2PVGC

Crystal srtucture of the binary complex between ferredoxin and ferredoxin:thioredoxin reductase
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
96
structure length
96
Chain Sequence
ASYTVKLITPDGESSIECSDDTYILDAAEEAGLELPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords Ferredoxin-thioredoxin reductase, catalytic chain
publication title Structural snapshots along the reaction pathway of ferredoxin-thioredoxin reductase.
pubmed doi rcsb
source organism Synechocystis sp.
total genus 24
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 2007-05-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2pvgC00
2WP9B 1EWYC 1E0ZA 2BS3B 4JWUC 1YQ3B 2MJDA 2K5PA 2B76B 1WWTA 3AECB 2JX5A 1N62A 2WU5B 2WU2B 1QOBA 1R7SA 3DWMA 3P4SB 1FXAA 4ZOHC 1FRDA 4YSYB 3PO0A 1AYFA 1XLQA 1KF6B 1TKYA 3VR9B 1PFDA 3AE7B 2M19A 5EE0A 1DOXA 1N60A 3AEBB 4USAA 5H8YE 3VRAB 1NYRA 1JW9D 2Q5WD 3NVVA 1OQRA 3AE4B 2QIEB 2WDRB 1RM6C 1TYGB 3B9JA 3FC4A 1L6VA 1V8CA 5G5GA 5AUKA 1NENB 2M56B 3AEDB 1FMAD 1T3QA 1WGKA 1ZOYB 3AH7A 1L6UA 1OFFA 5GXGB 1JQ4A 1ZUD2 2N0SB 2W55A 4US9A 3W5UB 1WYGA 3AEFB 3P4QB 5MPOA 1FO4A 1N63A 1JALA 1CJEA 1YJIA 1E6EB 1ZP0B 2K9XA 2MJ3A 2Y5CA 2HTME 1NYQA 3SR6A 4HROA 1XLPA 1XO3A 2MH7A 1FM0D 3AEAB 2BS2B 4LTUA 1FIQA 3ZYYX 3W5VB 4US8A 1ROEA 5AUIA 1RWSA 1WRIA 2AX5A 4YSZB 3P4PB 1TKEA 1RFKA 1B9RA 4N59A 2WDVB 3HRDD 3AE3B 1N5XA 3DWGC 4IDIA 3NS1A 2PVGC 1E9MA 1SIJA 1FFVA 1L5PA 4WWMA 1GAQB 2H89B 3NVWA 2MJEA 1IUEA 1FFUA 3LXFA 1QF6A 1JWAD 2K22A 3AE9B 3P1MA 1JRPA 4FXCA 1E10A 3SFDB 1J7CA 1A70A 1VDVA 2PIAA 4YT0B 4C80A 1V97A 3BIID 3CIRB 4HRSA 3HUIA 2H88B 2E3TA 1NEKB 1UWMA 4N58A 2WLBA 3HVZA 2L52A 1ZXIA 1I7HA 3AE6B 1N61A 3RPFC 4C7ZA 3AE5B 1J7AA 2JQRB 4YSXB 1JROA 1AWDA 2BT6A 1GPXA 5EE3A 1QT9A 2WQYB 1RYJA 1N5WA 1OQQA 1WXQA 2DWQA 2DBYA 2LEKA 3AEGB 3B2FA 3ETRA 4YTMB 1DOYA 3P4RB 1VJKA 4N6EB 3AE8B 2W54A 5G5HA 4JWSC 2FBWB 5H92C 3AE1B 1TKGA 3NVYA 1FXIA 5EE9A 1L0VB 3AMZA 2L83A 3FAHA 4ITKA 4KX6B 2PVOD 1JWBD 1PDXA 1KRHA 2W3RA 3AM9A 2KMMA 3AN1A 1CZPA 5C2TB 4YTNB 1YQ4B 4ZHPA 1FRRA 1YJJA 1QOAA 2CJNA 4YXDB 1QOFA 3LB8C 1E7PB 2BS4B 4JX1C 5EE1A 1XLOA 3KWLA 1F0ZA 2OHFA 1KFYB 1DOIA 1DGJA 3CWIA 4ZHOA 5C3JB 1VLBA 4P6VF 3AB5A 4A9AA 3AE2B 4WQMA 3VRBB 2CJOA 3W9CB 2QJLA 3WCQA 1NI3A 1TJEA 2ACZB 3L4PA 1SB3C 1J7BA 1XLNA 1NVID 2PKOA 2WDQB 2WS3B 3NVZA 4YTPB 3SFEB 4C7YA 2KAJA 3B2GA 3VR8B 3P63A 3NRZA 2CU3A 1SF0A 3ABVB 3AEEB 2W3SA 3EUB2 1QLBB 2G1EA 2EKIA 3AV8A 1PUTA 1QOGA
chains in the Genus database with same CATH superfamily
3RI7C 5DPWA 1WM2A 1BT0A 2M0XA 2N9KA 2D3AA 2BTEA 2RDBC 3VH3B 2JPHA 5IKCM 2IDYA 2WXFA 3R2IA 1RM6C 1XD3B 2HTHA 1WGKA 3ZJUA 5LXHA 3RYTA 5G55A 2DENB 1OFFA 1UF0A 4TQ0A 3OAWA 1SIFA 2IJ0A 2HTME 2KDFB 3GZNB 2BW2A 1FCLA 4KDLB 3QQ8B 5HG2A 1GAQB 2NVUI 3VQIA 1SE2A 1JWAD 4YT0B 3A9JB 4BKGA 1GOZA 1IYFA 1I4QA 3PV1A 4K7SA 2NPTA 2WYQA 1RAXA 2V1YA 1QT9A 2JRHA 3L0WB 2ZW1A 1F52A 3P4RB 3PPAA 2D3BA 4ARCA 5CHWA 2R2OA 4AWJA 3TEYA 3AM9A 1FRRA 1QOAA 3RZFA 1DYQA 3WAMA 1IP9A 2D11A 3GE8C 3KYDD 4KKIA 5FR6A 4HEA1 2GBRA 3UF8A 4BZAA 3MC9A 1YN5A 2LGYA 1EF5A 3EC8A 3W1SA 5HKHA 4FJYA 1LXDA 4RGTA 2FCMA 4ACFA 4C56C 1IBXB 2Z0EB 2MBEA 1AN8A 5JHBA 2D07B 3R2TA 4DK5A 1JW9D 3NG0A 1WGHA 1TYGB 3L08A 3MC8A 3QA8A 4JIOU 2M56B 1XCTL 1VZ6A 4NAWB 2QEJC 2AL3A 1C76A 4YWGG 1E8XA 3I9V1 4RH6A 1YOVB 2D3CA 4LNIA 3TMPB 3WIMA 1C77A 2AX5A 3B08A 5CX3A 4XYCA 4EFOA 3N9YC 1WMHB 1VRAB 2JWUA 5E6JA 3L13A 3PHXB 5FKAC 3CIRB 3AE6B 5CHFA 3Q3FA 2NS5A 1P1AA 2CHXA 2I38A 2WXIA 2BT6A 1YX6B 3I3TB 1RLFA 2DWQA 2KKCA 4KVGB 1V49A 2L76A 1ZPSA 4P16A 3O13A 2KN5A 3A9KA 3GOEA 3BVGA 3T3OA 1MJDA 4ITKA 4ZYNA 1E8YA 4R3DA 4IW0A 3ZVVA 2CKHB 3PZ8A 2PJHA 4G11A 4P7IA 4ZHOA 4MDKE 3Q3MC 3AB5A 3U7ZA 1CK1A 3L4PA 1Z5SB 3IBEA 2CU3A 2G4SA 4KKJA 2QMTA 1P7EA 2IPKD 1UWMA 3L16A 3Q8FA 1E0ZA 4M01A 2K5PA 2DNFA 1WXSA 3TEZA 2KLGA 3DWMA 1FRDA 1I35A 3V62A 2AL6A 2D3GA 2MBBB 2V4LA 2LFIA 4USAA 3VRAB 5KHQA 4NQLB 1J8CA 2WDRB 3BYTB 2N7JA 4WH4A 3CSTA 4NAWA 2W55A 4PT5A 3PGEA 1WX9A 1YN3A 3QX1A 2SAKA 3ML9A 4HJGE 3ZYYX 1FM0D 3V60A 1QKZA 2XK5B 4AUQC 3KW5B 1RWSA 1N5XA 1YNTE 4KGRA 3UIPB 2AQ1B 1FFVA 1HZ6A 2L8JA 3NY5A 4Q2JA 2FIFA 2ZPNA 3ZUNA 1ET9A 1YX5B 4FJVB 3DDCB 4WWNA 2PIAA 3Q8EA 4JE3B 1IGDA 4MGZE 4GIVA 4OHJA 4C7ZA 1UBQA 3IG3A 1GUAB 4CO7A 5J2RA 2VZKB 2PE9A 4F8CB 4OZCA 2KXJA 1WGDA 2M0AA 3T3NA 2DZIA 2Z0DB 4HJKA 2EKEC 1F2RI 1P3QU 2QILA 1L0VB 4WJNA 3AMZA 1BMLC 2CR5A 5JZEB 4BBNF 1CZPA 2ZZPB 4ZHPA 2KN4A 2L0TA 5EE1A 3KWLA 4KZCA 3P42A 4OZBA 2KX0A 4LNNA 2MEKA 2HE7A 3AE2B 1NI3A 1XCQL 3FKYA 2LXCA 4KDIC 5IOIA 4REZA 2EKIA 1C1YB 3AV8A 3KYCD 3KUDB 1EWYC 5BMHA 2B76B 1VCBA 3BZDB 4XDDA 4S17A 3GZNI 4BAXA 1ENFA 1L7YA 2MCNB 1MG8A 3UQBA 5D6JB 1N60A 3AEBB 3GE3C 2RMMA 4K1RB 1LFDA 3EFUA 4TUUA 5AZGA 2IO1B 1FNVA 4I6NB 2N0SB 3P4QB 3AEFB 4M02A 1T5XD 2MJ3A 2MHJA 2FUG1 1D5MC 2AQ3B 2XK5A 4L23A 2BKRB 2KWUB 4FADA 4F1SA 3KUCB 3V6EB 1WJUA 2BPSA 1QF6A 2N4FA 3WALA 3U7DA 3A1QB 1J7CA 2LI5A 3HIZA 2XEWA 1TBEA 2G9HD 1A5RA 2L52A 2ICIA 2YEPF 2DZMA 1R4MB 5C23A 2LVPA 3DQVA 1WR1A 2N9LA 4A20A 3HVDA 2LXAA 1OQQA 2DBYA 3HK0A 1K8RB 1L4DB 4GU2A 4KZ0A 1JWUD 2JRIB 1UD7A 1FXIA 2L83A 2WXHA 5T8IA 3VUYA 5C2TB 4YTNB 1YQ4B 2CJNA 2RDGA 3SEBA 5IA7A 2W9NA 3H6NA 3QARA 5D94A 2AEHA 4II2B 2INNE 3K9OB 4OVVA 4WQMA 4HKZE 4LJPB 4XGAB 4XE0A 4MGKE 1XT9B 4G3XB 2KC1A 3I57A 1QOGA 3WAPA 1FPYA 2WXQA 3AXCA 1C4AA 1YIWA 3AECB 5L95C 1WZ0A 2KJ6A 4PS3A 1KF6B 1PFDA 1V5TA 3AI5A 1PGBA 2E6XA 2DYBA 3APCA 1TY2A 2EMTA 3E9SA 5IP4D 1NENB 4DXFA 5KHOA 1KLUD 5BMGA 4GOCA 5GXGB 3W5UB 3X0WA 3AULA 3LJ3A 2WXLA 1HTOA 2Z8LA 3A4RA 4P1CC 2ASQA 2KDMA 1NDDA 4FULA 3P4PB 2KT7A 2WWZA 3AE3B 2N9XA 4IM0A 2ZCCA 1MVKA 