2C7HA

Solution nmr structure of the dwnn domain from human rbbp6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GPLGSMSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ubiquitin-like protein
molecule keywords RETINOBLASTOMA-BINDING PROTEIN 6, ISOFORM 3
publication title Dwnn, a Novel Ubiquitin-Like Domain, Implicates Rbbp6 in Mrna Processing and Ubiquitin-Like Pathways
pubmed doi rcsb
source organism Homo sapiens
total genus 18
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08783 DWNN DWNN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c7hA00
1GUAB 2LXAA 3H1UA 4MGIE 5D6JB 5DPTA 1WGHA 2D10A 2LVPA 3C0RB 2L3ZA 1ZW7A 3D32A 3H7PB 2KX3A 2M1MA 4F1SA 1H8CA 3ZIMA 3BY4B 5JH5C 3ECIA 4HJKA 3VUXA 2G4DB 1C1YB 3KYDD 2Z59B 2LRUA 4LJPB 4GDLA 4XC2A 3RCZA 3ZTDA 5LXIB 1F9JA 4GDKA 3ZDTA 2EKEC 5L95C 3JW0X 3EHVA 1WRDB 4J6IA 2KZRA 2OJRA 3NOBA 3KVFB 2KDIA 2FCNA 5C1ZA 2N1WA 3VXWA 5EDSA 4WJNA 4BBNC 2CS4A 2DYMA 3AULA 4W9KA 3EC8A 1P9DU 2FIFA 2RSUA 3PPAA 4HDOA 4M0WB 3KUDB 2MP2B 4F8CB 2ZCBA 1RRBA 3CF6E 3RUIB 1EF5A 4I6LB 3K9PB 3IHPC 4PS8A 2L00B 2O6VD 1WZ0A 2FUHB 1WXSA 2MW5A 4P7IA 3ZNGC 2C7NB 3K9OB 2DX5B 3RZFA 1WMHB 2BYFA 3A1QA 4KDIC 4HCPB 1WE6A 1D3ZA 3UINB 2K39A 4W9IA 2REXA 3IBEA 4GN1A 3PRPB 3WAOA 3VTUA 3QARA 2L7RA 5KHOA 2UYZB 1KM7A 1V6EA 2PPHA 5AZGA 4ZRIA 3V6CB 1UH6A 2KANA 5CHFA 1OQYA 1E90A 4EEWA 2R2QA 3M3JA 4GSWA 3V6EB 2FCSA 1WI0A 5DPSA 1MG8A 2DENB 2J0MA 5DPWA 3AU4A 3IG3A 1V86A 3QK0A 4GGQA 3VH3B 2DZKA 2K1FA 3MTNB 5AZHA 1ZKHA 1WM3A 4AJWA 2ZZPB 2LRWA 4K7WA 3PHWB 1WF9A 2I1JA 2JVCA 2KJRA 4A20A 2CU1A 3LJ3A 4BKSA 3PVLA 3B08A 2MBHA 2JRIB 5AZFA 2IBIB 2C7HA 3VH4B 5JHBA 1K8RB 3VUWA 2G45B 3ALBA 3QAQA 4HLEA 4K81A 5TR5A 4IWPA 1WM2A 2BF8B 2GBKA 3L08A 3PSEB 3A9KA 1WH3A 1CMXB 3KYCD 2K25A 1TGZB 2CHWA 4RM9A 1IPGA 2PJHA 1Y8RC 2KOXA 3QIJA 5DPRA 1KOTA 3HK0A 4BOZB 3PLUA 2PE6B 4FJZA 1GG3A 2LASA 1H4RA 2QHOA 2CHZA 4PS3A 3WIMA 1ZGUB 2KTFA 2KXJA 3L17A 3JYUA 2EMTA 2NPTA 3A4SC 4W9FA 1YX5B 1XD3B 1E8WA 1WY8A 3QWZB 4FA6A 4K7UA 5CX3A 1WXAA 3L54A 2A5UA 2KC1A 3DOWA 4DDGD 3T8MA 3DCGA 2ZNVC 2DYBA 4G0NB 3V61A 5L83A 3R7QA 3ENEA 4NPNA 1WJNA 3EFUA 2AL3A 4I6NB 2KFKA 2FAZA 1XT9B 2JPHA 2K8CA 3W1SA 3QCAA 5J17A 4KVGB 1LXDA 2GBMA 2D07B 1J0GA 3V62A 2O2VA 2NBWB 2BWFA 3RD2A 1LQBA 4PYUA 4WWNA 2UWQA 5C23A 3APDA 2JF5A 2C60A 3Q3FA 4TQ1A 1WIAA 1TZ1A 2DZJA 2DHZA 2KLGA 3ZTCA 3T9LA 2MSED 4GDLB 2LGYA 1V5TA 2AL6A 3VTVA 4AOFA 3PREA 1E7UA 3PS6A 4GDKB 1OEYA 3OAWA 1E7VA 4TUUA 2JXXA 4CO7A 2R2OA 4MSMB 1WGYA 4KIKB 4MELA 1E8XA 3ZUNA 2KQSA 1E5WA 2IO1B 5E6PA 4KIKA 3TL5A 1OGWA 1YIWA 2L0TA 2XEWA 3APFA 4HDQA 3A9JA 3H7SA 3UF8A 2BYVE 4TV3A 3TMPB 4MJSA 4CYEA 1R4NI 3TBLD 3PV1A 2IYDB 4DHJB 2XK5A 4G50A 2DAJA 3ZRFA 3DBHI 4TKNA 4LDTB 2ZVNA 1UD7A 3DBSA 4KZ0A 2L8JA 1WX7A 3A33B 4RM8A 4XX5A 5IAAC 2HE7A 1YX6B 2L05A 3IVFA 4F7ZA 2C9WB 3DBLI 3A1QB 3DQVA 4JIOU 4A3PA 1KJTA 4DK5A 4AWJA 1WJ6A 2RR9A 2LZ6A 4FLHA 2WX1A 4IC7B 3L13A 4LCDE 4ICUA 3ZNID 4E71A 2KTRA 1WZ3A 5JHAA 3ZNHB 2K8HA 2MLBA 4G11A 4HK2A 4BKTA 1NBFC 1SGHA 2IZVB 2RPQA 2DAFA 4W9LA 2KVRA 3M63B 1WX8A 1V49A 2MQJA 3R3MA 5BO4B 1Z5SB 2N9PC 4EUTA 1E8ZA 1WXMA 2MWSB 2KMAA 3Q3JA 1OTRB 4HVBA 2A4ZA 3ONSA 4WJQA 1WJ4A 1QZEA 4MDKE 4N9F4 4MSQB 2KWUB 2N9EB 2LGDA 2J7QB 3WANA 1LM8B 1WR1A 3GOEA 4DDID 2GBRA 3W1YA 4ZRKA 1KLVA 4DHZE 5AEKB 3L0WB 5KHQA 3N3KB 2KJHB 2C5LC 3CSFA 3P2BA 3WA0A 1GJZA 1C3TA 2Y5BB 5D2MB 2JUOA 2N4FA 3ZO5B 3CMMB 3L10B 4HCNB 2L76A 4W9JA 4GOCA 4W9EA 3PRZA 2LGXA 3U7DA 3OLMD 3UQAA 1UZXB 2DZIA 3A9KB 2J0JA 3DVNU 4KDLB 5J18A 2O6VA 2MBBB 2IO2B 4HXDA 1L7YA 1V2YA 2KWCA 2J0KA 3H9DA 1Q5WB 4EZKA 2KDFB 3WAPA 3TJPA 4A3OA 4ANVA 1A5RA 3HM6X 1V81A 3U30A 4MH0E 1X1MA 1BT0A 3DVGX 4GU2A 4GB9A 2DZMA 3SDLC 1WR6E 2NPTB 2ZVOA 3KH0A 4ICVA 3W1SC 2MBEA 4ZRJA 3UQBA 4JL9A 1EO6A 2NR2A 3JSVA 3TCAA 4IWQA 5IA7A 1NDDA 3V60A 3PHXB 4URKA 1GNUA 4KV2A 4HPLB 4B6WA 4ANWA 2MCNB 4OVUA 2GBJA 2C7MB 2JT4B 2KFKB 4EKUA 4X57B 4PS7A 3DVNV 3U8ZA 4IW0A 1T0YA 2MRPA 4NAWA 5CHWA 3N32A 4IUMB 2O2VB 2KD0A 4W9GA 1OEYJ 3EECA 2ZPYA 3VAWA 3B1LX 1WGRA 2KMCA 2NVUI 3QHTA 4K1RB 3RULA 3ZRCA 3ML8A 2M17A 4AJYB 4G3XB 1JRUA 2ZNVB 4B9KA 2BPSA 3QA8A 4DXAB 3BINA 2EMSA 2KJ6A 1PQSA 3MJWA 3PRMB 4EZLA 3VUYA 1IYFA 2LJ5A 1WXVA 1Q1OA 4MGKE 4DHJD 3GZNI 3VVWB 2NCNA 4RMAA 2IO0B 4GXBA 4LDTD 4NY0A 1WX9A 2JWZA 2LUEA 4FN2A 3VTWA 1P1AA 2MA9B 2V3SA 2FIDA 3MHSD 4II2B 4HWIB 4NJ7A 5GMVA 4DHZB 1HE8A 2M0XA 3ML9A 2BYEA 3VDZA 3R7RA 3NS8A 1G6JA 1SE9A 5LLIA 4BVUC 1P3QU 2D3GA 3KUZA 3A9JB 3LDZE 4BKGA 3R66C 2KC2A 4MJSB 2KWVB 1WGDA 2MX2A 3X0WA 3QC8B 2XK5B 2ASQA 3IFWB 1P0RA 4DWFA 4ASWC 3RYTA 1Z2MA 4BFRA 4II3B 4NQLB 5DCNA 1WYWB 3H7PA 2AEHA 1YJ1A 1YD8U 2LD9A 3QJZA 4WWPA 4MM3A 1VD2A 5JZEB 3HM3A 4FHJA 2HJ8A 3UIOB 3UGBB 4E74A 2JZ3B 2LI5A 3WALA 2GBNA 2Z0DB 2KO3A 3KW5B 4TQ0A 2KTRB 1WGGA 2LWPA 3NHEB 1EF1A 1TTNA 2OOBB 4FHKA 2WX0A 3M95A 4EFOA 1GC7A 1S3SG 1E8YA 2PEAA 4ANXA 1RLFA 4KSLC 2N7DA 3AXCA 3UIPB 3WAMA 2MBQA 4BKSD 5E6OA 3TIXA 1YQBA 2VRRB 2L0FA 1FXTB 2LVQA 3M62B 4JGHB 1I35A 1V5OA 3NZUA 2KLCA 4AP4C 3KUCB 2MP2A 4IM3A 2XBBC 2JY6A 4PYZA 2YVCA 2FNJB 2N9XA 3DBRI 1M94A 1VCBA 4ANUA 2ZEQA 3PTFC 1RFAA 1WMHA 3VQIA 2KHWB 1EUVB 5E6NA 1XQQA 3VHTC 3ZNZB 2G3QB 2V4LA 3X23A 2BKFA 4B95A 4MGYE 3CSTA 3APCA 5FR6A 4LJOB 1LFDA 2D11A 4IWOA 3ZDMC 2K6QA 4AUQC 4GMVA 3DDCB 3ZW3A 4W9HA 3PT2B 2I1KA 3A4RA 1L2NA 2LVOA 2O6VB 2M8SA 2KX0A 1NI2A 4FADA 4CHKA 2M4NA 4HPMB 3N30A 1ISNA 4ZYNA 4BBNF 2WYQA 2BGFA 2K6DB 3L16A 2YLMA 3AU5A 2D2QA 2G4SA 2IY1B 4WJOA 2NBVB 3ZVVA 3PLVA 3ZKJC 2GMIC 2ZCCA 2N7EA 2GOWA 5CHVC 3JSVB 2IO3B 3DVGY 1UBQA 2WDTB 3NY5A 3AI5A 2Z0EB 3SHQA 4MGZE 1SIFA 1TBEA 1J8CA 2DYOA 2KQ7A 4IM0A 3VFKA 4JQWC 4KSKC 2CHXA 1IP9A 2BKRB 2HTHA 2NS5A 4WAAA 2KFJA 4FULA 4W9CA 4M8MA 2HD5B 3O65B 3I3TB 2MBOA 3PGEA 1U4AA 5D94A 4OVVA 4WWOA 2AWTA 1UGMA 5LXHA 1WFYA 1WE7A 1R4MI 1V9JA 3PZDA 4NAWB 4YL8A 2IY0B 3QQ8B 4I6PA 3ZLZA 3OJ4B 3HIZA 2CKHB 2JZZA 2K8BA 1V80A 2BWES 1AARA 2W9NA 3QX1A 1RAXA 2KDBA 2PE9A 4KZCA 2KKCA 4DBGA 4FBJB 5J2RA 2JRHA 2CR5A 2RD0A 4ZDVA 2B3AA 2V1YA 3JVZX 2KK8A 2LXCA 2AYOB 4FJVB 4WJPA 1J19A 1UBIA 2N1VA 2WWZA 4M8NA 2RGFA 1GC6A 4GIVA 4EOYA 3SD5A 5HKHA 4NJ6A 3DPDA 4IM2A 4XZ4A 3RT3B 3S2AA 4BOSC 1Q0WB 1S1QB 3HHMA 5G55A 4K7SA 4E3CA 4W9DA 4NNJB 2KDEB 2ZJDA 4EZJA 5D7GA 4MEMA 3RZWC 4NQKE 4FJYA 5G2NA 3B0AA 4WQOB 2KN5A 3H6NA 5CTRC 1P98A 2ZPNA 3SU8X 3OJ3A 3NZSA 1UELA 2FCMA 2FCQA 2KNBA 4IG7B 4JLCA 2NBUA 1WJUA 1I42A
chains in the Genus database with same CATH superfamily
