2C7HA

Solution nmr structure of the dwnn domain from human rbbp6
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
86
structure length
86
Chain Sequence
GPLGSMSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dwnn, a Novel Ubiquitin-Like Domain, Implicates Rbbp6 in Mrna Processing and Ubiquitin-Like Pathways
pubmed doi rcsb
source organism Homo sapiens
molecule tags Ubiquitin-like protein
molecule keywords RETINOBLASTOMA-BINDING PROTEIN 6, ISOFORM 3
total genus 18
structure length 86
sequence length 86
ec nomenclature ec 2.3.2.27: RING-type E3 ubiquitin transferase.
pdb deposition date 2005-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08783 DWNN DWNN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2c7hA00
4MJSA 2Z59B 2Z0EB 1IYFA 4GDKA 3RD2A 2Z0DB 4RM9A 2M1MA 4W9EA 2NS5A 4AUQC 1NBFC 1YQBA 1GJZA 2MLBA 3WAMA 2VRRB 4W9HA 3IFWB 4IC7B 4PS7A 2FIFA 3UIOB 3W1SA 2PE9A 2JRHA 3B0AA 1ZW7A 3A1QA 3H9DA 2EMSA 3T8MA 3NOBA 1OQYA 2D11A 3QHTA 2KWVB 2DZMA 3N30A 2WX0A 4DWFA 3RYTA 3M3JA 3OLMD 1V2YA 2KDEB 2W9NA 2K6DB 2JF5A 1WJ6A 4BOSC 3WAPA 3TL5A 2C7MB 1MG8A 1WXVA 4WWOA 2LRUA 4MH0E 2J0JA 3M63B 3MTNB 4KSLC 1WGDA 5FR6A 3OJ3A 4PS3A 1WIAA 4CYEA 3ONSA 1R4NI 1P98A 2EMTA 2KVRA 1WX9A 3VUXA 3L0WB 2N9EB 3Q3JA 4EFOA 1OEYJ 3PPAA 4GMVA 3SDLC 5L83A 3NHEB 4DHZB 5JHAA 1S3SG 1WX7A 4JIOU 1RLFA 2K6QA 2LJ5A 2WYQA 2FIDA 1V9JA 4FN2A 2KJHB 2KX0A 1WGRA 4DXAB 3CMMB 3ZNZB 5G2NA 3QX1A 2KTRB 2NR2A 1WZ3A 2KTRA 4EUTA 3KH0A 2KWUB 3DBRI 2IO1B 4FLHA 4LDTB 4EZKA 2L0FA 4DHZE 2FCSA 4K7SA 4DDID 4MGZE 2L7RA 3NZSA 3A9JB 3IVFA 1OEYA 2N1VA 4KDIC 3PT2B 2CR5A 4IG7B 4BBNC 3DVGX 1J0GA 1L2NA 1H8CA 2QHOA 5KHQA 1G6JA 5LLIA 4E74A 4FULA 4ZRKA 3PREA 2LWPA 5J17A 1WM2A 4IW0A 2L00B 1WZ0A 2MBOA 3V6EB 1SGHA 2GBKA 2KC2A 3CF6E 4GSWA 4ANUA 3L17A 3S2AA 2OJRA 2BPSA 4MM3A 3B1LX 4KIKB 1VCBA 3WA0A 4URKA 2WX1A 2MSED 1KJTA 2KWCA 1L7YA 2KK8A 1WXSA 3ZNGC 3NY5A 2KD0A 2ZEQA 3ZUNA 3W1YA 2YLMA 3I3TB 2XK5B 3AU5A 4HLEA 3DPDA 2MX2A 1ZKHA 3H1UA 1RAXA 3KUZA 3TCAA 3P2BA 4JQWC 3A4SC 4MEMA 4P7IA 4EZLA 3APCA 3NZUA 3QARA 1E8XA 2KN5A 1GNUA 4KZCA 3IHPC 3VTWA 4FJVB 2KFKA 4HXDA 2MQJA 2K1FA 2KC1A 4WJPA 4CHKA 3OAWA 3ZNID 2KANA 3DVNV 4KIKA 2PEAA 2FCMA 3MHSD 2JUOA 2JPHA 3QCAA 4MSMB 2LXAA 3R3MA 4ANXA 2ZVNA 1ZGUB 3JSVB 1HE8A 5BO4B 3PGEA 3DOWA 2KQSA 4IWQA 3TMPB 3VFKA 1UBIA 3C0RB 2J0KA 1OTRB 4W9IA 3ZTDA 2K8HA 3L16A 3MJWA 2ZJDA 2ZNVC 4IWPA 5GMVA 3KYCD 2L0TA 2O6VA 1V5TA 5CTRC 2DHZA 1I42A 3PSEB 4W9JA 2J0MA 1R4MI 3VVWB 4XZ4A 1YD8U 3PS6A 1UGMA 3RT3B 3ZRFA 4BKGA 4MSQB 4BFRA 4FBJB 2RR9A 2JY6A 4II2B 1Z5SB 4M8NA 1WM3A 1WR6E 4NJ6A 4F7ZA 4BBNF 1CMXB 2MWSB 3DVNU 4GGQA 3V62A 1E7VA 4KVGB 3A9KA 3DBSA 2CHWA 1BT0A 1H4RA 1T0YA 2BYEA 2LVOA 4W9GA 3PLVA 3UF8A 2V1YA 4NNJB 3A9JA 2BKFA 3H7PA 3TBLD 5DPTA 5AZHA 2FCNA 3QA8A 4XX5A 3ZW3A 3U7DA 2C5LC 2RPQA 3DDCB 5IA7A 5DCNA 4LJPB 4K7WA 3VDZA 4A20A 1KM7A 1WE7A 2JZ3B 1P3QU 2IO3B 3VH3B 4W9LA 1Q1OA 3Q3FA 4HJKA 2O6VD 3V60A 1KLVA 1UD7A 3SU8X 2PPHA 4JLCA 4B6WA 2M17A 3R66C 1GG3A 1XQQA 2BWES 2C60A 4E3CA 4I6NB 4WJOA 1P9DU 1YX6B 2AL6A 1ISNA 3IG3A 4NPNA 3UQBA 3VTVA 1QZEA 2ASQA 5LXIB 1WF9A 2RGFA 3DQVA 5G55A 1IPGA 4ASWC 5D7GA 3RCZA 3RZFA 4KDLB 2D3GA 2AEHA 2KDBA 2N4FA 2IY1B 2MBEA 1WR1A 3PLUA 2NBWB 3LJ3A 2RSUA 1V5OA 2BWFA 3RZWC 2DX5B 2K8BA 1V81A 1RRBA 3BINA 4NQLB 4CO7A 5EDSA 3HM6X 5KHOA 4YL8A 2V3SA 1TGZB 2C7NB 4LDTD 4WQOB 5CX3A 2HTHA 2O2VA 3VHTC 2LXCA 1LFDA 1E8WA 4TUUA 2BYVE 1XD3B 2LGXA 3KUCB 1TZ1A 5DPSA 1M94A 4GOCA 1VD2A 4HWIB 2NPTA 4FHJA 4IWOA 3SHQA 2BKRB 3QWZB 4K7UA 4M0WB 3QQ8B 2R2OA 2ZCCA 2MCNB 4BVUC 2KXJA 4TV3A 2KTFA 4RMAA 3ZO5B 1SIFA 3EFUA 4TQ0A 2LUEA 1WGGA 2D2QA 3JSVA 1A5RA 5CHWA 2LGYA 1NI2A 4F1SA 2M4NA 3QC8B 4B9KA 1EUVB 1WFYA 3ML9A 3DBHI 2M8SA 3ZDTA 2D07B 4ZRIA 2KJRA 2FNJB 2IBIB 2KHWB 4J6IA 4X57B 1GC7A 3O65B 3PRZA 4KSKC 4AOFA 2XEWA 2AWTA 4GU2A 3GZNI 1K8RB 5IAAC 1U4AA 3B08A 3QIJA 2I1JA 2DAFA 4GDLB 2KMAA 5D6JB 4NQKE 4W9KA 1RFAA 3PV1A 4G50A 3BY4B 3N3KB 2CHZA 5J2RA 2BGFA 1E5WA 2CKHB 4HCNB 2O2VB 1Q0WB 3QJZA 3ZRCA 1EO6A 2DENB 2LZ6A 1FXTB 4G3XB 3ZKJC 4FHKA 1JRUA 2JWZA 3JYUA 5E6OA 1D3ZA 3U30A 3WANA 3EECA 2D10A 1Y8RC 2MBHA 4WWPA 2WWZA 5DPWA 1WMHA 3ML8A 4AJYB 3ZDMC 2GOWA 2I1KA 2K25A 4HCPB 3UIPB 4HPMB 2IY0B 4BKSD 4JGHB 2N9PC 4OVUA 1AARA 4MGIE 3APDA 1F9JA 2HD5B 5L95C 4II3B 2G3QB 2KLCA 2WDTB 5TR5A 2JT4B 3KYDD 1OGWA 2V4LA 1Q5WB 2DZKA 4MJSB 2N7DA 2IO2B 1XT9B 1WRDB 3ECIA 4I6PA 4MELA 2ZCBA 2ZZPB 1PQSA 4F8CB 1WH3A 4DK5A 2MA9B 4ZYNA 2LVQA 3HHMA 3AU4A 3ZVVA 1UH6A 2J7QB 4TKNA 3APFA 2LVPA 4LCDE 1E90A 3A9KB 1Z2MA 4G0NB 3W1SC 3L10B 4ZRJA 1WXAA 4NY0A 3X0WA 4ICUA 2MP2B 3PVLA 4EOYA 5C23A 4BKSA 2DYBA 2JVCA 3A4RA 2L05A 5E6NA 2KOXA 3KUDB 1WJUA 2DZJA 1IP9A 2NPTB 4HPLB 3HK0A 4GXBA 3AXCA 3R7QA 2XK5A 3WIMA 1WJ4A 4HVBA 2HE7A 2LGDA 3ALBA 4K1RB 2A5UA 1EF5A 1YIWA 2DAJA 5JHBA 2KFKB 4MGKE 5J18A 2L76A 4B95A 4DHJD 2GBNA 1UZXB 2GBRA 2R2QA 1C3TA 2Y5BB 1WE6A 5CHVC 1NDDA 3ZLZA 4FADA 3H7SA 3L13A 4ICVA 1E8ZA 4AP4C 1LM8B 3DBLI 4GB9A 2CHXA 4EKUA 2IYDB 4E71A 2DZIA 4PYUA 3TJPA 3WAOA 2KX3A 3QK0A 2G4SA 2NCNA 4KZ0A 4OVVA 3QAQA 2GBJA 2LASA 1WXMA 4WAAA 1WX8A 2A4ZA 2ZPNA 2N9XA 3CSFA 4FJZA 3T9LA 3GOEA 3JVZX 3PHXB 1V49A 5CHFA 3UINB 2C7HA 4XC2A 1LQBA 2JXXA 2PJHA 5DPRA 3UGBB 3ZIMA 2ZNVB 4TQ1A 4WJQA 3VH4B 2MBBB 3PHWB 1KOTA 1P0RA 3VQIA 3IBEA 2MBQA 3H6NA 3PRPB 2XBBC 4DBGA 2ZVOA 4WJNA 2RD0A 3D32A 4PS8A 2M0XA 1J8CA 4NAWB 1V80A 2FAZA 1E8YA 2G4DB 4MGYE 4LJOB 3V61A 2O6VB 4GN1A 2L8JA 1WYWB 1EF1A 1WGHA 4EEWA 1GUAB 1TBEA 3U8ZA 2MP2A 2KNBA 2DYMA 2L3ZA 2NBVB 3VTUA 1P1AA 1WI0A 2AYOB 2K39A 1V86A 3ZNHB 4AJWA 2LI5A 2AL3A 3M62B 2NVUI 2FUHB 3JW0X 3DVGY 4M8MA 4EZJA 3OJ4B 2PE6B 3TIXA 3X23A 1C1YB 1TTNA 2KO3A 2ZPYA 5JZEB 4DHJB 4A3PA 2JZZA 3K9PB 5AZGA 1WMHB 4PYZA 4MDKE 2K8CA 2N1WA 3PTFC 3M95A 3ENEA 4BOZB 4ANWA 3RULA 1LXDA 1X1MA 5E6PA 2KMCA 3K9OB 3R7RA 2IZVB 3AULA 4HK2A 3ZTCA 3N32A 2CS4A 2KQ7A 3LDZE 4W9CA 5LXHA 1WY8A 2JRIB 2UWQA 3WALA 1J19A 4W9DA 4FA6A 3A1QB 5JH5C 1UBQA 4ANVA 4N9F4 2DYOA 3CSTA 3HM3A 3EC8A 2KJ6A 4FJYA 2IO0B 4GDLA 4I6LB 5D2MB 2GMIC 3UQAA 2EKEC 3V6CB 1UELA 2C9WB 2OOBB 3VUYA 1I35A 4W9FA 3VAWA 1V6EA 4A3OA 1YX5B 2KFJA 5AZFA 3L08A 2CU1A 5AEKB 4IM2A 3PRMB 4IUMB 2YVCA 3NS8A 4GDKB 4AWJA 5C1ZA 2LD9A 1WJNA 2NBUA 3KW5B 5D94A 3AI5A 3VXWA 2KKCA 2MW5A 3L54A 4WWNA 4RM8A 4G11A 2BF8B 3KVFB 4NJ7A 3H7PB 2GBMA 4ZDVA 2MRPA 2KZRA 4JL9A 2G45B 1GC6A 3A33B 4GIVA 1YJ1A 1SE9A 4IM0A 2KDFB 3EHVA 2FCQA 4KV2A 2HJ8A 3RUIB 2REXA 3HIZA 4HDQA 2UYZB 2KDIA 2BYFA 3DCGA 4HDOA 3PZDA 2B3AA 4NAWA 3VUWA 3SD5A 4DDGD 4BKTA 1E7UA 2LRWA 1WGYA 2KLGA 5HKHA 4IM3A 4K81A 2N7EA 1S1QB
chains in the Genus database with same CATH superfamily
