CST A;  4NQK E;  3V6C B;  3L0W B;  2FCM A;  4FAD A;  3UQB A;  4HCN B;  4CO7 A;  4G50 A;  3LJ3 A;  5LXH A;  3T9L A;  3PHX B;  3A33 B;  2C9W B;  3OJ3 A;  3PHW B;  2W9N A;  2N1W A;  5JH5 C;  4WJO A;  2M1M A;  1YX5 B;  2BWF A;  4M0W B;  3APD A;  2GBJ A;  5HKH A;  2BPS A;  1WGH A;  2RSU A;  2C7H A;  3A1Q B;  3AI5 A;  4MDK E;  4WJP A;  3ZNH B;  1WIA A;  3R7R A;  2DZK A;  4KDI C;  3TCA A;  3BIN A;  2K8B A;  2MP2 B;  4ICV A;  4MGI E;  5IAA C;  3PLU A;  3U30 A;  2MSE D;  3B0A A;  3O65 B;  2ZCB A;  2ZJD A;  3JYU A;  2LXC A;  2ZNV B;  2O6V A;  4A3O A;  3QQ8 B;  3N30 A;  5E6N A;  1XT9 B;  1Q1O A;  2KTR A;  2FNJ B;  2GBN A;  2RD0 A;  3RUL A;  3KUD B;  3OAW A;  4HLE A;  4F1S A;  4KZC A;  3DVG X;  1EF5 A;  2KLC A;  3V61 A;  3A9J A;  4LJO B;  4ANU A;  2V1Y A;  1GG3 A;  3DDC B;  4HCP B;  3BY4 B;  4PYZ A;  3UF8 A;  1TTN A;  4I6N B;  2IZV B;  1SIF A;  2C7M B;  2KQS A;  2GBR A;  3VTV A;  4IM3 A;  1RFA A;  4AOF A;  2BWE S;  1WM2 A;  1WJN A;  3APF A;  1E8X A;  4BKS A;  4DK5 A;  4MSM B;  2HD5 B;  3UIN B;  3S2A A;  3A4S C;  2C60 A;  4EEW A;  2N4F A;  2NBW B;  1Z2M A;  2HTH A;  3QIJ A;  3P2B A;  2MW5 A;  2LRU A;  3GOE A;  3ZLZ A;  5CHV C;  2GMI C;  3DBH I;  1WE6 A;  3L08 A;  4N9F 4;  2MCN B;  3WAM A;  2AEH A;  1IP9 A;  3DBS A;  4FA6 A;  3IVF A;  2DX5 B;  2LJ5 A;  2ZVO A;  3W1S C;  1WX7 A;  4DHJ D;  4E74 A;  3KW5 B;  3JVZ X;  2DYM A;  4NJ7 A;  2FCQ A;  3PZD A;  1S3S G;  2JVC A;  2IY0 B;  2BKR B;  2MBB B;  3N3K B;  3DQV A;  3QJZ A;  4FLH A;  1WX8 A;  3PRE A;  3C0R B;  1WXS A;  1HE8 A;  4WAA A;  3NY5 A;  3QWZ B;  4JQW C;  4G11 A;  1Q0W B;  4WWP A;  3CF6 E;  5DPT A;  2ZPY A;  4MGK E;  2I1K A;  2KZR A;  4WJN A;  4NAW A;  2KFK A;  3SDL C;  3RUI B;  1WXM A;  4WJQ A;  1RLF A;  5J2R A;  1NBF C;  2M17 A;  4JL9 A;  5LLI A;  2JWZ A;  4EZK A;  2QHO A;  4PYU A;  2JZZ A;  2VRR B;  4HDQ A;  1EF1 A;  3NS8 A;  4NQL B;  2FIF A;  2XEW A;  2K6Q A;  2L76 A;  3SU8 X;  3MJW A;  1WR1 A;  1WX9 A;  5E6P A;  2DYO A;  3DVG Y;  2GOW A;  2ZZP B;  3ECI A;  1E90 A;  3PV1 A;  1E8Y A;  3ZDM C;  2NVU I;  1P9D U;  4MJS B;  1V2Y A;  2EMS A;  2YVC A;  4GDK A;  5LXI B;  2IO3 B;  1RRB A;  2L0T A;  3DPD A;  2FID A;  4YL8 A;  3RD2 A;  2L7R A;  1LXD A;  4DDG D;  4DHZ E;  2MP2 A;  2LRW A;  1UH6 A;  1VD2 A;  4GN1 A;  1F9J A;  2R2O A;  4KDL B;  1FXT B;  2O6V B;  4B9K A;  3PRZ A;  3UQA A;  3SHQ A;  4RM8 A;  3M62 B;  2DZJ A;  3PLV A;  1OEY J;  4KSL C;  3JW0 X;  3AXC A;  2KN5 A;  4IM0 A;  5CTR C;  2J0M A;  2LWP A;  2YLM A;  4GDL A;  4HPL B;  3TIX A;  3RCZ A;  4AUQ C;  2NR2 A;  4ANX A;  2N7D A;  3ZTD A;  2BF8 B;  2DAJ A;  2KMC A;  3H6N A;  2DHZ A;  3HM3 A;  3RYT A;  2FCN A;  2KC2 A;  1GUA B;  2DYB A;  1K8R B;  2MWS B;  2L0F A;  1UZX B;  1UEL A;  2LXA A;  3KUZ A;  4MGZ E;  2Z0E B;  4BBN F;  2JRH A;  2DAF A;  4AJY B;  2K25 A;  4URK A;  4GIV A;  2KDI A;  3VH4 B;  1M94 A;  3A9K A;  2REX A;  1ZGU B;  3U8Z A;  3ZKJ C;  2N9P C;  3X0W A;  5GMV A;  4IUM B;  1WGY A;  2CHX A;  2LUE A;  3CMM B;  2IY1 B;  4IC7 B;  5G2N A;  1CMX B;  5L95 C;  3H7P A;  3PVL A;  2RGF A;  4GGQ A;  4HXD A;  3RT3 B;  3VFK A;  4W9J A;  2KNB A;  4II3 B;  4MJS A;  5C23 A;  3ZNZ B;  3PT2 B;  4RMA A;  5AEK B;  4NNJ B;  5AZF A;  3VUW A;  2N9E B;  4XX5 A;  5TR5 A;  1R4M I;  3MHS D;  1WGG A;  2M4N A;  4XC2 A;  4DWF A;  2L05 A;  4GOC A;  4W9D A;  2KJH B;  1UBI A;  3H9D A;  3JSV A;  5G55 A;  1WJU A;  3UIP B;  1EO6 A;  2IBI B;  3V6E B;  4HWI B;  1WRD B;  3DBL I;  4IWQ A;  1P3Q U;  2G3Q B;  2M8S A;  3LDZ E;  3MTN B;  1YQB A;  4HDO A;  4JIO U;  5D6J B;  4IWP A;  2IYD B;  2UYZ B;  4EZJ A;  4LDT B;  1GC6 A;  4TQ1 A;  2J7Q B;  5DPR A;  3VXW A;  4PS7 A;  4M8M A;  2Z0D B;  2J0J A;  2LVQ A;  4KVG B;  3QK0 A;  2MLB A;  4HJK A;  5JHB A;  4ANW A;  2OJR A;  3VAW A;  4B6W A;  1Q5W B;  3DVN V;  4TUU A;  4BKT A;  4X57 B;  2L3Z A;  3NZS A;  4NPN A;  4FBJ B;  5AZG A;  4BFR A;  4GU2 A;  4GXB A;  2KHW B;  2HJ8 A;  1G6J A;  2J0K A;  2KXJ A;  3Q3F A;  3WAO A;  1UGM A;  2KK8 A;  1LM8 B;  4IWO A;  