2LEKA

Solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiamin biosynthesis ThiS
publication title Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325
rcsb
source organism Rhodopseudomonas palustris
molecule tags Biosynthetic protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lekA00
5EE3A 1FMAD 1JROA 3NVVA 4YTMB 2M56B 2H88B 1ROEA 4JWUC 1XO3A 3AE2B 1XLPA 3W5UB 1J7BA 5AUKA 4YSYB 3AE3B 1N61A 1SB3C 1L0VB 2W54A 3P4PB 4JWSC 1VJKA 3FC4A 4P6VF 4C7YA 1DGJA 1JALA 1QLBB 3VRAB 1E7PB 3CWIA 1E9MA 2WU5B 1DOXA 3AN1A 3EUB2 3P1MA 4US8A 1I7HA 2KAJA 5H92C 1KRHA 1E6EB 2DWQA 3VR9B 1F0ZA 4HROA 2CJNA 3P4SB 4USAA 2AX5A 3DWGC 1NYQA 2Y5CA 1FRDA 1FM0D 2JX5A 4C7ZA 4ZHOA 4ZHPA 1NYRA 3P4QB 5GXGB 1XLQA 4HRSA 3HUIA 3ETRA 1A70A 1QOGA 1TYGB 2MJ3A 2N0SB 1RYJA 1ZUD2 3NRZA 1N60A 3AEDB 2K5PA 2W3SA 1XLOA 3AECB 4YTNB 3B9JA 3WCQA 1L6UA 3B2GA 4C80A 1SF0A 2WU2B 5AUIA 5G5HA 3AB5A 3AE6B 3SFDB 2B76B 3ZYYX 4YXDB 3CIRB 1TKYA 1NI3A 1ZXIA 3W9CB 1WYGA 2W55A 4A9AA 2BT6A 1FFVA 3P4RB 2WDQB 1JW9D 1L5PA 2MJEA 4WWMA 1YJIA 3AE4B 2WDRB 3AMZA 1N63A 1DOYA 4YTPB 1OFFA 4N58A 1WWTA 1JQ4A 3AE1B 1WRIA 1AWDA 2WQYB 1OQQA 1CJEA 1FXAA 1PDXA 1GAQB 3LB8C 2ACZB 3DWMA 3KWLA 1NEKB 1J7AA 1TKGA 2M19A 1FO4A 2H89B 4YSZB 2E3TA 1XLNA 1N5WA 2FBWB 5C3JB 2PKOA 3AE7B 1IUEA 1RFKA 2WP9B 3NS1A 2WDVB 1UWMA 2OHFA 2BS4B 3AE9B 2WS3B 3BIID 2LEKA 1PUTA 3B2FA 1V97A 1R7SA 1QF6A 1JWAD 4JX1C 1WXQA 2PVGC 1RM6C 1ZP0B 3AEGB 4WQMA 4ZOHC 1EWYC 1FFUA 3HVZA 1QOBA 3LXFA 2QIEB 3AEFB 1L6VA 1ZOYB 1T3QA 1N62A 2Q5WD 3AM9A 1KF6B 2WLBA 1VDVA 2EKIA 3W5VB 1RWSA 3SFEB 3VRBB 3SR6A 3AEAB 4YT0B 1FRRA 5G5GA 2DBYA 2W3RA 5H8YE 2JQRB 2BS3B 1YQ4B 2BS2B 2QJLA 3L4PA 1JWBD 3NVZA 2CJOA 1E0ZA 2L83A 5EE9A 1AYFA 1NENB 1QOAA 1J7CA 1SIJA 2MJDA 3AH7A 1FXIA 3NVWA 2PIAA 2PVOD 1N5XA 3AE8B 4N6EB 4US9A 3AEEB 3P63A 4ITKA 1JRPA 5C2TB 1E10A 1YQ3B 2G1EA 1V8CA 1TKEA 2KMMA 2MH7A 3HRDD 4KX6B 1CZPA 1TJEA 3ABVB 1FIQA 4N59A 4FXCA 1WGKA 2HTME 3FAHA 3RPFC 5EE1A 2K9XA 1PFDA 1KFYB 3AE5B 4YSXB 1B9RA 1QT9A 4IDIA 1NVID 5EE0A 2CU3A 1VLBA 3PO0A 4LTUA 1GPXA 2L52A 1QOFA 3NVYA 1DOIA 3VR8B 5MPOA 3AEBB 2K22A 1OQRA 3AV8A 1YJJA
chains in the Genus database with same CATH superfamily
4KZCA 5HI1A 2TSSA 1L4ZB 3QC8B 3QK0A 4IWQA 4FN2A 4AS1A 2KN5A 4W9KA 1UD7A 4JWSC 1HQRD 4K81A 1CK1A 3IFWB 2ZCCA 2Y5BB 1KRHA 5DPRA 2LHDA 1C4CA 4C7ZA 2JVCA 2D10A 3APDA 1XLOA 2BKRB 4B95A 1NDDA 3B2GA 5AUIA 3AB5A 3N30A 3P4RB 3Q69A 1UUPA 1F52A 2ZVNA 2J52A 1WWTA 1FXAA 2DAFA 1P7EA 4XX5A 1FO4A 3D32A 3VDZA 1SXTA 5C3JB 4RFBA 1IUEA 2IJ0A 2UYZB 1ZXHA 2OHFA 1V5OA 4HXDA 1VZ8A 5EDSA 4HKQA 1MHXA 2BWES 2RMMA 4EFOA 4NPNA 1T0YA 3ZDTA 1E5WA 4A3PA 2EKIA 1WH3A 2N9KA 4OZCA 2KO3A 5H8YE 4HPLB 2BS3B 3V6EB 1JWBD 2LASA 4TUUA 1YIWA 3PVLA 2PW9A 1HZ5A 4LDTB 1JRPA 2G1EA 1XT9B 2R2OA 2BB5A 2K9XA 1UBIA 2IGHA 5J18A 2MLBA 3TEWA 3AEBB 4HKZE 1DYQA 1V5TA 1WR6E 2LGIA 1F1HA 2N9EB 2H88B 2C5LC 4HJKA 1IP9A 4A8XC 5JHBA 4S17A 4X57B 2IGDA 1E7PB 5JZEB 3A4RA 2LJ5A 3U30A 3DBRI 1IGDA 5AZHA 2K6QA 2PE6B 4HRSA 3SU8X 4EOYA 1WM3A 1I4GA 3NRZA 2AQ1B 2K5PA 1GC6A 1STEA 3ZYYX 3WALA 1UNSA 3APFA 3AE4B 3AMZA 2GBMA 3DVNV 4BBNF 1JQ4A 2KJ6A 3IG3A 1EO6A 1F9JA 4XYCA 2KTFA 3HHMA 1PDXA 2QC8A 2ACZB 2L3ZA 2M19A 2E3TA 4DXFA 2QSDA 4RGTA 3N9YC 4NQLB 3QJZA 1PYWD 3IXSA 4L2YA 1FCCC 1EWYC 1D5XC 2DYBA 5JHAA 1WIAA 2RPVA 1EU4A 3SFEB 2M1MA 1V9JA 3KH0A 5BYQA 2RDGA 1P98A 4UDUC 4F7ZA 3PPAA 4N6EB 3DBLB 2V3NA 3QX1A 5C23A 3UGBB 3QCAA 1LXDA 1UELA 1S3SG 4OZBA 2IO3B 2WGSA 2L52A 1TS2A 1WRIA 4M00A 2A4ZA 2ZW1A 3NHEB 4YSYB 2FAZA 1N61A 4WAFA 4JL9A 4H2AA 4C7YA 1ZE3D 1VZ7A 3TCAA 2KAJA 1PQSA 5FK9C 3H6NA 4W9FA 2FCQA 1V49A 1TS4A 4IWOA 4ZHPA 5GXGB 2JZZA 2Z59B 1F2RC 2VZKB 2NCNA 1NBFC 1WFYA 3K9PB 3DBHI 4P1BC 3FILB 2BW2A 2LJIA 1JW9D 3QWZB 4P16A 3UI3A 1ZKHA 1N63A 2JRHA 4ZDVA 1OQQA 2E6XA 3P42A 1P0RA 1LO5D 2KTRB 3PSEB 4C00A 3ONSA 2WS3B 4C4VA 2OEDA 4E3CA 4HJGE 4OW0A 3RI7C 1YNTE 2RDBC 2X8XX 4M01A 3KYCD 3W1YA 3NS8A 3Q8CA 1I35A 2QIEB 1K50A 1SIFA 1IYFA 1L0XB 1T3QA 1E90A 1XXGA 2KVRA 1SE4A 4WJOA 5D94A 2D3AA 2KC2A 4M8MA 1GB1A 1XEEA 2NS5A 4ICVA 3VXWA 2MWSB 3FILA 4B0MA 2JU6X 1B9RA 2K1FA 3VR8B 3ABVB 1UGMA 3VH4B 3DHIC 1SGHA 3Q6BA 4K3CA 3TJPA 1YOVB 4G11A 3ZRCA 3R3MA 2KWDA 4IG7B 4JWUC 3NZSA 3SD5A 3AE3B 1SB3C 3N1YC 4GN1A 5LXIB 1L7YA 4EZJA 4US8A 2MQJA 3QHTA 3GE8C 2AQ2B 3PLVA 3V62A 2HJ8A 4FJZA 3HK0A 1I42A 2JSVX 4RGOS 3RZWC 1HE8A 4CQNA 2K25A 2KHWB 2LZ6A 1GB4A 2FE8A 1GC7A 2INNE 1XQQA 2GMIC 1R4MB 1OQYA 2JYEA 2NR2A 1OFFA 2NTTA 4JPSA 1CJEA 2JZ3B 3QA8A 2KDFB 1VCBA 2O6VD 1J7AA 3KWLA 2ZW0A 4YL8A 4DK5A 2D07B 1RFKA 2BB6A 2DZMA 4BBNC 1PUTA 3ZNGC 3AEGB 1T0SC 2KWVB 2DLBA 1YQBA 2FUHB 3EECA 2BYVE 4XDDA 2ON8A 3Q2AC 3RCZA 2LRUA 4US9A 2RGFA 3U8ZA 1MJDA 1YQ3B 4KZ0A 4N59A 3ZVVA 2D3GA 1WGHA 2XK5B 4OVUA 3PO0A 1VLBA 1I4QA 2PE9A 3IBEA 1RAXA 2L7RA 4ASWC 3HIZA 2WNMA 1MVKA 1RLFA 4WQOB 1XO3A 5L95C 3UQBA 3MFGA 4I6NB 2EKEC 2GRIA 5J17A 3DPDA 4KDLB 3T3OA 4PT5A 5BMGA 1V2YA 4RGNA 2LVQA 3P4SB 4ZHOA 2JX5A 1FM0D 3Q8BA 3GZNI 3LYYA 1TYGB 1D5MC 2MHJA 2XK5A 3R2TA 3WCQA 4F1SA 3ALBA 3GOEA 2PPHA 2CKHB 3MC8A 1WYGA 4HCNB 4E74A 1YN4A 4XDCA 3C19A 2N9PC 2UWQA 2Y3AA 4GU2A 3OWEB 5CHVC 3MP9A 3DOWA 3PRZA 2EMTA 2INCC 2FBWB 3U52E 1OGWA 2BS4B 3BK1A 3VFKA 4GDKB 3V6CB 1MI0A 3ZUNA 3HVZA 4KKJA 2LVOA 1VRAB 4F8CB 2KKCA 2G9HD 1E8YA 3RN9C 4NJ6A 2NMQA 3QAQA 3BK2A 2KJRA 4KKIA 1FNUA 1Q1OA 4E71A 3A9KB 2AEHA 1FXIA 3E56A 4JLCA 3HM3A 1Z2MA 1TKEA 5D7GA 4FXCA 2LI5A 2K39A 3HVDA 2OOBB 5EE0A 2IZVB 2OJRA 3P2BA 5CHFA 2M8SA 4WJPA 2M56B 1ROEA 4EKUA 4KDIC 4GDKA 4MEMA 1J7BA 2YLMA 2J7QB 3OG5A 2W54A 3A1QB 1Q5WB 2WXIA 1LFDA 3L08A 1V1OA 1JALA 2W9NA 3VRAB 4AOFA 2J53A 2NPTA 