2Z59B 2Z0DB 1DGJA 1NBFC 5MPOA 4W9HA 3IFWB 4IC7B 2GLSA 3T8MA 1OQYA 2LGIA 4YTNB 3N30A 2WXNA 2WX0A 4DWFA 3RYTA 2W9NA 2K6DB 2BBCA 2QIEB 4BOSC 3TL5A 4L23A 1WGDA 5FR6A 3OJ3A 1R4NI 2EMTA 1WX9A 3VUXA 3L0WB 1YQ3B 3V05A 5L83A 3SDLC 4DHZB 4JIOU 1ZP0B 2K6QA 1F77A 2LJ5A 4FN2A 2RPVA 4YSXB 2X38A 2KJHB 4YTPB 4ZYSA 3CMMB 3MP9A 1WZ3A 2UU7A 4DDID 1K52A 4MGZE 3EUB2 3IVFA 4IDIA 2CR5A 4DQOC 1IUEA 5KHQA 4FXCA 4FULA 1JWBD 3AE8B 1JQ4A 1WZ0A 2MBOA 2WDRB 1XXGA 2GBKA 1IGCA 1SE2A 3S2AA 3DWGC 1VCBA 3WA0A 1F2RC 1I4PA 1BXTA 1L7YA 2KK8A 4H2AA 1B9RA 3H1UA 3KUZA 4KKIA 2LMCA 4MEMA 2KN4A 3APCA 3QARA 2KN5A 4KZCA 3VTWA 1FEHA 2KFKA 3NVVA 4LLGM 1ET9A 4KIKA 1PGXA 2PEAA 2FCMA 2KT7A 2VZKB 2WXMA 1HE8A 3T3OA 3ZTDA 1WXQA 4M01A 4P16A 1JALA 1E0ZA 3PSEB 3VVWB 3PS6A 4BKGA 4Q2JA 3Q6BA 1HZ5A 2RR9A 4RF0A 1Z5SB 4M8NA 4KGTA 1WM3A 1CMXB 1E7VA 3PLVA 1DOXA 1FXAA 1SB3C 3H7PA 2FCNA 3DDCB 4K7WA 1CK1A 1I4QA 3Q3FA 3V60A 2O6VD 1YMHE 3SU8X 1GG3A 4S0RA 4I6NB 3FILB 3P4QB 5LXIB 3DQVA 3RCZA 4KDLB 2N4FA 1L4DB 4WURA 3LJ3A 3TUOA 2BWFA 2SAKA 3RZWC 2DX5B 1FRRA 2B76B 4CO7A 1FFUA 3MHZA 3BYYB 4WQOB 4TUUA 2BYVE 2W3SA 1MPEA 5DPSA 2QJLA 3UI3A 1JROA 4HWIB 2NPTA 1VRAB 3WCQA 3TEYA 4K7UA 3QWZB 3IT4B 4ITKA 4M0WB 1L6UA 1FM0D 3ZYYX 2WXLA 2N9LA 3ZO5B 3I5JC 1SIFA 5IOIA 3EFUA 2JQRB 3B9JA 2M4NA 4BAXA 1V1PB 3QC8B 1MI0A 3ML9A 3DBHI 2M8SA 3B2FA 2D07B 4ZRIA 1N61A 2IBIB 2KHWB 4J6IA 1GC7A 1GB1A 3BWUD 2XEWA 3W2DA 2FE8A 3AE6B 4GU2A 1K8RB 5IAAC 3AECB 3B08A 3H8HA 2I1JA 5D6JB 3N3KB 3SR6A 1E5WA 2CKHB 4HCNB 4NZLB 2JYTA 3ZRCA 5D3DA 2WXOA 2DENB 1IBXA 2LZ6A 1C4CA 4FHKA 1EWCA 5E6OA 3AE5B 1E7PB 1WSPA 5DPWA 1WMHA 3NVWA 4AJYB 3ZDMC 1FMAD 3BYTB 4HCPB 4RF1A 3Q69A 4BKSD 3P4PB 3OG5A 3GE3C 1AARA 4II3B 3GZNB 1QOAA 3MC0B 2K0PA 5HHDG 2WP9B 3KYDD 1Q5WB 1RYJA 2DZKA 2ZCBA 4ZYNA 1AW7A 4ARIA 4B0MA 3A9KB 1Z2MA 3NVZA 4G0NB 3ZGZA 1KTKA 3Q8AA 2MP2B 2KDMA 2JVCA 2L05A 2D5GA 4LNNA 2NPTB 4HPLB 3HK0A 3R7QA 2XK5A 1Q10A 2FBWB 2DAJA 1YOVB 3BVGA 2KFKB 2XNAC 1FCCC 1QQRA 2BS4B 2E6XA 1NDDA 4ICVA 1E8ZA 2V4IB 1FPYA 4ZOHC 4PYUA 3RNBC 3VRBB 2NCNA 4P1CC 2GBJA 1WXMA 4XDCA 2VZKD 3ZJTA 1F2RI 1M4VA 4FJZA 4YT0B 4YWGG 1NENB 1V49A 4XC2A 2JXXA 2CJNA 2SEBD 1KOTA 3FKYA 3IBEA 2RD0A 3D32A 3W9CB 1J8CA 2HTME 1V80A 2FAZA 1E8YA 4MGYE 3AEFB 2L8JA 2BB5A 5EE9A 1EF1A 5FKAC 3HRDD 1TBEA 1QKZA 2MP2A 2KAJA 3I63C 2K39A 1V86A 4UDUC 3M62B 2FUHB 4M8MA 1IBXB 4RCOA 2KO3A 2JZZA 4NJCA 2K8CA 2N1WA 1BUIC 3DBHB 3ENEA 3RULA 5EE1A 1X1MA 5E6PA 2KMCA 3AULA 4TSSA 1TKEA 4W9CA 1WY8A 2JRIB 2LEKA 1J19A 5IKCM 5JH5C 1UBQA 4ZRPA 3CSTA 3UQAA 5D2MB 2GMIC 1DOIA 1UELA 2IGGA 2WGSA 1HEZE 1V6EA 1YX5B 2KFJA 3L08A 2CU1A 4AS1A 3SEBA 3PRMB 2YVCA 2LD9A 2NBUA 3E9SA 1JWUD 4A6QA 1TS2A 4WWNA 4XWTA 2BF8B 3KVFB 4A9AA 2KZRA 4GIVA 1YJ1A 3ZJVA 1SE9A 2KDFB 5GXGB 4KV2A 2X8XX 1P7FA 2REXA 2BW2A 3N20C 1PFDA 2LRWA 1VR9A 4M00A 5HKHA 1TKGA 2INPE 4IM3A 4WWMA 1EU4A 1IYFA 2INDC 3RD2A 1GJZA 2IGHA 2NS5A 2LHEA 3Q8BA 1LO5D 1V1OA 1SSNA 2FIFA 4CQNA 3B0AA 1RFKA 3NOBA 2WU2B 1VDVA 3AMZA 1WJ6A 2C7MB 1MG8A 4WWOA 4MH0E 1JWAD 2K3UA 3M63B 4PS3A 3ONSA 4RH6A 2WLBA 3J9CA 1I4XA 5JHAA 2LGSA 1WX7A 2WYQA 4OZCA 1C78A 2MJEA 3Q8CA 1C9FA 1HXYD 2KTRA 1I4HA 4EUTA 2PVGC 2IO1B 4LDTB 2ON8A 2L0FA 4DHZE 1P7EA 1OEYA 4KDIC 1J0GA 1H8CA 2QHOA 5LLIA 4E74A 3PREA 1WM2A 2ZW0A 5LNK1 1SGHA 3L17A 1SIJA 3HUIA 3ZNGC 2KD0A 2ZEQA 3I3TB 1ZXHA 4ACFA 2XK5B 4HLEA 3DPDA 4ZHPA 1ZKHA 3A4SC 1RWSA 1E8XA 1T3QA 4FJVB 2AQ1B 4CHKA 2KC1A 2KWDA 2WHIA 1DOYA 1TY0A 2BS3B 1ACCA 3DVNV 2XN9C 1NYQA 1DYQA 3MHSD 2JPHA 4MSMB 1CJEA 5BO4B 4IWQA 1UBIA 3C0RB 1R4NB 1ZE3D 3L16A 2ZNVC 2KQ4X 2L0TA 1V5TA 2DHZA 3BK1A 4W9JA 3LXFA 1UGMA 3RT3B 4FBJB 4II2B 2PTLA 2L32A 3SFEB 4NJ6A 4F7ZA 4BBNF 2MWSB 4GGQA 3DVNU 1T0QC 3V62A 2KVZA 1QF6A 2G1EA 1CQVA 4NNJB 2RDBC 2BKFA 4RNAA 5AZHA 1FFVA 1I4GA 4IOIE 1YQ4B 2YEPF 4HRSA 1P3QU 4W9LA 1UD7A 2GB1A 3Q3NC 2ACZB 4B6WA 2BWES 2C60A 2GI9A 4WJOA 1YX6B 2AL6A 4NPNA 3VTVA 4USAA 2RGFA 5G55A 5D7GA 1TZOA 2LUMA 2IY1B 3PLUA 4OW0A 2NBWB 2RSUA 3BINA 4NQLB 1V81A 2V3SA 4LDTD 5CX3A 1QOBA 2O2VA 3P63A 1LFDA 1E8WA 4NAMA 3KUCB 3AE1B 1KH0A 3AE3B 4GOCA 1UWMA 2D3CA 1BMLC 3IAS1 4FHJA 3O13A 2M56B 3QQ8B 2R2OA 2ZCCA 2MCNB 4TV3A 1PGAA 3SFDB 2MHJA 2WNMA 4TQ0A 1WGGA 1JCKB 3W5UB 4KX6B 1N63A 2FNJB 2PMVA 2MJDA 3O65B 3PRZA 4AOFA 1ZXIA 2AWTA 2Y5PA 1WWTA 3HVZA 4GDLB 1XLNA 1YJIA 1ROEA 4ZHOA 4NQKE 4W9KA 1SBBB 1MG4A 1RFAA 4G50A 1D5ZC 2CHZA 5J2RA 2BGFA 1EO6A 3JYUA 2JWZA 2QC8A 4HPPA 3U30A 3EECA 2D10A 2J42A 1EM7A 2WWZA 2GOWA 2OJWA 1TIFA 2I1KA 4KGSA 2QDFA 2V3NA 4HPMB 4JGHB 3C8YA 4OVUA 5IP4D 2G9HD 4XE0A 3Q3MC 5L95C 1HQRD 1WGKA 4A8XC 1OGWA 5FR3A 4MJSB 2N7DA 1WRDB 1E10A 1PQSA 1SE4A 1UH6A 4P6VF 3VRAB 4ZRJA 4NY0A 3PVLA 4HEA1 4BKSA 5E6NA 2KOXA 3KUDB 3BVZA 2DZJA 3WIMA 1WJ4A 2WXGA 4TMAB 3AE7B 3RI7C 1EF5A 1YIWA 2D3BA 1YN3A 5JHBA 4MGKE 2L76A 4B95A 4N59A 4DHJD 2CU3A 2R2QA 2TSSA 2Y5BB 1TKYA 1AWDA 4US8A 3RNAC 1LM8B 1L0YB 3DBLI 2CHXA 1T0RC 2GRIA 1GB4A 2G4SA 1R7SA 3QAQA 1FNVA 2HJ1A 4S17A 3JVZX 1KRHA 3PHXB 5CHFA 1ENFA 2C7HA 1LQBA 3UGBB 4WJQA 2MBBB 3PHWB 3VQIA 3RNCC 3PRPB 4MACA 2V0GA 1TS4A 4NAWB 4LJOB 1JWSD 3C19A 1WGHA 4EEWA 5FK9C 4LNIA 2L3ZA 2NBVB 1L5PA 3VTUA 1P1AA 1WI0A 2BYTA 1QILA 3R2TA 3ZNHB 4AJWA 2LI5A 2AL3A 3N1YC 3VR9B 3JW0X 3DVGY 3OJ4B 2PE6B 1XEEA 1FXIA 3K9PB 5AZGA 2QILA 3PTFC 1C76A 4O1NA 4BOZB 3KLSX 1LXDA 1MVKA 2V9HA 2WXJA 1I7HA 2N7JA 2UWQA 2AQ2B 2QCZA 2BT6A 4ANVA 3HM3A 3V6CB 3MC9A 3BIID 2KACA 4A3OA 4XWWA 4IM2A 3NS8A 4MH8A 5D94A 3L54A 1JW9D 1N5WA 1VJKA 1XLOA 2L83A 4ZDVA 2MRPA 1T6BX 4JL9A 2G45B 2M0AA 1PGBA 4IM0A 3EHVA 5C3JB 1WRIA 4L1BA 4M0WA 1PYWD 2ICIA 1PUTA 4HDOA 3U4EG 4OVZA 3SD5A 4DDGD 1JMLA 2OHFA 2LJIA 4K81A 3NUHB 2N7EA 3ETRA 3WAPA 1MJDA 4MJSA 2AQ3B 2FUG1 4C56C 2M1MA 4AUQC 1YQBA 2MLBA 1FD6A 3WAMA 3NJTA 4PS7A 1I4RA 1ZW7A 2DLBA 1SJED 2D11A 3PO0A 3QHTA 2DZMA 1GAQB 1J7AA 2BQQA 1V2YA 2KDEB 1SXTA 2JF5A 2RMMA 1WXVA 2LRUA 2J0JA 3MTNB 3U52E 1V8CA 1WIAA 4KKJA 4CYEA 1T5XD 1RM6C 2KVRA 3Q3JA 4EFOA 2WQYB 1VZ8A 3PPAA 3N1ZC 1RLFA 2H89B 2FIDA 2K22A 4WIPA 5G2NA 2KTRB 2NR2A 2KWUB 2PVOD 3DBRI 4FLHA 3AN1A 3T3NA 1HA5A 2FCSA 2YEPB 2L52A 2L7RA 3NZSA 3AE4B 2N1VA 3PT2B 4BBNC 1L2NA 3DVGX 1B1ZA 4C7YA 4IW0A 1E6EB 2L00B 2LFIA 3HVDA 3KWVA 3CF6E 3BK2A 4ANUA 2BPSA 4URKA 2I2YA 2WX1A 2MSED 1D5XC 2KWCA 3ZUNA 4B0EA 3RMKC 2PLPA 2MX2A 3TCAA 1RAXA 3P2BA 4JQWC 4P7IA 4EZLA 3NZUA 1GNUA 3IHPC 4PT5A 1ZUD2 4ANXA 3R3MA 2ZVNA 3JSVB 3PGEA 3TMPB 1J7CA 2J0KA 3AEEB 3EFCA 3DHIC 4W9IA 3MJWA 2ZJDA 3CIRB 5GMVA 3KYCD 2D3AA 3PZ8A 1I42A 4MM3B 2JU6X 5IN7A 1XLPA 2QMTA 3ZRFA 5BMHA 4MSQB 4BFRA 1L4ZB 2JY6A 1WR6E 1SEBD 4KVGB 3A9KA 5HFYA 3DBSA 3ZXRA 1T0YA 1H4RA 2BYEA 1GOZA 2V1YA 3A9JA 3AEDB 3TBLD 3U2SC 3QA8A 3ZW3A 3U7DA 2C5LC 2RPQA 5IA7A 5DCNA 3VDZA 1QLBB 4A20A 4BZAA 4N6EB 3U7ZA 2PPHA 4JLCA 3AM9A 3EA6A 1YNTE 3ZQ4A 1XQQA 4E3CA 4C80A 1P9DU 1UUPA 1ISNA 3CWIA 3IG3A 3UQBA 1QZEA 2ASQA 1IPGA 1TYGB 3RZFA 5BYRA 2KDBA 2IJ0A 4REZA 4L2YA 1N5XA 2MBEA 1WR1A 3Q14C 4YSYB 5EDSA 1RRBA 2WDVB 5KHOA 3PZ7A 4YL8A 1TGZB 2C7NB 1WYGA 2HTHA 3NS1A 1XO3A 2LXCA 4WQMA 2MEKA 2LGXA 1VD2A 1F1HA 2WXIA 1CZPA 1MHXA 2DWQA 2KXJA 2KTFA 4RFBA 1TJEA 2LUEA 3JSVA 1A5RA 2J4XA 1N62A 4F1SA 1FIQA 1WFYA 2JYEA 3ZDTA 5H8YE 4LNOA 4X57B 3KWLA 3GZNI 3L4PA 1U4AA 3QIJA 5HG2A 1PDXA 3Q8EA 4YXDB 2KMAA 2H88B 3PV1A 3BY4B 5D3IB 1JRPA 3QJZA 1Q0WB 1VLBA 1D3ZA 1L0VB 3WANA 3AV8A 1Y8RC 5EE0A 5G5HA 2MBHA 5HI1A 4WWPA 2AX5A 3ML8A 2HDEA 4D2KA 4JWSC 3UIPB 2N9PC 3RN9C 4MGIE 2G3QB 2JT4B 3IXSA 1JWMD 1YN5A 2INCC 3ECIA 2BTEA 2ZZPB 1WH3A 4DK5A 1N60A 2LVQA 3AU4A 2NTSA 2WS3B 2JX5A 4IKGA 3ZVVA 2J7QB 2BVCA 4TKNA 3APFA 2LVPA 5JXVA 1E90A 3W1SC 1OFFA 1QOGA 2QEJC 3GP7A 3DBRB 4RGNA 5C23A 3A4RA 1WJUA 4GXBA 3AXCA 1HTQA 3RNEC 2HE7A 2LGDA 4AQ7A 4QAYA 3ALBA 2A5UA 2KMMA 4GLSC 1UZXB 2KYWA 1SE3A 1C3TA 3FILA 5CHVC 3BZDB 4P1BC 1Y56A 3L13A 4EKUA 4E71A 2DZIA 2W82A 2CJOA 3GE8C 2KX3A 3QK0A 4KZ0A 4OVVA 4WAAA 2LASA 1WX8A 3T9LA 3CSFA 3RFZB 3GOEA 4RGMA 2IDYA 4C4VB 