2IYDB

Senp1 covalent complex with sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Senp1 Native Structure
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iydB00
3U8ZA 4BKSA 5C1ZA 1T0YA 1V80A 2EMTA 1WGYA 2OOBB 4DDGD 2R2QA 1XQQA 2GMIC 3WA0A 1X1MA 3QA8A 4G11A 1V86A 1WJNA 2KANA 3ENEA 3V61A 4AP4C 1IPGA 2MA9B 2GBMA 4DXAB 5LXHA 2KTFA 3PHXB 1WX9A 3DCGA 2J0KA 4ASWC 5DPWA 4ANXA 4GDKA 1Z5SB 3Q3FA 3VQIA 3NHEB 2N4FA 3L17A 3RD2A 5AEKB 3ZUNA 2DZMA 2FIFA 2DAFA 2KQ7A 2MW5A 3APFA 4AJWA 2KLGA 1QZEA 2J7QB 1WRDB 3T8MA 1EUVB 1MG8A 4GOCA 1AARA 1OEYA 2AYOB 3DOWA 4IWQA 3VAWA 2UWQA 2L8JA 1E8WA 1WGHA 1C3TA 2KFKA 5D94A 2MBBB 3DBHI 2KO3A 2BF8B 3UQAA 2KWVB 4E3CA 3EFUA 4E74A 3CF6E 3DPDA 2BYEA 3VFKA 1GC6A 4GMVA 4GN1A 3RULA 1L2NA 4FN2A 3LDZE 4JL9A 2KJ6A 2KQSA 4IWOA 3VH4B 1KM7A 3X23A 4DK5A 1L7YA 2PEAA 1RRBA 3QX1A 5C23A 2KVRA 4HDQA 2KNBA 1LM8B 4MSQB 1WGGA 1EF1A 2KFJA 2KTRB 1Z2MA 3ZW3A 1OEYJ 1P9DU 2MCNB 2L05A 3K9PB 4IG7B 3UIPB 5CX3A 3EECA 3PPAA 2REXA 3VTUA 4XX5A 1NBFC 3L54A 2D3GA 4FBJB 3BINA 2ZNVB 2J0JA 3A1QB 2FNJB 2KHWB 3A9KA 3H1UA 2FIDA 4P7IA 4A3OA 2K6DB 1UH6A 2KMCA 1UGMA 2JVCA 4IW0A 2EKEC 2GBJA 4F8CB 5L83A 5CHVC 4A3PA 2LD9A 5LLIA 4IM2A 3UQBA 2M8SA 2ZZPB 1YIWA 4F7ZA 2VRRB 2LJ5A 2DYMA 4EKUA 4K81A 5FR6A 4ICVA 4BFRA 5JZEB 1UBQA 2LZ6A 3QHTA 2JF5A 1I35A 2C7HA 3JW0X 3M62B 2CKHB 4HCPB 2MWSB 4KVGB 1XT9B 2BKRB 4NQKE 1SE9A 2MBQA 4II3B 3TJPA 2V4LA 3KUCB 3WANA 4CYEA 1WXAA 4IM0A 4G3XB 4GDLB 2D2QA 3A33B 3OJ3A 2J0MA 5J2RA 2KKCA 3VDZA 4BOSC 2IO0B 1RLFA 2IO3B 3EHVA 5HKHA 2O6VB 2Z0DB 4ANVA 2CR5A 3W1SC 3H7PB 4J6IA 3IFWB 4DBGA 4WWOA 2XK5A 3A9JA 1Q1OA 3PHWB 4RM8A 1UELA 2JT4B 3AULA 2NPTB 4YL8A 2KMAA 4WJQA 3AU4A 4B9KA 3DBLI 2L0FA 3IG3A 2G45B 3P2BA 4NAWA 3ZLZA 3ONSA 5GMVA 3ZRFA 1V6EA 2G3QB 2MQJA 1TGZB 1WR6E 2M4NA 2QHOA 1E8YA 1TBEA 1V9JA 1IYFA 2LVPA 4B6WA 4MGYE 1V5OA 3JSVB 4WJNA 4HWIB 2UYZB 1WMHB 4BKGA 4GB9A 2KDFB 4MGKE 1RFAA 4FJYA 2FCSA 1G6JA 2C5LC 2BYVE 3C0RB 4NNJB 3DVNV 3HM3A 3L10B 3L16A 4FULA 1WF9A 1K8RB 2G4SA 1SIFA 5L95C 3ECIA 3LJ3A 4W9IA 2C9WB 2KDIA 1C1YB 2N7EA 2A5UA 2BGFA 4ICUA 4W9LA 5DCNA 1WR1A 4I6PA 4KSLC 2JPHA 3PREA 3M3JA 4B95A 1P0RA 1NI2A 2IZVB 1WJUA 2FAZA 3VUWA 2RPQA 4EEWA 1UZXB 1GUAB 2PPHA 2IO2B 2RD0A 3T9LA 4AUQC 4WWNA 1PQSA 2CS4A 3QC8B 2KDEB 3DBSA 5JH5C 4RM9A 3H9DA 3DVNU 2D10A 2DYBA 3ALBA 2KDBA 2KFKB 3R7QA 3R3MA 4MGZE 2BPSA 3PVLA 3W1SA 3ML8A 1WXVA 1S3SG 1WX8A 2ZNVC 3VTVA 3ZKJC 1WJ4A 4ANUA 4HDOA 3ZVVA 2CHZA 2KX0A 2JXXA 2LGDA 3EC8A 5CHWA 3QK0A 4ZDVA 5DPRA 2D07B 3RUIB 3SHQA 3JYUA 2WDTB 5IAAC 2FUHB 3X0WA 3PZDA 4JIOU 3V6CB 1H4RA 1YD8U 3B1LX 1WH3A 3RT3B 4HLEA 2LXCA 3ZO5B 2N9XA 3ZIMA 2HE7A 3HHMA 4WAAA 2GOWA 2OJRA 1ISNA 2HTHA 3NZUA 4OVUA 3RCZA 3KH0A 2IY0B 2JUOA 2KWUB 2KLCA 2RSUA 3VVWB 3KYCD 2IBIB 2IY1B 2L00B 4HVBA 4A20A 3MHSD 4NY0A 3GZNI 4URKA 1LQBA 4F1SA 1Y8RC 2DENB 3A9KB 2NR2A 2V1YA 3UGBB 2ZJDA 5KHQA 1V49A 4I6LB 1I42A 1E90A 3O65B 1WYWB 5AZFA 3PS6A 2DX5B 2K6QA 3PTFC 2AL3A 2GBRA 2MP2A 4FLHA 1CMXB 4EZLA 2WX1A 3QIJA 2PE9A 2EMSA 4KV2A 3DVGX 4PS8A 4TKNA 4TQ0A 1HE8A 1ZGUB 3CSTA 5D7GA 2NBUA 3BY4B 1YX5B 4PYZA 2RR9A 3DDCB 3VXWA 5DPSA 2KTRA 3NZSA 1E8XA 3L13A 5AZGA 1KOTA 1V2YA 4BKSD 3R7RA 2M0XA 1OGWA 2A4ZA 2N1VA 4FHKA 3QCAA 4W9FA 3PV1A 4NJ6A 2MBOA 1LXDA 4MSMB 2IYDB 2FCQA 2XK5B 4LJPB 2KN5A 1WM3A 3A9JB 3MTNB 3QJZA 4G0NB 4TV3A 3UIOB 3N32A 3VUYA 3AU5A 2LI5A 2YLMA 3K9OB 4MJSA 3ZNGC 4E71A 1D3ZA 3PRMB 2LUEA 3HK0A 4IC7B 1JRUA 4NAWB 3CMMB 3ZTDA 3PGEA 4CO7A 4PS3A 3S2AA 2NS5A 1OQYA 2D11A 4KZCA 2LRUA 2DHZA 4MELA 1EF5A 1UBIA 2CU1A 2BYFA 2KWCA 2NBVB 4HK2A 2JWZA 4HPMB 5BO4B 3VTWA 1R4NI 4M0WB 2I1JA 2LGXA 2NCNA 4MM3A 3U30A 2ASQA 2O2VA 3ZNZB 2LRWA 2PE6B 2RGFA 4NPNA 3ZNHB 4DHJB 1WE7A 4FADA 2JRHA 2KX3A 2LGYA 2L76A 3SDLC 4HXDA 2K1FA 2KJRA 4GXBA 4WQOB 1Q5WB 2XEWA 1VCBA 2KK8A 4N9F4 3OJ4B 3NOBA 1WM2A 2ZPNA 3QAQA 2ZVOA 4AOFA 4JGHB 3WAOA 2MSED 4K1RB 4KSKC 1WJ6A 4W9KA 5CTRC 1WGRA 1YX6B 2N9EB 4IM3A 2K8CA 3DBRI 3JVZX 4FHJA 2KXJA 4OVVA 1A5RA 3WAPA 3PRZA 3PT2B 2GBKA 3TBLD 2V3SA 2LVQA 4GDKB 4WJOA 4AJYB 1BT0A 2BWES 2L0TA 3WIMA 5E6NA 4AWJA 1P3QU 2DZJA 1OTRB 2ZEQA 4KIKA 2MLBA 1J8CA 2IO1B 3N30A 3SU8X 4KDIC 3KUZA 1S1QB 2K8HA 2WYQA 3U7DA 3V6EB 3TMPB 4MEMA 4MH0E 4PS7A 1WY8A 2N9PC 5D6JB 1GG3A 5J18A 4DHZB 4G50A 4EZJA 5EDSA 2WX0A 4BVUC 2MBEA 2XBBC 3KW5B 5E6PA 1M94A 2ZCCA 3OAWA 4FJZA 4X57B 3L08A 4GU2A 1E8ZA 3HIZA 2NVUI 5JHAA 2L7RA 3AI5A 3H6NA 3WAMA 3CSFA 1WXSA 2K39A 3QWZB 5TR5A 4DWFA 4FA6A 3WALA 4EOYA 1WZ3A 1GJZA 2JRIB 4TQ1A 3QARA 3Q3JA 4K7UA 3VUXA 3IVFA 3M63B 1WE6A 2KD0A 3L0WB 3N3KB 2K8BA 1WXMA 2O6VD 4IWPA 2K25A 4BBNF 4FJVB 2MRPA 4K7SA 2DYOA 1KJTA 1UD7A 3PSEB 2PJHA 3A4SC 3UF8A 2C60A 2MP2B 4LDTB 3D32A 3R66C 4W9DA 3H7SA 3APCA 3MJWA 2YVCA 4II2B 1VD2A 3RYTA 4XC2A 3APDA 2GBNA 4W9HA 4DDID 1NDDA 4BKTA 5DPTA 1WIAA 3VHTC 3ML9A 5LXIB 3OLMD 4K7WA 2JZ3B 2Y5BB 1P98A 2LWPA 4HCNB 4EFOA 1FXTB 4JQWC 2AL6A 3B08A 4XZ4A 4ANWA 1ZKHA 4DHJD 2Z0EB 3B0AA 4WJPA 1IP9A 2W9NA 4GGQA 3TCAA 4EUTA 2WWZA 1GNUA 2G4DB 2NBWB 3V62A 4W9JA 2CHXA 2KC2A 3DVGY 3AXCA 2KC1A 1Q0WB 3HM6X 3PLUA 4MDKE 3ZRCA 3A1QA 4MJSB 4DHZE 4TUUA 2LASA 1EO6A 1RAXA 3W1YA 4KZ0A 4ZRKA 2DZIA 3VH3B 3KVFB 3SD5A 2AWTA 2CHWA 3KUDB 4ZRJA 1J19A 1R4MI 4GSWA 3PLVA 3TL5A 4EZKA 1TTNA 4ZRIA 4WWPA 3M95A 1KLVA 1H8CA 4JLCA 2C7NB 2ZCBA 3ZTCA 3NS8A 2O2VB 4PYUA 2L3ZA 1V5TA 2DAJA 4BOZB 3UINB 3TIXA 2N1WA 5KHOA 4W9CA 4M8NA 2HJ8A 1WZ0A 4GDLA 2BWFA 4ZYNA 4NQLB 5D2MB 4MGIE 2BKFA 2JY6A 5AZHA 2O6VA 3QQ8B 3DQVA 3KYDD 1E7VA 2N7DA 4W9EA 2ZPYA 3A4RA 2MX2A 3H7PA 5G55A 4HJKA 5CHFA 3NY5A 1J0GA 1P1AA 2DZKA 3PRPB 4GIVA 1LFDA 2I1KA 2JZZA 2NPTA 2R2OA 4HPLB 2ZVNA 4BBNC 1XD3B 5J17A 4I6NB 3RZWC 2B3AA 4M8MA 1V81A 3GOEA 4LCDE 4IUMB 1WGDA 2M17A 2MBHA 3V60A 4LJOB 2LXAA 4KIKB 5E6OA 4NJ7A 3RZFA 2KZRA 1GC7A 4W9GA 2C7MB 4CHKA 1E5WA 1E7UA 2KJHB 2LVOA 1U4AA 1WX7A 3I3TB 3ZDMC 3ZDTA 3IHPC 4KDLB 1YJ1A 1YQBA 1WI0A 5IA7A 1F9JA 1TZ1A 4RMAA 5G2NA 2FCNA 3JSVA 4LDTD 2FCMA 1WMHA 3ZNID 5JHBA 2Z59B 1SGHA 1WFYA 2M1MA 2KOXA 3IBEA 2AEHA 2HD5B 1ZW7A
chains in the Genus database with same CATH superfamily
3U8ZA 5C1ZA 3N1ZC 1V80A 3W5UB 2EMTA 2RDBC 3NZ3A 1Q10A 4DXFA 1JWSD 4G11A 3ENEA 4AP4C 1JWMD 2KTFA 2SEBD 1QT9A 5MPOA 3RMKC 2J0KA 5DPWA 3AM9A 3UI3A 3NHEB 2DZMA 2FIFA 2KQ7A 3APFA 2NMQA 3MC8A 1EUVB 1MG8A 2UWQA 3P4SB 3OG5A 1WGHA 5LNK1 3DBHI 2MJEA 1KLUD 2BF8B 4HROA 3UQAA 4E3CA 3EFUA 1M4VA 1B9RA 3Q3NC 2SAKA 4FN2A 1HZ6A 4DK5A 3AE8B 3QX1A 5C23A 4C7ZA 2KNBA 1LM8B 4MSQB 1EF1A 1YMHE 1OEYJ 1P9DU 3K9PB 2WU5B 2KN4A 1EM7A 3MC0B 3Q69A 4XX5A 3IAS1 1OQRA 3L54A 2MHJA 3BINA 5H8YE 4P7IA 2HTME 2QSDA 2V4IB 1NYRA 2IJ0A 3N20C 3IAM1 4ICVA 2C7HA 2CKHB 4D2KA 4RH6A 4NQKE 4P1BC 4TMAB 3WANA 5J2RA 4G3XB 3VDZA 4BOSC 2X8XX 4ANVA 3W1SC 1GPXA 3T3NA 4DBGA 4WWOA 2KMAA 4RGOS 2JYEA 1FIQA 2L0FA 4WWMA 1T3QA 3ZLZA 3ONSA 5GMVA 3ZRFA 3DHHC 4LNIA 1PGBA 3N9YC 2X38A 2M4NA 1IGCA 1IYFA 2N9LA 4B6WA 2WDVB 2UYZB 4MGKE 4XYCA 3C0RB 4C7YA 2MH7A 4JWUC 2KDIA 5DCNA 1TS4A 4B95A 1P0RA 3ZXRA 3VUWA 4J3OD 4EEWA 2WU2B 2J53A 2DYBA 3ALBA 3ABVB 1GAQB 1STEA 1D5ZC 3W1SA 1WXVA 1S3SG 4L23A 1WJ4A 3RNBC 4KX6B 4ANUA 2CHZA 3EC8A 1T5XD 1YN4A 2D07B 4M00A 3Q3MC 3W2DA 4HKQA 1ZP0B 3FILB 3B1LX 1WH3A 2HE7A 3HHMA 2KLCA 3VVWB 1JWBD 2L00B 4HVBA 