2FUG1 2LRWA 1DOXA 3AN1A 3H7SA 3ZXVA 2O6VA 1T0RC 2IO1B 1P9DU 4BKGA 2GBNA 5LXHA 2C7NB 2XEWA 1G6JA 3MHZA 4RCOA 1C4PA 1A70A 3AEDB 3Q3FA 3Q8AA 4ANUA 2MBHA 1TTNA 1IBXB 1L6UA 3L54A 2LMCA 5TSSA 4BOSC 1NI3A 3JW0X 1GG3A 4II3B 2MP2A 2SEBD 4LNKA 4FA6A 1ZPSA 1TS5A 1TZOA 1R4NB 4G0NB 1XCTL 2LFIA 3RNGC 4W9HA 3A1QA 3NOBA 1WY8A 2V3PA 1U4AA 2DZKA 4BKSA 3WIMA 1MFWA 3BIID 3Q3OC 5E6NA 2RSUA 2WXKA 3N20C 3ZLZA 1FFUA 2KC1A 2N7DA 2C7HA 1BMLC 3DHGC 1KF6B 3CSFA 1IBXA 3W5VB 4YT0B 5G5GA 3ZNHB 1HA5A 2CJOA 2L83A 3VTVA 1UZXB 4K7WA 3PRPB 3AEEB 3P63A 2N1WA 1CZPA 1WGKA 1FCLA 3RD2A 2BWFA 3GB1A 4DWFA 3RZFA 4LTUA 2KACA 1ZDXA 1OQRA 1EUVB 1RFAA 1FMAD 1T5XD 3W5UB 1TGZB 2NBUA 5CX3A 3ECIA 3PV1A 1YN3A 3BWUD 1E9MA 3L16A 2LGXA 3QQ8B 2KFJA 2YEPF 1I7HA 4FULA 1EU3A 5CTRC 4RNAA 2KX0A 2KQ4X 3B1LX 1C79A 1H8CA 3KUCB 1Q10A 4RM9A 3WANA 2J42A 2N0SB 5E6JA 2LGSA 2CU1A 1WI0A 3RUIB 4RM8A 3N1ZC 4C80A 3TUOA 2QEJC 3EGRA 3T3NA 4DHJD 4A9AA 2W55A 1FFVA 1WYWB 1MPEA 4NZLB 1E8WA 2MJEA 3IVFA 4BKTA 4FJYA 2REXA 2R61A 2JYTA 1AWDA 2BKFA 2NBVB 3CF6E 3TL5A 3LB8C 2WXFA 2FCNA 2WXHA 2ZNVC 3I5JC 3X23A 4PS7A 3AE7B 2SAKA 4FJVB 3PGEA 4BZAA 1CMXB 1WGYA 1JWAD 1ZP0B 3PRMB 4ANWA 3VTWA 2J0KA 2I1JA 4I6LB 1KTKA 3ZTDA 2O2VB 1E0ZA 3IHPC 1E7VA 2PVOD 3AE8B 2WWZA 2BGFA 3NJTA 1FIQA 1K51A 1KFYB 4FLHA 2YEPB 5BMIA 3TEXA 2JUOA 3ZNZB 4WAAA 1WGRA 1WXVA 4KGRA 5DPTA 2AQ3B 4WURA 2KQ7A 4IOIE 1D5ZC 1WE7A 1XCQL 3DVGY 4EEWA 3RNBC 3Q8EA 2KD0A 2WX0A 2DNFA 2KDEB 1L4DB 3AULA 2V3SA 4DXAB 3MJ5A 4HLEA 3TSSA 2WU5B 2IY1B 3H8HA 2MRPA 2MX2A 4HK2A 2FIFA 1QILA 1E8ZA 2MSED 3BZDB 1KLUD 2KANA 2PJHA 2O2VA 3DVNU 3PTFC 4W9GA 3VR9B 2K8BA 2DZIA 3WAPA 2WYQA 5G2NA 3S2AA 1ZUD2 2DENB 5E6OA 3R2IA 2KOXA 1J0GA 4WWNA 2N4FA 3QIJA 3W1SA 3W9CB 4L23A 4TV3A 5D2MB 1UH6A 2LWPA 2L8JA 4B9KA 1VZ6A 4C4VB 3TBLD 1DOYA 4XC2A 2KK8A 4TQ0A 4FHJA 3TEZA 2L76A 3ZQ4A 2PLPA 4GB9A 1YMHE 2DZJA 2MBQA 3GP7A 4HWIB 1LM8B 3MTNB 3AE9B 2KNBA 4II2B 1TZ1A 3DDCB 4W9CA 1I4RA 4HDOA 2PEAA 3FKYA 3GS2A 4XWWA 1LQBA 2MBOA 2IGGA 4NJ7A 2Q5WD 1ET6A 2LGYA 4PS8A 4EUTA 2CR5A 5BYRA 1S1QB 4CYEA 2KXJA 2DX5B 2M0XA 1SIJA 1E7UA 1E10A 5KHQA 3L17A 5AZFA 2MH7A 2JF5A 2V4IB 2GBKA 4GDLB 1A5RA 3CMMB 3ZXRA 2KQSA 4HVBA 4NAMA 2BBCA 3A9JB 3MC9A 4MSMB 3BINA 1QZEA 4EE2A 2LUEA 2C9WB 1SEBD 5FR3A 4AWJA 3VUXA 3RMKC 1DGJA 2K0PA 5FKAC 1WR1A 2BYTA 1ZDVA 3VTUA 2DWQA 2FIDA 2AX5A 2VH2A 3DWGC 4IW0A 4DDGD 3PZ7A 1WJ4A 2IPKD 5DPWA 2QHOA 3U7DA 2N9LA 3EFUA 2Y5PA 4GDLA 3W1SC 4A3OA 5LLIA 2WU2B 3AE6B 3CIRB 1TKYA 2KZRA 3A9JA 2JWZA 2AYOB 3KQ4A 4K3BA 3DVGX 2N7EA 4MACA 1YX6B 1D3ZA 3NY5A 2WHIA 2AWTA 1UGJA 3OAWA 2WXMA 2LXCA 3VAWA 1WJ6A 1QF6A 4WQMA 3BVGA 3OJ3A 1MHHE 4MM3B 1WGGA 2BYEA 3JVZX 3PZDA 3IT4B 5HFYA 1YX5B 2OJWA 3DBRB 1RWSA 2JRIB 3EC8A 2WXRA 4MELA 5IO9A 5EE9A 5TR5A 1NENB 1ZGUB 3K9OB 3T8MA 4IC7B 4ANVA 3R8BA 2WXOA 3HRDD 3BVZA 1QQRA 1P3QU 2HJ1A 2V4LA 1WXAA 2J0JA 1GPXA 1PGXA 4ZYNA 2IO0B 3APCA 2G4SA 1VD2A 4XE0A 3KLSX 3N1XC 1JMLA 2C60A 4W9IA 1QKZA 2WXPA 3P4PB 3ZO5B 4MM3A 2XN9C 4P6VF 2V1YA 4GSWA 2WX1A 3H9DA 4D2KA 3I57A 1V86A 1LGRA 4LJOB 3N32A 1SE9A 1TS3A 1E6EB 5KHOA 1I4HA 4HROA 2CJNA 2Y5CA 1GNUA 3BVMA 4CHKA 2WXQA 3MHSD 2Z0EB 3ZJUA 1RRBA 2LHEA 1L2NA 2MW5A 1Z5SB 4AUQC 3ZJTA 3IAS1 3WA0A 1TT5B 4YWGG 1EWCA 3VQIA 3RNFC 1SJED 2PTLA 1F2RI 3X0WA 4HPMB 1BXTA 2JWUA 3DWMA 2QDFA 4M02A 4NAWB 1WX9A 2PKOA 1ISNA 5G55A 2WXNA 4B0EA 3DCGA 4M8NA 3GE3C 3TMPB 1TIFA 4ZOHC 2XNAC 2KYWA 1WXMA 5BYSA 3AM9A 4RF1A 3V60A 2HTHA 3L13A 3ZGZA 2GB1A 5C1ZA 3Q14C 2BPSA 1N6ZA 4OVZA 2CS4A 1J7CA 4YTPB 4K1RB 1N5XA 2EELA 4KSKC 4KX6B 1ENFA 4MGZE 2KDBA 3DBHB 4DQOC 4GLSC 4ZRPA 2L1AA 2R2QA 1HXYD 2NPTB 3I3TB 4NAWA 2O6VB 3RYTA 3L10B 1JROA 2RR9A 1C77A 2L0FA 4LNOA 2Z8LA 4I6PA 4LNFA 4W9DA 1WX7A 4JIOU 2VH1A 4GXBA 3P1MA 4WJNA 3L0WB 1AN8A 4A20A 1WE6A 2IYDB 5DCNA 5T8IA 3UINB 1IPGA 3RNCC 2BYFA 3V61A 1FD6A 4A6QA 2M4NA 2MP2B 1XLQA 2K8HA 2MJ3A 2IDYA 5I4DA 3AECB 1FNVA 5J2RA 1HEZE 2KMCA 4TMAB 3C8YA 3RFZB 1SF0A 3DBLI 4YXDB 4LDTD 1F77A 4G3XB 5FR6A 1WJNA 2NTSA 2ZEQA 1XF5L 4ICUA 2ZNVB 4J6IA 5AEKB 4MGKE 2QCZA 4DBGA 2FCMA 3O13A 2D3BA 1C9FA 1GAQB 2UU7A 1E8XA 2H89B 2QMTA 2RDHA 1XLNA 2MBBB 1Q0WB 5IP4D 3BYTB 2MCNB 1FPYA 2EMSA 2PVGC 3UQAA 1XD3B 3NZUA 4MGIE 1JWSD 3PLUA 1D6EC 2J4XA 4G50A 2DBYA 2QJLA 2KT7A 3NVZA 3EHVA 5D6JB 2LXAA 2N7JA 3LJ3A 1KH0A 1AYFA 3AH7A 3A33B 1Y8RC 2GLSA 3WAOA 2KVZA 2GBJA 4ITKA 2AL3A 1V8CA 2KMMA 4KSLC 1EF1A 2HTME 3MJWA 1TY0A 1PFDA 4ANXA 1QT9A 2KN4A 4W9JA 2QILA 3ZNID 4GIVA 2Z0DB 2GOWA 1VR9A 2W3RA 4FBJB 2INPE 5L83A 3KWVA 1C76A 3R66C 1L0VB 2GBRA 1QLBB 3CWIA 5IOIA 2NBWB 3EUB2 4KIKB 3ZKJC 2NVUI 3KVFB 1ESFA 4USAA 2ZPYA 1FRDA 5HG2A 3P4QB 1PGBA 3ETRA 1FXTB 1RYJA 2K3UA 2ZZPB 2JXXA 1I4PA 2KMAA 2ZCBA 1H4RA 1AW7A 2B76B 2HE7A 3JSVB 4GMVA 5D3IB 4MT5A 1WMHB 4S0RA 3AXCA 3PHWB 2BVCA 3BY4B 1WM2A 1N5WA 1L0YB 4KIKA 2LEKA 1V97A 4JX1C 1KOTA 2L0TA 1M94A 5BMHA 5GMVA 2I2YA 1N62A 2WLBA 4XZ4A 4GOCA 1J8CA 3QARA 1JWMD 3GZNB 4A55A 4ZRJA 3UF8A 3VHTC 4HDQA 4IM2A 2VRRB 3JSVA 2RPQA 3SDLC 3DBSA 2ICIA 1WMHA 2VZKD 3VUYA 2KX3A 1IGCA 4LJPB 4W9LA 2KFKB 1FEHA 2CHWA 4MH0E 1R4MI 4YSXB 3N3KB 2IY0B 1NVID 3CSTA 2MEKA 2WXJA 4FHKA 2K22A 3EFCA 4DDID 3AV8A 3H1UA 2LD9A 2JT4B 5EE3A 1OEYJ 4ACFA 4IUMB 1XLPA 2L05A 4A90A 3FC4A 4ZRKA 3OLMD 1UF0A 2AL6A 4LK0M 2JPHA 4NNJB 3Q8FA 3URYA 4BAXA 2LVPA 1F0ZA 2HD5B 4TSSA 1NYRA 1K52A 5E6PA 4LNNA 2KFKA 4EZKA 1I4XA 1UBQA 4KGTA 4N9F4 4Q2JA 3HM6X 1HTQA 4ZRIA 2K6DB 1AARA 3TEYA 4L1BA 2IO2B 1C78A 1SE2A 4N58A 3AE1B 2WQYB 1KM7A 4K7UA 3EA6A 2BF8B 3O65B 3PHXB 1ET9A 3KYDD 2N1VA 1V81A 2ZVOA 3KUZA 3A4SC 2KLCA 3NS1A 3T9LA 3AU4A 3TIXA 3JYUA 2G4DB 2INDC 4MH8A 1R7SA 2LGDA 1SSNA 5JH5C 4MJSB 3MC0B 2D11A 