5E6OA 2IY1B 3DBSA 4C00A 4TSSA 4KSKC 3A1QA 3PLUA 4AP4C 1SEBD 3HUIA 3MJ5A 4ZRJA 4ANWA 1T0QC 2KWDA 4MGIE 2WQYB 1F9JA 1FCCC 1EU4A 1VR9A 4A6QA 4HPMB 1H8CA 4N6EB 2BGFA 1TTNA 1WZ3A 2W3RA 2IY0B 1LGRA 5DCNA 5G2NA 1YMHE 1HZ5A 3A33B 4GSWA 1DOIA 2KHWB 3T9LA 2NBVB 2KANA 3RNEC 3VUWA 5C3JB 3IAM1 4P6VF 1KJTA 1V6EA 2L0FA 1NBFC 3ZNHB 3P63A 3ZLZA 3U8ZA 1U4AA 3APFA 3EUB2 4LJOB 2G1EA 4A3OA 1RRBA 2INPE 4DXGA 1WF9A 4GMVA 2MJDA 4J6IA 2KYWA 4OW0A 5DPRA 4PYUA 2ZVOA 3IT6B 2WNMA 1GC7A 5CTRC 5C1ZA 3KQ4A 2LUEA 1K52A 1KM7A 4IM2A 2RR9A 5G5GA 2M8SA 5LXIB 3CF6E 3TL5A 3AH7A 3AU5A 5HFYA 2JZPA 2WGSA 2KO3A 3X23A 2KX3A 1I4GA 2O6VD 3Q3NC 4IKGA 2D10A 1NYQA 3RNBC 4W9EA 2K39A 4NQKE 1T6BX 1P0RA 1P7FA 2ZEQA 1SE3A 2VH2A 3M63B 1WXVA 5AZHA 4HCPB 3N1YC 3O65B 5JXVA 3HVZA 4MSQB 2LHEA 2OOBB 2JQRB 4OVUA 2XNAC 1N5WA 1OEYJ 3C0RB 2L00B 1MPEA 3VXWA 1E7VA 2CHWA 4ICVA 2KK8A 1TKGA 2GBJA 3ENEA 2KD0A 1JWBD 3BWUD 2LGIA 2BS4B 3U2SC 2JUOA 2PMVA 2REXA 1VLBA 2GBNA 4RM9A 2PKOA 1J19A 1UWXA 3ALBA 3A9KB 2B3AA 4EOYA 1WGYA 2RPQA 4B6WA 1AW7A 1VD2A 4JGHB 3PTFC 1WWTA 3ECIA 2DAJA 4DHJD 1AYFA 3VR9B 1WH3A 3CSFA 1DOXA 2FCNA 3GP7A 5DPTA 3E56A 2AQ2B 4MACA 3DBRB 2OJWA 3VTUA 1ZOYB 2JXXA 4HPPA 4P1BC 1OQYA 1R4MI 4BKSD 4S0RA 4E74A 1LM8B 4GGQA 4BKTA 1H4RA 4RNAA 4XWWA 2ZNVB 4XDCA 3LYYA 2WDVB 2N1WA 4JQWC 4ANUA 2MP2A 4BFRA 4WWMA 3ZW3A 4EUTA 3RD2A 2KLCA 4L2YA 4M8MA 1VDVA 4MJSA 1K50A 1WX7A 3MC0B 3RNGC 4MH8A 4HK2A 2MBOA 4W9CA 2ZNVC 1J7AA 4NJCA 5AEKB 4MH0E 2KACA 3LB8C 1BUIC 3ETRA 1DOYA 1TS5A 4H2AA 1L4ZB 2KJHB 1ZE3D 5EE9A 1NI2A 2X38A 3ZRCA 1PDXA 4WAFA 1E7PB 2R2QA 1HXYD 2LD9A 3ZJVA 2MBHA 1V5OA 1LQBA 3NVZA 2ZCBA 2C60A 2J52A 1FNWA 2K8CA 2VRRB 4QAYA 3DHIC 4HDQA 3OLMD 2WP9B 3DVGX 4JWUC 4IG7B 3UINB 2IYDB 2JX5A 3DBLB 2WU5B 1GB4A 3ZXVA 1C78A 1XLQA 4ZRQA 5D7GA 4IM3A 2KMAA 2YVCA 1WR6E 2AYOB 4AOFA 1PGXA 3B9JA 3H7PA 2MWSB 3AEDB 4US9A 5GMVA 5BO4B 1WYGA 4M8NA 3BK2A 5JH5C 3U4EG 3N30A 2K8HA 2FE8A 3R66C 2X8XX 2JT4B 3DWGC 1EF1A 3H9DA 2OEDA 3KVFB 1SIJA 1V81A 4CQNA 1FFUA 1JWMD 2IGHA 2GBMA 3EA6A 1E10A 2C9WB 4HWIB 4M0WB 3Q8CA 1ZKHA 3URYA 1FD6A 1ACCA 3B2FA 2IZVB 2V3SA 3Q6BA 3R3MA 3VUXA 2KQ4X 4L1BA 5IAAC 1OGWA 2EMSA 4TQ1A 1Y56A 1YJJA 1UGMA 4GN1A 4KSLC 4JX1C 3B1LX 4DWFA 1SE4A 2K25A 1V1OA 1DGJA 2L3ZA 4JLCA 3PRZA 4BOSC 3CWIA 3WANA 2OJRA 2K6QA 1UNSA 4GB9A 2CJOA 2WXPA 2ACZB 4BOZB 4YTPB 2UWQA 3ZO5B 3SFEB 4RCOA 2INDC 2GLSA 2JSVX 3KLSX 3NRZA 2QDFA 1SE9A 2HJ8A 2FIDA 2WX0A 3RNCC 1PGAA 2WHIA 4A55A 3UQAA 3DHHC 1FXAA 3ZTCA 4LDTD 3V6CB 2WXMA 3FILB 1TKYA 4G50A 1TY0A 3HM3A 2Q5WD 3NVVA 1P98A 4II3B 4NPNA 1KLGD 1WE7A 4WIPA 1WXMA 2QCZA 1WJ4A 1D6EC 3MFGA 4IWPA 3SR6A 2Y5CA 4MM3B 1XLPA 2DZJA 4O1NA 1RFKA 4HVBA 2BWES 1C4PA 1L5PA 2AWTA 1D5ZC 2ZW0A 4K81A 2KWVB 3K9PB 1JRPA 3RNAC 2GOWA 3SFDB 3ZIMA 4ANVA 3JSVB 1YQBA 1UH6A 3PVLA 4HRSA 2DAFA 2DYMA 2JZ3B 4M0WA 3TIXA 4ICUA 4FJZA 2LRWA 3BVZA 3N1ZC 5BYRA 4A9AA 2CU1A 5IN7A 3RUIB 4YTMB 1HEZE 1WGGA 2GRIA 2FBWB 2FUHB 4TV3A 5D3IB 3VH4B 1V1PB 3FAHA 4K3CA 4KX6B 2J0JA 3MJWA 4MGYE 3D32A 3QCAA 1WIAA 1GB1A 3SHQA 3VRBB 3WCQA 3N3KB 2K1FA 1NVID 2N7EA 2I2YA 4IWOA 2JXTA 2KVRA 2PTLA 2M17A 3DBRI 2XBBC 2KDEB 2QHOA 4BBNC 2WX1A 3DCGA 2I1JA 1YQ3B 3TEWA 1K51A 1Q1OA 2BYFA 2Y5PA 4HLEA 1R7SA 2L7RA 3H7SA 2HJ1A 4ZOHC 3H8HA 1WSPA 3FILA 2DYOA 3OJ4B 2WXKA 1FEHA 1ZXHA 1D3ZA 3MHZA 4NNJB 1V86A 4A8XC 1V8CA 3VVWB 3WA0A 4K7UA 3M3JA 4PYZA 2YLMA 1V2YA 2LJ5A 1IPGA 1CJEA 2L05A 1GC6A 2EELA 4W9HA 2INCC 2Z59B 3W5VB 3AEAB 4MM3A 3ZKJC 1WRIA 1TZ1A 4I6PA 4N59A 3HRDD 4IDIA 4JPSA 3NS1A 3DHGC 2KMCA 3NVWA 3LXFA 2K22A 3QJZA 3P1MA 4WWPA 2KFJA 1OEYA 4XC2A 3JSVA 3OWEB 3IHPC 2WXRA 1TS2A 3BK1A 3ZXRA 3V61A 3ZQ4A 4F7ZA 1RYJA 3AEGB 1MI0A 1JWSD 4D2KA 2KZRA 3QAQA 5AZFA 1SJED 1F77A 4ZRPA 1GNUA 2SEBD 5H92C 1V1PA 2ZVNA 4HPLB 2NCNA 2O2VB 3DBLI 2BWFA 3QHTA 2RPVA 4EEWA 1ESFA 2ZJDA 2A4ZA 1TJEA 2KAJA 1B1ZA 3U30A 1SF0A 3ABVB 3AEEB 1HQRD 4G0NB 3UIOB 3ZTDA 3ZGZA 1XXGA 3BY4B 2FCQA 4FN2A 4C4VA 3R8BA 2WXNA 3PO0A 2BBCA 1MHXA 2JYTA 1ZW7A 2G3QB 1XEEA 1NYRA 1OQRA 2MBQA 1LO5D 1L6VA 4FHKA 4DHZB 1CMXB 4WWOA 5TR5A 4W9FA 2UYZB 2DZKA 4W9GA 3OJ3A 5MPOA 3N1XC 1FO4A 2K9XA 4WJPA 1XO3A 2ZPYA 2BS2B 4MELA 1TKEA 2J53A 2XN9C 4LLGM 3SDLC 3JW0X 3VHTC 3NZ3A 4C80A 1Y8RC 1V80A 3B0AA 1WE6A 2GI9A 1NEKB 2E3TA 1ZXIA 4AJYB 2IGGA 1UBIA 1FXTB 2MRPA 3APDA 3EFCA 3KWVA 2MP2B 2DHZA 3NVYA 2PLPA 2PW9A 1RFAA 2JY6A 4MJSB 4W9LA 5TSSA 3HM6X 2RGFA 1QOFA 2MA9B 5JHAA 2KDIA 2O2VA 4N9F4 3DVNU 1TS3A 3PZDA 4RF0A 1KOTA 1MHHE 4DXAB 3Q8BA 3TJPA 3W1SC 3V3XA 1F2RC 4WJQA 1M4VA 1BXTA 1TS4A 2KFKB 1L0YB 4MSMB 1KTKA 3RZWC 1EWCA 2KC2A 3NZUA 2KWCA 4FA6A 4CHKA 1EM7A 3ZNZB 1EUVB 2CS4A 4HDOA 2MLBA 3AE7B 1TZOA 2LRUA 3DBHB 1N6ZA 3BINA 1GG3A 4RFBA 2QIEB 2L32A 2D2QA 4PK1A 1L6UA 3VTVA 1WXAA 1JQ4A 1M94A 3ZNID 2LZ6A 1YJIA 3ZDMC 4HROA 1PQSA 2N1VA 5AUIA 1SGHA 3DOWA 3MTNB 1HA5A 4AS1A 3RN9C 2LVQA 1E9MA 3C19A 4KIKB 1ZGUB 1C4CA 3PLVA 2J0KA 4HKQA 3H7PB 4JL9A 4EE2A 4DDGD 4XWTA 3IFWB 1Q5WB 1QZEA 2WLBA 1WM3A 3P2BA 2VZKD 1WX8A 1R4NB 1C3TA 1Q10A 1WFYA 4XZ4A 5FR3A 2J42A 5HI1A 3RT3B 3RFZB 5G5HA 1E8ZA 3PHWB 3QK0A 2VH1A 4FHJA 2RD0A 2K3UA 1YD8U 4FLHA 2BYEA 4CYEA 3NOBA 1E90A 2C5LC 3UI3A 1F0ZA 3DVGY 2OHFA 4IOIE 3C8YA 3HHMA 2N7DA 2J7QB 5LLIA 2GMIC 3ONSA 4DDID 2BB6A 3S2AA 3L10B 3WAOA 2KFKA 2KDBA 1E7UA 1EU3A 3NHEB 4UDUC 1L0XB 2WXJA 2JF5A 3RULA 2QC8A 5FK9C 1I42A 3P4SB 3PREA 3I63C 5EE0A 3QWZB 2LWPA 2BQQA 3R7QA 2JU6X 3AE4B 1SSNA 3TEXA 3OG5A 1I4PA 3A9JA 4NY0A 1GJZA 1VZ8A 2LGXA 3RNFC 3GB1A 2MH7A 2O6VB 2C7HA 2K6DB 2BYVE 4J3OD 4TKNA 1ZDVA 2NBUA 3U52E 2LHDA 4KIKA 2MJEA 1IUEA 3ZDTA 2IO3B 3AE9B 4FXCA 1EO6A 1HTQA 3BIID 1PYWD 5BYSA 4N58A 1L2NA 5L83A 4X57B 4LNOA 4DQOC 4YSXB 4B0EA 1JROA 4I6LB 1YJ1A 3TBLD 