2IYDB

Senp1 covalent complex with sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
b'NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Senp1 Native Structure
rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iydB00
4HJKA 1GG3A 2ZCBA 3ZNID 1UBQA 5JH5C 1D3ZA 2KJHB 2DAFA 3BINA 2KWVB 1U4AA 2K8HA 4KIKA 5CHVC 4CHKA 2GBNA 3DBLI 4KV2A 4URKA 4GN1A 3VXWA 3RYTA 3RZFA 3VH3B 4IM0A 1KJTA 2LGXA 2KN5A 3QCAA 4W9JA 3ZNHB 3JYUA 3VFKA 3CMMB 1V80A 4FJVB 3PS6A 4WJPA 4DXAB 2DZMA 2KANA 3QAQA 3QJZA 2ZVOA 4M8MA 5KHOA 2MX2A 2V3SA 2DZKA 3DBHI 2KLGA 2KX3A 3VUXA 1KM7A 1WXAA 2ZNVC 4LDTB 3RT3B 4TV3A 4NJ7A 2B3AA 4G0NB 4W9LA 3NOBA 4GDLB 3L0WB 3PRPB 1YJ1A 1TZ1A 3WANA 2AEHA 2K8BA 3ZUNA 3N3KB 3HHMA 3NHEB 4JGHB 2RR9A 3X0WA 2N1VA 3NS8A 3TL5A 1GC6A 2IBIB 4JQWC 4B9KA 2KFJA 1AARA 2MBBB 4RM8A 2KDBA 3WIMA 2QHOA 3PRMB 3TIXA 5AZHA 3M95A 2HD5B 5CHWA 4CO7A 3H6NA 3N32A 4MEMA 4BOSC 3JW0X 1WJ4A 2DZIA 2KO3A 4DK5A 1G6JA 1LQBA 3OJ3A 3VTWA 1YX6B 2CHXA 1RLFA 1LFDA 4HWIB 2NBWB 4NNJB 2KDIA 2D3GA 2NBUA 2M1MA 4II3B 1Q5WB 4G3XB 3VUYA 5C23A 1E90A 3OJ4B 3JSVB 3H9DA 5DPTA 4HDOA 2C60A 4G50A 1A5RA 1BT0A 4WWOA 1YIWA 2LVPA 2MA9B 4PS3A 4E74A 3PHXB 5FR6A 3H7PB 2L7RA 2LGDA 4TKNA 4PS8A 3V6EB 1MG8A 3AU4A 4EZLA 3HM3A 4HPLB 3DBSA 3ZRFA 1OEYJ 3N30A 4DWFA 3V6CB 3BY4B 4HLEA 2G45B 2JRIB 2ZZPB 2AL6A 1M94A 3APDA 3SHQA 1S1QB 4HVBA 2KC2A 5J17A 3KUZA 1WX8A 2M0XA 2OJRA 2O6VA 4IWQA 4BVUC 1H8CA 3KW5B 1F9JA 5L95C 2HTHA 2KJRA 2WWZA 1V5TA 2ASQA 2EMTA 1UH6A 2MCNB 1IPGA 5G55A 4B95A 1WGGA 2PPHA 2BYEA 4ZRKA 4NAWB 3CSFA 4W9FA 2BKFA 3R7QA 3UINB 2AWTA 2ZEQA 1Z2MA 2LWPA 2K6QA 3EHVA 3PHWB 2G3QB 3OLMD 4EOYA 2KTFA 4HXDA 3ZNZB 2BWES 2YLMA 1LM8B 4PYZA 3TCAA 2J0KA 4MGYE 3MTNB 2ZPYA 4X57B 2NPTA 5EDSA 2LVOA 2JRHA 3VAWA 5IAAC 2GBJA 2FUHB 1IP9A 2BGFA 2DZJA 3OAWA 3QWZB 4AJWA 2Z59B 3DVGY 3WAMA 2C5LC 4FJZA 1V2YA 1X1MA 2L3ZA 2LD9A 2C7NB 2LGYA 1I35A 3TJPA 4GMVA 3UF8A 2G4SA 2RSUA 2C7MB 4W9GA 3U8ZA 1WGRA 1S3SG 1IYFA 1H4RA 2KX0A 3TBLD 4RMAA 5DPSA 2JVCA 3QX1A 2HE7A 1WZ3A 3ZO5B 4ANUA 4BOZB 3ALBA 3VTUA 4PS7A 2LXCA 3AXCA 3PTFC 2DYOA 3QC8B 2KTRA 2CS4A 3A4SC 3RULA 3PV1A 2FCNA 5HKHA 2KZRA 2N1WA 2XK5A 3KUDB 1R4MI 1WR6E 4EUTA 1ZKHA 2N9EB 5AEKB 1Q0WB 1V49A 1V9JA 2KMAA 3GZNI 1SGHA 4TUUA 2UWQA 4GSWA 4GDKB 3QIJA 4ICVA 3M62B 4NY0A 3ONSA 2MP2A 3DPDA 3LJ3A 5LXHA 1E7UA 4IM2A 1KOTA 4IWOA 3SDLC 2RPQA 5LXIB 1E8ZA 1PQSA 1WXSA 2DYMA 2NS5A 2ZPNA 5D2MB 2K6DB 3W1SC 4HCNB 1EF5A 3A9JA 1Q1OA 3P2BA 3ECIA 1P1AA 3MJWA 4J6IA 4KIKB 3U30A 4LDTD 1YQBA 2BYVE 2NR2A 3A4RA 3ML9A 4KZCA 3W1YA 4A3PA 1JRUA 3PZDA 1L2NA 3VVWB 2KWUB 5TR5A 1XT9B 1P9DU 3PSEB 1K8RB 4IUMB 2KQ7A 2KQSA 3HK0A 2YVCA 4YL8A 3DVGX 2RGFA 2LJ5A 5E6PA 1GUAB 4DBGA 5IA7A 2LZ6A 4EKUA 2W9NA 4LCDE 3ZIMA 2D2QA 5DCNA 4KSKC 2JUOA 2CKHB 1XD3B 2EMSA 3X23A 2MQJA 3ZRCA 2JY6A 3L17A 1SIFA 3WALA 1OGWA 3PGEA 4KSLC 4DHZB 1WGDA 2LRUA 3PRZA 3GOEA 2DAJA 1V6EA 2BYFA 3VTVA 4W9DA 4MJSA 2O2VA 3KVFB 2MBEA 2L05A 4AOFA 1WRDB 4EZJA 2MBOA 3JVZX 1OTRB 1E8XA 3AULA 3VDZA 2IY0B 3WAOA 2JZ3B 3H1UA 4WAAA 1WY8A 2AYOB 2J7QB 4ZRIA 4FHKA 2L0FA 2FNJB 2XEWA 4K7UA 3KYDD 4NQKE 1RAXA 1UGMA 1UD7A 5D7GA 2FCQA 4GU2A 2OOBB 1EF1A 3UIOB 2PE9A 1CMXB 3WAPA 3DCGA 4FADA 3IG3A 4ANWA 4ICUA 4NPNA 2KC1A 1NBFC 2MWSB 2GOWA 2L0TA 4IM3A 2DX5B 2N4FA 1WGHA 2PE6B 3PLUA 4XZ4A 1WM3A 1WR1A 2WX0A 2NVUI 5CTRC 3A1QA 4K7SA 2MBHA 2N7DA 3L13A 3A9KA 4HPMB 3ZDTA 5E6OA 1WF9A 2IO1B 2K39A 2KOXA 3H7SA 2JF5A 2KFKA 4MGKE 3VQIA 1QZEA 3B1LX 1V81A 2RD0A 2DHZA 1J19A 2G4DB 2JPHA 2KD0A 4ZYNA 2O6VB 2I1KA 3IFWB 2JWZA 3QHTA 2ZVNA 4N9F4 4WJNA 5CX3A 2KXJA 1XQQA 2D10A 3R66C 2LRWA 1WXVA 3TMPB 4MELA 4BKTA 4I6LB 2L76A 3UGBB 5LLIA 2AL3A 3LDZE 4GIVA 3ZDMC 3L16A 2K25A 1WMHA 3DBRI 2BF8B 4IW0A 4KDIC 4DHJB 3PPAA 5DPRA 4BBNC 2KDFB 4GXBA 4MGZE 4GGQA 1Z5SB 1ZW7A 4II2B 2BKRB 1RRBA 4AJYB 4HK2A 4OVUA 4ANXA 1WGYA 4W9EA 1SE9A 3IBEA 2JT4B 3L10B 4KDLB 4DHZE 3QQ8B 4B6WA 4MSQB 4GB9A 2Y5BB 1E8WA 3RUIB 2J0MA 5L83A 5D94A 2NPTB 4HCPB 2Z0DB 1WFYA 1UELA 1WIAA 2IO0B 3SU8X 4FA6A 2WDTB 3APCA 4A20A 3Q3FA 4NQLB 4AUQC 3MHSD 4G11A 3O65B 1NDDA 1WJUA 4KVGB 5JHBA 4FN2A 2KWCA 3ZLZA 1HE8A 1VD2A 1L7YA 3CF6E 4GDLA 4AWJA 5JZEB 4BKGA 2WX1A 1WXMA 2CU1A 4I6NB 4ZDVA 4W9HA 3PREA 1GJZA 3IHPC 4JLCA 2M4NA 2KTRB 2FAZA 1YX5B 3VUWA 4E71A 1WJNA 2K1FA 2XK5B 2PEAA 2M17A 3UIPB 2KKCA 3Q3JA 3APFA 3B0AA 2LASA 2EKEC 3DOWA 2PJHA 3DVNU 3K9OB 4WWNA 3SD5A 1V86A 1WX7A 3ZW3A 3M63B 3IVFA 2IZVB 3ZKJC 2MP2B 1FXTB 4E3CA 2WYQA 4IC7B 3DVNV 4IG7B 2R2OA 4BKSA 1WZ0A 2VRRB 4KZ0A 1YD8U 2N7EA 3QA8A 4M0WB 2R2QA 5J18A 1WX9A 3M3JA 3KYCD 3V62A 3PVLA 4DDGD 3A33B 3RZWC 1E8YA 3A9JB 4BKSD 2LUEA 4F1SA 1ISNA 2UYZB 2REXA 3JSVA 2CR5A 3DDCB 4IWPA 4MGIE 3RD2A 3C0RB 3W1SA 2V1YA 2CHWA 1ZGUB 2A5UA 4ZRJA 3U7DA 4MH0E 4NJ6A 4W9CA 1C1YB 1C3TA 1R4NI 2N9XA 1WI0A 3H7PA 5DPWA 2N9PC 2I1JA 5KHQA 3ZNGC 1T0YA 4WQOB 2C7HA 4JL9A 3HM6X 4BBNF 3VH4B 4XC2A 4TQ0A 3QK0A 1WE7A 4M8NA 3D32A 1J0GA 4P7IA 2FCMA 1WH3A 2D07B 2KJ6A 3UQBA 1P3QU 3PLVA 4JIOU 4K81A 2GBMA 2KHWB 4LJOB 1UBIA 3AU5A 4MM3A 4WJQA 1KLVA 2IYDB 3L54A 3S2AA 2ZNVB 3KH0A 1I42A 2ZCCA 4F8CB 2KVRA 2LI5A 3K9PB 2L00B 1TTNA 1GC7A 3B08A 3UQAA 1V5OA 2J0JA 2M8SA 4FULA 3V60A 1WYWB 4NAWA 4MJSB 2O2VB 4A3OA 2A4ZA 4AP4C 2JXXA 4FBJB 3I3TB 3EECA 4EZKA 5C1ZA 4W9KA 5AZFA 2FCSA 2L8JA 2HJ8A 2FIDA 2KDEB 4PYUA 4FJYA 3ZTDA 1P0RA 2NBVB 2ZJDA 3EC8A 2DENB 2Z0EB 2BPSA 1LXDA 3DQVA 4WJOA 5CHFA 4FLHA 5D6JB 4I6PA 2MBQA 1P98A 2IY1B 2MRPA 2MW5A 5BO4B 4W9IA 2XBBC 1NI2A 2IO2B 1E7VA 1WE6A 1WJ6A 4ASWC 2O6VD 1EO6A 3WA0A 4CYEA 2DYBA 3ML8A 3AI5A 3CSTA 4WWPA 4K7WA 4BFRA 1WM2A 3ZTCA 3V61A 1J8CA 3A1QB 4LJPB 2D11A 5JHAA 4DHJD 2LXAA 3A9KB 3NZSA 1VCBA 2GBKA 5G2NA 4EFOA 5AZGA 1E5WA 2FIFA 5E6NA 3ZVVA 2GMIC 2K8CA 1OQYA 2MLBA 2NCNA 2KFKB 4K1RB 3HIZA 5GMVA 4TQ1A 2KK8A 4OVVA 1RFAA 3ENEA 4GOCA 3NY5A 3VHTC 2C9WB 2JZZA 2IO3B 1Y8RC 2MSED 3RCZA 2BWFA 3PT2B 4EEWA 4FHJA 4RM9A 4XX5A 3R7RA 3NZUA 2V4LA 2LVQA 1TBEA 2CHZA 4MSMB 4F7ZA 5J2RA 2GBRA 1OEYA 1WMHB 2KLCA 1GNUA 2KMCA 3EFUA 3L08A 1TGZB 4GDKA 4MDKE 3KUCB 4ANVA 4HDQA 3T8MA 2KNBA 1UZXB 4DDID 3T9LA 3R3MA 3QARA 1EUVB
chains in the Genus database with same CATH superfamily
3H8HA 1HTOA 1HEZE 3ZJTA 5JH5C 3DBLI 5G5GA 3VXWA 5EE0A 2WP9B 3GS2A 2LGXA 1BMLC 4W9JA 1QOBA 2Z8LA 3JYUA 2FBWB 1V80A 2WU5B 1OFFA 2DZMA 2KANA 3B9JA 2ON8A 2BYTA 2ZVOA 5KHOA 2V3SA 1SEBD 1XLNA 2HJ1A 2KLGA 3E9SA 3VUXA 1KM7A 1WXAA 4NJ7A 2B3AA 1VR9A 2M0AA 4G0NB 4W9LA 1WRIA 3L0WB 1L4ZB 3PRPB 4RGNA 1YOVB 3HHMA 4KKJA 3NS8A 1FRRA 3PRMB 5CHWA 2HD5B 3TEXA 2ZW0A 1ZE3D 3P42A 3J9CA 1I4RA 2KO3A 2M19A 1LQBA 3OJ3A 3TEZA 2RDGA 1K53A 1L4DB 2M1MA 2K9XA 4G3XB 1E90A 1R4MB 3OJ4B 1YN3A 1D5ZC 1NI3A 2WNMA 4RFBA 2LVPA 4E74A 5FR6A 3H7PB 4ITKA 4HLEA 1OEYJ 1DOXA 2JRIB 1ACCA 3APDA 1ZXIA 4IKGA 3P4PB 2OJRA 4BVUC 2BBCA 2PVOD 2KJRA 2KWDA 2QSDA 3NZ3A 1I4XA 2BYEA 4ZRKA 1UGJA 3UINB 2YEPF 2AWTA 4B0EA 1UWMA 1MJDA 3PHWB 2G3QB 2KTFA 4HXDA 1IGDA 4C4VB 2ZPYA 2NPTA 2L32A 1YJIA 1ZPSA 4XDCA 3OAWA 2MJ3A 2C5LC 3WAMA 4HRSA 3AH7A 2C7MB 1V97A 1WGRA 1IYFA 4RMAA 2JVCA 4BOZB 5EE9A 1PGAA 3ALBA 3GB1A 3VRAB 4US8A 2CS4A 2Y3AA 2KZRA 2N1WA 1WR6E 4EUTA 1ZKHA 1V9JA 1SGHA 3E56A 2MP2A 3LJ3A 5IN7A 5LXHA 1E8ZA 2ZPNA 1WXSA 2K6DB 4D2KA 3W1SC 3ECIA 1P1AA 3MJWA 3A4RA 1YJJA 3VVWB 2KWUB 