3VTU A;  1WI0 A;  2JUO A;  2KQ7 A;  2D2Q A;  1V5O A;  2EMT A;  2ZPN A;  3SD5 A;  3W1S A;  3M95 A;  5L83 A;  5C1Z A;  3IBE A;  1KOT A;  1S1Q B;  4EZL A;  1L7Y A;  4W9G A;  1P0R A;  3RZF A;  3HIZ A;  4ICU A;  4RM9 A;  1KM7 A;  4I6L B;  1ZKH A;  3Q3J A;  1V6E A;  4EFO A;  4HPM B;  1BT0 A;  4K7W A;  2KJR A;  3QX1 A;  2KWV B;  5E6O A;  3ZRF A;  3JSV B;  2KC1 A;  4KIK A;  4ZRJ A;  2C7N B;  4I6P A;  4AP4 C;  3WAL A;  4OVU A;  2KAN A;  3DVN U;  3AU5 A;  4A3P A;  4MM3 A;  3QHT A;  1D3Z A;  1YD8 U;  1YIW A;  3H7P B;  4W9C A;  3ENE A;  4BKG A;  2L8J A;  1E8W A;  2KMA A;  2LGD A;  2PJH A;  1WXA A;  3KH0 A;  2KFJ A;  3M63 B;  2Z59 B;  2DEN B;  4MSQ B;  2V4L A;  2K8H A;  4GB9 A;  2MBE A;  3ZVV A;  2ZNV C;  3R66 C;  4II2 B;  4K81 A;  3ML9 A;  1P98 A;  2CU1 A;  2XK5 A;  2CS4 A;  1WJ6 A;  5DPW A;  3OJ4 B;  3VDZ A;  5BO4 B;  3N32 A;  2KDB A;  4CYE A;  4KV2 A;  1WGR A;  2O6V D;  2PEA A;  2KOX A;  2WDT B;  2R2Q A;  3EFU A;  2PPH A;  4BBN C;  1KJT A;  2LD9 A;  4P7I A;  5D7G A;  2A5U A;  3PRP B;  4GMV A;  4DHZ B;  3EC8 A;  2D3G A;  2CHZ A;  2O2V A;  3APC A;  3VTW A;  1TGZ B;  2N1V A;  2KWC A;  2KTF A;  3EEC A;  4K1R B;  3ZTC A;  1T0Y A;  1NI2 A;  2WWZ A;  4MEL A;  3X23 A;  5D94 A;  2IO1 B;  2MRP A;  5AZH A;  1E8Z A;  2D07 B;  4WWO A;  3UIO B;  3TMP B;  1Z5S B;  3NOB A;  2EKE C;  3K9O B;  1TBE A;  2KFK B;  2NBV B;  4FJZ A;  3VH3 B;  2KVR A;  4EOY A;  2G4S A;  2K1F A;  1J19 A;  4FHJ A;  1GJZ A;  1IPG A;  4ZYN A;  1JRU A;  1XD3 B;  2JRI B;  4E71 A;  1I35 A;  3V62 A;  2LI5 A;  5FR6 A;  3ZO5 B;  2IO0 B;  4G0N B;  2MQJ A;  3L10 B;  1WGD A;  4M8N A;  2C5L C;  4A20 A;  2KKC A;  4ZDV A;  3ZNI D;  4GSW A;  3KYD D;  2KDE B;  4W9E A;  2LGY A;  2ZCC A;  3IFW B;  3L13 A;  4J6I A;  3PRM B;  2CHW A;  4W9K A;  2JXX A;  3ZNG C;  5EDS A;  2LAS A;  4ZRI A;  1WXV A;  2CR5 A;  1AAR A;  4W9H A;  1KLV A;  2NPT A;  4KZ0 A;  4ZRK A;  3M3J A;  2G4D B;  4TKN A;  2JZ3 B;  2JY6 A;  3B08 A;  2XBB C;  3WAP A;  4W9I A;  3R3M A;  1WMH A;  2BYF A;  1L2N A;  2GBM A;  2NBU A;  1WYW B;  3L16 A;  4K7U A;  2NCN A;  4BKS D;  1MG8 A;  2M0X A;  3A9K B;  1WM3 A;  2JF5 A;  3U7D A;  2N7E A;  3QC8 B;  3QA8 A;  2AL3 A;  4FHK A;  5CHF A;  4LDT D;  3IG3 A;  2BGF A;  3L17 A;  4W9F A;  3H1U A;  4W9L A;  3WA0 A;  3TL5 A;  4EKU A;  2N9X A;  4G3X B;  1P1A A;  4CHK A;  1PQS A;  4BOS C;  2MBQ A;  2ASQ A;  1A5R A;  2NPT B;  3PSE B;  1V9J A;  4BVU C;  2PE9 A;  3VVW B;  1V80 A;  2XK5 B;  1RAX A;  2BYV E;  4KIK B;  5IA7 A;  3D32 A;  5J18 A;  4DBG A;  3VUX A;  2KX3 A;  3WIM A;  2L00 B;  4FUL A;  2FCS A;  2AYO B;  2MBO A;  1QZE A;  1UBQ A;  3A9J B;  2K6D B;  5CX3 A;  5D2M B;  2I1J A;  5JZE B;  1IYF A;  1WJ4 A;  2GBK A;  1OTR B;  1V5T A;  1E7U A;  3OLM D;  3DBR I;  1E7V A; 
#chains in the Genus database with same CATH topology
 3V60 A;  4OVV A;  2JWU A;  1SE9 A;  3PS6 A;  1PGA A;  1SJH D;  2WX1 A;  3TJP A;  4KGS A;  5KHO A;  4N59 A;  2WX0 A;  3NVV A;  4L23 A;  4TQ0 A;  2DZM A;  2JPH A;  3NVZ A;  2B3A A;  2KO3 A;  1E7P B;  2Y5C A;  2WU2 B;  2W55 A;  3ZDT A;  3B1L X;  2D10 A;  3FC4 A;  1WMH B;  3HHM A;  4IW0 A;  4ZOH C;  1TJE A;  2KWU B;  2K22 A;  3K9P B;  2A4Z A;  1VCB A;  4AJW A;  1UUP A;  2RMM A;  4K3B A;  5HG2 A;  1WFY A;  4WWN A;  3VQI A;  2AL6 A;  1EWC A;  2WP9 B;  1SGH A;  2MBH A;  2V3S A;  3QCA A;  3TBL D;  1Y8R C;  4ZHP A;  2IDY A;  3ZW3 A;  2WS3 B;  1WGK A;  3AM9 A;  4GDK B;  4NAW B;  1GNU A;  3UGB B;  3ZQ4 A;  4M01 A;  1HZ6 A;  4JX1 C;  3PPA A;  1J0G A;  2KLG A;  1AYF A;  4MEM A;  1WF9 A;  4MT5 A;  4B95 A;  3W1Y A;  3ZGZ A;  1GB4 A;  1V1P B;  2QJL A;  3KVF B;  2LJI A;  4Q2J A;  2FUH B;  1GPX A;  2LZ6 A;  3I5J C;  1ZDV A;  1EUV B;  2AQ2 B;  3GZN I;  1VJK A;  3IHP C;  4IG7 B;  3CSF A;  2KJ6 A;  2JZP A;  2FCM A;  1VZ7 A;  2JSV X;  1KFY B;  1FM0 D;  2VH2 A;  3T9L A;  1UNS A;  4KGR A;  2W9N A;  4YSX B;  4WJO A;  4DQO C;  1OQQ A;  2M0A A;  3A1Q B;  4MDK E;  2C7H A;  2D5G A;  3DBH B;  5H92 C;  4KDI C;  5MPO A;  4ICV A;  5IAA C;  3VR8 B;  