2LEKA

Solution nmr structure of a thiamine biosynthesis (this) protein rpa3574 from rhodopseudomonas palustris refined with nh rdcs. northeast structural genomics consortium target rpr325
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
73
structure length
73
Chain Sequence
b'MLVTINGEQREVQSASVAALMTELDCTDGHYAVALNYDVVPRGKWDETPVTAGDEIEILTPRQGGLEHHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative thiamin biosynthesis ThiS
publication title Solution NMR structure of a Thiamine Biosynthesis (ThiS) Protein RPA3574 from Rhodopseudomonas palustris. Northeast Structural Genomics Consortium target RpR325
rcsb
source organism Rhodopseudomonas palustris
molecule tags Biosynthetic protein
total genus 14
structure length 73
sequence length 73
ec nomenclature
pdb deposition date 2011-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02597 ThiS ThiS family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2lekA00
1ZP0B 1JALA 1NI3A 3AE9B 1FIQA 1YQ3B 1DGJA 1V97A 4YXDB 4JWUC 2OHFA 1VDVA 3AN1A 1JW9D 1TKYA 3VR9B 2Y5CA 2BS3B 3AE4B 3AEGB 1JROA 1ZXIA 3AE3B 2N0SB 4YTPB 4USAA 2K9XA 2DWQA 2W3RA 5H8YE 4YTNB 2WQYB 2MJDA 4ITKA 5G5HA 1RWSA 4N59A 4ZHOA 1XLNA 1WWTA 2PIAA 1AYFA 2H88B 1XLOA 1J7BA 1L0VB 3NS1A 1JWAD 3P4PB 4US8A 3W5VB 2HTME 3AV8A 5G5GA 3VRBB 1IUEA 4C7YA 1NYQA 1AWDA 1XLQA 1RYJA 2WDRB 1WYGA 5AUIA 1WXQA 2K22A 5EE3A 1NVID 1R7SA 3VRAB 1E9MA 1JRPA 4ZHPA 2QIEB 4FXCA 3DWGC 1FRRA 3NVVA 1FXAA 5EE9A 1N61A 3EUB2 3P63A 1FRDA 1VLBA 3AE5B 2KMMA 3CIRB 2FBWB 3AEAB 1J7CA 5AUKA 3AEFB 1NENB 2M56B 3ZYYX 2WDVB 5EE1A 1XLPA 2JQRB 1QOFA 3CWIA 1E0ZA 5C2TB 3FC4A 1ZOYB 5H92C 1A70A 3ABVB 3B2GA 1L6UA 1PFDA 2JX5A 2MJEA 2M19A 2DBYA 4WQMA 3P4QB 2K5PA 2L52A 2G1EA 2PKOA 4ZOHC 2ACZB 3AB5A 1QF6A 1FM0D 1KF6B 3AECB 4N6EB 1QLBB 4HRSA 3SFDB 4YSZB 1CZPA 1SF0A 3AE7B 3LXFA 5EE0A 5C3JB 1E6EB 3AH7A 3FAHA 3HVZA 4KX6B 2W55A 1GAQB 1YQ4B 4YTMB 1DOXA 1N60A 3B9JA 4IDIA 4LTUA 2BS4B 4C7ZA 4C80A 1I7HA 3LB8C 1QOAA 3P4SB 1CJEA 4YSYB 5MPOA 1TYGB 2W3SA 3W5UB 2WS3B 1PUTA 3P1MA 3NVYA 3P4RB 2Q5WD 4JX1C 1OQQA 4JWSC 1T3QA 3AE6B 1NEKB 2E3TA 1JWBD 2MJ3A 1KRHA 1XO3A 3HRDD 3RPFC 1GPXA 2L83A 1EWYC 1L5PA 3NVZA 3HUIA 2MH7A 1YJJA 3AMZA 5GXGB 3SFEB 3BIID 4HROA 1TKGA 1QOGA 2BT6A 1E10A 1ROEA 1L6VA 2LEKA 1RM6C 3AEDB 1ZUD2 3SR6A 1N63A 2AX5A 3VR8B 2WLBA 1FXIA 2WP9B 3PO0A 4YT0B 1JQ4A 3L4PA 2QJLA 1PDXA 1J7AA 2B76B 3NVWA 2CJOA 2KAJA 2WU5B 1VJKA 1YJIA 3AM9A 3NRZA 1WGKA 1FO4A 1UWMA 3AE1B 1FMAD 1N62A 1F0ZA 3DWMA 2EKIA 2WDQB 1OFFA 1SIJA 3ETRA 3AE8B 2PVOD 4N58A 4A9AA 4US9A 1TJEA 2WU2B 1FFVA 1KFYB 1OQRA 1NYRA 4P6VF 2BS2B 4YSXB 1FFUA 2W54A 3W9CB 2PVGC 2CU3A 1QOBA 1SB3C 1E7PB 3B2FA 3AEEB 2CJNA 3AEBB 3AE2B 1DOIA 1TKEA 1WRIA 2H89B 1B9RA 1N5XA 1RFKA 3KWLA 1DOYA 4WWMA 1QT9A 1V8CA 3WCQA 1N5WA
chains in the Genus database with same CATH superfamily
2I1KA 3RZWC 3AE9B 1MHHE 2JXTA 2KJRA 3A4SC 2W3RA 2MSED 3P2BA 1RRBA 3HIZA 3RMKC 5C1ZA 3KWVA 4OZBA 1WGDA 2MQJA 3M95A 2V1YA 2WXFA 4EEWA 2K22A 4X57B 4K7WA 2KMMA 1X1MA 2KNBA 2DNFA 2KKCA 3BYTB 2BBCA 4KSLC 3WALA 1M4VA 5LLIA 2GOWA 4MJSA 2ZW1A 4US8A 1EU3A 1TS5A 3ZNID 1YMHE 3CSTA 3PLUA 2LD9A 5FR6A 2ON8A 4C80A 4KKJA 2W3SA 3W5UB 2KFJA 3GZNB 3O65B 3Q8CA 1SE2A 1SSNA 3SD5A 2DAJA 4WWPA 2MJ3A 4M8NA 3RNCC 1ISNA 1YJJA 2RPVA 5JHBA 1OGWA 3DBLI 2C60A 1JQ4A 3DBRI 2B76B 2NTTA 3DBHB 2BYEA 3PZDA 3TEZA 1PQSA 2BF8B 1DYQA 2WDQB 2Z8LA 3ETRA 5CHWA 1V5TA 4EZKA 4URKA 2JU6X 3GS2A 2I38A 2BTEA 2NBUA 2G45B 5CHFA 2J7QB 1HTOA 4OW0A 5HKHA 2QC8A 1P7FA 3KYCD 1QQRA 4NQKE 1JALA 2V3SA 2C5LC 4DQOC 1UUPA 3V6CB 4REZA 5FR3A 1QKZA 1WZ3A 4BAXA 3DVNU 2LJIA 3BVZA 2V3PA 2BKRB 3CMMB 1SXTA 1XQQA 2VZKB 2UU7A 1I4PA 1RYJA 1XLQA 2WDRB 5BMGA 3DHGC 4IC7B 4NPNA 2MX2A 5I4DA 2DENB 3ZNGC 1FXTB 3AE5B 3AEFB 2KVRA 2JRIB 2K8HA 1Q1OA 3L13A 4HDOA 2NCNA 2C7MB 4F7ZA 3NG0A 1D5MC 2JX5A 2DBYA 4M0WA 2QEJC 2ACZB 1QLBB 3H9DA 2W55A 1GAQB 4YTMB 4ZYNA 4L2YA 2UWQA 2N1WA 3TEWA 2XN9C 1L2NA 3Q3OC 1JWSD 1WZ0A 4W9KA 2Q5WD 4JWSC 1P3QU 3H8HA 3QAQA 2RDGA 5E6OA 3PT2B 2KDEB 2LGXA 5IA7A 2JZZA 2KTFA 2KDMA 2KC1A 1WYWB 2KACA 4EUTA 1EM7A 3PHXB 3QWZB 2QJLA 2QCZA 4JQWC 3QA8A 3AXCA 1UZXB 3BVMA 4DWFA 3VTWA 1I42A 2WDTB 4JE3B 2ZCBA 1XEEA 3JYUA 1WMHA 3PZ7A 1IYFA 1C78A 2RMMA 2BYTA 1R4MI 4MACA 5KHOA 1WRIA 5JZEB 4GGQA 3L0WB 1C4CA 4P1BC 1NI3A 2MP2B 4J6IA 4BKSD 2LXCA 2QILA 2KDIA 1TKYA 4XGAB 3KYDD 1PGBA 2LVQA 3RZFA 4W9HA 2XK5B 4IWQA 2K6QA 3E9SA 4W9LA 2BYFA 2J4XA 1OEYJ 3IBEA 3DOWA 3CIRB 3AEAB 4WURA 2JXXA 3PHWB 3N3KB 3UQBA 2EMSA 1JCKB 1E0ZA 3PV1A 3URYA 2NPTA 2E6XA 2CR5A 1WX7A 2MJEA 4ZDVA 2LVOA 4LK0M 4OVZA 1GB1A 2D3BA 1E7UA 3I57A 1DOXA 2R2OA 2O6VD 2FCNA 1YX5B 2CS4A 4UDUC 4ZRPA 2HTHA 1VR9A 3QC8B 3RN9C 1KRHA 1GPXA 4TMAB 4AJYB 1XXGA 4RGTA 1ZW7A 2FUHB 3W1SA 4KGSA 3AMZA 3SFEB 4XDCA 2LEKA 3AEDB 4GLSC 4EFOA 3U2SC 3VR8B 1K53A 5DPRA 4JGHB 2D3GA 2DLBA 1E90A 1KJTA 3AE1B 4HVBA 1VZ8A 2JT4B 3DWMA 2PPHA 1VCBA 2VH1A 1L0YB 3QHTA 5HI1A 3W9CB 2FCSA 1WX8A 3RT3B 5AZHA 3C8YA 1XCTL 3MC0B 2PJHA 2DX5B 2BGFA 2MA9B 4G11A 5BMHA 4BBNF 1QT9A 2FIFA 1XF5L 1HZ6A 3S2AA 3UI3A 1T0RC 3ENEA 4HWIB 3Q8FA 1DGJA 5AZFA 2KANA 3UIOB 4AWJA 3DHHC 4IM3A 2DWQA 3T8MA 1XT9B 1WWTA 1P1AA 1AYFA 1CMXB 3IT4B 4TQ0A 1MHXA 1I4XA 2ZVNA 1WYGA 3SEBA 3SU8X 2ZNVC 2JYTA 1YNTE 3LYYA 3VUYA 1VLBA 3A1QB 1MG8A 2PLPA 3DVGX 3OAWA 4KVGB 1EO6A 4ANUA 5LXHA 3RNBC 3APCA 2PW9A 3QQ8B 3KUDB 3B2GA 3BYYB 1N6ZA 5D7GA 1FEHA 3N1YC 4KDIC 4W9JA 3OWEB 2AQ2B 3B08A 1V5OA 2MW5A 2FE8A 2ZEQA 3KLSX 1E5WA 1I7HA 2RGFA 3RCZA 2LGDA 5KHQA 2ZW0A 5HG2A 3QARA 2DYOA 3TSSA 3ZLZA 1GG3A 1XO3A 1WJNA 3M3JA 1E8XA 3BIID 5IOIA 4IWOA 2LHEA 2AX5A 4RM8A 4DHJD 3RNFC 4GSWA 2KC2A 4WWOA 3V61A 3UIPB 1TIFA 1FMAD 4IKGA 4MEMA 4BFRA 1PYWD 3ZXRA 4BKSA 