2WDQB 3VH4B 4DXGA 2MBQA 3H6NA 2XBBC 4PS8A 3V61A 4GN1A 1WYWB 1GUAB 1D5MC 2KNBA 3W5VB 3MJ5A 2AYOB 3NG0A 2OEDA 1XLQA 2NVUI 4EZJA 2BB6A 3TIXA 1C1YB 1TTNA 1FCLA 4YTMB 2L1AA 3NZ3A 4DHJB 4A3PA 1YN4A 1WMHB 4PYZA 4MDKE 1NI3A 4ANWA 3P1MA 1UF0A 1ZDXA 3K9OB 3R7RA 3ZXVA 2IZVB 4US9A 4HK2A 4A90A 2KQ7A 5EE3A 2WXRA 3RPFC 4FA6A 3WALA 4W9DA 3I57A 3A1QB 2PKOA 4C00A 4GDLA 2V3PA 3VUYA 1I35A 2Y3AA 4W9FA 3VAWA 3E56A 3AB5A 5AEKB 2J53A 4K3BA 3P4RB 4IUMB 5C1ZA 4GDKB 3KW5B 2KKCA 2MW5A 3NRZA 4OZBA 4G11A 3VR8B 3A33B 3LB8C 1IGDA 2FCQA 2HJ8A 2ZW1A 3LYYA 1R4MB 2BYFA 2B3AA 4NAWA 4HJGE 3VUWA 4BKTA 2M19A 1GPXA 3ZLZA 2Z8LA 2Z0EB 4GDKA 4RM9A 5H92C 4W9EA 3RNGC 1MFWA 2VRRB 1STEA 5IO9A 3W1SA 3UIOB 2PE9A 2JRHA 1K53A 3A1QA 3H9DA 2EMSA 2KWVB 3M3JA 1KLGD 3OLMD 2W3RA 5G5GA 1C77A 3KQ4A 4KSLC 3DHGC 1P98A 2QSDA 1ZPSA 2N9EB 1OEYJ 4GMVA 3NHEB 4N58A 1S3SG 4XYCA 1V9JA 2WXKA 2KX0A 1WGRA 4DXAB 2DBYA 1LGRA 3AH7A 2K9XA 3QX1A 3ZNZB 3KH0A 1ET6A 3FC4A 4EZKA 2VH2A 4K3CA 2Y5CA 4M02A 4K7SA 3R8BA 3A9JB 4IG7B 3I9V1 1G6JA 4C4VA 5J17A 4ZRKA 2LWPA 3IT6B 2RDHA 3V6EB 4ZRQA 2KC2A 4GSWA 2I38A 2OJRA 4MM3A 3B1LX 4KIKB 2N9KA 4A55A 1KJTA 1WXSA 3NY5A 3W1YA 4WH4A 2YLMA 2PW9A 3AU5A 2WXPA 2LHDA 1D6EC 1XCTL 4J3OD 4HXDA 1T0SC 2MQJA 2K1FA 4WJPA 4YSZB 3OAWA 3ZNID 2KANA 3TEXA 2JUOA 3QCAA 2PIAA 2LXAA 1ZGUB 2JXTA 2EKIA 3DOWA 2KQSA 3VFKA 1C4AA 3ZJUA 2JSVX 1OTRB 2K8HA 3DWMA 4IWPA 2O6VA 5CTRC 1K50A 3R2IA 2J0MA 1R4MI 4XZ4A 1YD8U 1HTOA 3EGRA 3AEGB 2Q5WD 1D4BA 5I4DA 1KLUD 2CHWA 1BT0A 2EELA 4W9GA 3UF8A 2LVOA 4R3DA 5BMGA 5DPTA 4JWUC 1TS3A 4XX5A 3AEAB 4LJPB 2WXQA 1KM7A 1WE7A 1V97A 2JZ3B 2IO3B 3VH3B 1Q1OA 1SF0A 4HJKA 1KLVA 2JZPA 2M17A 3R66C 2INNE 3AE2B 1WF9A 4ASWC 2D3GA 2AEHA 2ONQA 5E6JA 1V5OA 2K8BA 2N0SB 3HM6X 2W54A 2NTTA 1NVID 5BYSA 3VHTC 4LTUA 1XD3B 2J52A 1V1PA 1TZ1A 4OHJA 1EWYC 1M94A 1ZDVA 4IWOA 2MH7A 1UNSA 2BKRB 1UGJA 4BVUC 5TSSA 4RMAA 3RNFC 2E3TA 3IAM1 2RDGA 1HZ6A 2D2QA 5CHWA 2LGYA 2R61A 1NI2A 4B9KA 1EUVB 2KJRA 4KSKC 2IPKD 2WU5B 1FNUA 2DAFA 4HKQA 1ESFA 3TEZA 1OQRA 1C4PA 4RGTA 3V3XA 1K51A 2O2VB 4LNFA 3ZKJC 1FXTB 4G3XB 1JRUA 3Q3OC 4DXFA 3TSSA 3OWEB 3URYA 1ZOYB 4LNKA 2WXFA 3B2GA 2K25A 1VZ7A 2IY0B 3GS2A 3APDA 4ARCA 1F9JA 2HD5B 3AE9B 2KLCA 2WDTB 3GB1A 1MHHE 5TR5A 1TS5A 2V4LA 3N1XC 4MELA 2IO2B 1XT9B 3SHQA 4I6PA 4F8CB 1AN8A 1L0XB 4XGAB 2MA9B 1XCQL 1KFYB 3HHMA 1XF5L 2IGDA 4LCDE 3L10B 4JE3B 1WXAA 1L6VA 3MC8A 4JX1C 3X0WA 4ICUA 1F0ZA 4EOYA 2DYBA 5BYQA 2JWUA 3MFGA 1IP9A 3Q2AC 1FRDA 4HVBA 4K1RB 3P42A 5J18A 2GBNA 2GBRA 5T8IA 1WE6A 1OQQA 1TT5B 4MT5A 1AYFA 1NEKB 4FADA 3H7SA 2WXHA 3ABVB 3FAHA 4AP4C 4GB9A 3AEBB 2IYDB 3Q8FA 1QT9A 1UWXA 4KGRA 4PK1A 4JPSA 3TJPA 3WAOA 1VZ6A 4C7ZA 2A4ZA 2ZPNA 2N9XA 5BMIA 3UINB 5AUIA 1A70A 3NVYA 2PJHA 5DPRA 3ZIMA 2ZNVB 4EE2A 4TQ1A 1P0RA 4DBGA 2ZVOA 4WJNA 1YJJA 4HKZE 2M0XA 2G4DB 2O6VB 3TEWA 3U8ZA 2W55A 2DYMA 3N9YC 5C2TB 1C79A 1TY2A 2MJ3A 3X23A 5JZEB 2NMQA 2ZPYA 2DNFA 2VH1A 3DHHC 4HROA 1N6ZA 3M95A 2K5PA 1SJHD 5AUKA 3ZTCA 1QOFA 4RGOS 3N32A 2CS4A 3LDZE 4LK0M 5LXHA 1FNWA 1J7BA 4N9F4 2DYOA 3EC8A 2KJ6A 4FJYA 2IO0B 4I6LB 2EKEC 2C9WB 2OOBB 1F52A 3DBLB 5AZFA 4AWJA 1WJNA 3BVMA 3AI5A 3P4SB 3VXWA 1E9MA 4RM8A 4NJ7A 3H7PB 2GBMA 4XDDA 1GC6A 2BS2B 4WAFA 4OZAA 3RUIB 3HIZA 4HDQA 2UYZB 2KDIA 3DCGA 1FO4A 3PZDA 1KF6B 1E7UA 1WGYA 2KLGA 1NYRA 1EU3A 1S1QB
chains in the Genus database with same CATH topology
4MJSA 2Z59B 2Z0EB 1IYFA 4GDKA 3RD2A 2Z0DB 4RM9A 2M1MA 4W9EA 2NS5A 4AUQC 1NBFC 1YQBA 1GJZA 2MLBA 3WAMA 2VRRB 4W9HA 3IFWB 4IC7B 4PS7A 2FIFA 3UIOB 3W1SA 2PE9A 2JRHA 3B0AA 1ZW7A 3A1QA 3H9DA 2EMSA 3T8MA 3NOBA 1OQYA 2D11A 3QHTA 2KWVB 2DZMA 3N30A 2WX0A 4DWFA 3RYTA 3M3JA 3OLMD 1V2YA 2KDEB 2W9NA 2K6DB 2JF5A 1WJ6A 4BOSC 3WAPA 3TL5A 2C7MB 1MG8A 1WXVA 4WWOA 2LRUA 4MH0E 2J0JA 3M63B 3MTNB 4KSLC 1WGDA 5FR6A 3OJ3A 4PS3A 1WIAA 4CYEA 3ONSA 1R4NI 1P98A 2EMTA 2KVRA 1WX9A 3VUXA 3L0WB 2N9EB 3Q3JA 4EFOA 1OEYJ 3PPAA 4GMVA 3SDLC 5L83A 3NHEB 4DHZB 5JHAA 1S3SG 1WX7A 4JIOU 1RLFA 2K6QA 2LJ5A 2WYQA 2FIDA 1V9JA 4FN2A 2KJHB 2KX0A 1WGRA 4DXAB 3CMMB 3ZNZB 5G2NA 3QX1A 2KTRB 2NR2A 1WZ3A 2KTRA 4EUTA 3KH0A 2KWUB 3DBRI 2IO1B 4FLHA 4LDTB 4EZKA 2L0FA 4DHZE 2FCSA 4K7SA 4DDID 4MGZE 2L7RA 3NZSA 3A9JB 3IVFA 1OEYA 2N1VA 4KDIC 3PT2B 2CR5A 4IG7B 4BBNC 3DVGX 1J0GA 1L2NA 1H8CA 2QHOA 5KHQA 1G6JA 5LLIA 4E74A 4FULA 4ZRKA 3PREA 2LWPA 5J17A 1WM2A 4IW0A 2L00B 1WZ0A 2MBOA 3V6EB 1SGHA 2GBKA 2KC2A 3CF6E 4GSWA 4ANUA 3L17A 3S2AA 2OJRA 2BPSA 4MM3A 3B1LX 4KIKB 1VCBA 3WA0A 4URKA 2WX1A 2MSED 1KJTA 2KWCA 1L7YA 2KK8A 1WXSA 3ZNGC 3NY5A 2KD0A 2ZEQA 3ZUNA 3W1YA 2YLMA 3I3TB 2XK5B 3AU5A 4HLEA 3DPDA 2MX2A 1ZKHA 3H1UA 1RAXA 3KUZA 3TCAA 3P2BA 4JQWC 3A4SC 4MEMA 4P7IA 4EZLA 3APCA 3NZUA 3QARA 1E8XA 2KN5A 1GNUA 4KZCA 3IHPC 3VTWA 4FJVB 2KFKA 4HXDA 2MQJA 2K1FA 2KC1A 4WJPA 4CHKA 3OAWA 3ZNID 2KANA 3DVNV 4KIKA 2PEAA 2FCMA 3MHSD 2JUOA 2JPHA 3QCAA 4MSMB 2LXAA 3R3MA 4ANXA 2ZVNA 1ZGUB 3JSVB 1HE8A 5BO4B 3PGEA 3DOWA 2KQSA 4IWQA 3TMPB 3VFKA 1UBIA 3C0RB 2J0KA 1OTRB 4W9IA 3ZTDA 2K8HA 3L16A 3MJWA 2ZJDA 2ZNVC 4IWPA 5GMVA 3KYCD 2L0TA 2O6VA 1V5TA 5CTRC 2DHZA 1I42A 3PSEB 4W9JA 2J0MA 1R4MI 3VVWB 4XZ4A 1YD8U 3PS6A 1UGMA 3RT3B 3ZRFA 4BKGA 4MSQB 4BFRA 4FBJB 2RR9A 2JY6A 4II2B 1Z5SB 4M8NA 1WM3A 1WR6E 4NJ6A 4F7ZA 4BBNF 1CMXB 2MWSB 3DVNU 4GGQA 3V62A 1E7VA 4KVGB 3A9KA 3DBSA 2CHWA 1BT0A 1H4RA 1T0YA 2BYEA 2LVOA 4W9GA 3PLVA 3UF8A 2V1YA 4NNJB 3A9JA 2BKFA 3H7PA 3TBLD 5DPTA 5AZHA 2FCNA 3QA8A 4XX5A 3ZW3A 3U7DA 2C5LC 2RPQA 3DDCB 5IA7A 5DCNA 4LJPB 4K7WA 3VDZA 4A20A 1KM7A 1WE7A 2JZ3B 1P3QU 2IO3B 3VH3B 4W9LA 1Q1OA 3Q3FA 4HJKA 2O6VD 3V60A 1KLVA 1UD7A 3SU8X 2PPHA 4JLCA 4B6WA 2M17A 3R66C 1GG3A 1XQQA 2BWES 2C60A 4E3CA 4I6NB 4WJOA 1P9DU 1YX6B 2AL6A 1ISNA 3IG3A 4NPNA 3UQBA 3VTVA 1QZEA 2ASQA 5LXIB 1WF9A 2RGFA 3DQVA 5G55A 1IPGA 4ASWC 5D7GA 3RCZA 3RZFA 4KDLB 2D3GA 2AEHA 2KDBA 2N4FA 2IY1B 2MBEA 1WR1A 3PLUA 2NBWB 3LJ3A 2RSUA 1V5OA 2BWFA 3RZWC 2DX5B 2K8BA 1V81A 1RRBA 3BINA 4NQLB 4CO7A 5EDSA 3HM6X 5KHOA 4YL8A 2V3SA 1TGZB 2C7NB 4LDTD 4WQOB 5CX3A 2HTHA 2O2VA 3VHTC 2LXCA 1LFDA 1E8WA 4TUUA 2BYVE 1XD3B 2LGXA 3KUCB 1TZ1A 5DPSA 1M94A 4GOCA 1VD2A 4HWIB 2NPTA 4FHJA 4IWOA 3SHQA 2BKRB 3QWZB 4K7UA 4M0WB 3QQ8B 2R2OA 2ZCCA 2MCNB 4BVUC 2KXJA 4TV3A 2KTFA 4RMAA 3ZO5B 1SIFA 3EFUA 4TQ0A 2LUEA 1WGGA 2D2QA 3JSVA 1A5RA 5CHWA 2LGYA 1NI2A 4F1SA 2M4NA 3QC8B 4B9KA 1EUVB 1WFYA 3ML9A 3DBHI 2M8SA 3ZDTA 2D07B 4ZRIA 2KJRA 2FNJB 2IBIB 2KHWB 4J6IA 4X57B 1GC7A 3O65B 3PRZA 4KSKC 4AOFA 2XEWA 2AWTA 4GU2A 3GZNI 1K8RB 5IAAC 1U4AA 3B08A 3QIJA 2I1JA 2DAFA 4GDLB 2KMAA 5D6JB 4NQKE 4W9KA 1RFAA 3PV1A 4G50A 3BY4B 3N3KB 2CHZA 5J2RA 2BGFA 1E5WA 2CKHB 4HCNB 2O2VB 1Q0WB 3QJZA 3ZRCA 1EO6A 2DENB 2LZ6A 1FXTB 4G3XB 3ZKJC 4FHKA 1JRUA 2JWZA 3JYUA 5E6OA 1D3ZA 3U30A 3WANA 3EECA 2D10A 1Y8RC 2MBHA 4WWPA 2WWZA 5DPWA 1WMHA 3ML8A 4AJYB 3ZDMC 2GOWA 2I1KA 2K25A 4HCPB 3UIPB 4HPMB 2IY0B 4BKSD 4JGHB 2N9PC 4OVUA 1AARA 4MGIE 3APDA 1F9JA 2HD5B 5L95C 4II3B 2G3QB 2KLCA 2WDTB 5TR5A 2JT4B 3KYDD 1OGWA 2V4LA 1Q5WB 2DZKA 4MJSB 2N7DA 2IO2B 1XT9B 1WRDB 3ECIA 4I6PA 4MELA 2ZCBA 2ZZPB 1PQSA 4F8CB 1WH3A 4DK5A 2MA9B 4ZYNA 2LVQA 3HHMA 3AU4A 3ZVVA 1UH6A 2J7QB 4TKNA 3APFA 2LVPA 4LCDE 1E90A 3A9KB 1Z2MA 4G0NB 3W1SC 3L10B 4ZRJA 1WXAA 4NY0A 3X0WA 4ICUA 2MP2B 3PVLA 4EOYA 5C23A 4BKSA 2DYBA 2JVCA 3A4RA 2L05A 5E6NA 2KOXA 3KUDB 