2IYDB

Senp1 covalent complex with sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
publication title Senp1 Native Structure
rcsb
source organism Homo sapiens
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iydB00
1BT0A 1LXDA 2O2VB 4FADA 5J2RA 1GJZA 4MSMB 3V6EB 1P9DU 4GOCA 3QAQA 3CSFA 2L0TA 3R7QA 1V5TA 3A33B 3RYTA 4IC7B 3T8MA 1ISNA 4AJWA 1KM7A 4ZRIA 3DPDA 4LDTB 1K8RB 2GBKA 2MSED 4LJPB 2ZPNA 3K9PB 3V62A 4ANVA 2EMTA 3OAWA 2KX0A 5DCNA 1YX6B 1TZ1A 1Q0WB 1WZ0A 3OJ4B 2L7RA 3PVLA 3M3JA 3QHTA 4IWOA 1RFAA 1NI2A 2GOWA 2OOBB 2RD0A 2N9XA 2R2OA 4HK2A 4W9IA 4BOSC 3DVNU 4NQKE 2ZCCA 4WJPA 4JLCA 2J0KA 2KC1A 2D07B 2DZIA 4RMAA 2K25A 3A9JB 3VFKA 2NPTB 2LGYA 2IO2B 2W9NA 2EKEC 2LXCA 2D10A 2DAJA 2KFJA 1M94A 2CHXA 1WGDA 1V86A 4PYZA 1EF1A 1YX5B 4MJSA 3DVGY 4ZYNA 2ZJDA 3HIZA 4IW0A 3JW0X 4F8CB 3KW5B 3B1LX 1WX9A 2KMAA 4K81A 4MEMA 1GC7A 3HM3A 1FXTB 4WWOA 1C1YB 4A20A 2KJHB 1J0GA 1D3ZA 3PV1A 5C23A 4EZKA 3T9LA 4HVBA 2PEAA 4W9EA 4TV3A 5CTRC 3PGEA 3MTNB 3VUXA 3LJ3A 3A9KA 4II2B 3W1YA 1WX7A 2JXXA 1E8ZA 3RZWC 2KO3A 1I35A 3PPAA 1PQSA 2GBRA 3TCAA 4FBJB 1NDDA 1WJ4A 3QX1A 2M0XA 3C0RB 1SGHA 2GBMA 1E7UA 5CHWA 4A3PA 1GC6A 4DHJB 5EDSA 1Q1OA 1ZW7A 3M63B 1KOTA 4PYUA 3X0WA 3DBLI 2V4LA 3PLVA 1TBEA 2MA9B 2ZEQA 3KH0A 3WANA 1WXSA 3DCGA 4URKA 4DWFA 4KDIC 4NJ7A 1JRUA 2ZVNA 4GDKB 2IO3B 5IA7A 2M17A 4HPMB 3SHQA 4NQLB 3P2BA 4K7WA 4HXDA 2LI5A 3VUWA 4GXBA 4TQ1A 3W1SA 1WGHA 3H1UA 4ASWC 1WI0A 1Z2MA 2IY0B 3ENEA 4HPLB 4K7UA 3NOBA 2MLBA 1HE8A 3UGBB 3WAMA 2KDIA 2Z0DB 1WR6E 3UIPB 2C5LC 5E6OA 5AZHA 4GDKA 5D2MB 5GMVA 2DYBA 3PT2B 2AL6A 3QQ8B 3GZNI 2LRUA 4EUTA 2DZJA 2M4NA 3DBHI 4IWQA 1V81A 4KSLC 4PS3A 4EZJA 3UQAA 1WRDB 2FCMA 4DXAB 2KJ6A 3R7RA 1WF9A 2KDBA 4GB9A 1RRBA 2N1VA 4MELA 4HWIB 1WIAA 1IPGA 2FCSA 5LLIA 3V60A 1E5WA 5D94A 3RULA 1CMXB 2BYFA 3EC8A 3GOEA 1S1QB 2QHOA 2MBQA 2IBIB 5KHOA 3NZSA 2EMSA 3H7PB 3PRMB 3QCAA 1WE7A 3QARA 1RAXA 4KIKA 4WAAA 1V2YA 3QWZB 4BKSA 1MG8A 3ZNID 3OLMD 1ZGUB 4EOYA 2XBBC 2FIDA 1WM3A 2PE9A 4G3XB 4BBNC 3LDZE 3H7PA 2DHZA 1UH6A 2NCNA 4RM8A 2LVOA 1LFDA 3WALA 3DBRI 3VVWB 2I1KA 4KZCA 3ZIMA 3NHEB 3PREA 4AJYB 4NAWA 3APDA 2IZVB 1GUAB 4WJQA 3HM6X 1Q5WB 3KUCB 3VAWA 5FR6A 1V5OA 1UBQA 2KQ7A 1OQYA 2KC2A 2K8HA 3B0AA 2Y5BB 4EEWA 3ECIA 4CO7A 1EO6A 4XC2A 4ANXA 1WMHA 1YIWA 3A1QA 2JZZA 2KLCA 4LDTD 4MJSB 3VTVA 3QA8A 3WIMA 2KNBA 1EF5A 1P98A 2IY1B 4FJYA 3VQIA 1WJ6A 1ZKHA 3JSVA 4GMVA 4WJOA 1A5RA 4LJOB 3JYUA 2CKHB 2D3GA 5HKHA 3SDLC 2DZMA 2N9EB 4W9LA 3QK0A 2REXA 2KVRA 3WAPA 4DHZE 4IUMB 1E90A 3RUIB 5CX3A 3TBLD 5IAAC 2KN5A 2GBJA 4PS7A 3ZNZB 2WWZA 4MM3A 5G55A 1I42A 4MDKE 4KV2A 5BO4B 3A9KB 4MGYE 1VCBA 1UELA 4W9HA 4NPNA 2LGXA 3SU8X 2G4DB 2A4ZA 4FLHA 4BVUC 3BY4B 4F7ZA 3R66C 2NVUI 3ZW3A 4BBNF 2L3ZA 4B9KA 1WGYA 4ICUA 4XZ4A 1IYFA 5L83A 3AU4A 3PLUA 1EUVB 2V3SA 3L16A 3EHVA 4F1SA 2DYOA 2D2QA 2KWCA 1KLVA 1XT9B 3L13A 4I6LB 3VHTC 2LWPA 1L7YA 4G50A 4JL9A 1C3TA 2K6QA 3RD2A 3VDZA 2NBUA 3EECA 5KHQA 4E71A 2NBWB 4IG7B 5G2NA 1OEYJ 2NS5A 1GG3A 2KANA 4AWJA 5JH5C 1G6JA 2MP2A 3DVGX 4II3B 2BF8B 5J18A 2HTHA 3AI5A 2MBHA 3MJWA 3RZFA 3Q3JA 4K1RB 4J6IA 3PHXB 3X23A 5AZFA 2IYDB 3V61A 3ZDMC 2ZPYA 2CR5A 1V80A 3PRPB 2PE6B 3I3TB 3U8ZA 4DHJD 3KYCD 3IHPC 4P7IA 2DYMA 4FJVB 3D32A 3IBEA 3TMPB 3ZDTA 1TGZB 1WXAA 2BKRB 1WE6A 5LXHA 2AWTA 2LJ5A 4KDLB 2BWES 4LCDE 1E7VA 2LVPA 2PPHA 2DX5B 1OTRB 2KQSA 2DENB 2LD9A 1WYWB 2VRRB 4WQOB 2V1YA 4EZLA 2AEHA 1YJ1A 1WGGA 4DDGD 5D7GA 2BGFA 3TIXA 4X57B 3M95A 3A4SC 4HJKA 4WWNA 4AP4C 2KLGA 4KIKB 4HLEA 2RPQA 1S3SG 1WGRA 4FHKA 4NJ6A 3ZTDA 5JZEB 4M0WB 4BOZB 4MGZE 2PJHA 3ZO5B 4CHKA 2C7HA 2WYQA 2HE7A 1NBFC 2M1MA 2WX0A 4OVVA 4ZRJA 3W1SC 4EKUA 2HD5B 4K7SA 3IFWB 1F9JA 4EFOA 2ZVOA 4PS8A 3VUYA 5AEKB 4ANUA 1WM2A 2LVQA 2O6VB 1WY8A 2M8SA 2IO1B 2LASA 3PS6A 4NY0A 4W9GA 2BYVE 4ZRKA 4AOFA 4ZDVA 4NAWB 1WXMA 2NR2A 2XK5B 1SIFA 2KWVB 2BPSA 2YVCA 4JQWC 1U4AA 3ONSA 2ZNVB 2LGDA 3VH3B 2N7EA 4JGHB 2LXAA 3Q3FA 4FA6A 3B08A 3H9DA 4KSKC 2C60A 2O6VA 1UD7A 5C1ZA 1WMHB 4M8NA 3A1QB 3V6CB 5JHAA 3KYDD 3U30A 1WJNA 2KTFA 2MW5A 2XK5A 3ALBA 3PRZA 2R2QA 5E6NA 1VD2A 3JSVB 1RLFA 3TL5A 1WXVA 3PZDA 4FULA 4BFRA 2KFKB 1P0RA 2JRIB 5J17A 2Z59B 3ZRFA 3DBSA 3N30A 2KDFB 1J8CA 2NBVB 3PTFC 5DPRA 2CHWA 2JVCA 3DQVA 4DBGA 4DK5A 5JHBA 2WX1A 2CHZA 4B95A 4FN2A 1E8YA 4MGIE 2I1JA 2RSUA 2JRHA 3L08A 2KFKA 3AULA 1P3QU 3NY5A 4RM9A 2N4FA 2G4SA 3R3MA 4GDLB 3H7SA 2MCNB 5E6PA 2ZNVC 2O2VA 2C7MB 2DZKA 3L17A 4NNJB 3KUDB 1UGMA 3M62B 1SE9A 2LUEA 2CS4A 2L8JA 3N3KB 2FCQA 5DPTA 3L10B 4MSQB 4DHZB 2KD0A 4GU2A 3N32A 2UYZB 2LRWA 3AXCA 3QC8B 4GDLA 4KZ0A 4MGKE 1LQBA 3HK0A 2RGFA 3UQBA 3L0WB 3RT3B 2AYOB 2K6DB 2KX3A 3S2AA 3KUZA 3QJZA 4IWPA 4FHJA 3WA0A 1WZ3A 2C7NB 1WH3A 2MP2B 2CU1A 3RCZA 4BKTA 1GNUA 4W9DA 5DPSA 2D11A 3KVFB 4A3OA 2DAFA 3A4RA 2UWQA 3ML8A 5D6JB 3IVFA 3ZRCA 1H8CA 4GN1A 3VXWA 4TQ0A 1J19A 2JPHA 1V49A 3ZLZA 1UBIA 1WFYA 3A9JA 3NZUA 2NPTA 3EFUA 3OJ3A 4TKNA 3UF8A 2JY6A 1TTNA 4ICVA 2BWFA 2KMCA 3DVNV 1XQQA 2KDEB 2KOXA 1XD3B 3L54A 4W9FA 2J7QB 1E8WA 2L05A 1V6EA 2L76A 2ZZPB 4YL8A 4HDQA 3ZNHB 3ZNGC 2JWZA 2MX2A 4MH0E 2RR9A 2B3AA 1X1MA 2N1WA 2KHWB 2ASQA 3VH4B 3TJPA 2KK8A 1WJUA 3CSTA 3HHMA 4KVGB 4W9JA 4ANWA 3CF6E 2K39A 2XEWA 2AL3A 5CHVC 2J0MA 1AARA 1IP9A 2JT4B 1QZEA 4I6PA 4GGQA 3APCA 3NS8A 1R4MI 3PHWB 2N9PC 1LM8B 2MWSB 1Y8RC 4JIOU 1YD8U 2FCNA 2MBOA 4HCNB 2MBEA 3MHSD 2IO0B 4XX5A 3DOWA 3SD5A 3U7DA 4IM3A 3UIOB 3WAOA 3PSEB 4GSWA 2K8CA 2J0JA 3APFA 1WR1A 4FJZA 2LZ6A 3ML9A 4OVUA 1E8XA 4GIVA 4CYEA 2KKCA 3JVZX 2MRPA 4W9CA 4N9F4 2KTRB 2GBNA 3IG3A 3ZVVA 2GMIC 3VTUA 3ZTCA 2N7DA 2JZ3B 2YLMA 5TR5A 5AZGA 1YQBA 2G45B 4I6NB 2A5UA 2FNJB 3CMMB 3H6NA 2KZRA 2L0FA 3AU5A 1KJTA 4E3CA 5L95C 4W9KA 2K1FA 4BKSD 3QIJA 4G0NB 4G11A 2FIFA 2KXJA 4IM0A 4M8MA 2KTRA 3ZKJC 3O65B 4IM2A 1R4NI 1OEYA 2OJRA 2ZCBA 5LXIB 1V9JA 2BKFA 1OGWA 2C9WB 2HJ8A 1H4RA 4WWPA 2WDTB 4HCPB 2KJRA 2Z0EB 2MBBB 2MQJA 2O6VD 2BYEA 3ZUNA 4WJNA 3VTWA 2KWUB 3UINB 3K9OB 2K8BA 2FAZA 2G3QB 4E74A 4TUUA 1WX8A 2L00B 3DDCB 5DPWA 1UZXB 4BKGA 2JUOA 4DDID 1T0YA 2JF5A 4AUQC 1L2NA 4HDOA 1Z5SB 3BINA 1P1AA 2FUHB 5CHFA 4B6WA
chains in the Genus database with same CATH superfamily
1JWUD 1V97A 4FADA 2QILA 1JRPA 4YTPB 3CSFA 1MFWA 3R7QA 2AQ3B 4IC7B 2K3UA 2PMVA 3T8MA 2WP9B 3U2SC 1ZOYB 1J7BA 2ZPNA 1B9RA 3GE8C 4ANVA 5DCNA 1SBBB 1YX6B 1VDVA 2HDEA 1NI2A 2GOWA 2OOBB 2RD0A 4W9IA 3DVNU 4QAYA 3AMZA 2D3CA 5HG2A 3A9JB 1QF6A 2NPTB 4XWWA 2EKEC 2LXCA 2L83A 1M94A 1VZ6A 1JWAD 4F8CB 1C76A 1WX9A 3R2IA 1SE2A 2DWQA 1JQ4A 1R4MB 1GB1A 3PV1A 4HVBA 2PEAA 1ZXHA 1EWYC 3URYA 3VUXA 1CQVA 4GLSC 1QOFA 2KO3A 4D2KA 4FBJB 1HZ6A 1NDDA 4YSYB 4DHJB 1ZW7A 1FXAA 3B9JA 3M63B 3X0WA 2MA9B 2ZEQA 3BZDB 4DWFA 4KDIC 3AM9A 1JRUA 2ZVNA 4GDKB 5IA7A 3SHQA 4NQLB 3P2BA 1N6ZA 4K7WA 3AEAB 1WGHA 3H1UA 1P7EA 4S0RA 4HPLB 3ENEA 4K7UA 2DNFA 1HE8A 1KLGD 2KT7A 2J52A 3GZNI 2DZJA 2M4NA 3DBHI 4IWQA 4R3DA 4WURA 3TUOA 2LHEA 3LB8C 3V60A 3GOEA 3KWVA 2MBQA 2EMSA 3ZJUA 1SIJA 4XYCA 2XNAC 1C4PA 3QWZB 1UF0A 3ZNID 4IDIA 2XBBC 4FXCA 4NJCA 4BBNC 3LDZE 4C56C 2Z8LA 4ARCA 4RM8A 3RNEC 4ACFA 2LVOA 1UNSA 3DBRI 2I1KA 3PREA 3APDA 2WU5B 3P4SB 2TSSA 1V5OA 3KLSX 1HEZE 2K8HA 3ECIA 1EO6A 4XC2A 1K51A 1YIWA 1IUEA 3A1QA 3E9SA 4LDTD 3VTVA 4XGAB 3WIMA 3TEZA 1EF5A 3IT6B 1YOVB 4LJOB 5HKHA 4HROA 2DZMA 2N9EB 4W9LA 2KVRA 4IUMB 5AUKA 3EUB2 1IBXA 3TBLD 3BVMA 4PS7A 2WWZA 5G55A 4RGTA 2LHDA 4MDKE 4W9HA 4NPNA 2LGXA 3R66C 1UWXA 4WQMA 2V3SA 2DYOA 3RFZB 3BK1A 1XT9B 1L7YA 1JALA 1KFYB 4G50A 1C3TA 2K6QA 3RD2A 5KHQA 5G2NA 2KANA 3J9CA 3OWEB 1I4PA 5JH5C 4II3B 2BF8B 3RPFC 4J6IA 4K1RB 3ZYYX 5AZFA 1RYJA 5D3IB 2BVCA 2M19A 3BYTB 3PRPB 2PE6B 2DYMA 4FJVB 1KLUD 4KDLB 2MJDA 2BWES 1E7VA 4KKIA 1OTRB 5T8IA 2DENB 2VRRB 3IAM1 1EU4A 4HJKA 3A4SC 3Q6BA 4KIKB 4HLEA 2RPQA 1NEKB 1MHXA 4M0WB 1MVKA 4MGZE 2PJHA 3ZO5B 2HE7A 4OVVA 2WX0A 3ZXRA 2HD5B 4EFOA 4PS8A 4ANUA 1WM2A 4W9GA 1WY8A 2IO1B 4NY0A 1FPYA 1SSNA 1SIFA 2YVCA 1TKEA 1U4AA 3ONSA 3VH3B 2N7EA 4JWUC 1ET6A 2CJOA 2J53A 3B08A 1KTKA 2C60A 2LEKA 2O6VA 3Q3NC 1L0YB 2FUG1 1DYQA 1AWDA 3V6CB 2RDGA 5JHAA 3KYDD 3PRZA 2XK5A 3ALBA 2WXLA 4A55A 3JSVB 3TL5A 4US8A 4BFRA 2JRIB 2GB1A 1D5MC 4K3CA 5DPRA 4C00A 2WX1A 3U52E 4B95A 4YSXB 2JRHA 3AULA 1P3QU 3NY5A 3N1ZC 1FRRA 1PGXA 3L17A 1SE9A 4NAMA 1YN3A 4DHZB 3NG0A 2LRWA 3QC8B 3BIID 4MT5A 1LQBA 2RGFA 3RT3B 2AYOB 2KX3A 4XWTA 3KUZA 4IWPA 4DXFA 1TKYA 1WZ3A 1WH3A 4A3OA 3KVFB 3A4RA 1H8CA 2D3AA 4TQ0A 1J19A 1I4GA 2JPHA 1K53A 1UBIA 1WFYA 3A9JA 1OQQA 3UF8A 2NPTA 4TKNA 1TTNA 1T5XD 1XCQL 5I4DA 2KDEB 3W9CB 4W9FA 2J7QB 4S17A 3Q69A 3C8YA 4J3OD 3DHGC 3ZNGC 1FNWA 2RR9A 2B3AA 1X1MA 2KHWB 2JYTA 3TJPA 1SEBD 2XEWA 2J0MA 1GOZA 4GGQA 3APCA 1Q10A 1ZP0B 3P4QB 4JIOU 3DWMA 4HCNB 2IO0B 4XX5A 4C7ZA 2BT6A 3WAOA 3FKYA 4GSWA 2J0JA 4FJZA 2LZ6A 1XLNA 1ZE3D 3JVZX 4N9F4 3IG3A 2WXOA 4KX6B 2G45B 4P16A 2A5UA 3P4RB 4JX1C 2BS4B 2KZRA 2L0FA 3AE4B 1KJTA 1WYGA 3AU5A 4E3CA 5L95C 4G0NB 2INDC 1IGDA 1ZDXA 2FIFA 2QMTA 4IM0A 5IKCM 1CZPA 3AEDB 1OFFA 5LXIB 2SAKA 3HVDA 1V9JA 2BKFA 1OGWA 1C77A 2WGSA 5IP4D 2Z0EB 2MBBB 2G3QB 4PK1A 2L00B 3B2FA 3NS1A 5DPWA 1UZXB 4BKGA 1HA5A 2LFIA 2K5PA 3R2TA 2KAJA 4RNAA 4ZHOA 2FBWB 2O2VB 2WXPA 2BB5A 5J2RA 1GJZA 1TS4A 1P9DU 4O1NA 1HTQA 4GOCA 2EKIA 1SB3C 2QC8A 1XCTL 3RYTA 3FILB 3DPDA 4LDTB 2GBKA 4LJPB 2MSED 1T6BX 3OAWA 2KX0A 2AQ2B 1TZ1A 3PVLA 2L7RA 4IWOA 4OZCA 2N9XA 3VRBB 4HK2A 2WXQA 3HUIA 2ZCCA 2CJNA 4WJPA 2J0KA 2KC1A 2D07B 4RMAA 4B0MA 2WXKA 2LGYA 3DHHC 4P1CC 4MH8A 2D10A 2KFJA 2CHXA 3P63A 2WXIA 4ZYNA 3DVGY 2WXHA 3HIZA 1V1PB 3W5UB 1HXYD 3B1LX 2KMAA 4K81A 4MEMA 1ZXIA 1YQ4B 1FXTB 3Q8AA 2J4XA 4WWOA 3GE3C 2CU3A 2KJHB 1J0GA 1D3ZA 2BQQA 1XO3A 4TV3A 1UWMA 1FFVA 3PGEA 5CTRC 3MTNB 5IOIA 3LJ3A 2QSDA 1MJDA 4II2B 3W1YA 2WNMA 2IGDA 1E8ZA 3PPAA 1WJ4A 3FC4A 3C0RB 2GBMA 5CHWA 5EDSA 1Q1OA 3VR8B 5FR3A 1KOTA 2V4LA 1TBEA 3KH0A 3V05A 3DCGA 2PLPA 3ZQ4A 4WAFA 2LI5A 5C3JB 1L4DB 2MEKA 2IY0B 3VR9B 1EU3A 4XDCA 3NOBA 3WAMA 1WR6E 4BZAA 3AEEB 5AZHA 1E9MA 3WCQA 2AL6A 4EUTA 1C79A 4PS3A 1V81A 4EZJA 1GPXA 1WRDB 2KDBA 1RRBA 4HWIB 1WIAA 3HVZA 4WIPA 1E5WA 3EC8A 1S1QB 2W3RA 2QHOA 2IBIB 3NZSA 3PRMB 3AH7A 1FCCC 3QARA 1VLBA 4KIKA 4BKSA 1MG8A 2AX5A 2Y5PA 4EOYA 2M0AA 2PE9A 4G3XB 1F2RI 3H7PA 2DLBA 2NCNA 1DGJA 3NVYA 3RNCC 1LFDA 3VVWB 4KZCA 1SF0A 1J7CA 1OQRA 2IZVB 3KUCB 3VAWA 5FR6A 2PW9A 3SR6A 4CO7A 1PYWD 1NYRA 1P98A 1WJ6A 3JSVA 3ZGZA 4WJOA 1A5RA 1EWCA 1E6EB 2D3GA 2G9HD 3QK0A 2REXA 1WGKA 4DHZE 5IAAC 3ZNZB 4KV2A 5BO4B 1VZ7A 4MGYE 3IXSA 1FRDA 4FLHA 4BVUC 1J7AA 1QOAA 4BBNF 2L3ZA 2ZW0A 3U7ZA 1WWTA 4XZ4A 1XLOA 2I38A 4F1SA 2KWCA 3L13A 3VHTC 1N62A 1VZ8A 3EECA 4LTUA 2NBWB 2NS5A 3EGRA 3MC9A 3VRAB 1TKGA 3AEBB 5H92C 2HTHA 2MBHA 3MJWA 3RZFA 4WH4A 3GZNB 3Q3JA 3PHXB 2CR5A 4OVZA 4AS1A 2Y5CA 4P7IA 2GRIA 3P42A 3ZDTA 3D32A 3IBEA 3NVWA 2BKRB 2LJ5A 4A6QA 4LCDE 3RMKC 2LVPA 2DX5B 1YN5A 2X38A 2LD9A 4WQOB 1L5PA 1YJ1A 5D7GA 1FEHA 3M95A 5C2TB 5JZEB 1K50A 1NBFC 4RGMA 3DBRB 3W1SC 3IFWB 3AE9B 3VUYA 2LVQA 1F0ZA 3CWIA 4AOFA 4NAWB 2W54A 2ONQA 2BPSA 4JQWC 4LNFA 2LGDA 2LXAA 4FA6A 3H9DA 1WMHB 4M02A 3U30A 1WJNA 2KTFA 5E6NA 1UGJA 4FULA 1T3QA 2YEPB 2Z59B 2X8XX 2KDFB 2NBVB 2J42A 2JVCA 1YMHE 3DQVA 4DK5A 4OW0A 3AB5A 2KFKA 2N4FA 1RM6C 4GDLB 2O2VA 2C7MB 1QQRA 1ET9A 2DZKA 5AUIA 1CJEA 2CS4A 3Q14C 5G5HA 3U4EG 3FILA 2M56B 3CIRB 1PDXA 4KZ0A 4MGKE 3L0WB 2MP2B 3DBLB 1GNUA 4HEA1 4WWMA 5D6JB 3IVFA 3RNBC 3VXWA 1V49A 3ZLZA 3I63C 3OJ3A 3EFUA 2JY6A 3HRDD 1L6UA 3DHIC 2E3TA 2IJ0A 2V3NA 1JW9D 2JXTA 1E8WA 1V6EA 2ZZPB 1V1PA 4HDQA 4MH0E 1YJJA 2N1WA 1FCLA 1P7FA 2JZPA 1KH0A 4RFBA 1PFDA 3HHMA 4W9JA 5BYRA 3PZ7A 1C9FA 1IP9A 1AARA 2N9PC 1Y8RC 2MBOA 2MBEA 3DOWA 2JSVX 2K8CA 1V1OA 3APFA 1BMLC 4OVUA 1E8XA 4CYEA 1TS2A 2KTRB 2GBNA 1XLQA 2GMIC 3MC8A 2N7DA 2YLMA 5TR5A 1Y56A 5BYQA 1YQBA 4I6NB 3MFGA 3CMMB 3H6NA 4JPSA 3GP7A 5BYSA 1UUPA 3O65B 1YJIA 4IM2A 2ZCBA 2OJRA 1RWSA 4HPPA 2HJ8A 1T0RC 1N61A 4JE3B 2O6VD 2BYEA 2KWUB 3K9OB 4YWGG 1B1ZA 1C78A 1WX8A 3DDCB 3H8HA 2L52A 2JUOA 1AYFA 4DDID 2JF5A 4AUQC 2LUMA 4HDOA 3BVGA 2FUHB 1STEA 4B6WA 3TSSA 1SJHD 1LXDA 1TY2A 4MSMB 2EELA 3QAQA 1BXTA 5BMHA 4BAXA 1V5TA 3A33B 3LYYA 1ISNA 4AJWA 1KM7A 2ICIA 1K8RB 3V62A 3K9PB 2OHFA 2EMTA 2KMMA 3GB1A 2V0GA 1Q0WB 1WZ0A 3QHTA 1RFAA 2R2OA 1XLPA 2DZIA 2K25A 4L1BA 2V3PA 3VFKA 3ETRA 3TEYA 5FKAC 1I4HA 1WGDA 2WDRB 1NVID 1V86A 4PYZA 5H8YE 4IW0A 2JQRB 1BUIC 5LNK1 2OJWA 2IPKD 1TS5A 1C1YB 4A20A 4EZKA 2WXFA 3T9LA 4ITKA 4W9EA 4LNNA 3SFEB 2N9KA 3RZWC 1DOIA 1FM0D 1AN8A 2RDBC 1I35A 1PQSA 2GBRA 1VRAB 3QX1A 2M0XA 1DOYA 1SGHA 1E7UA 1TT5B 4A3PA 1GC6A 4Q2JA 4K3BA 3PLVA 1WXSA 4URKA 2IO3B 2INNE 2M17A 4HPMB 4HXDA 3VUWA 4TQ1A 3W1SA 1YNTE 3PZ8A 1WI0A 3UGBB 3R8BA 2KDIA 2Z0DB 2C5LC 5E6OA 4GDKA 5GMVA 2DYBA 3AE5B 2WS3B 3PT2B 4REZA 4KSLC 1E10A 2FCMA 4DXAB 1HQRD 3R7RA 1L6VA 4GB9A 4KKJA 4MELA 3RNGC 1IPGA 5LLIA 1CMXB 2BYFA 2WXJA 4L23A 3T3NA 3QCAA 2QCZA 2R61A 2QDFA 4WAAA 1V2YA 2MJEA 1IGCA 1XEEA 2H88B 3OLMD 1ZGUB 1L0XB 3OG5A 1EM7A 1WM3A 2IDYA 1TS3A 3PO0A 2DHZA 3WALA 3Q8FA 5GXGB 4AJYB 1D4BA 2H89B 4NAWA 1GUAB 1UBQA 3FAHA 3AE2B 1PGBA 3MP9A 1ROEA 4C4VB 3ZJVA 2QEJC 4EEWA 2Y5BB 2JYEA 4ZOHC 1WMHA 1WXQA 2RDHA 2VZKD 2KLCA 1JROA 1IBXB 4MJSB 3GS2A 1N63A 2KNBA 2L1AA 3VQIA 4GMVA 3LXFA 4ZRPA 4A9AA 2CKHB 2GLSA 3RUIB 3P4PB 5CX3A 4AQ7A 2W82A 2JX5A 4YXDB 3A9KB 3IT4B 3AV8A 1UELA 5G5GA 3SU8X 2A4ZA 4F7ZA 2NVUI 3ZW3A 4B9KA 1IYFA 4XE0A 4US9A 3L16A 3DWGC 5E6JA 4I6LB 2LWPA 3I57A 4JL9A 1NENB 3VDZA 5MPOA 2NBUA 2MH7A 4E71A 4IG7B 1OEYJ 1GG3A 2QIEB 1E7PB 1G6JA 2MP2A 2INPE 3AECB 3AI5A 4C80A 2K9XA 1R4NB 3NVVA 2ZPYA 1V80A 3NUHB 3I3TB 3U8ZA 3AE7B 3IHPC 3TMPB 5LXHA 1WXAA 2AWTA 2PPHA 4TSSA 3KQ4A 3MC0B 4YTMB 2V1YA 2D5GA 1WGGA 2BGFA 4X57B 4WWNA 3I9V1 1TYGB 2KLGA 4YSZB 1S3SG 4NJ6A 3ZTDA 4RF1A 2WYQA 2WXRA 2M1MA 3ABVB 4EKUA 4ZRJA 3I5JC 4K7SA 1F9JA 2O6VB 4XDDA 2M8SA 3BWUD 5FK9C 4ZDVA 1N5WA 1WXMA 2NR2A 4M0WA 2XK5B 1L4ZB 1I4XA 1RFKA 4ZYSA 2ZNVB 3SFDB 1HZ5A 3Q3FA 4OHJA 1F77A 2ON8A 1UD7A 4M8NA 2N7JA 1TJEA 3ZJTA 1FNVA 2UU7A 3RI7C 1JCKB 2VH2A 1RLFA 3MHZA 4C7YA 1WXVA 1MHHE 3PZDA 1FIQA 1F2RC 3BYYB 2V4IB 3ZRFA 3N30A 3PTFC 4DBGA 1NYQA 3N1XC 4MM3B 1E8YA 2I1JA 4RM9A 3ZXVA 2G4SA 2MCNB 1MI0A 2ZNVC 3W2DA 1UGMA 3Q8BA 2L8JA 3N3KB 2FCQA 3Q8EA 2KD0A 4GU2A 3N1YC 3AXCA 2LMCA 1QKZA 2WDVB 3QJZA 4FHJA 3RCZA 2CU1A 4L2YA 1MG4A 1FFUA 1D5ZC 2DAFA 2BYTA 3ML8A 3RNAC 2OEDA 1WRIA 4GN1A 1D5XC 3Q3MC 1GB4A 2BWFA 2KMCA 3DVNV 2B76B 1ESFA 2KOXA 1XD3B 2V9HA 2DBYA 4ZRQA 2L76A 1TZOA 4YL8A 2JWZA 1FNUA 2MX2A 3DBHB 2SEBD 2ASQA 3AE8B 1WJUA 4KVGB 4ANWA 3CF6E 2AL3A 3V3XA 2JT4B 1QZEA 4I6PA 