3TUOA 3Q3OC 4MEMA 4W9IA 4HXDA 4ZRIA 2Y3AA 4JWSC 1SJHD 4NAMA 1WJ6A 1KRHA 1TIFA 1KH0A 2KMMA 3AN1A 3PZ7A 2PEAA 4YL8A 4A90A 3KUZA 1VZ7A 1YN4A 1IBXA 2FNJB 2JVCA 1MG4A 4OVZA 2UU7A 2NTTA 1XLNA 5HHDG 1K53A 4W9DA 3VR8B 2ONQA 2KOXA 2RDHA 2W3SA 3PS6A 3W2DA 4KV2A 2IBIB 2J0MA 1JRUA 1WRDB 5BYQA 1N62A 2WU2B 1QOBA 1OTRB 1WGRA 4WJOA 2PPHA 4DHJB 1S3SG 2K0PA 5H8YE 4AQ7A 2W82A 4W9JA 4EZLA 4GDKB 4RGMA 3FC4A 1WMHA 3T8MA 2DLBA 4ANXA 3ZRFA 4BVUC 2JYEA 1P9DU 1QQRA 4B95A 2LASA 1JALA 1E6EB 2O6VA 1FIQA 3I5JC 4K7WA 4EZKA 4YSZB 1WY8A 4PS7A 2PVGC 4HCNB 2IO0B 2DX5B 3KH0A 2H89B 2MQJA 5EDSA 1MFWA 4GLSC 4GDLB 2KNBA 3TCAA 2WXOA 1A70A 2V3PA 2V0GA 2NBWB 2KVZA 1TGZB 1J0GA 1I7HA 1N61A 3PT2B 3AE5B 2LGSA 1I4HA 1TT5B 3AU4A 2JWZA 1S1QB 4B0MA 1AWDA 4RGOS 4WAAA 5EE3A 4RMAA 1WXQA 1AARA 1I4XA 5BMIA 1VJKA 2GB1A 4M00A 3AE8B 1XQQA 2W54A 2C7MB 2JZZA 3AE1B 1WI0A 3VAWA 2LGDA 2M1MA 3EGRA 1T0SC 3NUHB 1XLOA 2KTRB 4RGNA 3JYUA 3CMMB 3MP9A 4URKA 3QC8B 3DBHI 2QJLA 2C7NB 3SD5A 1J7BA 1WYWB 2WDQB 4WURA 4W9KA 3IAS1 4DBGA 1WJNA 2R61A 4WQOB 2NMQA 2IGDA 1PUTA 2MX2A 1ISNA 2WXGA 2NTSA 3EECA 1T0RC 4FBJB 3W1YA 2GBKA 2G45B 2M19A 3L17A 4B9KA 1KLVA 3PRPB 2CHZA 3Q14C 1ET6A 4GDKA 1UELA 3NJTA 5AUKA 1T0YA 1T3QA 2A5UA 2V3NA 3DPDA 1ZUD2 3SU8X 1ZP0B 4OZAA 1R4NI 4C4VB 4LTUA 4BKSA 2BYTA 4LNKA 1X1MA 1B9RA 3ZJTA 4LK0M 2KTFA 3BYYB 4KGTA 2Y5BB 2N9EB 3Q3JA 2RSUA 2TSSA 4IC7B 4GDLA 2N9PC 3R7RA 1V97A 3Q8AA 2LUMA 2H88B 3ML8A 3TSSA 3PSEB 3QIJA 2I1KA 5E6PA 4A3PA 4NJ6A 2FAZA 2LEKA 1QILA 2BB5A 2BKFA 2ON8A 1SBBB 1ZDXA 3RMKC 2LMCA 3NZSA 4LCDE 2PVOD 1E8WA 1XF5L 5CHVC 4ZRKA 1HE8A 4ZYSA 3V05A 2KTRA 2YEPB 4NZLB 4ARIA 1C79A 3W9CB 3DVNV 3H1UA 1SB3C 4XX5A 3JVZX 2J4XA 4C7YA 4KGSA 5D3DA 1Q0WB 5LNK1 3LDZE 4IUMB 2HDEA 4ZDVA 2HD5B 4AJWA 2QSDA 3J9CA 2PE6B 3M95A 2BS3B 2M4NA 4RF1A 4YSYB 1D4BA 4LDTB 4EZJA 2WDTB 1Z2MA 3MHSD 1FMAD 2MSED 4LNFA 5DPSA 1I4RA 1FNUA 3IVFA 3Q2AC 1N63A 1IGCA 5I4DA 2KQSA 4US8A 3VDZA 4EKUA 1ROEA 3VFKA 3EHVA 5J17A 4E3CA 3RCZA 3Q69A 5E6NA 3GS2A 1STEA 3IXSA 1SXTA 4TMAB 1UGJA 2FCSA 1JMLA 5J18A 2BF8B 1F1HA 3NS8A 2L1AA 3VTWA 2NPTB 2NR2A 2K8BA 3RPFC 2D5GA 5D2MB 3BVMA 3PRMB 1GPXA 4PS8A 2KQ7A 4GXBA 2V4IB 3ZNGC 3N32A 1CQVA 4MT5A 1D5XC 1E5WA 3N20C 3A4SC 4E71A 2LJIA 3M62B 1V9JA 4IWQA 4ASWC 1UUPA 3L54A 4YXDB 2IO2B 1KFYB 2V9HA 4NJ7A 3UGBB 4DHZE 2KJRA 3IT4B 5IO9A 4K3BA 2MW5A 1JCKB 1UZXB 2WS3B 1C9FA 2G4DB 2BVCA 3B2GA 1G6JA 4RM8A 1QLBB 2LVOA
chains in the Genus database with same CATH topology
4UDUC 1L0XB 2WXQA 1PGAA 1C4AA 2WXJA 2N9KA 4A55A 3AECB 5FK9C 3P4SB 1FXAA 2BTEA 2WXMA 3FILB 1KF6B 1TKYA 1PFDA 5EE0A 1PGBA 2E6XA 1TY0A 2IDYA 2Q5WD 2WXFA 2JU6X 3NVVA 1TY2A 3AE4B 3R2IA 1RM6C 1SSNA 1KLGD 3E9SA 3TEXA 1NENB 4DXFA 1WGKA 3ZJUA 1KLUD 4WIPA 5BMGA 1I4PA 1OFFA 5GXGB 3W5UB 1VZ8A 1D6EC 4TQ0A 2WXLA 3MFGA 2Z8LA 2Y5CA 3SR6A 2IJ0A 2HTME 4MM3B 3GB1A 1XLPA 2MH7A 2KDMA 3P4PB 4O1NA 1RFKA 4J3OD 1ZDVA 3AE3B 1C4PA 2BW2A 1FCLA 1MVKA 5HG2A 1L5PA 3U52E 2LHDA 1D5ZC 1GAQB 2ZW0A 3VQIA 2MJEA 1IUEA 1SE2A 1JWAD 3AE9B 4TSSA 1JRPA 4FXCA 3SFDB 4YT0B 1SEBD 1GOZA 3BIID 4HRSA 3HUIA 1PYWD 5BYSA 1I4QA 4N58A 2DYMA 3MJ5A 4M0WA 2KWDA 4DQOC 4YSXB 4B0EA 1JROA 3BVZA 1QT9A 2WQYB 5BYRA 3TUOA 4A9AA 2ZW1A 1FCCC 1EU4A 1VR9A 4A6QA 4YTMB 3P4RB 1HEZE 4N6EB 2GRIA 2Y3AA 4JWSC 2FBWB 5D3IB 1SJHD 4ARCA 1V1PB 4NAMA 3FAHA 4KX6B 1KRHA 3TEYA 1KH0A 2W3RA 2KMMA 3AM9A 3AN1A 3PZ7A 4A90A 1YMHE 1FRRA 1QOAA 1HZ5A 1VZ7A 1DYQA 1YN4A 1IBXA 1DOIA 1GB1A 5C3JB 3IAM1 4P6VF 4OVZA 4KKIA 2NTTA 3VRBB 3WCQA 4HEA1 1XLNA 1NVID 1YN5A 2I2YA 5HHDG 1K53A 2JXTA 2PTLA 3W1SA 3VR8B 3P63A 2ONQA 2RDHA 2W3SA 3EUB2 2G1EA 4RGTA 3W2DA 2INPE 4DXGA 1YQ3B 3TEWA 2MJDA 1K51A 4C56C 1IBXB 4OW0A 2Y5PA 5BYQA 1N62A 2WU2B 1QOBA 1R7SA 1AN8A 4ZOHC 3IT6B 3H8HA 1WSPA 3FILA 2DYOA 2WNMA 3R2TA 2K0PA 4AQ7A 5H8YE 2W82A 3KQ4A 1JW9D 1K52A 2WXKA 1FEHA 1ZXHA 1TYGB 3MHZA 4GDKB 4RGMA 3FC4A 4A8XC 1V8CA 2DLBA 5G5GA 2M56B 3AH7A 1XCTL 1VZ6A 2JYEA 4NAWB 5HFYA 2QEJC 2JZPA 1C76A 4YWGG 1QQRA 4RH6A 3I9V1 1I4GA 1JALA 1CJEA 4IKGA 1E6EB 2EELA 3W5VB 1NYQA 3AEAB 1FIQA 1C77A 1WRIA 1T6BX 2AX5A 4YSZB 1P7FA 4N59A 1SE3A 3HRDD 4IDIA 4JPSA 3NS1A 2PVGC 2H89B 3N9YC 3NVWA 3LXFA 4GLSC 1VRAB 2JWUA 2K22A 3P1MA 4GDLB 5E6JA 2WXOA 1A70A 5FKAC 2V3PA 2V0GA 3OWEB 3CIRB 5JXVA 2WXRA 3HVZA 1TS2A 1I7HA 3AE6B 1N61A 3AE5B 2LHEA 1I4HA 2JQRB 3BK1A 2XNAC 1AWDA 2I38A 2BT6A 2WXIA 4RGOS 3ZQ4A 4B0MA 5EE3A 1RYJA 1N5WA 1WXQA 2DWQA 3AEGB 1MI0A 1MPEA 1JWSD 1I4XA 5BMIA 1VJKA 4P16A 1ZPSA 2GB1A 3O13A 4D2KA 3AE8B 2W54A 1SJED 1F77A 4ZRPA 2SEBD 5H92C 3AE1B 1TKGA 1V1PA 3BVGA 3T3OA 4ITKA 1JWBD 3BWUD 4R3DA 3EGRA 2LGIA 2BS4B 3NUHB 1XLOA 3PZ8A 3U2SC 4RGNA 2PMVA 2RPVA 4ZHOA 1VLBA 3AB5A 3MP9A 3U7ZA 1CK1A 1ESFA 2QJLA 1TJEA 3L4PA 1J7BA 2PKOA 1UWXA 2WDQB 2KAJA 4WURA 1B1ZA 3IAS1 2CU3A 4KKJA 1SF0A 2QMTA 2R61A 3ABVB 3AEEB 1HQRD 1P7EA 2NMQA 2IPKD 2IGDA 1PUTA 1UWMA 3Q8FA 3ZGZA 1E0ZA 1XXGA 1AW7A 2K5PA 2WXGA 2NTSA 1WWTA 3TEZA 3DWMA 3R8BA 1FRDA 2WXNA 3PO0A 2BBCA 1AYFA 1MHXA 3VR9B 2JYTA 2M19A 1DOXA 2LFIA 4USAA 1XEEA 1NYRA 3VRAB 1OQRA 3GP7A 2WDRB 3BYTB 1LO5D 1L6VA 1ET6A 2N7JA 2AQ2B 3E56A 4MACA 5AUKA 1T3QA 1ZOYB 4WH4A 2V3NA 1ZUD2 2W55A 4PT5A 5MPOA 1FO4A 2K9XA 1ZP0B 1YN3A 2SAKA 4OZAA 4HJGE 1XO3A 4RNAA 3ZYYX 1FM0D 4LTUA 2BS2B 2BYTA 4XWWA 1QKZA 1RWSA 4XDCA 3LYYA 1TKEA 1B9RA 2J53A 2WDVB 2XN9C 1N5XA 4LK0M 4LLGM 3BYYB 4KGTA 3ZJTA 1YNTE 4KGRA 2AQ1B 1FFVA 1HZ6A 4WWMA 4Q2JA 2TSSA 3NZ3A 1ET9A 4L2YA 1VDVA 2PIAA 4C80A 3Q8EA 1K50A 1V97A 3MC0B 3Q8AA 4JE3B 2LUMA 1IGDA 2H88B 2GI9A 1NEKB 2E3TA 4OHJA 1ZXIA 4MH8A 3TSSA 4C7ZA 2IGGA 4NJCA 1J7AA 2VZKB 2KACA 3LB8C 3KWVA 1BUIC 2LEKA 1QILA 4OZCA 2BB5A 3ETRA 2ON8A 1DOYA 1SBBB 2M0AA 1TS5A 4H2AA 1L4ZB 3T3NA 