2PVGC

Crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
molecule tags Electron transport
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvgC00
1SF0A 3AEFB 2L52A 1FM0D 3AE2B 1TKGA 4HRSA 1CJEA 2EKIA 2E3TA 3AEGB 2BS2B 1N62A 1XLPA 5AUKA 3AE3B 3AEDB 1TYGB 1JRPA 1I7HA 1XLOA 1QLBB 1RM6C 1DOXA 5EE3A 3NVWA 4ZHPA 4YT0B 3ZYYX 3SFDB 2FBWB 1E9MA 2W3SA 3SR6A 2CJNA 1GPXA 2WQYB 1OQQA 2MJ3A 4IDIA 1PUTA 2K22A 1FO4A 4FXCA 4JWSC 1FFUA 1KF6B 1TKEA 1TJEA 2W54A 3AEAB 3LB8C 1VDVA 3AE5B 1WGKA 4YTMB 1E7PB 1XLQA 1V8CA 2WDRB 3P4RB 5MPOA 3DWGC 1T3QA 2CU3A 4KX6B 3ETRA 5H92C 5H8YE 3AEBB 3FAHA 1JWBD 1E0ZA 1EWYC 2QIEB 3PO0A 4YTNB 2QJLA 1FRDA 1TKYA 3HUIA 1L5PA 1J7CA 3HVZA 2ACZB 4C7YA 2N0SB 2PKOA 1QOBA 1RWSA 4YXDB 2HTME 3CWIA 2JQRB 3P1MA 2PVGC 1DOIA 1QOFA 4JX1C 5EE9A 1NEKB 1ZUD2 1V97A 1NYRA 1F0ZA 1A70A 2K9XA 2MJEA 3NVVA 3AE1B 1YQ3B 4YSYB 1RYJA 1XLNA 4HROA 1ROEA 4YSXB 5C3JB 3AE9B 2MJDA 1CZPA 1FMAD 2KAJA 3P63A 4LTUA 4C7ZA 1DGJA 3VR9B 2B76B 3AE4B 3W5VB 1JALA 4YSZB 4WWMA 1KRHA 2K5PA 1DOYA 3B2FA 2DWQA 4N6EB 4US9A 1ZOYB 1NENB 2Q5WD 3AM9A 1NYQA 1N61A 3NVYA 4JWUC 2L83A 3VR8B 1ZP0B 1AWDA 1L0VB 1QF6A 3NVZA 2WP9B 3AV8A 3VRBB 3W9CB 1B9RA 1SB3C 1WYGA 1N63A 1XO3A 2W3RA 2AX5A 2WU2B 1L6UA 3AE6B 2H88B 2WLBA 1FFVA 2DBYA 3AEEB 1OFFA 3P4PB 4ITKA 3W5UB 1YQ4B 2KMMA 3AN1A 1L6VA 1PFDA 2PIAA 4ZHOA 2BS3B 2M19A 1NVID 3BIID 4ZOHC 5EE0A 3NRZA 5AUIA 5C2TB 3AE8B 2W55A 1JQ4A 1FRRA 3RPFC 1FXIA 2WDVB 1N5WA 4A9AA 4N59A 3FC4A 2WU5B 1R7SA 3AECB 1FIQA 2MH7A 3AB5A 3B2GA 4USAA 1RFKA 4N58A 4US8A 2PVOD 3AE7B 1IUEA 2BS4B 3LXFA 3VRAB 2H89B 4WQMA 1E6EB 5G5GA 1WXQA 1QOGA 1WRIA 1KFYB 2G1EA 2LEKA 3DWMA 3NS1A 3AH7A 5GXGB 1QOAA 1YJJA 3B9JA 1GAQB 1J7AA 1UWMA 2BT6A 2Y5CA 3AMZA 1JW9D 1VLBA 3HRDD 1JROA 1YJIA 4YTPB 3ABVB 1WWTA 5EE1A 3SFEB 4C80A 3KWLA 1N5XA 1JWAD 1PDXA 1N60A 1SIJA 1VJKA 1QT9A 1E10A 3WCQA 1FXAA 2M56B 2OHFA 3CIRB 1NI3A 3P4QB 4P6VF 3EUB2 2WS3B 2JX5A 1AYFA 5G5HA 1ZXIA 2CJOA 1J7BA 3L4PA 2WDQB 1OQRA 3P4SB
chains in the Genus database with same CATH superfamily
4HRSA 1N62A 3GS2A 2G4DB 3R3MA 1J19A 2LWPA 1RM6C 3SFDB 3H7PA 1L7YA 1YN5A 2WQYB 3VTUA 1F1HA 4OZAA 2BB6A 2DX5B 3PREA 4HPMB 1I4QA 1IBXA 4S0RA 3EFUA 4LNNA 3TSSA 3QARA 3VTWA 4W9EA 3L0WB 3TUOA 1NEKB 1E8WA 4PS3A 3KH0A 4EEWA 3CMMB 2MQJA 1QQRA 3VFKA 4YSYB 1S3SG 1KLVA 2YEPF 4MM3B 2BKFA 1VD2A 2DLBA 3B2FA 3KWVA 2L76A 4IW0A 4B0EA 2DYBA 2Y3AA 2RSUA 3U8ZA 1ZDVA 1WYGA 1N63A 2AQ3B 4MH0E 4WIPA 4H2AA 5AUIA 3O13A 2N9KA 1WZ3A 4DHJB 2ICIA 4KDIC 4BVUC 2LMCA 3PV1A 3ZTDA 2MX2A 1J8CA 4WQMA 1WXQA 1SBBB 2LEKA 3RT3B 3LJ3A 4K7SA 2D07B 4BAXA 5DPWA 1V9JA 2M0XA 4GMVA 2KTRB 3W1SC 3M62B 4CQNA 3RI7C 2JX5A 3N1YC 4RH6A 4K7WA 4TMAB 1QKZA 1FM0D 3CSFA 1WGHA 2LHEA 2N1WA 4W9JA 2B3AA 5CHFA 3ZXRA 2FNJB 2VRRB 3DVNV 3RZFA 1HQRD 1G6JA 2AQ1B 4P16A 4ARCA 2MBEA 2LJIA 3MC8A 1OQQA 5TSSA 1E90A 3N20C 4TV3A 4L2YA 2IO1B 1E8ZA 2KVZA 4UDUC 2MSED 2WWZA 4KGTA 4DWFA 2UU7A 2WXLA 2GRIA 1Q5WB 5HG2A 3ZLZA 3ZDTA 3KLSX 2J7QB 5GMVA 3NY5A 4XE0A 1TTNA 4KSLC 3U4EG 2WNMA 2ZNVC 1KJTA 2WXFA 1E5WA 4JL9A 2GBMA 1CK1A 2NBVB 4WWOA 4C7ZA 2X8XX 2XBBC 3V05A 3H7SA 2FIFA 5D3IB 2PLPA 3W9CB 1KM7A 1SB3C 4K3BA 2MP2B 2KJHB 1SIFA 2BS3B 4LNKA 2AEHA 2G45B 5C2TB 1YN3A 2CHZA 3QC8B 1IGDA 4IM3A 2WDTB 5DPSA 2M8SA 2Y5CA 3AMZA 1JW9D 1WWTA 2C5LC 4MH8A 2L0FA 1LXDA 2RDGA 2WS3B 1R4NB 3RULA 4IUMB 2E6XA 4KGSA 2LVPA 3KYDD 2EKEC 1CJEA 3RNEC 5AUKA 3Q3FA 1YNTE 2KC1A 4ZRJA 1WF9A 1WGDA 2C60A 4PS7A 2OEDA 3I57A 1E9MA 3BZDB 2BB5A 3PVLA 1E7UA 1TS3A 1PUTA 2L8JA 2KWUB 1WX7A 2JXXA 2N9XA 4PK1A 3N30A 4OVZA 1TY0A 4MT5A 3EECA 1FRDA 1UELA 2RD0A 2O6VD 1L5PA 1LFDA 4KVGB 1YX6B 3SDLC 3P42A 3A33B 5AZHA 2RPQA 1DOIA 1HXYD 4C00A 5D94A 3AU4A 3PS6A 4GDLB 4Q2JA 4RGNA 4C4VA 2WX1A 2KAJA 5HKHA 1TS5A 2D10A 3Q8AA 4KIKA 1KLGD 4RMAA 1BUIC 4XX5A 2MEKA 2KX0A 2XK5A 1UH6A 2BVCA 1JWUD 3W1SA 1VZ8A 2WU2B 4MGKE 1YQBA 2FUHB 2KMMA 1ESFA 1V1PA 1UBQA 2MBQA 1C76A 1MHXA 2NTTA 3RPFC 5E6OA 4A9AA 4ZYNA 4K81A 5G55A 3U7ZA 1RFKA 2UWQA 4HKZE 2AL6A 1ACCA 3TJPA 4M01A 1SE4A 1JWSD 1KFYB 3GZNB 3HM6X 4C80A 3RNBC 1TS4A 3ABVB 5EE1A 3N9YC 3VH3B 3WCQA 2KFKB 1WZ0A 2D3CA 4NJCA 2IY0B 1P98A 5JHAA 1D5MC 3T3OA 1TBEA 4NQKE 4WJQA 4E71A 2WDQB 2KQSA 4RM9A 1AN8A 1JMLA 2JY6A 1JRPA 4W9GA 4S17A 2DZJA 1PGAA 2KANA 2CJNA 3QJZA 3SR6A 4EE2A 5IN7A 2MJ3A 1YOVB 4XWTA 1TJEA 1E7VA 3KUDB 3ZNGC 4OZBA 1WFYA 1SJHD 1TZOA 4GDKB 4LDTB 4II3B 1P7EA 1K52A 1SE2A 4XGAB 2L7RA 2WX0A 4MDKE 3DHIC 2J52A 2ZVNA 5E6JA 3TBLD 3DHGC 4BKTA 2OJRA 1OEYA 4WJPA 1QOBA 1EM7A 2WHIA 2J4XA 4LK0M 4HKQA 3AE1B 3BVMA 1FMAD 3HVDA 1JALA 1MFWA 3DPDA 3WANA 2JZ3B 3KUCB 4IM2A 1WXAA 2NBWB 3DVGX 4W9LA 2M1MA 2D5GA 4BOZB 3R2TA 4E3CA 3RZWC 3T3NA 2PIAA 3V6CB 1WJNA 2LZ6A 5C23A 2W55A 5L83A 1WGYA 2KO3A 2J0MA 5D6JB 2FE8A 1AW7A 3AE7B 1WXVA 2XEWA 2K8HA 2PE9A 4HK2A 5GXGB 1WRIA 2K0PA 3GE3C 3M3JA 3GP7A 4MELA 2DAFA 2LGDA 1K53A 1SIJA 2JWUA 4ANXA 2DNFA 1TGZB 3JYUA 1STEA 1SF0A 2I38A 1L4ZB 4MSQB 1MI0A 1TS2A 4ANVA 1BMLC 5FK9C 2KDMA 1XLOA 4RGOS 5C1ZA 3ZYYX 4A6QA 1XT9B 1FCCC 4JE3B 3T9LA 1GPXA 3UGBB 1C78A 2RDHA 1RLFA 3R2IA 1VCBA 4XYCA 1WGGA 2KHWB 2CU1A 2QC8A 3R7RA 1E7PB 2NR2A 3ZQ4A 1U4AA 4ZRQA 1E8YA 1V2YA 1GUAB 3ETRA 2IDYA 4DBGA 2QIEB 3BWUD 3BVZA 3FILA 3BVGA 4GN1A 3DBSA 4FHKA 4XC2A 3VXWA 4M00A 3AULA 1J0GA 4M0WA 1ZUD2 4NNJB 4DQOC 2V4IB 4NJ7A 1P9DU 2MJEA 2QMTA 2G9HD 4RGMA 3Q3NC 1XLNA 3L54A 3N1ZC 3CF6E 1CZPA 2EELA 2GBRA 2FAZA 4YSZB 1WIAA 1HEZE 3A9JB 3AM9A 1ENFA 3VUXA 2NVUI 1T0QC 4A3OA 3RNFC 2J53A 4W9DA 2D3GA 3AE6B 1OEYJ 2H88B 3AN1A 1PFDA 5DPTA 2V4LA 1ZXHA 3NRZA 3ZNZB 2VZKB 2WDVB 2KDEB 5IA7A 3BK1A 3NZSA 1ET6A 5TR5A 4B9KA 1MHHE 2GBKA 3NS1A 1WJUA 