2LEKA

Solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiamin biosynthesis ThiS
publication title Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325
rcsb
source organism Rhodopseudomonas palustris
molecule tags Biosynthetic protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lekA00
4LTUA 3AE9B 1FM0D 4ITKA 1JRPA 1N63A 1B9RA 2H88B 1DGJA 3LB8C 2OHFA 1EWYC 3B2GA 3NVWA 1ZOYB 3HRDD 1YQ4B 2PKOA 1OQQA 1PUTA 3DWGC 3VR9B 2BT6A 2QJLA 1XLOA 5C3JB 1E0ZA 1NI3A 1L6UA 1VLBA 4YT0B 1WXQA 1XLPA 1DOIA 1KRHA 3B2FA 3NVVA 1DOYA 2AX5A 4HRSA 5H92C 3AE1B 1AWDA 2CU3A 3NS1A 1V8CA 1E7PB 3CIRB 4IDIA 1SB3C 2W3RA 4JWUC 3SFEB 1PFDA 1A70A 1OFFA 1TKYA 1NYRA 4KX6B 1J7AA 3ZYYX 2WDQB 1QF6A 1I7HA 1E9MA 2LEKA 4FXCA 3AE5B 3AE6B 1FMAD 3P1MA 3AE3B 1SF0A 1RWSA 1JWBD 2E3TA 4JX1C 1TYGB 2MJEA 1JROA 1N5XA 3AEGB 1QOBA 1F0ZA 2Q5WD 2W55A 2G1EA 1TKEA 1NYQA 1ROEA 5G5HA 1E10A 4YTPB 3NRZA 1YQ3B 4N59A 4N6EB 1ZXIA 4YSXB 4US8A 5EE9A 1WYGA 3B9JA 2BS2B 4C7ZA 1T3QA 2FBWB 1XLNA 1L0VB 2WS3B 1JW9D 1N5WA 2DWQA 3HVZA 1XLQA 4YSYB 2M56B 3L4PA 5AUIA 1JWAD 1OQRA 2QIEB 2WU5B 1NVID 2CJNA 1QOFA 1WRIA 2W3SA 1AYFA 1J7BA 3P4QB 1QOGA 1SIJA 1KF6B 2L52A 1FFVA 2MJDA 2BS3B 1NENB 3AEEB 3SFDB 5EE0A 3FAHA 1IUEA 1QLBB 2L83A 2PVOD 2WU2B 3AEFB 5G5GA 2B76B 2M19A 1YJIA 2BS4B 2HTME 3NVZA 3P63A 1FRDA 5EE3A 1RM6C 3P4PB 2WQYB 1YJJA 4WQMA 1CZPA 4A9AA 2MJ3A 1GAQB 5EE1A 4WWMA 1QOAA 3DWMA 4HROA 1N60A 3BIID 3VRAB 4C7YA 4ZHPA 2ACZB 2WLBA 3ETRA 3ABVB 3AEDB 3AECB 1WWTA 3P4SB 1N62A 1L5PA 2KAJA 1J7CA 3AB5A 1E6EB 1VJKA 2N0SB 1FXIA 2K9XA 3EUB2 3FC4A 1R7SA 3LXFA 1TJEA 4YSZB 2EKIA 3NVYA 3AM9A 1ZUD2 3KWLA 2JQRB 3AH7A 5GXGB 1NEKB 3VRBB 4US9A 1KFYB 3W5VB 1VDVA 4N58A 1N61A 3AEAB 2DBYA 4JWSC 4P6VF 3SR6A 1TKGA 1UWMA 1V97A 2WDVB 4YTNB 3PO0A 3AMZA 4USAA 4ZOHC 4YXDB 2KMMA 4ZHOA 3CWIA 1JALA 3VR8B 2K5PA 1L6VA 1XO3A 1FFUA 2Y5CA 1RYJA 2WDRB 1QT9A 2H89B 2CJOA 2K22A 1RFKA 5H8YE 1FO4A 1FIQA 1PDXA 3P4RB 3AE4B 2W54A 1WGKA 2MH7A 2JX5A 3HUIA 3AV8A 3WCQA 3AN1A 5AUKA 1FXAA 4YTMB 2WP9B 5C2TB 1GPXA 1JQ4A 5MPOA 1DOXA 2PIAA 3RPFC 3AE7B 1CJEA 3AE2B 3W5UB 2PVGC 3AE8B 3AEBB 1ZP0B 4C80A 1FRRA 3W9CB
chains in the Genus database with same CATH superfamily
2LVOA 2M8SA 3DBSA 4JQWC 1ET9A 1EU3A 4M8NA 4TKNA 4MM3A 3CSFA 3B08A 2IY1B 3V6CB 4OHJA 2BT6A 2ZW1A 3JVZX 1KRHA 1SE2A 3O65B 1UH6A 4XDCA 3TCAA 1A70A 1BXTA 1JCKB 1GC6A 2XN9C 4HK2A 3ZRCA 5JXVA 1FD6A 1PGXA 4NAMA 2PJHA 1XXGA 4XWWA 1TY0A 1F0ZA 4OVUA 2C7NB 3BK2A 1CMXB 5DPTA 1A5RA 3GP7A 3B1LX 3GE8C 3DDCB 1WSPA 3GE3C 4DK5A 2LJ5A 3EA6A 2QIEB 2KMAA 3R2TA 3VTVA 2QCZA 4WJNA 1MFWA 4K81A 4DQOC 3VAWA 1E7VA 4BKSD 2YEPB 1KJTA 1H8CA 1XCTL 1WJUA 2VZKB 2WQYB 3ZKJC 2N9KA 2WXNA 4EFOA 2L76A 3ABVB 3U7ZA 3VTUA 2KWCA 4KDLB 3NVYA 4GB9A 2CR5A 4IW0A 5HG2A 5D6JB 3RNGC 1QZEA 1VDVA 3PREA 4YTNB 2D11A 2NBVB 2LGYA 2M4NA 3ZVVA 3DBLB 3OAWA 3DHIC 2IO0B 2LGXA 4IM0A 1QILA 2J0KA 2KDMA 2INNE 5BMIA 4O1NA 3ZJUA 4RGTA 4GMVA 2LVQA 2KN5A 1G6JA 2L05A 4ITKA 2ZNVC 4XGAB 5HKHA 1DGJA 1MG4A 2RD0A 3BZDB 3L16A 2GRIA 3QARA 1XLOA 3N30A 1ET6A 3PHWB 5TSSA 2AX5A 2FE8A 2UU7A 1V1PB 2NR2A 2W3RA 3SFEB 3UQAA 2R61A 3ZNHB 2ZJDA 3SEBA 2X38A 3AE3B 2N9EB 4PYUA 3DBLI 2RPQA 1FPYA 1ROEA 1F52A 1IPGA 4N6EB 3SHQA 4US8A 1WGDA 2GB1A 2CS4A 5FR6A 3AXCA 1WRDB 3ALBA 3KLSX 3Q8FA 1SE9A 4W9IA 2WU2B 3KYCD 1F2RI 1E8XA 1R4MB 3CMMB 2JU6X 1YOVB 4K3CA 2N9PC 3ZW3A 3BIID 4C7YA 2KJRA 4B9KA 1CK1A 2NVUI 3P4SB 2WXOA 1L5PA 2KFKA 1J7CA 2N9XA 4NQKE 2KWVB 2NTSA 4JL9A 1I4PA 1KLGD 2J53A 3HVDA 1FCCC 3AEAB 1JRUA 3EGRA 3H1UA 4KZCA 3ZTDA 2K22A 1WY8A 2KVZA 1L7YA 3HM3A 2INDC 4BKSA 2MBEA 2JZPA 2V3PA 2LUEA 1D6EC 2JVCA 1P7EA 3W5UB 3L0WB 4DHJB 1C79A 4FA6A 2NBWB 2KKCA 4KIKA 3RZFA 4FADA 2BB5A 4R3DA 4WWNA 4MDKE 1HTQA 2KANA 2YVCA 4GXBA 1KTKA 1PFDA 1J7AA 4IOIE 2M0AA 3BINA 2OJWA 4LNOA 4MEMA 3VDZA 3PLVA 2KOXA 3MJWA 3P1MA 3TIXA 4G11A 2IZVB 1GUAB 3I3TB 4TV3A 2VRRB 2CHZA 4FN2A 5AZHA 2TSSA 3ZNZB 2RR9A 3Q8BA 3TL5A 5E6NA 3RNFC 4AOFA 2DWQA 2D3GA 2FIFA 4WIPA 2L1AA 2G4SA 5CHVC 1AYFA 1F2RC 2LWPA 2GBRA 2WX1A 3R2IA 3SDLC 4M8MA 2L3ZA 2HTME 3W2DA 1C4CA 1YJJA 1CZPA 2QEJC 2MJ3A 1GAQB 1ZPSA 4IWPA 4DXFA 3A9JB 4NQLB 2WX0A 3N9YC 2ONQA 4N9F4 2OEDA 3AI5A 3FC4A 2MCNB 4CYEA 4L23A 2KNBA 2LXAA 3N1YC 3U7DA 2VZKD 5D3DA 4DHZB 2WYQA 2ZPYA 4W9KA 3W1SA 1RYJA 3JSVB 4EZLA 5E6OA 4X57B 1WXVA 4K3BA 1HE8A 3DPDA 4C4VB 4P1CC 4A20A 5MPOA 1DOXA 2Z0EB 2V1YA 2DYBA 3AE2B 4F8CB 4WAFA 4A9AA 4LTUA 3HHMA 1N63A 5L83A 3HRDD 2PKOA 4LDTB 1C1YB 1L6UA 1XLPA 4ANVA 1R4NI 2ZPNA 3CIRB 3EECA 1V1OA 3A1QA 4NAWB 2UYZB 2C60A 2HTHA 2BQQA 3QX1A 2K39A 1RRBA 4GN1A 2KT7A 1ZDXA 1JROA 1C76A 5G5HA 3NRZA 1YQ3B 1ZXIA 4WURA 3IT4B 4L2YA 2O2VB 4GDLB 3Q3JA 1C77A 4UDUC 3ZUNA 2MQJA 1NVID 1QOFA 3CSTA 2QHOA 1FFVA 2BS3B 3C0RB 2M1MA 2QMTA 1TIFA 4NJ6A 1YJIA 3ZXVA 2MA9B 5EE3A 1H4RA 2WXFA 2GLSA 4G3XB 3RNAC 5EE1A 4A6QA 2KZRA 4HROA 3E56A 1KH0A 1BMLC 2K3UA 2N0SB 2DX5B 1R7SA 1LFDA 4M01A 2LHDA 3Q3MC 3UIPB 3PGEA 3TBLD 2DBYA 1T0SC 1V80A 1HZ6A 5DPSA 4RM9A 3WAMA 2K5PA 4HVBA 4ANXA 3GZNI 3K9OB 3PSEB 1WGKA 5FK9C 2CHXA 1EM7A 2D2QA 2Z0DB 4ARIA 2DLBA 3L54A 2JXTA 1P3QU 5LLIA 3QIJA 2OHFA 1ZOYB 2MP2A 5IKCM 4DDID 4WQOB 1LQBA 4YT0B 1DOYA 1DOIA 1WJ6A 4W9LA 2IO1B 4E3CA 3DVNU 2SAKA 5BYRA 4MJSA 4KX6B 4KGRA 4G0NB 4GDKB 1I7HA 2Z59B 2AQ3B 4II3B 3SD5A 2R2OA 1NYQA 2V9HA 3MTNB 3UIOB 4W9FA 2GOWA 5EE9A 2AYOB 1U4AA 3A33B 2GBJA 3DOWA 3AULA 1MJDA 3SFDB 3O13A 3FAHA 1IUEA 2IO3B 3DBHI 1SE3A 1LM8B 3BYYB 3D32A 1C4AA 4PS8A 3IFWB 2PW9A 3V3XA 3NHEB 2FUHB 4IUMB 3MFGA 4ZHPA 2ACZB 3Q3NC 1WWTA 2MRPA 3AB5A 4CO7A 2FUG1 4RNAA 1V2YA 5HI1A 1YJ1A 2BPSA 3SU8X 4EE2A 4MT5A 1UZXB 3L13A 2WXHA 4RH6A 1P1AA 1WI0A 2BYFA 2KWUB 