2WXQA 5DPSA 1SE4A 3L08A 4MJSB 4RGMA 2FIDA 3T3OA 1TS4A 2N7JA 2BVCA 4WWMA 4FLHA 1V8CA 1K52A 2ZCCA 4XDDA 5BYQA 4RM9A 1AN8A 3N32A 2WX0A 3AN1A 3U30A 3MTNB 2LMCA 2K9XA 2EKEC 1I4QA 5G5HA 1RWSA 3ONSA 1MPEA 2H88B 3Q6BA 2B3AA 5EE3A 3HHMA 3CSFA 4RNAA 3V3XA 3DBRB 4I6PA 4XZ4A 5AEKB 1P0RA 4DHZB 3BINA 4II3B 2O6VA 4ASWC 2YLMA 4BZAA 2K1FA 1ZOYB 3ABVB 4IG7B 1V49A 4C56C 2M19A 3ECIA 3P4QB 4K7SA 2KX0A 1WXSA 4GXBA 3AE7B 2JUOA 3AU4A 4JLCA 1YQ4B 2RDBC 4C7ZA 2I1JA 5JH5C 4YSYB 4HXDA 2V3NA 4F8CB 1T0QC 3B1LX 4KZCA 4GDLA 3I5JC 3R3MA 4JIOU 2WP9B 4YT0B 2KXJA 3WA0A 2QSDA 3NVWA 3PRZA 5AZGA 2IO2B 1LXDA 1WGKA 1WSPA 2HJ8A 4ANVA 2MBQA 2DAFA 1YIWA 4PYZA 2NBVB 3X0WA 3Q3NC 3DHIC 4MH8A 3AE8B 4W9CA 3NZSA 3JVZX 1KFYB 1PGAA 1QOBA 1SB3C 2GBNA 3ZO5B 4M0WB 2LVPA 3APDA 1KTKA 4DHZE 1H8CA 3C19A 4ARCA 1DOYA 4OZAA 1LM8B 2BS3B 4LDTB 1C77A 4XYCA 3MHZA 1D5XC 2D3AA 2INNE 2C7HA 1VDVA 4TKNA 2IO3B 2DZKA 2MLBA 3JW0X 4N59A 4ZHOA 3TIXA 3QJZA 4GDKA 1WI0A 3WIMA 2KTRA 3L54A 4K3BA 1L4DB 5T8IA 2HD5B 2GB1A 4CYEA 1R7SA 4G50A 3NVVA 5HFYA 4HDQA 3U7ZA 2FUG1 2KYWA 1WF9A 4KKIA 2K3UA 1TGZB 1WMHB 2KDFB 1A70A 1GNUA 2JZPA 1KF6B 4S17A 1JWMD 3HVZA 3IAS1 1I4GA 3T3NA 4NY0A 1SJED 3LB8C 3HM6X 1TBEA 4DDGD 3P4RB 3V6EB 1AW7A 1NBFC 4PS3A 2IO1B 3NVZA 4MM3A 2BB6A 1E7VA 4HROA 5G2NA 2SAKA 2BQQA 4RH6A 1WM2A 1J7AA 4GB9A 2KQ4X 4ACFA 2M17A 5LNK1 3NY5A 2M0AA 3C0RB 2NPTB 2UYZB 2WXNA 5IKCM 3UINB 1V1PA 3ZDMC 1D6EC 1WE6A 2BW2A 1N5XA 3KWLA 4AJWA 3R7RA 1K8RB 1GB4A 2ZPYA 1CK1A 2OHFA 1JW9D 2M0XA 4YTPB 4A3OA 2N0SB 4USAA 2QHOA 2GMIC 2R2QA 1MVKA 1V81A 1FNWA 1TS2A 1L0VB 4WJOA 1VZ6A 4PK1A 1WXQA 2K8BA 3U8ZA 2L05A 1LO5D 1N61A 2KWCA 4KIKA 3EA6A 2FBWB 3KH0A 3IHPC 1EF5A 3ZYYX 2J53A 3VUWA 1UH6A 3DBSA 5CX3A 1FD6A 2NBWB 2KJ6A 1FM0D 4N6EB 4KGRA 4HRSA 1CZPA 3QCAA 2KZRA 3EFUA 4IDIA 3B9JA 2A5UA 2DHZA 3PVLA 5E6JA 3B0AA 4A20A 4TQ1A 2D11A 1SJHD 2DZIA 1LGRA 3VVWB 4HKQA 3RPFC 4A6QA 3PPAA 2Z59B 2MBOA 1HA5A 4MGYE 4WAFA 4AS1A 2IO0B 4RF1A 1GUAB 2AWTA 3SR6A 3TJPA 2AQ1B 4W9DA 2WLBA 3PO0A 4WJNA 3V62A 4B0MA 2YEPB 4WH4A 3JSVB 3ZKJC 1Q10A 2N9KA 1OFFA 1V9JA 3MJ5A 4AOFA 2D2QA 2DYBA 1TJEA 1L0XB 2BYVE 4ZRQA 1S3SG 4II2B 3IT6B 3B2FA 3N9YC 4DXFA 2LHDA 5J2RA 4MGZE 1RFKA 1IBXA 3NZUA 2LASA 3NZ3A 2G9HD 3TMPB 2BKFA 1C9FA 4IUMB 3OJ3A 3Q3JA 3PRPB 1NI2A 1FIQA 1YJ1A 2K39A 3Q8AA 3K9PB 1MJDA 1XLNA 4MT5A 2PE6B 4RGNA 3NS1A 2JPHA 1JWAD 4BBNC 3FILA 5D3IB 1XD3B 1ENFA 4GN1A 3VRAB 4BOZB 4FJZA 1HTQA 2PMVA 4C4VB 1UELA 2Y5PA 2BWFA 4WJQA 4EZLA 1YN3A 5C2TB 4NAWA 1ZKHA 3FC4A 3PZ8A 4KZ0A 4NQLB 2RR9A 4HCPB 4WQOB 3H6NA 3AB5A 4FHKA 2KMAA 4LTUA 1IGCA 1UWXA 4P1CC 2NTSA 2KWVB 1BT0A 3QIJA 2L0TA 4KV2A 3W2DA 2OJWA 5FK9C 1Q0WB 2N7DA 3MP9A 1EWYC 1UGJA 5TSSA 3RUIB 1D3ZA 4DBGA 4M00A 1NDDA 4KGTA 4NNJB 1QOGA 5J18A 3P42A 3EHVA 1FCLA 1ZUD2 3L4PA 1TZ1A 4OZCA 2D10A 4FJVB 1AARA 3VTVA 1KH0A 1C79A 2KN4A 3BK1A 4HPLB 2KX3A 2O6VB 2RD0A 3MFGA 1ZPSA 1IGDA 5IN7A 1Z2MA 5IO9A 3EFCA 2N1VA 4TV3A 1GJZA 2INDC 3VXWA 3VR9B 2WGSA 2Y5CA 5BMIA 4FBJB 1ZXIA 3ZJTA 1WR1A 2PTLA 1K51A 4A8XC 2WWZA 2XNAC 4IWPA 4PS8A 4GDLB 1J7BA 1KLGD 4ANXA 5IAAC 2HTME 1WX9A 2L8JA 5L83A 5D94A 3QX1A 1F9JA 1JRPA 4FADA 2WXJA 3ZVVA 1JRUA 1QOFA 1IP9A 2EELA 3EGRA 2TSSA 5BYSA 1R4NI 4K81A 2GBMA 2Z0DB 2L76A 1N60A 2L3ZA 2JYEA 4TUUA 3P4SB 3H7SA 5MPOA 4MGIE 4LNFA 3JSVA 3Q8BA 2D3CA 1KOTA 2L83A 4GDKB 3VH4B 1L5PA 5FKAC 2KTRB 5GXGB 2KQ7A 2RSUA 3BWUD 5HHDG 5BYRA 2JSVX 4LJPB 3WAOA 2KD0A 1FO4A 3BVGA 1UWMA 1YX6B 4K1RB 3Q14C 3R7QA 4G3XB 4MSQB 2YVCA 1JMLA 4CQNA 1P9DU 1NYRA 2BS2B 1FFUA 3VAWA 4XWWA 1VZ7A 3RULA 1I4RA 4JL9A 1WXAA 2QMTA 3ZRCA 1YN5A 1GC6A 4NJ7A 4C4VA 4DHJB 1YN4A 4J3OD 1QZEA 3IXSA 3VDZA 4LNNA 2RDHA 4L23A 2LRUA 2BB5A 4MM3B 1RAXA 4C7YA 5L95C 2KWDA 2IGGA 3H1UA 1ACCA 1C1YB 1NVID 1SE9A 4RCOA 1F77A 1V80A 4I6LB 3BY4B 2FCMA 3I3TB 4A90A 1NENB 2ZZPB 2WDVB 1UNSA 1WGRA 2AL3A 1MG4A 4BOSC 1L6UA 1V1PB 2L52A 4ZOHC 4EE2A 4M02A 1FCCC 2J0KA 2KOXA 4KX6B 1HEZE 2J0JA 1ZXHA 3DBLB 1EWCA 2BS4B 1BXTA 2V4IB 3U7DA 1SGHA 3PGEA 1QOAA 3RNAC 3P1MA 2KN5A 2NVUI 2BPSA 4YWGG 2LFIA 1JWBD 4XC2A 2KJHB 3LDZE 4I6NB 3I63C 4MELA 2MH7A 1ROEA 1ESFA 1RM6C 1T0YA 2KT7A 3VUXA 2GLSA 1CQVA 4OVUA 3AM9A 3N1ZC 3NRZA 3ZTDA 4KIKB 1N62A 1OEYA 3NUHB 1E8ZA 2L7RA 2V4LA 3W1YA 1ZGUB 3HM3A 4YSXB 4HJGE 5C23A 1MI0A 3ALBA 2OEDA 3EECA 1PGXA 2WXGA 3Q3FA 2A4ZA 1VRAB 3UGBB 4YXDB 3T9LA 1F1HA 2MJDA 3TBLD 4PS7A 3GE3C 5JXVA 1ZE3D 2KVZA 1KLUD 2EMTA 3J9CA 1IUEA 1G6JA 1WR6E 1QILA 4MH0E 3Q3MC 3A9KA 3DWGC 2VRRB 3APFA 5AUKA 5TR5A 3GE8C 4DXGA 5EE1A 1I35A 3ML8A 3NHEB 1WE7A 3DQVA 1U4AA 2LUEA 3AI5A 1WGGA 4WQMA 3OLMD 3KUCB 1Y8RC 5E6NA 1IBXB 3SFDB 3LXFA 1I4HA 2X38A 3DPDA 4ICUA 1L7YA 4H2AA 4NAMA 3MC9A 3R2TA 3TUOA 1NEKB 3DVGY 1C4AA 4S0RA 4XX5A 2JF5A 3FILB 1WM3A 1KLVA 3ZDTA 1FXIA 1R4MB 1FPYA 3ZNZB 1V1OA 4NJ6A 5LXIB 1TY0A 1S1QB 1RLFA 2WNMA 4A9AA 4HPMB 3TCAA 5D6JB 2L00B 4NAWB 3IVFA 4K7UA 1STEA 5J17A 4RFBA 1J19A 1C76A 2IYDB 2OOBB 1V2YA 4HPPA 4DXAB 3AEGB 2VH2A 4CO7A 2IDYA 4BKGA 1ET6A 4LCDE 2WQYB 3PRMB 4ITKA 3H7PA 2ZJDA 4XWTA 1HXYD 1YQBA 2J52A 4GU2A 3V60A 3P4PB 4BKTA 1IPGA 3LJ3A 4HJKA 2K0PA 4B95A 4M01A 5EE9A 2KDBA 3I9V1 1YD8U 4HLEA 3PSEB 4W9IA 2O2VA 2INCC 3CWIA 2Z0EB 3L17A 1T5XD 3WANA 2W9NA 1UBQA 3AU5A 1E6EB 2M8SA 3ZJUA 1KM7A 1TYGB 2JY6A 1F52A 1H4RA 4HK2A 2WXKA 1L6VA 3HVDA 2LXAA 4WAAA 2JRHA 1OTRB 3VH3B 2DZMA 2KAJA 1YJIA 2WXIA 2DYMA 2IY0B 2MBEA 2CHZA 3GOEA 3MJWA 4YL8A 1FFVA 2VZKD 1LQBA 2RPQA 4W9EA 5DPTA 3PREA 1TKEA 1Q5WB 1R4NB 1FNVA 4MGKE 3OJ4B 4ZRJA 2LGIA 4LJOB 2ZNVB 2KO3A 4WJPA 4AP4C 3L10B 1T0SC 2WXHA 1WGYA 1D5ZC 3R8BA 4FHJA 4LNKA 2GBKA 3IFWB 3VFKA 3Q69A 2IY1B 1E9MA 4FA6A 4ARIA 3ZGZA 2ZVOA 1WJUA 2GBJA 2KFKB 2I2YA 1P7EA 1ZDXA 1J7CA 2LWPA 3RYTA 4NZLB 2MCNB 2JZ3B 3BZDB 2N4FA 4EKUA 3AULA 3A9JA 2SEBD 