3AE8B 1WRIA 2LVPA 1ZW7A 3TUOA 2M1MA 3BY4B 1YN4A 3KYDD 2LRUA 3RCZA 1KLGD 2EKEC 2WS3B 4L23A 1WRDB 3Q3OC 1MPEA 1AYFA 2KDIA 3MHZA 3W9CB 4WJNA 2DYMA 3AULA 4A90A 1P9DU 2RSUA 2SAKA 4HDOA 4XWTA 3KUDB 1PGXA 3W5UB 1TZOA 3AE1B 1EF5A 4EE2A 4MACA 1C79A 1WZ0A 2FUHB 1WXSA 1D5MC 2JU6X 1JCKB 4OW0A 1WE6A 2WXHA 2WXNA 3UINB 4TSSA 3AE4B 1NVID 3PRPB 3VTUA 4REZA 5KHOA 2CJOA 2UYZB 1V6EA 2KANA 1RWSA 2AQ2B 2WXFA 2J0MA 1V86A 5AZHA 1ZKHA 1FXAA 2PKOA 3VRAB 4A20A 1IBXB 1XXGA 2CU1A 3LJ3A 3Q2AC 3VH4B 5AZFA 1FNWA 1XF5L 4K81A 1WM2A 2GBKA 4RNAA 2LGIA 1WH3A 3AMZA 4WWMA 2PJHA 5DPRA 1Y8RC 1KOTA 2BS4B 3PLUA 1CZPA 4RCOA 1E0ZA 1RFKA 4LTUA 3CWIA 2D3CA 2OHFA 3AE6B 3GB1A 3U7ZA 3T8MA 3U52E 1FMAD 2DBYA 1VJKA 1FD6A 5J17A 1NYQA 1LXDA 3V62A 2MH7A 2O2VA 1LQBA 1C9FA 1TZ1A 2DZJA 2H88B 2MSED 4GDLB 2G9HD 4AOFA 1OEYA 4TUUA 1E9MA 4O1NA 5T8IA 4MSMB 3E9SA 1TKYA 1MVKA 3IT6B 5E6PA 3T3OA 4US9A 2BBCA 3TL5A 2XEWA 1FIQA 3UF8A 3MC0B 4CYEA 2JWUA 4DHJB 1D6EC 1YN3A 2JX5A 3NVVA 5IAAC 1YX6B 3I5JC 5HG2A 4PT5A 4F7ZA 1CK1A 2C9WB 3V3XA 4FLHA 4ICUA 3Q8FA 2KTRA 1WZ3A 3GP7A 1SGHA 3M63B 1WX8A 4Q2JA 4EUTA 5HHDG 1WXMA 2KMAA 2KYWA 1OTRB 2A4ZA 3ONSA 1QZEA 3B2FA 3GOEA 3L0WB 3C8YA 5D2MB 4RGTA 2JUOA 1E10A 3CMMB 4W9EA 2OEDA 4J3OD 2LGXA 3U7DA 3AM9A 2MHJA 3UQAA 2VH1A 4BAXA 3L4PA 4KDLB 3PZ7A 3AH7A 2YEPF 1KFYB 2PVGC 1VLBA 2L52A 4HXDA 2KWCA 1SE2A 1HQRD 3H9DA 3WAPA 1PGBA 3TJPA 1A5RA 3DVGX 1BT0A 2DZMA 4LNKA 2ZVOA 3KH0A 4WURA 4JX1C 3W1SC 1SEBD 3GE8C 4JL9A 2NR2A 3JSVA 3RI7C 2PW9A 1GNUA 4KV2A 4ANWA 1WYGA 2EKIA 2JT4B 4WQMA 1VDVA 4HPPA 1T3QA 1TKGA 4B0EA 3FILB 2MRPA 4NAWA 5CHWA 3N32A 1B1ZA 4IUMB 1I4PA 3EECA 2ZPYA 3VAWA 1WGRA 3ZRCA 3NVYA 4AJYB 2L83A 1JRUA 2ZNVB 4DXAB 2JSVX 1IUEA 2EMSA 3BINA 3MC8A 3MJWA 3RNGC 2LJ5A 2SEBD 1Q1OA 3GZNI 3Q8CA 2NCNA 1DOIA 2LUEA 1P1AA 2V3SA 3MHSD 2FIDA 4NAMA 5GMVA 3T3NA 1HE8A 3KWVA 3ML9A 2ZW1A 3NS8A 3AE3B 5LLIA 4UDUC 3E56A 3HVZA 1P0RA 4DWFA 1UUPA 4OZCA 3DWMA 2LD9A 1VD2A 4N58A 3UIOB 3UGBB 2JZ3B 2LI5A 3P4QB 3WALA 2KO3A 5GXGB 2K9XA 1GC7A 1S3SG 1E8YA 1RLFA 1PUTA 3AXCA 1QLBB 1YQBA 4HKZE 4JGHB 1I35A 4AS1A 1V5OA 1ROEA 1JWBD 2FNJB 1OQRA 1M94A 1TS4A 1J7CA 1HZ6A 4YSZB 1T0SC 2QIEB 3ZDMC 2D11A 2K6QA 1YOVB 3DDCB 3ZW3A 3P4PB 2HJ1A 1KRHA 2LVOA 4TMAB 1FXIA 3N30A 1ISNA 1JWAD 4JPSA 2BGFA 2K6DB 3L16A 4WJOA 2NBVB 3ZVVA 1I4QA 2ZCCA 4C80A 3DVGY 3NS1A 2Z0EB 4M01A 2DYOA 3VFKA 2CHXA 2BKRB 2WNMA 2NS5A 2KFJA 4W9CA 3MFGA 3P4RB 1GAQB 2MBOA 2QCZA 4OVVA 5FK9C 1UGMA 3NVZA 1WFYA 4RH6A 1ENFA 3QQ8B 1QF6A 2JZZA 2BWES 3GZNB 2KDBA 2PE9A 4QAYA 2CR5A 1I4RA 2RD0A 5H92C 2KK8A 2LXCA 4YTMB 5C3JB 2WWZA 4M8NA 1GC6A 4NJ6A 2BTEA 4XZ4A 1V1PA 3HHMA 5G55A 2KAJA 4K7SA 1XO3A 2AX5A 2RDGA 1J7BA 3RZWC 4WQOB 4D2KA 3SU8X 2DNFA 3OJ3A 4M02A 1AW7A 4P6VF 1GUAB 1F2RI 3H1UA 5D6JB 2QEJC 2D10A 4GLSC 5TSSA 3I63C 2WU5B 2ACZB 4MM3B 5JH5C 1C1YB 2Z59B 1ZDXA 4LJPB 1ESFA 1JMLA 2V3NA 3ZTDA 1TY2A 2TSSA 1F9JA 2CJNA 4GDKA 1EWCA 3NOBA 5C1ZA 2CS4A 3NUHB 4W9KA 3RNFC 2Z8LA 3RPFC 1RRBA 1TY0A 3CF6E 3RUIB 1FRDA 3IHPC 2MW5A 2K5PA 4P7IA 3ZNGC 1EU4A 3N1ZC 3RZFA 2W3RA 2BYFA 3A1QA 4KDIC 4HCPB 1D3ZA 3W5VB 2REXA 3IBEA 4GN1A 2GB1A 3WAOA 1A70A 2WP9B 2L7RA 3PZ8A 3C19A 5IO9A 2PPHA 5AZGA 3V6CB 4ZRIA 1GB4A 1T0RC 1I4XA 1OQYA 2R2QA 2FCSA 1WI0A 1MG8A 3IG3A 3VH3B 2DZKA 1QILA 3TEWA 1PGAA 4AJWA 3PHWB 2JVCA 4BKSA 2MBHA 2C7HA 1K8RB 3QAQA 1ZE3D 4HLEA 4IWPA 2BF8B 4ACFA 3A9KA 2RDHA 2K25A 1F2RC 1YQ4B 3QIJA 1KTKA 4OHJA 2L1AA 2PE6B 4FJZA 1GG3A 1H4RA 1KLUD 2QHOA 2CHZA 4PS3A 3WIMA 1VZ7A 4LNOA 2EMTA 3A4SC 2WXMA 3RMKC 1XD3B 1E8WA 3QWZB 2FBWB 4ZYSA 1JALA 3DCGA 2DYBA 3V61A 1WJNA 2AL3A 1BMLC 3BIID 1N61A 3NRZA 4FXCA 4RGOS 1VZ8A 2BB5A 2K8CA 3QCAA 3AEEB 1HTQA 1WGKA 3BVZA 2BWFA 2BYTA 2N9LA 3TEZA 4HROA 4TQ1A 3Q3FA 4K3BA 3T9LA 1YMHE 2AL6A 1E7UA 1WSPA 1SE3A 4NJCA 1DGJA 2KQSA 4KIKA 3P1MA 3BVMA 2L0TA 3APFA 2INDC 3A9JA 3H7SA 1R4NI 3AN1A 3ETRA 3TBLD 2IYDB 1QOAA 2XK5A 2DAJA 3ZRFA 2ZVNA 2L8JA 1WX7A 4RM8A 2HE7A 2IPKD 3IVFA 1FEHA 1QOGA 5IP4D 2RR9A 2WX1A 3URYA 2KQ4X 3RNCC 4P1CC 3ZXRA 2IZVB 1YNTE 1BUIC 2DAFA 1Z5SB 1SE4A 1L6VA 2MWSB 3Q3JA 3CIRB 4WJQA 4MDKE 1DOYA 1LM8B 1WR1A 2GBRA 1KLVA 1XLQA 3U4EG 1L4DB 1K52A 2C5LC 2KJHB 3CSFA 3P2BA 2N4FA 4W9JA 3PRZA 2RPVA 1ACCA 5J18A 2O6VA 2EELA 2V3PA 5FKAC 1KF6B 2PTLA 2J0KA 1Q5WB 4A3OA 1V81A 2UU7A 4GU2A 4GB9A 1WR6E 2NPTB 4ICVA 2MBEA 3AV8A 2LHDA 5IA7A 3ABVB 3V60A 4URKA 4HPLB 2MCNB 4OVUA 2JQRB 2KFKB 4XGAB 4PS7A 3U8ZA 3I57A 3RULA 4K1RB 2M17A 2WDQB 2BPSA 3QA8A 1V8CA 2KJ6A 5BYSA 2XN9C 3VVWB 4RMAA 1R4NB 2Y3AA 4LDTD 2KN4A 2WDRB 3Q69A 3TEXA 4NJ7A 5IKCM 4BVUC 1EWYC 1E7PB 4BKGA 4MJSB 2J42A 3TEYA 2MX2A 2ASQA 2WU2B 3RYTA 4C00A 3W2DA 4BFRA 4NQLB 1WYWB 1K50A 1NEKB 1YJ1A 3HRDD 5JZEB 3U2SC 2WXLA 4E74A 1T5XD 1TS5A 1WGGA 4A8XC 4FHKA 1FO4A 5HI1A 4R3DA 1D5ZC 3WAMA 2MBQA 4BKSD 1V97A 2ICIA 2LVQA 3RFZB 3KUCB 1QOFA 1TS3A 2I38A 4IM3A 3BYTB 4LNFA 1VCBA 2YEPB 3NJTA 4ANUA 1AN8A 1HA5A 3VQIA 4EZJA 4B95A 2G3QB 4MGYE 1LO5D 3APCA 5FR6A 4LJOB 4KX6B 1SXTA 4W9HA 1WWTA 2LUMA 4IKGA 3NVWA 4CHKA 4IDIA 2M4NA 3R2IA 4HPMB 4BBNF 2WYQA 1VZ6A 2N7JA 1J7AA 3AU5A 4XDCA 2BQQA 3PLVA 2N7EA 5CHVC 2D3AA 3N1YC 1C4CA 4YTPB 1UBQA 2WDTB 3SHQA 4MGZE 2E6XA 1IBXA 1QOBA 2WXKA 1TBEA 4IM0A 2HTHA 2CU3A 1UF0A 3IAM1 1MHHE 4ITKA 1U4AA 5D94A 2WXPA 4WWOA 2AWTA 2QJLA 3Q8BA 3BVGA 4US8A 3DHHC 4YL8A 3ZLZA 3QX1A 1RAXA 4DBGA 1CJEA 1UBIA 3SFEB 5HKHA 3DPDA 2FE8A 4ARCA 4HKQA 3RT3B 3S2AA 1Q0WB 3DWGC 1D5XC 4MEMA 1ET9A 5G2NA 1I7HA 2ZPNA 2NTTA 2OJWA 2KNBA 2MJEA 4JLCA 2NBUA 2LXAA 1YN5A 1IGDA 2MJ3A 5DPTA 4C7ZA 1WGHA 1STEA 2WXOA 1SSNA 2G1EA 3C0RB 2L3ZA 2WGSA 3H7PB 1C76A 1H8CA 4F1SA 3ZIMA 3ECIA 1JWUD 4NZLB 1GOZA 2K0PA 3VUXA 1T0QC 1JROA 4GDLA 4C4VB 5LXIB 3ZDTA 1E6EB 2QMTA 3JW0X 3AECB 2PIAA 3EHVA 2KZRA 4J6IA 2FCNA 1L0XB 2N1WA 3VXWA 1FRRA 2V4IB 3EC8A 3PPAA 4M0WB 2KDMA 3RNAC 3ZGZA 1TYGB 3B9JA 2MP2B 3MP9A 4I6LB 2V9HA 5D3DA 4PS8A 2L00B 2O6VD 3BK1A 3Q3NC 4S17A 2PMVA 2C7NB 2DX5B 1WMHB 5E6JA 2WDVB 3AE5B 3UI3A 1KM7A 3BYYB 1XLOA 4RFBA 5FR3A 1E90A 4EEWA 4GSWA 5EE3A 2DENB 3VR9B 2IGHA 3MTNB 1DYQA 2DWQA 3OG5A 2B76B 1FM0D 3GS2A 2ZZPB 2I1JA 2BT6A 1C77A 1M4VA 3PVLA 3Q3MC 2VZKD 3VUWA 2X8XX 2Q5WD 3EA6A 1UWXA 1VR9A 3L08A 1CMXB 2J4XA 4RM9A 1TGZB 2CHWA 2WXJA 2AQ3B 4BOZB 4P1BC 5BYRA 1ZGUB 2KTFA 2KXJA 5BMGA 3JYUA 4W9FA 1WY8A 4FA6A 4K7UA 5CX3A 3EGRA 2A5UA 2KC1A 4DDGD 5L83A 4G0NB 3R7QA 3EFUA 2PLPA 4N59A 4I6NB 1ZXHA 2JYEA 2FAZA 3BK2A 3FILA 1N6ZA 3W1SA 4KGSA 4KVGB 2D07B 1J0GA 2IDYA 1XLNA 4WWNA 5C23A 5BYQA 2LJIA 1XCTL 1WIAA 4ZHPA 4ZHOA 1N60A 3OWEB 3ZTCA 3Q8EA 2K3UA 3VTVA 3PREA 3DHGC 3OAWA 2JXXA 2R2OA 4KIKB 3R8BA 1E8XA 4L1BA 1OGWA 1YIWA 2IGGA 2BYVE 4TV3A 3TMPB 3PV1A 4KGRA 4G50A 1UD7A 4KZ0A 3A33B 4XX5A 3H8HA 2L05A 2W3SA 4USAA 4JIOU 2HDEA 1DOXA 4DK5A 4AWJA 2LZ6A 4IC7B 3ZNID 4RF0A 3ZNHB 2K8HA 4G11A 4HK2A 1NBFC 2AQ1B 2RPQA 2BB6A 4W9LA 1V49A 3R3MA 5BO4B 2INCC 4HVBA 4N9F4 4MSQB 2KWUB 1JRPA 2N9EB 2LGDA 2KACA 4DHZE 5AEKB 1XLPA 5KHQA 1ZDVA 4OVZA 3N3KB 1GJZA 1C3TA 2Y5BB 3FKYA 3L10B 4HCNB 2L76A 4GOCA 1XCQL 3OLMD 3NZ3A 3EFCA 2JYTA 1I4HA 1L7YA 1JW9D 2KDFB 3HM6X 1X1MA 2WXIA 1PFDA 4M00A 3AEGB 5MPOA 4IWQA 1ET6A 3ZQ4A 4L2YA 4B6WA 2C7MB 4EKUA 3DVNV 4IW0A 2LEKA 1HZ5A 4YSXB 2O2VB 2XNAC 4PK1A 1OEYJ 3B1LX 2KMCA 4DQOC 2BS2B 4G3XB 3HVDA 1PQSA 3BWUD 3PRMB 3SR6A 1EU3A 2QSDA 1WXVA 4DHJD 4KGTA 1HXYD 2QDFA 4GXBA 4NY0A 1WX9A 3VTWA 1P7EA 4FN2A 4DHZB 2MA9B 3AEFB 3VDZA 3R7RA 1KH0A 2D3GA 3AE9B 3KUZA 1EM7A 2KC2A 2WLBA 3KLSX 1WGDA 3X0WA 3IFWB 4ASWC 2KVZA 4II3B 2NMQA 5DCNA 1HEZE 1UNSA 2AEHA 1SJED 1YD8U 4MT5A 3WCQA 4YXDB 4MM3A 4KKIA 4FHJA 2HJ8A 2ZW0A 1TJEA 2I2YA 1SIJA 4ZRQA 2GBNA 2Z0DB 4TQ0A 2KTRB 1EF1A 2OOBB 5G5GA 4EFOA 3Q8AA 3AE7B 2PEAA 1F52A 4WAFA 1PDXA 3UIPB 2N7DA 4HRSA 5E6OA 3TIXA 1N63A 2VRRB 2INNE 3NZUA 1C4PA 2D3BA 1TKEA 4A6QA 1NENB 2XBBC 2W82A 3MJ5A 2QILA 3DBRI 1MG4A 2ZEQA 3PTFC 1MFWA 5E6NA 3VHTC 2V4LA 3IT4B 2X38A 4H2AA 1MJDA 4AUQC 4GMVA 1RM6C 1L2NA 1RYJA 4JE3B 5EE9A 2M8SA 2KX0A 4RF1A 3P42A 3AE2B 1GPXA 2KMMA 2YLMA 4WH4A 2D2QA 2IY1B 3ZKJC 2GMIC 3JSVB 2IO3B 3NY5A 3AI5A 4HEA1 1SIFA 3ZYYX 1J8CA 2KQ7A 1IP9A 4KSKC 4WAAA 