4A20A 3MHSD 2B76B 3J9CA 3U7ZA 4URKA 3DBLB 3U52E 1L6VA 3MHZA 3UGBB 3BVMA 1V49A 3ZJTA 4S17A 3DHIC 4EZLA 2PKOA 2PE9A 4P1CC 2IGDA 4KV2A 3TUOA 3ZXVA 4XGAB 3VRAB 4PYZA 3VXWA 2WHIA 2LFIA 1V2YA 4BKSD 3R7RA 2M0XA 2A4ZA 1YQ3B 2WGSA 4NJ6A 1IBXA 3N32A 4ITKA 1FRRA 5EE0A 2KAJA 3EGRA 1D3ZA 3HK0A 3CMMB 5IOIA 4PS3A 4KZCA 4MELA 1EF5A 2KWCA 3VTWA 2LGXA 2NCNA 4MM3A 2Z8LA 3AE4B 1SF0A 2XN9C 1CQVA 2RGFA 1WE7A 4FADA 2KJRA 1TS3A 4HPPA 2YEPB 3NOBA 3BVZA 1P7FA 1VLBA 2ZVOA 4K1RB 5CTRC 1MJDA 4IM3A 2K8CA 3DBRI 3JVZX 3BVGA 3PRZA 1ZXIA 2CJNA 4WJOA 2AQ1B 4AJYB 1TIFA 2ZEQA 4KIKA 1J8CA 3N30A 2OEDA 4MH0E 3AE9B 3AEAB 1D5MC 3KW5B 2LJIA 2RPVA 2K9XA 1SSNA 4YWGG 3CSFA 2NTSA 4FA6A 1TY0A 1GJZA 2JRIB 3VUXA 3M63B 3N3KB 1P7EA 1WXMA 2K25A 1BUIC 1KJTA 1UD7A 3AB5A 4LDTB 3AE5B 1E7PB 3MJWA 4L2YA 1XO3A 3RYTA 3APDA 2GBNA 1ZDVA 1MFWA 4KGSA 3MFGA 3OLMD 1CJEA 2LWPA 1FXTB 4JQWC 2AL6A 4XZ4A 5IN7A 2KQ4X 3EFCA 4ANWA 2RDHA 4JE3B 3B0AA 5C3JB 2W9NA 4GGQA 3E56A 3V62A 3W9CB 2CU3A 2WDRB 3HM6X 2KC1A 1Q0WB 3U2SC 3ZRCA 4MJSB 4DHZE 1TYGB 4TUUA 1SE2A 4KZ0A 2DZIA 2K5PA 4ZRJA 4B0EA 1C4CA 1R4MI 3NVYA 3PLVA 1TTNA 1KLVA 2INNE 2O2VB 1VZ7A 2L3ZA 1UWMA 5C2TB 1XLNA 4M8NA 2BS2B 4LTUA 4YTNB 2JYTA 3DQVA 2G1EA 2JWUA 3NY5A 1J0GA 4OHJA 2DZKA 3PRPB 2NTTA 1LFDA 2I1KA 2ZVNA 1XD3B 4I6NB 1XF5L 3GOEA 2M17A 1WRIA 2MBHA 1TY2A 3V60A 1C76A 1MPEA 4O1NA 3SFDB 3RZFA 2PVGC 4W9GA 2C7MB 2YEPF 2KJHB 3ZDMC 1T0SC 1GOZA 5G2NA 2BQQA 2FCNA 3RPFC 2AEHA 1SXTA 4WURA 2BW2A 4PT5A 1WGYA 1XQQA 2GMIC 3WA0A 1X1MA 3QA8A 1WJNA 2KANA 4MACA 2GBMA 3I9V1 2N4FA 3ZUNA 2MW5A 2HJ1A 4GOCA 1K52A 2D3CA 4IWQA 1SJED 4HJGE 2QC8A 1MVKA 3VAWA 4JPSA 5D94A 3NJTA 4MT5A 3DPDA 2VZKD 2WLBA 4GN1A 3RULA 4JL9A 1NENB 3FILA 3VH4B 1L7YA 1QOBA 2PEAA 1ET6A 2W3SA 2WS3B 3DWMA 5AUIA 4US8A 1R7SA 4RCOA 3ZW3A 3UIPB 2L05A 5CX3A 3EECA 3DHGC 2REXA 3RN9C 2LUMA 5JXVA 2FBWB 2J0JA 2KHWB 3H1UA 2FIDA 4A3OA 2OHFA 2KMCA 1UGMA 5L83A 2GBJA 5IKCM 4IM2A 2IGHA 2PW9A 1JRPA 4BZAA 1YIWA 2GLSA 2I38A 1VR9A 3W5VB 1ZXHA 4EKUA 4K81A 3FAHA 4BFRA 1UBQA 1I35A 3JW0X 2MWSB 1XT9B 1K50A 2MBQA 4KKJA 2L83A 3KUCB 3AE3B 2QDFA 4CYEA 4MM3B 3A33B 3P4QB 2IO0B 1WXQA 5HKHA 2Z0DB 2W82A 2KT7A 4J6IA 1TKEA 1HXYD 4RM8A 1UELA 2V9HA 2NPTB 2N0SB 2LHEA 1EU3A 2Y3AA 4B9KA 2WXKA 3DBLI 3P2BA 2L1AA 1V6EA 1UNSA 2MQJA 1JMLA 3GE3C 1WR6E 1V9JA 1AW7A 1BXTA 1V5OA 4GB9A 3PO0A 1SJHD 1NYQA 2WXGA 1RFAA 3DVNV 3HM3A 1MG4A 4N58A 3AE2B 4BAXA 2N7EA 2A5UA 4ICUA 2JPHA 1JROA 2IZVB 1WJUA 2RPQA 4WQMA 3IXSA 2IO2B 1C77A 1PQSA 2KDEB 3DBSA 1UGJA 3H9DA 2D10A 2TSSA 2KFKB 3R7QA 4WIPA 3PVLA 5IO9A 3VTVA 2JXXA 3QK0A 4ZDVA 5DPRA 3SHQA 4KGRA 2FUG1 3R2IA 3X0WA 3PZDA 1AYFA 4JIOU 1T0RC 3RT3B 2JQRB 2N9XA 4WAAA 2GOWA 1ISNA 3RCZA 3KH0A 1FFVA 2IY0B 2RSUA 2PTLA 2IY1B 2INPE 4NY0A 1LQBA 2WQYB 1Y8RC 4C4VB 2NR2A 1YOVB 3B9JA 2ZJDA 1I42A 1A70A 3OWEB 4I6LB 5AZFA 1TZOA 4FLHA 4RF1A 1CMXB 3QIJA 2V3PA 4TKNA 1TT5B 1ZGUB 3CSTA 2NBUA 3BY4B 2RR9A 3DDCB 4TSSA 2KTRA 1KF6B 1E8XA 1KOTA 1HA5A 2IDYA 2N1VA 3QCAA 4W9FA 3PV1A 1VRAB 2LGSA 1TS5A 3A9JB 4G0NB 4TV3A 2YLMA 5BMIA 4MJSA 3RNCC 2M19A 3PRMB 2LUEA 5H92C 4NAWB 3ZTDA 1ZE3D 3TEZA 3P4PB 3KLSX 2LRUA 1ENFA 1UBIA 2CU1A 2BYFA 2J4XA 2JWZA 5BO4B 4M0WB 3U30A 2BTEA 2O2VA 1DOIA 5HFYA 3SDLC 2K1FA 2EELA 4GXBA 4WQOB 1E0ZA 3ZQ4A 5HG2A 2WXNA 1VCBA 1ZUD2 3OJ4B 2ZPNA 3I5JC 2MSED 3BK1A 1WJ6A 4XDDA 3GZNB 1N60A 1ZDXA 4OVVA 1A5RA 3PT2B 2WXHA 4OZAA 1BT0A 1I4HA 1I4XA 2BWES 2DZJA 3AEGB 2INDC 1ACCA 1I4RA 3SU8X 4KDIC 1JWAD 3Q8FA 3KUZA 2WXIA 1S1QB 2K8HA 2WYQA 3U7DA 2WXPA 3V6EB 3TMPB 2V0GA 5J18A 2BS4B 4G50A 3RNEC 2MBEA 1OFFA 4FJZA 4X57B 3L08A 3O13A 1E8ZA 4YSXB 2NVUI 3H6NA 2WXLA 1WXSA 4DWFA 2WXFA 4XWTA 4EOYA 5BMHA 3QARA 2CJOA 3AV8A 2K8BA 4Q2JA 3MC9A 3MJ5A 1XLPA 5I4DA 4DXGA 1ZOYB 3UF8A 3NVVA 4W9DA 3D32A 3H7SA 3APCA 1VD2A 1NDDA 1WIAA 5LXIB 1MI0A 3AEDB 1P98A 4UDUC 4HCNB 4EFOA 1XCTL 2Z0EB 4DHJD 1FEHA 2VH2A 4WJPA 1IP9A 3TCAA 4EUTA 2NBWB 2DWQA 4AS1A 3AXCA 1AN8A 1FMAD 2LASA 1EO6A 1RAXA 4ZRKA 3VH3B 3SD5A 3KUDB 4GSWA 2VZKB 4EZKA 2ZW0A 4JLCA 2C7NB 2ZCBA 3Q8BA 3ZTCA 3AN1A 2PMVA 3AEFB 4HRSA 3TIXA 5KHOA 1WZ0A 3LXFA 1XLOA 3BZDB 2BWFA 4L1BA 5D2MB 4MGIE 2JU6X 2JY6A 4P16A 5AZHA 3QQ8B 3KYDD 1E7VA 4W9EA 3A4RA 4M01A 5CHFA 1FM0D 3ZGZA 1RM6C 4KGTA 1I4PA 1UUPA 2NPTA 2R2OA 5J17A 2ACZB 5AUKA 4LJOB 4C56C 2KZRA 1C79A 1E5WA 2LVOA 5EDSA 5G5HA 5JHBA 2Z59B 2M1MA 1WFYA 3DWGC 4M02A 3Q8CA 1F52A 4BKSA 2ONQA 2WXOA 3PZ8A 2OOBB 2R2QA 1IPGA 2MA9B 4DXAB 1WYGA 1GB4A 3DCGA 4ANXA 4GDKA 1NEKB 1FO4A 3L17A 3RD2A 3GP7A 1SBBB 4AJWA 2KLGA 1QZEA 1WRDB 1AARA 1OEYA 2AYOB 4YXDB 3DOWA 1C3TA 1WGKA 2KFKA 2MBBB 3IT6B 2KWVB 4E74A 1UF0A 3CF6E 2BYEA 2DNFA 3VFKA 1GC6A 2PVOD 1YQ4B 1T6BX 3LDZE 2KQSA 1KM7A 1E9MA 2DBYA 2KVRA 1WGGA 2KTRB 1Z2MA 2MCNB 1F2RC 1PDXA 1CK1A 3PPAA 3VTUA 2WXRA 5TSSA 1ROEA 3AH7A 2D3AA 5T8IA 4C4VA 2FNJB 2J52A 4F8CB 2QILA 4IW0A 2EKEC 2JX5A 3IT4B 1N5XA 1XEEA 5LLIA 1FXIA 2M8SA 4OZCA 3UQBA 2ZZPB 3ZJUA 4XE0A 4KKIA 2LJ5A 2DYMA 1SE4A 1EWYC 4HCPB 2RMMA 4KVGB 2WXJA 3BYTB 1SE9A 5GXGB 3TJPA 3B2GA 2V4LA 1N62A 4IM0A 2D2QA 2J0MA 3CIRB 1NI3A 2KKCA 1K53A 2IO3B 2O6VB 1DYQA 2CR5A 3H7PB 4A6QA 3IFWB 3A9JA 4ARIA 3GB1A 3AULA 3Q6BA 2KDMA 1PGXA 3IG3A 4NAWA 4WH4A 3ZJVA 2ZW1A 1T0QC 1E8YA 4FXCA 2LVPA 4XWWA 4MGYE 2JSVX 4M0WA 1EU4A 1I7HA 4HWIB 1SE3A 4BKGA 4RNAA 2FCSA 3TEXA 3L16A 4FULA 1WF9A 1K8RB 1FCCC 1SIFA 5EE9A 4LNOA 3SFEB 4A9AA 3LJ3A 1V1OA 4W9IA 2C9WB 5EE1A 1C1YB 4RGNA 4W9LA 4I6PA 5FR3A 5E6JA 4IDIA 5G5GA 3U4EG 1UWXA 4AUQC 4C00A 2CS4A 5JH5C 4RM9A 3GS2A 4IOIE 2KDBA 2V3NA 3R3MA 4MGZE 4ACFA 2ZNVC 3TSSA 3ZVVA 2WDQB 1F2RI 2KX0A 5CHWA 5HI1A 3RUIB 2WDTB 3HRDD 3V6CB 1H4RA 1YD8U 4N6EB 2LXCA 2JZPA 3ZIMA 2HTHA 1IUEA 4ZRPA 3HVDA 1ESFA 3KYCD 4ZOHC 3GZNI 2DENB 3A9KB 2QCZA 1HTOA 5KHQA 3O65B 2K6QA 2GBRA 3AE6B 2EMSA 3RFZB 4PS8A 4TQ0A 1HE8A 4LNFA 3AEEB 1YX5B 5EE3A 5DPSA 3RI7C 1K51A 3MP9A 2BT6A 4FHKA 1LXDA 2J42A 2IYDB 2FCQA 2XK5B 2DLBA 2KN5A 1WM3A 3MTNB 4MSMB 3UIOB 4OVZA 3AU5A 2LI5A 3R8BA 3VR8B 1JRUA 3C8YA 4GLSC 2NS5A 1OQYA 4K3CA 4RGMA 2L52A 1QLBB 4HK2A 2NBVB 3AE1B 2HDEA 4YT0B 2XNAC 4P6VF 1IGDA 3ZNZB 3V3XA 2LRWA 5BYRA 4NPNA 3ZNHB 4DHJB 2BVCA 2JRHA 2KX3A 2LGYA 2MEKA 3AMZA 4HXDA 1J7CA 4R3DA 1Q5WB 2H88B 1J7BA 2KK8A 2GB1A 4N9F4 4US9A 5BYSA 1WM2A 3URYA 2LEKA 4N59A 4JGHB 3WAOA 1WGRA 1YX6B 2N9EB 3NUHB 1XXGA 3WCQA 3P4RB 1NVID 1I4QA 3WAPA 2W54A 3TBLD 4GDKB 5E6NA 4AWJA 1P3QU 1OTRB 2MLBA 1B1ZA 1HEZE 1WWTA 1YN3A 4MEMA 1KLGD 4B0MA 1WY8A 2N9PC 3FKYA 5D6JB 1GG3A 1QQRA 2WX0A 4H2AA 4BVUC 2N7JA 3B2FA 3Q14C 1YNTE 1D4BA 3KWLA 3HIZA 2QIEB 1PFDA 1JALA 4LLGM 1VZ8A 5TR5A 3QWZB 1LGRA 1C9FA 2QEJC 4TQ1A 1PYWD 1VZ6A 3Q3JA 1RYJA 1WE6A 1GB1A 2KD0A 3L0WB 2O6VD 1R4MB 4IWPA 4BBNF 4FJVB 4K7SA 1F1HA 3PSEB 1TS2A 2PJHA 3TEWA 3A4SC 2INCC 2C60A 2MP2B 3R66C 1FNVA 1R4NB 4II2B 3VRBB 2BBCA 4DDID 5DPTA 3VHTC 3ML9A 1N61A 4K7WA 2JZ3B 2Y5BB 1JCKB 2WNMA 3B08A 1OQQA 5BYQA 1N5WA 3SEBA 4W9JA 2MJDA 4DQOC 1KFYB 2AX5A 3W1YA 1MHHE 3L4PA 4AQ7A 2BB5A 2K0PA 5IP4D 3NS8A 3AECB 2DAJA 2N1WA 1YJJA 1J7AA 4PK1A 4ZYNA 4HEA1 4NQLB 2BKFA 2N9KA 2O6VA 1SIJA 2N7DA 2ZPYA 3H7PA 4HJKA 4RF0A 3TEYA 4OW0A 2K3UA 2WP9B 1ET9A 4BBNC 1V81A 2R61A 3VR9B 2EKIA 4YSZB 5E6OA 4LK0M 2VH1A 4NJ7A 3BWUD 3ZDTA 1U4AA 3I3TB 3GE8C 4KDLB 1YJ1A 1YQBA 2FCMA 3ZNID 