2LEKA

Solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Biosynthetic protein
molecule keywords Putative thiamin biosynthesis ThiS
publication title Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325
rcsb
source organism Rhodopseudomonas palustris
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lekA00
1KFYB 1VDVA 1TYGB 3AEAB 1FM0D 2PKOA 4N58A 3AECB 2W54A 2WDVB 3HVZA 1L6UA 1KF6B 1XLNA 3ETRA 5EE9A 4YTNB 5C2TB 1DOYA 1J7CA 3ABVB 2DWQA 4A9AA 1FXIA 1QOFA 1WGKA 3CWIA 2AX5A 1NYQA 4N59A 1JWAD 1V8CA 1ROEA 4P6VF 2MJDA 1FIQA 2G1EA 2K22A 3VR8B 1WRIA 3W5VB 1ZP0B 3HUIA 1QOBA 5EE1A 3VRAB 2MJ3A 3P63A 2DBYA 5GXGB 1NVID 3P4QB 1SIJA 3AE4B 3AEGB 1PDXA 1XLPA 2PVGC 3AE1B 1CZPA 4JWUC 1QT9A 1WXQA 1ZXIA 4USAA 5EE0A 1UWMA 4C80A 3P4RB 3AM9A 1AWDA 2H89B 1TKEA 3AEBB 3FC4A 1FRDA 2QIEB 3AE9B 2M56B 4US8A 1J7BA 1JWBD 1QLBB 1WYGA 1E9MA 3AB5A 4WWMA 5G5HA 2EKIA 2W3RA 3LXFA 3P1MA 4ZHPA 3B2GA 5MPOA 1DOXA 1RYJA 3P4SB 4YT0B 1E0ZA 3LB8C 1L5PA 4N6EB 3VR9B 4ZHOA 3CIRB 1J7AA 1TKYA 4KX6B 2WU5B 1NI3A 2WQYB 3B2FA 4YSZB 1XLOA 1XLQA 1JW9D 2L83A 2B76B 4IDIA 1JALA 1GAQB 1VJKA 1T3QA 2OHFA 3AMZA 1RFKA 3NS1A 1E6EB 1TJEA 1YJIA 1KRHA 1V97A 3NVWA 3B9JA 1N61A 1A70A 2MH7A 3DWMA 3AEFB 1JQ4A 3AN1A 1OQRA 3AEDB 1PUTA 1FMAD 3AV8A 2BT6A 1DOIA 1XO3A 3VRBB 2W55A 3NRZA 2KAJA 1FFUA 1RM6C 4ITKA 4US9A 2BS3B 3EUB2 4FXCA 1R7SA 3FAHA 2QJLA 3NVVA 2HTME 1FXAA 5H8YE 2M19A 2PVOD 2BS4B 1N5WA 1GPXA 3AE3B 2MJEA 2PIAA 3AE7B 3WCQA 1FFVA 1I7HA 1E7PB 1JROA 3NVYA 1N62A 2WU2B 3P4PB 2N0SB 1NENB 4HRSA 1E10A 3KWLA 3SR6A 3DWGC 4HROA 2H88B 2W3SA 4LTUA 1NYRA 3RPFC 4JWSC 4YSXB 1OFFA 3AE8B 3AH7A 1YJJA 2JX5A 3AE2B 3BIID 1EWYC 1L6VA 1CJEA 2ACZB 3ZYYX 1OQQA 2CU3A 3AE6B 5C3JB 1YQ3B 1JRPA 4YTMB 5AUIA 3AE5B 1AYFA 4YSYB 1SF0A 2K9XA 1N63A 3NVZA 2L52A 5AUKA 4ZOHC 5EE3A 2E3TA 2BS2B 1ZOYB 1PFDA 1ZUD2 5G5GA 2Q5WD 2WDQB 1N60A 2FBWB 2WS3B 3PO0A 2K5PA 4YTPB 1FRRA 3W5UB 1SB3C 1NEKB 2LEKA 2WP9B 4WQMA 3AEEB 1QOGA 4JX1C 3SFDB 4YXDB 1QOAA 3L4PA 2Y5CA 1WWTA 1IUEA 1QF6A 1L0VB 2CJNA 2KMMA 2WLBA 2CJOA 4C7YA 4C7ZA 1YQ4B 5H92C 2WDRB 3SFEB 1TKGA 1FO4A 1DGJA 2JQRB 1F0ZA 1B9RA 1N5XA 1VLBA 3HRDD 3W9CB 1RWSA
chains in the Genus database with same CATH superfamily
2WX1A 4RM9A 3NS8A 3UIOB 1T6BX 3PHXB 4AQ7A 3DBSA 4RGMA 4UDUC 3MP9A 5C2TB 4TV3A 2MBEA 3ABVB 1EUVB 1WR6E 3IFWB 1GJZA 3MHSD 4KV2A 3RNEC 4B95A 5I4DA 3FKYA 2G1EA 2K1FA 4BZAA 4M02A 4F7ZA 1XD3B 4PS3A 1NVID 4LCDE 3APDA 2PVGC 3EECA 2BWFA 2M0AA 2D3AA 1E5WA 1RAXA 1JWBD 3HIZA 3UQAA 4N6EB 2XK5B 4GXBA 4LNIA 4B0MA 2N9PC 4M0WA 5JZEB 2BB5A 1TZ1A 5KHQA 2KACA 1YN5A 2WXPA 4MM3B 1VZ6A 1M4VA 1PUTA 1ET6A 4GIVA 2XNAC 2NS5A 4ANWA 2BS3B 3A4RA 3ZJUA 3ZNGC 3R66C 4CQNA 4RH6A 4AOFA 1Y8RC 2IBIB 3VTUA 5JXVA 2D5GA 3L16A 1OFFA 1XF5L 3ZW3A 2DYBA 1L6VA 2WXGA 1OQQA 4XC2A 4EE2A 3M63B 2KVZA 1PGBA 4DHJD 4IKGA 2SAKA 5HI1A 1L4ZB 3DQVA 2IZVB 3EFUA 2LVQA 3VXWA 2KK8A 3JVZX 4A90A 3RNBC 1VDVA 2MP2B 2FAZA 1I4RA 1FEHA 2LGSA 3HVZA 1PQSA 1VZ8A 3URYA 5G55A 2Y3AA 4HPPA 3NUHB 4A3PA 2QHOA 2BKRB 1YX5B 3MJ5A 3OG5A 1ROEA 4Q2JA 2ZW1A 3DVGY 3IAS1 4CYEA 1PGAA 1C3TA 2L0FA 2BB6A 1PDXA 1XLPA 3E9SA 1UWMA 2WXNA 2QIEB 1C76A 2YVCA 3AE9B 3AB5A 4HEA1 2L32A 2PE6B 1GG3A 2MBHA 5D6JB 4LNOA 1BXTA 1TS2A 1UZXB 1ESFA 5DPWA 3AEFB 3HK0A 2K0PA 3Q14C 2JZ3B 1V5OA 3CF6E 1WRDB 3WAPA 4KZ0A 2NTSA 3APFA 3NZ3A 4F8CB 2LJIA 3DCGA 5HKHA 1UBIA 1S3SG 1E8WA 3SR6A 2H88B 4W9HA 5FR3A 2WXKA 3BK2A 1EWYC 4B9KA 2J7QB 4WWNA 1UWXA 2LHDA 1WJ6A 3PVLA 4ZOHC 1ZOYB 1PFDA 2BF8B 2D3GA 2FBWB 4KDIC 1R4MI 1FRRA 4LNKA 1M94A 1EM7A 4YXDB 2B3AA 1WXAA 1FO4A 1AW7A 1SGHA 1VLBA 3HRDD 1RWSA 2ON8A 3PZ7A 1P7FA 1KF6B 4GOCA 1XLNA 2KTRB 1GC6A 4GDLB 4R3DA 2O2VA 2KQ4X 2JUOA 3PLUA 3D32A 3BVMA 5E6JA 4DDID 1WRIA 3W5VB 1SE9A 2WHIA 5GXGB 3VTVA 2JU6X 3DBLI 4DK5A 2D2QA 3N30A 3UIPB 1V1PA 2V4LA 3AEBB 3KVFB 4MGIE 5E6OA 5E6PA 4ZHPA 2DNFA 3P4SB 1Z2MA 4ZHOA 3CIRB 2LHEA 2L83A 2DAJA 4P1CC 1GOZA 3AMZA 1WGHA 3E56A 2VZKD 1E6EB 3U2SC 1TJEA 1OTRB 4KSLC 1LM8B 5DPTA 2K8BA 2V3NA 3EGRA 1R7SA 2M1MA 2QILA 2Y5BB 5EDSA 2G45B 4WQOB 4RGOS 1I7HA 4ZYSA 2N0SB 4W9JA 2DENB 4YSXB 2JX5A 4G0NB 2FE8A 3ZXRA 4A6QA 2KWDA 3ALBA 1N63A 2L52A 3WA0A 4KVGB 1ZUD2 2WS3B 3PO0A 3DOWA 1SE2A 2LGDA 3R7RA 4BVUC 1IUEA 2JZZA 2NBVB 4GU2A 1P0RA 4NJ6A 4C7YA 1D5XC 4ARCA 2DYMA 5IA7A 4P1BC 4NNJB 2V3SA 4PS8A 3ZTDA 3ZRFA 1KFYB 1Z5SB 2J0MA 4MGKE 5BMIA 1I42A 2V4IB 3H7PB 1L6UA 2REXA 4NAMA 3VFKA 2LXCA 1HZ6A 2DWQA 3U52E 2FNJB 3Q2AC 3LYYA 2K25A 4XWTA 2LRWA 2MJDA 3U7DA 1UF0A 3IAM1 4BKTA 2QCZA 2RDGA 2KFJA 2R61A 2DBYA 1XEEA 1R4MB 2PE9A 1T0RC 3P4QB 1Q5WB 2G4DB 5L95C 3ZNHB 2ZVOA 1X1MA 3A9KB 5TSSA 5EE0A 3VDZA 1KM7A 1U4AA 1KTKA 2KYWA 4ACFA 2GOWA 1J7BA 3UF8A 4URKA 1WYGA 2Z0DB 4EFOA 4YT0B 2ZCCA 1L5PA 3LDZE 3KQ4A 1XLOA 5J2RA 4LNFA 1E90A 1WZ0A 4N9F4 2INNE 2MH7A 1K8RB 2IO3B 3HHMA 3Q8BA 3VRBB 3QK0A 4FXCA 3NVVA 2AQ2B 3N32A 1V49A 2G4SA 2MRPA 4BBNF 2SEBD 2L05A 2XK5A 2MBQA 4JLCA 2RR9A 4JWSC 2XBBC 1YJJA 2KWUB 4K7SA 3PLVA 2PMVA 1YQ3B 2ZNVB 3A1QB 4MM3A 4FHJA 4LJPB 2BS2B 3DBHI 1EU3A 4YTPB 3X0WA 1T0YA 2AYOB 2KMMA 2KN4A 1SEBD 1XCQL 5JH5C 4PS7A 2FCQA 4L2YA 2VH2A 2ZCBA 4IC7B 3RNFC 1UNSA 2JWUA 2EMTA 1NDDA 1WXVA 4HJKA 2KTFA 4BAXA 3TJPA 3L10B 4P16A 1VRAB 4ZRKA 2PTLA 1E7VA 5C23A 1TZOA 4IWQA 3AE1B 2K6DB 1AWDA 4BBNC 2MP2A 2PPHA 1LQBA 4I6NB 1E9MA 3LXFA 3VR9B 1D4BA 4ASWC 3KYDD 2WU5B 4WH4A 3LJ3A 4S17A 2KQ7A 2ASQA 2IO0B 2TSSA 1A70A 2NMQA 2KX3A 3VH3B 1F1HA 2OOBB 3RN9C 5JHAA 1GUAB 1VZ7A 4C56C 2IJ0A 1SJHD 5H8YE 4MH0E 1E7PB 1D3ZA 4MEMA 2N7DA 3IXSA 4XZ4A 4NJCA 3GE8C 3NG0A 2BYVE 5AZFA 1I4QA 3PPAA 4QAYA 2KDBA 3AE5B 4E3CA 3L54A 4WWOA 1H8CA 1YX6B 1N60A 2WWZA 5IO9A 4WJOA 4BOZB 3C0RB 