4XYCA 2HD5B 3O65B 1GB1A 4DXGA 3PGEA 5LXHA 1R4MI 1V9JA 4NAWB 2IY0B 1JWSD 4I6PA 4KKJA 3OJ4B 3HIZA 2CKHB 1V80A 2KKCA 4FBJB 3BZDB 4ZDVA 3JVZX 3VR8B 2JZPA 4FJVB 4WJPA 1P7FA 2RGFA 3SD5A 3LYYA 1S1QB 4E3CA 4W9DA 4NNJB 2KDEB 5D7GA 4NQKE 3H6NA 5CTRC 5BMIA 2W55A 1UELA 2FCQA 2RDBC 4JWUC 1L0VB 4MGIE 3ZJTA 3V05A 3D32A 1FFUA 2KX3A 1L0YB 4HJKA 2G4DB 4RGMA 4XC2A 5L95C 4YTNB 1F77A 3LB8C 2OJRA 3KVFB 4A9AA 3DBRB 5EDSA 4BBNC 3N20C 1FNVA 2FIFA 1OQQA 1LGRA 4F8CB 5LNK1 3AEAB 3P63A 2ZCBA 3Q6BA 3K9PB 5G5HA 3J9CA 5IN7A 2QC8A 1C78A 1Q10A 3K9OB 4AQ7A 2M19A 2VH2A 2RMMA 1NYRA 2K39A 4W9IA 2W54A 2LFIA 4C7YA 3QARA 3GE3C 3P4SB 1UH6A 5CHFA 3M3JA 3V6EB 5DPSA 1N5WA 5BMHA 5DPWA 1ZPSA 3AU4A 3QK0A 4GGQA 1JQ4A 3B2GA 2K1FA 1WM3A 1FFVA 1R4MB 1TT5B 2LRWA 3NG0A 4K7WA 1WF9A 3RNBC 2KJRA 3LXFA 3B08A 2JRIB 2IBIB 5JHBA 2V0GA 2G45B 3ALBA 5IOIA 4LNIA 5TR5A 3PSEB 3TSSA 3KYCD 4YT0B 1IPGA 5D3IB 2KOXA 3HK0A 1F0ZA 2FUG1 2LASA 4P16A 4WIPA 3L17A 3RN9C 1L6UA 2NPTA 5C2TB 1YX5B 4HJGE 1WXAA 2M0AA 2HTME 3L54A 5EE0A 1V1PB 1YJIA 3DOWA 1D4BA 3IXSA 2ZNVC 3ZJVA 3ENEA 4NPNA 2KFKA 1JWMD 3PO0A 1ZP0B 2ON8A 2IJ0A 1XT9B 2JPHA 3AEBB 2N9KA 2GBMA 3SEBA 2Y5CA 2NBWB 3RD2A 4PYUA 1L5PA 2UWQA 3APDA 1T6BX 2JF5A 2C60A 1AWDA 2DHZA 2KLGA 1FPYA 2LGYA 2BVCA 1V5TA 5AUKA 3PS6A 4GDKB 2WQYB 1E7VA 2MEKA 3DHIC 4CO7A 1WGYA 4MELA 3ZUNA 1E5WA 3N9YC 4BZAA 2IO1B 4HDQA 4MJSA 1I4GA 1L4ZB 3DBHI 4TKNA 2JXTA 4LDTB 4B0MA 3DBSA 2NTSA 2K22A 4S0RA 3DBLI 4LLGM 3A1QB 1IGCA 3DQVA 4A3PA 1KJTA 1YJJA 1WJ6A 4LCDE 3L13A 4E71A 1N5XA 3IAS1 5JHAA 1K51A 2MLBA 2WXRA 4XE0A 4BKTA 4ZRPA 4IOIE 2KVRA 1BXTA 2MQJA 3FAHA 2N9PC 3VRBB 1E8ZA 4YWGG 1WJ4A 3FC4A 1FCLA 2J7QB 4YSYB 3WANA 4DDID 3W1YA 4ZRKA 1WXQA 3WA0A 5I4DA 3Q14C 3ZO5B 1SB3C 2PVOD 3SFDB 1UZXB 2DZIA 3A9KB 2J0JA 3DVNU 2BW2A 2MBBB 2IO2B 5JXVA 1V2YA 1MI0A 4N6EB 2GLSA 5AUIA 4EZKA 4ANVA 3U30A 4MH0E 4C56C 3SDLC 1K53A 1B9RA 4ZRJA 3UQBA 1EO6A 3TCAA 3O13A 1NDDA 3PHXB 1UGJA 1SJHD 1NI3A 4A55A 2M56B 2GBJA 3RNEC 2WXQA 4X57B 5H8YE 1T0YA 4CQNA 1R7SA 2KD0A 1Y56A 4W9GA 2NVUI 3QHTA 3ML8A 4K3CA 4B9KA 3N1XC 4EZLA 3VUYA 1IYFA 1V1OA 4MGKE 1HTOA 2IO0B 4MH8A 2JWZA 3MC9A 4II2B 3ZXVA 4HWIB 3DBHB 2M0XA 2BYEA 1MHXA 1G6JA 1SE9A 2DLBA 2WHIA 1P3QU 3A9JB 3LDZE 3R66C 3DBLB 2WXGA 2KWVB 2LMCA 1CQVA 3QC8B 2XK5B 1Z2MA 3H7PA 3QJZA 4WWPA 3EUB2 3HM3A 2D5GA 1PYWD 1ZUD2 4C4VA 1SBBB 3KW5B 3R2TA 2LHEA 2LWPA 3NHEB 4LNNA 1TTNA 4ZOHC 2WX0A 1QKZA 3M95A 5HFYA 4ANXA 4KSLC 1QT9A 2L0FA 1FXTB 3M62B 4M0WA 4AP4C 1SF0A 2KLCA 1VRAB 2MP2A 2R61A 1TS2A 2MJDA 3I9V1 3KQ4A 4PYZA 2JY6A 2YVCA 2N9XA 1RFAA 1WMHA 4LK0M 2Y5PA 2KHWB 1EUVB 1XQQA 3ZNZB 3X23A 2BKFA 3CSTA 1LFDA 4IWOA 2N0SB 2J53A 1OFFA 1FCCC 1QQRA 2L32A 3PT2B 4RGNA 2I1KA 3A4RA 3ZJUA 1TIFA 2J52A 2O6VB 1YQ3B 5EE1A 1NI2A 1C4AA 4FADA 4ZYNA 4OZBA 2G4SA 4JWSC 2H89B 2IGDA 2GOWA 1XEEA 3HUIA 1FNUA 1N62A 4JQWC 4FULA 2GI9A 4M8MA 1UWMA 3KWLA 3I3TB 2BS3B 2E3TA 4DXFA 1WE7A 1ZXIA 3PZDA 4XWWA 2K8BA 1AARA 2W9NA 1F1HA 4OZAA 4KZCA 5J2RA 2JRHA 2KT7A 2B3AA 2V1YA 2VZKB 2AYOB 1J19A 2N1VA 4GIVA 4EOYA 4XDDA 4IM2A 4BOSC 4ARIA 3AB5A 2LGSA 2ZJDA 2ONQA 2GRIA 4FJYA 3B0AA 2KN5A 1P98A 3NZSA 1ZOYB 2INPE 2FCMA 4IG7B 2KWDA 3AEDB 1WJUA 1I42A
chains in the Genus database with same CATH topology
1GUAB 2LXAA 3H1UA 4MGIE 5D6JB 5DPTA 1WGHA 2D10A 2LVPA 3C0RB 2L3ZA 1ZW7A 3D32A 3H7PB 2KX3A 2M1MA 4F1SA 1H8CA 3ZIMA 3BY4B 5JH5C 3ECIA 4HJKA 3VUXA 2G4DB 1C1YB 3KYDD 2Z59B 2LRUA 4LJPB 4GDLA 4XC2A 3RCZA 3ZTDA 5LXIB 1F9JA 4GDKA 3ZDTA 2EKEC 5L95C 3JW0X 3EHVA 1WRDB 4J6IA 2KZRA 2OJRA 3NOBA 3KVFB 2KDIA 2FCNA 5C1ZA 2N1WA 3VXWA 5EDSA 4WJNA 4BBNC 2CS4A 2DYMA 3AULA 4W9KA 3EC8A 1P9DU 2FIFA 2RSUA 3PPAA 4HDOA 4M0WB 3KUDB 2MP2B 4F8CB 2ZCBA 1RRBA 3CF6E 3RUIB 1EF5A 4I6LB 3K9PB 3IHPC 4PS8A 2L00B 2O6VD 1WZ0A 2FUHB 1WXSA 2MW5A 4P7IA 3ZNGC 2C7NB 3K9OB 2DX5B 3RZFA 1WMHB 2BYFA 3A1QA 4KDIC 4HCPB 1WE6A 1D3ZA 3UINB 2K39A 4W9IA 2REXA 3IBEA 4GN1A 3PRPB 3WAOA 3VTUA 3QARA 2L7RA 5KHOA 2UYZB 1KM7A 1V6EA 2PPHA 5AZGA 4ZRIA 3V6CB 1UH6A 2KANA 5CHFA 1OQYA 1E90A 4EEWA 2R2QA 3M3JA 4GSWA 3V6EB 2FCSA 1WI0A 5DPSA 1MG8A 2DENB 2J0MA 5DPWA 3AU4A 3IG3A 1V86A 3QK0A 4GGQA 3VH3B 2DZKA 2K1FA 3MTNB 5AZHA 1ZKHA 1WM3A 4AJWA 2ZZPB 2LRWA 4K7WA 3PHWB 1WF9A 2I1JA 2JVCA 2KJRA 4A20A 2CU1A 3LJ3A 4BKSA 3PVLA 3B08A 2MBHA 2JRIB 5AZFA 2IBIB 2C7HA 3VH4B 5JHBA 1K8RB 3VUWA 2G45B 3ALBA 3QAQA 4HLEA 4K81A 5TR5A 4IWPA 1WM2A 2BF8B 2GBKA 3L08A 3PSEB 3A9KA 1WH3A 1CMXB 3KYCD 2K25A 1TGZB 2CHWA 4RM9A 1IPGA 2PJHA 1Y8RC 2KOXA 3QIJA 5DPRA 1KOTA 3HK0A 4BOZB 3PLUA 2PE6B 4FJZA 1GG3A 2LASA 1H4RA 2QHOA 2CHZA 4PS3A 3WIMA 1ZGUB 2KTFA 2KXJA 3L17A 3JYUA 2EMTA 2NPTA 3A4SC 4W9FA 1YX5B 1XD3B 1E8WA 1WY8A 3QWZB 4FA6A 4K7UA 5CX3A 1WXAA 3L54A 2A5UA 2KC1A 3DOWA 4DDGD 3T8MA 3DCGA 2ZNVC 2DYBA 4G0NB 3V61A 5L83A 3R7QA 3ENEA 4NPNA 1WJNA 3EFUA 2AL3A 4I6NB 2KFKA 2FAZA 1XT9B 2JPHA 2K8CA 3W1SA 3QCAA 5J17A 4KVGB 1LXDA 2GBMA 2D07B 1J0GA 3V62A 2O2VA 2NBWB 2BWFA 3RD2A 1LQBA 4PYUA 4WWNA 2UWQA 5C23A 3APDA 2JF5A 2C60A 3Q3FA 4TQ1A 1WIAA 1TZ1A 2DZJA 2DHZA 2KLGA 3ZTCA 3T9LA 2MSED 4GDLB 2LGYA 1V5TA 2AL6A 3VTVA 4AOFA 3PREA 1E7UA 3PS6A 4GDKB 1OEYA 3OAWA 1E7VA 4TUUA 2JXXA 4CO7A 2R2OA 4MSMB 1WGYA 4KIKB 4MELA 1E8XA 3ZUNA 2KQSA 1E5WA 2IO1B 5E6PA 4KIKA 3TL5A 1OGWA 1YIWA 2L0TA 2XEWA 3APFA 4HDQA 3A9JA 3H7SA 3UF8A 2BYVE 4TV3A 3TMPB 4MJSA 4CYEA 1R4NI 3TBLD 3PV1A 2IYDB 4DHJB 2XK5A 4G50A 2DAJA 3ZRFA 3DBHI 4TKNA 4LDTB 2ZVNA 1UD7A 3DBSA 4KZ0A 2L8JA 1WX7A 3A33B 4RM8A 4XX5A 5IAAC 2HE7A 1YX6B 2L05A 3IVFA 4F7ZA 2C9WB 3DBLI 3A1QB 3DQVA 4JIOU 4A3PA 1KJTA 4DK5A 4AWJA 1WJ6A 2RR9A 2LZ6A 4FLHA 2WX1A 4IC7B 3L13A 4LCDE 4ICUA 3ZNID 4E71A 2KTRA 1WZ3A 5JHAA 3ZNHB 2K8HA 2MLBA 4G11A 4HK2A 4BKTA 1NBFC 1SGHA 2IZVB 2RPQA 2DAFA 4W9LA 2KVRA 3M63B 1WX8A 1V49A 2MQJA 3R3MA 5BO4B 1Z5SB 2N9PC 4EUTA 1E8ZA 1WXMA 2MWSB 2KMAA 3Q3JA 1OTRB 4HVBA 2A4ZA 3ONSA 4WJQA 1WJ4A 1QZEA 4MDKE 4N9F4 4MSQB 2KWUB 2N9EB 2LGDA 2J7QB 3WANA 1LM8B 1WR1A 3GOEA 4DDID 2GBRA 3W1YA 4ZRKA 1KLVA 4DHZE 5AEKB 3L0WB 5KHQA 3N3KB 2KJHB 2C5LC 3CSFA 3P2BA 3WA0A 1GJZA 1C3TA 2Y5BB 5D2MB 2JUOA 2N4FA 3ZO5B 3CMMB 3L10B 4HCNB 2L76A 4W9JA 4GOCA 4W9EA 3PRZA 2LGXA 3U7DA 3OLMD 3UQAA 1UZXB 2DZIA 3A9KB 2J0JA 3DVNU 4KDLB 5J18A 2O6VA 2MBBB 2IO2B 4HXDA 1L7YA 1V2YA 2KWCA 2J0KA 3H9DA 1Q5WB 4EZKA 2KDFB 3WAPA 3TJPA 4A3OA 4ANVA 1A5RA 3HM6X 1V81A 3U30A 4MH0E 1X1MA 1BT0A 3DVGX 4GU2A 4GB9A 2DZMA 3SDLC 1WR6E 2NPTB 2ZVOA 3KH0A 4ICVA 3W1SC 2MBEA 4ZRJA 3UQBA 4JL9A 1EO6A 2NR2A 3JSVA 3TCAA 4IWQA 5IA7A 1NDDA 3V60A 3PHXB 4URKA 1GNUA 4KV2A 4HPLB 4B6WA 4ANWA 2MCNB 4OVUA 2GBJA 2C7MB 2JT4B 2KFKB 4EKUA 4X57B 4PS7A 3DVNV 3U8ZA 4IW0A 1T0YA 2MRPA 4NAWA 5CHWA 3N32A 4IUMB 2O2VB 2KD0A 4W9GA 1OEYJ 3EECA 2ZPYA 3VAWA 3B1LX 1WGRA 2KMCA 2NVUI 3QHTA 4K1RB 3RULA 3ZRCA 3ML8A 2M17A 4AJYB 4G3XB 1JRUA 2ZNVB 4B9KA 2BPSA 3QA8A 4DXAB 3BINA 2EMSA 2KJ6A 1PQSA 3MJWA 3PRMB 4EZLA 3VUYA 1IYFA 2LJ5A 1WXVA 1Q1OA 4MGKE 4DHJD 3GZNI 3VVWB 2NCNA 4RMAA 2IO0B 4GXBA 4LDTD 4NY0A 1WX9A 2JWZA 2LUEA 4FN2A 3VTWA 1P1AA 2MA9B 2V3SA 2FIDA 3MHSD 4II2B 4HWIB 4NJ7A 5GMVA 4DHZB 1HE8A 2M0XA 3ML9A 2BYEA 3VDZA 3R7RA 3NS8A 1G6JA 1SE9A 5LLIA 4BVUC 1P3QU 2D3GA 3KUZA 3A9JB 3LDZE 4BKGA 3R66C 2KC2A 4MJSB 2KWVB 1WGDA 2MX2A 3X0WA 3QC8B 2XK5B 2ASQA 3IFWB 1P0RA 4DWFA 4ASWC 3RYTA 1Z2MA 4BFRA 4II3B 