4P6VF 2HD5B 2L8JA 2WXMA 4XC2A 2JSVX 1AARA 2G45B 2BF8B 3RZWC 1T0QC 1FNVA 2Y5CA 2FCMA 3BVMA 2QDFA 3APCA 1Q5WB 2G4DB 4W9GA 3WAOA 5AUKA 4CQNA 4W9CA 1WF9A 3N3KB 1P9DU 1ZDVA 2BB6A 1FM0D 1B9RA 1BUIC 1WJNA 1MHXA 1VZ6A 2L32A 4GSWA 2D3CA 1WE7A 2QJLA 1E0ZA 1LGRA 3Q69A 5BO4B 1FNUA 5BMGA 1OEYA 1P0RA 2KTRA 2RDHA 1KLVA 3PHXB 2I1JA 3KQ4A 2PE9A 3ZNID 1EWCA 3VH3B 2QILA 2LEKA 2N7EA 1SF0A 4BKGA 3U30A 1X1MA 2Q5WD 1FNWA 4ZYNA 5FKAC 2FCQA 3MP9A 2MLBA 2MBHA 3I57A 1WYGA 5JHAA 3QAQA 4W9EA 3PRPB 1FEHA 2IJ0A 2WXIA 4XZ4A 1M4VA 3Q14C 2A5UA 3BVZA 2MHJA 3H6NA 3UI3A 2B76B 5AZFA 4L1BA 3NY5A 3HK0A 2JT4B 4AS1A 2KJHB 4HCPB 1V5TA 2HJ1A 2KAJA 5HFYA 2L0TA 2KX0A 3S2AA 1RAXA 4KVGB 1ZUD2 2BBCA 4MH0E 3W5VB 4AJYB 1TZ1A 2Y3AA 1E8WA 1PYWD 4HKQA 1WMHB 2WDRB 3WANA 3UF8A 2ON8A 3GS2A 3PS6A 2LASA 3KWVA 3EFCA 2PVGC 1Y8RC 4EZJA 1WM3A 4C80A 1IGCA 2HE7A 3MHZA 3RT3B 3AE9B 1JRPA 1XCQL 4J6IA 1OQYA 3OLMD 3DVGX 2QC8A 3RNBC 1WGGA 2L7RA 2RDBC 3R66C 1D5ZC 1SB3C 2O6VB 1YX5B 2IGHA 1NYRA 1YN5A 3IT6B 4PS7A 3ZRFA 4FXCA 3AE5B 4KDIC 4S17A 1V9JA 3A9JA 1RFAA 1CQVA 2L0FA 1MG8A 2W55A 4TQ0A 5CX3A 4K7UA 1ZE3D 4IM2A 3MHSD 4FJVB 3MC0B 1E90A 4FLHA 2BWES 1L4ZB 1GB1A 1L0VB 2IPKD 1V81A 3B0AA 4HPLB 2ZVOA 3QWZB 3N1ZC 1QOGA 3JSVA 2KQ4X 2GBNA 4HJGE 4RF1A 3P63A 1FRDA 1WR6E 3PZ8A 4ZYSA 1ZW7A 3M62B 3X0WA 1I42A 3T9LA 1E8ZA 5HHDG 1YN4A 3AECB 3WALA 4KSLC 2EMTA 4GU2A 3EUB2 1L0XB 3NJTA 4JE3B 4NPNA 2J4XA 3DQVA 3I63C 3U2SC 4IWQA 1NI2A 2KLCA 3PO0A 4ZOHC 3ZJTA 4XYCA 2WXPA 4NAWA 1OEYJ 1QT9A 3H7PB 3OG5A 3RMKC 2WDTB 5D3IB 5IA7A 3JYUA 1XD3B 3V60A 4A3OA 5J18A 4II2B 4LJPB 2O2VA 3HM6X 4GDLA 4LNKA 1UWXA 3VUXA 1EWYC 2KFJA 3U8ZA 2NCNA 2ASQA 3VR9B 3ZNGC 1NI3A 2KHWB 1HEZE 2J52A 4WJQA 4MM3B 1AWDA 2NTTA 1E7PB 4ICUA 4J3OD 4W9JA 1I4RA 2KK8A 2WDQB 3P2BA 1QF6A 4HJKA 1FMAD 2KVRA 3TEYA 2E3TA 3NG0A 1UNSA 4OW0A 4IWOA 4HXDA 4W9DA 2RGFA 4IM3A 5G55A 4YSXB 4WJOA 3FKYA 5T8IA 1XLQA 1EO6A 2K25A 1VCBA 2WXJA 4HDOA 1XQQA 2XNAC 2IY0B 3BWUD 3H7SA 3IHPC 4HPMB 3AEFB 3NVZA 4CHKA 4NY0A 1SXTA 3P4PB 4PYZA 1LO5D 4WWMA 5IO9A 1MPEA 2NPTB 2SEBD 2DAFA 3ETRA 3UGBB 1JWMD 1C3TA 1K52A 2N1VA 3R7RA 1Z2MA 2L00B 3LXFA 3UQBA 3TMPB 4JGHB 1SEBD 3CF6E 2AL3A 2WDVB 4ZRJA 1JWSD 3QK0A 4GDKA 2DZJA 4XDDA 1KLUD 1E7UA 5CHFA 1DYQA 3PPAA 5KHOA 3U52E 1JQ4A 3KUZA 1WM2A 3RFZB 1R4NB 1J0GA 2VH1A 1S1QB 4A8XC 2J7QB 3VQIA 3VFKA 1ACCA 2H88B 3LB8C 2DNFA 1F77A 3QC8B 1L4DB 2KQSA 4KGSA 3QHTA 3V62A 2MBOA 3NS1A 4B95A 4JWUC 5CTRC 2BWFA 2LGIA 1SJED 1E9MA 1UUPA 4WAAA 3TEZA 4TUUA 2MJEA 2JZ3B 2BW2A 2OOBB 4A3PA 5G2NA 5C23A 2LUMA 2BS2B 5IAAC 2GBKA 2E6XA 2C9WB 2O6VD 4BZAA 5AUIA 1OQRA 1L2NA 3L10B 1WRIA 4FHJA 1YN3A 1SSNA 2RPVA 4PK1A 2L83A 3PRZA 2Z8LA 2BS4B 3VTWA 5IP4D 1YNTE 3DWMA 1D5MC 3GZNB 2RMMA 3ZTCA 2D5GA 4TQ1A 2HDEA 4M00A 1F9JA 2DENB 4M02A 2W9NA 1NBFC 4TMAB 1MI0A 2KFKB 3OJ3A 5JH5C 1YIWA 3CWIA 1JWUD 4M0WB 2KD0A 2M17A 2JX5A 2R2QA 4ICVA 3TUOA 2IYDB 2LD9A 4YTMB 5C2TB 3NZ3A 4KSKC 5LNK1 1WR1A 1E5WA 4I6PA 1PGBA 4MH8A 2A4ZA 3Q2AC 1PUTA 2PTLA 1IBXB 2AEHA 1HXYD 4HRSA 1VD2A 1XT9B 1WX7A 3RUIB 2D10A 2IDYA 2KDIA 2W82A 2ZVNA 3T8MA 4BFRA 2LGSA 4OVVA 3PRMB 3RULA 3A9KB 2V4LA 4LLGM 3Q8CA 1WH3A 2D3AA 2KDEB 3DVGY 4MGYE 4DHZE 3MJ5A 1K8RB 4ARCA 3ZJVA 3DBHB 2INPE 4GGQA 2K0PA 1L0YB 3B9JA 1I4XA 2KLGA 2MWSB 3OWEB 3EC8A 1GC7A 3KYDD 2M56B 1GG3A 2RDGA 4DHJD 1KF6B 3RD2A 2PVOD 4FBJB 2M19A 1GOZA 1RM6C 1IGDA 1WX8A 2J0JA 1HTOA 1STEA 4BKTA 1N60A 4RF0A 5BYSA 5D94A 4DXAB 3QA8A 3GB1A 2PPHA 1FXIA 4HCNB 1HZ5A 1NEKB 4ZRQA 1TT5B 4I6LB 3L17A 3SR6A 1WGRA 4RFBA 5KHQA 2O6VA 1IP9A 2V0GA 1I4HA 1V5OA 1Z5SB 1FFUA 3ENEA 2DYOA 2GI9A 2AL6A 2PLPA 4LJOB 2LXCA 1T5XD 3AE4B 3AN1A 5DPRA 5JZEB 2EMSA 4KZ0A 2N7DA 3IXSA 4E74A 4HLEA 2G1EA 3TEWA 1SE4A 3NZSA 3W1YA 1B1ZA 1V1PA 3DHGC 1YQ4B 1OQQA 2XBBC 3B2FA 3NVVA 1WZ0A 5GMVA 5H92C 2KYWA 2LMCA 3T3NA 2CU3A 3ONSA 1OFFA 1QQRA 1RLFA 1UGMA 4A55A 4XWTA 4REZA 3A1QB 2XEWA 1TKEA 1WFYA 3BY4B 2ZCCA 2MX2A 4W9HA 4LCDE 2FNJB 3KW5B 4MELA 2LRUA 2KO3A 4ZRKA 2JWZA 4PS3A 2PEAA 1TS4A 3K9PB 1TGZB 4P1BC 5L95C 5AEKB 4K1RB 2CJNA 1K51A 1J7BA 3P4QB 3H7PA 4F7ZA 4EUTA 2NMQA 3Q8EA 3RNEC 4LDTD 4WH4A 1GNUA 4WQMA 2DHZA 3ZIMA 1Q10A 4YL8A 2UWQA 1BT0A 4BAXA 5LXIB 2I2YA 4EKUA 2K9XA 1TS5A 1VR9A 5J17A 2RSUA 3X23A 3AH7A 3RN9C 2YLMA 4US9A 1KFYB 1C4PA 4JWSC 1TZOA 1FCLA 2KACA 1C78A 5BMHA 3MC9A 3NOBA 2ZEQA 4YXDB 2KMMA 4ZHOA 2NBUA 3ZXRA 3ML8A 1MHHE 1L6VA 1VZ7A 3EHVA 2H89B 1RFKA 2LRWA 3DCGA 3ECIA 3GOEA 4AJWA 5C1ZA 2W54A 1J8CA 1FXAA 2PIAA 2KXJA 2DZIA 4HPPA 4RGNA 2JYEA 3B2GA 1YX6B 3E9SA 3LJ3A 4DDGD 4AWJA 4C00A 3PZ7A 2KJ6A 3DBRB 4BBNF 4HDQA 2MP2B 2FCNA 2INCC 4HKZE 1M94A 4KKJA 4OZCA 4IKGA 3IVFA 2JRIB 2NPTA 4IC7B 1RWSA 1WE6A 2AWTA 3IAM1 4MJSB 2LJIA 1UD7A 3W1SC 3ZLZA 4AQ7A 2FBWB 2J42A 1XLNA 3BVGA 3PTFC 1N5WA 2GBMA 2WXQA 4RM8A 1EF1A 1P7FA 1I4GA 3KVFB 2W3SA 2XK5B 4A90A 1F1HA 1SBBB 2CHWA 2LI5A 2DYMA 4KGTA 2HJ8A 2FCSA 3DBRI 1D5XC 4MGIE 3ML9A 4JLCA 3VRAB 2Y5BB 4B0MA 4NJCA 4TSSA 2LHEA 1XF5L 4MSMB 2AQ1B 3APFA 2CU1A 2JQRB 4URKA 2KC2A 4PT5A 4MGKE 1V97A 2EKEC 1VRAB 4NZLB 4GIVA 4USAA 2V3SA 4C4VA 3R7QA 3Q3FA 3TSSA 3V6EB 2CJOA 2JRHA 4GLSC 4MGZE 4DBGA 3V05A 2FAZA 3HUIA 3FILB 2NS5A 1ISNA 1KM7A 3BK1A 4AUQC 1WXSA 2JPHA 1ZP0B 5EDSA 4K7SA 2D3BA 2DZMA 2DAJA 3M95A 1AN8A 3ZDMC 1WGHA 3DVNV 4KKIA 3PVLA 5C3JB 1VLBA 1TTNA 1E8YA 1WJ4A 3N1XC 3ZQ4A 4D2KA 1S3SG 3I9V1 2N7JA 2QSDA 2MBBB 2MBQA 2ZCBA 3VH4B 2D07B 2JWUA 4LNIA 3QJZA 2KTRB 4WWPA 4G50A 1LXDA 1E10A 4JPSA 4N59A 1MVKA 2LFIA 1T3QA 1WX9A 2G3QB 1J19A 3MC8A 4M0WA 1N6ZA 2MJDA 3AEEB 5EE0A 4E71A 5G5GA 4RGOS 2B3AA 1ESFA 4MSQB 1YQBA 4WJPA 1D4BA 3U4EG 3AEDB 2K8CA 4HEA1 1T6BX 1TJEA 2BYVE 2BKFA 2KN4A 3AM9A 3ZO5B 1IBXA 1T0RC 