4KV2A 3LXFA 3U7ZA 1MG4A 3I63C 3I9V1 3ML9A 4PS3A 3PT2B 2DHZA 4GGQA 4DHZE 1T6BX 3L4PA 4WWOA 2IBIB 2LUMA 3NVWA 5HKHA 4DHJB 2FNJB 2CHXA 3NZ3A 3H7PB 4PK1A 5EE1A 2K8CA 3AE5B 4IDIA 4OVVA 4AP4C 1QOFA 4FADA 3B0AA 2V0GA 3NVVA 4YTMB 1CQVA 3AE2B 1GJZA 5AUKA 4MJSA 1TBEA 1FNWA 4LLGM 1WZ0A 3B08A 1KJTA 4REZA 3Q3JA 5CHWA 2ZJDA 1GUAB 3BYYB 4ARCA 1NYQA 1GOZA 1C4AA 3M95A 5D3DA 1BUIC 1SBBB 3H7PA 4O1NA 1YD8U 3B9JA 4J3OD 2KLGA 3R7QA 3SHQA 4RMAA 2X38A 2WXGA 3AU5A 3ZTCA 1SE3A 4WIPA 2WDQB 4P7IA 1HTOA 4P1CC 4JGHB 2JZPA 3V05A 1HZ6A 1NEKB 3LDZE 2A5UA 1M4VA 5BO4B 1B1ZA 4ARIA 1D4BA 2ONQA 1YN5A 2WDVB 1WF9A 2WXLA 1EM7A 2W82A 1WZ3A 3ZDMC 1P1AA 2ASQA 1WXQA 4XWTA 2V9HA 1QOBA 2KTRA 1ZOYB 4BVUC 3Q3NC 2KDIA 1VDVA 5HHDG 3SR6A 2JQRB 3NG0A 1YQ4B 5AZGA 5DPSA 3M62B 1P7FA 3SEBA 1V6EA 1KLVA 4KVGB 4EZLA 2MJDA 1K53A 4M0WB 2RD0A 4IWPA 4MGYE 4BOZB 1TJEA 4URKA 3PS6A 1WRDB 2XBBC 2MBEA 4IM0A 4RF0A 2CU3A 2GI9A 3PREA 1R4NI 4OHJA 3J9CA 3KW5B 1T0QC 5IKCM 4XGAB 4K7SA 1C1YB 5LNK1 4R3DA 1VJKA 4BFRA 3VUWA 3V3XA 3OJ4B 2FCSA 3Q3MC 2ZPNA 4TKNA 3U4EG 1V80A 1ZW7A 2DYMA 4IM3A 1WGDA 4M0WA 2I1KA 1Y56A 2DYOA 4NY0A 2KJHB 1WJUA 2CHZA 4RGMA 5G5HA 1TY2A 1NI2A 1ZXIA 2D5GA 5IN7A 3UIOB 3ZJVA 1L5PA 5IA7A 3NUHB 3PZ8A 3ZRFA 4CO7A 3DQVA 2I38A 2HDEA 5JXVA 1TKGA 3R7RA 2M17A 2WP9B 1UWMA 3RT3B 3W2DA 3B2FA 3ML8A 5IAAC 1RM6C 4LCDE 4NQKE 3RNAC 4BKSD 1OTRB 1EF5A 4AJYB 1X1MA 1PGAA 2G45B 3AEFB 1L6VA 3DHHC 1JRUA 3VRBB 4AJWA 4QAYA 1QOAA 3UIPB 5C2TB 4JE3B 4WWMA 2BTEA 1KLGD 3U2SC 3RNEC 1WX8A 1JWUD 3NVYA 5MPOA 1DOIA 3C0RB 3VVWB 4WJQA 2JY6A 4NJCA 2DAJA 2YVCA 1WSPA 4WWPA 1OEYA 3WAMA 4C56C 4MSQB 4OZAA 4PYZA 5H92C 4ZRQA 1ACCA 1C3TA 2KDMA 2L32A 1V1PB 4HCPB 1J19A 3ENEA 4ZYSA 3HUIA 2J0MA 2KWCA 1QOGA 2KWUB 1YJ1A 4PYUA 1N60A 2W3SA 4YTNB 3M3JA 4WH4A 1K8RB 2BQQA 4B6WA 4HEA1 3SFDB 4LNIA 4W9EA 2M0AA 2PMVA 3E9SA 4RH6A 2BT6A 4IKGA 1YJIA 2WDRB 4MDKE 3VH3B 4AQ7A 3AI5A 2G3QB 1JCKB 1SJHD 4KGSA 3IAM1 4YSZB 1BT0A 2D3CA 2MA9B 2L00B 4HPPA 1V1PA 4DHZB 3RULA 4DXGA 2JXTA 4JQWC 1WXSA 3ZIMA 2B3AA 3AEAB 1FRRA 2C7MB 2BS2B 2WDTB 1UWXA 2PIAA 2D2QA 4TQ1A 3KUDB 1MG8A 2N9XA 3RPFC 3FAHA 3M63B 3IT6B 3A9KA 1YJJA 3ZW3A
chains in the Genus database with same CATH topology
5EE3A 5HI1A 2WNMA 1MVKA 2TSSA 1XO3A 1L4ZB 1XLPA 4EE2A 4AS1A 3MFGA 1SEBD 5FR3A 4A90A 4JWSC 2GRIA 3FC4A 1HQRD 1DGJA 2K0PA 5FKAC 1CK1A 4LK0M 3Q8FA 2BYTA 3T3OA 3URYA 1KRHA 1ZDVA 4PT5A 2LHDA 5BMGA 1F0ZA 2DWQA 1C4CA 4RGNA 3P4SB 2AX5A 3DWGC 4C7ZA 4ZHOA 2JX5A 1FM0D 4TSSA 3PZ7A 3Q8BA 1NYRA 1K52A 2IPKD 3LYYA 1TYGB 1D5MC 1XLOA 2N9LA 3R2TA 2Y5PA 3WCQA 1I4XA 4KGTA 3B2GA 4Q2JA 2WU2B 5AUIA 3AB5A 3AE6B 3CIRB 1TKYA 1WYGA 3TEYA 1YN4A 4L1BA 3P4RB 4XDCA 3Q69A 1C78A 1UUPA 3KQ4A 1SE2A 4N58A 2J52A 1WWTA 2Y3AA 3AE1B 3OWEB 2WQYB 3MP9A 1FXAA 1P7EA 3EA6A 4MACA 1FO4A 1ET9A 1SXTA 2FBWB 5C3JB 4RFBA 1UGJA 3U52E 1IUEA 2IJ0A 3NS1A 1ZXHA 2WXMA 2OHFA 2BS4B 1VZ8A 3BK1A 4MH8A 4HKQA 4GDKB 1MHXA 1R7SA 1QF6A 1SSNA 1MI0A 4WQMA 2RMMA 3BVGA 3MC0B 1MHHE 3HVZA 4KKJA 4MM3B 3LXFA 1VRAB 3U7ZA 3IT4B 5HFYA 2EKIA 2N9KA 3I9V1 1RWSA 2G9HD 4OZCA 2NMQA 5H8YE 2BS3B 1T6BX 3L4PA 2WXRA 3BK2A 1JWBD 2LUMA 4KKIA 1FNUA 5EE9A 1NENB 3NVWA 2PW9A 1FXIA 3E56A 1HZ5A 1JRPA 3R8BA 2G1EA 2WXOA 1TKEA 5D7GA 3HRDD 3BVZA 1QQRA 3NZ3A 4FXCA 2BB5A 5EE1A 2K9XA 3HVDA 2IGHA 3AE5B 4IDIA 5EE0A 1GPXA 1PGXA 1QOFA 3TEWA 3AEBB 4HKZE 4XE0A 1DYQA 2V0GA 2LGIA 3KLSX 3NVVA 4YTMB 2M56B 2H88B 1ROEA 1CQVA 3AE2B 1JMLA 1J7BA 5AUKA 1QKZA 2WXPA 4A8XC 1FNWA 2W54A 3P4PB 4LLGM 2WXIA 2XN9C 4P6VF 1V1OA 1JALA 2IGDA 4REZA 3VRAB 1E7PB 2J53A 4D2KA 3I57A 2FUG1 1DOXA 3AN1A 1TS3A 1E6EB 1I4HA 3BYYB 4HROA 2CJNA 4ARCA 1NYQA 2Y5CA 1GOZA 1IGDA 1C4AA 3BVMA 3MHZA 4RCOA 2WXQA 5D3DA 3ZJUA 4HRSA 1C4PA 2LHEA 1BUIC 1A70A 1I4GA 1SBBB 3NRZA 3AEDB 2AQ1B 2K5PA 3Q8AA 4O1NA 3ZJTA 1IBXB 3IAS1 3B9JA 4J3OD 1L6UA 2LMCA 5TSSA 1STEA 2X38A 2WXGA 3ZYYX 4YWGG 1EWCA 1NI3A 3VQIA 1SE3A 2SEBD 4WIPA 1UNSA 1ZPSA 2WDQB 1SJED 2PTLA 1F2RI 1TS5A 3AE4B 3AMZA 1TZOA 1BXTA 1XCTL 1JQ4A 2LFIA 2JZPA 1PDXA 2JWUA 2ACZB 3DWMA 1HZ6A 3V05A 1NEKB 2M19A 2E3TA 1M4VA 1B1ZA 2V3PA 2QSDA 4DXFA 4ARIA 4NAWB 1D4BA 2ONQA 2PKOA 4RGTA 1YN5A 3N9YC 2WDVB 2WXLA 2WXNA 4B0EA 1EM7A 2W82A 3BIID 1PYWD 3IXSA 2WXKA 1WXQA 4XWTA 4ZOHC 4L2YA 1FCCC 2XNAC 1EWYC 1FFUA 1D5XC 1QOBA 5BYSA 1BMLC 1ZOYB 3AM9A 4RF1A 1KF6B 2RPVA 1IBXA 1VDVA 1EU4A 3W5VB 3ZGZA 2GB1A 5HHDG 3SFEB 3SR6A 4YT0B 5G5GA 5BYQA 1HA5A 2JQRB 1YQ4B 2RDGA 4UDUC 2CJOA 1P7FA 3SEBA 2L83A 4OVZA 1J7CA 2MJDA 4YTPB 4N6EB 1N5XA 1K53A 3AEEB 2EELA 3P63A 2V3NA 4KX6B 1ENFA 1CZPA 1TJEA 4DQOC 1WGKA 4GLSC 1FCLA 4ZRPA 4OZBA 2L1AA 4RF0A 3GB1A 2CU3A 2GI9A 4LTUA 2L52A 1HXYD 2KACA 1ZDXA 1TS2A 4OHJA 1WRIA 1OQRA 3J9CA 1FMAD 2ZW1A 1JROA 1T5XD 1C77A 3W5UB 2Z8LA 4YSYB 1N61A 4WAFA 5LNK1 4R3DA 4H2AA 1VJKA 4C7YA 1YN3A 1ZE3D 3BWUD 3V3XA 1E9MA 1VZ7A 3P1MA 2YEPF 1I7HA 1AN8A 2KAJA 1EU3A 5FK9C 4RNAA 3U4EG 5T8IA 2DYMA 2KQ4X 1C79A 1FD6A 4A6QA 1Q10A 1TS4A 4ZHPA 2J42A 5GXGB 1XLQA 4M0WA 2MJ3A 2IDYA 2N0SB 5I4DA 1Y56A 5E6JA 3AECB 2DYOA 1FNVA 1F2RC 1HEZE 2VZKB 4TMAB 3C8YA 3RFZB 4C80A 4RGMA 1SF0A 3TUOA 2QEJC 5G5HA 3EGRA 4YXDB 1TY2A 3T3NA 1ZXIA 2D5GA 4A9AA 1F77A 2W55A 1FFVA 4NZLB 1MPEA 3FILB 2NTSA 2BW2A 2LJIA 1JW9D 1L5PA 4P16A 2MJEA 3ZJVA 1XF5L 3NUHB 3UI3A 1N63A 3PZ8A 2R61A 2JYTA 1AWDA 2I38A 1OQQA 3O13A 1C9FA 1GAQB 2E6XA 2HDEA 3LB8C 2WXFA 3P42A 1TKGA 5JXVA 2WXHA 2H89B 2QMTA 1LO5D 2RDHA 1XLNA 3AE7B 2WP9B 2SAKA 1UWMA 3BYTB 2WS3B 3W2DA 3B2FA 2OEDA 1JWAD 4HJGE 4OW0A 2PVGC 1RM6C 1YNTE 1ZP0B 3Q8CA 1PGAA 2QIEB 1K50A 3AEFB 1L0XB 1L6VA 1T3QA 1JWSD 1D6EC 1XXGA 3VRBB 2J4XA 1SE4A 2DBYA 1KTKA 2QJLA 3NVZA 1E0ZA 1GB1A 1XEEA 2N7JA 1KH0A 