2IYDB

Senp1 covalent complex with sumo-2
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
79
structure length
79
Chain Sequence
NDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Senp1 Native Structure
rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords SENTRIN-SPECIFIC PROTEASE 1
total genus 15
structure length 79
sequence length 79
ec nomenclature
pdb deposition date 2006-07-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2iydB00
2KMCA 1VD2A 2ZJDA 5J18A 1BT0A 3AI5A 3KYCD 4WJPA 5CX3A 3ZNHB 3RYTA 2AL6A 1G6JA 1V2YA 5D94A 2O2VA 4B6WA 5KHQA 3DVGX 1D3ZA 1E5WA 4J6IA 1I35A 2O2VB 2G45B 4GGQA 4W9EA 4WJOA 2IO3B 5J2RA 4GIVA 2KC1A 3U30A 3L10B 3AU5A 3KUZA 4DK5A 1FXTB 1SGHA 2KTRB 4FLHA 1UZXB 4HDQA 4IM2A 3VUWA 5DPRA 1L2NA 2RR9A 1K8RB 2KX0A 2LUEA 4I6NB 5AZHA 2JRHA 4IW0A 4EEWA 3HM3A 3DVNV 3H7PA 1OTRB 4MSQB 4ZRJA 2KX3A 5AZFA 2RD0A 2KWUB 2A5UA 2LASA 4X57B 3VHTC 4MGKE 2ASQA 2KFKA 3ZTDA 2KNBA 4HCPB 4MGIE 3L13A 1U4AA 1WXSA 4DHJB 5AEKB 2JVCA 2JWZA 2DAFA 2XK5B 3JSVB 1WZ0A 1WX9A 4CYEA 4ASWC 4FADA 3QC8B 3PVLA 2NPTB 3GOEA 2EMTA 4ANXA 2LVQA 4G11A 1J19A 4F8CB 2L76A 4XC2A 2CHWA 2A4ZA 3HHMA 2IO1B 3TJPA 3HM6X 3W1SA 3DDCB 2M8SA 4BKSA 1WI0A 1J0GA 3QCAA 2L7RA 3NZUA 4GMVA 1WY8A 3ZDTA 2BGFA 3M63B 4G50A 2N7DA 5E6OA 3A9KB 2WWZA 4MSMB 1WJ6A 3PREA 2MBQA 3WAOA 1R4MI 2KWVB 1GUAB 5D7GA 2KQ7A 2LGYA 1NDDA 4EZLA 4PYZA 2L00B 2K25A 4BOZB 4OVVA 2B3AA 3AU4A 2LGDA 3R66C 1P98A 4EKUA 3QWZB 3H9DA 2BWES 4DHZE 2JRIB 1WJNA 4GDLA 3R7QA 4DHJD 3WIMA 3PS6A 5LXIB 1WX7A 1UH6A 2M1MA 4NPNA 4FJZA 3ZW3A 2BYEA 1GC7A 5HKHA 5J17A 2Z59B 3A9KA 3M3JA 3RZWC 3D32A 5LLIA 3RT3B 4BKSD 2R2OA 3AULA 5D2MB 4FJYA 1GNUA 4FULA 1S3SG 1EF1A 2MX2A 2C7NB 2CS4A 2KMAA 3OAWA 3QQ8B 4LDTB 3WA0A 3DVGY 4MJSB 2DX5B 2O6VB 4GDKA 3IFWB 4LCDE 4HJKA 3QA8A 3W1SC 3VTUA 1UD7A 1WXAA 2WDTB 3PHXB 4ANUA 1R4NI 4JIOU 2UWQA 3UGBB 3S2AA 2FCNA 1E7UA 4E74A 1EUVB 3Q3JA 4NAWA 4WWOA 3K9PB 2GBMA 3U8ZA 3X0WA 4BKTA 2OJRA 4HXDA 4BBNC 5LXHA 1GJZA 4A20A 1OEYA 5CHWA 1J8CA 3EFUA 4MDKE 1E90A 4W9JA 2LD9A 3IVFA 4HCNB 2IY0B 3L54A 1Q5WB 4YL8A 1WE6A 1V81A 2MWSB 2NBVB 1P9DU 3H1UA 2Z0DB 3B1LX 5L83A 4M0WB 1WXVA 3ZRFA 2MSED 2MBBB 4IM3A 3DQVA 3HIZA 4DDGD 4DBGA 2ZCBA 1KOTA 1OEYJ 5JHBA 2C7HA 3EHVA 4AWJA 4KDIC 2JUOA 2MBHA 4W9FA 2DZIA 1Z2MA 4HPMB 1Q0WB 1OGWA 3KW5B 1UELA 2XK5A 3M62B 3ALBA 2J0MA 2K8BA 3ECIA 1V80A 1WGRA 2MCNB 4NJ7A 3B0AA 4TQ0A 2W9NA 1YJ1A 4NY0A 4JGHB 4IM0A 4IC7B 1WGGA 1GC6A 2MA9B 1A5RA 4RMAA 3MHSD 2KOXA 3V61A 2AL3A 4W9GA 3UF8A 1C3TA 4K7WA 3RULA 4AJYB 1I42A 2KANA 5JH5C 5CTRC 4ZRIA 3A4SC 4KDLB 5CHVC 2CHZA 1UBQA 4PS8A 2JF5A 4RM9A 4EZKA 3APCA 3X23A 2WX0A 4K7UA 2LRUA 2LRWA 1GG3A 3PHWB 3NOBA 2ZCCA 1ZKHA 2KFKB 5AZGA 3VTVA 1XD3B 2XBBC 3ML9A 2KFJA 2FIFA 2ZNVB 1TGZB 3K9OB 3DBSA 2KK8A 2M17A 2C60A 2D2QA 2OOBB 3UIPB 3UQBA 4KIKB 3KYDD 4IWPA 4BBNF 2NPTA 2NR2A 3A4RA 3KVFB 4XX5A 2HJ8A 3DVNU 3MJWA 1TTNA 2LXCA 2DZMA 2G3QB 3DBHI 3QAQA 4MJSA 3SDLC 3DPDA 3DBLI 1E8WA 2IY1B 2PJHA 2DAJA 1V6EA 1WGYA 4GSWA 1LM8B 1WX8A 2FAZA 1M94A 1VCBA 3L0WB 3VH3B 3KUDB 3VVWB 1RAXA 5GMVA 2DYMA 2KLCA 3SU8X 2MBOA 1IPGA 1P3QU 2LJ5A 4MEMA 2NS5A 4PS3A 3DOWA 4W9LA 2IO2B 1IYFA 1E8XA 2NVUI 1QZEA 2L0FA 2D3GA 2DZKA 4DXAB 4KZCA 2LXAA 5CHFA 3QJZA 1WF9A 3VTWA 1CMXB 5DPSA 4FHKA 1WJ4A 2IYDB 3ZKJC 4ANVA 3OLMD 1WIAA 3CMMB 2K6DB 3CSFA 2GBRA 3N3KB 4GN1A 3APFA 4HPLB 2FUHB 2GOWA 3SHQA 4FN2A 4IUMB 2GBNA 2G4SA 3SD5A 2L05A 1WRDB 4PYUA 1RRBA 3P2BA 2KLGA 1L7YA 2JZZA 