2LEKA

Solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325
rcsb
source organism Rhodopseudomonas palustris
molecule tags Biosynthetic protein
molecule keywords Putative thiamin biosynthesis ThiS
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lekA00
1PDXA 2WU2B 2BT6A 1XLOA 1KF6B 1GAQB 2BS2B 1JRPA 1RM6C 1UWMA 2L83A 1NEKB 1OQRA 1RYJA 1SIJA 2WU5B 2Y5CA 3KWLA 3PO0A 3WCQA 5H8YE 3SFDB 3P1MA 4WQMA 1YJIA 3AEAB 5MPOA 1FIQA 1NENB 1N61A 1CJEA 1RFKA 1ZXIA 1I7HA 2PKOA 5C3JB 1N62A 3AE3B 2DWQA 4USAA 3NVWA 3AE6B 3AE8B 4YSZB 2JX5A 3DWGC 3P4QB 1KRHA 3W5VB 3NVZA 1E9MA 1NVID 1NYRA 2KMMA 1ROEA 3B2GA 5AUIA 3W9CB 1SB3C 1WRIA 3AE7B 2EKIA 1YJJA 2PIAA 2W3RA 2MJ3A 1FFUA 2Q5WD 4JX1C 5EE9A 4ZHPA 2M56B 3AE2B 1JW9D 4YT0B 3LB8C 1R7SA 2CJOA 2QIEB 1L0VB 2PVOD 2ACZB 3SR6A 2K9XA 2WLBA 1WXQA 3SFEB 1QF6A 1SF0A 3AEDB 2K5PA 3ETRA 3HVZA 3NVYA 5EE1A 1AWDA 2B76B 3RPFC 4A9AA 4HRSA 3VR8B 4YXDB 1WGKA 1FRRA 2QJLA 2W54A 4YTNB 2FBWB 1GPXA 2WQYB 1EWYC 3AEGB 1FO4A 3FAHA 4YTPB 1JROA 2E3TA 3CWIA 1E0ZA 1QOBA 1QLBB 3AH7A 3AV8A 4WWMA 2L52A 1L6VA 1FXAA 3AE4B 1L6UA 1J7AA 3AEEB 4YTMB 1V8CA 1IUEA 1FRDA 5EE0A 5GXGB 4N6EB 1N5WA 2WDVB 1PFDA 4ITKA 3AEBB 2H88B 1TYGB 2KAJA 1N5XA 4C7ZA 3B2FA 4FXCA 4LTUA 2WS3B 1ZP0B 3AB5A 1ZOYB 4US8A 2G1EA 3AE9B 1YQ3B 5AUKA 1AYFA 1ZUD2 2MJDA 3W5UB 2PVGC 1WWTA 2BS4B 2H89B 1FFVA 2MJEA 2M19A 2K22A 4C7YA 3NVVA 1J7BA 2OHFA 1T3QA 1OQQA 4P6VF 5C2TB 3HUIA 1RWSA 3FC4A 3CIRB 3ABVB 1QT9A 2WDQB 1TKYA 3LXFA 4N59A 5G5HA 3NS1A 3EUB2 1DGJA 1PUTA 4YSYB 5EE3A 1FM0D 4JWUC 3P4SB 1TJEA 1VLBA 3AECB 1N60A 1N63A 3VR9B 1B9RA 5G5GA 1NI3A 1JWBD 2HTME 1E7PB 1OFFA 1L5PA 4KX6B 2WDRB 4C80A 3HRDD 1DOYA 1WYGA 3NRZA 4IDIA 2CJNA 1CZPA 1TKGA 1YQ4B 2W3SA 4US9A 4JWSC 3AE5B 3AN1A 1V97A 3B9JA 3P63A 1JQ4A 1DOXA 3BIID 2WP9B 1NYQA 1VDVA 2N0SB 3L4PA 2JQRB 2BS3B 1J7CA 3ZYYX 1FXIA 2CU3A 1XLNA 2MH7A 3P4PB 4HROA 2W55A 1A70A 1DOIA 1FMAD 3AMZA 1QOGA 2AX5A 3AE1B 4ZHOA 1QOAA 3VRAB 3DWMA 5H92C 4ZOHC 1E6EB 1VJKA 3AEFB 3AM9A 1XLQA 1QOFA 1TKEA 1E10A 1XLPA 1KFYB 2DBYA 4YSXB 1JALA 1F0ZA 1JWAD 1XO3A 2LEKA 3P4RB 3VRBB 4N58A
chains in the Genus database with same CATH superfamily
2KMAA 1PDXA 3TL5A 5HKHA 2XN9C 4XGAB 2K6DB 4W9EA 1UNSA 1YN3A 4ASWC 3QWZB 1V1PA 2WX0A 1YOVB 3UIPB 3KW5B 2KFJA 1EM7A 3WIMA 4DK5A 1SE9A 4OVVA 2KVZA 4EFOA 4I6LB 2M0XA 1V2YA 3W2DA 1YX6B 1XCQL 2W3RA 4LK0M 1JW9D 2KACA 1UBQA 3R3MA 1GG3A 1YNTE 3KYDD 4ZYSA 1WZ0A 2MBBB 3IT6B 3WAPA 1MHHE 1WMHB 2BYFA 4DXFA 2GBJA 3GZNI 1E0ZA 1WR1A 3ZNZB 1RFAA 3UIOB 5HFYA 1TBEA 4KV2A 3NY5A 2I1KA 2RSUA 3KH0A 1WX8A 1LGRA 3V61A 2WNMA 2G4SA 3E56A 4B6WA 1V6EA 1I4PA 5AUKA 1AYFA 2MJDA 2BS4B 3KYCD 3DVNU 1FFVA 1ZE3D 2JU6X 2LJ5A 1L0XB 1D5ZC 4URKA 4M8NA 5C2TB 3APCA 4IWOA 2ZJDA 3P4SB 1Y56A 2SEBD 2WDRB 1YQ4B 3PGEA 4X57B 5TSSA 3DVNV 2BWES 1V5OA 4CO7A 3HK0A 4AJWA 1UH6A 5HG2A 2V1YA 5C1ZA 4JIOU 2QCZA 4PT5A 3VHTC 1M4VA 2L83A 2TSSA 1D3ZA 5LLIA 3AEAB 3MJWA 4XYCA 4HLEA 1I7HA 2DYBA 4LJPB 3BWUD 2FIFA 1SJHD 5BYRA 4FLHA 2AQ3B 2GOWA 3NVZA 1C3TA 5KHQA 3W9CB 2O2VB 3L0WB 2MP2A 3UGBB 2ZPYA 5JXVA 2WLBA 1WY8A 3ZQ4A 2L0FA 4ANXA 2VZKD 4GLSC 3A9JB 4PYUA 1QILA 4XC2A 2WXMA 4M02A 4GDKA 5EE0A 5GXGB 2JY6A 1TZOA 2R61A 3AEBB 3KWVA 4FXCA 4MSMB 4EUTA 2INPE 2WXHA 1BUIC 2DYOA 2UYZB 2FCQA 3EFCA 4PS8A 5IA7A 2LGYA 2V9HA 3H7PA 4IW0A 1VR9A 2RPQA 1TIFA 2BVCA 3U2SC 1J19A 3ZNHB 3H8HA 3EFUA 3VQIA 1TKGA 2CHZA 3B9JA 4OZAA 4IC7B 2CU3A 1XLNA 4A3OA 4K3BA 3EC8A 3H6NA 5FKAC 4G11A 3M63B 3ENEA 1XLQA 3EHVA 2X38A 1WXSA 4WURA 5DPRA 2C7NB 2BT6A 4HWIB 1SIJA 3PRMB 1CJEA 3QHTA 2N9KA 2NTSA 1N62A 2NCNA 1I4HA 3AE8B 4QAYA 5DPSA 4B95A 1HTQA 1NYRA 2BW2A 2KDMA 2ONQA 1WFYA 4HDOA 4PYZA 4OVUA 4XDCA 1ZGUB 1YX5B 3VDZA 1H4RA 3UINB 3ETRA 2L1AA 4XWWA 1V49A 3QX1A 1WGDA 3UI3A 1WGKA 3PV1A 2KN4A 3NG0A 5JH5C 3DBLB 2K8BA 2KT7A 1WSPA 2PPHA 4JPSA 4EZJA 2L52A 3NJTA 2MQJA 3TEXA 1N5WA 4E71A 5G55A 4TQ1A 1N5XA 2IPKD 4XE0A 2BGFA 3IVFA 2WXJA 4LDTD 2HTHA 2VZKB 1WX9A 1FNVA 1ZXHA 3H1UA 2OHFA 4ZRKA 2W82A 3VTWA 1HXYD 1XEEA 2N9PC 3AECB 1VLBA 4ARCA 1J0GA 3BZDB 1L5PA 3ZDMC 4IDIA 4M0WA 4BKSD 2WP9B 2N0SB 1SSNA 2Z8LA 4K3CA 2CHWA 4HCPB 2AX5A 4ZHOA 4TMAB 3M62B 1T5XD 3JSVB 2GBKA 3TUOA 3NZ3A 1F77A 3R7QA 1WJ6A 3ZXRA 4RNAA 3SD5A 3AE3B 1UD7A 1UWMA 5CHFA 2N7EA 3W1SC 3C8YA 1C9FA 1UUPA 3CF6E 3N1XC 4DHZE 4YL8A 2IGHA 4HPPA 5C3JB 2HJ8A 1MG8A 2DWQA 4USAA 4MGKE 4AWJA 2WXOA 2BBCA 2LI5A 2O2VA 1NVID 3TIXA 4TKNA 3AE7B 3MTNB 4II2B 1BMLC 3A33B 2FCSA 3DDCB 4UDUC 4EEWA 3DHHC 1C79A 3RNFC 3R8BA 3BK2A 2PVOD 2WXPA 1T0YA 2DAJA 2KX0A 2K3UA 1LM8B 5EE1A 2L76A 2MA9B 2MRPA 3RPFC 3VR8B 4MEMA 2M1MA 1FRRA 1EWYC 3QCAA 2Z59B 1I4RA 5IO9A 1L6VA 2JVCA 1WXMA 4YTMB 2GLSA 1V8CA 3A1QA 3V05A 3B08A 2BQQA 1WZ3A 3OAWA 3OWEB 1IBXB 1ET9A 2AQ2B 3URYA 2K1FA 4H2AA 3BYYB 3C19A 3ZW3A 2M19A 1NI2A 3PZDA 5DPWA 2AL6A 1OQQA 1HA5A 1YIWA 1G6JA 3Q8BA 1WX7A 2RMMA 4NAWB 3JSVA 5HHDG 1LO5D 1B1ZA 3APFA 1B9RA 4ARIA 1NI3A 4KX6B 3FKYA 3NZUA 2WXRA 1UBIA 2G45B 4JWSC 3ZKJC 3P63A 1V1OA 3EECA 5E6PA 4DDID 2G9HD 2RDBC 3O65B 3OJ3A 2CS4A 2W55A 4W9KA 1DOIA 2LRUA 1TS2A 2PLPA 3P2BA 1U4AA 1XD3B 2INDC 2O6VD 3ZXVA 1JALA 2BTEA 4ZRIA 2NBWB 1IPGA 3VRBB 2K39A 4NY0A 2ZW1A 2OJRA 3KWLA 1RYJA 3MFGA 3VFKA 2QEJC 2KNBA 1FCLA 5BYQA 1ZKHA 1E5WA 3T8MA 2V3SA 2KK8A 4HXDA 4GMVA 1E9MA 4TUUA 4BOZB 2BYVE 2WXIA 3KQ4A 2BKFA 4B0MA 3ZIMA 3DBHB 4R3DA 3LYYA 4JGHB 1R7SA 4AOFA 3S2AA 2K9XA 1VCBA 3HVZA 1Q10A 3JYUA 5E6OA 4YXDB 2KQ4X 3QJZA 1TS4A 1YN4A 1C78A 2L32A 2KC2A 3QIJA 1FO4A 2C60A 3AV8A 4BOSC 2WDTB 3AEEB 4HVBA 1LQBA 5BMGA 1YMHE 2A5UA 3APDA 3AXCA 2XK5A 1RAXA 2FUHB 3A9KB 2IY1B 3AE9B 1ZUD2 4ICUA 2K22A 2NS5A 1BT0A 4HKQA 1WM3A 1WJ4A 4KIKB 3CIRB 