2QMTA 1I4HA 1N62A 3DVGX 2RGFA 3NVWA 4HKZE 2XN9C 2W9NA 2ONQA 4LCDE 2D2QA 3SFEB 1UNSA 2JUOA 2CKHB 2MQJA 4QAYA 2WXMA 2DBYA 3AECB 3PGEA 3AE2B 2DAJA 2L83A 4MJSA 2O2VA 4AOFA 1WRDB 4C7ZA 5H8YE 3JVZX 1E8XA 3AULA 4S17A 2IY0B 1FXAA 3Q2AC 4PK1A 1NVID 3KYDD 4GU2A 5BYQA 1CMXB 3WAPA 3V3XA 4FADA 3IG3A 4M02A 4RNAA 3MC9A 1NBFC 2MWSB 2GOWA 1HZ5A 2N4FA 2PE6B 2OJWA 2KQ4X 5TSSA 2WX0A 5CTRC 3WCQA 1FIQA 2MBHA 3L13A 1FRDA 3A9KA 2KACA 4M00A 3ZDTA 3RNEC 2K39A 3H7SA 3RNGC 4MGKE 2DHZA 2O6VB 3IFWB 1ZXHA 1FEHA 5CX3A 2IGGA 1WXVA 2LRWA 3TMPB 2JU6X 4BKTA 3UGBB 1FNWA 3L16A 4C7YA 1WMHA 2BF8B 1DOIA 2KDFB 4GXBA 3NUHB 4A55A 4GGQA 1Z5SB 1RRBA 4AJYB 3CWIA 2GB1A 1F77A 4GB9A 2W54A 2XNAC 3Q3MC 2GI9A 4WIPA 4A20A 1FXIA 4NQLB 4AUQC 3MHSD 4RF0A 3R8BA 1I4PA 1WJUA 2X8XX 2ZW1A 4RGMA 1CZPA 3ZLZA 1JWMD 2BVCA 3CF6E 4LNNA 4BKGA 2WX1A 3PREA 5E6JA 3IHPC 5IKCM 1WJNA 1E0ZA 2M17A 1EWCA 3B0AA 1FMAD 1VLBA 1TKEA 3SD5A 1KFYB 3ZW3A 3M63B 3ZKJC 1FXTB 4BKSA 2R2OA 1YD8U 2INCC 1WX9A 4YTNB 3KYCD 3A9JB 1GOZA 2N9LA 2LUEA 1ISNA 3RD2A 2CR5A 3U7DA 1C1YB 1C77A 1ZOYB 1EU4A 1WI0A 2N9XA 3H7PA 5DPWA 2I1JA 3ZNGC 3Q6BA 1T0YA 4BBNF 3P4QB 3D32A 1TY0A 2D07B 2KJ6A 1KF6B 4JIOU 4WQMA 2KAJA 5HFYA 4LJOB 2Y5CA 4MM3A 1KLVA 2IYDB 4AQ7A 1C4CA 3HRDD 1WXQA 3GZNB 2TSSA 1JALA 1TTNA 3RPFC 3B08A 3UQAA 3W5VB 4XGAB 2J0JA 1BXTA 4FULA 1KH0A 5C2TB 4LNFA 4FBJB 3PZ8A 3I3TB 5FR3A 3ZTDA 3FAHA 2Z0EB 2J53A 5CHFA 2I2YA 4FLHA 4C4VA 5BO4B 4W9IA 2XBBC 2IO2B 4ASWC 4CYEA 2DYBA 3ML8A 3AM9A 3CSTA 4C80A 4WWPA 4K7WA 4BFRA 1EU3A 1WM2A 3V61A 2G9HD 1HTQA 3NZSA 5AZGA 4P16A 5E6NA 2K8CA 4ZRPA 4K1RB 2KFKB 1NEKB 1MVKA 1QQRA 1V1PB 1RYJA 4ZHPA 3Q8BA 4FHJA 2RDBC 2IDYA 3R7RA 2WS3B 2MJDA 1TJEA 2V0GA 1TBEA 3EFUA 3UF8A 1T0SC 1XF5L 1GNUA 2JZPA 1P7FA 3N1YC 4KX6B 3N1XC 2AX5A 4HJKA 2CJOA 2G1EA 4LNKA 1WSPA 4L1BA 3VR8B 3RFZB 2KJHB 3W9CB 4GN1A 3VH3B 4IM0A 1TYGB 4P1BC 2AQ2B 4FJVB 4M8MA 3DBHI 2INPE 4LDTB 2ZNVC 2E6XA 1C9FA 1ZDXA 2CJNA 3ZUNA 3N3KB 3NHEB 4JGHB 3X0WA 4B9KA 2IBIB 2WDVB 2KFJA 2RMMA 3AE8B 3TIXA 1TS5A 2IGHA 5D3DA 2EKIA 4MEMA 2EELA 1A70A 2DZIA 3VTWA 1YX6B 1LFDA 2NBWB 4NNJB 3AEAB 4II3B 1Q5WB 1YNTE 1SF0A 1JROA 5DPTA 4HDOA 1C4AA 4G50A 1BT0A 1EM7A 2PKOA 4P6VF 1FM0D 2LGDA 5AUIA 2BT6A 4TKNA 3AU4A 2WXPA 4DWFA 3V6CB 3BY4B 4ARIA 1JRPA 2GLSA 1M94A 2WDQB 1SXTA 3Q3OC 1WX8A 2M0XA 4IWQA 2O6VA 4BZAA 3KW5B 1F9JA 2BB6A 2WWZA 1V5TA 3U2SC 2EMTA 3KWLA 1ET6A 1IPGA 5G55A 4NAWB 3GE3C 2BKFA 2L52A 4XWWA 2LWPA 2K6QA 3EHVA 4EOYA 3VRBB 2BWES 2YLMA 4PYZA 4EE2A 1AYFA 4ACFA 3Q8CA 1R4NB 3AE5B 5IAAC 1GPXA 2FUHB 1DYQA 2QIEB 2DZJA 3QWZB 3NG0A 1SSNA 1R7SA 4FJZA 2JQRB 1X1MA 2LGYA 5EE1A 1I35A 2MHJA 1SBBB 4W9GA 3GE8C 1H4RA 2KX0A 3TBLD 3IXSA 5JXVA 5DPSA 3QX1A 4ANUA 3O13A 3VTUA 4PS7A 4ZYSA 2LXCA 2B76B 3RULA 3PV1A 3DHHC 1R4MI 5AEKB 2KMAA 2LGSA 3QIJA 1K52A 3ONSA 3DPDA 1T6BX 1TY2A 2PLPA 3SDLC 2RPQA 2DYMA 5D2MB 4HCNB 1C79A 3A9JA 1Q1OA 3N9YC 4B0MA 1YQBA 2BYVE 4KZCA 1FNUA 1JRUA 2K3UA 3DBRB 3PZDA 5C3JB 1L2NA 1P9DU 2KQ7A 4WH4A 1L0XB 4DBGA 1GUAB 2LZ6A 1QLBB 1ESFA 4KSKC 2EMSA 3X23A 2D3CA 1MPEA 3W2DA 3U7ZA 3U4EG 3KWVA 1F0ZA 4JX1C 1FCLA 3AN1A 3NVVA 2LRUA 3PRZA 2ACZB 1GB1A 3IT6B 2JYTA 2MBEA 1WGKA 4EZJA 1OTRB 4HPPA 1PFDA 3VDZA 4YSXB 1PGBA 2JZ3B 4HJGE 3C19A 2PVGC 3URYA 1J7AA 3DBLB 2SEBD 4ZRIA 4FHKA 4BAXA 3LYYA 3TEYA 4K7UA 1UGMA 1UD7A 3UIOB 4ANWA 4NPNA 1C76A 2DX5B 1WGHA 3BVZA 4K7SA 3P4SB 1KLGD 4HPMB 2AQ3B 1E10A 3AEBB 1WF9A 4JWSC 2JWUA 2KFKA 4L2YA 1FPYA 1QZEA 3VQIA 2RD0A 2G4DB 2JPHA 4ZOHC 4ZYNA 2JWZA 2ZVNA 1V1PA 2KXJA 3R66C 4YXDB 1PDXA 3MP9A 1GAQB 2L76A 2LMCA 4BBNC 3VR9B 2BS3B 3DWGC 3B2GA 4HK2A 1SE9A 2JT4B 1YN4A 1VZ8A 3QQ8B 3LXFA 2Y5BB 2J0MA 5L83A 1T5XD 1DOYA 1EWYC 2WLBA 2Z0DB 1WIAA 2IO0B 2LGIA 1VJKA 3SU8X 1B1ZA 3Q3FA 1C78A 1KTKA 2W3SA 1NDDA 1CK1A 5JHBA 2D5GA 2KWCA 1T0RC 2CU1A 4I6NB 3OWEB 3SEBA 2N0SB 3IAS1 1JQ4A 2FAZA 1YX5B 3VUWA 3UIPB 2KKCA 1TIFA 2EKEC 1FCCC 1WX7A 3FC4A 5FKAC 4E3CA 1WYGA 2WYQA 3DVNV 1WZ0A 2VRRB 4KZ0A 4M0WB 2N7EA 5J18A 3M3JA 2JYEA 3V62A 1YN5A 3PVLA 1F2RI 3W1SA 4IWPA 1I7HA 2CHWA 1ZGUB 4NJ6A 4KGSA 4W9CA 4K3CA 4N6EB 5BYSA 1L5PA 3HM6X 1N5XA 4M8NA 4YTMB 2YEPB 4RCOA 2FCMA 3PLVA 1UBIA 3S2AA 1MFWA 1MHXA 2ZNVB 1XCQL 1XLOA 2KVRA 2LI5A 1ZDVA 2VH1A 4NAWA 1I42A 4AP4C 4EZKA 2L1AA 3EECA 5AZFA 4N59A 2FCSA 2KDEB 1DGJA 2NBVB 2W82A 2DENB 1LXDA 1QILA 5D6JB 2VZKD 4I6PA 2H89B 4DQOC 1P98A 1WE6A 2NMQA 1VZ6A 2WGSA 1UUPA 4LK0M 5JHAA 2W55A 2LXAA 4DHJD 3T3OA 1VCBA 2GBKA 3ZVVA 2FIFA 3BIID 2NCNA 2DLBA 3HIZA 5GMVA 2KK8A 3ENEA 2LHEA 1MI0A 3NY5A 2IO3B 3Q3NC 5EE3A 4NJCA 4XX5A 2IJ0A 1PYWD 2LVQA 2V4LA 4MSMB 1OEYA 4WJNA 3GP7A 3T8MA 1SJED 5BMHA 1XO3A 2BS2B 2UU7A 3FILB 2ZCBA 3ZNID 1UBQA 1D3ZA 3BINA 2DAFA 3Q8AA 5IOIA 2K8HA 4DK5A 2GBNA 1ZUD2 4URKA 1D5XC 3AE7B 3RZFA 1KJTA 3OG5A 2KN5A 3QCAA 2J4XA 1F1HA 3NRZA 2KN4A 3PS6A 4WJPA 4DXAB 3QJZA 4MT5A 2MX2A 2DZKA 3RT3B 3NOBA 4GDLB 3Q69A 1TZ1A 2KDMA 3BK2A 2OEDA 1TKYA 3TL5A 1JW9D 1AARA 4RM8A 2KDBA 2KMMA 5AZHA 3M95A 4CO7A 3N32A 3SFDB 3JW0X 3BYYB 2Q5WD 1XLQA 2CHXA 1LGRA 1L0YB 2C60A 2HTME 3ABVB 4WWOA 1YIWA 1PGXA 1K50A 3PHXB 3P63A 4TMAB 2L7RA 1IBXB 3V6EB 4PS8A 4XWTA 3RN9C 4HPLB 3ZRFA 3DBSA 3N30A 2NTSA 2G45B 3SHQA 4HVBA 2KC2A 1H8CA 2ASQA 1UH6A 2MCNB 2PPHA 3CSFA 3AE9B 3NS1A 3FKYA 1Z2MA 4OZBA 1HA5A 2LHDA 4WWMA 3ZNZB 1LO5D 1LM8B 2DWQA 1NYRA 3TCAA 3SR6A 3MTNB 1HZ6A 4H2AA 4X57B 3ZJUA 2JRHA 3VAWA 2GBJA 4R3DA 2BGFA 4ARCA 4AJWA 3AEGB 2LEKA 2Z59B 1E7PB 2PTLA 4RGOS 1IUEA 1V2YA 2L3ZA 1N6ZA 3TJPA 4GMVA 3ZGZA 1L6VA 1S3SG 2N9KA 4KGRA 2HE7A 1WZ3A 4NZLB 1SE4A 3AXCA 4AS1A 2K0PA 3QC8B 3A4SC 2D3BA 2FCNA 5HKHA 4JWUC 1GB4A 3KUDB 1QOAA 2N9EB 4A8XC 1V49A 4TUUA 3NVZA 4GDKB 4ICVA 2J42A 4NY0A 4Q2JA 4YTPB 1KOTA 4M0WA 1V1OA 4J6IA 4KIKB 3U30A 3CIRB 2NR2A 4A3PA 3RMKC 5I4DA 5TR5A 3ZXRA 1OQQA 1QF6A 1K8RB 4IUMB 4TSSA 4YL8A 1CQVA 4GLSC 1OQRA 1N5WA 3B2FA 5E6PA 5IA7A 5HHDG 3V05A 1SE2A 3ZIMA 1TT5B 1XD3B 4WURA 3ZRCA 1XEEA 3L17A 5BMGA 2MEKA 1TS3A 3WALA 1OGWA 3N20C 4KSLC 4DHZB 1WGDA 1WWTA 1V6EA 2BYFA 3VTVA 4W9DA 2L05A 2MBOA 1F2RC 2WXHA 2WHIA 1T3QA 1WY8A 3BK1A 2L0FA 2R61A 2XEWA 4NQKE 1RAXA 4J3OD 2V4IB 1UF0A 2PE9A 3DCGA 4ICUA 2KC1A 2M56B 2MH7A 4IM3A 3DBHB 2V9HA 1FFVA 3NVYA 1WM3A 1WR1A 2NVUI 1BUIC 2NTTA 1RM6C 2IO1B 2KOXA 3RNAC 3C8YA 3B1LX 1V81A 2ICIA 2PW9A 1FD6A 1J19A 4PT5A 2AQ1B 4N9F4 1XQQA 1J0GA 3ZDMC 2AL3A 3LDZE 3DBRI 4IW0A 4KDIC 2V3PA 5DPRA 1N61A 4II2B 3ZQ4A 3DWMA 2SAKA 4ANXA 3FILA 1SJHD 4W9EA 3IBEA 4DHZE 3ETRA 4B6WA 4MSQB 1AW7A 1E9MA 4DXFA 5D94A 4HCPB 1WFYA 1UELA 5MPOA 4FA6A 2WDTB 3APCA 4UDUC 3BYTB 4G11A 3O65B 4LTUA 2BTEA 4KVGB 5GXGB 3IAM1 4FN2A 1I4QA 1STEA 4O1NA 4GDLA 4AWJA 1JCKB 2WXGA 3RNCC 1ET9A 1WXMA 4W9HA 1GJZA 4JLCA 2WXFA 2KTRB 1B9RA 2K1FA 2XK5B 3MJ5A 2PEAA 3HVDA 3APFA 2PJHA 4L23A 1V86A 5HI1A 2IZVB 4DDGD 3RZWC 3W5UB 1E8YA 1QOGA 2JX5A 2UYZB 4MGIE 4N58A 2VH2A 3C0RB 2V1YA 1NENB 3U52E 4MH0E 4S0RA 1C4PA 2E3TA 3Q14C 2QEJC 1M4VA 2N9PC 3EUB2 4A9AA 5KHQA 1IBXA 2GRIA 4WQOB 3AE1B 4JL9A 2WXJA 4XC2A 4TQ0A 2Y5PA 4WAFA 2N7JA 1AWDA 2MJEA 4YT0B 2WU2B 4M01A 5BYRA 2ZCCA 4OHJA 3K9PB 3I63C 2M8SA 3V60A 4P1CC 1TS2A 1WYWB 1Y56A 2A4ZA 2JXXA 1ENFA 3UI3A 2L8JA 2HJ8A 4PYUA 3EC8A 1SB3C 2K5PA 2BPSA 3DQVA 4DXGA 3HUIA 4MM3B 3EFCA 2MBQA 1NYQA 2MRPA 2MW5A 1P7EA 1E7VA 1WJ6A 2O6VD 2IPKD 