4IG7B 4ZRPA 1R4MI 4QAYA 4N58A 4ASWC 1ZGUB 2J0MA 3VVWB 4EZKA 2FIDA 2BKRB 1V49A 3NUHB 2IGGA 4ZDVA 4Q2JA 4P7IA 3A9KA 3KH0A 1PDXA 2N1WA 3P4RB 2LVPA 5IN7A 1WXMA 1UF0A 2GMIC 3RPFC 3AE7B 2WXRA 4XE0A 1CJEA 3AE8B 3IBEA 5E6PA 1ENFA 3DWGC 2KWDA 4EOYA 1OGWA 1TY2A 1V86A 3J9CA 5D7GA 3WA0A 2KDFB 3WIMA 3AE1B 3RCZA 2IO2B 4LNFA 1Y56A 2K6QA 1TKYA 2I38A 2EELA 2PMVA 4NJ7A 3AE6B 1JWBD 3I5JC 3AEGB 4LNNA 1QOBA 2IGDA 3NZUA 1QKZA 1FXTB 2WS3B 1JW9D 3HVZA 1YMHE 1HA5A 5CHWA 2OJRA 1D3ZA 3IG3A 2WXLA 3APDA 1NENB 4BOSC 1UELA 1YD8U 3Q6BA 2BTEA 4RCOA 5BYQA 1ZXHA 4ZRIA 3PZDA 5LXHA 4OZAA 2ZW0A 1QOAA 1IYFA 2Y5PA 2WLBA 3WAPA 4C56C 3AU5A 4ANWA 2V4IB 1AW7A 4YSZB 3RNCC 1KOTA 2EKIA 2ZZPB 1PQSA 2JY6A 1I4QA 1N61A 3KUDB 1WZ3A 3AMZA 3VR8B 2C7HA 1FO4A 1FIQA 4WWOA 3AV8A 5J2RA 3NS8A 2REXA 3VXWA 2BGFA 1Q1OA 4MACA 3PLUA 3RI7C 3W9CB 1SJHD 3Q3OC 1WXAA 1GJZA 4YWGG 1SIFA 5E6JA 1T0YA 2M0XA 5D2MB 2KX3A 3OJ4B 2JYTA 2KQ7A 3EFUA 3V61A 1PGAA 5DCNA 1K50A 2JXXA 3LYYA 2JF5A 4KV2A 1V8CA 2DZKA 3KUCB 4IDIA 3N20C 5I4DA 5JHBA 2CKHB 3ZYYX 3HIZA 2C7MB 4FJZA 2K6DB 3TEXA 2V3NA 2KDBA 1N5XA 2C5LC 3T3OA 3C8YA 2WGSA 1SGHA 4YTPB 3A4RA 4BBNC 4C7ZA 3VHTC 3P42A 4RGMA 3DHHC 3R3MA 4KIKB 1JWAD 2WU5B 3VUWA 4B0EA 2WHIA 2JUOA 4S0RA 2WXKA 3UINB 2BYTA 3R8BA 1VZ8A 3LDZE 2AQ2B 1N62A 1WGYA 2KMCA 1TS2A 2JZZA 5AZGA 2YEPF 3KWLA 4NNJB 5GXGB 1WMHA 3JW0X 3PT2B 4H2AA 1TS3A 3Q8AA 1JALA 2WXGA 2G9HD 3URYA 1XO3A 1I35A 2MW5A 3M3JA 4BOZB 4FJYA 4LK0M 1GB4A 3QQ8B 4GOCA 2I1KA 3A4SC 4XX5A 3WCQA 4RMAA 1Q0WB 3N32A 5FR3A 3NVWA 2BYEA 1P98A 2LZ6A 2KTFA 2XK5A 1K53A 2N4FA 1WXQA 4EEWA 2K8HA 2K8BA 2K1FA 4HWIB 2MEKA 1UBIA 4K7WA 2KC1A 1V6EA 2WNMA 2N9LA 4OZBA 3L08A 5TR5A 4F1SA 2VH2A 4JX1C 1TYGB 2WWZA 4FHKA 1NDDA 4OVZA 4I6NB 1C9FA 3H9DA 2ICIA 4AP4C 3AU4A 1EF5A 1OTRB 4P16A 4YSYB 3L4PA 1XEEA 2PE6B 1SIJA 2LGDA 2L52A 1UGJA 3RYTA 1QLBB 3FILA 4JIOU 3QCAA 4B6WA 1TBEA 3M63B 4DWFA 3H8HA 3VUYA 3PV1A 1HQRD 1EU4A 2ZNVB 1UBQA 3IAS1 1E6EB 1VJKA 1EUVB 1JMLA 3VRBB 3ZDTA 5DPWA 3TJPA 3C19A 1TKGA 1UWMA 1WYWB 4ACFA 3BYTB 2MSED 1WIAA 2BVCA 5H8YE 4BVUC 2MH7A 4DXGA 2IBIB 1ZKHA 2X8XX 2WP9B 3ZGZA 1GPXA 4FULA 4ANUA 3AEBB 5IOIA 1FRRA
chains in the Genus database with same CATH topology
1ET9A 1EU3A 1AN8A 4A8XC 3VQIA 1ACCA 2H88B 3LB8C 2OHFA 4KKIA 1ZOYB 4OHJA 1F77A 1L4DB 2BT6A 5C3JB 2ZW1A 4KGSA 1VLBA 4YT0B 1DOYA 1DOIA 1KRHA 3ZQ4A 4D2KA 3I9V1 1SE2A 3NS1A 2SAKA 5BYRA 2N7JA 2QSDA 4XDCA 4JWUC 1A70A 2LGIA 1BXTA 1JCKB 2XN9C 4KX6B 4KGRA 2JWUA 1SJED 4GDKB 1I7HA 1E9MA 5JXVA 1FD6A 1UUPA 2AQ3B 1PGXA 4NAMA 3TEZA 1XXGA 2MJEA 4XWWA 1TY0A 1F0ZA 2BW2A 3BK2A 1NYQA 1E10A 4JPSA 4N59A 1MVKA 2LFIA 5EE9A 2LUMA 3GP7A 2BS2B 1T3QA 1WSPA 2E6XA 5AUIA 3EA6A 1OQRA 2QIEB 3R2TA 4M0WA 1WRIA 1YN3A 2MJDA 3SFDB 4DQOC 3AEEB 1SSNA 2RPVA 3O13A 5EE0A 3FAHA 1IUEA 2L83A 2YEPB 5G5GA 2Z8LA 2BS4B 4RGOS 1SE3A 1XCTL 2VZKB 2WQYB 3BYYB 1ESFA 1C4AA 1YNTE 2PW9A 3V3XA 2N9KA 2WXNA 3DWMA 3MFGA 1D5MC 4ZHPA 2ACZB 1D4BA 3U4EG 3ABVB 3AEDB 3U7ZA 1WWTA 3AB5A 2RMMA 2FUG1 2D5GA 4RNAA 4TQ1A 2HDEA 4HEA1 1T6BX 1TJEA 5HI1A 2KN4A 4EE2A 3NVYA 3AM9A 4MT5A 1IBXA 2WXHA 5HG2A 4ZRPA 4RH6A 1VDVA 4N58A 4P6VF 4TMAB 1MI0A 4YTNB 2WXMA 2JSVX 3NUHB 2IGGA 3CWIA 4Q2JA 1JWUD 1FNVA 2Y5CA 1QILA 3BVMA 1PDXA 3P4RB 2JX5A 2KDMA 3TUOA 4CQNA 5AUKA 2INNE 4YTMB 5C2TB 5BMIA 3RPFC 3AE7B 2WXRA 3NZ3A 1CJEA 4O1NA 4XE0A 4RGTA 3AE8B 3ZJUA 5LNK1 1ZDVA 2BB6A 1FM0D 4ITKA 1B9RA 1PGBA 1BUIC 1DGJA 4MH8A 3BZDB 1MHXA 1PUTA 1VZ6A 2L32A 2PTLA 1ENFA 2GRIA 3DWGC 2KWDA 2QJLA 1XLOA 1E0ZA 1ET6A 3Q69A 5TSSA 1IBXB 1FNUA 1HXYD 1TY2A 2AX5A 3J9CA 4HRSA 5D7GA 2FE8A 5BMGA 3AE1B 2RDHA 2IDYA 2W82A 1V1PB 3KQ4A 2W3RA 3SFEB 1Y56A 2R61A 1TKYA 1EWCA 2I38A 2QILA 3SEBA 2EELA 2LEKA 2PMVA 3AE6B 2X38A 3AE3B 4LLGM 1SF0A 3Q8CA 1JWBD 3AEGB 1QOBA 2Q5WD 2IGDA 1FNWA 1ROEA 5FKAC 3MJ5A 4N6EB 3MP9A 4US8A 4ARCA 3ZJVA 2INPE 1QKZA 2K0PA 3I57A 1L0YB 1WYGA 3B9JA 1I4XA 2GB1A 3OWEB 2WS3B 1JW9D 3HVZA 1YMHE 1HA5A 2M56B 1FEHA 2IJ0A 2WXIA 1M4VA 2WXLA 2RDGA 3BVZA 1KF6B 3KLSX 1NENB 3Q8FA 2WU2B 2PVOD 3UI3A 1F2RI 2B76B 2M19A 2BTEA 4RCOA 1GOZA 1RM6C 5BYQA 1IGDA 1ZXHA 2JU6X 4L1BA 1STEA 4OZAA 2ZW0A 1QOAA 1N60A 3BIID 4C7YA 4AS1A 2Y5PA 2WLBA 4RF0A 5BYSA 1CK1A 3P4SB 2WXOA 4C56C 1L5PA 2KAJA 1J7CA 5HFYA 3GB1A 1FXIA 2NTSA 1AW7A 2V4IB 4YSZB 1HZ5A 2EKIA 1ZUD2 2BBCA 1I4PA 1NEKB 1KLGD 2J53A 3HVDA 4ZRQA 1FCCC 1I4QA 3W5VB 1N61A 3AEAB 3SR6A 4RFBA 3AMZA 3EGRA 2V0GA 1I4HA 3VR8B 2Y3AA 1PYWD 1FFUA 4HKQA 2DYOA 2GI9A 2WDRB 2K22A 1FO4A 2PLPA 1FIQA 1T5XD 3AE4B 2ON8A 3AV8A 3AN1A 3GS2A 2JZPA 2V3PA 1D6EC 3KWVA 1P7EA 3W5UB 2PVGC 3IXSA 4MACA 4C80A 1IGCA 2G1EA 3MHZA 1C79A 1SE4A 1SJHD 3W9CB 3TEWA 3AE9B 1JRPA 1B1ZA 4YWGG 1V1PA 1XCQL 5E6JA 1YQ4B 2BB5A 1OQQA 4R3DA 2JYTA 3B2FA 3NVVA 1PGAA 1K50A 3LYYA 5H92C 2LMCA 3T3NA 2CU3A 1D5ZC 1V8CA 4IDIA 1SB3C 1KTKA 1PFDA 1OFFA 1QQRA 2IGHA 1NYRA 1YN5A 1J7AA 3IT6B 3ZYYX 5I4DA 4IOIE 2M0AA 4FXCA 3AE5B 4A55A 4XWTA 3P1MA 3TEXA 2V3NA 1CQVA 3T3OA 1N5XA 4REZA 2W55A 3C8YA 1TKEA 4TQ0A 4YTPB 1ZE3D 2TSSA 3Q8BA 3MC0B 4C7ZA 1L4ZB 3P42A 1GB1A 1L0VB 2DWQA 2IPKD 4RGMA 1TS4A 4WIPA 2L1AA 1JWAD 2WU5B 2CJNA 1K51A 1AYFA 1J7BA 3P4QB 1F2RC 1QOGA 4B0EA 2KQ4X 4HJGE 2WXKA 3R2IA 4RF1A 2NMQA 2BYTA 3R8BA 2HTME 3P63A 3Q8EA 1FRDA 1VZ8A 1C4CA 4WH4A 3W2DA 1YJJA 4WQMA 3PZ8A 1CZPA 2QEJC 2MJ3A 1GAQB 4ZYSA 1ZPSA 4DXFA 1Q10A 5HHDG 1YN4A 3AECB 2AQ2B 3N9YC 1N62A 2ONQA 1TS2A 2I2YA 2OEDA 2K9XA 1TS5A 3EUB2 3FC4A 1VR9A 1L0XB 4JE3B 2YEPF 2J4XA 3KWLA 3AH7A 5GXGB 3U2SC 4L23A 1KFYB 1C4PA 4US9A 4JWSC 1TZOA 1FCLA 2KACA 1C78A 5BMHA 4H2AA 1TS3A 3PO0A 3Q8AA 4ZOHC 2KMMA 4YXDB 2VZKD 4ZHOA 3ZJTA 1JALA 2WXGA 5D3DA 2WXPA 1MHHE 1L6VA 1VZ7A 1XO3A 