3AXCA 3ZNZB 4KVGB 4NQLB 3PRMB 1YIWA 2KC2A 2KO3A 4AP4C 3KUCB 2MP2B 3H7SA 3ZUNA 4ZDVA 3PGEA 1NI2A 4EZJA 1SIFA 1WJUA 2C5LC 3H6NA 4IWOA 2N9XA 2CHXA 3JYUA 3A9JA 4TV3A 1H8CA 3L16A 3ML8A 3ZTCA 4M8NA 2R2QA 2KJHB 5C1ZA 3MTNB 1WZ3A 2MQJA 1C1YB 1Y8RC 3A33B 4W9CA 2I1KA 3N30A 1YX6B 2I1JA 4MELA 2DZJA 2EKEC 2PPHA 4AOFA 3UQAA 2IZVB 2MLBA 4HWIB 5KHOA 5G55A 5G2NA 2N1VA 3N32A 1E7VA 1WM2A 1WE7A 4JLCA 4K81A 5DCNA 3TIXA 3PLVA 2D07B 1JRUA 2KDBA 2BYFA 2MW5A 5D6JB 5JHAA 3WANA 1S1QB 1WM3A 3RZFA 1E8ZA 1WFYA 2N7EA 3TMPB 2O6VD 3CSTA 2JPHA 5E6NA 4JQWC 2KN5A 2YVCA 4HK2A 4W9DA 3ZDMC 2CKHB 1LQBA 2MP2A 4OVUA 4CO7A 3B08A 4A3OA 2HD5B 4ICUA 2KJRA 2V4LA 5DPTA 3M95A 2IBIB 2VRRB 4IG7B 4II3B 1WH3A 3QX1A 4HLEA 4TQ1A 1WXMA 5TR5A 4GU2A 2K6QA 1TBEA 2J0KA 2KDIA 3JW0X 3V6EB 4XZ4A 4FA6A 2KDEB 2RSUA 3IG3A 4P7IA 3LJ3A 2V3SA 4EUTA 2FCMA 2WX1A 2NBUA 4FJVB 3ZNGC 4B95A 4PS7A 3QK0A 5JZEB 2M4NA 3OJ3A 2REXA 1Q1OA 1LFDA 3V62A 2DENB 2KVRA 2N1WA 4G3XB 2O6VA 2ZVOA 3H7PB 2AEHA 3DCGA 2GBKA 3Q3FA 5IA7A 2ZVNA 4ZYNA 2PEAA 2FIDA 2K8CA 2LWPA 3T9LA 3VUXA 3R3MA 1EO6A 2FNJB 3JVZX 4MH0E 4WJNA 1MG8A 1KJTA 2CR5A 2N9PC 3WAPA 1YQBA 4GDLB 2DYBA 3PV1A 4LJOB 2K1FA 4I6LB 2LZ6A 3VQIA 3ENEA 2N4FA 1AARA 4AUQC 4BOSC 3PRZA 1YD8U 2IO0B 3QIJA 3WAMA 5EDSA 3TL5A 2JXXA 2KQSA 1OQYA 4GOCA 3APDA 4JL9A 2CU1A 3W1YA 2J7QB 3RUIB 2ZPNA 2ZEQA 4II2B 1V49A 2DYOA 3IBEA 2K8HA 2HE7A 4ANWA 4BKGA 2KXJA 5BO4B 2BYVE 4KSKC 2J0JA 2KZRA 5C23A 4MGYE 1ZW7A 3ZLZA 3PTFC 2NCNA 1SE9A 2KTFA 2Y5BB 3TCAA 3V60A 3VAWA 4BFRA 3VH4B 2BWFA 4KIKA 2ZNVC 4E71A 3CF6E 4W9HA 4KSLC 4CHKA 3U7DA 4EOYA 4B9KA 3ZRCA 3JSVA 2RGFA 2LGXA 1XQQA 5E6PA 3VXWA 1UBIA 2KKCA 3NHEB 2JZ3B 2LI5A 4I6PA 3ZVVA 4NJ6A 4HVBA 4W9KA 1P0RA 3IHPC 4MGZE 3ZO5B 2K39A 2KTRA 1KM7A 4DDID 3BINA 2UYZB 2XEWA 4DWFA 4IWQA 4EFOA 4GXBA 3QARA 5DPWA 1IP9A 3PZDA 3EC8A 3ZNID 2NBWB 4LJPB 2MBEA 4K1RB 2BKFA 3HK0A 3A1QA 1V5OA 1F9JA 3NY5A 4AJWA 4M8MA 2FCSA 1UGMA 1P1AA 2HTHA 4HDOA 2D10A 3EECA 3UIOB 4FHJA 1E8YA 1V86A 2AYOB 1T0YA 2KJ6A 2GBJA 4MM3A 1Z5SB 4KZ0A 3PT2B 2N9EB 3A9JB 3L08A 4F1SA 4RM8A 4WWNA 1KLVA 1X1MA 3PSEB 4NQKE 4NAWB 3NZSA 2QHOA 2YLMA 1WR1A 1V5TA 2PE9A 4WAAA 3TBLD 4W9IA 1EF5A 4WQOB 3RCZA 3RD2A 3VUYA 2WYQA 3GZNI 3I3TB 2GMIC 3KH0A 1HE8A 3V6CB 4TUUA 3QHTA 1XT9B 1WGHA 2JT4B 4G0NB 4KV2A 4ZRKA 2KHWB 1PQSA 2LVOA 4NNJB 1LXDA 2RPQA 3DBRI 4GDKB 1V9JA 1RFAA 4LDTD 3LDZE 4WJQA 2FCQA 4FBJB 4F7ZA 1WGDA 2BPSA 2C7MB 1WMHA 1YX5B 4URKA 2ZZPB 2Z0EB 1WMHB 2AWTA 2JY6A 2C9WB 3ONSA 2PE6B 2MRPA 3BY4B 3PLUA 4ICVA 3R7RA 2V1YA 4DHZB 2LVPA 2L0TA 3L17A 5IAAC 3ZIMA 1WYWB 1TZ1A 2DHZA 3O65B 5FR6A 1H4RA 3WALA 2KWCA 3NS8A 3PPAA 5L95C 2M0XA 3C0RB 2D11A 4WWPA 1ISNA 3PRPB 4N9F4 4TKNA 1ZGUB 3T8MA 3OJ4B 4E3CA 4A3PA 2BKRB 2KDFB 1NBFC 2L3ZA 2BF8B 4GB9A 4K7SA 3VFKA 2L8JA 3UINB 3VDZA 2KD0A 2G4DB 4BVUC 2EMSA 2ZPYA 3A1QB 1RLFA 1WR6E
chains in the Genus database with same CATH superfamily
2KMCA 2ZJDA 1BT0A 3KYCD 5CX3A 3Q3NC 4ITKA 5EE0A 4YTMB 3NVYA 1D3ZA 3NS1A 1I35A 4JE3B 3L10B 1D5MC 1FXTB 3AEAB 4LNFA 4HDQA 2RR9A 3P4PB 1C77A 3AE6B 2QC8A 3GB1A 1FEHA 3H7PA 2RD0A 2LASA 3VHTC 2WP9B 2KFKA 1NI3A 1ZOYB 1U4AA 2AQ3B 4R3DA 2JWZA 1WZ0A 4CYEA 4ASWC 4FADA 1VZ8A 4ZRPA 4AS1A 3MFGA 4F8CB 4XC2A 3HHMA 2IO1B 3HM6X 2BBCA 4ZOHC 2L7RA 2KYWA 2BGFA 5E6OA 2WWZA 3PREA 2V4IB 1GUAB 2KQ7A 3MJ5A 2WXRA 4BOZB 3AU4A 1I4XA 3R66C 3QWZB 2JRIB 4TSSA 1FFVA 2INPE 2PKOA 1JWUD 3O13A 5LXIB 4XWTA 1FCLA 1EWCA 5LLIA 3RT3B 4BKSD 1B9RA 1S3SG 1EF1A 3RNFC 5IKCM 2C7NB 