5JHAA 3AECB 5EE0A 2G4SA 2WX1A 4OHJA 1TZOA 4IM2A 3E56A 5D3DA 1Y56A 3NVYA 1UBIA 2MEKA 4D2KA 4AUQC 3AE6B 4FJYA 3Q2AC 3UQAA 3NOBA 4P7IA 1E10A 5DPWA 2WYQA 1E8YA 2LGYA 3R66C 2G4DB 1YOVB 3RD2A 1VJKA 2D5GA 1UD7A 2EKIA 1SIJA 2MBHA 3Q8EA 4US9A 4GMVA 4WIPA 3VTUA 2PVGC 4RMAA 3ZW3A 2CJNA 1B9RA 2LUMA 4TSSA 4E3CA 1ZP0B 2MWSB 4KSKC 4QAYA 2Y3AA 3GZNI 2IBIB 4ANWA 4JWUC 4N9F4 3AE3B 2ICIA 3PLVA 3ZXVA 4YTNB 1MFWA 4FN2A 2WHIA 2JWUA 1SIFA 2IPKD 2ASQA 3O13A 5G5GA 3VRBB 4HKZE 4GIVA 3RNGC 1EU4A 1WIAA 3DBHI 4ZHPA 5DCNA 4RGOS 3P63A 1FRDA 2R61A 4NJCA 1LFDA 2G3QB 2M56B 3W1SC 2NS5A 4B6WA 1C4PA 3N1XC 4PYUA 3U52E 3PTFC 3TEYA 2PKOA 2W82A 1SF0A 3FAHA 2GRIA 4IOIE 3PS6A 1HE8A 4IM0A 2Y5BB 1PUTA 5EDSA 4B0EA 1B1ZA 2WXLA 1T3QA 2E3TA 1FNUA 3M62B 4HCNB 1L4ZB 3HUIA 5D2MB 2BT6A 2LRWA 2KLGA 1SEBD 3A33B 2HE7A 2KHWB 1V86A 1PDXA 3A9KB 4KDLB 2CJOA 4Q2JA 3VQIA 3RI7C 2REXA 3ZIMA 1VD2A 1ZDVA 1D4BA 2DZJA 2FNJB 1J8CA 4N58A 2PVOD 2XBBC 1M94A 2X8XX 2WU2B 5CTRC 4P6VF 2JVCA 1TY2A 3UF8A 1HZ5A 1GC7A 2CU1A 3AEEB 3MHSD 4EOYA 1DOIA 2AEHA 3M63B 4L1BA 2ZPNA 3WCQA 4ICVA 4ZYSA 1SE3A 4ZRKA 3ML9A 1C3TA 1XCQL 1YQ3B 2KFKA 2LJ5A 1WGHA 2AL6A 1JROA 5H8YE 3OG5A 2N9PC 1V6EA 2OJRA 4A55A 3GB1A 1EF1A 2QDFA 2CHWA 4RF0A 1BUIC 3W5VB 3AV8A 1TT5B 1AWDA 3ZJVA 5AUIA 1WJ4A 2QIEB 4MSMB 4B9KA 1FXAA 2C7NB 4GOCA 1RFAA 3RNEC 3BK2A 4K3CA 1SBBB 2V0GA 3DDCB 2HJ1A 1XLPA 2JQRB 3SHQA 2LGSA 3IG3A 3KW5B 4EZJA 5H92C 2INPE 1PFDA 1WY8A 2WXOA 1QF6A 4E71A 5C3JB 4IW0A 1WFYA 4A3PA 2MP2A 2L32A 4DDID 4WWNA 1WXVA 3WAPA 2V9HA 1HQRD 2BWES 4JX1C 4PT5A 1WH3A 4MDKE 1JWUD 3H7PB 2IZVB 3ZUNA 4LLGM 5BO4B 3KVFB 2K6DB 1GOZA 2KQSA 2M1MA 2XK5A 3D32A 3SDLC 1N63A 2AYOB 3U4EG 3KUZA 2MHJA 2WU5B 4FULA 1K50A 4JPSA 1F0ZA 4LNOA 2O2VB 3ZRFA 3V05A 3X23A 3N20C 4W9GA 2W54A 1TTNA 4G0NB 4DK5A 4LNIA 1WRDB 3A4RA 4BVUC 2H89B 5G55A 2NR2A 2L0FA 3RFZB 1N5WA 2KK8A 2MRPA 3CF6E 1T6BX 3MC8A 2K25A 2YEPF 4E74A 1WJ6A 1V97A 1EUVB 3NS8A 2GBRA 3AE4B 1Z5SB 2FAZA 2LI5A 2J42A 2CHXA 1J0GA 2FCQA 2IJ0A 2MBBB 2PIAA 3ZTCA 3ZNHB 2JWZA 2C9WB 2CKHB 2WXPA 1XLOA 4O1NA 4W9FA 2D07B 2ONQA 2NMQA 3GP7A 2K8CA 2N9XA 1NYQA 1OQYA 1ET9A 2J0MA 4CHKA 4P16A 5CHVC 4FXCA 1FRRA 3EUB2 2WXMA 5E6PA 1UGMA 3ZQ4A 3KQ4A 3TL5A 2IGHA 1UF0A 3DCGA 2K5PA 2PEAA 2G1EA 5IP4D 3DVNV 4XE0A 1E8WA 4YSZB 3TEXA 3NJTA 2WXRA 3AH7A 4AQ7A 2L1AA 3VHTC 1CJEA 1F2RC 2KWUB 2WS3B 3K9OB 4C00A 4HEA1 1F2RI 4OVVA 2KLCA 1OQQA 1WXMA 2HDEA 2PE9A 3R2IA 4R3DA 1BMLC 3HRDD 2AQ3B 3N30A 2M4NA 2IGDA 4LDTD 3HK0A 1TKGA 2LZ6A 3QK0A 2N9LA 3EC8A 4F1SA 2N9EB 3IAM1 4M8MA 3WAMA 3A1QA 5GMVA 3FKYA 3L16A 2KMCA 4ZRIA 1OQRA 2CU3A 2XEWA 1P98A 3AEBB 1TS3A 3AE2B 3A9JB 2N7EA 2GI9A 1E7PB 1A5RA
chains in the Genus database with same CATH topology
1FNVA 4XDDA 5BYQA 3AE9B 1AN8A 1MHHE 2JXTA 2LGIA 3AN1A 3VR9B 5BMIA 2Y5CA 1ZXIA 2LMCA 3ZJTA 2PTLA 2K9XA 1K51A 4A8XC 2W3RA 1I4QA 2XNAC 5G5HA 1RWSA 3KWVA 1MPEA 2WXHA 4GDLB 4OZBA 1D5ZC 2H88B 3R8BA 1J7BA 1KLGD 2HTME 2WXFA 2K22A 3Q69A 5EE3A 1E9MA 1JRPA 4ARIA 3ZGZA 4RNAA 3V3XA 2WXJA 2I2YA 1P7EA 2KMMA 1ZDXA 3BYTB 1J7CA 2BBCA 1M4VA 1QOFA 4NZLB 2EELA 3BZDB 1ZOYB 3ABVB 2ZW1A 4C56C 4US8A 1EU3A 1TS5A 2M19A 3EGRA 2TSSA 3P4QB 5BYSA 1YMHE 2SEBD 3AECB 3AE7B 5EE0A 1YQ4B 4OHJA 1N60A 2ON8A 1TZOA 4C7ZA 4C80A 2JYEA 3P4SB 3E56A 4YSYB 4KKJA 2W3SA 5MPOA 5D3DA 3W5UB 1Y56A 3NVYA 3Q8CA 1SE2A 1SSNA 3Q8BA 2MEKA 4D2KA 3AE6B 2MJ3A 2L83A 4GDKB 2V3NA 1L5PA 5FKAC 1YJJA 5GXGB 1E10A 2RPVA 3BWUD 5HHDG 1JQ4A 2WP9B 4YT0B 5BYRA 2JSVX 2QSDA 3NVWA 2B76B 2NTTA 1VJKA 1FO4A 1WGKA 1WSPA 3BVGA 1UWMA 2D5GA 3TEZA 2EKIA 2WDQB 1DYQA 2Z8LA 1SIJA 3ETRA 4MH8A 1JMLA 3AE8B 3Q8EA 4US9A 4CQNA 1KFYB 1PGAA 1NYRA 2JU6X 2I38A 2BS2B 3GS2A 1FFUA 4WIPA 2BTEA 2PVGC 1QOBA 1SB3C 4XWWA 1VZ7A 2CJNA 1KTKA 4OW0A 1I4RA 4ARCA 1B9RA 1P7FA 1DOYA 4OZAA 1QQRA 2BS3B 2LUMA 1JALA 2QMTA 4TSSA 1ZP0B 1C77A 4DQOC 1UUPA 1YN5A 2Y3AA 4REZA 5FR3A 1QKZA 3MHZA 1D5XC 4JWUC 2INNE 1VDVA 2LJIA 3BVZA 1YN4A 4J3OD 2V3PA 3AE3B 3IXSA 2ICIA 2RDHA 4YTNB 1SXTA 4L23A 4N59A 4ZHOA 2BB5A 4MM3B 2JWUA 2IPKD 3O13A 1L4DB 2VZKB 5G5GA 5T8IA 3VRBB 4C7YA 4HKZE 1I4PA 1RYJA 1XLQA 2KWDA 2WDRB 2IGGA 2GB1A 5BMGA 1ACCA 1EU4A 1NVID 1R7SA 4RCOA 4ZHPA 5I4DA 1F77A 4RGOS 3NVVA 5HFYA 3P63A 1FRDA 3AE5B 3U7ZA 2FUG1 2R61A 4NJCA 4A90A 3AEFB 1NENB 2M56B 4KKIA 2WDVB 2K3UA 1UNSA 1C4PA 1A70A 3U52E 1D5MC 1L6UA 1V1PB 2JX5A 2DBYA 2L52A 4M0WA 4ZOHC 2PKOA 2QEJC 2ACZB 2JZPA 4EE2A 3TEYA 1KF6B 2W82A 1QLBB 1FCCC 1JWMD 1SF0A 3FAHA 3HVZA 4KX6B 2GRIA 3IAS1 4IOIE 1HEZE 1GAQB 1I4GA 1ZXHA 2W55A 4YTMB 3T3NA 1EWCA 2BS4B 1BXTA 2V4IB 4L2YA 1SJED 3LB8C 1QOAA 3TEWA 2XN9C 1PUTA 3P1MA 4B0EA 1B1ZA 3P4RB 1JWSD 4YWGG 2LFIA 2WXLA 2Q5WD 4JWSC 3H8HA 1T3QA 2E3TA 1AW7A 2RDGA 1FNUA 1JWBD 1L4ZB 3NVZA 3HUIA 2MH7A 2BB6A 2KDMA 4HROA 2KACA 2BT6A 2SAKA 1ROEA 1EM7A 1ESFA 1RM6C 1SEBD 4RH6A 2QJLA 1CQVA 1J7AA 1PDXA 2CJOA 3AM9A 3NRZA 4Q2JA 3VQIA 2KQ4X 1N62A 3BVMA 3NUHB 5LNK1 1ZDVA 1D4BA 2M0AA 4N58A 2PVOD 4JE3B 1XEEA 2WU2B 4P6VF 4YSXB 4HJGE 1TY2A 3PZ7A 1HZ5A 2WXNA 1C78A 2RMMA 2BYTA 1MI0A 1V1PA 3AEEB 4MACA 1D6EC 1DOIA 2OEDA 1WRIA 2BW2A 1N5XA 3KWLA 4L1BA 1PGXA 3WCQA 4ZYSA 2WXGA 1C4CA 1NI3A 1SE3A 1VRAB 2QILA 1XCQL 1YQ3B 4YXDB 1GB4A 1CK1A 2OHFA 1JW9D 1TKYA 1JROA 4YTPB 2N0SB 4USAA 5H8YE 1MVKA 2MJDA 1PGBA 1FNWA 4A55A 1ZE3D 5JXVA 3GB1A 1TS2A 1L0VB 4RF0A 1KLUD 1BUIC 3W5VB 3E9SA 3AV8A 1VZ6A 1IUEA 3J9CA 1AWDA 3ZJVA 5AUIA 1WXQA 2J4XA 1QILA 2QIEB 3DWGC 1FXAA 1LO5D 1N61A 3BK2A 3EA6A 3CIRB 2FBWB 1SBBB 3AEAB 4WURA 5AUKA 2V0GA 3ZYYX 2J53A 4DXGA 1JCKB 5EE1A 1XLPA 2JQRB 1E0ZA 3URYA 2E6XA 5H92C 2INPE 1FD6A 1PFDA 2MJEA 4WQMA 2WXOA 1QF6A 1FM0D 4LK0M 4N6EB 4OVZA 4KGRA 4HRSA 3SFDB 1IBXB 1CZPA 3LXFA 1GB1A 5C3JB 1I4HA 3I57A 1DOXA 2X38A 4IDIA 3B9JA 2L32A 4H2AA 5E6JA 