2D3BA 1WWTA 5L83A 1HXYD 4C7ZA 4FBJB 3ZGZA 1F0ZA 4WAAA 3U7ZA 1N5XA 1C79A 1XCTL 1A5RA 5D94A 2LWPA 3C8YA 4J3OD 3GE3C 1C4AA 1TY2A 1FCLA 1IGDA 2N9XA 2AX5A 2IGDA 3TSSA 3P63A 3VUWA 1XT9B 4OZCA 4LJOB 1WJUA 4CHKA 4X57B 3TCAA 2N9EB 3L0WB 2PJHA 3VVWB 2ONQA 3PRPB 2I38A 2Z8LA 4HCNB 2MBOA 2J0KA 2GI9A 2M8SA 2W3RA 3GB1A 1UBQA 2DZKA 1WSPA 2G3QB 2KTRA 3R2IA 1WYWB 4GDLA 3PZ8A 3W1SC 3ML8A 1YJIA 2K8HA 3APCA 3KLSX 4IOIE 3AN1A 4WJNA 5JHBA 1VD2A 1SIFA 2GBMA 3CSFA 3TEZA 2A4ZA 2JZPA 3RT3B 4DWFA 4DXFA 4KSKC 2HE7A 2PIAA 2N9KA 1GB1A 2WU2B 1JWUD 1E8XA 1HA5A 3DHIC 1V2YA 4IWPA 2LUMA 4HWIB 2BWES 2JYTA 2ZNVC 3I57A 1VCBA 2WGSA 2AQ1B 3V6EB 4OHJA 1ZW7A 4HJGE 4I6LB 2KC1A 2HD5B 5AUKA 4K1RB 1KJTA 2GB1A 2L8JA 2Q5WD 4ANXA 1QOGA 3L4PA 2ICIA 2NVUI 4J6IA 1V86A 2N1VA 3SDLC 3QHTA 3K9OB 3OAWA 4FA6A 1CMXB 3DVNU 4HDQA 4YTNB 5EE9A 1OQYA 4NPNA 4YWGG 2BYFA 1NBFC 2VRRB 1E7UA 4II2B 3Q8EA 1KLVA 2HDEA 4HLEA 4N59A 3QJZA 2QC8A 1C4CA 1MG8A 2IGGA 2HJ1A 2KWCA 3HVDA 1EF1A 5CTRC 2RPVA 5D3IB 4USAA 2ZJDA 1BMLC 1F2RI 4RM8A 2AL3A 2MEKA 3R2TA 1F52A 4XYCA 2RSUA 4MGYE 4XDCA 4HVBA 4IM3A 2EKIA 3UGBB 4HDOA 4M01A 3H7PA 4E74A 2KMAA 4WJQA 2YLMA 3T3NA 1TIFA 4LLGM 3EC8A 3VQIA 1LGRA 4W9FA 1T3QA 2YEPB 1WFYA 2JF5A 1YMHE 1WXSA 5D2MB 4JL9A 2BYEA 1XO3A 3PRMB 3ZXVA 4EZKA 3A4SC 2KAJA 5CHVC 3A9KA 5E6NA 5AEKB 4NQKE 4L23A 2X38A 4ARIA 2BS4B 1GPXA 3WCQA 3ZO5B 2L1AA 2MCNB 3ZKJC 3TUOA 4HRSA 5HHDG 3KWLA 4HROA 4KGTA 3AH7A 2GBJA 1WX7A 3QA8A 1SXTA 1JRPA 2KLGA 2AEHA 5AUIA 2KN5A 1C78A 1SF0A 3NJTA 4WWPA 3W1SA 2W9NA 3OJ3A 1EF5A 2K5PA 1NEKB 2LEKA 1CQVA 1I4PA 3GP7A 1J8CA 1GC7A 3ONSA 3BK1A 3ZIMA 4H2AA 4LDTD 4N58A 4KGRA 2BPSA 2I2YA 3UQBA 1KLGD 3ZLZA 1Q1OA 3A1QA 4WURA 3WIMA 4XDDA 1ZDVA 4C00A 1B9RA 4BOSC 4M8MA 3ML9A 3VRAB 1E8YA 5BMGA 1WF9A 4JPSA 1SIJA 4GB9A 1QZEA 3VUYA 4ZRQA 1WGRA 1WXQA 4DXAB 4RNAA 2GRIA 4HK2A 3Q8CA 1DOXA 4AUQC 2Z59B 2FCSA 2MW5A 2B76B 1JALA 2KLCA 1VJKA 2OHFA 3RULA 3WAOA 1KRHA 2KZRA 1RRBA 4WIPA 3TIXA 2JT4B 4K81A 3KUCB 2CHXA 1WXMA 2BT6A 1MPEA 1TS5A 4G3XB 3IG3A 1V6EA 2WXFA 1TY0A 2KQSA 2MSED 4IUMB 1GNUA 4MGZE 1N5WA 1T0SC 1RLFA 2NBUA 3ZDMC 2NR2A 4RMAA 1YJ1A 1WZ3A 4AJWA 3AE2B 1G6JA 2IPKD 3WALA 3ZQ4A 3I5JC 2YEPF 2KDMA 3BWUD 3ZJVA 2GBNA 4HXDA 4IW0A 2E3TA 5G5GA 3SU8X 3GS2A 3W5UB 2INPE 2FIFA 3AEEB 1SE3A 3AULA 4PYUA 2NPTB 1QOAA 1WI0A 2J52A 1TKGA 3N1YC 3CMMB 3BVZA 5BYRA 1HEZE 3RZWC 2PKOA 2EMSA 2WXLA 2W54A 2WXQA 1L2NA 1D5MC 3VH4B 2DAFA 2KHWB 1FCCC 4GN1A 2KJ6A 1V5TA 3QARA 5AZGA 4YL8A 4FLHA 3VR8B 2VH1A 1ZP0B 2UU7A 4BKSD 1MFWA 1Q10A 1L0XB 5KHOA 3OJ4B 2GLSA 2LXAA 4B6WA 4HCPB 3NOBA 1TKEA 3H7SA 3Q6BA 1FRDA 1K51A 4WWMA 1WGGA 2IDYA 2JPHA 3P1MA 2LZ6A 2C7NB 4M00A 1GB4A 2DX5B 5IKCM 1FPYA 2MWSB 3DDCB 3NS1A 3W2DA 4BKSA 2D11A 1OQRA 1MVKA 2QEJC 1FXTB 1S1QB 4DQOC 2K39A 4RCOA 4NJ7A 4W9GA 3FAHA 2KVRA 1FXAA 2PVOD 3AI5A 3Q69A 4TMAB 3AE7B 3MJWA 2O6VB 2WXOA 2CU3A 3K9PB 2E6XA 4YSYB 4MSMB 2BTEA 1ACCA 4MACA 3SFDB 1QF6A 2D3CA 2CJOA 3RNGC 3JYUA 5H92C 3P42A 2I1KA 1TTNA 2LGIA 3BY4B 4EUTA 4MH8A 2OEDA 3A9JB 3U30A 5FK9C 1V1OA 1I35A 3RNCC 3FILB 3BVGA 2K22A 2NCNA 2BBCA 4NAWB 3UI3A 1KOTA 2ZVNA 2CKHB 3TEXA 2K6QA 3EHVA 2R2OA 4IM0A 2J4XA 2KJHB 2M56B 1EWCA 1V80A 1TT5B 3LB8C 4ZRJA 1UGMA 1XLQA 4KKJA 4JE3B 2KX0A 3DWMA 3DBRB 2DZMA 1WX9A 5DPSA 3AV8A 1WGDA 1YD8U 2CS4A 2WXRA 1FFUA 1RM6C 1C77A 1F2RC 4C4VB 1IBXB 3PREA 2MJEA 1RFAA 1HE8A 4RF0A 3PTFC 3Q3MC 3RYTA 2CHZA 5IN7A 2DHZA 1NYRA 2LI5A 1FNUA 1WMHB 5AZHA 3PT2B 2G9HD 1ZKHA 3AE6B 3ZUNA 1UUPA 3WANA 4G11A 1JWSD 5BO4B 3IT6B 2BKFA 2KANA 2RD0A 4GMVA 2KNBA 1UELA 2Y5CA 4ICVA 2ZZPB 3N20C 3Q3FA 3TL5A 3L17A 4W9CA 3AE8B 1T5XD 3OLMD 3HM6X 2I1JA 4OVZA 4F1SA 2WDVB 4ICUA 1ZE3D 1DOYA 1WGYA 4DDGD 2JVCA 2WXIA 2QSDA 1ET9A 1FXIA 2LVOA 3Q8AA 1D6EC 3CSTA 3A33B 3HUIA 1QOBA 4A20A 2BYTA 4DXGA 1J19A 2DLBA 4ANVA 1I4GA 4TUUA 1SE4A 2AWTA 2EKEC 2MBBB 2L0TA 2CHWA 3P4RB 2H89B 3FC4A 2R2QA 2V9HA 4US8A 5C1ZA 2KWVB 3TBLD 5MPOA 1LO5D 4AJYB 1L4DB 1MI0A 3PV1A 1NI3A 2AQ3B 4A8XC 2WYQA 1GAQB 3B1LX 2LVPA 3GOEA 1FNWA 2ZPYA 1L7YA 4OVVA 1JQ4A 3M62B 2L00B 3VHTC 4RF1A 4II3B 2W55A 4ITKA 3KWVA 2KDIA 1ZPSA 3ZDTA 3PHWB 3IT4B 5GMVA 3GZNB 3WAMA 3RZFA 3J9CA 3SEBA 1FFVA 2KT7A 4XX5A 3MC9A 3U8ZA 2KMCA 3NY5A 2CR5A 1YN4A 3H1UA 1QQRA 1WE7A 3RFZB 5LNK1 5TR5A 1CJEA 2PEAA 3RD2A 5C3JB 2DZIA 3IVFA 2A5UA 5DPRA 1B1ZA 3N1XC 5BMHA 3EFCA 4WQMA 3EA6A 1K50A 1L0VB 2WLBA 5LXIB 4TSSA 2INCC 3QWZB 3AEAB 1D5ZC 5HG2A 4EEWA 3KW5B 5D3DA 4MJSB 3ETRA 4A55A 4PYZA 1J7CA 1R4NB 2QMTA 4ANUA 3Q3JA 3PRZA 1UD7A 2JRHA 4G50A 2C7MB 1JWAD 2MLBA 3UINB 2KO3A 3JSVB 3V60A 3N3KB 4FULA 5EE1A 3B08A 3TEYA 2NPTA 2Y5PA 3T3OA 2RMMA 2MX2A 4KZCA 3B0AA 2EELA 3ZNID 3AM9A 1MG4A 3T9LA 2NTTA 1I4HA 2KFKB 1IPGA 4L1BA 4MT5A 1RYJA 2RDHA 1E0ZA 2N7JA 1LXDA 1J7AA 3DVGX 3MHZA 1EO6A 1YIWA 3O65B 3RI7C 4TKNA 1BT0A 4XE0A 3IBEA 4BKGA 3TEWA 1WJNA 3NRZA 1C1YB 3I3TB 3KH0A 3DHGC 1STEA 1NENB 4IG7B 2UYZB 2W3SA 1FD6A 1HQRD 3BIID 3ECIA 2ACZB 2O6VD 3Q3OC 1P7EA 2DYOA 2K9XA 3BZDB 4IWOA 4OVUA 5CHWA 3NZSA 3KUZA 2WP9B 5J18A 1F9JA 4JX1C 2MHJA 4FADA 1E8ZA 2WX0A 4JQWC 1SBBB 1XXGA 1YQ4B 3C19A 3SFEB 3QAQA 1OGWA 2C5LC 4A3OA 5G5HA 1TYGB 1P98A 1FNVA 3L13A 1ZXHA 5BYSA 2O6VA 3OWEB 3QX1A 3ENEA 1WE6A 3VAWA 1AARA 2HTHA 2RPQA 1MHXA 1WR1A 1C9FA 1UH6A 3V3XA 2MJ3A 1OEYA 3AE4B 3M95A 3AEGB 5G2NA 1JRUA 3VTWA 1QT9A 2ZEQA 1IYFA 1YN3A 1BUIC 3B2GA 3RCZA 1TGZB 3A9JA 1TKYA 4GDKB 4IDIA 1RFKA 4KIKB 4HPMB 3FILA 1V97A 2N7EA 4NAWA 2IO1B 2LASA 1CK1A 3I63C 5FKAC 1DOIA 4W9KA 4JIOU 3ZNZB 4FJZA 2N9LA 2WXHA 4XGAB 5CHFA 2W82A 4AWJA 2Z0EB 3AE3B 1TS4A 3ZRCA 1JROA 3P4PB 2GBRA 3I9V1 1HTOA 3DWGC 5DCNA 3R8BA 2HJ8A 3ZYYX 2C9WB 3X23A 2NBWB 3V05A 4CO7A 2QDFA 2WDQB 2M4NA 