3PRZA 1CQVA 2QDFA 2KD0A 4N59A 3TJPA 2BB6A 2KWDA 4AQ7A 2JYEA 2VH1A 5JHAA 2W3SA 4PK1A 3ML8A 3N1ZC 1KLVA 1VZ6A 3Q8FA 3QK0A 1A70A 3Q3MC 1GUAB 2KN5A 4ZOHC 1JWMD 2REXA 2Y5PA 5BYSA 1XLPA 2LXAA 1SBBB 4WWOA 4ZYNA 2AQ1B 3WAMA 1OQRA 2SAKA 2XNAC 3N3KB 3Q3OC 1UZXB 4RGMA 1NBFC 2IYDB 1MI0A 1OQYA 3GZNB 4F8CB 2KJRA 1LXDA 1OEYJ 2DZMA 1XXGA 2DX5B 1D5XC 1FFUA 4MJSB 2YLMA 3ONSA 4I6NB 4IWQA 1AARA 1I42A 1NDDA 2LVQA 2DLBA 4II3B 4NJ7A 2W54A 3FILA 1GPXA 1Z5SB 2GRIA 1JROA 1D5MC 1AW7A 3ZRCA 1E8YA 4FHKA 4A20A 2J0MA 1TT5B 4MH0E 1TYGB 4GN1A 4K7SA 3L08A 1E90A 4WJQA 5IP4D 1M94A 3VUWA 1JRUA 2EMTA 2LZ6A 4GDLA 4FJYA 3VUXA 3HM3A 5CTRC 4NAWA 3IG3A 3U7ZA 1TKYA 1OEYA 3ECIA 5DCNA 4DHJD 4JWUC 1OTRB 4P1CC 4EZKA 3GE3C 3DHGC 1I4GA 1SXTA 3VVWB 2MHJA 3N9YC 3BINA 1MVKA 3E9SA 5CX3A 5L83A 1FD6A 2IO1B 2ZNVC 4BBNC 1TS5A 4RMAA 3P4RB 1T0RC 1CK1A 1XLOA 1GAQB 1JRPA 1RM6C 1QF6A 3PO0A 1WIAA 3DBRB 4BKTA 1ZXIA 4GSWA 1MJDA 1XF5L 3Q3NC 4RFBA 2WXKA 2PEAA 2GBRA 4LJOB 2KMMA 3J9CA 1WRIA 1R4MB 1WI0A 5AZHA 1T0QC 2D11A 3ZJVA 4OW0A 1E7VA 4A3PA 2JXTA 1SF0A 4LNNA 4DXGA 2LVPA 1P3QU 2KDEB 3A4SC 1KOTA 1WMHA 4YTNB 4YTPB 2KJ6A 4WJOA 1FNWA 2GI9A 3AE4B 3TEZA 1N6ZA 2KYWA 1FRDA 2QMTA 2WDVB 3DBSA 1UF0A 4MDKE 3PHWB 1WXVA 1Y8RC 2EMSA 1GB4A 4IM2A 3Q6BA 5C23A 2WGSA 2AWTA 1QKZA 2PE9A 5E6JA 4WAFA 1KLUD 2N1VA 3DVGX 1MPEA 1V81A 4FADA 3T9LA 4HJKA 1WYGA 4NJ6A 1D4BA 1E8WA 3AE5B 2DNFA 2ZEQA 3PPAA 3BIID 1KH0A 2BS3B 2YVCA 4W9IA 1P1AA 2X8XX 2XK5B 4HROA 3KUZA 3QARA 1TS3A 2K8HA 1HTOA 2ZPNA 2WHIA 4YSXB 5I4DA 2MCNB 3WANA 2ON8A 3T3OA 2KLCA 4EZLA 2N1WA 2D2QA 1N61A 2MBOA 1ACCA 2DENB 2PKOA 4GOCA 4E74A 3I3TB 4XZ4A 5AZFA 3LJ3A 1WE7A 3KUDB 3O13A 4J6IA 3W5VB 5AUIA 4JX1C 1HQRD 4M8MA 3MJ5A 4MACA 2ASQA 4A90A 2ACZB 1V9JA 1C4CA 4A8XC 3PREA 2RPVA 1WH3A 3NS8A 2QSDA 3FILB 2PMVA 4OVZA 4OZBA 3DOWA 3AEGB 2R2OA 1QLBB 1FXAA 1TTNA 5BMIA 2CU1A 4BKGA 2ZVOA 3X23A 4US8A 1PYWD 2INCC 3W5UB 2JXXA 4B9KA 2V4IB 3UQAA 1CMXB 3DQVA 2KTRA 4NQKE 2BF8B 4PS3A 1GB1A 1QT9A 1EU4A 1FM0D 3N20C 2WWZA 3N32A 4DXAB 4EE2A 4ACFA 3Q8CA 3Q3JA 5HI1A 3SEBA 2JPHA 4HKZE 5IOIA 3RFZB 3VH3B 3A1QB 2CR5A 3ZVVA 3R2TA 4KKIA 5J2RA 2IO0B 4WJPA 2BB5A 1QOAA 2D3AA 3AM9A 5D6JB 1E10A 1P7FA 3VAWA 1WE6A 5FR6A 3VXWA 3U30A 2LRWA 3DBHI 1KJTA 4US9A 1EU3A 1KF6B 1R4MI 3MC9A 4GXBA 2E6XA 1VZ7A 4RF0A 1K51A 2JUOA 3RULA 4GU2A 4RGTA 5FK9C 2GB1A 1JCKB 2M8SA 3QC8B 4ZRJA 3BVZA 3P4QB 1ZDXA 3PHXB 3RN9C 1I35A 3RNBC 2LGSA 3ZLZA 4ZHPA 2J7QB 2LFIA 2M56B 3PVLA 1L0VB 1X1MA 1WXQA 2JWUA 3QQ8B 1IYFA 1GOZA 2JWZA 1C1YB 2FUG1 3R2IA 2MWSB 4W9FA 3CWIA 4W9JA 2Z0DB 1QOBA 4IOIE 2KFKA 3AH7A 3PTFC 1YN5A 3AI5A 2KWUB 1YJ1A 3GP7A 2IY0B 1JMLA 4ITKA 5GMVA 4KGTA 4ANVA 1SE3A 4OZCA 4KZ0A 1ZP0B 1C4PA 1IGDA 2KDIA 3X0WA 1A5RA 4RGNA 2YEPF 4XX5A 4P6VF 2NTTA 4JE3B 4F1SA 5FR3A 3LXFA 4C00A 1N60A 3VR9B 3DHIC 1JWBD 4M0WB 2RDHA 5AEKB 4HPLB 4KZCA 3L4PA 1J7CA 4OHJA 4WIPA 2MBHA 3VTUA 4IM0A 1VJKA 2KTFA 4K7UA 4AJYB 3DVGY 1JWAD 4ZRPA 1MFWA 3KLSX 2G4DB 3HHMA 5H8YE 3P1MA 1VZ8A 1UGJA 2IBIB 3TEWA 1YQBA 4RH6A 2ZW0A 4MELA 1TY0A 4RF1A 2L7RA 3P42A 2GBNA 5T8IA 1WGGA 2L3ZA 2ZVNA 3NOBA 1KRHA 4FBJB 1L4DB 1SB3C 4GIVA 1FEHA 1XT9B 1K8RB 2WYQA 3RZWC 4WJNA 4P1BC 2CJOA 2LGIA 3W1SA 2KTRB 3R7RA 3A9KA 2KOXA 2FBWB 1QQRA 5IKCM 4MGYE 1R4NI 2E3TA 3WAOA 4J3OD 3B0AA 1K50A 1PGBA 2K8CA 1L6UA 1IUEA 3N30A 5CHWA 3L17A 2A4ZA 4L23A 3RNGC 3AB5A 1V80A 1ZOYB 2K25A 1I4QA 1YQ3B 4HEA1 1KLGD 4MM3B 4S17A 2J52A 5D7GA 4M01A 5JHBA 2V4LA 2LUEA 2LHDA 3NVVA 1Q5WB 2J0JA 3ABVB 1WJUA 2RDGA 4YSYB 2BYTA 2I38A 5D94A 3Q69A 4LNOA 4D2KA 1BXTA 4RCOA 1MHXA 3BK1A 3CSTA 1VDVA 4FJVB 3ZYYX 3OG5A 2D07B 2MX2A 2V3PA 4P7IA 5L95C 4P16A 2WXGA 3V6EB 3BVMA 1KTKA 1ZPSA 2M0AA 4XDDA 3RZFA 2IGDA 4DHZB 1RLFA 4FJZA 4WQMA 5IAAC 2L05A 4GDLB 2IGGA 4TQ0A 3M95A 2JZPA 4LNIA 4WWPA 4L1BA 4FA6A 2HD5B 2ZZPB 4TSSA 2PIAA 3RMKC 2LGXA 3AU4A 5IN7A 3SR6A 4IM3A 1V86A 2JRHA 3VUYA 2WXQA 3RT3B 3RCZA 3RNEC 4HK2A 2RGFA 4BKSA 3K9OB 2CHXA 4WWMA 1FXTB 1SGHA 2INNE 1L2NA 2H88B 3VTVA 4TV3A 2VRRB 2KMCA 3ZNGC 5D2MB 4C4VB 2V3NA 1WGYA 4PS7A 1WXAA 3HUIA 4W9LA 4KGSA 3MHSD 3IBEA 3V3XA 2G3QB 1E7PB 2O6VA 2BWFA 3HRDD 4XWTA 2KQSA 2JZZA 3L13A 5LXIB 4FHJA 4WWNA 3V6CB 5BMHA 5J17A 2D5GA 1VD2A 1ENFA 2DYMA 1PQSA 4HDQA 3RNAC 1EF1A 2DBYA 3ZNID 2C7HA 1HZ6A 4N58A 5DPTA 3TSSA 4AP4C 4NZLB 3WCQA 1EF5A 1F2RI 1YJIA 1ISNA 4NAMA 1GC7A 1RFKA 3WALA 3V62A 2IO2B 2MW5A 1K52A 1XQQA 2FNJB 4O1NA 4YSZB 3DWGC 1SE2A 4MJSA 2EKIA 1ESFA 2FIDA 1OGWA 2NPTB 2MJ3A 3ML9A 2C5LC 1V1PB 3SFEB 2KO3A 1GC6A 5KHOA 1AWDA 4A9AA 2I1JA 2LGDA 4MSQB 3PZ8A 4G50A 4FN2A 1P0RA 2PW9A 3KUCB 1UELA 3AU5A 1WJNA 4GDKB 3QAQA 3B2FA 3PRPB 2O6VB 4MM3A 2H89B 2M4NA 2Z0EB 5E6NA 4KSLC 3VH4B 4ZDVA 1T3QA 3ZRFA 4DHJB 4NJCA 5G5HA 2D3GA 1DGJA 4Q2JA 3H7PB 5D3DA 5G5GA 1OFFA 2CKHB 2WXLA 3N1YC 2CJNA 4BFRA 1YD8U 3Q8AA 4DBGA 2MBEA 3P4PB 2DZIA 3GOEA 3AMZA 3PT2B 2B3AA 5G2NA 1WYWB 2AEHA 1IBXA 1TKEA 4BZAA 2NMQA 3V60A 2OEDA 2LASA 3OJ4B 4ZRQA 2L8JA 2WU5B 2Y5CA 2FCMA 2LJIA 1WGHA 2C7MB 1C76A 2XEWA 5J18A 4B0EA 3ZJUA 1F9JA 2PTLA 3AE6B 4JL9A 4ICVA 3U8ZA 5BO4B 3I57A 1ROEA 4KGRA 3UF8A 3AE2B 3SU8X 3DCGA 3ALBA 3AEDB 3GE8C 1C77A 2N9LA 4MT5A 2UU7A 2N7JA 1Q1OA 3CMMB 3ZTCA 1HE8A 3IAS1 2MP2B 4BAXA 4BVUC 3IXSA 2VH2A 3TCAA 2ZCBA 3IT4B 1R4NB 2JYTA 3HIZA 3GS2A 3PLVA 2AL3A 2KAJA 1MG4A 2KQ7A 2OOBB 1TZ1A 2WS3B 1EUVB 2I2YA 4LNFA 3LDZE 2RR9A 1HZ5A 4REZA 2MJEA 3PS6A 2L0TA 4C7YA 2MBQA 1RWSA 2IZVB 2KDFB 2LVOA 1PGXA 1PUTA 1QZEA 2KVRA 1N63A 1SIFA 2HJ1A 4LNKA 2DZJA 2DHZA 4KDIC 4K7WA 2KANA 2ICIA 2JQRB 4I6PA 2KFKB 2GBMA 1TY2A 3Q8EA 3EA6A 2KJHB 2NPTA 1XCTL 1QOGA 3AE1B 4WQOB 4G3XB 3VRAB 4C4VA 2NVUI 3ZUNA 3WA0A 3HVDA 4MH8A 1D6EC 1F0ZA 2LEKA 