2JWZA 1YIWA 3SFEB 1JRUA 2D3BA 1MVKA 3EGRA 2ZPNA 2CS4A 2WXGA 2J0KA 3RNGC 4DHZE 3EA6A 3HHMA 2L05A 3E9SA 1F9JA 3P4SB 3DHHC 4YWGG 3AXCA 3UQAA 3AE3B 1Q0WB 1TYGB 4WURA 5JHBA 1XQQA 2QILA 3ZO5B 1MG4A 1TKEA 4M8NA 4MGZE 3NZ3A 2RMMA 4GIVA 1WH3A 2YEPB 3AU5A 3ZUNA 4YTNB 5E6PA 1TT5B 2GBNA 4DXGA 3UQBA 1UNSA 3TEXA 1R4NI 2HTHA 1WSPA 2PJHA 3S2AA 3TEWA 3IVFA 4BBNC 2AQ2B 3P63A 1P1AA 4LCDE 3A1QA 4ANWA 3ZRFA 1XCQL 4A8XC 3NVYA 2V3PA 3PT2B 1WE7A 1WE6A 4LJPB 1XO3A 3P4PB 3RN9C 1SGHA 4TQ1A 3LDZE 2WYQA 2V0GA 1AARA 3AE8B 4K1RB 3X0WA 1FXIA 2KYWA 2VH1A 2BQQA 3AECB 3RD2A 4DHJD 5IO9A 4US8A 1UF0A 3H7PB 3LXFA 3OAWA 4TQ0A 1E6EB 1UGJA 3AH7A 3B9JA 3PZDA 1GAQB 4LLGM 2BT6A 2OOBB 3O65B 4YSXB 5JZEB 2MBOA 3DDCB 4LNOA 1C79A 5FR6A 3K9OB 1ZW7A 2QSDA 1YMHE 2M56B 4P6VF 1K50A 1UUPA 5KHOA 1IBXB 4EOYA 3DCGA 1T6BX 1Q10A 4BFRA 3AE2B 4HPLB 3J9CA 4DDID 1KLUD 2NTSA 3ZW3A 2CKHB 1WX9A 2N4FA 3IT4B 2FCMA 3C0RB 4AP4C 2LUMA 3WIMA 1V8CA 4NZLB 5MPOA 2WXKA 1HA5A 4KX6B 5BMIA 2JZPA 1WJ4A 4MGYE 2N7EA 3W1YA 1FEHA 3HIZA 4AS1A 4X57B 1N6ZA 4TKNA 3Q6BA 4YXDB 2GB1A 1PYWD 2JQRB 1WYWB 4ZDVA 1V97A 2UYZB 2MBBB 2Z0DB 2JUOA 1YQ3B 3PRZA 4MJSA 4GXBA 5CX3A 5C3JB 4OZCA 3MC0B 3ZJTA 1QILA 1XEEA 2DWQA 2HJ1A 3MFGA 2KWCA 3TL5A 1L0VB 3ONSA 4ACFA 3NVZA 5J2RA 2HJ8A 4B6WA 2K1FA 3Q8FA 3BIID 2IJ0A 4GLSC 3WAMA 1TIFA 2W82A 1HZ5A 3AB5A 4OW0A 4N58A 3IBEA 4IC7B 1WI0A 5CTRC 4GSWA 3VTVA 3H1UA 2KWDA 1YJJA 2LXAA 4ZRPA 4LJOB 1VLBA 3R8BA 1JROA 2GI9A 5HFYA 1WX8A 4MEMA 2AWTA 1N60A 1I4XA 3BINA 3PRPB 3V60A 3PLUA 3EUB2 2IPKD 1GB4A 1P3QU 1Y56A 1YD8U 3DBLI 3P4RB 2SEBD 2EMTA 3DVNU 3NHEB 1V80A 4W9FA 2BBCA 3ZGZA 2KTFA 4NPNA 2INNE 5J17A 1KF6B 1SEBD 2WXJA 3QCAA 1EF1A 1C9FA 4RCOA 1XLQA 2YLMA 4L1BA 2BYVE 4II2B 3ZNHB 5H8YE 3NUHB 2SAKA 3WA0A 1HZ6A 4W9IA 4EZLA 2JXTA 2ONQA 3URYA 2XNAC 1DYQA 2PVGC 1I4RA 1V6EA 2LD9A 3WAOA 4GGQA 3NVVA 4IWOA 3RFZB 4ZYSA 1WM3A 2C7NB 2KZRA 2ON8A 3H8HA 5LXIB 3VVWB 2KDIA 4US9A 4HDQA 2QCZA 2LASA 4FBJB 1R4MI 2O6VA 4W9HA 1NYQA 1LO5D 3RCZA 1C4PA 3DBRI 3ZRCA 2MA9B 3JW0X 3UIPB 3Q8CA 5DCNA 3WALA 1FFVA 4BKSD 3AEEB 1OFFA 2JVCA 1YQ4B 4FJZA 4NJ6A 4ZOHC 1FCLA 4NAMA 1M94A 1ET9A 3FC4A 1FIQA 2FUG1 3B2GA 2KMCA 2KX3A 3D32A 2K3UA 2K8CA 4DK5A 1QOGA 4IWPA 4C56C 3QQ8B 4KZ0A 4FJVB 4KKIA 1JWAD 1PDXA 1E10A 5IKCM 1F52A 1MG8A 3IAM1 1XF5L 3RYTA 4DXFA 2GOWA 3AEFB 4JIOU 1KTKA 4ICUA 2BS2B 3KYCD 2GBJA 3AEDB 1JCKB 1I7HA 1JWMD 4BKGA 5EE3A 2PTLA 2ASQA 2G4SA 3Q3OC 3I63C 4G0NB 1HTQA 4KDLB 4BBNF 2L0TA 3IG3A 3OJ3A 1EU4A 4C4VB 4A90A 1WXMA 4KIKB 2IO0B 1EWYC 3PTFC 1C77A 3UI3A 4FHJA 2XK5B 3BYYB 2ACZB 4GB9A 3L08A 2N0SB 3V6EB 3IT6B 5D2MB 1RWSA 3H6NA 4KZCA 4GU2A 4AJWA 2HTME 5EE9A 2C7HA 2R2OA 1V1PB 4HLEA 2WXMA 2K9XA 3QIJA 3SHQA 2MWSB 3JSVA 2KJRA 3OJ4B 3GE8C 2BPSA 3ML8A 3AE9B 2MJDA 4LTUA 5AZFA 3NS8A 1TY2A 4M02A 2BWES 3RMKC 3TIXA 2L83A 2L3ZA 1AWDA 2BWFA 3AV8A 4M8MA 3ZJVA 3JVZX 2AX5A 4ITKA 2V9HA 2RDBC 3PLVA 4XWWA 2CHWA 1HE8A 1OGWA 2DENB 2WXIA 2ZNVB 2H89B 2R2QA 2WXRA 5G5GA 1IP9A 2N9LA 4IKGA 1DOYA 4AOFA 2Z59B 2O2VA 4FA6A 1SSNA 5JXVA 5G2NA 2LGIA 2ZVOA 4WQOB 2L52A 1YJ1A 2AYOB 5T8IA 1T0SC 4P7IA 4KV2A 3K9PB 4XDCA 4MACA 3NJTA 2ZW0A 2MCNB 2LUEA 1RAXA 4WAFA 3PPAA 2K22A 3P2BA 4ZRKA 1WJ6A 4AUQC 4YTMB 4HCNB 1M4VA 3A9KA 3DWGC 1D6EC 2LGYA 2PEAA 1LM8B 3M63B 4OHJA 3FAHA 1JWBD 2RPVA 1V5OA 2K6DB 3HUIA 1J7CA 1T5XD 5D7GA 3N3KB 1RRBA 5IAAC 1L2NA 4DHZB 2INDC 2WXPA 2O2VB 5IOIA 2WXHA 3GB1A 1GNUA 2KK8A 1UWXA 4WAAA 1F0ZA 3Q2AC 2HE7A 2KDBA 5BO4B 4KKJA 2N9PC 1FD6A 2G3QB 2B76B 2K5PA 2KMAA 2KC2A 1F2RI 1CQVA 2KQ7A 2KD0A 2L1AA 1ZP0B 2I2YA 1QF6A 2WP9B 3ALBA 3DQVA 4ZHPA 2PE6B 4IWQA 4W9CA 5EE0A 4LNFA 4JLCA 3OWEB 2VZKD 1N5WA 1NDDA 1R7SA 2MH7A 3B0AA 1D3ZA 4N9F4 1IUEA 2G1EA 5IP4D 2HDEA 1V86A 1YJIA 4DDGD 3KWLA 4FADA 1N5XA 4IOIE 2DYMA 3TEYA 1ZGUB 4G11A 1E8XA 1EU3A 4L23A 3FILB 1J7BA 2LI5A 2K39A 2N7DA 2DAJA 2IO3B 4A55A 1XLPA 5FR3A 1EF5A 3Q8BA 5HHDG 5AZGA 4RF0A 4ZRIA 3N1XC 3IHPC 3VQIA 2K8BA 2KKCA 4M0WB 2BYTA 2WGSA 2R61A 1KH0A 4JPSA 3PZ7A 4FXCA 5CHVC 1OTRB 4TSSA 3V61A 1WGKA 2LGXA 3TMPB 2WDRB 2KNBA 1WRDB 3TCAA 4A20A 3APCA 1WGRA 1FNUA 2RGFA 3KVFB 3DOWA 2LJ5A 3ZNID 2Z8LA 3VUWA 3WAPA 4HROA 1ROEA 1WR1A 5LXHA 3IFWB 3B08A 3AE4B 1K51A 3IXSA 5E6NA 2LVOA 1GB1A 1ZOYB 2LRWA 2N9EB 1V5TA 2A5UA 2DZIA 5LNK1 2C9WB 1EWCA 1X1MA 1FNVA 1SXTA 2IO2B 2BW2A 1V81A 3AI5A 2GLSA 3IAS1 1FRRA 2WXOA 3ZVVA 1UD7A 4MM3A 1IPGA 1VZ7A 1WY8A 2ZEQA 3T8MA 4R3DA 2Y5PA 2JF5A 1I4GA 4YTPB 1GOZA 2D3AA 4IG7B 3QA8A 2LRUA 2D11A 5BYQA 2BKRB 3Q3JA 4KGRA 3N32A 2BYEA 3NG0A 1LQBA 3BYTB 2NS5A 1TKGA 3ZTCA 2BF8B 2FBWB 2QHOA 2W3SA 1I4PA 2V1YA 3UF8A 2JU6X 3LB8C 1WR6E 2N7JA 2J42A 2WXNA 1ZKHA 4OVVA 2JT4B 3A1QB 2KTRA 4HCPB 2KOXA 1WMHA 4MGIE 5J18A 1Z5SB 4WH4A 3QHTA 4K3CA 3A4RA 4F7ZA 3TEZA 1TZ1A 1YN4A 2PKOA 4HDOA 1CMXB 1C4CA 4K7UA 2PPHA 2RR9A 2LXCA 4JX1C 1XCTL 3P1MA 4NAWA 3PHWB 3SU8X 3Q3MC 1L0YB 1BXTA 4WWPA 4PS8A 1L0XB 3VH4B 4I6PA 1KRHA 4N6EB 3GZNI 1NENB 3DBHB 3KUZA 4P1BC 4RF1A 3A4SC 1L6UA 2KN4A 1WMHB 4FJYA 1GG3A 3UINB 4FLHA 1GC7A 2WU5B 3HK0A 3APDA 3BK2A 1SE3A 4NAWB 3VRAB 3SD5A 3KW5B 3DWMA 4NY0A 5JH5C 2ZZPB 4JWUC 3ZDMC 1PQSA 3I5JC 3Q69A 1QT9A 2FCNA 1WXSA 2IYDB 1NI3A 4EUTA 3L16A 2MP2A 1ZXIA 4ICVA 1EO6A 1OQRA 1Z2MA 5HI1A 2EKIA 4PYUA 2K6QA 4HJKA 1P7FA 1QLBB 1Y8RC 3ZKJC 1OQYA 3VHTC 2M0AA 2AL3A 4B95A 4B0MA 2Z0EB 2KDFB 3APFA 2JYTA 4IDIA 4MJSB 5AEKB 2MHJA 3PZ8A 2MRPA 1B1ZA 1FNWA 4AJYB 3U30A 3E56A 3AEBB 2HD5B 3Q14C 4WWNA 2QJLA 1Q1OA 4RM8A 1D4BA 1LGRA 2IZVB 2LFIA 5CHWA 3L17A 1QOFA 1C4AA 2QDFA 4FN2A 1NYRA 1KOTA 1RYJA 4F1SA 4HXDA 1XXGA 2WXQA 3VR9B 4AWJA 4PT5A 4BOSC 4HEA1 1I35A 1GJZA 3U52E 3MJWA 2REXA 3ZXVA 3W5UB 2I1KA 4WJNA 3EC8A 