4M8NA 2JYEA 3H6NA 1MJDA 4FN2A 3BYTB 2IGHA 2JWZA 2CJNA 3DPDA 4C4VA 1IBXA 1JMLA 2MA9B 3MTNB 3W9CB 4MSQB 4RGTA 2KKCA 3KUDB 4W9DA 5BYQA 1WMHA 3Q3NC 2L76A 4EKUA 1YNTE 2V3PA 4A9AA 4M0WB 4TQ0A 2KDFB 1QKZA 3RUIB 4HKZE 1NYQA 2K3UA 1V8CA 2LGXA 1SSNA 2BVCA 4ZDVA 2JY6A 2BQQA 4E71A 3NHEB 1XQQA 1JWMD 4JWUC 4KKIA 4C80A 1SJED 1KH0A 3RMKC 2KD0A 1QLBB 3IHPC 1MHHE 1JCKB 3V61A 4KX6B 3B2FA 3DBRI 4ZYNA 1JW9D 2WXJA 1IGCA 4FJVB 3U4EG 4LK0M 4RGNA 1EU4A 3NVWA 3RNAC 1IP9A 1N61A 2M17A 3AEDB 1FMAD 2GBKA 2LJ5A 3EUB2 1HTQA 1P1AA 2HTME 2JXXA 2OJRA 4ZRIA 1ZDXA 4NZLB 5CX3A 1K53A 3N1ZC 3RPFC 2FCMA 4B0EA 3QCAA 1YOVB 2IO2B 2INDC 2KC2A 2KJRA 5IAAC 5EE3A 4DHJB 5FR6A 4EZJA 1ZGUB 4NY0A 1NI2A 2FCNA 4EOYA 1WIAA 2JRIB 2X8XX 4KGSA 2FIDA 1DGJA 1WM3A 3MFGA 2GMIC 2WXMA 2IYDB 5J17A 1FM0D 3AECB 1WX8A 1QOFA 4PK1A 1WGKA 4GGQA 3O13A 3P2BA 2MQJA 1WH3A 4FJYA 4K3BA 2XEWA 2D07B 1VR9A 4JGHB 4W9IA 3PZDA 3H9DA 4MELA 2J0JA 1N6ZA 3DBLB 2IY1B 1UGJA 4YSZB 2BW2A 4MJSA 2WQYB 1I4XA 4KDLB 1QILA 3JSVA 3B9JA 2D10A 4MDKE 1P9DU 2FUHB 2N4FA 3TMPB 3GZNI 3MC0B 3PGEA 1AN8A 4US9A 3KYCD 1F77A 4W9EA 2OJWA 1WM2A 2M19A 1WJ4A 2LGYA 2LD9A 4P7IA 2KFKA 2ZPNA 4I6PA 4O1NA 2C60A 2RGFA 3SD5A 4LDTB 5D7GA 1E10A 4LTUA 1TBEA 1DYQA 4REZA 1PYWD 3QC8B 3ZTCA 2N1WA 2LFIA 4HKQA 4YTMB 4NQLB 1K52A 1LFDA 1AYFA 4LNNA 2WNMA 2O2VB 4XWWA 3NVZA 1T0QC 4K7UA 2IY0B 1L0YB 4OZBA 3W1YA 3QQ8B 1HZ5A 2V0GA 1H4RA 4EZLA 2LRUA 3AXCA 3AU4A 2WDRB 2JQRB 4FHKA 3JW0X 1V1PB 2J53A 1R4NI 4OW0A 1Q0WB 3DHHC 3HM3A 4WAFA 3NZUA 3QIJA 3BINA 3CWIA 3PSEB 4GLSC 4P6VF 4IM2A 4BFRA 2KXJA 1FIQA 4ZRPA 2UWQA 1KLUD 3VUXA 5HFYA 1ENFA 4AS1A 2AL6A 2LUEA 1J0GA 1CZPA 1ZXIA 2J42A 4W9LA 1C4PA 3V6CB 2PW9A 4DBGA 2L7RA 1YQBA 2V1YA 1V9JA 4S0RA 3S2AA 2FUG1 2WDTB 4GSWA 4DHZE 5IP4D 2VZKB 2M0XA 2XN9C 2L3ZA 4K3CA 3Q8FA 4HPLB 4PT5A 3T8MA 4K7WA 1ISNA 2CU1A 3DVNV 4WJPA 2JSVX 2QJLA 3H8HA 5LXHA 3SHQA 3MC8A 4RFBA 2ZW0A 3R7QA 2BGFA 2JXTA 3NVYA 1N62A 3PS6A 4AP4C 2LMCA 3V62A 5IOIA 2C7HA 4GDKA 1TS3A 2PLPA 2RDBC 3BYYB 4KIKA 4DHZB 4D2KA 2K8CA 2DZJA 3N9YC 3L08A 1WY8A 4OZAA 5LLIA 3ZVVA 1SB3C 1Y56A 1PGXA 2KDEB 4TQ1A 3ZJTA 1V81A 3AU5A 3DBHB 3M3JA 3R3MA 1P3QU 5T8IA 2KOXA 1OEYJ
chains in the Genus database with same CATH topology
1TYGB 2PKOA 2WXLA 1T6BX 2W54A 1FNVA 2WXQA 1ZXHA 5BYSA 1UNSA 1D5MC 2JWUA 3OWEB 4AQ7A 1FCCC 4RGMA 4UDUC 3MP9A 5C2TB 3ABVB 5I4DA 4P16A 1MHXA 2G1EA 1VRAB 3VR8B 1C9FA 1ZP0B 3V3XA 2MJ3A 2PTLA 1Q10A 1L0XB 1NVID 3AE4B 3AEGB 2PVGC 1TZOA 3AE1B 1QT9A 2M0AA 1AWDA 1YN3A 1TKEA 1FRDA 1K51A 1BUIC 1JWBD 4WWMA 1E9MA 2IDYA 3LXFA 3P1MA 3B2GA 4N6EB 3VR9B 1D4BA 1GB4A 1TKYA 2WU5B 4WH4A 4GDKB 4B0MA 4IDIA 4M0WA 1RFKA 3NS1A 2BB5A 3FILA 1V97A 2KACA 3W2DA 2TSSA 1YN5A 2WXPA 4MM3B 1A70A 1VZ6A 2NMQA 1M4VA 1CK1A 1OQRA 5FKAC 1MVKA 1PUTA 1ET6A 2QEJC 2XNAC 1DOIA 2N9LA 4DQOC 2BS3B 1VZ7A 4C56C 4RCOA 2IJ0A 2WXHA 3ZJUA 3FAHA 1SJHD 5H8YE 1FXAA 2PVOD 2W82A 3Q69A 3AE3B 1TS4A 3AE7B 4RH6A 4TMAB 4CQNA 1E7PB 1JROA 3P4PB 3I9V1 5JXVA 2D5GA 3DWGC 3IXSA 3R8BA 4NJCA 1OFFA 1XF5L 1L6VA 1I4QA 2WXOA 2WXGA 3ZYYX 1OQQA 2CU3A 3V05A 3AE5B 2E6XA 4YSYB 4EE2A 1PGBA 2WDQB 1N60A 2BTEA 1ACCA 2JYEA 2SAKA 4IKGA 4MACA 5HI1A 1L4ZB 3BYTB 2IGHA 3SFDB 1WWTA 1QF6A 2CJNA 2CJOA 1IBXA 1HXYD 1JMLA 4C7ZA 5H92C 3P42A 3ZGZA 1F0ZA 3U7ZA 4A90A 1N5XA 3W9CB 1C79A 2LGIA 4RGTA 1XCTL 1VDVA 1I4RA 4MH8A 5BYQA 1FEHA 2OEDA 3HVZA 4J3OD 3C8YA 1VZ8A 3URYA 5FK9C 1C4AA 1V1OA 1TY2A 2Y3AA 1FCLA 1YNTE 2V3PA 1IGDA 3NUHB 4A9AA 4TQ0A 1QKZA 4HKZE 3FILB 2AX5A 1NYQA 2K3UA 1V8CA 3MJ5A 1ROEA 3BVGA 2K22A 4Q2JA 2BBCA 2IGDA 4NAWB 1SSNA 3TSSA 2ZW1A 3IAS1 3P63A 3UI3A 1PGAA 4OZCA 2BB6A 1PDXA 1XLPA 3TEXA 1JWMD 4JWUC 3E9SA 4KKIA 1UWMA 4C80A 2ONQA 2I38A 2J4XA 1SJED 2WXNA 1KH0A 2Z8LA 2QIEB 1C76A 3AE9B 2M56B 2GI9A 1QLBB 3AB5A 4HEA1 1EWCA 2W3RA 2L32A 3GB1A 1MHHE 1WSPA 3LB8C 1JCKB 4KX6B 3B2FA 3R2IA 1BXTA 1XLQA 1JW9D 2WXJA 3PZ8A 1IGCA 1TS2A 3U4EG 4KKJA 4LK0M 4RGNA 1EU4A 1ESFA 1YJIA 3NVWA 4JE3B 1N61A 3DWMA 3KLSX 4IOIE 3AEFB 3AN1A 3AEDB 2K0PA 1FMAD 3AV8A 2WXRA 1FFUA 1RM6C 1C77A 3EUB2 1F2RC 3TEZA 2NTSA 3NZ3A 2JZPA 2HTME 4DXFA 1IBXB 1ZDXA 2MJEA 2PIAA 2LJIA 2N9KA 4NZLB 1GB1A 4RF0A 2WU2B 1JWUD 1HA5A 1K53A 3SR6A 2H88B 2LUMA 1NYRA 3RPFC 5FR3A 2WXKA 1FNUA 2JYTA 3I57A 3BK2A 1EWYC 2AQ1B 4B0EA 4OHJA 2G9HD 4HJGE 3AE6B 1UWXA 2LHDA 1UUPA 5AUKA 4ZOHC 5EE3A 1ZOYB 1PFDA 2GB1A 2Q5WD 1JWSD 2FBWB 1FRRA 3IT6B 1EM7A 1QOGA 4YXDB 3L4PA 2Y5CA 2ICIA 4KGSA 1FO4A 1AW7A 1DGJA 3MFGA 1VLBA 3AE8B 3HRDD 1T5XD 1RWSA 2WXMA 1FM0D 4OVZA 3AECB 2ON8A 3PZ7A 2WDVB 1P7FA 1ZE3D 1KF6B 1XLNA 1DOYA 5EE9A 4YTNB 4GDLB 4YWGG 2WXIA 2QSDA 4R3DA 1ET9A 1FXIA 1QOFA 3Q8AA 3Q8EA 1WGKA 2HDEA 4N59A 1D6EC 2KQ4X 5E6JA 3O13A 3BVMA 1WRIA 3W5VB 3HUIA 1QOBA 2BYTA 1C4CA 4DXGA 2DLBA 5GXGB 1I4GA 2IGGA 3HVDA 2JU6X 1SE4A 1VR9A 2RPVA 5D3IB 4USAA 1BMLC 1F2RI 3P4RB 2H89B 2MEKA 1V1PA 3AEBB 3FC4A 3R2TA 4US8A 4XDCA 5MPOA 2EKIA 4ZHPA 1LO5D 1UGJA 3P4SB 1L4DB 1MI0A 4ZHOA 3CIRB 4YSZB 2BW2A 1NI3A 2WQYB 2AQ3B 2LHEA 3T3NA 1I4XA 4LLGM 2L83A 4A8XC 3VQIA 1GAQB 1GOZA 1T3QA 3AMZA 3E56A 1FNWA 2YEPB 2VZKD 1E6EB 1QILA 3U2SC 1TJEA 3B9JA 1JQ4A 1YMHE 4RF1A 3MC0B 1XO3A 2W55A 2KAJA 4ITKA 2V3NA 1AN8A 3KWVA 3EGRA 1ZPSA 4US9A 1R7SA 1F77A 4L23A 2M19A 2QILA 2X38A 3IT4B 4ARIA 2BS4B 1GPXA 3J9CA 3WCQA 3SEBA 1FFVA 1I7HA 2L1AA 4RGOS 4ZYSA 2N0SB 4O1NA 3TUOA 4HRSA 5D7GA 3KWLA 5HHDG 4HROA 4LTUA 1E10A 1YN4A 4YSXB 4KGTA 1DYQA 3AH7A 4REZA 1PYWD 1QQRA 3RFZB 2JX5A 5LNK1 1CJEA 2FE8A 5C3JB 2LFIA 4HKQA 1SXTA 4A6QA 1JRPA 4YTMB 2KWDA 1K52A 5AUIA 1AYFA 1B1ZA 1C78A 1SF0A 2WNMA 3W1SA 1N63A 3NVZA 2L52A 4XWWA 1L0YB 4OZBA 1ZUD2 5BMHA 2WS3B 3PO0A 2K5PA 4WQMA 1HZ5A 1NEKB 2LEKA 1SE2A 