2G9HD 3URYA 3W1SA 1RYJA 1QT9A 2H89B 1RFKA 2W54A 4LK0M 5D3IB 1GB4A 1FXAA 5MPOA 1DOXA 2PIAA 3AE2B 4WAFA 3WCQA 4RGNA 4A9AA 4LTUA 2JYEA 5FR3A 1N63A 1UWXA 3NVWA 3B2GA 1EWYC 3E9SA 3HRDD 2PKOA 3VR9B 1K53A 1NI3A 1L6UA 1HEZE 1WXQA 1XLPA 3PZ7A 2J52A 4MM3B 1AWDA 2NTTA 1E7PB 3CIRB 2MEKA 1V1OA 4J3OD 4HKZE 1I4RA 2WDQB 4KKJA 4NAWB 4OZCA 4IKGA 1QF6A 1FMAD 2WNMA 2N9LA 4OZBA 1RWSA 3TEYA 2E3TA 4JX1C 1TYGB 1UNSA 1ZDXA 1JROA 4OW0A 3IAM1 2LJIA 4OVZA 1C76A 5G5HA 1C9FA 3NRZA 1YQ3B 1ZXIA 2ICIA 4YSXB 4WURA 3IT4B 4L2YA 4AQ7A 2FBWB 2J42A 4GDLB 1XLNA 3BVGA 1N5WA 1C77A 5T8IA 2WXQA 4UDUC 1XLQA 4P16A 4YSYB 3L4PA 1XEEA 2WXJA 1P7FA 1I4GA 1NVID 1QOFA 2W3SA 4A90A 1SIJA 2XNAC 3BWUD 2L52A 1FFVA 1UGJA 1SBBB 2BS3B 2DYMA 4KGTA 1QLBB 3AEFB 2QMTA 3FILA 1YJIA 3NVZA 5EE3A 1SXTA 3P4PB 2WXFA 5EE1A 4A6QA 1LO5D 3H8HA 4WWMA 1D5XC 1MPEA 4HROA 1HQRD 2SEBD 3VRAB 3E56A 1EU4A 3ETRA 4B0MA 4NJCA 1KH0A 4TSSA 1JWMD 2LHEA 3IAS1 1BMLC 1E6EB 1K52A 1VJKA 2K3UA 2N0SB 1XF5L 1R7SA 3LXFA 1JMLA 2LHDA 2AQ1B 2JQRB 3VRBB 1SEBD 4PT5A 2DBYA 1TKGA 1UWMA 1V97A 1VRAB 2WDVB 4NZLB 1HZ6A 4USAA 3BYTB 1JWSD 2K5PA 3TSSA 2CJOA 4GLSC 5H8YE 4XDDA 3V05A 1KLUD 1WGKA 2MH7A 3HUIA 5FK9C 4DXGA 3FILB 1DYQA 2WP9B 3U52E 3ZGZA 1GPXA 1JQ4A 1EM7A 3RFZB 3BK1A 4ARIA 2DLBA 3AEBB 1ZP0B 2JXTA 1FRRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LTU A;  3AE9 B;  1FM0 D;  4ITK A;  1JRP A;  1N63 A;  1B9R A;  2H88 B;  1DGJ A;  3LB8 C;  2OHF A;  1EWY C;  3B2G A;  3NVW A;  1ZOY B;  3HRD D;  1YQ4 B;  2PKO A;  1OQQ A;  1PUT A;  3DWG C;  3VR9 B;  2BT6 A;  2QJL A;  1XLO A;  5C3J B;  1E0Z A;  1NI3 A;  1L6U A;  1VLB A;  4YT0 B;  1WXQ A;  1XLP A;  1DOI A;  1KRH A;  3B2F A;  3NVV A;  1DOY A;  2AX5 A;  4HRS A;  5H92 C;  3AE1 B;  1AWD A;  2CU3 A;  3NS1 A;  1V8C A;  1E7P B;  3CIR B;  4IDI A;  1SB3 C;  2W3R A;  4JWU C;  3SFE B;  1PFD A;  1A70 A;  1OFF A;  1TKY A;  1NYR A;  4KX6 B;  1J7A A;  3ZYY X;  2WDQ B;  1QF6 A;  1I7H A;  1E9M A;  2LEK A;  4FXC A;  3AE5 B;  3AE6 B;  1FMA D;  3P1M A;  3AE3 B;  1SF0 A;  1RWS A;  1JWB D;  2E3T A;  4JX1 C;  1TYG B;  2MJE A;  1JRO A;  1N5X A;  3AEG B;  1QOB A;  1F0Z A;  2Q5W D;  2W55 A;  2G1E A;  1TKE A;  1NYQ A;  1ROE A;  5G5H A;  1E10 A;  4YTP B;  3NRZ A;  1YQ3 B;  4N59 A;  4N6E B;  1ZXI A;  4YSX B;  4US8 A;  5EE9 A;  1WYG A;  3B9J A;  2BS2 B;  4C7Z A;  1T3Q A;  2FBW B;  1XLN A;  1L0V B;  2WS3 B;  1JW9 D;  1N5W A;  2DWQ A;  3HVZ A;  1XLQ A;  4YSY B;  2M56 B;  3L4P A;  5AUI A;  1JWA D;  1OQR A;  2QIE B;  2WU5 B;  1NVI D;  2CJN A;  1QOF A;  1WRI A;  2W3S A;  1AYF A;  1J7B A;  3P4Q B;  1QOG A;  1SIJ A;  1KF6 B;  2L52 A;  1FFV A;  2MJD A;  2BS3 B;  1NEN B;  3AEE B;  3SFD B;  5EE0 A;  3FAH A;  1IUE A;  1QLB B;  2L83 A;  2PVO D;  2WU2 B;  3AEF B;  5G5G A;  2B76 B;  2M19 A;  1YJI A;  2BS4 B;  2HTM E;  3NVZ A;  3P63 A;  1FRD A;  5EE3 A;  1RM6 C;  3P4P B;  2WQY B;  1YJJ A;  4WQM A;  1CZP A;  4A9A A;  2MJ3 A;  1GAQ B;  5EE1 A;  4WWM A;  1QOA A;  3DWM A;  4HRO A;  1N60 A;  3BII D;  3VRA B;  4C7Y A;  4ZHP A;  2ACZ B;  2WLB A;  3ETR A;  3ABV B;  3AED B;  3AEC B;  1WWT A;  3P4S B;  1N62 A;  1L5P A;  2KAJ A;  1J7C A;  3AB5 A;  1E6E B;  1VJK A;  2N0S B;  1FXI A;  2K9X A;  3EUB 2;  3FC4 A;  1R7S A;  3LXF A;  1TJE A;  4YSZ B;  2EKI A;  3NVY A;  3AM9 A;  1ZUD 2;  3KWL A;  2JQR B;  3AH7 A;  5GXG B;  1NEK B;  3VRB B;  4US9 A;  1KFY B;  3W5V B;  1VDV A;  4N58 A;  1N61 A;  3AEA B;  2DBY A;  4JWS C;  4P6V F;  3SR6 A;  1TKG A;  1UWM A;  1V97 A;  2WDV B;  4YTN B;  3PO0 A;  3AMZ A;  4USA A;  4ZOH C;  4YXD B;  2KMM A;  4ZHO A;  3CWI A;  1JAL A;  3VR8 B;  2K5P A;  1L6V A;  1XO3 A;  1FFU A;  2Y5C A;  1RYJ A;  2WDR B;  1QT9 A;  2H89 B;  2CJO A;  2K22 A;  1RFK A;  5H8Y E;  1FO4 A;  1FIQ A;  1PDX A;  3P4R B;  3AE4 B;  2W54 A;  1WGK A;  2MH7 A;  2JX5 A;  3HUI A;  3AV8 A;  3WCQ A;  3AN1 A;  5AUK A;  1FXA A;  4YTM B;  2WP9 B;  5C2T B;  1GPX A;  1JQ4 A;  5MPO A;  1DOX A;  2PIA A;  3RPF C;  3AE7 B;  1CJE A;  3AE2 B;  3W5U B;  2PVG C;  3AE8 B;  3AEB B;  1ZP0 B;  4C80 A;  1FRR A;  3W9C B; 
#chains in the Genus database with same CATH topology
 2LVO A;  2M8S A;  3DBS A;  4JQW C;  1ET9 A;  1EU3 A;  4M8N A;  4TKN A;  4MM3 A;  3CSF A;  3B08 A;  2IY1 B;  3V6C B;  4OHJ A;  2BT6 A;  2ZW1 A;  3JVZ X;  1KRH A;  1SE2 A;  3O65 B;  1UH6 A;  4XDC A;  3TCA A;  1A70 A;  1BXT A;  1JCK B;  1GC6 A;  2XN9 C;  4HK2 A;  3ZRC A;  5JXV A;  1FD6 A;  1PGX A;  4NAM A;  2PJH A;  1XXG A;  4XWW A;  1TY0 A;  1F0Z A;  4OVU A;  2C7N B;  3BK2 A;  1CMX B;  5DPT A;  1A5R A;  3GP7 A;  3B1L X;  3GE8 C;  3DDC B;  1WSP A;  3GE3 C;  4DK5 A;  2LJ5 A;  3EA6 A;  2QIE B;  2KMA A;  3R2T A;  3VTV A;  2QCZ A;  4WJN A;  1MFW A;  4K81 A;  4DQO C;  3VAW A;  1E7V A;  4BKS D;  2YEP B;  1KJT A;  1H8C A;  1XCT L;  1WJU A;  2VZK B;  2WQY B;  3ZKJ C;  2N9K A;  2WXN A;  4EFO A;  2L76 A;  3ABV B;  3U7Z A;  3VTU A;  2KWC A;  4KDL B;  3NVY A;  4GB9 A;  2CR5 A;  4IW0 A;  5HG2 A;  5D6J B;  3RNG C;  1QZE A;  1VDV A;  3PRE A;  4YTN B;  2D11 A;  2NBV B;  2LGY A;  2M4N A;  3ZVV A;  3DBL B;  3OAW A;  3DHI C;  2IO0 B;  2LGX A;  4IM0 A;  1QIL A;  2J0K A;  2KDM A;  2INN E;  5BMI A;  4O1N A;  3ZJU A;  4RGT A;  4GMV A;  2LVQ A;  2KN5 A;  1G6J A;  2L05 A;  4ITK A;  2ZNV C;  4XGA B;  5HKH A;  1DGJ A;  1MG4 A;  2RD0 A;  3BZD B;  3L16 A;  2GRI A;  3QAR A;  1XLO A;  3N30 A;  1ET6 A;  3PHW B;  5TSS A;  2AX5 A;  2FE8 A;  2UU7 A;  1V1P B;  2NR2 A;  2W3R A;  3SFE B;  3UQA A;  2R61 A;  3ZNH B;  2ZJD A;  3SEB A;  2X38 A;  3AE3 B;  2N9E B;  4PYU A;  3DBL I;  2RPQ A;  1FPY A;  1ROE A;  1F52 