1WJUA 2DZJA 1IP9A 2NPTB 4HPLB 3HK0A 4GXBA 3AXCA 3R7QA 2XK5A 3WIMA 1WJ4A 4HVBA 2HE7A 2LGDA 3ALBA 4K1RB 2A5UA 1EF5A 1YIWA 2DAJA 5JHBA 2KFKB 4MGKE 5J18A 2L76A 4B95A 4DHJD 2GBNA 1UZXB 2GBRA 2R2QA 1C3TA 2Y5BB 1WE6A 5CHVC 1NDDA 3ZLZA 4FADA 3H7SA 3L13A 4ICVA 1E8ZA 4AP4C 1LM8B 3DBLI 4GB9A 2CHXA 4EKUA 2IYDB 4E71A 2DZIA 4PYUA 3TJPA 3WAOA 2KX3A 3QK0A 2G4SA 2NCNA 4KZ0A 4OVVA 3QAQA 2GBJA 2LASA 1WXMA 4WAAA 1WX8A 2A4ZA 2ZPNA 2N9XA 3CSFA 4FJZA 3T9LA 3GOEA 3JVZX 3PHXB 1V49A 5CHFA 3UINB 2C7HA 4XC2A 1LQBA 2JXXA 2PJHA 5DPRA 3UGBB 3ZIMA 2ZNVB 4TQ1A 4WJQA 3VH4B 2MBBB 3PHWB 1KOTA 1P0RA 3VQIA 3IBEA 2MBQA 3H6NA 3PRPB 2XBBC 4DBGA 2ZVOA 4WJNA 2RD0A 3D32A 4PS8A 2M0XA 1J8CA 4NAWB 1V80A 2FAZA 1E8YA 2G4DB 4MGYE 4LJOB 3V61A 2O6VB 4GN1A 2L8JA 1WYWB 1EF1A 1WGHA 4EEWA 1GUAB 1TBEA 3U8ZA 2MP2A 2KNBA 2DYMA 2L3ZA 2NBVB 3VTUA 1P1AA 1WI0A 2AYOB 2K39A 1V86A 3ZNHB 4AJWA 2LI5A 2AL3A 3M62B 2NVUI 2FUHB 3JW0X 3DVGY 4M8MA 4EZJA 3OJ4B 2PE6B 3TIXA 3X23A 1C1YB 1TTNA 2KO3A 2ZPYA 5JZEB 4DHJB 4A3PA 2JZZA 3K9PB 5AZGA 1WMHB 4PYZA 4MDKE 2K8CA 2N1WA 3PTFC 3M95A 3ENEA 4BOZB 4ANWA 3RULA 1LXDA 1X1MA 5E6PA 2KMCA 3K9OB 3R7RA 2IZVB 3AULA 4HK2A 3ZTCA 3N32A 2CS4A 2KQ7A 3LDZE 4W9CA 5LXHA 1WY8A 2JRIB 2UWQA 3WALA 1J19A 4W9DA 4FA6A 3A1QB 5JH5C 1UBQA 4ANVA 4N9F4 2DYOA 3CSTA 3HM3A 3EC8A 2KJ6A 4FJYA 2IO0B 4GDLA 4I6LB 5D2MB 2GMIC 3UQAA 2EKEC 3V6CB 1UELA 2C9WB 2OOBB 3VUYA 1I35A 4W9FA 3VAWA 1V6EA 4A3OA 1YX5B 2KFJA 5AZFA 3L08A 2CU1A 5AEKB 4IM2A 3PRMB 4IUMB 2YVCA 3NS8A 4GDKB 4AWJA 5C1ZA 2LD9A 1WJNA 2NBUA 3KW5B 5D94A 3AI5A 3VXWA 2KKCA 2MW5A 3L54A 4WWNA 4RM8A 4G11A 2BF8B 3KVFB 4NJ7A 3H7PB 2GBMA 4ZDVA 2MRPA 2KZRA 4JL9A 2G45B 1GC6A 3A33B 4GIVA 1YJ1A 1SE9A 4IM0A 2KDFB 3EHVA 2FCQA 4KV2A 2HJ8A 3RUIB 2REXA 3HIZA 4HDQA 2UYZB 2KDIA 2BYFA 3DCGA 4HDOA 3PZDA 2B3AA 4NAWA 3VUWA 3SD5A 4DDGD 4BKTA 1E7UA 2LRWA 1WGYA 2KLGA 5HKHA 4IM3A 4K81A 2N7EA 1S1QB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MJS A;  2Z59 B;  2Z0E B;  1IYF A;  4GDK A;  3RD2 A;  2Z0D B;  4RM9 A;  2M1M A;  4W9E A;  2NS5 A;  4AUQ C;  1NBF C;  1YQB A;  1GJZ A;  2MLB A;  3WAM A;  2VRR B;  4W9H A;  3IFW B;  4IC7 B;  4PS7 A;  2FIF A;  3UIO B;  3W1S A;  2PE9 A;  2JRH A;  3B0A A;  1ZW7 A;  3A1Q A;  3H9D A;  2EMS A;  3T8M A;  3NOB A;  1OQY A;  2D11 A;  3QHT A;  2KWV B;  2DZM A;  3N30 A;  2WX0 A;  4DWF A;  3RYT A;  3M3J A;  3OLM D;  1V2Y A;  2KDE B;  2W9N A;  2K6D B;  2JF5 A;  1WJ6 A;  4BOS C;  3WAP A;  3TL5 A;  2C7M B;  1MG8 A;  1WXV A;  4WWO A;  2LRU A;  4MH0 E;  2J0J A;  3M63 B;  3MTN B;  4KSL C;  1WGD A;  5FR6 A;  3OJ3 A;  4PS3 A;  1WIA A;  4CYE A;  3ONS A;  1R4N I;  1P98 A;  2EMT A;  2KVR A;  1WX9 A;  3VUX A;  3L0W B;  2N9E B;  3Q3J A;  4EFO A;  1OEY J;  3PPA A;  4GMV A;  3SDL C;  5L83 A;  3NHE B;  4DHZ B;  5JHA A;  1S3S G;  1WX7 A;  4JIO U;  1RLF A;  2K6Q A;  2LJ5 A;  2WYQ A;  2FID A;  1V9J A;  4FN2 A;  2KJH B;  2KX0 A;  1WGR A;  4DXA B;  3CMM B;  3ZNZ B;  5G2N A;  3QX1 A;  2KTR B;  2NR2 A;  1WZ3 A;  2KTR A;  4EUT A;  3KH0 A;  2KWU B;  3DBR I;  2IO1 B;  4FLH A;  4LDT B;  4EZK A;  2L0F A;  4DHZ E;  2FCS A;  4K7S A;  4DDI D;  4MGZ E;  2L7R A;  3NZS A;  3A9J B;  3IVF A;  1OEY A;  2N1V A;  4KDI C;  3PT2 B;  2CR5 A;  4IG7 B;  4BBN C;  3DVG X;  1J0G A;  1L2N A;  1H8C A;  2QHO A;  5KHQ A;  1G6J A;  5LLI A;  4E74 A;  4FUL A;  4ZRK A;  3PRE A;  2LWP A;  5J17 A;  1WM2 A;  4IW0 A;  2L00 B;  1WZ0 A;  2MBO A;  3V6E B;  1SGH A;  2GBK A;  2KC2 A;  3CF6 E;  4GSW A;  4ANU A;  3L17 A;  3S2A A;  2OJR A;  2BPS A;  4MM3 A;  3B1L X;  4KIK B;  1VCB A;  3WA0 A;  4URK A;  2WX1 A;  2MSE D;  1KJT A;  2KWC A;  1L7Y A;  2KK8 A;  1WXS A;  3ZNG C;  3NY5 A;  2KD0 A;  2ZEQ A;  3ZUN A;  3W1Y A;  2YLM A;  3I3T B;  2XK5 B;  3AU5 A;  4HLE A;  3DPD A;  2MX2 A;  1ZKH A;  3H1U A;  1RAX A;  3KUZ A;  3TCA A;  3P2B A;  4JQW C;  3A4S C;  4MEM A;  4P7I A;  4EZL A;  3APC A;  3NZU A;  3QAR A;  1E8X A;  2KN5 A;  1GNU A;  4KZC A;  3IHP C;  3VTW A;  4FJV B;  2KFK A;  4HXD A;  2MQJ A;  2K1F A;  2KC1 A;  4WJP A;  4CHK A;  3OAW A;  3ZNI D;  2KAN A;  3DVN V;  4KIK A;  2PEA A;  2FCM A;  3MHS D;  2JUO A;  2JPH A;  3QCA A;  4MSM B;  2LXA A;  3R3M A;  4ANX A;  2ZVN A;  1ZGU B;  3JSV B;  1HE8 A;  5BO4 B;  3PGE A;  3DOW A;  2KQS A;  4IWQ A;  3TMP B;  3VFK A;  1UBI A;  3C0R B;  2J0K A;  1OTR B;  4W9I A;  3ZTD A;  2K8H A;  3L16 A;  3MJW A;  2ZJD A;  2ZNV C;  4IWP A;  5GMV A;  3KYC D;  2L0T A;  2O6V A;  1V5T A;  5CTR C;  2DHZ A;  1I42 A;  3PSE B;  4W9J A;  2J0M A;  1R4M I;  3VVW B;  4XZ4 A;  1YD8 U;  3PS6 A;  1UGM A;  3RT3 B;  3ZRF A;  4BKG A;  4MSQ B;  4BFR A;  4FBJ B;  2RR9 A;  2JY6 A;  4II2 B;  1Z5S B;  4M8N A;  1WM3 A;  1WR6 E;  4NJ6 A;  4F7Z A;  4BBN F;  1CMX B;  2MWS B;  3DVN U;  4GGQ A;  3V62 A;  1E7V A;  4KVG B;  3A9K A;  3DBS A;  2CHW A;  1BT0 A;  1H4R A;  1T0Y A;  2BYE A;  2LVO A;  4W9G A;  3PLV A;  3UF8 A;  2V1Y A;  4NNJ B;  3A9J A;  2BKF A;  3H7P A;  3TBL D;  5DPT A;  5AZH A;  2FCN A;  3QA8 A;  4XX5 A;  3ZW3 A;  3U7D A;  2C5L C;  2RPQ A;  3DDC B;  5IA7 A;  5DCN A;  4LJP B;  4K7W A;  3VDZ A;  4A20 A;  1KM7 A;  1WE7 A;  2JZ3 B;  1P3Q U;  2IO3 B;  3VH3 B;  4W9L A;  1Q1O A;  3Q3F A;  4HJK A;  2O6V D;  3V60 A;  1KLV A;  1UD7 A;  3SU8 X;  2PPH A;  4JLC A;  4B6W A;  2M17 A;  3R66 C;  1GG3 A;  1XQQ A;  2BWE S;  2C60 A;  4E3C A;  4I6N B;  4WJO A;  1P9D U;  1YX6 B;  2AL6 A;  1ISN A;  3IG3 A;  4NPN A;  3UQB A;  3VTV A;  1QZE A;  2ASQ A;  5LXI B;  1WF9 A;  2RGF A;  3DQV A;  5G55 A;  1IPG A;  4ASW C;  5D7G A;  3RCZ A;  3RZF A;  4KDL B;  2D3G A;  2AEH A;  2KDB A;  2N4F A;  2IY1 B;  2MBE A;  1WR1 A;  3PLU A;  2NBW B;  3LJ3 A;  2RSU A;  1V5O A;  2BWF A;  3RZW C;  2DX5 B;  2K8B A;  1V81 A;  1RRB A;  3BIN A;  4NQL B;  4CO7 A;  5EDS A;  3HM6 X;  5KHO A;  4YL8 A;  2V3S A;  1TGZ B;  2C7N B;  4LDT D;  4WQO B;  5CX3 A;  2HTH A;  2O2V A;  3VHT C;  2LXC A;  1LFD A;  1E8W A;  4TUU A;  2BYV E;  1XD3 B;  2LGX A;  3KUC B;  1TZ1 A;  5DPS A;  1M94 A;  4GOC A;  1VD2 A;  4HWI B;  2NPT A;  4FHJ A;  4IWO A;  3SHQ A;  2BKR B;  3QWZ B;  4K7U A;  4M0W B;  3QQ8 B;  2R2O A;  2ZCC A;  2MCN B;  4BVU C;  2KXJ A;  4TV3 A;  2KTF A;  4RMA A;  3ZO5 B;  1SIF A;  3EFU A;  4TQ0 A;  2LUE A;  1WGG A;  2D2Q A;  3JSV A;  1A5R A;  5CHW A;  2LGY A;  1NI2 A;  4F1S A;  2M4N A;  3QC8 B;  4B9K A;  1EUV B;  1WFY A;  3ML9 A;  3DBH I;  2M8S A;  3ZDT A;  2D07 B;  4ZRI A;  2KJR A;  2FNJ B;  2IBI B;  2KHW B;  4J6I A;  4X57 B;  1GC7 A;  3O65 B;  3PRZ A;  4KSK C;  4AOF A;  2XEW A;  2AWT A;  4GU2 A;  3GZN I;  1K8R B;  5IAA C;  1U4A A;  3B08 A;  3QIJ A;  2I1J A;  2DAF A;  4GDL B;  2KMA A;  5D6J B;  4NQK E;  4W9K A;  1RFA A;  3PV1 A;  4G50 A;  3BY4 B;  3N3K B;  2CHZ A;  5J2R A;  2BGF A;  1E5W A;  2CKH B;  4HCN B;  2O2V B;  1Q0W B;  3QJZ A;  3ZRC A;  1EO6 A;  2DEN B;  2LZ6 A;  1FXT B;  4G3X B;  3ZKJ C;  4FHK A;  1JRU A;  2JWZ A;  3JYU A;  5E6O A;  1D3Z A;  3U30 A;  3WAN A;  3EEC A;  2D10 A;  1Y8R C;  2MBH A;  4WWP A;  2WWZ A;  5DPW A;  1WMH A;  3ML8 A;  4AJY B;  3ZDM C;  2GOW A;  2I1K A;  2K25 A;  4HCP B;  3UIP B;  4HPM B;  2IY0 B;  4BKS D;  4JGH B;  2N9P C;  4OVU A;  1AAR A;  4MGI E;  3APD A;  1F9J A;  2HD5 B;  5L95 C;  4II3 B;  2G3Q B;  2KLC A;  