4YTM B;  3AEG B;  2MSE D;  3O65 B;  5E6J A;  2ZNV B;  3N30 A;  2WLB A;  4OZC A;  1WRI A;  4LNI A;  2ZW0 A;  2IZV B;  1SIF A;  1I7H A;  1WM2 A;  1WJN A;  2IPK D;  2PMV A;  4H2A A;  1JRP A;  4MSM B;  3UIN B;  4EEW A;  3A4S C;  1QIL A;  2LHE A;  2R61 A;  2HTH A;  2FUG 1;  3AE9 B;  1NYQ A;  2MW5 A;  3ZLZ A;  4YXD B;  4N9F 4;  1IP9 A;  4FA6 A;  3W1S C;  2V4I B;  4DHJ D;  3NVY A;  2V3N A;  3AN1 A;  4NJ7 A;  2FCQ A;  2JVC A;  1PFD A;  3QJZ A;  4YTN B;  1WXS A;  1HE8 A;  4XDC A;  4MGK E;  5EE0 A;  2K9X A;  2JWZ A;  4EZK A;  1C9F A;  4AS1 A;  2XEW A;  2DYO A;  2ZZP B;  2J4X A;  1C79 A;  3ECI A;  3PV1 A;  2NVU I;  3O13 A;  5JXV A;  2KMM A;  2IO3 B;  3IT4 B;  3DHI C;  3HUI A;  4DDG D;  2MP2 A;  1VD2 A;  2R2O A;  2BS2 B;  4B9K A;  2O6V B;  1N60 A;  1XLO A;  3SHQ A;  4RM8 A;  3JW0 X;  3AXC A;  5IOI A;  2J0M A;  4GDL A;  3TIX A;  3RCZ A;  1MJD A;  2DAJ A;  2KMC A;  2KC2 A;  2J53 A;  1FXI A;  1GUA B;  1FCC C;  2LEK A;  4NZL B;  2Z0E B;  2JRH A;  1JWM D;  4FXC A;  4GIV A;  3A9K A;  3ZKJ C;  3X0W A;  5GMV A;  4IUM B;  1F2R I;  2W54 A;  2IY1 B;  5L95 C;  3H7P A;  3PVL A;  1EM7 A;  1EWY C;  1SXT A;  4II3 B;  1FMA D;  1YN3 A;  1L6V A;  1UF0 A;  1MHH E;  1F52 A;  1TKG A;  2D3B A;  2X38 A;  5AZF A;  3VUW A;  2N9E B;  1R4M I;  1J7C A;  3MHS D;  4DWF A;  4RNA A;  1PGX A;  2L05 A;  3Q8F A;  4W9D A;  1E6E B;  3H9D A;  4CQN A;  2IBI B;  1P3Q U;  3MTN B;  1YQB A;  1ESF A;  4EZJ A;  3V05 A;  5BMG A;  4HRS A;  2J7Q B;  3VXW A;  1YJI A;  1HXY D;  4HJK A;  3C19 A;  5JHB A;  5FR3 A;  2OJR A;  3VAW A;  3LYY A;  4X57 B;  1IGD A;  3GZN B;  4JE3 B;  4FBJ B;  1JQ4 A;  2KXJ A;  1I4R A;  1UGM A;  2KK8 A;  4IWO A;  3VTU A;  4US8 A;  3SD5 A;  2D2Q A;  2EMT A;  5L83 A;  3I57 A;  3M95 A;  1S1Q B;  3DBL B;  4RM9 A;  1KM7 A;  1UGJ A;  4ZRP A;  3Q3J A;  4A90 A;  1XCT L;  3BVG A;  5E6O A;  2BQQ A;  3JSV B;  2KC1 A;  2C7N B;  4AP4 C;  3WAL A;  3H7P B;  1XLQ A;  3ENE A;  1KLG D;  1JWS D;  2L8J A;  2WXP A;  3RNE C;  5EE9 A;  4II2 B;  2EEL A;  1V1O A;  3T3N A;  3OJ4 B;  4A8X C;  3BZD B;  1WGR A;  1T5X D;  2WDT B;  3AEB B;  1KJT A;  4HJG E;  4DHZ B;  3EC8 A;  2D3G A;  3B2G A;  3APC A;  3VTW A;  2KTF A;  4O1N A;  4MEL A;  5D94 A;  1E8Z A;  2D07 B;  3TMP B;  1Z5S B;  2KFK B;  3VH3 B;  2IGD A;  3DWM A;  4IOI E;  1SE2 A;  1JWA D;  2MQJ A;  1FFU A;  4A20 A;  4GSW A;  4W9E A;  2ZCC A;  4W9K A;  2LAS A;  2CR5 A;  1KLV A;  1YMH E;  2JY6 A;  3BVM A;  3WAP A;  1WMH A;  3VR9 B;  2RDB C;  2JXT A;  4USA A;  3N1Y C;  2QCZ A;  1L2N A;  2GRI A;  2N7J A;  1F2R C;  1RYJ A;  3AE5 B;  4US9 A;  3QC8 B;  2UU7 A;  2Y5P A;  4LDT D;  3IG3 A;  3DBR B;  1IGC A;  2LGS A;  4W9F A;  3H1U A;  1ET6 A;  4EKU A;  2HJ1 A;  3B9J A;  1GB1 A;  1PQS A;  2SAK A;  1A5R A;  2PLP A;  3VVW B;  2XK5 B;  1RAX A;  3D32 A;  4DBG A;  3VUX A;  4FUL A;  1QZE A;  1QT9 A;  2K6D B;  2WXJ A;  1IYF A;  3PZ8 A;  2K0P A;  5BMH A;  3OLM D;  4S17 A;  3KYC D;  3NZU A;  3SFD B;  1YJ1 A;  1UWX A;  2MJ3 A;  2QDF A;  2CKH B;  3ZUN A;  4DXA B;  5I4D A;  4IM2 A;  2JYE A;  2DNF A;  4FJV B;  4JWU C;  4K7S A;  1P7E A;  2RDH A;  4C80 A;  1WZ3 A;  3KLS X;  1T6B X;  1ET9 A;  1J7A A;  3V3X A;  2OHF A;  1A70 A;  2EKI A;  1STE A;  1SSN A;  1E5W A;  2WYQ A;  3A1Q A;  3Q3N C;  1C4A A;  4MH0 E;  2JQR B;  4YT0 B;  1KF6 B;  3ALB A;  1R4N B;  4JGH B;  1J8C A;  3VHT C;  1L0V B;  1XXG A;  1DYQ A;  2RR9 A;  2W3R A;  4LJP B;  3P63 A;  2G45 B;  2LGX A;  4LTU A;  2LVP A;  2YEP F;  2KD0 A;  2PE6 B;  3EHV A;  1XQQ A;  2OJW A;  1XLN A;  4HVB A;  1SEB D;  3CST A;  4NQK E;  4HCN B;  4CO7 A;  4G50 A;  2ZW1 A;  3DHH C;  3PHW B;  1FO4 A;  3PO0 A;  1PYW D;  1QKZ A;  3AE7 B;  2M1M A;  1YX5 B;  1PGB A;  1I4P A;  2GBJ A;  5HKH A;  3AI5 A;  1SB3 C;  1WIA A;  4KGT A;  1N62 A;  2WXG A;  2WXF A;  3BIN A;  4M00 A;  2ZJD A;  3QQ8 B;  1XT9 B;  2RD0 A;  1V8C A;  2GBN A;  4OVZ A;  1EF5 A;  2KLC A;  3A9J A;  4ANU A;  1GG3 A;  4PYZ A;  2C7M B;  2KQS A;  1I4H A;  2GBR A;  4AOF A;  1RFA A;  3APF A;  1E8X A;  4WAF A;  