1ZDXA 1F2RI 2LMCA 3NVYA 2PLPA 2QILA 1ZE3D 2PW9A 1L0VB 5EE9A 3AMZA 1BMLC 2X38A 2PVOD 1XF5L 1PDXA 1CZPA 5TSSA 4ZHPA 4ZYSA 3V05A 2KN4A 4WAFA 1QOFA 1E7PB 5EE1A 3KWLA 3P42A 1HXYD 4OZBA 3ZJVA 1TS3A 2MEKA 2YEPB 4NZLB 4RF0A 4ARIA 1C79A 1MHHE 3AE2B 3W9CB 3Q8BA 1NI3A 3V3XA 1XCQL 1SB3C 3NVZA 2J4XA 1F2RC 4C7YA 4KGSA 5D3DA 2J52A 1M4VA 1BXTA 5LNK1 1FNWA 1TS4A 2HDEA 1L0YB 4REZA 1KTKA 2QSDA 3J9CA 2EKIA 1EWCA 3AV8A 2WP9B 1EWYC 2BS3B 4JWUC 5BMHA 2B76B 1EM7A 3BZDB 4RF1A 4XDDA 2JX5A 1ENFA 2WU5B 1GB4A 1C78A 4YSYB 1XLQA 4ZRQA 3AE7B 1TZOA 5D7GA 1D4BA 1N60A 3AEBB 4RFBA 2QIEB 2RMMA 1PGXA 2L32A 3B9JA 3AEDB 1FMAD 1L6UA 1FNVA 1I4RA 1FNUA 1JQ4A 2N0SB 4US9A 1WYGA 3AEFB 3P4QB 3BK2A 1N63A 1IGCA 1T5XD 1YJIA 2MJ3A 3U4EG 5I4DA 4HROA 4US8A 2FUG1 1ROEA 1D5MC 2AQ3B 4L23A 5AUIA 1HA5A 2FE8A 4AS1A 3Q69A 3GS2A 3DWGC 1E9MA 2OEDA 1SIJA 4CQNA 1C4CA 1STEA 3IXSA 1SXTA 4HKQA 1FFUA 4TMAB 1QF6A 4EE2A 1UGJA 1JWMD 2IGHA 1JMLA 3EA6A 4XWTA 1E10A 1J7CA 2L1AA 2G9HD 2WLBA 2L52A 2ICIA 2YEPF 2VZKD 3Q8CA 3RPFC 2D5GA 2N9LA 3HVDA 3URYA 3BVMA 1Q10A 1FD6A 1GPXA 1ACCA 1OQQA 2DBYA 3B2FA 5FR3A 2J42A 5HI1A 3RFZB 2V4IB 1L4DB 5G5HA 1JWUD 1CQVA 4MT5A 1D5XC 1FXIA 2K3UA 2LJIA 2KQ4X 2L83A 4L1BA 2WXHA 5T8IA 1UUPA 4TQ1A 1Y56A 4YTNB 1YQ4B 5C2TB 1YJJA 3UI3A 2CJNA 4YXDB 4JX1C 1F0ZA 2RDGA 3SEBA 1SE4A 2OHFA 1KFYB 4IOIE 1V1OA 3C8YA 1DGJA 2INNE 3CWIA 1UNSA 3IT4B 4WQMA 2CJOA 4HKZE 2WXPA 2ACZB 1JCKB 2WS3B 4XE0A 4YTPB 1C9FA 3SFEB 4RCOA 2BB6A 3B2GA 2JSVX 3KLSX 3NRZA 1QLBB 3I57A 1EU3A 1QOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WP9 B;  1EWY C;  1E0Z A;  2BS3 B;  4JWU C;  1YQ3 B;  2MJD A;  2K5P A;  2B76 B;  1WWT A;  3AEC B;  2JX5 A;  1N62 A;  2WU5 B;  2WU2 B;  1QOB A;  1R7S A;  3DWM A;  3P4S B;  1FXA A;  4ZOH C;  1FRD A;  4YSY B;  3PO0 A;  1AYF A;  1XLQ A;  1KF6 B;  1TKY A;  3VR9 B;  1PFD A;  3AE7 B;  2M19 A;  5EE0 A;  1DOX A;  1N60 A;  3AEB B;  4USA A;  5H8Y E;  3VRA B;  1NYR A;  1JW9 D;  2Q5W D;  3NVV A;  1OQR A;  3AE4 B;  2QIE B;  2WDR B;  1RM6 C;  1TYG B;  3B9J A;  3FC4 A;  1L6V A;  1V8C A;  5G5G A;  5AUK A;  1NEN B;  2M56 B;  3AED B;  1FMA D;  1T3Q A;  1WGK A;  1ZOY B;  3AH7 A;  1L6U A;  1OFF A;  5GXG B;  1JQ4 A;  1ZUD 2;  2N0S B;  2W55 A;  4US9 A;  3W5U B;  1WYG A;  3AEF B;  3P4Q B;  5MPO A;  1FO4 A;  1N63 A;  1JAL A;  1CJE A;  1YJI A;  1E6E B;  1ZP0 B;  2K9X A;  2MJ3 A;  2Y5C A;  2HTM E;  1NYQ A;  3SR6 A;  4HRO A;  1XLP A;  1XO3 A;  2MH7 A;  1FM0 D;  3AEA B;  2BS2 B;  4LTU A;  1FIQ A;  3ZYY X;  3W5V B;  4US8 A;  1ROE A;  5AUI A;  1RWS A;  1WRI A;  2AX5 A;  4YSZ B;  3P4P B;  1TKE A;  1RFK A;  1B9R A;  4N59 A;  2WDV B;  3HRD D;  3AE3 B;  1N5X A;  3DWG C;  4IDI A;  3NS1 A;  2PVG C;  1E9M A;  1SIJ A;  1FFV A;  1L5P A;  4WWM A;  1GAQ B;  2H89 B;  3NVW A;  2MJE A;  1IUE A;  1FFU A;  3LXF A;  1QF6 A;  1JWA D;  2K22 A;  3AE9 B;  3P1M A;  1JRP A;  4FXC A;  1E10 A;  3SFD B;  1J7C A;  1A70 A;  1VDV A;  2PIA A;  4YT0 B;  4C80 A;  1V97 A;  3BII D;  3CIR B;  4HRS A;  3HUI A;  2H88 B;  2E3T A;  1NEK B;  1UWM A;  4N58 A;  2WLB A;  3HVZ A;  2L52 A;  1ZXI A;  1I7H A;  3AE6 B;  1N61 A;  3RPF C;  4C7Z A;  3AE5 B;  1J7A A;  2JQR B;  4YSX B;  1JRO A;  1AWD A;  2BT6 A;  1GPX A;  5EE3 A;  1QT9 A;  2WQY B;  1RYJ A;  1N5W A;  1OQQ A;  1WXQ A;  2DWQ A;  2DBY A;  2LEK A;  3AEG B;  3B2F A;  3ETR A;  4YTM B;  1DOY A;  3P4R B;  1VJK A;  4N6E B;  3AE8 B;  2W54 A;  5G5H A;  4JWS C;  2FBW B;  5H92 C;  3AE1 B;  1TKG A;  3NVY A;  1FXI A;  5EE9 A;  1L0V B;  3AMZ A;  2L83 A;  3FAH A;  4ITK A;  4KX6 B;  2PVO D;  1JWB D;  1PDX A;  1KRH A;  2W3R A;  3AM9 A;  2KMM A;  3AN1 A;  1CZP A;  5C2T B;  4YTN B;  1YQ4 B;  4ZHP A;  1FRR A;  1YJJ A;  1QOA A;  2CJN A;  4YXD B;  1QOF A;  3LB8 C;  1E7P B;  2BS4 B;  4JX1 C;  5EE1 A;  1XLO A;  3KWL A;  1F0Z A;  2OHF A;  1KFY B;  1DOI A;  1DGJ A;  3CWI A;  4ZHO A;  5C3J B;  1VLB A;  4P6V F;  3AB5 A;  4A9A A;  3AE2 B;  4WQM A;  3VRB B;  2CJO A;  3W9C B;  2QJL A;  3WCQ A;  1NI3 A;  1TJE A;  2ACZ B;  3L4P A;  1SB3 C;  1J7B A;  1XLN A;  1NVI D;  2PKO A;  2WDQ B;  2WS3 B;  3NVZ A;  4YTP B;  3SFE B;  4C7Y A;  2KAJ A;  3B2G A;  3VR8 B;  3P63 A;  3NRZ A;  2CU3 A;  1SF0 A;  3ABV B;  3AEE B;  2W3S A;  3EUB 2;  1QLB B;  2G1E A;  2EKI A;  3AV8 A;  1PUT A;  1QOG A; 
#chains in the Genus database with same CATH topology
 3RI7 C;  5DPW A;  1WM2 A;  1BT0 A;  2M0X A;  2N9K A;  2D3A A;  2BTE A;  2RDB C;  3VH3 B;  2JPH A;  5IKC M;  2IDY A;  2WXF A;  3R2I A;  1RM6 C;  1XD3 B;  2HTH A;  1WGK A;  3ZJU A;  5LXH A;  3RYT A;  5G55 A;  2DEN B;  1OFF A;  1UF0 A;  4TQ0 A;  3OAW A;  1SIF A;  2IJ0 A;  2HTM E;  2KDF B;  3GZN B;  2BW2 A;  1FCL A;  4KDL B;  3QQ8 B;  5HG2 A;  1GAQ B;  2NVU I;  3VQI A;  1SE2 A;  1JWA D;  4YT0 B;  3A9J B;  4BKG A;  1GOZ A;  1IYF A;  1I4Q A;  3PV1 A;  4K7S A;  2NPT A;  2WYQ A;  1RAX A;  2V1Y A;  1QT9 A;  2JRH A;  3L0W B;  2ZW1 A;  1F52 A;  3P4R B;  3PPA A;  2D3B A;  4ARC A;  5CHW A;  2R2O A;  4AWJ A;  3TEY A;  3AM9 A;  1FRR A;  1QOA A;  3RZF A;  1DYQ A;  3WAM A;  1IP9 A;  2D11 A;  3GE8 C;  3KYD D;  4KKI A;  5FR6 A;  4HEA 1;  2GBR A;  3UF8 A;  4BZA A;  3MC9 A;  1YN5 A;  2LGY A;  1EF5 A;  3EC8 A;  3W1S A;  5HKH A;  4FJY A;  1LXD A;  4RGT A;  2FCM A;  4ACF A;  4C56 C;  1IBX B;  2Z0E B;  2MBE A;  1AN8 A;  5JHB A;  2D07 B;  3R2T A;  4DK5 A;  1JW9 D;  3NG0 A;  1WGH A;  1TYG B;  3L08 A;  3MC8 A;  3QA8 A;  4JIO U;  2M56 B;  1XCT L;  1VZ6 A;  4NAW B;  2QEJ C;  2AL3 A;  1C76 A;  4YWG G;  1E8X A;  3I9V 1;  4RH6 A;  1YOV B;  2D3C A;  4LNI A;  3TMP B;  3WIM A;  1C77 A;  2AX5 A;  3B08 A;  5CX3 A;  4XYC A;  4EFO A;  3N9Y C;  