3IBEA 4F1SA 2HD5B 1T0YA 1L4ZB 4DDGD 1F77A 1FXAA 4ZYSA 2KVZA 5D3DA 1L0XB 1V86A 3V61A 5LXHA 3PHXB 1WX9A 4ASWC 1Z5SB 3Q3FA 1QOGA 3VQIA 5AEKB 2DAFA 2J7QB 3T8MA 1XLQA 4EE2A 1C4AA 2L8JA 1E8WA 3P63A 2KO3A 3KQ4A 3Q3OC 1ZPSA 1AWDA 1N63A 3BYYB 4GMVA 1L2NA 2KJ6A 4IWOA 3X23A 1JW9D 2KACA 1RRBA 2ICIA 4A90A 4HDQA 1WSPA 4ZHOA 3NVWA 1V97A 2KFJA 3V05A 4IG7B 1L0VB 1KTKA 4YTPB 1NBFC 2D3GA 1L4DB 4FBJB 2BS3B 2ZNVB 2RDGA 3A1QB 3BK2A 1L0YB 3A9KA 3P1MA 2K6DB 1UH6A 2JVCA 1L6UA 5CHVC 4A3PA 2LD9A 4F7ZA 2VRRB 5FR6A 5JZEB 2LZ6A 1I4GA 2JF5A 3QHTA 1YN5A 3M62B 1MHXA 2BKRB 2Q5WD 4II3B 3LYYA 2I2YA 1V1PA 1WXAA 4GDLB 3RNGC 3OJ3A 1RLFA 3EHVA 4NAMA 3SR6A 1HZ5A 3NVZA 3I57A 1E10A 2XK5A 5BMGA 1Q1OA 2BB6A 3PHWB 1DOYA 2JT4B 4XDCA 1QILA 4YL8A 3H8HA 3AU4A 4WJQA 4IKGA 2G45B 2AQ2B 1DOXA 5D3IB 2G3QB 3DBHB 3RNFC 1TGZB 2QHOA 1VDVA 1TBEA 1E6EB 4NZLB 3JSVB 4WJNA 2KMMA 1WMHB 2KDFB 4JWSC 4FJYA 1G6JA 2C5LC 2BYVE 2UU7A 4NNJB 3L10B 2Y5CA 1V8CA 1QKZA 2G4SA 2AQ3B 5L95C 3ECIA 2BGFA 1VJKA 1WR1A 1D6EC 4KSLC 3PREA 3M3JA 4C80A 1NI2A 1C4PA 2FAZA 1UZXB 1GUAB 2PPHA 2RD0A 2W55A 3T9LA 1JQ4A 4WWNA 3AEBB 3QC8B 3Q8EA 5HHDG 1SB3C 3DVNU 4HKZE 2QJLA 2BPSA 3ML8A 4ARCA 1WX8A 3ZKJC 4HDOA 2LGDA 3JYUA 5IAAC 2FUHB 1FFUA 1L5PA 4HLEA 1C78A 3ZO5B 3EUB2 2OJRA 4OVUA 3NZUA 1XCQL 3T3OA 3AE7B 2JUOA 2KWUB 2LMCA 2IBIB 2ON8A 2L32A 3I63C 2V1YA 4CQNA 4A55A 1E90A 3N1XC 2M0AA 1FCLA 1WYWB 3PS6A 2DX5B 3PTFC 4YSYB 2AL3A 2MP2A 3CWIA 1KH0A 4LNNA 2WX1A 3DVGX 1HTQA 3Q8AA 4ZRQA 4JX1C 5D7GA 1KRHA 2KWDA 3NZSA 2PLPA 1FPYA 3L13A 5AZGA 2GI9A 3NG0A 1OGWA 2G9HD 4YTMB 2MBOA 4ZHPA 1F0ZA 4LJPB 3QJZA 1SEBD 3VUYA 2GRIA 3K9OB 4E71A 3ZNGC 2K22A 2Y5PA 4IC7B 2PIAA 3PGEA 4CO7A 3S2AA 3R2TA 1PUTA 1RWSA 2D11A 2DHZA 1FRDA 1FNWA 2E3TA 4HPMB 1R4NI 2I1JA 1TJEA 2ASQA 2PE6B 3RNAC 1TKYA 2L76A 2QMTA 2XEWA 2E6XA 1DGJA 3QAQA 4AOFA 3EA6A 4KSKC 4W9KA 2IPKD 1Y56A 4FHJA 1QOAA 2KXJA 3Q2AC 1LO5D 2GBKA 2V3SA 2LVQA 3BIID 2OJWA 2L0TA 3WIMA 2JXTA 2KYWA 2IO1B 4K3BA 4PS7A 2LHDA 4DHZB 4S0RA 1JWUD 4EZJA 2XBBC 5E6PA 1M94A 2ZCCA 3LB8C 5FK9C 1QF6A 3OAWA 3PZ7A 4GU2A 2MJ3A 2H89B 5JHAA 2L7RA 3AI5A 3WAMA 2K39A 3P42A 3E9SA 3WALA 3HUIA 4QAYA 1WZ3A 4A8XC 2FE8A 4K7UA 3IVFA 1EWCA 4RGTA 3N1YC 4NJCA 2MRPA 3KWVA 2DYOA 2M56B 4MH8A 1D5XC 3NS1A 2D3BA 1BMLC 2YVCA 3ZYYX 4XC2A 4W9HA 4BKTA 2BYTA 1ZKHA 4RFBA 1V1PB 4REZA 2WWZA 1GNUA 2G4DB 4WAFA 1FD6A 3DBRB 1IBXB 2CHXA 2KC2A 3DVGY 2W3RA 4MDKE 3PLUA 2LGIA 3A1QA 4LNKA 1N6ZA 1RFKA 3FC4A 3KVFB 2AWTA 2CHWA 4USAA 1J19A 3TL5A 1FNUA 4ZRIA 4WWPA 3M95A 1H8CA 1YJIA 4PYUA 1V5TA 4BOZB 3UINB 3NRZA 4W9CA 2HJ8A 4GDLA 2WXQA 5G55A 2MX2A 2WXMA 3ETRA 1P1AA 4GIVA 1PGAA 1QOFA 2IGGA 2JZZA 4HPLB 3RZWC 2B3AA 4M8MA 4LCDE 4IUMB 1WGDA 1CZPA 3HVZA 2LXAA 4KIKB 2D5GA 1GC7A 1TKGA 4CHKA 1E7UA 1WX7A 5IA7A 3IHPC 1HQRD 1WI0A 1F9JA 1TZ1A 3C19A 4RMAA 5FKAC 3JSVA 4OZBA 4LDTD 1WMHA 1SGHA 2KOXA 1ZW7A
chains in the Genus database with same CATH topology
3U8ZA 4BKSA 5C1ZA 1T0YA 1V80A 2EMTA 1WGYA 2OOBB 4DDGD 2R2QA 1XQQA 2GMIC 3WA0A 1X1MA 3QA8A 4G11A 1V86A 1WJNA 2KANA 3ENEA 3V61A 4AP4C 1IPGA 2MA9B 2GBMA 4DXAB 5LXHA 2KTFA 3PHXB 1WX9A 3DCGA 2J0KA 4ASWC 5DPWA 4ANXA 4GDKA 1Z5SB 3Q3FA 3VQIA 3NHEB 2N4FA 3L17A 3RD2A 5AEKB 3ZUNA 2DZMA 2FIFA 2DAFA 2KQ7A 2MW5A 3APFA 4AJWA 2KLGA 1QZEA 2J7QB 1WRDB 3T8MA 1EUVB 1MG8A 4GOCA 1AARA 1OEYA 2AYOB 3DOWA 4IWQA 3VAWA 2UWQA 2L8JA 1E8WA 1WGHA 1C3TA 2KFKA 5D94A 2MBBB 3DBHI 2KO3A 2BF8B 3UQAA 2KWVB 4E3CA 3EFUA 4E74A 3CF6E 3DPDA 2BYEA 3VFKA 1GC6A 4GMVA 4GN1A 3RULA 1L2NA 4FN2A 3LDZE 4JL9A 2KJ6A 2KQSA 4IWOA 3VH4B 1KM7A 3X23A 4DK5A 1L7YA 2PEAA 1RRBA 3QX1A 5C23A 2KVRA 4HDQA 2KNBA 1LM8B 4MSQB 1WGGA 1EF1A 2KFJA 2KTRB 1Z2MA 3ZW3A 1OEYJ 1P9DU 2MCNB 2L05A 3K9PB 4IG7B 3UIPB 5CX3A 3EECA 3PPAA 2REXA 3VTUA 4XX5A 1NBFC 3L54A 2D3GA 4FBJB 3BINA 2ZNVB 2J0JA 3A1QB 2FNJB 2KHWB 3A9KA 3H1UA 2FIDA 4P7IA 4A3OA 2K6DB 1UH6A 2KMCA 1UGMA 2JVCA 4IW0A 2EKEC 2GBJA 4F8CB 5L83A 5CHVC 4A3PA 2LD9A 5LLIA 4IM2A 3UQBA 2M8SA 2ZZPB 1YIWA 4F7ZA 2VRRB 2LJ5A 2DYMA 4EKUA 4K81A 5FR6A 4ICVA 4BFRA 5JZEB 1UBQA 2LZ6A 3QHTA 2JF5A 1I35A 2C7HA 3JW0X 3M62B 2CKHB 4HCPB 2MWSB 4KVGB 1XT9B 2BKRB 4NQKE 1SE9A 2MBQA 4II3B 3TJPA 2V4LA 3KUCB 3WANA 4CYEA 1WXAA 4IM0A 4G3XB 4GDLB 2D2QA 3A33B 3OJ3A 2J0MA 5J2RA 2KKCA 3VDZA 4BOSC 2IO0B 1RLFA 2IO3B 3EHVA 5HKHA 2O6VB 2Z0DB 4ANVA 2CR5A 3W1SC 3H7PB 4J6IA 3IFWB 4DBGA 4WWOA 2XK5A 3A9JA 1Q1OA 3PHWB 4RM8A 1UELA 2JT4B 3AULA 2NPTB 4YL8A 2KMAA 4WJQA 3AU4A 4B9KA 3DBLI 2L0FA 3IG3A 2G45B 3P2BA 4NAWA 3ZLZA 3ONSA 5GMVA 3ZRFA 1V6EA 2G3QB 2MQJA 1TGZB 1WR6E 2M4NA 2QHOA 1E8YA 1TBEA 1V9JA 1IYFA 2LVPA 4B6WA 4MGYE 1V5OA 3JSVB 4WJNA 4HWIB 2UYZB 1WMHB 4BKGA 4GB9A 2KDFB 4MGKE 1RFAA 4FJYA 2FCSA 1G6JA 2C5LC 2BYVE 3C0RB 4NNJB 3DVNV 3HM3A 3L10B 3L16A 4FULA 1WF9A 1K8RB 2G4SA 1SIFA 5L95C 3ECIA 3LJ3A 4W9IA 2C9WB 2KDIA 1C1YB 2N7EA 2A5UA 2BGFA 4ICUA 4W9LA 5DCNA 1WR1A 4I6PA 4KSLC 2JPHA 3PREA 3M3JA 4B95A 1P0RA 1NI2A 2IZVB 1WJUA 2FAZA 3VUWA 2RPQA 4EEWA 1UZXB 1GUAB 2PPHA 2IO2B 2RD0A 3T9LA 4AUQC 4WWNA 1PQSA 2CS4A 3QC8B 2KDEB 3DBSA 5JH5C 4RM9A 3H9DA 3DVNU 2D10A 2DYBA 3ALBA 2KDBA 2KFKB 3R7QA 3R3MA 4MGZE 2BPSA 3PVLA 3W1SA 3ML8A 1WXVA 1S3SG 1WX8A 2ZNVC 3VTVA 3ZKJC 1WJ4A 4ANUA 4HDOA 3ZVVA 2CHZA 2KX0A 2JXXA 2LGDA 3EC8A 5CHWA 3QK0A 4ZDVA 5DPRA 2D07B 3RUIB 3SHQA 3JYUA 2WDTB 5IAAC 2FUHB 3X0WA 3PZDA 4JIOU 3V6CB 1H4RA 1YD8U 3B1LX 1WH3A 3RT3B 4HLEA 2LXCA 3ZO5B 2N9XA 3ZIMA 2HE7A 3HHMA 4WAAA 2GOWA 2OJRA 1ISNA 2HTHA 3NZUA 4OVUA 3RCZA 3KH0A 2IY0B 2JUOA 2KWUB 2KLCA 2RSUA 3VVWB 3KYCD 2IBIB 2IY1B 2L00B 4HVBA 4A20A 3MHSD 4NY0A 3GZNI 4URKA 1LQBA 4F1SA 1Y8RC 2DENB 3A9KB 2NR2A 2V1YA 3UGBB 2ZJDA 5KHQA 1V49A 4I6LB 1I42A 1E90A 3O65B 1WYWB 5AZFA 3PS6A 2DX5B 2K6QA 3PTFC 2AL3A 2GBRA 2MP2A 4FLHA 1CMXB 4EZLA 2WX1A 3QIJA 2PE9A 2EMSA 4KV2A 3DVGX 4PS8A 4TKNA 4TQ0A 1HE8A 1ZGUB 3CSTA 5D7GA 2NBUA 3BY4B 1YX5B 4PYZA 2RR9A 3DDCB 3VXWA 5DPSA 2KTRA 3NZSA 1E8XA 3L13A 5AZGA 1KOTA 1V2YA 4BKSD 3R7RA 2M0XA 1OGWA 2A4ZA 2N1VA 4FHKA 3QCAA 4W9FA 3PV1A 4NJ6A 2MBOA 1LXDA 4MSMB 2IYDB 2FCQA 2XK5B 4LJPB 2KN5A 1WM3A 3A9JB 3MTNB 3QJZA 4G0NB 4TV3A 3UIOB 3N32A 3VUYA 3AU5A 2LI5A 2YLMA 3K9OB 4MJSA 3ZNGC 4E71A 1D3ZA 3PRMB 2LUEA 3HK0A 4IC7B 1JRUA 4NAWB 3CMMB 3ZTDA 3PGEA 4CO7A 4PS3A 3S2AA 2NS5A 1OQYA 2D11A 4KZCA 2LRUA 2DHZA 4MELA 1EF5A 1UBIA 2CU1A 2BYFA 2KWCA 2NBVB 4HK2A 2JWZA 4HPMB 5BO4B 3VTWA 1R4NI 4M0WB 2I1JA 2LGXA 2NCNA 4MM3A 3U30A 2ASQA 2O2VA 3ZNZB 2LRWA 2PE6B 2RGFA 4NPNA 3ZNHB 4DHJB 1WE7A 4FADA 2JRHA 2KX3A 2LGYA 2L76A 3SDLC 4HXDA 2K1FA 2KJRA 4GXBA 4WQOB 1Q5WB 2XEWA 1VCBA 2KK8A 4N9F4 3OJ4B 3NOBA 1WM2A 2ZPNA 3QAQA 2ZVOA 4AOFA 4JGHB 3WAOA 2MSED 4K1RB 4KSKC 1WJ6A 4W9KA 5CTRC 1WGRA 1YX6B 2N9EB 4IM3A 2K8CA 3DBRI 3JVZX 4FHJA 2KXJA 4OVVA 1A5RA 3WAPA 3PRZA 3PT2B 2GBKA 3TBLD 2V3SA 2LVQA 4GDKB 4WJOA 4AJYB 1BT0A 2BWES 2L0TA 3WIMA 5E6NA 4AWJA 1P3QU 2DZJA 1OTRB 2ZEQA 4KIKA 2MLBA 1J8CA 2IO1B 3N30A 3SU8X 4KDIC 3KUZA 1S1QB 2K8HA 2WYQA 3U7DA 3V6EB 3TMPB 4MEMA 4MH0E 4PS7A 1WY8A 2N9PC 5D6JB 1GG3A 5J18A 4DHZB 4G50A 4EZJA 5EDSA 2WX0A 4BVUC 2MBEA 2XBBC 3KW5B 5E6PA 1M94A 2ZCCA 3OAWA 4FJZA 4X57B 3L08A 4GU2A 1E8ZA 3HIZA 2NVUI 5JHAA 2L7RA 3AI5A 3H6NA 3WAMA 3CSFA 1WXSA 2K39A 3QWZB 5TR5A 4DWFA 4FA6A 3WALA 4EOYA 1WZ3A 