4DK5 A;  2C60 A;  3QIJ A;  1Z2M A;  4KKI A;  3P2B A;  1D5X C;  2M56 B;  5GXG B;  2LRU A;  1IBX B;  3WAM A;  5LNK 1;  1C76 A;  1OFF A;  2AEH A;  1FIQ A;  1NEN B;  4HEA 1;  2DX5 B;  2LJ5 A;  4E74 A;  3JVZ X;  2IY0 B;  3DQV A;  3PRE A;  3C0R B;  3FIL B;  4N58 A;  2WXR A;  1KRH A;  2WXI A;  3CF6 E;  4WJN A;  5IKC M;  2V3P A;  4WJQ A;  1RLF A;  2BB5 A;  2M17 A;  4JL9 A;  5LLI A;  4PYU A;  2VRR B;  4NQL B;  2K6Q A;  1GOZ A;  3DVG Y;  3AH7 A;  1E90 A;  1ZOY B;  1E8Y A;  3ZDM C;  1P9D U;  3TUO A;  3DPD A;  3RD2 A;  1PUT A;  2L7R A;  3RFZ B;  1LXD A;  4PT5 A;  4C56 C;  1UH6 A;  3AE3 B;  4KDL B;  4C7Z A;  1FXT B;  1TY2 A;  3PRZ A;  3UQA A;  1FPY A;  2DZJ A;  3PLV A;  1T0S C;  1R4M B;  3RNG C;  4IM0 A;  5CTR C;  3W5U B;  4HPL B;  2RPV A;  2N7D A;  1FNW A;  3R8B A;  1K50 A;  3HM3 A;  3RYT A;  2MWS B;  3KUZ A;  4BBN F;  4N6E B;  3KQ4 A;  2K25 A;  3VH4 B;  1TS5 A;  2CHX A;  2LUE A;  1VDV A;  3CMM B;  3IAS 1;  2WDV B;  2WXN A;  2RGF A;  1FEH A;  4GGQ A;  4HXD A;  3VFK A;  4W9J A;  1K53 A;  2KNB A;  5IN7 A;  2MH7 A;  4P1B C;  3PT2 B;  4RMA A;  3HVD A;  4NNJ B;  4XX5 A;  5TR5 A;  1FD6 A;  2M4N A;  3RMK C;  3Q8A A;  1V1P A;  2INP E;  4GOC A;  2H89 B;  5G55 A;  3UIP B;  1YJJ A;  5BYQ A;  1EO6 A;  4HWI B;  1WRD B;  4R3D A;  3LDZ E;  4HDO A;  4ZRQ A;  2IYD B;  4OZA A;  1SF0 A;  4J3O D;  3FAH A;  3ZXR A;  2D3C A;  4M8M A;  4KVG B;  2LVQ A;  1SE3 A;  3QK0 A;  1QLB B;  2MLB A;  1CJE A;  3DVN V;  2ONQ A;  3Q3M C;  1XF5 L;  2ICI A;  2L3Z A;  4GU2 A;  4GXB A;  2KHW B;  2WQY B;  2XN9 C;  2WXO A;  1LM8 B;  2L83 A;  3UI3 A;  2KQ7 A;  2ZPN A;  3RZF A;  3HIZ A;  4ICU A;  2E3T A;  4I6L B;  1ZKH A;  3MFG A;  4K7W A;  3QX1 A;  2JX5 A;  2KWV B;  3CIR B;  3ZRF A;  3Q2A C;  2I38 A;  4KIK A;  1BXT A;  4OVU A;  3DHG C;  2PKO A;  3QHT A;  2WU5 B;  4BKG A;  1HA5 A;  1WXA A;  1N61 A;  3P1M A;  2KFJ A;  2Z59 B;  2DEN B;  2V4L A;  4GB9 A;  3R66 C;  4REZ A;  2IGG A;  3ML9 A;  1P98 A;  2CS4 A;  1WJ6 A;  3MC0 B;  3N32 A;  4KV2 A;  2PEA A;  1TS4 A;  2R2Q A;  4IKG A;  3TSS A;  1L6U A;  4MH8 A;  4LNK A;  4P16 A;  5D7G A;  3GE8 C;  4GMV A;  1KTK A;  3N1X C;  2PW9 A;  3NUH B;  1AW7 A;  3U2S C;  4K1R B;  3ZTC A;  4MM3 B;  1NI2 A;  1T0Y A;  1E10 A;  3E56 A;  4RFB A;  4WWO A;  2INC C;  3SR6 A;  2EKE C;  2QSD A;  1TBE A;  2NBV B;  3DWG C;  4FJZ A;  2KVR A;  1IUE A;  2OED A;  3IT6 B;  4ZYN A;  1XD3 B;  4E71 A;  1I35 A;  3V62 A;  2LI5 A;  4G0N B;  3U4E G;  3L10 B;  3ZNI D;  4D2K A;  1E0Z A;  2LGY A;  3L13 A;  4J6I A;  3ZJT A;  3ZNG C;  3BYY B;  1AAR A;  1VR9 A;  4KZ0 A;  4WUR A;  2G4D B;  1YNT E;  4TKN A;  2VZK D;  2WGS A;  4YTP B;  2JZ3 B;  3VRA B;  1D5Z C;  1P7F A;  2WDR B;  3EFC A;  4K3C A;  3L16 A;  2NCN A;  1NI3 A;  1ZXH A;  1MG8 A;  2YEP B;  1DOY A;  1WM3 A;  2WXK A;  2N9X A;  4BOS C;  2QC8 A;  2ASQ A;  4MAC A;  4BVU C;  1V9J A;  1V80 A;  4A6Q A;  4KIK B;  5J18 A;  1ROE A;  3P4P B;  3RNB C;  3L4P A;  1FRD A;  2AYO B;  5CX3 A;  5JZE B;  1WJ4 A;  1NEK B;  2G1E A;  2G9H D;  1OTR B;  1E7U A;  1E7V A;  2UWQ A;  5T8I A;  4F8C B;  2BTE A;  3RZW C;  3DOW A;  1XLP A;  2K8C A;  1WE7 A;  4TV3 A;  1ISN A;  4WWM A;  1C3T A;  3W5V B;  2AWT A;  2QEJ C;  4EE2 A;  1DOX A;  2JYT A;  2TSS A;  2NS5 A;  3TEZ A;  4HK2 A;  3Q6B A;  2KX0 A;  4YSZ B;  3WAN A;  4PS3 A;  3QAR A;  3L54 A;  2OOB B;  3MHZ A;  3AB5 A;  4FN2 A;  2RDG A;  4EUT A;  2BYE A;  1QOA A;  4NJC A;  1FNU A;  3HK0 A;  3ZIM A;  4WQO B;  1YX6 B;  4F7Z A;  1ZUD 2;  5AUI A;  2LVO A;  1OEY A;  4PS8 A;  1ZXI A;  3PGE A;  3QAQ A;  3PTF C;  2KDF B;  1CK1 A;  3LXF A;  3RI7 C;  1VLB A;  1XEE A;  4C4V B;  2ZEQ A;  3AUL A;  4DDI D;  2DLB A;  3EA6 A;  1LQB A;  2HE7 A;  2IO2 B;  5KHQ A;  1N63 A;  4PK1 A;  2MA9 B;  1NDD A;  4WIP A;  3VUY A;  4YWG G;  1N6Z A;  1RM6 C;  4XZ4 A;  1UD7 A;  3R7Q A;  2MX2 A;  1WH3 A;  1GC7 A;  3A4R A;  2J52 A;  2RPQ A;  1ZPS A;  4JLC A;  4KSK C;  3ML8 A;  4AWJ A;  4LK0 M;  4DXF A;  3T8M A;  3I3T B;  3RPF C;  2LUM A;  1OQY A;  5HHD G;  3NHE B;  3V6C B;  