1WMH B;  1VRA B;  2JWU A;  5E6J A;  3L13 A;  3PHX B;  5FKA C;  3CIR B;  3AE6 B;  5CHF A;  3Q3F A;  2NS5 A;  1P1A A;  2CHX A;  2I38 A;  2WXI A;  2BT6 A;  1YX6 B;  3I3T B;  1RLF A;  2DWQ A;  2KKC A;  4KVG B;  1V49 A;  2L76 A;  1ZPS A;  4P16 A;  3O13 A;  2KN5 A;  3A9K A;  3GOE A;  3BVG A;  3T3O A;  1MJD A;  4ITK A;  4ZYN A;  1E8Y A;  4R3D A;  4IW0 A;  3ZVV A;  2CKH B;  3PZ8 A;  2PJH A;  4G11 A;  4P7I A;  4ZHO A;  4MDK E;  3Q3M C;  3AB5 A;  3U7Z A;  1CK1 A;  3L4P A;  1Z5S B;  3IBE A;  2CU3 A;  2G4S A;  4KKJ A;  2QMT A;  1P7E A;  2IPK D;  1UWM A;  3L16 A;  3Q8F A;  1E0Z A;  4M01 A;  2K5P A;  2DNF A;  1WXS A;  3TEZ A;  2KLG A;  3DWM A;  1FRD A;  1I35 A;  3V62 A;  2AL6 A;  2D3G A;  2MBB B;  2V4L A;  2LFI A;  4USA A;  3VRA B;  5KHQ A;  4NQL B;  1J8C A;  2WDR B;  3BYT B;  2N7J A;  4WH4 A;  3CST A;  4NAW A;  2W55 A;  4PT5 A;  3PGE A;  1WX9 A;  1YN3 A;  3QX1 A;  2SAK A;  3ML9 A;  4HJG E;  3ZYY X;  1FM0 D;  3V60 A;  1QKZ A;  2XK5 B;  4AUQ C;  3KW5 B;  1RWS A;  1N5X A;  1YNT E;  4KGR A;  3UIP B;  2AQ1 B;  1FFV A;  1HZ6 A;  2L8J A;  3NY5 A;  4Q2J A;  2FIF A;  2ZPN A;  3ZUN A;  1ET9 A;  1YX5 B;  4FJV B;  3DDC B;  4WWN A;  2PIA A;  3Q8E A;  4JE3 B;  1IGD A;  4MGZ E;  4GIV A;  4OHJ A;  4C7Z A;  1UBQ A;  3IG3 A;  1GUA B;  4CO7 A;  5J2R A;  2VZK B;  2PE9 A;  4F8C B;  4OZC A;  2KXJ A;  1WGD A;  2M0A A;  3T3N A;  2DZI A;  2Z0D B;  4HJK A;  2EKE C;  1F2R I;  1P3Q U;  2QIL A;  1L0V B;  4WJN A;  3AMZ A;  1BML C;  2CR5 A;  5JZE B;  4BBN F;  1CZP A;  2ZZP B;  4ZHP A;  2KN4 A;  2L0T A;  5EE1 A;  3KWL A;  4KZC A;  3P42 A;  4OZB A;  2KX0 A;  4LNN A;  2MEK A;  2HE7 A;  3AE2 B;  1NI3 A;  1XCQ L;  3FKY A;  2LXC A;  4KDI C;  5IOI A;  4REZ A;  2EKI A;  1C1Y B;  3AV8 A;  3KYC D;  3KUD B;  1EWY C;  5BMH A;  2B76 B;  1VCB A;  3BZD B;  4XDD A;  4S17 A;  3GZN I;  4BAX A;  1ENF A;  1L7Y A;  2MCN B;  1MG8 A;  3UQB A;  5D6J B;  1N60 A;  3AEB B;  3GE3 C;  2RMM A;  4K1R B;  1LFD A;  3EFU A;  4TUU A;  5AZG A;  2IO1 B;  1FNV A;  4I6N B;  2N0S B;  3P4Q B;  3AEF B;  4M02 A;  1T5X D;  2MJ3 A;  2MHJ A;  2FUG 1;  1D5M C;  2AQ3 B;  2XK5 A;  4L23 A;  2BKR B;  2KWU B;  4FAD A;  4F1S A;  3KUC B;  3V6E B;  1WJU A;  2BPS A;  1QF6 A;  2N4F A;  3WAL A;  3U7D A;  3A1Q B;  1J7C A;  2LI5 A;  3HIZ A;  2XEW A;  1TBE A;  2G9H D;  1A5R A;  2L52 A;  2ICI A;  2YEP F;  2DZM A;  1R4M B;  5C23 A;  2LVP A;  3DQV A;  1WR1 A;  2N9L A;  4A20 A;  3HVD A;  2LXA A;  1OQQ A;  2DBY A;  3HK0 A;  1K8R B;  1L4D B;  4GU2 A;  4KZ0 A;  1JWU D;  2JRI B;  1UD7 A;  1FXI A;  2L83 A;  2WXH A;  5T8I A;  3VUY A;  5C2T B;  4YTN B;  1YQ4 B;  2CJN A;  2RDG A;  3SEB A;  5IA7 A;  2W9N A;  3H6N A;  3QAR A;  5D94 A;  2AEH A;  4II2 B;  2INN E;  3K9O B;  4OVV A;  4WQM A;  4HKZ E;  4LJP B;  4XGA B;  4XE0 A;  4MGK E;  1XT9 B;  4G3X B;  2KC1 A;  3I57 A;  1QOG A;  3WAP A;  1FPY A;  2WXQ A;  3AXC A;  1C4A A;  1YIW A;  3AEC B;  5L95 C;  1WZ0 A;  2KJ6 A;  4PS3 A;  1KF6 B;  1PFD A;  1V5T A;  3AI5 A;  1PGB A;  2E6X A;  2DYB A;  3APC A;  1TY2 A;  2EMT A;  3E9S A;  5IP4 D;  1NEN B;  4DXF A;  5KHO A;  1KLU D;  5BMG A;  4GOC A;  5GXG B;  3W5U B;  3X0W A;  3AUL A;  3LJ3 A;  2WXL A;  1HTO A;  2Z8L A;  3A4R A;  4P1C C;  2ASQ A;  2KDM A;  1NDD A;  4FUL A;  3P4P B;  2KT7 A;  2WWZ A;  3AE3 B;  2N9X A;  4IM0 A;  2ZCC A;  1MVK A;  5E6O A;  2IY1 B;  3DBS A;  4C00 A;  4TSS A;  4KSK C;  3A1Q A;  3PLU A;  4AP4 C;  1SEB D;  3HUI A;  3MJ5 A;  4ZRJ A;  4ANW A;  1T0Q C;  2KWD A;  4MGI E;  2WQY B;  1F9J A;  1FCC C;  1EU4 A;  1VR9 A;  4A6Q A;  4HPM B;  1H8C A;  4N6E B;  2BGF A;  1TTN A;  1WZ3 A;  2W3R A;  2IY0 B;  1LGR A;  5DCN A;  5G2N A;  1YMH E;  1HZ5 A;  3A33 B;  4GSW A;  1DOI A;  2KHW B;  3T9L A;  2NBV B;  2KAN A;  3RNE C;  3VUW A;  5C3J B;  3IAM 1;  4P6V F;  1KJT A;  1V6E A;  2L0F A;  1NBF C;  3ZNH B;  3P63 A;  3ZLZ A;  3U8Z A;  1U4A A;  3APF A;  3EUB 2;  4LJO B;  2G1E A;  4A3O A;  1RRB A;  2INP E;  4DXG A;  1WF9 A;  4GMV A;  2MJD A;  4J6I A;  2KYW A;  4OW0 A;  5DPR A;  4PYU A;  2ZVO A;  3IT6 B;  2WNM A;  1GC7 A;  5CTR C;  5C1Z A;  3KQ4 A;  2LUE A;  1K52 A;  1KM7 A;  4IM2 A;  2RR9 A;  5G5G A;  2M8S A;  5LXI B;  3CF6 E;  3TL5 A;  3AH7 A;  3AU5 A;  5HFY A;  2JZP A;  2WGS A;  2KO3 A;  3X23 A;  2KX3 A;  1I4G A;  2O6V D;  3Q3N C;  4IKG A;  2D10 A;  1NYQ A;  3RNB C;  4W9E A;  2K39 A;  4NQK E;  1T6B X;  1P0R A;  1P7F A;  2ZEQ A;  1SE3 A;  2VH2 A;  3M63 B;  1WXV A;  5AZH A;  4HCP B;  3N1Y C;  3O65 B;  5JXV A;  3HVZ A;  4MSQ B;  2LHE A;  2OOB B;  2JQR B;  4OVU A;  2XNA C;  1N5W A;  1OEY J;  3C0R B;  2L00 B;  1MPE A;  3VXW A;  1E7V A;  2CHW A;  4ICV A;  2KK8 A;  1TKG A;  2GBJ A;  3ENE A;  2KD0 A;  1JWB D;  3BWU D;  2LGI A;  2BS4 B;  3U2S C;  2JUO A;  2PMV A;  2REX A;  1VLB A;  2GBN A;  4RM9 A;  2PKO A;  1J19 A;  1UWX A;  3ALB A;  3A9K B;  2B3A A;  4EOY A;  1WGY A;  2RPQ A;  4B6W A;  1AW7 A;  1VD2 A;  4JGH B;  3PTF C;  1WWT A;  3ECI A;  2DAJ A;  4DHJ D;  1AYF A;  3VR9 B;  1WH3 A;  3CSF A;  1DOX A;  2FCN A;  3GP7 A;  5DPT A;  3E56 A;  2AQ2 B;  4MAC A;  3DBR B;  2OJW A;  3VTU A;  1ZOY B;  2JXX A;  4HPP A;  4P1B C;  1OQY A;  1R4M I;  4BKS D;  4S0R A;  4E74 A;  1LM8 B;  4GGQ A;  4BKT A;  1H4R A;  4RNA A;  4XWW A;  2ZNV B;  4XDC A;  3LYY A;  2WDV B;  2N1W A;  4JQW C;  4ANU A;  2MP2 A;  4BFR A;  4WWM A;  3ZW3 A;  4EUT A;  3RD2 A;  2KLC A;  4L2Y A;  4M8M A;  1VDV A;  4MJS A;  1K50 A;  1WX7 A;  3MC0 B;  3RNG C;  4MH8 A;  4HK2 A;  2MBO A;  4W9C A;  2ZNV C;  1J7A A;  4NJC A;  5AEK B;  4MH0 E;  2KAC A;  3LB8 C;  1BUI C;  3ETR A;  1DOY A;  1TS5 A;  4H2A A;  1L4Z B;  2KJH B;  