3OAWA 3QQ8B 4NJCA 4LNKA 4MJSB 4LCDE 4HJKA 3VTUA 1K52A 2GLSA 2WXJA 3RNEC 2WDTB 3KWVA 3AE3B 4JIOU 3S2AA 1E7UA 3K9PB 2OJRA 4HXDA 1TT5B 1RFKA 1V1PB 2EKIA 3FAHA 2BS2B 3IVFA 3ZXRA 2GI9A 2KN4A 3SFDB 2R61A 4L2YA 3N9YC 1XLNA 2WXNA 1V8CA 2MJ3A 2ZCBA 2JQRB 3DHIC 2YEPB 4AWJA 1QKZA 1XEEA 4P6VF 1OGWA 4REZA 3M62B 2J0MA 1V1PA 1V80A 3B2FA 2MCNB 1YJ1A 4JGHB 1R4MB 1XF5L 5C3JB 2KT7A 4USAA 2KOXA 2AL3A 1T0SC 1ET9A 4AJYB 1I42A 3ZJVA 5JH5C 5CTRC 1EM7A 4KDLB 1XCTL 4RM9A 1N63A 4HRSA 3X23A 2DNFA 4P1CC 2WX0A 4K7UA 2SEBD 1YQ4B 4CQNA 2KFKB 2QJLA 2XBBC 3ML9A 3AE4B 2ICIA 2M17A 1J7AA 1OQRA 3V05A 2OOBB 3UIPB 4HJGE 4IWPA 1UWMA 4LK0M 3A4RA 3KVFB 2DLBA 3DVNU 2H88B 3SDLC 1L4ZB 4QAYA 3DBLI 1XLQA 2MHJA 1MHXA 2J53A 1I7HA 2ZW1A 3L0WB 1N60A 3AEDB 2LEKA 2MBOA 3BK2A 2INCC 4W9LA 1ROEA 3IAS1 1E8XA 2D3GA 3B9JA 1CMXB 5DPSA 3HRDD 4FHKA 2L52A 4RGNA 3OLMD 2K5PA 3CMMB 4GN1A 2GOWA 2GBNA 1L6VA 1TKGA 1I4RA 2IGGA 4NQLB 2KO3A 4AP4C 3H7SA 1NYQA 1NI2A 2VH1A 1SIFA 3W5UB 2N9XA 3JYUA 1H8CA 5AUIA 3ZTCA 4M8NA 3ZGZA 2KJHB 5C1ZA 1WZ3A 1D5XC 1QLBB 1NEKB 4FXCA 1ZE3D 1YX6B 5EE1A 3UQAA 2IZVB 5KHOA 5G55A 1WM2A 5DCNA 1FRDA 3BIID 3RNBC 3RZFA 4N59A 1KFYB 2JPHA 3GZNB 3MC9A 2IDYA 1AYFA 3DBHB 3ZDMC 1E7PB 2CKHB 2PTLA 1IGDA 3B08A 2HD5B 4ICUA 4KKIA 2FUG1 1MVKA 4II3B 3TEYA 2X8XX 2INNE 3V6EB 3JW0X 2FCMA 2NBUA 1FMAD 4B95A 4PS7A 2KAJA 2B76B 1I4HA 3Q3MC 2AEHA 2ZVNA 2K8CA 3R3MA 1EO6A 2FNJB 4MH0E 1MG8A 1KJTA 2N9PC 5IO9A 3WAPA 1YQBA 4OZBA 4GDLB 2HTME 3PV1A 1JWBD 3VQIA 1SF0A 2WGSA 3BYTB 2V3NA 1L5PA 1V49A 2PVOD 3IBEA 2HE7A 4KSKC 4A90A 3ZLZA 3PTFC 1D4BA 2NCNA 2N0SB 3V60A 3TCAA 4RGMA 1QF6A 4KIKA 3TSSA 1I4PA 3IT6B 4KSLC 3U7DA 3C8YA 4B9KA 1LGRA 2W3RA 1KF6B 2LGXA 2KKCA 3NHEB 4NAMA 2JZ3B 2BB6A 2LI5A 2WDQB 1P0RA 4MGZE 3ZO5B 4KGRA 1XXGA 1KM7A 2L32A 4DDID 1GAQB 2XEWA 4IWQA 4GXBA 2QDFA 3EC8A 1QILA 2LJIA 4N6EB 3A1QA 1V5OA 3NY5A 1QOAA 4JWUC 1K51A 1E8YA 2BS3B 2GBJA 4RFBA 2N9EB 3L08A 4RM8A 2BS4B 2D3BA 3OG5A 3PSEB 1GPXA 4A8XC 1WR1A 1V5TA 2WXHA 3RD2A 3RCZA 3NJTA 1WYGA 3GZNI 2GMIC 3V6CB 3QHTA 1WGHA 1PGAA 3PO0A 4G0NB 4KV2A 3VR8B 3CWIA 4C4VA 4URKA 1F2RI 1YX5B 1LO5D 2G1EA 2AWTA 2JY6A 3P1MA 2C9WB 5D3IB 3IT4B 5IAAC 4MM3B 2WXLA 3PPAA 5L95C 1CK1A 2D11A 4WWPA 1D6EC 2BKRB 1B1ZA 1NBFC 3AE7B 4GB9A 4K7SA 2L8JA 3VDZA 2G4DB 3AH7A 2JXTA 1RLFA 1VD2A 3N20C 3VR9B 1V2YA 4BAXA 4WWMA 4B6WA 2LUMA 2O2VB 2G45B 2WXPA 4GGQA 4W9EA 4WJOA 4GIVA 3U30A 3KUZA 4DK5A 2KTRB 4FLHA 1HEZE 2Y5CA 4IM2A 2VZKB 4XGAB 1L2NA 2QCZA 1K8RB 4I6NB 4IOIE 2JRHA 4IW0A 3RPFC 4MSQB 4ZRJA 2KX3A 2KWUB 1I4GA 1FO4A 4N58A 4MGIE 1WXSA 1SB3C 2KACA 3U52E 4DHJB 2JVCA 2XK5B 3QC8B 3PVLA 1WWTA 5BYRA 3P4QB 2LVQA 2A4ZA 2WU5B 1AWDA 2CU3A 3DDCB 3N1ZC 1WI0A 4NZLB 4GMVA 1WY8A 5IN7A 2ON8A 2N7DA 1K50A 1XLPA 4MSMB 1WJ6A 1DGJA 3WAOA 1R4MI 1AN8A 4EZLA 1V97A 3AEBB 1RYJA 2D5GA 2WNMA 4DXGA 1E6EB 2BWES 1FNUA 3WIMA 4YTNB 2M1MA 1IGCA 4FJZA 3WCQA 2BYEA 1GC7A 3W9CB 5BMIA 2R2OA 5D2MB 5BYQA 1J7BA 4M0WA 3DVGY 4WH4A 2DX5B 3KWLA 2JWUA 3QA8A 3T3OA 1R4NI 2UWQA 4PK1A 3AEGB 2FCNA 4NAWA 1N5XA 4XDDA 1QT9A 5LXHA 2GB1A 2I38A 2PMVA 5CHWA 3EFUA 4MDKE 2LD9A 3TEWA 4S17A 2WU2B 3Q8BA 1WE6A 3GS2A 1P9DU 3H1UA 2Z0DB 5L83A 4M0WB 3ZRFA 2MBBB 3DQVA 3HIZA 4DBGA 3MC8A 1KOTA 3EHVA 3NRZA 2MBHA 2DZIA 1Z2MA 4JX1C 2MJDA 2BYTA 2WDRB 1UELA 1A70A 2K8BA 3ECIA 1MHHE 4NY0A 4IC7B 2KVZA 4RMAA 3MHSD 3V61A 2KANA 4C00A 1NENB 2BVCA 5T8IA 1ZXIA 5CHVC 1NYRA 1ACCA 1WSPA 1ESFA 3NOBA 2ZCCA 3VTVA 1XD3B 2G9HD 2KK8A 4WQMA 4XX5A 3BVZA 