2C7HA

Solution nmr structure of the dwnn domain from human rbbp6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GPLGSMSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RETINOBLASTOMA-BINDING PROTEIN 6, ISOFORM 3
publication title Dwnn, a Novel Ubiquitin-Like Domain, Implicates Rbbp6 in Mrna Processing and Ubiquitin-Like Pathways
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin-like protein
total genus 18
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08783 DWNN DWNN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c7hA00
2IO3B 2K25A 2KTRB 2DHZA 3VH3B 4CO7A 3PRMB 1XT9B 2M4NA 3PS6A 4BFRA 3P2BA 3PLUA 4K1RB 3IG3A 1WJ4A 1MG8A 2V3SA 2XEWA 2KX3A 3DOWA 4MJSA 2DZIA 4EUTA 4P7IA 4DDGD 2BWES 4BKSD 2BYVE 1WGDA 2IBIB 1XD3B 1LM8B 2GMIC 2JF5A 2LJ5A 3DQVA 4HCNB 4WJOA 4JL9A 2N7EA 1OEYA 3WAMA 4TUUA 4A3PA 4NAWB 3O65B 4NPNA 1WE7A 2D11A 4NQLB 2BF8B 5DPWA 4E3CA 4TQ1A 3R66C 1BT0A 2L76A 2G4SA 4KSLC 2UYZB 5J2RA 4OVUA 4A3OA 1EO6A 5DPTA 3NOBA 3B0AA 2WWZA 4WQOB 3W1YA 3JW0X 3AXCA 1TBEA 3H6NA 4KVGB 5CHFA 3CF6E 2I1JA 3AU4A 3KUZA 1U4AA 4I6LB 4FADA 4HVBA 2FUHB 3QCAA 1SGHA 4B95A 4EKUA 3V6CB 5KHOA 2N9EB 1WR1A 4N9F4 2IO2B 2LRWA 3HK0A 3VUWA 3QAQA 3DVGX 3ZDTA 4JLCA 4DHJB 5J18A 3TIXA 3K9OB 2G3QB 2MLBA 4MGZE 3DVGY 1NBFC 2JZZA 4ICVA 2CS4A 3SU8X 4G3XB 4E71A 2BYFA 5AEKB 3VTUA 2ZVOA 3HIZA 1WM3A 2L0FA 4W9EA 2ZCBA 3PVLA 2K6DB 4EFOA 5GMVA 2LVPA 2BKFA 2G4DB 3ZRCA 4GXBA 1WGYA 2R2OA 2Z0DB 3OAWA 4EZKA 2C5LC 3ZVVA 2K1FA 3PRPB 4HWIB 3KUDB 2LVOA 1WJ6A 2ZZPB 5CX3A 3W1SA 3VUXA 2J0JA 4MEMA 2GBMA 4MJSB 2DENB 2D3GA 3H7PA 3RZFA 1E8WA 2KC1A 1KOTA 1UELA 3KYDD 1J19A 1GJZA 1EUVB 4FULA 1OQYA 3WANA 4JIOU 2L8JA 2KC2A 1H8CA 4KZCA 2M1MA 3PT2B 1GG3A 3ENEA 2O6VA 2A4ZA 2C60A 4RM9A 5CHWA 1HE8A 1PQSA 2IO0B 2ZJDA 3A1QA 2DX5B 2NR2A 4GB9A 3VTVA 2CHXA 4EZJA 1YJ1A 2YVCA 3H7SA 1SIFA 2V4LA 3R7RA 1RAXA 1V6EA 1WMHA 1P1AA 2YLMA 1C1YB 3OJ3A 1UZXB 2GBKA 2J7QB 3Q3FA 3VUYA 5DCNA 3UINB 5AZFA 4DK5A 5EDSA 1WX8A 2W9NA 4JQWC 1V9JA 5TR5A 2NPTA 3ZIMA 2I1KA 3ML9A 2KFKB 4GIVA 2EKEC 3HHMA 1EF5A 2DZKA 3PHWB 3AULA 2JY6A 4LDTB 1WXMA 2K39A 4G11A 4WAAA 3UGBB 1KJTA 1E8XA 4W9IA 2MW5A 3WALA 3KYCD 4TQ0A 3IFWB 1YD8U 3OJ4B 3ZNZB 4PS7A 4WWOA 1ZKHA 2JPHA 1TTNA 4HPLB 4ZYNA 2QHOA 3DDCB 2HTHA 4GDLB 1UGMA 3EECA 5IA7A 2ZVNA 5C23A 2MQJA 3DBHI 4W9JA 5CTRC 2KN5A 3VHTC 3PREA 3TL5A 2ZPNA 3LDZE 2DZJA 1RRBA 3CMMB 2DZMA 4YL8A 2PE6B 2PJHA 1H4RA 4AUQC 2AEHA 3APDA 2REXA 2KO3A 2FCMA 3CSFA 3TJPA 3IHPC 2KWUB 3HM6X 2KLCA 4IWPA 1E8ZA 2K8HA 1T0YA 4IC7B 3JYUA 1P9DU 4HLEA 1X1MA 2BYEA 2LGDA 1V80A 2GBJA 3JVZX 3M63B 2KZRA 3EC8A 1WE6A 3B08A 1R4MI 4X57B 3KVFB 2ZCCA 3IBEA 2PPHA 2DAFA 1VCBA 2FCQA 3T9LA 1Z5SB 3V62A 3UQAA 1GC6A 2O6VB 4W9GA 4HXDA 2N1VA 2KOXA 3NZUA 1ZW7A 4KV2A 3NHEB 3RT3B 2CR5A 3A1QB 1YX5B 4F1SA 3ZO5B 4NJ6A 5KHQA 1RLFA 1IYFA 4DHJD 2CHWA 2K6QA 2C7HA 2LRUA 1E7UA 3ZKJC 1WMHB 2JUOA 4ANVA 2KMAA 3QX1A 3H1UA 3VH4B 4AWJA 3S2AA 2KQ7A 2ZEQA 4TKNA 2AL3A 4IM3A 5JHAA 2KDIA 4F8CB 4MGKE 4IWQA 5D2MB 2KJ6A 2AWTA 4K7UA 5D6JB 2O2VA 4GMVA 1WIAA 3CSTA 1L2NA 4W9HA 3A4RA 1WGRA 3GZNI 4NY0A 4MH0E 3N32A 4G0NB 3HM3A 2IZVB 3KH0A 3MJWA 5JHBA 2MSED 2ZNVC 3VQIA 2C7NB 4ANWA 2IO1B 4K7WA 2K8CA 1WXSA 5LXIB 3M3JA 2KJRA 3V6EB 4AP4C 4IM2A 4I6NB 4NNJB 2MBBB 3BINA 1FXTB 2B3AA 2N7DA 2WYQA 4ANUA 1V2YA 3ML8A 3QARA 4BOSC 1NI2A 1AARA 3PZDA 3Q3JA 2HE7A 2KDBA 1WR6E 2BPSA 4BVUC 1P0RA 2K8BA 2MX2A 3TBLD 2V1YA 2CKHB 4XC2A 2N1WA 1KLVA 1K8RB 3DCGA 5DPSA 3ZRFA 4BOZB 4URKA 2HJ8A 2MP2A 3V61A 4DBGA 5J17A 1F9JA 4PYZA 1WXVA 4LCDE 4ANXA 2NBWB 3AU5A 3L54A 2KQSA 1D3ZA 4WWPA 2KHWB 2C7MB 4KIKA 4ASWC 4WJNA 4BBNF 3U30A 4DHZE 2ZPYA 3L13A 5FR6A 3T8MA 2FIDA 3DPDA 1A5RA 2XK5A 4FHJA 4IW0A 4AJYB 3VTWA 2N9PC 1LFDA 4GGQA 4CHKA 3X0WA 2EMSA 2GBRA 2KTRA 1WZ0A 2A5UA 2CHZA 2UWQA 4FJYA 4LDTD 3QA8A 4GSWA 1WF9A 3ZDMC 2LZ6A 2MBEA 4J6IA 1IP9A 1I42A 3B1LX 1VD2A 3SDLC 2L05A 2KDEB 2KXJA 2L00B 3APCA 2KLGA 4GU2A 1GC7A 2NBVB 5G2NA 2RD0A 3V60A 2JWZA 1KM7A 2IYDB 2O2VB 1Q0WB 3TMPB 3ALBA 3I3TB 3H9DA 4ZRJA 1M94A 3JSVA 4MM3A 4OVVA 3UF8A 1ISNA 2C9WB 4NJ7A 1YQBA 4W9DA 2KFJA 4EOYA 5G55A 2LVQA 1NDDA 2M8SA 1WH3A 4RM8A 2ASQA 2KD0A 2M17A 3PGEA 3DVNV 2MBHA 4BKSA 4WWNA 1P98A 4FJZA 2FAZA 4GDKA 4WJPA 1E90A 1WI0A 3NZSA 4FBJB 4TV3A 2LGYA 2VRRB 4IUMB 3A9JA 4HDOA 5IAAC 2O6VD 2WX1A 3PLVA 2G45B 4I6PA 3GOEA 2KANA 4M0WB 3QC8B 3A9KA 1WGGA 2KKCA 3L10B 4BKGA 2MP2B 2KX0A 2L3ZA 3DBLI 1SE9A 3WIMA 1WZ3A 3H7PB 3PTFC 3C0RB 1V5TA 4PYUA 3A4SC 3N3KB 4KIKB 4BBNC 1WJNA 2MBOA 4ICUA 1E5WA 3WAOA 1WFYA 1GUAB 1OEYJ 4KZ0A 1UBIA 2D07B 3DBSA 3ZTCA 2AL6A 4GN1A 4M8NA 2BWFA 3A33B 1P3QU 3VAWA 2WX0A 1UD7A 4FN2A 4RMAA 4AJWA 2IY1B 2PE9A 3ZLZA 3ONSA 2DYMA 4ZDVA 1EF1A 5AZHA 4XX5A 3ZW3A 4ZRIA 3BY4B 3ZNHB 2MRPA 5C1ZA 2LI5A 1Y8RC 5D7GA 1WYWB 3OLMD 3ECIA 3VXWA 4GOCA 5JZEB 3LJ3A 3R7QA 2FCSA 1WM2A 2OOBB 5L83A 2AYOB 5DPRA 5JH5C 3NS8A 2NPTB 4MSMB 4MDKE 3JSVB 1V5OA 2JZ3B 2Z59B 4HDQA 4DHZB 3ZNGC 2JT4B 1TZ1A 3UIOB 3VFKA 4BKTA 1GNUA 1TGZB 3QK0A 3VDZA 2KMCA 2L7RA 2D2QA 2RGFA 1XQQA 4HJKA 4HCPB 5L95C 2Y5BB 4LJOB 3QQ8B 4IWOA 3X23A 3RUIB 3L16A 3R3MA 4W9KA 4GDKB 3RULA 3SD5A 2FCNA 1Q5WB 1LQBA 2NVUI 2DYBA 4W9CA 3RCZA 1WGHA 4B9KA 2D10A 2RR9A 1OGWA 2OJRA 4K7SA 3A9JB 5E6OA 2KWCA 3MTNB 1L7YA 2KFKA 2J0MA 3QWZB 1WJUA 3A9KB 1CMXB 4MGIE 2N9XA 1V86A 3IVFA 3U8ZA 2JRHA 3ZNID 3QJZA 2KK8A 3TCAA 3U7DA 2JVCA 1V81A 4MELA 5LLIA 1G6JA 3EHVA 1I35A 4XZ4A 4PS3A 1Z2MA 1WX7A 3PRZA 1YX6B 4DXAB 2NS5A 2L0TA 4GDLA 4DDID 1RFAA 2KVRA 2LXAA 3VVWB 2N4FA 1QZEA 4FA6A 2NBUA 4KDIC 4NQKE 2KWVB 3SHQA 3PV1A 4PS8A 2ZNVB 3KUCB 3N30A 5BO4B 2LASA 3L08A 4CYEA 4MGYE 2J0KA 4HK2A 5D94A 2MCNB 1UBQA 2RPQA 3PPAA 4JGHB 4IM0A 4B6WA 1UH6A 2GBNA 4HPMB 4FLHA 4A20A 5E6PA 1J8CA 5CHVC 3PHXB 4WJQA 2LUEA 1S3SG 3NY5A 5LXHA 4MSQB 1JRUA 1C3TA 2PEAA 2KTFA 1E8YA 3EFUA 2KDFB 2HD5B 4II2B 4NAWA 1J0GA 4W9LA 3RD2A 2MA9B 3D32A 4EEWA 2JRIB 3QHTA 3AI5A 1IPGA 2DYOA 5E6NA 2KJHB 1LXDA 3ZUNA 2BGFA 3KW5B 3W1SC 2FIFA 2MBQA 4FJVB 3UQBA 3K9PB 4LJPB 1ZGUB 3RZWC 3UIPB 3L17A 3L0WB 4FHKA 2LGXA 2JXXA 1S1QB 1V49A 1WXAA 4ZRKA 4DWFA 4G50A 1R4NI 4IG7B 3ZTDA 3PSEB 1WX9A 3QIJA 2MWSB 2BKRB 3MHSD 4F7ZA 3DBRI 5HKHA 2DAJA 1Q1OA 2M0XA 4M8MA 4AOFA 4W9FA 4EZLA 1WRDB 2KNBA 2LXCA 3APFA 1E7VA 2GOWA 3WAPA 3WA0A 2CU1A 2FNJB 2WDTB 1OTRB 1YIWA 4KSKC 2EMTA 2NCNA 2RSUA 2R2QA 2XBBC 2LD9A 2XK5B 2LWPA 3M95A 4KDLB 3DVNU 5AZGA 3RYTA 4E74A 3M62B 4K81A 2IY0B 4II3B 2Z0EB 1WY8A
chains in the Genus database with same CATH superfamily