3NS8A 1R4MI 3E56A 3PHWB 2RMMA 4A8XC 3MHSD 3U7DA 4IM3A 3UIOB 1WR1A 3ML9A 3N9YC 4GIVA 3ZVVA 2Y3AA 3VTUA 2BS3B 3ZTCA 2YEPF 5AZGA 1KF6B 4HKQA 4MACA 2NMQA 2FNJB 2Q5WD 4DQOC 3C19A 1M4VA 2INCC 4G11A 2KXJA 5EE3A 3BVZA 1OEYA 4DXGA 1FO4A 2C9WB 4WWPA 1H4RA 2WDTB 2KJRA 2MQJA 3ZUNA 2HJ1A 3UINB 1AW7A 2FAZA 4TUUA 3AEFB 3RN9C 2GI9A 1L2NA 3P1MA 2LJIA 1BT0A 3B2GA 3V6EB 2L0TA 2WXNA 2VZKB 1GAQB 4ZRIA 1ACCA 2WDQB 4LLGM 4LK0M 3OJ4B 3M3JA 3NZ3A 1PUTA 2E6XA 4BOSC 2QJLA 4IOIE 4NQKE 1FD6A 2BW2A 4JLCA 2AQ1B 2HTME 4C4VA 2KVZA 1PGAA 3UI3A 1QLBB 2IO2B 1LGRA 2K0PA 2W9NA 1ENFA 2ACZB 2DAJA 4IKGA 1EF1A 1YX5B 4MJSA 2RPVA 3W5VB 2ZJDA 4M00A 3JW0X 3EA6A 3KW5B 1GC7A 3HM3A 4P1BC 1VJKA 2WLBA 5C23A 1FXIA 1C4CA 3A9KA 4OZBA 1QILA 2G1EA 1CK1A 3T3OA 1WX7A 2JXXA 1WSPA 3TCAA 1DOXA 4PYUA 3TEWA 3DBLI 3WANA 1I4QA 4NJ7A 1MPEA 4GXBA 4LNOA 4ASWC 1Z2MA 2MJ3A 2MLBA 3UIPB 5D2MB 3QQ8B 2NTSA 2LRUA 1I7HA 5EE9A 3UQAA 2KJ6A 1WF9A 2N1VA 1T0QC 2FCSA 4PT5A 4UDUC 5D94A 3RULA 5KHOA 3H7PB 1WE7A 4A90A 3NJTA 1RAXA 4OZAA 2BB6A 4RGNA 2D3BA 2FIDA 1UH6A 3ZIMA 3KWLA 3L4PA 3NHEB 4ZHPA 4WJQA 3HM6X 1Q5WB 4H2AA 2KQ4X 3AE6B 3AE1B 2KQ7A 1OQYA 2KC2A 1R7SA 3TEXA 3B0AA 3BK2A 4ANXA 1N5XA 2JZZA 5HI1A 4M01A 1F52A 3AEGB 4LNIA 2PIAA 2W3SA 3QA8A 2IY1B 4FJYA 1ZKHA 3JYUA 1LO5D 3SDLC 3WAPA 1E90A 2KN5A 2GBJA 4CQNA 2W55A 4JWSC 4MM3A 2WQYB 1I42A 2KACA 1FMAD 2PVOD 1VCBA 4NZLB 1KRHA 5JXVA 2G4DB 2IGGA 2NTTA 3BY4B 1WGYA 2KN4A 3Q3OC 2MHJA 4ICUA 5D3DA 5L83A 3AU4A 3PLUA 1EUVB 1TY0A 3EHVA 5EE1A 2D2QA 4USAA 1KLVA 1D6EC 1SE4A 2KDMA 4AWJA 4TMAB 3DVGX 2PKOA 4RGOS 1K52A 5J18A 1JWMD 5BMIA 2JWUA 1A70A 3X23A 2IYDB 3V61A 3ZDMC 1I4RA 4HJGE 4DHJD 3KYCD 2KWDA 4HRSA 1TGZB 1WE6A 2ZW1A 1XXGA 4N59A 1VR9A 2KQSA 1WYWB 4EZLA 1HTOA 2BS2B 2AEHA 3AE3B 4DDGD 3TIXA 4AP4C 1SXTA 1ZDVA 4N58A 4KGRA 1WGRA 4FHKA 1YQ3B 4BOZB 4CHKA 2C7HA 2ZVOA 2XN9C 5AEKB 2JU6X 2LASA 3PS6A 3NRZA 2WXGA 2BYVE 4ZRKA 1TIFA 3AN1A 2KWVB 3SEBA 1ZUD2 4JGHB 3MJ5A 4KSKC 1T0SC 3IAS1 5C1ZA 3A1QB 2LGSA 4RCOA 2MW5A 2R2QA 1E0ZA 1VD2A 2KFKB 1P0RA 3Q8CA 2N0SB 3RNFC 5J17A 2KYWA 2N9LA 3DBSA 5EE0A 1L0VB 2BBCA 1J8CA 3EFCA 2CHWA 5JHBA 2CHZA 4HKZE 4FN2A 4MGIE 2RSUA 3L08A 5HHDG 3R3MA 3H7SA 5E6PA 1QOBA 1YN4A 4NNJB 3KUDB 3M62B 3O13A 2LUEA 1QOGA 1F1HA 4RH6A 4KGSA 4YTNB 3L10B 4MSQB 5DPTA 3N32A 2UYZB 4GDLA 3HK0A 3UQBA 2K6DB 3S2AA 3WA0A 2C7NB 4BKTA 4W9DA 5DPSA 2D11A 2UWQA 3ZRCA 4N6EB 5HFYA 3NZUA 2WXMA 1JWBD 4ICVA 1XQQA 4B0EA 4RF0A 2LGIA 3L54A 2L05A 4EE2A 3Q2AC 3ZNHB 5IN7A 1SE3A 1NI3A 4KGTA 3VH4B 2KK8A 3CSTA 1ZPSA 2K39A 5CHVC 4LNKA 1LM8B 2MWSB 5BMGA 1C4AA 1YD8U 2FCNA 2WHIA 2IGHA 3SD5A 3PSEB 2PVGC 2KKCA 3N20C 2MRPA 4W9CA 4P6VF 2K22A 5IO9A 1N60A 2JZ3B 2I2YA 1V8CA 3NVZA 4W9KA 2K1FA 4BKSD 3QIJA 4M8MA 2KTRA 3ZKJC 1R4NI 1JMLA 4ARIA 1SJED 4YT0B 1XF5L 2BTEA 2WU2B 4HCPB 2PTLA 1JWSD 4WJNA 3VTWA 2K8BA 2VH1A 4E74A 5TSSA 2FE8A 1QT9A 1T0YA 2L32A 1Z5SB 3BINA 1P1AA 5CHFA
chains in the Genus database with same CATH topology
1BT0A 1LXDA 2O2VB 4FADA 5J2RA 1GJZA 4MSMB 3V6EB 1P9DU 4GOCA 3QAQA 3CSFA 2L0TA 3R7QA 1V5TA 3A33B 3RYTA 4IC7B 3T8MA 1ISNA 4AJWA 1KM7A 4ZRIA 3DPDA 4LDTB 1K8RB 2GBKA 2MSED 4LJPB 2ZPNA 3K9PB 3V62A 4ANVA 2EMTA 3OAWA 2KX0A 5DCNA 1YX6B 1TZ1A 1Q0WB 1WZ0A 3OJ4B 2L7RA 3PVLA 3M3JA 3QHTA 4IWOA 1RFAA 1NI2A 2GOWA 2OOBB 2RD0A 2N9XA 2R2OA 4HK2A 4W9IA 4BOSC 3DVNU 4NQKE 2ZCCA 4WJPA 4JLCA 2J0KA 2KC1A 2D07B 2DZIA 4RMAA 2K25A 3A9JB 3VFKA 2NPTB 2LGYA 2IO2B 2W9NA 2EKEC 2LXCA 2D10A 2DAJA 2KFJA 1M94A 2CHXA 1WGDA 1V86A 4PYZA 1EF1A 1YX5B 4MJSA 3DVGY 4ZYNA 2ZJDA 3HIZA 4IW0A 3JW0X 4F8CB 3KW5B 3B1LX 1WX9A 2KMAA 4K81A 4MEMA 1GC7A 3HM3A 1FXTB 4WWOA 1C1YB 4A20A 2KJHB 1J0GA 1D3ZA 3PV1A 5C23A 4EZKA 3T9LA 4HVBA 2PEAA 4W9EA 4TV3A 5CTRC 3PGEA 3MTNB 3VUXA 3LJ3A 3A9KA 4II2B 3W1YA 1WX7A 2JXXA 1E8ZA 3RZWC 2KO3A 1I35A 3PPAA 1PQSA 2GBRA 3TCAA 4FBJB 1NDDA 1WJ4A 3QX1A 2M0XA 3C0RB 1SGHA 2GBMA 1E7UA 5CHWA 4A3PA 1GC6A 4DHJB 5EDSA 1Q1OA 1ZW7A 3M63B 1KOTA 4PYUA 3X0WA 3DBLI 2V4LA 3PLVA 1TBEA 2MA9B 2ZEQA 3KH0A 3WANA 1WXSA 3DCGA 4URKA 4DWFA 4KDIC 4NJ7A 1JRUA 2ZVNA 4GDKB 2IO3B 5IA7A 2M17A 4HPMB 3SHQA 4NQLB 3P2BA 4K7WA 4HXDA 2LI5A 3VUWA 4GXBA 4TQ1A 3W1SA 1WGHA 3H1UA 4ASWC 1WI0A 1Z2MA 2IY0B 3ENEA 4HPLB 4K7UA 3NOBA 2MLBA 1HE8A 3UGBB 3WAMA 2KDIA 2Z0DB 1WR6E 3UIPB 2C5LC 5E6OA 5AZHA 4GDKA 5D2MB 5GMVA 2DYBA 3PT2B 2AL6A 3QQ8B 3GZNI 2LRUA 4EUTA 2DZJA 2M4NA 3DBHI 4IWQA 1V81A 4KSLC 4PS3A 4EZJA 3UQAA 1WRDB 2FCMA 4DXAB 2KJ6A 3R7RA 1WF9A 2KDBA 4GB9A 1RRBA 2N1VA 4MELA 4HWIB 1WIAA 1IPGA 2FCSA 5LLIA 3V60A 1E5WA 5D94A 3RULA 1CMXB 2BYFA 3EC8A 3GOEA 1S1QB 2QHOA 2MBQA 2IBIB 5KHOA 3NZSA 2EMSA 3H7PB 3PRMB 3QCAA 1WE7A 3QARA 1RAXA 4KIKA 4WAAA 1V2YA 3QWZB 4BKSA 1MG8A 3ZNID 3OLMD 1ZGUB 4EOYA 2XBBC 2FIDA 1WM3A 2PE9A 4G3XB 4BBNC 3LDZE 3H7PA 2DHZA 1UH6A 2NCNA 4RM8A 2LVOA 1LFDA 3WALA 3DBRI 3VVWB 2I1KA 4KZCA 3ZIMA 3NHEB 3PREA 4AJYB 4NAWA 3APDA 2IZVB 1GUAB 4WJQA 3HM6X 1Q5WB 3KUCB 3VAWA 5FR6A 1V5OA 1UBQA 2KQ7A 1OQYA 2KC2A 2K8HA 3B0AA 2Y5BB 4EEWA 3ECIA 4CO7A 1EO6A 4XC2A 4ANXA 1WMHA 1YIWA 3A1QA 2JZZA 2KLCA 4LDTD 4MJSB 3VTVA 3QA8A 3WIMA 2KNBA 1EF5A 1P98A 2IY1B 4FJYA 3VQIA 1WJ6A 1ZKHA 3JSVA 4GMVA 4WJOA 1A5RA 4LJOB 3JYUA 2CKHB 2D3GA 5HKHA 3SDLC 2DZMA 2N9EB 4W9LA 3QK0A 2REXA 2KVRA 3WAPA 4DHZE 4IUMB 1E90A 3RUIB 5CX3A 3TBLD 5IAAC 2KN5A 2GBJA 4PS7A 3ZNZB 2WWZA 4MM3A 5G55A 1I42A 4MDKE 4KV2A 5BO4B 3A9KB 4MGYE 1VCBA 1UELA 4W9HA 4NPNA 2LGXA 3SU8X 2G4DB 2A4ZA 4FLHA 4BVUC 3BY4B 4F7ZA 3R66C 2NVUI 3ZW3A 4BBNF 2L3ZA 4B9KA 1WGYA 4ICUA 4XZ4A 1IYFA 5L83A 3AU4A 3PLUA 1EUVB 2V3SA 3L16A 3EHVA 4F1SA 2DYOA 2D2QA 2KWCA 1KLVA 1XT9B 3L13A 4I6LB 3VHTC 2LWPA 1L7YA 4G50A 4JL9A 1C3TA 2K6QA 3RD2A 3VDZA 2NBUA 3EECA 5KHQA 4E71A 2NBWB 4IG7B 5G2NA 1OEYJ 2NS5A 1GG3A 2KANA 4AWJA 5JH5C 1G6JA 2MP2A 3DVGX 4II3B 2BF8B 5J18A 2HTHA 3AI5A 2MBHA 3MJWA 3RZFA 3Q3JA 4K1RB 4J6IA 3PHXB 3X23A 5AZFA 2IYDB 3V61A 3ZDMC 2ZPYA 2CR5A 1V80A 3PRPB 2PE6B 3I3TB 3U8ZA 4DHJD 3KYCD 3IHPC 4P7IA 2DYMA 4FJVB 3D32A 3IBEA 3TMPB 3ZDTA 1TGZB 1WXAA 2BKRB 1WE6A 5LXHA 2AWTA 2LJ5A 4KDLB 2BWES 4LCDE 1E7VA 2LVPA 2PPHA 2DX5B 1OTRB 2KQSA 2DENB 2LD9A 1WYWB 2VRRB 4WQOB 2V1YA 4EZLA 2AEHA 1YJ1A 1WGGA 4DDGD 5D7GA 2BGFA 3TIXA 4X57B 3M95A 3A4SC 4HJKA 4WWNA 4AP4C 2KLGA 4KIKB 4HLEA 2RPQA 1S3SG 1WGRA 4FHKA 4NJ6A 3ZTDA 5JZEB 4M0WB 4BOZB 4MGZE 2PJHA 3ZO5B 4CHKA 2C7HA 2WYQA 2HE7A 1NBFC 2M1MA 2WX0A 4OVVA 4ZRJA 3W1SC 4EKUA 2HD5B 4K7SA 3IFWB 1F9JA 4EFOA 2ZVOA 4PS8A 3VUYA 5AEKB 4ANUA 1WM2A 2LVQA 2O6VB 1WY8A 2M8SA 2IO1B 2LASA 3PS6A 4NY0A 4W9GA 2BYVE 4ZRKA 4AOFA 4ZDVA 4NAWB 1WXMA 2NR2A 2XK5B 1SIFA 2KWVB 2BPSA 2YVCA 4JQWC 1U4AA 3ONSA 2ZNVB 2LGDA 3VH3B 2N7EA 4JGHB 2LXAA 3Q3FA 4FA6A 3B08A 3H9DA 4KSKC 2C60A 2O6VA 1UD7A 5C1ZA 1WMHB 4M8NA 3A1QB 3V6CB 5JHAA 3KYDD 3U30A 1WJNA 2KTFA 2MW5A 2XK5A 3ALBA 3PRZA 2R2QA 5E6NA 1VD2A 3JSVB 1RLFA 3TL5A 1WXVA 3PZDA 4FULA 4BFRA 2KFKB 1P0RA 2JRIB 5J17A 2Z59B 3ZRFA 3DBSA 3N30A 2KDFB 1J8CA 2NBVB 3PTFC 5DPRA 2CHWA 2JVCA 3DQVA 4DBGA 4DK5A 5JHBA 2WX1A 2CHZA 4B95A 4FN2A 1E8YA 4MGIE 2I1JA 2RSUA 2JRHA 3L08A 2KFKA 3AULA 1P3QU 3NY5A 4RM9A 2N4FA 2G4SA 3R3MA 4GDLB 3H7SA 2MCNB 5E6PA 2ZNVC 2O2VA 2C7MB 2DZKA 3L17A 4NNJB 3KUDB 1UGMA 3M62B 1SE9A 2LUEA 2CS4A 2L8JA 3N3KB 2FCQA 5DPTA 3L10B 4MSQB 