3AV8A 3MJWA 1F2RC 1SEBD 1HTQA 3QAQA 3DBHI 4MJSA 1JMLA 2ONQA 3L4PA 3DPDA 3FC4A 1FD6A 2DAJA 2FE8A 1LM8B 5D3DA 3MHZA 1VCBA 3VH3B 3N1YC 2WQYB 1L0XB 3DOWA 4WIPA 5TSSA 1IYFA 4KX6B 1ET6A 2LXAA 4RH6A 3QJZA 1PGXA 2IYDB 3Q69A 4IKGA 3SHQA 2K22A 1JALA 2G4SA 2L05A 2BB5A 3Q8FA 4PYUA 3P2BA 1K53A 1UUPA 4KVGB 1V1OA 2KC2A 1C4AA 2HDEA 2JX5A 2MP2B 3ZUNA 3Q6BA 4YSYB 1P7FA 4IWOA 2CHXA 2K0PA 3ABVB 4TV3A 4KKJA 1SXTA 1UGJA 2R2QA 2MQJA 1TJEA 1C1YB 1ENFA 1Y8RC 4C56C 1TIFA 1R4NB 4MELA 2EKEC 2PPHA 1J7CA 1P7EA 5G2NA 3N32A 4K81A 3P4SB 2D07B 2KDBA 2MW5A 3EGRA 5JHAA 1S1QB 1E8ZA 3CSTA 1I4QA 1YN4A 5E6NA 4JQWC 4HK2A 4W9DA 1LQBA 4A3OA 3M95A 2LHEA 1AW7A 4HKQA 5TR5A 4GU2A 2K6QA 1TBEA 2J0KA 2KDIA 3I63C 1SE3A 3IG3A 3LJ3A 2V3SA 4EUTA 3ZNGC 2DENB 2CJNA 2N1WA 1JW9D 3CIRB 2ZVOA 1XLOA 3H7PB 2TSSA 3T9LA 2K9XA 3R2IA 2K1FA 4YSZB 1AARA 4AUQC 3PRZA 4YSXB 3WAMA 5EDSA 4OZAA 2E3TA 2JXXA 4IDIA 3APDA 3W1YA 4II2B 1TS2A 1YN5A 2DYOA 2PVGC 1C9FA 4ANWA 5IOIA 2KZRA 5C23A 4MGYE 2VZKD 4M00A 3RI7C 2KTFA 3VAWA 2BWFA 2K3UA 3PZ7A 1T6BX 4CHKA 1N62A 3ZRCA 3JSVA 1IBXA 2RGFA 4I6PA 4NJ6A 1MJDA 2K39A 4ZYSA 2UYZB 2NMQA 4EFOA 3QARA 2IJ0A 5IP4D 1E0ZA 3ZNID 2NBWB 5GXGB 1F9JA 4AJWA 1P1AA 2HTHA 3I5JC 2D10A 1HA5A 2KJ6A 1FRRA 4KZ0A 3Q14C 3PT2B 3Q3OC 3EA6A 4YXDB 2BTEA 2Y5PA 2PE9A 4WAAA 4W9IA 1EF5A 4WQOB 3I3TB 2Q5WD 4H2AA 4LTUA 2KHWB 1MFWA 1LXDA 2RPQA 4GDKB 1JRPA 1V9JA 3LDZE 3TEXA 2FCQA 4F7ZA 2BPSA 1WMHA 2ZZPB 2Z0EB 1E9MA 4ICVA 1L4DB 2DWQA 3L17A 1WYWB 3O65B 2PIAA 2KWDA 5FR6A 5HFYA 1TZOA 2M0XA 4TKNA 1ISNA 3T8MA 3OJ4B 3N1XC 5H92C 3VFKA 1N5WA 3UINB 1FXAA 5G5HA 2OEDA 1C76A 4ARIA 1WR6E 4ARCA 5J18A 3DBRB 3AI5A 4WJPA 2AL6A 2BW2A 1E5WA 2ACZB 1FPYA 1YN3A 3GE3C 2KC1A 3AU5A 2W55A 4YT0B 1FM0D 3VUWA 2LUEA 1KLUD 4LNIA 5AZHA 2N7JA 4XWWA 3DVNV 4WAFA 3TEZA 4MGKE 2ASQA 1L0YB 2N9LA 2KNBA 4HCPB 3L13A 1HXYD 2DAFA 3JSVB 3HUIA 5MPOA 1WX9A 3GOEA 2WXKA 1J19A 2L76A 2CHWA 3DHGC 2ZW0A 3QCAA 3NZUA 3ZDTA 3M63B 3A9KB 2MBQA 5D7GA 4EE2A 2LGYA 2MEKA 2K25A 4OVVA 2B3AA 3IAM1 2MH7A 1L6UA 1RWSA 3H9DA 4DHZE 4GDLA 3R7QA 4DHJD 1WX7A 4K3CA 1TS4A 3BK1A 4NPNA 1QOGA 2XN9C 3ZW3A 3A9KA 3M3JA 2RDHA 3R8BA 4FJYA 2MX2A 3WA0A 2KMAA 1C4PA 1YOVB 2O6VB 4GDKA 3IFWB 3ZXVA 3E56A 1UD7A 1WXAA 3PHXB 1CJEA 2AQ1B 2RPVA 1RM6C 1EUVB 3Q3JA 4BKTA 4A20A 1OEYA 1E90A 2IY0B 1Q5WB 4YL8A 5JXVA 2MWSB 1SJED 2NBVB 3B1LX 1WXVA 4IM3A 3HVZA 1OEYJ 5JHBA 2C7HA 4W9FA 3BVGA 3AE1B 1F0ZA 1Q0WB 3DWGC 3KW5B 2JSVX 2XK5A 1WGRA 4NJ7A 1N61A 3B0AA 4TQ0A 4M02A 3AEFB 1XCQL 1WGGA 1GC6A 1A5RA 1EU4A 2N9KA 4W9GA 3UF8A 4C7YA 1C3TA 4K7WA 3RULA 1VJKA 4OW0A 4ZRIA 3A4SC 2CHZA 1T0RC 4ZRQA 4PS8A 3Q8CA 2OHFA 4EZKA 3APCA 3ZYYX 4RF0A 2LRUA 3AEEB 2LRWA 1GG3A 1ZKHA 2BQQA 3UI3A 1C79A 4O1NA 2C60A 3MP9A 4KIKB 4BBNF 2NR2A 2HJ8A 1FIQA 2LMCA 2CJOA 1TTNA 2WLBA 2XNAC 1WXQA 4OZCA 2SAKA 2PJHA 1IUEA 1V6EA 1F52A 1M94A 4B0EA 3KUDB 1RAXA 2DYMA 3SU8X 1P3QU 2NS5A 4PS3A 2NVUI 2LHDA 1Y56A 4KZCA 2IGDA 1WF9A 3VTWA 1PGBA 1WJ4A 1FXIA 2M19A 1WIAA 3N3KB 2GBRA 4HPLB 3APFA 4IUMB 2Y3AA 1RRBA 1L7YA 5E6JA 3ZNZB 3PRMB 1JROA 1YMHE 4ZDVA 3J9CA 1WJUA 3H6NA 3A9JA 1JCKB 2LFIA 1KLGD 3ML8A 4KGTA 1STEA 3MTNB 3ZJTA 3A33B 2I1KA 3N30A 2I1JA 4AOFA 1R7SA 2MLBA 4HWIB 2NTSA 2N1VA 1E7VA 1WE7A 4JLCA 3PLVA 4B0MA 1JRUA 1MI0A 1YQ3B 5D6JB 1DOYA 3WANA 3ETRA 1WM3A 2M56B 1WFYA 2N7EA 2O6VD 1YJIA 3R2TA 1GOZA 2YVCA 2MP2A 4OVUA 2JYTA 2KJRA 5DPTA 3Q8EA 1KRHA 2IBIB 3RNCC 2VRRB 3DWMA 4IG7B 1DYQA 5EE3A 1F1HA 2QSDA 4HLEA 1WXMA 3AM9A 4XZ4A 4FA6A 2KDEB 