2KQ4X 2YVCA 4GDLA 3QX1A 2KVRA 2BTEA 2MLBA 2DYOA 3PRMB 2INCC 2A4ZA 3NOBA 1QOAA 4G50A 4IM0A 3PSEB 3HRDD 1K8RB 4J3OD 3ZJUA 3QAQA 4NQLB 1VJKA 1I4HA 1MJDA 4J6IA 3CIRB 4BKSA 2JYEA 3GOEA 3SEBA 2ZCBA 5BMGA 2E3TA 1DOXA 5KHQA 2IBIB 4CHKA 2PW9A 3PHXB 2DZKA 3I9V1 4JWSC 1VDVA 5I4DA 4RNAA 2V3NA 1T3QA 2CU3A 1S1QB 2KFKA 2MW5A 2OJWA 2JPHA 2O6VB 2INPE 2JSVX 4ARIA 2Y5BB 1TKYA 1UBIA 3HVZA 3C8YA 3MHZA 3KQ4A 3QK0A 3CWIA 2XN9C 1A70A 4EZKA 4QAYA 5EDSA 2M17A 3W5VB 4WWMA 4GDKA 4LDTD 4WJOA 4AQ7A 2W9NA 4ANUA 3NZUA 1N61A 3MHSD 3PGEA 1B9RA 5BYSA 2W3RA 1BT0A 1V1OA 1T0RC 2M19A 2L32A 2J0JA 3M95A 2ZJDA 4OVUA 1I42A 1EUVB 1T0YA 1UWMA 2ZPYA 5H92C 2NPTA 2IGHA 2KT7A 2BGFA 2NMQA 1XD3B 3RUIB 1ZPSA 2OHFA 3V62A 4EFOA 2KLCA 4JGHB 2EMSA 4DXAB 1ZDXA 3R66C 1WM2A 2KJ6A 1GC6A 2K25A 2PMVA 3U2SC 1H8CA 2C7MB 2X38A 3U7DA 3OG5A 5L95C 1P0RA 2IGGA 3JSVB 3ECIA 4FULA 1FFUA 1FPYA 1VRAB 3AEAB 4HJGE 1H4RA 2JRHA 3AE5B 3OLMD 4RGTA 1E0ZA 5BMHA 3PO0A 3DBLB 1SJED 2NPTB 3CSTA 4URKA 1C3TA 4GOCA 4I6NB 4YL8A 3HM3A 4CO7A 3VDZA 3R7QA 1IGCA 4F8CB 2QEJC 1DGJA 2KFJA 1PGXA 3DVGY 2FCSA 1A5RA 2JZZA 3W2DA 1QZEA 2KWVB 2LVQA 3VR8B 1YX5B 3L13A 3H9DA 5BYRA 1UGMA 3RNAC 1PGBA 4TUUA 2MBHA 2WLBA 2DBYA 2KN5A 3L10B 1NI2A 2KACA 3QWZB 1C1YB 4REZA 2FIDA 1F2RC 3BY4B 2LHDA 1JQ4A 4HVBA 2ZCCA 1L4DB 2BS4B 4I6LB 3EFCA 3A9JA 2ZW1A 1R4MB 3EHVA 2BYFA 3DBRB 3A9KB 2IY1B 3MJ5A 1FXAA 3FKYA 4MSMB 4RFBA 2VH2A 3MP9A 1ZE3D 3I3TB 2CJOA 3V3XA 2NBUA 2FCQA 3DBHI 3X23A 3AEGB 3B1LX 4D2KA 3NVWA 4YT0B 4JQWC 3VUYA 1V49A 4XDDA 3ENEA 1FO4A 2D2QA 2W54A 3Q8EA 1FXTB 2DHZA 2KXJA 4A3PA 2CHXA 1VR9A 3ZIMA 4EZJA 3C19A 1HTOA 3UIOB 2JRIB 4C7YA 1SE9A 3MTNB 4EKUA 4KSKC 4HWIB 2M4NA 2NCNA 4HPPA 2LGSA 5DPRA 1D5ZC 2KLGA 3MC9A 3ML9A 5FKAC 1VZ6A 1F77A 1RFAA 2I1JA 5D3DA 4P1CC 1NBFC 4CYEA 2Q5WD 4G3XB 4ASWC 4XZ4A 2V3SA 2GMIC 3VRBB 3LYYA 1D5XC 4PYZA 1IYFA 4ZHOA 1MPEA 1L6VA 4BZAA 1NVID 1UZXB 4E74A 2L00B 3RNCC 4N59A 4USAA 2PVOD 2N1VA 5LLIA 2IGDA 1J7AA 4O1NA 2DZMA 2TSSA 4LNIA 3P4QB 4W9KA 2CR5A 1AYFA 3VAWA 5G5HA 1ISNA 3L4PA
chains in the Genus database with same CATH topology
1SF0A 3AEFB 2I38A 5HI1A 4HRSA 1L4ZB 2EKIA 1MI0A 1TS2A 1KTKA 1BMLC 2BS2B 1N62A 3GS2A 2KDMA 5FK9C 3AEDB 1JCKB 1I7HA 1JWMD 1P7FA 1QLBB 1RM6C 1XLOA 4RGOS 5EE3A 3ZYYX 3SFDB 4A6QA 2PTLA 2M0AA 4B0MA 1YN5A 1FCCC 4JE3B 1GPXA 2WQYB 2JYTA 1C78A 2RDHA 3R2IA 4IDIA 1EU4A 4OZAA 4A90A 2BB6A 1E7PB 3PZ8A 3ZQ4A 4ZRQA 1B1ZA 1FNWA 3ETRA 2IDYA 3E56A 3AEBB 1EWYC 2QIEB 3BWUD 3BVZA 1C77A 1I4QA 3UI3A 3FILA 2QJLA 3BVGA 1IBXA 3BYYB 2ACZB 2N0SB 1D4BA 3TSSA 3IT6B 1RWSA 2LFIA 2HTME 5EE9A 3TUOA 1QOFA 4M0WA 1C4AA 1NEKB 1ZUD2 1V1PB 1NYRA 4DQOC 2V4IB 2WXMA 2MJEA 2K9XA 2QMTA 1QQRA 2G9HD 4RGMA 4YSYB 1RYJA 1XLNA 3AE9B 2MJDA 1CZPA 4LTUA 2EELA 2YEPF 1XXGA 2WXQA 3VR9B 4MM3B 4YSZB 1TY2A 2DLBA 3B2FA 1HEZE 3KWVA 4PT5A 4HEA1 3AM9A 4B0EA 1ENFA 2Y3AA 3U52E 2L83A 1AWDA 2J53A 1ZDVA 3AV8A 3ZJVA 1WYGA 1N63A 2AQ3B 2AX5A 3AE6B 3W5UB 2H88B 4ITKA 4WIPA 3AN1A 4H2AA 1PFDA 1ZXHA 2KQ4X 3NRZA 4XWWA 2VZKB 5AUIA 3O13A 2N9KA 2WDVB 2ICIA 2BTEA 3BK1A 2WXIA 2DYOA 2LMCA 1ET6A 1MHHE 2H89B 4WQMA 2WXRA 5G5GA 1WXQA 2N9LA 1SBBB 2LEKA 3NS1A 4IKGA 1QOAA 1DOYA 3HRDD 3SFEB 4J3OD 3ZJUA 1MVKA 3EGRA 1VJKA 2WXGA 1I4HA 1SSNA 3CIRB 5JXVA 4CQNA 2JYEA 2JX5A 2LGIA 3SEBA 3EA6A 5BMGA 3E9SA 4RH6A 3P4SB 4TMAB 1QKZA 2L52A 1FM0D 4YWGG 5T8IA 2LHEA 2E3TA 4XDCA 3AE3B 1TYGB 4WURA 1DOXA 4MACA 1HQRD 2AQ1B 4P16A 4ARCA 2ZW0A 2PW9A 2LJIA 1OQQA 4WAFA 2QILA 2K22A 3I9V1 4JWSC 1TKEA 5TSSA 1VDVA 4L2YA 3NZ3A 5I4DA 2RMMA 4YTMB 4RNAA 2V3NA 1M4VA 3DWGC 1T3QA 1D6EC 2CU3A 2YEPB 4UDUC 4OHJA 4KGTA 3FAHA 1JWBD 2RPVA 2WXLA 2GRIA 4YTNB 5HG2A 2INPE 2JSVX 4ARIA 1TKYA 3HUIA 3HVZA 1J7CA 1T5XD 3KLSX 5D7GA 3C8YA 3MHZA 4XE0A 4DXGA 2WXPA 1UNSA 3TEXA 2WXHA 3KQ4A 3GB1A 3CWIA 3U4EG 2WNMA 2WXFA 1UWXA 1F0ZA 2XN9C 1A70A 1WSPA 3TEWA 4KKJA 1CK1A 2AQ2B 3P63A 1FD6A 4C7ZA 2B76B 3W5VB 4WWMA 2K5PA 4AQ7A 1F2RI 1CQVA 3V05A 1N61A 1XCQL 4A8XC 3NVYA 2V3PA 2L1AA 1ZP0B 2I2YA 5D3IB 1QF6A 2WP9B 2PLPA 3W9CB 1B9RA 1SB3C 5BYSA 1XO3A 1V1OA 2W3RA 4ZHPA 3P4PB 4TQ1A 2BS3B 2M19A 2L32A 5EE0A 2V0GA 5C2TB 3AE8B 3OWEB 2VZKD 1FXIA 1N5WA 1YN3A 1R7SA 3AECB 2MH7A 1IGDA 4US8A 1IUEA 3LXFA 4TQ0A 1E6EB 1UGJA 2G1EA 3AH7A 2HDEA 3B9JA 1GAQB 1UWMA 2BT6A 2Y5CA 4LLGM 3AMZA 1JW9D 5H92C 4YSXB 1YJIA 1WWTA 2IGHA 3KWLA 1N5XA 1C79A 2NMQA 4MH8A 2QSDA 1ZPSA 4IOIE 1YMHE 2DYMA 2M56B 2OHFA 2RDGA 3TEYA 4P6VF 1K50A 1UUPA 2WS3B 1EU3A 4L23A 4KGSA 2E6XA 3FILB 1IBXB 1J7BA 1T6BX 1ZDXA 1Q10A 3AE2B 1CJEA 4A55A 1XLPA 5AUKA 5FR3A 2PMVA 3Q8BA 3U2SC 5HHDG 1YNTE 4RF0A 2X38A 3J9CA 3VQIA 2OEDA 1KLUD 1E9MA 3I57A 2BYTA 2NTSA 2R61A 3BZDB 2BB5A 1TS3A 1KH0A 2IGGA 4JPSA 3PZ7A 1PUTA 4FXCA 1FFUA 1VRAB 3AEAB 3IT4B 4HJGE 2LUMA 4TSSA 3AE5B 1WGKA 1V8CA 2WDRB 4NZLB 5MPOA 2WXKA 1HA5A 4KX6B 5BMIA 2JZPA 4OVZA 1TY0A 4MT5A 4RGTA 1E0ZA 5BMHA 3PO0A 1FRDA 1L5PA 1FEHA 1SJED 1FNUA 3P42A 4AS1A 4YXDB 2GB1A 1PYWD 2JQRB 2Z8LA 1DOIA 1HXYD 1V97A 4GDLB 1YQ3B 4Q2JA 4RGNA 4HROA 1ROEA 1IGCA 5C3JB 4OZCA 2QEJC 2KAJA 3MC0B 1DGJA 3AE4B 1K51A 3ZJTA 1QILA 1TS5A 1XEEA 1PGXA 3Q8AA 2DWQA 3IXSA 3W2DA 3MFGA 1GB1A 1ZOYB 1KLGD 1BUIC 2MEKA 3VR8B 1L0VB 1JWUD 3NVZA 5BYRA 3W1SA 1PGBA 1VZ8A 5LNK1 2WU2B 1EWCA 2WLBA 2DBYA 1FNVA 1SXTA 3Q8FA 2KMMA 1ESFA 1V1PA 2BW2A 2IJ0A 2KACA 3BIID 4GLSC 4REZA 1C76A 2W82A 1F2RC 2LHDA 3IAS1 1JQ4A 1MHXA 2NTTA 1FRRA 1HZ5A 3RPFC 4A9AA 2WXOA 3AB5A 4OW0A 3U7ZA 1RFKA 4HKZE 4N58A 1ACCA 1L4DB 2BS4B 1VZ7A 4R3DA 1SE4A 1JWSD 1KFYB 2KWDA 2ZW1A 1YJJA 4ZRPA 4C80A 2Y5PA 1VLBA 3R8BA 1JROA 1I4GA 2GI9A 1TS4A 3ABVB 1GOZA 4YTPB 5EE1A 5HFYA 1N60A 1I4XA 3MJ5A 3N9YC 3WCQA 1FXAA 