3ZJVA 3ZTCA 1J8CA 3A1QB 4LJPB 4EFOA 1E5WA 4LNIA 2MLBA 5LNK1 2OHFA 4C00A 4HROA 4OVVA 2KYWA 3BZDB 1TKGA 3VHTC 1L6UA 2C9WB 2JZZA 1Y8RC 3RCZA 2HDEA 3PT2B 4RM9A 3NZUA 3R2IA 5H92C 4F7ZA 2K22A 4GDKA 2KLCA 1TGZB 4MDKE 3KUCB 2KNBA 1T0QC 3T9LA 3T3NA 4A6QA 3QARA 3P4RB 1EUVB 1GG3A 5CHVC 2KWVB 1U4AA 4KIKA 4CHKA 1KLUD 3RNBC 2H88B 4KV2A 3RYTA 5D3IB 3ZNHB 1RFKA 3VFKA 3CMMB 1ZP0B 3QAQA 3DHGC 4OZAA 3AB5A 2KX3A 4IDIA 4TV3A 2PIAA 1YJ1A 3WANA 2AEHA 2K8BA 2RR9A 3I5JC 2N1VA 1GC6A 4JQWC 2MBBB 3WIMA 2LJIA 2QHOA 3H6NA 4BOSC 1WJ4A 1UWXA 3RI7C 4HEA1 1G6JA 1N60A 1RLFA 4HWIB 2KDIA 2D3GA 2NBUA 2V3NA 3VUYA 5C23A 3JSVB 3H9DA 1JWBD 3MHZA 3KLSX 1A5RA 2MA9B 4PS3A 4YWGG 3ZYYX 3NJTA 2RPVA 3PZ7A 1MG8A 4EZLA 3HM3A 2I38A 1JWSD 2WXRA 2ZZPB 2QILA 2AL6A 2JXTA 1S1QB 3N1ZC 3ZXVA 5J17A 1ROEA 3KUZA 3PO0A 2HTHA 3BVMA 2LUMA 4B95A 1WGGA 4C56C 4MACA 5FK9C 4W9FA 4CQNA 4NAMA 3R7QA 3AEDB 2ZEQA 1RWSA 5IP4D 4REZA 4KKIA 1YQ3B 3OLMD 3AEFB 3RNFC 2J0KA 4MGYE 5EDSA 2LVOA 1SIJA 1IGCA 1IP9A 3DVGY 2BB5A 2LD9A 2C7NB 3TSSA 2G4SA 2RSUA 3DHIC 4XDDA 3AEEB 3U8ZA 3AE4B 3ZO5B 2WXKA 2WDRB 1VDVA 3PTFC 2DYOA 2KTRA 5G5HA 4KGTA 2XK5A 4LNOA 4A90A 1Q0WB 3GZNI 2UWQA 4GSWA 2WXIA 3M62B 3TEWA 1E7UA 4IM2A 4IWOA 1QKZA 2WXLA 5LXIB 1PQSA 3BVGA 2NS5A 1EF5A 3P2BA 4FXCA 4LDTD 3KQ4A 3W1YA 3ML9A 1XT9B 3PSEB 2KT7A 1TZOA 2BS4B 2KQSA 2YVCA 3HK0A 2LJ5A 4YSZB 2INDC 4EKUA 5DCNA 4RH6A 4RF1A 1E6EB 2QCZA 2PMVA 2JY6A 1I4GA 1JMLA 1SIFA 4LLGM 1XLPA 3GOEA 3Q8EA 1MHHE 3KVFB 5HG2A 1Q10A 1D6EC 2W3RA 1HXYD 4OW0A 3WAOA 3LB8C 3H1UA 4WAAA 4XE0A 2AYOB 2J7QB 2FNJB 1TS4A 2WXOA 4IOIE 2BW2A 5D7GA 2FCQA 2OOBB 1EF1A 2FUG1 2IGDA 2FE8A 3I57A 2L0TA 2BQQA 3PLUA 4XZ4A 2J52A 3AMZA 3A1QA 3P1MA 2DNFA 2N7DA 1D4BA 2WXQA 2VZKB 3R2TA 5E6OA 2JF5A 2KVZA 1K51A 4MH8A 1J7BA 2KD0A 2I1KA 3QHTA 1L0VB 2D10A 1QOFA 1VZ7A 4MELA 4I6LB 2JSVX 5LLIA 4GIVA 3AV8A 2K25A 5IO9A 4DHJB 3PPAA 3TUOA 4MGZE 1ZW7A 2BKRB 4XYCA 2X38A 4OVUA 3L4PA 1WGYA 3L10B 4KDLB 4JPSA 3HVZA 1E8WA 3RUIB 3MFGA 4JE3B 2WQYB 2NPTB 2D3AA 4OVZA 1PUTA 1D5MC 1FO4A 1HE8A 1VD2A 1L7YA 5JZEB 4ZHOA 4ZDVA 2M4NA 5T8IA 4E71A 5BMIA 3Q3JA 3DOWA 2LASA 3DVNU 3K9OB 4WWNA 2CU3A 3IVFA 1AN8A 1YMHE 2MP2B 4IC7B 4IG7B 5L95C 3QA8A 1CJEA 2R2QA 3A33B 4BKSD 4F1SA 3JSVA 2REXA 3DDCB 1XCTL 2A5UA 4ZRJA 1V8CA 1C3TA 1R4NI 3BWUD 1SE3A 1QT9A 2C7HA 3VH4B 3QK0A 1WE7A 4P7IA 3UQBA 1WH3A 1HQRD 1P3QU 4K81A 2GBMA 2KHWB 4USAA 1MG4A 3AU5A 4WJQA 3L54A 3KH0A 1FFUA 2INNE 4F8CB 2LFIA 3AE3B 2L00B 3Q8FA 1GC7A 1YQ4B 3I9V1 4K3BA 1V5OA 1FNVA 4A3OA 4MJSB 2O2VB 5C1ZA 4RGTA 4ZRQA 4W9KA 2FIDA 1JWUD 4OZCA 1JWAD 4FJYA 1P0RA 2ZJDA 1N63A 4YSYB 2QDFA 2WXNA 4WJOA 2IY1B 1J7CA 1XXGA 1NI2A 3AE6B 1EO6A 3WA0A 3AI5A 2QC8A 4US9A 3MC8A 2D11A 3A9KB 5G2NA 2RDHA 2GMIC 1VRAB 1OQYA 1KRHA 4TQ1A 1RFAA 2QJLA 3EA6A 4GOCA 3EGRA 2MSED 2BWFA 3IT4B 4EEWA 1F52A 2CHZA 5J2RA 2GBRA 1WMHB 2KMCA 3L08A 4ANVA 5AUKA 4HKQA 4HDQA 3MC0B 1UZXB 4DDID 3R3MA
chains in the Genus database with same CATH topology
4HJKA 1GG3A 2ZCBA 3ZNID 1UBQA 5JH5C 1D3ZA 2KJHB 2DAFA 3BINA 2KWVB 1U4AA 2K8HA 4KIKA 5CHVC 4CHKA 2GBNA 3DBLI 4KV2A 4URKA 4GN1A 3VXWA 3RYTA 3RZFA 3VH3B 4IM0A 1KJTA 2LGXA 2KN5A 3QCAA 4W9JA 3ZNHB 3JYUA 3VFKA 3CMMB 1V80A 4FJVB 3PS6A 4WJPA 4DXAB 2DZMA 2KANA 3QAQA 3QJZA 2ZVOA 4M8MA 5KHOA 2MX2A 2V3SA 2DZKA 3DBHI 2KLGA 2KX3A 3VUXA 1KM7A 1WXAA 2ZNVC 4LDTB 3RT3B 4TV3A 4NJ7A 2B3AA 4G0NB 4W9LA 3NOBA 4GDLB 3L0WB 3PRPB 1YJ1A 1TZ1A 3WANA 2AEHA 2K8BA 3ZUNA 3N3KB 3HHMA 3NHEB 4JGHB 2RR9A 3X0WA 2N1VA 3NS8A 3TL5A 1GC6A 2IBIB 4JQWC 4B9KA 2KFJA 1AARA 2MBBB 4RM8A 2KDBA 3WIMA 2QHOA 3PRMB 3TIXA 5AZHA 3M95A 2HD5B 5CHWA 4CO7A 3H6NA 3N32A 4MEMA 4BOSC 3JW0X 1WJ4A 2DZIA 2KO3A 4DK5A 1G6JA 1LQBA 3OJ3A 3VTWA 1YX6B 2CHXA 1RLFA 1LFDA 4HWIB 2NBWB 4NNJB 2KDIA 2D3GA 2NBUA 2M1MA 4II3B 1Q5WB 4G3XB 3VUYA 5C23A 1E90A 3OJ4B 3JSVB 3H9DA 5DPTA 4HDOA 2C60A 4G50A 1A5RA 1BT0A 4WWOA 1YIWA 2LVPA 2MA9B 4PS3A 4E74A 3PHXB 5FR6A 3H7PB 2L7RA 2LGDA 4TKNA 4PS8A 3V6EB 1MG8A 3AU4A 4EZLA 3HM3A 4HPLB 3DBSA 3ZRFA 1OEYJ 3N30A 4DWFA 3V6CB 3BY4B 4HLEA 2G45B 2JRIB 2ZZPB 2AL6A 1M94A 3APDA 3SHQA 1S1QB 4HVBA 2KC2A 5J17A 3KUZA 1WX8A 2M0XA 2OJRA 2O6VA 4IWQA 4BVUC 1H8CA 3KW5B 1F9JA 5L95C 2HTHA 2KJRA 2WWZA 1V5TA 2ASQA 2EMTA 1UH6A 2MCNB 1IPGA 5G55A 4B95A 1WGGA 2PPHA 2BYEA 4ZRKA 4NAWB 3CSFA 4W9FA 2BKFA 3R7QA 3UINB 2AWTA 2ZEQA 1Z2MA 2LWPA 2K6QA 3EHVA 3PHWB 2G3QB 3OLMD 4EOYA 2KTFA 4HXDA 3ZNZB 2BWES 2YLMA 1LM8B 4PYZA 3TCAA 2J0KA 4MGYE 3MTNB 2ZPYA 4X57B 2NPTA 5EDSA 2LVOA 2JRHA 3VAWA 5IAAC 2GBJA 2FUHB 1IP9A 2BGFA 2DZJA 3OAWA 3QWZB 4AJWA 2Z59B 3DVGY 3WAMA 2C5LC 4FJZA 1V2YA 1X1MA 2L3ZA 2LD9A 2C7NB 2LGYA 1I35A 3TJPA 4GMVA 3UF8A 2G4SA 2RSUA 2C7MB 4W9GA 3U8ZA 1WGRA 1S3SG 1IYFA 1H4RA 2KX0A 3TBLD 4RMAA 5DPSA 2JVCA 3QX1A 2HE7A 1WZ3A 3ZO5B 4ANUA 4BOZB 3ALBA 3VTUA 4PS7A 2LXCA 3AXCA 3PTFC 2DYOA 3QC8B 2KTRA 2CS4A 3A4SC 3RULA 3PV1A 2FCNA 5HKHA 2KZRA 2N1WA 2XK5A 3KUDB 1R4MI 1WR6E 4EUTA 1ZKHA 2N9EB 5AEKB 1Q0WB 1V49A 1V9JA 2KMAA 3GZNI 1SGHA 4TUUA 2UWQA 4GSWA 4GDKB 3QIJA 4ICVA 3M62B 4NY0A 3ONSA 2MP2A 3DPDA 3LJ3A 5LXHA 1E7UA 4IM2A 1KOTA 4IWOA 3SDLC 2RPQA 5LXIB 1E8ZA 1PQSA 1WXSA 2DYMA 2NS5A 2ZPNA 5D2MB 2K6DB 3W1SC 4HCNB 1EF5A 3A9JA 1Q1OA 3P2BA 3ECIA 1P1AA 3MJWA 4J6IA 4KIKB 3U30A 4LDTD 1YQBA 2BYVE 2NR2A 3A4RA 3ML9A 4KZCA 3W1YA 4A3PA 1JRUA 3PZDA 1L2NA 3VVWB 2KWUB 5TR5A 1XT9B 1P9DU 3PSEB 1K8RB 4IUMB 2KQ7A 2KQSA 3HK0A 2YVCA 4YL8A 3DVGX 2RGFA 2LJ5A 5E6PA 1GUAB 4DBGA 5IA7A 2LZ6A 4EKUA 2W9NA 4LCDE 3ZIMA 2D2QA 5DCNA 4KSKC 2JUOA 2CKHB 1XD3B 2EMSA 3X23A 2MQJA 3ZRCA 2JY6A 3L17A 1SIFA 3WALA 1OGWA 3PGEA 4KSLC 4DHZB 1WGDA 2LRUA 3PRZA 3GOEA 2DAJA 1V6EA 2BYFA 3VTVA 4W9DA 4MJSA 2O2VA 3KVFB 2MBEA 2L05A 4AOFA 1WRDB 4EZJA 2MBOA 3JVZX 1OTRB 1E8XA 3AULA 3VDZA 2IY0B 3WAOA 2JZ3B 3H1UA 4WAAA 1WY8A 2AYOB 2J7QB 4ZRIA 4FHKA 2L0FA 2FNJB 2XEWA 4K7UA 3KYDD 4NQKE 1RAXA 1UGMA 1UD7A 5D7GA 2FCQA 4GU2A 2OOBB 1EF1A 3UIOB 2PE9A 1CMXB 3WAPA 3DCGA 4FADA 3IG3A 4ANWA 4ICUA 4NPNA 2KC1A 1NBFC 2MWSB 2GOWA 2L0TA 4IM3A 2DX5B 2N4FA 1WGHA 2PE6B 3PLUA 4XZ4A 1WM3A 1WR1A 2WX0A 2NVUI 5CTRC 3A1QA 4K7SA 2MBHA 2N7DA 3L13A 3A9KA 4HPMB 3ZDTA 5E6OA 1WF9A 2IO1B 2K39A 2KOXA 3H7SA 2JF5A 2KFKA 4MGKE 3VQIA 1QZEA 3B1LX 1V81A 2RD0A 2DHZA 1J19A 2G4DB 2JPHA 2KD0A 4ZYNA 2O6VB 2I1KA 3IFWB 2JWZA 3QHTA 2ZVNA 4N9F4 4WJNA 5CX3A 2KXJA 1XQQA 2D10A 3R66C 2LRWA 1WXVA 3TMPB 4MELA 4BKTA 4I6LB 2L76A 3UGBB 5LLIA 2AL3A 3LDZE 4GIVA 3ZDMC 3L16A 2K25A 1WMHA 3DBRI 2BF8B 4IW0A 4KDIC 4DHJB 3PPAA 5DPRA 4BBNC 2KDFB 4GXBA 4MGZE 4GGQA 1Z5SB 1ZW7A 4II2B 2BKRB 1RRBA 4AJYB 4HK2A 4OVUA 4ANXA 1WGYA 4W9EA 1SE9A 3IBEA 2JT4B 3L10B 4KDLB 4DHZE 3QQ8B 4B6WA 4MSQB 4GB9A 2Y5BB 1E8WA 3RUIB 2J0MA 5L83A 5D94A 2NPTB 4HCPB 2Z0DB 1WFYA 1UELA 1WIAA 2IO0B 3SU8X 4FA6A 2WDTB 3APCA 4A20A 3Q3FA 4NQLB 4AUQC 3MHSD 4G11A 3O65B 1NDDA 1WJUA 4KVGB 5JHBA 4FN2A 2KWCA 3ZLZA 1HE8A 1VD2A 1L7YA 3CF6E 4GDLA 4AWJA 5JZEB 4BKGA 2WX1A 1WXMA 2CU1A 4I6NB 4ZDVA 4W9HA 3PREA 1GJZA 3IHPC 4JLCA 2M4NA 2KTRB 2FAZA 1YX5B 3VUWA 4E71A 1WJNA 2K1FA 2XK5B 2PEAA 2M17A 3UIPB 2KKCA 3Q3JA 3APFA 3B0AA 2LASA 2EKEC 3DOWA 2PJHA 3DVNU 3K9OB 4WWNA 3SD5A 1V86A 1WX7A 3ZW3A 3M63B 3IVFA 2IZVB 3ZKJC 2MP2B 1FXTB 4E3CA 2WYQA 4IC7B 3DVNV 4IG7B 2R2OA 4BKSA 1WZ0A 2VRRB 4KZ0A 1YD8U 