4DHZB 2KD0A 4GU2A 3N32A 2UYZB 2LRWA 3AXCA 3QC8B 4GDLA 4KZ0A 4MGKE 1LQBA 3HK0A 2RGFA 3UQBA 3L0WB 3RT3B 2AYOB 2K6DB 2KX3A 3S2AA 3KUZA 3QJZA 4IWPA 4FHJA 3WA0A 1WZ3A 2C7NB 1WH3A 2MP2B 2CU1A 3RCZA 4BKTA 1GNUA 4W9DA 5DPSA 2D11A 3KVFB 4A3OA 2DAFA 3A4RA 2UWQA 3ML8A 5D6JB 3IVFA 3ZRCA 1H8CA 4GN1A 3VXWA 4TQ0A 1J19A 2JPHA 1V49A 3ZLZA 1UBIA 1WFYA 3A9JA 3NZUA 2NPTA 3EFUA 3OJ3A 4TKNA 3UF8A 2JY6A 1TTNA 4ICVA 2BWFA 2KMCA 3DVNV 1XQQA 2KDEB 2KOXA 1XD3B 3L54A 4W9FA 2J7QB 1E8WA 2L05A 1V6EA 2L76A 2ZZPB 4YL8A 4HDQA 3ZNHB 3ZNGC 2JWZA 2MX2A 4MH0E 2RR9A 2B3AA 1X1MA 2N1WA 2KHWB 2ASQA 3VH4B 3TJPA 2KK8A 1WJUA 3CSTA 3HHMA 4KVGB 4W9JA 4ANWA 3CF6E 2K39A 2XEWA 2AL3A 5CHVC 2J0MA 1AARA 1IP9A 2JT4B 1QZEA 4I6PA 4GGQA 3APCA 3NS8A 1R4MI 3PHWB 2N9PC 1LM8B 2MWSB 1Y8RC 4JIOU 1YD8U 2FCNA 2MBOA 4HCNB 2MBEA 3MHSD 2IO0B 4XX5A 3DOWA 3SD5A 3U7DA 4IM3A 3UIOB 3WAOA 3PSEB 4GSWA 2K8CA 2J0JA 3APFA 1WR1A 4FJZA 2LZ6A 3ML9A 4OVUA 1E8XA 4GIVA 4CYEA 2KKCA 3JVZX 2MRPA 4W9CA 4N9F4 2KTRB 2GBNA 3IG3A 3ZVVA 2GMIC 3VTUA 3ZTCA 2N7DA 2JZ3B 2YLMA 5TR5A 5AZGA 1YQBA 2G45B 4I6NB 2A5UA 2FNJB 3CMMB 3H6NA 2KZRA 2L0FA 3AU5A 1KJTA 4E3CA 5L95C 4W9KA 2K1FA 4BKSD 3QIJA 4G0NB 4G11A 2FIFA 2KXJA 4IM0A 4M8MA 2KTRA 3ZKJC 3O65B 4IM2A 1R4NI 1OEYA 2OJRA 2ZCBA 5LXIB 1V9JA 2BKFA 1OGWA 2C9WB 2HJ8A 1H4RA 4WWPA 2WDTB 4HCPB 2KJRA 2Z0EB 2MBBB 2MQJA 2O6VD 2BYEA 3ZUNA 4WJNA 3VTWA 2KWUB 3UINB 3K9OB 2K8BA 2FAZA 2G3QB 4E74A 4TUUA 1WX8A 2L00B 3DDCB 5DPWA 1UZXB 4BKGA 2JUOA 4DDID 1T0YA 2JF5A 4AUQC 1L2NA 4HDOA 1Z5SB 3BINA 1P1AA 2FUHB 5CHFA 4B6WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BT0 A;  1LXD A;  2O2V B;  4FAD A;  5J2R A;  1GJZ A;  4MSM B;  3V6E B;  1P9D U;  4GOC A;  3QAQ A;  3CSF A;  2L0T A;  3R7Q A;  1V5T A;  3A33 B;  3RYT A;  4IC7 B;  3T8M A;  1ISN A;  4AJW A;  1KM7 A;  4ZRI A;  3DPD A;  4LDT B;  1K8R B;  2GBK A;  2MSE D;  4LJP B;  2ZPN A;  3K9P B;  3V62 A;  4ANV A;  2EMT A;  3OAW A;  2KX0 A;  5DCN A;  1YX6 B;  1TZ1 A;  1Q0W B;  1WZ0 A;  3OJ4 B;  2L7R A;  3PVL A;  3M3J A;  3QHT A;  4IWO A;  1RFA A;  1NI2 A;  2GOW A;  2OOB B;  2RD0 A;  2N9X A;  2R2O A;  4HK2 A;  4W9I A;  4BOS C;  3DVN U;  4NQK E;  2ZCC A;  4WJP A;  4JLC A;  2J0K A;  2KC1 A;  2D07 B;  2DZI A;  4RMA A;  2K25 A;  3A9J B;  3VFK A;  2NPT B;  2LGY A;  2IO2 B;  2W9N A;  2EKE C;  2LXC A;  2D10 A;  2DAJ A;  2KFJ A;  1M94 A;  2CHX A;  1WGD A;  1V86 A;  4PYZ A;  1EF1 A;  1YX5 B;  4MJS A;  3DVG Y;  4ZYN A;  2ZJD A;  3HIZ A;  4IW0 A;  3JW0 X;  4F8C B;  3KW5 B;  3B1L X;  1WX9 A;  2KMA A;  4K81 A;  4MEM A;  1GC7 A;  3HM3 A;  1FXT B;  4WWO A;  1C1Y B;  4A20 A;  2KJH B;  1J0G A;  1D3Z A;  3PV1 A;  5C23 A;  4EZK A;  3T9L A;  4HVB A;  2PEA A;  4W9E A;  4TV3 A;  5CTR C;  3PGE A;  3MTN B;  3VUX A;  3LJ3 A;  3A9K A;  4II2 B;  3W1Y A;  1WX7 A;  2JXX A;  1E8Z A;  3RZW C;  2KO3 A;  1I35 A;  3PPA A;  1PQS A;  2GBR A;  3TCA A;  4FBJ B;  1NDD A;  1WJ4 A;  3QX1 A;  2M0X A;  3C0R B;  1SGH A;  2GBM A;  1E7U A;  5CHW A;  4A3P A;  1GC6 A;  4DHJ B;  5EDS A;  1Q1O A;  1ZW7 A;  3M63 B;  1KOT A;  4PYU A;  3X0W A;  3DBL I;  2V4L A;  3PLV A;  1TBE A;  2MA9 B;  2ZEQ A;  3KH0 A;  3WAN A;  1WXS A;  3DCG A;  4URK A;  4DWF A;  4KDI C;  4NJ7 A;  1JRU A;  2ZVN A;  4GDK B;  2IO3 B;  5IA7 A;  2M17 A;  4HPM B;  3SHQ A;  4NQL B;  3P2B A;  4K7W A;  4HXD A;  2LI5 A;  3VUW A;  4GXB A;  4TQ1 A;  3W1S A;  1WGH A;  3H1U A;  4ASW C;  1WI0 A;  1Z2M A;  2IY0 B;  3ENE A;  4HPL B;  4K7U A;  3NOB A;  2MLB A;  1HE8 A;  3UGB B;  3WAM A;  2KDI A;  2Z0D B;  1WR6 E;  3UIP B;  2C5L C;  5E6O A;  5AZH A;  4GDK A;  5D2M B;  5GMV A;  2DYB A;  3PT2 B;  2AL6 A;  3QQ8 B;  3GZN I;  2LRU A;  4EUT A;  2DZJ A;  2M4N A;  3DBH I;  4IWQ A;  1V81 A;  4KSL C;  4PS3 A;  4EZJ A;  3UQA A;  1WRD B;  2FCM A;  4DXA B;  2KJ6 A;  3R7R A;  1WF9 A;  2KDB A;  4GB9 A;  1RRB A;  2N1V A;  4MEL A;  4HWI B;  1WIA A;  1IPG A;  2FCS A;  5LLI A;  3V60 A;  1E5W A;  5D94 A;  3RUL A;  1CMX B;  2BYF A;  3EC8 A;  3GOE A;  1S1Q B;  2QHO A;  2MBQ A;  2IBI B;  5KHO A;  3NZS A;  2EMS A;  3H7P B;  3PRM B;  3QCA A;  1WE7 A;  3QAR A;  1RAX A;  4KIK A;  4WAA A;  1V2Y A;  3QWZ B;  4BKS A;  1MG8 A;  3ZNI D;  3OLM D;  1ZGU B;  4EOY A;  2XBB C;  2FID A;  1WM3 A;  2PE9 A;  4G3X B;  4BBN C;  3LDZ E;  3H7P A;  2DHZ A;  1UH6 A;  2NCN A;  4RM8 A;  2LVO A;  1LFD A;  3WAL A;  3DBR I;  3VVW B;  2I1K A;  4KZC A;  3ZIM A;  3NHE B;  3PRE A;  4AJY B;  4NAW A;  3APD A;  2IZV B;  1GUA B;  4WJQ A;  3HM6 X;  1Q5W B;  3KUC B;  3VAW A;  5FR6 A;  1V5O A;  1UBQ A;  2KQ7 A;  1OQY A;  2KC2 A;  2K8H A;  3B0A A;  2Y5B B;  4EEW A;  3ECI A;  4CO7 A;  1EO6 A;  4XC2 A;  4ANX A;  1WMH A;  1YIW A;  3A1Q A;  2JZZ A;  2KLC A;  4LDT D;  4MJS B;  3VTV A;  3QA8 A;  3WIM A;  2KNB A;  1EF5 A;  1P98 A;  2IY1 B;  4FJY A;  3VQI A;  1WJ6 A;  1ZKH A;  3JSV A;  4GMV A;  4WJO A;  1A5R A;  4LJO B;  3JYU A;  2CKH B;  2D3G A;  5HKH A;  3SDL C;  2DZM A;  2N9E B;  4W9L A;  3QK0 A;  2REX A;  2KVR A;  3WAP A;  4DHZ E;  4IUM B;  1E90 A;  3RUI B;  5CX3 A;  3TBL D;  5IAA C;  2KN5 A;  2GBJ A;  4PS7 A;  3ZNZ B;  2WWZ A;  4MM3 A;  5G55 A;  1I42 A;  4MDK E;  4KV2 A;  5BO4 B;  3A9K B;  4MGY E;  1VCB A;  1UEL A;  4W9H A;  4NPN A;  2LGX A;  3SU8 X;  2G4D B;  2A4Z A;  4FLH A;  4BVU C;  3BY4 B;  4F7Z A;  3R66 C;  2NVU I;  3ZW3 A;  4BBN F;  2L3Z A;  4B9K A;  1WGY A;  4ICU A;  4XZ4 A;  1IYF A;  5L83 A;  3AU4 A;  3PLU A;  1EUV B;  2V3S A;  3L16 A;  3EHV A;  4F1S A;  2DYO A;  2D2Q A;  2KWC A;  1KLV A;  1XT9 B;  3L13 A;  4I6L B;  3VHT C;  2LWP A;  1L7Y A;  4G50 A;  4JL9 A;  1C3T A;  2K6Q A;  3RD2 A;  3VDZ A;  2NBU A;  3EEC A;  5KHQ A;  4E71 A;  2NBW B;  4IG7 B;  5G2N A;  1OEY J;  2NS5 A;  1GG3 A;  2KAN A;  4AWJ A;  5JH5 C;  1G6J A;  2MP2 A;  3DVG X;  4II3 B;  2BF8 B;  5J18 A;  2HTH A;  3AI5 A;  2MBH A;  3MJW A;  3RZF A;  3Q3J A;  4K1R B;  4J6I A;  3PHX B;  3X23 A;  5AZF A;  2IYD B;  3V61 A;  3ZDM C;  2ZPY A;  2CR5 A;  1V80 A;  3PRP B;  2PE6 B;  3I3T B;  3U8Z A;  4DHJ D;  3KYC D;  3IHP C;  4P7I A;  2DYM A;  4FJV B;  3D32 A;  3IBE A;  3TMP B;  3ZDT A;  1TGZ B;  1WXA A;  2BKR B;  1WE6 A;  5LXH A;  2AWT A;  2LJ5 A;  4KDL B;  2BWE S;  4LCD E;  1E7V A;  2LVP A;  2PPH A;  2DX5 B;  1OTR B;  2KQS A;  2DEN B;  2LD9 A;  1WYW B;  2VRR B;  4WQO B;  2V1Y A;  4EZL A;  2AEH A;  1YJ1 A;  1WGG A;  4DDG D;  5D7G A;  2BGF A;  3TIX A;  4X57 B;  3M95 A;  3A4S C;  4HJK A;  4WWN A;  4AP4 C;  2KLG A;  4KIK B;  4HLE A;  2RPQ A;  1S3S G;  1WGR A;  4FHK A;  4NJ6 A;  3ZTD A;  5JZE B;  4M0W B;  4BOZ B;  4MGZ E;  2PJH A;  3ZO5 B;  4CHK A;  2C7H A;  2WYQ A;  2HE7 A;  1NBF C;  2M1M A;  2WX0 A;  4OVV A;  4ZRJ A;  3W1S C;  4EKU A;  2HD5 B;  4K7S A;  3IFW B;  1F9J A;  4EFO A;  2ZVO A;  4PS8 A;  3VUY A;  5AEK B;  4ANU A;  1WM2 A;  2LVQ A;  2O6V B;  1WY8 A;  2M8S A;  2IO1 B;  2LAS A;  3PS6 A;  4NY0 A;  4W9G A;  2BYV E;  4ZRK A;  4AOF A;  4ZDV A;  4NAW B;  1WXM A;  2NR2 A;  2XK5 B;  1SIF A;  2KWV B;  2BPS A;  2YVC A;  4JQW C;  1U4A A;  3ONS A;  2ZNV B;  2LGD A;  3VH3 B;  2N7E A;  4JGH B;  2LXA A;  3Q3F A;  4FA6 A;  3B08 A;  3H9D A;  4KSK C;  2C60 A;  2O6V A;  1UD7 A;  5C1Z A;  