1AYFA 1QOAA 3AH7A 3FILA 4B0MA 2JU6X 2PVOD 3AE8B 4ITKA 5C2TB 4JE3B 1B9RA 1V8CA 2KMMA 4WWMA 3VR8B 3ABVB 1FIQA 1K51A 2HTME 2BTEA 1TY0A 1PFDA 1KFYB 2YEPB 1KLGD 1QT9A 3TEXA 3U2SC 5BMIA 2KN4A 2QILA 1JWUD 3NVYA 5MPOA 1DOIA 1VR9A 2W3RA 4KGRA 2INPE 2AQ3B 4WURA 2KWDA 3KWVA 1D5ZC 4IOIE 1XCQL 4JWUC 1C76A 4NJCA 3Q8EA 3AE3B 1SB3C 1WSPA 1L4DB 1L0VB 4C56C 1QLBB 3MJ5A 3TSSA 3CWIA 4OZAA 2WU5B 3H8HA 3EUB2 4US8A 5H92C 1QILA 4ZRQA 2AQ2B 1ACCA 3BZDB 1KLUD 2KDMA 3VR9B 2L32A 1V1PB 1ESFA 4USAA 4ZYSA 1FRDA 2JSVX 4RGOS 5HG2A 3P4QB 3HUIA 1PGBA 3ETRA 1QOGA 1RYJA 1ZUD2 1N60A 4CQNA 2K3UA 2W3SA 4YTNB 3R2IA 4WH4A 1GB4A 1I4PA 4HEA1 2FE8A 1AW7A 2B76B 3SFDB 2M0AA 2INNE 2PMVA 5D3IB 3E9SA 3W1SA 4RH6A 3W9CB 4L23A 2BT6A 4MT5A 4IKGA 2JYEA 1VZ6A 1YJIA 2WDRB 1DOYA 1OFFA 4AQ7A 4TQ0A 2NTTA 4JPSA 1JCKB 1CJEA 1SJHD 3TEZA 4KGSA 3ZQ4A 3KWLA 1J7AA 2PLPA 2ZW0A 3IAM1 4YSZB 1YMHE 1N5WA 3GP7A 1L0YB 1RFKA 2BB6A 3AE9B 2LEKA 1PUTA 1V97A 4JX1C 1V1PA 3AEGB 1I4RA 3GS2A 4XWWA 5BMHA 2DLBA 2I2YA 2IGGA 4DXGA 1N62A 2Q5WD 2JXTA 2WLBA 1ET6A 4XDDA 2ON8A 3AEAB 1FRRA 1JWMD 4A55A 2BS2B 5BYRA 1UWXA 2ICIA 1SIJA 2PIAA 4US9A 2VZKD 1E10A 4TQ1A 1YQ3B 2MH7A 2V4IB 1IGCA 4N59A 3RPFC 1FEHA 3FAHA 4GDLB 3IT6B 4YSXB 1NVID 3PO0A 1VLBA 1I4QA 2MEKA 2WXJA 4NAMA 2K22A 2BBCA 3AV8A 1YJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EE3 A;  1FMA D;  1JRO A;  3NVV A;  4YTM B;  2M56 B;  2H88 B;  1ROE A;  4JWU C;  1XO3 A;  3AE2 B;  1XLP A;  3W5U B;  1J7B A;  5AUK A;  4YSY B;  3AE3 B;  1N61 A;  1SB3 C;  1L0V B;  2W54 A;  3P4P B;  4JWS C;  1VJK A;  3FC4 A;  4P6V F;  4C7Y A;  1DGJ A;  1JAL A;  1QLB B;  3VRA B;  1E7P B;  3CWI A;  1E9M A;  2WU5 B;  1DOX A;  3AN1 A;  3EUB 2;  3P1M A;  4US8 A;  1I7H A;  2KAJ A;  5H92 C;  1KRH A;  1E6E B;  2DWQ A;  3VR9 B;  1F0Z A;  4HRO A;  2CJN A;  3P4S B;  4USA A;  2AX5 A;  3DWG C;  1NYQ A;  2Y5C A;  1FRD A;  1FM0 D;  2JX5 A;  4C7Z A;  4ZHO A;  4ZHP A;  1NYR A;  3P4Q B;  5GXG B;  1XLQ A;  4HRS A;  3HUI A;  3ETR A;  1A70 A;  1QOG A;  1TYG B;  2MJ3 A;  2N0S B;  1RYJ A;  1ZUD 2;  3NRZ A;  1N60 A;  3AED B;  2K5P A;  2W3S A;  1XLO A;  3AEC B;  4YTN B;  3B9J A;  3WCQ A;  1L6U A;  3B2G A;  4C80 A;  1SF0 A;  2WU2 B;  5AUI A;  5G5H A;  3AB5 A;  3AE6 B;  3SFD B;  2B76 B;  3ZYY X;  4YXD B;  3CIR B;  1TKY A;  1NI3 A;  1ZXI A;  3W9C B;  1WYG A;  2W55 A;  4A9A A;  2BT6 A;  1FFV A;  3P4R B;  2WDQ B;  1JW9 D;  1L5P A;  2MJE A;  4WWM A;  1YJI A;  3AE4 B;  2WDR B;  3AMZ A;  1N63 A;  1DOY A;  4YTP B;  1OFF A;  4N58 A;  1WWT A;  1JQ4 A;  3AE1 B;  1WRI A;  1AWD A;  2WQY B;  1OQQ A;  1CJE A;  1FXA A;  1PDX A;  1GAQ B;  3LB8 C;  2ACZ B;  3DWM A;  3KWL A;  1NEK B;  1J7A A;  1TKG A;  2M19 A;  1FO4 A;  2H89 B;  4YSZ B;  2E3T A;  1XLN A;  1N5W A;  2FBW B;  5C3J B;  2PKO A;  3AE7 B;  1IUE A;  1RFK A;  2WP9 B;  3NS1 A;  2WDV B;  1UWM A;  2OHF A;  2BS4 B;  3AE9 B;  2WS3 B;  3BII D;  2LEK A;  1PUT A;  3B2F A;  1V97 A;  1R7S A;  1QF6 A;  1JWA D;  4JX1 C;  1WXQ A;  2PVG C;  1RM6 C;  1ZP0 B;  3AEG B;  4WQM A;  4ZOH C;  1EWY C;  1FFU A;  3HVZ A;  1QOB A;  3LXF A;  2QIE B;  3AEF B;  1L6V A;  1ZOY B;  1T3Q A;  1N62 A;  2Q5W D;  3AM9 A;  1KF6 B;  2WLB A;  1VDV A;  2EKI A;  3W5V B;  1RWS A;  3SFE B;  3VRB B;  3SR6 A;  3AEA B;  4YT0 B;  1FRR A;  5G5G A;  2DBY A;  2W3R A;  5H8Y E;  2JQR B;  2BS3 B;  1YQ4 B;  2BS2 B;  2QJL A;  3L4P A;  1JWB D;  3NVZ A;  2CJO A;  1E0Z A;  2L83 A;  5EE9 A;  1AYF A;  1NEN B;  1QOA A;  1J7C A;  1SIJ A;  2MJD A;  3AH7 A;  1FXI A;  3NVW A;  2PIA A;  2PVO D;  1N5X A;  3AE8 B;  4N6E B;  4US9 A;  3AEE B;  3P63 A;  4ITK A;  1JRP A;  5C2T B;  1E10 A;  1YQ3 B;  2G1E A;  1V8C A;  1TKE A;  2KMM A;  2MH7 A;  3HRD D;  4KX6 B;  1CZP A;  1TJE A;  3ABV B;  1FIQ A;  4N59 A;  4FXC A;  1WGK A;  2HTM E;  3FAH A;  3RPF C;  5EE1 A;  2K9X A;  1PFD A;  1KFY B;  3AE5 B;  4YSX B;  1B9R A;  1QT9 A;  4IDI A;  1NVI D;  5EE0 A;  2CU3 A;  1VLB A;  3PO0 A;  4LTU A;  1GPX A;  2L52 A;  1QOF A;  3NVY A;  1DOI A;  3VR8 B;  5MPO A;  3AEB B;  2K22 A;  1OQR A;  3AV8 A;  1YJJ A; 
#chains in the Genus database with same CATH topology
 4KZC A;  5HI1 A;  2TSS A;  1L4Z B;  3QC8 B;  3QK0 A;  4IWQ A;  4FN2 A;  4AS1 A;  2KN5 A;  4W9K A;  1UD7 A;  4JWS C;  1HQR D;  4K81 A;  1CK1 A;  3IFW B;  2ZCC A;  2Y5B B;  1KRH A;  5DPR A;  2LHD A;  1C4C A;  4C7Z A;  2JVC A;  2D10 A;  3APD A;  1XLO A;  2BKR B;  4B95 A;  1NDD A;  3B2G A;  5AUI A;  3AB5 A;  3N30 A;  3P4R B;  3Q69 A;  1UUP A;  1F52 A;  2ZVN A;  2J52 A;  1WWT A;  1FXA A;  2DAF A;  1P7E A;  4XX5 A;  1FO4 A;  3D32 A;  3VDZ A;  1SXT A;  5C3J B;  4RFB A;  1IUE A;  2IJ0 A;  2UYZ B;  1ZXH A;  2OHF A;  1V5O A;  4HXD A;  1VZ8 A;  5EDS A;  4HKQ A;  1MHX A;  2BWE S;  2RMM A;  4EFO A;  4NPN A;  1T0Y A;  3ZDT A;  1E5W A;  4A3P A;  2EKI A;  1WH3 A;  2N9K A;  4OZC A;  2KO3 A;  5H8Y E;  4HPL B;  2BS3 B;  3V6E B;  1JWB D;  2LAS A;  4TUU A;  1YIW A;  3PVL A;  2PW9 A;  1HZ5 A;  4LDT B;  1JRP A;  2G1E A;  1XT9 B;  2R2O A;  2BB5 A;  2K9X A;  1UBI A;  2IGH A;  5J18 A;  2MLB A;  3TEW A;  3AEB B;  4HKZ E;  1DYQ A;  1V5T A;  1WR6 E;  2LGI A;  1F1H A;  2N9E B;  2H88 B;  2C5L C;  4HJK A;  1IP9 A;  4A8X C;  5JHB A;  4S17 A;  4X57 B;  2IGD A;  1E7P B;  5JZE B;  3A4R A;  2LJ5 A;  3U30 A;  3DBR I;  1IGD A;  5AZH A;  2K6Q A;  2PE6 B;  4HRS A;  3SU8 X;  4EOY A;  1WM3 A;  1I4G A;  3NRZ A;  2AQ1 B;  2K5P A;  1GC6 A;  1STE A;  3ZYY X;  3WAL A;  1UNS A;  3APF A;  3AE4 B;  3AMZ A;  2GBM A;  3DVN V;  4BBN F;  1JQ4 A;  2KJ6 A;  3IG3 A;  1EO6 A;  1F9J A;  4XYC A;  2KTF A;  3HHM A;  1PDX A;  2QC8 