5BYQA 4NJCA 4RFBA 3EUB2 3MP9A 1ZE3D 4KGRA 1D5MC 3T3OA 2IPKD 2CJOA 1GB4A 2WDQB 1Y56A 3V3XA 3P4RB 3BYTB 2SEBD 1TKGA 3AEGB 1AN8A 4D2KA 1JMLA 1JRPA 3NVWA 4YT0B 2BBCA 2FBWB 2W3SA 3SR6A 1I4PA 1PGAA 2CJNA 4EE2A 4XDDA 3ZGZA 2MJ3A 1FO4A 2INNE 1KF6B 2JU6X 1TJEA 2W54A 4XWTA 3Q8EA 1SEBD 2WXJA 3LB8C 2N7JA 2J42A 2WXNA 1C9FA 4RCOA 1XLQA 4OZBA 1SJHD 1VR9A 4L1BA 1TZOA 4GDKB 5H8YE 1P7EA 1K52A 1SE2A 2SAKA 3NUHB 4WH4A 1HZ6A 2J52A 5E6JA 3TEZA 4C7YA 1YN4A 2PKOA 2JXTA 1QOBA 2ONQA 3URYA 1C4CA 2XNAC 1DYQA 1EM7A 1XCTL 3P1MA 2PVGC 1I4RA 2J4XA 4JX1C 4LK0M 4HKQA 3NVVA 3AE1B 3RFZB 1L0YB 1BXTA 4ZYSA 1D5ZC 3BVMA 2ON8A 1FMAD 3H8HA 3HVDA 5FKAC 1L0XB 1VZ6A 1JALA 1F77A 1KRHA 5D3DA 4N6EB 4US9A 1NENB 2Q5WD 1NYQA 1LO5D 1C4PA 2D5GA 3R2TA 3Q8CA 4RF1A 3VRBB 3LYYA 1L6UA 1D5XC 1FFVA 3AEEB 1OFFA 3T3NA 2KN4A 1YQ4B 4ZHOA 1MPEA 1L6VA 2PIAA 1NVID 4ZOHC 1FCLA 2W55A 4NAMA 4N59A 1ET9A 2WU5B 3FC4A 1FIQA 2FUG1 3B2GA 2FE8A 4USAA 1AW7A 2PVOD 3AE7B 2K3UA 3BK2A 1SE3A 4NAWB 3VRAB 5GXGB 1QOGA 1WRIA 3DWMA 4C56C 2IGDA 4JWUC 1J7AA 4O1NA 2K0PA 3GP7A 3Q69A 4KKIA 1JWAD 2TSSA 1PDXA 1K53A 1SIJA 1E10A 1QT9A 2JWUA 1NI3A 3P4QB 3IAM1 1AYFA 1XF5L 5G5HA 1ZXIA 3L4PA 4DXFA 1OQRA 1STEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SF0 A;  3AEF B;  2L52 A;  1FM0 D;  3AE2 B;  1TKG A;  4HRS A;  1CJE A;  2EKI A;  2E3T A;  3AEG B;  2BS2 B;  1N62 A;  1XLP A;  5AUK A;  3AE3 B;  3AED B;  1TYG B;  1JRP A;  1I7H A;  1XLO A;  1QLB B;  1RM6 C;  1DOX A;  5EE3 A;  3NVW A;  4ZHP A;  4YT0 B;  3ZYY X;  3SFD B;  2FBW B;  1E9M A;  2W3S A;  3SR6 A;  2CJN A;  1GPX A;  2WQY B;  1OQQ A;  2MJ3 A;  4IDI A;  1PUT A;  2K22 A;  1FO4 A;  4FXC A;  4JWS C;  1FFU A;  1KF6 B;  1TKE A;  1TJE A;  2W54 A;  3AEA B;  3LB8 C;  1VDV A;  3AE5 B;  1WGK A;  4YTM B;  1E7P B;  1XLQ A;  1V8C A;  2WDR B;  3P4R B;  5MPO A;  3DWG C;  1T3Q A;  2CU3 A;  4KX6 B;  3ETR A;  5H92 C;  5H8Y E;  3AEB B;  3FAH A;  1JWB D;  1E0Z A;  1EWY C;  2QIE B;  3PO0 A;  4YTN B;  2QJL A;  1FRD A;  1TKY A;  3HUI A;  1L5P A;  1J7C A;  3HVZ A;  2ACZ B;  4C7Y A;  2N0S B;  2PKO A;  1QOB A;  1RWS A;  4YXD B;  2HTM E;  3CWI A;  2JQR B;  3P1M A;  2PVG C;  1DOI A;  1QOF A;  4JX1 C;  5EE9 A;  1NEK B;  1ZUD 2;  1V97 A;  1NYR A;  1F0Z A;  1A70 A;  2K9X A;  2MJE A;  3NVV A;  3AE1 B;  1YQ3 B;  4YSY B;  1RYJ A;  1XLN A;  4HRO A;  1ROE A;  4YSX B;  5C3J B;  3AE9 B;  2MJD A;  1CZP A;  1FMA D;  2KAJ A;  3P63 A;  4LTU A;  4C7Z A;  1DGJ A;  3VR9 B;  2B76 B;  3AE4 B;  3W5V B;  1JAL A;  4YSZ B;  4WWM A;  1KRH A;  2K5P A;  1DOY A;  3B2F A;  2DWQ A;  4N6E B;  4US9 A;  1ZOY B;  1NEN B;  2Q5W D;  3AM9 A;  1NYQ A;  1N61 A;  3NVY A;  4JWU C;  2L83 A;  3VR8 B;  1ZP0 B;  1AWD A;  1L0V B;  1QF6 A;  3NVZ A;  2WP9 B;  3AV8 A;  3VRB B;  3W9C B;  1B9R A;  1SB3 C;  1WYG A;  1N63 A;  1XO3 A;  2W3R A;  2AX5 A;  2WU2 B;  1L6U A;  3AE6 B;  2H88 B;  2WLB A;  1FFV A;  2DBY A;  3AEE B;  1OFF A;  3P4P B;  4ITK A;  3W5U B;  1YQ4 B;  2KMM A;  3AN1 A;  1L6V A;  1PFD A;  2PIA A;  4ZHO A;  2BS3 B;  2M19 A;  1NVI D;  3BII D;  4ZOH C;  5EE0 A;  3NRZ A;  5AUI A;  5C2T B;  3AE8 B;  2W55 A;  1JQ4 A;  1FRR A;  3RPF C;  1FXI A;  2WDV B;  1N5W A;  4A9A A;  4N59 A;  3FC4 A;  2WU5 B;  1R7S A;  3AEC B;  1FIQ A;  2MH7 A;  3AB5 A;  3B2G A;  4USA A;  1RFK A;  4N58 A;  4US8 A;  2PVO D;  3AE7 B;  1IUE A;  2BS4 B;  3LXF A;  3VRA B;  2H89 B;  4WQM A;  1E6E B;  5G5G A;  1WXQ A;  1QOG A;  1WRI A;  1KFY B;  2G1E A;  2LEK A;  3DWM A;  3NS1 A;  3AH7 A;  5GXG B;  1QOA A;  1YJJ A;  3B9J A;  1GAQ B;  1J7A A;  1UWM A;  2BT6 A;  2Y5C A;  3AMZ A;  1JW9 D;  1VLB A;  3HRD D;  1JRO A;  1YJI A;  4YTP B;  3ABV B;  1WWT A;  5EE1 A;  3SFE B;  4C80 A;  3KWL A;  1N5X A;  1JWA D;  1PDX A;  1N60 A;  1SIJ A;  1VJK A;  1QT9 A;  1E10 A;  3WCQ A;  1FXA A;  2M56 B;  2OHF A;  3CIR B;  1NI3 A;  3P4Q B;  4P6V F;  3EUB 2;  2WS3 B;  2JX5 A;  1AYF A;  5G5H A;  1ZXI A;  2CJO A;  1J7B A;  3L4P A;  2WDQ B;  1OQR A;  3P4S B; 
#chains in the Genus database with same CATH topology
 4HRS A;  1N62 A;  3GS2 A;  2G4D B;  3R3M A;  1J19 A;  2LWP A;  1RM6 C;  3SFD B;  3H7P A;  1L7Y A;  1YN5 A;  2WQY B;  3VTU A;  1F1H A;  4OZA A;  2BB6 A;  2DX5 B;  3PRE A;  4HPM B;  1I4Q A;  1IBX A;  4S0R A;  3EFU A;  4LNN A;  3TSS A;  3QAR A;  3VTW A;  4W9E A;  3L0W B;  3TUO A;  1NEK B;  1E8W A;  4PS3 A;  3KH0 A;  4EEW A;  3CMM B;  2MQJ A;  1QQR A;  3VFK A;  4YSY B;  1S3S G;  1KLV A;  2YEP F;  4MM3 B;  2BKF A;  1VD2 A;  2DLB A;  3B2F A;  3KWV A;  2L76 A;  4IW0 A;  4B0E A;  2DYB A;  2Y3A A;  2RSU A;  3U8Z A;  1ZDV A;  1WYG A;  1N63 A;  2AQ3 B;  4MH0 E;  4WIP A;  4H2A A;  5AUI A;  3O13 A;  2N9K A;  1WZ3 A;  4DHJ B;  2ICI A;  4KDI C;  4BVU C;  2LMC A;  3PV1 A;  3ZTD A;  2MX2 A;  1J8C A;  4WQM A;  1WXQ A;  1SBB B;  2LEK A;  3RT3 B;  3LJ3 A;  4K7S A;  2D07 B;  4BAX A;  5DPW A;  1V9J A;  2M0X A;  4GMV A;  2KTR B;  3W1S C;  3M62 B;  4CQN A;  3RI7 C;  2JX5 A;  3N1Y C;  4RH6 A;  4K7W A;  4TMA B;  1QKZ A;  1FM0 D;  3CSF A;  1WGH A;  2LHE A;  2N1W A;  4W9J A;  2B3A A;  5CHF A;  3ZXR A;  2FNJ B;  2VRR B;  3DVN V;  3RZF A;  1HQR D;  1G6J A;  2AQ1 B;  4P16 A;  4ARC A;  2MBE A;  2LJI A;  3MC8 A;  1OQQ A;  5TSS A;  1E90 A;  3N20 C;  4TV3 A;  4L2Y A;  2IO1 B;  1E8Z A;  2KVZ A;  4UDU C;  2MSE D;  2WWZ A;  4KGT A;  4DWF A;  2UU7 A;  2WXL A;  2GRI A;  1Q5W B;  5HG2 A;  3ZLZ A;  3ZDT A;  3KLS X;  2J7Q B;  5GMV A;  3NY5 A;  4XE0 A;  1TTN A;  4KSL C;  3U4E G;  2WNM A;  2ZNV C;  1KJT A;  2WXF A;  1E5W A;  4JL9 A;  2GBM A;  1CK1 A;  2NBV B;  4WWO A;  4C7Z A;  2X8X