2IO3B 3W9CB 2DHZA 4CO7A 3RNBC 1C4CA 2K5PA 4K1RB 1MG8A 3DOWA 2BWES 1R7SA 2BYVE 1WGDA 3SFDB 4HCNB 2KWDA 1OEYA 1FFUA 1P7FA 4NAWB 1SBBB 1PGBA 2J4XA 1WE7A 4TQ1A 1T0RC 1BT0A 1L0XB 2D3BA 4KGRA 2UYZB 4OVUA 1EO6A 3B0AA 3AE7B 2WWZA 2ACZB 2M56B 3AXCA 4KVGB 2MEKA 2I1JA 1JWMD 3AU4A 5H92C 1C4PA 4I6LB 2FUHB 4B95A 5KHOA 2LRWA 3DVGX 3ZDTA 2PKOA 2INDC 3BVZA 2G3QB 1NBFC 4ICVA 2CS4A 2BB5A 4E71A 2BYFA 2ZVOA 3HIZA 2L0FA 4W9EA 2N7JA 3ZRCA 3OG5A 2R2OA 1ZUD2 3OAWA 4EZKA 2C5LC 3U52E 3KUDB 1L0YB 1YQ4B 2RDGA 3FKYA 5CX3A 3N1YC 2GBMA 1NEKB 2DENB 1E8WA 2KC1A 1OQYA 4JIOU 2BB6A 1TYGB 3B2GA 2M1MA 3PT2B 1GG3A 3ENEA 2O6VA 2A4ZA 2C60A 4ZRPA 5CHWA 5G5GA 4GLSC 3W5VB 1OQQA 2DX5B 2NR2A 4YWGG 5EE0A 2UU7A 4GB9A 3VTVA 1YJ1A 1P1AA 2L83A 3AEEB 1C1YB 3OJ3A 2PW9A 4DK5A 4US8A 4O1NA 2HJ1A 2W9NA 1ZPSA 2NPTA 1SIJA 1E8XA 1I4PA 3WALA 3IFWB 1TTNA 3Q8BA 3EECA 4XE0A 3DBHI 4W9JA 3VHTC 3PREA 2ZPNA 1EM7A 3LDZE 2DZJA 4YL8A 3ZYYX 1JMLA 1BUIC 2KO3A 4QAYA 3HM6X 4IWPA 2K8HA 1T0YA 4IC7B 4M02A 1P9DU 4HLEA 1X1MA 2LGDA 3JVZX 3B08A 4X57B 3KVFB 2ZCCA 1V1OA 2DAFA 2QEJC 2Y3AA 3AEDB 2N1VA 3FC4A 4KV2A 4LNIA 1FNWA 3RT3B 3SFEB 1E10A 1IYFA 5KHQA 1RLFA 3I57A 2K6QA 1FEHA 3ZKJC 3QX1A 4AWJA 1HQRD 2QMTA 3S2AA 2KQ7A 4REZA 2ZEQA 4TKNA 2AL3A 5JHAA 4F8CB 4AQ7A 1T6BX 1J7BA 1K53A 5D2MB 2KJ6A 5D6JB 1WGRA 3GZNI 4NY0A 4XDCA 5FKAC 3NVVA 1DOIA 3VQIA 1GB4A 4DXGA 2IO1B 4ZRQA 3AEBB 3V6EB 1D5MC 4KGSA 3BINA 1FXTB 1L4ZB 4RGTA 3AN1A 1AARA 2KDBA 4RGOS 2BPSA 4HROA 2MX2A 3HVDA 2LFIA 3NVYA 1YN4A 4PYZA 2WNMA 2NBWB 3AU5A 3L54A 2LEKA 2EELA 1HA5A 3U30A 1ENFA 2JXTA 4HKQA 3MC8A 3DPDA 1A5RA 1EWCA 2SAKA 4FHJA 4GGQA 2EMSA 2GBRA 2UWQA 2CHZA 4J6IA 2L00B 4GU2A 2RD0A 1XLOA 2AQ2B 1Q0WB 1ISNA 2C9WB 2QJLA 2X8XX 3I5JC 4EOYA 4CQNA 3ETRA 1WH3A 4RM8A 4JPSA 3MHZA 4BKSA 2W55A 3RPFC 2D3CA 3IT4B 5BMIA 2QILA 4WJPA 4FBJB 2LHEA 2VRRB 3A9JA 2G9HD 1UUPA 2G45B 4I6PA 2KANA 1I4HA 1WGGA 2KKCA 2MP2B 2L3ZA 1FM0D 2WDQB 2X38A 4PYUA 4KIKB 3WAOA 3R2IA 2D07B 2WXFA 3ZTCA 2AL6A 4KKIA 3Q8EA 3VAWA 4RMAA 1C4AA 2PE9A 3FILA 2DYMA 3NVWA 1QOBA 4XX5A 3ZGZA 1QKZA 5C1ZA 3R7QA 2FCSA 2LMCA 5IO9A 5DPRA 5JH5C 2NPTB 2KDMA 4MSMB 1N60A 1IUEA 4MM3B 4DHZB 3NUHB 2JT4B 2GLSA 3P1MA 3RNGC 2RGFA 2TSSA 4IWOA 2VZKB 1MVKA 3RUIB 1ACCA 4W9KA 4GDKB 1Q5WB 2DYBA 1VR9A 2IDYA 4B9KA 4K7SA 2D5GA 2J0MA 3QWZB 3QJZA 4OVZA 2KK8A 4N59A 2JVCA 4MELA 3EHVA 1I35A 1YX6B 2NS5A 2CJNA 1QZEA 4FA6A 4ZOHC 1ZP0B 2FE8A 4YTPB 3PV1A 4PS8A 2ZNVB 1KF6B 5D94A 4JWSC 1WYGA 4B6WA 2GBNA 2N0SB 1WSPA 1J8CA 3NY5A 4NAWA 3NRZA 4PK1A 4KGTA 3AI5A 1IPGA 5E6NA 1CJEA 4DXFA 1LXDA 4YTNB 4FJVB 3RZWC 1TY2A 4OZBA 3UIPB 3DHIC 4FHKA 2ONQA 4C7ZA 2HTME 1VLBA 4ZRKA 4G50A 1E7PB 1R4NI 4F7ZA 2DAJA 1ZXHA 4IOIE 2YEPF 2Y5CA 4C56C 3WAPA 1WXQA 3EUB2 2CU1A 2QDFA 1ZDVA 2EMTA 2RSUA 1I7HA 3M95A 1Q10A 4KDLB 2BVCA 4W9IA 2RDHA 4NZLB 3VH3B 3NZ3A 1WJ4A 3BK1A 4EUTA 3TEWA 2KX3A 3C8YA 5JXVA 1XD3B 3AE1B 4WJOA 4JL9A 2N7EA 3WAMA 4US9A 1TT5B 2LGIA 1UWMA 4BAXA 1SF0A 4L23A 1SEBD 3T3OA 2L76A 2G4SA 3ZQ4A 2QC8A 4KSLC 5J2RA 5DPTA 1FIQA 2WXNA 3W1YA 3H6NA 5E6JA 1F1HA 4RGMA 4HVBA 4FXCA 1WR1A 3ABVB 4XDDA 3QAQA 4DHJB 3MP9A 3TIXA 4MGZE 1I4QA 3DVGY 2JZZA 1FMAD 2QCZA 2RDBC 1TS5A 3SU8X 3DWGC 2AQ1B 1SJHD 1MI0A 2JU6X 1Y56A 5GMVA 2LVPA 2Z0DB 2WLBA 2ZW0A 3PRPB 1N61A 1JALA 4M0WA 2ZZPB 2BW2A 3W2DA 4LNKA 3VUXA 2J0JA 2D3AA 4MJSB 2BS4B 2GI9A 1ZOYB 3KYDD 1GJZA 3V05A 1EUVB 3GZNB 3WANA 2AX5A 2KC2A 5G5HA 1PQSA 1FXAA 2YVCA 3ZJUA 4RGNA 3AEAB 2YLMA 3NVZA 1SE4A 4NJCA 2GBKA 2J7QB 5DCNA 3UINB 1GOZA 5TR5A 2I1KA 3HHMA 2DZKA 2WDRB 3PHWB 3AULA 4LDTB 1WXMA 4WAAA 3UGBB 2H88B 1KJTA 2MW5A 3KYCD 4TQ0A 1DYQA 4HPLB 1D6EC 1XCQL 2HTHA 1YNTE 3V3XA 4TSSA 5C23A 1NI3A 2KN5A 2Y5PA 3CMMB 2B76B 1IGDA 3H8HA 1V97A 4AUQC 2AEHA 2N9KA 2REXA 3CSFA 3IAM1 1E8ZA 3JYUA 2BYEA 3M63B 1V80A 2GBJA 2WXOA 3GB1A 1VZ8A 4LNFA 3NHEB 1YX5B 4F1SA 2LRUA 1E7UA 2JUOA 3AE8B 5FK9C 2WXPA 2AWTA 3CSTA 2L32A 4MH0E 3NG0A 1TKEA 2NTTA 2XN9C 2ZNVC 4MACA 2C7NB 1SXTA 1N62A 1WXSA 4LLGM 5LXIB 4I6NB 3LXFA 2MBBB 2N7DA 3ML8A 4YXDB 4BOSC 1NI2A 3PZDA 2HE7A 1WR6E 4OZAA 2WDVB 2MP2A 5J17A 1F9JA 4LCDE 4ANXA 2JYEA 1YOVB 4ASWC 4KIKA 1VDVA 4DHZE 2AQ3B 3HUIA 1I4RA 3AV8A 3RNEC 2LHDA 3T8MA 2XK5A 1T0QC 5TSSA 4IW0A 2KAJA 2N9PC 2GB1A 2KN4A 2KTRA 2JSVX 5HKHA 1WZ0A 3ZDMC 4A55A 4GSWA 2J53A 2MBEA 1IP9A 1I42A 3PO0A 4N58A 3B1LX 3SDLC 2L05A 2NBVB 3V60A 2JWZA 2O2VB 3H9DA 4MM3A 4OVVA 2KFJA 2LVQA 3DHHC 2M8SA 2ASQA 2PVOD 4USAA 4GDKA 2JYTA 3O13A 1E90A 1T5XD 1TKYA 1WI0A 2WXQA 4IUMB 1NYQA 1OFFA 2O6VD 3PLVA 4JX1C 4M0WB 1C9FA 3DBLI 2CJOA 1JRPA 3RFZB 5BYSA 1WJNA 1E5WA 1UNSA 2PMVA 4KZ0A 4M8NA 3A33B 2WX0A 4RH6A 2MH7A 2LGSA 3ONSA 4KKJA 4LNOA 3ZW3A 3MFGA 1SE3A 1TKGA 3ZNHB 2PTLA 1CQVA 1R4NB 1Y8RC 5D7GA 2VZKD 3LJ3A 5HFYA 3Q3MC 3NS8A 1KFYB 1FPYA 3JSVB 2JZ3B 3ZNGC 1TZ1A 4BKTA 1GNUA 3RN9C 1HZ6A 2D2QA 5I4DA 4HJKA 2WXHA 3QQ8B 3X23A 4NAMA 2FCNA 4W9CA 1ROEA 1OGWA 2OJRA 1XF5L 5E6OA 2KQ4X 2KWCA 2KFKA 3A9KB 2N9XA 3ZNID 5IKCM 2WXGA 2L0TA 1T3QA 3VVWB 2N4FA 2BT6A 2NBUA 4KDIC 3SHQA 3N30A 1K52A 1DOXA 3L4PA 4HK2A 1F2RC 2MCNB 1UBQA 2RPQA 4L2YA 4XYCA 4A20A 2PLPA 5E6PA 2NTSA 3PHXB 5CHVC 2LUEA 1JRUA 2KTFA 1E8YA 2RPVA 1XLPA 2HD5B 1N6ZA 2MA9B 3OWEB 2JRIB 3QHTA 2DYOA 2KJHB 3GP7A 2IJ0A 3T3NA 3ZUNA 3W1SC 3UQBA 4YTMB 4LJPB 1KLUD 2DWQA 1L4DB 3BIID 3L17A 2LGXA 1AWDA 2QIEB 1S1QB 1WXAA 4M01A 2VH2A 1J7CA 1WX9A 2MWSB 2K3UA 1PGXA 2M0XA 4AOFA 1QOAA 1WGKA 1E7VA 2WDTB 4EE2A 1FCCC 2CU3A 1FD6A 1D5XC 2R2QA 2LD9A 2XK5B 3Q2AC 4M00A 1DOYA 4E74A 3DVNU 4K81A 1PFDA 1WY8A 2K25A 2KTRB 3LYYA 1XT9B 2M4NA 2INPE 3PS6A 2WXKA 3P2BA 4BFRA 3IG3A 2XEWA 4MJSA 4DDGD 4BKSD 2GMIC 2WXLA 3DBRB 4TUUA 4A3PA 1RWSA 3O65B 4NQLB 2BTEA 4ITKA 3R66C 1YN3A 2W3RA 2ICIA 3NOBA 3JW0X 1GAQB 3KUZA 1XXGA 4FADA 3CIRB 3V6CB 2N9EB 4N9F4 1RYJA 2IO2B 2SEBD 3HK0A 3TUOA 2M19A 3VUWA 2EKIA 4JLCA 3U2SC 5J18A 3K9OB 2MLBA 1PYWD 4G3XB 5AEKB 3VTUA 3EFCA 5EE3A 2K0PA 3PVLA 2QSDA 4GXBA 1WGYA 4C80A 2LVOA 1WJ6A 3AM9A 3W1SA 3ZXRA 4P1CC 2HDEA 5LNK1 4RNAA 4D2KA 2D3GA 1KOTA 1UELA 1J19A 3P4SB 4FULA 1QILA 1NVID 1J7AA 4WWMA 2L8JA 4XGAB 4OZCA 1H8CA 4KZCA 3Q8CA 1E6EB 4RM9A 1HE8A 1K51A 2ZJDA 3P42A 4MT5A 1GB1A 4EZJA 3H7SA 2V4LA 3R7RA 1RAXA 3DHGC 1I4XA 3VUYA 3Q3FA 2G1EA 3LB8C 5EE1A 2KFKB 2GRIA 2K39A 4G11A 2V4IB 3GE3C 1P7EA 4WWOA 2JPHA 1AYFA 2WGSA 2JWUA 1VZ6A 1EU4A 2E3TA 5IA7A 1FCLA 1RRBA 1C78A 1CZPA 2PJHA 2FCMA 3TJPA 2KWUB 2V3PA 3GS2A 1KRHA 5IN7A 3EC8A 1WE6A 1NYRA 1R4MI 1QOFA 1TY0A 3IBEA 3V62A 1VCBA 2WXMA 3UQAA 2MHJA 2KOXA 3A1QB 3ZO5B 2CHWA 2C7HA 5HG2A 3DBHB 2WU2B 1WMHB 2KMAA 3H1UA 3VH4B 2L52A 1QT9A 3UI3A 2M0AA 4MGKE 2BYTA 4YSYB 2O2VA 4GMVA 3AEGB 3AH7A 1WIAA 1D5ZC 4W9HA 3A4RA 1CK1A 3DBLB 3MC9A 4S17A 4G0NB 3HM3A 2IGDA 3KH0A 5JHBA 2MSED 4K7WA 1HXYD 2XNAC 2JQRB 3M3JA 2KJRA 1PDXA 4IM2A 4OHJA 1V2YA 1MHHE 1P0RA 2K8BA 4XWWA 2WXRA 4C7YA 2V1YA 1KLVA 2WS3B 4N6EB 5DPSA 3ZRFA 4BOZB 4URKA 2HJ8A 1E0ZA 4RCOA 4DBGA 5IP4D 4P16A 1D3ZA 2C7MB 2KHWB 4A8XC 4WJNA 3SEBA 1HTQA 2ZPYA 3C19A 2PVGC 4YSXB 3L13A 3Q8AA 5FR6A 5BYRA 2OEDA 1TS3A 2FIDA 4AJYB 4RF0A 1LFDA 1L5PA 4CHKA 3BZDB 1C76A 2J42A 4WH4A 1WF9A 2LZ6A 2BS2B 4ZHPA 1VD2A 3AE3B 2KDEB 2KXJA 3APCA 4C00A 2KLGA 3TSSA 5G2NA 1KM7A 2IYDB 3TMPB 3ALBA 5BYQA 4ZRJA 1M94A 3JSVA 3UF8A 4HEA1 4W9DA 1NDDA 1F0ZA 2M17A 2MBHA 5D3IB 1P98A 1VZ7A 4FJZA 1B9RA 1YJIA 2IPKD 3AE2B 4TV3A 2LGYA 1RFKA 3GOEA 3QC8B 3A9KA 5MPOA 2I2YA 1JW9D 3PTFC 1V5TA 3N3KB 1WRIA 2MBOA 3B9JA 4PT5A 1OEYJ 2KACA 3DBSA 1N5WA 1YJJA 1F52A 1UD7A 1TIFA 2W3SA 4FN2A 2I38A 3PZ8A 3W5UB 4AJWA 3ZJVA 3ZLZA 4A9AA 1EF1A 5AZHA 5HI1A 1WYWB 2V3NA 3ECIA 4GOCA 5JZEB 3BVMA 2OOBB 5L83A 3HRDD 2K9XA 1V5OA 2OHFA 4HDQA 4BZAA 3VFKA 3UIOB 5T8IA 3VDZA 1TGZB 4WURA 2KMCA 1K50A 4H2AA 1XQQA 5L95C 1DGJA 2DBYA 3L16A 3RULA 2VH1A 4K3CA 3SD5A 2NVUI 1LQBA 3RCZA 1WGHA 2D10A 1YQ3B 4A90A 3NS1A 3TEZA 3VR8B 2MJDA 4MGIE 3TEXA 1JWBD 3U8ZA 5H8YE 1FRDA 5LLIA 1KTKA 1Z2MA 1LO5D 1EWYC 4DXAB 4DDID 4GDLA 1RFAA 2OJWA 2BS3B 2E6XA 3MC0B 3Q14C 4NQKE 1STEA 2KWVB 4JE3B 3KUCB 5BO4B 2LASA 3L08A 4CYEA 3CWIA 4MGYE 2J0KA 3PPAA 2Z8LA 2Q5WD 4IM0A 1UH6A 2BBCA 4HPMB 3U7ZA 5LXHA 4MSQB 1C3TA 