1WMH B;  4M8N A;  3A1Q B;  3V6C B;  5JHA A;  3KYD D;  3U30 A;  1WJN A;  2KTF A;  2MW5 A;  2XK5 A;  3ALB A;  3PRZ A;  2R2Q A;  5E6N A;  1VD2 A;  3JSV B;  1RLF A;  3TL5 A;  1WXV A;  3PZD A;  4FUL A;  4BFR A;  2KFK B;  1P0R A;  2JRI B;  5J17 A;  2Z59 B;  3ZRF A;  3DBS A;  3N30 A;  2KDF B;  1J8C A;  2NBV B;  3PTF C;  5DPR A;  2CHW A;  2JVC A;  3DQV A;  4DBG A;  4DK5 A;  5JHB A;  2WX1 A;  2CHZ A;  4B95 A;  4FN2 A;  1E8Y A;  4MGI E;  2I1J A;  2RSU A;  2JRH A;  3L08 A;  2KFK A;  3AUL A;  1P3Q U;  3NY5 A;  4RM9 A;  2N4F A;  2G4S A;  3R3M A;  4GDL B;  3H7S A;  2MCN B;  5E6P A;  2ZNV C;  2O2V A;  2C7M B;  2DZK A;  3L17 A;  4NNJ B;  3KUD B;  1UGM A;  3M62 B;  1SE9 A;  2LUE A;  2CS4 A;  2L8J A;  3N3K B;  2FCQ A;  5DPT A;  3L10 B;  4MSQ B;  4DHZ B;  2KD0 A;  4GU2 A;  3N32 A;  2UYZ B;  2LRW A;  3AXC A;  3QC8 B;  4GDL A;  4KZ0 A;  4MGK E;  1LQB A;  3HK0 A;  2RGF A;  3UQB A;  3L0W B;  3RT3 B;  2AYO B;  2K6D B;  2KX3 A;  3S2A A;  3KUZ A;  3QJZ A;  4IWP A;  4FHJ A;  3WA0 A;  1WZ3 A;  2C7N B;  1WH3 A;  2MP2 B;  2CU1 A;  3RCZ A;  4BKT A;  1GNU A;  4W9D A;  5DPS A;  2D11 A;  3KVF B;  4A3O A;  2DAF A;  3A4R A;  2UWQ A;  3ML8 A;  5D6J B;  3IVF A;  3ZRC A;  1H8C A;  4GN1 A;  3VXW A;  4TQ0 A;  1J19 A;  2JPH A;  1V49 A;  3ZLZ A;  1UBI A;  1WFY A;  3A9J A;  3NZU A;  2NPT A;  3EFU A;  3OJ3 A;  4TKN A;  3UF8 A;  2JY6 A;  1TTN A;  4ICV A;  2BWF A;  2KMC A;  3DVN V;  1XQQ A;  2KDE B;  2KOX A;  1XD3 B;  3L54 A;  4W9F A;  2J7Q B;  1E8W A;  2L05 A;  1V6E A;  2L76 A;  2ZZP B;  4YL8 A;  4HDQ A;  3ZNH B;  3ZNG C;  2JWZ A;  2MX2 A;  4MH0 E;  2RR9 A;  2B3A A;  1X1M A;  2N1W A;  2KHW B;  2ASQ A;  3VH4 B;  3TJP A;  2KK8 A;  1WJU A;  3CST A;  3HHM A;  4KVG B;  4W9J A;  4ANW A;  3CF6 E;  2K39 A;  2XEW A;  2AL3 A;  5CHV C;  2J0M A;  1AAR A;  1IP9 A;  2JT4 B;  1QZE A;  4I6P A;  4GGQ A;  3APC A;  3NS8 A;  1R4M I;  3PHW B;  2N9P C;  1LM8 B;  2MWS B;  1Y8R C;  4JIO U;  1YD8 U;  2FCN A;  2MBO A;  4HCN B;  2MBE A;  3MHS D;  2IO0 B;  4XX5 A;  3DOW A;  3SD5 A;  3U7D A;  4IM3 A;  3UIO B;  3WAO A;  3PSE B;  4GSW A;  2K8C A;  2J0J A;  3APF A;  1WR1 A;  4FJZ A;  2LZ6 A;  3ML9 A;  4OVU A;  1E8X A;  4GIV A;  4CYE A;  2KKC A;  3JVZ X;  2MRP A;  4W9C A;  4N9F 4;  2KTR B;  2GBN A;  3IG3 A;  3ZVV A;  2GMI C;  3VTU A;  3ZTC A;  2N7D A;  2JZ3 B;  2YLM A;  5TR5 A;  5AZG A;  1YQB A;  2G45 B;  4I6N B;  2A5U A;  2FNJ B;  3CMM B;  3H6N A;  2KZR A;  2L0F A;  3AU5 A;  1KJT A;  4E3C A;  5L95 C;  4W9K A;  2K1F A;  4BKS D;  3QIJ A;  4G0N B;  4G11 A;  2FIF A;  2KXJ A;  4IM0 A;  4M8M A;  2KTR A;  3ZKJ C;  3O65 B;  4IM2 A;  1R4N I;  1OEY A;  2OJR A;  2ZCB A;  5LXI B;  1V9J A;  2BKF A;  1OGW A;  2C9W B;  2HJ8 A;  1H4R A;  4WWP A;  2WDT B;  4HCP B;  2KJR A;  2Z0E B;  2MBB B;  2MQJ A;  2O6V D;  2BYE A;  3ZUN A;  4WJN A;  3VTW A;  2KWU B;  3UIN B;  3K9O B;  2K8B A;  2FAZ A;  2G3Q B;  4E74 A;  4TUU A;  1WX8 A;  2L00 B;  3DDC B;  5DPW A;  1UZX B;  4BKG A;  2JUO A;  4DDI D;  1T0Y A;  2JF5 A;  4AUQ C;  1L2N A;  4HDO A;  1Z5S B;  3BIN A;  1P1A A;  2FUH B;  5CHF A;  4B6W A; 
#chains in the Genus database with same CATH topology
 1JWU D;  1V97 A;  4FAD A;  2QIL A;  1JRP A;  4YTP B;  3CSF A;  1MFW A;  3R7Q A;  2AQ3 B;  4IC7 B;  2K3U A;  2PMV A;  3T8M A;  2WP9 B;  3U2S C;  1ZOY B;  1J7B A;  2ZPN A;  1B9R A;  3GE8 C;  4ANV A;  5DCN A;  1SBB B;  1YX6 B;  1VDV A;  2HDE A;  1NI2 A;  2GOW A;  2OOB B;  2RD0 A;  4W9I A;  3DVN U;  4QAY A;  3AMZ A;  2D3C A;  5HG2 A;  3A9J B;  1QF6 A;  2NPT B;  4XWW A;  2EKE C;  2LXC A;  2L83 A;  1M94 A;  1VZ6 A;  1JWA D;  4F8C B;  1C76 A;  1WX9 A;  3R2I A;  1SE2 A;  2DWQ A;  1JQ4 A;  1R4M B;  1GB1 A;  3PV1 A;  4HVB A;  2PEA A;  1ZXH A;  1EWY C;  3URY A;  3VUX A;  1CQV A;  4GLS C;  1QOF A;  2KO3 A;  4D2K A;  4FBJ B;  1HZ6 A;  1NDD A;  4YSY B;  4DHJ B;  1ZW7 A;  1FXA A;  3B9J A;  3M63 B;  3X0W A;  2MA9 B;  2ZEQ A;  3BZD B;  4DWF A;  4KDI C;  3AM9 A;  1JRU A;  2ZVN A;  4GDK B;  5IA7 A;  3SHQ A;  4NQL B;  3P2B A;  1N6Z A;  4K7W A;  3AEA B;  1WGH A;  3H1U A;  1P7E A;  4S0R A;  4HPL B;  3ENE A;  4K7U A;  2DNF A;  1HE8 A;  1KLG D;  2KT7 A;  2J52 A;  3GZN I;  2DZJ A;  2M4N A;  3DBH I;  4IWQ A;  4R3D A;  4WUR A;  3TUO A;  2LHE A;  3LB8 C;  3V60 A;  3GOE A;  3KWV A;  2MBQ A;  2EMS A;  3ZJU A;  1SIJ A;  4XYC A;  2XNA C;  1C4P A;  3QWZ B;  1UF0 A;  3ZNI D;  4IDI A;  2XBB C;  4FXC A;  4NJC A;  4BBN C;  3LDZ E;  4C56 C;  2Z8L A;  4ARC A;  4RM8 A;  3RNE C;  4ACF A;  2LVO A;  1UNS A;  3DBR I;  2I1K A;  3PRE A;  3APD A;  2WU5 B;  3P4S B;  2TSS A;  1V5O A;  3KLS X;  1HEZ E;  2K8H A;  3ECI A;  1EO6 A;  4XC2 A;  1K51 A;  1YIW A;  1IUE A;  3A1Q A;  3E9S A;  4LDT D;  3VTV A;  4XGA B;  3WIM A;  3TEZ A;  1EF5 A;  3IT6 B;  1YOV B;  4LJO B;  5HKH A;  4HRO A;  2DZM A;  2N9E B;  4W9L A;  2KVR A;  4IUM B;  5AUK A;  3EUB 2;  1IBX A;  3TBL D;  3BVM A;  4PS7 A;  2WWZ A;  5G55 A;  4RGT A;  2LHD A;  4MDK E;  4W9H A;  4NPN A;  2LGX A;  3R66 C;  1UWX A;  4WQM A;  2V3S A;  2DYO A;  3RFZ B;  3BK1 A;  1XT9 B;  1L7Y A;  1JAL A;  1KFY B;  4G50 A;  1C3T A;  2K6Q A;  3RD2 A;  5KHQ A;  5G2N A;  2KAN A;  3J9C A;  3OWE B;  1I4P A;  5JH5 C;  4II3 B;  2BF8 B;  3RPF C;  4J6I A;  4K1R B;  3ZYY X;  5AZF A;  1RYJ A;  5D3I B;  2BVC A;  2M19 A;  3BYT B;  3PRP B;  2PE6 B;  2DYM A;  4FJV B;  1KLU D;  4KDL B;  2MJD A;  2BWE S;  1E7V A;  4KKI A;  1OTR B;  5T8I A;  2DEN B;  2VRR B;  3IAM 1;  1EU4 A;  4HJK A;  3A4S C;  3Q6B A;  4KIK B;  4HLE A;  2RPQ A;  1NEK B;  1MHX A;  4M0W B;  1MVK A;  4MGZ E;  2PJH A;  3ZO5 B;  2HE7 A;  4OVV A;  2WX0 A;  3ZXR A;  2HD5 B;  4EFO A;  4PS8 A;  4ANU A;  1WM2 A;  4W9G A;  1WY8 A;  2IO1 B;  4NY0 A;  1FPY A;  1SSN A;  1SIF A;  2YVC A;  1TKE A;  1U4A A;  3ONS A;  3VH3 B;  2N7E A;  4JWU C;  1ET6 A;  2CJO A;  2J53 A;  3B08 A;  1KTK A;  2C60 A;  2LEK A;  2O6V A;  3Q3N C;  1L0Y B;  2FUG 1;  1DYQ A;  1AWD A;  3V6C B;  2RDG A;  5JHA A;  3KYD D;  3PRZ A;  2XK5 A;  3ALB A;  2WXL A;  4A55 A;  3JSV B;  3TL5 A;  4US8 A;  4BFR A;  2JRI B;  2GB1 A;  1D5M C;  4K3C A;  5DPR A;  4C00 A;  2WX1 A;  3U52 E;  4B95 A;  4YSX B;  2JRH A;  3AUL A;  1P3Q U;  3NY5 A;  3N1Z C;  1FRR A;  1PGX A;  3L17 A;  1SE9 A;  4NAM A;  1YN3 A;  4DHZ B;  3NG0 A;  2LRW A;  3QC8 B;  3BII D;  4MT5 A;  1LQB A;  2RGF A;  3RT3 B;  2AYO B;  2KX3 A;  4XWT A;  3KUZ A;  4IWP A;  4DXF A;  1TKY A;  1WZ3 A;  1WH3 A;  4A3O A;  3KVF B;  3A4R A;  1H8C A;  2D3A A;  4TQ0 A;  1J19 A;  1I4G A;  2JPH A;  1K53 A;  1UBI A;  1WFY A;  3A9J A;  1OQQ A;  3UF8 A;  2NPT A;  4TKN A;  1TTN A;  1T5X D;  1XCQ L;  5I4D A;  2KDE B;  3W9C B;  4W9F A;  2J7Q B;  4S17 A;  3Q69 A;  3C8Y A;  4J3O D;  3DHG C;  3ZNG C;  1FNW A;  2RR9 A;  2B3A A;  1X1M A;  2KHW B;  2JYT A;  3TJP A;  1SEB D;  2XEW A;  2J0M A;  1GOZ A;  4GGQ A;  3APC A;  1Q10 A;  1ZP0 B;  3P4Q B;  4JIO U;  3DWM A;  4HCN B;  2IO0 B;  4XX5 A;  4C7Z A;  2BT6 A;  3WAO A;  3FKY A;  4GSW A;  2J0J A;  4FJZ A;  2LZ6 A;  1XLN A;  1ZE3 D;  3JVZ X;  4N9F 4;  3IG3 A;  2WXO A;  4KX6 B;  2G45 B;  4P16 A;  2A5U A;  3P4R B;  4JX1 C;  2BS4 B;  2KZR A;  2L0F A;  3AE4 B;  1KJT