1ZE3 D;  5EE9 A;  1NI2 A;  2X38 A;  3ZRC A;  1PDX A;  4WAF A;  1E7P B;  2R2Q A;  1HXY D;  2LD9 A;  3ZJV A;  2MBH A;  1V5O A;  1LQB A;  3NVZ A;  2ZCB A;  2C60 A;  2J52 A;  1FNW A;  2K8C A;  2VRR B;  4QAY A;  3DHI C;  4HDQ A;  3OLM D;  2WP9 B;  3DVG X;  4JWU C;  4IG7 B;  3UIN B;  2IYD B;  2JX5 A;  3DBL B;  2WU5 B;  1GB4 A;  3ZXV A;  1C78 A;  1XLQ A;  4ZRQ A;  5D7G A;  4IM3 A;  2KMA A;  2YVC A;  1WR6 E;  2AYO B;  4AOF A;  1PGX A;  3B9J A;  3H7P A;  2MWS B;  3AED B;  4US9 A;  5GMV A;  5BO4 B;  1WYG A;  4M8N A;  3BK2 A;  5JH5 C;  3U4E G;  3N30 A;  2K8H A;  2FE8 A;  3R66 C;  2X8X X;  2JT4 B;  3DWG C;  1EF1 A;  3H9D A;  2OED A;  3KVF B;  1SIJ A;  1V81 A;  4CQN A;  1FFU A;  1JWM D;  2IGH A;  2GBM A;  3EA6 A;  1E10 A;  2C9W B;  4HWI B;  4M0W B;  3Q8C A;  1ZKH A;  3URY A;  1FD6 A;  1ACC A;  3B2F A;  2IZV B;  2V3S A;  3Q6B A;  3R3M A;  3VUX A;  2KQ4 X;  4L1B A;  5IAA C;  1OGW A;  2EMS A;  4TQ1 A;  1Y56 A;  1YJJ A;  1UGM A;  4GN1 A;  4KSL C;  4JX1 C;  3B1L X;  4DWF A;  1SE4 A;  2K25 A;  1V1O A;  1DGJ A;  2L3Z A;  4JLC A;  3PRZ A;  4BOS C;  3CWI A;  3WAN A;  2OJR A;  2K6Q A;  1UNS A;  4GB9 A;  2CJO A;  2WXP A;  2ACZ B;  4BOZ B;  4YTP B;  2UWQ A;  3ZO5 B;  3SFE B;  4RCO A;  2IND C;  2GLS A;  2JSV X;  3KLS X;  3NRZ A;  2QDF A;  1SE9 A;  2HJ8 A;  2FID A;  2WX0 A;  3RNC C;  1PGA A;  2WHI A;  4A55 A;  3UQA A;  3DHH C;  1FXA A;  3ZTC A;  4LDT D;  3V6C B;  2WXM A;  3FIL B;  1TKY A;  4G50 A;  1TY0 A;  3HM3 A;  2Q5W D;  3NVV A;  1P98 A;  4II3 B;  4NPN A;  1KLG D;  1WE7 A;  4WIP A;  1WXM A;  2QCZ A;  1WJ4 A;  1D6E C;  3MFG A;  4IWP A;  3SR6 A;  2Y5C A;  4MM3 B;  1XLP A;  2DZJ A;  4O1N A;  1RFK A;  4HVB A;  2BWE S;  1C4P A;  1L5P A;  2AWT A;  1D5Z C;  2ZW0 A;  4K81 A;  2KWV B;  3K9P B;  1JRP A;  3RNA C;  2GOW A;  3SFD B;  3ZIM A;  4ANV A;  3JSV B;  1YQB A;  1UH6 A;  3PVL A;  4HRS A;  2DAF A;  2DYM A;  2JZ3 B;  4M0W A;  3TIX A;  4ICU A;  4FJZ A;  2LRW A;  3BVZ A;  3N1Z C;  5BYR A;  4A9A A;  2CU1 A;  5IN7 A;  3RUI B;  4YTM B;  1HEZ E;  1WGG A;  2GRI A;  2FBW B;  2FUH B;  4TV3 A;  5D3I B;  3VH4 B;  1V1P B;  3FAH A;  4K3C A;  4KX6 B;  2J0J A;  3MJW A;  4MGY E;  3D32 A;  3QCA A;  1WIA A;  1GB1 A;  3SHQ A;  3VRB B;  3WCQ A;  3N3K B;  2K1F A;  1NVI D;  2N7E A;  2I2Y A;  4IWO A;  2JXT A;  2KVR A;  2PTL A;  2M17 A;  3DBR I;  2XBB C;  2KDE B;  2QHO A;  4BBN C;  2WX1 A;  3DCG A;  2I1J A;  1YQ3 B;  3TEW A;  1K51 A;  1Q1O A;  2BYF A;  2Y5P A;  4HLE A;  1R7S A;  2L7R A;  3H7S A;  2HJ1 A;  4ZOH C;  3H8H A;  1WSP A;  3FIL A;  2DYO A;  3OJ4 B;  2WXK A;  1FEH A;  1ZXH A;  1D3Z A;  3MHZ A;  4NNJ B;  1V86 A;  4A8X C;  1V8C A;  3VVW B;  3WA0 A;  4K7U A;  3M3J A;  4PYZ A;  2YLM A;  1V2Y A;  2LJ5 A;  1IPG A;  1CJE A;  2L05 A;  1GC6 A;  2EEL A;  4W9H A;  2INC C;  2Z59 B;  3W5V B;  3AEA B;  4MM3 A;  3ZKJ C;  1WRI A;  1TZ1 A;  4I6P A;  4N59 A;  3HRD D;  4IDI A;  4JPS A;  3NS1 A;  3DHG C;  2KMC A;  3NVW A;  3LXF A;  2K22 A;  3QJZ A;  3P1M A;  4WWP A;  2KFJ A;  1OEY A;  4XC2 A;  3JSV A;  3OWE B;  3IHP C;  2WXR A;  1TS2 A;  3BK1 A;  3ZXR A;  3V61 A;  3ZQ4 A;  4F7Z A;  1RYJ A;  3AEG B;  1MI0 A;  1JWS D;  4D2K A;  2KZR A;  3QAQ A;  5AZF A;  1SJE D;  1F77 A;  4ZRP A;  1GNU A;  2SEB D;  5H92 C;  1V1P A;  2ZVN A;  4HPL B;  2NCN A;  2O2V B;  3DBL I;  2BWF A;  3QHT A;  2RPV A;  4EEW A;  1ESF A;  2ZJD A;  2A4Z A;  1TJE A;  2KAJ A;  1B1Z A;  3U30 A;  1SF0 A;  3ABV B;  3AEE B;  1HQR D;  4G0N B;  3UIO B;  3ZTD A;  3ZGZ A;  1XXG A;  3BY4 B;  2FCQ A;  4FN2 A;  4C4V A;  3R8B A;  2WXN A;  3PO0 A;  2BBC A;  1MHX A;  2JYT A;  1ZW7 A;  2G3Q B;  1XEE A;  1NYR A;  1OQR A;  2MBQ A;  1LO5 D;  1L6V A;  4FHK A;  4DHZ B;  1CMX B;  4WWO A;  5TR5 A;  4W9F A;  2UYZ B;  2DZK A;  4W9G A;  3OJ3 A;  5MPO A;  3N1X C;  1FO4 A;  2K9X A;  4WJP A;  1XO3 A;  2ZPY A;  2BS2 B;  4MEL A;  1TKE A;  2J53 A;  2XN9 C;  4LLG M;  3SDL C;  3JW0 X;  3VHT C;  3NZ3 A;  4C80 A;  1Y8R C;  1V80 A;  3B0A A;  1WE6 A;  2GI9 A;  1NEK B;  2E3T A;  1ZXI A;  4AJY B;  2IGG A;  1UBI A;  1FXT B;  2MRP A;  3APD A;  3EFC A;  3KWV A;  2MP2 B;  2DHZ A;  3NVY A;  2PLP A;  2PW9 A;  1RFA A;  2JY6 A;  4MJS B;  4W9L A;  5TSS A;  3HM6 X;  2RGF A;  1QOF A;  2MA9 B;  5JHA A;  2KDI A;  2O2V A;  4N9F 4;  3DVN U;  1TS3 A;  3PZD A;  4RF0 A;  1KOT A;  1MHH E;  4DXA B;  3Q8B A;  3TJP A;  3W1S C;  3V3X A;  1F2R C;  4WJQ A;  1M4V A;  1BXT A;  1TS4 A;  2KFK B;  1L0Y B;  4MSM B;  1KTK A;  3RZW C;  1EWC A;  2KC2 A;  3NZU A;  2KWC A;  4FA6 A;  4CHK A;  1EM7 A;  3ZNZ B;  1EUV B;  2CS4 A;  4HDO A;  2MLB A;  3AE7 B;  1TZO A;  2LRU A;  3DBH B;  1N6Z A;  3BIN A;  1GG3 A;  4RFB A;  2QIE B;  2L32 A;  2D2Q A;  4PK1 A;  1L6U A;  3VTV A;  1WXA A;  1JQ4 A;  1M94 A;  3ZNI D;  2LZ6 A;  1YJI A;  3ZDM C;  4HRO A;  1PQS A;  2N1V A;  5AUI A;  1SGH A;  3DOW A;  3MTN B;  1HA5 A;  4AS1 A;  3RN9 C;  2LVQ A;  1E9M A;  3C19 A;  4KIK B;  1ZGU B;  1C4C A;  3PLV A;  2J0K A;  4HKQ A;  3H7P B;  4JL9 A;  4EE2 A;  4DDG D;  4XWT A;  3IFW B;  1Q5W B;  1QZE A;  2WLB A;  1WM3 A;  3P2B A;  2VZK D;  1WX8 A;  1R4N B;  1C3T A;  1Q10 A;  1WFY A;  4XZ4 A;  5FR3 A;  2J42 A;  5HI1 A;  3RT3 B;  3RFZ B;  5G5H A;  1E8Z A;  3PHW B;  3QK0 A;  2VH1 A;  4FHJ A;  2RD0 A;  2K3U A;  1YD8 U;  4FLH A;  2BYE A;  4CYE A;  3NOB A;  1E90 A;  2C5L C;  3UI3 A;  1F0Z A;  3DVG Y;  2OHF A;  4IOI E;  3C8Y A;  3HHM A;  2N7D A;  2J7Q B;  5LLI A;  2GMI C;  3ONS A;  4DDI D;  2BB6 A;  3S2A A;  3L10 B;  3WAO A;  2KFK A;  2KDB A;  1E7U A;  1EU3 A;  3NHE B;  4UDU C;  1L0X B;  2WXJ A;  2JF5 A;  3RUL A;  2QC8 A;  5FK9 C;  1I42 A;  3P4S B;  