2PEAA 3BYTB 3Q8FA 3EFUA 2KDFB 1AW7A 4II2B 1J0GA 4W9LA 4HKZE 1L0VB 3KLSX 2MJEA 4EEWA 1MG4A 2BGFA 3KW5B 2FIFA 3WCQA 1FFVA 2ON8A 4ACFA 4WQMA 3VRAB 1V49A 4DWFA 4YSZB 3PSEB 1ET6A 1SSNA 1SB3C 2BKRB 3MHSD 1TJEA 4EZLA 4W9FA 3EGRA 1UF0A 1C79A 1JWUD 2GOWA 1E9MA 3WA0A 4HRSA 4L1BA 5AUKA 3ZJTA 5AZGA 3RYTA 4XWTA 4NJ7A 3VRBB 1FRRA 3PRMB 3PLUA 2V3SA 4ZYSA 1TS2A 2DZIA 4P7IA 1RM6C 1JROA 2IBIB 1LM8B 2JF5A 3R8BA 2LJ5A 3DQVA 3NJTA 3J9CA 2N9LA 2KMMA 5GXGB 3KWLA 4NPNA 2D11A 2BF8B 5DPWA 4E3CA 1FO4A 1C77A 2W54A 4A3OA 4WQOB 1TBEA 4LTUA 5CHFA 3CF6E 3DWMA 1IBXB 1U4AA 1TS4A 3QCAA 1SGHA 4P1BC 2ZW1A 4EKUA 2IGGA 3URYA 5EE9A 3RNAC 4B0MA 5AUIA 1R4MB 3AE9B 1KH0A 1WM3A 3BVGA 2ZCBA 2K6DB 4EFOA 2BKFA 2G4DB 2RMMA 1FNUA 3ZVVA 3KWVA 2K1FA 4HWIB 5BMGA 2MJ3A 4MEMA 1F2RI 1V1PA 3H7PA 3RZFA 3I9V1 1L6UA 3Q3NC 2YEPB 2IO0B 3A1QA 3N20C 5D3DA 3HVZA 4KX6B 2LUMA 2CHXA 4P6VF 1SIFA 1JCKB 1V6EA 1WMHA 2WU5B 1BXTA 1UZXB 3Q6BA 5IOIA 1N5XA 3P4QB 5AZFA 5EDSA 1L6VA 1WX8A 4JQWC 1V9JA 3ZIMA 1N63A 2WHIA 3ML9A 4GIVA 1A70A 2EKEC 1EF5A 2JY6A 1YMHE 1YD8U 3OJ4B 3ZNZB 4PS7A 4ARCA 3P4PB 1ZKHA 4ZYNA 2QHOA 3DDCB 4JWUC 4C4VA 3BK2A 4GDLB 1UGMA 2ZVNA 3AB5A 2MQJA 5CTRC 3TL5A 1MJDA 3FAHA 1ZDXA 4K3BA 2DZMA 2PE6B 4HPPA 1H4RA 1JWAD 3APDA 1VJKA 3IHPC 2KLCA 1ET9A 4Q2JA 3PZ7A 2H89B 2KZRA 2V0GA 2PPHA 2FCQA 3T9LA 1Z5SB 1GC6A 2O6VB 4W9GA 4HXDA 1JWSD 3NZUA 2W82A 1B1ZA 1ZW7A 2CR5A 3AE4B 4NJ6A 4DHJD 2JX5A 4WIPA 4ANVA 1QF6A 1OQRA 4IM3A 2KDIA 4IWQA 3AE6B 4K7UA 3RI7C 1XCTL 1L2NA 1FXIA 3RMKC 3N32A 4LK0M 2IZVB 1MFWA 3N1ZC 2KVZA 3MJWA 4ANWA 4HJGE 2WXIA 2K8CA 4YT0B 2WQYB 5BMHA 4AP4C 4NNJB 2B3AA 3AECB 2WYQA 4ANUA 3QARA 3Q3JA 4BVUC 3TBLD 2CKHB 4XC2A 2N1WA 1K8RB 3DCGA 4UDUC 2J52A 3N9YC 3V61A 4TMAB 1WXVA 4RFBA 2KQSA 4WWPA 4BBNF 2NMQA 1ESFA 1ZE3D 1YN5A 1HZ5A 4IDIA 3VTWA 1UWXA 3X0WA 2A5UA 4LDTD 2BQQA 4FJYA 4LNNA 3QA8A 3U4EG 5FR3A 3MJ5A 1GC7A 3B2FA 3IAS1 4DQOC 3I3TB 2FUG1 1YQBA 5G55A 2WP9B 2KD0A 3PGEA 3DVNV 4WWNA 3Q69A 1IGCA 2DLBA 4WAFA 2FAZA 4ARIA 1BMLC 3NZSA 4S0RA 4HDOA 5IAAC 2WX1A 1UGJA 1SE2A 3L10B 4BKGA 2KX0A 1V1PB 4IKGA 1SE9A 1XO3A 3WIMA 1WZ3A 3H7PB 3C0RB 3A4SC 4BBNC 3N1XC 4ICUA 2R61A 1WFYA 1GUAB 1UBIA 4GN1A 2BWFA 1P3QU 1HEZE 1WWTA 2IY1B 4ZDVA 1SJED 4ZRIA 3BY4B 3AMZA 3E56A 2MRPA 2LI5A 1KLGD 2K22A 3OLMD 3VXWA 1EU3A 3KQ4A 1FNVA 1WM2A 2AYOB 3Q3OC 4MDKE 2Z59B 1GPXA 1ZXIA 3QK0A 2L7RA 2INCC 4HCPB 2Y5BB 4LJOB 4C4VB 3VR9B 3R3MA 2RR9A 3EA6A 3A9JB 3MTNB 1L7YA 2IGHA 4A6QA 1WJUA 1CMXB 3RNFC 1V86A 1V8CA 1I4GA 3IVFA 3AEFB 1JQ4A 1M4VA 2JRHA 2L1AA 3TCAA 3U7DA 1V81A 1G6JA 3E9SA 4XZ4A 4PS3A 5C3JB 1WX7A 3I63C 3PRZA 1QQRA 2KVRA 1TZOA 2LXAA 3P4RB 3RNCC 1QOGA 3IXSA 1AN8A 3BWUD 3FILB 1HTOA 2KT7A 4OW0A 4JGHB 3R2TA 5C2TB 1T0SC 4FLHA 4MH8A 3TEYA 3ZXVA 1D4BA 2WXJA 4WJQA 1S3SG 1F77A 2PIAA 3SR6A 4B0EA 1MHXA 2INNE 1LGRA 3RD2A 3D32A 2FBWB 1QLBB 2V9HA 2MBQA 4AS1A 1NENB 1XEEA 3K9PB 1ZGUB 2LJIA 3BYYB 1VRAB 3L0WB 1IBXA 2JXXA 1PGAA 1XLQA 2KYWA 3IT6B 4IG7B 3ZTDA 3QIJA 1PUTA 3DBRI 1Q1OA 4M8MA 4RF1A 1WRDB 2KNBA 2LXCA 3AE5B 3APFA 3GE8C 4ZHOA 1MPEA 3P63A 2FNJB 1OTRB 1YIWA 4J3OD 4KSKC 2NCNA 4R3DA 2XBBC 2DNFA 2LWPA 5HHDG 1XLNA 3M62B 2IY0B 4II3B 2Z0EB 2JZPA
chains in the Genus database with same CATH topology
2IO3B 2K25A 2KTRB 2DHZA 3VH3B 4CO7A 3PRMB 1XT9B 2M4NA 3PS6A 4BFRA 3P2BA 3PLUA 4K1RB 3IG3A 1WJ4A 1MG8A 2V3SA 2XEWA 2KX3A 3DOWA 4MJSA 2DZIA 4EUTA 4P7IA 4DDGD 2BWES 4BKSD 2BYVE 1WGDA 2IBIB 1XD3B 1LM8B 2GMIC 2JF5A 2LJ5A 3DQVA 4HCNB 4WJOA 4JL9A 2N7EA 1OEYA 3WAMA 4TUUA 4A3PA 4NAWB 3O65B 4NPNA 1WE7A 2D11A 4NQLB 2BF8B 5DPWA 4E3CA 4TQ1A 3R66C 1BT0A 2L76A 2G4SA 4KSLC 2UYZB 5J2RA 4OVUA 4A3OA 1EO6A 5DPTA 3NOBA 3B0AA 2WWZA 4WQOB 3W1YA 3JW0X 3AXCA 1TBEA 3H6NA 4KVGB 5CHFA 3CF6E 2I1JA 3AU4A 3KUZA 1U4AA 4I6LB 4FADA 4HVBA 2FUHB 3QCAA 1SGHA 4B95A 4EKUA 3V6CB 5KHOA 2N9EB 1WR1A 4N9F4 2IO2B 2LRWA 3HK0A 3VUWA 3QAQA 3DVGX 3ZDTA 4JLCA 4DHJB 5J18A 3TIXA 3K9OB 2G3QB 2MLBA 4MGZE 3DVGY 1NBFC 2JZZA 4ICVA 2CS4A 3SU8X 4G3XB 4E71A 2BYFA 5AEKB 3VTUA 2ZVOA 3HIZA 1WM3A 2L0FA 4W9EA 2ZCBA 3PVLA 2K6DB 4EFOA 5GMVA 2LVPA 2BKFA 2G4DB 3ZRCA 4GXBA 1WGYA 2R2OA 2Z0DB 3OAWA 4EZKA 2C5LC 3ZVVA 2K1FA 3PRPB 4HWIB 3KUDB 2LVOA 1WJ6A 2ZZPB 5CX3A 3W1SA 3VUXA 2J0JA 4MEMA 2GBMA 4MJSB 2DENB 2D3GA 3H7PA 3RZFA 1E8WA 2KC1A 1KOTA 1UELA 3KYDD 1J19A 1GJZA 1EUVB 4FULA 1OQYA 3WANA 4JIOU 2L8JA 2KC2A 1H8CA 4KZCA 2M1MA 3PT2B 1GG3A 3ENEA 2O6VA 2A4ZA 2C60A 4RM9A 5CHWA 1HE8A 1PQSA 2IO0B 2ZJDA 3A1QA 2DX5B 2NR2A 4GB9A 3VTVA 2CHXA 4EZJA 1YJ1A 2YVCA 3H7SA 1SIFA 2V4LA 3R7RA 1RAXA 1V6EA 1WMHA 1P1AA 2YLMA 1C1YB 3OJ3A 1UZXB 2GBKA 2J7QB 3Q3FA 3VUYA 5DCNA 3UINB 5AZFA 4DK5A 5EDSA 1WX8A 2W9NA 4JQWC 1V9JA 5TR5A 2NPTA 3ZIMA 2I1KA 3ML9A 2KFKB 4GIVA 2EKEC 3HHMA 1EF5A 2DZKA 3PHWB 3AULA 2JY6A 4LDTB 1WXMA 2K39A 4G11A 4WAAA 3UGBB 1KJTA 1E8XA 4W9IA 2MW5A 3WALA 3KYCD 4TQ0A 3IFWB 1YD8U 3OJ4B 3ZNZB 4PS7A 4WWOA 1ZKHA 2JPHA 1TTNA 4HPLB 4ZYNA 2QHOA 3DDCB 2HTHA 4GDLB 1UGMA 3EECA 5IA7A 2ZVNA 5C23A 2MQJA 3DBHI 4W9JA 5CTRC 2KN5A 3VHTC 3PREA 3TL5A 2ZPNA 3LDZE 2DZJA 1RRBA 3CMMB 2DZMA 4YL8A 2PE6B 2PJHA 1H4RA 4AUQC 2AEHA 3APDA 2REXA 2KO3A 2FCMA 3CSFA 3TJPA 3IHPC 2KWUB 3HM6X 2KLCA 4IWPA 1E8ZA 2K8HA 1T0YA 4IC7B 3JYUA 1P9DU 4HLEA 1X1MA 2BYEA 2LGDA 1V80A 2GBJA 3JVZX 3M63B 2KZRA 3EC8A 1WE6A 3B08A 1R4MI 4X57B 3KVFB 2ZCCA 3IBEA 2PPHA 2DAFA 1VCBA 2FCQA 3T9LA 1Z5SB 3V62A 3UQAA 1GC6A 2O6VB 4W9GA 4HXDA 2N1VA 2KOXA 3NZUA 1ZW7A 4KV2A 3NHEB 3RT3B 2CR5A 3A1QB 1YX5B 4F1SA 3ZO5B 4NJ6A 5KHQA 1RLFA 1IYFA 4DHJD 2CHWA 2K6QA 2C7HA 2LRUA 1E7UA 3ZKJC 1WMHB 2JUOA 4ANVA 2KMAA 3QX1A 3H1UA 3VH4B 4AWJA 3S2AA 2KQ7A 2ZEQA 4TKNA 2AL3A 4IM3A 5JHAA 2KDIA 4F8CB 4MGKE 4IWQA 5D2MB 2KJ6A 2AWTA 4K7UA 5D6JB 2O2VA 4GMVA 1WIAA 3CSTA 1L2NA 4W9HA 3A4RA 1WGRA 3GZNI 4NY0A 4MH0E 3N32A 4G0NB 3HM3A 2IZVB 3KH0A 3MJWA 5JHBA 2MSED 2ZNVC 3VQIA 2C7NB 4ANWA 2IO1B 4K7WA 2K8CA 1WXSA 5LXIB 3M3JA 2KJRA 3V6EB 4AP4C 4IM2A 4I6NB 4NNJB 2MBBB 3BINA 1FXTB 2B3AA 2N7DA 2WYQA 4ANUA 1V2YA 3ML8A 3QARA 4BOSC 1NI2A 1AARA 3PZDA 3Q3JA 2HE7A 2KDBA 1WR6E 2BPSA 4BVUC 1P0RA 2K8BA 2MX2A 3TBLD 2V1YA 2CKHB 4XC2A 2N1WA 1KLVA 1K8RB 3DCGA 5DPSA 3ZRFA 4BOZB 4URKA 2HJ8A 2MP2A 3V61A 4DBGA 5J17A 1F9JA 4PYZA 1WXVA 4LCDE 4ANXA 2NBWB 3AU5A 3L54A 2KQSA 1D3ZA 4WWPA 2KHWB 2C7MB 4KIKA 4ASWC 4WJNA 4BBNF 3U30A 4DHZE 2ZPYA 3L13A 5FR6A 3T8MA 2FIDA 3DPDA 1A5RA 2XK5A 4FHJA 4IW0A 4AJYB 3VTWA 2N9PC 1LFDA 4GGQA 4CHKA 3X0WA 2EMSA 2GBRA 2KTRA 1WZ0A 2A5UA 2CHZA 2UWQA 4FJYA 4LDTD 3QA8A 4GSWA 1WF9A 3ZDMC 2LZ6A 2MBEA 4J6IA 1IP9A 1I42A 3B1LX 1VD2A 3SDLC 2L05A 2KDEB 2KXJA 2L00B 3APCA 2KLGA 4GU2A 1GC7A 2NBVB 5G2NA 2RD0A 3V60A 2JWZA 1KM7A 2IYDB 2O2VB 1Q0WB 3TMPB 3ALBA 3I3TB 3H9DA 4ZRJA 1M94A 3JSVA 4MM3A 4OVVA 3UF8A 1ISNA 2C9WB 4NJ7A 1YQBA 4W9DA 2KFJA 4EOYA 5G55A 2LVQA 1NDDA 2M8SA 1WH3A 4RM8A 2ASQA 2KD0A 2M17A 3PGEA 3DVNV 2MBHA 4BKSA 4WWNA 1P98A 4FJZA 2FAZA 4GDKA 4WJPA 1E90A 1WI0A 3NZSA 4FBJB 4TV3A 2LGYA 2VRRB 4IUMB 3A9JA 4HDOA 5IAAC 2O6VD 2WX1A 3PLVA 2G45B 4I6PA 3GOEA 2KANA 4M0WB 3QC8B 3A9KA 1WGGA 2KKCA 3L10B 4BKGA 2MP2B 2KX0A 2L3ZA 3DBLI 1SE9A 3WIMA 1WZ3A 3H7PB 3PTFC 3C0RB 1V5TA 4PYUA 3A4SC 3N3KB 4KIKB 4BBNC 1WJNA 2MBOA 4ICUA 1E5WA 3WAOA 1WFYA 1GUAB 1OEYJ 4KZ0A 1UBIA 2D07B 3DBSA 3ZTCA 2AL6A 4GN1A 4M8NA 2BWFA 3A33B 1P3QU 3VAWA 2WX0A 