4NQLB 5DCNA 1WYWB 3H7PA 2AEHA 1YJ1A 1YD8U 2LD9A 3QJZA 4WWPA 4MM3A 1VD2A 5JZEB 3HM3A 4FHJA 2HJ8A 3UIOB 3UGBB 4E74A 2JZ3B 2LI5A 3WALA 2GBNA 2Z0DB 2KO3A 3KW5B 4TQ0A 2KTRB 1WGGA 2LWPA 3NHEB 1EF1A 1TTNA 2OOBB 4FHKA 2WX0A 3M95A 4EFOA 1GC7A 1S3SG 1E8YA 2PEAA 4ANXA 1RLFA 4KSLC 2N7DA 3AXCA 3UIPB 3WAMA 2MBQA 4BKSD 5E6OA 3TIXA 1YQBA 2VRRB 2L0FA 1FXTB 2LVQA 3M62B 4JGHB 1I35A 1V5OA 3NZUA 2KLCA 4AP4C 3KUCB 2MP2A 4IM3A 2XBBC 2JY6A 4PYZA 2YVCA 2FNJB 2N9XA 3DBRI 1M94A 1VCBA 4ANUA 2ZEQA 3PTFC 1RFAA 1WMHA 3VQIA 2KHWB 1EUVB 5E6NA 1XQQA 3VHTC 3ZNZB 2G3QB 2V4LA 3X23A 2BKFA 4B95A 4MGYE 3CSTA 3APCA 5FR6A 4LJOB 1LFDA 2D11A 4IWOA 3ZDMC 2K6QA 4AUQC 4GMVA 3DDCB 3ZW3A 4W9HA 3PT2B 2I1KA 3A4RA 1L2NA 2LVOA 2O6VB 2M8SA 2KX0A 1NI2A 4FADA 4CHKA 2M4NA 4HPMB 3N30A 1ISNA 4ZYNA 4BBNF 2WYQA 2BGFA 2K6DB 3L16A 2YLMA 3AU5A 2D2QA 2G4SA 2IY1B 4WJOA 2NBVB 3ZVVA 3PLVA 3ZKJC 2GMIC 2ZCCA 2N7EA 2GOWA 5CHVC 3JSVB 2IO3B 3DVGY 1UBQA 2WDTB 3NY5A 3AI5A 2Z0EB 3SHQA 4MGZE 1SIFA 1TBEA 1J8CA 2DYOA 2KQ7A 4IM0A 3VFKA 4JQWC 4KSKC 2CHXA 1IP9A 2BKRB 2HTHA 2NS5A 4WAAA 2KFJA 4FULA 4W9CA 4M8MA 2HD5B 3O65B 3I3TB 2MBOA 3PGEA 1U4AA 5D94A 4OVVA 4WWOA 2AWTA 1UGMA 5LXHA 1WFYA 1WE7A 1R4MI 1V9JA 3PZDA 4NAWB 4YL8A 2IY0B 3QQ8B 4I6PA 3ZLZA 3OJ4B 3HIZA 2CKHB 2JZZA 2K8BA 1V80A 2BWES 1AARA 2W9NA 3QX1A 1RAXA 2KDBA 2PE9A 4KZCA 2KKCA 4DBGA 4FBJB 5J2RA 2JRHA 2CR5A 2RD0A 4ZDVA 2B3AA 2V1YA 3JVZX 2KK8A 2LXCA 2AYOB 4FJVB 4WJPA 1J19A 1UBIA 2N1VA 2WWZA 4M8NA 2RGFA 1GC6A 4GIVA 4EOYA 3SD5A 5HKHA 4NJ6A 3DPDA 4IM2A 4XZ4A 3RT3B 3S2AA 4BOSC 1Q0WB 1S1QB 3HHMA 5G55A 4K7SA 4E3CA 4W9DA 4NNJB 2KDEB 2ZJDA 4EZJA 5D7GA 4MEMA 3RZWC 4NQKE 4FJYA 5G2NA 3B0AA 4WQOB 2KN5A 3H6NA 5CTRC 1P98A 2ZPNA 3SU8X 3OJ3A 3NZSA 1UELA 2FCMA 2FCQA 2KNBA 4IG7B 4JLCA 2NBUA 1WJUA 1I42A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GUA B;  2LXA A;  3H1U A;  4MGI E;  5D6J B;  5DPT A;  1WGH A;  2D10 A;  2LVP A;  3C0R B;  2L3Z A;  1ZW7 A;  3D32 A;  3H7P B;  2KX3 A;  2M1M A;  4F1S A;  1H8C A;  3ZIM A;  3BY4 B;  5JH5 C;  3ECI A;  4HJK A;  3VUX A;  2G4D B;  1C1Y B;  3KYD D;  2Z59 B;  2LRU A;  4LJP B;  4GDL A;  4XC2 A;  3RCZ A;  3ZTD A;  5LXI B;  1F9J A;  4GDK A;  3ZDT A;  2EKE C;  5L95 C;  3JW0 X;  3EHV A;  1WRD B;  4J6I A;  2KZR A;  2OJR A;  3NOB A;  3KVF B;  2KDI A;  2FCN A;  5C1Z A;  2N1W A;  3VXW A;  5EDS A;  4WJN A;  4BBN C;  2CS4 A;  2DYM A;  3AUL A;  4W9K A;  3EC8 A;  1P9D U;  2FIF A;  2RSU A;  3PPA A;  4HDO A;  4M0W B;  3KUD B;  2MP2 B;  4F8C B;  2ZCB A;  1RRB A;  3CF6 E;  3RUI B;  1EF5 A;  4I6L B;  3K9P B;  3IHP C;  4PS8 A;  2L00 B;  2O6V D;  1WZ0 A;  2FUH B;  1WXS A;  2MW5 A;  4P7I A;  3ZNG C;  2C7N B;  3K9O B;  2DX5 B;  3RZF A;  1WMH B;  2BYF A;  3A1Q A;  4KDI C;  4HCP B;  1WE6 A;  1D3Z A;  3UIN B;  2K39 A;  4W9I A;  2REX A;  3IBE A;  4GN1 A;  3PRP B;  3WAO A;  3VTU A;  3QAR A;  2L7R A;  5KHO A;  2UYZ B;  1KM7 A;  1V6E A;  2PPH A;  5AZG A;  4ZRI A;  3V6C B;  1UH6 A;  2KAN A;  5CHF A;  1OQY A;  1E90 A;  4EEW A;  2R2Q A;  3M3J A;  4GSW A;  3V6E B;  2FCS A;  1WI0 A;  5DPS A;  1MG8 A;  2DEN B;  2J0M A;  5DPW A;  3AU4 A;  3IG3 A;  1V86 A;  3QK0 A;  4GGQ A;  3VH3 B;  2DZK A;  2K1F A;  3MTN B;  5AZH A;  1ZKH A;  1WM3 A;  4AJW A;  2ZZP B;  2LRW A;  4K7W A;  3PHW B;  1WF9 A;  2I1J A;  2JVC A;  2KJR A;  4A20 A;  2CU1 A;  3LJ3 A;  4BKS A;  3PVL A;  3B08 A;  2MBH A;  2JRI B;  5AZF A;  2IBI B;  2C7H A;  3VH4 B;  5JHB A;  1K8R B;  3VUW A;  2G45 B;  3ALB A;  3QAQ A;  4HLE A;  4K81 A;  5TR5 A;  4IWP A;  1WM2 A;  2BF8 B;  2GBK A;  3L08 A;  3PSE B;  3A9K A;  1WH3 A;  1CMX B;  3KYC D;  2K25 A;  1TGZ B;  2CHW A;  4RM9 A;  1IPG A;  2PJH A;  1Y8R C;  2KOX A;  3QIJ A;  5DPR A;  1KOT A;  3HK0 A;  4BOZ B;  3PLU A;  2PE6 B;  4FJZ A;  1GG3 A;  2LAS A;  1H4R A;  2QHO A;  2CHZ A;  4PS3 A;  3WIM A;  1ZGU B;  2KTF A;  2KXJ A;  3L17 A;  3JYU A;  2EMT A;  2NPT A;  3A4S C;  4W9F A;  1YX5 B;  1XD3 B;  1E8W A;  1WY8 A;  3QWZ B;  4FA6 A;  4K7U A;  5CX3 A;  1WXA A;  3L54 A;  2A5U A;  2KC1 A;  3DOW A;  4DDG D;  3T8M A;  3DCG A;  2ZNV C;  2DYB A;  4G0N B;  3V61 A;  5L83 A;  3R7Q A;  3ENE A;  4NPN A;  1WJN A;  3EFU A;  2AL3 A;  4I6N B;  2KFK A;  2FAZ A;  1XT9 B;  2JPH A;  2K8C A;  3W1S A;  3QCA A;  5J17 A;  4KVG B;  1LXD A;  2GBM A;  2D07 B;  1J0G A;  3V62 A;  2O2V A;  2NBW B;  2BWF A;  3RD2 A;  1LQB A;  4PYU A;  4WWN A;  2UWQ A;  5C23 A;  3APD A;  2JF5 A;  2C60 A;  3Q3F A;  4TQ1 A;  1WIA A;  1TZ1 A;  2DZJ A;  2DHZ A;  2KLG A;  3ZTC A;  3T9L A;  2MSE D;  4GDL B;  2LGY A;  1V5T A;  2AL6 A;  3VTV A;  4AOF A;  3PRE A;  1E7U A;  3PS6 A;  4GDK B;  1OEY A;  3OAW A;  1E7V A;  4TUU A;  2JXX A;  4CO7 A;  2R2O A;  4MSM B;  1WGY A;  4KIK B;  4MEL A;  1E8X A;  3ZUN A;  2KQS A;  1E5W A;  2IO1 B;  5E6P A;  4KIK A;  3TL5 A;  1OGW A;  1YIW A;  2L0T A;  2XEW A;  3APF A;  4HDQ A;  3A9J A;  3H7S A;  3UF8 A;  2BYV E;  4TV3 A;  3TMP B;  4MJS A;  4CYE A;  1R4N I;  3TBL D;  3PV1 A;  2IYD B;  4DHJ B;  2XK5 A;  4G50 A;  2DAJ A;  3ZRF A;  3DBH I;  4TKN A;  4LDT B;  2ZVN A;  1UD7 A;  3DBS A;  4KZ0 A;  2L8J A;  1WX7 A;  3A33 B;  4RM8 A;  4XX5 A;  5IAA C;  2HE7 A;  1YX6 B;  2L05 A;  3IVF A;  4F7Z A;  2C9W B;  3DBL I;  3A1Q B;  3DQV A;  4JIO U;  4A3P A;  1KJT A;  4DK5 A;  4AWJ A;  1WJ6 A;  2RR9 A;  2LZ6 A;  4FLH A;  2WX1 A;  4IC7 B;  3L13 A;  4LCD E;  4ICU A;  3ZNI D;  4E71 A;  2KTR A;  1WZ3 A;  5JHA A;  3ZNH B;  2K8H A;  2MLB A;  4G11 A;  4HK2 A;  4BKT A;  1NBF C;  1SGH A;  2IZV B;  2RPQ A;  2DAF A;  4W9L A;  2KVR A;  3M63 B;  1WX8 A;  1V49 A;  2MQJ A;  3R3M A;  5BO4 B;  1Z5S B;  2N9P C;  4EUT A;  1E8Z A;  1WXM A;  2MWS B;  2KMA A;  3Q3J A;  1OTR B;  4HVB A;  2A4Z A;  3ONS A;  4WJQ A;  1WJ4 A;  1QZE A;  4MDK E;  4N9F 4;  4MSQ B;  2KWU B;  2N9E B;  2LGD A;  2J7Q B;  3WAN A;  1LM8 B;  1WR1 A;  3GOE A;  4DDI D;  2GBR A;  3W1Y A;  4ZRK A;  1KLV A;  4DHZ E;  5AEK B;  3L0W B;  5KHQ A;  3N3K B;  2KJH B;  2C5L C;  3CSF A;  3P2B A;  3WA0 A;  1GJZ A;  1C3T A;  2Y5B B;  5D2M B;  2JUO A;  2N4F A;  3ZO5 B;  3CMM B;  3L10 B;  4HCN B;  2L76 A;  4W9J A;  4GOC A;  4W9E A;  3PRZ A;  2LGX A;  3U7D A;  3OLM D;  3UQA A;  1UZX B;  2DZI A;  3A9K B;  2J0J A;  3DVN U;  4KDL B;  5J18 A;  2O6V A;  2MBB B;  2IO2 B;  4HXD A;  1L7Y A;  1V2Y A;  2KWC A;  2J0K A;  3H9D A;  1Q5W B;  4EZK A;  2KDF B;  3WAP A;  3TJP A;  4A3O A;  4ANV A;  1A5R A;  3HM6 X;  1V81 A;  3U30 A;  4MH0 E;  1X1M A;  1BT0 A;  3DVG X;  4GU2 A;  4GB9 A;  2DZM A;  3SDL C;  1WR6 E;  2NPT B;  2ZVO A;  3KH0 A;  4ICV A;  3W1S C;  2MBE A;  4ZRJ A;  3UQB A;  4JL9 A;  1EO6 A;  2NR2 A;  3JSV A;  3TCA A;  4IWQ A;  5IA7 A;  1NDD A;  3V60 A;  3PHX B;  4URK A;  1GNU A;  4KV2 A;  4HPL B;  4B6W A;  4ANW A;  2MCN B;  4OVU A;  2GBJ A;  2C7M B;  2JT4 B;  2KFK B;  4EKU A;  4X57 B;  4PS7 A;  3DVN V;  3U8Z A;  4IW0 A;  1T0Y A;  2MRP A;  4NAW A;  5CHW A;  3N32 A;  4IUM B;  2O2V B;  2KD0 A;  4W9G A;  1OEY J;  3EEC A;  2ZPY A;  3VAW A;  3B1L X;  1WGR A;  2KMC A;  2NVU I;  3QHT A;  4K1R B;  3RUL A;  3ZRC A;  3ML8 A;  2M17 A;  4AJY B;  4G3X B;  1JRU A;  2ZNV B;  4B9K A;  2BPS A;  3QA8 A;  4DXA B;  3BIN A;  2EMS A;  2KJ6 A;  1PQS A;  3MJW A;  3PRM B;  4EZL A;  