3PRE A;  3I63 C;  5EE0 A;  3QWZ B;  2LWP A;  2BQQ A;  3R7Q A;  2JU6 X;  3AE4 B;  1SSN A;  3TEX A;  3OG5 A;  1I4P A;  3A9J A;  4NY0 A;  1GJZ A;  1VZ8 A;  2LGX A;  3RNF C;  3GB1 A;  2MH7 A;  2O6V B;  2C7H A;  2K6D B;  2BYV E;  4J3O D;  4TKN A;  1ZDV A;  2NBU A;  3U52 E;  2LHD A;  4KIK A;  2MJE A;  1IUE A;  3ZDT A;  2IO3 B;  3AE9 B;  4FXC A;  1EO6 A;  1HTQ A;  3BII D;  1PYW D;  5BYS A;  4N58 A;  1L2N A;  5L83 A;  4X57 B;  4LNO A;  4DQO C;  4YSX B;  4B0E A;  1JRO A;  4I6L B;  1YJ1 A;  3TBL D;  3TUO A;  3Q3O C;  4MEM A;  4W9I A;  4HXD A;  4ZRI A;  2Y3A A;  4JWS C;  1SJH D;  4NAM A;  1WJ6 A;  1KRH A;  1TIF A;  1KH0 A;  2KMM A;  3AN1 A;  3PZ7 A;  2PEA A;  4YL8 A;  4A90 A;  3KUZ A;  1VZ7 A;  1YN4 A;  1IBX A;  2FNJ B;  2JVC A;  1MG4 A;  4OVZ A;  2UU7 A;  2NTT A;  1XLN A;  5HHD G;  1K53 A;  4W9D A;  3VR8 B;  2ONQ A;  2KOX A;  2RDH A;  2W3S A;  3PS6 A;  3W2D A;  4KV2 A;  2IBI B;  2J0M A;  1JRU A;  1WRD B;  5BYQ A;  1N62 A;  2WU2 B;  1QOB A;  1OTR B;  1WGR A;  4WJO A;  2PPH A;  4DHJ B;  1S3S G;  2K0P A;  5H8Y E;  4AQ7 A;  2W82 A;  4W9J A;  4EZL A;  4GDK B;  4RGM A;  3FC4 A;  1WMH A;  3T8M A;  2DLB A;  4ANX A;  3ZRF A;  4BVU C;  2JYE A;  1P9D U;  1QQR A;  4B95 A;  2LAS A;  1JAL A;  1E6E B;  2O6V A;  1FIQ A;  3I5J C;  4K7W A;  4EZK A;  4YSZ B;  1WY8 A;  4PS7 A;  2PVG C;  4HCN B;  2IO0 B;  2DX5 B;  3KH0 A;  2H89 B;  2MQJ A;  5EDS A;  1MFW A;  4GLS C;  4GDL B;  2KNB A;  3TCA A;  2WXO A;  1A70 A;  2V3P A;  2V0G A;  2NBW B;  2KVZ A;  1TGZ B;  1J0G A;  1I7H A;  1N61 A;  3PT2 B;  3AE5 B;  2LGS A;  1I4H A;  1TT5 B;  3AU4 A;  2JWZ A;  1S1Q B;  4B0M A;  1AWD A;  4RGO S;  4WAA A;  5EE3 A;  4RMA A;  1WXQ A;  1AAR A;  1I4X A;  5BMI A;  1VJK A;  2GB1 A;  4M00 A;  3AE8 B;  1XQQ A;  2W54 A;  2C7M B;  2JZZ A;  3AE1 B;  1WI0 A;  3VAW A;  2LGD A;  2M1M A;  3EGR A;  1T0S C;  3NUH B;  1XLO A;  2KTR B;  4RGN A;  3JYU A;  3CMM B;  3MP9 A;  4URK A;  3QC8 B;  3DBH I;  2QJL A;  2C7N B;  3SD5 A;  1J7B A;  1WYW B;  2WDQ B;  4WUR A;  4W9K A;  3IAS 1;  4DBG A;  1WJN A;  2R61 A;  4WQO B;  2NMQ A;  2IGD A;  1PUT A;  2MX2 A;  1ISN A;  2WXG A;  2NTS A;  3EEC A;  1T0R C;  4FBJ B;  3W1Y A;  2GBK A;  2G45 B;  2M19 A;  3L17 A;  4B9K A;  1KLV A;  3PRP B;  2CHZ A;  3Q14 C;  1ET6 A;  4GDK A;  1UEL A;  3NJT A;  5AUK A;  1T0Y A;  1T3Q A;  2A5U A;  2V3N A;  3DPD A;  1ZUD 2;  3SU8 X;  1ZP0 B;  4OZA A;  1R4N I;  4C4V B;  4LTU A;  4BKS A;  2BYT A;  4LNK A;  1X1M A;  1B9R A;  3ZJT A;  4LK0 M;  2KTF A;  3BYY B;  4KGT A;  2Y5B B;  2N9E B;  3Q3J A;  2RSU A;  2TSS A;  4IC7 B;  4GDL A;  2N9P C;  3R7R A;  1V97 A;  3Q8A A;  2LUM A;  2H88 B;  3ML8 A;  3TSS A;  3PSE B;  3QIJ A;  2I1K A;  5E6P A;  4A3P A;  4NJ6 A;  2FAZ A;  2LEK A;  1QIL A;  2BB5 A;  2BKF A;  2ON8 A;  1SBB B;  1ZDX A;  3RMK C;  2LMC A;  3NZS A;  4LCD E;  2PVO D;  1E8W A;  1XF5 L;  5CHV C;  4ZRK A;  1HE8 A;  4ZYS A;  3V05 A;  2KTR A;  2YEP B;  4NZL B;  4ARI A;  1C79 A;  3W9C B;  3DVN V;  3H1U A;  1SB3 C;  4XX5 A;  3JVZ X;  2J4X A;  4C7Y A;  4KGS A;  5D3D A;  1Q0W B;  5LNK 1;  3LDZ E;  4IUM B;  2HDE A;  4ZDV A;  2HD5 B;  4AJW A;  2QSD A;  3J9C A;  2PE6 B;  3M95 A;  2BS3 B;  2M4N A;  4RF1 A;  4YSY B;  1D4B A;  4LDT B;  4EZJ A;  2WDT B;  1Z2M A;  3MHS D;  1FMA D;  2MSE D;  4LNF A;  5DPS A;  1I4R A;  1FNU A;  3IVF A;  3Q2A C;  1N63 A;  1IGC A;  5I4D A;  2KQS A;  4US8 A;  3VDZ A;  4EKU A;  1ROE A;  3VFK A;  3EHV A;  5J17 A;  4E3C A;  3RCZ A;  3Q69 A;  5E6N A;  3GS2 A;  1STE A;  3IXS A;  1SXT A;  4TMA B;  1UGJ A;  2FCS A;  1JML A;  5J18 A;  2BF8 B;  1F1H A;  3NS8 A;  2L1A A;  3VTW A;  2NPT B;  2NR2 A;  2K8B A;  3RPF C;  2D5G A;  5D2M B;  3BVM A;  3PRM B;  1GPX A;  4PS8 A;  2KQ7 A;  4GXB A;  2V4I B;  3ZNG C;  3N32 A;  1CQV A;  4MT5 A;  1D5X C;  1E5W A;  3N20 C;  3A4S C;  4E71 A;  2LJI A;  3M62 B;  1V9J A;  4IWQ A;  4ASW C;  1UUP A;  3L54 A;  4YXD B;  2IO2 B;  1KFY B;  2V9H A;  4NJ7 A;  3UGB B;  4DHZ E;  2KJR A;  3IT4 B;  5IO9 A;  4K3B A;  2MW5 A;  1JCK B;  1UZX B;  2WS3 B;  1C9F A;  2G4D B;  2BVC A;  3B2G A;  1G6J A;  4RM8 A;  1QLB B;  2LVO A; 
#chains in the Genus database with same CATH homology
 4UDU C;  1L0X B;  2WXQ A;  1PGA A;  1C4A A;  2WXJ A;  2N9K A;  4A55 A;  3AEC B;  5FK9 C;  3P4S B;  1FXA A;  2BTE A;  2WXM A;  3FIL B;  1KF6 B;  1TKY A;  1PFD A;  5EE0 A;  1PGB A;  2E6X A;  1TY0 A;  2IDY A;  2Q5W D;  2WXF A;  2JU6 X;  3NVV A;  1TY2 A;  3AE4 B;  3R2I A;  1RM6 C;  1SSN A;  1KLG D;  3E9S A;  3TEX A;  1NEN B;  4DXF A;  1WGK A;  3ZJU A;  1KLU D;  4WIP A;  5BMG A;  1I4P A;  1OFF A;  5GXG B;  3W5U B;  1VZ8 A;  1D6E C;  4TQ0 A;  2WXL A;  3MFG A;  2Z8L A;  2Y5C A;  3SR6 A;  2IJ0 A;  2HTM E;  4MM3 B;  3GB1 A;  1XLP A;  2MH7 A;  2KDM A;  3P4P B;  4O1N A;  1RFK A;  4J3O D;  1ZDV A;  3AE3 B;  1C4P A;  2BW2 A;  1FCL A;  1MVK A;  5HG2 A;  1L5P A;  3U52 E;  2LHD A;  1D5Z C;  1GAQ B;  2ZW0 A;  3VQI A;  2MJE A;  1IUE A;  1SE2 A;  1JWA D;  3AE9 B;  4TSS A;  1JRP A;  4FXC A;  3SFD B;  4YT0 B;  1SEB D;  1GOZ A;  3BII D;  4HRS A;  3HUI A;  1PYW D;  5BYS A;  1I4Q A;  4N58 A;  2DYM A;  3MJ5 A;  4M0W A;  2KWD A;  4DQO C;  4YSX B;  4B0E A;  1JRO A;  3BVZ A;  1QT9 A;  2WQY B;  5BYR A;  3TUO A;  4A9A A;  2ZW1 A;  1FCC C;  1EU4 A;  1VR9 A;  4A6Q A;  4YTM B;  3P4R B;  1HEZ E;  4N6E B;  2GRI A;  2Y3A A;  4JWS C;  2FBW B;  5D3I B;  1SJH D;  4ARC A;  1V1P B;  4NAM A;  3FAH A;  4KX6 B;  1KRH A;  3TEY A;  1KH0 A;  2W3R A;  2KMM A;  3AM9 A;  3AN1 A;  3PZ7 A;  4A90 A;  1YMH E;  1FRR A;  1QOA A;  1HZ5 A;  1VZ7 A;  1DYQ A;  1YN4 A;  1IBX A;  1DOI A;  1GB1 A;  5C3J