1GJZA 2JRIB 4TQ1A 3QARA 3Q3JA 4K7UA 3VUXA 3IVFA 3M63B 1WE6A 2KD0A 3L0WB 3N3KB 2K8BA 1WXMA 2O6VD 4IWPA 2K25A 4BBNF 4FJVB 2MRPA 4K7SA 2DYOA 1KJTA 1UD7A 3PSEB 2PJHA 3A4SC 3UF8A 2C60A 2MP2B 4LDTB 3D32A 3R66C 4W9DA 3H7SA 3APCA 3MJWA 2YVCA 4II2B 1VD2A 3RYTA 4XC2A 3APDA 2GBNA 4W9HA 4DDID 1NDDA 4BKTA 5DPTA 1WIAA 3VHTC 3ML9A 5LXIB 3OLMD 4K7WA 2JZ3B 2Y5BB 1P98A 2LWPA 4HCNB 4EFOA 1FXTB 4JQWC 2AL6A 3B08A 4XZ4A 4ANWA 1ZKHA 4DHJD 2Z0EB 3B0AA 4WJPA 1IP9A 2W9NA 4GGQA 3TCAA 4EUTA 2WWZA 1GNUA 2G4DB 2NBWB 3V62A 4W9JA 2CHXA 2KC2A 3DVGY 3AXCA 2KC1A 1Q0WB 3HM6X 3PLUA 4MDKE 3ZRCA 3A1QA 4MJSB 4DHZE 4TUUA 2LASA 1EO6A 1RAXA 3W1YA 4KZ0A 4ZRKA 2DZIA 3VH3B 3KVFB 3SD5A 2AWTA 2CHWA 3KUDB 4ZRJA 1J19A 1R4MI 4GSWA 3PLVA 3TL5A 4EZKA 1TTNA 4ZRIA 4WWPA 3M95A 1KLVA 1H8CA 4JLCA 2C7NB 2ZCBA 3ZTCA 3NS8A 2O2VB 4PYUA 2L3ZA 1V5TA 2DAJA 4BOZB 3UINB 3TIXA 2N1WA 5KHOA 4W9CA 4M8NA 2HJ8A 1WZ0A 4GDLA 2BWFA 4ZYNA 4NQLB 5D2MB 4MGIE 2BKFA 2JY6A 5AZHA 2O6VA 3QQ8B 3DQVA 3KYDD 1E7VA 2N7DA 4W9EA 2ZPYA 3A4RA 2MX2A 3H7PA 5G55A 4HJKA 5CHFA 3NY5A 1J0GA 1P1AA 2DZKA 3PRPB 4GIVA 1LFDA 2I1KA 2JZZA 2NPTA 2R2OA 4HPLB 2ZVNA 4BBNC 1XD3B 5J17A 4I6NB 3RZWC 2B3AA 4M8MA 1V81A 3GOEA 4LCDE 4IUMB 1WGDA 2M17A 2MBHA 3V60A 4LJOB 2LXAA 4KIKB 5E6OA 4NJ7A 3RZFA 2KZRA 1GC7A 4W9GA 2C7MB 4CHKA 1E5WA 1E7UA 2KJHB 2LVOA 1U4AA 1WX7A 3I3TB 3ZDMC 3ZDTA 3IHPC 4KDLB 1YJ1A 1YQBA 1WI0A 5IA7A 1F9JA 1TZ1A 4RMAA 5G2NA 2FCNA 3JSVA 4LDTD 2FCMA 1WMHA 3ZNID 5JHBA 2Z59B 1SGHA 1WFYA 2M1MA 2KOXA 3IBEA 2AEHA 2HD5B 1ZW7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8Z A;  4BKS A;  5C1Z A;  1T0Y A;  1V80 A;  2EMT A;  1WGY A;  2OOB B;  4DDG D;  2R2Q A;  1XQQ A;  2GMI C;  3WA0 A;  1X1M A;  3QA8 A;  4G11 A;  1V86 A;  1WJN A;  2KAN A;  3ENE A;  3V61 A;  4AP4 C;  1IPG A;  2MA9 B;  2GBM A;  4DXA B;  5LXH A;  2KTF A;  3PHX B;  1WX9 A;  3DCG A;  2J0K A;  4ASW C;  5DPW A;  4ANX A;  4GDK A;  1Z5S B;  3Q3F A;  3VQI A;  3NHE B;  2N4F A;  3L17 A;  3RD2 A;  5AEK B;  3ZUN A;  2DZM A;  2FIF A;  2DAF A;  2KQ7 A;  2MW5 A;  3APF A;  4AJW A;  2KLG A;  1QZE A;  2J7Q B;  1WRD B;  3T8M A;  1EUV B;  1MG8 A;  4GOC A;  1AAR A;  1OEY A;  2AYO B;  3DOW A;  4IWQ A;  3VAW A;  2UWQ A;  2L8J A;  1E8W A;  1WGH A;  1C3T A;  2KFK A;  5D94 A;  2MBB B;  3DBH I;  2KO3 A;  2BF8 B;  3UQA A;  2KWV B;  4E3C A;  3EFU A;  4E74 A;  3CF6 E;  3DPD A;  2BYE A;  3VFK A;  1GC6 A;  4GMV A;  4GN1 A;  3RUL A;  1L2N A;  4FN2 A;  3LDZ E;  4JL9 A;  2KJ6 A;  2KQS A;  4IWO A;  3VH4 B;  1KM7 A;  3X23 A;  4DK5 A;  1L7Y A;  2PEA A;  1RRB A;  3QX1 A;  5C23 A;  2KVR A;  4HDQ A;  2KNB A;  1LM8 B;  4MSQ B;  1WGG A;  1EF1 A;  2KFJ A;  2KTR B;  1Z2M A;  3ZW3 A;  1OEY J;  1P9D U;  2MCN B;  2L05 A;  3K9P B;  4IG7 B;  3UIP B;  5CX3 A;  3EEC A;  3PPA A;  2REX A;  3VTU A;  4XX5 A;  1NBF C;  3L54 A;  2D3G A;  4FBJ B;  3BIN A;  2ZNV B;  2J0J A;  3A1Q B;  2FNJ B;  2KHW B;  3A9K A;  3H1U A;  2FID A;  4P7I A;  4A3O A;  2K6D B;  1UH6 A;  2KMC A;  1UGM A;  2JVC A;  4IW0 A;  2EKE C;  2GBJ A;  4F8C B;  5L83 A;  5CHV C;  4A3P A;  2LD9 A;  5LLI A;  4IM2 A;  3UQB A;  2M8S A;  2ZZP B;  1YIW A;  4F7Z A;  2VRR B;  2LJ5 A;  2DYM A;  4EKU A;  4K81 A;  5FR6 A;  4ICV A;  4BFR A;  5JZE B;  1UBQ A;  2LZ6 A;  3QHT A;  2JF5 A;  1I35 A;  2C7H A;  3JW0 X;  3M62 B;  2CKH B;  4HCP B;  2MWS B;  4KVG B;  1XT9 B;  2BKR B;  4NQK E;  1SE9 A;  2MBQ A;  4II3 B;  3TJP A;  2V4L A;  3KUC B;  3WAN A;  4CYE A;  1WXA A;  4IM0 A;  4G3X B;  4GDL B;  2D2Q A;  3A33 B;  3OJ3 A;  2J0M A;  5J2R A;  2KKC A;  3VDZ A;  4BOS C;  2IO0 B;  1RLF A;  2IO3 B;  3EHV A;  5HKH A;  2O6V B;  2Z0D B;  4ANV A;  2CR5 A;  3W1S C;  3H7P B;  4J6I A;  3IFW B;  4DBG A;  4WWO A;  2XK5 A;  3A9J A;  1Q1O A;  3PHW B;  4RM8 A;  1UEL A;  2JT4 B;  3AUL A;  2NPT B;  4YL8 A;  2KMA A;  4WJQ A;  3AU4 A;  4B9K A;  3DBL I;  2L0F A;  3IG3 A;  2G45 B;  3P2B A;  4NAW A;  3ZLZ A;  3ONS A;  5GMV A;  3ZRF A;  1V6E A;  2G3Q B;  2MQJ A;  1TGZ B;  1WR6 E;  2M4N A;  2QHO A;  1E8Y A;  1TBE A;  1V9J A;  1IYF A;  2LVP A;  4B6W A;  4MGY E;  1V5O A;  3JSV B;  4WJN A;  4HWI B;  2UYZ B;  1WMH B;  4BKG A;  4GB9 A;  2KDF B;  4MGK E;  1RFA A;  4FJY A;  2FCS A;  1G6J A;  2C5L C;  2BYV E;  3C0R B;  4NNJ B;  3DVN V;  3HM3 A;  3L10 B;  3L16 A;  4FUL A;  1WF9 A;  1K8R B;  2G4S A;  1SIF A;  5L95 C;  3ECI A;  3LJ3 A;  4W9I A;  2C9W B;  2KDI A;  1C1Y B;  2N7E A;  2A5U A;  2BGF A;  4ICU A;  4W9L A;  5DCN A;  1WR1 A;  4I6P A;  4KSL C;  2JPH A;  3PRE A;  3M3J A;  4B95 A;  1P0R A;  1NI2 A;  2IZV B;  1WJU A;  2FAZ A;  3VUW A;  2RPQ A;  4EEW A;  1UZX B;  1GUA B;  2PPH A;  2IO2 B;  2RD0 A;  3T9L A;  4AUQ C;  4WWN A;  1PQS A;  2CS4 A;  3QC8 B;  2KDE B;  3DBS A;  5JH5 C;  4RM9 A;  3H9D A;  3DVN U;  2D10 A;  2DYB A;  3ALB A;  2KDB A;  2KFK B;  3R7Q A;  3R3M A;  4MGZ E;  2BPS A;  3PVL A;  3W1S A;  3ML8 A;  1WXV A;  1S3S G;  1WX8 A;  2ZNV C;  3VTV A;  3ZKJ C;  1WJ4 A;  4ANU A;  4HDO A;  3ZVV A;  2CHZ A;  2KX0 A;  2JXX A;  2LGD A;  3EC8 A;  5CHW A;  3QK0 A;  4ZDV A;  5DPR A;  2D07 B;  3RUI B;  3SHQ A;  3JYU A;  2WDT B;  5IAA C;  2FUH B;  3X0W A;  3PZD A;  4JIO U;  3V6C B;  1H4R A;  1YD8 U;  3B1L X;  1WH3 A;  3RT3 B;  4HLE A;  2LXC A;  3ZO5 B;  2N9X A;  3ZIM A;  2HE7 A;  3HHM A;  4WAA A;  2GOW A;  2OJR A;  1ISN A;  2HTH A;  3NZU A;  4OVU A;  3RCZ A;  3KH0 A;  2IY0 B;  2JUO A;  2KWU B;  2KLC A;  2RSU A;  3VVW B;  3KYC D;  2IBI B;  2IY1 B;  2L00 B;  4HVB A;  4A20 A;  3MHS D;  4NY0 A;  3GZN I;  4URK A;  1LQB A;  4F1S A;  1Y8R C;  2DEN B;  3A9K B;  2NR2 A;  2V1Y A;  3UGB B;  2ZJD A;  5KHQ A;  1V49 A;  4I6L B;  1I42 A;  1E90 A;  3O65 B;  1WYW B;  5AZF A;  3PS6 A;  2DX5 B;  2K6Q A;  3PTF C;  2AL3 A;  2GBR A;  2MP2 A;  4FLH A;  1CMX B;  4EZL A;  2WX1 A;  3QIJ A;  2PE9 A;  2EMS A;  4KV2 A;  3DVG X;  4PS8 A;  4TKN A;  4TQ0 A;  1HE8 A;  1ZGU B;  3CST A;  5D7G A;  2NBU A;  3BY4 B;  1YX5 B;  4PYZ A;  2RR9 A;  3DDC B;  3VXW A;  5DPS A;  2KTR A;  3NZS A;  1E8X A;  3L13 A;  5AZG A;  1KOT A;  1V2Y A;  4BKS D;  3R7R A;  2M0X A;  1OGW A;  2A4Z A;  2N1V A;  4FHK A;  3QCA A;  4W9F A;  3PV1 A;  4NJ6 A;  2MBO A;  1LXD A;  4MSM B;  2IYD B;  2FCQ A;  2XK5 B;  4LJP B;  2KN5 A;  1WM3 A;  3A9J B;  3MTN B;  3QJZ A;  4G0N B;  4TV3 A;  3UIO B;  3N32 A;  3VUY A;  3AU5 A;  2LI5 A;  2YLM A;  3K9O B;  4MJS A;  3ZNG C;  4E71 A;  1D3Z A;  3PRM B;  2LUE A;  3HK0 A;  4IC7 B;  1JRU A;  4NAW B;  3CMM B;  3ZTD A;  3PGE A;  4CO7 A;  4PS3 A;  3S2A A;  2NS5 A;  1OQY A;  2D11 A;  4KZC A;  2LRU A;  2DHZ A;  4MEL A;  1EF5 A;  1UBI A;  2CU1 A;  2BYF A;  2KWC A;  2NBV B;  4HK2 A;  2JWZ A;  4HPM B;  5BO4 B;  3VTW A;  1R4N I;  4M0W B;  2I1J A;  2LGX A;  2NCN A;  4MM3 A;  3U30 A;  2ASQ A;  2O2V A;  3ZNZ B;  2LRW A;  2PE6 B;  2RGF A;  4NPN A;  3ZNH B;  4DHJ B;  1WE7 A;  4FAD A;  2JRH A;  2KX3 A;  2LGY A;  2L76 A;  3SDL C;  4HXD A;  2K1F A;  2KJR A;  4GXB A;  4WQO B;  1Q5W B;  2XEW A;  1VCB A;  2KK8 A;  4N9F 4;  3OJ4 B;  3NOB A;  1WM2 A;  2ZPN A;  3QAQ A;  2ZVO A;  4AOF A;  4JGH B;  3WAO A;  2MSE D;  4K1R B;  4KSK C;  1WJ6 A;  4W9K A;  5CTR C;  1WGR A;  1YX6 B;  2N9E B;  4IM3 A;  