A;  1IPG A;  4N6E B;  3SHQ A;  4US8 A;  1WGD A;  2GB1 A;  2CS4 A;  5FR6 A;  3AXC A;  1WRD B;  3ALB A;  3KLS X;  3Q8F A;  1SE9 A;  4W9I A;  2WU2 B;  3KYC D;  1F2R I;  1E8X A;  1R4M B;  3CMM B;  2JU6 X;  1YOV B;  4K3C A;  2N9P C;  3ZW3 A;  3BII D;  4C7Y A;  2KJR A;  4B9K A;  1CK1 A;  2NVU I;  3P4S B;  2WXO A;  1L5P A;  2KFK A;  1J7C A;  2N9X A;  4NQK E;  2KWV B;  2NTS A;  4JL9 A;  1I4P A;  1KLG D;  2J53 A;  3HVD A;  1FCC C;  3AEA B;  1JRU A;  3EGR A;  3H1U A;  4KZC A;  3ZTD A;  2K22 A;  1WY8 A;  2KVZ A;  1L7Y A;  3HM3 A;  2IND C;  4BKS A;  2MBE A;  2JZP A;  2V3P A;  2LUE A;  1D6E C;  2JVC A;  1P7E A;  3W5U B;  3L0W B;  4DHJ B;  1C79 A;  4FA6 A;  2NBW B;  2KKC A;  4KIK A;  3RZF A;  4FAD A;  2BB5 A;  4R3D A;  4WWN A;  4MDK E;  1HTQ A;  2KAN A;  2YVC A;  4GXB A;  1KTK A;  1PFD A;  1J7A A;  4IOI E;  2M0A A;  3BIN A;  2OJW A;  4LNO A;  4MEM A;  3VDZ A;  3PLV A;  2KOX A;  3MJW A;  3P1M A;  3TIX A;  4G11 A;  2IZV B;  1GUA B;  3I3T B;  4TV3 A;  2VRR B;  2CHZ A;  4FN2 A;  5AZH A;  2TSS A;  3ZNZ B;  2RR9 A;  3Q8B A;  3TL5 A;  5E6N A;  3RNF C;  4AOF A;  2DWQ A;  2D3G A;  2FIF A;  4WIP A;  2L1A A;  2G4S A;  5CHV C;  1AYF A;  1F2R C;  2LWP A;  2GBR A;  2WX1 A;  3R2I A;  3SDL C;  4M8M A;  2L3Z A;  2HTM E;  3W2D A;  1C4C A;  1YJJ A;  1CZP A;  2QEJ C;  2MJ3 A;  1GAQ B;  1ZPS A;  4IWP A;  4DXF A;  3A9J B;  4NQL B;  2WX0 A;  3N9Y C;  2ONQ A;  4N9F 4;  2OED A;  3AI5 A;  3FC4 A;  2MCN B;  4CYE A;  4L23 A;  2KNB A;  2LXA A;  3N1Y C;  3U7D A;  2VZK D;  5D3D A;  4DHZ B;  2WYQ A;  2ZPY A;  4W9K A;  3W1S A;  1RYJ A;  3JSV B;  4EZL A;  5E6O A;  4X57 B;  1WXV A;  4K3B A;  1HE8 A;  3DPD A;  4C4V B;  4P1C C;  4A20 A;  5MPO A;  1DOX A;  2Z0E B;  2V1Y A;  2DYB A;  3AE2 B;  4F8C B;  4WAF A;  4A9A A;  4LTU A;  3HHM A;  1N63 A;  5L83 A;  3HRD D;  2PKO A;  4LDT B;  1C1Y B;  1L6U A;  1XLP A;  4ANV A;  1R4N I;  2ZPN A;  3CIR B;  3EEC A;  1V1O A;  3A1Q A;  4NAW B;  2UYZ B;  2C60 A;  2HTH A;  2BQQ A;  3QX1 A;  2K39 A;  1RRB A;  4GN1 A;  2KT7 A;  1ZDX A;  1JRO A;  1C76 A;  5G5H A;  3NRZ A;  1YQ3 B;  1ZXI A;  4WUR A;  3IT4 B;  4L2Y A;  2O2V B;  4GDL B;  3Q3J A;  1C77 A;  4UDU C;  3ZUN A;  2MQJ A;  1NVI D;  1QOF A;  3CST A;  2QHO A;  1FFV A;  2BS3 B;  3C0R B;  2M1M A;  2QMT A;  1TIF A;  4NJ6 A;  1YJI A;  3ZXV A;  2MA9 B;  5EE3 A;  1H4R A;  2WXF A;  2GLS A;  4G3X B;  3RNA C;  5EE1 A;  4A6Q A;  2KZR A;  4HRO A;  3E56 A;  1KH0 A;  1BML C;  2K3U A;  2N0S B;  2DX5 B;  1R7S A;  1LFD A;  4M01 A;  2LHD A;  3Q3M C;  3UIP B;  3PGE A;  3TBL D;  2DBY A;  1T0S C;  1V80 A;  1HZ6 A;  5DPS A;  4RM9 A;  3WAM A;  2K5P A;  4HVB A;  4ANX A;  3GZN I;  3K9O B;  3PSE B;  1WGK A;  5FK9 C;  2CHX A;  1EM7 A;  2D2Q A;  2Z0D B;  4ARI A;  2DLB A;  3L54 A;  2JXT A;  1P3Q U;  5LLI A;  3QIJ A;  2OHF A;  1ZOY B;  2MP2 A;  5IKC M;  4DDI D;  4WQO B;  1LQB A;  4YT0 B;  1DOY A;  1DOI A;  1WJ6 A;  4W9L A;  2IO1 B;  4E3C A;  3DVN U;  2SAK A;  5BYR A;  4MJS A;  4KX6 B;  4KGR A;  4G0N B;  4GDK B;  1I7H A;  2Z59 B;  2AQ3 B;  4II3 B;  3SD5 A;  2R2O A;  1NYQ A;  2V9H A;  3MTN B;  3UIO B;  4W9F A;  2GOW A;  5EE9 A;  2AYO B;  1U4A A;  3A33 B;  2GBJ A;  3DOW A;  3AUL A;  1MJD A;  3SFD B;  3O13 A;  3FAH A;  1IUE A;  2IO3 B;  3DBH I;  1SE3 A;  1LM8 B;  3BYY B;  3D32 A;  1C4A A;  4PS8 A;  3IFW B;  2PW9 A;  3V3X A;  3NHE B;  2FUH B;  4IUM B;  3MFG A;  4ZHP A;  2ACZ B;  3Q3N C;  1WWT A;  2MRP A;  3AB5 A;  4CO7 A;  2FUG 1;  4RNA A;  1V2Y A;  5HI1 A;  1YJ1 A;  2BPS A;  3SU8 X;  4EE2 A;  4MT5 A;  1UZX B;  3L13 A;  2WXH A;  4RH6 A;  1P1A A;  1WI0 A;  2BYF A;  2KWU B;  4P6V F;  2HD5 B;  2L8J A;  2WXM A;  4XC2 A;  2JSV X;  1AAR A;  2G45 B;  2BF8 B;  3RZW C;  1T0Q C;  1FNV A;  2Y5C A;  2FCM A;  3BVM A;  2QDF A;  3APC A;  1Q5W B;  2G4D B;  4W9G A;  3WAO A;  5AUK A;  4CQN A;  4W9C A;  1WF9 A;  3N3K B;  1P9D U;  1ZDV A;  2BB6 A;  1FM0 D;  1B9R A;  1BUI C;  1WJN A;  1MHX A;  1VZ6 A;  2L32 A;  4GSW A;  2D3C A;  1WE7 A;  2QJL A;  1E0Z A;  1LGR A;  3Q69 A;  5BO4 B;  1FNU A;  5BMG A;  1OEY A;  1P0R A;  2KTR A;  2RDH A;  1KLV A;  3PHX B;  2I1J A;  3KQ4 A;  2PE9 A;  3ZNI D;  1EWC A;  3VH3 B;  2QIL A;  2LEK A;  2N7E A;  1SF0 A;  4BKG A;  3U30 A;  1X1M A;  2Q5W D;  1FNW A;  4ZYN A;  5FKA C;  2FCQ A;  3MP9 A;  2MLB A;  2MBH A;  3I57 A;  1WYG A;  5JHA A;  3QAQ A;  4W9E A;  3PRP B;  1FEH A;  2IJ0 A;  2WXI A;  4XZ4 A;  1M4V A;  3Q14 C;  2A5U A;  3BVZ A;  2MHJ A;  3H6N A;  3UI3 A;  2B76 B;  5AZF A;  4L1B A;  3NY5 A;  3HK0 A;  2JT4 B;  4AS1 A;  2KJH B;  4HCP B;  1V5T A;  2HJ1 A;  2KAJ A;  5HFY A;  2L0T A;  2KX0 A;  3S2A A;  1RAX A;  4KVG B;  1ZUD 2;  2BBC A;  4MH0 E;  3W5V B;  4AJY B;  1TZ1 A;  2Y3A A;  1E8W A;  1PYW D;  4HKQ A;  1WMH B;  2WDR B;  3WAN A;  3UF8 A;  2ON8 A;  3GS2 A;  3PS6 A;  2LAS A;  3KWV A;  3EFC A;  2PVG C;  1Y8R C;  4EZJ A;  1WM3 A;  4C80 A;  1IGC A;  2HE7 A;  3MHZ A;  3RT3 B;  3AE9 B;  1JRP A;  1XCQ L;  4J6I A;  1OQY A;  3OLM D;  3DVG X;  2QC8 A;  3RNB C;  1WGG A;  2L7R A;  2RDB C;  3R66 C;  1D5Z C;  1SB3 C;  2O6V B;  1YX5 B;  2IGH A;  1NYR A;  1YN5 A;  3IT6 B;  4PS7 A;  3ZRF A;  4FXC A;  3AE5 B;  4KDI C;  4S17 A;  1V9J A;  3A9J A;  1RFA A;  1CQV A;  2L0F A;  1MG8 A;  2W55 A;  4TQ0 A;  5CX3 A;  4K7U A;  1ZE3 D;  4IM2 A;  3MHS D;  4FJV B;  3MC0 B;  1E90 A;  4FLH A;  2BWE S;  1L4Z B;  1GB1 A;  1L0V B;  2IPK D;  1V81 A;  3B0A A;  4HPL B;  2ZVO A;  3QWZ B;  3N1Z C;  1QOG A;  3JSV A;  2KQ4 X;  2GBN A;  4HJG E;  4RF1 A;  3P63 A;  1FRD A;  1WR6 E;  3PZ8 A;  4ZYS A;  1ZW7 A;  3M62 B;  3X0W