3L0W B;  3UQB A;  1WSP A;  3LJ3 A;  3ZJU A;  3RN9 C;  3MJ5 A;  3A33 B;  1D6E C;  2V0G A;  3OJ3 A;  2BB6 A;  2N1W A;  3APD A;  2BPS A;  3ZNH B;  4QAY A;  2DZK A;  3ZYY X;  4HKZ E;  4MGI E;  3PLU A;  3B0A A;  2ZCB A;  4XGA B;  3JYU A;  2LXC A;  2O6V A;  3Q8C A;  5E6N A;  1Q1O A;  4KX6 B;  2FNJ B;  3RUL A;  1QOB A;  4B0M A;  3AE6 B;  4F1S A;  3Q3O C;  3V61 A;  4LJO B;  2V1Y A;  3WCQ A;  3DDC B;  4HCP B;  3BY4 B;  3FIL A;  4I6N B;  3AE2 B;  2QMT A;  5TSS A;  2KYW A;  4LNO A;  2KAC A;  2HD5 B;  3S2A A;  2N4F A;  1VZ8 A;  2NBW B;  1MVK A;  3GOE A;  2GMI C;  1JWU D;  1WE6 A;  3KWL A;  2MCN B;  5H8Y E;  3IVF A;  1WX7 A;  1LO5 D;  2DYM A;  1OQR A;  1S3S G;  2BKR B;  3N3K B;  4C7Y A;  2L32 A;  4WAA A;  3NY5 A;  3QWZ B;  4JQW C;  1Q0W B;  4WWP A;  5DPT A;  2ZPY A;  4NAW A;  3AMZ A;  4XWT A;  3RUI B;  2MJD A;  4A9A A;  3NJT A;  2QHO A;  3BK1 A;  2JZZ A;  3NS8 A;  2FIF A;  1WR1 A;  5E6P A;  1XCQ L;  2GOW A;  1EU4 A;  3ZJV A;  3I63 C;  4GDK A;  1MPE A;  1RRB A;  1CZP A;  4A55 A;  1EU3 A;  4YL8 A;  5HFY A;  4DHZ E;  2SEB D;  2LRW A;  3AED B;  1F9J A;  5BMI A;  3MP9 A;  4GLS C;  2KN5 A;  2KN4 A;  4ANX A;  2BF8 B;  3H6N A;  4JWS C;  2DHZ A;  2MHJ A;  2FCN A;  1HQR D;  1UZX B;  1FXA A;  4URK A;  1HTQ A;  2LMC A;  4OZB A;  2REX A;  1MG4 A;  2HDE A;  1TZO A;  1CMX B;  2AX5 A;  1QF6 A;  1AN8 A;  3TEW A;  1FRR A;  2AQ3 B;  2INN E;  4MJS A;  1VZ6 A;  3P4R B;  3ZNZ B;  2N9L A;  1YOV B;  4LLG M;  2BT6 A;  1WGG A;  4XC2 A;  4OW0 A;  2NMQ A;  1NVI D;  2KJH B;  1UBI A;  2CJO A;  3JSV A;  1I4G A;  3V6E B;  3DBL I;  4IWQ A;  5D6J B;  5C2T B;  4IWP A;  1L5P A;  4LDT B;  2D3A A;  4TQ1 A;  5DPR A;  3IAM 1;  3R2T A;  5EE1 A;  4TUU A;  4L2Y A;  4HPP A;  3AEA B;  1DGJ A;  3NZS A;  4NPN A;  4BFR A;  3Q69 A;  2W82 A;  1LGR A;  3J9C A;  2HJ8 A;  1G6J A;  2J0K A;  3Q3F A;  1WI0 A;  3GP7 A;  2JUO A;  1V5O A;  3W1S A;  4YSY B;  1KOT A;  2LFI A;  3IBE A;  2FBW B;  4W9G A;  1P0R A;  5AUK A;  1HTO A;  1V6E A;  1N5X A;  1BT0 A;  4IDI A;  1B9R A;  2N0S B;  4ZHO A;  1BML C;  3U7Z A;  4I6P A;  2KAN A;  4MM3 A;  1D3Z A;  1YIW A;  3NVW A;  1E8W A;  1QOG A;  3KH0 A;  3M63 B;  4HRO A;  2KAJ A;  4MSQ B;  3ZVV A;  4K81 A;  2XK5 A;  2Z8L A;  2N9K A;  1ZDX A;  2KDB A;  1IBX A;  4WH4 A;  2O6V D;  2KOX A;  3EFU A;  2PPH A;  2LD9 A;  2WNM A;  2H88 B;  2BBC A;  2HTM E;  2Q5W D;  2CHZ A;  1ZP0 B;  3EEC A;  2WWZ A;  3X23 A;  2QIL A;  5AZH A;  3BVZ A;  3UIO B;  3R2I A;  3NOB A;  3K9O B;  4ITK A;  3TEY A;  4EOY A;  3BYT B;  3OG5 A;  2K1F A;  4FHJ A;  4ACF A;  1HEZ E;  1IPG A;  3GE3 C;  2JRI B;  4ARC A;  2ACZ B;  2IO0 B;  3E9S A;  4M8N A;  5G5H A;  2C5L C;  2KKC A;  4ZDV A;  3KYD D;  2KDE B;  3PZ7 A;  3PRM B;  2CHW A;  2JXX A;  1WXV A;  2NPT A;  4ZRK A;  1MI0 A;  1RWS A;  3B08 A;  2XBB C;  1M4V A;  1F1H A;  4P6V F;  4RGO S;  2PVG C;  3VRB B;  4BAX A;  2BYF A;  4RCO A;  4K7U A;  2GBM A;  1WYW B;  2NBU A;  1T3Q A;  3ETR A;  4BKS D;  4LNN A;  2JF5 A;  2N7E A;  1PDX A;  3QA8 A;  2AL3 A;  4FHK A;  1NYR A;  5CHF A;  5EE3 A;  4RF0 A;  3T3O A;  2BGF A;  3WA0 A;  4W9L A;  3TL5 A;  1QOF A;  1P1A A;  4CHK A;  2MBQ A;  3MC8 A;  2NPT B;  3SFE B;  5IA7 A;  3WIM A;  2L00 B;  4WQM A;  3B2F A;  3N20 C;  2MBO A;  1UBQ A;  5D2M B;  2DWQ A;  3DBR I;  1TT5 B;  3PHX B;  5CHW A;  1YQ3 B;  3HM6 X;  4LCD E;  1LFD A;  5DPS A;  4ASW C;  5JHA A;  4E3C A;  1SE4 A;  4NY0 A;  4BOZ B;  2K39 A;  1R4N I;  1WY8 A;  2BS4 B;  3AEF B;  3HVZ A;  1V49 A;  4RGM A;  2Y5B B;  4DHJ B;  3GS2 A;  1TY0 A;  3URY A;  3ZXV A;  2FAZ A;  4AQ7 A;  3Q14 C;  3ZRC A;  4XE0 A;  4UDU C;  4ANV A;  3SEB A;  1WR6 E;  3NG0 A;  4MGY E;  5DCN A;  3NZ3 A;  3KUC B;  1V81 A;  5G5G A;  2JT4 B;  4BZA A;  3AU4 A;  2WXQ A;  1TZ1 A;  4GDL B;  2DZI A;  2ZVN A;  3NRZ A;  1VRA B;  1D5M C;  1C78 A;  1V86 A;  2IJ0 A;  1I42 A;  1F77 A;  4NJ6 A;  2WXM A;  3P4Q B;  1FCL A;  2CU3 A;  1C1Y B;  1H8C A;  4TMA B;  2BKF A;  3EGR A;  3DCG A;  2ON8 A;  2KTR B;  1QQR A;  5BYR A;  1X1M A;  3H7S A;  4FJY A;  