A;  2ACZ B;  2L3Z A;  2M19 A;  2E3T A;  4DXF A;  2QSD A;  4RGT A;  3N9Y C;  4NQL B;  3QJZ A;  1PYW D;  3IXS A;  4L2Y A;  1FCC C;  1EWY C;  1D5X C;  2DYB A;  5JHA A;  1WIA A;  2RPV A;  1EU4 A;  3SFE B;  2M1M A;  1V9J A;  3KH0 A;  5BYQ A;  2RDG A;  1P98 A;  4UDU C;  4F7Z A;  3PPA A;  4N6E B;  3DBL B;  2V3N A;  3QX1 A;  5C23 A;  3UGB B;  3QCA A;  1LXD A;  1UEL A;  1S3S G;  4OZB A;  2IO3 B;  2WGS A;  2L52 A;  1TS2 A;  1WRI A;  4M00 A;  2A4Z A;  2ZW1 A;  3NHE B;  4YSY B;  2FAZ A;  1N61 A;  4WAF A;  4JL9 A;  4H2A A;  4C7Y A;  1ZE3 D;  1VZ7 A;  3TCA A;  2KAJ A;  1PQS A;  5FK9 C;  3H6N A;  4W9F A;  2FCQ A;  1V49 A;  1TS4 A;  4IWO A;  4ZHP A;  5GXG B;  2JZZ A;  2Z59 B;  1F2R C;  2VZK B;  2NCN A;  1NBF C;  1WFY A;  3K9P B;  3DBH I;  4P1B C;  3FIL B;  2BW2 A;  2LJI A;  1JW9 D;  3QWZ B;  4P16 A;  3UI3 A;  1ZKH A;  1N63 A;  2JRH A;  4ZDV A;  1OQQ A;  2E6X A;  3P42 A;  1P0R A;  1LO5 D;  2KTR B;  3PSE B;  4C00 A;  3ONS A;  2WS3 B;  4C4V A;  2OED A;  4E3C A;  4HJG E;  4OW0 A;  3RI7 C;  1YNT E;  2RDB C;  2X8X X;  4M01 A;  3KYC D;  3W1Y A;  3NS8 A;  3Q8C A;  1I35 A;  2QIE B;  1K50 A;  1SIF A;  1IYF A;  1L0X B;  1T3Q A;  1E90 A;  1XXG A;  2KVR A;  1SE4 A;  4WJO A;  5D94 A;  2D3A A;  2KC2 A;  4M8M A;  1GB1 A;  1XEE A;  2NS5 A;  4ICV A;  3VXW A;  2MWS B;  3FIL A;  4B0M A;  2JU6 X;  1B9R A;  2K1F A;  3VR8 B;  3ABV B;  1UGM A;  3VH4 B;  3DHI C;  1SGH A;  3Q6B A;  4K3C A;  3TJP A;  1YOV B;  4G11 A;  3ZRC A;  3R3M A;  2KWD A;  4IG7 B;  4JWU C;  3NZS A;  3SD5 A;  3AE3 B;  1SB3 C;  3N1Y C;  4GN1 A;  5LXI B;  1L7Y A;  4EZJ A;  4US8 A;  2MQJ A;  3QHT A;  3GE8 C;  2AQ2 B;  3PLV A;  3V62 A;  2HJ8 A;  4FJZ A;  3HK0 A;  1I42 A;  2JSV X;  4RGO S;  3RZW C;  1HE8 A;  4CQN A;  2K25 A;  2KHW B;  2LZ6 A;  1GB4 A;  2FE8 A;  1GC7 A;  2INN E;  1XQQ A;  2GMI C;  1R4M B;  1OQY A;  2JYE A;  2NR2 A;  1OFF A;  2NTT A;  4JPS A;  1CJE A;  2JZ3 B;  3QA8 A;  2KDF B;  1VCB A;  2O6V D;  1J7A A;  3KWL A;  2ZW0 A;  4YL8 A;  4DK5 A;  2D07 B;  1RFK A;  2BB6 A;  2DZM A;  4BBN C;  1PUT A;  3ZNG C;  3AEG B;  1T0S C;  2KWV B;  2DLB A;  1YQB A;  2FUH B;  3EEC A;  2BYV E;  4XDD A;  2ON8 A;  3Q2A C;  3RCZ A;  2LRU A;  4US9 A;  2RGF A;  3U8Z A;  1MJD A;  1YQ3 B;  4KZ0 A;  4N59 A;  3ZVV A;  2D3G A;  1WGH A;  2XK5 B;  4OVU A;  3PO0 A;  1VLB A;  1I4Q A;  2PE9 A;  3IBE A;  1RAX A;  2L7R A;  4ASW C;  3HIZ A;  2WNM A;  1MVK A;  1RLF A;  4WQO B;  1XO3 A;  5L95 C;  3UQB A;  3MFG A;  4I6N B;  2EKE C;  2GRI A;  5J17 A;  3DPD A;  4KDL B;  3T3O A;  4PT5 A;  5BMG A;  1V2Y A;  4RGN A;  2LVQ A;  3P4S B;  4ZHO A;  2JX5 A;  1FM0 D;  3Q8B A;  3GZN I;  3LYY A;  1TYG B;  1D5M C;  2MHJ A;  2XK5 A;  3R2T A;  3WCQ A;  4F1S A;  3ALB A;  3GOE A;  2PPH A;  2CKH B;  3MC8 A;  1WYG A;  4HCN B;  4E74 A;  1YN4 A;  4XDC A;  3C19 A;  2N9P C;  2UWQ A;  2Y3A A;  4GU2 A;  3OWE B;  5CHV C;  3MP9 A;  3DOW A;  3PRZ A;  2EMT A;  2INC C;  2FBW B;  3U52 E;  1OGW A;  2BS4 B;  3BK1 A;  3VFK A;  4GDK B;  3V6C B;  1MI0 A;  3ZUN A;  3HVZ A;  4KKJ A;  2LVO A;  1VRA B;  4F8C B;  2KKC A;  2G9H D;  1E8Y A;  3RN9 C;  4NJ6 A;  2NMQ A;  3QAQ A;  3BK2 A;  2KJR A;  4KKI A;  1FNU A;  1Q1O A;  4E71 A;  3A9K B;  2AEH A;  1FXI A;  3E56 A;  4JLC A;  3HM3 A;  1Z2M A;  1TKE A;  5D7G A;  4FXC A;  2LI5 A;  2K39 A;  3HVD A;  2OOB B;  5EE0 A;  2IZV B;  2OJR A;  3P2B A;  5CHF A;  2M8S A;  4WJP A;  2M56 B;  1ROE A;  4EKU A;  4KDI C;  4GDK A;  4MEM A;  1J7B A;  2YLM A;  2J7Q B;  3OG5 A;  2W54 A;  3A1Q B;  1Q5W B;  2WXI A;  1LFD A;  3L08 A;  1V1O A;  1JAL A;  2W9N A;  3VRA B;  4AOF A;  2J53 A;  2NPT A;  2FUG 1;  2LRW A;  1DOX A;  3AN1 A;  3H7S A;  3ZXV A;  2O6V A;  1T0R C;  2IO1 B;  1P9D U;  4BKG A;  2GBN A;  5LXH A;  2C7N B;  2XEW A;  1G6J A;  3MHZ A;  4RCO A;  1C4P A;  1A70 A;  3AED B;  3Q3F A;  3Q8A A;  4ANU A;  2MBH A;  1TTN A;  1IBX B;  1L6U A;  3L54 A;  2LMC A;  5TSS A;  4BOS C;  1NI3 A;  3JW0 X;  1GG3 A;  4II3 B;  2MP2 A;  2SEB D;  4LNK A;  4FA6 A;  1ZPS A;  1TS5 A;  1TZO A;  1R4N B;  4G0N B;  1XCT L;  2LFI A;  3RNG C;  4W9H A;  3A1Q A;  3NOB A;  1WY8 A;  2V3P A;  1U4A A;  2DZK A;  4BKS A;  3WIM A;  1MFW A;  3BII D;  3Q3O C;  5E6N A;  2RSU A;  2WXK A;  3N20 C;  3ZLZ A;  1FFU A;  2KC1 A;  2N7D A;  2C7H A;  1BML C;  3DHG C;  1KF6 B;  3CSF A;  1IBX A;  3W5V B;  4YT0 B;  5G5G A;  3ZNH B;  1HA5 A;  2CJO A;  2L83 A;  3VTV A;  1UZX B;  4K7W A;  3PRP B;  3AEE B;  3P63 A;  2N1W A;  1CZP A;  1WGK A;  1FCL A;  3RD2 A;  2BWF A;  3GB1 A;  4DWF A;  3RZF A;  4LTU A;  2KAC A;  1ZDX A;  1OQR A;  1EUV B;  1RFA A;  1FMA D;  1T5X D;  3W5U B;  1TGZ B;  2NBU A;  5CX3 A;  3ECI A;  3PV1 A;  1YN3 A;  3BWU D;  1E9M A;  3L16 A;  2LGX A;  3QQ8 B;  2KFJ A;  2YEP F;  1I7H A;  4FUL A;  1EU3 A;  5CTR C;  4RNA A;  2KX0 A;  2KQ4 X;  3B1L X;  1C79 A;  1H8C A;  3KUC B;  1Q10 A;  4RM9 A;  3WAN A;  2J42 A;  2N0S B;  5E6J A;  2LGS A;  2CU1 A;  1WI0 A;  3RUI B;  4RM8 A;  3N1Z C;  4C80 A;  3TUO A;  2QEJ C;  3EGR A;  3T3N A;  4DHJ D;  4A9A A;  2W55 A;  1FFV A;  1WYW B;  1MPE A;  4NZL B;  1E8W A;  2MJE A;  3IVF A;  4BKT A;  4FJY A;  2REX A;  2R61 A;  2JYT A;  1AWD A;  2BKF A;  2NBV B;  3CF6 E;  3TL5 A;  3LB8 C;  2WXF A;  2FCN A;  2WXH A;  2ZNV C;  3I5J C;  3X23 A;  4PS7 A;  3AE7 B;  2SAK A;  4FJV B;  3PGE A;  4BZA A;  1CMX B;  1WGY A;  1JWA D;  1ZP0 B;  3PRM B;  4ANW A;  3VTW A;  2J0K A;  2I1J A;  4I6L B;  1KTK A;  3ZTD A;  2O2V B;  1E0Z A;  3IHP C;  1E7V A;  2PVO D;  3AE8 B;  2WWZ A;  2BGF A;  3NJT A;  1FIQ A;  1K51 A;  1KFY B;  4FLH A;  2YEP B;  5BMI