3VUY A;  1IYF A;  2LJ5 A;  1WXV A;  1Q1O A;  4MGK E;  4DHJ D;  3GZN I;  3VVW B;  2NCN A;  4RMA A;  2IO0 B;  4GXB A;  4LDT D;  4NY0 A;  1WX9 A;  2JWZ A;  2LUE A;  4FN2 A;  3VTW A;  1P1A A;  2MA9 B;  2V3S A;  2FID A;  3MHS D;  4II2 B;  4HWI B;  4NJ7 A;  5GMV A;  4DHZ B;  1HE8 A;  2M0X A;  3ML9 A;  2BYE A;  3VDZ A;  3R7R A;  3NS8 A;  1G6J A;  1SE9 A;  5LLI A;  4BVU C;  1P3Q U;  2D3G A;  3KUZ A;  3A9J B;  3LDZ E;  4BKG A;  3R66 C;  2KC2 A;  4MJS B;  2KWV B;  1WGD A;  2MX2 A;  3X0W A;  3QC8 B;  2XK5 B;  2ASQ A;  3IFW B;  1P0R A;  4DWF A;  4ASW C;  3RYT A;  1Z2M A;  4BFR A;  4II3 B;  4NQL B;  5DCN A;  1WYW B;  3H7P A;  2AEH A;  1YJ1 A;  1YD8 U;  2LD9 A;  3QJZ A;  4WWP A;  4MM3 A;  1VD2 A;  5JZE B;  3HM3 A;  4FHJ A;  2HJ8 A;  3UIO B;  3UGB B;  4E74 A;  2JZ3 B;  2LI5 A;  3WAL A;  2GBN A;  2Z0D B;  2KO3 A;  3KW5 B;  4TQ0 A;  2KTR B;  1WGG A;  2LWP A;  3NHE B;  1EF1 A;  1TTN A;  2OOB B;  4FHK A;  2WX0 A;  3M95 A;  4EFO A;  1GC7 A;  1S3S G;  1E8Y A;  2PEA A;  4ANX A;  1RLF A;  4KSL C;  2N7D A;  3AXC A;  3UIP B;  3WAM A;  2MBQ A;  4BKS D;  5E6O A;  3TIX A;  1YQB A;  2VRR B;  2L0F A;  1FXT B;  2LVQ A;  3M62 B;  4JGH B;  1I35 A;  1V5O A;  3NZU A;  2KLC A;  4AP4 C;  3KUC B;  2MP2 A;  4IM3 A;  2XBB C;  2JY6 A;  4PYZ A;  2YVC A;  2FNJ B;  2N9X A;  3DBR I;  1M94 A;  1VCB A;  4ANU A;  2ZEQ A;  3PTF C;  1RFA A;  1WMH A;  3VQI A;  2KHW B;  1EUV B;  5E6N A;  1XQQ A;  3VHT C;  3ZNZ B;  2G3Q B;  2V4L A;  3X23 A;  2BKF A;  4B95 A;  4MGY E;  3CST A;  3APC A;  5FR6 A;  4LJO B;  1LFD A;  2D11 A;  4IWO A;  3ZDM C;  2K6Q A;  4AUQ C;  4GMV A;  3DDC B;  3ZW3 A;  4W9H A;  3PT2 B;  2I1K A;  3A4R A;  1L2N A;  2LVO A;  2O6V B;  2M8S A;  2KX0 A;  1NI2 A;  4FAD A;  4CHK A;  2M4N A;  4HPM B;  3N30 A;  1ISN A;  4ZYN A;  4BBN F;  2WYQ A;  2BGF A;  2K6D B;  3L16 A;  2YLM A;  3AU5 A;  2D2Q A;  2G4S A;  2IY1 B;  4WJO A;  2NBV B;  3ZVV A;  3PLV A;  3ZKJ C;  2GMI C;  2ZCC A;  2N7E A;  2GOW A;  5CHV C;  3JSV B;  2IO3 B;  3DVG Y;  1UBQ A;  2WDT B;  3NY5 A;  3AI5 A;  2Z0E B;  3SHQ A;  4MGZ E;  1SIF A;  1TBE A;  1J8C A;  2DYO A;  2KQ7 A;  4IM0 A;  3VFK A;  4JQW C;  4KSK C;  2CHX A;  1IP9 A;  2BKR B;  2HTH A;  2NS5 A;  4WAA A;  2KFJ A;  4FUL A;  4W9C A;  4M8M A;  2HD5 B;  3O65 B;  3I3T B;  2MBO A;  3PGE A;  1U4A A;  5D94 A;  4OVV A;  4WWO A;  2AWT A;  1UGM A;  5LXH A;  1WFY A;  1WE7 A;  1R4M I;  1V9J A;  3PZD A;  4NAW B;  4YL8 A;  2IY0 B;  3QQ8 B;  4I6P A;  3ZLZ A;  3OJ4 B;  3HIZ A;  2CKH B;  2JZZ A;  2K8B A;  1V80 A;  2BWE S;  1AAR A;  2W9N A;  3QX1 A;  1RAX A;  2KDB A;  2PE9 A;  4KZC A;  2KKC A;  4DBG A;  4FBJ B;  5J2R A;  2JRH A;  2CR5 A;  2RD0 A;  4ZDV A;  2B3A A;  2V1Y A;  3JVZ X;  2KK8 A;  2LXC A;  2AYO B;  4FJV B;  4WJP A;  1J19 A;  1UBI A;  2N1V A;  2WWZ A;  4M8N A;  2RGF A;  1GC6 A;  4GIV A;  4EOY A;  3SD5 A;  5HKH A;  4NJ6 A;  3DPD A;  4IM2 A;  4XZ4 A;  3RT3 B;  3S2A A;  4BOS C;  1Q0W B;  1S1Q B;  3HHM A;  5G55 A;  4K7S A;  4E3C A;  4W9D A;  4NNJ B;  2KDE B;  2ZJD A;  4EZJ A;  5D7G A;  4MEM A;  3RZW C;  4NQK E;  4FJY A;  5G2N A;  3B0A A;  4WQO B;  2KN5 A;  3H6N A;  5CTR C;  1P98 A;  2ZPN A;  3SU8 X;  3OJ3 A;  3NZS A;  1UEL A;  2FCM A;  2FCQ A;  2KNB A;  4IG7 B;  4JLC A;  2NBU A;  1WJU A;  1I42 A; 
#chains in the Genus database with same CATH topology
 3AE8 B;  1WRI A;  2LVP A;  1ZW7 A;  3TUO A;  2M1M A;  3BY4 B;  1YN4 A;  3KYD D;  2LRU A;  3RCZ A;  1KLG D;  2EKE C;  2WS3 B;  4L23 A;  1WRD B;  3Q3O C;  1MPE A;  1AYF A;  2KDI A;  3MHZ A;  3W9C B;  4WJN A;  2DYM A;  3AUL A;  4A90 A;  1P9D U;  2RSU A;  2SAK A;  4HDO A;  4XWT A;  3KUD B;  1PGX A;  3W5U B;  1TZO A;  3AE1 B;  1EF5 A;  4EE2 A;  4MAC A;  1C79 A;  1WZ0 A;  2FUH B;  1WXS A;  1D5M C;  2JU6 X;  1JCK B;  4OW0 A;  1WE6 A;  2WXH A;  2WXN A;  3UIN B;  4TSS A;  3AE4 B;  1NVI D;  3PRP B;  3VTU A;  4REZ A;  5KHO A;  2CJO A;  2UYZ B;  1V6E A;  2KAN A;  1RWS A;  2AQ2 B;  2WXF A;  2J0M A;  1V86 A;  5AZH A;  1ZKH A;  1FXA A;  2PKO A;  3VRA B;  4A20 A;  1IBX B;  1XXG A;  2CU1 A;  3LJ3 A;  3Q2A C;  3VH4 B;  5AZF A;  1FNW A;  1XF5 L;  4K81 A;  1WM2 A;  2GBK A;  4RNA A;  2LGI A;  1WH3 A;  3AMZ A;  4WWM A;  2PJH A;  5DPR A;  1Y8R C;  1KOT A;  2BS4 B;  3PLU A;  1CZP A;  4RCO A;  1E0Z A;  1RFK A;  4LTU A;  3CWI A;  2D3C A;  2OHF A;  3AE6 B;  3GB1 A;  3U7Z A;  3T8M A;  3U52 E;  1FMA D;  2DBY A;  1VJK A;  1FD6 A;  5J17 A;  1NYQ A;  1LXD A;  3V62 A;  2MH7 A;  2O2V A;  1LQB A;  1C9F A;  1TZ1 A;  2DZJ A;  2H88 B;  2MSE D;  4GDL B;  2G9H D;  4AOF A;  1OEY A;  4TUU A;  1E9M A;  4O1N A;  5T8I A;  4MSM B;  3E9S A;  1TKY A;  1MVK A;  3IT6 B;  5E6P A;  3T3O A;  4US9 A;  2BBC A;  3TL5 A;  2XEW A;  1FIQ A;  3UF8 A;  3MC0 B;  4CYE A;  2JWU A;  4DHJ B;  1D6E C;  1YN3 A;  2JX5 A;  3NVV A;  5IAA C;  1YX6 B;  3I5J C;  5HG2 A;  4PT5 A;  4F7Z A;  1CK1 A;  2C9W B;  3V3X A;  4FLH A;  4ICU A;  3Q8F A;  2KTR A;  1WZ3 A;  3GP7 A;  1SGH A;  3M63 B;  1WX8 A;  4Q2J A;  4EUT A;  5HHD G;  1WXM A;  2KMA A;  2KYW A;  1OTR B;  2A4Z A;  3ONS A;  1QZE A;  3B2F A;  3GOE A;  3L0W B;  3C8Y A;  5D2M B;  4RGT A;  2JUO A;  1E10 A;  3CMM B;  4W9E A;  2OED A;  4J3O D;  2LGX A;  3U7D A;  3AM9 A;  2MHJ A;  3UQA A;  2VH1 A;  4BAX A;  3L4P A;  4KDL B;  3PZ7 A;  3AH7 A;  2YEP F;  1KFY B;  2PVG C;  1VLB A;  2L52 A;  4HXD A;  2KWC A;  1SE2 A;  1HQR D;  3H9D A;  3WAP A;  1PGB A;  3TJP A;  1A5R A;  3DVG X;  1BT0 A;  2DZM A;  4LNK A;  2ZVO A;  3KH0 A;  4WUR A;  4JX1 C;  3W1S C;  1SEB D;  3GE8 C;  4JL9 A;  2NR2 A;  3JSV A;  3RI7 C;  2PW9 A;  1GNU A;  4KV2 A;  4ANW A;  1WYG A;  2EKI A;  2JT4 B;  4WQM A;  1VDV A;  4HPP A;  1T3Q A;  1TKG A;  4B0E A;  3FIL B;  2MRP A;  4NAW A;  5CHW A;  3N32 A;  1B1Z A;  4IUM B;  1I4P A;  3EEC A;  2ZPY A;  3VAW A;  1WGR A;  3ZRC A;  3NVY A;  4AJY B;  2L83 A;  1JRU A;  2ZNV B;  4DXA B;  2JSV X;  1IUE A;  2EMS A;  3BIN A;  3MC8 A;  3MJW A;  3RNG C;  2LJ5 A;  2SEB D;  1Q1O A;  3GZN I;  3Q8C A;  2NCN A;  1DOI A;  2LUE A;  1P1A A;  2V3S A;  3MHS D;  2FID A;  4NAM A;  5GMV A;  3T3N A;  1HE8 A;  3KWV A;  3ML9 A;  2ZW1 A;  3NS8 A;  3AE3 B;  5LLI A;  4UDU C;  3E56 A;  3HVZ A;  1P0R A;  4DWF A;  1UUP A;  4OZC A;  3DWM A;  2LD9 A;  1VD2 A;  4N58 A;  3UIO B;  3UGB B;  2JZ3 B;  2LI5 A;  3P4Q B;  3WAL A;  2KO3 A;  5GXG B;  2K9X A;  1GC7 A;  1S3S G;  1E8Y A;  1RLF A;  1PUT A;  3AXC A;  1QLB B;  1YQB A;  4HKZ E;  4JGH B;  1I35 A;  4AS1 A;  1V5O A;  1ROE A;  1JWB D;  2FNJ B;  1OQR A;  1M94 A;  1TS4 A;  1J7C A;  1HZ6 A;  4YSZ B;  1T0S C;  2QIE B;  3ZDM C;  2D11 A;  2K6Q A;  1YOV B;  3DDC B;  3ZW3 A;  3P4P B;  2HJ1 A;  1KRH A;  2LVO A;  4TMA B;  1FXI A;  3N30 A;  1ISN A;  1JWA D;  4JPS A;  2BGF A;  2K6D B;  3L16 A;  4WJO A;  2NBV B;  3ZVV A;  1I4Q A;  2ZCC A;  4C80 A;  3DVG Y;  3NS1 A;  2Z0E B;  4M01 A;  2DYO A;  3VFK A;  2CHX A;  2BKR B;  2WNM A;  2NS5 A;  2KFJ A;  4W9C A;  3MFG A;  3P4R B;  1GAQ B;  2MBO A;  2QCZ A;  4OVV A;  5FK9 C;  1UGM A;  3NVZ A;  1WFY A;  4RH6 A;  1ENF A;  3QQ8 B;  1QF6 A;  2JZZ A;  2BWE S;  3GZN B;  2KDB A;  2PE9 A;  4QAY A;  2CR5 A;  1I4R A;  2RD0 A;  5H92 C;  2KK8 A;  2LXC A;  4YTM B;  5C3J B;  2WWZ A;  