1UD7A 4FN2A 4RMAA 4AJWA 2IY1B 2PE9A 3ZLZA 3ONSA 2DYMA 4ZDVA 1EF1A 5AZHA 4XX5A 3ZW3A 4ZRIA 3BY4B 3ZNHB 2MRPA 5C1ZA 2LI5A 1Y8RC 5D7GA 1WYWB 3OLMD 3ECIA 3VXWA 4GOCA 5JZEB 3LJ3A 3R7QA 2FCSA 1WM2A 2OOBB 5L83A 2AYOB 5DPRA 5JH5C 3NS8A 2NPTB 4MSMB 4MDKE 3JSVB 1V5OA 2JZ3B 2Z59B 4HDQA 4DHZB 3ZNGC 2JT4B 1TZ1A 3UIOB 3VFKA 4BKTA 1GNUA 1TGZB 3QK0A 3VDZA 2KMCA 2L7RA 2D2QA 2RGFA 1XQQA 4HJKA 4HCPB 5L95C 2Y5BB 4LJOB 3QQ8B 4IWOA 3X23A 3RUIB 3L16A 3R3MA 4W9KA 4GDKB 3RULA 3SD5A 2FCNA 1Q5WB 1LQBA 2NVUI 2DYBA 4W9CA 3RCZA 1WGHA 4B9KA 2D10A 2RR9A 1OGWA 2OJRA 4K7SA 3A9JB 5E6OA 2KWCA 3MTNB 1L7YA 2KFKA 2J0MA 3QWZB 1WJUA 3A9KB 1CMXB 4MGIE 2N9XA 1V86A 3IVFA 3U8ZA 2JRHA 3ZNID 3QJZA 2KK8A 3TCAA 3U7DA 2JVCA 1V81A 4MELA 5LLIA 1G6JA 3EHVA 1I35A 4XZ4A 4PS3A 1Z2MA 1WX7A 3PRZA 1YX6B 4DXAB 2NS5A 2L0TA 4GDLA 4DDID 1RFAA 2KVRA 2LXAA 3VVWB 2N4FA 1QZEA 4FA6A 2NBUA 4KDIC 4NQKE 2KWVB 3SHQA 3PV1A 4PS8A 2ZNVB 3KUCB 3N30A 5BO4B 2LASA 3L08A 4CYEA 4MGYE 2J0KA 4HK2A 5D94A 2MCNB 1UBQA 2RPQA 3PPAA 4JGHB 4IM0A 4B6WA 1UH6A 2GBNA 4HPMB 4FLHA 4A20A 5E6PA 1J8CA 5CHVC 3PHXB 4WJQA 2LUEA 1S3SG 3NY5A 5LXHA 4MSQB 1JRUA 1C3TA 2PEAA 2KTFA 1E8YA 3EFUA 2KDFB 2HD5B 4II2B 4NAWA 1J0GA 4W9LA 3RD2A 2MA9B 3D32A 4EEWA 2JRIB 3QHTA 3AI5A 1IPGA 2DYOA 5E6NA 2KJHB 1LXDA 3ZUNA 2BGFA 3KW5B 3W1SC 2FIFA 2MBQA 4FJVB 3UQBA 3K9PB 4LJPB 1ZGUB 3RZWC 3UIPB 3L17A 3L0WB 4FHKA 2LGXA 2JXXA 1S1QB 1V49A 1WXAA 4ZRKA 4DWFA 4G50A 1R4NI 4IG7B 3ZTDA 3PSEB 1WX9A 3QIJA 2MWSB 2BKRB 3MHSD 4F7ZA 3DBRI 5HKHA 2DAJA 1Q1OA 2M0XA 4M8MA 4AOFA 4W9FA 4EZLA 1WRDB 2KNBA 2LXCA 3APFA 1E7VA 2GOWA 3WAPA 3WA0A 2CU1A 2FNJB 2WDTB 1OTRB 1YIWA 4KSKC 2EMTA 2NCNA 2RSUA 2R2QA 2XBBC 2LD9A 2XK5B 2LWPA 3M95A 4KDLB 3DVNU 5AZGA 3RYTA 4E74A 3M62B 4K81A 2IY0B 4II3B 2Z0EB 1WY8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IO3 B;  2K25 A;  2KTR B;  2DHZ A;  3VH3 B;  4CO7 A;  3PRM B;  1XT9 B;  2M4N A;  3PS6 A;  4BFR A;  3P2B A;  3PLU A;  4K1R B;  3IG3 A;  1WJ4 A;  1MG8 A;  2V3S A;  2XEW A;  2KX3 A;  3DOW A;  4MJS A;  2DZI A;  4EUT A;  4P7I A;  4DDG D;  2BWE S;  4BKS D;  2BYV E;  1WGD A;  2IBI B;  1XD3 B;  1LM8 B;  2GMI C;  2JF5 A;  2LJ5 A;  3DQV A;  4HCN B;  4WJO A;  4JL9 A;  2N7E A;  1OEY A;  3WAM A;  4TUU A;  4A3P A;  4NAW B;  3O65 B;  4NPN A;  1WE7 A;  2D11 A;  4NQL B;  2BF8 B;  5DPW A;  4E3C A;  4TQ1 A;  3R66 C;  1BT0 A;  2L76 A;  2G4S A;  4KSL C;  2UYZ B;  5J2R A;  4OVU A;  4A3O A;  1EO6 A;  5DPT A;  3NOB A;  3B0A A;  2WWZ A;  4WQO B;  3W1Y A;  3JW0 X;  3AXC A;  1TBE A;  3H6N A;  4KVG B;  5CHF A;  3CF6 E;  2I1J A;  3AU4 A;  3KUZ A;  1U4A A;  4I6L B;  4FAD A;  4HVB A;  2FUH B;  3QCA A;  1SGH A;  4B95 A;  4EKU A;  3V6C B;  5KHO A;  2N9E B;  1WR1 A;  4N9F 4;  2IO2 B;  2LRW A;  3HK0 A;  3VUW A;  3QAQ A;  3DVG X;  3ZDT A;  4JLC A;  4DHJ B;  5J18 A;  3TIX A;  3K9O B;  2G3Q B;  2MLB A;  4MGZ E;  3DVG Y;  1NBF C;  2JZZ A;  4ICV A;  2CS4 A;  3SU8 X;  4G3X B;  4E71 A;  2BYF A;  5AEK B;  3VTU A;  2ZVO A;  3HIZ A;  1WM3 A;  2L0F A;  4W9E A;  2ZCB A;  3PVL A;  2K6D B;  4EFO A;  5GMV A;  2LVP A;  2BKF A;  2G4D B;  3ZRC A;  4GXB A;  1WGY A;  2R2O A;  2Z0D B;  3OAW A;  4EZK A;  2C5L C;  3ZVV A;  2K1F A;  3PRP B;  4HWI B;  3KUD B;  2LVO A;  1WJ6 A;  2ZZP B;  5CX3 A;  3W1S A;  3VUX A;  2J0J A;  4MEM A;  2GBM A;  4MJS B;  2DEN B;  2D3G A;  3H7P A;  3RZF A;  1E8W A;  2KC1 A;  1KOT A;  1UEL A;  3KYD D;  1J19 A;  1GJZ A;  1EUV B;  4FUL A;  1OQY A;  3WAN A;  4JIO U;  2L8J A;  2KC2 A;  1H8C A;  4KZC A;  2M1M A;  3PT2 B;  1GG3 A;  3ENE A;  2O6V A;  2A4Z A;  2C60 A;  4RM9 A;  5CHW A;  1HE8 A;  1PQS A;  2IO0 B;  2ZJD A;  3A1Q A;  2DX5 B;  2NR2 A;  4GB9 A;  3VTV A;  2CHX A;  4EZJ A;  1YJ1 A;  2YVC A;  3H7S A;  1SIF A;  2V4L A;  3R7R A;  1RAX A;  1V6E A;  1WMH A;  1P1A A;  2YLM A;  1C1Y B;  3OJ3 A;  1UZX B;  2GBK A;  2J7Q B;  3Q3F A;  3VUY A;  5DCN A;  3UIN B;  5AZF A;  4DK5 A;  5EDS A;  1WX8 A;  2W9N A;  4JQW C;  1V9J A;  5TR5 A;  2NPT A;  3ZIM A;  2I1K A;  3ML9 A;  2KFK B;  4GIV A;  2EKE C;  3HHM A;  1EF5 A;  2DZK A;  3PHW B;  3AUL A;  2JY6 A;  4LDT B;  1WXM A;  2K39 A;  4G11 A;  4WAA A;  3UGB B;  1KJT A;  1E8X A;  4W9I A;  2MW5 A;  3WAL A;  3KYC D;  4TQ0 A;  3IFW B;  1YD8 U;  3OJ4 B;  3ZNZ B;  4PS7 A;  4WWO A;  1ZKH A;  2JPH A;  1TTN A;  4HPL B;  4ZYN A;  2QHO A;  3DDC B;  2HTH A;  4GDL B;  1UGM A;  3EEC A;  5IA7 A;  2ZVN A;  5C23 A;  2MQJ A;  3DBH I;  4W9J A;  5CTR C;  2KN5 A;  3VHT C;  3PRE A;  3TL5 A;  2ZPN A;  3LDZ E;  2DZJ A;  1RRB A;  3CMM B;  2DZM A;  4YL8 A;  2PE6 B;  2PJH A;  1H4R A;  4AUQ C;  2AEH A;  3APD A;  2REX A;  2KO3 A;  2FCM A;  3CSF A;  3TJP A;  3IHP C;  2KWU B;  3HM6 X;  2KLC A;  4IWP A;  1E8Z A;  2K8H A;  1T0Y A;  4IC7 B;  3JYU A;  1P9D U;  4HLE A;  1X1M A;  2BYE A;  2LGD A;  1V80 A;  2GBJ A;  3JVZ X;  3M63 B;  2KZR A;  3EC8 A;  1WE6 A;  3B08 A;  1R4M I;  4X57 B;  3KVF B;  2ZCC A;  3IBE A;  2PPH A;  2DAF A;  1VCB A;  2FCQ A;  3T9L A;  1Z5S B;  3V62 A;  3UQA A;  1GC6 A;  2O6V B;  4W9G A;  4HXD A;  2N1V A;  2KOX A;  3NZU A;  1ZW7 A;  4KV2 A;  3NHE B;  3RT3 B;  2CR5 A;  3A1Q B;  1YX5 B;  4F1S A;  3ZO5 B;  4NJ6 A;  5KHQ A;  1RLF A;  1IYF A;  4DHJ D;  2CHW A;  2K6Q A;  2C7H A;  2LRU A;  1E7U A;  3ZKJ C;  1WMH B;  2JUO A;  4ANV A;  2KMA A;  3QX1 A;  3H1U A;  3VH4 B;  4AWJ A;  3S2A A;  2KQ7 A;  2ZEQ A;  4TKN A;  2AL3 A;  4IM3 A;  5JHA A;  2KDI A;  4F8C B;  4MGK E;  4IWQ A;  5D2M B;  2KJ6 A;  2AWT A;  4K7U A;  5D6J B;  2O2V A;  4GMV A;  1WIA A;  3CST A;  1L2N A;  4W9H A;  3A4R A;  1WGR A;  3GZN I;  4NY0 A;  4MH0 E;  3N32 A;  4G0N B;  3HM3 A;  2IZV B;  3KH0 A;  3MJW A;  5JHB A;  2MSE D;  2ZNV C;  3VQI A;  2C7N B;  4ANW A;  2IO1 B;  4K7W A;  2K8C A;  1WXS A;  5LXI B;  3M3J A;  2KJR A;  3V6E B;  4AP4 C;  4IM2 A;  4I6N B;  4NNJ B;  2MBB B;  3BIN A;  1FXT B;  2B3A A;  2N7D A;  2WYQ A;  4ANU A;  1V2Y A;  3ML8 A;  3QAR A;  4BOS C;  1NI2 A;  1AAR A;  3PZD A;  3Q3J A;  2HE7 A;  2KDB A;  1WR6 E;  2BPS A;  4BVU C;  1P0R A;  2K8B A;  2MX2 A;  3TBL D;  2V1Y A;  2CKH B;  4XC2 A;  2N1W A;  1KLV A;  1K8R B;  3DCG A;  5DPS A;  3ZRF A;  4BOZ B;  4URK A;  2HJ8 A;  2MP2 A;  3V61 A;  4DBG A;  5J17 A;  1F9J A;  4PYZ A;  1WXV A;  4LCD E;  4ANX A;  2NBW B;  3AU5 A;  3L54 A;  2KQS A;  1D3Z A;  4WWP A;  2KHW B;  2C7M B;  4KIK A;  4ASW C;  4WJN A;  4BBN F;  3U30 A;  4DHZ E;  2ZPY A;  3L13 A;  5FR6 A;  3T8M A;  2FID A;  3DPD A;  1A5R A;  2XK5 A;  4FHJ A;  4IW0 A;  4AJY B;  3VTW A;  2N9P C;  1LFD A;  4GGQ A;  4CHK A;  3X0W A;  2EMS A;  2GBR A;  2KTR A;  1WZ0 A;  2A5U A;  2CHZ A;  2UWQ A;  4FJY A;  4LDT D;  3QA8 A;  4GSW A;  1WF9 A;  3ZDM C;  2LZ6 A;  2MBE A;  4J6I A;  1IP9 A;  1I42 A;  3B1L X;  1VD2 A;  3SDL C;  2L05 A;  2KDE B;  2KXJ A;  2L00 B;  3APC A;  2KLG A;  4GU2 A;  1GC7 A;  2NBV B;  5G2N A;  2RD0 A;  3V60 A;  2JWZ A;  1KM7 A;  2IYD B;  2O2V B;  1Q0W B;  3TMP B;  3ALB A;  3I3T B;  3H9D A;  4ZRJ A;  1M94 A;  3JSV A;  4MM3 A;  4OVV A;  3UF8 A;  1ISN A;  2C9W B;  4NJ7 A;  1YQB A;  4W9D A;  2KFJ A;  4EOY A;  5G55 A;  2LVQ A;  1NDD A;  2M8S A;  1WH3 A;  4RM8 A;  2ASQ A;  2KD0 A;  2M17 A;  3PGE A;  3DVN V;  2MBH A;  4BKS A;  4WWN A;  1P98 A;  