A;  3TEX A;  2JUO A;  3ZNZ B;  4WAA A;  1WGR A;  1WXV A;  4KGR A;  5DPT A;  2AQ3 B;  4WUR A;  2KQ7 A;  4IOI E;  1D5Z C;  1WE7 A;  1XCQ L;  3DVG Y;  4EEW A;  3RNB C;  3Q8E A;  2KD0 A;  2WX0 A;  2DNF A;  2KDE B;  1L4D B;  3AUL A;  2V3S A;  4DXA B;  3MJ5 A;  4HLE A;  3TSS A;  2WU5 B;  2IY1 B;  3H8H A;  2MRP A;  2MX2 A;  4HK2 A;  2FIF A;  1QIL A;  1E8Z A;  2MSE D;  3BZD B;  1KLU D;  2KAN A;  2PJH A;  2O2V A;  3DVN U;  3PTF C;  4W9G A;  3VR9 B;  2K8B A;  2DZI A;  3WAP A;  2WYQ A;  5G2N A;  3S2A A;  1ZUD 2;  2DEN B;  5E6O A;  3R2I A;  2KOX A;  1J0G A;  4WWN A;  2N4F A;  3QIJ A;  3W1S A;  3W9C B;  4L23 A;  4TV3 A;  5D2M B;  1UH6 A;  2LWP A;  2L8J A;  4B9K A;  1VZ6 A;  4C4V B;  3TBL D;  1DOY A;  4XC2 A;  2KK8 A;  4TQ0 A;  4FHJ A;  3TEZ A;  2L76 A;  3ZQ4 A;  2PLP A;  4GB9 A;  1YMH E;  2DZJ A;  2MBQ A;  3GP7 A;  4HWI B;  1LM8 B;  3MTN B;  3AE9 B;  2KNB A;  4II2 B;  1TZ1 A;  3DDC B;  4W9C A;  1I4R A;  4HDO A;  2PEA A;  3FKY A;  3GS2 A;  4XWW A;  1LQB A;  2MBO A;  2IGG A;  4NJ7 A;  2Q5W D;  1ET6 A;  2LGY A;  4PS8 A;  4EUT A;  2CR5 A;  5BYR A;  1S1Q B;  4CYE A;  2KXJ A;  2DX5 B;  2M0X A;  1SIJ A;  1E7U A;  1E10 A;  5KHQ A;  3L17 A;  5AZF A;  2MH7 A;  2JF5 A;  2V4I B;  2GBK A;  4GDL B;  1A5R A;  3CMM B;  3ZXR A;  2KQS A;  4HVB A;  4NAM A;  2BBC A;  3A9J B;  3MC9 A;  4MSM B;  3BIN A;  1QZE A;  4EE2 A;  2LUE A;  2C9W B;  1SEB D;  5FR3 A;  4AWJ A;  3VUX A;  3RMK C;  1DGJ A;  2K0P A;  5FKA C;  1WR1 A;  2BYT A;  1ZDV A;  3VTU A;  2DWQ A;  2FID A;  2AX5 A;  2VH2 A;  3DWG C;  4IW0 A;  4DDG D;  3PZ7 A;  1WJ4 A;  2IPK D;  5DPW A;  2QHO A;  3U7D A;  2N9L A;  3EFU A;  2Y5P A;  4GDL A;  3W1S C;  4A3O A;  5LLI A;  2WU2 B;  3AE6 B;  3CIR B;  1TKY A;  2KZR A;  3A9J A;  2JWZ A;  2AYO B;  3KQ4 A;  4K3B A;  3DVG X;  2N7E A;  4MAC A;  1YX6 B;  1D3Z A;  3NY5 A;  2WHI A;  2AWT A;  1UGJ A;  3OAW A;  2WXM A;  2LXC A;  3VAW A;  1WJ6 A;  1QF6 A;  4WQM A;  3BVG A;  3OJ3 A;  1MHH E;  4MM3 B;  1WGG A;  2BYE A;  3JVZ X;  3PZD A;  3IT4 B;  5HFY A;  1YX5 B;  2OJW A;  3DBR B;  1RWS A;  2JRI B;  3EC8 A;  2WXR A;  4MEL A;  5IO9 A;  5EE9 A;  5TR5 A;  1NEN B;  1ZGU B;  3K9O B;  3T8M A;  4IC7 B;  4ANV A;  3R8B A;  2WXO A;  3HRD D;  3BVZ A;  1QQR A;  1P3Q U;  2HJ1 A;  2V4L A;  1WXA A;  2J0J A;  1GPX A;  1PGX A;  4ZYN A;  2IO0 B;  3APC A;  2G4S A;  1VD2 A;  4XE0 A;  3KLS X;  3N1X C;  1JML A;  2C60 A;  4W9I A;  1QKZ A;  2WXP A;  3P4P B;  3ZO5 B;  4MM3 A;  2XN9 C;  4P6V F;  2V1Y A;  4GSW A;  2WX1 A;  3H9D A;  4D2K A;  3I57 A;  1V86 A;  1LGR A;  4LJO B;  3N32 A;  1SE9 A;  1TS3 A;  1E6E B;  5KHO A;  1I4H A;  4HRO A;  2CJN A;  2Y5C A;  1GNU A;  3BVM A;  4CHK A;  2WXQ A;  3MHS D;  2Z0E B;  3ZJU A;  1RRB A;  2LHE A;  1L2N A;  2MW5 A;  1Z5S B;  4AUQ C;  3ZJT A;  3IAS 1;  3WA0 A;  1TT5 B;  4YWG G;  1EWC A;  3VQI A;  3RNF C;  1SJE D;  2PTL A;  1F2R I;  3X0W A;  4HPM B;  1BXT A;  2JWU A;  3DWM A;  2QDF A;  4M02 A;  4NAW B;  1WX9 A;  2PKO A;  1ISN A;  5G55 A;  2WXN A;  4B0E A;  3DCG A;  4M8N A;  3GE3 C;  3TMP B;  1TIF A;  4ZOH C;  2XNA C;  2KYW A;  1WXM A;  5BYS A;  3AM9 A;  4RF1 A;  3V60 A;  2HTH A;  3L13 A;  3ZGZ A;  2GB1 A;  5C1Z A;  3Q14 C;  2BPS A;  1N6Z A;  4OVZ A;  2CS4 A;  1J7C A;  4YTP B;  4K1R B;  1N5X A;  2EEL A;  4KSK C;  4KX6 B;  1ENF A;  4MGZ E;  2KDB A;  3DBH B;  4DQO C;  4GLS C;  4ZRP A;  2L1A A;  2R2Q A;  1HXY D;  2NPT B;  3I3T B;  4NAW A;  2O6V B;  3RYT A;  3L10 B;  1JRO A;  2RR9 A;  1C77 A;  2L0F A;  4LNO A;  2Z8L A;  4I6P A;  4LNF A;  4W9D A;  1WX7 A;  4JIO U;  2VH1 A;  4GXB A;  3P1M A;  4WJN A;  3L0W B;  1AN8 A;  4A20 A;  1WE6 A;  2IYD B;  5DCN A;  5T8I A;  3UIN B;  1IPG A;  3RNC C;  2BYF A;  3V61 A;  1FD6 A;  4A6Q A;  2M4N A;  2MP2 B;  1XLQ A;  2K8H A;  2MJ3 A;  2IDY A;  5I4D A;  3AEC B;  1FNV A;  5J2R A;  1HEZ E;  2KMC A;  4TMA B;  3C8Y A;  3RFZ B;  1SF0 A;  3DBL I;  4YXD B;  4LDT D;  1F77 A;  4G3X B;  5FR6 A;  1WJN A;  2NTS A;  2ZEQ A;  1XF5 L;  4ICU A;  2ZNV B;  4J6I A;  5AEK B;  4MGK E;  2QCZ A;  4DBG A;  2FCM A;  3O13 A;  2D3B A;  1C9F A;  1GAQ B;  2UU7 A;  1E8X A;  2H89 B;  2QMT A;  2RDH A;  1XLN A;  2MBB B;  1Q0W B;  5IP4 D;  3BYT B;  2MCN B;  1FPY A;  2EMS A;  2PVG C;  3UQA A;  1XD3 B;  3NZU A;  4MGI E;  1JWS D;  3PLU A;  1D6E C;  2J4X A;  4G50 A;  2DBY A;  2QJL A;  2KT7 A;  3NVZ A;  3EHV A;  5D6J B;  2LXA A;  2N7J A;  3LJ3 A;  1KH0 A;  1AYF A;  3AH7 A;  3A33 B;  1Y8R C;  2GLS A;  3WAO A;  2KVZ A;  2GBJ A;  4ITK A;  2AL3 A;  1V8C A;  2KMM A;  4KSL C;  1EF1 A;  2HTM E;  3MJW A;  1TY0 A;  1PFD A;  4ANX A;  1QT9 A;  2KN4 A;  4W9J A;  2QIL A;  3ZNI D;  4GIV A;  2Z0D B;  2GOW A;  1VR9 A;  2W3R A;  4FBJ B;  2INP E;  5L83 A;  3KWV A;  1C76 A;  3R66 C;  1L0V B;  2GBR A;  1QLB B;  3CWI A;  5IOI A;  2NBW B;  3EUB 2;  4KIK B;  3ZKJ C;  2NVU I;  3KVF B;  1ESF A;  4USA A;  2ZPY A;  1FRD A;  5HG2 A;  3P4Q B;  1PGB A;  3ETR A;  1FXT B;  1RYJ A;  2K3U A;  2ZZP B;  2JXX A;  1I4P A;  2KMA A;  2ZCB A;  1H4R A;  1AW7 A;  2B76 B;  2HE7 A;  3JSV B;  4GMV A;  5D3I B;  4MT5 A;  1WMH B;  4S0R A;  3AXC A;  3PHW B;  2BVC A;  3BY4 B;  1WM2 A;  1N5W A;  1L0Y B;  4KIK A;  2LEK A;  1V97 A;  4JX1 C;  1KOT A;  2L0T A;  1M94 A;  5BMH A;  5GMV A;  2I2Y A;  1N62 A;  2WLB A;  4XZ4 A;  4GOC A;  1J8C A;  3QAR A;  1JWM D;  3GZN B;  4A55 A;  4ZRJ A;  3UF8 A;  3VHT C;  4HDQ A;  4IM2 A;  2VRR B;  3JSV A;  2RPQ A;  3SDL C;  3DBS A;  2ICI A;  1WMH A;  2VZK D;  3VUY A;  2KX3 A;  1IGC A;  4LJP B;  4W9L A;  2KFK B;  1FEH A;  2CHW A;  4MH0 E;  1R4M I;  4YSX B;  3N3K B;  