3EA6A 1CQVA 2V0GA 1I4PA 1K50A 3GP7A 1IUEA 1L0VB 2WLBA 4C7YA 3BK1A 1D5XC 4ARCA 4H2AA 2DYMA 2WDRB 4TSSA 2JQRB 1V1PB 1KFYB 2J53A 4OW0A 3AEAB 1D5ZC 4N58A 4KGRA 5HG2A 5BMIA 2I2YA 1KLGD 2V4IB 5D3DA 1L6UA 4NAMA 3ETRA 4A55A 1J7CA 4WAFA 1HZ6A 2QMTA 2DWQA 3U52E 4WURA 4XDDA 3LYYA 1ZDVA 3CWIA 4GLSC 4P6VF 4XWTA 1B9RA 1JWAD 2MJDA 1FIQA 4ZRPA 3IAM1 1KLUD 2RDGA 5EE1A 2R61A 3VRAB 3TEYA 2DBYA 5HFYA 1XEEA 1ENFA 5BMGA 3P4QB 2Y5PA 3T3OA 4JPSA 1SIJA 4AS1A 2RMMA 4ZRQA 1CZPA 2EELA 1WXQA 5TSSA 1ZXIA 5EE0A 2J42A 4RNAA 1C4PA 3AM9A 1KTKA 2PW9A 2GRIA 2NTTA 1J7BA 1I4HA 1WYGA 4L1BA 4MT5A 1DOXA 3Q8CA 1RYJA 2RDHA 4YT0B 1E0ZA 1L5PA 2FUG1 2N7JA 1J7AA 3KQ4A 3MHZA 1XLOA 2B76B 1JALA 1VJKA 2OHFA 2VZKB 2XN9C 1KRHA 4XE0A 2INNE 4WIPA 2MH7A 3Q8FA 4PT5A 2BT6A 3TEWA 3Q8BA 3VRBB 1MPEA 1TS5A 3NRZA 2JSVX 2WXFA 4FXCA 1TY0A 2QJLA 3H8HA 3NVVA 2AQ2B 4RFBA 2ZW0A 1N5WA 2JXTA 3NVYA 1N62A 1STEA 1NENB 2LMCA 2SEBD 2W3SA 4JWSC 1TS3A 1FD6A 2PLPA 1YJJA 1HQRD 3AE2B 3BIID 2IPKD 3BYYB 3ZQ4A 2ACZB 2PMVA 4D2KA 2YEPF 1YQ3B 1P7EA 2DYOA 2KDMA 3BWUD 3ZJVA 3N9YC 2K9XA 3BZDB 4OZAA 2E3TA 2BS2B 5G5GA 1EU3A 3GS2A 4YTPB 3W5UB 1SB3C 2INPE 2WP9B 1Y56A 3AEEB 1SE3A 1PGXA 4JX1C 1QOAA 4TQ1A 3ZJTA 2KMMA 1SBBB 1XXGA 1SEBD 1XCQL 2KN4A 1YQ4B 2J52A 3SFEB 1TKGA 5T8IA 3BVZA 4L2YA 5BYRA 1HEZE 5G5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KFY B;  1VDV A;  1TYG B;  3AEA B;  1FM0 D;  2PKO A;  4N58 A;  3AEC B;  2W54 A;  2WDV B;  3HVZ A;  1L6U A;  1KF6 B;  1XLN A;  3ETR A;  5EE9 A;  4YTN B;  5C2T B;  1DOY A;  1J7C A;  3ABV B;  2DWQ A;  4A9A A;  1FXI A;  1QOF A;  1WGK A;  3CWI A;  2AX5 A;  1NYQ A;  4N59 A;  1JWA D;  1V8C A;  1ROE A;  4P6V F;  2MJD A;  1FIQ A;  2G1E A;  2K22 A;  3VR8 B;  1WRI A;  3W5V B;  1ZP0 B;  3HUI A;  1QOB A;  5EE1 A;  3VRA B;  2MJ3 A;  3P63 A;  2DBY A;  5GXG B;  1NVI D;  3P4Q B;  1SIJ A;  3AE4 B;  3AEG B;  1PDX A;  1XLP A;  2PVG C;  3AE1 B;  1CZP A;  4JWU C;  1QT9 A;  1WXQ A;  1ZXI A;  4USA A;  5EE0 A;  1UWM A;  4C80 A;  3P4R B;  3AM9 A;  1AWD A;  2H89 B;  1TKE A;  3AEB B;  3FC4 A;  1FRD A;  2QIE B;  3AE9 B;  2M56 B;  4US8 A;  1J7B A;  1JWB D;  1QLB B;  1WYG A;  1E9M A;  3AB5 A;  4WWM A;  5G5H A;  2EKI A;  2W3R A;  3LXF A;  3P1M A;  4ZHP A;  3B2G A;  5MPO A;  1DOX A;  1RYJ A;  3P4S B;  4YT0 B;  1E0Z A;  3LB8 C;  1L5P A;  4N6E B;  3VR9 B;  4ZHO A;  3CIR B;  1J7A A;  1TKY A;  4KX6 B;  2WU5 B;  1NI3 A;  2WQY B;  3B2F A;  4YSZ B;  1XLO A;  1XLQ A;  1JW9 D;  2L83 A;  2B76 B;  4IDI A;  1JAL A;  1GAQ B;  1VJK A;  1T3Q A;  2OHF A;  3AMZ A;  1RFK A;  3NS1 A;  1E6E B;  1TJE A;  1YJI A;  1KRH A;  1V97 A;  3NVW A;  3B9J A;  1N61 A;  1A70 A;  2MH7 A;  3DWM A;  3AEF B;  1JQ4 A;  3AN1 A;  1OQR A;  3AED B;  1PUT A;  1FMA D;  3AV8 A;  2BT6 A;  1DOI A;  1XO3 A;  3VRB B;  2W55 A;  3NRZ A;  2KAJ A;  1FFU A;  1RM6 C;  4ITK A;  4US9 A;  2BS3 B;  3EUB 2;  4FXC A;  1R7S A;  3FAH A;  2QJL A;  3NVV A;  2HTM E;  1FXA A;  5H8Y E;  2M19 A;  2PVO D;  2BS4 B;  1N5W A;  1GPX A;  3AE3 B;  2MJE A;  2PIA A;  3AE7 B;  3WCQ A;  1FFV A;  1I7H A;  1E7P B;  1JRO A;  3NVY A;  1N62 A;  2WU2 B;  3P4P B;  2N0S B;  1NEN B;  4HRS A;  1E10 A;  3KWL A;  3SR6 A;  3DWG C;  4HRO A;  2H88 B;  2W3S A;  4LTU A;  1NYR A;  3RPF C;  4JWS C;  4YSX B;  1OFF A;  3AE8 B;  3AH7 A;  1YJJ A;  2JX5 A;  3AE2 B;  3BII D;  1EWY C;  1L6V A;  1CJE A;  2ACZ B;  3ZYY X;  1OQQ A;  2CU3 A;  3AE6 B;  5C3J B;  1YQ3 B;  1JRP A;  4YTM B;  5AUI A;  3AE5 B;  1AYF A;  4YSY B;  1SF0 A;  2K9X A;  1N63 A;  3NVZ A;  2L52 A;  5AUK A;  4ZOH C;  5EE3 A;  2E3T A;  2BS2 B;  1ZOY B;  1PFD A;  1ZUD 2;  5G5G A;  2Q5W D;  2WDQ B;  1N60 A;  2FBW B;  2WS3 B;  3PO0 A;  2K5P A;  4YTP B;  1FRR A;  3W5U B;  1SB3 C;  1NEK B;  2LEK A;  2WP9 B;  4WQM A;  3AEE B;  1QOG A;  4JX1 C;  3SFD B;  4YXD B;  1QOA A;  3L4P A;  2Y5C A;  1WWT A;  1IUE A;  1QF6 A;  1L0V B;  2CJN A;  2KMM A;  2WLB A;  2CJO A;  4C7Y A;  4C7Z A;  1YQ4 B;  5H92 C;  2WDR B;  3SFE B;  1TKG A;  1FO4 A;  1DGJ A;  2JQR B;  1F0Z A;  1B9R A;  1N5X A;  1VLB A;  3HRD D;  3W9C B;  1RWS A; 
#chains in the Genus database with same CATH topology
 2WX1 A;  4RM9 A;  3NS8 A;  3UIO B;  1T6B X;  3PHX B;  4AQ7 A;  3DBS A;  4RGM A;  4UDU C;  3MP9 A;  5C2T B;  4TV3 A;  2MBE A;  3ABV B;  1EUV B;  1WR6 E;  3IFW B;  1GJZ A;  3MHS D;  4KV2 A;  3RNE C;  4B95 A;  5I4D A;  3FKY A;  2G1E A;  2K1F A;  4BZA A;  4M02 A;  4F7Z A;  1XD3 B;  4PS3 A;  1NVI D;  4LCD E;  3APD A;  2PVG C;  3EEC A;  2BWF A;  2M0A A;  2D3A A;  1E5W A;  1RAX A;  1JWB D;  3HIZ A;  3UQA A;  4N6E B;  2XK5 B;  4GXB A;  4LNI A;  4B0M A;  2N9P C;  4M0W A;  5JZE B;  2BB5 A;  1TZ1 A;  5KHQ A;  2KAC A;  1YN5 A;  2WXP A;  4MM3 B;  1VZ6 A;  1M4V A;  1PUT A;  1ET6 A;  4GIV A;  2XNA C;  2NS5 A;  4ANW A;  2BS3 B;  3A4R A;  3ZJU A;  3ZNG C;  3R66 C;  4CQN A;  4RH6 A;  4AOF A;  1Y8R C;  2IBI B;  3VTU A;  5JXV A;  2D5G A;  3L16 A;  1OFF A;  1XF5 L;  3ZW3 A;  2DYB A;  1L6V A;  2WXG A;  1OQQ A;  4XC2 A;  4EE2 A;  3M63 B;  2KVZ A;  1PGB A;  4DHJ D;  4IKG A;  2SAK A;  5HI1 A;  1L4Z B;  3DQV A;  2IZV B;  3EFU A;  2LVQ A;  3VXW A;  2KK8 A;  3JVZ X;  4A90 A;  3RNB C;  1VDV A;  2MP2 B;  2FAZ A;  1I4R A;  1FEH A;  2LGS A;  3HVZ A;  1PQS A;  1VZ8 A;  3URY A;  5G55 A;  2Y3A A;  4HPP A;  3NUH B;  4A3P A;  2QHO A;  2BKR B;  1YX5 B;  3MJ5 A;  3OG5 A;  1ROE A;  4Q2J A;  2ZW1 A;  3DVG Y;  3IAS 1;  4CYE A;  1PGA A;  1C3T A;  2L0F A;  2BB6 A;  1PDX A;  1XLP A;  3E9S A;  1UWM A;  2WXN A;  2QIE B;  1C76 A;  2YVC A;  3AE9 B;  3AB5 A;  4HEA 1;  2L32 A;  2PE6 B;  1GG3 A;  2MBH A;  