2WDT B;  5TR5 A;  2JT4 B;  3KYD D;  1OGW A;  2V4L A;  1Q5W B;  2DZK A;  4MJS B;  2N7D A;  2IO2 B;  1XT9 B;  1WRD B;  3ECI A;  4I6P A;  4MEL A;  2ZCB A;  2ZZP B;  1PQS A;  4F8C B;  1WH3 A;  4DK5 A;  2MA9 B;  4ZYN A;  2LVQ A;  3HHM A;  3AU4 A;  3ZVV A;  1UH6 A;  2J7Q B;  4TKN A;  3APF A;  2LVP A;  4LCD E;  1E90 A;  3A9K B;  1Z2M A;  4G0N B;  3W1S C;  3L10 B;  4ZRJ A;  1WXA A;  4NY0 A;  3X0W A;  4ICU A;  2MP2 B;  3PVL A;  4EOY A;  5C23 A;  4BKS A;  2DYB A;  2JVC A;  3A4R A;  2L05 A;  5E6N A;  2KOX A;  3KUD B;  1WJU A;  2DZJ A;  1IP9 A;  2NPT B;  4HPL B;  3HK0 A;  4GXB A;  3AXC A;  3R7Q A;  2XK5 A;  3WIM A;  1WJ4 A;  4HVB A;  2HE7 A;  2LGD A;  3ALB A;  4K1R B;  2A5U A;  1EF5 A;  1YIW A;  2DAJ A;  5JHB A;  2KFK B;  4MGK E;  5J18 A;  2L76 A;  4B95 A;  4DHJ D;  2GBN A;  1UZX B;  2GBR A;  2R2Q A;  1C3T A;  2Y5B B;  1WE6 A;  5CHV C;  1NDD A;  3ZLZ A;  4FAD A;  3H7S A;  3L13 A;  4ICV A;  1E8Z A;  4AP4 C;  1LM8 B;  3DBL I;  4GB9 A;  2CHX A;  4EKU A;  2IYD B;  4E71 A;  2DZI A;  4PYU A;  3TJP A;  3WAO A;  2KX3 A;  3QK0 A;  2G4S A;  2NCN A;  4KZ0 A;  4OVV A;  3QAQ A;  2GBJ A;  2LAS A;  1WXM A;  4WAA A;  1WX8 A;  2A4Z A;  2ZPN A;  2N9X A;  3CSF A;  4FJZ A;  3T9L A;  3GOE A;  3JVZ X;  3PHX B;  1V49 A;  5CHF A;  3UIN B;  2C7H A;  4XC2 A;  1LQB A;  2JXX A;  2PJH A;  5DPR A;  3UGB B;  3ZIM A;  2ZNV B;  4TQ1 A;  4WJQ A;  3VH4 B;  2MBB B;  3PHW B;  1KOT A;  1P0R A;  3VQI A;  3IBE A;  2MBQ A;  3H6N A;  3PRP B;  2XBB C;  4DBG A;  2ZVO A;  4WJN A;  2RD0 A;  3D32 A;  4PS8 A;  2M0X A;  1J8C A;  4NAW B;  1V80 A;  2FAZ A;  1E8Y A;  2G4D B;  4MGY E;  4LJO B;  3V61 A;  2O6V B;  4GN1 A;  2L8J A;  1WYW B;  1EF1 A;  1WGH A;  4EEW A;  1GUA B;  1TBE A;  3U8Z A;  2MP2 A;  2KNB A;  2DYM A;  2L3Z A;  2NBV B;  3VTU A;  1P1A A;  1WI0 A;  2AYO B;  2K39 A;  1V86 A;  3ZNH B;  4AJW A;  2LI5 A;  2AL3 A;  3M62 B;  2NVU I;  2FUH B;  3JW0 X;  3DVG Y;  4M8M A;  4EZJ A;  3OJ4 B;  2PE6 B;  3TIX A;  3X23 A;  1C1Y B;  1TTN A;  2KO3 A;  2ZPY A;  5JZE B;  4DHJ B;  4A3P A;  2JZZ A;  3K9P B;  5AZG A;  1WMH B;  4PYZ A;  4MDK E;  2K8C A;  2N1W A;  3PTF C;  3M95 A;  3ENE A;  4BOZ B;  4ANW A;  3RUL A;  1LXD A;  1X1M A;  5E6P A;  2KMC A;  3K9O B;  3R7R A;  2IZV B;  3AUL A;  4HK2 A;  3ZTC A;  3N32 A;  2CS4 A;  2KQ7 A;  3LDZ E;  4W9C A;  5LXH A;  1WY8 A;  2JRI B;  2UWQ A;  3WAL A;  1J19 A;  4W9D A;  4FA6 A;  3A1Q B;  5JH5 C;  1UBQ A;  4ANV A;  4N9F 4;  2DYO A;  3CST A;  3HM3 A;  3EC8 A;  2KJ6 A;  4FJY A;  2IO0 B;  4GDL A;  4I6L B;  5D2M B;  2GMI C;  3UQA A;  2EKE C;  3V6C B;  1UEL A;  2C9W B;  2OOB B;  3VUY A;  1I35 A;  4W9F A;  3VAW A;  1V6E A;  4A3O A;  1YX5 B;  2KFJ A;  5AZF A;  3L08 A;  2CU1 A;  5AEK B;  4IM2 A;  3PRM B;  4IUM B;  2YVC A;  3NS8 A;  4GDK B;  4AWJ A;  5C1Z A;  2LD9 A;  1WJN A;  2NBU A;  3KW5 B;  5D94 A;  3AI5 A;  3VXW A;  2KKC A;  2MW5 A;  3L54 A;  4WWN A;  4RM8 A;  4G11 A;  2BF8 B;  3KVF B;  4NJ7 A;  3H7P B;  2GBM A;  4ZDV A;  2MRP A;  2KZR A;  4JL9 A;  2G45 B;  1GC6 A;  3A33 B;  4GIV A;  1YJ1 A;  1SE9 A;  4IM0 A;  2KDF B;  3EHV A;  2FCQ A;  4KV2 A;  2HJ8 A;  3RUI B;  2REX A;  3HIZ A;  4HDQ A;  2UYZ B;  2KDI A;  2BYF A;  3DCG A;  4HDO A;  3PZD A;  2B3A A;  4NAW A;  3VUW A;  3SD5 A;  4DDG D;  4BKT A;  1E7U A;  2LRW A;  1WGY A;  2KLG A;  5HKH A;  4IM3 A;  4K81 A;  2N7E A;  1S1Q B; 
#chains in the Genus database with same CATH topology
 2Z59 B;  2Z0D B;  1DGJ A;  1NBF C;  5MPO A;  4W9H A;  3IFW B;  4IC7 B;  2GLS A;  3T8M A;  1OQY A;  2LGI A;  4YTN B;  3N30 A;  2WXN A;  2WX0 A;  4DWF A;  3RYT A;  2W9N A;  2K6D B;  2BBC A;  2QIE B;  4BOS C;  3TL5 A;  4L23 A;  1WGD A;  5FR6 A;  3OJ3 A;  1R4N I;  2EMT A;  1WX9 A;  3VUX A;  3L0W B;  1YQ3 B;  3V05 A;  5L83 A;  3SDL C;  4DHZ B;  4JIO U;  1ZP0 B;  2K6Q A;  1F77 A;  2LJ5 A;  4FN2 A;  2RPV A;  4YSX B;  2X38 A;  2KJH B;  4YTP B;  4ZYS A;  3CMM B;  3MP9 A;  1WZ3 A;  2UU7 A;  4DDI D;  1K52 A;  4MGZ E;  3EUB 2;  3IVF A;  4IDI A;  2CR5 A;  4DQO C;  1IUE A;  5KHQ A;  4FXC A;  4FUL A;  1JWB D;  3AE8 B;  1JQ4 A;  1WZ0 A;  2MBO A;  2WDR B;  1XXG A;  2GBK A;  1IGC A;  1SE2 A;  3S2A A;  3DWG C;  1VCB A;  3WA0 A;  1F2R C;  1I4P A;  1BXT A;  1L7Y A;  2KK8 A;  4H2A A;  1B9R A;  3H1U A;  3KUZ A;  4KKI A;  2LMC A;  4MEM A;  2KN4 A;  3APC A;  3QAR A;  2KN5 A;  4KZC A;  3VTW A;  1FEH A;  2KFK A;  3NVV A;  4LLG M;  1ET9 A;  4KIK A;  1PGX A;  2PEA A;  2FCM A;  2KT7 A;  2VZK B;  2WXM A;  1HE8 A;  3T3O A;  3ZTD A;  1WXQ A;  4M01 A;  4P16 A;  1JAL A;  1E0Z A;  3PSE B;  3VVW B;  3PS6 A;  4BKG A;  4Q2J A;  3Q6B A;  1HZ5 A;  2RR9 A;  4RF0 A;  1Z5S B;  4M8N A;  4KGT A;  1WM3 A;  1CMX B;  1E7V A;  3PLV A;  1DOX A;  1FXA A;  1SB3 C;  3H7P A;  2FCN A;  3DDC B;  4K7W A;  1CK1 A;  1I4Q A;  3Q3F A;  3V60 A;  2O6V D;  1YMH E;  3SU8 X;  1GG3 A;  4S0R A;  4I6N B;  3FIL B;  3P4Q B;  5LXI B;  3DQV A;  3RCZ A;  4KDL B;  2N4F A;  1L4D B;  4WUR A;  3LJ3 A;  3TUO A;  2BWF A;  2SAK A;  3RZW C;  2DX5 B;  1FRR A;  2B76 B;  4CO7 A;  1FFU A;  3MHZ A;  3BYY B;  4WQO B;  4TUU A;  2BYV E;  2W3S A;  1MPE A;  5DPS A;  2QJL A;  3UI3 A;  1JRO A;  4HWI B;  2NPT A;  1VRA B;  3WCQ A;  3TEY A;  4K7U A;  3QWZ B;  3IT4 B;  4ITK A;  4M0W B;  1L6U A;  1FM0 D;  3ZYY X;  2WXL A;  2N9L A;  3ZO5 B;  3I5J C;  1SIF A;  5IOI A;  3EFU A;  2JQR B;  3B9J A;  2M4N A;  4BAX A;  1V1P B;  3QC8 B;  1MI0 A;  3ML9 A;  3DBH I;  2M8S A;  3B2F A;  2D07 B;  4ZRI A;  1N61 A;  2IBI B;  2KHW B;  4J6I A;  1GC7 A;  1GB1 A;  3BWU D;  2XEW A;  3W2D A;  2FE8 A;  3AE6 B;  4GU2 A;  1K8R B;  5IAA C;  3AEC B;  3B08 A;  3H8H A;  2I1J A;  5D6J B;  3N3K B;  3SR6 A;  1E5W A;  2CKH B;  4HCN B;  4NZL B;  2JYT A;  3ZRC A;  5D3D A;  2WXO A;  2DEN B;  1IBX A;  2LZ6 A;  1C4C A;  4FHK A;  1EWC A;  5E6O A;  3AE5 B;  1E7P B;  1WSP A;  5DPW A;  1WMH A;  3NVW A;  4AJY B;  3ZDM C;  1FMA D;  3BYT B;  4HCP B;  4RF1 A;  3Q69 A;  4BKS D;  3P4P B;  3OG5 A;  3GE3 C;  1AAR A;  4II3 B;  3GZN B;  1QOA A;  3MC0 B;  2K0P A;  5HHD G;  2WP9 B;  3KYD D;  1Q5W B;  1RYJ A;  2DZK A;  2ZCB A;  4ZYN A;  1AW7 A;  4ARI A;  4B0M A;  3A9K B;  1Z2M A;  3NVZ A;  4G0N B;  3ZGZ A;  1KTK A;  3Q8A A;  2MP2 B;  2KDM A;  2JVC A;  2L05 A;  2D5G A;  4LNN A;  2NPT B;  4HPL B;  3HK0 A;  3R7Q A;  2XK5 A;  1Q10 A;  2FBW B;  2DAJ A;  1YOV B;  3BVG A;  2KFK B;  2XNA C;  1FCC C;  1QQR A;  2BS4 B;  2E6X A;  1NDD A;  4ICV A;  1E8Z A;  2V4I B;  1FPY A;  4ZOH C;  4PYU A;  3RNB C;  3VRB B;  2NCN A;  4P1C C;  2GBJ A;  1WXM A;  4XDC A;  2VZK D;  3ZJT A;  1F2R I;  1M4V A;  4FJZ A;  4YT0 B;  4YWG G;  1NEN B;  1V49 A;  4XC2 A;  2JXX A;  2CJN A;  2SEB D;  1KOT A;  3FKY A;  3IBE A;  2RD0 A;  3D32 A;  3W9C B;  1J8C A;  2HTM E;  1V80 A;  2FAZ A;  1E8Y A;  4MGY E;  3AEF B;  2L8J A;  2BB5 A;  5EE9 A;  1EF1 A;  5FKA C;  3HRD D;  1TBE A;  1QKZ A;  2MP2 A;  2KAJ A;  3I63 C;  2K39 A;  1V86 A;  4UDU C;  3M62 B;  2FUH B;  4M8M A;  1IBX B;  4RCO A;  2KO3 A;  2JZZ A;  4NJC A;  2K8C A;  2N1W A;  1BUI C;  3DBH B;  3ENE A;  3RUL A;  5EE1 A;  1X1M A;  5E6P A;  2KMC A;  3AUL A;  4TSS A;  1TKE A;  4W9C A;  1WY8 A;  2JRI B;  2LEK A;  1J19 A;  5IKC M;  5JH5 C;  1UBQ A;  4ZRP A;  3CST A;  