1SE2A 2HJ1A 3QK0A 5JZEB 3OJ3A 2REXA 4L23A 3V62A 2KVRA 1UNSA 1OQQA 4G3XB 4A6QA 5G5GA 2VH2A 3DCGA 2GBKA 3Q3FA 4UDUC 2FIDA 2LWPA 3VUXA 3JVZX 2CR5A 1C78A 1PDXA 4LJOB 4I6LB 3NVWA 3KLSX 3ENEA 2N4FA 4M01A 4GLSC 1YD8U 3QIJA 3TL5A 4GOCA 2J7QB 4XDCA 2ZPNA 3BVMA 1TY0A 4RCOA 5BO4B 1FNWA 5C2TB 2BYVE 3Q8AA 3B2GA 1ZW7A 5BMHA 3IXSA 2Y5BB 4BFRA 2LGSA 1MG4A 4JPSA 4LLGM 3VH4B 3CF6E 4W9HA 4EOYA 1M4VA 1XQQA 3C19A 5BMGA 3VXWA 1UBIA 1HZ6A 1YJJA 3VRAB 4HVBA 4W9KA 1PUTA 4DWFA 3FILA 4DXFA 5DPWA 1IP9A 3PZDA 1CQVA 2V9HA 2MBEA 2BKFA 3HK0A 1Q10A 2D3AA 4M8MA 4HDOA 3UIOB 4FHJA 2AYOB 5FKAC 3P4RB 1Z5SB 3A9JB 4NQKE 4NAWB 2QHOA 4DQOC 2YLMA 1IBXB 4A9AA 3VUYA 2WYQA 4OHJA 3KH0A 3E9SA 1HTOA 1KTKA 1XT9B 3I9V1 2LVOA 4K3BA 1PYWD 1RFAA 4BZAA 3SR6A 1WGDA 2WXMA 4C4VB 4RNAA 3LYYA 1C4CA 3MC0B 4Q2JA 3BY4B 3PLUA 4XE0A 3TUOA 2DHZA 3WALA 1ZXHA 4US8A 2MJEA 3PZ8A 1N6ZA 2IGHA 3EFCA 4E3CA 3AB5A 5HG2A 1BUIC 2KD0A 4P16A 4BVUC 2EMSA 3RZWC 1DOIA 3ZNHB 1G6JA 3RYTA 4ZHPA 5D94A 2O2VA 5KHQA 3DVGX 4J6IA 1BMLC 2H89B 2IO3B 5J2RA 2Z8LA 3NZ3A 2KDMA 4YTPB 1SGHA 1UZXB 5DPRA 2KX0A 4EEWA 3URYA 3HM3A 1FCCC 3RMKC 4P1BC 4WURA 1OTRB 2J52A 2QILA 5AZFA 2A5UA 4X57B 3DBLB 3ZTDA 1VLBA 5HHDG 5AEKB 4LNOA 4ZHOA 2NPTB 2NTTA 5AUKA 2EMTA 4ANXA 1JWSD 4G11A 3EUB2 2M0AA 3TJPA 2L83A 3W1SA 3VRBB 2M8SA 4BKSA 1GB4A 1J0GA 3HVDA 4G50A 1CZPA 3NG0A 1SE4A 2KWVB 5I4DA 1NDDA 3SEBA 4PYZA 2L00B 1QOFA 2LGDA 1P98A 4EKUA 1WJNA 4AQ7A 3PS6A 1SIJA 4MH8A 1UH6A 2KQ4X 5J17A 5HKHA 1TY2A 2Z59B 4PT5A 3D32A 3AULA 1GNUA 1KH0A 2WXFA 4FULA 2QMTA 3NVZA 2CS4A 3AE2B 4LDTB 3SFEB 2X38A 3W1SC 2WXIA 4ANUA 3UGBB 4E74A 2WXOA 4WWOA 1JQ4A 2GBMA 3U8ZA 3X0WA 3ZQ4A 1TS3A 4BBNC 2RDGA 1GJZA 3GE8C 3NVVA 1J8CA 4W9JA 1ZUD2 4HCNB 5LNK1 1ZP0B 3L54A 5BYSA 3ZJUA 1NVID 1V81A 1T5XD 3RFZB 2V0GA 2MSED 1FFUA 4DDGD 4LNNA 2PLPA 3AE9B 3DHHC 2AQ2B 1VRAB 2WS3B 2JUOA 4KDIC 2I2YA 4HPMB 4OVZA 5FK9C 2QIEB 3ALBA 3BYYB 2YEPF 3AE8B 2W9NA 4IM0A 3W5VB 2MA9B 1ZPSA 2JZPA 1TYGB 1QQRA 1UBQA 3I57A 2JF5A 3LB8C 2L1AA 3PHWB 5AZGA 4HROA 2KFJA 2FIFA 2ZNVB 1TGZB 2QEJC 2KMMA 3DBSA 3K9OB 2D2QA 3AN1A 1FNVA 1F77A 3UQBA 3KYDD 3RNAC 1SJHD 2NPTA 1YNTE 3NUHB 2LXCA 2DZMA 1D5ZC 2G3QB 1E8WA 2IY1B 3H8HA 1WGYA 4GSWA 1WX8A 2FAZA 3VVWB 5FR3A 5GMVA 2KLCA 1IPGA 2AX5A 2LJ5A 4MEMA 2IO2B 1OFFA 4MACA 1QZEA 2L0FA 2DZKA 4DXAB 2INDC 3RN9C 5CHFA 4J3OD 2W54A 3BZDB 1WRIA 3ZKJC 4ANVA 2K6DB 3CSFA 2FUHB 2OJWA 4FN2A 3W2DA 3SD5A 4L1BA 3U2SC 1WRDB 1UWXA 2KLGA 2JZZA 3AECB 3AXCA 1YIWA 3KUCB 3PGEA 4EZJA 2C5LC 4A55A 1BXTA 3L16A 4RGTA 2WHIA 4W9CA 4MT5A 2IPKD 2DZJA 4D2KA 1MPEA 3OWEB 3TIXA 1ZDXA 2BYFA 3V3XA 3BWUD 3P63A 3TMPB 2EELA 1VZ7A 5EE9A 1SSNA 1T3QA 2BT6A 2GRIA 2V3PA 2KN5A 4S0RA 4CO7A 2V4LA 4RGOS 4HPPA 1L0VB 1WH3A 3QX1A 1TKYA 4TQ1A 5HI1A 2DBYA 1HQRD 2RSUA 4P7IA 2WX1A 4FJVB 5H8YE 4C7ZA 2M4NA 1Q1OA 1LFDA 3U7ZA 2J42A 4XYCA 2O6VA 4HKZE 5IA7A 4ZYNA 1SBBB 2PEAA 4US9A 2W3SA 4WJNA 4C80A 1VR9A 2DYBA 2LZ6A 2JYEA 4BOSC 2IO0B 4HEA1 2KQSA 1OQYA 4JL9A 2CU1A 3RUIB 2ZEQA 3P42A 2K8HA 4BKGA 2KXJA 2J0JA 1PFDA 1SE9A 2J4XA 1EWYC 2ZNVC 4E71A 2WXGA 1UF0A 5E6PA 2FBWB 3RNGC 3ZVVA 3IHPC 2KTRA 2WDVB 3KQ4A 3BINA 4LJPB 1EU3A 1VDVA 4K1RB 3Q2AC 1ZDVA 2FCSA 1UGMA 1TS5A 3EECA 2LGIA 1V86A 2JU6X 1T0YA 4MM3A 4F1SA 4WWNA 1KLVA 4RF1A 1GB1A 1X1MA 1JWAD 1T0QC 3NZSA 3T3NA 3TBLD 1WGKA 1VZ6A 3U4EG 4KGSA 1HE8A 1QOBA 2W82A 3FKYA 2WXQA 4YWGG 2RDBC 4TUUA 2D3CA 2JT4B 4ZRKA 1PQSA 4NNJB 3FILB 3DBRI 3GP7A 4WJQA 4LDTD 2RMMA 1E10A 4FBJB 2C7MB 4JWSC 1WMHB 3LXFA 1TKEA 1HZ5A 2PE6B 3ONSA 2MRPA 3R7RA 2V1YA 4DHZB 2LVPA 4TMAB 2L0TA 3ZIMA 1TZ1A 2UU7A 1H4RA 1DOXA 2KWCA 3NS8A 3C0RB 3AMZA 4N9F4 3PRPB 1ZGUB 2E6XA 3AE5B 4A3PA 2KDFB 2L3ZA 2BF8B 4ACFA 1XO3A 2PW9A 2ZPYA 3A1QB 1JWMD