A;  1I42 A;  3T9L A;  1E8Z A;  5HHD G;  1YN4 A;  3AEC B;  3WAL A;  4KSL C;  2EMT A;  4GU2 A;  3EUB 2;  1L0X B;  3NJT A;  4JE3 B;  4NPN A;  2J4X A;  3DQV A;  3I63 C;  3U2S C;  4IWQ A;  1NI2 A;  2KLC A;  3PO0 A;  4ZOH C;  3ZJT A;  4XYC A;  2WXP A;  4NAW A;  1OEY J;  1QT9 A;  3H7P B;  3OG5 A;  3RMK C;  2WDT B;  5D3I B;  5IA7 A;  3JYU A;  1XD3 B;  3V60 A;  4A3O A;  5J18 A;  4II2 B;  4LJP B;  2O2V A;  3HM6 X;  4GDL A;  4LNK A;  1UWX A;  3VUX A;  1EWY C;  2KFJ A;  3U8Z A;  2NCN A;  2ASQ A;  3VR9 B;  3ZNG C;  1NI3 A;  2KHW B;  1HEZ E;  2J52 A;  4WJQ A;  4MM3 B;  1AWD A;  2NTT A;  1E7P B;  4ICU A;  4J3O D;  4W9J A;  1I4R A;  2KK8 A;  2WDQ B;  3P2B A;  1QF6 A;  4HJK A;  1FMA D;  2KVR A;  3TEY A;  2E3T A;  3NG0 A;  1UNS A;  4OW0 A;  4IWO A;  4HXD A;  4W9D A;  2RGF A;  4IM3 A;  5G55 A;  4YSX B;  4WJO A;  3FKY A;  5T8I A;  1XLQ A;  1EO6 A;  2K25 A;  1VCB A;  2WXJ A;  4HDO A;  1XQQ A;  2XNA C;  2IY0 B;  3BWU D;  3H7S A;  3IHP C;  4HPM B;  3AEF B;  3NVZ A;  4CHK A;  4NY0 A;  1SXT A;  3P4P B;  4PYZ A;  1LO5 D;  4WWM A;  5IO9 A;  1MPE A;  2NPT B;  2SEB D;  2DAF A;  3ETR A;  3UGB B;  1JWM D;  1C3T A;  1K52 A;  2N1V A;  3R7R A;  1Z2M A;  2L00 B;  3LXF A;  3UQB A;  3TMP B;  4JGH B;  1SEB D;  3CF6 E;  2AL3 A;  2WDV B;  4ZRJ A;  1JWS D;  3QK0 A;  4GDK A;  2DZJ A;  4XDD A;  1KLU D;  1E7U A;  5CHF A;  1DYQ A;  3PPA A;  5KHO A;  3U52 E;  1JQ4 A;  3KUZ A;  1WM2 A;  3RFZ B;  1R4N B;  1J0G A;  2VH1 A;  1S1Q B;  4A8X C;  2J7Q B;  3VQI A;  3VFK A;  1ACC A;  2H88 B;  3LB8 C;  2DNF A;  1F77 A;  3QC8 B;  1L4D B;  2KQS A;  4KGS A;  3QHT A;  3V62 A;  2MBO A;  3NS1 A;  4B95 A;  4JWU C;  5CTR C;  2BWF A;  2LGI A;  1SJE D;  1E9M A;  1UUP A;  4WAA A;  3TEZ A;  4TUU A;  2MJE A;  2JZ3 B;  2BW2 A;  2OOB B;  4A3P A;  5G2N A;  5C23 A;  2LUM A;  2BS2 B;  5IAA C;  2GBK A;  2E6X A;  2C9W B;  2O6V D;  4BZA A;  5AUI A;  1OQR A;  1L2N A;  3L10 B;  1WRI A;  4FHJ A;  1YN3 A;  1SSN A;  2RPV A;  4PK1 A;  2L83 A;  3PRZ A;  2Z8L A;  2BS4 B;  3VTW A;  5IP4 D;  1YNT E;  3DWM A;  1D5M C;  3GZN B;  2RMM A;  3ZTC A;  2D5G A;  4TQ1 A;  2HDE A;  4M00 A;  1F9J A;  2DEN B;  4M02 A;  2W9N A;  1NBF C;  4TMA B;  1MI0 A;  2KFK B;  3OJ3 A;  5JH5 C;  1YIW A;  3CWI A;  1JWU D;  4M0W B;  2KD0 A;  2M17 A;  2JX5 A;  2R2Q A;  4ICV A;  3TUO A;  2IYD B;  2LD9 A;  4YTM B;  5C2T B;  3NZ3 A;  4KSK C;  5LNK 1;  1WR1 A;  1E5W A;  4I6P A;  1PGB A;  4MH8 A;  2A4Z A;  3Q2A C;  1PUT A;  2PTL A;  1IBX B;  2AEH A;  1HXY D;  4HRS A;  1VD2 A;  1XT9 B;  1WX7 A;  3RUI B;  2D10 A;  2IDY A;  2KDI A;  2W82 A;  2ZVN A;  3T8M A;  4BFR A;  2LGS A;  4OVV A;  3PRM B;  3RUL A;  3A9K B;  2V4L A;  4LLG M;  3Q8C A;  1WH3 A;  2D3A A;  2KDE B;  3DVG Y;  4MGY E;  4DHZ E;  3MJ5 A;  1K8R B;  4ARC A;  3ZJV A;  3DBH B;  2INP E;  4GGQ A;  2K0P A;  1L0Y B;  3B9J A;  1I4X A;  2KLG A;  2MWS B;  3OWE B;  3EC8 A;  1GC7 A;  3KYD D;  2M56 B;  1GG3 A;  2RDG A;  4DHJ D;  1KF6 B;  3RD2 A;  2PVO D;  4FBJ B;  2M19 A;  1GOZ A;  1RM6 C;  1IGD A;  1WX8 A;  2J0J A;  1HTO A;  1STE A;  4BKT A;  1N60 A;  4RF0 A;  5BYS A;  5D94 A;  4DXA B;  3QA8 A;  3GB1 A;  2PPH A;  1FXI A;  4HCN B;  1HZ5 A;  1NEK B;  4ZRQ A;  1TT5 B;  4I6L B;  3L17 A;  3SR6 A;  1WGR A;  4RFB A;  5KHQ A;  2O6V A;  1IP9 A;  2V0G A;  1I4H A;  1V5O A;  1Z5S B;  1FFU A;  3ENE A;  2DYO A;  2GI9 A;  2AL6 A;  2PLP A;  4LJO B;  2LXC A;  1T5X D;  3AE4 B;  3AN1 A;  5DPR A;  5JZE B;  2EMS A;  4KZ0 A;  2N7D A;  3IXS A;  4E74 A;  4HLE A;  2G1E A;  3TEW A;  1SE4 A;  3NZS A;  3W1Y A;  1B1Z A;  1V1P A;  3DHG C;  1YQ4 B;  1OQQ A;  2XBB C;  3B2F A;  3NVV A;  1WZ0 A;  5GMV A;  5H92 C;  2KYW A;  2LMC A;  3T3N A;  2CU3 A;  3ONS A;  1OFF A;  1QQR A;  1RLF A;  1UGM A;  4A55 A;  4XWT A;  4REZ A;  3A1Q B;  2XEW A;  1TKE A;  1WFY A;  3BY4 B;  2ZCC A;  2MX2 A;  4W9H A;  4LCD E;  2FNJ B;  3KW5 B;  4MEL A;  2LRU A;  2KO3 A;  4ZRK A;  2JWZ A;  4PS3 A;  2PEA A;  1TS4 A;  3K9P B;  1TGZ B;  4P1B C;  5L95 C;  5AEK B;  4K1R B;  2CJN A;  1K51 A;  1J7B A;  3P4Q B;  3H7P A;  4F7Z A;  4EUT A;  2NMQ A;  3Q8E A;  3RNE C;  4LDT D;  4WH4 A;  1GNU A;  4WQM A;  2DHZ A;  3ZIM A;  1Q10 A;  4YL8 A;  2UWQ A;  1BT0 A;  4BAX A;  5LXI B;  2I2Y A;  4EKU A;  2K9X A;  1TS5 A;  1VR9 A;  5J17 A;  2RSU A;  3X23 A;  3AH7 A;  3RN9 C;  2YLM A;  4US9 A;  1KFY B;  1C4P A;  4JWS C;  1TZO A;  1FCL A;  2KAC A;  1C78 A;  5BMH A;  3MC9 A;  3NOB A;  2ZEQ A;  4YXD B;  2KMM A;  4ZHO A;  2NBU A;  3ZXR A;  3ML8 A;  1MHH E;  1L6V A;  1VZ7 A;  3EHV A;  2H89 B;  1RFK A;  2LRW A;  3DCG A;  3ECI A;  3GOE A;  4AJW A;  5C1Z A;  2W54 A;  1J8C A;  1FXA A;  2PIA A;  2KXJ A;  2DZI A;  4HPP A;  4RGN A;  2JYE A;  3B2G A;  1YX6 B;  3E9S A;  3LJ3 A;  4DDG D;  4AWJ A;  4C00 A;  3PZ7 A;  2KJ6 A;  3DBR B;  4BBN F;  4HDQ A;  2MP2 B;  2FCN A;  2INC C;  4HKZ E;  1M94 A;  4KKJ A;  4OZC A;  4IKG A;  3IVF A;  2JRI B;  2NPT A;  4IC7 B;  1RWS A;  1WE6 A;  2AWT A;  3IAM 1;  4MJS B;  2LJI A;  1UD7 A;  3W1S C;  3ZLZ A;  4AQ7 A;  2FBW B;  2J42 A;  1XLN A;  3BVG A;  3PTF C;  1N5W A;  2GBM A;  2WXQ A;  4RM8 A;  1EF1 A;  1P7F A;  1I4G A;  3KVF B;  2W3S A;  2XK5 B;  4A90 A;  1F1H A;  1SBB B;  2CHW A;  2LI5 A;  2DYM A;  4KGT A;  2HJ8 A;  2FCS A;  3DBR I;  1D5X C;  4MGI E;  3ML9 A;  4JLC A;  3VRA B;  2Y5B B;  4B0M A;  4NJC A;  4TSS A;  2LHE A;  1XF5 L;  4MSM B;  2AQ1 B;  3APF A;  2CU1 A;  2JQR B;  4URK A;  2KC2 A;  4PT5 A;  4MGK E;  1V97 A;  2EKE C;  1VRA B;  4NZL B;  4GIV A;  4USA A;  2V3S A;  4C4V A;  3R7Q A;  3Q3F A;  3TSS A;  3V6E B;  2CJO A;  2JRH A;  