X;  2XBB C;  3V05 A;  3H7S A;  2FIF A;  5D3I B;  2PLP A;  3W9C B;  1KM7 A;  1SB3 C;  4K3B A;  2MP2 B;  2KJH B;  1SIF A;  2BS3 B;  4LNK A;  2AEH A;  2G45 B;  5C2T B;  1YN3 A;  2CHZ A;  3QC8 B;  1IGD A;  4IM3 A;  2WDT B;  5DPS A;  2M8S A;  2Y5C A;  3AMZ A;  1JW9 D;  1WWT A;  2C5L C;  4MH8 A;  2L0F A;  1LXD A;  2RDG A;  2WS3 B;  1R4N B;  3RUL A;  4IUM B;  2E6X A;  4KGS A;  2LVP A;  3KYD D;  2EKE C;  1CJE A;  3RNE C;  5AUK A;  3Q3F A;  1YNT E;  2KC1 A;  4ZRJ A;  1WF9 A;  1WGD A;  2C60 A;  4PS7 A;  2OED A;  3I57 A;  1E9M A;  3BZD B;  2BB5 A;  3PVL A;  1E7U A;  1TS3 A;  1PUT A;  2L8J A;  2KWU B;  1WX7 A;  2JXX A;  2N9X A;  4PK1 A;  3N30 A;  4OVZ A;  1TY0 A;  4MT5 A;  3EEC A;  1FRD A;  1UEL A;  2RD0 A;  2O6V D;  1L5P A;  1LFD A;  4KVG B;  1YX6 B;  3SDL C;  3P42 A;  3A33 B;  5AZH A;  2RPQ A;  1DOI A;  1HXY D;  4C00 A;  5D94 A;  3AU4 A;  3PS6 A;  4GDL B;  4Q2J A;  4RGN A;  4C4V A;  2WX1 A;  2KAJ A;  5HKH A;  1TS5 A;  2D10 A;  3Q8A A;  4KIK A;  1KLG D;  4RMA A;  1BUI C;  4XX5 A;  2MEK A;  2KX0 A;  2XK5 A;  1UH6 A;  2BVC A;  1JWU D;  3W1S A;  1VZ8 A;  2WU2 B;  4MGK E;  1YQB A;  2FUH B;  2KMM A;  1ESF A;  1V1P A;  1UBQ A;  2MBQ A;  1C76 A;  1MHX A;  2NTT A;  3RPF C;  5E6O A;  4A9A A;  4ZYN A;  4K81 A;  5G55 A;  3U7Z A;  1RFK A;  2UWQ A;  4HKZ E;  2AL6 A;  1ACC A;  3TJP A;  4M01 A;  1SE4 A;  1JWS D;  1KFY B;  3GZN B;  3HM6 X;  4C80 A;  3RNB C;  1TS4 A;  3ABV B;  5EE1 A;  3N9Y C;  3VH3 B;  3WCQ A;  2KFK B;  1WZ0 A;  2D3C A;  4NJC A;  2IY0 B;  1P98 A;  5JHA A;  1D5M C;  3T3O A;  1TBE A;  4NQK E;  4WJQ A;  4E71 A;  2WDQ B;  2KQS A;  4RM9 A;  1AN8 A;  1JML A;  2JY6 A;  1JRP A;  4W9G A;  4S17 A;  2DZJ A;  1PGA A;  2KAN A;  2CJN A;  3QJZ A;  3SR6 A;  4EE2 A;  5IN7 A;  2MJ3 A;  1YOV B;  4XWT A;  1TJE A;  1E7V A;  3KUD B;  3ZNG C;  4OZB A;  1WFY A;  1SJH D;  1TZO A;  4GDK B;  4LDT B;  4II3 B;  1P7E A;  1K52 A;  1SE2 A;  4XGA B;  2L7R A;  2WX0 A;  4MDK E;  3DHI C;  2J52 A;  2ZVN A;  5E6J A;  3TBL D;  3DHG C;  4BKT A;  2OJR A;  1OEY A;  4WJP A;  1QOB A;  1EM7 A;  2WHI A;  2J4X A;  4LK0 M;  4HKQ A;  3AE1 B;  3BVM A;  1FMA D;  3HVD A;  1JAL A;  1MFW A;  3DPD A;  3WAN A;  2JZ3 B;  3KUC B;  4IM2 A;  1WXA A;  2NBW B;  3DVG X;  4W9L A;  2M1M A;  2D5G A;  4BOZ B;  3R2T A;  4E3C A;  3RZW C;  3T3N A;  2PIA A;  3V6C B;  1WJN A;  2LZ6 A;  5C23 A;  2W55 A;  5L83 A;  1WGY A;  2KO3 A;  2J0M A;  5D6J B;  2FE8 A;  1AW7 A;  3AE7 B;  1WXV A;  2XEW A;  2K8H A;  2PE9 A;  4HK2 A;  5GXG B;  1WRI A;  2K0P A;  3GE3 C;  3M3J A;  3GP7 A;  4MEL A;  2DAF A;  2LGD A;  1K53 A;  1SIJ A;  2JWU A;  4ANX A;  2DNF A;  1TGZ B;  3JYU A;  1STE A;  1SF0 A;  2I38 A;  1L4Z B;  4MSQ B;  1MI0 A;  1TS2 A;  4ANV A;  1BML C;  5FK9 C;  2KDM A;  1XLO A;  4RGO S;  5C1Z A;  3ZYY X;  4A6Q A;  1XT9 B;  1FCC C;  4JE3 B;  3T9L A;  1GPX A;  3UGB B;  1C78 A;  2RDH A;  1RLF A;  3R2I A;  1VCB A;  4XYC A;  1WGG A;  2KHW B;  2CU1 A;  2QC8 A;  3R7R A;  1E7P B;  2NR2 A;  3ZQ4 A;  1U4A A;  4ZRQ A;  1E8Y A;  1V2Y A;  1GUA B;  3ETR A;  2IDY A;  4DBG A;  2QIE B;  3BWU D;  3BVZ A;  3FIL A;  3BVG A;  4GN1 A;  3DBS A;  4FHK A;  4XC2 A;  3VXW A;  4M00 A;  3AUL A;  1J0G A;  4M0W A;  1ZUD 2;  4NNJ B;  4DQO C;  2V4I B;  4NJ7 A;  1P9D U;  2MJE A;  2QMT A;  2G9H D;  4RGM A;  3Q3N C;  1XLN A;  3L54 A;  3N1Z C;  3CF6 E;  1CZP A;  2EEL A;  2GBR A;  2FAZ A;  4YSZ B;  1WIA A;  1HEZ E;  3A9J B;  3AM9 A;  1ENF A;  3VUX A;  2NVU I;  1T0Q C;  4A3O A;  3RNF C;  2J53 A;  4W9D A;  2D3G A;  3AE6 B;  1OEY J;  2H88 B;  3AN1 A;  1PFD A;  5DPT A;  2V4L A;  1ZXH A;  3NRZ A;  3ZNZ B;  2VZK B;  2WDV B;  2KDE B;  5IA7 A;  3BK1 A;  3NZS A;  1ET6 A;  5TR5 A;  4B9K A;  1MHH E;  2GBK A;  3NS1 A;  1WJU A;  2JWZ A;  1YIW A;  3SFE B;  1JRU A;  2D3B A;  1MVK A;  3EGR A;  2ZPN A;  2CS4 A;  2WXG A;  2J0K A;  3RNG C;  4DHZ E;  3EA6 A;  3HHM A;  2L05 A;  3E9S A;  1F9J A;  3P4S B;  3DHH C;  4YWG G;  3AXC A;  3UQA A;  3AE3 B;  1Q0W B;  1TYG B;  4WUR A;  5JHB A;  1XQQ A;  2QIL A;  3ZO5 B;  1MG4 A;  1TKE A;  4M8N A;  4MGZ E;  3NZ3 A;  2RMM A;  4GIV A;  1WH3 A;  2YEP B;  3AU5 A;  3ZUN A;  4YTN B;  5E6P A;  1TT5 B;  2GBN A;  4DXG A;  3UQB A;  1UNS A;  3TEX A;  1R4N I;  2HTH A;  1WSP A;  2PJH A;  3S2A A;  3TEW A;  3IVF A;  4BBN C;  2AQ2 B;  3P63 A;  1P1A A;  4LCD E;  3A1Q A;  4ANW A;  3ZRF A;  1XCQ L;  4A8X C;  3NVY A;  2V3P A;  3PT2 B;  1WE7 A;  1WE6 A;  4LJP B;  1XO3 A;  3P4P B;  3RN9 C;  1SGH A;  4TQ1 A;  3LDZ E;  2WYQ A;  2V0G A;  1AAR A;  3AE8 B;  4K1R B;  3X0W A;  1FXI A;  2KYW A;  2VH1 A;  2BQQ A;  3AEC B;  3RD2 A;  4DHJ D;  5IO9 A;  4US8 A;  1UF0 A;  3H7P B;  3LXF A;  3OAW A;  4TQ0 A;  1E6E B;  1UGJ A;  3AH7 A;  3B9J A;  3PZD A;  1GAQ B;  4LLG M;  2BT6 A;  2OOB B;  3O65 B;  4YSX B;  5JZE B;  2MBO A;  3DDC B;  4LNO A;  1C79 A;  5FR6 A;  3K9O B;  1ZW7 A;  2QSD A;  1YMH E;  2M56 B;  4P6V F;  1K50 A;  1UUP A;  5KHO A;  1IBX B;  4EOY A;  3DCG A;  1T6B X;  1Q10 A;  4BFR A;  3AE2 B;  4HPL B;  3J9C A;  4DDI D;  1KLU D;  2NTS A;  3ZW3 A;  2CKH B;  1WX9 A;  2N4F A;  3IT4 B;  2FCM A;  3C0R B;  4AP4 C;  2LUM A;  3WIM A;  1V8C A;  4NZL B;  5MPO A;  2WXK A;  1HA5 A;  4KX6 B;  5BMI A;  2JZP A;  1WJ4 A;  4MGY E;  2N7E A;  3W1Y A;  1FEH A;  3HIZ A;  4AS1 A;  4X57 B;  1N6Z A;  4TKN A;  3Q6B A;  4YXD B;  2GB1 A;  1PYW D;  2JQR B;  1WYW B;  4ZDV A;  1V97 A;  2UYZ B;  2MBB B;  2Z0D B;  2JUO A;  1YQ3 B;  3PRZ A;  4MJS A;  4GXB A;  5CX3 A;  5C3J B;  4OZC A;  3MC0 B;  3ZJT A;  1QIL A;  1XEE A;  2DWQ A;  2HJ1 A;  3MFG