3L54A 2R2QA 3PSEB 2WU2B 3NUHB 1NEKB 1I4XA 4RGOS 4W9GA 2AYOB 3SFDB 1L7YA 1FCCC 3TEYA 1F1HA 2JZ3B 4KIKA 4YWGG 5CHVC 2JX5A 2NR2A 3PZ7A 4ANWA 2IO3B 2GMIC 3H7SA 1ZDVA 2C9WB 4N9F4 1PGAA 1TGZB 4GGQA 2KWCA 2EELA 4IKGA 4IUMB 2MLBA 4YT0B 1WF9A 2BYEA 2K5PA 4WH4A 2D3BA 4DDGD 1LFDA 2D3CA 2XBBC 2LWPA 4DQOC 5TR5A 2QJLA 2MSED 2FE8A 3FAHA 3IHPC 1STEA 3DBRI 1VRAB 2J42A 3MP9A 4N6EB 1ZW7A 3Q2AC 4F7ZA 1F52A 3DBLI 1AN8A 2YEPB 1WM2A 2L00B 2LD9A 4LTUA 3GB1A 1Q0WB 1IGCA 2J4XA 3MHZA 2N9EB 1RRBA 3I9V1 1J7BA 3Q14C 3FC4A 3RNCC 1J8CA 3NS1A 1L4ZB 3SHQA 1TJEA 3T3NA 1V5TA 2HTME 1L0YB 3NRZA 2J0KA 5LNK1 3AN1A 1F2RC 1JQ4A 2RD0A 2Y5BB 3D32A 1FXIA 4MGIE 2KLGA 3ZJTA 1EO6A 2JF5A 1P9DU 1E6EB 4FULA 1KFYB 2WX1A 4HCNB 3H9DA 3DPDA 1JWSD 4MGZE 4WAAA 4AUQC 2OJWA 3ZGZA 3UQBA 3ZDTA 3I63C 4CYEA 3L16A 2BS2B 2LUMA 4L2YA 4RM9A 5EDSA 2PE6B 4KDLB 5AZGA 2DAFA 2UWQA 1T0SC 3JVZX 4S0RA 3ZTDA 3ZO5B 3HM6X 2QC8A 2QILA 3U52E 1DYQA 4AS1A 3U4EG 3BYTB 2DZKA 2IJ0A 2N7DA 3LB8C 4EOYA 2FCNA 3MC8A 2WXNA 1FNUA 2B76B 1KM7A 3M3JA 4HRSA 2EKEC 4NQLB 4E3CA 2Y3AA 4HJGE 2KDBA 3IAM1 3KVFB 1J7AA 4DWFA 3AULA 1IP9A 3I5JC 3W1YA 3RUIB 4C7ZA 2KWVB 4ANUA 2G1EA 4A55A 1S1QB 1P7EA 2WDQB 5EE3A 2KXJA 3BY4B 4KSKC 3RI7C 3RD2A 2KX3A 2FAZA 2ZNVB 4W9CA 1JWUD 4C80A 1CZPA 4LDTB 1E8XA 2LHEA 4JLCA 2D10A 1WGRA 1FMAD 2ZCCA 5H92C 3OLMD 1QOFA 3JW0X 5JZEB 1Z2MA 2HDEA 3IFWB 3TBLD 3EGRA 1HEZE 5MPOA 4GB9A 3RYTA 4CQNA 3A9JA 2BPSA 3U7DA 4LCDE 4A6QA 1FIQA 1NENB 1C4AA 3PLUA 2NBVB 4K81A 2KZRA 3NVWA 4IWPA 4JQWC 4CHKA 3NHEB 3TMPB 2LXCA 3B2GA 3MC0B 1YJJA 2Q5WD 5EE9A 2IDYA 2QIEB 1WR6E 1SE4A 1E8ZA 3NVYA 4EKUA 4IG7B 2WXFA 2LMCA 5LXHA 2WQYB 1GJZA 2HE7A 4HPMB 1P98A 2NBUA 3R66C 3B1LX 1K53A 2BKRB 2K6QA 1PFDA 2JRIB 3NZSA 2V0GA 3CSFA 2JT4B 3C0RB 2M17A 1UGMA 4W9DA 1S3SG 4M00A 2K0PA 2KKCA 4KKJA 1SJED 1WWTA 2PVGC 4RM8A 2PJHA 2W9NA 5D3IB 4K1RB 2KHWB 1ET6A 4KVGB 3Q3FA 1FPYA 1EWCA 3EUB2 2JSVX 4G0NB 4W9HA 1DOYA 1T6BX 4BBNF 1V97A 1WRDB 1SEBD 1DOXA 1NYQA 3L10B 2N9XA 2MH7A 2KC1A 3K9PB 2J53A 2N4FA 1GNUA 4LLGM 3DWMA 4NNJB 1E7UA 1H8CA 3AEFB 4NPNA 3BVGA 4C56C 2MEKA 3A4RA 3SDLC 1XO3A 3QA8A 1UWXA 2QHOA
chains in the Genus database with same CATH topology
1PDXA 4US9A 1EU3A 1KF6B 2ZW1A 2WU5B 2Y5CA 2LJIA 1RYJA 2XN9C 3KWLA 1C76A 1UNSA 3MFGA 2E6XA 1VZ7A 4RF0A 1YN3A 2QEJC 1K51A 4B0EA 3ZJUA 1V1PA 1FCLA 5BYQA 1EM7A 4RGTA 2PTLA 5FK9C 2GB1A 1JCKB 3AE6B 3BVZA 3P4QB 1E9MA 3I57A 1ROEA 1ZDXA 2WXIA 3W2DA 3KQ4A 1XCQL 4B0MA 2W3RA 4KGRA 4LK0M 2LFIA 2M56B 4ZHPA 3AE2B 1JW9D 4R3DA 3LYYA 1R7SA 2KACA 1L0VB 2K9XA 1WXQA 1YNTE 2JWUA 3HVZA 1Q10A 3AEDB 1GOZA 4ZYSA 2FUG1 4YXDB 3IT6B 2KQ4X 3R2IA 1MHHE 1TS4A 1C77A 1YN4A 2N9LA 1C78A 2L32A 1FO4A 4MT5A 4DXFA 3CWIA 2N7JA 1E0ZA 1QOBA 4IOIE 3AH7A 3AV8A 3IAS1 1YN5A 5HFYA 3AEEB 3IXSA 5BMGA 3GP7A 1JMLA 1YMHE 3IT4B 4ITKA 2JYTA 4KGTA 3GS2A 2WNMA 1SE3A 2KAJA 3E56A 4OZCA 1I4PA 2WS3B 1ZP0B 1C4PA 2I2YA 1IGDA 3AE9B 5AUKA 1AYFA 1ZUD2 2MJDA 2BS4B 1HZ5A 4REZA 1FFVA 2MJEA 1ZE3D 2JU6X 2K22A 2YEPF 1L0XB 4RGNA 1D5ZC 4C7YA 4HKQA 4P6VF 2NTTA 4JE3B 5C2TB 1RWSA 3CIRB 1CQVA 5FR3A 3LXFA 4N59A 1PGXA 1PUTA 2BB6A 2KWDA 4AQ7A 2JYEA 3P4SB 1N60A 1N63A 1Y56A 3VR9B 2SEBD 1JWBD 2RDHA 2WDRB 1YQ4B 2W3SA 5TSSA 2ICIA 2JQRB 3L4PA 1J7CA 1VZ6A 3Q8FA 4OHJA 1TY2A 3Q8EA 3EA6A 1A70A 4WIPA 1XCTL 1QOGA 3AE1B 3VRAB 5HG2A 4ZOHC 1VJKA 1JWMD 2Y5PA 3HVDA 1XLPA 5BYSA 4MH8A 1D6EC 1JWAD 1SBBB 2LEKA 4PT5A 4ZRPA 1F0ZA 3KLSX 2AQ1B 2WU2B 3NUHB 1M4VA 2L83A 1NEKB 1OQRA 2SAKA 1I4XA 2TSSA 2XNAC 4RGOS 5H8YE 4RGMA 3P1MA 3SFDB 1VZ8A 1UGJA 1FCCC 3TEWA 2ZW0A 3AEAB 4RH6A 3TEYA 1TY0A 1MI0A 4RF1A 3P42A 1I7HA 5T8IA 3BWUD 1SJHD 4YWGG 5BYRA 2AQ3B 2JX5A 3PZ7A 1KRHA 3NVZA 1XXGA 1L4DB 3W9CB 1D5XC 1SB3C 1ZDVA 1FFUA 1PGAA 1FEHA 2EELA 4IKGA 4YT0B 5JXVA 2CJOA 2LGIA 2DLBA 2WLBA 3W1SA 2K5PA 4WH4A 3ZQ4A 4DQOC 2QJLA 2W54A 2FBWB 1QQRA 2VZKD 3FILA 1GPXA 2FE8A 3FAHA 2GRIA 1JROA 1STEA 2E3TA 4GLSC 4J3OD 1D5MC 1AW7A 1K50A 1PGBA 1QILA 1VRAB 2WXMA 1L6UA 1IUEA 2J42A 3MP9A 5EE0A 5GXGB 4N6EB 1TZOA 2R61A 3AEBB 1AN8A 1TYGB 2YEPB 4L23A 3KWVA 4FXCA 4LTUA 3AB5A 3GB1A 1ZOYB 2INPE 1IGCA 1I4QA 1YQ3B 4HEA1 2J4XA 3MHZA 1KLGD 4MM3B 2WXHA 2J52A 5D7GA 1BUIC 3I9V1 2DYOA 2LHDA 3NVVA 1J7BA 3FC4A 3ABVB 3U7ZA 1TKYA 2RDGA 3NS1A 1L4ZB 4YSYB 2BYTA 2I38A 4JWUC 1VR9A 1TJEA 3T3NA 2HTME 3U2SC 1L0YB 3H8HA 3NRZA 3VQIA 1TKGA 3Q69A 5LNK1 1I4GA 3AN1A 4D2KA 3B9JA 1BXTA 1F2RC 1SXTA 4RCOA 1JQ4A 1MHXA 3BK1A 3N9YC 1VDVA 4OZAA 3ZYYX 1MVKA 1FXIA 3E9SA 2CU3A 1FD6A 1XLNA 3ZJTA 5FKAC 2V3PA 1TS5A 1E6EB 1XLQA 1KFYB 2X38A 4WURA 4P16A 2WXGA 1JWSD 3P4RB 3ZGZA 3BVMA 1KTKA 1CK1A 1ZPSA 2M0AA 4XDDA 2BT6A 1XLOA 2BS2B 1GAQB 2IGDA 1JRPA 1RM6C 1QF6A 2LUMA 3PO0A 1SIJA 4L2YA 4WQMA 4GDLB 2IGGA 4TQ0A 1CJEA 1ZXIA 2N9KA 2NTSA 1N62A 2QILA 3U52E 1I4HA 1XF5L 1DYQA 3AE8B 4RFBA 2WXKA 2JZPA 2KMMA 1NYRA 2BW2A 4L1BA 4AS1A 2KDMA 3J9CA 2ONQA 1WRIA 4TSSA 3U4EG 3BYTB 2PIAA 2IJ0A 4XDCA 3LB8C 3ZJVA 4OW0A 3SR6A 2JXTA 1SF0A 2WXNA 1FNUA 2L1AA 3ETRA 4DXGA 4XWWA 2WXQA 2B76B 3UI3A 4HRSA 1WGKA 4YTNB 2KN4A 4YTPB 1WSPA 2Y3AA 4JPSA 4HJGE 1FNWA 2GI9A 4WWMA 2L52A 3AE4B 3IAM1 3TEZA 1J7AA 2INNE 1FRDA 3TEXA 1N5WA 2QMTA 2WDVB 4TQ1A 2H88B 1N5XA 2IPKD 4XE0A 4C7ZA 1GB4A 2G1EA 2V3NA 2WXJA 2VZKB 4A55A 1FNVA 1ZXHA 2OHFA 3HUIA 1P7EA 2W82A 1QKZA 5E6JA 4KGSA 4WAFA 1KLUD 2WDQB 1MPEA 1HXYD 5EE3A 1XEEA 3V3XA 3AECB 1VLBA 4ARCA 1E7PB 3BZDB 1L5PA 4XWTA 1JWUD 3HRDD 1WYGA 4IDIA 4C80A 1D4BA 1CZPA 4M0WA 3AE5B 3BIID 2WP9B 2N0SB 1KH0A 1SSNA 2BS3B 2LHEA 5BMHA 2Z8LA 4HROA 2D5GA 1FMAD 1TS3A 2AX5A 1ENFA 4ZHOA 2DYMA 4TMAB 5H92C 1T5XD 3TUOA 3NZ3A 1QOFA 2DBYA 1F77A 4YSXB 5I4DA 2HDEA 1HZ6A 4N58A 3EGRA 2ON8A 1HEZE 4RNAA 