3UQA A;  5D2M B;  2GMI C;  1DOI A;  1UEL A;  2IGG A;  2WGS A;  1HEZ E;  1V6E A;  1YX5 B;  2KFJ A;  3L08 A;  2CU1 A;  4AS1 A;  3SEB A;  3PRM B;  2YVC A;  2LD9 A;  2NBU A;  3E9S A;  1JWU D;  4A6Q A;  1TS2 A;  4WWN A;  4XWT A;  2BF8 B;  3KVF B;  4A9A A;  2KZR A;  4GIV A;  1YJ1 A;  3ZJV A;  1SE9 A;  2KDF B;  5GXG B;  4KV2 A;  2X8X X;  1P7F A;  2REX A;  2BW2 A;  3N20 C;  1PFD A;  2LRW A;  1VR9 A;  4M00 A;  5HKH A;  1TKG A;  2INP E;  4IM3 A;  4WWM A;  1EU4 A;  1IYF A;  2IND C;  3RD2 A;  1GJZ A;  2IGH A;  2NS5 A;  2LHE A;  3Q8B A;  1LO5 D;  1V1O A;  1SSN A;  2FIF A;  4CQN A;  3B0A A;  1RFK A;  3NOB A;  2WU2 B;  1VDV A;  3AMZ A;  1WJ6 A;  2C7M B;  1MG8 A;  4WWO A;  4MH0 E;  1JWA D;  2K3U A;  3M63 B;  4PS3 A;  3ONS A;  4RH6 A;  2WLB A;  3J9C A;  1I4X A;  5JHA A;  2LGS A;  1WX7 A;  2WYQ A;  4OZC A;  1C78 A;  2MJE A;  3Q8C A;  1C9F A;  1HXY D;  2KTR A;  1I4H A;  4EUT A;  2PVG C;  2IO1 B;  4LDT B;  2ON8 A;  2L0F A;  4DHZ E;  1P7E A;  1OEY A;  4KDI C;  1J0G A;  1H8C A;  2QHO A;  5LLI A;  4E74 A;  3PRE A;  1WM2 A;  2ZW0 A;  5LNK 1;  1SGH A;  3L17 A;  1SIJ A;  3HUI A;  3ZNG C;  2KD0 A;  2ZEQ A;  3I3T B;  1ZXH A;  4ACF A;  2XK5 B;  4HLE A;  3DPD A;  4ZHP A;  1ZKH A;  3A4S C;  1RWS A;  1E8X A;  1T3Q A;  4FJV B;  2AQ1 B;  4CHK A;  2KC1 A;  2KWD A;  2WHI A;  1DOY A;  1TY0 A;  2BS3 B;  1ACC A;  3DVN V;  2XN9 C;  1NYQ A;  1DYQ A;  3MHS D;  2JPH A;  4MSM B;  1CJE A;  5BO4 B;  4IWQ A;  1UBI A;  3C0R B;  1R4N B;  1ZE3 D;  3L16 A;  2ZNV C;  2KQ4 X;  2L0T A;  1V5T A;  2DHZ A;  3BK1 A;  4W9J A;  3LXF A;  1UGM A;  3RT3 B;  4FBJ B;  4II2 B;  2PTL A;  2L32 A;  3SFE B;  4NJ6 A;  4F7Z A;  4BBN F;  2MWS B;  4GGQ A;  3DVN U;  1T0Q C;  3V62 A;  2KVZ A;  1QF6 A;  2G1E A;  1CQV A;  4NNJ B;  2RDB C;  2BKF A;  4RNA A;  5AZH A;  1FFV A;  1I4G A;  4IOI E;  1YQ4 B;  2YEP F;  4HRS A;  1P3Q U;  4W9L A;  1UD7 A;  2GB1 A;  3Q3N C;  2ACZ B;  4B6W A;  2BWE S;  2C60 A;  2GI9 A;  4WJO A;  1YX6 B;  2AL6 A;  4NPN A;  3VTV A;  4USA A;  2RGF A;  5G55 A;  5D7G A;  1TZO A;  2LUM A;  2IY1 B;  3PLU A;  4OW0 A;  2NBW B;  2RSU A;  3BIN A;  4NQL B;  1V81 A;  2V3S A;  4LDT D;  5CX3 A;  1QOB A;  2O2V A;  3P63 A;  1LFD A;  1E8W A;  4NAM A;  3KUC B;  3AE1 B;  1KH0 A;  3AE3 B;  4GOC A;  1UWM A;  2D3C A;  1BML C;  3IAS 1;  4FHJ A;  3O13 A;  2M56 B;  3QQ8 B;  2R2O A;  2ZCC A;  2MCN B;  4TV3 A;  1PGA A;  3SFD B;  2MHJ A;  2WNM A;  4TQ0 A;  1WGG A;  1JCK B;  3W5U B;  4KX6 B;  1N63 A;  2FNJ B;  2PMV A;  2MJD A;  3O65 B;  3PRZ A;  4AOF A;  1ZXI A;  2AWT A;  2Y5P A;  1WWT A;  3HVZ A;  4GDL B;  1XLN A;  1YJI A;  1ROE A;  4ZHO A;  4NQK E;  4W9K A;  1SBB B;  1MG4 A;  1RFA A;  4G50 A;  1D5Z C;  2CHZ A;  5J2R A;  2BGF A;  1EO6 A;  3JYU A;  2JWZ A;  2QC8 A;  4HPP A;  3U30 A;  3EEC A;  2D10 A;  2J42 A;  1EM7 A;  2WWZ A;  2GOW A;  2OJW A;  1TIF A;  2I1K A;  4KGS A;  2QDF A;  2V3N A;  4HPM B;  4JGH B;  3C8Y A;  4OVU A;  5IP4 D;  2G9H D;  4XE0 A;  3Q3M C;  5L95 C;  1HQR D;  1WGK A;  4A8X C;  1OGW A;  5FR3 A;  4MJS B;  2N7D A;  1WRD B;  1E10 A;  1PQS A;  1SE4 A;  1UH6 A;  4P6V F;  3VRA B;  4ZRJ A;  4NY0 A;  3PVL A;  4HEA 1;  4BKS A;  5E6N A;  2KOX A;  3KUD B;  3BVZ A;  2DZJ A;  3WIM A;  1WJ4 A;  2WXG A;  4TMA B;  3AE7 B;  3RI7 C;  1EF5 A;  1YIW A;  2D3B A;  1YN3 A;  5JHB A;  4MGK E;  2L76 A;  4B95 A;  4N59 A;  4DHJ D;  2CU3 A;  2R2Q A;  2TSS A;  2Y5B B;  1TKY A;  1AWD A;  4US8 A;  3RNA C;  1LM8 B;  1L0Y B;  3DBL I;  2CHX A;  1T0R C;  2GRI A;  1GB4 A;  2G4S A;  1R7S A;  3QAQ A;  1FNV A;  2HJ1 A;  4S17 A;  3JVZ X;  1KRH A;  3PHX B;  5CHF A;  1ENF A;  2C7H A;  1LQB A;  3UGB B;  4WJQ A;  2MBB B;  3PHW B;  3VQI A;  3RNC C;  3PRP B;  4MAC A;  2V0G A;  1TS4 A;  4NAW B;  4LJO B;  1JWS D;  3C19 A;  1WGH A;  4EEW A;  5FK9 C;  4LNI A;  2L3Z A;  2NBV B;  1L5P A;  3VTU A;  1P1A A;  1WI0 A;  2BYT A;  1QIL A;  3R2T A;  3ZNH B;  4AJW A;  2LI5 A;  2AL3 A;  3N1Y C;  3VR9 B;  3JW0 X;  3DVG Y;  3OJ4 B;  2PE6 B;  1XEE A;  1FXI A;  3K9P B;  5AZG A;  2QIL A;  3PTF C;  1C76 A;  4O1N A;  4BOZ B;  3KLS X;  1LXD A;  1MVK A;  2V9H A;  2WXJ A;  1I7H A;  2N7J A;  2UWQ A;  2AQ2 B;  2QCZ A;  2BT6 A;  4ANV A;  3HM3 A;  3V6C B;  3MC9 A;  3BII D;  2KAC A;  4A3O A;  4XWW A;  4IM2 A;  3NS8 A;  4MH8 A;  5D94 A;  3L54 A;  1JW9 D;  1N5W A;  1VJK A;  1XLO A;  2L83 A;  4ZDV A;  2MRP A;  1T6B X;  4JL9 A;  2G45 B;  2M0A A;  1PGB A;  4IM0 A;  3EHV A;  5C3J B;  1WRI A;  4L1B A;  4M0W A;  1PYW D;  2ICI A;  1PUT A;  4HDO A;  3U4E G;  4OVZ A;  3SD5 A;  4DDG D;  1JML A;  2OHF A;  2LJI A;  4K81 A;  3NUH B;  2N7E A;  3ETR A;  3WAP A;  1MJD A;  4MJS A;  2AQ3 B;  2FUG 1;  4C56 C;  2M1M A;  4AUQ C;  1YQB A;  2MLB A;  1FD6 A;  3WAM A;  3NJT A;  4PS7 A;  1I4R A;  1ZW7 A;  2DLB A;  1SJE D;  2D11 A;  3PO0 A;  3QHT A;  2DZM A;  1GAQ B;  1J7A A;  2BQQ A;  1V2Y A;  2KDE B;  1SXT A;  2JF5 A;  2RMM A;  1WXV A;  2LRU A;  2J0J A;  3MTN B;  3U52 E;  1V8C A;  1WIA A;  4KKJ A;  4CYE A;  1T5X D;  1RM6 C;  2KVR A;  3Q3J A;  4EFO A;  2WQY B;  1VZ8 A;  3PPA A;  3N1Z C;  1RLF A;  2H89 B;  2FID A;  2K22 A;  4WIP A;  5G2N A;  2KTR B;  2NR2 A;  2KWU B;  2PVO D;  3DBR I;  4FLH A;  3AN1 A;  3T3N A;  1HA5 A;  2FCS A;  2YEP B;  2L52 A;  2L7R A;  3NZS A;  3AE4 B;  2N1V A;  3PT2 B;  4BBN C;  1L2N A;  3DVG X;  1B1Z A;  4C7Y A;  4IW0 A;  1E6E B;  2L00 B;  2LFI A;  3HVD A;  3KWV A;  3CF6 E;  3BK2 A;  4ANU A;  2BPS A;  4URK A;  2I2Y A;  2WX1 A;  2MSE D;  1D5X C;  2KWC A;  3ZUN A;  4B0E A;  3RMK C;  2PLP A;  2MX2 A;  3TCA A;  1RAX A;  3P2B A;  4JQW C;  4P7I A;  4EZL A;  3NZU A;  1GNU A;  3IHP C;  4PT5 A;  1ZUD 2;  4ANX A;  3R3M A;  2ZVN A;  3JSV B;  3PGE A;  3TMP B;  1J7C A;  2J0K A;  3AEE B;  3EFC A;  3DHI C;  4W9I A;  3MJW A;  2ZJD A;  3CIR B;  5GMV A;  3KYC D;  2D3A A;  3PZ8 A;  1I42 A;  4MM3 B;  2JU6 X;  5IN7 A;  1XLP A;  2QMT A;  3ZRF A;  5BMH A;  4MSQ B;  4BFR A;  1L4Z B;  2JY6 A;  1WR6 E;  1SEB D;  4KVG B;  3A9K A;  5HFY A;  3DBS A;  3ZXR A;  1T0Y A;  1H4R A;  2BYE A;  1GOZ A;  2V1Y A;  3A9J A;  3AED B;  3TBL D;  3U2S C;  3QA8 A;  3ZW3 A;  3U7D A;  2C5L C;  2RPQ A;  5IA7 A;  5DCN A;  3VDZ A;  1QLB B;  4A20 A;  4BZA A;  4N6E B;  3U7Z A;  2PPH A;  4JLC A;  3AM9 A;  3EA6 A;  1YNT E;  3ZQ4 A;  1XQQ A;  4E3C A;  4C80 A;  1P9D U;  1UUP A;  1ISN A;  3CWI A;  3IG3 A;  3UQB A;  1QZE A;  2ASQ A;  1IPG A;  1TYG B;  3RZF A;  5BYR A;  2KDB A;  2IJ0 A;  4REZ A;  4L2Y A;  1N5X A;  2MBE A;  1WR1 A;  3Q14 C;  4YSY B;  5EDS A;  1RRB A;  2WDV B;  5KHO A;  3PZ7 A;  4YL8 A;  1TGZ B;  2C7N B;  1WYG A;  2HTH A;  3NS1 A;  1XO3 A;  2LXC A;  4WQM A;  2MEK A;  2LGX A;  1VD2 A;  1F1H A;  2WXI A;  1CZP A;  1MHX A;  2DWQ A;  2KXJ A;  2KTF A;  4RFB A;  1TJE A;  2LUE A;  3JSV A;  1A5R A;  2J4X A;  1N62 A;  4F1S A;  1FIQ A;  1WFY A;  2JYE A;  3ZDT A;  5H8Y E;  4LNO A;  4X57 B;  3KWL A;  3GZN I;  3L4P A;  1U4A A;  3QIJ A;  5HG2 A;  1PDX A;  3Q8E A;  4YXD B;  2KMA A;  2H88 B;  3PV1 A;  3BY4 B;  5D3I B;  1JRP A;  3QJZ A;  1Q0W B;  1VLB A;  1D3Z A;  1L0V B;  3WAN A;  3AV8 A;  1Y8R C;  5EE0 A;  5G5H A;  2MBH A;  5HI1 A;  4WWP A;  2AX5 A;  3ML8 A;  2HDE A;  4D2K A;  4JWS C;  3UIP B;  2N9P C;  3RN9 C;  4MGI