2D11 A;  1OGW A;  1I4X A;  1ZW7 A;  1WZ0 A;  2O2V B;  1U4A A;  1TKE A;  5HI1 A;  3ONS A;  1ACC A;  1H4R A;  2NTT A;  3BK2 A;  5J17 A;  4XWW A;  3FKY A;  1T0R C;  4FAD A;  5LXH A;  2J42 A;  2C9W B;  3H8H A;  3AE4 B;  5JH5 C;  2FE8 A;  1DOI A;  1CQV A;  2BWF A;  4M0W B;  2KQ4 X;  2PVO D;  1WGH A;  2RSU A;  4WJP A;  3N1Z C;  3BWU D;  3R7R A;  1Y56 A;  3HRD D;  1JML A;  3TCA A;  5IP4 D;  2K8B A;  2MP2 B;  1C4C A;  3U30 A;  4RGN A;  2I2Y A;  2L52 A;  1C77 A;  1HZ5 A;  1KLU D;  4A3O A;  2WHI A;  4L1B A;  2CJN A;  2KTR A;  1AWD A;  3KUD B;  3OAW A;  2NTS A;  4HLE A;  4KZC A;  3DVG X;  4RH6 A;  3AE8 B;  3UF8 A;  2BVC A;  1TTN A;  1ENF A;  3VTV A;  4IM3 A;  2BWE S;  1L0X B;  2XNA C;  4BKS A;  2Y3A A;  2WXL A;  1Q10 A;  1N5W A;  5CHV C;  1MHX A;  2KVZ A;  3DBH I;  3L08 A;  3DBS A;  2ZVO A;  3KW5 B;  5FKA C;  3KWV A;  5D3D A;  4ZYS A;  3PZD A;  1JAL A;  2MBB B;  1BUI C;  4FLH A;  1WX8 A;  1C4P A;  4G11 A;  3P42 A;  4KKJ A;  2I1K A;  2KZR A;  3MC9 A;  2KFK A;  3SDL C;  1WXM A;  1JRO A;  5J2R A;  3P4S B;  1NBF C;  4RGT A;  5D3I B;  3AE1 B;  4HDQ A;  5FK9 C;  1EF1 A;  1ZE3 D;  2L76 A;  3SU8 X;  3MJW A;  1WX9 A;  4HKQ A;  2V9H A;  3GB1 A;  1L4D B;  4MJS B;  1V2Y A;  2EMS A;  2YVC A;  5LXI B;  2L0T A;  2FID A;  4TSS A;  1RFK A;  2JU6 X;  4RF1 A;  4GN1 A;  1JCK B;  3IXS A;  2E6X A;  4DXG A;  3M62 B;  1OEY J;  4KSL C;  3LB8 C;  2LWP A;  2YLM A;  4JPS A;  4AUQ C;  2NR2 A;  3ZTD A;  4S0R A;  4NAM A;  2DYB A;  1K8R B;  3Q8E A;  2L0F A;  4LNF A;  2LXA A;  1UEL A;  4MGZ E;  2DAF A;  4AJY B;  2BW2 A;  2KDI A;  3W9C B;  1TIF A;  4B0E A;  1M94 A;  1ZGU B;  2MJE A;  3U8Z A;  2N9P C;  1WGY A;  4C4V A;  4IC7 B;  5G2N A;  2L1A A;  3EUB 2;  2BYT A;  3RT3 B;  5C23 A;  1YQ4 B;  4XYC A;  2QIE B;  2VZK B;  5AEK B;  4M02 A;  3BII D;  1FNV A;  3U52 E;  2LGI A;  1WJU A;  1FFV A;  2G3Q B;  2M8S A;  4JIO U;  3NS1 A;  2UYZ B;  3I9V 1;  1GC6 A;  3Q8B A;  1K51 A;  3AEE B;  4PS7 A;  2Z0D B;  2J0J A;  2K5P A;  4ANW A;  4B6W A;  1SJE D;  1Q5W B;  4BKT A;  2IGH A;  1J7B A;  5AZG A;  3N9Y C;  3C8Y A;  2KT7 A;  3WAO A;  5C3J B;  5C1Z A;  4EZL A;  1L7Y A;  2BS3 B;  1TS2 A;  4EFO A;  4HPM B;  2KJR A;  4ZRJ A;  1TS3 A;  1I4Q A;  3DVN U;  3AU5 A;  1JW9 D;  4A3P A;  5BYS A;  4XDD A;  1YD8 U;  2B76 B;  4W9C A;  2KDM A;  1YN4 A;  2KMA A;  1SBB B;  1WXQ A;  4P1C C;  2LGD A;  2PJH A;  1XO3 A;  2K8H A;  2MBE A;  2ZNV C;  2CU1 A;  5DPW A;  3VDZ A;  2VH1 A;  5BO4 B;  4CYE A;  2DBY A;  1B1Z A;  4BBN C;  2PTL A;  4P7I A;  3PRP B;  2A5U A;  3AV8 A;  2X8X X;  2O2V A;  3RNA C;  1TGZ B;  2N1V A;  2KWC A;  3RNF C;  1KH0 A;  2IO1 B;  2MRP A;  1TKY A;  1V97 A;  2G4S A;  1J19 A;  1F0Z A;  2W3S A;  1GJZ A;  2K3U A;  1JRU A;  2GLS A;  1R7S A;  5FR6 A;  3ZO5 B;  1WGD A;  1SIJ A;  3IFW B;  3CWI A;  5EDS A;  4ZRI A;  4ARI A;  1L0Y B;  2M19 A;  4W9H A;  2KWD A;  4C00 A;  3M3J A;  1D4B A;  1JWB D;  4W9I A;  3R3M A;  3W2D A;  1WWT A;  2PIA A;  2IND C;  2M0X A;  3A9K B;  3U7D A;  2WDQ B;  1UWM A;  1K52 A;  3AEC B;  4OHJ A;  3L17 A;  2LHD A;  4G3X B;  1MFW A;  3ABV B;  3OWE B;  2GI9 A;  1WYG A;  5IO9 A;  1TYG B;  3PSE B;  2WXH A;  2PE9 A;  1E9M A;  2BYV E;  2MEK A;  2KX3 A;  2GB1 A;  1YN5 A;  1T0Q C;  1GAQ B;  2FCS A;  4M0W A;  2AQ1 B;  3A9J B;  3RNC C;  2I1J A;  2GBK A;  3TEX A;  1L4Z B;  1V5T A; 
#chains in the Genus database with same CATH homology
 5CHW A;  3KYC D;  3V60 A;  4OVV A;  2UWQ A;  3NZU A;  4F8C B;  3RZW C;  3DOW A;  3HM6 X;  1SE9 A;  4LCD E;  1LFD A;  3PS6 A;  5DPS A;  4ASW C;  2K8C A;  1YJ1 A;  2WX1 A;  1WE7 A;  4TV3 A;  1ISN A;  3TJP A;  1C3T A;  2CKH B;  5KHO A;  3ZUN A;  5JHA A;  2AWT A;  4E3C A;  4NY0 A;  4BOZ B;  2K39 A;  2WX0 A;  2NS5 A;  1R4N I;  4HK2 A;  4DXA B;  1WY8 A;  4TQ0 A;  2KX0 A;  2DZM A;  1V49 A;  2JPH A;  4FJV B;  4IM2 A;  2Y5B B;  3WAN A;  4DHJ B;  4PS3 A;  2B3A A;  2KO3 A;  3QAR A;  3L54 A;  2FAZ A;  2OOB B;  3ZDT A;  4FN2 A;  3B1L X;  4EUT A;  2D10 A;  2BYE A;  4K7S A;  3ZRC A;  1WMH B;  3HHM