4M8N A;  1GC6 A;  4NJ6 A;  2BTE A;  4XZ4 A;  1V1P A;  3HHM A;  5G55 A;  2KAJ A;  4K7S A;  1XO3 A;  2AX5 A;  2RDG A;  1J7B A;  3RZW C;  4WQO B;  4D2K A;  3SU8 X;  2DNF A;  3OJ3 A;  4M02 A;  1AW7 A;  4P6V F;  1GUA B;  1F2R I;  3H1U A;  5D6J B;  2QEJ C;  2D10 A;  4GLS C;  5TSS A;  3I63 C;  2WU5 B;  2ACZ B;  4MM3 B;  5JH5 C;  1C1Y B;  2Z59 B;  1ZDX A;  4LJP B;  1ESF A;  1JML A;  2V3N A;  3ZTD A;  1TY2 A;  2TSS A;  1F9J A;  2CJN A;  4GDK A;  1EWC A;  3NOB A;  5C1Z A;  2CS4 A;  3NUH B;  4W9K A;  3RNF C;  2Z8L A;  3RPF C;  1RRB A;  1TY0 A;  3CF6 E;  3RUI B;  1FRD A;  3IHP C;  2MW5 A;  2K5P A;  4P7I A;  3ZNG C;  1EU4 A;  3N1Z C;  3RZF A;  2W3R A;  2BYF A;  3A1Q A;  4KDI C;  4HCP B;  1D3Z A;  3W5V B;  2REX A;  3IBE A;  4GN1 A;  2GB1 A;  3WAO A;  1A70 A;  2WP9 B;  2L7R A;  3PZ8 A;  3C19 A;  5IO9 A;  2PPH A;  5AZG A;  3V6C B;  4ZRI A;  1GB4 A;  1T0R C;  1I4X A;  1OQY A;  2R2Q A;  2FCS A;  1WI0 A;  1MG8 A;  3IG3 A;  3VH3 B;  2DZK A;  1QIL A;  3TEW A;  1PGA A;  4AJW A;  3PHW B;  2JVC A;  4BKS A;  2MBH A;  2C7H A;  1K8R B;  3QAQ A;  1ZE3 D;  4HLE A;  4IWP A;  2BF8 B;  4ACF A;  3A9K A;  2RDH A;  2K25 A;  1F2R C;  1YQ4 B;  3QIJ A;  1KTK A;  4OHJ A;  2L1A A;  2PE6 B;  4FJZ A;  1GG3 A;  1H4R A;  1KLU D;  2QHO A;  2CHZ A;  4PS3 A;  3WIM A;  1VZ7 A;  4LNO A;  2EMT A;  3A4S C;  2WXM A;  3RMK C;  1XD3 B;  1E8W A;  3QWZ B;  2FBW B;  4ZYS A;  1JAL A;  3DCG A;  2DYB A;  3V61 A;  1WJN A;  2AL3 A;  1BML C;  3BII D;  1N61 A;  3NRZ A;  4FXC A;  4RGO S;  1VZ8 A;  2BB5 A;  2K8C A;  3QCA A;  3AEE B;  1HTQ A;  1WGK A;  3BVZ A;  2BWF A;  2BYT A;  2N9L A;  3TEZ A;  4HRO A;  4TQ1 A;  3Q3F A;  4K3B A;  3T9L A;  1YMH E;  2AL6 A;  1E7U A;  1WSP A;  1SE3 A;  4NJC A;  1DGJ A;  2KQS A;  4KIK A;  3P1M A;  3BVM A;  2L0T A;  3APF A;  2IND C;  3A9J A;  3H7S A;  1R4N I;  3AN1 A;  3ETR A;  3TBL D;  2IYD B;  1QOA A;  2XK5 A;  2DAJ A;  3ZRF A;  2ZVN A;  2L8J A;  1WX7 A;  4RM8 A;  2HE7 A;  2IPK D;  3IVF A;  1FEH A;  1QOG A;  5IP4 D;  2RR9 A;  2WX1 A;  3URY A;  2KQ4 X;  3RNC C;  4P1C C;  3ZXR A;  2IZV B;  1YNT E;  1BUI C;  2DAF A;  1Z5S B;  1SE4 A;  1L6V A;  2MWS B;  3Q3J A;  3CIR B;  4WJQ A;  4MDK E;  1DOY A;  1LM8 B;  1WR1 A;  2GBR A;  1KLV A;  1XLQ A;  3U4E G;  1L4D B;  1K52 A;  2C5L C;  2KJH B;  3CSF A;  3P2B A;  2N4F A;  4W9J A;  3PRZ A;  2RPV A;  1ACC A;  5J18 A;  2O6V A;  2EEL A;  2V3P A;  5FKA C;  1KF6 B;  2PTL A;  2J0K A;  1Q5W B;  4A3O A;  1V81 A;  2UU7 A;  4GU2 A;  4GB9 A;  1WR6 E;  2NPT B;  4ICV A;  2MBE A;  3AV8 A;  2LHD A;  5IA7 A;  3ABV B;  3V60 A;  4URK A;  4HPL B;  2MCN B;  4OVU A;  2JQR B;  2KFK B;  4XGA B;  4PS7 A;  3U8Z A;  3I57 A;  3RUL A;  4K1R B;  2M17 A;  2WDQ B;  2BPS A;  3QA8 A;  1V8C A;  2KJ6 A;  5BYS A;  2XN9 C;  3VVW B;  4RMA A;  1R4N B;  2Y3A A;  4LDT D;  2KN4 A;  2WDR B;  3Q69 A;  3TEX A;  4NJ7 A;  5IKC M;  4BVU C;  1EWY C;  1E7P B;  4BKG A;  4MJS B;  2J42 A;  3TEY A;  2MX2 A;  2ASQ A;  2WU2 B;  3RYT A;  4C00 A;  3W2D A;  4BFR A;  4NQL B;  1WYW B;  1K50 A;  1NEK B;  1YJ1 A;  3HRD D;  5JZE B;  3U2S C;  2WXL A;  4E74 A;  1T5X D;  1TS5 A;  1WGG A;  4A8X C;  4FHK A;  1FO4 A;  5HI1 A;  4R3D A;  1D5Z C;  3WAM A;  2MBQ A;  4BKS D;  1V97 A;  2ICI A;  2LVQ A;  3RFZ B;  3KUC B;  1QOF A;  1TS3 A;  2I38 A;  4IM3 A;  3BYT B;  4LNF A;  1VCB A;  2YEP B;  3NJT A;  4ANU A;  1AN8 A;  1HA5 A;  3VQI A;  4EZJ A;  4B95 A;  2G3Q B;  4MGY E;  1LO5 D;  3APC A;  5FR6 A;  4LJO B;  4KX6 B;  1SXT A;  4W9H A;  1WWT A;  2LUM A;  4IKG A;  3NVW A;  4CHK A;  4IDI A;  2M4N A;  3R2I A;  4HPM B;  4BBN F;  2WYQ A;  1VZ6 A;  2N7J A;  1J7A A;  3AU5 A;  4XDC A;  2BQQ A;  3PLV A;  2N7E A;  5CHV C;  2D3A A;  3N1Y C;  1C4C A;  4YTP B;  1UBQ A;  2WDT B;  3SHQ A;  4MGZ E;  2E6X A;  1IBX A;  1QOB A;  2WXK A;  1TBE A;  4IM0 A;  2HTH A;  2CU3 A;  1UF0 A;  3IAM 1;  1MHH E;  4ITK A;  1U4A A;  5D94 A;  2WXP A;  4WWO A;  2AWT A;  2QJL A;  3Q8B A;  3BVG A;  4US8 A;  3DHH C;  4YL8 A;  3ZLZ A;  3QX1 A;  1RAX A;  4DBG A;  1CJE A;  1UBI A;  3SFE B;  5HKH A;  3DPD A;  2FE8 A;  4ARC A;  4HKQ A;  3RT3 B;  3S2A A;  1Q0W B;  3DWG C;  1D5X C;  4MEM A;  1ET9 A;  5G2N A;  1I7H A;  2ZPN A;  2NTT A;  2OJW A;  2KNB A;  2MJE A;  4JLC A;  2NBU A;  2LXA A;  1YN5 A;  1IGD A;  2MJ3 A;  5DPT A;  4C7Z A;  1WGH A;  1STE A;  2WXO A;  1SSN A;  2G1E A;  3C0R B;  2L3Z A;  2WGS A;  3H7P B;  1C76 A;  1H8C A;  4F1S A;  3ZIM A;  3ECI A;  1JWU D;  4NZL B;  1GOZ A;  2K0P A;  3VUX A;  1T0Q C;  1JRO A;  4GDL A;  4C4V B;  5LXI B;  3ZDT A;  1E6E B;  2QMT A;  3JW0 X;  3AEC B;  2PIA A;  3EHV A;  2KZR A;  4J6I A;  2FCN A;  1L0X B;  2N1W A;  3VXW A;  1FRR A;  2V4I B;  3EC8 A;  3PPA A;  4M0W B;  2KDM A;  3RNA C;  3ZGZ A;  1TYG B;  3B9J A;  2MP2 B;  3MP9 A;  4I6L B;  2V9H A;  5D3D A;  4PS8 A;  2L00 B;  2O6V D;  3BK1 A;  3Q3N C;  4S17 A;  2PMV A;  2C7N B;  2DX5 B;  1WMH B;  5E6J A;  2WDV B;  3AE5 B;  3UI3 A;  1KM7 A;  3BYY B;  1XLO A;  4RFB A;  5FR3 A;  1E90 A;  4EEW A;  4GSW A;  5EE3 A;  2DEN B;  3VR9 B;  2IGH A;  3MTN B;  1DYQ A;  2DWQ A;  3OG5 A;  2B76 B;  1FM0 D;  3GS2 A;  2ZZP B;  2I1J A;  2BT6 A;  1C77 A;  1M4V A;  3PVL A;  3Q3M C;  2VZK D;  3VUW A;  2X8X X;  2Q5W D;  3EA6 A;  1UWX A;  1VR9 A;  3L08 A;  1CMX B;  2J4X A;  4RM9 A;  1TGZ B;  2CHW A;  2WXJ A;  2AQ3 B;  4BOZ B;  4P1B C;  5BYR A;  1ZGU B;  2KTF A;  2KXJ A;  5BMG A;  3JYU A;  4W9F A;  1WY8 A;  4FA6 A;  4K7U A;  5CX3 A;  3EGR A;  2A5U A;  2KC1 A;  4DDG D;  5L83 A;  4G0N B;  3R7Q A;  3EFU A;  2PLP A;  4N59 A;  4I6N B;  1ZXH A;  2JYE A;  2FAZ A;  3BK2 A;  3FIL A;  1N6Z A;  3W1S A;  4KGS A;  4KVG B;  2D07 B;  1J0G A;  2IDY A;  1XLN A;  4WWN A;  5C23 A;  5BYQ A;  2LJI A;  1XCT L;  1WIA A;  4ZHP A;  4ZHO A;  1N60 A;  3OWE B;  3ZTC A;  3Q8E A;  2K3U A;  3VTV A;  3PRE A;  3DHG C;  3OAW A;  2JXX A;  2R2O A;  4KIK B;  3R8B A;  1E8X A;  4L1B A;  1OGW A;  1YIW A;  2IGG A;  2BYV E;  4TV3 A;  3TMP B;  3PV1 A;  4KGR A;  4G50 A;  1UD7 A;  4KZ0 A;  3A33 B;  4XX5 A;  3H8H A;  2L05 A;  2W3S A;  4USA A;  4JIO U;  2HDE A;  1DOX A;  4DK5 A;  4AWJ A;  2LZ6 A;  4IC7 B;  3ZNI D;  4RF0 A;  3ZNH B;  2K8H A;  4G11 A;  4HK2 A;  1NBF C;  2AQ1 B;  2RPQ A;  2BB6 A;  4W9L A;  1V49 A;  3R3M A;  5BO4 B;  2INC C;  4HVB A;  4N9F 4;  4MSQ B;  2KWU B;  1JRP A;  2N9E B;  2LGD A;  2KAC A;  4DHZ E;  5AEK B;  1XLP A;  5KHQ A;  1ZDV A;  4OVZ A;  3N3K B;  1GJZ A;  1C3T A;  2Y5B B;  3FKY A;  3L10 B;  4HCN B;  2L76 A;  4GOC A;  1XCQ L;  3OLM D;  3NZ3 A;  3EFC A;  2JYT A;  1I4H A;  1L7Y A;  1JW9 D;  2KDF B;  3HM6 X;  1X1M A;  2WXI A;  1PFD A;  4M00 A;  3AEG B;  5MPO A;  4IWQ A;  1ET6 A;  3ZQ4 A;  4L2Y A;  4B6W A;  2C7M B;  4EKU A;  3DVN V;  4IW0 A;  2LEK A;  1HZ5 A;  4YSX B;  2O2V B;  2XNA C;  4PK1 A;  1OEY J;  3B1L X;  2KMC A;  4DQO C;  2BS2 B;  4G3X B;  3HVD A;  1PQS A;  3BWU D;  3PRM B;  3SR6 A;  1EU3 A;  2QSD A;  1WXV A;  4DHJ D;  4KGT A;  1HXY D;  2QDF A;  4GXB A;  4NY0 A;  1WX9 A;  3VTW A;  1P7E A;  4FN2 A;  4DHZ B;  2MA9 B;  3AEF B;  3VDZ A;  3R7R A;  1KH0 A;  2D3G A;  3AE9 B;  3KUZ A;  1EM7 A;  2KC2 A;  2WLB A;  3KLS X;  1WGD A;  3X0W A;  3IFW B;  4ASW C;  2KVZ A;  4II3 B;  