4GLS C;  4MGZ E;  4DBG A;  3V05 A;  2FAZ A;  3HUI A;  3FIL B;  2NS5 A;  1ISN A;  1KM7 A;  3BK1 A;  4AUQ C;  1WXS A;  2JPH A;  1ZP0 B;  5EDS A;  4K7S A;  2D3B A;  2DZM A;  2DAJ A;  3M95 A;  1AN8 A;  3ZDM C;  1WGH A;  3DVN V;  4KKI A;  3PVL A;  5C3J B;  1VLB A;  1TTN A;  1E8Y A;  1WJ4 A;  3N1X C;  3ZQ4 A;  4D2K A;  1S3S G;  3I9V 1;  2N7J A;  2QSD A;  2MBB B;  2MBQ A;  2ZCB A;  3VH4 B;  2D07 B;  2JWU A;  4LNI A;  3QJZ A;  2KTR B;  4WWP A;  4G50 A;  1LXD A;  1E10 A;  4JPS A;  4N59 A;  1MVK A;  2LFI A;  1T3Q A;  1WX9 A;  2G3Q B;  1J19 A;  3MC8 A;  4M0W A;  1N6Z A;  2MJD A;  3AEE B;  5EE0 A;  4E71 A;  5G5G A;  4RGO S;  2B3A A;  1ESF A;  4MSQ B;  1YQB A;  4WJP A;  1D4B A;  3U4E G;  3AED B;  2K8C A;  4HEA 1;  1T6B X;  1TJE A;  2BYV E;  2BKF A;  2KN4 A;  3AM9 A;  3ZO5 B;  1IBX A;  1T0R C;  4IG7 B;  4ZRP A;  1R4M I;  4QAY A;  4N58 A;  4ASW C;  1ZGU B;  2J0M A;  3VVW B;  4EZK A;  2FID A;  2BKR B;  1V49 A;  3NUH B;  2IGG A;  4ZDV A;  4Q2J A;  4P7I A;  3A9K A;  3KH0 A;  1PDX A;  2N1W A;  3P4R B;  2LVP A;  5IN7 A;  1WXM A;  1UF0 A;  2GMI C;  3RPF C;  3AE7 B;  2WXR A;  4XE0 A;  1CJE A;  3AE8 B;  3IBE A;  5E6P A;  1ENF A;  3DWG C;  2KWD A;  4EOY A;  1OGW A;  1TY2 A;  1V86 A;  3J9C A;  5D7G A;  3WA0 A;  2KDF B;  3WIM A;  3AE1 B;  3RCZ A;  2IO2 B;  4LNF A;  1Y56 A;  2K6Q A;  1TKY A;  2I38 A;  2EEL A;  2PMV A;  4NJ7 A;  3AE6 B;  1JWB D;  3I5J C;  3AEG B;  4LNN A;  1QOB A;  2IGD A;  3NZU A;  1QKZ A;  1FXT B;  2WS3 B;  1JW9 D;  3HVZ A;  1YMH E;  1HA5 A;  5CHW A;  2OJR A;  1D3Z A;  3IG3 A;  2WXL A;  3APD A;  1NEN B;  4BOS C;  1UEL A;  1YD8 U;  3Q6B A;  2BTE A;  4RCO A;  5BYQ A;  1ZXH A;  4ZRI A;  3PZD A;  5LXH A;  4OZA A;  2ZW0 A;  1QOA A;  1IYF A;  2Y5P A;  2WLB A;  3WAP A;  4C56 C;  3AU5 A;  4ANW A;  2V4I B;  1AW7 A;  4YSZ B;  3RNC C;  1KOT A;  2EKI A;  2ZZP B;  1PQS A;  2JY6 A;  1I4Q A;  1N61 A;  3KUD B;  1WZ3 A;  3AMZ A;  3VR8 B;  2C7H A;  1FO4 A;  1FIQ A;  4WWO A;  3AV8 A;  5J2R A;  3NS8 A;  2REX A;  3VXW A;  2BGF A;  1Q1O A;  4MAC A;  3PLU A;  3RI7 C;  3W9C B;  1SJH D;  3Q3O C;  1WXA A;  1GJZ A;  4YWG G;  1SIF A;  5E6J A;  1T0Y A;  2M0X A;  5D2M B;  2KX3 A;  3OJ4 B;  2JYT A;  2KQ7 A;  3EFU A;  3V61 A;  1PGA A;  5DCN A;  1K50 A;  2JXX A;  3LYY A;  2JF5 A;  4KV2 A;  1V8C A;  2DZK A;  3KUC B;  4IDI A;  3N20 C;  5I4D A;  5JHB A;  2CKH B;  3ZYY X;  3HIZ A;  2C7M B;  4FJZ A;  2K6D B;  3TEX A;  2V3N A;  2KDB A;  1N5X A;  2C5L C;  3T3O A;  3C8Y A;  2WGS A;  1SGH A;  4YTP B;  3A4R A;  4BBN C;  4C7Z A;  3VHT C;  3P42 A;  4RGM A;  3DHH C;  3R3M A;  4KIK B;  1JWA D;  2WU5 B;  3VUW A;  4B0E A;  2WHI A;  2JUO A;  4S0R A;  2WXK A;  3UIN B;  2BYT A;  3R8B A;  1VZ8 A;  3LDZ E;  2AQ2 B;  1N62 A;  1WGY A;  2KMC A;  1TS2 A;  2JZZ A;  5AZG A;  2YEP F;  3KWL A;  4NNJ B;  5GXG B;  1WMH A;  3JW0 X;  3PT2 B;  4H2A A;  1TS3 A;  3Q8A A;  1JAL A;  2WXG A;  2G9H D;  3URY A;  1XO3 A;  1I35 A;  2MW5 A;  3M3J A;  4BOZ B;  4FJY A;  4LK0 M;  1GB4 A;  3QQ8 B;  4GOC A;  2I1K A;  3A4S C;  4XX5 A;  3WCQ A;  4RMA A;  1Q0W B;  3N32 A;  5FR3 A;  3NVW A;  2BYE A;  1P98 A;  2LZ6 A;  2KTF A;  2XK5 A;  1K53 A;  2N4F A;  1WXQ A;  4EEW A;  2K8H A;  2K8B A;  2K1F A;  4HWI B;  2MEK A;  1UBI A;  4K7W A;  2KC1 A;  1V6E A;  2WNM A;  2N9L A;  4OZB A;  3L08 A;  5TR5 A;  4F1S A;  2VH2 A;  4JX1 C;  1TYG B;  2WWZ A;  4FHK A;  1NDD A;  4OVZ A;  4I6N B;  1C9F A;  3H9D A;  2ICI A;  4AP4 C;  3AU4 A;  1EF5 A;  1OTR B;  4P16 A;  4YSY B;  3L4P A;  1XEE A;  2PE6 B;  1SIJ A;  2LGD A;  2L52 A;  1UGJ A;  3RYT A;  1QLB B;  3FIL A;  4JIO U;  3QCA A;  4B6W A;  1TBE A;  3M63 B;  4DWF A;  3H8H A;  3VUY A;  3PV1 A;  1HQR D;  1EU4 A;  2ZNV B;  1UBQ A;  3IAS 1;  1E6E B;  1VJK A;  1EUV B;  1JML A;  3VRB B;  3ZDT A;  5DPW A;  3TJP A;  3C19 A;  1TKG A;  1UWM A;  1WYW B;  4ACF A;  3BYT B;  2MSE D;  1WIA A;  2BVC A;  5H8Y E;  4BVU C;  2MH7 A;  4DXG A;  2IBI B;  1ZKH A;  2X8X X;  2WP9 B;  3ZGZ A;  1GPX A;  4FUL A;  4ANU A;  3AEB B;  5IOI A;  1FRR A; 
#chains in the Genus database with same CATH homology
 1ET9 A;  1EU3 A;  1AN8 A;  4A8X C;  3VQI A;  1ACC A;  2H88 B;  3LB8 C;  2OHF A;  4KKI A;  1ZOY B;  4OHJ A;  1F77 A;  1L4D B;  2BT6 A;  5C3J B;  2ZW1 A;  4KGS A;  1VLB A;  4YT0 B;  1DOY A;  1DOI A;  1KRH A;  3ZQ4 A;  4D2K A;  3I9V 1;  1SE2 A;  3NS1 A;  2SAK A;  5BYR A;  2N7J A;  2QSD A;  4XDC A;  4JWU C;  1A70 A;  2LGI A;  1BXT A;  1JCK B;  2XN9 C;  4KX6 B;  4KGR A;  2JWU A;  1SJE D;  4GDK B;  1I7H A;  1E9M A;  5JXV A;  1FD6 A;  1UUP A;  2AQ3 B;  1PGX A;  4NAM A;  3TEZ A;  1XXG A;  2MJE A;  4XWW A;  1TY0 A;  1F0Z A;  2BW2 A;  3BK2 A;  1NYQ A;  1E10 A;  4JPS A;  4N59 A;  1MVK A;  2LFI A;  5EE9 A;  2LUM A;  3GP7 A;  2BS2 B;  1T3Q A;  1WSP A;  2E6X A;  5AUI A;  3EA6 A;  1OQR A;  2QIE B;  3R2T A;  4M0W A;  1WRI A;  1YN3 A;  2MJD A;  3SFD B;  4DQO C;  3AEE B;  1SSN A;  2RPV A;  3O13 A;  5EE0 A;  3FAH A;  1IUE A;  2L83 A;  2YEP B;  5G5G A;  2Z8L A;  2BS4 B;  4RGO S;  1SE3 A;  1XCT L;  2VZK B;  2WQY B;  3BYY B;  1ESF A;  1C4A A;  1YNT E;  2PW9 A;  3V3X A;  2N9K A;  2WXN A;  3DWM A;  3MFG A;  1D5M C;  4ZHP A;  2ACZ B;  1D4B A;  3U4E G;  3ABV B;  3AED B;  3U7Z A;  1WWT A;  3AB5 A;  2RMM A;  2FUG 1;  2D5G A;  4RNA A;  4TQ1 A;  2HDE A;  4HEA 1;  1T6B X;  1TJE A;  5HI1 A;  2KN4 A;  4EE2 A;  3NVY A;  3AM9 A;  4MT5 A;  1IBX A;  2WXH A;  5HG2 A;  4ZRP A;  4RH6 A;  1VDV A;  4N58 A;  4P6V F;  4TMA B;  1MI0 A;  4YTN B;  2WXM A;  2JSV X;  3NUH B;  2IGG A;  3CWI A;  4Q2J A;  1JWU D;  1FNV A;  2Y5C A;  1QIL