A;  1WYG A;  3AU5 A;  4E3C A;  5L95 C;  4G0N B;  2IND C;  1IGD A;  1ZDX A;  2FIF A;  2QMT A;  4IM0 A;  5IKC M;  1CZP A;  3AED B;  1OFF A;  5LXI B;  2SAK A;  3HVD A;  1V9J A;  2BKF A;  1OGW A;  1C77 A;  2WGS A;  5IP4 D;  2Z0E B;  2MBB B;  2G3Q B;  4PK1 A;  2L00 B;  3B2F A;  3NS1 A;  5DPW A;  1UZX B;  4BKG A;  1HA5 A;  2LFI A;  2K5P A;  3R2T A;  2KAJ A;  4RNA A;  4ZHO A;  2FBW B;  2O2V B;  2WXP A;  2BB5 A;  5J2R A;  1GJZ A;  1TS4 A;  1P9D U;  4O1N A;  1HTQ A;  4GOC A;  2EKI A;  1SB3 C;  2QC8 A;  1XCT L;  3RYT A;  3FIL B;  3DPD A;  4LDT B;  2GBK A;  4LJP B;  2MSE D;  1T6B X;  3OAW A;  2KX0 A;  2AQ2 B;  1TZ1 A;  3PVL A;  2L7R A;  4IWO A;  4OZC A;  2N9X A;  3VRB B;  4HK2 A;  2WXQ A;  3HUI A;  2ZCC A;  2CJN A;  4WJP A;  2J0K A;  2KC1 A;  2D07 B;  4RMA A;  4B0M A;  2WXK A;  2LGY A;  3DHH C;  4P1C C;  4MH8 A;  2D10 A;  2KFJ A;  2CHX A;  3P63 A;  2WXI A;  4ZYN A;  3DVG Y;  2WXH A;  3HIZ A;  1V1P B;  3W5U B;  1HXY D;  3B1L X;  2KMA A;  4K81 A;  4MEM A;  1ZXI A;  1YQ4 B;  1FXT B;  3Q8A A;  2J4X A;  4WWO A;  3GE3 C;  2CU3 A;  2KJH B;  1J0G A;  1D3Z A;  2BQQ A;  1XO3 A;  4TV3 A;  1UWM A;  1FFV A;  3PGE A;  5CTR C;  3MTN B;  5IOI A;  3LJ3 A;  2QSD A;  1MJD A;  4II2 B;  3W1Y A;  2WNM A;  2IGD A;  1E8Z A;  3PPA A;  1WJ4 A;  3FC4 A;  3C0R B;  2GBM A;  5CHW A;  5EDS A;  1Q1O A;  3VR8 B;  5FR3 A;  1KOT A;  2V4L A;  1TBE A;  3KH0 A;  3V05 A;  3DCG A;  2PLP A;  3ZQ4 A;  4WAF A;  2LI5 A;  5C3J B;  1L4D B;  2MEK A;  2IY0 B;  3VR9 B;  1EU3 A;  4XDC A;  3NOB A;  3WAM A;  1WR6 E;  4BZA A;  3AEE B;  5AZH A;  1E9M A;  3WCQ A;  2AL6 A;  4EUT A;  1C79 A;  4PS3 A;  1V81 A;  4EZJ A;  1GPX A;  1WRD B;  2KDB A;  1RRB A;  4HWI B;  1WIA A;  3HVZ A;  4WIP A;  1E5W A;  3EC8 A;  1S1Q B;  2W3R A;  2QHO A;  2IBI B;  3NZS A;  3PRM B;  3AH7 A;  1FCC C;  3QAR A;  1VLB A;  4KIK A;  4BKS A;  1MG8 A;  2AX5 A;  2Y5P A;  4EOY A;  2M0A A;  2PE9 A;  4G3X B;  1F2R I;  3H7P A;  2DLB A;  2NCN A;  1DGJ A;  3NVY A;  3RNC C;  1LFD A;  3VVW B;  4KZC A;  1SF0 A;  1J7C A;  1OQR A;  2IZV B;  3KUC B;  3VAW A;  5FR6 A;  2PW9 A;  3SR6 A;  4CO7 A;  1PYW D;  1NYR A;  1P98 A;  1WJ6 A;  3JSV A;  3ZGZ A;  4WJO A;  1A5R A;  1EWC A;  1E6E B;  2D3G A;  2G9H D;  3QK0 A;  2REX A;  1WGK A;  4DHZ E;  5IAA C;  3ZNZ B;  4KV2 A;  5BO4 B;  1VZ7 A;  4MGY E;  3IXS A;  1FRD A;  4FLH A;  4BVU C;  1J7A A;  1QOA A;  4BBN F;  2L3Z A;  2ZW0 A;  3U7Z A;  1WWT A;  4XZ4 A;  1XLO A;  2I38 A;  4F1S A;  2KWC A;  3L13 A;  3VHT C;  1N62 A;  1VZ8 A;  3EEC A;  4LTU A;  2NBW B;  2NS5 A;  3EGR A;  3MC9 A;  3VRA B;  1TKG A;  3AEB B;  5H92 C;  2HTH A;  2MBH A;  3MJW A;  3RZF A;  4WH4 A;  3GZN B;  3Q3J A;  3PHX B;  2CR5 A;  4OVZ A;  4AS1 A;  2Y5C A;  4P7I A;  2GRI A;  3P42 A;  3ZDT A;  3D32 A;  3IBE A;  3NVW A;  2BKR B;  2LJ5 A;  4A6Q A;  4LCD E;  3RMK C;  2LVP A;  2DX5 B;  1YN5 A;  2X38 A;  2LD9 A;  4WQO B;  1L5P A;  1YJ1 A;  5D7G A;  1FEH A;  3M95 A;  5C2T B;  5JZE B;  1K50 A;  1NBF C;  4RGM A;  3DBR B;  3W1S C;  3IFW B;  3AE9 B;  3VUY A;  2LVQ A;  1F0Z A;  3CWI A;  4AOF A;  4NAW B;  2W54 A;  2ONQ A;  2BPS A;  4JQW C;  4LNF A;  2LGD A;  2LXA A;  4FA6 A;  3H9D A;  1WMH B;  4M02 A;  3U30 A;  1WJN A;  2KTF A;  5E6N A;  1UGJ A;  4FUL A;  1T3Q A;  2YEP B;  2Z59 B;  2X8X X;  2KDF B;  2NBV B;  2J42 A;  2JVC A;  1YMH E;  3DQV A;  4DK5 A;  4OW0 A;  3AB5 A;  2KFK A;  2N4F A;  1RM6 C;  4GDL B;  2O2V A;  2C7M B;  1QQR A;  1ET9 A;  2DZK A;  5AUI A;  1CJE A;  2CS4 A;  3Q14 C;  5G5H A;  3U4E G;  3FIL A;  2M56 B;  3CIR B;  1PDX A;  4KZ0 A;  4MGK E;  3L0W B;  2MP2 B;  3DBL B;  1GNU A;  4HEA 1;  4WWM A;  5D6J B;  3IVF A;  3RNB C;  3VXW A;  1V49 A;  3ZLZ A;  3I63 C;  3OJ3 A;  3EFU A;  2JY6 A;  3HRD D;  1L6U A;  3DHI C;  2E3T A;  2IJ0 A;  2V3N A;  1JW9 D;  2JXT A;  1E8W A;  1V6E A;  2ZZP B;  1V1P A;  4HDQ A;  4MH0 E;  1YJJ A;  2N1W A;  1FCL A;  1P7F A;  2JZP A;  1KH0 A;  4RFB A;  1PFD A;  3HHM A;  4W9J A;  5BYR A;  3PZ7 A;  1C9F A;  1IP9 A;  1AAR A;  2N9P C;  1Y8R C;  2MBO A;  2MBE A;  3DOW A;  2JSV X;  2K8C A;  1V1O A;  3APF A;  1BML C;  4OVU A;  1E8X A;  4CYE A;  1TS2 A;  2KTR B;  2GBN A;  1XLQ A;  2GMI C;  3MC8 A;  2N7D A;  2YLM A;  5TR5 A;  1Y56 A;  5BYQ A;  1YQB A;  4I6N B;  3MFG A;  3CMM B;  3H6N A;  4JPS A;  3GP7 A;  5BYS A;  1UUP A;  3O65 B;  1YJI A;  4IM2 A;  2ZCB A;  2OJR A;  1RWS A;  4HPP A;  2HJ8 A;  1T0R C;  1N61 A;  4JE3 B;  2O6V D;  2BYE A;  2KWU B;  3K9O B;  4YWG G;  1B1Z A;  1C78 A;  1WX8 A;  3DDC B;  3H8H A;  2L52 A;  2JUO A;  1AYF A;  4DDI D;  2JF5 A;  4AUQ C;  2LUM A;  4HDO A;  3BVG A;  2FUH B;  1STE A;  4B6W A;  3TSS A;  1SJH D;  1LXD A;  1TY2 A;  4MSM B;  2EEL A;  3QAQ A;  1BXT A;  5BMH A;  4BAX A;  1V5T A;  3A33 B;  3LYY A;  1ISN A;  4AJW A;  1KM7 A;  2ICI A;  1K8R B;  3V62 A;  3K9P B;  2OHF A;  2EMT A;  2KMM A;  3GB1 A;  2V0G A;  1Q0W B;  1WZ0 A;  3QHT A;  1RFA A;  2R2O A;  1XLP A;  2DZI A;  2K25 A;  4L1B A;  2V3P A;  3VFK A;  3ETR A;  3TEY A;  5FKA C;  1I4H A;  1WGD A;  2WDR B;  1NVI D;  1V86 A;  4PYZ A;  5H8Y E;  4IW0 A;  2JQR B;  1BUI C;  5LNK 1;  2OJW A;  2IPK D;  1TS5 A;  1C1Y B;  4A20 A;  4EZK A;  2WXF A;  3T9L A;  4ITK A;  4W9E A;  4LNN A;  3SFE B;  2N9K A;  3RZW C;  1DOI A;  1FM0 D;  1AN8 A;  2RDB C;  1I35 A;  1PQS A;  2GBR A;  1VRA B;  3QX1 A;  2M0X A;  1DOY A;  1SGH A;  1E7U A;  1TT5 B;  4A3P A;  1GC6 A;  4Q2J A;  4K3B A;  3PLV A;  1WXS A;  4URK A;  2IO3 B;  2INN E;  2M17 A;  4HPM B;  4HXD A;  3VUW A;  4TQ1 A;  3W1S A;  1YNT E;  3PZ8 A;  1WI0 A;  3UGB B;  3R8B A;  2KDI A;  2Z0D B;  2C5L C;  5E6O A;  4GDK A;  5GMV A;  2DYB A;  3AE5 B;  2WS3 B;  3PT2 B;  4REZ A;  4KSL C;  1E10 A;  2FCM A;  4DXA B;  1HQR D;  3R7R A;  1L6V A;  4GB9 A;  4KKJ A;  4MEL A;  3RNG C;  1IPG A;  5LLI A;  1CMX B;  2BYF A;  2WXJ A;  4L23 A;  3T3N A;  3QCA A;  2QCZ A;  2R61 A;  2QDF A;  4WAA A;  1V2Y A;  2MJE A;  1IGC A;  1XEE A;  2H88 B;  3OLM D;  1ZGU B;  1L0X B;  3OG5 A;  1EM7 A;  1WM3 A;  2IDY A;  1TS3 A;  3PO0 A;  2DHZ A;  3WAL A;  3Q8F A;  5GXG B;  4AJY B;  1D4B A;  2H89 B;  4NAW A;  1GUA B;  1UBQ A;  3FAH A;  3AE2 B;  1PGB A;  3MP9 A;  1ROE A;  4C4V B;  3ZJV A;  2QEJ C;  4EEW A;  2Y5B B;  2JYE A;  4ZOH C;  1WMH A;  1WXQ A;  2RDH A;  2VZK D;  2KLC A;  1JRO A;  1IBX B;  4MJS B;  3GS2 A;  1N63 A;  2KNB A;  2L1A A;  3VQI A;  4GMV A;  3LXF A;  4ZRP A;  4A9A A;  2CKH B;  2GLS A;  3RUI B;  3P4P B;  5CX3 A;  4AQ7 A;  2W82 A;  2JX5 A;  4YXD B;  3A9K B;  3IT4 B;  3AV8 A;  1UEL A;  5G5G A;  3SU8 X;  2A4Z A;  4F7Z A;  2NVU I;  3ZW3 A;  4B9K A;  1IYF A;  4XE0 A;  4US9 A;  3L16 A;  3DWG C;  5E6J A;  4I6L B;  2LWP A;  3I57 A;  4JL9 A;  1NEN B;  3VDZ A;  5MPO A;  2NBU A;  2MH7 A;  4E71 A;  4IG7 B;  1OEY J;  1GG3 A;  2QIE B;  1E7P B;  1G6J A;  2MP2 A;  2INP E;  3AEC B;  3AI5 A;  4C80 A;  2K9X A;  1R4N B;  3NVV A;  2ZPY A;  1V80 A;  3NUH B;  3I3T B;  3U8Z A;  3AE7 B;  3IHP C;  3TMP B;  5LXH A;  1WXA A;  2AWT A;  2PPH A;  4TSS A;  3KQ4 A;  3MC0 B;  4YTM B;  2V1Y A;  2D5G A;  1WGG A;  2BGF A;  4X57 B;  4WWN A;  3I9V 1;  1TYG B;  2KLG A;  4YSZ B;  1S3S G;  4NJ6 A;  3ZTD