2N7EA 3QA8A 4M0WB 2R2QA 5J18A 1WX9A 3M3JA 3KYCD 3V62A 3PVLA 4DDGD 3A33B 3RZWC 1E8YA 3A9JB 4BKSD 2LUEA 4F1SA 1ISNA 2UYZB 2REXA 3JSVA 2CR5A 3DDCB 4IWPA 4MGIE 3RD2A 3C0RB 3W1SA 2V1YA 2CHWA 1ZGUB 2A5UA 4ZRJA 3U7DA 4MH0E 4NJ6A 4W9CA 1C1YB 1C3TA 1R4NI 2N9XA 1WI0A 3H7PA 5DPWA 2N9PC 2I1JA 5KHQA 3ZNGC 1T0YA 4WQOB 2C7HA 4JL9A 3HM6X 4BBNF 3VH4B 4XC2A 4TQ0A 3QK0A 1WE7A 4M8NA 3D32A 1J0GA 4P7IA 2FCMA 1WH3A 2D07B 2KJ6A 3UQBA 1P3QU 3PLVA 4JIOU 4K81A 2GBMA 2KHWB 4LJOB 1UBIA 3AU5A 4MM3A 4WJQA 1KLVA 2IYDB 3L54A 3S2AA 2ZNVB 3KH0A 1I42A 2ZCCA 4F8CB 2KVRA 2LI5A 3K9PB 2L00B 1TTNA 1GC7A 3B08A 3UQAA 1V5OA 2J0JA 2M8SA 4FULA 3V60A 1WYWB 4NAWA 4MJSB 2O2VB 4A3OA 2A4ZA 4AP4C 2JXXA 4FBJB 3I3TB 3EECA 4EZKA 5C1ZA 4W9KA 5AZFA 2FCSA 2L8JA 2HJ8A 2FIDA 2KDEB 4PYUA 4FJYA 3ZTDA 1P0RA 2NBVB 2ZJDA 3EC8A 2DENB 2Z0EB 2BPSA 1LXDA 3DQVA 4WJOA 5CHFA 4FLHA 5D6JB 4I6PA 2MBQA 1P98A 2IY1B 2MRPA 2MW5A 5BO4B 4W9IA 2XBBC 1NI2A 2IO2B 1E7VA 1WE6A 1WJ6A 4ASWC 2O6VD 1EO6A 3WA0A 4CYEA 2DYBA 3ML8A 3AI5A 3CSTA 4WWPA 4K7WA 4BFRA 1WM2A 3ZTCA 3V61A 1J8CA 3A1QB 4LJPB 2D11A 5JHAA 4DHJD 2LXAA 3A9KB 3NZSA 1VCBA 2GBKA 5G2NA 4EFOA 5AZGA 1E5WA 2FIFA 5E6NA 3ZVVA 2GMIC 2K8CA 1OQYA 2MLBA 2NCNA 2KFKB 4K1RB 3HIZA 5GMVA 4TQ1A 2KK8A 4OVVA 1RFAA 3ENEA 4GOCA 3NY5A 3VHTC 2C9WB 2JZZA 2IO3B 1Y8RC 2MSED 3RCZA 2BWFA 3PT2B 4EEWA 4FHJA 4RM9A 4XX5A 3R7RA 3NZUA 2V4LA 2LVQA 1TBEA 2CHZA 4MSMB 4F7ZA 5J2RA 2GBRA 1OEYA 1WMHB 2KLCA 1GNUA 2KMCA 3EFUA 3L08A 1TGZB 4GDKA 4MDKE 3KUCB 4ANVA 4HDQA 3T8MA 2KNBA 1UZXB 4DDID 3T9LA 3R3MA 3QARA 1EUVB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HJK A;  1GG3 A;  2ZCB A;  3ZNI D;  1UBQ A;  5JH5 C;  1D3Z A;  2KJH B;  2DAF A;  3BIN A;  2KWV B;  1U4A A;  2K8H A;  4KIK A;  5CHV C;  4CHK A;  2GBN A;  3DBL I;  4KV2 A;  4URK A;  4GN1 A;  3VXW A;  3RYT A;  3RZF A;  3VH3 B;  4IM0 A;  1KJT A;  2LGX A;  2KN5 A;  3QCA A;  4W9J A;  3ZNH B;  3JYU A;  3VFK A;  3CMM B;  1V80 A;  4FJV B;  3PS6 A;  4WJP A;  4DXA B;  2DZM A;  2KAN A;  3QAQ A;  3QJZ A;  2ZVO A;  4M8M A;  5KHO A;  2MX2 A;  2V3S A;  2DZK A;  3DBH I;  2KLG A;  2KX3 A;  3VUX A;  1KM7 A;  1WXA A;  2ZNV C;  4LDT B;  3RT3 B;  4TV3 A;  4NJ7 A;  2B3A A;  4G0N B;  4W9L A;  3NOB A;  4GDL B;  3L0W B;  3PRP B;  1YJ1 A;  1TZ1 A;  3WAN A;  2AEH A;  2K8B A;  3ZUN A;  3N3K B;  3HHM A;  3NHE B;  4JGH B;  2RR9 A;  3X0W A;  2N1V A;  3NS8 A;  3TL5 A;  1GC6 A;  2IBI B;  4JQW C;  4B9K A;  2KFJ A;  1AAR A;  2MBB B;  4RM8 A;  2KDB A;  3WIM A;  2QHO A;  3PRM B;  3TIX A;  5AZH A;  3M95 A;  2HD5 B;  5CHW A;  4CO7 A;  3H6N A;  3N32 A;  4MEM A;  4BOS C;  3JW0 X;  1WJ4 A;  2DZI A;  2KO3 A;  4DK5 A;  1G6J A;  1LQB A;  3OJ3 A;  3VTW A;  1YX6 B;  2CHX A;  1RLF A;  1LFD A;  4HWI B;  2NBW B;  4NNJ B;  2KDI A;  2D3G A;  2NBU A;  2M1M A;  4II3 B;  1Q5W B;  4G3X B;  3VUY A;  5C23 A;  1E90 A;  3OJ4 B;  3JSV B;  3H9D A;  5DPT A;  4HDO A;  2C60 A;  4G50 A;  1A5R A;  1BT0 A;  4WWO A;  1YIW A;  2LVP A;  2MA9 B;  4PS3 A;  4E74 A;  3PHX B;  5FR6 A;  3H7P B;  2L7R A;  2LGD A;  4TKN A;  4PS8 A;  3V6E B;  1MG8 A;  3AU4 A;  4EZL A;  3HM3 A;  4HPL B;  3DBS A;  3ZRF A;  1OEY J;  3N30 A;  4DWF A;  3V6C B;  3BY4 B;  4HLE A;  2G45 B;  2JRI B;  2ZZP B;  2AL6 A;  1M94 A;  3APD A;  3SHQ A;  1S1Q B;  4HVB A;  2KC2 A;  5J17 A;  3KUZ A;  1WX8 A;  2M0X A;  2OJR A;  2O6V A;  4IWQ A;  4BVU C;  1H8C A;  3KW5 B;  1F9J A;  5L95 C;  2HTH A;  2KJR A;  2WWZ A;  1V5T A;  2ASQ A;  2EMT A;  1UH6 A;  2MCN B;  1IPG A;  5G55 A;  4B95 A;  1WGG A;  2PPH A;  2BYE A;  4ZRK A;  4NAW B;  3CSF A;  4W9F A;  2BKF A;  3R7Q A;  3UIN B;  2AWT A;  2ZEQ A;  1Z2M A;  2LWP A;  2K6Q A;  3EHV A;  3PHW B;  2G3Q B;  3OLM D;  4EOY A;  2KTF A;  4HXD A;  3ZNZ B;  2BWE S;  2YLM A;  1LM8 B;  4PYZ A;  3TCA A;  2J0K A;  4MGY E;  3MTN B;  2ZPY A;  4X57 B;  2NPT A;  5EDS A;  2LVO A;  2JRH A;  3VAW A;  5IAA C;  2GBJ A;  2FUH B;  1IP9 A;  2BGF A;  2DZJ A;  3OAW A;  3QWZ B;  4AJW A;  2Z59 B;  3DVG Y;  3WAM A;  2C5L C;  4FJZ A;  1V2Y A;  1X1M A;  2L3Z A;  2LD9 A;  2C7N B;  2LGY A;  1I35 A;  3TJP A;  4GMV A;  3UF8 A;  2G4S A;  2RSU A;  2C7M B;  4W9G A;  3U8Z A;  1WGR A;  1S3S G;  1IYF A;  1H4R A;  2KX0 A;  3TBL D;  4RMA A;  5DPS A;  2JVC A;  3QX1 A;  2HE7 A;  1WZ3 A;  3ZO5 B;  4ANU A;  4BOZ B;  3ALB A;  3VTU A;  4PS7 A;  2LXC A;  3AXC A;  3PTF C;  2DYO A;  3QC8 B;  2KTR A;  2CS4 A;  3A4S C;  3RUL A;  3PV1 A;  2FCN A;  5HKH A;  2KZR A;  2N1W A;  2XK5 A;  3KUD B;  1R4M I;  1WR6 E;  4EUT A;  1ZKH A;  2N9E B;  5AEK B;  1Q0W B;  1V49 A;  1V9J A;  2KMA A;  3GZN I;  1SGH A;  4TUU A;  2UWQ A;  4GSW A;  4GDK B;  3QIJ A;  4ICV A;  3M62 B;  4NY0 A;  3ONS A;  2MP2 A;  3DPD A;  3LJ3 A;  5LXH A;  1E7U A;  4IM2 A;  1KOT A;  4IWO A;  3SDL C;  2RPQ A;  5LXI B;  1E8Z A;  1PQS A;  1WXS A;  2DYM A;  2NS5 A;  2ZPN A;  5D2M B;  2K6D B;  3W1S C;  4HCN B;  1EF5 A;  3A9J A;  1Q1O A;  3P2B A;  3ECI A;  1P1A A;  3MJW A;  4J6I A;  4KIK B;  3U30 A;  4LDT D;  1YQB A;  2BYV E;  2NR2 A;  3A4R A;  3ML9 A;  4KZC A;  3W1Y A;  4A3P A;  1JRU A;  3PZD A;  1L2N A;  3VVW B;  2KWU B;  5TR5 A;  1XT9 B;  1P9D U;  3PSE B;  1K8R B;  4IUM B;  2KQ7 A;  2KQS A;  3HK0 A;  2YVC A;  4YL8 A;  3DVG X;  2RGF A;  2LJ5 A;  5E6P A;  1GUA B;  4DBG A;  5IA7 A;  2LZ6 A;  4EKU A;  2W9N A;  4LCD E;  3ZIM A;  2D2Q A;  5DCN A;  4KSK C;  2JUO A;  2CKH B;  1XD3 B;  2EMS A;  3X23 A;  2MQJ A;  3ZRC A;  2JY6 A;  3L17 A;  1SIF A;  3WAL A;  1OGW A;  3PGE A;  4KSL C;  4DHZ B;  1WGD A;  2LRU A;  3PRZ A;  3GOE A;  2DAJ A;  1V6E A;  2BYF A;  3VTV A;  4W9D A;  4MJS A;  2O2V A;  3KVF B;  2MBE A;  2L05 A;  4AOF A;  1WRD B;  4EZJ A;  2MBO A;  3JVZ X;  1OTR B;  1E8X A;  3AUL A;  3VDZ A;  2IY0 B;  3WAO A;  2JZ3 B;  3H1U A;  4WAA A;  1WY8 A;  2AYO B;  2J7Q B;  4ZRI A;  4FHK A;  2L0F A;  2FNJ B;  2XEW A;  4K7U A;  3KYD D;  4NQK E;  1RAX A;  1UGM A;  1UD7 A;  5D7G A;  2FCQ A;  4GU2 A;  2OOB B;  1EF1 A;  3UIO B;  2PE9 A;  1CMX B;  3WAP A;  3DCG A;  4FAD A;  3IG3 A;  4ANW A;  4ICU A;  4NPN A;  2KC1 A;  1NBF C;  2MWS B;  2GOW A;  2L0T A;  4IM3 A;  2DX5 B;  2N4F A;  1WGH A;  2PE6 B;  3PLU A;  4XZ4 A;  1WM3 A;  1WR1 A;  2WX0 A;  2NVU I;  5CTR C;  3A1Q A;  4K7S A;  2MBH A;  2N7D A;  3L13 A;  3A9K A;  4HPM B;  3ZDT A;  5E6O A;  1WF9 A;  2IO1 B;  2K39 A;  2KOX A;  3H7S A;  2JF5 A;  2KFK A;  4MGK E;  3VQI A;  1QZE A;  3B1L X;  1V81 A;  2RD0 A;  2DHZ A;  1J19 A;  2G4D B;  2JPH A;  2KD0 A;  4ZYN A;  2O6V B;  2I1K A;  3IFW B;  2JWZ A;  3QHT A;  2ZVN A;  4N9F 4;  4WJN A;  5CX3 A;  2KXJ A;  1XQQ A;  2D10 A;  3R66 C;  2LRW A;  1WXV A;  3TMP B;  4MEL A;  4BKT A;  4I6L B;  2L76 A;  3UGB B;  5LLI A;  2AL3 A;  3LDZ E;  4GIV A;  3ZDM C;  3L16 A;  2K25 A;  1WMH A;  3DBR I;  2BF8 B;  4IW0 A;  4KDI C;  4DHJ B;  3PPA A;  5DPR A;  4BBN C;  2KDF B;  4GXB A;  4MGZ E;  4GGQ A;  1Z5S B;  1ZW7 A;  4II2 B;  2BKR B;  1RRB A;  4AJY B;  4HK2 A;  4OVU A;  4ANX A;  1WGY A;  4W9E A;  1SE9 A;  3IBE A;  2JT4 B;  3L10 B;  4KDL B;  4DHZ E;  3QQ8 B;  4B6W A;  4MSQ B;  4GB9 A;  2Y5B B;  1E8W A;  3RUI B;  2J0M A;  5L83 A;  5D94 A;  2NPT B;  4HCP B;  2Z0D B;  1WFY A;  1UEL A;  