4NAMA 1HQRD 4TQ1A 1SJHD 3R2TA 3TUOA 4JX1C 4PT5A 4UDUC 4ZRPA 1NEKB 4HKQA 1JWUD 1VR9A 1C4AA 1KRHA 3RPFC 4A6QA 1GPXA 4TMAB 4LLGM 4WAFA 1HA5A 1XXGA 4RGTA 1GOZA 3W1SA 4AS1A 4KGSA 3AMZA 3SFEB 4RF1A 4XDCA 2LEKA 3FILB 3AEDB 4GLSC 3SR6A 1N63A 2AQ1B 3U2SC 2WLBA 1FXIA 1K53A 3PO0A 3VR8B 1V1OA 3U4EG 2DLBA 2WU5B 1K50A 3AE1B 4B0MA 4JPSA 1TY0A 1VZ8A 2YEPB 4WH4A 1F0ZA 3DWMA 1Q10A 2N9KA 1OFFA 3MJ5A 1L0YB 4A9AA 2WNMA 1TJEA 3V05A 1L0XB 4NAWB 4ZRQA 2W54A 3IT6B 5HI1A 3W9CB 1STEA 3B2FA 3C8YA 3N9YC 4DXFA 2LHDA 1XCTL 3MC0B 2H89B 1RFKA 1IBXA 5BMHA 4RFBA 1QT9A 3NZ3A 1XF5L 2G9HD 3RFZB 1N5WA 1C9FA 1C76A 1HZ6A 1T6BX 3UI3A 1FIQA 2YEPF 3Q8FA 1V97A 1DGJA 3AE4B 3AEGB 2IDYA 3Q8AA 1ET6A 2DWQA 2J42A 2WQYB 4ITKA 4XWTA 2IJ0A 1HXYD 1XLNA 1WWTA 4MT5A 4RGNA 2PIAA 1AYFA 3IT4B 2WXPA 2J52A 4O1NA 1XLOA 3NS1A 1MHXA 4TQ0A 1I4XA 1JWAD 2NMQA 2ONQA 3GP7A 3P4PB 3FILA 1NYQA 5D3IB 1ET9A 1WYGA 4P16A 1ENFA 3SEBA 3VRAB 2K0PA 2JYTA 4FXCA 1FRRA 1YNTE 5EE9A 2PMVA 3EUB2 3LYYA 2WXMA 3I9V1 1VLBA 2Y5PA 2PLPA 1YN3A 3CWIA 5C2TB 3ZQ4A 2PW9A 3FC4A 3KQ4A 2IGHA 3B2GA 3BYYB 3PZ8A 5D7GA 2K5PA 2G1EA 1FEHA 1T5XD 3AB5A 3OWEB 4XE0A 4YSZB 3TEXA 1E6EB 2AQ2B 2WXRA 3AH7A 4AQ7A 2L1AA 2FE8A 4LTUA 3KLSX 1I7HA 1CJEA 1IGCA 3ZJUA 1UWXA 1TYGB 2NTSA 1F2RC 2WS3B 4HEA1 2ZW0A 1F2RI 5HG2A 2DYOA 1OQQA 2HDEA 3TSSA 3R2IA 4R3DA 3W2DA 1BMLC 1XO3A 3HRDD 5FK9C 3MP9A 2AQ3B 1EWYC 1UGJA 5TSSA 2IGDA 4KGTA 3BIID 1TKGA 1QOGA 2WXKA 3P42A 1L6VA 2LHEA 3HVDA 1FCLA 1ZUD2 2N9LA 2AX5A 3L4PA 2KAJA 4OZCA 1YJIA 3IAM1 1KH0A 2WXIA 1FMAD 1C79A 2KN4A 4IKGA 2DYMA 3BK1A 1PYWD 2WXQA 1FFVA 2VZKD 1OQRA 1ZPSA 3MFGA 1SE4A 1IGDA 2CU3A 4RGMA 3T3OA 3AEBB 1TS3A 3AE2B 1TS4A 2N7JA 1TKEA 4WWMA 2GI9A 1E7PB 1V8CA 1K52A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZP0 B;  1JAL A;  1NI3 A;  3AE9 B;  1FIQ A;  1YQ3 B;  1DGJ A;  1V97 A;  4YXD B;  4JWU C;  2OHF A;  1VDV A;  3AN1 A;  1JW9 D;  1TKY A;  3VR9 B;  2Y5C A;  2BS3 B;  3AE4 B;  3AEG B;  1JRO A;  1ZXI A;  3AE3 B;  2N0S B;  4YTP B;  4USA A;  2K9X A;  2DWQ A;  2W3R A;  5H8Y E;  4YTN B;  2WQY B;  2MJD A;  4ITK A;  5G5H A;  1RWS A;  4N59 A;  4ZHO A;  1XLN A;  1WWT A;  2PIA A;  1AYF A;  2H88 B;  1XLO A;  1J7B A;  1L0V B;  3NS1 A;  1JWA D;  3P4P B;  4US8 A;  3W5V B;  2HTM E;  3AV8 A;  5G5G A;  3VRB B;  1IUE A;  4C7Y A;  1NYQ A;  1AWD A;  1XLQ A;  1RYJ A;  2WDR B;  1WYG A;  5AUI A;  1WXQ A;  2K22 A;  5EE3 A;  1NVI D;  1R7S A;  3VRA B;  1E9M A;  1JRP A;  4ZHP A;  2QIE B;  4FXC A;  3DWG C;  1FRR A;  3NVV A;  1FXA A;  5EE9 A;  1N61 A;  3EUB 2;  3P63 A;  1FRD A;  1VLB A;  3AE5 B;  2KMM A;  3CIR B;  2FBW B;  3AEA B;  1J7C A;  5AUK A;  3AEF B;  1NEN B;  2M56 B;  3ZYY X;  2WDV B;  5EE1 A;  1XLP A;  2JQR B;  1QOF A;  3CWI A;  1E0Z A;  5C2T B;  3FC4 A;  1ZOY B;  5H92 C;  1A70 A;  3ABV B;  3B2G A;  1L6U A;  1PFD A;  2JX5 A;  2MJE A;  2M19 A;  2DBY A;  4WQM A;  3P4Q B;  2K5P A;  2L52 A;  2G1E A;  2PKO A;  4ZOH C;  2ACZ B;  3AB5 A;  1QF6 A;  1FM0 D;  1KF6 B;  3AEC B;  4N6E B;  1QLB B;  4HRS A;  3SFD B;  4YSZ B;  1CZP A;  1SF0 A;  3AE7 B;  3LXF A;  5EE0 A;  5C3J B;  1E6E B;  3AH7 A;  3FAH A;  3HVZ A;  4KX6 B;  2W55 A;  1GAQ B;  1YQ4 B;  4YTM B;  1DOX A;  1N60 A;  3B9J A;  4IDI A;  4LTU A;  2BS4 B;  4C7Z A;  4C80 A;  1I7H A;  3LB8 C;  1QOA A;  3P4S B;  1CJE A;  4YSY B;  5MPO A;  1TYG B;  2W3S A;  3W5U B;  2WS3 B;  1PUT A;  3P1M A;  3NVY A;  3P4R B;  2Q5W D;  4JX1 C;  1OQQ A;  4JWS C;  1T3Q A;  3AE6 B;  1NEK B;  2E3T A;  1JWB D;  2MJ3 A;  1KRH A;  1XO3 A;  3HRD D;  3RPF C;  1GPX A;  2L83 A;  1EWY C;  1L5P A;  3NVZ A;  3HUI A;  2MH7 A;  1YJJ A;  3AMZ A;  5GXG B;  3SFE B;  3BII D;  4HRO A;  1TKG A;  1QOG A;  2BT6 A;  1E10 A;  1ROE A;  1L6V A;  2LEK A;  1RM6 C;  3AED B;  1ZUD 2;  3SR6 A;  1N63 A;  2AX5 A;  3VR8 B;  2WLB A;  1FXI A;  2WP9 B;  3PO0 A;  4YT0 B;  1JQ4 A;  3L4P A;  2QJL A;  1PDX A;  1J7A A;  2B76 B;  3NVW A;  2CJO A;  2KAJ A;  2WU5 B;  1VJK A;  1YJI A;  3AM9 A;  3NRZ A;  1WGK A;  1FO4 A;  1UWM A;  3AE1 B;  1FMA D;  1N62 A;  1F0Z A;  3DWM A;  2EKI A;  2WDQ B;  1OFF A;  1SIJ A;  3ETR A;  3AE8 B;  2PVO D;  4N58 A;  4A9A A;  4US9 A;  1TJE A;  2WU2 B;  1FFV A;  1KFY B;  1OQR A;  1NYR A;  4P6V F;  2BS2 B;  4YSX B;  1FFU A;  2W54 A;  3W9C B;  2PVG C;  2CU3 A;  1QOB A;  1SB3 C;  1E7P B;  3B2F A;  3AEE B;  2CJN A;  3AEB B;  3AE2 B;  1DOI A;  1TKE A;  1WRI A;  2H89 B;  1B9R A;  1N5X A;  1RFK A;  3KWL A;  1DOY A;  4WWM A;  1QT9 A;  1V8C A;  3WCQ A;  1N5W A; 
#chains in the Genus database with same CATH topology
 2I1K A;  3RZW C;  3AE9 B;  1MHH E;  2JXT A;  2KJR A;  3A4S C;  2W3R A;  2MSE D;  3P2B A;  1RRB A;  3HIZ A;  3RMK C;  5C1Z A;  3KWV A;  4OZB A;  1WGD A;  2MQJ A;  3M95 A;  2V1Y A;  2WXF A;  4EEW A;  2K22 A;  4X57 B;  4K7W A;  2KMM A;  1X1M A;  2KNB A;  2DNF A;  2KKC A;  3BYT B;  2BBC A;  4KSL C;  3WAL A;  1M4V A;  5LLI A;  2GOW A;  4MJS A;  2ZW1 A;  4US8 A;  1EU3 A;  1TS5 A;  3ZNI D;  1YMH E;  3CST A;  3PLU A;  2LD9 A;  5FR6 A;  2ON8 A;  4C80 A;  4KKJ A;  2W3S A;  3W5U B;  2KFJ A;  3GZN B;  3O65 B;  3Q8C A;  1SE2 A;  1SSN A;  3SD5 A;  2DAJ A;  4WWP A;  2MJ3 A;  4M8N A;  3RNC C;  1ISN A;  1YJJ A;  2RPV A;  5JHB A;  1OGW A;  3DBL I;  2C60 A;  1JQ4 A;  3DBR I;  2B76 B;  2NTT A;  3DBH B;  2BYE A;  3PZD A;  3TEZ A;  1PQS A;  2BF8 B;  1DYQ A;  2WDQ B;  2Z8L A;  3ETR A;  5CHW A;  1V5T A;  4EZK A;  4URK A;  2JU6 X;  3GS2 A;  2I38 A;  2BTE A;  2NBU A;  2G45 B;  5CHF A;  2J7Q B;  1HTO A;  4OW0 A;  5HKH A;  2QC8 A;  1P7F A;  3KYC D;  1QQR A;  4NQK E;  1JAL A;  2V3S A;  2C5L C;  4DQO C;  1UUP A;  3V6C B;  4REZ A;  5FR3 A;  1QKZ A;  1WZ3 A;  4BAX A;  3DVN U;  2LJI A;  3BVZ A;  2V3P A;  2BKR B;  3CMM B;  1SXT A;  1XQQ A;  2VZK B;  2UU7 A;  1I4P A;  1RYJ A;  1XLQ A;  2WDR B;  5BMG A;  3DHG C;  4IC7 B;  4NPN A;  2MX2 A;  5I4D A;  2DEN B;  3ZNG C;  1FXT B;  3AE5 B;  3AEF B;  2KVR A;  2JRI B;  2K8H A;  1Q1O A;  3L13 A;  4HDO A;  2NCN A;  2C7M B;  4F7Z A;  3NG0 A;  1D5M C;  2JX5 A;  2DBY A;  4M0W A;  2QEJ C;  2ACZ B;  1QLB B;  3H9D A;  2W55 A;  1GAQ B;  4YTM B;  4ZYN A;  4L2Y A;  2UWQ A;  2N1W A;  3TEW A;  2XN9 C;  1L2N A;  3Q3O C;  1JWS D;  1WZ0 A;  4W9K A;  2Q5W D;  4JWS C;  1P3Q U;  3H8H A;  3QAQ A;  2RDG A;  5E6O A;  3PT2 B;  2KDE B;  2LGX A;  5IA7 A;  2JZZ A;  2KTF A;  2KDM A;  2KC1 A;  1WYW B;  2KAC A;  4EUT A;  1EM7 A;  3PHX B;  3QWZ B;  2QJL A;  2QCZ A;  4JQW C;  3QA8 A;  3AXC A;  1UZX B;  3BVM A;  4DWF A;  3VTW A;  1I42 A;  2WDT B;  4JE3 B;  2ZCB A;  1XEE A;  3JYU A;  1WMH A;  3PZ7 A;  1IYF A;  1C78 A;  2RMM A;  2BYT A;  1R4M I;  4MAC A;  5KHO A;  1WRI A;  5JZE B;  4GGQ A;  3L0W B;  1C4C A;  4P1B C;  1NI3 A;  2MP2 B;  4J6I A;  4BKS D;  2LXC A;  2QIL A;  2KDI A;  1TKY A;  4XGA B;  3KYD D;  1PGB A;  2LVQ A;  3RZF A;  4W9H A;  2XK5 B;  4IWQ A;  2K6Q A;  3E9S A;  4W9L A;  2BYF A;  2J4X A;  1OEY J;  3IBE A;  3DOW A;  3CIR B;  3AEA B;  4WUR A;  2JXX A;  3PHW B;  3N3K B;  3UQB A;  2EMS A;  1JCK B;  1E0Z A;  3PV1 A;  3URY A;  2NPT A;  2E6X A;  2CR5 A;  1WX7 A;  2MJE A;  4ZDV A;  2LVO A;  4LK0 M;  4OVZ A;  1GB1 A;  2D3B A;  1E7U A;  3I57 A;  1DOX A;  2R2O A;  2O6V D;  2FCN A;  1YX5 B;  2CS4 A;  4UDU C;  4ZRP A;  2HTH A;  1VR9 A;  3QC8 B;  3RN9 C;  1KRH A;  1GPX A;  4TMA B;  4AJY B;  1XXG A;  4RGT A;  1ZW7 A;  2FUH B;  3W1S A;  4KGS A;  3AMZ A;  3SFE B;  4XDC A;  2LEK A;  3AED B;  4GLS C;  4EFO A;  3U2S C;  3VR8 B;  1K53 A;  5DPR A;  4JGH B;  2D3G A;  2DLB A;  1E90 A;  1KJT A;  3AE1 B;  4HVB A;  1VZ8 A;  2JT4 B;  3DWM A;  2PPH A;  1VCB A;  2VH1 A;  1L0Y B;  3QHT A;  5HI1 A;  3W9C B;  2FCS A;  1WX8 A;  3RT3 B;  5AZH A;  3C8Y A;  1XCT L;  3MC0 B;  2PJH A;  2DX5 B;  2BGF A;  2MA9 B;  4G11 A;  5BMH A;  4BBN F;  1QT9 A;  2FIF A;  1XF5 L;  1HZ6 A;  3S2A A;  3UI3 A;  1T0R C;  3ENE A;  4HWI B;  3Q8F A;  1DGJ A;  5AZF A;  2KAN A;  3UIO B;  4AWJ A;  3DHH C;  4IM3 A;  2DWQ A;  3T8M A;  1XT9 B;  1WWT A;  1P1A A;  1AYF A;  1CMX B;  3IT4 B;  4TQ0 A;  1MHX A;  1I4X A;  2ZVN A;  1WYG A;  3SEB A;  3SU8 X;  2ZNV C;  2JYT A;  1YNT E;  3LYY A;  3VUY A;  1VLB A;  3A1Q B;  1MG8 A;  2PLP A;  3DVG X;  3OAW A;  4KVG B;  1EO6 A;  4ANU A;  5LXH A;  3RNB C;  3APC A;  2PW9 A;  3QQ8 B;  3KUD B;  3B2G A;  3BYY B;  1N6Z A;  5D7G A;  1FEH A;  3N1Y C;  4KDI C;  4W9J A;  3OWE B;  2AQ2 B;  3B08 A;  1V5O A;  2MW5 A;  2FE8 A;  2ZEQ A;  3KLS X;  1E5W A;  1I7H A;  2RGF A;  3RCZ A;  2LGD A;  5KHQ A;  2ZW0 A;  5HG2 A;  3QAR A;  2DYO A;  3TSS A;  3ZLZ A;  1GG3 A;  1XO3 A;  1WJN A;  3M3J A;  1E8X A;  3BII D;  5IOI A;  4IWO A;  2LHE A;  2AX5 A;  4RM8 A;  4DHJ D;  3RNF C;  4GSW A;  2KC2 A;  4WWO A;  3V61 A;  3UIP B;  1TIF A;  1FMA D;  4IKG A;  4MEM A;  4BFR A;  1PYW D;  3ZXR A;  4BKS A;  2WXQ A;  5DPS A;  1SE4 A;  3L08 A;  4MJS B;  4RGM A;  2FID A;  3T3O A;  1TS4 A;  2N7J A;  2BVC A;  4WWM A;  4FLH A;  1V8C A;  1K52 A;  2ZCC A;  4XDD A;  5BYQ A;  4RM9 A;  1AN8 A;  3N32 A;  2WX0 A;  3AN1 A;  3U30 A;  3MTN B;  2LMC A;  2K9X A;  2EKE C;  1I4Q A;  5G5H A;  1RWS A;  3ONS A;  1MPE A;  2H88 B;  3Q6B A;  2B3A A;  5EE3 A;  3HHM A;  3CSF A;  4RNA A;  3V3X A;  3DBR B;  4I6P A;  4XZ4 A;  5AEK B;  1P0R A;  4DHZ B;  3BIN A;  4II3 B;  2O6V A;  4ASW C;  2YLM A;  4BZA A;  2K1F A;  1ZOY B;  3ABV B;  4IG7 B;  1V49 A;  4C56 C;  2M19 A;  3ECI A;  3P4Q B;  4K7S A;  2KX0 A;  1WXS A;  4GXB A;  3AE7 B;  2JUO A;  3AU4 A;  4JLC A;  1YQ4 B;  2RDB C;  4C7Z A;  2I1J A;  5JH5 C;  4YSY B;  4HXD A;  2V3N A;  4F8C B;  1T0Q C;  3B1L X;  4KZC A;  4GDL A;  3I5J C;  3R3M A;  4JIO U;  2WP9 B;  4YT0 B;  2KXJ A;  3WA0 A;  2QSD A;  3NVW A;  3PRZ A;  5AZG A;  2IO2 B;  1LXD A;  1WGK A;  1WSP A;  2HJ8 A;  4ANV A;  2MBQ A;  2DAF A;  1YIW A;  4PYZ A;  2NBV B;  3X0W A;  3Q3N C;  3DHI C;  4MH8 A;  3AE8 B;  4W9C A;  3NZS A;  3JVZ X;  1KFY B;  1PGA A;  1QOB A;  1SB3 C;  2GBN A;  3ZO5 B;  4M0W B;  2LVP A;  3APD A;  1KTK A;  4DHZ E;  1H8C A;  3C19 A;  4ARC A;  1DOY A;  4OZA A;  1LM8 B;  2BS3 B;  4LDT B;  1C77 A;  4XYC A;  3MHZ A;  1D5X C;  2D3A A;  2INN E;  2C7H A;  1VDV A;  4TKN A;  2IO3 B;  2DZK A;  2MLB A;  3JW0 X;  4N59 A;  4ZHO A;  3TIX A;  3QJZ A;  4GDK A;  1WI0 A;  3WIM A;  2KTR A;  3L54 A;  4K3B A;  1L4D B;  5T8I A;  2HD5 B;  2GB1 A;  4CYE A;  1R7S A;  4G50 A;  3NVV A;  5HFY A;  4HDQ A;  3U7Z A;  2FUG 1;  2KYW A;  1WF9 A;  4KKI A;  2K3U A;  1TGZ B;  1WMH B;  2KDF B;  1A70 A;  1GNU A;  2JZP A;  1KF6 B;  4S17 A;  1JWM D;  3HVZ A;  3IAS 1;  1I4G A;  3T3N A;  4NY0 A;  1SJE D;  3LB8 C;  3HM6 X;  1TBE A;  4DDG D;  3P4R B;  3V6E B;  1AW7 A;  1NBF C;  4PS3 A;  2IO1 B;  3NVZ A;  4MM3 A;  2BB6 A;  1E7V A;  4HRO A;  5G2N A;  2SAK A;  2BQQ A;  4RH6 A;  1WM2 A;  1J7A A;  4GB9 A;  2KQ4 X;  4ACF A;  2M17 A;  5LNK 1;  3NY5 A;  2M0A A;  3C0R B;  2NPT B;  2UYZ B;  2WXN A;  5IKC M;  3UIN B;  1V1P A;  3ZDM C;  1D6E C;  1WE6 A;  2BW2 A;  1N5X A;  3KWL A;  4AJW A;  3R7R A;  1K8R B;  1GB4 A;  2ZPY A;  1CK1 A;  2OHF A;  1JW9 D;  2M0X A;  4YTP B;  4A3O A;  2N0S B;  4USA A;  2QHO A;  2GMI C;  2R2Q A;  1MVK A;  1V81 A;  1FNW A;  1TS2 A;  1L0V B;  4WJO A;  1VZ6 A;  4PK1 A;  1WXQ A;  2K8B A;  3U8Z A;  2L05 A;  1LO5 D;  1N61 A;  2KWC A;  4KIK A;  3EA6 A;  2FBW B;  3KH0 A;  3IHP C;  1EF5 A;  3ZYY X;  2J53 A;  3VUW A;  1UH6 A;  3DBS A;  5CX3 A;  1FD6 A;  2NBW