A;  2KWC A;  3TL5 A;  1L0V B;  3ONS A;  4ACF A;  3NVZ A;  5J2R A;  2HJ8 A;  4B6W A;  2K1F A;  3Q8F A;  3BII D;  2IJ0 A;  4GLS C;  3WAM A;  1TIF A;  2W82 A;  1HZ5 A;  3AB5 A;  4OW0 A;  4N58 A;  3IBE A;  4IC7 B;  1WI0 A;  5CTR C;  4GSW A;  3VTV A;  3H1U A;  2KWD A;  1YJJ A;  2LXA A;  4ZRP A;  4LJO B;  1VLB A;  3R8B A;  1JRO A;  2GI9 A;  5HFY A;  1WX8 A;  4MEM A;  2AWT A;  1N60 A;  1I4X A;  3BIN A;  3PRP B;  3V60 A;  3PLU A;  3EUB 2;  2IPK D;  1GB4 A;  1P3Q U;  1Y56 A;  1YD8 U;  3DBL I;  3P4R B;  2SEB D;  2EMT A;  3DVN U;  3NHE B;  1V80 A;  4W9F A;  2BBC A;  3ZGZ A;  2KTF A;  4NPN A;  2INN E;  5J17 A;  1KF6 B;  1SEB D;  2WXJ A;  3QCA A;  1EF1 A;  1C9F A;  4RCO A;  1XLQ A;  2YLM A;  4L1B A;  2BYV E;  4II2 B;  3ZNH B;  5H8Y E;  3NUH B;  2SAK A;  3WA0 A;  1HZ6 A;  4W9I A;  4EZL A;  2JXT A;  2ONQ A;  3URY A;  2XNA C;  1DYQ A;  2PVG C;  1I4R A;  1V6E A;  2LD9 A;  3WAO A;  4GGQ A;  3NVV A;  4IWO A;  3RFZ B;  4ZYS A;  1WM3 A;  2C7N B;  2KZR A;  2ON8 A;  3H8H A;  5LXI B;  3VVW B;  2KDI A;  4US9 A;  4HDQ A;  2QCZ A;  2LAS A;  4FBJ B;  1R4M I;  2O6V A;  4W9H A;  1NYQ A;  1LO5 D;  3RCZ A;  1C4P A;  3DBR I;  3ZRC A;  2MA9 B;  3JW0 X;  3UIP B;  3Q8C A;  5DCN A;  3WAL A;  1FFV A;  4BKS D;  3AEE B;  1OFF A;  2JVC A;  1YQ4 B;  4FJZ A;  4NJ6 A;  4ZOH C;  1FCL A;  4NAM A;  1M94 A;  1ET9 A;  3FC4 A;  1FIQ A;  2FUG 1;  3B2G A;  2KMC A;  2KX3 A;  3D32 A;  2K3U A;  2K8C A;  4DK5 A;  1QOG A;  4IWP A;  4C56 C;  3QQ8 B;  4KZ0 A;  4FJV B;  4KKI A;  1JWA D;  1PDX A;  1E10 A;  5IKC M;  1F52 A;  1MG8 A;  3IAM 1;  1XF5 L;  3RYT A;  4DXF A;  2GOW A;  3AEF B;  4JIO U;  1KTK A;  4ICU A;  2BS2 B;  3KYC D;  2GBJ A;  3AED B;  1JCK B;  1I7H A;  1JWM D;  4BKG A;  5EE3 A;  2PTL A;  2ASQ A;  2G4S A;  3Q3O C;  3I63 C;  4G0N B;  1HTQ A;  4KDL B;  4BBN F;  2L0T A;  3IG3 A;  3OJ3 A;  1EU4 A;  4C4V B;  4A90 A;  1WXM A;  4KIK B;  2IO0 B;  1EWY C;  3PTF C;  1C77 A;  3UI3 A;  4FHJ A;  2XK5 B;  3BYY B;  2ACZ B;  4GB9 A;  3L08 A;  2N0S B;  3V6E B;  3IT6 B;  5D2M B;  1RWS A;  3H6N A;  4KZC A;  4GU2 A;  4AJW A;  2HTM E;  5EE9 A;  2C7H A;  2R2O A;  1V1P B;  4HLE A;  2WXM A;  2K9X A;  3QIJ A;  3SHQ A;  2MWS B;  3JSV A;  2KJR A;  3OJ4 B;  3GE8 C;  2BPS A;  3ML8 A;  3AE9 B;  2MJD A;  4LTU A;  5AZF A;  3NS8 A;  1TY2 A;  4M02 A;  2BWE S;  3RMK C;  3TIX A;  2L83 A;  2L3Z A;  1AWD A;  2BWF A;  3AV8 A;  4M8M A;  3ZJV A;  3JVZ X;  2AX5 A;  4ITK A;  2V9H A;  2RDB C;  3PLV A;  4XWW A;  2CHW A;  1HE8 A;  1OGW A;  2DEN B;  2WXI A;  2ZNV B;  2H89 B;  2R2Q A;  2WXR A;  5G5G A;  1IP9 A;  2N9L A;  4IKG A;  1DOY A;  4AOF A;  2Z59 B;  2O2V A;  4FA6 A;  1SSN A;  5JXV A;  5G2N A;  2LGI A;  2ZVO A;  4WQO B;  2L52 A;  1YJ1 A;  2AYO B;  5T8I A;  1T0S C;  4P7I A;  4KV2 A;  3K9P B;  4XDC A;  4MAC A;  3NJT A;  2ZW0 A;  2MCN B;  2LUE A;  1RAX A;  4WAF A;  3PPA A;  2K22 A;  3P2B A;  4ZRK A;  1WJ6 A;  4AUQ C;  4YTM B;  4HCN B;  1M4V A;  3A9K A;  3DWG C;  1D6E C;  2LGY A;  2PEA A;  1LM8 B;  3M63 B;  4OHJ A;  3FAH A;  1JWB D;  2RPV A;  1V5O A;  2K6D B;  3HUI A;  1J7C A;  1T5X D;  5D7G A;  3N3K B;  1RRB A;  5IAA C;  1L2N A;  4DHZ B;  2IND C;  2WXP A;  2O2V B;  5IOI A;  2WXH A;  3GB1 A;  1GNU A;  2KK8 A;  1UWX A;  4WAA A;  1F0Z A;  3Q2A C;  2HE7 A;  2KDB A;  5BO4 B;  4KKJ A;  2N9P C;  1FD6 A;  2G3Q B;  2B76 B;  2K5P A;  2KMA A;  2KC2 A;  1F2R I;  1CQV A;  2KQ7 A;  2KD0 A;  2L1A A;  1ZP0 B;  2I2Y A;  1QF6 A;  2WP9 B;  3ALB A;  3DQV A;  4ZHP A;  2PE6 B;  4IWQ A;  4W9C A;  5EE0 A;  4LNF A;  4JLC A;  3OWE B;  2VZK D;  1N5W A;  1NDD A;  1R7S A;  2MH7 A;  3B0A A;  1D3Z A;  4N9F 4;  1IUE A;  2G1E A;  5IP4 D;  2HDE A;  1V86 A;  1YJI A;  4DDG D;  3KWL A;  4FAD A;  1N5X A;  4IOI E;  2DYM A;  3TEY A;  1ZGU B;  4G11 A;  1E8X A;  1EU3 A;  4L23 A;  3FIL B;  1J7B A;  2LI5 A;  2K39 A;  2N7D A;  2DAJ A;  2IO3 B;  4A55 A;  1XLP A;  5FR3 A;  1EF5 A;  3Q8B A;  5HHD G;  5AZG A;  4RF0 A;  4ZRI A;  3N1X C;  3IHP C;  3VQI A;  2K8B A;  2KKC A;  4M0W B;  2BYT A;  2WGS A;  2R61 A;  1KH0 A;  4JPS A;  3PZ7 A;  4FXC A;  5CHV C;  1OTR B;  4TSS A;  3V61 A;  1WGK A;  2LGX A;  3TMP B;  2WDR B;  2KNB A;  1WRD B;  3TCA A;  4A20 A;  3APC A;  1WGR A;  1FNU A;  2RGF A;  3KVF B;  3DOW A;  2LJ5 A;  3ZNI D;  2Z8L A;  3VUW A;  3WAP A;  4HRO A;  1ROE A;  1WR1 A;  5LXH A;  3IFW B;  3B08 A;  3AE4 B;  1K51 A;  3IXS A;  5E6N A;  2LVO A;  1GB1 A;  1ZOY B;  2LRW A;  2N9E B;  1V5T A;  2A5U A;  2DZI A;  5LNK 1;  2C9W B;  1EWC A;  1X1M A;  1FNV A;  1SXT A;  2IO2 B;  2BW2 A;  1V81 A;  3AI5 A;  2GLS A;  3IAS 1;  1FRR A;  2WXO A;  3ZVV A;  1UD7 A;  4MM3 A;  1IPG A;  1VZ7 A;  1WY8 A;  2ZEQ A;  3T8M A;  4R3D A;  2Y5P A;  2JF5 A;  1I4G A;  4YTP B;  1GOZ A;  2D3A A;  4IG7 B;  3QA8 A;  2LRU A;  2D11 A;  5BYQ A;  2BKR B;  3Q3J A;  4KGR A;  3N32 A;  2BYE A;  3NG0 A;  1LQB A;  3BYT B;  2NS5 A;  1TKG A;  3ZTC A;  2BF8 B;  2FBW B;  2QHO A;  2W3S A;  1I4P A;  2V1Y A;  3UF8 A;  2JU6 X;  3LB8 C;  1WR6 E;  2N7J A;  2J42 A;  2WXN A;  1ZKH A;  4OVV A;  2JT4 B;  3A1Q B;  2KTR A;  4HCP B;  2KOX A;  1WMH A;  4MGI E;  5J18 A;  1Z5S B;  4WH4 A;  3QHT A;  4K3C A;  3A4R A;  4F7Z A;  3TEZ A;  1TZ1 A;  1YN4 A;  2PKO A;  4HDO A;  1CMX B;  1C4C A;  4K7U A;  2PPH A;  2RR9 A;  2LXC A;  4JX1 C;  1XCT L;  3P1M A;  4NAW A;  3PHW B;  3SU8 X;  3Q3M C;  1L0Y B;  1BXT A;  4WWP A;  4PS8 A;  1L0X B;  3VH4 B;  4I6P A;  1KRH A;  4N6E B;  3GZN I;  1NEN B;  3DBH B;  3KUZ A;  4P1B C;  4RF1 A;  3A4S C;  1L6U A;  2KN4 A;  1WMH B;  4FJY A;  1GG3 A;  3UIN B;  