3AE3B 3TSSA 3T3OA 4NZLB 1UWMA 5MPOA 3WCQA 4CQNA 3C8YA 1C9FA 1UUPA 1F2RI 1YJIA 4NAMA 4A6QA 1FIQA 1NENB 1C4AA 1N61A 1ACCA 2IGHA 1RFKA 2PKOA 5C3JB 2DWQA 4USAA 3NVWA 1K52A 4O1NA 4YSZB 2WXOA 3DWGC 3O13A 2BBCA 3W5VB 1NVID 3B2GA 5AUIA 1SE2A 3AE7B 2EKIA 1ESFA 3MC0B 1YJJA 1BMLC 4JX1C 1HQRD 2MJ3A 2Q5WD 5EE9A 3MJ5A 4UDUC 4MACA 2IDYA 1C79A 2QIEB 3R8BA 1SE4A 2PVOD 2ACZB 3BK2A 1V1PB 2WXPA 1C4CA 3SFEB 4A90A 4A8XC 2RPVA 2K3UA 3NVYA 5EE1A 1AWDA 2WXFA 2LMCA 3RPFC 2QSDA 3FILB 2PMVA 3VR8B 4A9AA 4OVZA 1FRRA 4OZBA 2WQYB 1EWYC 3AEGB 3PZ8A 1I4RA 1QLBB 1K53A 1L6VA 1FXAA 2PW9A 4YTMB 1V8CA 3V05A 4GDKB 1PFDA 2V0GA 3OWEB 5BMIA 1IBXB 1ET9A 2AQ2B 3URYA 3B2FA 4US8A 4H2AA 1PYWD 3BYYB 3W5UB 2K0PA 4KKJA 1SJED 1WWTA 2PVGC 2H89B 2V4IB 5D3IB 2M19A 1ET6A 1T3QA 1OQQA 1HA5A 3Q8BA 1GB1A 1QT9A 4NJCA 1EWCA 5G5HA 3EUB2 1EU4A 1DGJA 2JSVX 2RMMA 4NAWB 1FM0D 4Q2JA 5HHDG 1LO5D 1B1ZA 5D3DA 1B9RA 4EE2A 5G5GA 1NI3A 4KX6B 4ARIA 1OFFA 1DOYA 3Q8CA 2WXLA 5HI1A 1T6BX 2CJNA 2WXRA 4JWSC 1V97A 3P63A 3SEBA 1SEBD 1V1OA 1DOXA 1NYQA 3Q8AA 4HKZE 2G9HD 3RFZB 2MH7A 3P4PB 2J53A 2W55A 1DOIA 3R2TA 4KKIA 3AMZA 1TS2A 2PLPA 2BB5A 1QOAA 4LLGM 3DWMA 3AEFB 3AM9A 3BVGA 1IBXA 1TKEA 1E10A 4C56C 1P7FA 2NMQA 2MEKA 2OEDA 1JALA 1XO3A 1UWXA 2BTEA 3VRBB 4ZRQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PDX A;  2WU2 B;  2BT6 A;  1XLO A;  1KF6 B;  1GAQ B;  2BS2 B;  1JRP A;  1RM6 C;  1UWM A;  2L83 A;  1NEK B;  1OQR A;  1RYJ A;  1SIJ A;  2WU5 B;  2Y5C A;  3KWL A;  3PO0 A;  3WCQ A;  5H8Y E;  3SFD B;  3P1M A;  4WQM A;  1YJI A;  3AEA B;  5MPO A;  1FIQ A;  1NEN B;  1N61 A;  1CJE A;  1RFK A;  1ZXI A;  1I7H A;  2PKO A;  5C3J B;  1N62 A;  3AE3 B;  2DWQ A;  4USA A;  3NVW A;  3AE6 B;  3AE8 B;  4YSZ B;  2JX5 A;  3DWG C;  3P4Q B;  1KRH A;  3W5V B;  3NVZ A;  1E9M A;  1NVI D;  1NYR A;  2KMM A;  1ROE A;  3B2G A;  5AUI A;  3W9C B;  1SB3 C;  1WRI A;  3AE7 B;  2EKI A;  1YJJ A;  2PIA A;  2W3R A;  2MJ3 A;  1FFU A;  2Q5W D;  4JX1 C;  5EE9 A;  4ZHP A;  2M56 B;  3AE2 B;  1JW9 D;  4YT0 B;  3LB8 C;  1R7S A;  2CJO A;  2QIE B;  1L0V B;  2PVO D;  2ACZ B;  3SR6 A;  2K9X A;  2WLB A;  1WXQ A;  3SFE B;  1QF6 A;  1SF0 A;  3AED B;  2K5P A;  3ETR A;  3HVZ A;  3NVY A;  5EE1 A;  1AWD A;  2B76 B;  3RPF C;  4A9A A;  4HRS A;  3VR8 B;  4YXD B;  1WGK A;  1FRR A;  2QJL A;  2W54 A;  4YTN B;  2FBW B;  1GPX A;  2WQY B;  1EWY C;  3AEG B;  1FO4 A;  3FAH A;  4YTP B;  1JRO A;  2E3T A;  3CWI A;  1E0Z A;  1QOB A;  1QLB B;  3AH7 A;  3AV8 A;  4WWM A;  2L52 A;  1L6V A;  1FXA A;  3AE4 B;  1L6U A;  1J7A A;  3AEE B;  4YTM B;  1V8C A;  1IUE A;  1FRD A;  5EE0 A;  5GXG B;  4N6E B;  1N5W A;  2WDV B;  1PFD A;  4ITK A;  3AEB B;  2H88 B;  1TYG B;  2KAJ A;  1N5X A;  4C7Z A;  3B2F A;  4FXC A;  4LTU A;  2WS3 B;  1ZP0 B;  3AB5 A;  1ZOY B;  4US8 A;  2G1E A;  3AE9 B;  1YQ3 B;  5AUK A;  1AYF A;  1ZUD 2;  2MJD A;  3W5U B;  2PVG C;  1WWT A;  2BS4 B;  2H89 B;  1FFV A;  2MJE A;  2M19 A;  2K22 A;  4C7Y A;  3NVV A;  1J7B A;  2OHF A;  1T3Q A;  1OQQ A;  4P6V F;  5C2T B;  3HUI A;  1RWS A;  3FC4 A;  3CIR B;  3ABV B;  1QT9 A;  2WDQ B;  1TKY A;  3LXF A;  4N59 A;  5G5H A;  3NS1 A;  3EUB 2;  1DGJ A;  1PUT A;  4YSY B;  5EE3 A;  1FM0 D;  4JWU C;  3P4S B;  1TJE A;  1VLB A;  3AEC B;  1N60 A;  1N63 A;  3VR9 B;  1B9R A;  5G5G A;  1NI3 A;  1JWB D;  2HTM E;  1E7P B;  1OFF A;  1L5P A;  4KX6 B;  2WDR B;  4C80 A;  3HRD D;  1DOY A;  1WYG A;  3NRZ A;  4IDI A;  2CJN A;  1CZP A;  1TKG A;  1YQ4 B;  2W3S A;  4US9 A;  4JWS C;  3AE5 B;  3AN1 A;  1V97 A;  3B9J A;  3P63 A;  1JQ4 A;  1DOX A;  3BII D;  2WP9 B;  1NYQ A;  1VDV A;  2N0S B;  3L4P A;  2JQR B;  2BS3 B;  1J7C A;  3ZYY X;  1FXI A;  2CU3 A;  1XLN A;  2MH7 A;  3P4P B;  4HRO A;  2W55 A;  1A70 A;  1DOI A;  1FMA D;  3AMZ A;  1QOG A;  2AX5 A;  3AE1 B;  4ZHO A;  1QOA A;  3VRA B;  3DWM A;  5H92 C;  4ZOH C;  1E6E B;  1VJK A;  3AEF B;  3AM9 A;  1XLQ A;  1QOF A;  1TKE A;  1E10 A;  1XLP A;  1KFY B;  2DBY A;  4YSX B;  1JAL A;  1F0Z A;  1JWA D;  1XO3 A;  2LEK A;  3P4R B;  3VRB B;  4N58 A; 
#chains in the Genus database with same CATH topology
 2KMA A;  1PDX A;  3TL5 A;  5HKH A;  2XN9 C;  4XGA B;  2K6D B;  4W9E A;  1UNS A;  1YN3 A;  4ASW C;  3QWZ B;  1V1P A;  2WX0 A;  1YOV B;  3UIP B;  3KW5 B;  2KFJ A;  1EM7 A;  3WIM A;  4DK5 A;  1SE9 A;  4OVV A;  2KVZ A;  4EFO A;  4I6L B;  2M0X A;  1V2Y A;  3W2D A;  1YX6 B;  1XCQ L;  2W3R A;  4LK0 M;  1JW9 D;  2KAC A;  1UBQ A;  3R3M A;  1GG3 A;  1YNT E;  3KYD D;  4ZYS A;  1WZ0 A;  2MBB B;  3IT6 B;  3WAP A;  1MHH E;  1WMH B;  2BYF A;  4DXF A;  2GBJ A;  3GZN I;  1E0Z A;  1WR1 A;  3ZNZ B;  1RFA A;  3UIO B;  5HFY A;  1TBE A;  4KV2 A;  3NY5 A;  2I1K A;  2RSU A;  3KH0 A;  1WX8 A;  1LGR A;  3V61 A;  2WNM A;  2G4S A;  3E56 A;  4B6W A;  1V6E A;  1I4P A;  5AUK A;  1AYF A;  2MJD A;  2BS4 B;  3KYC D;  3DVN U;  1FFV A;  1ZE3 D;  2JU6 X;  2LJ5 A;  1L0X B;  1D5Z C;  4URK A;  4M8N A;  5C2T B;  3APC A;  4IWO A;  2ZJD A;  3P4S B;  1Y56 A;  2SEB D;  2WDR B;  1YQ4 B;  3PGE A;  4X57 B;  5TSS A;  3DVN V;  2BWE S;  1V5O A;  4CO7 A;  3HK0 A;  4AJW A;  1UH6 A;  5HG2 A;  2V1Y A;  5C1Z A;  4JIO U;  2QCZ A;  4PT5 A;  3VHT C;  1M4V A;  2L83 A;  2TSS A;  1D3Z A;  5LLI A;  3AEA B;  3MJW A;  4XYC A;  4HLE A;  1I7H A;  2DYB A;  4LJP B;  3BWU D;  2FIF A;  1SJH D;  5BYR A;  4FLH A;  2AQ3 B;  2GOW A;  3NVZ A;  1C3T A;  5KHQ A;  3W9C B;  2O2V B;  3L0W B;  2MP2 A;  3UGB B;  2ZPY A;  5JXV A;  2WLB A;  1WY8 A;  3ZQ4 A;  2L0F A;  4ANX A;  2VZK D;  4GLS C;  3A9J B;  4PYU A;  1QIL A;  4XC2 A;  2WXM A;  4M02 A;  4GDK A;  5EE0 A;  5GXG