4FJZ A;  2FAZ A;  4GDK A;  4WJP A;  1E90 A;  1WI0 A;  3NZS A;  4FBJ B;  4TV3 A;  2LGY A;  2VRR B;  4IUM B;  3A9J A;  4HDO A;  5IAA C;  2O6V D;  2WX1 A;  3PLV A;  2G45 B;  4I6P A;  3GOE A;  2KAN A;  4M0W B;  3QC8 B;  3A9K A;  1WGG A;  2KKC A;  3L10 B;  4BKG A;  2MP2 B;  2KX0 A;  2L3Z A;  3DBL I;  1SE9 A;  3WIM A;  1WZ3 A;  3H7P B;  3PTF C;  3C0R B;  1V5T A;  4PYU A;  3A4S C;  3N3K B;  4KIK B;  4BBN C;  1WJN A;  2MBO A;  4ICU A;  1E5W A;  3WAO A;  1WFY A;  1GUA B;  1OEY J;  4KZ0 A;  1UBI A;  2D07 B;  3DBS A;  3ZTC A;  2AL6 A;  4GN1 A;  4M8N A;  2BWF A;  3A33 B;  1P3Q U;  3VAW A;  2WX0 A;  1UD7 A;  4FN2 A;  4RMA A;  4AJW A;  2IY1 B;  2PE9 A;  3ZLZ A;  3ONS A;  2DYM A;  4ZDV A;  1EF1 A;  5AZH A;  4XX5 A;  3ZW3 A;  4ZRI A;  3BY4 B;  3ZNH B;  2MRP A;  5C1Z A;  2LI5 A;  1Y8R C;  5D7G A;  1WYW B;  3OLM D;  3ECI A;  3VXW A;  4GOC A;  5JZE B;  3LJ3 A;  3R7Q A;  2FCS A;  1WM2 A;  2OOB B;  5L83 A;  2AYO B;  5DPR A;  5JH5 C;  3NS8 A;  2NPT B;  4MSM B;  4MDK E;  3JSV B;  1V5O A;  2JZ3 B;  2Z59 B;  4HDQ A;  4DHZ B;  3ZNG C;  2JT4 B;  1TZ1 A;  3UIO B;  3VFK A;  4BKT A;  1GNU A;  1TGZ B;  3QK0 A;  3VDZ A;  2KMC A;  2L7R A;  2D2Q A;  2RGF A;  1XQQ A;  4HJK A;  4HCP B;  5L95 C;  2Y5B B;  4LJO B;  3QQ8 B;  4IWO A;  3X23 A;  3RUI B;  3L16 A;  3R3M A;  4W9K A;  4GDK B;  3RUL A;  3SD5 A;  2FCN A;  1Q5W B;  1LQB A;  2NVU I;  2DYB A;  4W9C A;  3RCZ A;  1WGH A;  4B9K A;  2D10 A;  2RR9 A;  1OGW A;  2OJR A;  4K7S A;  3A9J B;  5E6O A;  2KWC A;  3MTN B;  1L7Y A;  2KFK A;  2J0M A;  3QWZ B;  1WJU A;  3A9K B;  1CMX B;  4MGI E;  2N9X A;  1V86 A;  3IVF A;  3U8Z A;  2JRH A;  3ZNI D;  3QJZ A;  2KK8 A;  3TCA A;  3U7D A;  2JVC A;  1V81 A;  4MEL A;  5LLI A;  1G6J A;  3EHV A;  1I35 A;  4XZ4 A;  4PS3 A;  1Z2M A;  1WX7 A;  3PRZ A;  1YX6 B;  4DXA B;  2NS5 A;  2L0T A;  4GDL A;  4DDI D;  1RFA A;  2KVR A;  2LXA A;  3VVW B;  2N4F A;  1QZE A;  4FA6 A;  2NBU A;  4KDI C;  4NQK E;  2KWV B;  3SHQ A;  3PV1 A;  4PS8 A;  2ZNV B;  3KUC B;  3N30 A;  5BO4 B;  2LAS A;  3L08 A;  4CYE A;  4MGY E;  2J0K A;  4HK2 A;  5D94 A;  2MCN B;  1UBQ A;  2RPQ A;  3PPA A;  4JGH B;  4IM0 A;  4B6W A;  1UH6 A;  2GBN A;  4HPM B;  4FLH A;  4A20 A;  5E6P A;  1J8C A;  5CHV C;  3PHX B;  4WJQ A;  2LUE A;  1S3S G;  3NY5 A;  5LXH A;  4MSQ B;  1JRU A;  1C3T A;  2PEA A;  2KTF A;  1E8Y A;  3EFU A;  2KDF B;  2HD5 B;  4II2 B;  4NAW A;  1J0G A;  4W9L A;  3RD2 A;  2MA9 B;  3D32 A;  4EEW A;  2JRI B;  3QHT A;  3AI5 A;  1IPG A;  2DYO A;  5E6N A;  2KJH B;  1LXD A;  3ZUN A;  2BGF A;  3KW5 B;  3W1S C;  2FIF A;  2MBQ A;  4FJV B;  3UQB A;  3K9P B;  4LJP B;  1ZGU B;  3RZW C;  3UIP B;  3L17 A;  3L0W B;  4FHK A;  2LGX A;  2JXX A;  1S1Q B;  1V49 A;  1WXA A;  4ZRK A;  4DWF A;  4G50 A;  1R4N I;  4IG7 B;  3ZTD A;  3PSE B;  1WX9 A;  3QIJ A;  2MWS B;  2BKR B;  3MHS D;  4F7Z A;  3DBR I;  5HKH A;  2DAJ A;  1Q1O A;  2M0X A;  4M8M A;  4AOF A;  4W9F A;  4EZL A;  1WRD B;  2KNB A;  2LXC A;  3APF A;  1E7V A;  2GOW A;  3WAP A;  3WA0 A;  2CU1 A;  2FNJ B;  2WDT B;  1OTR B;  1YIW A;  4KSK C;  2EMT A;  2NCN A;  2RSU A;  2R2Q A;  2XBB C;  2LD9 A;  2XK5 B;  2LWP A;  3M95 A;  4KDL B;  3DVN U;  5AZG A;  3RYT A;  4E74 A;  3M62 B;  4K81 A;  2IY0 B;  4II3 B;  2Z0E B;  1WY8 A; 
#chains in the Genus database with same CATH topology
 2IO3 B;  3W9C B;  2DHZ A;  4CO7 A;  3RNB C;  1C4C A;  2K5P A;  4K1R B;  1MG8 A;  3DOW A;  2BWE S;  1R7S A;  2BYV E;  1WGD A;  3SFD B;  4HCN B;  2KWD A;  1OEY A;  1FFU A;  1P7F A;  4NAW B;  1SBB B;  1PGB A;  2J4X A;  1WE7 A;  4TQ1 A;  1T0R C;  1BT0 A;  1L0X B;  2D3B A;  4KGR A;  2UYZ B;  4OVU A;  1EO6 A;  3B0A A;  3AE7 B;  2WWZ A;  2ACZ B;  2M56 B;  3AXC A;  4KVG B;  2MEK A;  2I1J A;  1JWM D;  3AU4 A;  5H92 C;  1C4P A;  4I6L B;  2FUH B;  4B95 A;  5KHO A;  2LRW A;  3DVG X;  3ZDT A;  2PKO A;  2IND C;  3BVZ A;  2G3Q B;  1NBF C;  4ICV A;  2CS4 A;  2BB5 A;  4E71 A;  2BYF A;  2ZVO A;  3HIZ A;  2L0F A;  4W9E A;  2N7J A;  3ZRC A;  3OG5 A;  2R2O A;  1ZUD 2;  3OAW A;  4EZK A;  2C5L C;  3U52 E;  3KUD B;  1L0Y B;  1YQ4 B;  2RDG A;  3FKY A;  5CX3 A;  3N1Y C;  2GBM A;  1NEK B;  2DEN B;  1E8W A;  2KC1 A;  1OQY A;  4JIO U;  2BB6 A;  1TYG B;  3B2G A;  2M1M A;  3PT2 B;  1GG3 A;  3ENE A;  2O6V A;  2A4Z A;  2C60 A;  4ZRP A;  5CHW A;  5G5G A;  4GLS C;  3W5V B;  1OQQ A;  2DX5 B;  2NR2 A;  4YWG G;  5EE0 A;  2UU7 A;  4GB9 A;  3VTV A;  1YJ1 A;  1P1A A;  2L83 A;  3AEE B;  1C1Y B;  3OJ3 A;  2PW9 A;  4DK5 A;  4US8 A;  4O1N A;  2HJ1 A;  2W9N A;  1ZPS A;  2NPT A;  1SIJ A;  1E8X A;  1I4P A;  3WAL A;  3IFW B;  1TTN A;  3Q8B A;  3EEC A;  4XE0 A;  3DBH I;  4W9J A;  3VHT C;  3PRE A;  2ZPN A;  1EM7 A;  3LDZ E;  2DZJ A;  4YL8 A;  3ZYY X;  1JML A;  1BUI C;  2KO3 A;  4QAY A;  3HM6 X;  4IWP A;  2K8H A;  1T0Y A;  4IC7 B;  4M02 A;  1P9D U;  4HLE A;  1X1M A;  2LGD A;  3JVZ X;  3B08 A;  4X57 B;  3KVF B;  2ZCC A;  1V1O A;  2DAF A;  2QEJ C;  2Y3A A;  3AED B;  2N1V A;  3FC4 A;  4KV2 A;  4LNI A;  1FNW A;  3RT3 B;  3SFE B;  1E10 A;  1IYF A;  5KHQ A;  1RLF A;  3I57 A;  2K6Q A;  1FEH A;  3ZKJ C;  3QX1 A;  4AWJ A;  1HQR D;  2QMT A;  3S2A A;  2KQ7 A;  4REZ A;  2ZEQ A;  4TKN A;  2AL3 A;  5JHA A;  4F8C B;  4AQ7 A;  1T6B X;  1J7B A;  1K53 A;  5D2M B;  2KJ6 A;  5D6J B;  1WGR A;  3GZN I;  4NY0 A;  4XDC A;  5FKA C;  3NVV A;  1DOI A;  3VQI A;  1GB4 A;  4DXG A;  2IO1 B;  4ZRQ A;  3AEB B;  3V6E B;  1D5M C;  4KGS A;  3BIN A;  1FXT B;  1L4Z B;  4RGT A;  3AN1 A;  1AAR A;  2KDB A;  4RGO S;  2BPS A;  4HRO A;  2MX2 A;  3HVD A;  2LFI A;  3NVY A;  1YN4 A;  4PYZ A;  2WNM A;  2NBW B;  3AU5 A;  3L54 A;  2LEK A;  2EEL A;  1HA5 A;  3U30 A;  1ENF A;  2JXT A;  4HKQ A;  3MC8 A;  3DPD A;  1A5R A;  1EWC A;  2SAK A;  4FHJ A;  4GGQ A;  2EMS A;  2GBR A;  2UWQ A;  2CHZ A;  4J6I A;  2L00 B;  4GU2 A;  2RD0 A;  1XLO A;  2AQ2 B;  1Q0W B;  1ISN A;  2C9W B;  2QJL A;  2X8X X;  3I5J C;  4EOY A;  4CQN A;  3ETR A;  1WH3 A;  4RM8 A;  4JPS A;  3MHZ A;  4BKS A;  2W55 A;  3RPF C;  2D3C A;  3IT4 B;  5BMI A;  2QIL A;  4WJP A;  4FBJ B;  2LHE A;  2VRR B;  3A9J A;  2G9H D;  1UUP A;  2G45 B;  4I6P A;  2KAN A;  1I4H A;  1WGG A;  2KKC A;  2MP2 B;  2L3Z A;  1FM0 D;  2WDQ B;  2X38 A;  4PYU A;  4KIK B;  3WAO A;  3R2I A;  2D07 B;  2WXF A;  3ZTC A;  2AL6 A;  4KKI A;  3Q8E A;  3VAW A;  4RMA A;  1C4A A;  2PE9 A;  3FIL A;  2DYM A;  3NVW A;  1QOB A;  4XX5 A;  3ZGZ A;  1QKZ A;  5C1Z A;  3R7Q A;  2FCS A;  2LMC A;  5IO9 A;  5DPR A;  5JH5 C;  2NPT B;  2KDM A;  4MSM B;  1N60 A;  1IUE A;  4MM3 B;  4DHZ B;  3NUH B;  2JT4 B;  2GLS A;  3P1M A;  3RNG C;  2RGF A;  2TSS A;  4IWO A;  2VZK B;  1MVK A;  3RUI B;  1ACC A;  4W9K A;  4GDK B;  1Q5W B;  2DYB A;  1VR9 A;  2IDY A;  4B9K A;  4K7S A;  2D5G A;  2J0M A;  3QWZ B;  3QJZ A;  4OVZ A;  2KK8 A;  4N59 A;  2JVC A;  4MEL A;  3EHV A;  1I35 A;  1YX6 B;  2NS5 A;  2CJN A;  1QZE A;  4FA6 A;  4ZOH C;  1ZP0 B;  2FE8 A;  4YTP B;  3PV1 A;  4PS8 A;  2ZNV B;  1KF6 B;  5D94 A;  4JWS C;  1WYG A;  4B6W A;  2GBN A;  2N0S B;  1WSP A;  1J8C A;  3NY5 A;  4NAW A;  3NRZ A;  4PK1 A;  4KGT A;  3AI5 A;  1IPG A;  5E6N A;  1CJE A;  4DXF A;  1LXD A;  4YTN B;  4FJV B;  3RZW C;  1TY2 A;  4OZB