B;  2KJ6 A;  1FM0 D;  4N6E B;  4KGR A;  4HRS A;  1CZP A;  3QCA A;  2KZR A;  3EFU A;  4IDI A;  3B9J A;  2A5U A;  2DHZ A;  3PVL A;  5E6J A;  3B0A A;  4A20 A;  4TQ1 A;  2D11 A;  1SJH D;  2DZI A;  1LGR A;  3VVW B;  4HKQ A;  3RPF C;  4A6Q A;  3PPA A;  2Z59 B;  2MBO A;  1HA5 A;  4MGY E;  4WAF A;  4AS1 A;  2IO0 B;  4RF1 A;  1GUA B;  2AWT A;  3SR6 A;  3TJP A;  2AQ1 B;  4W9D A;  2WLB A;  3PO0 A;  4WJN A;  3V62 A;  4B0M A;  2YEP B;  4WH4 A;  3JSV B;  3ZKJ C;  1Q10 A;  2N9K A;  1OFF A;  1V9J A;  3MJ5 A;  4AOF A;  2D2Q A;  2DYB A;  1TJE A;  1L0X B;  2BYV E;  4ZRQ A;  1S3S G;  4II2 B;  3IT6 B;  3B2F A;  3N9Y C;  4DXF A;  2LHD A;  5J2R A;  4MGZ E;  1RFK A;  1IBX A;  3NZU A;  2LAS A;  3NZ3 A;  2G9H D;  3TMP B;  2BKF A;  1C9F A;  4IUM B;  3OJ3 A;  3Q3J A;  3PRP B;  1NI2 A;  1FIQ A;  1YJ1 A;  2K39 A;  3Q8A A;  3K9P B;  1MJD A;  1XLN A;  4MT5 A;  2PE6 B;  4RGN A;  3NS1 A;  2JPH A;  1JWA D;  4BBN C;  3FIL A;  5D3I B;  1XD3 B;  1ENF A;  4GN1 A;  3VRA B;  4BOZ B;  4FJZ A;  1HTQ A;  2PMV A;  4C4V B;  1UEL A;  2Y5P A;  2BWF A;  4WJQ A;  4EZL A;  1YN3 A;  5C2T B;  4NAW A;  1ZKH A;  3FC4 A;  3PZ8 A;  4KZ0 A;  4NQL B;  2RR9 A;  4HCP B;  4WQO B;  3H6N A;  3AB5 A;  4FHK A;  2KMA A;  4LTU A;  1IGC A;  1UWX A;  4P1C C;  2NTS A;  2KWV B;  1BT0 A;  3QIJ A;  2L0T A;  4KV2 A;  3W2D A;  2OJW A;  5FK9 C;  1Q0W B;  2N7D A;  3MP9 A;  1EWY C;  1UGJ A;  5TSS A;  3RUI B;  1D3Z A;  4DBG A;  4M00 A;  1NDD A;  4KGT A;  4NNJ B;  1QOG A;  5J18 A;  3P42 A;  3EHV A;  1FCL A;  1ZUD 2;  3L4P A;  1TZ1 A;  4OZC A;  2D10 A;  4FJV B;  1AAR A;  3VTV A;  1KH0 A;  1C79 A;  2KN4 A;  3BK1 A;  4HPL B;  2KX3 A;  2O6V B;  2RD0 A;  3MFG A;  1ZPS A;  1IGD A;  5IN7 A;  1Z2M A;  5IO9 A;  3EFC A;  2N1V A;  4TV3 A;  1GJZ A;  2IND C;  3VXW A;  3VR9 B;  2WGS A;  2Y5C A;  5BMI A;  4FBJ B;  1ZXI A;  3ZJT A;  1WR1 A;  2PTL A;  1K51 A;  4A8X C;  2WWZ A;  2XNA C;  4IWP A;  4PS8 A;  4GDL B;  1J7B A;  1KLG D;  4ANX A;  5IAA C;  2HTM E;  1WX9 A;  2L8J A;  5L83 A;  5D94 A;  3QX1 A;  1F9J A;  1JRP A;  4FAD A;  2WXJ A;  3ZVV A;  1JRU A;  1QOF A;  1IP9 A;  2EEL A;  3EGR A;  2TSS A;  5BYS A;  1R4N I;  4K81 A;  2GBM A;  2Z0D B;  2L76 A;  1N60 A;  2L3Z A;  2JYE A;  4TUU A;  3P4S B;  3H7S A;  5MPO A;  4MGI E;  4LNF A;  3JSV A;  3Q8B A;  2D3C A;  1KOT A;  2L83 A;  4GDK B;  3VH4 B;  1L5P A;  5FKA C;  2KTR B;  5GXG B;  2KQ7 A;  2RSU A;  3BWU D;  5HHD G;  5BYR A;  2JSV X;  4LJP B;  3WAO A;  2KD0 A;  1FO4 A;  3BVG A;  1UWM A;  1YX6 B;  4K1R B;  3Q14 C;  3R7Q A;  4G3X B;  4MSQ B;  2YVC A;  1JML A;  4CQN A;  1P9D U;  1NYR A;  2BS2 B;  1FFU A;  3VAW A;  4XWW A;  1VZ7 A;  3RUL A;  1I4R A;  4JL9 A;  1WXA A;  2QMT A;  3ZRC A;  1YN5 A;  1GC6 A;  4NJ7 A;  4C4V A;  4DHJ B;  1YN4 A;  4J3O D;  1QZE A;  3IXS A;  3VDZ A;  4LNN A;  2RDH A;  4L23 A;  2LRU A;  2BB5 A;  4MM3 B;  1RAX A;  4C7Y A;  5L95 C;  2KWD A;  2IGG A;  3H1U A;  1ACC A;  1C1Y B;  1NVI D;  1SE9 A;  4RCO A;  1F77 A;  1V80 A;  4I6L B;  3BY4 B;  2FCM A;  3I3T B;  4A90 A;  1NEN B;  2ZZP B;  2WDV B;  1UNS A;  1WGR A;  2AL3 A;  1MG4 A;  4BOS C;  1L6U A;  1V1P B;  2L52 A;  4ZOH C;  4EE2 A;  4M02 A;  1FCC C;  2J0K A;  2KOX A;  4KX6 B;  1HEZ E;  2J0J A;  1ZXH A;  3DBL B;  1EWC A;  2BS4 B;  1BXT A;  2V4I B;  3U7D A;  1SGH A;  3PGE A;  1QOA A;  3RNA C;  3P1M A;  2KN5 A;  2NVU I;  2BPS A;  4YWG G;  2LFI A;  1JWB D;  4XC2 A;  2KJH B;  3LDZ E;  4I6N B;  3I63 C;  4MEL A;  2MH7 A;  1ROE A;  1ESF A;  1RM6 C;  1T0Y A;  2KT7 A;  3VUX A;  2GLS A;  1CQV A;  4OVU A;  3AM9 A;  3N1Z C;  3NRZ A;  3ZTD A;  4KIK B;  1N62 A;  1OEY A;  3NUH B;  1E8Z A;  2L7R A;  2V4L A;  3W1Y A;  1ZGU B;  3HM3 A;  4YSX B;  4HJG E;  5C23 A;  1MI0 A;  3ALB A;  2OED A;  3EEC A;  1PGX A;  2WXG A;  3Q3F A;  2A4Z A;  1VRA B;  3UGB B;  4YXD B;  3T9L A;  1F1H A;  2MJD A;  3TBL D;  4PS7 A;  3GE3 C;  5JXV A;  1ZE3 D;  2KVZ A;  1KLU D;  2EMT A;  3J9C A;  1IUE A;  1G6J A;  1WR6 E;  1QIL A;  4MH0 E;  3Q3M C;  3A9K A;  3DWG C;  2VRR B;  3APF A;  5AUK A;  5TR5 A;  3GE8 C;  4DXG A;  5EE1 A;  1I35 A;  3ML8 A;  3NHE B;  1WE7 A;  3DQV A;  1U4A A;  2LUE A;  3AI5 A;  1WGG A;  4WQM A;  3OLM D;  3KUC B;  1Y8R C;  5E6N A;  1IBX B;  3SFD B;  3LXF A;  1I4H A;  2X38 A;  3DPD A;  4ICU A;  1L7Y A;  4H2A A;  4NAM A;  3MC9 A;  3R2T A;  3TUO A;  1NEK B;  3DVG Y;  1C4A A;  4S0R A;  4XX5 A;  2JF5 A;  3FIL B;  1WM3 A;  1KLV A;  3ZDT A;  1FXI A;  1R4M B;  1FPY A;  3ZNZ B;  1V1O A;  4NJ6 A;  5LXI B;  1TY0 A;  1S1Q B;  1RLF A;  2WNM A;  4A9A A;  4HPM B;  3TCA A;  5D6J B;  2L00 B;  4NAW B;  3IVF A;  4K7U A;  1STE A;  5J17 A;  4RFB A;  1J19 A;  1C76 A;  2IYD B;  2OOB B;  1V2Y A;  4HPP A;  4DXA B;  3AEG B;  2VH2 A;  4CO7 A;  2IDY A;  4BKG A;  1ET6 A;  4LCD E;  2WQY B;  3PRM B;  4ITK A;  3H7P A;  2ZJD A;  4XWT A;  1HXY D;  1YQB A;  2J52 A;  4GU2 A;  3V60 A;  3P4P B;  4BKT A;  1IPG A;  3LJ3 A;  4HJK A;  2K0P A;  4B95 A;  4M01 A;  5EE9 A;  2KDB A;  3I9V 1;  1YD8 U;  4HLE A;  3PSE B;  4W9I A;  2O2V A;  2INC C;  3CWI A;  2Z0E B;  3L17 A;  1T5X D;  3WAN A;  2W9N A;  1UBQ A;  3AU5 A;  1E6E B;  2M8S A;  3ZJU A;  1KM7 A;  1TYG B;  2JY6 A;  1F52 A;  1H4R A;  4HK2 A;  2WXK A;  1L6V A;  3HVD A;  2LXA A;  4WAA A;  2JRH A;  1OTR B;  3VH3 B;  2DZM A;  2KAJ A;  1YJI A;  2WXI A;  2DYM A;  2IY0 B;  2MBE A;  2CHZ A;  3GOE A;  3MJW A;  4YL8 A;  1FFV A;  2VZK D;  1LQB A;  2RPQ A;  4W9E A;  5DPT A;  3PRE A;  1TKE A;  1Q5W B;  1R4N B;  1FNV A;  4MGK E;  3OJ4 B;  4ZRJ A;  2LGI A;  4LJO B;  2ZNV B;  2KO3 A;  4WJP A;  4AP4 C;  3L10 B;  1T0S C;  2WXH A;  1WGY A;  1D5Z C;  3R8B A;  4FHJ A;  4LNK A;  2GBK A;  3IFW