E;  2G3Q B;  2JT4 B;  3IXS A;  1JWM D;  1YN5 A;  2INC C;  3ECI A;  2BTE A;  2ZZP B;  1WH3 A;  4DK5 A;  1N60 A;  2LVQ A;  3AU4 A;  2NTS A;  2WS3 B;  2JX5 A;  4IKG A;  3ZVV A;  2J7Q B;  2BVC A;  4TKN A;  3APF A;  2LVP A;  5JXV A;  1E90 A;  3W1S C;  1OFF A;  1QOG A;  2QEJ C;  3GP7 A;  3DBR B;  4RGN A;  5C23 A;  3A4R A;  1WJU A;  4GXB A;  3AXC A;  1HTQ A;  3RNE C;  2HE7 A;  2LGD A;  4AQ7 A;  4QAY A;  3ALB A;  2A5U A;  2KMM A;  4GLS C;  1UZX B;  2KYW A;  1SE3 A;  1C3T A;  3FIL A;  5CHV C;  3BZD B;  4P1B C;  1Y56 A;  3L13 A;  4EKU A;  4E71 A;  2DZI A;  2W82 A;  2CJO A;  3GE8 C;  2KX3 A;  3QK0 A;  4KZ0 A;  4OVV A;  4WAA A;  2LAS A;  1WX8 A;  3T9L A;  3CSF A;  3RFZ B;  3GOE A;  4RGM A;  2IDY A;  4C4V B;  2WDQ B;  3VH4 B;  4DXG A;  2MBQ A;  3H6N A;  2XBB C;  4PS8 A;  3V61 A;  4GN1 A;  1WYW B;  1GUA B;  1D5M C;  2KNB A;  3W5V B;  3MJ5 A;  2AYO B;  3NG0 A;  2OED A;  1XLQ A;  2NVU I;  4EZJ A;  2BB6 A;  3TIX A;  1C1Y B;  1TTN A;  1FCL A;  4YTM B;  2L1A A;  3NZ3 A;  4DHJ B;  4A3P A;  1YN4 A;  1WMH B;  4PYZ A;  4MDK E;  1NI3 A;  4ANW A;  3P1M A;  1UF0 A;  1ZDX A;  3K9O B;  3R7R A;  3ZXV A;  2IZV B;  4US9 A;  4HK2 A;  4A90 A;  2KQ7 A;  5EE3 A;  2WXR A;  3RPF C;  4FA6 A;  3WAL A;  4W9D A;  3I57 A;  3A1Q B;  2PKO A;  4C00 A;  4GDL A;  2V3P A;  3VUY A;  1I35 A;  2Y3A A;  4W9F A;  3VAW A;  3E56 A;  3AB5 A;  5AEK B;  2J53 A;  4K3B A;  3P4R B;  4IUM B;  5C1Z A;  4GDK B;  3KW5 B;  2KKC A;  2MW5 A;  3NRZ A;  4OZB A;  4G11 A;  3VR8 B;  3A33 B;  3LB8 C;  1IGD A;  2FCQ A;  2HJ8 A;  2ZW1 A;  3LYY A;  1R4M B;  2BYF A;  2B3A A;  4NAW A;  4HJG E;  3VUW A;  4BKT A;  2M19 A;  1GPX A;  3ZLZ A;  2Z8L A;  2Z0E B;  4GDK A;  4RM9 A;  5H92 C;  4W9E A;  3RNG C;  1MFW A;  2VRR B;  1STE A;  5IO9 A;  3W1S A;  3UIO B;  2PE9 A;  2JRH A;  1K53 A;  3A1Q A;  3H9D A;  2EMS A;  2KWV B;  3M3J A;  1KLG D;  3OLM D;  2W3R A;  5G5G A;  1C77 A;  3KQ4 A;  4KSL C;  3DHG C;  1P98 A;  2QSD A;  1ZPS A;  2N9E B;  1OEY J;  4GMV A;  3NHE B;  4N58 A;  1S3S G;  4XYC A;  1V9J A;  2WXK A;  2KX0 A;  1WGR A;  4DXA B;  2DBY A;  1LGR A;  3AH7 A;  2K9X A;  3QX1 A;  3ZNZ B;  3KH0 A;  1ET6 A;  3FC4 A;  4EZK A;  2VH2 A;  4K3C A;  2Y5C A;  4M02 A;  4K7S A;  3R8B A;  3A9J B;  4IG7 B;  3I9V 1;  1G6J A;  4C4V A;  5J17 A;  4ZRK A;  2LWP A;  3IT6 B;  2RDH A;  3V6E B;  4ZRQ A;  2KC2 A;  4GSW A;  2I38 A;  2OJR A;  4MM3 A;  3B1L X;  4KIK B;  2N9K A;  4A55 A;  1KJT A;  1WXS A;  3NY5 A;  3W1Y A;  4WH4 A;  2YLM A;  2PW9 A;  3AU5 A;  2WXP A;  2LHD A;  1D6E C;  1XCT L;  4J3O D;  4HXD A;  1T0S C;  2MQJ A;  2K1F A;  4WJP A;  4YSZ B;  3OAW A;  3ZNI D;  2KAN A;  3TEX A;  2JUO A;  3QCA A;  2PIA A;  2LXA A;  1ZGU B;  2JXT A;  2EKI A;  3DOW A;  2KQS A;  3VFK A;  1C4A A;  3ZJU A;  2JSV X;  1OTR B;  2K8H A;  3DWM A;  4IWP A;  2O6V A;  5CTR C;  1K50 A;  3R2I A;  2J0M A;  1R4M I;  4XZ4 A;  1YD8 U;  1HTO A;  3EGR A;  3AEG B;  2Q5W D;  1D4B A;  5I4D A;  1KLU D;  2CHW A;  1BT0 A;  2EEL A;  4W9G A;  3UF8 A;  2LVO A;  4R3D A;  5BMG A;  5DPT A;  4JWU C;  1TS3 A;  4XX5 A;  3AEA B;  4LJP B;  2WXQ A;  1KM7 A;  1WE7 A;  1V97 A;  2JZ3 B;  2IO3 B;  3VH3 B;  1Q1O A;  1SF0 A;  4HJK A;  1KLV A;  2JZP A;  2M17 A;  3R66 C;  2INN E;  3AE2 B;  1WF9 A;  4ASW C;  2D3G A;  2AEH A;  2ONQ A;  5E6J A;  1V5O A;  2K8B A;  2N0S B;  3HM6 X;  2W54 A;  2NTT A;  1NVI D;  5BYS A;  3VHT C;  4LTU A;  1XD3 B;  2J52 A;  1V1P A;  1TZ1 A;  4OHJ A;  1EWY C;  1M94 A;  1ZDV A;  4IWO A;  2MH7 A;  1UNS A;  2BKR B;  1UGJ A;  4BVU C;  5TSS A;  4RMA A;  3RNF C;  2E3T A;  3IAM 1;  2RDG A;  1HZ6 A;  2D2Q A;  5CHW A;  2LGY A;  2R61 A;  1NI2 A;  4B9K A;  1EUV B;  2KJR A;  4KSK C;  2IPK D;  2WU5 B;  1FNU A;  2DAF A;  4HKQ A;  1ESF A;  3TEZ A;  1OQR A;  1C4P A;  4RGT A;  3V3X A;  1K51 A;  2O2V B;  4LNF A;  3ZKJ C;  1FXT B;  4G3X B;  1JRU A;  3Q3O C;  4DXF A;  3TSS A;  3OWE B;  3URY A;  1ZOY B;  4LNK A;  2WXF A;  3B2G A;  2K25 A;  1VZ7 A;  2IY0 B;  3GS2 A;  3APD A;  4ARC A;  1F9J A;  2HD5 B;  3AE9 B;  2KLC A;  2WDT B;  3GB1 A;  1MHH E;  5TR5 A;  1TS5 A;  2V4L A;  3N1X C;  4MEL A;  2IO2 B;  1XT9 B;  3SHQ A;  4I6P A;  4F8C B;  1AN8 A;  1L0X B;  4XGA B;  2MA9 B;  1XCQ L;  1KFY B;  3HHM A;  1XF5 L;  2IGD A;  4LCD E;  3L10 B;  4JE3 B;  1WXA A;  1L6V A;  3MC8 A;  4JX1 C;  3X0W A;  4ICU A;  1F0Z A;  4EOY A;  2DYB A;  5BYQ A;  2JWU A;  3MFG A;  1IP9 A;  3Q2A C;  1FRD A;  4HVB A;  4K1R B;  3P42 A;  5J18 A;  2GBN A;  2GBR A;  5T8I A;  1WE6 A;  1OQQ A;  1TT5 B;  4MT5 A;  1AYF A;  1NEK B;  4FAD A;  3H7S A;  2WXH A;  3ABV B;  3FAH A;  4AP4 C;  4GB9 A;  3AEB B;  2IYD B;  3Q8F A;  1QT9 A;  1UWX A;  4KGR A;  4PK1 A;  4JPS A;  3TJP A;  3WAO A;  1VZ6 A;  4C7Z A;  2A4Z A;  2ZPN A;  2N9X A;  5BMI A;  3UIN B;  5AUI A;  1A70 A;  3NVY A;  2PJH A;  5DPR A;  3ZIM A;  2ZNV B;  4EE2 A;  4TQ1 A;  1P0R A;  4DBG A;  2ZVO A;  4WJN A;  1YJJ A;  4HKZ E;  2M0X A;  2G4D B;  2O6V B;  3TEW A;  3U8Z A;  2W55 A;  2DYM A;  3N9Y C;  5C2T B;  1C79 A;  1TY2 A;  2MJ3 A;  3X23 A;  5JZE B;  2NMQ A;  2ZPY A;  2DNF A;  2VH1 A;  3DHH C;  4HRO A;  1N6Z A;  3M95 A;  2K5P A;  1SJH D;  5AUK A;  3ZTC A;  1QOF A;  4RGO S;  3N32 A;  2CS4 A;  3LDZ E;  4LK0 M;  5LXH A;  1FNW A;  1J7B A;  4N9F 4;  2DYO A;  3EC8 A;  2KJ6 A;  4FJY A;  2IO0 B;  4I6L B;  2EKE C;  2C9W B;  2OOB B;  1F52 A;  3DBL B;  5AZF A;  4AWJ A;  1WJN A;  3BVM A;  3AI5 A;  3P4S B;  3VXW A;  1E9M A;  4RM8 A;  4NJ7 A;  3H7P B;  2GBM A;  4XDD A;  1GC6 A;  2BS2 B;  4WAF A;  4OZA A;  3RUI B;  3HIZ A;  4HDQ A;  2UYZ B;  2KDI A;  3DCG A;  1FO4 A;  3PZD A;  1KF6 B;  1E7U A;  1WGY A;  2KLG A;  1NYR A;  1EU3 A;  1S1Q B; 
#chains in the Genus database with same CATH homology
 4MJS A;  2Z59 B;  2Z0E B;  1IYF A;  4GDK A;  3RD2 A;  2Z0D B;  4RM9 A;  2M1M A;  4W9E A;  2NS5 A;  4AUQ C;  1NBF C;  1YQB A;  1GJZ A;  2MLB A;  3WAM A;  2VRR B;  4W9H A;  3IFW B;  4IC7 B;  4PS7 A;  2FIF A;  3UIO B;  3W1S A;  2PE9 A;  2JRH A;  3B0A A;  1ZW7 A;  3A1Q A;  3H9D A;  2EMS A;  3T8M A;  3NOB A;  1OQY A;  2D11 A;  3QHT A;  2KWV B;  2DZM A;  3N30 A;  2WX0 A;  4DWF A;  3RYT A;  3M3J A;  3OLM D;  1V2Y A;  2KDE B;  2W9N A;  2K6D B;  2JF5 A;  1WJ6 A;  4BOS C;  3WAP A;  3TL5 A;  2C7M B;  1MG8 A;  1WXV A;  4WWO A;  2LRU A;  4MH0 E;  2J0J A;  3M63 B;  3MTN B;  4KSL C;  1WGD A;  5FR6 A;  3OJ3 A;  4PS3 A;  1WIA A;  4CYE A;  3ONS A;  1R4N I;  1P98 A;  2EMT A;  2KVR A;  1WX9 A;  3VUX A;  3L0W B;  2N9E B;  3Q3J A;  4EFO A;  1OEY J;  3PPA A;  4GMV A;  3SDL C;  5L83 A;  3NHE B;  4DHZ B;  5JHA A;  1S3S G;  1WX7 A;  4JIO U;  1RLF A;  2K6Q A;  2LJ5 A;  2WYQ A;  2FID A;  1V9J A;  4FN2 A;  2KJH B;  2KX0 A;  1WGR A;  4DXA B;  3CMM B;  3ZNZ B;  5G2N A;  3QX1 A;  2KTR B;  2NR2 A;  1WZ3 A;  2KTR A;  4EUT A;  3KH0 A;  2KWU B;  3DBR I;  2IO1 B;  4FLH A;  4LDT B;  4EZK A;  2L0F A;  4DHZ E;  2FCS A;  4K7S A;  4DDI D;  4MGZ E;  2L7R A;  3NZS A;  3A9J B;  3IVF A;  1OEY A;  2N1V A;  4KDI C;  3PT2 B;  2CR5 A;  4IG7 B;  4BBN C;  3DVG X;  1J0G A;  1L2N A;  1H8C A;  2QHO A;  5KHQ A;  1G6J A;  5LLI A;  4E74 A;  4FUL A;  4ZRK A;  3PRE A;  2LWP A;  5J17 A;  1WM2 A;  4IW0 A;  2L00 B;  1WZ0 A;  2MBO A;  3V6E B;  1SGH