A;  3UIP B;  3DHI C;  4FHK A;  2ONQ A;  4C7Z A;  2HTM E;  1VLB A;  4ZRK A;  4G50 A;  1E7P B;  1R4N I;  4F7Z A;  2DAJ A;  1ZXH A;  4IOI E;  2YEP F;  2Y5C A;  4C56 C;  3WAP A;  1WXQ A;  3EUB 2;  2CU1 A;  2QDF A;  1ZDV A;  2EMT A;  2RSU A;  1I7H A;  3M95 A;  1Q10 A;  4KDL B;  2BVC A;  4W9I A;  2RDH A;  4NZL B;  3VH3 B;  3NZ3 A;  1WJ4 A;  3BK1 A;  4EUT A;  3TEW A;  2KX3 A;  3C8Y A;  5JXV A;  1XD3 B;  3AE1 B;  4WJO A;  4JL9 A;  2N7E A;  3WAM A;  4US9 A;  1TT5 B;  2LGI A;  1UWM A;  4BAX A;  1SF0 A;  4L23 A;  1SEB D;  3T3O A;  2L76 A;  2G4S A;  3ZQ4 A;  2QC8 A;  4KSL C;  5J2R A;  5DPT A;  1FIQ A;  2WXN A;  3W1Y A;  3H6N A;  5E6J A;  1F1H A;  4RGM A;  4HVB A;  4FXC A;  1WR1 A;  3ABV B;  4XDD A;  3QAQ A;  4DHJ B;  3MP9 A;  3TIX A;  4MGZ E;  1I4Q A;  3DVG Y;  2JZZ A;  1FMA D;  2QCZ A;  2RDB C;  1TS5 A;  3SU8 X;  3DWG C;  2AQ1 B;  1SJH D;  1MI0 A;  2JU6 X;  1Y56 A;  5GMV A;  2LVP A;  2Z0D B;  2WLB A;  2ZW0 A;  3PRP B;  1N61 A;  1JAL A;  4M0W A;  2ZZP B;  2BW2 A;  3W2D A;  4LNK A;  3VUX A;  2J0J A;  2D3A A;  4MJS B;  2BS4 B;  2GI9 A;  1ZOY B;  3KYD D;  1GJZ A;  3V05 A;  1EUV B;  3GZN B;  3WAN A;  2AX5 A;  2KC2 A;  5G5H A;  1PQS A;  1FXA A;  2YVC A;  3ZJU A;  4RGN A;  3AEA B;  2YLM A;  3NVZ A;  1SE4 A;  4NJC A;  2GBK A;  2J7Q B;  5DCN A;  3UIN B;  1GOZ A;  5TR5 A;  2I1K A;  3HHM A;  2DZK A;  2WDR B;  3PHW B;  3AUL A;  4LDT B;  1WXM A;  4WAA A;  3UGB B;  2H88 B;  1KJT A;  2MW5 A;  3KYC D;  4TQ0 A;  1DYQ A;  4HPL B;  1D6E C;  1XCQ L;  2HTH A;  1YNT E;  3V3X A;  4TSS A;  5C23 A;  1NI3 A;  2KN5 A;  2Y5P A;  3CMM B;  2B76 B;  1IGD A;  3H8H A;  1V97 A;  4AUQ C;  2AEH A;  2N9K A;  2REX A;  3CSF A;  3IAM 1;  1E8Z A;  3JYU A;  2BYE A;  3M63 B;  1V80 A;  2GBJ A;  2WXO A;  3GB1 A;  1VZ8 A;  4LNF A;  3NHE B;  1YX5 B;  4F1S A;  2LRU A;  1E7U A;  2JUO A;  3AE8 B;  5FK9 C;  2WXP A;  2AWT A;  3CST A;  2L32 A;  4MH0 E;  3NG0 A;  1TKE A;  2NTT A;  2XN9 C;  2ZNV C;  4MAC A;  2C7N B;  1SXT A;  1N62 A;  1WXS A;  4LLG M;  5LXI B;  4I6N B;  3LXF A;  2MBB B;  2N7D A;  3ML8 A;  4YXD B;  4BOS C;  1NI2 A;  3PZD A;  2HE7 A;  1WR6 E;  4OZA A;  2WDV B;  2MP2 A;  5J17 A;  1F9J A;  4LCD E;  4ANX A;  2JYE A;  1YOV B;  4ASW C;  4KIK A;  1VDV A;  4DHZ E;  2AQ3 B;  3HUI A;  1I4R A;  3AV8 A;  3RNE C;  2LHD A;  3T8M A;  2XK5 A;  1T0Q C;  5TSS A;  4IW0 A;  2KAJ A;  2N9P C;  2GB1 A;  2KN4 A;  2KTR A;  2JSV X;  5HKH A;  1WZ0 A;  3ZDM C;  4A55 A;  4GSW A;  2J53 A;  2MBE A;  1IP9 A;  1I42 A;  3PO0 A;  4N58 A;  3B1L X;  3SDL C;  2L05 A;  2NBV B;  3V60 A;  2JWZ A;  2O2V B;  3H9D A;  4MM3 A;  4OVV A;  2KFJ A;  2LVQ A;  3DHH C;  2M8S A;  2ASQ A;  2PVO D;  4USA A;  4GDK A;  2JYT A;  3O13 A;  1E90 A;  1T5X D;  1TKY A;  1WI0 A;  2WXQ A;  4IUM B;  1NYQ A;  1OFF A;  2O6V D;  3PLV A;  4JX1 C;  4M0W B;  1C9F A;  3DBL I;  2CJO A;  1JRP A;  3RFZ B;  5BYS A;  1WJN A;  1E5W A;  1UNS A;  2PMV A;  4KZ0 A;  4M8N A;  3A33 B;  2WX0 A;  4RH6 A;  2MH7 A;  2LGS A;  3ONS A;  4KKJ A;  4LNO A;  3ZW3 A;  3MFG A;  1SE3 A;  1TKG A;  3ZNH B;  2PTL A;  1CQV A;  1R4N B;  1Y8R C;  5D7G A;  2VZK D;  3LJ3 A;  5HFY A;  3Q3M C;  3NS8 A;  1KFY B;  1FPY A;  3JSV B;  2JZ3 B;  3ZNG C;  1TZ1 A;  4BKT A;  1GNU A;  3RN9 C;  1HZ6 A;  2D2Q A;  5I4D A;  4HJK A;  2WXH A;  3QQ8 B;  3X23 A;  4NAM A;  2FCN A;  4W9C A;  1ROE A;  1OGW A;  2OJR A;  1XF5 L;  5E6O A;  2KQ4 X;  2KWC A;  2KFK A;  3A9K B;  2N9X A;  3ZNI D;  5IKC M;  2WXG A;  2L0T A;  1T3Q A;  3VVW B;  2N4F A;  2BT6 A;  2NBU A;  4KDI C;  3SHQ A;  3N30 A;  1K52 A;  1DOX A;  3L4P A;  4HK2 A;  1F2R C;  2MCN B;  1UBQ A;  2RPQ A;  4L2Y A;  4XYC A;  4A20 A;  2PLP A;  5E6P A;  2NTS A;  3PHX B;  5CHV C;  2LUE A;  1JRU A;  2KTF A;  1E8Y A;  2RPV A;  1XLP A;  2HD5 B;  1N6Z A;  2MA9 B;  3OWE B;  2JRI B;  3QHT A;  2DYO A;  2KJH B;  3GP7 A;  2IJ0 A;  3T3N A;  3ZUN A;  3W1S C;  3UQB A;  4YTM B;  4LJP B;  1KLU D;  2DWQ A;  1L4D B;  3BII D;  3L17 A;  2LGX A;  1AWD A;  2QIE B;  1S1Q B;  1WXA A;  4M01 A;  2VH2 A;  1J7C A;  1WX9 A;  2MWS B;  2K3U A;  1PGX A;  2M0X A;  4AOF A;  1QOA A;  1WGK A;  1E7V A;  2WDT B;  4EE2 A;  1FCC C;  2CU3 A;  1FD6 A;  1D5X C;  2R2Q A;  2LD9 A;  2XK5 B;  3Q2A C;  4M00 A;  1DOY A;  4E74 A;  3DVN U;  4K81 A;  1PFD A;  1WY8 A;  2K25 A;  2KTR B;  3LYY A;  1XT9 B;  2M4N A;  2INP E;  3PS6 A;  2WXK A;  3P2B A;  4BFR A;  3IG3 A;  2XEW A;  4MJS A;  4DDG D;  4BKS D;  2GMI C;  2WXL A;  3DBR B;  4TUU A;  4A3P A;  1RWS A;  3O65 B;  4NQL B;  2BTE A;  4ITK A;  3R66 C;  1YN3 A;  2W3R A;  2ICI A;  3NOB A;  3JW0 X;  1GAQ B;  3KUZ A;  1XXG A;  4FAD A;  3CIR B;  3V6C B;  2N9E B;  4N9F 4;  1RYJ A;  2IO2 B;  2SEB D;  3HK0 A;  3TUO A;  2M19 A;  3VUW A;  2EKI A;  4JLC A;  3U2S C;  5J18 A;  3K9O B;  2MLB A;  1PYW D;  4G3X B;  5AEK B;  3VTU A;  3EFC A;  5EE3 A;  2K0P A;  3PVL A;  2QSD A;  4GXB A;  1WGY A;  4C80 A;  2LVO A;  1WJ6 A;  3AM9 A;  3W1S A;  3ZXR A;  4P1C C;  2HDE A;  5LNK 1;  4RNA A;  4D2K A;  2D3G A;  1KOT A;  1UEL A;  1J19 A;  3P4S B;  4FUL A;  1QIL A;  1NVI D;  1J7A A;  4WWM A;  2L8J A;  4XGA B;  4OZC A;  1H8C A;  4KZC A;  3Q8C A;  1E6E B;  4RM9 A;  1HE8 A;  1K51 A;  2ZJD A;  3P42 A;  4MT5 A;  1GB1 A;  4EZJ A;  3H7S A;  2V4L A;  3R7R A;  1RAX A;  3DHG C;  1I4X A;  3VUY A;  3Q3F A;  2G1E A;  3LB8 C;  5EE1 A;  2KFK B;  2GRI A;  2K39 A;  4G11 A;  2V4I B;  3GE3 C;  1P7E A;  4WWO A;  2JPH A;  1AYF A;  2WGS A;  2JWU A;  1VZ6 A;  1EU4 A;  2E3T A;  5IA7 A;  1FCL A;  1RRB A;  1C78 A;  1CZP A;  2PJH A;  2FCM A;  3TJP A;  2KWU B;  2V3P A;  3GS2 A;  1KRH A;  5IN7 A;  3EC8 A;  1WE6 A;  1NYR A;  1R4M I;  1QOF A;  1TY0 A;  3IBE A;  3V62 A;  1VCB A;  2WXM A;  3UQA A;  2MHJ A;  2KOX A;  3A1Q B;  3ZO5 B;  2CHW A;  2C7H A;  5HG2 A;  3DBH B;  2WU2 B;  1WMH B;  2KMA A;  3H1U A;  3VH4 B;  2L52 A;  1QT9 A;  3UI3 A;  2M0A A;  4MGK E;  2BYT A;  4YSY B;  2O2V A;  4GMV A;  3AEG B;  3AH7 A;  1WIA A;  1D5Z C;  4W9H A;  3A4R A;  1CK1 A;  3DBL B;  3MC9 A;  4S17 A;  4G0N B;  3HM3 A;  2IGD A;  3KH0 A;  5JHB A;  2MSE D;  4K7W A;  1HXY D;  2XNA C;  2JQR B;  3M3J A;  2KJR A;  1PDX A;  4IM2 A;  4OHJ A;  1V2Y A;  1MHH E;  1P0R A;  2K8B A;  4XWW A;  2WXR A;  4C7Y A;  2V1Y A;  1KLV A;  2WS3 B;  4N6E B;  5DPS A;  3ZRF A;  4BOZ B;  4URK A;  2HJ8 A;  1E0Z A;  4RCO A;  4DBG A;  5IP4 D;  4P16 A;  1D3Z A;  2C7M B;  2KHW B;  4A8X C;  4WJN A;  3SEB A;  1HTQ A;  2ZPY A;  3C19 A;  2PVG C;  4YSX B;  3L13 A;  3Q8A A;  5FR6 A;  5BYR A;  2OED A;  1TS3 A;  2FID A;  4AJY B;  4RF0 A;  1LFD A;  1L5P A;  4CHK A;  3BZD B;  1C76 A;  2J42 A;  4WH4 A;  1WF9 A;  2LZ6 A;  2BS2 B;  4ZHP A;  1VD2 A;  3AE3 B;  2KDE B;  2KXJ A;  3APC A;  4C00 A;  2KLG A;  3TSS A;  5G2N A;  1KM7 A;  2IYD B;  3TMP B;  3ALB A;  5BYQ A;  4ZRJ A;  1M94 A;  3JSV A;  3UF8 A;  4HEA 1;  4W9D A;  1NDD A;  1F0Z A;  2M17 A;  2MBH A;  5D3I B;  1P98 A;  1VZ7 A;  4FJZ A;  1B9R A;  1YJI A;  2IPK D;  3AE2 B;  4TV3 A;  2LGY A;  1RFK A;  3GOE A;  3QC8 B;  3A9K A;  5MPO A;  2I2Y A;  1JW9 D;  3PTF C;  1V5T A;  3N3K B;  1WRI A;  2MBO A;  3B9J A;  4PT5 A;  1OEY J;  2KAC A;  3DBS A;  1N5W A;  1YJJ A;  1F52 A;  1UD7 A;  1TIF A;  2W3S A;  4FN2 