B;  3VFK A;  3Q69 A;  2IY1 B;  1E9M A;  4FA6 A;  4ARI A;  3ZGZ A;  2ZVO A;  1WJU A;  2GBJ A;  2KFK B;  2I2Y A;  1P7E A;  1ZDX A;  1J7C A;  2LWP A;  3RYT A;  4NZL B;  2MCN B;  2JZ3 B;  3BZD B;  2N4F A;  4EKU A;  3AUL A;  3A9J A;  2SEB D;  5JHA A;  3AEC B;  5EE0 A;  2G4S A;  2WX1 A;  4OHJ A;  1TZO A;  4IM2 A;  3E56 A;  5D3D A;  1Y56 A;  3NVY A;  1UBI A;  2MEK A;  4D2K A;  4AUQ C;  3AE6 B;  4FJY A;  3Q2A C;  3UQA A;  3NOB A;  4P7I A;  1E10 A;  5DPW A;  2WYQ A;  1E8Y A;  2LGY A;  3R66 C;  2G4D B;  1YOV B;  3RD2 A;  1VJK A;  2D5G A;  1UD7 A;  2EKI A;  1SIJ A;  2MBH A;  3Q8E A;  4US9 A;  4GMV A;  4WIP A;  3VTU A;  2PVG C;  4RMA A;  3ZW3 A;  2CJN A;  1B9R A;  2LUM A;  4TSS A;  4E3C A;  1ZP0 B;  2MWS B;  4KSK C;  4QAY A;  2Y3A A;  3GZN I;  2IBI B;  4ANW A;  4JWU C;  4N9F 4;  3AE3 B;  2ICI A;  3PLV A;  3ZXV A;  4YTN B;  1MFW A;  4FN2 A;  2WHI A;  2JWU A;  1SIF A;  2IPK D;  2ASQ A;  3O13 A;  5G5G A;  3VRB B;  4HKZ E;  4GIV A;  3RNG C;  1EU4 A;  1WIA A;  3DBH I;  4ZHP A;  5DCN A;  4RGO S;  3P63 A;  1FRD A;  2R61 A;  4NJC A;  1LFD A;  2G3Q B;  2M56 B;  3W1S C;  2NS5 A;  4B6W A;  1C4P A;  3N1X C;  4PYU A;  3U52 E;  3PTF C;  3TEY A;  2PKO A;  2W82 A;  1SF0 A;  3FAH A;  2GRI A;  4IOI E;  3PS6 A;  1HE8 A;  4IM0 A;  2Y5B B;  1PUT A;  5EDS A;  4B0E A;  1B1Z A;  2WXL A;  1T3Q A;  2E3T A;  1FNU A;  3M62 B;  4HCN B;  1L4Z B;  3HUI A;  5D2M B;  2BT6 A;  2LRW A;  2KLG A;  1SEB D;  3A33 B;  2HE7 A;  2KHW B;  1V86 A;  1PDX A;  3A9K B;  4KDL B;  2CJO A;  4Q2J A;  3VQI A;  3RI7 C;  2REX A;  3ZIM A;  1VD2 A;  1ZDV A;  1D4B A;  2DZJ A;  2FNJ B;  1J8C A;  4N58 A;  2PVO D;  2XBB C;  1M94 A;  2X8X X;  2WU2 B;  5CTR C;  4P6V F;  2JVC A;  1TY2 A;  3UF8 A;  1HZ5 A;  1GC7 A;  2CU1 A;  3AEE B;  3MHS D;  4EOY A;  1DOI A;  2AEH A;  3M63 B;  4L1B A;  2ZPN A;  3WCQ A;  4ICV A;  4ZYS A;  1SE3 A;  4ZRK A;  3ML9 A;  1C3T A;  1XCQ L;  1YQ3 B;  2KFK A;  2LJ5 A;  1WGH A;  2AL6 A;  1JRO A;  5H8Y E;  3OG5 A;  2N9P C;  1V6E A;  2OJR A;  4A55 A;  3GB1 A;  1EF1 A;  2QDF A;  2CHW A;  4RF0 A;  1BUI C;  3W5V B;  3AV8 A;  1TT5 B;  1AWD A;  3ZJV A;  5AUI A;  1WJ4 A;  2QIE B;  4MSM B;  4B9K A;  1FXA A;  2C7N B;  4GOC A;  1RFA A;  3RNE C;  3BK2 A;  4K3C A;  1SBB B;  2V0G A;  3DDC B;  2HJ1 A;  1XLP A;  2JQR B;  3SHQ A;  2LGS A;  3IG3 A;  3KW5 B;  4EZJ A;  5H92 C;  2INP E;  1PFD A;  1WY8 A;  2WXO A;  1QF6 A;  4E71 A;  5C3J B;  4IW0 A;  1WFY A;  4A3P A;  2MP2 A;  2L32 A;  4DDI D;  4WWN A;  1WXV A;  3WAP A;  2V9H A;  1HQR D;  2BWE S;  4JX1 C;  4PT5 A;  1WH3 A;  4MDK E;  1JWU D;  3H7P B;  2IZV B;  3ZUN A;  4LLG M;  5BO4 B;  3KVF B;  2K6D B;  1GOZ A;  2KQS A;  2M1M A;  2XK5 A;  3D32 A;  3SDL C;  1N63 A;  2AYO B;  3U4E G;  3KUZ A;  2MHJ A;  2WU5 B;  4FUL A;  1K50 A;  4JPS A;  1F0Z A;  4LNO A;  2O2V B;  3ZRF A;  3V05 A;  3X23 A;  3N20 C;  4W9G A;  2W54 A;  1TTN A;  4G0N B;  4DK5 A;  4LNI A;  1WRD B;  3A4R A;  4BVU C;  2H89 B;  5G55 A;  2NR2 A;  2L0F A;  3RFZ B;  1N5W A;  2KK8 A;  2MRP A;  3CF6 E;  1T6B X;  3MC8 A;  2K25 A;  2YEP F;  4E74 A;  1WJ6 A;  1V97 A;  1EUV B;  3NS8 A;  2GBR A;  3AE4 B;  1Z5S B;  2FAZ A;  2LI5 A;  2J42 A;  2CHX A;  1J0G A;  2FCQ A;  2IJ0 A;  2MBB B;  2PIA A;  3ZTC A;  3ZNH B;  2JWZ A;  2C9W B;  2CKH B;  2WXP A;  1XLO A;  4O1N A;  4W9F A;  2D07 B;  2ONQ A;  2NMQ A;  3GP7 A;  2K8C A;  2N9X A;  1NYQ A;  1OQY A;  1ET9 A;  2J0M A;  4CHK A;  4P16 A;  5CHV C;  4FXC A;  1FRR A;  3EUB 2;  2WXM A;  5E6P A;  1UGM A;  3ZQ4 A;  3KQ4 A;  3TL5 A;  2IGH A;  1UF0 A;  3DCG A;  2K5P A;  2PEA A;  2G1E A;  5IP4 D;  3DVN V;  4XE0 A;  1E8W A;  4YSZ B;  3TEX A;  3NJT A;  2WXR A;  3AH7 A;  4AQ7 A;  2L1A A;  3VHT C;  1CJE A;  1F2R C;  2KWU B;  2WS3 B;  3K9O B;  4C00 A;  4HEA 1;  1F2R I;  4OVV A;  2KLC A;  1OQQ A;  1WXM A;  2HDE A;  2PE9 A;  3R2I A;  4R3D A;  1BML C;  3HRD D;  2AQ3 B;  3N30 A;  2M4N A;  2IGD A;  4LDT D;  3HK0 A;  1TKG A;  2LZ6 A;  3QK0 A;  2N9L A;  3EC8 A;  4F1S A;  2N9E B;  3IAM 1;  4M8M A;  3WAM A;  3A1Q A;  5GMV A;  3FKY A;  3L16 A;  2KMC A;  4ZRI A;  1OQR A;  2CU3 A;  2XEW A;  1P98 A;  3AEB B;  1TS3 A;  3AE2 B;  3A9J B;  2N7E A;  2GI9 A;  1E7P B;  1A5R A; 
#chains in the Genus database with same CATH homology
 1FNV A;  4XDD A;  5BYQ A;  3AE9 B;  1AN8 A;  1MHH E;  2JXT A;  2LGI A;  3AN1 A;  3VR9 B;  5BMI A;  2Y5C A;  1ZXI A;  2LMC A;  3ZJT A;  2PTL A;  2K9X A;  1K51 A;  4A8X C;  2W3R A;  1I4Q A;  2XNA C;  5G5H A;  1RWS A;  3KWV A;  1MPE A;  2WXH A;  4GDL B;  4OZB A;  1D5Z C;  2H88 B;  3R8B A;  1J7B A;  1KLG D;  2HTM E;  2WXF A;  2K22 A;  3Q69 A;  5EE3 A;  1E9M A;  1JRP A;  4ARI A;  3ZGZ A;  4RNA A;  3V3X A;  2WXJ A;  2I2Y A;  1P7E A;  2KMM A;  1ZDX A;  3BYT B;  1J7C A;  2BBC A;  1M4V A;  1QOF A;  4NZL B;  2EEL A;  3BZD B;  1ZOY B;  3ABV B;  2ZW1 A;  4C56 C;  4US8 A;  1EU3 A;  1TS5 A;  2M19 A;  3EGR A;  2TSS A;  3P4Q B;  5BYS A;  1YMH E;  2SEB D;  3AEC B;  3AE7 B;  5EE0 A;  1YQ4 B;  4OHJ A;  1N60 A;  2ON8 A;  1TZO A;  4C7Z A;  4C80 A;  2JYE A;  3P4S B;  3E56 A;  4YSY B;  4KKJ A;  2W3S A;  5MPO A;  5D3D A;  3W5U B;  1Y56 A;  3NVY A;  3Q8C A;  1SE2 A;  1SSN A;  3Q8B A;  2MEK A;  4D2K A;  3AE6 B;  2MJ3 A;  2L83 A;  4GDK B;  2V3N A;  1L5P A;  5FKA C;  1YJJ A;  5GXG B;  1E10 A;  2RPV A;  3BWU D;  5HHD G;  1JQ4 A;  2WP9 B;  4YT0 B;  5BYR A;  2JSV X;  2QSD A;  3NVW A;  2B76 B;  2NTT A;  1VJK A;  1FO4 A;  1WGK A;  1WSP A;  3BVG A;  1UWM A;  2D5G A;  3TEZ A;  2EKI A;  2WDQ B;  1DYQ A;  2Z8L A;  1SIJ A;  3ETR A;  4MH8 A;  1JML A;  3AE8 B;  3Q8E A;  4US9 A;  4CQN A;  1KFY B;  1PGA A;  1NYR A;  2JU6 X;  2I38 A;  2BS2 B;  3GS2 