1WIA A;  2IO0 B;  3SU8 X;  4FA6 A;  2WDT B;  3APC A;  4A20 A;  3Q3F A;  4NQL B;  4AUQ C;  3MHS D;  4G11 A;  3O65 B;  1NDD A;  1WJU A;  4KVG B;  5JHB A;  4FN2 A;  2KWC A;  3ZLZ A;  1HE8 A;  1VD2 A;  1L7Y A;  3CF6 E;  4GDL A;  4AWJ A;  5JZE B;  4BKG A;  2WX1 A;  1WXM A;  2CU1 A;  4I6N B;  4ZDV A;  4W9H A;  3PRE A;  1GJZ A;  3IHP C;  4JLC A;  2M4N A;  2KTR B;  2FAZ A;  1YX5 B;  3VUW A;  4E71 A;  1WJN A;  2K1F A;  2XK5 B;  2PEA A;  2M17 A;  3UIP B;  2KKC A;  3Q3J A;  3APF A;  3B0A A;  2LAS A;  2EKE C;  3DOW A;  2PJH A;  3DVN U;  3K9O B;  4WWN A;  3SD5 A;  1V86 A;  1WX7 A;  3ZW3 A;  3M63 B;  3IVF A;  2IZV B;  3ZKJ C;  2MP2 B;  1FXT B;  4E3C A;  2WYQ A;  4IC7 B;  3DVN V;  4IG7 B;  2R2O A;  4BKS A;  1WZ0 A;  2VRR B;  4KZ0 A;  1YD8 U;  2N7E A;  3QA8 A;  4M0W B;  2R2Q A;  5J18 A;  1WX9 A;  3M3J A;  3KYC D;  3V62 A;  3PVL A;  4DDG D;  3A33 B;  3RZW C;  1E8Y A;  3A9J B;  4BKS D;  2LUE A;  4F1S A;  1ISN A;  2UYZ B;  2REX A;  3JSV A;  2CR5 A;  3DDC B;  4IWP A;  4MGI E;  3RD2 A;  3C0R B;  3W1S A;  2V1Y A;  2CHW A;  1ZGU B;  2A5U A;  4ZRJ A;  3U7D A;  4MH0 E;  4NJ6 A;  4W9C A;  1C1Y B;  1C3T A;  1R4N I;  2N9X A;  1WI0 A;  3H7P A;  5DPW A;  2N9P C;  2I1J A;  5KHQ A;  3ZNG C;  1T0Y A;  4WQO B;  2C7H A;  4JL9 A;  3HM6 X;  4BBN F;  3VH4 B;  4XC2 A;  4TQ0 A;  3QK0 A;  1WE7 A;  4M8N A;  3D32 A;  1J0G A;  4P7I A;  2FCM A;  1WH3 A;  2D07 B;  2KJ6 A;  3UQB A;  1P3Q U;  3PLV A;  4JIO U;  4K81 A;  2GBM A;  2KHW B;  4LJO B;  1UBI A;  3AU5 A;  4MM3 A;  4WJQ A;  1KLV A;  2IYD B;  3L54 A;  3S2A A;  2ZNV B;  3KH0 A;  1I42 A;  2ZCC A;  4F8C B;  2KVR A;  2LI5 A;  3K9P B;  2L00 B;  1TTN A;  1GC7 A;  3B08 A;  3UQA A;  1V5O A;  2J0J A;  2M8S A;  4FUL A;  3V60 A;  1WYW B;  4NAW A;  4MJS B;  2O2V B;  4A3O A;  2A4Z A;  4AP4 C;  2JXX A;  4FBJ B;  3I3T B;  3EEC A;  4EZK A;  5C1Z A;  4W9K A;  5AZF A;  2FCS A;  2L8J A;  2HJ8 A;  2FID A;  2KDE B;  4PYU A;  4FJY A;  3ZTD A;  1P0R A;  2NBV B;  2ZJD A;  3EC8 A;  2DEN B;  2Z0E B;  2BPS A;  1LXD A;  3DQV A;  4WJO A;  5CHF A;  4FLH A;  5D6J B;  4I6P A;  2MBQ A;  1P98 A;  2IY1 B;  2MRP A;  2MW5 A;  5BO4 B;  4W9I A;  2XBB C;  1NI2 A;  2IO2 B;  1E7V A;  1WE6 A;  1WJ6 A;  4ASW C;  2O6V D;  1EO6 A;  3WA0 A;  4CYE A;  2DYB A;  3ML8 A;  3AI5 A;  3CST A;  4WWP A;  4K7W A;  4BFR A;  1WM2 A;  3ZTC A;  3V61 A;  1J8C A;  3A1Q B;  4LJP B;  2D11 A;  5JHA A;  4DHJ D;  2LXA A;  3A9K B;  3NZS A;  1VCB A;  2GBK A;  5G2N A;  4EFO A;  5AZG A;  1E5W A;  2FIF A;  5E6N A;  3ZVV A;  2GMI C;  2K8C A;  1OQY A;  2MLB A;  2NCN A;  2KFK B;  4K1R B;  3HIZ A;  5GMV A;  4TQ1 A;  2KK8 A;  4OVV A;  1RFA A;  3ENE A;  4GOC A;  3NY5 A;  3VHT C;  2C9W B;  2JZZ A;  2IO3 B;  1Y8R C;  2MSE D;  3RCZ A;  2BWF A;  3PT2 B;  4EEW A;  4FHJ A;  4RM9 A;  4XX5 A;  3R7R A;  3NZU A;  2V4L A;  2LVQ A;  1TBE A;  2CHZ A;  4MSM B;  4F7Z A;  5J2R A;  2GBR A;  1OEY A;  1WMH B;  2KLC A;  1GNU A;  2KMC A;  3EFU A;  3L08 A;  1TGZ B;  4GDK A;  4MDK E;  3KUC B;  4ANV A;  4HDQ A;  3T8M A;  2KNB A;  1UZX B;  4DDI D;  3T9L A;  3R3M A;  3QAR A;  1EUV B; 
#chains in the Genus database with same CATH topology
 3H8H A;  1HTO A;  1HEZ E;  3ZJT A;  5JH5 C;  3DBL I;  5G5G A;  3VXW A;  5EE0 A;  2WP9 B;  3GS2 A;  2LGX A;  1BML C;  4W9J A;  1QOB A;  2Z8L A;  3JYU A;  2FBW B;  1V80 A;  2WU5 B;  1OFF A;  2DZM A;  2KAN A;  3B9J A;  2ON8 A;  2BYT A;  2ZVO A;  5KHO A;  2V3S A;  1SEB D;  1XLN A;  2HJ1 A;  2KLG A;  3E9S A;  3VUX A;  1KM7 A;  1WXA A;  4NJ7 A;  2B3A A;  1VR9 A;  2M0A A;  4G0N B;  4W9L A;  1WRI A;  3L0W B;  1L4Z B;  3PRP B;  4RGN A;  1YOV B;  3HHM A;  4KKJ A;  3NS8 A;  1FRR A;  3PRM B;  5CHW A;  2HD5 B;  3TEX A;  2ZW0 A;  1ZE3 D;  3P42 A;  3J9C A;  1I4R A;  2KO3 A;  2M19 A;  1LQB A;  3OJ3 A;  3TEZ A;  2RDG A;  1K53 A;  1L4D B;  2M1M A;  2K9X A;  4G3X B;  1E90 A;  1R4M B;  3OJ4 B;  1YN3 A;  1D5Z C;  1NI3 A;  2WNM A;  4RFB A;  2LVP A;  4E74 A;  5FR6 A;  3H7P B;  4ITK A;  4HLE A;  1OEY J;  1DOX A;  2JRI B;  1ACC A;  3APD A;  1ZXI A;  4IKG A;  3P4P B;  2OJR A;  4BVU C;  2BBC A;  2PVO D;  2KJR A;  2KWD A;  2QSD A;  3NZ3 A;  1I4X A;  2BYE A;  4ZRK A;  1UGJ A;  3UIN B;  2YEP F;  2AWT A;  4B0E A;  1UWM A;  1MJD A;  3PHW B;  2G3Q B;  2KTF A;  4HXD A;  1IGD A;  4C4V B;  2ZPY A;  2NPT A;  2L32 A;  1YJI A;  1ZPS A;  4XDC A;  3OAW A;  2MJ3 A;  2C5L C;  3WAM A;  4HRS A;  3AH7 A;  2C7M B;  1V97 A;  1WGR A;  1IYF A;  4RMA A;  2JVC A;  4BOZ B;  5EE9 A;  1PGA A;  3ALB A;  3GB1 A;  3VRA B;  4US8 A;  2CS4 A;  2Y3A A;  2KZR A;  2N1W A;  1WR6 E;  4EUT A;  1ZKH A;  1V9J A;  1SGH A;  3E56 A;  2MP2 A;  3LJ3 A;  5IN7 A;  5LXH A;  1E8Z A;  2ZPN A;  1WXS A;  2K6D B;  4D2K A;  3W1S C;  3ECI A;  1P1A A;  3MJW A;  3A4R A;  1YJJ A;  3VVW B;  2KWU B;  2QMT A;  1I4H A;  1N62 A;  3DVG X;  2RGF A;  3NVW A;  4HKZ E;  2XN9 C;  2W9N A;  2ONQ A;  4LCD E;  2D2Q A;  3SFE B;  1UNS A;  2JUO A;  2CKH B;  2MQJ A;  4QAY A;  2WXM A;  2DBY A;  3AEC B;  3PGE A;  3AE2 B;  2DAJ A;  2L83 A;  4MJS A;  2O2V A;  4AOF A;  1WRD B;  4C7Z A;  5H8Y E;  3JVZ X;  1E8X A;  3AUL A;  4S17 A;  2IY0 B;  1FXA A;  3Q2A C;  4PK1 A;  1NVI D;  3KYD D;  4GU2 A;  5BYQ A;  1CMX B;  3WAP A;  3V3X A;  4FAD A;  3IG3 A;  4M02 A;  4RNA A;  3MC9 A;  1NBF C;  2MWS B;  2GOW A;  1HZ5 A;  2N4F A;  2PE6 B;  2OJW A;  2KQ4 X;  5TSS A;  2WX0 A;  5CTR C;  3WCQ A;  1FIQ A;  2MBH A;  3L13 A;  1FRD A;  3A9K A;  2KAC A;  4M00 A;  3ZDT A;  3RNE C;  2K39 A;  3H7S A;  3RNG C;  4MGK E;  2DHZ A;  2O6V B;  3IFW B;  1ZXH A;  1FEH A;  5CX3 A;  2IGG A;  1WXV A;  2LRW A;  3TMP B;  2JU6 X;  4BKT A;  3UGB B;  1FNW A;  3L16 A;  4C7Y A;  1WMH A;  2BF8 B;  1DOI A;  2KDF B;  4GXB A;  3NUH B;  4A55 A;  4GGQ A;  1Z5S B;  1RRB A;  4AJY B;  3CWI A;  2GB1 A;  1F77 A;  4GB9 A;  2W54 A;  2XNA C;  3Q3M C;  2GI9 A;  4WIP A;  4A20 A;  1FXI A;  4NQL B;  4AUQ C;  3MHS D;  4RF0 A;  3R8B A;  1I4P A;  1WJU A;  2X8X X;  2ZW1 A;  4RGM A;  1CZP A;  3ZLZ A;  1JWM D;  2BVC A;  3CF6 E;  4LNN A;  4BKG A;  2WX1 A;  3PRE A;  5E6J A;  3IHP C;  5IKC M;  1WJN A;  1E0Z A;  2M17 A;  1EWC A;  3B0A A;  1FMA D;  1VLB A;  1TKE A;  3SD5 A;  1KFY B;  3ZW3 A;  3M63 B;  3ZKJ C;  1FXT B;  4BKS A;  2R2O A;  1YD8 U;  2INC C;  1WX9 A;  4YTN B;  3KYC D;  3A9J B;  1GOZ A;  2N9L A;  2LUE A;  1ISN A;  3RD2 A;  2CR5 A;  3U7D A;  1C1Y B;  1C77 A;  1ZOY B;  1EU4 A;  1WI0 A;  2N9X A;  3H7P A;  5DPW A;  2I1J A;  3ZNG C;  3Q6B A;  1T0Y A;  4BBN F;  3P4Q B;  3D32 A;  1TY0 A;  2D07 B;  2KJ6 A;  1KF6 B;  4JIO U;  4WQM A;  2KAJ A;  5HFY A;  4LJO B;  2Y5C A;  4MM3 A;  1KLV A;  2IYD B;  4AQ7 A;  1C4C A;  3HRD D;  1WXQ A;  3GZN B;  2TSS A;  1JAL A;  1TTN A;  3RPF C;  3B08 A;  3UQA A;  3W5V B;  4XGA B;  2J0J A;  1BXT A;  4FUL A;  1KH0 A;  5C2T B;  4LNF A;  4FBJ B;  3PZ8 A;  3I3T B;  5FR3 A;  3ZTD A;  3FAH A;  2Z0E B;  2J53 A;  5CHF A;  2I2Y A;  4FLH A;  4C4V A;  5BO4 B;  4W9I A;  2XBB C;  2IO2 B;  4ASW C;  4CYE A;  2DYB A;  3ML8 A;  3AM9 A;  3CST A;  4C80 A;  4WWP A;  4K7W A;  4BFR A;  1EU3 A;  1WM2 A;  3V61 A;  2G9H D;  1HTQ A;  3NZS A;  5AZG A;  4P16 A;  5E6N A;  2K8C A;  