5D6J B;  4LNO A;  1BXT A;  1TS2 A;  1UZX B;  1ESF A;  5DPW A;  3AEF B;  3HK0 A;  2K0P A;  3Q14 C;  2JZ3 B;  1V5O A;  3CF6 E;  1WRD B;  3WAP A;  4KZ0 A;  2NTS A;  3APF A;  3NZ3 A;  4F8C B;  2LJI A;  3DCG A;  5HKH A;  1UBI A;  1S3S G;  1E8W A;  3SR6 A;  2H88 B;  4W9H A;  5FR3 A;  2WXK A;  3BK2 A;  1EWY C;  4B9K A;  2J7Q B;  4WWN A;  1UWX A;  2LHD A;  1WJ6 A;  3PVL A;  4ZOH C;  1ZOY B;  1PFD A;  2BF8 B;  2D3G A;  2FBW B;  4KDI C;  1R4M I;  1FRR A;  4LNK A;  1M94 A;  1EM7 A;  4YXD B;  2B3A A;  1WXA A;  1FO4 A;  1AW7 A;  1SGH A;  1VLB A;  3HRD D;  1RWS A;  2ON8 A;  3PZ7 A;  1P7F A;  1KF6 B;  4GOC A;  1XLN A;  2KTR B;  1GC6 A;  4GDL B;  4R3D A;  2O2V A;  2KQ4 X;  2JUO A;  3PLU A;  3D32 A;  3BVM A;  5E6J A;  4DDI D;  1WRI A;  3W5V B;  1SE9 A;  2WHI A;  5GXG B;  3VTV A;  2JU6 X;  3DBL I;  4DK5 A;  2D2Q A;  3N30 A;  3UIP B;  1V1P A;  2V4L A;  3AEB B;  3KVF B;  4MGI E;  5E6O A;  5E6P A;  4ZHP A;  2DNF A;  3P4S B;  1Z2M A;  4ZHO A;  3CIR B;  2LHE A;  2L83 A;  2DAJ A;  4P1C C;  1GOZ A;  3AMZ A;  1WGH A;  3E56 A;  2VZK D;  1E6E B;  3U2S C;  1TJE A;  1OTR B;  4KSL C;  1LM8 B;  5DPT A;  2K8B A;  2V3N A;  3EGR A;  1R7S A;  2M1M A;  2QIL A;  2Y5B B;  5EDS A;  2G45 B;  4WQO B;  4RGO S;  1I7H A;  4ZYS A;  2N0S B;  4W9J A;  2DEN B;  4YSX B;  2JX5 A;  4G0N B;  2FE8 A;  3ZXR A;  4A6Q A;  2KWD A;  3ALB A;  1N63 A;  2L52 A;  3WA0 A;  4KVG B;  1ZUD 2;  2WS3 B;  3PO0 A;  3DOW A;  1SE2 A;  2LGD A;  3R7R A;  4BVU C;  1IUE A;  2JZZ A;  2NBV B;  4GU2 A;  1P0R A;  4NJ6 A;  4C7Y A;  1D5X C;  4ARC A;  2DYM A;  5IA7 A;  4P1B C;  4NNJ B;  2V3S A;  4PS8 A;  3ZTD A;  3ZRF A;  1KFY B;  1Z5S B;  2J0M A;  4MGK E;  5BMI A;  1I42 A;  2V4I B;  3H7P B;  1L6U A;  2REX A;  4NAM A;  3VFK A;  2LXC A;  1HZ6 A;  2DWQ A;  3U52 E;  2FNJ B;  3Q2A C;  3LYY A;  2K25 A;  4XWT A;  2LRW A;  2MJD A;  3U7D A;  1UF0 A;  3IAM 1;  4BKT A;  2QCZ A;  2RDG A;  2KFJ A;  2R61 A;  2DBY A;  1XEE A;  1R4M B;  2PE9 A;  1T0R C;  3P4Q B;  1Q5W B;  2G4D B;  5L95 C;  3ZNH B;  2ZVO A;  1X1M A;  3A9K B;  5TSS A;  5EE0 A;  3VDZ A;  1KM7 A;  1U4A A;  1KTK A;  2KYW A;  4ACF A;  2GOW A;  1J7B A;  3UF8 A;  4URK A;  1WYG A;  2Z0D B;  4EFO A;  4YT0 B;  2ZCC A;  1L5P A;  3LDZ E;  3KQ4 A;  1XLO A;  5J2R A;  4LNF A;  1E90 A;  1WZ0 A;  4N9F 4;  2INN E;  2MH7 A;  1K8R B;  2IO3 B;  3HHM A;  3Q8B A;  3VRB B;  3QK0 A;  4FXC A;  3NVV A;  2AQ2 B;  3N32 A;  1V49 A;  2G4S A;  2MRP A;  4BBN F;  2SEB D;  2L05 A;  2XK5 A;  2MBQ A;  4JLC A;  2RR9 A;  4JWS C;  2XBB C;  1YJJ A;  2KWU B;  4K7S A;  3PLV A;  2PMV A;  1YQ3 B;  2ZNV B;  3A1Q B;  4MM3 A;  4FHJ A;  4LJP B;  2BS2 B;  3DBH I;  1EU3 A;  4YTP B;  3X0W A;  1T0Y A;  2AYO B;  2KMM A;  2KN4 A;  1SEB D;  1XCQ L;  5JH5 C;  4PS7 A;  2FCQ A;  4L2Y A;  2VH2 A;  2ZCB A;  4IC7 B;  3RNF C;  1UNS A;  2JWU A;  2EMT A;  1NDD A;  1WXV A;  4HJK A;  2KTF A;  4BAX A;  3TJP A;  3L10 B;  4P16 A;  1VRA B;  4ZRK A;  2PTL A;  1E7V A;  5C23 A;  1TZO A;  4IWQ A;  3AE1 B;  2K6D B;  1AWD A;  4BBN C;  2MP2 A;  2PPH A;  1LQB A;  4I6N B;  1E9M A;  3LXF A;  3VR9 B;  1D4B A;  4ASW C;  3KYD D;  2WU5 B;  4WH4 A;  3LJ3 A;  4S17 A;  2KQ7 A;  2ASQ A;  2IO0 B;  2TSS A;  1A70 A;  2NMQ A;  2KX3 A;  3VH3 B;  1F1H A;  2OOB B;  3RN9 C;  5JHA A;  1GUA B;  1VZ7 A;  4C56 C;  2IJ0 A;  1SJH D;  5H8Y E;  4MH0 E;  1E7P B;  1D3Z A;  4MEM A;  2N7D A;  3IXS A;  4XZ4 A;  4NJC A;  3GE8 C;  3NG0 A;  2BYV E;  5AZF A;  1I4Q A;  3PPA A;  4QAY A;  2KDB A;  3AE5 B;  4E3C A;  3L54 A;  4WWO A;  1H8C A;  1YX6 B;  1N60 A;  2WWZ A;  5IO9 A;  4WJO A;  4BOZ B;  3C0R B;  2D3B A;  1WWT A;  5L83 A;  1HXY D;  4C7Z A;  4FBJ B;  3ZGZ A;  1F0Z A;  4WAA A;  3U7Z A;  1N5X A;  1C79 A;  1XCT L;  1A5R A;  5D94 A;  2LWP A;  3C8Y A;  4J3O D;  3GE3 C;  1C4A A;  1TY2 A;  1FCL A;  1IGD A;  2N9X A;  2AX5 A;  2IGD A;  3TSS A;  3P63 A;  3VUW A;  1XT9 B;  4OZC A;  4LJO B;  1WJU A;  4CHK A;  4X57 B;  3TCA A;  2N9E B;  3L0W B;  2PJH A;  3VVW B;  2ONQ A;  3PRP B;  2I38 A;  2Z8L A;  4HCN B;  2MBO A;  2J0K A;  2GI9 A;  2M8S A;  2W3R A;  3GB1 A;  1UBQ A;  2DZK A;  1WSP A;  2G3Q B;  2KTR A;  3R2I A;  1WYW B;  4GDL A;  3PZ8 A;  3W1S C;  3ML8 A;  1YJI A;  2K8H A;  3APC A;  3KLS X;  4IOI E;  3AN1 A;  4WJN A;  5JHB A;  1VD2 A;  1SIF A;  2GBM A;  3CSF A;  3TEZ A;  2A4Z A;  2JZP A;  3RT3 B;  4DWF A;  4DXF A;  4KSK C;  2HE7 A;  2PIA A;  2N9K A;  1GB1 A;  2WU2 B;  1JWU D;  1E8X A;  1HA5 A;  3DHI C;  1V2Y A;  4IWP A;  2LUM A;  4HWI B;  2BWE S;  2JYT A;  2ZNV C;  3I57 A;  1VCB A;  2WGS A;  2AQ1 B;  3V6E B;  4OHJ A;  1ZW7 A;  4HJG E;  4I6L B;  2KC1 A;  2HD5 B;  5AUK A;  4K1R B;  1KJT A;  2GB1 A;  2L8J A;  2Q5W D;  4ANX A;  1QOG A;  3L4P A;  2ICI A;  2NVU I;  4J6I A;  1V86 A;  2N1V A;  3SDL C;  3QHT A;  3K9O B;  3OAW A;  4FA6 A;  1CMX B;  3DVN U;  4HDQ A;  4YTN B;  5EE9 A;  1OQY A;  4NPN A;  4YWG G;  2BYF A;  1NBF C;  2VRR B;  1E7U A;  4II2 B;  3Q8E A;  1KLV A;  2HDE A;  4HLE A;  4N59 A;  3QJZ A;  2QC8 A;  1C4C A;  1MG8 A;  2IGG A;  2HJ1 A;  2KWC A;  3HVD A;  1EF1 A;  5CTR C;  2RPV A;  5D3I B;  4USA A;  2ZJD A;  1BML C;  1F2R I;  4RM8 A;  2AL3 A;  2MEK A;  3R2T A;  1F52 A;  4XYC A;  2RSU A;  4MGY E;  4XDC A;  4HVB A;  4IM3 A;  2EKI A;  3UGB B;  4HDO A;  4M01 A;  3H7P A;  4E74 A;  2KMA A;  4WJQ A;  2YLM A;  3T3N A;  1TIF A;  4LLG M;  3EC8 A;  3VQI A;  1LGR A;  4W9F A;  1T3Q A;  2YEP B;  1WFY A;  2JF5 A;  1YMH E;  1WXS A;  5D2M B;  4JL9 A;  2BYE A;  1XO3 A;  3PRM B;  3ZXV A;  4EZK A;  3A4S C;  2KAJ A;  5CHV C;  3A9K A;  5E6N A;  5AEK B;  4NQK E;  