2K8C A;  3DBR I;  3JVZ X;  4FHJ A;  2KXJ A;  4OVV A;  1A5R A;  3WAP A;  3PRZ A;  3PT2 B;  2GBK A;  3TBL D;  2V3S A;  2LVQ A;  4GDK B;  4WJO A;  4AJY B;  1BT0 A;  2BWE S;  2L0T A;  3WIM A;  5E6N A;  4AWJ A;  1P3Q U;  2DZJ A;  1OTR B;  2ZEQ A;  4KIK A;  2MLB A;  1J8C A;  2IO1 B;  3N30 A;  3SU8 X;  4KDI C;  3KUZ A;  1S1Q B;  2K8H A;  2WYQ A;  3U7D A;  3V6E B;  3TMP B;  4MEM A;  4MH0 E;  4PS7 A;  1WY8 A;  2N9P C;  5D6J B;  1GG3 A;  5J18 A;  4DHZ B;  4G50 A;  4EZJ A;  5EDS A;  2WX0 A;  4BVU C;  2MBE A;  2XBB C;  3KW5 B;  5E6P A;  1M94 A;  2ZCC A;  3OAW A;  4FJZ A;  4X57 B;  3L08 A;  4GU2 A;  1E8Z A;  3HIZ A;  2NVU I;  5JHA A;  2L7R A;  3AI5 A;  3H6N A;  3WAM A;  3CSF A;  1WXS A;  2K39 A;  3QWZ B;  5TR5 A;  4DWF A;  4FA6 A;  3WAL A;  4EOY A;  1WZ3 A;  1GJZ A;  2JRI B;  4TQ1 A;  3QAR A;  3Q3J A;  4K7U A;  3VUX A;  3IVF A;  3M63 B;  1WE6 A;  2KD0 A;  3L0W B;  3N3K B;  2K8B A;  1WXM A;  2O6V D;  4IWP A;  2K25 A;  4BBN F;  4FJV B;  2MRP A;  4K7S A;  2DYO A;  1KJT A;  1UD7 A;  3PSE B;  2PJH A;  3A4S C;  3UF8 A;  2C60 A;  2MP2 B;  4LDT B;  3D32 A;  3R66 C;  4W9D A;  3H7S A;  3APC A;  3MJW A;  2YVC A;  4II2 B;  1VD2 A;  3RYT A;  4XC2 A;  3APD A;  2GBN A;  4W9H A;  4DDI D;  1NDD A;  4BKT A;  5DPT A;  1WIA A;  3VHT C;  3ML9 A;  5LXI B;  3OLM D;  4K7W A;  2JZ3 B;  2Y5B B;  1P98 A;  2LWP A;  4HCN B;  4EFO A;  1FXT B;  4JQW C;  2AL6 A;  3B08 A;  4XZ4 A;  4ANW A;  1ZKH A;  4DHJ D;  2Z0E B;  3B0A A;  4WJP A;  1IP9 A;  2W9N A;  4GGQ A;  3TCA A;  4EUT A;  2WWZ A;  1GNU A;  2G4D B;  2NBW B;  3V62 A;  4W9J A;  2CHX A;  2KC2 A;  3DVG Y;  3AXC A;  2KC1 A;  1Q0W B;  3HM6 X;  3PLU A;  4MDK E;  3ZRC A;  3A1Q A;  4MJS B;  4DHZ E;  4TUU A;  2LAS A;  1EO6 A;  1RAX A;  3W1Y A;  4KZ0 A;  4ZRK A;  2DZI A;  3VH3 B;  3KVF B;  3SD5 A;  2AWT A;  2CHW A;  3KUD B;  4ZRJ A;  1J19 A;  1R4M I;  4GSW A;  3PLV A;  3TL5 A;  4EZK A;  1TTN A;  4ZRI A;  4WWP A;  3M95 A;  1KLV A;  1H8C A;  4JLC A;  2C7N B;  2ZCB A;  3ZTC A;  3NS8 A;  2O2V B;  4PYU A;  2L3Z A;  1V5T A;  2DAJ A;  4BOZ B;  3UIN B;  3TIX A;  2N1W A;  5KHO A;  4W9C A;  4M8N A;  2HJ8 A;  1WZ0 A;  4GDL A;  2BWF A;  4ZYN A;  4NQL B;  5D2M B;  4MGI E;  2BKF A;  2JY6 A;  5AZH A;  2O6V A;  3QQ8 B;  3DQV A;  3KYD D;  1E7V A;  2N7D A;  4W9E A;  2ZPY A;  3A4R A;  2MX2 A;  3H7P A;  5G55 A;  4HJK A;  5CHF A;  3NY5 A;  1J0G A;  1P1A A;  2DZK A;  3PRP B;  4GIV A;  1LFD A;  2I1K A;  2JZZ A;  2NPT A;  2R2O A;  4HPL B;  2ZVN A;  4BBN C;  1XD3 B;  5J17 A;  4I6N B;  3RZW C;  2B3A A;  4M8M A;  1V81 A;  3GOE A;  4LCD E;  4IUM B;  1WGD A;  2M17 A;  2MBH A;  3V60 A;  4LJO B;  2LXA A;  4KIK B;  5E6O A;  4NJ7 A;  3RZF A;  2KZR A;  1GC7 A;  4W9G A;  2C7M B;  4CHK A;  1E5W A;  1E7U A;  2KJH B;  2LVO A;  1U4A A;  1WX7 A;  3I3T B;  3ZDM C;  3ZDT A;  3IHP C;  4KDL B;  1YJ1 A;  1YQB A;  1WI0 A;  5IA7 A;  1F9J A;  1TZ1 A;  4RMA A;  5G2N A;  2FCN A;  3JSV A;  4LDT D;  2FCM A;  1WMH A;  3ZNI D;  5JHB A;  2Z59 B;  1SGH A;  1WFY A;  2M1M A;  2KOX A;  3IBE A;  2AEH A;  2HD5 B;  1ZW7 A; 
#chains in the Genus database with same CATH topology
 3U8Z A;  5C1Z A;  3N1Z C;  1V80 A;  3W5U B;  2EMT A;  2RDB C;  3NZ3 A;  1Q10 A;  4DXF A;  1JWS D;  4G11 A;  3ENE A;  4AP4 C;  1JWM D;  2KTF A;  2SEB D;  1QT9 A;  5MPO A;  3RMK C;  2J0K A;  5DPW A;  3AM9 A;  3UI3 A;  3NHE B;  2DZM A;  2FIF A;  2KQ7 A;  3APF A;  2NMQ A;  3MC8 A;  1EUV B;  1MG8 A;  2UWQ A;  3P4S B;  3OG5 A;  1WGH A;  5LNK 1;  3DBH I;  2MJE A;  1KLU D;  2BF8 B;  4HRO A;  3UQA A;  4E3C A;  3EFU A;  1M4V A;  1B9R A;  3Q3N C;  2SAK A;  4FN2 A;  1HZ6 A;  4DK5 A;  3AE8 B;  3QX1 A;  5C23 A;  4C7Z A;  2KNB A;  1LM8 B;  4MSQ B;  1EF1 A;  1YMH E;  1OEY J;  1P9D U;  3K9P B;  2WU5 B;  2KN4 A;  1EM7 A;  3MC0 B;  3Q69 A;  4XX5 A;  3IAS 1;  1OQR A;  3L54 A;  2MHJ A;  3BIN A;  5H8Y E;  4P7I A;  2HTM E;  2QSD A;  2V4I B;  1NYR A;  2IJ0 A;  3N20 C;  3IAM 1;  4ICV A;  2C7H A;  2CKH B;  4D2K A;  4RH6 A;  4NQK E;  4P1B C;  4TMA B;  3WAN A;  5J2R A;  4G3X B;  3VDZ A;  4BOS C;  2X8X X;  4ANV A;  3W1S C;  1GPX A;  3T3N A;  4DBG A;  4WWO A;  2KMA A;  4RGO S;  2JYE A;  1FIQ A;  2L0F A;  4WWM A;  1T3Q A;  3ZLZ A;  3ONS A;  5GMV A;  3ZRF A;  3DHH C;  4LNI A;  1PGB A;  3N9Y C;  2X38 A;  2M4N A;  1IGC A;  1IYF A;  2N9L A;  4B6W A;  2WDV B;  2UYZ B;  4MGK E;  4XYC A;  3C0R B;  4C7Y A;  2MH7 A;  4JWU C;  2KDI A;  5DCN A;  1TS4 A;  4B95 A;  1P0R A;  3ZXR A;  3VUW A;  4J3O D;  4EEW A;  2WU2 B;  2J53 A;  2DYB A;  3ALB A;  3ABV B;  1GAQ B;  1STE A;  1D5Z C;  3W1S A;  1WXV A;  1S3S G;  4L23 A;  1WJ4 A;  3RNB C;  4KX6 B;  4ANU A;  2CHZ A;  3EC8 A;  1T5X D;  1YN4 A;  2D07 B;  4M00 A;  3Q3M C;  3W2D A;  4HKQ A;  1ZP0 B;  3FIL B;  3B1L X;  1WH3 A;  2HE7 A;  3HHM A;  2KLC A;  3VVW B;  1JWB D;  2L00 B;  4HVB A;  4A20 A;  3MHS D;  2B76 B;  3J9C A;  3U7Z A;  4URK A;  3DBL B;  3U52 E;  1L6V A;  3MHZ A;  3UGB B;  3BVM A;  1V49 A;  3ZJT A;  4S17 A;  3DHI C;  4EZL A;  2PKO A;  2PE9 A;  4P1C C;  2IGD A;  4KV2 A;  3TUO A;  3ZXV A;  4XGA B;  3VRA B;  4PYZ A;  3VXW A;  2WHI A;  2LFI A;  1V2Y A;  4BKS D;  3R7R A;  2M0X A;  2A4Z A;  1YQ3 B;  2WGS A;  4NJ6 A;  1IBX A;  3N32 A;  4ITK A;  1FRR A;  5EE0 A;  2KAJ A;  3EGR A;  1D3Z A;  3HK0 A;  3CMM B;  5IOI A;  4PS3 A;  4KZC A;  4MEL A;  1EF5 A;  2KWC A;  3VTW A;  2LGX A;  2NCN A;  4MM3 A;  2Z8L A;  3AE4 B;  1SF0 A;  2XN9 C;  1CQV A;  2RGF A;  1WE7 A;  4FAD A;  2KJR A;  1TS3 A;  4HPP A;  2YEP B;  3NOB A;  3BVZ A;  1P7F A;  1VLB A;  2ZVO A;  4K1R B;  5CTR C;  1MJD A;  4IM3 A;  2K8C A;  3DBR I;  3JVZ X;  3BVG A;  3PRZ A;  1ZXI A;  2CJN A;  4WJO A;  2AQ1 B;  4AJY B;  1TIF A;  2ZEQ A;  4KIK A;  1J8C A;  3N30 A;  2OED A;  4MH0 E;  3AE9 B;  3AEA B;  1D5M C;  3KW5 B;  2LJI A;  2RPV A;  2K9X A;  1SSN A;  4YWG G;  3CSF A;  2NTS A;  4FA6 A;  1TY0 A;  1GJZ A;  2JRI B;  3VUX A;  3M63 B;  3N3K B;  1P7E A;  1WXM A;  2K25 A;  1BUI C;  1KJT A;  1UD7 A;  3AB5 A;  4LDT B;  3AE5 B;  1E7P B;  3MJW A;  4L2Y A;  1XO3 A;  3RYT A;  3APD A;  2GBN A;  1ZDV A;  1MFW A;  4KGS A;  3MFG A;  3OLM D;  1CJE A;  2LWP A;  1FXT B;  4JQW C;  2AL6 A;  4XZ4 A;  5IN7 A;  2KQ4 X;  3EFC A;  4ANW A;  2RDH A;  4JE3 B;  3B0A A;  5C3J B;  2W9N A;  4GGQ A;  3E56 A;  3V62 A;  3W9C B;  2CU3 A;  2WDR B;  3HM6 X;  2KC1 A;  1Q0W B;  3U2S C;  3ZRC A;  4MJS B;  4DHZ E;  1TYG B;  4TUU A;  1SE2 A;  4KZ0 A;  2DZI A;  2K5P A;  4ZRJ A;  4B0E A;  1C4C A;  1R4M I;  3NVY A;  3PLV A;  1TTN A;  1KLV A;  2INN E;  2O2V B;  1VZ7 A;  2L3Z A;  1UWM A;  5C2T B;  1XLN A;  4M8N A;  2BS2 B;  4LTU A;  4YTN B;  2JYT A;  3DQV A;  2G1E A;  2JWU A;  3NY5 A;  1J0G A;  4OHJ A;  2DZK A;  3PRP B;  2NTT A;  1LFD A;  2I1K A;  2ZVN A;  1XD3 B;  4I6N B;  1XF5 L;  3GOE A;  2M17 A;  1WRI A;  2MBH A;  1TY2 A;  3V60 A;  1C76 A;  1MPE A;  4O1N A;  3SFD B;  3RZF A;  2PVG C;  4W9G A;  2C7M B;  2YEP F;  2KJH B;  3ZDM C;  1T0S C;  1GOZ A;  5G2N A;  2BQQ A;  2FCN A;  3RPF C;  2AEH A;  1SXT A;  4WUR A;  2BW2 A;  4PT5 A;  1WGY A;  1XQQ A;  2GMI C;  3WA0 A;  1X1M A;  3QA8 A;  1WJN A;  2KAN A;  4MAC A;  2GBM A;  3I9V 