4FLH A;  1GC7 A;  2WU5 B;  3HK0 A;  3APD A;  3BK2 A;  1SE3 A;  4NAW B;  3VRA B;  3SD5 A;  3KW5 B;  3DWM A;  4NY0 A;  5JH5 C;  2ZZP B;  4JWU C;  3ZDM C;  1PQS A;  3I5J C;  3Q69 A;  1QT9 A;  2FCN A;  1WXS A;  2IYD B;  1NI3 A;  4EUT A;  3L16 A;  2MP2 A;  1ZXI A;  4ICV A;  1EO6 A;  1OQR A;  1Z2M A;  5HI1 A;  2EKI A;  4PYU A;  2K6Q A;  4HJK A;  1P7F A;  1QLB B;  1Y8R C;  3ZKJ C;  1OQY A;  3VHT C;  2M0A A;  2AL3 A;  4B95 A;  4B0M A;  2Z0E B;  2KDF B;  3APF A;  2JYT A;  4IDI A;  4MJS B;  5AEK B;  2MHJ A;  3PZ8 A;  2MRP A;  1B1Z A;  1FNW A;  4AJY B;  3U30 A;  3E56 A;  3AEB B;  2HD5 B;  3Q14 C;  4WWN A;  2QJL A;  1Q1O A;  4RM8 A;  1D4B A;  1LGR A;  2IZV B;  2LFI A;  5CHW A;  3L17 A;  1QOF A;  1C4A A;  2QDF A;  4FN2 A;  1NYR A;  1KOT A;  1RYJ A;  4F1S A;  4HXD A;  1XXG A;  2WXQ A;  3VR9 B;  4AWJ A;  4PT5 A;  4BOS C;  4HEA 1;  1I35 A;  1GJZ A;  3U52 E;  3MJW A;  2REX A;  3ZXV A;  3W5U B;  2I1K A;  4WJN A;  3EC8 A;  2KQ4 X;  2YVC A;  4GDL A;  3QX1 A;  2KVR A;  2BTE A;  2MLB A;  2DYO A;  3PRM B;  2INC C;  2A4Z A;  3NOB A;  1QOA A;  4G50 A;  4IM0 A;  3PSE B;  3HRD D;  1K8R B;  4J3O D;  3ZJU A;  3QAQ A;  4NQL B;  1VJK A;  1I4H A;  1MJD A;  4J6I A;  3CIR B;  4BKS A;  2JYE A;  3GOE A;  3SEB A;  2ZCB A;  5BMG A;  2E3T A;  1DOX A;  5KHQ A;  2IBI B;  4CHK A;  2PW9 A;  3PHX B;  2DZK A;  3I9V 1;  4JWS C;  1VDV A;  5I4D A;  4RNA A;  2V3N A;  1T3Q A;  2CU3 A;  1S1Q B;  2KFK A;  2MW5 A;  2OJW A;  2JPH A;  2O6V B;  2INP E;  2JSV X;  4ARI A;  2Y5B B;  1TKY A;  1UBI A;  3HVZ A;  3C8Y A;  3MHZ A;  3KQ4 A;  3QK0 A;  3CWI A;  2XN9 C;  1A70 A;  4EZK A;  4QAY A;  5EDS A;  2M17 A;  3W5V B;  4WWM A;  4GDK A;  4LDT D;  4WJO A;  4AQ7 A;  2W9N A;  4ANU A;  3NZU A;  1N61 A;  3MHS D;  3PGE A;  1B9R A;  5BYS A;  2W3R A;  1BT0 A;  1V1O A;  1T0R C;  2M19 A;  2L32 A;  2J0J A;  3M95 A;  2ZJD A;  4OVU A;  1I42 A;  1EUV B;  1T0Y A;  1UWM A;  2ZPY A;  5H92 C;  2NPT A;  2IGH A;  2KT7 A;  2BGF A;  2NMQ A;  1XD3 B;  3RUI B;  1ZPS A;  2OHF A;  3V62 A;  4EFO A;  2KLC A;  4JGH B;  2EMS A;  4DXA B;  1ZDX A;  3R66 C;  1WM2 A;  2KJ6 A;  1GC6 A;  2K25 A;  2PMV A;  3U2S C;  1H8C A;  2C7M B;  2X38 A;  3U7D A;  3OG5 A;  5L95 C;  1P0R A;  2IGG A;  3JSV B;  3ECI A;  4FUL A;  1FFU A;  1FPY A;  1VRA B;  3AEA B;  4HJG E;  1H4R A;  2JRH A;  3AE5 B;  3OLM D;  4RGT A;  1E0Z A;  5BMH A;  3PO0 A;  3DBL B;  1SJE D;  2NPT B;  3CST A;  4URK A;  1C3T A;  4GOC A;  4I6N B;  4YL8 A;  3HM3 A;  4CO7 A;  3VDZ A;  3R7Q A;  1IGC A;  4F8C B;  2QEJ C;  1DGJ A;  2KFJ A;  1PGX A;  3DVG Y;  2FCS A;  1A5R A;  2JZZ A;  3W2D A;  1QZE A;  2KWV B;  2LVQ A;  3VR8 B;  1YX5 B;  3L13 A;  3H9D A;  5BYR A;  1UGM A;  3RNA C;  1PGB A;  4TUU A;  2MBH A;  2WLB A;  2DBY A;  2KN5 A;  3L10 B;  1NI2 A;  2KAC A;  3QWZ B;  1C1Y B;  4REZ A;  2FID A;  1F2R C;  3BY4 B;  2LHD A;  1JQ4 A;  4HVB A;  2ZCC A;  1L4D B;  2BS4 B;  4I6L B;  3EFC A;  3A9J A;  2ZW1 A;  1R4M B;  3EHV A;  2BYF A;  3DBR B;  3A9K B;  2IY1 B;  3MJ5 A;  1FXA A;  3FKY A;  4MSM B;  4RFB A;  2VH2 A;  3MP9 A;  1ZE3 D;  3I3T B;  2CJO A;  3V3X A;  2NBU A;  2FCQ A;  3DBH I;  3X23 A;  3AEG B;  3B1L X;  4D2K A;  3NVW A;  4YT0 B;  4JQW C;  3VUY A;  1V49 A;  4XDD A;  3ENE A;  1FO4 A;  2D2Q A;  2W54 A;  3Q8E A;  1FXT B;  2DHZ A;  2KXJ A;  4A3P A;  2CHX A;  1VR9 A;  3ZIM A;  4EZJ A;  3C19 A;  1HTO A;  3UIO B;  2JRI B;  4C7Y A;  1SE9 A;  3MTN B;  4EKU A;  4KSK C;  4HWI B;  2M4N A;  2NCN A;  4HPP A;  2LGS A;  5DPR A;  1D5Z C;  2KLG A;  3MC9 A;  3ML9 A;  5FKA C;  1VZ6 A;  1F77 A;  1RFA A;  2I1J A;  5D3D A;  4P1C C;  1NBF C;  4CYE A;  2Q5W D;  4G3X B;  4ASW C;  4XZ4 A;  2V3S A;  2GMI C;  3VRB B;  3LYY A;  1D5X C;  4PYZ A;  1IYF A;  4ZHO A;  1MPE A;  1L6V A;  4BZA A;  1NVI D;  1UZX B;  4E74 A;  2L00 B;  3RNC C;  4N59 A;  4USA A;  2PVO D;  2N1V A;  5LLI A;  2IGD A;  1J7A A;  4O1N A;  2DZM A;  2TSS A;  4LNI A;  3P4Q B;  4W9K A;  2CR5 A;  1AYF A;  3VAW A;  5G5H A;  1ISN A;  3L4P A; 
#chains in the Genus database with same CATH homology
 1SF0 A;  3AEF B;  2I38 A;  5HI1 A;  4HRS A;  1L4Z B;  2EKI A;  1MI0 A;  1TS2 A;  1KTK A;  1BML C;  2BS2 B;  1N62 A;  3GS2 A;  2KDM A;  5FK9 C;  3AED B;  1JCK B;  1I7H A;  1JWM D;  1P7F A;  1QLB B;  1RM6 C;  1XLO A;  4RGO S;  5EE3 A;  3ZYY X;  3SFD B;  4A6Q A;  2PTL A;  2M0A A;  4B0M A;  1YN5 A;  1FCC C;  4JE3 B;  1GPX A;  2WQY B;  2JYT A;  1C78 A;  2RDH A;  3R2I A;  4IDI A;  1EU4 A;  4OZA A;  4A90 A;  2BB6 A;  1E7P B;  3PZ8 A;  3ZQ4 A;  4ZRQ A;  1B1Z A;  1FNW A;  3ETR A;  2IDY A;  3E56 A;  3AEB B;  1EWY C;  2QIE B;  3BWU D;  3BVZ A;  1C77 A;  1I4Q A;  3UI3 A;  3FIL A;  2QJL A;  3BVG A;  1IBX A;  3BYY B;  2ACZ B;  2N0S B;  1D4B A;  3TSS A;  3IT6 B;  1RWS A;  2LFI A;  2HTM E;  5EE9 A;  3TUO A;  1QOF A;  4M0W A;  1C4A A;  1NEK B;  1ZUD 2;  1V1P B;  1NYR A;  4DQO C;  2V4I B;  2WXM A;  2MJE A;  2K9X A;  2QMT A;  1QQR A;  2G9H D;  4RGM A;  4YSY B;  1RYJ A;  1XLN A;  3AE9 B;  2MJD A;  1CZP A;  4LTU A;  2EEL A;  2YEP F;  1XXG A;  2WXQ A;  3VR9 B;  4MM3 B;  4YSZ B;  1TY2 A;  2DLB A;  3B2F A;  1HEZ E;  3KWV A;  4PT5 A;  4HEA 1;  3AM9 A;  4B0E A;  1ENF A;  2Y3A A;  3U52 E;  2L83 A;  1AWD A;  2J53 A;  1ZDV A;  3AV8 A;  3ZJV A;  1WYG A;  1N63 A;  2AQ3 B;  2AX5 A;  3AE6 B;  3W5U B;  2H88 B;  4ITK A;  4WIP A;  3AN1 A;  4H2A A;  1PFD A;  1ZXH A;  2KQ4 X;  3NRZ A;  4XWW A;  2VZK B;  5AUI A;  3O13 A;  2N9K A;  2WDV B;  2ICI A;  2BTE A;  3BK1 A;  2WXI A;  2DYO A;  2LMC A;  1ET6 A;  1MHH E;  2H89 B;  4WQM A;  2WXR A;  5G5G