4L23 A;  2X38 A;  4ARI A;  2BS4 B;  1GPX A;  3WCQ A;  3ZO5 B;  2L1A A;  2MCN B;  3ZKJ C;  3TUO A;  4HRS A;  5HHD G;  3KWL A;  4HRO A;  4KGT A;  3AH7 A;  2GBJ A;  1WX7 A;  3QA8 A;  1SXT A;  1JRP A;  2KLG A;  2AEH A;  5AUI A;  2KN5 A;  1C78 A;  1SF0 A;  3NJT A;  4WWP A;  3W1S A;  2W9N A;  3OJ3 A;  1EF5 A;  2K5P A;  1NEK B;  2LEK A;  1CQV A;  1I4P A;  3GP7 A;  1J8C A;  1GC7 A;  3ONS A;  3BK1 A;  3ZIM A;  4H2A A;  4LDT D;  4N58 A;  4KGR A;  2BPS A;  2I2Y A;  3UQB A;  1KLG D;  3ZLZ A;  1Q1O A;  3A1Q A;  4WUR A;  3WIM A;  4XDD A;  1ZDV A;  4C00 A;  1B9R A;  4BOS C;  4M8M A;  3ML9 A;  3VRA B;  1E8Y A;  5BMG A;  1WF9 A;  4JPS A;  1SIJ A;  4GB9 A;  1QZE A;  3VUY A;  4ZRQ A;  1WGR A;  1WXQ A;  4DXA B;  4RNA A;  2GRI A;  4HK2 A;  3Q8C A;  1DOX A;  4AUQ C;  2Z59 B;  2FCS A;  2MW5 A;  2B76 B;  1JAL A;  2KLC A;  1VJK A;  2OHF A;  3RUL A;  3WAO A;  1KRH A;  2KZR A;  1RRB A;  4WIP A;  3TIX A;  2JT4 B;  4K81 A;  3KUC B;  2CHX A;  1WXM A;  2BT6 A;  1MPE A;  1TS5 A;  4G3X B;  3IG3 A;  1V6E A;  2WXF A;  1TY0 A;  2KQS A;  2MSE D;  4IUM B;  1GNU A;  4MGZ E;  1N5W A;  1T0S C;  1RLF A;  2NBU A;  3ZDM C;  2NR2 A;  4RMA A;  1YJ1 A;  1WZ3 A;  4AJW A;  3AE2 B;  1G6J A;  2IPK D;  3WAL A;  3ZQ4 A;  3I5J C;  2YEP F;  2KDM A;  3BWU D;  3ZJV A;  2GBN A;  4HXD A;  4IW0 A;  2E3T A;  5G5G A;  3SU8 X;  3GS2 A;  3W5U B;  2INP E;  2FIF A;  3AEE B;  1SE3 A;  3AUL A;  4PYU A;  2NPT B;  1QOA A;  1WI0 A;  2J52 A;  1TKG A;  3N1Y C;  3CMM B;  3BVZ A;  5BYR A;  1HEZ E;  3RZW C;  2PKO A;  2EMS A;  2WXL A;  2W54 A;  2WXQ A;  1L2N A;  1D5M C;  3VH4 B;  2DAF A;  2KHW B;  1FCC C;  4GN1 A;  2KJ6 A;  1V5T A;  3QAR A;  5AZG A;  4YL8 A;  4FLH A;  3VR8 B;  2VH1 A;  1ZP0 B;  2UU7 A;  4BKS D;  1MFW A;  1Q10 A;  1L0X B;  5KHO A;  3OJ4 B;  2GLS A;  2LXA A;  4B6W A;  4HCP B;  3NOB A;  1TKE A;  3H7S A;  3Q6B A;  1FRD A;  1K51 A;  4WWM A;  1WGG A;  2IDY A;  2JPH A;  3P1M A;  2LZ6 A;  2C7N B;  4M00 A;  1GB4 A;  2DX5 B;  5IKC M;  1FPY A;  2MWS B;  3DDC B;  3NS1 A;  3W2D A;  4BKS A;  2D11 A;  1OQR A;  1MVK A;  2QEJ C;  1FXT B;  1S1Q B;  4DQO C;  2K39 A;  4RCO A;  4NJ7 A;  4W9G A;  3FAH A;  2KVR A;  1FXA A;  2PVO D;  3AI5 A;  3Q69 A;  4TMA B;  3AE7 B;  3MJW A;  2O6V B;  2WXO A;  2CU3 A;  3K9P B;  2E6X A;  4YSY B;  4MSM B;  2BTE A;  1ACC A;  4MAC A;  3SFD B;  1QF6 A;  2D3C A;  2CJO A;  3RNG C;  3JYU A;  5H92 C;  3P42 A;  2I1K A;  1TTN A;  2LGI A;  3BY4 B;  4EUT A;  4MH8 A;  2OED A;  3A9J B;  3U30 A;  5FK9 C;  1V1O A;  1I35 A;  3RNC C;  3FIL B;  3BVG A;  2K22 A;  2NCN A;  2BBC A;  4NAW B;  3UI3 A;  1KOT A;  2ZVN A;  2CKH B;  3TEX A;  2K6Q A;  3EHV A;  2R2O A;  4IM0 A;  2J4X A;  2KJH B;  2M56 B;  1EWC A;  1V80 A;  1TT5 B;  3LB8 C;  4ZRJ A;  1UGM A;  1XLQ A;  4KKJ A;  4JE3 B;  2KX0 A;  3DWM A;  3DBR B;  2DZM A;  1WX9 A;  5DPS A;  3AV8 A;  1WGD A;  1YD8 U;  2CS4 A;  2WXR A;  1FFU A;  1RM6 C;  1C77 A;  1F2R C;  4C4V B;  1IBX B;  3PRE A;  2MJE A;  1RFA A;  1HE8 A;  4RF0 A;  3PTF C;  3Q3M C;  3RYT A;  2CHZ A;  5IN7 A;  2DHZ A;  1NYR A;  2LI5 A;  1FNU A;  1WMH B;  5AZH A;  3PT2 B;  2G9H D;  1ZKH A;  3AE6 B;  3ZUN A;  1UUP A;  3WAN A;  4G11 A;  1JWS D;  5BO4 B;  3IT6 B;  2BKF A;  2KAN A;  2RD0 A;  4GMV A;  2KNB A;  1UEL A;  2Y5C A;  4ICV A;  2ZZP B;  3N20 C;  3Q3F A;  3TL5 A;  3L17 A;  4W9C A;  3AE8 B;  1T5X D;  3OLM D;  3HM6 X;  2I1J A;  4OVZ A;  4F1S A;  2WDV B;  4ICU A;  1ZE3 D;  1DOY A;  1WGY A;  4DDG D;  2JVC A;  2WXI A;  2QSD A;  1ET9 A;  1FXI A;  2LVO A;  3Q8A A;  1D6E C;  3CST A;  3A33 B;  3HUI A;  1QOB A;  4A20 A;  2BYT A;  4DXG A;  1J19 A;  2DLB A;  4ANV A;  1I4G A;  4TUU A;  1SE4 A;  2AWT A;  2EKE C;  2MBB B;  2L0T A;  2CHW A;  3P4R B;  2H89 B;  3FC4 A;  2R2Q A;  2V9H A;  4US8 A;  5C1Z A;  2KWV B;  3TBL D;  5MPO A;  1LO5 D;  4AJY B;  1L4D B;  1MI0 A;  3PV1 A;  1NI3 A;  2AQ3 B;  4A8X C;  2WYQ A;  1GAQ B;  3B1L X;  2LVP A;  3GOE A;  1FNW A;  2ZPY A;  1L7Y A;  4OVV A;  1JQ4 A;  3M62 B;  2L00 B;  3VHT C;  4RF1 A;  4II3 B;  2W55 A;  4ITK A;  3KWV A;  2KDI A;  1ZPS A;  3ZDT A;  3PHW B;  3IT4 B;  5GMV A;  3GZN B;  3WAM A;  3RZF A;  3J9C A;  3SEB A;  1FFV A;  2KT7 A;  4XX5 A;  3MC9 A;  3U8Z A;  2KMC A;  3NY5 A;  2CR5 A;  1YN4 A;  3H1U A;  1QQR A;  1WE7 A;  3RFZ B;  5LNK 1;  5TR5 A;  1CJE A;  2PEA A;  3RD2 A;  5C3J B;  2DZI A;  3IVF A;  2A5U A;  5DPR A;  1B1Z A;  3N1X C;  5BMH A;  3EFC A;  4WQM A;  3EA6 A;  1K50 A;  1L0V B;  2WLB A;  5LXI B;  4TSS A;  2INC C;  3QWZ B;  3AEA B;  1D5Z C;  5HG2 A;  4EEW A;  3KW5 B;  5D3D A;  4MJS B;  3ETR A;  4A55 A;  4PYZ A;  1J7C A;  1R4N B;  2QMT A;  4ANU A;  3Q3J A;  3PRZ A;  1UD7 A;  2JRH A;  4G50 A;  2C7M B;  1JWA D;  2MLB A;  3UIN B;  2KO3 A;  3JSV B;  3V60 A;  3N3K B;  4FUL A;  5EE1 A;  3B08 A;  3TEY A;  2NPT A;  2Y5P A;  3T3O A;  2RMM A;  2MX2 A;  4KZC A;  3B0A A;  2EEL A;  3ZNI D;  3AM9 A;  1MG4 A;  3T9L A;  2NTT A;  1I4H A;  2KFK B;  1IPG A;  4L1B A;  4MT5 A;  1RYJ A;  2RDH A;  1E0Z A;  2N7J A;  1LXD A;  1J7A A;  3DVG X;  3MHZ A;  1EO6 A;  1YIW A;  3O65 B;  3RI7 C;  4TKN A;  1BT0 A;  4XE0 A;  3IBE A;  4BKG A;  3TEW A;  1WJN A;  3NRZ A;  1C1Y B;  3I3T B;  3KH0 A;  3DHG C;  1STE A;  1NEN B;  4IG7 B;  2UYZ B;  2W3S A;  1FD6 A;  1HQR D;  3BII D;  3ECI A;  2ACZ B;  2O6V D;  3Q3O C;  1P7E A;  2DYO A;  2K9X A;  3BZD B;  4IWO A;  4OVU A;  5CHW A;  3NZS A;  3KUZ A;  2WP9 B;  5J18 A;  1F9J A;  4JX1 C;  2MHJ A;  4FAD A;  1E8Z A;  2WX0 A;  4JQW C;  1SBB B;  1XXG A;  1YQ4 B;  3C19 A;  3SFE B;  3QAQ A;  1OGW A;  2C5L C;  4A3O A;  5G5H