A;  4RF1 A;  2WYQ A;  2WXR A;  2M1M A;  3ABV B;  4EKU A;  4ZRJ A;  3I5J C;  4K7S A;  1F9J A;  2O6V B;  4XDD A;  2M8S A;  3BWU D;  5FK9 C;  4ZDV A;  1N5W A;  1WXM A;  2NR2 A;  4M0W A;  2XK5 B;  1L4Z B;  1I4X A;  1RFK A;  4ZYS A;  2ZNV B;  3SFD B;  1HZ5 A;  3Q3F A;  4OHJ A;  1F77 A;  2ON8 A;  1UD7 A;  4M8N A;  2N7J A;  1TJE A;  3ZJT A;  1FNV A;  2UU7 A;  3RI7 C;  1JCK B;  2VH2 A;  1RLF A;  3MHZ A;  4C7Y A;  1WXV A;  1MHH E;  3PZD A;  1FIQ A;  1F2R C;  3BYY B;  2V4I B;  3ZRF A;  3N30 A;  3PTF C;  4DBG A;  1NYQ A;  3N1X C;  4MM3 B;  1E8Y A;  2I1J A;  4RM9 A;  3ZXV A;  2G4S A;  2MCN B;  1MI0 A;  2ZNV C;  3W2D A;  1UGM A;  3Q8B A;  2L8J A;  3N3K B;  2FCQ A;  3Q8E A;  2KD0 A;  4GU2 A;  3N1Y C;  3AXC A;  2LMC A;  1QKZ A;  2WDV B;  3QJZ A;  4FHJ A;  3RCZ A;  2CU1 A;  4L2Y A;  1MG4 A;  1FFU A;  1D5Z C;  2DAF A;  2BYT A;  3ML8 A;  3RNA C;  2OED A;  1WRI A;  4GN1 A;  1D5X C;  3Q3M C;  1GB4 A;  2BWF A;  2KMC A;  3DVN V;  2B76 B;  1ESF A;  2KOX A;  1XD3 B;  2V9H A;  2DBY A;  4ZRQ A;  2L76 A;  1TZO A;  4YL8 A;  2JWZ A;  1FNU A;  2MX2 A;  3DBH B;  2SEB D;  2ASQ A;  3AE8 B;  1WJU A;  4KVG B;  4ANW A;  3CF6 E;  2AL3 A;  3V3X A;  2JT4 B;  1QZE A;  4I6P A;  3NS8 A;  1R4M I;  3E56 A;  3PHW B;  2RMM A;  4A8X C;  3MHS D;  3U7D A;  4IM3 A;  3UIO B;  1WR1 A;  3ML9 A;  3N9Y C;  4GIV A;  3ZVV A;  2Y3A A;  3VTU A;  2BS3 B;  3ZTC A;  2YEP F;  5AZG A;  1KF6 B;  4HKQ A;  4MAC A;  2NMQ A;  2FNJ B;  2Q5W D;  4DQO C;  3C19 A;  1M4V A;  2INC C;  4G11 A;  2KXJ A;  5EE3 A;  3BVZ A;  1OEY A;  4DXG A;  1FO4 A;  2C9W B;  4WWP A;  1H4R A;  2WDT B;  2KJR A;  2MQJ A;  3ZUN A;  2HJ1 A;  3UIN B;  1AW7 A;  2FAZ A;  4TUU A;  3AEF B;  3RN9 C;  2GI9 A;  1L2N A;  3P1M A;  2LJI A;  1BT0 A;  3B2G A;  3V6E B;  2L0T A;  2WXN A;  2VZK B;  1GAQ B;  4ZRI A;  1ACC A;  2WDQ B;  4LLG M;  4LK0 M;  3OJ4 B;  3M3J A;  3NZ3 A;  1PUT A;  2E6X A;  4BOS C;  2QJL A;  4IOI E;  4NQK E;  1FD6 A;  2BW2 A;  4JLC A;  2AQ1 B;  2HTM E;  4C4V A;  2KVZ A;  1PGA A;  3UI3 A;  1QLB B;  2IO2 B;  1LGR A;  2K0P A;  2W9N A;  1ENF A;  2ACZ B;  2DAJ A;  4IKG A;  1EF1 A;  1YX5 B;  4MJS A;  2RPV A;  3W5V B;  2ZJD A;  4M00 A;  3JW0 X;  3EA6 A;  3KW5 B;  1GC7 A;  3HM3 A;  4P1B C;  1VJK A;  2WLB A;  5C23 A;  1FXI A;  1C4C A;  3A9K A;  4OZB A;  1QIL A;  2G1E A;  1CK1 A;  3T3O A;  1WX7 A;  2JXX A;  1WSP A;  3TCA A;  1DOX A;  4PYU A;  3TEW A;  3DBL I;  3WAN A;  1I4Q A;  4NJ7 A;  1MPE A;  4GXB A;  4LNO A;  4ASW C;  1Z2M A;  2MJ3 A;  2MLB A;  3UIP B;  5D2M B;  3QQ8 B;  2NTS A;  2LRU A;  1I7H A;  5EE9 A;  3UQA A;  2KJ6 A;  1WF9 A;  2N1V A;  1T0Q C;  2FCS A;  4PT5 A;  4UDU C;  5D94 A;  3RUL A;  5KHO A;  3H7P B;  1WE7 A;  4A90 A;  3NJT A;  1RAX A;  4OZA A;  2BB6 A;  4RGN A;  2D3B A;  2FID A;  1UH6 A;  3ZIM A;  3KWL A;  3L4P A;  3NHE B;  4ZHP A;  4WJQ A;  3HM6 X;  1Q5W B;  4H2A A;  2KQ4 X;  3AE6 B;  3AE1 B;  2KQ7 A;  1OQY A;  2KC2 A;  1R7S A;  3TEX A;  3B0A A;  3BK2 A;  4ANX A;  1N5X A;  2JZZ A;  5HI1 A;  4M01 A;  1F52 A;  3AEG B;  4LNI A;  2PIA A;  2W3S A;  3QA8 A;  2IY1 B;  4FJY A;  1ZKH A;  3JYU A;  1LO5 D;  3SDL C;  3WAP A;  1E90 A;  2KN5 A;  2GBJ A;  4CQN A;  2W55 A;  4JWS C;  4MM3 A;  2WQY B;  1I42 A;  2KAC A;  1FMA D;  2PVO D;  1VCB A;  4NZL B;  1KRH A;  5JXV A;  2G4D B;  2IGG A;  2NTT A;  3BY4 B;  1WGY A;  2KN4 A;  3Q3O C;  2MHJ A;  4ICU A;  5D3D A;  5L83 A;  3AU4 A;  3PLU A;  1EUV B;  1TY0 A;  3EHV A;  5EE1 A;  2D2Q A;  4USA A;  1KLV A;  1D6E C;  1SE4 A;  2KDM A;  4AWJ A;  4TMA B;  3DVG X;  2PKO A;  4RGO S;  1K52 A;  5J18 A;  1JWM D;  5BMI A;  2JWU A;  1A70 A;  3X23 A;  2IYD B;  3V61 A;  3ZDM C;  1I4R A;  4HJG E;  4DHJ D;  3KYC D;  2KWD A;  4HRS A;  1TGZ B;  1WE6 A;  2ZW1 A;  1XXG A;  4N59 A;  1VR9 A;  2KQS A;  1WYW B;  4EZL A;  1HTO A;  2BS2 B;  2AEH A;  3AE3 B;  4DDG D;  3TIX A;  4AP4 C;  1SXT A;  1ZDV A;  4N58 A;  4KGR A;  1WGR A;  4FHK A;  1YQ3 B;  4BOZ B;  4CHK A;  2C7H A;  2ZVO A;  2XN9 C;  5AEK B;  2JU6 X;  2LAS A;  3PS6 A;  3NRZ A;  2WXG A;  2BYV E;  4ZRK A;  1TIF A;  3AN1 A;  2KWV B;  3SEB A;  1ZUD 2;  4JGH B;  3MJ5 A;  4KSK C;  1T0S C;  3IAS 1;  5C1Z A;  3A1Q B;  2LGS A;  4RCO A;  2MW5 A;  2R2Q A;  1E0Z A;  1VD2 A;  2KFK B;  1P0R A;  3Q8C A;  2N0S B;  3RNF C;  5J17 A;  2KYW A;  2N9L A;  3DBS A;  5EE0 A;  1L0V B;  2BBC A;  1J8C A;  3EFC A;  2CHW A;  5JHB A;  2CHZ A;  4HKZ E;  4FN2 A;  4MGI E;  2RSU A;  3L08 A;  5HHD G;  3R3M A;  3H7S A;  5E6P A;  1QOB A;  1YN4 A;  4NNJ B;  3KUD B;  3M62 B;  3O13 A;  2LUE A;  1QOG A;  1F1H A;  4RH6 A;  4KGS A;  4YTN B;  3L10 B;  4MSQ B;  5DPT A;  3N32 A;  2UYZ B;  4GDL A;  3HK0 A;  3UQB A;  2K6D B;  3S2A A;  3WA0 A;  2C7N B;  4BKT A;  4W9D A;  5DPS A;  2D11 A;  2UWQ A;  3ZRC A;  4N6E B;  5HFY A;  3NZU A;  2WXM A;  1JWB D;  4ICV A;  1XQQ A;  4B0E A;  4RF0 A;  2LGI A;  3L54 A;  2L05 A;  4EE2 A;  3Q2A C;  3ZNH B;  5IN7 A;  1SE3 A;  1NI3 A;  4KGT A;  3VH4 B;  2KK8 A;  3CST A;  1ZPS A;  2K39 A;  5CHV C;  4LNK A;  1LM8 B;  2MWS B;  5BMG A;  1C4A A;  1YD8 U;  2FCN A;  2WHI A;  2IGH A;  3SD5 A;  3PSE B;  2PVG C;  2KKC A;  3N20 C;  2MRP A;  4W9C A;  4P6V F;  2K22 A;  5IO9 A;  1N60 A;  2JZ3 B;  2I2Y A;  1V8C A;  3NVZ A;  4W9K A;  2K1F A;  4BKS D;  3QIJ A;  4M8M A;  2KTR A;  3ZKJ C;  1R4N I;  1JML A;  4ARI A;  1SJE D;  4YT0 B;  1XF5 L;  2BTE A;  2WU2 B;  4HCP B;  2PTL A;  1JWS D;  4WJN A;  3VTW A;  2K8B A;  2VH1 A;  4E74 A;  5TSS A;  2FE8 A;  1QT9 A;  1T0Y A;  2L32 A;  1Z5S B;  3BIN A;  1P1A A;  5CHF A; 
#chains in the Genus database with same CATH homology
 1BT0 A;  1LXD A;  2O2V B;  4FAD A;  5J2R A;  1GJZ A;  4MSM B;  3V6E B;  1P9D U;  4GOC A;  3QAQ A;  3CSF A;  2L0T A;  3R7Q A;  1V5T A;  3A33 B;  3RYT A;  4IC7 B;  3T8M A;  1ISN A;  4AJW A;  1KM7 A;  4ZRI A;  3DPD A;  4LDT B;  1K8R B;  2GBK A;  2MSE D;  4LJP B;  2ZPN A;  3K9P B;  3V62 A;  4ANV A;  2EMT A;  3OAW A;  2KX0 A;  5DCN A;  1YX6 B;  1TZ1 A;  1Q0W B;  1WZ0 A;  3OJ4 B;  2L7R A;  3PVL A;  3M3J A;  3QHT A;  4IWO A;  1RFA A;  1NI2 A;  2GOW A;  2OOB B;  2RD0 A;  2N9X A;  2R2O A;  4HK2 A;  4W9I A;  4BOS C;  3DVN U;  4NQK E;  2ZCC A;  4WJP A;  4JLC A;  2J0K A;  2KC1 A;  2D07 B;  2DZI A;  4RMA A;  2K25 A;  3A9J B;  3VFK A;  2NPT B;  2LGY A;  2IO2 B;  2W9N A;  2EKE C;  2LXC A;  2D10 A;  2DAJ A;  2KFJ A;  1M94 A;  2CHX A;  1WGD A;  1V86 A;  4PYZ A;  1EF1 A;  1YX5 B;  4MJS A;  3DVG Y;  4ZYN A;  2ZJD A;  3HIZ A;  4IW0 A;  3JW0 X;  4F8C B;  3KW5 B;  3B1L X;  1WX9 A;  2KMA A;  4K81 A;  4MEM A;  1GC7 A;  3HM3 A;  1FXT B;  4WWO A;  1C1Y B;  4A20 A;  2KJH B;  1J0G A;  1D3Z A;  3PV1 A;  5C23 A;  4EZK A;  3T9L A;  4HVB A;  2PEA A;  4W9E A;  4TV3 A;  5CTR C;  3PGE A;  3MTN B;  3VUX A;  3LJ3 A;  3A9K A;  4II2 B;  3W1Y A;  1WX7 A;  2JXX A;  1E8Z A;  3RZW C;  2KO3 A;  1I35 A;  3PPA A;  1PQS A;  2GBR A;  3TCA A;  4FBJ B;  1NDD A;  1WJ4 A;  3QX1 A;  2M0X A;  3C0R B;  1SGH A;  2GBM A;  1E7U A;  5CHW A;  4A3P A;  1GC6 A;  4DHJ B;  5EDS A;  1Q1O A;  1ZW7 A;  3M63 B;  1KOT A;  4PYU A;  3X0W A;  3DBL I;  2V4L A;  3PLV A;  1TBE A;  2MA9 B;  2ZEQ A;  3KH0 A;  3WAN A;  1WXS