B;  2JY6 A;  1TZO A;  2R61 A;  3AEB B;  3KWV A;  4FXC A;  4MSM B;  4EUT A;  2INP E;  2WXH A;  1BUI C;  2DYO A;  2UYZ B;  2FCQ A;  3EFC A;  4PS8 A;  5IA7 A;  2LGY A;  2V9H A;  3H7P A;  4IW0 A;  1VR9 A;  2RPQ A;  1TIF A;  2BVC A;  3U2S C;  1J19 A;  3ZNH B;  3H8H A;  3EFU A;  3VQI A;  1TKG A;  2CHZ A;  3B9J A;  4OZA A;  4IC7 B;  2CU3 A;  1XLN A;  4A3O A;  4K3B A;  3EC8 A;  3H6N A;  5FKA C;  4G11 A;  3M63 B;  3ENE A;  1XLQ A;  3EHV A;  2X38 A;  1WXS A;  4WUR A;  5DPR A;  2C7N B;  2BT6 A;  4HWI B;  1SIJ A;  3PRM B;  1CJE A;  3QHT A;  2N9K A;  2NTS A;  1N62 A;  2NCN A;  1I4H A;  3AE8 B;  4QAY A;  5DPS A;  4B95 A;  1HTQ A;  1NYR A;  2BW2 A;  2KDM A;  2ONQ A;  1WFY A;  4HDO A;  4PYZ A;  4OVU A;  4XDC A;  1ZGU B;  1YX5 B;  3VDZ A;  1H4R A;  3UIN B;  3ETR A;  2L1A A;  4XWW A;  1V49 A;  3QX1 A;  1WGD A;  3UI3 A;  1WGK A;  3PV1 A;  2KN4 A;  3NG0 A;  5JH5 C;  3DBL B;  2K8B A;  2KT7 A;  1WSP A;  2PPH A;  4JPS A;  4EZJ A;  2L52 A;  3NJT A;  2MQJ A;  3TEX A;  1N5W A;  4E71 A;  5G55 A;  4TQ1 A;  1N5X A;  2IPK D;  4XE0 A;  2BGF A;  3IVF A;  2WXJ A;  4LDT D;  2HTH A;  2VZK B;  1WX9 A;  1FNV A;  1ZXH A;  3H1U A;  2OHF A;  4ZRK A;  2W82 A;  3VTW A;  1HXY D;  1XEE A;  2N9P C;  3AEC B;  1VLB A;  4ARC A;  1J0G A;  3BZD B;  1L5P A;  3ZDM C;  4IDI A;  4M0W A;  4BKS D;  2WP9 B;  2N0S B;  1SSN A;  2Z8L A;  4K3C A;  2CHW A;  4HCP B;  2AX5 A;  4ZHO A;  4TMA B;  3M62 B;  1T5X D;  3JSV B;  2GBK A;  3TUO A;  3NZ3 A;  1F77 A;  3R7Q A;  1WJ6 A;  3ZXR A;  4RNA A;  3SD5 A;  3AE3 B;  1UD7 A;  1UWM A;  5CHF A;  2N7E A;  3W1S C;  3C8Y A;  1C9F A;  1UUP A;  3CF6 E;  3N1X C;  4DHZ E;  4YL8 A;  2IGH A;  4HPP A;  5C3J B;  2HJ8 A;  1MG8 A;  2DWQ A;  4USA A;  4MGK E;  4AWJ A;  2WXO A;  2BBC A;  2LI5 A;  2O2V A;  1NVI D;  3TIX A;  4TKN A;  3AE7 B;  3MTN B;  4II2 B;  1BML C;  3A33 B;  2FCS A;  3DDC B;  4UDU C;  4EEW A;  3DHH C;  1C79 A;  3RNF C;  3R8B A;  3BK2 A;  2PVO D;  2WXP A;  1T0Y A;  2DAJ A;  2KX0 A;  2K3U A;  1LM8 B;  5EE1 A;  2L76 A;  2MA9 B;  2MRP A;  3RPF C;  3VR8 B;  4MEM A;  2M1M A;  1FRR A;  1EWY C;  3QCA A;  2Z59 B;  1I4R A;  5IO9 A;  1L6V A;  2JVC A;  1WXM A;  4YTM B;  2GLS A;  1V8C A;  3A1Q A;  3V05 A;  3B08 A;  2BQQ A;  1WZ3 A;  3OAW A;  3OWE B;  1IBX B;  1ET9 A;  2AQ2 B;  3URY A;  2K1F A;  4H2A A;  3BYY B;  3C19 A;  3ZW3 A;  2M19 A;  1NI2 A;  3PZD A;  5DPW A;  2AL6 A;  1OQQ A;  1HA5 A;  1YIW A;  1G6J A;  3Q8B A;  1WX7 A;  2RMM A;  4NAW B;  3JSV A;  5HHD G;  1LO5 D;  1B1Z A;  3APF A;  1B9R A;  4ARI A;  1NI3 A;  4KX6 B;  3FKY A;  3NZU A;  2WXR A;  1UBI A;  2G45 B;  4JWS C;  3ZKJ C;  3P63 A;  1V1O A;  3EEC A;  5E6P A;  4DDI D;  2G9H D;  2RDB C;  3O65 B;  3OJ3 A;  2CS4 A;  2W55 A;  4W9K A;  1DOI A;  2LRU A;  1TS2 A;  2PLP A;  3P2B A;  1U4A A;  1XD3 B;  2IND C;  2O6V D;  3ZXV A;  1JAL A;  2BTE A;  4ZRI A;  2NBW B;  1IPG A;  3VRB B;  2K39 A;  4NY0 A;  2ZW1 A;  2OJR A;  3KWL A;  1RYJ A;  3MFG A;  3VFK A;  2QEJ C;  2KNB A;  1FCL A;  5BYQ A;  1ZKH A;  1E5W A;  3T8M A;  2V3S A;  2KK8 A;  4HXD A;  4GMV A;  1E9M A;  4TUU A;  4BOZ B;  2BYV E;  2WXI A;  3KQ4 A;  2BKF A;  4B0M A;  3ZIM A;  3DBH B;  4R3D A;  3LYY A;  4JGH B;  1R7S A;  4AOF A;  3S2A A;  2K9X A;  1VCB A;  3HVZ A;  1Q10 A;  3JYU A;  5E6O A;  4YXD B;  2KQ4 X;  3QJZ A;  1TS4 A;  1YN4 A;  1C78 A;  2L32 A;  2KC2 A;  3QIJ A;  1FO4 A;  2C60 A;  3AV8 A;  4BOS C;  2WDT B;  3AEE B;  4HVB A;  1LQB A;  5BMG A;  1YMH E;  2A5U A;  3APD A;  3AXC A;  2XK5 A;  1RAX A;  2FUH B;  3A9K B;  2IY1 B;  3AE9 B;  1ZUD 2;  4ICU A;  2K22 A;  2NS5 A;  1BT0 A;  4HKQ A;  1WM3 A;  1WJ4 A;  4KIK B;  3CIR B;  3PRZ A;  1CQV A;  2QDF A;  2KD0 A;  4N59 A;  3TJP A;  2BB6 A;  2KWD A;  4AQ7 A;  2JYE A;  2VH1 A;  5JHA A;  2W3S A;  4PK1 A;  3ML8 A;  3N1Z C;  1KLV A;  1VZ6 A;  3Q8F A;  3QK0 A;  1A70 A;  3Q3M C;  1GUA B;  2KN5 A;  4ZOH C;  1JWM D;  2REX A;  2Y5P A;  5BYS A;  1XLP A;  2LXA A;  1SBB B;  4WWO A;  4ZYN A;  2AQ1 B;  3WAM A;  1OQR A;  2SAK A;  2XNA C;  3N3K B;  3Q3O C;  1UZX B;  4RGM A;  1NBF C;  2IYD B;  1MI0 A;  1OQY A;  3GZN B;  4F8C B;  2KJR A;  1LXD A;  1OEY J;  2DZM A;  1XXG A;  2DX5 B;  1D5X C;  1FFU A;  4MJS B;  2YLM A;  3ONS A;  4I6N B;  4IWQ A;  1AAR A;  1I42 A;  1NDD A;  2LVQ A;  2DLB A;  4II3 B;  4NJ7 A;  2W54 A;  3FIL A;  1GPX A;  1Z5S B;  2GRI A;  1JRO A;  1D5M C;  1AW7 A;  3ZRC A;  1E8Y A;  4FHK A;  4A20 A;  2J0M A;  1TT5 B;  4MH0 E;  1TYG B;  4GN1 A;  4K7S A;  3L08 A;  1E90 A;  4WJQ A;  5IP4 D;  1M94 A;  3VUW A;  1JRU A;  2EMT A;  2LZ6 A;  4GDL A;  4FJY A;  3VUX A;  3HM3 A;  5CTR C;  4NAW A;  3IG3 A;  3U7Z A;  1TKY A;  1OEY A;  3ECI A;  5DCN A;  4DHJ D;  4JWU C;  1OTR B;  4P1C C;  4EZK A;  3GE3 C;  3DHG C;  1I4G A;  1SXT A;  3VVW B;  2MHJ A;  3N9Y C;  3BIN A;  1MVK A;  3E9S A;  5CX3 A;  5L83 A;  1FD6 A;  2IO1 B;  2ZNV C;  4BBN C;  1TS5 A;  4RMA A;  3P4R B;  1T0R C;  1CK1 A;  1XLO A;  1GAQ B;  1JRP A;  1RM6 C;  1QF6 A;  3PO0 A;  1WIA A;  3DBR B;  4BKT A;  1ZXI A;  4GSW A;  1MJD A;  1XF5 L;  3Q3N C;  4RFB A;  2WXK A;  2PEA A;  2GBR A;  4LJO B;  2KMM A;  3J9C A;  1WRI A;  1R4M B;  1WI0 A;  5AZH A;  1T0Q C;  2D11 A;  3ZJV A;  4OW0 A;  1E7V A;  4A3P A;  2JXT A;  1SF0 A;  4LNN A;  4DXG A;  2LVP A;  1P3Q U;  2KDE B;  3A4S C;  1KOT A;  1WMH A;  4YTN B;  4YTP B;  2KJ6 A;  4WJO A;  1FNW A;  2GI9 A;  3AE4 B;  3TEZ A;  1N6Z A;  2KYW A;  1FRD A;  2QMT A;  2WDV B;  3DBS A;  1UF0 A;  4MDK E;  3PHW B;  1WXV A;  1Y8R C;  2EMS A;  1GB4 A;  4IM2 A;  3Q6B A;  5C23 A;  2WGS A;  2AWT A;  1QKZ A;  