4ZRP A;  4K1R B;  2KFK B;  1NEK B;  1MVK A;  1QQR A;  1V1P B;  1RYJ A;  4ZHP A;  3Q8B A;  4FHJ A;  2RDB C;  2IDY A;  3R7R A;  2WS3 B;  2MJD A;  1TJE A;  2V0G A;  1TBE A;  3EFU A;  3UF8 A;  1T0S C;  1XF5 L;  1GNU A;  2JZP A;  1P7F A;  3N1Y C;  4KX6 B;  3N1X C;  2AX5 A;  4HJK A;  2CJO A;  2G1E A;  4LNK A;  1WSP A;  4L1B A;  3VR8 B;  3RFZ B;  2KJH B;  3W9C B;  4GN1 A;  3VH3 B;  4IM0 A;  1TYG B;  4P1B C;  2AQ2 B;  4FJV B;  4M8M A;  3DBH I;  2INP E;  4LDT B;  2ZNV C;  2E6X A;  1C9F A;  1ZDX A;  2CJN A;  3ZUN A;  3N3K B;  3NHE B;  4JGH B;  3X0W A;  4B9K A;  2IBI B;  2WDV B;  2KFJ A;  2RMM A;  3AE8 B;  3TIX A;  1TS5 A;  2IGH A;  5D3D A;  2EKI A;  4MEM A;  2EEL A;  1A70 A;  2DZI A;  3VTW A;  1YX6 B;  1LFD A;  2NBW B;  4NNJ B;  3AEA B;  4II3 B;  1Q5W B;  1YNT E;  1SF0 A;  1JRO A;  5DPT A;  4HDO A;  1C4A A;  4G50 A;  1BT0 A;  1EM7 A;  2PKO A;  4P6V F;  1FM0 D;  2LGD A;  5AUI A;  2BT6 A;  4TKN A;  3AU4 A;  2WXP A;  4DWF A;  3V6C B;  3BY4 B;  4ARI A;  1JRP A;  2GLS A;  1M94 A;  2WDQ B;  1SXT A;  3Q3O C;  1WX8 A;  2M0X A;  4IWQ A;  2O6V A;  4BZA A;  3KW5 B;  1F9J A;  2BB6 A;  2WWZ A;  1V5T A;  3U2S C;  2EMT A;  3KWL A;  1ET6 A;  1IPG A;  5G55 A;  4NAW B;  3GE3 C;  2BKF A;  2L52 A;  4XWW A;  2LWP A;  2K6Q A;  3EHV A;  4EOY A;  3VRB B;  2BWE S;  2YLM A;  4PYZ A;  4EE2 A;  1AYF A;  4ACF A;  3Q8C A;  1R4N B;  3AE5 B;  5IAA C;  1GPX A;  2FUH B;  1DYQ A;  2QIE B;  2DZJ A;  3QWZ B;  3NG0 A;  1SSN A;  1R7S A;  4FJZ A;  2JQR B;  1X1M A;  2LGY A;  5EE1 A;  1I35 A;  2MHJ A;  1SBB B;  4W9G A;  3GE8 C;  1H4R A;  2KX0 A;  3TBL D;  3IXS A;  5JXV A;  5DPS A;  3QX1 A;  4ANU A;  3O13 A;  3VTU A;  4PS7 A;  4ZYS A;  2LXC A;  2B76 B;  3RUL A;  3PV1 A;  3DHH C;  1R4M I;  5AEK B;  2KMA A;  2LGS A;  3QIJ A;  1K52 A;  3ONS A;  3DPD A;  1T6B X;  1TY2 A;  2PLP A;  3SDL C;  2RPQ A;  2DYM A;  5D2M B;  4HCN B;  1C79 A;  3A9J A;  1Q1O A;  3N9Y C;  4B0M A;  1YQB A;  2BYV E;  4KZC A;  1FNU A;  1JRU A;  2K3U A;  3DBR B;  3PZD A;  5C3J B;  1L2N A;  1P9D U;  2KQ7 A;  4WH4 A;  1L0X B;  4DBG A;  1GUA B;  2LZ6 A;  1QLB B;  1ESF A;  4KSK C;  2EMS A;  3X23 A;  2D3C A;  1MPE A;  3W2D A;  3U7Z A;  3U4E G;  3KWV A;  1F0Z A;  4JX1 C;  1FCL A;  3AN1 A;  3NVV A;  2LRU A;  3PRZ A;  2ACZ B;  1GB1 A;  3IT6 B;  2JYT A;  2MBE A;  1WGK A;  4EZJ A;  1OTR B;  4HPP A;  1PFD A;  3VDZ A;  4YSX B;  1PGB A;  2JZ3 B;  4HJG E;  3C19 A;  2PVG C;  3URY A;  1J7A A;  3DBL B;  2SEB D;  4ZRI A;  4FHK A;  4BAX A;  3LYY A;  3TEY A;  4K7U A;  1UGM A;  1UD7 A;  3UIO B;  4ANW A;  4NPN A;  1C76 A;  2DX5 B;  1WGH A;  3BVZ A;  4K7S A;  3P4S B;  1KLG D;  4HPM B;  2AQ3 B;  1E10 A;  3AEB B;  1WF9 A;  4JWS C;  2JWU A;  2KFK A;  4L2Y A;  1FPY A;  1QZE A;  3VQI A;  2RD0 A;  2G4D B;  2JPH A;  4ZOH C;  4ZYN A;  2JWZ A;  2ZVN A;  1V1P A;  2KXJ A;  3R66 C;  4YXD B;  1PDX A;  3MP9 A;  1GAQ B;  2L76 A;  2LMC A;  4BBN C;  3VR9 B;  2BS3 B;  3DWG C;  3B2G A;  4HK2 A;  1SE9 A;  2JT4 B;  1YN4 A;  1VZ8 A;  3QQ8 B;  3LXF A;  2Y5B B;  2J0M A;  5L83 A;  1T5X D;  1DOY A;  1EWY C;  2WLB A;  2Z0D B;  1WIA A;  2IO0 B;  2LGI A;  1VJK A;  3SU8 X;  1B1Z A;  3Q3F A;  1C78 A;  1KTK A;  2W3S A;  1NDD A;  1CK1 A;  5JHB A;  2D5G A;  2KWC A;  1T0R C;  2CU1 A;  4I6N B;  3OWE B;  3SEB A;  2N0S B;  3IAS 1;  1JQ4 A;  2FAZ A;  1YX5 B;  3VUW A;  3UIP B;  2KKC A;  1TIF A;  2EKE C;  1FCC C;  1WX7 A;  3FC4 A;  5FKA C;  4E3C A;  1WYG A;  2WYQ A;  3DVN V;  1WZ0 A;  2VRR B;  4KZ0 A;  4M0W B;  2N7E A;  5J18 A;  3M3J A;  2JYE A;  3V62 A;  1YN5 A;  3PVL A;  1F2R I;  3W1S A;  4IWP A;  1I7H A;  2CHW A;  1ZGU B;  4NJ6 A;  4KGS A;  4W9C A;  4K3C A;  4N6E B;  5BYS A;  1L5P A;  3HM6 X;  1N5X A;  4M8N A;  4YTM B;  2YEP B;  4RCO A;  2FCM A;  3PLV A;  1UBI A;  3S2A A;  1MFW A;  1MHX A;  2ZNV B;  1XCQ L;  1XLO A;  2KVR A;  2LI5 A;  1ZDV A;  2VH1 A;  4NAW A;  1I42 A;  4AP4 C;  4EZK A;  2L1A A;  3EEC A;  5AZF A;  4N59 A;  2FCS A;  2KDE B;  1DGJ A;  2NBV B;  2W82 A;  2DEN B;  1LXD A;  1QIL A;  5D6J B;  2VZK D;  4I6P A;  2H89 B;  4DQO C;  1P98 A;  1WE6 A;  2NMQ A;  1VZ6 A;  2WGS A;  1UUP A;  4LK0 M;  5JHA A;  2W55 A;  2LXA A;  4DHJ D;  3T3O A;  1VCB A;  2GBK A;  3ZVV A;  2FIF A;  3BII D;  2NCN A;  2DLB A;  3HIZ A;  5GMV A;  2KK8 A;  3ENE A;  2LHE A;  1MI0 A;  3NY5 A;  2IO3 B;  3Q3N C;  5EE3 A;  4NJC A;  4XX5 A;  2IJ0 A;  1PYW D;  2LVQ A;  2V4L A;  4MSM B;  1OEY A;  4WJN A;  3GP7 A;  3T8M A;  1SJE D;  5BMH A;  1XO3 A;  2BS2 B;  2UU7 A;  3FIL B;  2ZCB A;  3ZNI D;  1UBQ A;  1D3Z A;  3BIN A;  2DAF A;  3Q8A A;  5IOI A;  2K8H A;  4DK5 A;  2GBN A;  1ZUD 2;  4URK A;  1D5X C;  3AE7 B;  3RZF A;  1KJT A;  3OG5 A;  2KN5 A;  3QCA A;  2J4X A;  1F1H A;  3NRZ A;  2KN4 A;  3PS6 A;  4WJP A;  4DXA B;  3QJZ A;  4MT5 A;  2MX2 A;  2DZK A;  3RT3 B;  3NOB A;  4GDL B;  3Q69 A;  1TZ1 A;  2KDM A;  3BK2 A;  2OED A;  1TKY A;  3TL5 A;  1JW9 D;  1AAR A;  4RM8 A;  2KDB A;  2KMM A;  5AZH A;  3M95 A;  4CO7 A;  3N32 A;  3SFD B;  3JW0 X;  3BYY B;  2Q5W D;  1XLQ A;  2CHX A;  1LGR A;  1L0Y B;  2C60 A;  2HTM E;  3ABV B;  4WWO A;  1YIW A;  1PGX A;  1K50 A;  3PHX B;  3P63 A;  4TMA B;  2L7R A;  1IBX B;  3V6E B;  4PS8 A;  4XWT A;  3RN9 C;  4HPL B;  3ZRF A;  3DBS A;  3N30 A;  2NTS A;  2G45 B;  3SHQ A;  4HVB A;  2KC2 A;  1H8C A;  2ASQ A;  1UH6 A;  2MCN B;  2PPH A;  3CSF A;  3AE9 B;  3NS1 A;  3FKY A;  1Z2M A;  4OZB A;  1HA5 A;  2LHD A;  4WWM A;  3ZNZ B;  1LO5 D;  1LM8 B;  2DWQ A;  1NYR A;  3TCA A;  3SR6 A;  3MTN B;  1HZ6 A;  4H2A A;  4X57 B;  3ZJU A;  2JRH A;  3VAW A;  2GBJ A;  4R3D A;  2BGF A;  4ARC A;  4AJW A;  3AEG B;  2LEK A;  2Z59 B;  1E7P B;  2PTL A;  4RGO S;  1IUE A;  1V2Y A;  2L3Z A;  1N6Z A;  3TJP A;  4GMV A;  3ZGZ A;  1L6V A;  1S3S G;  2N9K A;  4KGR A;  2HE7 A;  1WZ3 A;  4NZL B;  1SE4 A;  3AXC A;  4AS1 A;  2K0P A;  3QC8 B;  3A4S C;  2D3B A;  2FCN A;  5HKH A;  4JWU C;  1GB4 A;  3KUD B;  1QOA A;  2N9E B;  4A8X C;  1V49 A;  4TUU A;  3NVZ A;  4GDK B;  4ICV A;  2J42 A;  4NY0 A;  4Q2J A;  4YTP B;  1KOT A;  4M0W A;  1V1O A;  4J6I A;  4KIK B;  3U30 A;  3CIR B;  2NR2 A;  4A3P A;  3RMK C;  5I4D A;  5TR5 A;  3ZXR A;  1OQQ A;  1QF6 A;  1K8R B;  4IUM B;  4TSS A;  4YL8 A;  1CQV A;  4GLS C;  1OQR A;  1N5W A;  3B2F A;  5E6P A;  5IA7 A;  5HHD G;  3V05 A;  1SE2 A;  3ZIM A;  1TT5 B;  1XD3 B;  4WUR A;  3ZRC A;  1XEE A;  3L17 A;  5BMG A;  2MEK A;  1TS3 A;  3WAL A;  1OGW A;  3N20 C;  4KSL C;  4DHZ B;  1WGD A;  1WWT A;  1V6E A;  2BYF A;  3VTV A;  4W9D A;  2L05 A;  2MBO A;  1F2R C;  2WXH A;  2WHI A;  1T3Q A;  1WY8 A;  3BK1 A;  2L0F A;  2R61 A;  2XEW A;  4NQK E;  1RAX A;  4J3O D;  2V4I B;  1UF0 A;  2PE9 A;  3DCG A;  4ICU A;  2KC1 A;  2M56 B;  2MH7 A;  4IM3 A;  3DBH B;  2V9H A;  1FFV A;  3NVY A;  1WM3 A;  1WR1 A;  2NVU I;  1BUI C;  2NTT A;  1RM6 C;  2IO1 B;  2KOX A;  3RNA C;  3C8Y A;  3B1L X;  1V81 A;  2ICI A;  2PW9 A;  1FD6 A;  1J19 A;  4PT5 A;  2AQ1 B;  4N9F 4;  1XQQ A;  1J0G A;  3ZDM C;  2AL3 A;  3LDZ E;  3DBR I;  4IW0 A;  4KDI C;  2V3P A;  5DPR A;  1N61 A;  4II2 B;  3ZQ4 A;  3DWM A;  2SAK A;  4ANX A;  3FIL A;  1SJH D;  4W9E A;  3IBE A;  4DHZ E;  3ETR