A;  3BVM A;  1PDX A;  3P4R B;  2JX5 A;  2KDM A;  3TUO A;  4CQN A;  5AUK A;  2INN E;  4YTM B;  5C2T B;  5BMI A;  3RPF C;  3AE7 B;  2WXR A;  3NZ3 A;  1CJE A;  4O1N A;  4XE0 A;  4RGT A;  3AE8 B;  3ZJU A;  5LNK 1;  1ZDV A;  2BB6 A;  1FM0 D;  4ITK A;  1B9R A;  1PGB A;  1BUI C;  1DGJ A;  4MH8 A;  3BZD B;  1MHX A;  1PUT A;  1VZ6 A;  2L32 A;  2PTL A;  1ENF A;  2GRI A;  3DWG C;  2KWD A;  2QJL A;  1XLO A;  1E0Z A;  1ET6 A;  3Q69 A;  5TSS A;  1IBX B;  1FNU A;  1HXY D;  1TY2 A;  2AX5 A;  3J9C A;  4HRS A;  5D7G A;  2FE8 A;  5BMG A;  3AE1 B;  2RDH A;  2IDY A;  2W82 A;  1V1P B;  3KQ4 A;  2W3R A;  3SFE B;  1Y56 A;  2R61 A;  1TKY A;  1EWC A;  2I38 A;  2QIL A;  3SEB A;  2EEL A;  2LEK A;  2PMV A;  3AE6 B;  2X38 A;  3AE3 B;  4LLG M;  1SF0 A;  3Q8C A;  1JWB D;  3AEG B;  1QOB A;  2Q5W D;  2IGD A;  1FNW A;  1ROE A;  5FKA C;  3MJ5 A;  4N6E B;  3MP9 A;  4US8 A;  4ARC A;  3ZJV A;  2INP E;  1QKZ A;  2K0P A;  3I57 A;  1L0Y B;  1WYG A;  3B9J A;  1I4X A;  2GB1 A;  3OWE B;  2WS3 B;  1JW9 D;  3HVZ A;  1YMH E;  1HA5 A;  2M56 B;  1FEH A;  2IJ0 A;  2WXI A;  1M4V A;  2WXL A;  2RDG A;  3BVZ A;  1KF6 B;  3KLS X;  1NEN B;  3Q8F A;  2WU2 B;  2PVO D;  3UI3 A;  1F2R I;  2B76 B;  2M19 A;  2BTE A;  4RCO A;  1GOZ A;  1RM6 C;  5BYQ A;  1IGD A;  1ZXH A;  2JU6 X;  4L1B A;  1STE A;  4OZA A;  2ZW0 A;  1QOA A;  1N60 A;  3BII D;  4C7Y A;  4AS1 A;  2Y5P A;  2WLB A;  4RF0 A;  5BYS A;  1CK1 A;  3P4S B;  2WXO A;  4C56 C;  1L5P A;  2KAJ A;  1J7C A;  5HFY A;  3GB1 A;  1FXI A;  2NTS A;  1AW7 A;  2V4I B;  4YSZ B;  1HZ5 A;  2EKI A;  1ZUD 2;  2BBC A;  1I4P A;  1NEK B;  1KLG D;  2J53 A;  3HVD A;  4ZRQ A;  1FCC C;  1I4Q A;  3W5V B;  1N61 A;  3AEA B;  3SR6 A;  4RFB A;  3AMZ A;  3EGR A;  2V0G A;  1I4H A;  3VR8 B;  2Y3A A;  1PYW D;  1FFU A;  4HKQ A;  2DYO A;  2GI9 A;  2WDR B;  2K22 A;  1FO4 A;  2PLP A;  1FIQ A;  1T5X D;  3AE4 B;  2ON8 A;  3AV8 A;  3AN1 A;  3GS2 A;  2JZP A;  2V3P A;  1D6E C;  3KWV A;  1P7E A;  3W5U B;  2PVG C;  3IXS A;  4MAC A;  4C80 A;  1IGC A;  2G1E A;  3MHZ A;  1C79 A;  1SE4 A;  1SJH D;  3W9C B;  3TEW A;  3AE9 B;  1JRP A;  1B1Z A;  4YWG G;  1V1P A;  1XCQ L;  5E6J A;  1YQ4 B;  2BB5 A;  1OQQ A;  4R3D A;  2JYT A;  3B2F A;  3NVV A;  1PGA A;  1K50 A;  3LYY A;  5H92 C;  2LMC A;  3T3N A;  2CU3 A;  1D5Z C;  1V8C A;  4IDI A;  1SB3 C;  1KTK A;  1PFD A;  1OFF A;  1QQR A;  2IGH A;  1NYR A;  1YN5 A;  1J7A A;  3IT6 B;  3ZYY X;  5I4D A;  4IOI E;  2M0A A;  4FXC A;  3AE5 B;  4A55 A;  4XWT A;  3P1M A;  3TEX A;  2V3N A;  1CQV A;  3T3O A;  1N5X A;  4REZ A;  2W55 A;  3C8Y A;  1TKE A;  4TQ0 A;  4YTP B;  1ZE3 D;  2TSS A;  3Q8B A;  3MC0 B;  4C7Z A;  1L4Z B;  3P42 A;  1GB1 A;  1L0V B;  2DWQ A;  2IPK D;  4RGM A;  1TS4 A;  4WIP A;  2L1A A;  1JWA D;  2WU5 B;  2CJN A;  1K51 A;  1AYF A;  1J7B A;  3P4Q B;  1F2R C;  1QOG A;  4B0E A;  2KQ4 X;  4HJG E;  2WXK A;  3R2I A;  4RF1 A;  2NMQ A;  2BYT A;  3R8B A;  2HTM E;  3P63 A;  3Q8E A;  1FRD A;  1VZ8 A;  1C4C A;  4WH4 A;  3W2D A;  1YJJ A;  4WQM A;  3PZ8 A;  1CZP A;  2QEJ C;  2MJ3 A;  1GAQ B;  4ZYS A;  1ZPS A;  4DXF A;  1Q10 A;  5HHD G;  1YN4 A;  3AEC B;  2AQ2 B;  3N9Y C;  1N62 A;  2ONQ A;  1TS2 A;  2I2Y A;  2OED A;  2K9X A;  1TS5 A;  3EUB 2;  3FC4 A;  1VR9 A;  1L0X B;  4JE3 B;  2YEP F;  2J4X A;  3KWL A;  3AH7 A;  5GXG B;  3U2S C;  4L23 A;  1KFY B;  1C4P A;  4US9 A;  4JWS C;  1TZO A;  1FCL A;  2KAC A;  1C78 A;  5BMH A;  4H2A A;  1TS3 A;  3PO0 A;  3Q8A A;  4ZOH C;  2KMM A;  4YXD B;  2VZK D;  4ZHO A;  3ZJT A;  1JAL A;  2WXG A;  5D3D A;  2WXP A;  1MHH E;  1L6V A;  1VZ7 A;  1XO3 A;  2G9H D;  3URY A;  3W1S A;  1RYJ A;  1QT9 A;  2H89 B;  1RFK A;  2W54 A;  4LK0 M;  5D3I B;  1GB4 A;  1FXA A;  5MPO A;  1DOX A;  2PIA A;  3AE2 B;  4WAF A;  3WCQ A;  4RGN A;  4A9A A;  4LTU A;  2JYE A;  5FR3 A;  1N63 A;  1UWX A;  3NVW A;  3B2G A;  1EWY C;  3E9S A;  3HRD D;  2PKO A;  3VR9 B;  1K53 A;  1NI3 A;  1L6U A;  1HEZ E;  1WXQ A;  1XLP A;  3PZ7 A;  2J52 A;  4MM3 B;  1AWD A;  2NTT A;  1E7P B;  3CIR B;  2MEK A;  1V1O A;  4J3O D;  4HKZ E;  1I4R A;  2WDQ B;  4KKJ A;  4NAW B;  4OZC A;  4IKG A;  1QF6 A;  1FMA D;  2WNM A;  2N9L A;  4OZB A;  1RWS A;  3TEY A;  2E3T A;  4JX1 C;  1TYG B;  1UNS A;  1ZDX A;  1JRO A;  4OW0 A;  3IAM 1;  2LJI A;  4OVZ A;  1C76 A;  5G5H A;  1C9F A;  3NRZ A;  1YQ3 B;  1ZXI A;  2ICI A;  4YSX B;  4WUR A;  3IT4 B;  4L2Y A;  4AQ7 A;  2FBW B;  2J42 A;  4GDL B;  1XLN A;  3BVG A;  1N5W A;  1C77 A;  5T8I A;  2WXQ A;  4UDU C;  1XLQ A;  4P16 A;  4YSY B;  3L4P A;  1XEE A;  2WXJ A;  1P7F A;  1I4G A;  1NVI D;  1QOF A;  2W3S A;  4A90 A;  1SIJ A;  2XNA C;  3BWU D;  2L52 A;  1FFV A;  1UGJ A;  1SBB B;  2BS3 B;  2DYM A;  4KGT A;  1QLB B;  3AEF B;  2QMT A;  3FIL A;  1YJI A;  3NVZ A;  5EE3 A;  1SXT A;  3P4P B;  2WXF A;  5EE1 A;  4A6Q A;  1LO5 D;  3H8H A;  4WWM A;  1D5X C;  1MPE A;  4HRO A;  1HQR D;  2SEB D;  3VRA B;  3E56 A;  1EU4 A;  3ETR A;  4B0M A;  4NJC A;  1KH0 A;  4TSS A;  1JWM D;  2LHE A;  3IAS 1;  1BML C;  1E6E B;  1K52 A;  1VJK A;  2K3U A;  2N0S B;  1XF5 L;  1R7S A;  3LXF A;  1JML A;  2LHD A;  2AQ1 B;  2JQR B;  3VRB B;  1SEB D;  4PT5 A;  2DBY A;  1TKG A;  1UWM A;  1V97 A;  1VRA B;  2WDV B;  4NZL B;  1HZ6 A;  4USA A;  3BYT B;  1JWS D;  2K5P A;  3TSS A;  2CJO A;  4GLS C;  5H8Y E;  4XDD A;  3V05 A;  1KLU D;  1WGK A;  2MH7 A;  3HUI A;  5FK9 C;  4DXG A;  3FIL B;  1DYQ A;  2WP9 B;  3U52 E;  3ZGZ A;  1GPX A;  1JQ4 A;  1EM7 A;  3RFZ B;  3BK1 A;  4ARI A;  2DLB A;  3AEB B;  1ZP0 B;  2JXT A;  1FRR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...