2PE9 A;  5E6J A;  4WAF A;  1KLU D;  2N1V A;  3DVG X;  1MPE A;  1V81 A;  4FAD A;  3T9L A;  4HJK A;  1WYG A;  4NJ6 A;  1D4B A;  1E8W A;  3AE5 B;  2DNF A;  2ZEQ A;  3PPA A;  3BII D;  1KH0 A;  2BS3 B;  2YVC A;  4W9I A;  1P1A A;  2X8X X;  2XK5 B;  4HRO A;  3KUZ A;  3QAR A;  1TS3 A;  2K8H A;  1HTO A;  2ZPN A;  2WHI A;  4YSX B;  5I4D A;  2MCN B;  3WAN A;  2ON8 A;  3T3O A;  2KLC A;  4EZL A;  2N1W A;  2D2Q A;  1N61 A;  2MBO A;  1ACC A;  2DEN B;  2PKO A;  4GOC A;  4E74 A;  3I3T B;  4XZ4 A;  5AZF A;  3LJ3 A;  1WE7 A;  3KUD B;  3O13 A;  4J6I A;  3W5V B;  5AUI A;  4JX1 C;  1HQR D;  4M8M A;  3MJ5 A;  4MAC A;  2ASQ A;  4A90 A;  2ACZ B;  1V9J A;  1C4C A;  4A8X C;  3PRE A;  2RPV A;  1WH3 A;  3NS8 A;  2QSD A;  3FIL B;  2PMV A;  4OVZ A;  4OZB A;  3DOW A;  3AEG B;  2R2O A;  1QLB B;  1FXA A;  1TTN A;  5BMI A;  2CU1 A;  4BKG A;  2ZVO A;  3X23 A;  4US8 A;  1PYW D;  2INC C;  3W5U B;  2JXX A;  4B9K A;  2V4I B;  3UQA A;  1CMX B;  3DQV A;  2KTR A;  4NQK E;  2BF8 B;  4PS3 A;  1GB1 A;  1QT9 A;  1EU4 A;  1FM0 D;  3N20 C;  2WWZ A;  3N32 A;  4DXA B;  4EE2 A;  4ACF A;  3Q8C A;  3Q3J A;  5HI1 A;  3SEB A;  2JPH A;  4HKZ E;  5IOI A;  3RFZ B;  3VH3 B;  3A1Q B;  2CR5 A;  3ZVV A;  3R2T A;  4KKI A;  5J2R A;  2IO0 B;  4WJP A;  2BB5 A;  1QOA A;  2D3A A;  3AM9 A;  5D6J B;  1E10 A;  1P7F A;  3VAW A;  1WE6 A;  5FR6 A;  3VXW A;  3U30 A;  2LRW A;  3DBH I;  1KJT A;  4US9 A;  1EU3 A;  1KF6 B;  1R4M I;  3MC9 A;  4GXB A;  2E6X A;  1VZ7 A;  4RF0 A;  1K51 A;  2JUO A;  3RUL A;  4GU2 A;  4RGT A;  5FK9 C;  2GB1 A;  1JCK B;  2M8S A;  3QC8 B;  4ZRJ A;  3BVZ A;  3P4Q B;  1ZDX A;  3PHX B;  3RN9 C;  1I35 A;  3RNB C;  2LGS A;  3ZLZ A;  4ZHP A;  2J7Q B;  2LFI A;  2M56 B;  3PVL A;  1L0V B;  1X1M A;  1WXQ A;  2JWU A;  3QQ8 B;  1IYF A;  1GOZ A;  2JWZ A;  1C1Y B;  2FUG 1;  3R2I A;  2MWS B;  4W9F A;  3CWI A;  4W9J A;  2Z0D B;  1QOB A;  4IOI E;  2KFK A;  3AH7 A;  3PTF C;  1YN5 A;  3AI5 A;  2KWU B;  1YJ1 A;  3GP7 A;  2IY0 B;  1JML A;  4ITK A;  5GMV A;  4KGT A;  4ANV A;  1SE3 A;  4OZC A;  4KZ0 A;  1ZP0 B;  1C4P A;  1IGD A;  2KDI A;  3X0W A;  1A5R A;  4RGN A;  2YEP F;  4XX5 A;  4P6V F;  2NTT A;  4JE3 B;  4F1S A;  5FR3 A;  3LXF A;  4C00 A;  1N60 A;  3VR9 B;  3DHI C;  1JWB D;  4M0W B;  2RDH A;  5AEK B;  4HPL B;  4KZC A;  3L4P A;  1J7C A;  4OHJ A;  4WIP A;  2MBH A;  3VTU A;  4IM0 A;  1VJK A;  2KTF A;  4K7U A;  4AJY B;  3DVG Y;  1JWA D;  4ZRP A;  1MFW A;  3KLS X;  2G4D B;  3HHM A;  5H8Y E;  3P1M A;  1VZ8 A;  1UGJ A;  2IBI B;  3TEW A;  1YQB A;  4RH6 A;  2ZW0 A;  4MEL A;  1TY0 A;  4RF1 A;  2L7R A;  3P42 A;  2GBN A;  5T8I A;  1WGG A;  2L3Z A;  2ZVN A;  3NOB A;  1KRH A;  4FBJ B;  1L4D B;  1SB3 C;  4GIV A;  1FEH A;  1XT9 B;  1K8R B;  2WYQ A;  3RZW C;  4WJN A;  4P1B C;  2CJO A;  2LGI A;  3W1S A;  2KTR B;  3R7R A;  3A9K A;  2KOX A;  2FBW B;  1QQR A;  5IKC M;  4MGY E;  1R4N I;  2E3T A;  3WAO A;  4J3O D;  3B0A A;  1K50 A;  1PGB A;  2K8C A;  1L6U A;  1IUE A;  3N30 A;  5CHW A;  3L17 A;  2A4Z A;  4L23 A;  3RNG C;  3AB5 A;  1V80 A;  1ZOY B;  2K25 A;  1I4Q A;  1YQ3 B;  4HEA 1;  1KLG D;  4MM3 B;  4S17 A;  2J52 A;  5D7G A;  4M01 A;  5JHB A;  2V4L A;  2LUE A;  2LHD A;  3NVV A;  1Q5W B;  2J0J A;  3ABV B;  1WJU A;  2RDG A;  4YSY B;  2BYT A;  2I38 A;  5D94 A;  3Q69 A;  4LNO A;  4D2K A;  1BXT A;  4RCO A;  1MHX A;  3BK1 A;  3CST A;  1VDV A;  4FJV B;  3ZYY X;  3OG5 A;  2D07 B;  2MX2 A;  2V3P A;  4P7I A;  5L95 C;  4P16 A;  2WXG A;  3V6E B;  3BVM A;  1KTK A;  1ZPS A;  2M0A A;  4XDD A;  3RZF A;  2IGD A;  4DHZ B;  1RLF A;  4FJZ A;  4WQM A;  5IAA C;  2L05 A;  4GDL B;  2IGG A;  4TQ0 A;  3M95 A;  2JZP A;  4LNI A;  4WWP A;  4L1B A;  4FA6 A;  2HD5 B;  2ZZP B;  4TSS A;  2PIA A;  3RMK C;  2LGX A;  3AU4 A;  5IN7 A;  3SR6 A;  4IM3 A;  1V86 A;  2JRH A;  3VUY A;  2WXQ A;  3RT3 B;  3RCZ A;  3RNE C;  4HK2 A;  2RGF A;  4BKS A;  3K9O B;  2CHX A;  4WWM A;  1FXT B;  1SGH A;  2INN E;  1L2N A;  2H88 B;  3VTV A;  4TV3 A;  2VRR B;  2KMC A;  3ZNG C;  5D2M B;  4C4V B;  2V3N A;  1WGY A;  4PS7 A;  1WXA A;  3HUI A;  4W9L A;  4KGS A;  3MHS D;  3IBE A;  3V3X A;  2G3Q B;  1E7P B;  2O6V A;  2BWF A;  3HRD D;  4XWT A;  2KQS A;  2JZZ A;  3L13 A;  5LXI B;  4FHJ A;  4WWN A;  3V6C B;  5BMH A;  5J17 A;  2D5G A;  1VD2 A;  1ENF A;  2DYM A;  1PQS A;  4HDQ A;  3RNA C;  1EF1 A;  2DBY A;  3ZNI D;  2C7H A;  1HZ6 A;  4N58 A;  5DPT A;  3TSS A;  4AP4 C;  4NZL B;  3WCQ A;  1EF5 A;  1F2R I;  1YJI A;  1ISN A;  4NAM A;  1GC7 A;  1RFK A;  3WAL A;  3V62 A;  2IO2 B;  2MW5 A;  1K52 A;  1XQQ A;  2FNJ B;  4O1N A;  4YSZ B;  3DWG C;  1SE2 A;  4MJS A;  2EKI A;  1ESF A;  2FID A;  1OGW A;  2NPT B;  2MJ3 A;  3ML9 A;  2C5L C;  1V1P B;  3SFE B;  2KO3 A;  1GC6 A;  5KHO A;  1AWD A;  4A9A A;  2I1J A;  2LGD A;  4MSQ B;  3PZ8 A;  4G50 A;  4FN2 A;  1P0R A;  2PW9 A;  3KUC B;  1UEL A;  3AU5 A;  1WJN A;  4GDK B;  3QAQ A;  3B2F A;  3PRP B;  2O6V B;  4MM3 A;  2H89 B;  2M4N A;  2Z0E B;  5E6N A;  4KSL C;  3VH4 B;  4ZDV A;  1T3Q A;  3ZRF A;  4DHJ B;  4NJC A;  5G5H A;  2D3G A;  1DGJ A;  4Q2J A;  3H7P B;  5D3D A;  5G5G A;  1OFF A;  2CKH B;  2WXL A;  3N1Y C;  2CJN A;  4BFR A;  1YD8 U;  3Q8A A;  4DBG A;  2MBE A;  3P4P B;  2DZI A;  3GOE A;  3AMZ A;  3PT2 B;  2B3A A;  5G2N A;  1WYW B;  2AEH A;  1IBX A;  1TKE A;  4BZA A;  2NMQ A;  3V60 A;  2OED A;  2LAS A;  3OJ4 B;  4ZRQ A;  2L8J A;  2WU5 B;  2Y5C A;  2FCM A;  2LJI A;  1WGH A;  2C7M B;  1C76 A;  2XEW A;  5J18 A;  4B0E A;  3ZJU A;  1F9J A;  2PTL A;  3AE6 B;  4JL9 A;  4ICV A;  3U8Z A;  5BO4 B;  3I57 A;  1ROE A;  4KGR A;  