1;  2N4F A;  3ZUN A;  2MW5 A;  2HJ1 A;  4GOC A;  1K52 A;  2D3C A;  4IWQ A;  1SJE D;  4HJG E;  2QC8 A;  1MVK A;  3VAW A;  4JPS A;  5D94 A;  3NJT A;  4MT5 A;  3DPD A;  2VZK D;  2WLB A;  4GN1 A;  3RUL A;  4JL9 A;  1NEN B;  3FIL A;  3VH4 B;  1L7Y A;  1QOB A;  2PEA A;  1ET6 A;  2W3S A;  2WS3 B;  3DWM A;  5AUI A;  4US8 A;  1R7S A;  4RCO A;  3ZW3 A;  3UIP B;  2L05 A;  5CX3 A;  3EEC A;  3DHG C;  2REX A;  3RN9 C;  2LUM A;  5JXV A;  2FBW B;  2J0J A;  2KHW B;  3H1U A;  2FID A;  4A3O A;  2OHF A;  2KMC A;  1UGM A;  5L83 A;  2GBJ A;  5IKC M;  4IM2 A;  2IGH A;  2PW9 A;  1JRP A;  4BZA A;  1YIW A;  2GLS A;  2I38 A;  1VR9 A;  3W5V B;  1ZXH A;  4EKU A;  4K81 A;  3FAH A;  4BFR A;  1UBQ A;  1I35 A;  3JW0 X;  2MWS B;  1XT9 B;  1K50 A;  2MBQ A;  4KKJ A;  2L83 A;  3KUC B;  3AE3 B;  2QDF A;  4CYE A;  4MM3 B;  3A33 B;  3P4Q B;  2IO0 B;  1WXQ A;  5HKH A;  2Z0D B;  2W82 A;  2KT7 A;  4J6I A;  1TKE A;  1HXY D;  4RM8 A;  1UEL A;  2V9H A;  2NPT B;  2N0S B;  2LHE A;  1EU3 A;  2Y3A A;  4B9K A;  2WXK A;  3DBL I;  3P2B A;  2L1A A;  1V6E A;  1UNS A;  2MQJ A;  1JML A;  3GE3 C;  1WR6 E;  1V9J A;  1AW7 A;  1BXT A;  1V5O A;  4GB9 A;  3PO0 A;  1SJH D;  1NYQ A;  2WXG A;  1RFA A;  3DVN V;  3HM3 A;  1MG4 A;  4N58 A;  3AE2 B;  4BAX A;  2N7E A;  2A5U A;  4ICU A;  2JPH A;  1JRO A;  2IZV B;  1WJU A;  2RPQ A;  4WQM A;  3IXS A;  2IO2 B;  1C77 A;  1PQS A;  2KDE B;  3DBS A;  1UGJ A;  3H9D A;  2D10 A;  2TSS A;  2KFK B;  3R7Q A;  4WIP A;  3PVL A;  5IO9 A;  3VTV A;  2JXX A;  3QK0 A;  4ZDV A;  5DPR A;  3SHQ A;  4KGR A;  2FUG 1;  3R2I A;  3X0W A;  3PZD A;  1AYF A;  4JIO U;  1T0R C;  3RT3 B;  2JQR B;  2N9X A;  4WAA A;  2GOW A;  1ISN A;  3RCZ A;  3KH0 A;  1FFV A;  2IY0 B;  2RSU A;  2PTL A;  2IY1 B;  2INP E;  4NY0 A;  1LQB A;  2WQY B;  1Y8R C;  4C4V B;  2NR2 A;  1YOV B;  3B9J A;  2ZJD A;  1I42 A;  1A70 A;  3OWE B;  4I6L B;  5AZF A;  1TZO A;  4FLH A;  4RF1 A;  1CMX B;  3QIJ A;  2V3P A;  4TKN A;  1TT5 B;  1ZGU B;  3CST A;  2NBU A;  3BY4 B;  2RR9 A;  3DDC B;  4TSS A;  2KTR A;  1KF6 B;  1E8X A;  1KOT A;  1HA5 A;  2IDY A;  2N1V A;  3QCA A;  4W9F A;  3PV1 A;  1VRA B;  2LGS A;  1TS5 A;  3A9J B;  4G0N B;  4TV3 A;  2YLM A;  5BMI A;  4MJS A;  3RNC C;  2M19 A;  3PRM B;  2LUE A;  5H92 C;  4NAW B;  3ZTD A;  1ZE3 D;  3TEZ A;  3P4P B;  3KLS X;  2LRU A;  1ENF A;  1UBI A;  2CU1 A;  2BYF A;  2J4X A;  2JWZ A;  5BO4 B;  4M0W B;  3U30 A;  2BTE A;  2O2V A;  1DOI A;  5HFY A;  3SDL C;  2K1F A;  2EEL A;  4GXB A;  4WQO B;  1E0Z A;  3ZQ4 A;  5HG2 A;  2WXN A;  1VCB A;  1ZUD 2;  3OJ4 B;  2ZPN A;  3I5J C;  2MSE D;  3BK1 A;  1WJ6 A;  4XDD A;  3GZN B;  1N60 A;  1ZDX A;  4OVV A;  1A5R A;  3PT2 B;  2WXH A;  4OZA A;  1BT0 A;  1I4H A;  1I4X A;  2BWE S;  2DZJ A;  3AEG B;  2IND C;  1ACC A;  1I4R A;  3SU8 X;  4KDI C;  1JWA D;  3Q8F A;  3KUZ A;  2WXI A;  1S1Q B;  2K8H A;  2WYQ A;  3U7D A;  2WXP A;  3V6E B;  3TMP B;  2V0G A;  5J18 A;  2BS4 B;  4G50 A;  3RNE C;  2MBE A;  1OFF A;  4FJZ A;  4X57 B;  3L08 A;  3O13 A;  1E8Z A;  4YSX B;  2NVU I;  3H6N A;  2WXL A;  1WXS A;  4DWF A;  2WXF A;  4XWT A;  4EOY A;  5BMH A;  3QAR A;  2CJO A;  3AV8 A;  2K8B A;  4Q2J A;  3MC9 A;  3MJ5 A;  1XLP A;  5I4D A;  4DXG A;  1ZOY B;  3UF8 A;  3NVV A;  4W9D A;  3D32 A;  3H7S A;  3APC A;  1VD2 A;  1NDD A;  1WIA A;  5LXI B;  1MI0 A;  3AED B;  1P98 A;  4UDU C;  4HCN B;  4EFO A;  1XCT L;  2Z0E B;  4DHJ D;  1FEH A;  2VH2 A;  4WJP A;  1IP9 A;  3TCA A;  4EUT A;  2NBW B;  2DWQ A;  4AS1 A;  3AXC A;  1AN8 A;  1FMA D;  2LAS A;  1EO6 A;  1RAX A;  4ZRK A;  3VH3 B;  3SD5 A;  3KUD B;  4GSW A;  2VZK B;  4EZK A;  2ZW0 A;  4JLC A;  2C7N B;  2ZCB A;  3Q8B A;  3ZTC A;  3AN1 A;  2PMV A;  3AEF B;  4HRS A;  3TIX A;  5KHO A;  1WZ0 A;  3LXF A;  1XLO A;  3BZD B;  2BWF A;  4L1B A;  5D2M B;  4MGI E;  2JU6 X;  2JY6 A;  4P16 A;  5AZH A;  3QQ8 B;  3KYD D;  1E7V A;  4W9E A;  3A4R A;  4M01 A;  5CHF A;  1FM0 D;  3ZGZ A;  1RM6 C;  4KGT A;  1I4P A;  1UUP A;  2NPT A;  2R2O A;  5J17 A;  2ACZ B;  5AUK A;  4LJO B;  4C56 C;  2KZR A;  1C79 A;  1E5W A;  2LVO A;  5EDS A;  5G5H A;  5JHB A;  2Z59 B;  2M1M A;  1WFY A;  3DWG C;  4M02 A;  3Q8C A;  1F52 A;  4BKS A;  2ONQ A;  2WXO A;  3PZ8 A;  2OOB B;  2R2Q A;  1IPG A;  2MA9 B;  4DXA B;  1WYG A;  1GB4 A;  3DCG A;  4ANX A;  4GDK A;  1NEK B;  1FO4 A;  3L17 A;  3RD2 A;  3GP7 A;  1SBB B;  4AJW A;  2KLG A;  1QZE A;  1WRD B;  1AAR A;  1OEY A;  2AYO B;  4YXD B;  3DOW A;  1C3T A;  1WGK A;  2KFK A;  2MBB B;  3IT6 B;  2KWV B;  4E74 A;  1UF0 A;  3CF6 E;  2BYE A;  2DNF A;  3VFK A;  1GC6 A;  2PVO D;  1YQ4 B;  1T6B X;  3LDZ E;  2KQS A;  1KM7 A;  1E9M A;  2DBY A;  2KVR A;  1WGG A;  2KTR B;  1Z2M A;  2MCN B;  1F2R C;  1PDX A;  1CK1 A;  3PPA A;  3VTU A;  2WXR A;  5TSS A;  1ROE A;  3AH7 A;  2D3A A;  5T8I A;  4C4V A;  2FNJ B;  2J52 A;  4F8C B;  2QIL A;  4IW0 A;  2EKE C;  2JX5 A;  3IT4 B;  1N5X A;  1XEE A;  5LLI A;  1FXI A;  2M8S A;  4OZC A;  3UQB A;  2ZZP B;  3ZJU A;  4XE0 A;  4KKI A;  2LJ5 A;  2DYM A;  1SE4 A;  1EWY C;  4HCP B;  2RMM A;  4KVG B;  2WXJ A;  3BYT B;  1SE9 A;  5GXG B;  3TJP A;  3B2G A;  2V4L A;  1N62 A;  4IM0 A;  2D2Q A;  2J0M A;  3CIR B;  1NI3 A;  2KKC A;  1K53 A;  2IO3 B;  2O6V B;  1DYQ A;  2CR5 A;  3H7P B;  4A6Q A;  3IFW B;  3A9J A;  4ARI A;  3GB1 A;  3AUL A;  3Q6B A;  2KDM A;  1PGX A;  3IG3 A;  4NAW A;  4WH4 A;  3ZJV A;  2ZW1 A;  1T0Q C;  1E8Y A;  4FXC A;  2LVP A;  4XWW A;  4MGY E;  2JSV X;  4M0W A;  1EU4 A;  1I7H A;  4HWI B;  1SE3 A;  4BKG A;  4RNA A;  2FCS A;  3TEX A;  3L16 A;  4FUL A;  1WF9 A;  1K8R B;  1FCC C;  1SIF A;  5EE9 A;  4LNO A;  3SFE B;  4A9A A;  3LJ3 A;  1V1O A;  4W9I A;  2C9W B;  5EE1 A;  1C1Y B;  4RGN A;  4W9L A;  4I6P A;  5FR3 A;  5E6J A;  4IDI A;  5G5G A;  3U4E G;  1UWX A;  4AUQ C;  4C00 A;  2CS4 A;  5JH5 C;  4RM9 A;  3GS2 A;  4IOI E;  2KDB A;  2V3N A;  3R3M A;  4MGZ E;  4ACF A;  2ZNV C;  3TSS A;  3ZVV A;  2WDQ B;  1F2R I;  2KX0 A;  5CHW A;  5HI1 A;  3RUI B;  2WDT B;  3HRD D;  3V6C B;  1H4R A;  1YD8 U;  4N6E B;  2LXC A;  2JZP A;  3ZIM A;  2HTH A;  1IUE A;  4ZRP A;  3HVD A;  1ESF A;  3KYC D;  4ZOH C;  3GZN I;  2DEN B;  3A9K B;  2QCZ A;  1HTO A;  5KHQ A;  3O65 B;  2K6Q A;  2GBR A;  3AE6 B;  2EMS A;  3RFZ B;  4PS8 A;  4TQ0 A;  1HE8 A;  4LNF A;  3AEE B;  1YX5 B;  5EE3 A;  5DPS A;  3RI7 C;  1K51 A;  3MP9 A;  2BT6 A;  4FHK A;  1LXD A;  2J42 A;  2IYD B;  2FCQ A;  2XK5 B;  2DLB A;  2KN5 A;  1WM3 A;  3MTN B;  4MSM B;  3UIO B;  4OVZ A;  3AU5 A;  2LI5 A;  3R8B A;  3VR8 B;  1JRU A;  3C8Y A;  4GLS C;  2NS5 A;  1OQY A;  4K3C A;  4RGM A;  2L52 A;  1QLB B;  4HK2 A;  2NBV B;  3AE1 B;  2HDE A;  4YT0 B;  2XNA C;  4P6V F;  1IGD A;  3ZNZ B;  3V3X A;  2LRW A;  5BYR A;  4NPN A;  3ZNH B;  4DHJ B;  2BVC A;  2JRH A;  2KX3 A;  2LGY A;  2MEK A;  3AMZ A;  4HXD A;  1J7C A;  4R3D A;  1Q5W B;  2H88 B;  1J7B A;  2KK8 A;  2GB1 A;  4N9F 4;  4US9 A;  5BYS A;  1WM2 A;  3URY A;  2LEK A;  4N59 A;  4JGH B;  3WAO A;  1WGR A;  1YX6 B;  2N9E B;  3NUH B;  1XXG A;  3WCQ A;  3P4R B;  1NVI D;  1I4Q A;  3WAP A;  2W54 A;  3TBL D;  4GDK B;  5E6N A;  4AWJ A;  1P3Q U;  1OTR B;  2MLB A;  1B1Z A;  