A;  4IW0 A;  2KWU B;  3HK0 A;  3ZIM A;  4WQO B;  1YX6 B;  3K9P B;  4ANV A;  4F7Z A;  2A4Z A;  1WR6 E;  1WZ3 A;  4MGY E;  5DCN A;  1VCB A;  2LVO A;  1OEY A;  4AJW A;  4PS8 A;  3KUC B;  1V81 A;  2JT4 B;  1WFY A;  4WWN A;  3VQI A;  3AU4 A;  3PGE A;  3QAQ A;  3PTF C;  2KDF B;  2AL6 A;  1TZ1 A;  4GDL B;  1SGH A;  2DZI A;  2MBH A;  2V3S A;  2ZVN A;  3QCA A;  1Y8R C;  3TBL D;  2ZEQ A;  3AUL A;  4DDI D;  3ZW3 A;  1E5W A;  1LQB A;  2WYQ A;  3A1Q A;  2HE7 A;  1V86 A;  2IO2 B;  1I42 A;  4GDK B;  4MH0 E;  4NAW B;  1GNU A;  3UGB B;  5KHQ A;  4NJ6 A;  2MA9 B;  1NDD A;  1C1Y B;  3PPA A;  1J0G A;  2KLG A;  3VUY A;  1H8C A;  4MEM A;  1WF9 A;  4XZ4 A;  4B95 A;  2BKF A;  1UD7 A;  3W1Y A;  3ALB A;  4JGH B;  1J8C A;  3R7Q A;  3DCG A;  3VHT C;  2MX2 A;  2KTR B;  1WH3 A;  3KVF B;  1X1M A;  2RR9 A;  3H7S A;  4FJY A;  2D11 A;  2G45 B;  1GC7 A;  4LJP B;  2LGX A;  3A4R A;  1OGW A;  1ZW7 A;  1WZ0 A;  2FUH B;  2LVP A;  2O2V B;  2LZ6 A;  2RPQ A;  1U4A A;  4JLC A;  2KD0 A;  4KSK C;  3ML8 A;  2PE6 B;  4AWJ A;  3EHV A;  1EUV B;  3GZN I;  1XQQ A;  3IHP C;  3ONS A;  4IG7 B;  3T8M A;  4HVB A;  3CSF A;  1H4R A;  3I3T B;  5J17 A;  1OQY A;  2KJ6 A;  3NHE B;  3CST A;  4NQK E;  3V6C B;  3L0W B;  2FCM A;  4FAD A;  3UQB A;  4HCN B;  4CO7 A;  4G50 A;  3LJ3 A;  5LXH A;  3T9L A;  3PHX B;  3A33 B;  2C9W B;  3OJ3 A;  3PHW B;  2W9N A;  2N1W A;  5JH5 C;  4WJO A;  2M1M A;  1YX5 B;  2BWF A;  4M0W B;  3APD A;  2GBJ A;  5HKH A;  2BPS A;  1WGH A;  2RSU A;  2C7H A;  3A1Q B;  3AI5 A;  4MDK E;  4WJP A;  3ZNH B;  1WIA A;  3R7R A;  2DZK A;  4KDI C;  3TCA A;  3BIN A;  2K8B A;  2MP2 B;  4ICV A;  4MGI E;  5IAA C;  3PLU A;  3U30 A;  2MSE D;  3B0A A;  3O65 B;  2ZCB A;  2ZJD A;  3JYU A;  2LXC A;  2ZNV B;  2O6V A;  4A3O A;  3QQ8 B;  3N30 A;  5E6N A;  1XT9 B;  1Q1O A;  2KTR A;  2FNJ B;  2GBN A;  2RD0 A;  3RUL A;  3KUD B;  3OAW A;  4HLE A;  4F1S A;  4KZC A;  3DVG X;  1EF5 A;  2KLC A;  3V61 A;  3A9J A;  4LJO B;  4ANU A;  2V1Y A;  1GG3 A;  3DDC B;  4HCP B;  3BY4 B;  4PYZ A;  3UF8 A;  1TTN A;  4I6N B;  2IZV B;  1SIF A;  2C7M B;  2KQS A;  2GBR A;  3VTV A;  4IM3 A;  1RFA A;  4AOF A;  2BWE S;  1WM2 A;  1WJN A;  3APF A;  1E8X A;  4BKS A;  4DK5 A;  4MSM B;  2HD5 B;  3UIN B;  3S2A A;  3A4S C;  2C60 A;  4EEW A;  2N4F A;  2NBW B;  1Z2M A;  2HTH A;  3QIJ A;  3P2B A;  2MW5 A;  2LRU A;  3GOE A;  3ZLZ A;  5CHV C;  2GMI C;  3DBH I;  1WE6 A;  3L08 A;  4N9F 4;  2MCN B;  3WAM A;  2AEH A;  1IP9 A;  3DBS A;  4FA6 A;  3IVF A;  2DX5 B;  2LJ5 A;  2ZVO A;  3W1S C;  1WX7 A;  4DHJ D;  4E74 A;  3KW5 B;  3JVZ X;  2DYM A;  4NJ7 A;  2FCQ A;  3PZD A;  1S3S G;  2JVC A;  2IY0 B;  2BKR B;  2MBB B;  3N3K B;  3DQV A;  3QJZ A;  4FLH A;  1WX8 A;  3PRE A;  3C0R B;  1WXS A;  1HE8 A;  4WAA A;  3NY5 A;  3QWZ B;  4JQW C;  4G11 A;  1Q0W B;  4WWP A;  3CF6 E;  5DPT A;  2ZPY A;  4MGK E;  2I1K A;  2KZR A;  4WJN A;  4NAW A;  2KFK A;  3SDL C;  3RUI B;  1WXM A;  4WJQ A;  1RLF A;  5J2R A;  1NBF C;  2M17 A;  4JL9 A;  5LLI A;  2JWZ A;  4EZK A;  2QHO A;  4PYU A;  2JZZ A;  2VRR B;  4HDQ A;  1EF1 A;  3NS8 A;  4NQL B;  2FIF A;  2XEW A;  2K6Q A;  2L76 A;  3SU8 X;  3MJW A;  1WR1 A;  1WX9 A;  5E6P A;  2DYO A;  3DVG Y;  2GOW A;  2ZZP B;  3ECI A;  1E90 A;  3PV1 A;  1E8Y A;  3ZDM C;  2NVU I;  1P9D U;  4MJS B;  1V2Y A;  2EMS A;  2YVC A;  4GDK A;  5LXI B;  2IO3 B;  1RRB A;  2L0T A;  3DPD A;  2FID A;  4YL8 A;  3RD2 A;  2L7R A;  1LXD A;  4DDG D;  4DHZ E;  2MP2 A;  2LRW A;  1UH6 A;  1VD2 A;  4GN1 A;  1F9J A;  2R2O A;  4KDL B;  1FXT B;  2O6V B;  4B9K A;  3PRZ A;  3UQA A;  3SHQ A;  4RM8 A;  3M62 B;  2DZJ A;  3PLV A;  1OEY J;  4KSL C;  3JW0 X;  3AXC A;  2KN5 A;  4IM0 A;  5CTR C;  2J0M A;  2LWP A;  2YLM A;  4GDL A;  4HPL B;  3TIX A;  3RCZ A;  4AUQ C;  2NR2 A;  4ANX A;  2N7D A;  3ZTD A;  2BF8 B;  2DAJ A;  2KMC A;  3H6N A;  2DHZ A;  3HM3 A;  3RYT A;  2FCN A;  2KC2 A;  1GUA B;  2DYB A;  1K8R B;  2MWS B;  2L0F A;  1UZX B;  1UEL A;  2LXA A;  3KUZ A;  4MGZ E;  2Z0E B;  4BBN F;  2JRH A;  2DAF A;  4AJY