A;  2I38 A;  3PZ8 A;  3W5U B;  4AJW A;  3ZJV A;  3ZLZ A;  4A9A A;  1EF1 A;  5AZH A;  5HI1 A;  1WYW B;  2V3N A;  3ECI A;  4GOC A;  5JZE B;  3BVM A;  2OOB B;  5L83 A;  3HRD D;  2K9X A;  1V5O A;  2OHF A;  4HDQ A;  4BZA A;  3VFK A;  3UIO B;  5T8I A;  3VDZ A;  1TGZ B;  4WUR A;  2KMC A;  1K50 A;  4H2A A;  1XQQ A;  5L95 C;  1DGJ A;  2DBY A;  3L16 A;  3RUL A;  2VH1 A;  4K3C A;  3SD5 A;  2NVU I;  1LQB A;  3RCZ A;  1WGH A;  2D10 A;  1YQ3 B;  4A90 A;  3NS1 A;  3TEZ A;  3VR8 B;  2MJD A;  4MGI E;  3TEX A;  1JWB D;  3U8Z A;  5H8Y E;  1FRD A;  5LLI A;  1KTK A;  1Z2M A;  1LO5 D;  1EWY C;  4DXA B;  4DDI D;  4GDL A;  1RFA A;  2OJW A;  2BS3 B;  2E6X A;  3MC0 B;  3Q14 C;  4NQK E;  1STE A;  2KWV B;  4JE3 B;  3KUC B;  5BO4 B;  2LAS A;  3L08 A;  4CYE A;  3CWI A;  4MGY E;  2J0K A;  3PPA A;  2Z8L A;  2Q5W D;  4IM0 A;  1UH6 A;  2BBC A;  4HPM B;  3U7Z A;  5LXH A;  4MSQ B;  1C3T A;  2PEA A;  3BYT B;  3Q8F A;  3EFU A;  2KDF B;  1AW7 A;  4II2 B;  1J0G A;  4W9L A;  4HKZ E;  1L0V B;  3KLS X;  2MJE A;  4EEW A;  1MG4 A;  2BGF A;  3KW5 B;  2FIF A;  3WCQ A;  1FFV A;  2ON8 A;  4ACF A;  4WQM A;  3VRA B;  1V49 A;  4DWF A;  4YSZ B;  3PSE B;  1ET6 A;  1SSN A;  1SB3 C;  2BKR B;  3MHS D;  1TJE A;  4EZL A;  4W9F A;  3EGR A;  1UF0 A;  1C79 A;  1JWU D;  2GOW A;  1E9M A;  3WA0 A;  4HRS A;  4L1B A;  5AUK A;  3ZJT A;  5AZG A;  3RYT A;  4XWT A;  4NJ7 A;  3VRB B;  1FRR A;  3PRM B;  3PLU A;  2V3S A;  4ZYS A;  1TS2 A;  2DZI A;  4P7I A;  1RM6 C;  1JRO A;  2IBI B;  1LM8 B;  2JF5 A;  3R8B A;  2LJ5 A;  3DQV A;  3NJT A;  3J9C A;  2N9L A;  2KMM A;  5GXG B;  3KWL A;  4NPN A;  2D11 A;  2BF8 B;  5DPW A;  4E3C A;  1FO4 A;  1C77 A;  2W54 A;  4A3O A;  4WQO B;  1TBE A;  4LTU A;  5CHF A;  3CF6 E;  3DWM A;  1IBX B;  1U4A A;  1TS4 A;  3QCA A;  1SGH A;  4P1B C;  2ZW1 A;  4EKU A;  2IGG A;  3URY A;  5EE9 A;  3RNA C;  4B0M A;  5AUI A;  1R4M B;  3AE9 B;  1KH0 A;  1WM3 A;  3BVG A;  2ZCB A;  2K6D B;  4EFO A;  2BKF A;  2G4D B;  2RMM A;  1FNU A;  3ZVV A;  3KWV A;  2K1F A;  4HWI B;  5BMG A;  2MJ3 A;  4MEM A;  1F2R I;  1V1P A;  3H7P A;  3RZF A;  3I9V 1;  1L6U A;  3Q3N C;  2YEP B;  2IO0 B;  3A1Q A;  3N20 C;  5D3D A;  3HVZ A;  4KX6 B;  2LUM A;  2CHX A;  4P6V F;  1SIF A;  1JCK B;  1V6E A;  1WMH A;  2WU5 B;  1BXT A;  1UZX B;  3Q6B A;  5IOI A;  1N5X A;  3P4Q B;  5AZF A;  5EDS A;  1L6V A;  1WX8 A;  4JQW C;  1V9J A;  3ZIM A;  1N63 A;  2WHI A;  3ML9 A;  4GIV A;  1A70 A;  2EKE C;  1EF5 A;  2JY6 A;  1YMH E;  1YD8 U;  3OJ4 B;  3ZNZ B;  4PS7 A;  4ARC A;  3P4P B;  1ZKH A;  4ZYN A;  2QHO A;  3DDC B;  4JWU C;  4C4V A;  3BK2 A;  4GDL B;  1UGM A;  2ZVN A;  3AB5 A;  2MQJ A;  5CTR C;  3TL5 A;  1MJD A;  3FAH A;  1ZDX A;  4K3B A;  2DZM A;  2PE6 B;  4HPP A;  1H4R A;  1JWA D;  3APD A;  1VJK A;  3IHP C;  2KLC A;  1ET9 A;  4Q2J A;  3PZ7 A;  2H89 B;  2KZR A;  2V0G A;  2PPH A;  2FCQ A;  3T9L A;  1Z5S B;  1GC6 A;  2O6V B;  4W9G A;  4HXD A;  1JWS D;  3NZU A;  2W82 A;  1B1Z A;  1ZW7 A;  2CR5 A;  3AE4 B;  4NJ6 A;  4DHJ D;  2JX5 A;  4WIP A;  4ANV A;  1QF6 A;  1OQR A;  4IM3 A;  2KDI A;  4IWQ A;  3AE6 B;  4K7U A;  3RI7 C;  1XCT L;  1L2N A;  1FXI A;  3RMK C;  3N32 A;  4LK0 M;  2IZV B;  1MFW A;  3N1Z C;  2KVZ A;  3MJW A;  4ANW A;  4HJG E;  2WXI A;  2K8C A;  4YT0 B;  2WQY B;  5BMH A;  4AP4 C;  4NNJ B;  2B3A A;  3AEC B;  2WYQ A;  4ANU A;  3QAR A;  3Q3J A;  4BVU C;  3TBL D;  2CKH B;  4XC2 A;  2N1W A;  1K8R B;  3DCG A;  4UDU C;  2J52 A;  3N9Y C;  3V61 A;  4TMA B;  1WXV A;  4RFB A;  2KQS A;  4WWP A;  4BBN F;  2NMQ A;  1ESF A;  1ZE3 D;  1YN5 A;  1HZ5 A;  4IDI A;  3VTW A;  1UWX A;  3X0W A;  2A5U A;  4LDT D;  2BQQ A;  4FJY A;  4LNN A;  3QA8 A;  3U4E G;  5FR3 A;  3MJ5 A;  1GC7 A;  3B2F A;  3IAS 1;  4DQO C;  3I3T B;  2FUG 1;  1YQB A;  5G55 A;  2WP9 B;  2KD0 A;  3PGE A;  3DVN V;  4WWN A;  3Q69 A;  1IGC A;  2DLB A;  4WAF A;  2FAZ A;  4ARI A;  1BML C;  3NZS A;  4S0R A;  4HDO A;  5IAA C;  2WX1 A;  1UGJ A;  1SE2 A;  3L10 B;  4BKG A;  2KX0 A;  1V1P B;  4IKG A;  1SE9 A;  1XO3 A;  3WIM A;  1WZ3 A;  3H7P B;  3C0R B;  3A4S C;  4BBN C;  3N1X C;  4ICU A;  2R61 A;  1WFY A;  1GUA B;  1UBI A;  4GN1 A;  2BWF A;  1P3Q U;  1HEZ E;  1WWT A;  2IY1 B;  4ZDV A;  1SJE D;  4ZRI A;  3BY4 B;  3AMZ A;  3E56 A;  2MRP A;  2LI5 A;  1KLG D;  2K22 A;  3OLM D;  3VXW A;  1EU3 A;  3KQ4 A;  1FNV A;  1WM2 A;  2AYO B;  3Q3O C;  4MDK E;  2Z59 B;  1GPX A;  1ZXI A;  3QK0 A;  2L7R A;  2INC C;  4HCP B;  2Y5B B;  4LJO B;  4C4V B;  3VR9 B;  3R3M A;  2RR9 A;  3EA6 A;  3A9J B;  3MTN B;  1L7Y A;  2IGH A;  4A6Q A;  1WJU A;  1CMX B;  3RNF C;  1V86 A;  1V8C A;  1I4G A;  3IVF A;  3AEF B;  1JQ4 A;  1M4V A;  2JRH A;  2L1A A;  3TCA A;  3U7D A;  1V81 A;  1G6J A;  3E9S A;  4XZ4 A;  4PS3 A;  5C3J B;  1WX7 A;  3I63 C;  3PRZ A;  1QQR A;  2KVR A;  1TZO A;  2LXA A;  3P4R B;  3RNC C;  1QOG A;  3IXS A;  1AN8 A;  3BWU D;  3FIL B;  1HTO A;  2KT7 A;  4OW0 A;  4JGH B;  3R2T A;  5C2T B;  1T0S C;  4FLH A;  4MH8 A;  3TEY A;  3ZXV A;  1D4B A;  2WXJ A;  4WJQ A;  1S3S G;  1F77 A;  2PIA A;  3SR6 A;  4B0E A;  1MHX A;  2INN E;  1LGR A;  3RD2 A;  3D32 A;  2FBW B;  1QLB B;  2V9H A;  2MBQ A;  4AS1 A;  1NEN B;  1XEE A;  3K9P B;  1ZGU B;  2LJI A;  3BYY B;  1VRA B;  3L0W B;  1IBX A;  2JXX A;  1PGA A;  1XLQ A;  2KYW A;  3IT6 B;  4IG7 B;  3ZTD A;  3QIJ A;  1PUT A;  3DBR I;  1Q1O A;  4M8M A;  4RF1 A;  1WRD B;  2KNB A;  2LXC A;  3AE5 B;  3APF A;  3GE8 C;  4ZHO A;  1MPE A;  3P63 A;  2FNJ B;  1OTR B;  1YIW A;  4J3O D;  4KSK C;  2NCN A;  4R3D A;  2XBB C;  2DNF A;  2LWP A;  5HHD G;  1XLN A;  3M62 B;  2IY0 B;  4II3 B;  2Z0E B;  2JZP A; 
#chains in the Genus database with same CATH homology
 2IO3 B;  2K25 A;  2KTR B;  2DHZ A;  3VH3 B;  4CO7 A;  3PRM B;  1XT9 B;  2M4N A;  3PS6 A;  4BFR A;  3P2B A;  3PLU A;  4K1R B;  3IG3 A;  1WJ4 A;  1MG8 A;  2V3S A;  2XEW A;  2KX3 A;  3DOW A;  4MJS A;  2DZI A;  4EUT A;  4P7I A;  4DDG D;  2BWE S;  4BKS D;  2BYV E;  1WGD A;  2IBI B;  1XD3 B;  1LM8 B;  2GMI C;  2JF5 A;  2LJ5 A;  3DQV A;  4HCN B;  4WJO A;  4JL9 A;  2N7E A;  1OEY A;  3WAM A;  4TUU A;  4A3P A;  4NAW B;  3O65 B;  4NPN A;  1WE7 A;  2D11 A;  4NQL B;  2BF8 B;  5DPW A;  4E3C A;  4TQ1 A;  3R66 C;  1BT0 A;  2L76 A;  2G4S A;  4KSL C;  2UYZ B;  5J2R A;  4OVU A;  4A3O A;  1EO6 A;  5DPT A;  3NOB A;  3B0A A;  2WWZ A;  4WQO B;  3W1Y A;  3JW0 X;  3AXC A;  1TBE A;  3H6N A;  4KVG B;  5CHF A;  3CF6 E;  2I1J A;  3AU4 A;  3KUZ A;  1U4A A;  4I6L B;  4FAD A;  4HVB A;  2FUH B;  3QCA A;  1SGH A;  4B95 A;  4EKU A;  3V6C B;  5KHO A;  2N9E B;  1WR1 A;  4N9F 4;  2IO2 B;  2LRW A;  3HK0 A;  3VUW A;  3QAQ A;  3DVG X;  3ZDT A;  4JLC A;  4DHJ B;  5J18 A;  3TIX A;  3K9O B;  2G3Q B;  2MLB A;  4MGZ E;  3DVG Y;  1NBF C;  2JZZ A;  4ICV A;  2CS4 A;  3SU8 X;  4G3X B;  4E71 A;  2BYF A;  5AEK B;  3VTU A;  2ZVO A;  3HIZ A;  1WM3 A;  2L0F A;  4W9E A;  2ZCB A;  3PVL A;  2K6D B;  4EFO A;  5GMV A;  2LVP A;  2BKF A;  2G4D B;  3ZRC A;  4GXB A;  1WGY A;  2R2O A;  2Z0D B;  3OAW A;  4EZK A;  2C5L C;  3ZVV A;  2K1F A;  3PRP B;  4HWI B;  3KUD B;  2LVO A;  1WJ6 A;  2ZZP B;  5CX3 A;  3W1S A;  3VUX A;  2J0J A;  4MEM A;  2GBM A;  4MJS B;  2DEN B;  2D3G A;  