A;  1FFU A;  4WIP A;  2BTE A;  2PVG C;  1QOB A;  1SB3 C;  4XWW A;  1VZ7 A;  2CJN A;  1KTK A;  4OW0 A;  1I4R A;  4ARC A;  1B9R A;  1P7F A;  1DOY A;  4OZA A;  1QQR A;  2BS3 B;  2LUM A;  1JAL A;  2QMT A;  4TSS A;  1ZP0 B;  1C77 A;  4DQO C;  1UUP A;  1YN5 A;  2Y3A A;  4REZ A;  5FR3 A;  1QKZ A;  3MHZ A;  1D5X C;  4JWU C;  2INN E;  1VDV A;  2LJI A;  3BVZ A;  1YN4 A;  4J3O D;  2V3P A;  3AE3 B;  3IXS A;  2ICI A;  2RDH A;  4YTN B;  1SXT A;  4L23 A;  4N59 A;  4ZHO A;  2BB5 A;  4MM3 B;  2JWU A;  2IPK D;  3O13 A;  1L4D B;  2VZK B;  5G5G A;  5T8I A;  3VRB B;  4C7Y A;  4HKZ E;  1I4P A;  1RYJ A;  1XLQ A;  2KWD A;  2WDR B;  2IGG A;  2GB1 A;  5BMG A;  1ACC A;  1EU4 A;  1NVI D;  1R7S A;  4RCO A;  4ZHP A;  5I4D A;  1F77 A;  4RGO S;  3NVV A;  5HFY A;  3P63 A;  1FRD A;  3AE5 B;  3U7Z A;  2FUG 1;  2R61 A;  4NJC A;  4A90 A;  3AEF B;  1NEN B;  2M56 B;  4KKI A;  2WDV B;  2K3U A;  1UNS A;  1C4P A;  1A70 A;  3U52 E;  1D5M C;  1L6U A;  1V1P B;  2JX5 A;  2DBY A;  2L52 A;  4M0W A;  4ZOH C;  2PKO A;  2QEJ C;  2ACZ B;  2JZP A;  4EE2 A;  3TEY A;  1KF6 B;  2W82 A;  1QLB B;  1FCC C;  1JWM D;  1SF0 A;  3FAH A;  3HVZ A;  4KX6 B;  2GRI A;  3IAS 1;  4IOI E;  1HEZ E;  1GAQ B;  1I4G A;  1ZXH A;  2W55 A;  4YTM B;  3T3N A;  1EWC A;  2BS4 B;  1BXT A;  2V4I B;  4L2Y A;  1SJE D;  3LB8 C;  1QOA A;  3TEW A;  2XN9 C;  1PUT A;  3P1M A;  4B0E A;  1B1Z A;  3P4R B;  1JWS D;  4YWG G;  2LFI A;  2WXL A;  2Q5W D;  4JWS C;  3H8H A;  1T3Q A;  2E3T A;  1AW7 A;  2RDG A;  1FNU A;  1JWB D;  1L4Z B;  3NVZ A;  3HUI A;  2MH7 A;  2BB6 A;  2KDM A;  4HRO A;  2KAC A;  2BT6 A;  2SAK A;  1ROE A;  1EM7 A;  1ESF A;  1RM6 C;  1SEB D;  4RH6 A;  2QJL A;  1CQV A;  1J7A A;  1PDX A;  2CJO A;  3AM9 A;  3NRZ A;  4Q2J A;  3VQI A;  2KQ4 X;  1N62 A;  3BVM A;  3NUH B;  5LNK 1;  1ZDV A;  1D4B A;  2M0A A;  4N58 A;  2PVO D;  4JE3 B;  1XEE A;  2WU2 B;  4P6V F;  4YSX B;  4HJG E;  1TY2 A;  3PZ7 A;  1HZ5 A;  2WXN A;  1C78 A;  2RMM A;  2BYT A;  1MI0 A;  1V1P A;  3AEE B;  4MAC A;  1D6E C;  1DOI A;  2OED A;  1WRI A;  2BW2 A;  1N5X A;  3KWL A;  4L1B A;  1PGX A;  3WCQ A;  4ZYS A;  2WXG A;  1C4C A;  1NI3 A;  1SE3 A;  1VRA B;  2QIL A;  1XCQ L;  1YQ3 B;  4YXD B;  1GB4 A;  1CK1 A;  2OHF A;  1JW9 D;  1TKY A;  1JRO A;  4YTP B;  2N0S B;  4USA A;  5H8Y E;  1MVK A;  2MJD A;  1PGB A;  1FNW A;  4A55 A;  1ZE3 D;  5JXV A;  3GB1 A;  1TS2 A;  1L0V B;  4RF0 A;  1KLU D;  1BUI C;  3W5V B;  3E9S A;  3AV8 A;  1VZ6 A;  1IUE A;  3J9C A;  1AWD A;  3ZJV A;  5AUI A;  1WXQ A;  2J4X A;  1QIL A;  2QIE B;  3DWG C;  1FXA A;  1LO5 D;  1N61 A;  3BK2 A;  3EA6 A;  3CIR B;  2FBW B;  1SBB B;  3AEA B;  4WUR A;  5AUK A;  2V0G A;  3ZYY X;  2J53 A;  4DXG A;  1JCK B;  5EE1 A;  1XLP A;  2JQR B;  1E0Z A;  3URY A;  2E6X A;  5H92 C;  2INP E;  1FD6 A;  1PFD A;  2MJE A;  4WQM A;  2WXO A;  1QF6 A;  1FM0 D;  4LK0 M;  4N6E B;  4OVZ A;  4KGR A;  4HRS A;  3SFD B;  1IBX B;  1CZP A;  3LXF A;  1GB1 A;  5C3J B;  1I4H A;  3I57 A;  1DOX A;  2X38 A;  4IDI A;  3B9J A;  2L32 A;  4H2A A;  5E6J A;  4NAM A;  1HQR D;  4TQ1 A;  1SJH D;  3R2T A;  3TUO A;  4JX1 C;  4PT5 A;  4UDU C;  4ZRP A;  1NEK B;  4HKQ A;  1JWU D;  1VR9 A;  1C4A A;  1KRH A;  3RPF C;  4A6Q A;  1GPX A;  4TMA B;  4LLG M;  4WAF A;  1HA5 A;  1XXG A;  4RGT A;  1GOZ A;  3W1S A;  4AS1 A;  4KGS A;  3AMZ A;  3SFE B;  4RF1 A;  4XDC A;  2LEK A;  3FIL B;  3AED B;  4GLS C;  3SR6 A;  1N63 A;  2AQ1 B;  3U2S C;  2WLB A;  1FXI A;  1K53 A;  3PO0 A;  3VR8 B;  1V1O A;  3U4E G;  2DLB A;  2WU5 B;  1K50 A;  3AE1 B;  4B0M A;  4JPS A;  1TY0 A;  1VZ8 A;  2YEP B;  4WH4 A;  1F0Z A;  3DWM A;  1Q10 A;  2N9K A;  1OFF A;  3MJ5 A;  1L0Y B;  4A9A A;  2WNM A;  1TJE A;  3V05 A;  1L0X B;  4NAW B;  4ZRQ A;  2W54 A;  3IT6 B;  5HI1 A;  3W9C B;  1STE A;  3B2F A;  3C8Y A;  3N9Y C;  4DXF A;  2LHD A;  1XCT L;  3MC0 B;  2H89 B;  1RFK A;  1IBX A;  5BMH A;  4RFB A;  1QT9 A;  3NZ3 A;  1XF5 L;  2G9H D;  3RFZ B;  1N5W A;  1C9F A;  1C76 A;  1HZ6 A;  1T6B X;  3UI3 A;  1FIQ A;  2YEP F;  3Q8F A;  1V97 A;  1DGJ A;  3AE4 B;  3AEG B;  2IDY A;  3Q8A A;  1ET6 A;  2DWQ A;  2J42 A;  2WQY B;  4ITK A;  4XWT A;  2IJ0 A;  1HXY D;  1XLN A;  1WWT A;  4MT5 A;  4RGN A;  2PIA A;  1AYF A;  3IT4 B;  2WXP A;  2J52 A;  4O1N A;  1XLO A;  3NS1 A;  1MHX A;  4TQ0 A;  1I4X A;  1JWA D;  2NMQ A;  2ONQ A;  3GP7 A;  3P4P B;  3FIL A;  1NYQ A;  5D3I B;  1ET9 A;  1WYG A;  4P16 A;  1ENF A;  3SEB A;  3VRA B;  2K0P A;  2JYT A;  4FXC A;  1FRR A;  1YNT E;  5EE9 A;  2PMV A;  3EUB 2;  3LYY A;  2WXM A;  3I9V 1;  1VLB A;  2Y5P A;  2PLP A;  1YN3 A;  3CWI A;  5C2T B;  3ZQ4 A;  2PW9 A;  3FC4 A;  3KQ4 A;  2IGH A;  3B2G A;  3BYY B;  3PZ8 A;  5D7G A;  2K5P A;  2G1E A;  1FEH A;  1T5X D;  3AB5 A;  3OWE B;  4XE0 A;  4YSZ B;  3TEX A;  1E6E B;  2AQ2 B;  2WXR A;  3AH7 A;  4AQ7 A;  2L1A A;  2FE8 A;  4LTU A;  3KLS X;  1I7H A;  1CJE A;  1IGC A;  3ZJU A;  1UWX A;  1TYG B;  2NTS A;  1F2R C;  2WS3 B;  4HEA 1;  2ZW0 A;  1F2R I;  5HG2 A;  2DYO A;  1OQQ A;  2HDE A;  3TSS A;  3R2I A;  4R3D A;  3W2D A;  1BML C;  1XO3 A;  3HRD D;  5FK9 C;  3MP9 A;  2AQ3 B;  1EWY C;  1UGJ A;  5TSS A;  2IGD A;  4KGT A;  3BII D;  1TKG A;  1QOG A;  2WXK A;  3P42 A;  1L6V A;  2LHE A;  3HVD A;  1FCL A;  1ZUD 2;  2N9L A;  2AX5 A;  3L4P A;  2KAJ A;  4OZC A;  1YJI A;  3IAM 1;  1KH0 A;  2WXI A;  1FMA D;  1C79 A;  2KN4 A;  4IKG A;  2DYM A;  3BK1 A;  1PYW D;  2WXQ A;  1FFV A;  2VZK D;  1OQR A;  1ZPS A;  3MFG A;  1SE4 A;  1IGD A;  2CU3 A;  4RGM A;  3T3O A;  3AEB B;  1TS3 A;  3AE2 B;  1TS4 A;  2N7J A;  1TKE A;  4WWM A;  2GI9 A;  1E7P B;  1V8C A;  1K52 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...