A;  2GBK A;  2KC2 A;  3CF6 E;  4GSW A;  4ANU A;  3L17 A;  3S2A A;  2OJR A;  2BPS A;  4MM3 A;  3B1L X;  4KIK B;  1VCB A;  3WA0 A;  4URK A;  2WX1 A;  2MSE D;  1KJT A;  2KWC A;  1L7Y A;  2KK8 A;  1WXS A;  3ZNG C;  3NY5 A;  2KD0 A;  2ZEQ A;  3ZUN A;  3W1Y A;  2YLM A;  3I3T B;  2XK5 B;  3AU5 A;  4HLE A;  3DPD A;  2MX2 A;  1ZKH A;  3H1U A;  1RAX A;  3KUZ A;  3TCA A;  3P2B A;  4JQW C;  3A4S C;  4MEM A;  4P7I A;  4EZL A;  3APC A;  3NZU A;  3QAR A;  1E8X A;  2KN5 A;  1GNU A;  4KZC A;  3IHP C;  3VTW A;  4FJV B;  2KFK A;  4HXD A;  2MQJ A;  2K1F A;  2KC1 A;  4WJP A;  4CHK A;  3OAW A;  3ZNI D;  2KAN A;  3DVN V;  4KIK A;  2PEA A;  2FCM A;  3MHS D;  2JUO A;  2JPH A;  3QCA A;  4MSM B;  2LXA A;  3R3M A;  4ANX A;  2ZVN A;  1ZGU B;  3JSV B;  1HE8 A;  5BO4 B;  3PGE A;  3DOW A;  2KQS A;  4IWQ A;  3TMP B;  3VFK A;  1UBI A;  3C0R B;  2J0K A;  1OTR B;  4W9I A;  3ZTD A;  2K8H A;  3L16 A;  3MJW A;  2ZJD A;  2ZNV C;  4IWP A;  5GMV A;  3KYC D;  2L0T A;  2O6V A;  1V5T A;  5CTR C;  2DHZ A;  1I42 A;  3PSE B;  4W9J A;  2J0M A;  1R4M I;  3VVW B;  4XZ4 A;  1YD8 U;  3PS6 A;  1UGM A;  3RT3 B;  3ZRF A;  4BKG A;  4MSQ B;  4BFR A;  4FBJ B;  2RR9 A;  2JY6 A;  4II2 B;  1Z5S B;  4M8N A;  1WM3 A;  1WR6 E;  4NJ6 A;  4F7Z A;  4BBN F;  1CMX B;  2MWS B;  3DVN U;  4GGQ A;  3V62 A;  1E7V A;  4KVG B;  3A9K A;  3DBS A;  2CHW A;  1BT0 A;  1H4R A;  1T0Y A;  2BYE A;  2LVO A;  4W9G A;  3PLV A;  3UF8 A;  2V1Y A;  4NNJ B;  3A9J A;  2BKF A;  3H7P A;  3TBL D;  5DPT A;  5AZH A;  2FCN A;  3QA8 A;  4XX5 A;  3ZW3 A;  3U7D A;  2C5L C;  2RPQ A;  3DDC B;  5IA7 A;  5DCN A;  4LJP B;  4K7W A;  3VDZ A;  4A20 A;  1KM7 A;  1WE7 A;  2JZ3 B;  1P3Q U;  2IO3 B;  3VH3 B;  4W9L A;  1Q1O A;  3Q3F A;  4HJK A;  2O6V D;  3V60 A;  1KLV A;  1UD7 A;  3SU8 X;  2PPH A;  4JLC A;  4B6W A;  2M17 A;  3R66 C;  1GG3 A;  1XQQ A;  2BWE S;  2C60 A;  4E3C A;  4I6N B;  4WJO A;  1P9D U;  1YX6 B;  2AL6 A;  1ISN A;  3IG3 A;  4NPN A;  3UQB A;  3VTV A;  1QZE A;  2ASQ A;  5LXI B;  1WF9 A;  2RGF A;  3DQV A;  5G55 A;  1IPG A;  4ASW C;  5D7G A;  3RCZ A;  3RZF A;  4KDL B;  2D3G A;  2AEH A;  2KDB A;  2N4F A;  2IY1 B;  2MBE A;  1WR1 A;  3PLU A;  2NBW B;  3LJ3 A;  2RSU A;  1V5O A;  2BWF A;  3RZW C;  2DX5 B;  2K8B A;  1V81 A;  1RRB A;  3BIN A;  4NQL B;  4CO7 A;  5EDS A;  3HM6 X;  5KHO A;  4YL8 A;  2V3S A;  1TGZ B;  2C7N B;  4LDT D;  4WQO B;  5CX3 A;  2HTH A;  2O2V A;  3VHT C;  2LXC A;  1LFD A;  1E8W A;  4TUU A;  2BYV E;  1XD3 B;  2LGX A;  3KUC B;  1TZ1 A;  5DPS A;  1M94 A;  4GOC A;  1VD2 A;  4HWI B;  2NPT A;  4FHJ A;  4IWO A;  3SHQ A;  2BKR B;  3QWZ B;  4K7U A;  4M0W B;  3QQ8 B;  2R2O A;  2ZCC A;  2MCN B;  4BVU C;  2KXJ A;  4TV3 A;  2KTF A;  4RMA A;  3ZO5 B;  1SIF A;  3EFU A;  4TQ0 A;  2LUE A;  1WGG A;  2D2Q A;  3JSV A;  1A5R A;  5CHW A;  2LGY A;  1NI2 A;  4F1S A;  2M4N A;  3QC8 B;  4B9K A;  1EUV B;  1WFY A;  3ML9 A;  3DBH I;  2M8S A;  3ZDT A;  2D07 B;  4ZRI A;  2KJR A;  2FNJ B;  2IBI B;  2KHW B;  4J6I A;  4X57 B;  1GC7 A;  3O65 B;  3PRZ A;  4KSK C;  4AOF A;  2XEW A;  2AWT A;  4GU2 A;  3GZN I;  1K8R B;  5IAA C;  1U4A A;  3B08 A;  3QIJ A;  2I1J A;  2DAF A;  4GDL B;  2KMA A;  5D6J B;  4NQK E;  4W9K A;  1RFA A;  3PV1 A;  4G50 A;  3BY4 B;  3N3K B;  2CHZ A;  5J2R A;  2BGF A;  1E5W A;  2CKH B;  4HCN B;  2O2V B;  1Q0W B;  3QJZ A;  3ZRC A;  1EO6 A;  2DEN B;  2LZ6 A;  1FXT B;  4G3X B;  3ZKJ C;  4FHK A;  1JRU A;  2JWZ A;  3JYU A;  5E6O A;  1D3Z A;  3U30 A;  3WAN A;  3EEC A;  2D10 A;  1Y8R C;  2MBH A;  4WWP A;  2WWZ A;  5DPW A;  1WMH A;  3ML8 A;  4AJY B;  3ZDM C;  2GOW A;  2I1K A;  2K25 A;  4HCP B;  3UIP B;  4HPM B;  2IY0 B;  4BKS D;  4JGH B;  2N9P C;  4OVU A;  1AAR A;  4MGI E;  3APD A;  1F9J A;  2HD5 B;  5L95 C;  4II3 B;  2G3Q B;  2KLC A;  2WDT B;  5TR5 A;  2JT4 B;  3KYD D;  1OGW A;  2V4L A;  1Q5W B;  2DZK A;  4MJS B;  2N7D A;  2IO2 B;  1XT9 B;  1WRD B;  3ECI A;  4I6P A;  4MEL A;  2ZCB A;  2ZZP B;  1PQS A;  4F8C B;  1WH3 A;  4DK5 A;  2MA9 B;  4ZYN A;  2LVQ A;  3HHM A;  3AU4 A;  3ZVV A;  1UH6 A;  2J7Q B;  4TKN A;  3APF A;  2LVP A;  4LCD E;  1E90 A;  3A9K B;  1Z2M A;  4G0N B;  3W1S C;  3L10 B;  4ZRJ A;  1WXA A;  4NY0 A;  3X0W A;  4ICU A;  2MP2 B;  3PVL A;  4EOY A;  5C23 A;  4BKS A;  2DYB A;  2JVC A;  3A4R A;  2L05 A;  5E6N A;  2KOX A;  3KUD B;  1WJU A;  2DZJ A;  1IP9 A;  2NPT B;  4HPL B;  3HK0 A;  4GXB A;  3AXC A;  3R7Q A;  2XK5 A;  3WIM A;  1WJ4 A;  4HVB A;  2HE7 A;  2LGD A;  3ALB A;  4K1R B;  2A5U A;  1EF5 A;  1YIW A;  2DAJ A;  5JHB A;  2KFK B;  4MGK E;  5J18 A;  2L76 A;  4B95 A;  4DHJ D;  2GBN A;  1UZX B;  2GBR A;  2R2Q A;  1C3T A;  2Y5B B;  1WE6 A;  5CHV C;  1NDD A;  3ZLZ A;  4FAD A;  3H7S A;  3L13 A;  4ICV A;  1E8Z A;  4AP4 C;  1LM8 B;  3DBL I;  4GB9 A;  2CHX A;  4EKU A;  2IYD B;  4E71 A;  2DZI A;  4PYU A;  3TJP A;  3WAO A;  2KX3 A;  3QK0 A;  2G4S A;  2NCN A;  4KZ0 A;  4OVV A;  3QAQ A;  2GBJ A;  2LAS A;  1WXM A;  4WAA A;  1WX8 A;  2A4Z A;  2ZPN A;  2N9X A;  3CSF A;  4FJZ A;  3T9L A;  3GOE A;  3JVZ X;  3PHX B;  1V49 A;  5CHF A;  3UIN B;  2C7H A;  4XC2 A;  1LQB A;  2JXX A;  2PJH A;  5DPR A;  3UGB B;  3ZIM A;  2ZNV B;  4TQ1 A;  4WJQ A;  3VH4 B;  2MBB B;  3PHW B;  1KOT A;  1P0R A;  3VQI A;  3IBE A;  2MBQ A;  3H6N A;  3PRP B;  2XBB C;  4DBG A;  2ZVO A;  4WJN A;  2RD0 A;  3D32 A;  4PS8 A;  2M0X A;  1J8C A;  4NAW B;  1V80 A;  2FAZ A;  1E8Y A;  2G4D B;  4MGY E;  4LJO B;  3V61 A;  2O6V B;  4GN1 A;  2L8J A;  1WYW B;  1EF1 A;  1WGH A;  4EEW A;  1GUA B;  1TBE A;  3U8Z A;  2MP2 A;  2KNB A;  2DYM A;  2L3Z A;  2NBV B;  3VTU A;  1P1A A;  1WI0 A;  2AYO B;  2K39 A;  1V86 A;  3ZNH B;  4AJW A;  2LI5 A;  2AL3 A;  3M62 B;  2NVU I;  2FUH B;  3JW0 X;  3DVG Y;  4M8M A;  4EZJ A;  3OJ4 B;  2PE6 B;  3TIX A;  3X23 A;  1C1Y B;  1TTN A;  2KO3 A;  2ZPY A;  5JZE B;  4DHJ B;  4A3P A;  2JZZ A;  3K9P B;  5AZG A;  1WMH B;  4PYZ A;  4MDK E;  2K8C A;  2N1W A;  3PTF C;  3M95 A;  3ENE A;  4BOZ B;  4ANW A;  3RUL A;  1LXD A;  1X1M A;  5E6P A;  2KMC A;  3K9O B;  3R7R A;  2IZV B;  3AUL A;  4HK2 A;  3ZTC A;  3N32 A;  2CS4 A;  2KQ7 A;  3LDZ E;  4W9C A;  5LXH A;  1WY8 A;  2JRI B;  2UWQ A;  3WAL A;  1J19 A;  4W9D A;  4FA6 A;  3A1Q B;  5JH5 C;  1UBQ A;  4ANV A;  4N9F 4;  2DYO A;  3CST A;  3HM3 A;  3EC8 A;  2KJ6 A;  4FJY A;  2IO0 B;  4GDL A;  4I6L B;  5D2M B;  2GMI C;  3UQA A;  2EKE C;  3V6C B;  1UEL A;  2C9W B;  2OOB B;  3VUY A;  1I35 A;  4W9F A;  3VAW A;  1V6E A;  4A3O A;  1YX5 B;  2KFJ A;  5AZF A;  3L08 A;  2CU1 A;  5AEK B;  4IM2 A;  3PRM B;  4IUM B;  2YVC A;  3NS8 A;  4GDK B;  4AWJ A;  5C1Z A;  2LD9 A;  1WJN A;  2NBU A;  3KW5 B;  5D94 A;  3AI5 A;  3VXW A;  2KKC A;  2MW5 A;  3L54 A;  4WWN A;  4RM8 A;  4G11 A;  2BF8 B;  3KVF B;  4NJ7 A;  3H7P B;  2GBM A;  4ZDV A;  2MRP A;  2KZR A;  4JL9 A;  2G45 B;  1GC6 A;  3A33 B;  4GIV A;  1YJ1 A;  1SE9 A;  4IM0 A;  2KDF B;  3EHV A;  2FCQ A;  4KV2 A;  2HJ8 A;  3RUI B;  2REX A;  3HIZ A;  4HDQ A;  2UYZ B;  2KDI A;  2BYF A;  3DCG A;  4HDO A;  3PZD A;  2B3A A;  4NAW A;  3VUW A;  3SD5 A;  4DDG D;  4BKT A;  1E7U A;  2LRW A;  1WGY A;  2KLG A;  5HKH A;  4IM3 A;  4K81 A;  2N7E A;  1S1Q B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...