3H7P A;  3RZF A;  1E8W A;  2KC1 A;  1KOT A;  1UEL A;  3KYD D;  1J19 A;  1GJZ A;  1EUV B;  4FUL A;  1OQY A;  3WAN A;  4JIO U;  2L8J A;  2KC2 A;  1H8C A;  4KZC A;  2M1M A;  3PT2 B;  1GG3 A;  3ENE A;  2O6V A;  2A4Z A;  2C60 A;  4RM9 A;  5CHW A;  1HE8 A;  1PQS A;  2IO0 B;  2ZJD A;  3A1Q A;  2DX5 B;  2NR2 A;  4GB9 A;  3VTV A;  2CHX A;  4EZJ A;  1YJ1 A;  2YVC A;  3H7S A;  1SIF A;  2V4L A;  3R7R A;  1RAX A;  1V6E A;  1WMH A;  1P1A A;  2YLM A;  1C1Y B;  3OJ3 A;  1UZX B;  2GBK A;  2J7Q B;  3Q3F A;  3VUY A;  5DCN A;  3UIN B;  5AZF A;  4DK5 A;  5EDS A;  1WX8 A;  2W9N A;  4JQW C;  1V9J A;  5TR5 A;  2NPT A;  3ZIM A;  2I1K A;  3ML9 A;  2KFK B;  4GIV A;  2EKE C;  3HHM A;  1EF5 A;  2DZK A;  3PHW B;  3AUL A;  2JY6 A;  4LDT B;  1WXM A;  2K39 A;  4G11 A;  4WAA A;  3UGB B;  1KJT A;  1E8X A;  4W9I A;  2MW5 A;  3WAL A;  3KYC D;  4TQ0 A;  3IFW B;  1YD8 U;  3OJ4 B;  3ZNZ B;  4PS7 A;  4WWO A;  1ZKH A;  2JPH A;  1TTN A;  4HPL B;  4ZYN A;  2QHO A;  3DDC B;  2HTH A;  4GDL B;  1UGM A;  3EEC A;  5IA7 A;  2ZVN A;  5C23 A;  2MQJ A;  3DBH I;  4W9J A;  5CTR C;  2KN5 A;  3VHT C;  3PRE A;  3TL5 A;  2ZPN A;  3LDZ E;  2DZJ A;  1RRB A;  3CMM B;  2DZM A;  4YL8 A;  2PE6 B;  2PJH A;  1H4R A;  4AUQ C;  2AEH A;  3APD A;  2REX A;  2KO3 A;  2FCM A;  3CSF A;  3TJP A;  3IHP C;  2KWU B;  3HM6 X;  2KLC A;  4IWP A;  1E8Z A;  2K8H A;  1T0Y A;  4IC7 B;  3JYU A;  1P9D U;  4HLE A;  1X1M A;  2BYE A;  2LGD A;  1V80 A;  2GBJ A;  3JVZ X;  3M63 B;  2KZR A;  3EC8 A;  1WE6 A;  3B08 A;  1R4M I;  4X57 B;  3KVF B;  2ZCC A;  3IBE A;  2PPH A;  2DAF A;  1VCB A;  2FCQ A;  3T9L A;  1Z5S B;  3V62 A;  3UQA A;  1GC6 A;  2O6V B;  4W9G A;  4HXD A;  2N1V A;  2KOX A;  3NZU A;  1ZW7 A;  4KV2 A;  3NHE B;  3RT3 B;  2CR5 A;  3A1Q B;  1YX5 B;  4F1S A;  3ZO5 B;  4NJ6 A;  5KHQ A;  1RLF A;  1IYF A;  4DHJ D;  2CHW A;  2K6Q A;  2C7H A;  2LRU A;  1E7U A;  3ZKJ C;  1WMH B;  2JUO A;  4ANV A;  2KMA A;  3QX1 A;  3H1U A;  3VH4 B;  4AWJ A;  3S2A A;  2KQ7 A;  2ZEQ A;  4TKN A;  2AL3 A;  4IM3 A;  5JHA A;  2KDI A;  4F8C B;  4MGK E;  4IWQ A;  5D2M B;  2KJ6 A;  2AWT A;  4K7U A;  5D6J B;  2O2V A;  4GMV A;  1WIA A;  3CST A;  1L2N A;  4W9H A;  3A4R A;  1WGR A;  3GZN I;  4NY0 A;  4MH0 E;  3N32 A;  4G0N B;  3HM3 A;  2IZV B;  3KH0 A;  3MJW A;  5JHB A;  2MSE D;  2ZNV C;  3VQI A;  2C7N B;  4ANW A;  2IO1 B;  4K7W A;  2K8C A;  1WXS A;  5LXI B;  3M3J A;  2KJR A;  3V6E B;  4AP4 C;  4IM2 A;  4I6N B;  4NNJ B;  2MBB B;  3BIN A;  1FXT B;  2B3A A;  2N7D A;  2WYQ A;  4ANU A;  1V2Y A;  3ML8 A;  3QAR A;  4BOS C;  1NI2 A;  1AAR A;  3PZD A;  3Q3J A;  2HE7 A;  2KDB A;  1WR6 E;  2BPS A;  4BVU C;  1P0R A;  2K8B A;  2MX2 A;  3TBL D;  2V1Y A;  2CKH B;  4XC2 A;  2N1W A;  1KLV A;  1K8R B;  3DCG A;  5DPS A;  3ZRF A;  4BOZ B;  4URK A;  2HJ8 A;  2MP2 A;  3V61 A;  4DBG A;  5J17 A;  1F9J A;  4PYZ A;  1WXV A;  4LCD E;  4ANX A;  2NBW B;  3AU5 A;  3L54 A;  2KQS A;  1D3Z A;  4WWP A;  2KHW B;  2C7M B;  4KIK A;  4ASW C;  4WJN A;  4BBN F;  3U30 A;  4DHZ E;  2ZPY A;  3L13 A;  5FR6 A;  3T8M A;  2FID A;  3DPD A;  1A5R A;  2XK5 A;  4FHJ A;  4IW0 A;  4AJY B;  3VTW A;  2N9P C;  1LFD A;  4GGQ A;  4CHK A;  3X0W A;  2EMS A;  2GBR A;  2KTR A;  1WZ0 A;  2A5U A;  2CHZ A;  2UWQ A;  4FJY A;  4LDT D;  3QA8 A;  4GSW A;  1WF9 A;  3ZDM C;  2LZ6 A;  2MBE A;  4J6I A;  1IP9 A;  1I42 A;  3B1L X;  1VD2 A;  3SDL C;  2L05 A;  2KDE B;  2KXJ A;  2L00 B;  3APC A;  2KLG A;  4GU2 A;  1GC7 A;  2NBV B;  5G2N A;  2RD0 A;  3V60 A;  2JWZ A;  1KM7 A;  2IYD B;  2O2V B;  1Q0W B;  3TMP B;  3ALB A;  3I3T B;  3H9D A;  4ZRJ A;  1M94 A;  3JSV A;  4MM3 A;  4OVV A;  3UF8 A;  1ISN A;  2C9W B;  4NJ7 A;  1YQB A;  4W9D A;  2KFJ A;  4EOY A;  5G55 A;  2LVQ A;  1NDD A;  2M8S A;  1WH3 A;  4RM8 A;  2ASQ A;  2KD0 A;  2M17 A;  3PGE A;  3DVN V;  2MBH A;  4BKS A;  4WWN A;  1P98 A;  4FJZ A;  2FAZ A;  4GDK A;  4WJP A;  1E90 A;  1WI0 A;  3NZS A;  4FBJ B;  4TV3 A;  2LGY A;  2VRR B;  4IUM B;  3A9J A;  4HDO A;  5IAA C;  2O6V D;  2WX1 A;  3PLV A;  2G45 B;  4I6P A;  3GOE A;  2KAN A;  4M0W B;  3QC8 B;  3A9K A;  1WGG A;  2KKC A;  3L10 B;  4BKG A;  2MP2 B;  2KX0 A;  2L3Z A;  3DBL I;  1SE9 A;  3WIM A;  1WZ3 A;  3H7P B;  3PTF C;  3C0R B;  1V5T A;  4PYU A;  3A4S C;  3N3K B;  4KIK B;  4BBN C;  1WJN A;  2MBO A;  4ICU A;  1E5W A;  3WAO A;  1WFY A;  1GUA B;  1OEY J;  4KZ0 A;  1UBI A;  2D07 B;  3DBS A;  3ZTC A;  2AL6 A;  4GN1 A;  4M8N A;  2BWF A;  3A33 B;  1P3Q U;  3VAW A;  2WX0 A;  1UD7 A;  4FN2 A;  4RMA A;  4AJW A;  2IY1 B;  2PE9 A;  3ZLZ A;  3ONS A;  2DYM A;  4ZDV A;  1EF1 A;  5AZH A;  4XX5 A;  3ZW3 A;  4ZRI A;  3BY4 B;  3ZNH B;  2MRP A;  5C1Z A;  2LI5 A;  1Y8R C;  5D7G A;  1WYW B;  3OLM D;  3ECI A;  3VXW A;  4GOC A;  5JZE B;  3LJ3 A;  3R7Q A;  2FCS A;  1WM2 A;  2OOB B;  5L83 A;  2AYO B;  5DPR A;  5JH5 C;  3NS8 A;  2NPT B;  4MSM B;  4MDK E;  3JSV B;  1V5O A;  2JZ3 B;  2Z59 B;  4HDQ A;  4DHZ B;  3ZNG C;  2JT4 B;  1TZ1 A;  3UIO B;  3VFK A;  4BKT A;  1GNU A;  1TGZ B;  3QK0 A;  3VDZ A;  2KMC A;  2L7R A;  2D2Q A;  2RGF A;  1XQQ A;  4HJK A;  4HCP B;  5L95 C;  2Y5B B;  4LJO B;  3QQ8 B;  4IWO A;  3X23 A;  3RUI B;  3L16 A;  3R3M A;  4W9K A;  4GDK B;  3RUL A;  3SD5 A;  2FCN A;  1Q5W B;  1LQB A;  2NVU I;  2DYB A;  4W9C A;  3RCZ A;  1WGH A;  4B9K A;  2D10 A;  2RR9 A;  1OGW A;  2OJR A;  4K7S A;  3A9J B;  5E6O A;  2KWC A;  3MTN B;  1L7Y A;  2KFK A;  2J0M A;  3QWZ B;  1WJU A;  3A9K B;  1CMX B;  4MGI E;  2N9X A;  1V86 A;  3IVF A;  3U8Z A;  2JRH A;  3ZNI D;  3QJZ A;  2KK8 A;  3TCA A;  3U7D A;  2JVC A;  1V81 A;  4MEL A;  5LLI A;  1G6J A;  3EHV A;  1I35 A;  4XZ4 A;  4PS3 A;  1Z2M A;  1WX7 A;  3PRZ A;  1YX6 B;  4DXA B;  2NS5 A;  2L0T A;  4GDL A;  4DDI D;  1RFA A;  2KVR A;  2LXA A;  3VVW B;  2N4F A;  1QZE A;  4FA6 A;  2NBU A;  4KDI C;  4NQK E;  2KWV B;  3SHQ A;  3PV1 A;  4PS8 A;  2ZNV B;  3KUC B;  3N30 A;  5BO4 B;  2LAS A;  3L08 A;  4CYE A;  4MGY E;  2J0K A;  4HK2 A;  5D94 A;  2MCN B;  1UBQ A;  2RPQ A;  3PPA A;  4JGH B;  4IM0 A;  4B6W A;  1UH6 A;  2GBN A;  4HPM B;  4FLH A;  4A20 A;  5E6P A;  1J8C A;  5CHV C;  3PHX B;  4WJQ A;  2LUE A;  1S3S G;  3NY5 A;  5LXH A;  4MSQ B;  1JRU A;  1C3T A;  2PEA A;  2KTF A;  1E8Y A;  3EFU A;  2KDF B;  2HD5 B;  4II2 B;  4NAW A;  1J0G A;  4W9L A;  3RD2 A;  2MA9 B;  3D32 A;  4EEW A;  2JRI B;  3QHT A;  3AI5 A;  1IPG A;  2DYO A;  5E6N A;  2KJH B;  1LXD A;  3ZUN A;  2BGF A;  3KW5 B;  3W1S C;  2FIF A;  2MBQ A;  4FJV B;  3UQB A;  3K9P B;  4LJP B;  1ZGU B;  3RZW C;  3UIP B;  3L17 A;  3L0W B;  4FHK A;  2LGX A;  2JXX A;  1S1Q B;  1V49 A;  1WXA A;  4ZRK A;  4DWF A;  4G50 A;  1R4N I;  4IG7 B;  3ZTD A;  3PSE B;  1WX9 A;  3QIJ A;  2MWS B;  2BKR B;  3MHS D;  4F7Z A;  3DBR I;  5HKH A;  2DAJ A;  1Q1O A;  2M0X A;  4M8M A;  4AOF A;  4W9F A;  4EZL A;  1WRD B;  2KNB A;  2LXC A;  3APF A;  1E7V A;  2GOW A;  3WAP A;  3WA0 A;  2CU1 A;  2FNJ B;  2WDT B;  1OTR B;  1YIW A;  4KSK C;  2EMT A;  2NCN A;  2RSU A;  2R2Q A;  2XBB C;  2LD9 A;  2XK5 B;  2LWP A;  3M95 A;  4KDL B;  3DVN U;  5AZG A;  3RYT A;  4E74 A;  3M62 B;  4K81 A;  2IY0 B;  4II3 B;  2Z0E B;  1WY8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...