chains in the Genus database with same CATH topology
2KMCA 1VD2A 2ZJDA 5J18A 1BT0A 3AI5A 3KYCD 4WJPA 5CX3A 3ZNHB 3RYTA 2AL6A 1G6JA 1V2YA 5D94A 2O2VA 4B6WA 5KHQA 3DVGX 1D3ZA 1E5WA 4J6IA 1I35A 2O2VB 2G45B 4GGQA 4W9EA 4WJOA 2IO3B 5J2RA 4GIVA 2KC1A 3U30A 3L10B 3AU5A 3KUZA 4DK5A 1FXTB 1SGHA 2KTRB 4FLHA 1UZXB 4HDQA 4IM2A 3VUWA 5DPRA 1L2NA 2RR9A 1K8RB 2KX0A 2LUEA 4I6NB 5AZHA 2JRHA 4IW0A 4EEWA 3HM3A 3DVNV 3H7PA 1OTRB 4MSQB 4ZRJA 2KX3A 5AZFA 2RD0A 2KWUB 2A5UA 2LASA 4X57B 3VHTC 4MGKE 2ASQA 2KFKA 3ZTDA 2KNBA 4HCPB 4MGIE 3L13A 1U4AA 1WXSA 4DHJB 5AEKB 2JVCA 2JWZA 2DAFA 2XK5B 3JSVB 1WZ0A 1WX9A 4CYEA 4ASWC 4FADA 3QC8B 3PVLA 2NPTB 3GOEA 2EMTA 4ANXA 2LVQA 4G11A 1J19A 4F8CB 2L76A 4XC2A 2CHWA 2A4ZA 3HHMA 2IO1B 3TJPA 3HM6X 3W1SA 3DDCB 2M8SA 4BKSA 1WI0A 1J0GA 3QCAA 2L7RA 3NZUA 4GMVA 1WY8A 3ZDTA 2BGFA 3M63B 4G50A 2N7DA 5E6OA 3A9KB 2WWZA 4MSMB 1WJ6A 3PREA 2MBQA 3WAOA 1R4MI 2KWVB 1GUAB 5D7GA 2KQ7A 2LGYA 1NDDA 4EZLA 4PYZA 2L00B 2K25A 4BOZB 4OVVA 2B3AA 3AU4A 2LGDA 3R66C 1P98A 4EKUA 3QWZB 3H9DA 2BWES 4DHZE 2JRIB 1WJNA 4GDLA 3R7QA 4DHJD 3WIMA 3PS6A 5LXIB 1WX7A 1UH6A 2M1MA 4NPNA 4FJZA 3ZW3A 2BYEA 1GC7A 5HKHA 5J17A 2Z59B 3A9KA 3M3JA 3RZWC 3D32A 5LLIA 3RT3B 4BKSD 2R2OA 3AULA 5D2MB 4FJYA 1GNUA 4FULA 1S3SG 1EF1A 2MX2A 2C7NB 2CS4A 2KMAA 3OAWA 3QQ8B 4LDTB 3WA0A 3DVGY 4MJSB 2DX5B 2O6VB 4GDKA 3IFWB 4LCDE 4HJKA 3QA8A 3W1SC 3VTUA 1UD7A 1WXAA 2WDTB 3PHXB 4ANUA 1R4NI 4JIOU 2UWQA 3UGBB 3S2AA 2FCNA 1E7UA 4E74A 1EUVB 3Q3JA 4NAWA 4WWOA 3K9PB 2GBMA 3U8ZA 3X0WA 4BKTA 2OJRA 4HXDA 4BBNC 5LXHA 1GJZA 4A20A 1OEYA 5CHWA 1J8CA 3EFUA 4MDKE 1E90A 4W9JA 2LD9A 3IVFA 4HCNB 2IY0B 3L54A 1Q5WB 4YL8A 1WE6A 1V81A 2MWSB 2NBVB 1P9DU 3H1UA 2Z0DB 3B1LX 5L83A 4M0WB 1WXVA 3ZRFA 2MSED 2MBBB 4IM3A 3DQVA 3HIZA 4DDGD 4DBGA 2ZCBA 1KOTA 1OEYJ 5JHBA 2C7HA 3EHVA 4AWJA 4KDIC 2JUOA 2MBHA 4W9FA 2DZIA 1Z2MA 4HPMB 1Q0WB 1OGWA 3KW5B 1UELA 2XK5A 3M62B 3ALBA 2J0MA 2K8BA 3ECIA 1V80A 1WGRA 2MCNB 4NJ7A 3B0AA 4TQ0A 2W9NA 1YJ1A 4NY0A 4JGHB 4IM0A 4IC7B 1WGGA 1GC6A 2MA9B 1A5RA 4RMAA 3MHSD 2KOXA 3V61A 2AL3A 4W9GA 3UF8A 1C3TA 4K7WA 3RULA 4AJYB 1I42A 2KANA 5JH5C 5CTRC 4ZRIA 3A4SC 4KDLB 5CHVC 2CHZA 1UBQA 4PS8A 2JF5A 4RM9A 4EZKA 3APCA 3X23A 2WX0A 4K7UA 2LRUA 2LRWA 1GG3A 3PHWB 3NOBA 2ZCCA 1ZKHA 2KFKB 5AZGA 3VTVA 1XD3B 2XBBC 3ML9A 2KFJA 2FIFA 2ZNVB 1TGZB 3K9OB 3DBSA 2KK8A 2M17A 2C60A 2D2QA 2OOBB 3UIPB 3UQBA 4KIKB 3KYDD 4IWPA 4BBNF 2NPTA 2NR2A 3A4RA 3KVFB 4XX5A 2HJ8A 3DVNU 3MJWA 1TTNA 2LXCA 2DZMA 2G3QB 3DBHI 3QAQA 4MJSA 3SDLC 3DPDA 3DBLI 1E8WA 2IY1B 2PJHA 2DAJA 1V6EA 1WGYA 4GSWA 1LM8B 1WX8A 2FAZA 1M94A 1VCBA 3L0WB 3VH3B 3KUDB 3VVWB 1RAXA 5GMVA 2DYMA 2KLCA 3SU8X 2MBOA 1IPGA 1P3QU 2LJ5A 4MEMA 2NS5A 4PS3A 3DOWA 4W9LA 2IO2B 1IYFA 1E8XA 2NVUI 1QZEA 2L0FA 2D3GA 2DZKA 4DXAB 4KZCA 2LXAA 5CHFA 3QJZA 1WF9A 3VTWA 1CMXB 5DPSA 4FHKA 1WJ4A 2IYDB 3ZKJC 4ANVA 3OLMD 1WIAA 3CMMB 2K6DB 3CSFA 2GBRA 3N3KB 4GN1A 3APFA 4HPLB 2FUHB 2GOWA 3SHQA 4FN2A 4IUMB 2GBNA 2G4SA 3SD5A 2L05A 1WRDB 4PYUA 1RRBA 3P2BA 2KLGA 1L7YA 2JZZA 3AXCA 3ZNZB 4KVGB 4NQLB 3PRMB 1YIWA 2KC2A 2KO3A 4AP4C 3KUCB 2MP2B 3H7SA 3ZUNA 4ZDVA 3PGEA 1NI2A 4EZJA 1SIFA 1WJUA 2C5LC 3H6NA 4IWOA 2N9XA 2CHXA 3JYUA 3A9JA 4TV3A 1H8CA 3L16A 3ML8A 3ZTCA 