2NMQ A;  5DCN A;  1HEZ E;  1UNS A;  2AEH A;  1SJE D;  1YD8 U;  4MT5 A;  3WCQ A;  4YXD B;  4MM3 A;  4KKI A;  4FHJ A;  2HJ8 A;  2ZW0 A;  1TJE A;  2I2Y A;  1SIJ A;  4ZRQ A;  2GBN A;  2Z0D B;  4TQ0 A;  2KTR B;  1EF1 A;  2OOB B;  5G5G A;  4EFO A;  3Q8A A;  3AE7 B;  2PEA A;  1F52 A;  4WAF A;  1PDX A;  3UIP B;  2N7D A;  4HRS A;  5E6O A;  3TIX A;  1N63 A;  2VRR B;  2INN E;  3NZU A;  1C4P A;  2D3B A;  1TKE A;  4A6Q A;  1NEN B;  2XBB C;  2W82 A;  3MJ5 A;  2QIL A;  3DBR I;  1MG4 A;  2ZEQ A;  3PTF C;  1MFW A;  5E6N A;  3VHT C;  2V4L A;  3IT4 B;  2X38 A;  4H2A A;  1MJD A;  4AUQ C;  4GMV A;  1RM6 C;  1L2N A;  1RYJ A;  4JE3 B;  5EE9 A;  2M8S A;  2KX0 A;  4RF1 A;  3P42 A;  3AE2 B;  1GPX A;  2KMM A;  2YLM A;  4WH4 A;  2D2Q A;  2IY1 B;  3ZKJ C;  2GMI C;  3JSV B;  2IO3 B;  3NY5 A;  3AI5 A;  4HEA 1;  1SIF A;  3ZYY X;  1J8C A;  2KQ7 A;  1IP9 A;  4KSK C;  4WAA A;  4XYC A;  2HD5 B;  3O65 B;  1GB1 A;  4DXG A;  3PGE A;  5LXH A;  1R4M I;  1V9J A;  4NAW B;  2IY0 B;  1JWS D;  4I6P A;  4KKJ A;  3OJ4 B;  3HIZ A;  2CKH B;  1V80 A;  2KKC A;  4FBJ B;  3BZD B;  4ZDV A;  3JVZ X;  3VR8 B;  2JZP A;  4FJV B;  4WJP A;  1P7F A;  2RGF A;  3SD5 A;  3LYY A;  1S1Q B;  4E3C A;  4W9D A;  4NNJ B;  2KDE B;  5D7G A;  4NQK E;  3H6N A;  5CTR C;  5BMI A;  2W55 A;  1UEL A;  2FCQ A;  2RDB C;  4JWU C;  1L0V B;  4MGI E;  3ZJT A;  3V05 A;  3D32 A;  1FFU A;  2KX3 A;  1L0Y B;  4HJK A;  2G4D B;  4RGM A;  4XC2 A;  5L95 C;  4YTN B;  1F77 A;  3LB8 C;  2OJR A;  3KVF B;  4A9A A;  3DBR B;  5EDS A;  4BBN C;  3N20 C;  1FNV A;  2FIF A;  1OQQ A;  1LGR A;  4F8C B;  5LNK 1;  3AEA B;  3P63 A;  2ZCB A;  3Q6B A;  3K9P B;  5G5H A;  3J9C A;  5IN7 A;  2QC8 A;  1C78 A;  1Q10 A;  3K9O B;  4AQ7 A;  2M19 A;  2VH2 A;  2RMM A;  1NYR A;  2K39 A;  4W9I A;  2W54 A;  2LFI A;  4C7Y A;  3QAR A;  3GE3 C;  3P4S B;  1UH6 A;  5CHF A;  3M3J A;  3V6E B;  5DPS A;  1N5W A;  5BMH A;  5DPW A;  1ZPS A;  3AU4 A;  3QK0 A;  4GGQ A;  1JQ4 A;  3B2G A;  2K1F A;  1WM3 A;  1FFV A;  1R4M B;  1TT5 B;  2LRW A;  3NG0 A;  4K7W A;  1WF9 A;  3RNB C;  2KJR A;  3LXF A;  3B08 A;  2JRI B;  2IBI B;  5JHB A;  2V0G A;  2G45 B;  3ALB A;  5IOI A;  4LNI A;  5TR5 A;  3PSE B;  3TSS A;  3KYC D;  4YT0 B;  1IPG A;  5D3I B;  2KOX A;  3HK0 A;  1F0Z A;  2FUG 1;  2LAS A;  4P16 A;  4WIP A;  3L17 A;  3RN9 C;  1L6U A;  2NPT A;  5C2T B;  1YX5 B;  4HJG E;  1WXA A;  2M0A A;  2HTM E;  3L54 A;  5EE0 A;  1V1P B;  1YJI A;  3DOW A;  1D4B A;  3IXS A;  2ZNV C;  3ZJV A;  3ENE A;  4NPN A;  2KFK A;  1JWM D;  3PO0 A;  1ZP0 B;  2ON8 A;  2IJ0 A;  1XT9 B;  2JPH A;  3AEB B;  2N9K A;  2GBM A;  3SEB A;  2Y5C A;  2NBW B;  3RD2 A;  4PYU A;  1L5P A;  2UWQ A;  3APD A;  1T6B X;  2JF5 A;  2C60 A;  1AWD A;  2DHZ A;  2KLG A;  1FPY A;  2LGY A;  2BVC A;  1V5T A;  5AUK A;  3PS6 A;  4GDK B;  2WQY B;  1E7V A;  2MEK A;  3DHI C;  4CO7 A;  1WGY A;  4MEL A;  3ZUN A;  1E5W A;  3N9Y C;  4BZA A;  2IO1 B;  4HDQ A;  4MJS A;  1I4G A;  1L4Z B;  3DBH I;  4TKN A;  2JXT A;  4LDT B;  4B0M A;  3DBS A;  2NTS A;  2K22 A;  4S0R A;  3DBL I;  4LLG M;  3A1Q B;  1IGC A;  3DQV A;  4A3P A;  1KJT A;  1YJJ A;  1WJ6 A;  4LCD E;  3L13 A;  4E71 A;  1N5X A;  3IAS 1;  5JHA A;  1K51 A;  2MLB A;  2WXR A;  4XE0 A;  4BKT A;  4ZRP A;  4IOI E;  2KVR A;  1BXT A;  2MQJ A;  3FAH A;  2N9P C;  3VRB B;  1E8Z A;  4YWG G;  1WJ4 A;  3FC4 A;  1FCL A;  2J7Q B;  4YSY B;  3WAN A;  4DDI D;  3W1Y A;  4ZRK A;  1WXQ A;  3WA0 A;  5I4D A;  3Q14 C;  3ZO5 B;  1SB3 C;  2PVO D;  3SFD B;  1UZX B;  2DZI A;  3A9K B;  2J0J A;  3DVN U;  2BW2 A;  2MBB B;  2IO2 B;  5JXV A;  1V2Y A;  1MI0 A;  4N6E B;  2GLS A;  5AUI A;  4EZK A;  4ANV A;  3U30 A;  4MH0 E;  4C56 C;  3SDL C;  1K53 A;  1B9R A;  4ZRJ A;  3UQB A;  1EO6 A;  3TCA A;  3O13 A;  1NDD A;  3PHX B;  1UGJ A;  1SJH D;  1NI3 A;  4A55 A;  2M56 B;  2GBJ A;  3RNE C;  2WXQ A;  4X57 B;  5H8Y E;  1T0Y A;  4CQN A;  1R7S A;  2KD0 A;  1Y56 A;  4W9G A;  2NVU I;  3QHT A;  3ML8 A;  4K3C A;  4B9K A;  3N1X C;  4EZL A;  3VUY A;  1IYF A;  1V1O A;  4MGK E;  1HTO A;  2IO0 B;  4MH8 A;  2JWZ A;  3MC9 A;  4II2 B;  3ZXV A;  4HWI B;  3DBH B;  2M0X A;  2BYE A;  1MHX A;  1G6J A;  1SE9 A;  2DLB A;  2WHI A;  1P3Q U;  3A9J B;  3LDZ E;  3R66 C;  3DBL B;  2WXG A;  2KWV B;  2LMC A;  1CQV A;  3QC8 B;  2XK5 B;  1Z2M A;  3H7P A;  3QJZ A;  4WWP A;  3EUB 2;  3HM3 A;  2D5G A;  1PYW D;  1ZUD 2;  4C4V A;  1SBB B;  3KW5 B;  3R2T A;  2LHE A;  2LWP A;  3NHE B;  4LNN A;  1TTN A;  4ZOH C;  2WX0 A;  1QKZ A;  3M95 A;  5HFY A;  4ANX A;  4KSL C;  1QT9 A;  2L0F A;  1FXT B;  3M62 B;  4M0W A;  4AP4 C;  1SF0 A;  2KLC A;  1VRA B;  2MP2 A;  2R61 A;  1TS2 A;  2MJD A;  3I9V 1;  3KQ4 A;  4PYZ A;  2JY6 A;  2YVC A;  2N9X A;  1RFA A;  1WMH A;  4LK0 M;  2Y5P A;  2KHW B;  1EUV B;  1XQQ A;  3ZNZ B;  3X23 A;  2BKF A;  3CST A;  1LFD A;  4IWO A;  2N0S B;  2J53 A;  1OFF A;  1FCC C;  1QQR A;  2L32 A;  3PT2 B;  4RGN A;  2I1K A;  3A4R A;  3ZJU A;  1TIF A;  2J52 A;  2O6V B;  1YQ3 B;  5EE1 A;  1NI2 A;  1C4A A;  4FAD A;  4ZYN A;  4OZB A;  2G4S A;  4JWS C;  2H89 B;  2IGD A;  2GOW A;  1XEE A;  3HUI A;  1FNU A;  1N62 A;  4JQW C;  4FUL A;  2GI9 A;  4M8M A;  1UWM A;  3KWL A;  3I3T B;  2BS3 B;  2E3T A;  4DXF A;  1WE7 A;  1ZXI A;  3PZD A;  4XWW A;  2K8B A;  1AAR A;  2W9N A;  1F1H A;  4OZA A;  4KZC A;  5J2R A;  2JRH A;  2KT7 A;  2B3A A;  2V1Y A;  2VZK B;  2AYO B;  1J19 A;  2N1V A;  4GIV A;  4EOY A;  4XDD A;  4IM2 A;  4BOS C;  4ARI A;  3AB5 A;  2LGS A;  2ZJD A;  2ONQ A;  2GRI A;  4FJY A;  3B0A A;  2KN5 A;  1P98 A;  3NZS A;  1ZOY B;  2INP E;  2FCM A;  4IG7 B;  2KWD A;  3AED B;  1WJU A;  1I42 A; 
#chains in the Genus database with same CATH homology
 1GUA B;  2LXA A;  3H1U A;  4MGI E;  5D6J B;  5DPT A;  1WGH A;  2D10 A;  2LVP A;  3C0R B;  2L3Z A;  1ZW7 A;  3D32 A;  3H7P B;  2KX3 A;  2M1M A;  4F1S A;  1H8C A;  3ZIM A;  3BY4 B;  5JH5 C;  3ECI A;  4HJK A;  3VUX A;  2G4D B;  1C1Y B;  3KYD D;  2Z59 B;  2LRU A;  4LJP B;  4GDL A;  4XC2 A;  3RCZ A;  3ZTD A;  5LXI B;  1F9J A;  4GDK A;  3ZDT A;  2EKE C;  5L95 C;  3JW0 X;  3EHV A;  1WRD B;  4J6I A;  2KZR A;  2OJR A;  3NOB A;  3KVF B;  2KDI A;  2FCN A;  5C1Z A;  2N1W A;  3VXW A;  5EDS A;  4WJN A;  4BBN C;  2CS4 A;  2DYM A;  3AUL A;  4W9K A;  3EC8 A;  1P9D U;  2FIF A;  2RSU A;  3PPA A;  4HDO A;  4M0W B;  3KUD B;  2MP2 B;  4F8C B;  2ZCB A;  1RRB A;  3CF6 E;  3RUI B;  1EF5 A;  4I6L B;  3K9P B;  3IHP C;  4PS8 A;  2L00 B;  2O6V D;  1WZ0 A;  2FUH B;  1WXS A;  2MW5 A;  4P7I A;  3ZNG C;  2C7N B;  3K9O B;  2DX5 B;  3RZF A;  1WMH B;  2BYF A;  3A1Q A;  4KDI C;  4HCP B;  1WE6 A;  1D3Z A;  3UIN B;  2K39 A;  4W9I A;  2REX A;  3IBE A;  4GN1 A;  3PRP B;  3WAO A;  3VTU A;  3QAR A;  2L7R A;  5KHO A;  2UYZ B;  1KM7 A;  1V6E A;  2PPH A;  5AZG A;  4ZRI A;  3V6C B;  1UH6 A;  2KAN A;  5CHF A;  1OQY A;  1E90 A;  4EEW A;  2R2Q A;  3M3J A;  4GSW A;  3V6E B;  2FCS A;  1WI0 A;  5DPS A;  1MG8 A;  2DEN B;  2J0M A;  5DPW A;  3AU4 A;  3IG3 A;  1V86 A;  3QK0 A;  4GGQ A;  3VH3 B;  2DZK A;  2K1F A;  3MTN B;  5AZH A;  1ZKH A;  1WM3 A;  4AJW A;  2ZZP B;  2LRW A;  4K7W A;  3PHW B;  1WF9 A;  2I1J A;  2JVC A;  2KJR A;  4A20 A;  2CU1 A;  3LJ3 A;  4BKS A;  