1HEZ E;  1WWT A;  1YN3 A;  4MEM A;  1KLG D;  4B0M A;  1WY8 A;  2N9P C;  3FKY A;  5D6J B;  1GG3 A;  1QQR A;  2WX0 A;  4H2A A;  4BVU C;  2N7J A;  3B2F A;  3Q14 C;  1YNT E;  1D4B A;  3KWL A;  3HIZ A;  2QIE B;  1PFD A;  1JAL A;  4LLG M;  1VZ8 A;  5TR5 A;  3QWZ B;  1LGR A;  1C9F A;  2QEJ C;  4TQ1 A;  1PYW D;  1VZ6 A;  3Q3J A;  1RYJ A;  1WE6 A;  1GB1 A;  2KD0 A;  3L0W B;  2O6V D;  1R4M B;  4IWP A;  4BBN F;  4FJV B;  4K7S A;  1F1H A;  3PSE B;  1TS2 A;  2PJH A;  3TEW A;  3A4S C;  2INC C;  2C60 A;  2MP2 B;  3R66 C;  1FNV A;  1R4N B;  4II2 B;  3VRB B;  2BBC A;  4DDI D;  5DPT A;  3VHT C;  3ML9 A;  1N61 A;  4K7W A;  2JZ3 B;  2Y5B B;  1JCK B;  2WNM A;  3B08 A;  1OQQ A;  5BYQ A;  1N5W A;  3SEB A;  4W9J A;  2MJD A;  4DQO C;  1KFY B;  2AX5 A;  3W1Y A;  1MHH E;  3L4P A;  4AQ7 A;  2BB5 A;  2K0P A;  5IP4 D;  3NS8 A;  3AEC B;  2DAJ A;  2N1W A;  1YJJ A;  1J7A A;  4PK1 A;  4ZYN A;  4HEA 1;  4NQL B;  2BKF A;  2N9K A;  2O6V A;  1SIJ A;  2N7D A;  2ZPY A;  3H7P A;  4HJK A;  4RF0 A;  3TEY A;  4OW0 A;  2K3U A;  2WP9 B;  1ET9 A;  4BBN C;  1V81 A;  2R61 A;  3VR9 B;  2EKI A;  4YSZ B;  5E6O A;  4LK0 M;  2VH1 A;  4NJ7 A;  3BWU D;  3ZDT A;  1U4A A;  3I3T B;  3GE8 C;  4KDL B;  1YJ1 A;  1YQB A;  2FCM A;  3ZNI D;  3IBE A;  4F1S A;  2HD5 B;  1T0Y A;  1L4Z B;  4DDG D;  1F77 A;  1FXA A;  4ZYS A;  2KVZ A;  5D3D A;  1L0X B;  1V86 A;  3V61 A;  5LXH A;  3PHX B;  1WX9 A;  4ASW C;  1Z5S B;  3Q3F A;  1QOG A;  3VQI A;  5AEK B;  2DAF A;  2J7Q B;  3T8M A;  1XLQ A;  4EE2 A;  1C4A A;  2L8J A;  1E8W A;  3P63 A;  2KO3 A;  3KQ4 A;  3Q3O C;  1ZPS A;  1AWD A;  1N63 A;  3BYY B;  4GMV A;  1L2N A;  2KJ6 A;  4IWO A;  3X23 A;  1JW9 D;  2KAC A;  1RRB A;  2ICI A;  4A90 A;  4HDQ A;  1WSP A;  4ZHO A;  3NVW A;  1V97 A;  2KFJ A;  3V05 A;  4IG7 B;  1L0V B;  1KTK A;  4YTP B;  1NBF C;  2D3G A;  1L4D B;  4FBJ B;  2BS3 B;  2ZNV B;  2RDG A;  3A1Q B;  3BK2 A;  1L0Y B;  3A9K A;  3P1M A;  2K6D B;  1UH6 A;  2JVC A;  1L6U A;  5CHV C;  4A3P A;  2LD9 A;  4F7Z A;  2VRR B;  5FR6 A;  5JZE B;  2LZ6 A;  1I4G A;  2JF5 A;  3QHT A;  1YN5 A;  3M62 B;  1MHX A;  2BKR B;  2Q5W D;  4II3 B;  3LYY A;  2I2Y A;  1V1P A;  1WXA A;  4GDL B;  3RNG C;  3OJ3 A;  1RLF A;  3EHV A;  4NAM A;  3SR6 A;  1HZ5 A;  3NVZ A;  3I57 A;  1E10 A;  2XK5 A;  5BMG A;  1Q1O A;  2BB6 A;  3PHW B;  1DOY A;  2JT4 B;  4XDC A;  1QIL A;  4YL8 A;  3H8H A;  3AU4 A;  4WJQ A;  4IKG A;  2G45 B;  2AQ2 B;  1DOX A;  5D3I B;  2G3Q B;  3DBH B;  3RNF C;  1TGZ B;  2QHO A;  1VDV A;  1TBE A;  1E6E B;  4NZL B;  3JSV B;  4WJN A;  2KMM A;  1WMH B;  2KDF B;  4JWS C;  4FJY A;  1G6J A;  2C5L C;  2BYV E;  2UU7 A;  4NNJ B;  3L10 B;  2Y5C A;  1V8C A;  1QKZ A;  2G4S A;  2AQ3 B;  5L95 C;  3ECI A;  2BGF A;  1VJK A;  1WR1 A;  1D6E C;  4KSL C;  3PRE A;  3M3J A;  4C80 A;  1NI2 A;  1C4P A;  2FAZ A;  1UZX B;  1GUA B;  2PPH A;  2RD0 A;  2W55 A;  3T9L A;  1JQ4 A;  4WWN A;  3AEB B;  3QC8 B;  3Q8E A;  5HHD G;  1SB3 C;  3DVN U;  4HKZ E;  2QJL A;  2BPS A;  3ML8 A;  4ARC A;  1WX8 A;  3ZKJ C;  4HDO A;  2LGD A;  3JYU A;  5IAA C;  2FUH B;  1FFU A;  1L5P A;  4HLE A;  1C78 A;  3ZO5 B;  3EUB 2;  2OJR A;  4OVU A;  3NZU A;  1XCQ L;  3T3O A;  3AE7 B;  2JUO A;  2KWU B;  2LMC A;  2IBI B;  2ON8 A;  2L32 A;  3I63 C;  2V1Y A;  4CQN A;  4A55 A;  1E90 A;  3N1X C;  2M0A A;  1FCL A;  1WYW B;  3PS6 A;  2DX5 B;  3PTF C;  4YSY B;  2AL3 A;  2MP2 A;  3CWI A;  1KH0 A;  4LNN A;  2WX1 A;  3DVG X;  1HTQ A;  3Q8A A;  4ZRQ A;  4JX1 C;  5D7G A;  1KRH A;  2KWD A;  3NZS A;  2PLP A;  1FPY A;  3L13 A;  5AZG A;  2GI9 A;  3NG0 A;  1OGW A;  2G9H D;  4YTM B;  2MBO A;  4ZHP A;  1F0Z A;  4LJP B;  3QJZ A;  1SEB D;  3VUY A;  2GRI A;  3K9O B;  4E71 A;  3ZNG C;  2K22 A;  2Y5P A;  4IC7 B;  2PIA A;  3PGE A;  4CO7 A;  3S2A A;  3R2T A;  1PUT A;  1RWS A;  2D11 A;  2DHZ A;  1FRD A;  1FNW A;  2E3T A;  4HPM B;  1R4N I;  2I1J A;  1TJE A;  2ASQ A;  2PE6 B;  3RNA C;  1TKY A;  2L76 A;  2QMT A;  2XEW A;  2E6X A;  1DGJ A;  3QAQ A;  4AOF A;  3EA6 A;  4KSK C;  4W9K A;  2IPK D;  1Y56 A;  4FHJ A;  1QOA A;  2KXJ A;  3Q2A C;  1LO5 D;  2GBK A;  2V3S A;  2LVQ A;  3BII D;  2OJW A;  2L0T A;  3WIM A;  2JXT A;  2KYW A;  2IO1 B;  4K3B A;  4PS7 A;  2LHD A;  4DHZ B;  4S0R A;  1JWU D;  4EZJ A;  2XBB C;  5E6P A;  1M94 A;  2ZCC A;  3LB8 C;  5FK9 C;  1QF6 A;  3OAW A;  3PZ7 A;  4GU2 A;  2MJ3 A;  2H89 B;  5JHA A;  2L7R A;  3AI5 A;  3WAM A;  2K39 A;  3P42 A;  3E9S A;  3WAL A;  3HUI A;  4QAY A;  1WZ3 A;  4A8X C;  2FE8 A;  4K7U A;  3IVF A;  1EWC A;  4RGT A;  3N1Y C;  4NJC A;  2MRP A;  3KWV A;  2DYO A;  2M56 B;  4MH8 A;  1D5X C;  3NS1 A;  2D3B A;  1BML C;  2YVC A;  3ZYY X;  4XC2 A;  4W9H A;  4BKT A;  2BYT A;  1ZKH A;  4RFB A;  1V1P B;  4REZ A;  2WWZ A;  1GNU A;  2G4D B;  4WAF A;  1FD6 A;  3DBR B;  1IBX B;  2CHX A;  2KC2 A;  3DVG Y;  2W3R A;  4MDK E;  3PLU A;  2LGI A;  3A1Q A;  4LNK A;  1N6Z A;  1RFK A;  3FC4 A;  3KVF B;  2AWT A;  2CHW A;  4USA A;  1J19 A;  3TL5 A;  1FNU A;  4ZRI A;  4WWP A;  3M95 A;  1H8C A;  1YJI A;  4PYU A;  1V5T A;  4BOZ B;  3UIN B;  3NRZ A;  4W9C A;  2HJ8 A;  4GDL A;  2WXQ A;  5G55 A;  2MX2 A;  2WXM A;  3ETR A;  1P1A A;  4GIV A;  1PGA A;  1QOF A;  2IGG A;  2JZZ A;  4HPL B;  3RZW C;  2B3A A;  4M8M A;  4LCD E;  4IUM B;  1WGD A;  1CZP A;  3HVZ A;  2LXA A;  4KIK B;  2D5G A;  1GC7 A;  1TKG A;  4CHK A;  1E7U A;  1WX7 A;  5IA7 A;  3IHP C;  1HQR D;  1WI0 A;  1F9J A;  1TZ1 A;  3C19 A;  4RMA A;  5FKA C;  3JSV A;  4OZB A;  4LDT D;  1WMH A;  1SGH A;  2KOX A;  1ZW7 A; 
#chains in the Genus database with same CATH homology
 3U8Z A;  4BKS A;  5C1Z A;  1T0Y A;  1V80 A;  2EMT A;  1WGY A;  2OOB B;  4DDG D;  2R2Q A;  1XQQ A;  2GMI C;  3WA0 A;  1X1M A;  3QA8 A;  4G11 A;  1V86 A;  1WJN A;  2KAN A;  3ENE A;  3V61 A;  4AP4 C;  1IPG A;  2MA9 B;  2GBM A;  4DXA B;  5LXH A;  2KTF A;  3PHX B;  1WX9 A;  3DCG A;  2J0K A;  4ASW C;  5DPW A;  4ANX A;  4GDK A;  1Z5S B;  3Q3F A;  3VQI A;  3NHE B;  2N4F A;  3L17 A;  3RD2 A;  5AEK B;  3ZUN A;  2DZM A;  2FIF A;  2DAF A;  2KQ7 A;  2MW5 A;  3APF A;  4AJW A;  2KLG A;  1QZE A;  2J7Q B;  1WRD B;  3T8M A;  1EUV B;  1MG8 A;  4GOC A;  1AAR A;  1OEY A;  2AYO B;  3DOW A;  4IWQ A;  3VAW A;  2UWQ A;  2L8J A;  1E8W A;  1WGH A;  1C3T A;  2KFK A;  5D94 A;  2MBB B;  3DBH I;  2KO3 A;  2BF8 B;  3UQA A;  2KWV B;  4E3C A;  3EFU A;  4E74 A;  3CF6 E;  3DPD A;  2BYE A;  3VFK A;  1GC6 A;  4GMV A;  4GN1 A;  3RUL A;  1L2N A;  4FN2 A;  3LDZ E;  4JL9 A;  2KJ6 A;  2KQS A;  4IWO A;  3VH4 B;  1KM7 A;  3X23 A;  4DK5 A;  1L7Y A;  2PEA A;  1RRB A;  3QX1 A;  5C23 A;  2KVR A;  4HDQ A;  2KNB A;  1LM8 B;  4MSQ B;  1WGG A;  1EF1 A;  2KFJ A;  2KTR B;  1Z2M A;  3ZW3 A;  1OEY J;  1P9D U;  2MCN B;  2L05 A;  3K9P B;  4IG7 B;  3UIP B;  5CX3 A;  3EEC A;  3PPA A;  2REX A;  3VTU A;  4XX5 A;  1NBF C;  3L54 A;  2D3G A;  4FBJ B;  3BIN A;  2ZNV B;  2J0J A;  3A1Q B;  2FNJ B;  2KHW B;  3A9K A;  3H1U A;  2FID A;  4P7I A;  4A3O A;  2K6D B;  1UH6 A;  2KMC A;  1UGM A;  2JVC A;  4IW0 A;  2EKE C;  2GBJ A;  4F8C B;  5L83 A;  5CHV C;  4A3P A;  2LD9 A;  5LLI A;  4IM2 A;  3UQB A;  2M8S A;  2ZZP B;  1YIW A;  