4M8NA 2R2QA 2KJHB 5C1ZA 3MTNB 1WZ3A 2MQJA 1C1YB 1Y8RC 3A33B 4W9CA 2I1KA 3N30A 1YX6B 2I1JA 4MELA 2DZJA 2EKEC 2PPHA 4AOFA 3UQAA 2IZVB 2MLBA 4HWIB 5KHOA 5G55A 5G2NA 2N1VA 3N32A 1E7VA 1WM2A 1WE7A 4JLCA 4K81A 5DCNA 3TIXA 3PLVA 2D07B 1JRUA 2KDBA 2BYFA 2MW5A 5D6JB 5JHAA 3WANA 1S1QB 1WM3A 3RZFA 1E8ZA 1WFYA 2N7EA 3TMPB 2O6VD 3CSTA 2JPHA 5E6NA 4JQWC 2KN5A 2YVCA 4HK2A 4W9DA 3ZDMC 2CKHB 1LQBA 2MP2A 4OVUA 4CO7A 3B08A 4A3OA 2HD5B 4ICUA 2KJRA 2V4LA 5DPTA 3M95A 2IBIB 2VRRB 4IG7B 4II3B 1WH3A 3QX1A 4HLEA 4TQ1A 1WXMA 5TR5A 4GU2A 2K6QA 1TBEA 2J0KA 2KDIA 3JW0X 3V6EB 4XZ4A 4FA6A 2KDEB 2RSUA 3IG3A 4P7IA 3LJ3A 2V3SA 4EUTA 2FCMA 2WX1A 2NBUA 4FJVB 3ZNGC 4B95A 4PS7A 3QK0A 5JZEB 2M4NA 3OJ3A 2REXA 1Q1OA 1LFDA 3V62A 2DENB 2KVRA 2N1WA 4G3XB 2O6VA 2ZVOA 3H7PB 2AEHA 3DCGA 2GBKA 3Q3FA 5IA7A 2ZVNA 4ZYNA 2PEAA 2FIDA 2K8CA 2LWPA 3T9LA 3VUXA 3R3MA 1EO6A 2FNJB 3JVZX 4MH0E 4WJNA 1MG8A 1KJTA 2CR5A 2N9PC 3WAPA 1YQBA 4GDLB 2DYBA 3PV1A 4LJOB 2K1FA 4I6LB 2LZ6A 3VQIA 3ENEA 2N4FA 1AARA 4AUQC 4BOSC 3PRZA 1YD8U 2IO0B 3QIJA 3WAMA 5EDSA 3TL5A 2JXXA 2KQSA 1OQYA 4GOCA 3APDA 4JL9A 2CU1A 3W1YA 2J7QB 3RUIB 2ZPNA 2ZEQA 4II2B 1V49A 2DYOA 3IBEA 2K8HA 2HE7A 4ANWA 4BKGA 2KXJA 5BO4B 2BYVE 4KSKC 2J0JA 2KZRA 5C23A 4MGYE 1ZW7A 3ZLZA 3PTFC 2NCNA 1SE9A 2KTFA 2Y5BB 3TCAA 3V60A 3VAWA 4BFRA 3VH4B 2BWFA 4KIKA 2ZNVC 4E71A 3CF6E 4W9HA 4KSLC 4CHKA 3U7DA 4EOYA 4B9KA 3ZRCA 3JSVA 2RGFA 2LGXA 1XQQA 5E6PA 3VXWA 1UBIA 2KKCA 3NHEB 2JZ3B 2LI5A 4I6PA 3ZVVA 4NJ6A 4HVBA 4W9KA 1P0RA 3IHPC 4MGZE 3ZO5B 2K39A 2KTRA 1KM7A 4DDID 3BINA 2UYZB 2XEWA 4DWFA 4IWQA 4EFOA 4GXBA 3QARA 5DPWA 1IP9A 3PZDA 3EC8A 3ZNID 2NBWB 4LJPB 2MBEA 4K1RB 2BKFA 3HK0A 3A1QA 1V5OA 1F9JA 3NY5A 4AJWA 4M8MA 2FCSA 1UGMA 1P1AA 2HTHA 4HDOA 2D10A 3EECA 3UIOB 4FHJA 1E8YA 1V86A 2AYOB 1T0YA 2KJ6A 2GBJA 4MM3A 1Z5SB 4KZ0A 3PT2B 2N9EB 3A9JB 3L08A 4F1SA 4RM8A 4WWNA 1KLVA 1X1MA 3PSEB 4NQKE 4NAWB 3NZSA 2QHOA 2YLMA 1WR1A 1V5TA 2PE9A 4WAAA 3TBLD 4W9IA 1EF5A 4WQOB 3RCZA 3RD2A 3VUYA 2WYQA 3GZNI 3I3TB 2GMIC 3KH0A 1HE8A 3V6CB 4TUUA 3QHTA 1XT9B 1WGHA 2JT4B 4G0NB 4KV2A 4ZRKA 2KHWB 1PQSA 2LVOA 4NNJB 1LXDA 2RPQA 3DBRI 4GDKB 1V9JA 1RFAA 4LDTD 3LDZE 4WJQA 2FCQA 4FBJB 4F7ZA 1WGDA 2BPSA 2C7MB 1WMHA 1YX5B 4URKA 2ZZPB 2Z0EB 1WMHB 2AWTA 2JY6A 2C9WB 3ONSA 2PE6B 2MRPA 3BY4B 3PLUA 4ICVA 3R7RA 2V1YA 4DHZB 2LVPA 2L0TA 3L17A 5IAAC 3ZIMA 1WYWB 1TZ1A 2DHZA 3O65B 5FR6A 1H4RA 3WALA 2KWCA 3NS8A 3PPAA 5L95C 2M0XA 3C0RB 2D11A 4WWPA 1ISNA 3PRPB 4N9F4 4TKNA 1ZGUB 3T8MA 3OJ4B 4E3CA 4A3PA 2BKRB 2KDFB 1NBFC 2L3ZA 2BF8B 4GB9A 4K7SA 3VFKA 2L8JA 3UINB 3VDZA 2KD0A 2G4DB 4BVUC 2EMSA 2ZPYA 3A1QB 1RLFA 1WR6E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KMC A;  1VD2 A;  2ZJD A;  5J18 A;  1BT0 A;  3AI5 A;  3KYC D;  4WJP A;  5CX3 A;  3ZNH B;  3RYT A;  2AL6 A;  1G6J A;  1V2Y A;  5D94 A;  2O2V A;  4B6W A;  5KHQ A;  3DVG X;  1D3Z A;  1E5W A;  4J6I A;  1I35 A;  2O2V B;  2G45 B;  4GGQ A;  4W9E A;  4WJO A;  2IO3 B;  5J2R A;  4GIV A;  2KC1 A;  3U30 A;  3L10 B;  3AU5 A;  3KUZ A;  4DK5 A;  1FXT B;  1SGH A;  2KTR B;  4FLH A;  1UZX B;  4HDQ A;  4IM2 A;  3VUW A;  5DPR A;  1L2N A;  2RR9 A;  1K8R B;  2KX0 A;  2LUE A;  4I6N B;  5AZH A;  2JRH A;  4IW0 A;  4EEW A;  3HM3 A;  3DVN V;  3H7P A;  1OTR B;  4MSQ B;  4ZRJ A;  2KX3 A;  5AZF A;  2RD0 A;  2KWU B;  2A5U A;  2LAS A;  4X57 B;  3VHT C;  4MGK E;  2ASQ A;  2KFK A;  3ZTD A;  2KNB A;  4HCP B;  4MGI E;  3L13 A;  1U4A A;  1WXS A;  4DHJ B;  