A;  4B6W A;  4MSQ B;  1AW7 A;  1E9M A;  4DXF A;  5D94 A;  4HCP B;  1WFY A;  1UEL A;  5MPO A;  4FA6 A;  2WDT B;  3APC A;  4UDU C;  3BYT B;  4G11 A;  3O65 B;  4LTU A;  2BTE A;  4KVG B;  5GXG B;  3IAM 1;  4FN2 A;  1I4Q A;  1STE A;  4O1N A;  4GDL A;  4AWJ A;  1JCK B;  2WXG A;  3RNC C;  1ET9 A;  1WXM A;  4W9H A;  1GJZ A;  4JLC A;  2WXF A;  2KTR B;  1B9R A;  2K1F A;  2XK5 B;  3MJ5 A;  2PEA A;  3HVD A;  3APF A;  2PJH A;  4L23 A;  1V86 A;  5HI1 A;  2IZV B;  4DDG D;  3RZW C;  3W5U B;  1E8Y A;  1QOG A;  2JX5 A;  2UYZ B;  4MGI E;  4N58 A;  2VH2 A;  3C0R B;  2V1Y A;  1NEN B;  3U52 E;  4MH0 E;  4S0R A;  1C4P A;  2E3T A;  3Q14 C;  2QEJ C;  1M4V A;  2N9P C;  3EUB 2;  4A9A A;  5KHQ A;  1IBX A;  2GRI A;  4WQO B;  3AE1 B;  4JL9 A;  2WXJ A;  4XC2 A;  4TQ0 A;  2Y5P A;  4WAF A;  2N7J A;  1AWD A;  2MJE A;  4YT0 B;  2WU2 B;  4M01 A;  5BYR A;  2ZCC A;  4OHJ A;  3K9P B;  3I63 C;  2M8S A;  3V60 A;  4P1C C;  1TS2 A;  1WYW B;  1Y56 A;  2A4Z A;  2JXX A;  1ENF A;  3UI3 A;  2L8J A;  2HJ8 A;  4PYU A;  3EC8 A;  1SB3 C;  2K5P A;  2BPS A;  3DQV A;  4DXG A;  3HUI A;  4MM3 B;  3EFC A;  2MBQ A;  1NYQ A;  2MRP A;  2MW5 A;  1P7E A;  1E7V A;  1WJ6 A;  2O6V D;  2IPK D;  3ZJV A;  3ZTC A;  1J8C A;  3A1Q B;  4LJP B;  4EFO A;  1E5W A;  4LNI A;  2MLB A;  5LNK 1;  2OHF A;  4C00 A;  4HRO A;  4OVV A;  2KYW A;  3BZD B;  1TKG A;  3VHT C;  1L6U A;  2C9W B;  2JZZ A;  1Y8R C;  3RCZ A;  2HDE A;  3PT2 B;  4RM9 A;  3NZU A;  3R2I A;  5H92 C;  4F7Z A;  2K22 A;  4GDK A;  2KLC A;  1TGZ B;  4MDK E;  3KUC B;  2KNB A;  1T0Q C;  3T9L A;  3T3N A;  4A6Q A;  3QAR A;  3P4R B;  1EUV B;  1GG3 A;  5CHV C;  2KWV B;  1U4A A;  4KIK A;  4CHK A;  1KLU D;  3RNB C;  2H88 B;  4KV2 A;  3RYT A;  5D3I B;  3ZNH B;  1RFK A;  3VFK A;  3CMM B;  1ZP0 B;  3QAQ A;  3DHG C;  4OZA A;  3AB5 A;  2KX3 A;  4IDI A;  4TV3 A;  2PIA A;  1YJ1 A;  3WAN A;  2AEH A;  2K8B A;  2RR9 A;  3I5J C;  2N1V A;  1GC6 A;  4JQW C;  2MBB B;  3WIM A;  2LJI A;  2QHO A;  3H6N A;  4BOS C;  1WJ4 A;  1UWX A;  3RI7 C;  4HEA 1;  1G6J A;  1N60 A;  1RLF A;  4HWI B;  2KDI A;  2D3G A;  2NBU A;  2V3N A;  3VUY A;  5C23 A;  3JSV B;  3H9D A;  1JWB D;  3MHZ A;  3KLS X;  1A5R A;  2MA9 B;  4PS3 A;  4YWG G;  3ZYY X;  3NJT A;  2RPV A;  3PZ7 A;  1MG8 A;  4EZL A;  3HM3 A;  2I38 A;  1JWS D;  2WXR A;  2ZZP B;  2QIL A;  2AL6 A;  2JXT A;  1S1Q B;  3N1Z C;  3ZXV A;  5J17 A;  1ROE A;  3KUZ A;  3PO0 A;  2HTH A;  3BVM A;  2LUM A;  4B95 A;  1WGG A;  4C56 C;  4MAC A;  5FK9 C;  4W9F A;  4CQN A;  4NAM A;  3R7Q A;  3AED B;  2ZEQ A;  1RWS A;  5IP4 D;  4REZ A;  4KKI A;  1YQ3 B;  3OLM D;  3AEF B;  3RNF C;  2J0K A;  4MGY E;  5EDS A;  2LVO A;  1SIJ A;  1IGC A;  1IP9 A;  3DVG Y;  2BB5 A;  2LD9 A;  2C7N B;  3TSS A;  2G4S A;  2RSU A;  3DHI C;  4XDD A;  3AEE B;  3U8Z A;  3AE4 B;  3ZO5 B;  2WXK A;  2WDR B;  1VDV A;  3PTF C;  2DYO A;  2KTR A;  5G5H A;  4KGT A;  2XK5 A;  4LNO A;  4A90 A;  1Q0W B;  3GZN I;  2UWQ A;  4GSW A;  2WXI A;  3M62 B;  3TEW A;  1E7U A;  4IM2 A;  4IWO A;  1QKZ A;  2WXL A;  5LXI B;  1PQS A;  3BVG A;  2NS5 A;  1EF5 A;  3P2B A;  4FXC A;  4LDT D;  3KQ4 A;  3W1Y A;  3ML9 A;  1XT9 B;  3PSE B;  2KT7 A;  1TZO A;  2BS4 B;  2KQS A;  2YVC A;  3HK0 A;  2LJ5 A;  4YSZ B;  2IND C;  4EKU A;  5DCN A;  4RH6 A;  4RF1 A;  1E6E B;  2QCZ A;  2PMV A;  2JY6 A;  1I4G A;  1JML A;  1SIF A;  4LLG M;  1XLP A;  3GOE A;  3Q8E A;  1MHH E;  3KVF B;  5HG2 A;  1Q10 A;  1D6E C;  2W3R A;  1HXY D;  4OW0 A;  3WAO A;  3LB8 C;  3H1U A;  4WAA A;  4XE0 A;  2AYO B;  2J7Q B;  2FNJ B;  1TS4 A;  2WXO A;  4IOI E;  2BW2 A;  5D7G A;  2FCQ A;  2OOB B;  1EF1 A;  2FUG 1;  2IGD A;  2FE8 A;  3I57 A;  2L0T A;  2BQQ A;  3PLU A;  4XZ4 A;  2J52 A;  3AMZ A;  3A1Q A;  3P1M A;  2DNF A;  2N7D A;  1D4B A;  2WXQ A;  2VZK B;  3R2T A;  5E6O A;  2JF5 A;  2KVZ A;  1K51 A;  4MH8 A;  1J7B A;  2KD0 A;  2I1K A;  3QHT A;  1L0V B;  2D10 A;  1QOF A;  1VZ7 A;  4MEL A;  4I6L B;  2JSV X;  5LLI A;  4GIV A;  3AV8 A;  2K25 A;  5IO9 A;  4DHJ B;  3PPA A;  3TUO A;  4MGZ E;  1ZW7 A;  2BKR B;  4XYC A;  2X38 A;  4OVU A;  3L4P A;  1WGY A;  3L10 B;  4KDL B;  4JPS A;  3HVZ A;  1E8W A;  3RUI B;  3MFG A;  4JE3 B;  2WQY B;  2NPT B;  2D3A A;  4OVZ A;  1PUT A;  1D5M C;  1FO4 A;  1HE8 A;  1VD2 A;  1L7Y A;  5JZE B;  4ZHO A;  4ZDV A;  2M4N A;  5T8I A;  4E71 A;  5BMI A;  3Q3J A;  3DOW A;  2LAS A;  3DVN U;  3K9O B;  4WWN A;  2CU3 A;  3IVF A;  1AN8 A;  1YMH E;  2MP2 B;  4IC7 B;  4IG7 B;  5L95 C;  3QA8 A;  1CJE A;  2R2Q A;  3A33 B;  4BKS D;  4F1S A;  3JSV A;  2REX A;  3DDC B;  1XCT L;  2A5U A;  4ZRJ A;  1V8C A;  1C3T A;  1R4N I;  3BWU D;  1SE3 A;  1QT9 A;  2C7H A;  3VH4 B;  3QK0 A;  1WE7 A;  4P7I A;  3UQB A;  1WH3 A;  1HQR D;  1P3Q U;  4K81 A;  2GBM A;  2KHW B;  4USA A;  1MG4 A;  3AU5 A;  4WJQ A;  3L54 A;  3KH0 A;  1FFU A;  2INN E;  4F8C B;  2LFI A;  3AE3 B;  2L00 B;  3Q8F A;  1GC7 A;  1YQ4 B;  3I9V 1;  4K3B A;  1V5O A;  1FNV A;  4A3O A;  4MJS B;  2O2V B;  5C1Z A;  4RGT A;  4ZRQ A;  4W9K A;  2FID A;  1JWU D;  4OZC A;  1JWA D;  4FJY A;  1P0R A;  2ZJD A;  1N63 A;  4YSY B;  2QDF A;  2WXN A;  4WJO A;  2IY1 B;  1J7C A;  1XXG A;  1NI2 A;  3AE6 B;  1EO6 A;  3WA0 A;  3AI5 A;  2QC8 A;  4US9 A;  3MC8 A;  2D11 A;  3A9K B;  5G2N A;  2RDH A;  2GMI C;  1VRA B;  1OQY A;  1KRH A;  4TQ1 A;  1RFA A;  2QJL A;  3EA6 A;  4GOC A;  3EGR A;  2MSE D;  2BWF A;  3IT4 B;  4EEW A;  1F52 A;  2CHZ A;  5J2R A;  2GBR A;  1WMH B;  2KMC A;  3L08 A;  4ANV A;  5AUK A;  4HKQ A;  4HDQ A;  3MC0 B;  1UZX B;  4DDI D;  3R3M A; 
#chains in the Genus database with same CATH homology
 4HJK A;  1GG3 A;  2ZCB A;  3ZNI D;  1UBQ A;  5JH5 C;  1D3Z A;  2KJH B;  2DAF A;  3BIN A;  2KWV B;  1U4A A;  2K8H A;  4KIK A;  5CHV C;  4CHK A;  2GBN A;  3DBL I;  4KV2 A;  4URK A;  4GN1 A;  3VXW A;  3RYT A;  3RZF A;  3VH3 B;  4IM0 A;  1KJT A;  2LGX A;  2KN5 A;  3QCA A;  4W9J A;  3ZNH B;  3JYU A;  3VFK A;  3CMM B;  1V80 A;  4FJV B;  3PS6 A;  4WJP A;  4DXA B;  2DZM A;  2KAN A;  3QAQ A;  3QJZ A;  2ZVO A;  4M8M A;  5KHO A;  2MX2 A;  2V3S A;  2DZK A;  3DBH I;  2KLG A;  2KX3 A;  3VUX A;  1KM7 A;  1WXA A;  2ZNV C;  4LDT B;  3RT3 B;  4TV3 A;  4NJ7 A;  2B3A A;  4G0N B;  4W9L A;  3NOB A;  4GDL B;  3L0W B;  3PRP B;  1YJ1 A;  1TZ1 A;  3WAN A;  2AEH A;  2K8B A;  3ZUN A;  3N3K B;  3HHM A;  3NHE B;  4JGH B;  2RR9 A;  3X0W A;  2N1V A;  3NS8 A;  3TL5 A;  1GC6 A;  2IBI B;  4JQW C;  4B9K A;  2KFJ A;  1AAR A;  2MBB B;  4RM8 A;  2KDB A;  3WIM A;  2QHO A;  3PRM B;  3TIX A;  5AZH A;  3M95 A;  2HD5 B;  5CHW A;  4CO7 A;  3H6N A;  3N32 A;  4MEM A;  4BOS C;  3JW0 X;  1WJ4 A;  2DZI A;  2KO3 A;  4DK5 A;  1G6J A;  1LQB A;  3OJ3 A;  3VTW A;  1YX6 B;  2CHX A;  1RLF A;  1LFD A;  4HWI B;  2NBW B;  4NNJ B;  2KDI A;  2D3G A;  2NBU A;  2M1M A;  4II3 B;  1Q5W B;  4G3X B;  3VUY A;  5C23 A;  1E90 A;  3OJ4 B;  3JSV B;  3H9D A;  5DPT A;  4HDO A;  2C60 A;  4G50 A;  1A5R A;  1BT0 A;  4WWO A;  1YIW A;  2LVP A;  2MA9 B;  4PS3 A;  4E74 A;  3PHX B;  5FR6 A;  3H7P B;  2L7R A;  2LGD A;  4TKN A;  4PS8 A;  3V6E B;  1MG8 A;  3AU4 A;  4EZL A;  3HM3 A;  4HPL B;  3DBS A;  3ZRF A;  1OEY J;  3N30 A;  4DWF