3PVL A;  3B08 A;  2MBH A;  2JRI B;  5AZF A;  2IBI B;  2C7H A;  3VH4 B;  5JHB A;  1K8R B;  3VUW A;  2G45 B;  3ALB A;  3QAQ A;  4HLE A;  4K81 A;  5TR5 A;  4IWP A;  1WM2 A;  2BF8 B;  2GBK A;  3L08 A;  3PSE B;  3A9K A;  1WH3 A;  1CMX B;  3KYC D;  2K25 A;  1TGZ B;  2CHW A;  4RM9 A;  1IPG A;  2PJH A;  1Y8R C;  2KOX A;  3QIJ A;  5DPR A;  1KOT A;  3HK0 A;  4BOZ B;  3PLU A;  2PE6 B;  4FJZ A;  1GG3 A;  2LAS A;  1H4R A;  2QHO A;  2CHZ A;  4PS3 A;  3WIM A;  1ZGU B;  2KTF A;  2KXJ A;  3L17 A;  3JYU A;  2EMT A;  2NPT A;  3A4S C;  4W9F A;  1YX5 B;  1XD3 B;  1E8W A;  1WY8 A;  3QWZ B;  4FA6 A;  4K7U A;  5CX3 A;  1WXA A;  3L54 A;  2A5U A;  2KC1 A;  3DOW A;  4DDG D;  3T8M A;  3DCG A;  2ZNV C;  2DYB A;  4G0N B;  3V61 A;  5L83 A;  3R7Q A;  3ENE A;  4NPN A;  1WJN A;  3EFU A;  2AL3 A;  4I6N B;  2KFK A;  2FAZ A;  1XT9 B;  2JPH A;  2K8C A;  3W1S A;  3QCA A;  5J17 A;  4KVG B;  1LXD A;  2GBM A;  2D07 B;  1J0G A;  3V62 A;  2O2V A;  2NBW B;  2BWF A;  3RD2 A;  1LQB A;  4PYU A;  4WWN A;  2UWQ A;  5C23 A;  3APD A;  2JF5 A;  2C60 A;  3Q3F A;  4TQ1 A;  1WIA A;  1TZ1 A;  2DZJ A;  2DHZ A;  2KLG A;  3ZTC A;  3T9L A;  2MSE D;  4GDL B;  2LGY A;  1V5T A;  2AL6 A;  3VTV A;  4AOF A;  3PRE A;  1E7U A;  3PS6 A;  4GDK B;  1OEY A;  3OAW A;  1E7V A;  4TUU A;  2JXX A;  4CO7 A;  2R2O A;  4MSM B;  1WGY A;  4KIK B;  4MEL A;  1E8X A;  3ZUN A;  2KQS A;  1E5W A;  2IO1 B;  5E6P A;  4KIK A;  3TL5 A;  1OGW A;  1YIW A;  2L0T A;  2XEW A;  3APF A;  4HDQ A;  3A9J A;  3H7S A;  3UF8 A;  2BYV E;  4TV3 A;  3TMP B;  4MJS A;  4CYE A;  1R4N I;  3TBL D;  3PV1 A;  2IYD B;  4DHJ B;  2XK5 A;  4G50 A;  2DAJ A;  3ZRF A;  3DBH I;  4TKN A;  4LDT B;  2ZVN A;  1UD7 A;  3DBS A;  4KZ0 A;  2L8J A;  1WX7 A;  3A33 B;  4RM8 A;  4XX5 A;  5IAA C;  2HE7 A;  1YX6 B;  2L05 A;  3IVF A;  4F7Z A;  2C9W B;  3DBL I;  3A1Q B;  3DQV A;  4JIO U;  4A3P A;  1KJT A;  4DK5 A;  4AWJ A;  1WJ6 A;  2RR9 A;  2LZ6 A;  4FLH A;  2WX1 A;  4IC7 B;  3L13 A;  4LCD E;  4ICU A;  3ZNI D;  4E71 A;  2KTR A;  1WZ3 A;  5JHA A;  3ZNH B;  2K8H A;  2MLB A;  4G11 A;  4HK2 A;  4BKT A;  1NBF C;  1SGH A;  2IZV B;  2RPQ A;  2DAF A;  4W9L A;  2KVR A;  3M63 B;  1WX8 A;  1V49 A;  2MQJ A;  3R3M A;  5BO4 B;  1Z5S B;  2N9P C;  4EUT A;  1E8Z A;  1WXM A;  2MWS B;  2KMA A;  3Q3J A;  1OTR B;  4HVB A;  2A4Z A;  3ONS A;  4WJQ A;  1WJ4 A;  1QZE A;  4MDK E;  4N9F 4;  4MSQ B;  2KWU B;  2N9E B;  2LGD A;  2J7Q B;  3WAN A;  1LM8 B;  1WR1 A;  3GOE A;  4DDI D;  2GBR A;  3W1Y A;  4ZRK A;  1KLV A;  4DHZ E;  5AEK B;  3L0W B;  5KHQ A;  3N3K B;  2KJH B;  2C5L C;  3CSF A;  3P2B A;  3WA0 A;  1GJZ A;  1C3T A;  2Y5B B;  5D2M B;  2JUO A;  2N4F A;  3ZO5 B;  3CMM B;  3L10 B;  4HCN B;  2L76 A;  4W9J A;  4GOC A;  4W9E A;  3PRZ A;  2LGX A;  3U7D A;  3OLM D;  3UQA A;  1UZX B;  2DZI A;  3A9K B;  2J0J A;  3DVN U;  4KDL B;  5J18 A;  2O6V A;  2MBB B;  2IO2 B;  4HXD A;  1L7Y A;  1V2Y A;  2KWC A;  2J0K A;  3H9D A;  1Q5W B;  4EZK A;  2KDF B;  3WAP A;  3TJP A;  4A3O A;  4ANV A;  1A5R A;  3HM6 X;  1V81 A;  3U30 A;  4MH0 E;  1X1M A;  1BT0 A;  3DVG X;  4GU2 A;  4GB9 A;  2DZM A;  3SDL C;  1WR6 E;  2NPT B;  2ZVO A;  3KH0 A;  4ICV A;  3W1S C;  2MBE A;  4ZRJ A;  3UQB A;  4JL9 A;  1EO6 A;  2NR2 A;  3JSV A;  3TCA A;  4IWQ A;  5IA7 A;  1NDD A;  3V60 A;  3PHX B;  4URK A;  1GNU A;  4KV2 A;  4HPL B;  4B6W A;  4ANW A;  2MCN B;  4OVU A;  2GBJ A;  2C7M B;  2JT4 B;  2KFK B;  4EKU A;  4X57 B;  4PS7 A;  3DVN V;  3U8Z A;  4IW0 A;  1T0Y A;  2MRP A;  4NAW A;  5CHW A;  3N32 A;  4IUM B;  2O2V B;  2KD0 A;  4W9G A;  1OEY J;  3EEC A;  2ZPY A;  3VAW A;  3B1L X;  1WGR A;  2KMC A;  2NVU I;  3QHT A;  4K1R B;  3RUL A;  3ZRC A;  3ML8 A;  2M17 A;  4AJY B;  4G3X B;  1JRU A;  2ZNV B;  4B9K A;  2BPS A;  3QA8 A;  4DXA B;  3BIN A;  2EMS A;  2KJ6 A;  1PQS A;  3MJW A;  3PRM B;  4EZL A;  3VUY A;  1IYF A;  2LJ5 A;  1WXV A;  1Q1O A;  4MGK E;  4DHJ D;  3GZN I;  3VVW B;  2NCN A;  4RMA A;  2IO0 B;  4GXB A;  4LDT D;  4NY0 A;  1WX9 A;  2JWZ A;  2LUE A;  4FN2 A;  3VTW A;  1P1A A;  2MA9 B;  2V3S A;  2FID A;  3MHS D;  4II2 B;  4HWI B;  4NJ7 A;  5GMV A;  4DHZ B;  1HE8 A;  2M0X A;  3ML9 A;  2BYE A;  3VDZ A;  3R7R A;  3NS8 A;  1G6J A;  1SE9 A;  5LLI A;  4BVU C;  1P3Q U;  2D3G A;  3KUZ A;  3A9J B;  3LDZ E;  4BKG A;  3R66 C;  2KC2 A;  4MJS B;  2KWV B;  1WGD A;  2MX2 A;  3X0W A;  3QC8 B;  2XK5 B;  2ASQ A;  3IFW B;  1P0R A;  4DWF A;  4ASW C;  3RYT A;  1Z2M A;  4BFR A;  4II3 B;  4NQL B;  5DCN A;  1WYW B;  3H7P A;  2AEH A;  1YJ1 A;  1YD8 U;  2LD9 A;  3QJZ A;  4WWP A;  4MM3 A;  1VD2 A;  5JZE B;  3HM3 A;  4FHJ A;  2HJ8 A;  3UIO B;  3UGB B;  4E74 A;  2JZ3 B;  2LI5 A;  3WAL A;  2GBN A;  2Z0D B;  2KO3 A;  3KW5 B;  4TQ0 A;  2KTR B;  1WGG A;  2LWP A;  3NHE B;  1EF1 A;  1TTN A;  2OOB B;  4FHK A;  2WX0 A;  3M95 A;  4EFO A;  1GC7 A;  1S3S G;  1E8Y A;  2PEA A;  4ANX A;  1RLF A;  4KSL C;  2N7D A;  3AXC A;  3UIP B;  3WAM A;  2MBQ A;  4BKS D;  5E6O A;  3TIX A;  1YQB A;  2VRR B;  2L0F A;  1FXT B;  2LVQ A;  3M62 B;  4JGH B;  1I35 A;  1V5O A;  3NZU A;  2KLC A;  4AP4 C;  3KUC B;  2MP2 A;  4IM3 A;  2XBB C;  2JY6 A;  4PYZ A;  2YVC A;  2FNJ B;  2N9X A;  3DBR I;  1M94 A;  1VCB A;  4ANU A;  2ZEQ A;  3PTF C;  1RFA A;  1WMH A;  3VQI A;  2KHW B;  1EUV B;  5E6N A;  1XQQ A;  3VHT C;  3ZNZ B;  2G3Q B;  2V4L A;  3X23 A;  2BKF A;  4B95 A;  4MGY E;  3CST A;  3APC A;  5FR6 A;  4LJO B;  1LFD A;  2D11 A;  4IWO A;  3ZDM C;  2K6Q A;  4AUQ C;  4GMV A;  3DDC B;  3ZW3 A;  4W9H A;  3PT2 B;  2I1K A;  3A4R A;  1L2N A;  2LVO A;  2O6V B;  2M8S A;  2KX0 A;  1NI2 A;  4FAD A;  4CHK A;  2M4N A;  4HPM B;  3N30 A;  1ISN A;  4ZYN A;  4BBN F;  2WYQ A;  2BGF A;  2K6D B;  3L16 A;  2YLM A;  3AU5 A;  2D2Q A;  2G4S A;  2IY1 B;  4WJO A;  2NBV B;  3ZVV A;  3PLV A;  3ZKJ C;  2GMI C;  2ZCC A;  2N7E A;  2GOW A;  5CHV C;  3JSV B;  2IO3 B;  3DVG Y;  1UBQ A;  2WDT B;  3NY5 A;  3AI5 A;  2Z0E B;  3SHQ A;  4MGZ E;  1SIF A;  1TBE A;  1J8C A;  2DYO A;  2KQ7 A;  4IM0 A;  3VFK A;  4JQW C;  4KSK C;  2CHX A;  1IP9 A;  2BKR B;  2HTH A;  2NS5 A;  4WAA A;  2KFJ A;  4FUL A;  4W9C A;  4M8M A;  2HD5 B;  3O65 B;  3I3T B;  2MBO A;  3PGE A;  1U4A A;  5D94 A;  4OVV A;  4WWO A;  2AWT A;  1UGM A;  5LXH A;  1WFY A;  1WE7 A;  1R4M I;  1V9J A;  3PZD A;  4NAW B;  4YL8 A;  2IY0 B;  3QQ8 B;  4I6P A;  3ZLZ A;  3OJ4 B;  3HIZ A;  2CKH B;  2JZZ A;  2K8B A;  1V80 A;  2BWE S;  1AAR A;  2W9N A;  3QX1 A;  1RAX A;  2KDB A;  2PE9 A;  4KZC A;  2KKC A;  4DBG A;  4FBJ B;  5J2R A;  2JRH A;  2CR5 A;  2RD0 A;  4ZDV A;  2B3A A;  2V1Y A;  3JVZ X;  2KK8 A;  2LXC A;  2AYO B;  4FJV B;  4WJP A;  1J19 A;  1UBI A;  2N1V A;  2WWZ A;  4M8N A;  2RGF A;  1GC6 A;  4GIV A;  4EOY A;  3SD5 A;  5HKH A;  4NJ6 A;  3DPD A;  4IM2 A;  4XZ4 A;  3RT3 B;  3S2A A;  4BOS C;  1Q0W B;  1S1Q B;  3HHM A;  5G55 A;  4K7S A;  4E3C A;  4W9D A;  4NNJ B;  2KDE B;  2ZJD A;  4EZJ A;  5D7G A;  4MEM A;  3RZW C;  4NQK E;  4FJY A;  5G2N A;  3B0A A;  4WQO B;  2KN5 A;  3H6N A;  5CTR C;  1P98 A;  2ZPN A;  3SU8 X;  3OJ3 A;  3NZS A;  1UEL A;  2FCM A;  2FCQ A;  2KNB A;  4IG7 B;  4JLC A;  2NBU A;  1WJU A;  1I42 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...