A;  1TYG B;  1P98 A;  1FNV A;  3L13 A;  1ZXH A;  5BYS A;  2O6V A;  3OWE B;  3QX1 A;  3ENE A;  1WE6 A;  3VAW A;  1AAR A;  2HTH A;  2RPQ A;  1MHX A;  1WR1 A;  1C9F A;  1UH6 A;  3V3X A;  2MJ3 A;  1OEY A;  3AE4 B;  3M95 A;  3AEG B;  5G2N A;  1JRU A;  3VTW A;  1QT9 A;  2ZEQ A;  1IYF A;  1YN3 A;  1BUI C;  3B2G A;  3RCZ A;  1TGZ B;  3A9J A;  1TKY A;  4GDK B;  4IDI A;  1RFK A;  4KIK B;  4HPM B;  3FIL A;  1V97 A;  2N7E A;  4NAW A;  2IO1 B;  2LAS A;  1CK1 A;  3I63 C;  5FKA C;  1DOI A;  4W9K A;  4JIO U;  3ZNZ B;  4FJZ A;  2N9L A;  2WXH A;  4XGA B;  5CHF A;  2W82 A;  4AWJ A;  2Z0E B;  3AE3 B;  1TS4 A;  3ZRC A;  1JRO A;  3P4P B;  2GBR A;  3I9V 1;  1HTO A;  3DWG C;  5DCN A;  3R8B A;  2HJ8 A;  3ZYY X;  2C9W B;  3X23 A;  2NBW B;  3V05 A;  4CO7 A;  2QDF A;  2WDQ B;  2M4N A;  4M8N A;  2JYE A;  3H6N A;  1MJD A;  4FN2 A;  3BYT B;  2IGH A;  2JWZ A;  2CJN A;  3DPD A;  4C4V A;  1IBX A;  1JML A;  2MA9 B;  3MTN B;  3W9C B;  4MSQ B;  4RGT A;  2KKC A;  3KUD B;  4W9D A;  5BYQ A;  1WMH A;  3Q3N C;  2L76 A;  4EKU A;  1YNT E;  2V3P A;  4A9A A;  4M0W B;  4TQ0 A;  2KDF B;  1QKZ A;  3RUI B;  4HKZ E;  1NYQ A;  2K3U A;  1V8C A;  2LGX A;  1SSN A;  2BVC A;  4ZDV A;  2JY6 A;  2BQQ A;  4E71 A;  3NHE B;  1XQQ A;  1JWM D;  4JWU C;  4KKI A;  4C80 A;  1SJE D;  1KH0 A;  3RMK C;  2KD0 A;  1QLB B;  3IHP C;  1MHH E;  1JCK B;  3V61 A;  4KX6 B;  3B2F A;  3DBR I;  4ZYN A;  1JW9 D;  2WXJ A;  1IGC A;  4FJV B;  3U4E G;  4LK0 M;  4RGN A;  1EU4 A;  3NVW A;  3RNA C;  1IP9 A;  1N61 A;  2M17 A;  3AED B;  1FMA D;  2GBK A;  2LJ5 A;  3EUB 2;  1HTQ A;  1P1A A;  2HTM E;  2JXX A;  2OJR A;  4ZRI A;  1ZDX A;  4NZL B;  5CX3 A;  1K53 A;  3N1Z C;  3RPF C;  2FCM A;  4B0E A;  3QCA A;  1YOV B;  2IO2 B;  2IND C;  2KC2 A;  2KJR A;  5IAA C;  5EE3 A;  4DHJ B;  5FR6 A;  4EZJ A;  1ZGU B;  4NY0 A;  1NI2 A;  2FCN A;  4EOY A;  1WIA A;  2JRI B;  2X8X X;  4KGS A;  2FID A;  1DGJ A;  1WM3 A;  3MFG A;  2GMI C;  2WXM A;  2IYD B;  5J17 A;  1FM0 D;  3AEC B;  1WX8 A;  1QOF A;  4PK1 A;  1WGK A;  4GGQ A;  3O13 A;  3P2B A;  2MQJ A;  1WH3 A;  4FJY A;  4K3B A;  2XEW A;  2D07 B;  1VR9 A;  4JGH B;  4W9I A;  3PZD A;  3H9D A;  4MEL A;  2J0J A;  1N6Z A;  3DBL B;  2IY1 B;  1UGJ A;  4YSZ B;  2BW2 A;  4MJS A;  2WQY B;  1I4X A;  4KDL B;  1QIL A;  3JSV A;  3B9J A;  2D10 A;  4MDK E;  1P9D U;  2FUH B;  2N4F A;  3TMP B;  3GZN I;  3MC0 B;  3PGE A;  1AN8 A;  4US9 A;  3KYC D;  1F77 A;  4W9E A;  2OJW A;  1WM2 A;  2M19 A;  1WJ4 A;  2LGY A;  2LD9 A;  4P7I A;  2KFK A;  2ZPN A;  4I6P A;  4O1N A;  2C60 A;  2RGF A;  3SD5 A;  4LDT B;  5D7G A;  1E10 A;  4LTU A;  1TBE A;  1DYQ A;  4REZ A;  1PYW D;  3QC8 B;  3ZTC A;  2N1W A;  2LFI A;  4HKQ A;  4YTM B;  4NQL B;  1K52 A;  1LFD A;  1AYF A;  4LNN A;  2WNM A;  2O2V B;  4XWW A;  3NVZ A;  1T0Q C;  4K7U A;  2IY0 B;  1L0Y B;  4OZB A;  3W1Y A;  3QQ8 B;  1HZ5 A;  2V0G A;  1H4R A;  4EZL A;  2LRU A;  3AXC A;  3AU4 A;  2WDR B;  2JQR B;  4FHK A;  3JW0 X;  1V1P B;  2J53 A;  1R4N I;  4OW0 A;  1Q0W B;  3DHH C;  3HM3 A;  4WAF A;  3NZU A;  3QIJ A;  3BIN A;  3CWI A;  3PSE B;  4GLS C;  4P6V F;  4IM2 A;  4BFR A;  2KXJ A;  1FIQ A;  4ZRP A;  2UWQ A;  1KLU D;  3VUX A;  5HFY A;  1ENF A;  4AS1 A;  2AL6 A;  2LUE A;  1J0G A;  1CZP A;  1ZXI A;  2J42 A;  4W9L A;  1C4P A;  3V6C B;  2PW9 A;  4DBG A;  2L7R A;  1YQB A;  2V1Y A;  1V9J A;  4S0R A;  3S2A A;  2FUG 1;  2WDT B;  4GSW A;  4DHZ E;  5IP4 D;  2VZK B;  2M0X A;  2XN9 C;  2L3Z A;  4K3C A;  3Q8F A;  4HPL B;  4PT5 A;  3T8M A;  4K7W A;  1ISN A;  2CU1 A;  3DVN V;  4WJP A;  2JSV X;  2QJL A;  3H8H A;  5LXH A;  3SHQ A;  3MC8 A;  4RFB A;  2ZW0 A;  3R7Q A;  2BGF A;  2JXT A;  3NVY A;  1N62 A;  3PS6 A;  4AP4 C;  2LMC A;  3V62 A;  5IOI A;  2C7H A;  4GDK A;  1TS3 A;  2PLP A;  2RDB C;  3BYY B;  4KIK A;  4DHZ B;  4D2K A;  2K8C A;  2DZJ A;  3N9Y C;  3L08 A;  1WY8 A;  4OZA A;  5LLI A;  3ZVV A;  1SB3 C;  1Y56 A;  1PGX A;  2KDE B;  4TQ1 A;  3ZJT A;  1V81 A;  3AU5 A;  3DBH B;  3M3J A;  3R3M A;  1P3Q U;  5T8I A;  2KOX A;  1OEY J; 
#chains in the Genus database with same CATH homology
 1TYG B;  2PKO A;  2WXL A;  1T6B X;  2W54 A;  1FNV A;  2WXQ A;  1ZXH A;  5BYS A;  1UNS A;  1D5M C;  2JWU A;  3OWE B;  4AQ7 A;  1FCC C;  4RGM A;  4UDU C;  3MP9 A;  5C2T B;  3ABV B;  5I4D A;  4P16 A;  1MHX A;  2G1E A;  1VRA B;  3VR8 B;  1C9F A;  1ZP0 B;  3V3X A;  2MJ3 A;  2PTL A;  1Q10 A;  1L0X B;  1NVI D;  3AE4 B;  3AEG B;  2PVG C;  1TZO A;  3AE1 B;  1QT9 A;  2M0A A;  1AWD A;  1YN3 A;  1TKE A;  1FRD A;  1K51 A;  1BUI C;  1JWB D;  4WWM A;  1E9M A;  2IDY A;  3LXF A;  3P1M A;  3B2G A;  4N6E B;  3VR9 B;  1D4B A;  1GB4 A;  1TKY A;  2WU5 B;  4WH4 A;  4GDK B;  4B0M A;  4IDI A;  4M0W A;  1RFK A;  3NS1 A;  2BB5 A;  3FIL A;  1V97 A;  2KAC A;  3W2D A;  2TSS A;  1YN5 A;  2WXP A;  4MM3 B;  1A70 A;  1VZ6 A;  2NMQ A;  1M4V A;  1CK1 A;  1OQR A;  5FKA C;  1MVK A;  1PUT A;  1ET6 A;  2QEJ C;  2XNA C;  1DOI A;  2N9L A;  4DQO C;  2BS3 B;  1VZ7 A;  4C56 C;  4RCO A;  2IJ0 A;  2WXH A;  3ZJU A;  3FAH A;  1SJH D;  5H8Y E;  1FXA A;  2PVO D;  2W82 A;  3Q69 A;  3AE3 B;  1TS4 A;  3AE7 B;  4RH6 A;  4TMA B;  4CQN A;  1E7P B;  1JRO A;  3P4P B;  3I9V 1;  5JXV A;  2D5G A;  3DWG C;  3IXS A;  3R8B A;  4NJC A;  1OFF A;  1XF5 L;  1L6V A;  1I4Q A;  2WXO A;  2WXG A;  3ZYY X;  1OQQ A;  2CU3 A;  3V05 A;  3AE5 B;  2E6X A;  4YSY B;  4EE2 A;  1PGB A;  2WDQ B;  1N60 A;  2BTE A;  1ACC A;  2JYE A;  2SAK A;  4IKG A;  4MAC A;  5HI1 A;  1L4Z B;  3BYT B;  2IGH A;  3SFD B;  1WWT A;  1QF6 A;  2CJN A;  2CJO A;  1IBX A;  1HXY D;  1JML A;  