3UF8 A;  3AE2 B;  3SU8 X;  3DCG A;  3ALB A;  3AED B;  3GE8 C;  1C77 A;  2N9L A;  4MT5 A;  2UU7 A;  2N7J A;  1Q1O A;  3CMM B;  3ZTC A;  1HE8 A;  3IAS 1;  2MP2 B;  4BAX A;  4BVU C;  3IXS A;  2VH2 A;  3TCA A;  2ZCB A;  3IT4 B;  1R4N B;  2JYT A;  3HIZ A;  3GS2 A;  3PLV A;  2AL3 A;  2KAJ A;  1MG4 A;  2KQ7 A;  2OOB B;  1TZ1 A;  2WS3 B;  1EUV B;  2I2Y A;  4LNF A;  3LDZ E;  2RR9 A;  1HZ5 A;  4REZ A;  2MJE A;  3PS6 A;  2L0T A;  4C7Y A;  2MBQ A;  1RWS A;  2IZV B;  2KDF B;  2LVO A;  1PGX A;  1PUT A;  1QZE A;  2KVR A;  1N63 A;  1SIF A;  2HJ1 A;  4LNK A;  2DZJ A;  2DHZ A;  4KDI C;  4K7W A;  2KAN A;  2ICI A;  2JQR B;  4I6P A;  2KFK B;  2GBM A;  1TY2 A;  3Q8E A;  3EA6 A;  2KJH B;  2NPT A;  1XCT L;  1QOG A;  3AE1 B;  4WQO B;  4G3X B;  3VRA B;  4C4V A;  2NVU I;  3ZUN A;  3WA0 A;  3HVD A;  4MH8 A;  1D6E C;  1F0Z A;  2LEK A;  3L54 A;  2R2Q A;  3PSE B;  2WU2 B;  3NUH B;  1NEK B;  1I4X A;  4RGO S;  4W9G A;  2AYO B;  3SFD B;  1L7Y A;  1FCC C;  3TEY A;  1F1H A;  2JZ3 B;  4KIK A;  4YWG G;  5CHV C;  2JX5 A;  2NR2 A;  3PZ7 A;  4ANW A;  2IO3 B;  2GMI C;  3H7S A;  1ZDV A;  2C9W B;  4N9F 4;  1PGA A;  1TGZ B;  4GGQ A;  2KWC A;  2EEL A;  4IKG A;  4IUM B;  2MLB A;  4YT0 B;  1WF9 A;  2BYE A;  2K5P A;  4WH4 A;  2D3B A;  4DDG D;  1LFD A;  2D3C A;  2XBB C;  2LWP A;  4DQO C;  5TR5 A;  2QJL A;  2MSE D;  2FE8 A;  3FAH A;  3IHP C;  1STE A;  3DBR I;  1VRA B;  2J42 A;  3MP9 A;  4N6E B;  1ZW7 A;  3Q2A C;  4F7Z A;  1F52 A;  3DBL I;  1AN8 A;  2YEP B;  1WM2 A;  2L00 B;  2LD9 A;  4LTU A;  3GB1 A;  1Q0W B;  1IGC A;  2J4X A;  3MHZ A;  2N9E B;  1RRB A;  3I9V 1;  1J7B A;  3Q14 C;  3FC4 A;  3RNC C;  1J8C A;  3NS1 A;  1L4Z B;  3SHQ A;  1TJE A;  3T3N A;  1V5T A;  2HTM E;  1L0Y B;  3NRZ A;  2J0K A;  5LNK 1;  3AN1 A;  1F2R C;  1JQ4 A;  2RD0 A;  2Y5B B;  3D32 A;  1FXI A;  4MGI E;  2KLG A;  3ZJT A;  1EO6 A;  2JF5 A;  1P9D U;  1E6E B;  4FUL A;  1KFY B;  2WX1 A;  4HCN B;  3H9D A;  3DPD A;  1JWS D;  4MGZ E;  4WAA A;  4AUQ C;  2OJW A;  3ZGZ A;  3UQB A;  3ZDT A;  3I63 C;  4CYE A;  3L16 A;  2BS2 B;  2LUM A;  4L2Y A;  4RM9 A;  5EDS A;  2PE6 B;  4KDL B;  5AZG A;  2DAF A;  2UWQ A;  1T0S C;  3JVZ X;  4S0R A;  3ZTD A;  3ZO5 B;  3HM6 X;  2QC8 A;  2QIL A;  3U52 E;  1DYQ A;  4AS1 A;  3U4E G;  3BYT B;  2DZK A;  2IJ0 A;  2N7D A;  3LB8 C;  4EOY A;  2FCN A;  3MC8 A;  2WXN A;  1FNU A;  2B76 B;  1KM7 A;  3M3J A;  4HRS A;  2EKE C;  4NQL B;  4E3C A;  2Y3A A;  4HJG E;  2KDB A;  3IAM 1;  3KVF B;  1J7A A;  4DWF A;  3AUL A;  1IP9 A;  3I5J C;  3W1Y A;  3RUI B;  4C7Z A;  2KWV B;  4ANU A;  2G1E A;  4A55 A;  1S1Q B;  1P7E A;  2WDQ B;  5EE3 A;  2KXJ A;  3BY4 B;  4KSK C;  3RI7 C;  3RD2 A;  2KX3 A;  2FAZ A;  2ZNV B;  4W9C A;  1JWU D;  4C80 A;  1CZP A;  4LDT B;  1E8X A;  2LHE A;  4JLC A;  2D10 A;  1WGR A;  1FMA D;  2ZCC A;  5H92 C;  3OLM D;  1QOF A;  3JW0 X;  5JZE B;  1Z2M A;  2HDE A;  3IFW B;  3TBL D;  3EGR A;  1HEZ E;  5MPO A;  4GB9 A;  3RYT A;  4CQN A;  3A9J A;  2BPS A;  3U7D A;  4LCD E;  4A6Q A;  1FIQ A;  1NEN B;  1C4A A;  3PLU A;  2NBV B;  4K81 A;  2KZR A;  3NVW A;  4IWP A;  4JQW C;  4CHK A;  3NHE B;  3TMP B;  2LXC A;  3B2G A;  3MC0 B;  1YJJ A;  2Q5W D;  5EE9 A;  2IDY A;  2QIE B;  1WR6 E;  1SE4 A;  1E8Z A;  3NVY A;  4EKU A;  4IG7 B;  2WXF A;  2LMC A;  5LXH A;  2WQY B;  1GJZ A;  2HE7 A;  4HPM B;  1P98 A;  2NBU A;  3R66 C;  3B1L X;  1K53 A;  2BKR B;  2K6Q A;  1PFD A;  2JRI B;  3NZS A;  2V0G A;  3CSF A;  2JT4 B;  3C0R B;  2M17 A;  1UGM A;  4W9D A;  1S3S G;  4M00 A;  2K0P A;  2KKC A;  4KKJ A;  1SJE D;  1WWT A;  2PVG C;  4RM8 A;  2PJH A;  2W9N A;  5D3I B;  4K1R B;  2KHW B;  1ET6 A;  4KVG B;  3Q3F A;  1FPY A;  1EWC A;  3EUB 2;  2JSV X;  4G0N B;  4W9H A;  1DOY A;  1T6B X;  4BBN F;  1V97 A;  1WRD B;  1SEB D;  1DOX A;  1NYQ A;  3L10 B;  2N9X A;  2MH7 A;  2KC1 A;  3K9P B;  2J53 A;  2N4F A;  1GNU A;  4LLG M;  3DWM A;  4NNJ B;  1E7U A;  1H8C A;  3AEF B;  4NPN A;  3BVG A;  4C56 C;  2MEK A;  3A4R A;  3SDL C;  1XO3 A;  3QA8 A;  1UWX A;  2QHO A; 
#chains in the Genus database with same CATH homology
 1PDX A;  4US9 A;  1EU3 A;  1KF6 B;  2ZW1 A;  2WU5 B;  2Y5C A;  2LJI A;  1RYJ A;  2XN9 C;  3KWL A;  1C76 A;  1UNS A;  3MFG A;  2E6X A;  1VZ7 A;  4RF0 A;  1YN3 A;  2QEJ C;  1K51 A;  4B0E A;  3ZJU A;  1V1P A;  1FCL A;  5BYQ A;  1EM7 A;  4RGT A;  2PTL A;  5FK9 C;  2GB1 A;  1JCK B;  3AE6 B;  3BVZ A;  3P4Q B;  1E9M A;  3I57 A;  1ROE A;  1ZDX A;  2WXI A;  3W2D A;  3KQ4 A;  1XCQ L;  4B0M A;  2W3R A;  4KGR A;  4LK0 M;  2LFI A;  2M56 B;  4ZHP A;  3AE2 B;  1JW9 D;  4R3D A;  3LYY A;  1R7S A;  2KAC A;  1L0V B;  2K9X A;  1WXQ A;  1YNT E;  2JWU A;  3HVZ A;  1Q10 A;  3AED B;  1GOZ A;  4ZYS A;  2FUG 1;  4YXD B;  3IT6 B;  2KQ4 X;  3R2I A;  1MHH E;  1TS4 A;  1C77 A;  1YN4 A;  2N9L A;  1C78 A;  2L32 A;  1FO4 A;  4MT5 A;  4DXF A;  3CWI A;  2N7J A;  1E0Z A;  1QOB A;  4IOI E;  3AH7 A;  3AV8 A;  3IAS 1;  1YN5 A;  5HFY A;  3AEE B;  3IXS A;  5BMG A;  3GP7 A;  1JML A;  1YMH E;  3IT4 B;  4ITK A;  2JYT A;  4KGT A;  3GS2 A;  2WNM A;  1SE3 A;  2KAJ A;  3E56 A;  4OZC A;  1I4P A;  2WS3 B;  1ZP0 B;  1C4P A;  2I2Y A;  1IGD A;  3AE9 B;  5AUK A;  1AYF A;  1ZUD 2;  2MJD A;  2BS4 B;  1HZ5 A;  4REZ A;  1FFV A;  2MJE A;  1ZE3 D;  2JU6 X;  2K22 A;  2YEP F;  1L0X B;  4RGN A;  1D5Z C;  4C7Y A;  4HKQ A;  4P6V F;  2NTT A;  4JE3 B;  5C2T B;  1RWS A;  3CIR B;  1CQV A;  5FR3 A;  3LXF A;  4N59 A;  1PGX A;  1PUT A;  2BB6 A;  2KWD A;  4AQ7 A;  2JYE A;  3P4S B;  1N60 A;  1N63 A;  1Y56 A;  3VR9 B;  2SEB D;  1JWB D;  2RDH A;  2WDR B;  1YQ4 B;  