B;  2K25 A;  4URK A;  4GIV A;  2KDI A;  3VH4 B;  1M94 A;  3A9K A;  2REX A;  1ZGU B;  3U8Z A;  3ZKJ C;  2N9P C;  3X0W A;  5GMV A;  4IUM B;  1WGY A;  2CHX A;  2LUE A;  3CMM B;  2IY1 B;  4IC7 B;  5G2N A;  1CMX B;  5L95 C;  3H7P A;  3PVL A;  2RGF A;  4GGQ A;  4HXD A;  3RT3 B;  3VFK A;  4W9J A;  2KNB A;  4II3 B;  4MJS A;  5C23 A;  3ZNZ B;  3PT2 B;  4RMA A;  5AEK B;  4NNJ B;  5AZF A;  3VUW A;  2N9E B;  4XX5 A;  5TR5 A;  1R4M I;  3MHS D;  1WGG A;  2M4N A;  4XC2 A;  4DWF A;  2L05 A;  4GOC A;  4W9D A;  2KJH B;  1UBI A;  3H9D A;  3JSV A;  5G55 A;  1WJU A;  3UIP B;  1EO6 A;  2IBI B;  3V6E B;  4HWI B;  1WRD B;  3DBL I;  4IWQ A;  1P3Q U;  2G3Q B;  2M8S A;  3LDZ E;  3MTN B;  1YQB A;  4HDO A;  4JIO U;  5D6J B;  4IWP A;  2IYD B;  2UYZ B;  4EZJ A;  4LDT B;  1GC6 A;  4TQ1 A;  2J7Q B;  5DPR A;  3VXW A;  4PS7 A;  4M8M A;  2Z0D B;  2J0J A;  2LVQ A;  4KVG B;  3QK0 A;  2MLB A;  4HJK A;  5JHB A;  4ANW A;  2OJR A;  3VAW A;  4B6W A;  1Q5W B;  3DVN V;  4TUU A;  4BKT A;  4X57 B;  2L3Z A;  3NZS A;  4NPN A;  4FBJ B;  5AZG A;  4BFR A;  4GU2 A;  4GXB A;  2KHW B;  2HJ8 A;  1G6J A;  2J0K A;  2KXJ A;  3Q3F A;  3WAO A;  1UGM A;  2KK8 A;  1LM8 B;  4IWO A;  3VTU A;  1WI0 A;  2JUO A;  2KQ7 A;  2D2Q A;  1V5O A;  2EMT A;  2ZPN A;  3SD5 A;  3W1S A;  3M95 A;  5L83 A;  5C1Z A;  3IBE A;  1KOT A;  1S1Q B;  4EZL A;  1L7Y A;  4W9G A;  1P0R A;  3RZF A;  3HIZ A;  4ICU A;  4RM9 A;  1KM7 A;  4I6L B;  1ZKH A;  3Q3J A;  1V6E A;  4EFO A;  4HPM B;  1BT0 A;  4K7W A;  2KJR A;  3QX1 A;  2KWV B;  5E6O A;  3ZRF A;  3JSV B;  2KC1 A;  4KIK A;  4ZRJ A;  2C7N B;  4I6P A;  4AP4 C;  3WAL A;  4OVU A;  2KAN A;  3DVN U;  3AU5 A;  4A3P A;  4MM3 A;  3QHT A;  1D3Z A;  1YD8 U;  1YIW A;  3H7P B;  4W9C A;  3ENE A;  4BKG A;  2L8J A;  1E8W A;  2KMA A;  2LGD A;  2PJH A;  1WXA A;  3KH0 A;  2KFJ A;  3M63 B;  2Z59 B;  2DEN B;  4MSQ B;  2V4L A;  2K8H A;  4GB9 A;  2MBE A;  3ZVV A;  2ZNV C;  3R66 C;  4II2 B;  4K81 A;  3ML9 A;  1P98 A;  2CU1 A;  2XK5 A;  2CS4 A;  1WJ6 A;  5DPW A;  3OJ4 B;  3VDZ A;  5BO4 B;  3N32 A;  2KDB A;  4CYE A;  4KV2 A;  1WGR A;  2O6V D;  2PEA A;  2KOX A;  2WDT B;  2R2Q A;  3EFU A;  2PPH A;  4BBN C;  1KJT A;  2LD9 A;  4P7I A;  5D7G A;  2A5U A;  3PRP B;  4GMV A;  4DHZ B;  3EC8 A;  2D3G A;  2CHZ A;  2O2V A;  3APC A;  3VTW A;  1TGZ B;  2N1V A;  2KWC A;  2KTF A;  3EEC A;  4K1R B;  3ZTC A;  1T0Y A;  1NI2 A;  2WWZ A;  4MEL A;  3X23 A;  5D94 A;  2IO1 B;  2MRP A;  5AZH A;  1E8Z A;  2D07 B;  4WWO A;  3UIO B;  3TMP B;  1Z5S B;  3NOB A;  2EKE C;  3K9O B;  1TBE A;  2KFK B;  2NBV B;  4FJZ A;  3VH3 B;  2KVR A;  4EOY A;  2G4S A;  2K1F A;  1J19 A;  4FHJ A;  1GJZ A;  1IPG A;  4ZYN A;  1JRU A;  1XD3 B;  2JRI B;  4E71 A;  1I35 A;  3V62 A;  2LI5 A;  5FR6 A;  3ZO5 B;  2IO0 B;  4G0N B;  2MQJ A;  3L10 B;  1WGD A;  4M8N A;  2C5L C;  4A20 A;  2KKC A;  4ZDV A;  3ZNI D;  4GSW A;  3KYD D;  2KDE B;  4W9E A;  2LGY A;  2ZCC A;  3IFW B;  3L13 A;  4J6I A;  3PRM B;  2CHW A;  4W9K A;  2JXX A;  3ZNG C;  5EDS A;  2LAS A;  4ZRI A;  1WXV A;  2CR5 A;  1AAR A;  4W9H A;  1KLV A;  2NPT A;  4KZ0 A;  4ZRK A;  3M3J A;  2G4D B;  4TKN A;  2JZ3 B;  2JY6 A;  3B08 A;  2XBB C;  3WAP A;  4W9I A;  3R3M A;  1WMH A;  2BYF A;  1L2N A;  2GBM A;  2NBU A;  1WYW B;  3L16 A;  4K7U A;  2NCN A;  4BKS D;  1MG8 A;  2M0X A;  3A9K B;  1WM3 A;  2JF5 A;  3U7D A;  2N7E A;  3QC8 B;  3QA8 A;  2AL3 A;  4FHK A;  5CHF A;  4LDT D;  3IG3 A;  2BGF A;  3L17 A;  4W9F A;  3H1U A;  4W9L A;  3WA0 A;  3TL5 A;  4EKU A;  2N9X A;  4G3X B;  1P1A A;  4CHK A;  1PQS A;  4BOS C;  2MBQ A;  2ASQ A;  1A5R A;  2NPT B;  3PSE B;  1V9J A;  4BVU C;  2PE9 A;  3VVW B;  1V80 A;  2XK5 B;  1RAX A;  2BYV E;  4KIK B;  5IA7 A;  3D32 A;  5J18 A;  4DBG A;  3VUX A;  2KX3 A;  3WIM A;  2L00 B;  4FUL A;  2FCS A;  2AYO B;  2MBO A;  1QZE A;  1UBQ A;  3A9J B;  2K6D B;  5CX3 A;  5D2M B;  2I1J A;  5JZE B;  1IYF A;  1WJ4 A;  2GBK A;  1OTR B;  1V5T A;  1E7U A;  3OLM D;  3DBR I;  1E7V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...