4C7Z A;  5H92 C;  3P42 A;  3ZGZ A;  1F0Z A;  3U7Z A;  4A90 A;  1N5X A;  3W9C B;  1C79 A;  2LGI A;  4RGT A;  1XCT L;  1VDV A;  1I4R A;  4MH8 A;  5BYQ A;  1FEH A;  2OED A;  3HVZ A;  4J3O D;  3C8Y A;  1VZ8 A;  3URY A;  5FK9 C;  1C4A A;  1V1O A;  1TY2 A;  2Y3A A;  1FCL A;  1YNT E;  2V3P A;  1IGD A;  3NUH B;  4A9A A;  4TQ0 A;  1QKZ A;  4HKZ E;  3FIL B;  2AX5 A;  1NYQ A;  2K3U A;  1V8C A;  3MJ5 A;  1ROE A;  3BVG A;  2K22 A;  4Q2J A;  2BBC A;  2IGD A;  4NAW B;  1SSN A;  3TSS A;  2ZW1 A;  3IAS 1;  3P63 A;  3UI3 A;  1PGA A;  4OZC A;  2BB6 A;  1PDX A;  1XLP A;  3TEX A;  1JWM D;  4JWU C;  3E9S A;  4KKI A;  1UWM A;  4C80 A;  2ONQ A;  2I38 A;  2J4X A;  1SJE D;  2WXN A;  1KH0 A;  2Z8L A;  2QIE B;  1C76 A;  3AE9 B;  2M56 B;  2GI9 A;  1QLB B;  3AB5 A;  4HEA 1;  1EWC A;  2W3R A;  2L32 A;  3GB1 A;  1MHH E;  1WSP A;  3LB8 C;  1JCK B;  4KX6 B;  3B2F A;  3R2I A;  1BXT A;  1XLQ A;  1JW9 D;  2WXJ A;  3PZ8 A;  1IGC A;  1TS2 A;  3U4E G;  4KKJ A;  4LK0 M;  4RGN A;  1EU4 A;  1ESF A;  1YJI A;  3NVW A;  4JE3 B;  1N61 A;  3DWM A;  3KLS X;  4IOI E;  3AEF B;  3AN1 A;  3AED B;  2K0P A;  1FMA D;  3AV8 A;  2WXR A;  1FFU A;  1RM6 C;  1C77 A;  3EUB 2;  1F2R C;  3TEZ A;  2NTS A;  3NZ3 A;  2JZP A;  2HTM E;  4DXF A;  1IBX B;  1ZDX A;  2MJE A;  2PIA A;  2LJI A;  2N9K A;  4NZL B;  1GB1 A;  4RF0 A;  2WU2 B;  1JWU D;  1HA5 A;  1K53 A;  3SR6 A;  2H88 B;  2LUM A;  1NYR A;  3RPF C;  5FR3 A;  2WXK A;  1FNU A;  2JYT A;  3I57 A;  3BK2 A;  1EWY C;  2AQ1 B;  4B0E A;  4OHJ A;  2G9H D;  4HJG E;  3AE6 B;  1UWX A;  2LHD A;  1UUP A;  5AUK A;  4ZOH C;  5EE3 A;  1ZOY B;  1PFD A;  2GB1 A;  2Q5W D;  1JWS D;  2FBW B;  1FRR A;  3IT6 B;  1EM7 A;  1QOG A;  4YXD B;  3L4P A;  2Y5C A;  2ICI A;  4KGS A;  1FO4 A;  1AW7 A;  1DGJ A;  3MFG A;  1VLB A;  3AE8 B;  3HRD D;  1T5X D;  1RWS A;  2WXM A;  1FM0 D;  4OVZ A;  3AEC B;  2ON8 A;  3PZ7 A;  2WDV B;  1P7F A;  1ZE3 D;  1KF6 B;  1XLN A;  1DOY A;  5EE9 A;  4YTN B;  4GDL B;  4YWG G;  2WXI A;  2QSD A;  4R3D A;  1ET9 A;  1FXI A;  1QOF A;  3Q8A A;  3Q8E A;  1WGK A;  2HDE A;  4N59 A;  1D6E C;  2KQ4 X;  5E6J A;  3O13 A;  3BVM A;  1WRI A;  3W5V B;  3HUI A;  1QOB A;  2BYT A;  1C4C A;  4DXG A;  2DLB A;  5GXG B;  1I4G A;  2IGG A;  3HVD A;  2JU6 X;  1SE4 A;  1VR9 A;  2RPV A;  5D3I B;  4USA A;  1BML C;  1F2R I;  3P4R B;  2H89 B;  2MEK A;  1V1P A;  3AEB B;  3FC4 A;  3R2T A;  4US8 A;  4XDC A;  5MPO A;  2EKI A;  4ZHP A;  1LO5 D;  1UGJ A;  3P4S B;  1L4D B;  1MI0 A;  4ZHO A;  3CIR B;  4YSZ B;  2BW2 A;  1NI3 A;  2WQY B;  2AQ3 B;  2LHE A;  3T3N A;  1I4X A;  4LLG M;  2L83 A;  4A8X C;  3VQI A;  1GAQ B;  1GOZ A;  1T3Q A;  3AMZ A;  3E56 A;  1FNW A;  2YEP B;  2VZK D;  1E6E B;  1QIL A;  3U2S C;  1TJE A;  3B9J A;  1JQ4 A;  1YMH E;  4RF1 A;  3MC0 B;  1XO3 A;  2W55 A;  2KAJ A;  4ITK A;  2V3N A;  1AN8 A;  3KWV A;  3EGR A;  1ZPS A;  4US9 A;  1R7S A;  1F77 A;  4L23 A;  2M19 A;  2QIL A;  2X38 A;  3IT4 B;  4ARI A;  2BS4 B;  1GPX A;  3J9C A;  3WCQ A;  3SEB A;  1FFV A;  1I7H A;  2L1A A;  4RGO S;  4ZYS A;  2N0S B;  4O1N A;  3TUO A;  4HRS A;  5D7G A;  3KWL A;  5HHD G;  4HRO A;  4LTU A;  1E10 A;  1YN4 A;  4YSX B;  4KGT A;  1DYQ A;  3AH7 A;  4REZ A;  1PYW D;  1QQR A;  3RFZ B;  2JX5 A;  5LNK 1;  1CJE A;  2FE8 A;  5C3J B;  2LFI A;  4HKQ A;  1SXT A;  4A6Q A;  1JRP A;  4YTM B;  2KWD A;  1K52 A;  5AUI A;  1AYF A;  1B1Z A;  1C78 A;  1SF0 A;  2WNM A;  3W1S A;  1N63 A;  3NVZ A;  2L52 A;  4XWW A;  1L0Y B;  4OZB A;  1ZUD 2;  5BMH A;  2WS3 B;  3PO0 A;  2K5P A;  4WQM A;  1HZ5 A;  1NEK B;  2LEK A;  1SE2 A;  3EA6 A;  1CQV A;  2V0G A;  1I4P A;  1K50 A;  3GP7 A;  1IUE A;  1L0V B;  2WLB A;  4C7Y A;  3BK1 A;  1D5X C;  4ARC A;  4H2A A;  2DYM A;  2WDR B;  4TSS A;  2JQR B;  1V1P B;  1KFY B;  2J53 A;  4OW0 A;  3AEA B;  1D5Z C;  4N58 A;  4KGR A;  5HG2 A;  5BMI A;  2I2Y A;  1KLG D;  2V4I B;  5D3D A;  1L6U A;  4NAM A;  3ETR A;  4A55 A;  1J7C A;  4WAF A;  1HZ6 A;  2QMT A;  2DWQ A;  3U52 E;  4WUR A;  4XDD A;  3LYY A;  1ZDV A;  3CWI A;  4GLS C;  4P6V F;  4XWT A;  1B9R A;  1JWA D;  2MJD A;  1FIQ A;  4ZRP A;  3IAM 1;  1KLU D;  2RDG A;  5EE1 A;  2R61 A;  3VRA B;  3TEY A;  2DBY A;  5HFY A;  1XEE A;  1ENF A;  5BMG A;  3P4Q B;  2Y5P A;  3T3O A;  4JPS A;  1SIJ A;  4AS1 A;  2RMM A;  4ZRQ A;  1CZP A;  2EEL A;  1WXQ A;  5TSS A;  1ZXI A;  5EE0 A;  2J42 A;  4RNA A;  1C4P A;  3AM9 A;  1KTK A;  2PW9 A;  2GRI A;  2NTT A;  1J7B A;  1I4H A;  1WYG A;  4L1B A;  4MT5 A;  1DOX A;  3Q8C A;  1RYJ A;  2RDH A;  4YT0 B;  1E0Z A;  1L5P A;  2FUG 1;  2N7J A;  1J7A A;  3KQ4 A;  3MHZ A;  1XLO A;  2B76 B;  1JAL A;  1VJK A;  2OHF A;  2VZK B;  2XN9 C;  1KRH A;  4XE0 A;  2INN E;  4WIP A;  2MH7 A;  3Q8F A;  4PT5 A;  2BT6 A;  3TEW A;  3Q8B A;  3VRB B;  1MPE A;  1TS5 A;  3NRZ A;  2JSV X;  2WXF A;  4FXC A;  1TY0 A;  2QJL A;  3H8H A;  3NVV A;  2AQ2 B;  4RFB A;  2ZW0 A;  1N5W A;  2JXT A;  3NVY A;  1N62 A;  1STE A;  1NEN B;  2LMC A;  2SEB D;  2W3S A;  4JWS C;  1TS3 A;  1FD6 A;  2PLP A;  1YJJ A;  1HQR D;  3AE2 B;  3BII D;  2IPK D;  3BYY B;  3ZQ4 A;  2ACZ B;  2PMV A;  4D2K A;  2YEP F;  1YQ3 B;  1P7E A;  2DYO A;  2KDM A;  3BWU D;  3ZJV A;  3N9Y C;  2K9X A;  3BZD B;  4OZA A;  2E3T A;  2BS2 B;  5G5G A;  1EU3 A;  3GS2 A;  4YTP B;  3W5U B;  1SB3 C;  2INP E;  2WP9 B;  1Y56 A;  3AEE B;  1SE3 A;  1PGX A;  4JX1 C;  1QOA A;  4TQ1 A;  3ZJT A;  2KMM A;  1SBB B;  1XXG A;  1SEB D;  1XCQ L;  2KN4 A;  1YQ4 B;  2J52 A;  3SFE B;  1TKG A;  5T8I A;  3BVZ A;  4L2Y A;  5BYR A;  1HEZ E;  5G5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...