2IY0 B;  1NVI D;  3CST A;  2MEK A;  2WXJ A;  4FHK A;  2K22 A;  3EFC A;  4DDI D;  3AV8 A;  3H1U A;  2LD9 A;  2JT4 B;  5EE3 A;  1OEY J;  4ACF A;  4IUM B;  1XLP A;  2L05 A;  4A90 A;  3FC4 A;  4ZRK A;  3OLM D;  1UF0 A;  2AL6 A;  4LK0 M;  2JPH A;  4NNJ B;  3Q8F A;  3URY A;  4BAX A;  2LVP A;  1F0Z A;  2HD5 B;  4TSS A;  1NYR A;  1K52 A;  5E6P A;  4LNN A;  2KFK A;  4EZK A;  1I4X A;  1UBQ A;  4KGT A;  4N9F 4;  4Q2J A;  3HM6 X;  1HTQ A;  4ZRI A;  2K6D B;  1AAR A;  3TEY A;  4L1B A;  2IO2 B;  1C78 A;  1SE2 A;  4N58 A;  3AE1 B;  2WQY B;  1KM7 A;  4K7U A;  3EA6 A;  2BF8 B;  3O65 B;  3PHX B;  1ET9 A;  3KYD D;  2N1V A;  1V81 A;  2ZVO A;  3KUZ A;  3A4S C;  2KLC A;  3NS1 A;  3T9L A;  3AU4 A;  3TIX A;  3JYU A;  2G4D B;  2IND C;  4MH8 A;  1R7S A;  2LGD A;  1SSN A;  5JH5 C;  4MJS B;  3MC0 B;  2D11 A;  4KV2 A;  3LXF A;  3U7Z A;  1MG4 A;  3I63 C;  3I9V 1;  3ML9 A;  4PS3 A;  3PT2 B;  2DHZ A;  4GGQ A;  4DHZ E;  1T6B X;  3L4P A;  4WWO A;  2IBI B;  2LUM A;  3NVW A;  5HKH A;  4DHJ B;  2FNJ B;  2CHX A;  3NZ3 A;  3H7P B;  4PK1 A;  5EE1 A;  2K8C A;  3AE5 B;  4IDI A;  4OVV A;  4AP4 C;  1QOF A;  4FAD A;  3B0A A;  2V0G A;  3NVV A;  4YTM B;  1CQV A;  3AE2 B;  1GJZ A;  5AUK A;  4MJS A;  1TBE A;  1FNW A;  4LLG M;  1WZ0 A;  3B08 A;  1KJT A;  4REZ A;  3Q3J A;  5CHW A;  2ZJD A;  1GUA B;  3BYY B;  4ARC A;  1NYQ A;  1GOZ A;  1C4A A;  3M95 A;  5D3D A;  1BUI C;  1SBB B;  3H7P A;  4O1N A;  1YD8 U;  3B9J A;  4J3O D;  2KLG A;  3R7Q A;  3SHQ A;  4RMA A;  2X38 A;  2WXG A;  3AU5 A;  3ZTC A;  1SE3 A;  4WIP A;  2WDQ B;  4P7I A;  1HTO A;  4P1C C;  4JGH B;  2JZP A;  3V05 A;  1HZ6 A;  1NEK B;  3LDZ E;  2A5U A;  1M4V A;  5BO4 B;  1B1Z A;  4ARI A;  1D4B A;  2ONQ A;  1YN5 A;  2WDV B;  1WF9 A;  2WXL A;  1EM7 A;  2W82 A;  1WZ3 A;  3ZDM C;  1P1A A;  2ASQ A;  1WXQ A;  4XWT A;  2V9H A;  1QOB A;  2KTR A;  1ZOY B;  4BVU C;  3Q3N C;  2KDI A;  1VDV A;  5HHD G;  3SR6 A;  2JQR B;  3NG0 A;  1YQ4 B;  5AZG A;  5DPS A;  3M62 B;  1P7F A;  3SEB A;  1V6E A;  1KLV A;  4KVG B;  4EZL A;  2MJD A;  1K53 A;  4M0W B;  2RD0 A;  4IWP A;  4MGY E;  4BOZ B;  1TJE A;  4URK A;  3PS6 A;  1WRD B;  2XBB C;  2MBE A;  4IM0 A;  4RF0 A;  2CU3 A;  2GI9 A;  3PRE A;  1R4N I;  4OHJ A;  3J9C A;  3KW5 B;  1T0Q C;  5IKC M;  4XGA B;  4K7S A;  1C1Y B;  5LNK 1;  4R3D A;  1VJK A;  4BFR A;  3VUW A;  3V3X A;  3OJ4 B;  2FCS A;  3Q3M C;  2ZPN A;  4TKN A;  3U4E G;  1V80 A;  1ZW7 A;  2DYM A;  4IM3 A;  1WGD A;  4M0W A;  2I1K A;  1Y56 A;  2DYO A;  4NY0 A;  2KJH B;  1WJU A;  2CHZ A;  4RGM A;  5G5H A;  1TY2 A;  1NI2 A;  1ZXI A;  2D5G A;  5IN7 A;  3UIO B;  3ZJV A;  1L5P A;  5IA7 A;  3NUH B;  3PZ8 A;  3ZRF A;  4CO7 A;  3DQV A;  2I38 A;  2HDE A;  5JXV A;  1TKG A;  3R7R A;  2M17 A;  2WP9 B;  1UWM A;  3RT3 B;  3W2D A;  3B2F A;  3ML8 A;  5IAA C;  1RM6 C;  4LCD E;  4NQK E;  3RNA C;  4BKS D;  1OTR B;  1EF5 A;  4AJY B;  1X1M A;  1PGA A;  2G45 B;  3AEF B;  1L6V A;  3DHH C;  1JRU A;  3VRB B;  4AJW A;  4QAY A;  1QOA A;  3UIP B;  5C2T B;  4JE3 B;  4WWM A;  2BTE A;  1KLG D;  3U2S C;  3RNE C;  1WX8 A;  1JWU D;  3NVY A;  5MPO A;  1DOI A;  3C0R B;  3VVW B;  4WJQ A;  2JY6 A;  4NJC A;  2DAJ A;  2YVC A;  1WSP A;  4WWP A;  1OEY A;  3WAM A;  4C56 C;  4MSQ B;  4OZA A;  4PYZ A;  5H92 C;  4ZRQ A;  1ACC A;  1C3T A;  2KDM A;  2L32 A;  1V1P B;  4HCP B;  1J19 A;  3ENE A;  4ZYS A;  3HUI A;  2J0M A;  2KWC A;  1QOG A;  2KWU B;  1YJ1 A;  4PYU A;  1N60 A;  2W3S A;  4YTN B;  3M3J A;  4WH4 A;  1K8R B;  2BQQ A;  4B6W A;  4HEA 1;  3SFD B;  4LNI A;  4W9E A;  2M0A A;  2PMV A;  3E9S A;  4RH6 A;  2BT6 A;  4IKG A;  1YJI A;  2WDR B;  4MDK E;  3VH3 B;  4AQ7 A;  3AI5 A;  2G3Q B;  1JCK B;  1SJH D;  4KGS A;  3IAM 1;  4YSZ B;  1BT0 A;  2D3C A;  2MA9 B;  2L00 B;  4HPP A;  1V1P A;  4DHZ B;  3RUL A;  4DXG A;  2JXT A;  4JQW C;  1WXS A;  3ZIM A;  2B3A A;  3AEA B;  1FRR A;  2C7M B;  2BS2 B;  2WDT B;  1UWX A;  2PIA A;  2D2Q A;  4TQ1 A;  3KUD B;  1MG8 A;  2N9X A;  3RPF C;  3FAH A;  3M63 B;  3IT6 B;  3A9K A;  1YJJ A;  3ZW3 A; 
#chains in the Genus database with same CATH homology
 5EE3 A;  5HI1 A;  2WNM A;  1MVK A;  2TSS A;  1XO3 A;  1L4Z B;  1XLP A;  4EE2 A;  4AS1 A;  3MFG A;  1SEB D;  5FR3 A;  4A90 A;  4JWS C;  2GRI A;  3FC4 A;  1HQR D;  1DGJ A;  2K0P A;  5FKA C;  1CK1 A;  4LK0 M;  3Q8F A;  2BYT A;  3T3O A;  3URY A;  1KRH A;  1ZDV A;  4PT5 A;  2LHD A;  5BMG A;  1F0Z A;  2DWQ A;  1C4C A;  4RGN A;  3P4S B;  2AX5 A;  3DWG C;  4C7Z A;  4ZHO A;  2JX5 A;  1FM0 D;  4TSS A;  3PZ7 A;  3Q8B A;  1NYR A;  1K52 A;  2IPK D;  3LYY A;  1TYG B;  1D5M C;  1XLO A;  2N9L A;  3R2T A;  2Y5P A;  3WCQ A;  1I4X A;  4KGT A;  3B2G A;  4Q2J A;  2WU2 B;  5AUI A;  3AB5 A;  3AE6 B;  3CIR B;  1TKY A;  1WYG A;  3TEY A;  1YN4 A;  4L1B A;  3P4R B;  4XDC A;  3Q69 A;  1C78 A;  1UUP A;  3KQ4 A;  1SE2 A;  4N58 A;  2J52 A;  1WWT A;  2Y3A A;  3AE1 B;  3OWE B;  2WQY B;  3MP9 A;  1FXA A;  1P7E A;  3EA6 A;  4MAC A;  1FO4 A;  1ET9 A;  1SXT A;  2FBW B;  5C3J B;  4RFB A;  1UGJ A;  3U52 E;  1IUE A;  2IJ0 A;  3NS1 A;  1ZXH A;  2WXM A;  2OHF A;  2BS4 B;  1VZ8 A;  3BK1 A;  4MH8 A;  4HKQ A;  4GDK B;  1MHX A;  1R7S A;  1QF6 A;  1SSN A;  1MI0 A;  4WQM A;  2RMM A;  3BVG A;  3MC0 B;  1MHH E;  3HVZ A;  4KKJ A;  4MM3 B;  3LXF A;  1VRA B;  3U7Z A;  3IT4 B;  5HFY A;  2EKI A;  2N9K A;  3I9V 1;  1RWS A;  2G9H D;  4OZC A;  2NMQ A;  5H8Y E;  2BS3 B;  1T6B X;  3L4P A;  2WXR A;  3BK2 A;  1JWB D;  2LUM A;  4KKI A;  1FNU A;  5EE9 A;  1NEN B;  3NVW A;  2PW9 A;  1FXI A;  3E56 A;  1HZ5 A;  1JRP A;  3R8B A;  2G1E A;  2WXO A;  