B;  3IAM 1;  4P6V F;  4OVZ A;  4KKI A;  2NTT A;  3VRB B;  3WCQ A;  4HEA 1;  1XLN A;  1NVI D;  1YN5 A;  2I2Y A;  5HHD G;  1K53 A;  2JXT A;  2PTL A;  3W1S A;  3VR8 B;  3P63 A;  2ONQ A;  2RDH A;  2W3S A;  3EUB 2;  2G1E A;  4RGT A;  3W2D A;  2INP E;  4DXG A;  1YQ3 B;  3TEW A;  2MJD A;  1K51 A;  4C56 C;  1IBX B;  4OW0 A;  2Y5P A;  5BYQ A;  1N62 A;  2WU2 B;  1QOB A;  1R7S A;  1AN8 A;  4ZOH C;  3IT6 B;  3H8H A;  1WSP A;  3FIL A;  2DYO A;  2WNM A;  3R2T A;  2K0P A;  4AQ7 A;  5H8Y E;  2W82 A;  3KQ4 A;  1JW9 D;  1K52 A;  2WXK A;  1FEH A;  1ZXH A;  1TYG B;  3MHZ A;  4GDK B;  4RGM A;  3FC4 A;  4A8X C;  1V8C A;  2DLB A;  5G5G A;  2M56 B;  3AH7 A;  1XCT L;  1VZ6 A;  2JYE A;  4NAW B;  5HFY A;  2QEJ C;  2JZP A;  1C76 A;  4YWG G;  1QQR A;  4RH6 A;  3I9V 1;  1I4G A;  1JAL A;  1CJE A;  4IKG A;  1E6E B;  2EEL A;  3W5V B;  1NYQ A;  3AEA B;  1FIQ A;  1C77 A;  1WRI A;  1T6B X;  2AX5 A;  4YSZ B;  1P7F A;  4N59 A;  1SE3 A;  3HRD D;  4IDI A;  4JPS A;  3NS1 A;  2PVG C;  2H89 B;  3N9Y C;  3NVW A;  3LXF A;  4GLS C;  1VRA B;  2JWU A;  2K22 A;  3P1M A;  4GDL B;  5E6J A;  2WXO A;  1A70 A;  5FKA C;  2V3P A;  2V0G A;  3OWE B;  3CIR B;  5JXV A;  2WXR A;  3HVZ A;  1TS2 A;  1I7H A;  3AE6 B;  1N61 A;  3AE5 B;  2LHE A;  1I4H A;  2JQR B;  3BK1 A;  2XNA C;  1AWD A;  2I38 A;  2BT6 A;  2WXI A;  4RGO S;  3ZQ4 A;  4B0M A;  5EE3 A;  1RYJ A;  1N5W A;  1WXQ A;  2DWQ A;  3AEG B;  1MI0 A;  1MPE A;  1JWS D;  1I4X A;  5BMI A;  1VJK A;  4P16 A;  1ZPS A;  2GB1 A;  3O13 A;  4D2K A;  3AE8 B;  2W54 A;  1SJE D;  1F77 A;  4ZRP A;  2SEB D;  5H92 C;  3AE1 B;  1TKG A;  1V1P A;  3BVG A;  3T3O A;  4ITK A;  1JWB D;  3BWU D;  4R3D A;  3EGR A;  2LGI A;  2BS4 B;  3NUH B;  1XLO A;  3PZ8 A;  3U2S C;  4RGN A;  2PMV A;  2RPV A;  4ZHO A;  1VLB A;  3AB5 A;  3MP9 A;  3U7Z A;  1CK1 A;  1ESF A;  2QJL A;  1TJE A;  3L4P A;  1J7B A;  2PKO A;  1UWX A;  2WDQ B;  2KAJ A;  4WUR A;  1B1Z A;  3IAS 1;  2CU3 A;  4KKJ A;  1SF0 A;  2QMT A;  2R61 A;  3ABV B;  3AEE B;  1HQR D;  1P7E A;  2NMQ A;  2IPK D;  2IGD A;  1PUT A;  1UWM A;  3Q8F A;  3ZGZ A;  1E0Z A;  1XXG A;  1AW7 A;  2K5P A;  2WXG A;  2NTS A;  1WWT A;  3TEZ A;  3DWM A;  3R8B A;  1FRD A;  2WXN A;  3PO0 A;  2BBC A;  1AYF A;  1MHX A;  3VR9 B;  2JYT A;  2M19 A;  1DOX A;  2LFI A;  4USA A;  1XEE A;  1NYR A;  3VRA B;  1OQR A;  3GP7 A;  2WDR B;  3BYT B;  1LO5 D;  1L6V A;  1ET6 A;  2N7J A;  2AQ2 B;  3E56 A;  4MAC A;  5AUK A;  1T3Q A;  1ZOY B;  4WH4 A;  2V3N A;  1ZUD 2;  2W55 A;  4PT5 A;  5MPO A;  1FO4 A;  2K9X A;  1ZP0 B;  1YN3 A;  2SAK A;  4OZA A;  4HJG E;  1XO3 A;  4RNA A;  3ZYY X;  1FM0 D;  4LTU A;  2BS2 B;  2BYT A;  4XWW A;  1QKZ A;  1RWS A;  4XDC A;  3LYY A;  1TKE A;  1B9R A;  2J53 A;  2WDV B;  2XN9 C;  1N5X A;  4LK0 M;  4LLG M;  3BYY B;  4KGT A;  3ZJT A;  1YNT E;  4KGR A;  2AQ1 B;  1FFV A;  1HZ6 A;  4WWM A;  4Q2J A;  2TSS A;  3NZ3 A;  1ET9 A;  4L2Y A;  1VDV A;  2PIA A;  4C80 A;  3Q8E A;  1K50 A;  1V97 A;  3MC0 B;  3Q8A A;  4JE3 B;  2LUM A;  1IGD A;  2H88 B;  2GI9 A;  1NEK B;  2E3T A;  4OHJ A;  1ZXI A;  4MH8 A;  3TSS A;  4C7Z A;  2IGG A;  4NJC A;  1J7A A;  2VZK B;  2KAC A;  3LB8 C;  3KWV A;  1BUI C;  2LEK A;  1QIL A;  4OZC A;  2BB5 A;  3ETR A;  2ON8 A;  1DOY A;  1SBB B;  2M0A A;  1TS5 A;  4H2A A;  1L4Z B;  3T3N A;  1ZDX A;  1F2R I;  2LMC A;  3NVY A;  2PLP A;  2QIL A;  1ZE3 D;  2PW9 A;  1L0V B;  5EE9 A;  3AMZ A;  1BML C;  2X38 A;  2PVO D;  1XF5 L;  1PDX A;  1CZP A;  5TSS A;  4ZHP A;  4ZYS A;  3V05 A;  2KN4 A;  4WAF A;  1QOF A;  1E7P B;  5EE1 A;  3KWL A;  3P42 A;  1HXY D;  4OZB A;  3ZJV A;  1TS3 A;  2MEK A;  2YEP B;  4NZL B;  4RF0 A;  4ARI A;  1C79 A;  1MHH E;  3AE2 B;  3W9C B;  3Q8B A;  1NI3 A;  3V3X A;  1XCQ L;  1SB3 C;  3NVZ A;  2J4X A;  1F2R C;  4C7Y A;  4KGS A;  5D3D A;  2J52 A;  1M4V A;  1BXT A;  5LNK 1;  1FNW A;  1TS4 A;  2HDE A;  1L0Y B;  4REZ A;  1KTK A;  2QSD A;  3J9C A;  2EKI A;  1EWC A;  3AV8 A;  2WP9 B;  1EWY C;  2BS3 B;  4JWU C;  5BMH A;  2B76 B;  1EM7 A;  3BZD B;  4RF1 A;  4XDD A;  2JX5 A;  1ENF A;  2WU5 B;  1GB4 A;  1C78 A;  4YSY B;  1XLQ A;  4ZRQ A;  3AE7 B;  1TZO A;  5D7G A;  1D4B A;  1N60 A;  3AEB B;  4RFB A;  2QIE B;  2RMM A;  1PGX A;  2L32 A;  3B9J A;  3AED B;  1FMA D;  1L6U A;  1FNV A;  1I4R A;  1FNU A;  1JQ4 A;  2N0S B;  4US9 A;  1WYG A;  3AEF B;  3P4Q B;  3BK2 A;  1N63 A;  1IGC A;  1T5X D;  1YJI A;  2MJ3 A;  3U4E G;  5I4D A;  4HRO A;  4US8 A;  2FUG 1;  1ROE A;  1D5M C;  2AQ3 B;  4L23 A;  5AUI A;  1HA5 A;  2FE8 A;  4AS1 A;  3Q69 A;  3GS2 A;  3DWG C;  1E9M A;  2OED A;  1SIJ A;  4CQN A;  1C4C A;  1STE A;  3IXS A;  1SXT A;  4HKQ A;  1FFU A;  4TMA B;  1QF6 A;  4EE2 A;  1UGJ A;  1JWM D;  2IGH A;  1JML A;  3EA6 A;  4XWT A;  1E10 A;  1J7C A;  2L1A A;  2G9H D;  2WLB A;  2L52 A;  2ICI A;  2YEP F;  2VZK D;  3Q8C A;  3RPF C;  2D5G A;  2N9L A;  3HVD A;  3URY A;  3BVM A;  1Q10 A;  1FD6 A;  1GPX A;  1ACC A;  1OQQ A;  2DBY A;  3B2F A;  5FR3 A;  2J42 A;  5HI1 A;  3RFZ B;  2V4I B;  1L4D B;  5G5H A;  1JWU D;  1CQV A;  4MT5 A;  1D5X C;  1FXI A;  2K3U A;  2LJI A;  2KQ4 X;  2L83 A;  4L1B A;  2WXH A;  5T8I A;  1UUP A;  4TQ1 A;  1Y56 A;  4YTN B;  1YQ4 B;  5C2T B;  1YJJ A;  3UI3 A;  2CJN A;  4YXD B;  4JX1 C;  1F0Z A;  2RDG A;  3SEB A;  1SE4 A;  2OHF A;  1KFY B;  4IOI E;  1V1O A;  3C8Y A;  1DGJ A;  2INN E;  3CWI A;  1UNS A;  3IT4 B;  4WQM A;  2CJO A;  4HKZ E;  2WXP A;  2ACZ B;  1JCK B;  2WS3 B;  4XE0 A;  4YTP B;  1C9F A;  3SFE B;  4RCO A;  2BB6 A;  3B2G A;  2JSV X;  3KLS X;  3NRZ A;  1QLB B;  3I57 A;  1EU3 A;  1QOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...