2W3S A;  5TSS A;  2ICI A;  2JQR B;  3L4P A;  1J7C A;  1VZ6 A;  3Q8F A;  4OHJ A;  1TY2 A;  3Q8E A;  3EA6 A;  1A70 A;  4WIP A;  1XCT L;  1QOG A;  3AE1 B;  3VRA B;  5HG2 A;  4ZOH C;  1VJK A;  1JWM D;  2Y5P A;  3HVD A;  1XLP A;  5BYS A;  4MH8 A;  1D6E C;  1JWA D;  1SBB B;  2LEK A;  4PT5 A;  4ZRP A;  1F0Z A;  3KLS X;  2AQ1 B;  2WU2 B;  3NUH B;  1M4V A;  2L83 A;  1NEK B;  1OQR A;  2SAK A;  1I4X A;  2TSS A;  2XNA C;  4RGO S;  5H8Y E;  4RGM A;  3P1M A;  3SFD B;  1VZ8 A;  1UGJ A;  1FCC C;  3TEW A;  2ZW0 A;  3AEA B;  4RH6 A;  3TEY A;  1TY0 A;  1MI0 A;  4RF1 A;  3P42 A;  1I7H A;  5T8I A;  3BWU D;  1SJH D;  4YWG G;  5BYR A;  2AQ3 B;  2JX5 A;  3PZ7 A;  1KRH A;  3NVZ A;  1XXG A;  1L4D B;  3W9C B;  1D5X C;  1SB3 C;  1ZDV A;  1FFU A;  1PGA A;  1FEH A;  2EEL A;  4IKG A;  4YT0 B;  5JXV A;  2CJO A;  2LGI A;  2DLB A;  2WLB A;  3W1S A;  2K5P A;  4WH4 A;  3ZQ4 A;  4DQO C;  2QJL A;  2W54 A;  2FBW B;  1QQR A;  2VZK D;  3FIL A;  1GPX A;  2FE8 A;  3FAH A;  2GRI A;  1JRO A;  1STE A;  2E3T A;  4GLS C;  4J3O D;  1D5M C;  1AW7 A;  1K50 A;  1PGB A;  1QIL A;  1VRA B;  2WXM A;  1L6U A;  1IUE A;  2J42 A;  3MP9 A;  5EE0 A;  5GXG B;  4N6E B;  1TZO A;  2R61 A;  3AEB B;  1AN8 A;  1TYG B;  2YEP B;  4L23 A;  3KWV A;  4FXC A;  4LTU A;  3AB5 A;  3GB1 A;  1ZOY B;  2INP E;  1IGC A;  1I4Q A;  1YQ3 B;  4HEA 1;  2J4X A;  3MHZ A;  1KLG D;  4MM3 B;  2WXH A;  2J52 A;  5D7G A;  1BUI C;  3I9V 1;  2DYO A;  2LHD A;  3NVV A;  1J7B A;  3FC4 A;  3ABV B;  3U7Z A;  1TKY A;  2RDG A;  3NS1 A;  1L4Z B;  4YSY B;  2BYT A;  2I38 A;  4JWU C;  1VR9 A;  1TJE A;  3T3N A;  2HTM E;  3U2S C;  1L0Y B;  3H8H A;  3NRZ A;  3VQI A;  1TKG A;  3Q69 A;  5LNK 1;  1I4G A;  3AN1 A;  4D2K A;  3B9J A;  1BXT A;  1F2R C;  1SXT A;  4RCO A;  1JQ4 A;  1MHX A;  3BK1 A;  3N9Y C;  1VDV A;  4OZA A;  3ZYY X;  1MVK A;  1FXI A;  3E9S A;  2CU3 A;  1FD6 A;  1XLN A;  3ZJT A;  5FKA C;  2V3P A;  1TS5 A;  1E6E B;  1XLQ A;  1KFY B;  2X38 A;  4WUR A;  4P16 A;  2WXG A;  1JWS D;  3P4R B;  3ZGZ A;  3BVM A;  1KTK A;  1CK1 A;  1ZPS A;  2M0A A;  4XDD A;  2BT6 A;  1XLO A;  2BS2 B;  1GAQ B;  2IGD A;  1JRP A;  1RM6 C;  1QF6 A;  2LUM A;  3PO0 A;  1SIJ A;  4L2Y A;  4WQM A;  4GDL B;  2IGG A;  4TQ0 A;  1CJE A;  1ZXI A;  2N9K A;  2NTS A;  1N62 A;  2QIL A;  3U52 E;  1I4H A;  1XF5 L;  1DYQ A;  3AE8 B;  4RFB A;  2WXK A;  2JZP A;  2KMM A;  1NYR A;  2BW2 A;  4L1B A;  4AS1 A;  2KDM A;  3J9C A;  2ONQ A;  1WRI A;  4TSS A;  3U4E G;  3BYT B;  2PIA A;  2IJ0 A;  4XDC A;  3LB8 C;  3ZJV A;  4OW0 A;  3SR6 A;  2JXT A;  1SF0 A;  2WXN A;  1FNU A;  2L1A A;  3ETR A;  4DXG A;  4XWW A;  2WXQ A;  2B76 B;  3UI3 A;  4HRS A;  1WGK A;  4YTN B;  2KN4 A;  4YTP B;  1WSP A;  2Y3A A;  4JPS A;  4HJG E;  1FNW A;  2GI9 A;  4WWM A;  2L52 A;  3AE4 B;  3IAM 1;  3TEZ A;  1J7A A;  2INN E;  1FRD A;  3TEX A;  1N5W A;  2QMT A;  2WDV B;  4TQ1 A;  2H88 B;  1N5X A;  2IPK D;  4XE0 A;  4C7Z A;  1GB4 A;  2G1E A;  2V3N A;  2WXJ A;  2VZK B;  4A55 A;  1FNV A;  1ZXH A;  2OHF A;  3HUI A;  1P7E A;  2W82 A;  1QKZ A;  5E6J A;  4KGS A;  4WAF A;  1KLU D;  2WDQ B;  1MPE A;  1HXY D;  5EE3 A;  1XEE A;  3V3X A;  3AEC B;  1VLB A;  4ARC A;  1E7P B;  3BZD B;  1L5P A;  4XWT A;  1JWU D;  3HRD D;  1WYG A;  4IDI A;  4C80 A;  1D4B A;  1CZP A;  4M0W A;  3AE5 B;  3BII D;  2WP9 B;  2N0S B;  1KH0 A;  1SSN A;  2BS3 B;  2LHE A;  5BMH A;  2Z8L A;  4HRO A;  2D5G A;  1FMA D;  1TS3 A;  2AX5 A;  1ENF A;  4ZHO A;  2DYM A;  4TMA B;  5H92 C;  1T5X D;  3TUO A;  3NZ3 A;  1QOF A;  2DBY A;  1F77 A;  4YSX B;  5I4D A;  2HDE A;  1HZ6 A;  4N58 A;  3EGR A;  2ON8 A;  1HEZ E;  4RNA A;  3AE3 B;  3TSS A;  3T3O A;  4NZL B;  1UWM A;  5MPO A;  3WCQ A;  4CQN A;  3C8Y A;  1C9F A;  1UUP A;  1F2R I;  1YJI A;  4NAM A;  4A6Q A;  1FIQ A;  1NEN B;  1C4A A;  1N61 A;  1ACC A;  2IGH A;  1RFK A;  2PKO A;  5C3J B;  2DWQ A;  4USA A;  3NVW A;  1K52 A;  4O1N A;  4YSZ B;  2WXO A;  3DWG C;  3O13 A;  2BBC A;  3W5V B;  1NVI D;  3B2G A;  5AUI A;  1SE2 A;  3AE7 B;  2EKI A;  1ESF A;  3MC0 B;  1YJJ A;  1BML C;  4JX1 C;  1HQR D;  2MJ3 A;  2Q5W D;  5EE9 A;  3MJ5 A;  4UDU C;  4MAC A;  2IDY A;  1C79 A;  2QIE B;  3R8B A;  1SE4 A;  2PVO D;  2ACZ B;  3BK2 A;  1V1P B;  2WXP A;  1C4C A;  3SFE B;  4A90 A;  4A8X C;  2RPV A;  2K3U A;  3NVY A;  5EE1 A;  1AWD A;  2WXF A;  2LMC A;  3RPF C;  2QSD A;  3FIL B;  2PMV A;  3VR8 B;  4A9A A;  4OVZ A;  1FRR A;  4OZB A;  2WQY B;  1EWY C;  3AEG B;  3PZ8 A;  1I4R A;  1QLB B;  1K53 A;  1L6V A;  1FXA A;  2PW9 A;  4YTM B;  1V8C A;  3V05 A;  4GDK B;  1PFD A;  2V0G A;  3OWE B;  5BMI A;  1IBX B;  1ET9 A;  2AQ2 B;  3URY A;  3B2F A;  4US8 A;  4H2A A;  1PYW D;  3BYY B;  3W5U B;  2K0P A;  4KKJ A;  1SJE D;  1WWT A;  2PVG C;  2H89 B;  2V4I B;  5D3I B;  2M19 A;  1ET6 A;  1T3Q A;  1OQQ A;  1HA5 A;  3Q8B A;  1GB1 A;  1QT9 A;  4NJC A;  1EWC A;  5G5H A;  3EUB 2;  1EU4 A;  1DGJ A;  2JSV X;  2RMM A;  4NAW B;  1FM0 D;  4Q2J A;  5HHD G;  1LO5 D;  1B1Z A;  5D3D A;  1B9R A;  4EE2 A;  5G5G A;  1NI3 A;  4KX6 B;  4ARI A;  1OFF A;  1DOY A;  3Q8C A;  2WXL A;  5HI1 A;  1T6B X;  2CJN A;  2WXR A;  4JWS C;  1V97 A;  3P63 A;  3SEB A;  1SEB D;  1V1O A;  1DOX A;  1NYQ A;  3Q8A A;  4HKZ E;  2G9H D;  3RFZ B;  2MH7 A;  3P4P B;  2J53 A;  2W55 A;  1DOI A;  3R2T A;  4KKI A;  3AMZ A;  1TS2 A;  2PLP A;  2BB5 A;  1QOA A;  4LLG M;  3DWM A;  3AEF B;  3AM9 A;  3BVG A;  1IBX A;  1TKE A;  1E10 A;  4C56 C;  1P7F A;  2NMQ A;  2MEK A;  2OED A;  1JAL A;  1XO3 A;  1UWX A;  2BTE A;  3VRB B;  4ZRQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...