A;  3DCG A;  4URK A;  4DWF A;  4KDI C;  4NJ7 A;  1JRU A;  2ZVN A;  4GDK B;  2IO3 B;  5IA7 A;  2M17 A;  4HPM B;  3SHQ A;  4NQL B;  3P2B A;  4K7W A;  4HXD A;  2LI5 A;  3VUW A;  4GXB A;  4TQ1 A;  3W1S A;  1WGH A;  3H1U A;  4ASW C;  1WI0 A;  1Z2M A;  2IY0 B;  3ENE A;  4HPL B;  4K7U A;  3NOB A;  2MLB A;  1HE8 A;  3UGB B;  3WAM A;  2KDI A;  2Z0D B;  1WR6 E;  3UIP B;  2C5L C;  5E6O A;  5AZH A;  4GDK A;  5D2M B;  5GMV A;  2DYB A;  3PT2 B;  2AL6 A;  3QQ8 B;  3GZN I;  2LRU A;  4EUT A;  2DZJ A;  2M4N A;  3DBH I;  4IWQ A;  1V81 A;  4KSL C;  4PS3 A;  4EZJ A;  3UQA A;  1WRD B;  2FCM A;  4DXA B;  2KJ6 A;  3R7R A;  1WF9 A;  2KDB A;  4GB9 A;  1RRB A;  2N1V A;  4MEL A;  4HWI B;  1WIA A;  1IPG A;  2FCS A;  5LLI A;  3V60 A;  1E5W A;  5D94 A;  3RUL A;  1CMX B;  2BYF A;  3EC8 A;  3GOE A;  1S1Q B;  2QHO A;  2MBQ A;  2IBI B;  5KHO A;  3NZS A;  2EMS A;  3H7P B;  3PRM B;  3QCA A;  1WE7 A;  3QAR A;  1RAX A;  4KIK A;  4WAA A;  1V2Y A;  3QWZ B;  4BKS A;  1MG8 A;  3ZNI D;  3OLM D;  1ZGU B;  4EOY A;  2XBB C;  2FID A;  1WM3 A;  2PE9 A;  4G3X B;  4BBN C;  3LDZ E;  3H7P A;  2DHZ A;  1UH6 A;  2NCN A;  4RM8 A;  2LVO A;  1LFD A;  3WAL A;  3DBR I;  3VVW B;  2I1K A;  4KZC A;  3ZIM A;  3NHE B;  3PRE A;  4AJY B;  4NAW A;  3APD A;  2IZV B;  1GUA B;  4WJQ A;  3HM6 X;  1Q5W B;  3KUC B;  3VAW A;  5FR6 A;  1V5O A;  1UBQ A;  2KQ7 A;  1OQY A;  2KC2 A;  2K8H A;  3B0A A;  2Y5B B;  4EEW A;  3ECI A;  4CO7 A;  1EO6 A;  4XC2 A;  4ANX A;  1WMH A;  1YIW A;  3A1Q A;  2JZZ A;  2KLC A;  4LDT D;  4MJS B;  3VTV A;  3QA8 A;  3WIM A;  2KNB A;  1EF5 A;  1P98 A;  2IY1 B;  4FJY A;  3VQI A;  1WJ6 A;  1ZKH A;  3JSV A;  4GMV A;  4WJO A;  1A5R A;  4LJO B;  3JYU A;  2CKH B;  2D3G A;  5HKH A;  3SDL C;  2DZM A;  2N9E B;  4W9L A;  3QK0 A;  2REX A;  2KVR A;  3WAP A;  4DHZ E;  4IUM B;  1E90 A;  3RUI B;  5CX3 A;  3TBL D;  5IAA C;  2KN5 A;  2GBJ A;  4PS7 A;  3ZNZ B;  2WWZ A;  4MM3 A;  5G55 A;  1I42 A;  4MDK E;  4KV2 A;  5BO4 B;  3A9K B;  4MGY E;  1VCB A;  1UEL A;  4W9H A;  4NPN A;  2LGX A;  3SU8 X;  2G4D B;  2A4Z A;  4FLH A;  4BVU C;  3BY4 B;  4F7Z A;  3R66 C;  2NVU I;  3ZW3 A;  4BBN F;  2L3Z A;  4B9K A;  1WGY A;  4ICU A;  4XZ4 A;  1IYF A;  5L83 A;  3AU4 A;  3PLU A;  1EUV B;  2V3S A;  3L16 A;  3EHV A;  4F1S A;  2DYO A;  2D2Q A;  2KWC A;  1KLV A;  1XT9 B;  3L13 A;  4I6L B;  3VHT C;  2LWP A;  1L7Y A;  4G50 A;  4JL9 A;  1C3T A;  2K6Q A;  3RD2 A;  3VDZ A;  2NBU A;  3EEC A;  5KHQ A;  4E71 A;  2NBW B;  4IG7 B;  5G2N A;  1OEY J;  2NS5 A;  1GG3 A;  2KAN A;  4AWJ A;  5JH5 C;  1G6J A;  2MP2 A;  3DVG X;  4II3 B;  2BF8 B;  5J18 A;  2HTH A;  3AI5 A;  2MBH A;  3MJW A;  3RZF A;  3Q3J A;  4K1R B;  4J6I A;  3PHX B;  3X23 A;  5AZF A;  2IYD B;  3V61 A;  3ZDM C;  2ZPY A;  2CR5 A;  1V80 A;  3PRP B;  2PE6 B;  3I3T B;  3U8Z A;  4DHJ D;  3KYC D;  3IHP C;  4P7I A;  2DYM A;  4FJV B;  3D32 A;  3IBE A;  3TMP B;  3ZDT A;  1TGZ B;  1WXA A;  2BKR B;  1WE6 A;  5LXH A;  2AWT A;  2LJ5 A;  4KDL B;  2BWE S;  4LCD E;  1E7V A;  2LVP A;  2PPH A;  2DX5 B;  1OTR B;  2KQS A;  2DEN B;  2LD9 A;  1WYW B;  2VRR B;  4WQO B;  2V1Y A;  4EZL A;  2AEH A;  1YJ1 A;  1WGG A;  4DDG D;  5D7G A;  2BGF A;  3TIX A;  4X57 B;  3M95 A;  3A4S C;  4HJK A;  4WWN A;  4AP4 C;  2KLG A;  4KIK B;  4HLE A;  2RPQ A;  1S3S G;  1WGR A;  4FHK A;  4NJ6 A;  3ZTD A;  5JZE B;  4M0W B;  4BOZ B;  4MGZ E;  2PJH A;  3ZO5 B;  4CHK A;  2C7H A;  2WYQ A;  2HE7 A;  1NBF C;  2M1M A;  2WX0 A;  4OVV A;  4ZRJ A;  3W1S C;  4EKU A;  2HD5 B;  4K7S A;  3IFW B;  1F9J A;  4EFO A;  2ZVO A;  4PS8 A;  3VUY A;  5AEK B;  4ANU A;  1WM2 A;  2LVQ A;  2O6V B;  1WY8 A;  2M8S A;  2IO1 B;  2LAS A;  3PS6 A;  4NY0 A;  4W9G A;  2BYV E;  4ZRK A;  4AOF A;  4ZDV A;  4NAW B;  1WXM A;  2NR2 A;  2XK5 B;  1SIF A;  2KWV B;  2BPS A;  2YVC A;  4JQW C;  1U4A A;  3ONS A;  2ZNV B;  2LGD A;  3VH3 B;  2N7E A;  4JGH B;  2LXA A;  3Q3F A;  4FA6 A;  3B08 A;  3H9D A;  4KSK C;  2C60 A;  2O6V A;  1UD7 A;  5C1Z A;  1WMH B;  4M8N A;  3A1Q B;  3V6C B;  5JHA A;  3KYD D;  3U30 A;  1WJN A;  2KTF A;  2MW5 A;  2XK5 A;  3ALB A;  3PRZ A;  2R2Q A;  5E6N A;  1VD2 A;  3JSV B;  1RLF A;  3TL5 A;  1WXV A;  3PZD A;  4FUL A;  4BFR A;  2KFK B;  1P0R A;  2JRI B;  5J17 A;  2Z59 B;  3ZRF A;  3DBS A;  3N30 A;  2KDF B;  1J8C A;  2NBV B;  3PTF C;  5DPR A;  2CHW A;  2JVC A;  3DQV A;  4DBG A;  4DK5 A;  5JHB A;  2WX1 A;  2CHZ A;  4B95 A;  4FN2 A;  1E8Y A;  4MGI E;  2I1J A;  2RSU A;  2JRH A;  3L08 A;  2KFK A;  3AUL A;  1P3Q U;  3NY5 A;  4RM9 A;  2N4F A;  2G4S A;  3R3M A;  4GDL B;  3H7S A;  2MCN B;  5E6P A;  2ZNV C;  2O2V A;  2C7M B;  2DZK A;  3L17 A;  4NNJ B;  3KUD B;  1UGM A;  3M62 B;  1SE9 A;  2LUE A;  2CS4 A;  2L8J A;  3N3K B;  2FCQ A;  5DPT A;  3L10 B;  4MSQ B;  4DHZ B;  2KD0 A;  4GU2 A;  3N32 A;  2UYZ B;  2LRW A;  3AXC A;  3QC8 B;  4GDL A;  4KZ0 A;  4MGK E;  1LQB A;  3HK0 A;  2RGF A;  3UQB A;  3L0W B;  3RT3 B;  2AYO B;  2K6D B;  2KX3 A;  3S2A A;  3KUZ A;  3QJZ A;  4IWP A;  4FHJ A;  3WA0 A;  1WZ3 A;  2C7N B;  1WH3 A;  2MP2 B;  2CU1 A;  3RCZ A;  4BKT A;  1GNU A;  4W9D A;  5DPS A;  2D11 A;  3KVF B;  4A3O A;  2DAF A;  3A4R A;  2UWQ A;  3ML8 A;  5D6J B;  3IVF A;  3ZRC A;  1H8C A;  4GN1 A;  3VXW A;  4TQ0 A;  1J19 A;  2JPH A;  1V49 A;  3ZLZ A;  1UBI A;  1WFY A;  3A9J A;  3NZU A;  2NPT A;  3EFU A;  3OJ3 A;  4TKN A;  3UF8 A;  2JY6 A;  1TTN A;  4ICV A;  2BWF A;  2KMC A;  3DVN V;  1XQQ A;  2KDE B;  2KOX A;  1XD3 B;  3L54 A;  4W9F A;  2J7Q B;  1E8W A;  2L05 A;  1V6E A;  2L76 A;  2ZZP B;  4YL8 A;  4HDQ A;  3ZNH B;  3ZNG C;  2JWZ A;  2MX2 A;  4MH0 E;  2RR9 A;  2B3A A;  1X1M A;  2N1W A;  2KHW B;  2ASQ A;  3VH4 B;  3TJP A;  2KK8 A;  1WJU A;  3CST A;  3HHM A;  4KVG B;  4W9J A;  4ANW A;  3CF6 E;  2K39 A;  2XEW A;  2AL3 A;  5CHV C;  2J0M A;  1AAR A;  1IP9 A;  2JT4 B;  1QZE A;  4I6P A;  4GGQ A;  3APC A;  3NS8 A;  1R4M I;  3PHW B;  2N9P C;  1LM8 B;  2MWS B;  1Y8R C;  4JIO U;  1YD8 U;  2FCN A;  2MBO A;  4HCN B;  2MBE A;  3MHS D;  2IO0 B;  4XX5 A;  3DOW A;  3SD5 A;  3U7D A;  4IM3 A;  3UIO B;  3WAO A;  3PSE B;  4GSW A;  2K8C A;  2J0J A;  3APF A;  1WR1 A;  4FJZ A;  2LZ6 A;  3ML9 A;  4OVU A;  1E8X A;  4GIV A;  4CYE A;  2KKC A;  3JVZ X;  2MRP A;  4W9C A;  4N9F 4;  2KTR B;  2GBN A;  3IG3 A;  3ZVV A;  2GMI C;  3VTU A;  3ZTC A;  2N7D A;  2JZ3 B;  2YLM A;  5TR5 A;  5AZG A;  1YQB A;  2G45 B;  4I6N B;  2A5U A;  2FNJ B;  3CMM B;  3H6N A;  2KZR A;  2L0F A;  3AU5 A;  1KJT A;  4E3C A;  5L95 C;  4W9K A;  2K1F A;  4BKS D;  3QIJ A;  4G0N B;  4G11 A;  2FIF A;  2KXJ A;  4IM0 A;  4M8M A;  2KTR A;  3ZKJ C;  3O65 B;  4IM2 A;  1R4N I;  1OEY A;  2OJR A;  2ZCB A;  5LXI B;  1V9J A;  2BKF A;  1OGW A;  2C9W B;  2HJ8 A;  1H4R A;  4WWP A;  2WDT B;  4HCP B;  2KJR A;  2Z0E B;  2MBB B;  2MQJ A;  2O6V D;  2BYE A;  3ZUN A;  4WJN A;  3VTW A;  2KWU B;  3UIN B;  3K9O B;  2K8B A;  2FAZ A;  2G3Q B;  4E74 A;  4TUU A;  1WX8 A;  2L00 B;  3DDC B;  5DPW A;  1UZX B;  4BKG A;  2JUO A;  4DDI D;  1T0Y A;  2JF5 A;  4AUQ C;  1L2N A;  4HDO A;  1Z5S B;  3BIN A;  1P1A A;  2FUH B;  5CHF A;  4B6W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...