A;  3V6C B;  3BY4 B;  4HLE A;  2G45 B;  2JRI B;  2ZZP B;  2AL6 A;  1M94 A;  3APD A;  3SHQ A;  1S1Q B;  4HVB A;  2KC2 A;  5J17 A;  3KUZ A;  1WX8 A;  2M0X A;  2OJR A;  2O6V A;  4IWQ A;  4BVU C;  1H8C A;  3KW5 B;  1F9J A;  5L95 C;  2HTH A;  2KJR A;  2WWZ A;  1V5T A;  2ASQ A;  2EMT A;  1UH6 A;  2MCN B;  1IPG A;  5G55 A;  4B95 A;  1WGG A;  2PPH A;  2BYE A;  4ZRK A;  4NAW B;  3CSF A;  4W9F A;  2BKF A;  3R7Q A;  3UIN B;  2AWT A;  2ZEQ A;  1Z2M A;  2LWP A;  2K6Q A;  3EHV A;  3PHW B;  2G3Q B;  3OLM D;  4EOY A;  2KTF A;  4HXD A;  3ZNZ B;  2BWE S;  2YLM A;  1LM8 B;  4PYZ A;  3TCA A;  2J0K A;  4MGY E;  3MTN B;  2ZPY A;  4X57 B;  2NPT A;  5EDS A;  2LVO A;  2JRH A;  3VAW A;  5IAA C;  2GBJ A;  2FUH B;  1IP9 A;  2BGF A;  2DZJ A;  3OAW A;  3QWZ B;  4AJW A;  2Z59 B;  3DVG Y;  3WAM A;  2C5L C;  4FJZ A;  1V2Y A;  1X1M A;  2L3Z A;  2LD9 A;  2C7N B;  2LGY A;  1I35 A;  3TJP A;  4GMV A;  3UF8 A;  2G4S A;  2RSU A;  2C7M B;  4W9G A;  3U8Z A;  1WGR A;  1S3S G;  1IYF A;  1H4R A;  2KX0 A;  3TBL D;  4RMA A;  5DPS A;  2JVC A;  3QX1 A;  2HE7 A;  1WZ3 A;  3ZO5 B;  4ANU A;  4BOZ B;  3ALB A;  3VTU A;  4PS7 A;  2LXC A;  3AXC A;  3PTF C;  2DYO A;  3QC8 B;  2KTR A;  2CS4 A;  3A4S C;  3RUL A;  3PV1 A;  2FCN A;  5HKH A;  2KZR A;  2N1W A;  2XK5 A;  3KUD B;  1R4M I;  1WR6 E;  4EUT A;  1ZKH A;  2N9E B;  5AEK B;  1Q0W B;  1V49 A;  1V9J A;  2KMA A;  3GZN I;  1SGH A;  4TUU A;  2UWQ A;  4GSW A;  4GDK B;  3QIJ A;  4ICV A;  3M62 B;  4NY0 A;  3ONS A;  2MP2 A;  3DPD A;  3LJ3 A;  5LXH A;  1E7U A;  4IM2 A;  1KOT A;  4IWO A;  3SDL C;  2RPQ A;  5LXI B;  1E8Z A;  1PQS A;  1WXS A;  2DYM A;  2NS5 A;  2ZPN A;  5D2M B;  2K6D B;  3W1S C;  4HCN B;  1EF5 A;  3A9J A;  1Q1O A;  3P2B A;  3ECI A;  1P1A A;  3MJW A;  4J6I A;  4KIK B;  3U30 A;  4LDT D;  1YQB A;  2BYV E;  2NR2 A;  3A4R A;  3ML9 A;  4KZC A;  3W1Y A;  4A3P A;  1JRU A;  3PZD A;  1L2N A;  3VVW B;  2KWU B;  5TR5 A;  1XT9 B;  1P9D U;  3PSE B;  1K8R B;  4IUM B;  2KQ7 A;  2KQS A;  3HK0 A;  2YVC A;  4YL8 A;  3DVG X;  2RGF A;  2LJ5 A;  5E6P A;  1GUA B;  4DBG A;  5IA7 A;  2LZ6 A;  4EKU A;  2W9N A;  4LCD E;  3ZIM A;  2D2Q A;  5DCN A;  4KSK C;  2JUO A;  2CKH B;  1XD3 B;  2EMS A;  3X23 A;  2MQJ A;  3ZRC A;  2JY6 A;  3L17 A;  1SIF A;  3WAL A;  1OGW A;  3PGE A;  4KSL C;  4DHZ B;  1WGD A;  2LRU A;  3PRZ A;  3GOE A;  2DAJ A;  1V6E A;  2BYF A;  3VTV A;  4W9D A;  4MJS A;  2O2V A;  3KVF B;  2MBE A;  2L05 A;  4AOF A;  1WRD B;  4EZJ A;  2MBO A;  3JVZ X;  1OTR B;  1E8X A;  3AUL A;  3VDZ A;  2IY0 B;  3WAO A;  2JZ3 B;  3H1U A;  4WAA A;  1WY8 A;  2AYO B;  2J7Q B;  4ZRI A;  4FHK A;  2L0F A;  2FNJ B;  2XEW A;  4K7U A;  3KYD D;  4NQK E;  1RAX A;  1UGM A;  1UD7 A;  5D7G A;  2FCQ A;  4GU2 A;  2OOB B;  1EF1 A;  3UIO B;  2PE9 A;  1CMX B;  3WAP A;  3DCG A;  4FAD A;  3IG3 A;  4ANW A;  4ICU A;  4NPN A;  2KC1 A;  1NBF C;  2MWS B;  2GOW A;  2L0T A;  4IM3 A;  2DX5 B;  2N4F A;  1WGH A;  2PE6 B;  3PLU A;  4XZ4 A;  1WM3 A;  1WR1 A;  2WX0 A;  2NVU I;  5CTR C;  3A1Q A;  4K7S A;  2MBH A;  2N7D A;  3L13 A;  3A9K A;  4HPM B;  3ZDT A;  5E6O A;  1WF9 A;  2IO1 B;  2K39 A;  2KOX A;  3H7S A;  2JF5 A;  2KFK A;  4MGK E;  3VQI A;  1QZE A;  3B1L X;  1V81 A;  2RD0 A;  2DHZ A;  1J19 A;  2G4D B;  2JPH A;  2KD0 A;  4ZYN A;  2O6V B;  2I1K A;  3IFW B;  2JWZ A;  3QHT A;  2ZVN A;  4N9F 4;  4WJN A;  5CX3 A;  2KXJ A;  1XQQ A;  2D10 A;  3R66 C;  2LRW A;  1WXV A;  3TMP B;  4MEL A;  4BKT A;  4I6L B;  2L76 A;  3UGB B;  5LLI A;  2AL3 A;  3LDZ E;  4GIV A;  3ZDM C;  3L16 A;  2K25 A;  1WMH A;  3DBR I;  2BF8 B;  4IW0 A;  4KDI C;  4DHJ B;  3PPA A;  5DPR A;  4BBN C;  2KDF B;  4GXB A;  4MGZ E;  4GGQ A;  1Z5S B;  1ZW7 A;  4II2 B;  2BKR B;  1RRB A;  4AJY B;  4HK2 A;  4OVU A;  4ANX A;  1WGY A;  4W9E A;  1SE9 A;  3IBE A;  2JT4 B;  3L10 B;  4KDL B;  4DHZ E;  3QQ8 B;  4B6W A;  4MSQ B;  4GB9 A;  2Y5B B;  1E8W A;  3RUI B;  2J0M A;  5L83 A;  5D94 A;  2NPT B;  4HCP B;  2Z0D B;  1WFY A;  1UEL A;  1WIA A;  2IO0 B;  3SU8 X;  4FA6 A;  2WDT B;  3APC A;  4A20 A;  3Q3F A;  4NQL B;  4AUQ C;  3MHS D;  4G11 A;  3O65 B;  1NDD A;  1WJU A;  4KVG B;  5JHB A;  4FN2 A;  2KWC A;  3ZLZ A;  1HE8 A;  1VD2 A;  1L7Y A;  3CF6 E;  4GDL A;  4AWJ A;  5JZE B;  4BKG A;  2WX1 A;  1WXM A;  2CU1 A;  4I6N B;  4ZDV A;  4W9H A;  3PRE A;  1GJZ A;  3IHP C;  4JLC A;  2M4N A;  2KTR B;  2FAZ A;  1YX5 B;  3VUW A;  4E71 A;  1WJN A;  2K1F A;  2XK5 B;  2PEA A;  2M17 A;  3UIP B;  2KKC A;  3Q3J A;  3APF A;  3B0A A;  2LAS A;  2EKE C;  3DOW A;  2PJH A;  3DVN U;  3K9O B;  4WWN A;  3SD5 A;  1V86 A;  1WX7 A;  3ZW3 A;  3M63 B;  3IVF A;  2IZV B;  3ZKJ C;  2MP2 B;  1FXT B;  4E3C A;  2WYQ A;  4IC7 B;  3DVN V;  4IG7 B;  2R2O A;  4BKS A;  1WZ0 A;  2VRR B;  4KZ0 A;  1YD8 U;  2N7E A;  3QA8 A;  4M0W B;  2R2Q A;  5J18 A;  1WX9 A;  3M3J A;  3KYC D;  3V62 A;  3PVL A;  4DDG D;  3A33 B;  3RZW C;  1E8Y A;  3A9J B;  4BKS D;  2LUE A;  4F1S A;  1ISN A;  2UYZ B;  2REX A;  3JSV A;  2CR5 A;  3DDC B;  4IWP A;  4MGI E;  3RD2 A;  3C0R B;  3W1S A;  2V1Y A;  2CHW A;  1ZGU B;  2A5U A;  4ZRJ A;  3U7D A;  4MH0 E;  4NJ6 A;  4W9C A;  1C1Y B;  1C3T A;  1R4N I;  2N9X A;  1WI0 A;  3H7P A;  5DPW A;  2N9P C;  2I1J A;  5KHQ A;  3ZNG C;  1T0Y A;  4WQO B;  2C7H A;  4JL9 A;  3HM6 X;  4BBN F;  3VH4 B;  4XC2 A;  4TQ0 A;  3QK0 A;  1WE7 A;  4M8N A;  3D32 A;  1J0G A;  4P7I A;  2FCM A;  1WH3 A;  2D07 B;  2KJ6 A;  3UQB A;  1P3Q U;  3PLV A;  4JIO U;  4K81 A;  2GBM A;  2KHW B;  4LJO B;  1UBI A;  3AU5 A;  4MM3 A;  4WJQ A;  1KLV A;  2IYD B;  3L54 A;  3S2A A;  2ZNV B;  3KH0 A;  1I42 A;  2ZCC A;  4F8C B;  2KVR A;  2LI5 A;  3K9P B;  2L00 B;  1TTN A;  1GC7 A;  3B08 A;  3UQA A;  1V5O A;  2J0J A;  2M8S A;  4FUL A;  3V60 A;  1WYW B;  4NAW A;  4MJS B;  2O2V B;  4A3O A;  2A4Z A;  4AP4 C;  2JXX A;  4FBJ B;  3I3T B;  3EEC A;  4EZK A;  5C1Z A;  4W9K A;  5AZF A;  2FCS A;  2L8J A;  2HJ8 A;  2FID A;  2KDE B;  4PYU A;  4FJY A;  3ZTD A;  1P0R A;  2NBV B;  2ZJD A;  3EC8 A;  2DEN B;  2Z0E B;  2BPS A;  1LXD A;  3DQV A;  4WJO A;  5CHF A;  4FLH A;  5D6J B;  4I6P A;  2MBQ A;  1P98 A;  2IY1 B;  2MRP A;  2MW5 A;  5BO4 B;  4W9I A;  2XBB C;  1NI2 A;  2IO2 B;  1E7V A;  1WE6 A;  1WJ6 A;  4ASW C;  2O6V D;  1EO6 A;  3WA0 A;  4CYE A;  2DYB A;  3ML8 A;  3AI5 A;  3CST A;  4WWP A;  4K7W A;  4BFR A;  1WM2 A;  3ZTC A;  3V61 A;  1J8C A;  3A1Q B;  4LJP B;  2D11 A;  5JHA A;  4DHJ D;  2LXA A;  3A9K B;  3NZS A;  1VCB A;  2GBK A;  5G2N A;  4EFO A;  5AZG A;  1E5W A;  2FIF A;  5E6N A;  3ZVV A;  2GMI C;  2K8C A;  1OQY A;  2MLB A;  2NCN A;  2KFK B;  4K1R B;  3HIZ A;  5GMV A;  4TQ1 A;  2KK8 A;  4OVV A;  1RFA A;  3ENE A;  4GOC A;  3NY5 A;  3VHT C;  2C9W B;  2JZZ A;  2IO3 B;  1Y8R C;  2MSE D;  3RCZ A;  2BWF A;  3PT2 B;  4EEW A;  4FHJ A;  4RM9 A;  4XX5 A;  3R7R A;  3NZU A;  2V4L A;  2LVQ A;  1TBE A;  2CHZ A;  4MSM B;  4F7Z A;  5J2R A;  2GBR A;  1OEY A;  1WMH B;  2KLC A;  1GNU A;  2KMC A;  3EFU A;  3L08 A;  1TGZ B;  4GDK A;  4MDK E;  3KUC B;  4ANV A;  4HDQ A;  3T8M A;  2KNB A;  1UZX B;  4DDI D;  3T9L A;  3R3M A;  3QAR A;  1EUV B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...