1TKE A;  5D7G A;  3HRD D;  3BVZ A;  1QQR A;  3NZ3 A;  4FXC A;  2BB5 A;  5EE1 A;  2K9X A;  3HVD A;  2IGH A;  3AE5 B;  4IDI A;  5EE0 A;  1GPX A;  1PGX A;  1QOF A;  3TEW A;  3AEB B;  4HKZ E;  4XE0 A;  1DYQ A;  2V0G A;  2LGI A;  3KLS X;  3NVV A;  4YTM B;  2M56 B;  2H88 B;  1ROE A;  1CQV A;  3AE2 B;  1JML A;  1J7B A;  5AUK A;  1QKZ A;  2WXP A;  4A8X C;  1FNW A;  2W54 A;  3P4P B;  4LLG M;  2WXI A;  2XN9 C;  4P6V F;  1V1O A;  1JAL A;  2IGD A;  4REZ A;  3VRA B;  1E7P B;  2J53 A;  4D2K A;  3I57 A;  2FUG 1;  1DOX A;  3AN1 A;  1TS3 A;  1E6E B;  1I4H A;  3BYY B;  4HRO A;  2CJN A;  4ARC A;  1NYQ A;  2Y5C A;  1GOZ A;  1IGD A;  1C4A A;  3BVM A;  3MHZ A;  4RCO A;  2WXQ A;  5D3D A;  3ZJU A;  4HRS A;  1C4P A;  2LHE A;  1BUI C;  1A70 A;  1I4G A;  1SBB B;  3NRZ A;  3AED B;  2AQ1 B;  2K5P A;  3Q8A A;  4O1N A;  3ZJT A;  1IBX B;  3IAS 1;  3B9J A;  4J3O D;  1L6U A;  2LMC A;  5TSS A;  1STE A;  2X38 A;  2WXG A;  3ZYY X;  4YWG G;  1EWC A;  1NI3 A;  3VQI A;  1SE3 A;  2SEB D;  4WIP A;  1UNS A;  1ZPS A;  2WDQ B;  1SJE D;  2PTL A;  1F2R I;  1TS5 A;  3AE4 B;  3AMZ A;  1TZO A;  1BXT A;  1XCT L;  1JQ4 A;  2LFI A;  2JZP A;  1PDX A;  2JWU A;  2ACZ B;  3DWM A;  1HZ6 A;  3V05 A;  1NEK B;  2M19 A;  2E3T A;  1M4V A;  1B1Z A;  2V3P A;  2QSD A;  4DXF A;  4ARI A;  4NAW B;  1D4B A;  2ONQ A;  2PKO A;  4RGT A;  1YN5 A;  3N9Y C;  2WDV B;  2WXL A;  2WXN A;  4B0E A;  1EM7 A;  2W82 A;  3BII D;  1PYW D;  3IXS A;  2WXK A;  1WXQ A;  4XWT A;  4ZOH C;  4L2Y A;  1FCC C;  2XNA C;  1EWY C;  1FFU A;  1D5X C;  1QOB A;  5BYS A;  1BML C;  1ZOY B;  3AM9 A;  4RF1 A;  1KF6 B;  2RPV A;  1IBX A;  1VDV A;  1EU4 A;  3W5V B;  3ZGZ A;  2GB1 A;  5HHD G;  3SFE B;  3SR6 A;  4YT0 B;  5G5G A;  5BYQ A;  1HA5 A;  2JQR B;  1YQ4 B;  2RDG A;  4UDU C;  2CJO A;  1P7F A;  3SEB A;  2L83 A;  4OVZ A;  1J7C A;  2MJD A;  4YTP B;  4N6E B;  1N5X A;  1K53 A;  3AEE B;  2EEL A;  3P63 A;  2V3N A;  4KX6 B;  1ENF A;  1CZP A;  1TJE A;  4DQO C;  1WGK A;  4GLS C;  1FCL A;  4ZRP A;  4OZB A;  2L1A A;  4RF0 A;  3GB1 A;  2CU3 A;  2GI9 A;  4LTU A;  2L52 A;  1HXY D;  2KAC A;  1ZDX A;  1TS2 A;  4OHJ A;  1WRI A;  1OQR A;  3J9C A;  1FMA D;  2ZW1 A;  1JRO A;  1T5X D;  1C77 A;  3W5U B;  2Z8L A;  4YSY B;  1N61 A;  4WAF A;  5LNK 1;  4R3D A;  4H2A A;  1VJK A;  4C7Y A;  1YN3 A;  1ZE3 D;  3BWU D;  3V3X A;  1E9M A;  1VZ7 A;  3P1M A;  2YEP F;  1I7H A;  1AN8 A;  2KAJ A;  1EU3 A;  5FK9 C;  4RNA A;  3U4E G;  5T8I A;  2DYM A;  2KQ4 X;  1C79 A;  1FD6 A;  4A6Q A;  1Q10 A;  1TS4 A;  4ZHP A;  2J42 A;  5GXG B;  1XLQ A;  4M0W A;  2MJ3 A;  2IDY A;  2N0S B;  5I4D A;  1Y56 A;  5E6J A;  3AEC B;  2DYO A;  1FNV A;  1F2R C;  1HEZ E;  2VZK B;  4TMA B;  3C8Y A;  3RFZ B;  4C80 A;  4RGM A;  1SF0 A;  3TUO A;  2QEJ C;  5G5H A;  3EGR A;  4YXD B;  1TY2 A;  3T3N A;  1ZXI A;  2D5G A;  4A9A A;  1F77 A;  2W55 A;  1FFV A;  4NZL B;  1MPE A;  3FIL B;  2NTS A;  2BW2 A;  2LJI A;  1JW9 D;  1L5P A;  4P16 A;  2MJE A;  3ZJV A;  1XF5 L;  3NUH B;  3UI3 A;  1N63 A;  3PZ8 A;  2R61 A;  2JYT A;  1AWD A;  2I38 A;  1OQQ A;  3O13 A;  1C9F A;  1GAQ B;  2E6X A;  2HDE A;  3LB8 C;  2WXF A;  3P42 A;  1TKG A;  5JXV A;  2WXH A;  2H89 B;  2QMT A;  1LO5 D;  2RDH A;  1XLN A;  3AE7 B;  2WP9 B;  2SAK A;  1UWM A;  3BYT B;  2WS3 B;  3W2D A;  3B2F A;  2OED A;  1JWA D;  4HJG E;  4OW0 A;  2PVG C;  1RM6 C;  1YNT E;  1ZP0 B;  3Q8C A;  1PGA A;  2QIE B;  1K50 A;  3AEF B;  1L0X B;  1L6V A;  1T3Q A;  1JWS D;  1D6E C;  1XXG A;  3VRB B;  2J4X A;  1SE4 A;  2DBY A;  1KTK A;  2QJL A;  3NVZ A;  1E0Z A;  1GB1 A;  1XEE A;  2N7J A;  1KH0 A;  1AYF A;  1QOA A;  3AH7 A;  3FIL A;  4B0M A;  2JU6 X;  2PVO D;  3AE8 B;  4ITK A;  5C2T B;  4JE3 B;  1B9R A;  1V8C A;  2KMM A;  4WWM A;  3VR8 B;  3ABV B;  1FIQ A;  1K51 A;  2HTM E;  2BTE A;  1TY0 A;  1PFD A;  1KFY B;  2YEP B;  1KLG D;  1QT9 A;  3TEX A;  3U2S C;  5BMI A;  2KN4 A;  2QIL A;  1JWU D;  3NVY A;  5MPO A;  1DOI A;  1VR9 A;  2W3R A;  4KGR A;  2INP E;  2AQ3 B;  4WUR A;  2KWD A;  3KWV A;  1D5Z C;  4IOI E;  1XCQ L;  4JWU C;  1C76 A;  4NJC A;  3Q8E A;  3AE3 B;  1SB3 C;  1WSP A;  1L4D B;  1L0V B;  4C56 C;  1QLB B;  3MJ5 A;  3TSS A;  3CWI A;  4OZA A;  2WU5 B;  3H8H A;  3EUB 2;  4US8 A;  5H92 C;  1QIL A;  4ZRQ A;  2AQ2 B;  1ACC A;  3BZD B;  1KLU D;  2KDM A;  3VR9 B;  2L32 A;  1V1P B;  1ESF A;  4USA A;  4ZYS A;  1FRD A;  2JSV X;  4RGO S;  5HG2 A;  3P4Q B;  3HUI A;  1PGB A;  3ETR A;  1QOG A;  1RYJ A;  1ZUD 2;  1N60 A;  4CQN A;  2K3U A;  2W3S A;  4YTN B;  3R2I A;  4WH4 A;  1GB4 A;  1I4P A;  4HEA 1;  2FE8 A;  1AW7 A;  2B76 B;  3SFD B;  2M0A A;  2INN E;  2PMV A;  5D3I B;  3E9S A;  3W1S A;  4RH6 A;  3W9C B;  4L23 A;  2BT6 A;  4MT5 A;  4IKG A;  2JYE A;  1VZ6 A;  1YJI A;  2WDR B;  1DOY A;  1OFF A;  4AQ7 A;  4TQ0 A;  2NTT A;  4JPS A;  1JCK B;  1CJE A;  1SJH D;  3TEZ A;  4KGS A;  3ZQ4 A;  3KWL A;  1J7A A;  2PLP A;  2ZW0 A;  3IAM 1;  4YSZ B;  1YMH E;  1N5W A;  3GP7 A;  1L0Y B;  1RFK A;  2BB6 A;  3AE9 B;  2LEK A;  1PUT A;  1V97 A;  4JX1 C;  1V1P A;  3AEG B;  1I4R A;  3GS2 A;  4XWW A;  5BMH A;  2DLB A;  2I2Y A;  2IGG A;  4DXG A;  1N62 A;  2Q5W D;  2JXT A;  2WLB A;  1ET6 A;  4XDD A;  2ON8 A;  3AEA B;  1FRR A;  1JWM D;  4A55 A;  2BS2 B;  5BYR A;  1UWX A;  2ICI A;  1SIJ A;  2PIA A;  4US9 A;  2VZK D;  1E10 A;  4TQ1 A;  1YQ3 B;  2MH7 A;  2V4I B;  1IGC A;  4N59 A;  3RPF C;  1FEH A;  3FAH A;  4GDL B;  3IT6 B;  4YSX B;  1NVI D;  3PO0 A;  1VLB A;  1I4Q A;  2MEK A;  2WXJ A;  4NAM A;  2K22 A;  2BBC A;  3AV8 A;  1YJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...