A;  1WXQ A;  2N9L A;  1SBB B;  2LEK A;  3NS1 A;  4IKG A;  1QOA A;  1DOY A;  3HRD D;  3SFE B;  4J3O D;  3ZJU A;  1MVK A;  3EGR A;  1VJK A;  2WXG A;  1I4H A;  1SSN A;  3CIR B;  5JXV A;  4CQN A;  2JYE A;  2JX5 A;  2LGI A;  3SEB A;  3EA6 A;  5BMG A;  3E9S A;  4RH6 A;  3P4S B;  4TMA B;  1QKZ A;  2L52 A;  1FM0 D;  4YWG G;  5T8I A;  2LHE A;  2E3T A;  4XDC A;  3AE3 B;  1TYG B;  4WUR A;  1DOX A;  4MAC A;  1HQR D;  2AQ1 B;  4P16 A;  4ARC A;  2ZW0 A;  2PW9 A;  2LJI A;  1OQQ A;  4WAF A;  2QIL A;  2K22 A;  3I9V 1;  4JWS C;  1TKE A;  5TSS A;  1VDV A;  4L2Y A;  3NZ3 A;  5I4D A;  2RMM A;  4YTM B;  4RNA A;  2V3N A;  1M4V A;  3DWG C;  1T3Q A;  1D6E C;  2CU3 A;  2YEP B;  4UDU C;  4OHJ A;  4KGT A;  3FAH A;  1JWB D;  2RPV A;  2WXL A;  2GRI A;  4YTN B;  5HG2 A;  2INP E;  2JSV X;  4ARI A;  1TKY A;  3HUI A;  3HVZ A;  1J7C A;  1T5X D;  3KLS X;  5D7G A;  3C8Y A;  3MHZ A;  4XE0 A;  4DXG A;  2WXP A;  1UNS A;  3TEX A;  2WXH A;  3KQ4 A;  3GB1 A;  3CWI A;  3U4E G;  2WNM A;  2WXF A;  1UWX A;  1F0Z A;  2XN9 C;  1A70 A;  1WSP A;  3TEW A;  4KKJ A;  1CK1 A;  2AQ2 B;  3P63 A;  1FD6 A;  4C7Z A;  2B76 B;  3W5V B;  4WWM A;  2K5P A;  4AQ7 A;  1F2R I;  1CQV A;  3V05 A;  1N61 A;  1XCQ L;  4A8X C;  3NVY A;  2V3P A;  2L1A A;  1ZP0 B;  2I2Y A;  5D3I B;  1QF6 A;  2WP9 B;  2PLP A;  3W9C B;  1B9R A;  1SB3 C;  5BYS A;  1XO3 A;  1V1O A;  2W3R A;  4ZHP A;  3P4P B;  4TQ1 A;  2BS3 B;  2M19 A;  2L32 A;  5EE0 A;  2V0G A;  5C2T B;  3AE8 B;  3OWE B;  2VZK D;  1FXI A;  1N5W A;  1YN3 A;  1R7S A;  3AEC B;  2MH7 A;  1IGD A;  4US8 A;  1IUE A;  3LXF A;  4TQ0 A;  1E6E B;  1UGJ A;  2G1E A;  3AH7 A;  2HDE A;  3B9J A;  1GAQ B;  1UWM A;  2BT6 A;  2Y5C A;  4LLG M;  3AMZ A;  1JW9 D;  5H92 C;  4YSX B;  1YJI A;  1WWT A;  2IGH A;  3KWL A;  1N5X A;  1C79 A;  2NMQ A;  4MH8 A;  2QSD A;  1ZPS A;  4IOI E;  1YMH E;  2DYM A;  2M56 B;  2OHF A;  2RDG A;  3TEY A;  4P6V F;  1K50 A;  1UUP A;  2WS3 B;  1EU3 A;  4L23 A;  4KGS A;  2E6X A;  3FIL B;  1IBX B;  1J7B A;  1T6B X;  1ZDX A;  1Q10 A;  3AE2 B;  1CJE A;  4A55 A;  1XLP A;  5AUK A;  5FR3 A;  2PMV A;  3Q8B A;  3U2S C;  5HHD G;  1YNT E;  4RF0 A;  2X38 A;  3J9C A;  3VQI A;  2OED A;  1KLU D;  1E9M A;  3I57 A;  2BYT A;  2NTS A;  2R61 A;  3BZD B;  2BB5 A;  1TS3 A;  1KH0 A;  2IGG A;  4JPS A;  3PZ7 A;  1PUT A;  4FXC A;  1FFU A;  1VRA B;  3AEA B;  3IT4 B;  4HJG E;  2LUM A;  4TSS A;  3AE5 B;  1WGK A;  1V8C A;  2WDR B;  4NZL B;  5MPO A;  2WXK A;  1HA5 A;  4KX6 B;  5BMI A;  2JZP A;  4OVZ A;  1TY0 A;  4MT5 A;  4RGT A;  1E0Z A;  5BMH A;  3PO0 A;  1FRD A;  1L5P A;  1FEH A;  1SJE D;  1FNU A;  3P42 A;  4AS1 A;  4YXD B;  2GB1 A;  1PYW D;  2JQR B;  2Z8L A;  1DOI A;  1HXY D;  1V97 A;  4GDL B;  1YQ3 B;  4Q2J A;  4RGN A;  4HRO A;  1ROE A;  1IGC A;  5C3J B;  4OZC A;  2QEJ C;  2KAJ A;  3MC0 B;  1DGJ A;  3AE4 B;  1K51 A;  3ZJT A;  1QIL A;  1TS5 A;  1XEE A;  1PGX A;  3Q8A A;  2DWQ A;  3IXS A;  3W2D A;  3MFG A;  1GB1 A;  1ZOY B;  1KLG D;  1BUI C;  2MEK A;  3VR8 B;  1L0V B;  1JWU D;  3NVZ A;  5BYR A;  3W1S A;  1PGB A;  1VZ8 A;  5LNK 1;  2WU2 B;  1EWC A;  2WLB A;  2DBY A;  1FNV A;  1SXT A;  3Q8F A;  2KMM A;  1ESF A;  1V1P A;  2BW2 A;  2IJ0 A;  2KAC A;  3BII D;  4GLS C;  4REZ A;  1C76 A;  2W82 A;  1F2R C;  2LHD A;  3IAS 1;  1JQ4 A;  1MHX A;  2NTT A;  1FRR A;  1HZ5 A;  3RPF C;  4A9A A;  2WXO A;  3AB5 A;  4OW0 A;  3U7Z A;  1RFK A;  4HKZ E;  4N58 A;  1ACC A;  1L4D B;  2BS4 B;  1VZ7 A;  4R3D A;  1SE4 A;  1JWS D;  1KFY B;  2KWD A;  2ZW1 A;  1YJJ A;  4ZRP A;  4C80 A;  2Y5P A;  1VLB A;  3R8B A;  1JRO A;  1I4G A;  2GI9 A;  1TS4 A;  3ABV B;  1GOZ A;  4YTP B;  5EE1 A;  5HFY A;  1N60 A;  1I4X A;  3MJ5 A;  3N9Y C;  3WCQ A;  1FXA A;  5BYQ A;  4NJC A;  4RFB A;  3EUB 2;  3MP9 A;  1ZE3 D;  4KGR A;  1D5M C;  3T3O A;  2IPK D;  2CJO A;  1GB4 A;  2WDQ B;  1Y56 A;  3V3X A;  3P4R B;  3BYT B;  2SEB D;  1TKG A;  3AEG B;  1AN8 A;  4D2K A;  1JML A;  1JRP A;  3NVW A;  4YT0 B;  2BBC A;  2FBW B;  2W3S A;  3SR6 A;  1I4P A;  1PGA A;  2CJN A;  4EE2 A;  4XDD A;  3ZGZ A;  2MJ3 A;  1FO4 A;  2INN E;  1KF6 B;  2JU6 X;  1TJE A;  2W54 A;  4XWT A;  3Q8E A;  1SEB D;  2WXJ A;  3LB8 C;  2N7J A;  2J42 A;  2WXN A;  1C9F A;  4RCO A;  1XLQ A;  4OZB A;  1SJH D;  1VR9 A;  4L1B A;  1TZO A;  4GDK B;  5H8Y E;  1P7E A;  1K52 A;  1SE2 A;  2SAK A;  3NUH B;  4WH4 A;  1HZ6 A;  2J52 A;  5E6J A;  3TEZ A;  4C7Y A;  1YN4 A;  2PKO A;  2JXT A;  1QOB A;  2ONQ A;  3URY A;  1C4C A;  2XNA C;  1DYQ A;  1EM7 A;  1XCT L;  3P1M A;  2PVG C;  1I4R A;  2J4X A;  4JX1 C;  4LK0 M;  4HKQ A;  3NVV A;  3AE1 B;  3RFZ B;  1L0Y B;  1BXT A;  4ZYS A;  1D5Z C;  3BVM A;  2ON8 A;  1FMA D;  3H8H A;  3HVD A;  5FKA C;  1L0X B;  1VZ6 A;  1JAL A;  1F77 A;  1KRH A;  5D3D A;  4N6E B;  4US9 A;  1NEN B;  2Q5W D;  1NYQ A;  1LO5 D;  1C4P A;  2D5G A;  3R2T A;  3Q8C A;  4RF1 A;  3VRB B;  3LYY A;  1L6U A;  1D5X C;  1FFV A;  3AEE B;  1OFF A;  3T3N A;  2KN4 A;  1YQ4 B;  4ZHO A;  1MPE A;  1L6V A;  2PIA A;  1NVI D;  4ZOH C;  1FCL A;  2W55 A;  4NAM A;  4N59 A;  1ET9 A;  2WU5 B;  3FC4 A;  1FIQ A;  2FUG 1;  3B2G A;  2FE8 A;  4USA A;  1AW7 A;  2PVO D;  3AE7 B;  2K3U A;  3BK2 A;  1SE3 A;  4NAW B;  3VRA B;  5GXG B;  1QOG A;  1WRI A;  3DWM A;  4C56 C;  2IGD A;  4JWU C;  1J7A A;  4O1N A;  2K0P A;  3GP7 A;  3Q69 A;  4KKI A;  1JWA D;  2TSS A;  1PDX A;  1K53 A;  1SIJ A;  1E10 A;  1QT9 A;  2JWU A;  1NI3 A;  3P4Q B;  3IAM 1;  1AYF A;  1XF5 L;  5G5H A;  1ZXI A;  3L4P A;  4DXF A;  1OQR A;  1STE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...