4F7Z A;  2VRR B;  2LJ5 A;  2DYM A;  4EKU A;  4K81 A;  5FR6 A;  4ICV A;  4BFR A;  5JZE B;  1UBQ A;  2LZ6 A;  3QHT A;  2JF5 A;  1I35 A;  2C7H A;  3JW0 X;  3M62 B;  2CKH B;  4HCP B;  2MWS B;  4KVG B;  1XT9 B;  2BKR B;  4NQK E;  1SE9 A;  2MBQ A;  4II3 B;  3TJP A;  2V4L A;  3KUC B;  3WAN A;  4CYE A;  1WXA A;  4IM0 A;  4G3X B;  4GDL B;  2D2Q A;  3A33 B;  3OJ3 A;  2J0M A;  5J2R A;  2KKC A;  3VDZ A;  4BOS C;  2IO0 B;  1RLF A;  2IO3 B;  3EHV A;  5HKH A;  2O6V B;  2Z0D B;  4ANV A;  2CR5 A;  3W1S C;  3H7P B;  4J6I A;  3IFW B;  4DBG A;  4WWO A;  2XK5 A;  3A9J A;  1Q1O A;  3PHW B;  4RM8 A;  1UEL A;  2JT4 B;  3AUL A;  2NPT B;  4YL8 A;  2KMA A;  4WJQ A;  3AU4 A;  4B9K A;  3DBL I;  2L0F A;  3IG3 A;  2G45 B;  3P2B A;  4NAW A;  3ZLZ A;  3ONS A;  5GMV A;  3ZRF A;  1V6E A;  2G3Q B;  2MQJ A;  1TGZ B;  1WR6 E;  2M4N A;  2QHO A;  1E8Y A;  1TBE A;  1V9J A;  1IYF A;  2LVP A;  4B6W A;  4MGY E;  1V5O A;  3JSV B;  4WJN A;  4HWI B;  2UYZ B;  1WMH B;  4BKG A;  4GB9 A;  2KDF B;  4MGK E;  1RFA A;  4FJY A;  2FCS A;  1G6J A;  2C5L C;  2BYV E;  3C0R B;  4NNJ B;  3DVN V;  3HM3 A;  3L10 B;  3L16 A;  4FUL A;  1WF9 A;  1K8R B;  2G4S A;  1SIF A;  5L95 C;  3ECI A;  3LJ3 A;  4W9I A;  2C9W B;  2KDI A;  1C1Y B;  2N7E A;  2A5U A;  2BGF A;  4ICU A;  4W9L A;  5DCN A;  1WR1 A;  4I6P A;  4KSL C;  2JPH A;  3PRE A;  3M3J A;  4B95 A;  1P0R A;  1NI2 A;  2IZV B;  1WJU A;  2FAZ A;  3VUW A;  2RPQ A;  4EEW A;  1UZX B;  1GUA B;  2PPH A;  2IO2 B;  2RD0 A;  3T9L A;  4AUQ C;  4WWN A;  1PQS A;  2CS4 A;  3QC8 B;  2KDE B;  3DBS A;  5JH5 C;  4RM9 A;  3H9D A;  3DVN U;  2D10 A;  2DYB A;  3ALB A;  2KDB A;  2KFK B;  3R7Q A;  3R3M A;  4MGZ E;  2BPS A;  3PVL A;  3W1S A;  3ML8 A;  1WXV A;  1S3S G;  1WX8 A;  2ZNV C;  3VTV A;  3ZKJ C;  1WJ4 A;  4ANU A;  4HDO A;  3ZVV A;  2CHZ A;  2KX0 A;  2JXX A;  2LGD A;  3EC8 A;  5CHW A;  3QK0 A;  4ZDV A;  5DPR A;  2D07 B;  3RUI B;  3SHQ A;  3JYU A;  2WDT B;  5IAA C;  2FUH B;  3X0W A;  3PZD A;  4JIO U;  3V6C B;  1H4R A;  1YD8 U;  3B1L X;  1WH3 A;  3RT3 B;  4HLE A;  2LXC A;  3ZO5 B;  2N9X A;  3ZIM A;  2HE7 A;  3HHM A;  4WAA A;  2GOW A;  2OJR A;  1ISN A;  2HTH A;  3NZU A;  4OVU A;  3RCZ A;  3KH0 A;  2IY0 B;  2JUO A;  2KWU B;  2KLC A;  2RSU A;  3VVW B;  3KYC D;  2IBI B;  2IY1 B;  2L00 B;  4HVB A;  4A20 A;  3MHS D;  4NY0 A;  3GZN I;  4URK A;  1LQB A;  4F1S A;  1Y8R C;  2DEN B;  3A9K B;  2NR2 A;  2V1Y A;  3UGB B;  2ZJD A;  5KHQ A;  1V49 A;  4I6L B;  1I42 A;  1E90 A;  3O65 B;  1WYW B;  5AZF A;  3PS6 A;  2DX5 B;  2K6Q A;  3PTF C;  2AL3 A;  2GBR A;  2MP2 A;  4FLH A;  1CMX B;  4EZL A;  2WX1 A;  3QIJ A;  2PE9 A;  2EMS A;  4KV2 A;  3DVG X;  4PS8 A;  4TKN A;  4TQ0 A;  1HE8 A;  1ZGU B;  3CST A;  5D7G A;  2NBU A;  3BY4 B;  1YX5 B;  4PYZ A;  2RR9 A;  3DDC B;  3VXW A;  5DPS A;  2KTR A;  3NZS A;  1E8X A;  3L13 A;  5AZG A;  1KOT A;  1V2Y A;  4BKS D;  3R7R A;  2M0X A;  1OGW A;  2A4Z A;  2N1V A;  4FHK A;  3QCA A;  4W9F A;  3PV1 A;  4NJ6 A;  2MBO A;  1LXD A;  4MSM B;  2IYD B;  2FCQ A;  2XK5 B;  4LJP B;  2KN5 A;  1WM3 A;  3A9J B;  3MTN B;  3QJZ A;  4G0N B;  4TV3 A;  3UIO B;  3N32 A;  3VUY A;  3AU5 A;  2LI5 A;  2YLM A;  3K9O B;  4MJS A;  3ZNG C;  4E71 A;  1D3Z A;  3PRM B;  2LUE A;  3HK0 A;  4IC7 B;  1JRU A;  4NAW B;  3CMM B;  3ZTD A;  3PGE A;  4CO7 A;  4PS3 A;  3S2A A;  2NS5 A;  1OQY A;  2D11 A;  4KZC A;  2LRU A;  2DHZ A;  4MEL A;  1EF5 A;  1UBI A;  2CU1 A;  2BYF A;  2KWC A;  2NBV B;  4HK2 A;  2JWZ A;  4HPM B;  5BO4 B;  3VTW A;  1R4N I;  4M0W B;  2I1J A;  2LGX A;  2NCN A;  4MM3 A;  3U30 A;  2ASQ A;  2O2V A;  3ZNZ B;  2LRW A;  2PE6 B;  2RGF A;  4NPN A;  3ZNH B;  4DHJ B;  1WE7 A;  4FAD A;  2JRH A;  2KX3 A;  2LGY A;  2L76 A;  3SDL C;  4HXD A;  2K1F A;  2KJR A;  4GXB A;  4WQO B;  1Q5W B;  2XEW A;  1VCB A;  2KK8 A;  4N9F 4;  3OJ4 B;  3NOB A;  1WM2 A;  2ZPN A;  3QAQ A;  2ZVO A;  4AOF A;  4JGH B;  3WAO A;  2MSE D;  4K1R B;  4KSK C;  1WJ6 A;  4W9K A;  5CTR C;  1WGR A;  1YX6 B;  2N9E B;  4IM3 A;  2K8C A;  3DBR I;  3JVZ X;  4FHJ A;  2KXJ A;  4OVV A;  1A5R A;  3WAP A;  3PRZ A;  3PT2 B;  2GBK A;  3TBL D;  2V3S A;  2LVQ A;  4GDK B;  4WJO A;  4AJY B;  1BT0 A;  2BWE S;  2L0T A;  3WIM A;  5E6N A;  4AWJ A;  1P3Q U;  2DZJ A;  1OTR B;  2ZEQ A;  4KIK A;  2MLB A;  1J8C A;  2IO1 B;  3N30 A;  3SU8 X;  4KDI C;  3KUZ A;  1S1Q B;  2K8H A;  2WYQ A;  3U7D A;  3V6E B;  3TMP B;  4MEM A;  4MH0 E;  4PS7 A;  1WY8 A;  2N9P C;  5D6J B;  1GG3 A;  5J18 A;  4DHZ B;  4G50 A;  4EZJ A;  5EDS A;  2WX0 A;  4BVU C;  2MBE A;  2XBB C;  3KW5 B;  5E6P A;  1M94 A;  2ZCC A;  3OAW A;  4FJZ A;  4X57 B;  3L08 A;  4GU2 A;  1E8Z A;  3HIZ A;  2NVU I;  5JHA A;  2L7R A;  3AI5 A;  3H6N A;  3WAM A;  3CSF A;  1WXS A;  2K39 A;  3QWZ B;  5TR5 A;  4DWF A;  4FA6 A;  3WAL A;  4EOY A;  1WZ3 A;  1GJZ A;  2JRI B;  4TQ1 A;  3QAR A;  3Q3J A;  4K7U A;  3VUX A;  3IVF A;  3M63 B;  1WE6 A;  2KD0 A;  3L0W B;  3N3K B;  2K8B A;  1WXM A;  2O6V D;  4IWP A;  2K25 A;  4BBN F;  4FJV B;  2MRP A;  4K7S A;  2DYO A;  1KJT A;  1UD7 A;  3PSE B;  2PJH A;  3A4S C;  3UF8 A;  2C60 A;  2MP2 B;  4LDT B;  3D32 A;  3R66 C;  4W9D A;  3H7S A;  3APC A;  3MJW A;  2YVC A;  4II2 B;  1VD2 A;  3RYT A;  4XC2 A;  3APD A;  2GBN A;  4W9H A;  4DDI D;  1NDD A;  4BKT A;  5DPT A;  1WIA A;  3VHT C;  3ML9 A;  5LXI B;  3OLM D;  4K7W A;  2JZ3 B;  2Y5B B;  1P98 A;  2LWP A;  4HCN B;  4EFO A;  1FXT B;  4JQW C;  2AL6 A;  3B08 A;  4XZ4 A;  4ANW A;  1ZKH A;  4DHJ D;  2Z0E B;  3B0A A;  4WJP A;  1IP9 A;  2W9N A;  4GGQ A;  3TCA A;  4EUT A;  2WWZ A;  1GNU A;  2G4D B;  2NBW B;  3V62 A;  4W9J A;  2CHX A;  2KC2 A;  3DVG Y;  3AXC A;  2KC1 A;  1Q0W B;  3HM6 X;  3PLU A;  4MDK E;  3ZRC A;  3A1Q A;  4MJS B;  4DHZ E;  4TUU A;  2LAS A;  1EO6 A;  1RAX A;  3W1Y A;  4KZ0 A;  4ZRK A;  2DZI A;  3VH3 B;  3KVF B;  3SD5 A;  2AWT A;  2CHW A;  3KUD B;  4ZRJ A;  1J19 A;  1R4M I;  4GSW A;  3PLV A;  3TL5 A;  4EZK A;  1TTN A;  4ZRI A;  4WWP A;  3M95 A;  1KLV A;  1H8C A;  4JLC A;  2C7N B;  2ZCB A;  3ZTC A;  3NS8 A;  2O2V B;  4PYU A;  2L3Z A;  1V5T A;  2DAJ A;  4BOZ B;  3UIN B;  3TIX A;  2N1W A;  5KHO A;  4W9C A;  4M8N A;  2HJ8 A;  1WZ0 A;  4GDL A;  2BWF A;  4ZYN A;  4NQL B;  5D2M B;  4MGI E;  2BKF A;  2JY6 A;  5AZH A;  2O6V A;  3QQ8 B;  3DQV A;  3KYD D;  1E7V A;  2N7D A;  4W9E A;  2ZPY A;  3A4R A;  2MX2 A;  3H7P A;  5G55 A;  4HJK A;  5CHF A;  3NY5 A;  1J0G A;  1P1A A;  2DZK A;  3PRP B;  4GIV A;  1LFD A;  2I1K A;  2JZZ A;  2NPT A;  2R2O A;  4HPL B;  2ZVN A;  4BBN C;  1XD3 B;  5J17 A;  4I6N B;  3RZW C;  2B3A A;  4M8M A;  1V81 A;  3GOE A;  4LCD E;  4IUM B;  1WGD A;  2M17 A;  2MBH A;  3V60 A;  4LJO B;  2LXA A;  4KIK B;  5E6O A;  4NJ7 A;  3RZF A;  2KZR A;  1GC7 A;  4W9G A;  2C7M B;  4CHK A;  1E5W A;  1E7U A;  2KJH B;  2LVO A;  1U4A A;  1WX7 A;  3I3T B;  3ZDM C;  3ZDT A;  3IHP C;  4KDL B;  1YJ1 A;  1YQB A;  1WI0 A;  5IA7 A;  1F9J A;  1TZ1 A;  4RMA A;  5G2N A;  2FCN A;  3JSV A;  4LDT D;  2FCM A;  1WMH A;  3ZNI D;  5JHB A;  2Z59 B;  1SGH A;  1WFY A;  2M1M A;  2KOX A;  3IBE A;  2AEH A;  2HD5 B;  1ZW7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...