5AEK B;  2JVC A;  2JWZ A;  2DAF A;  2XK5 B;  3JSV B;  1WZ0 A;  1WX9 A;  4CYE A;  4ASW C;  4FAD A;  3QC8 B;  3PVL A;  2NPT B;  3GOE A;  2EMT A;  4ANX A;  2LVQ A;  4G11 A;  1J19 A;  4F8C B;  2L76 A;  4XC2 A;  2CHW A;  2A4Z A;  3HHM A;  2IO1 B;  3TJP A;  3HM6 X;  3W1S A;  3DDC B;  2M8S A;  4BKS A;  1WI0 A;  1J0G A;  3QCA A;  2L7R A;  3NZU A;  4GMV A;  1WY8 A;  3ZDT A;  2BGF A;  3M63 B;  4G50 A;  2N7D A;  5E6O A;  3A9K B;  2WWZ A;  4MSM B;  1WJ6 A;  3PRE A;  2MBQ A;  3WAO A;  1R4M I;  2KWV B;  1GUA B;  5D7G A;  2KQ7 A;  2LGY A;  1NDD A;  4EZL A;  4PYZ A;  2L00 B;  2K25 A;  4BOZ B;  4OVV A;  2B3A A;  3AU4 A;  2LGD A;  3R66 C;  1P98 A;  4EKU A;  3QWZ B;  3H9D A;  2BWE S;  4DHZ E;  2JRI B;  1WJN A;  4GDL A;  3R7Q A;  4DHJ D;  3WIM A;  3PS6 A;  5LXI B;  1WX7 A;  1UH6 A;  2M1M A;  4NPN A;  4FJZ A;  3ZW3 A;  2BYE A;  1GC7 A;  5HKH A;  5J17 A;  2Z59 B;  3A9K A;  3M3J A;  3RZW C;  3D32 A;  5LLI A;  3RT3 B;  4BKS D;  2R2O A;  3AUL A;  5D2M B;  4FJY A;  1GNU A;  4FUL A;  1S3S G;  1EF1 A;  2MX2 A;  2C7N B;  2CS4 A;  2KMA A;  3OAW A;  3QQ8 B;  4LDT B;  3WA0 A;  3DVG Y;  4MJS B;  2DX5 B;  2O6V B;  4GDK A;  3IFW B;  4LCD E;  4HJK A;  3QA8 A;  3W1S C;  3VTU A;  1UD7 A;  1WXA A;  2WDT B;  3PHX B;  4ANU A;  1R4N I;  4JIO U;  2UWQ A;  3UGB B;  3S2A A;  2FCN A;  1E7U A;  4E74 A;  1EUV B;  3Q3J A;  4NAW A;  4WWO A;  3K9P B;  2GBM A;  3U8Z A;  3X0W A;  4BKT A;  2OJR A;  4HXD A;  4BBN C;  5LXH A;  1GJZ A;  4A20 A;  1OEY A;  5CHW A;  1J8C A;  3EFU A;  4MDK E;  1E90 A;  4W9J A;  2LD9 A;  3IVF A;  4HCN B;  2IY0 B;  3L54 A;  1Q5W B;  4YL8 A;  1WE6 A;  1V81 A;  2MWS B;  2NBV B;  1P9D U;  3H1U A;  2Z0D B;  3B1L X;  5L83 A;  4M0W B;  1WXV A;  3ZRF A;  2MSE D;  2MBB B;  4IM3 A;  3DQV A;  3HIZ A;  4DDG D;  4DBG A;  2ZCB A;  1KOT A;  1OEY J;  5JHB A;  2C7H A;  3EHV A;  4AWJ A;  4KDI C;  2JUO A;  2MBH A;  4W9F A;  2DZI A;  1Z2M A;  4HPM B;  1Q0W B;  1OGW A;  3KW5 B;  1UEL A;  2XK5 A;  3M62 B;  3ALB A;  2J0M A;  2K8B A;  3ECI A;  1V80 A;  1WGR A;  2MCN B;  4NJ7 A;  3B0A A;  4TQ0 A;  2W9N A;  1YJ1 A;  4NY0 A;  4JGH B;  4IM0 A;  4IC7 B;  1WGG A;  1GC6 A;  2MA9 B;  1A5R A;  4RMA A;  3MHS D;  2KOX A;  3V61 A;  2AL3 A;  4W9G A;  3UF8 A;  1C3T A;  4K7W A;  3RUL A;  4AJY B;  1I42 A;  2KAN A;  5JH5 C;  5CTR C;  4ZRI A;  3A4S C;  4KDL B;  5CHV C;  2CHZ A;  1UBQ A;  4PS8 A;  2JF5 A;  4RM9 A;  4EZK A;  3APC A;  3X23 A;  2WX0 A;  4K7U A;  2LRU A;  2LRW A;  1GG3 A;  3PHW B;  3NOB A;  2ZCC A;  1ZKH A;  2KFK B;  5AZG A;  3VTV A;  1XD3 B;  2XBB C;  3ML9 A;  2KFJ A;  2FIF A;  2ZNV B;  1TGZ B;  3K9O B;  3DBS A;  2KK8 A;  2M17 A;  2C60 A;  2D2Q A;  2OOB B;  3UIP B;  3UQB A;  4KIK B;  3KYD D;  4IWP A;  4BBN F;  2NPT A;  2NR2 A;  3A4R A;  3KVF B;  4XX5 A;  2HJ8 A;  3DVN U;  3MJW A;  1TTN A;  2LXC A;  2DZM A;  2G3Q B;  3DBH I;  3QAQ A;  4MJS A;  3SDL C;  3DPD A;  3DBL I;  1E8W A;  2IY1 B;  2PJH A;  2DAJ A;  1V6E A;  1WGY A;  4GSW A;  1LM8 B;  1WX8 A;  2FAZ A;  1M94 A;  1VCB A;  3L0W B;  3VH3 B;  3KUD B;  3VVW B;  1RAX A;  5GMV A;  2DYM A;  2KLC A;  3SU8 X;  2MBO A;  1IPG A;  1P3Q U;  2LJ5 A;  4MEM A;  2NS5 A;  4PS3 A;  3DOW A;  4W9L A;  2IO2 B;  1IYF A;  1E8X A;  2NVU I;  1QZE A;  2L0F A;  2D3G A;  2DZK A;  4DXA B;  4KZC A;  2LXA A;  5CHF A;  3QJZ A;  1WF9 A;  3VTW A;  1CMX B;  5DPS A;  4FHK A;  1WJ4 A;  2IYD B;  3ZKJ C;  4ANV A;  3OLM D;  1WIA A;  3CMM B;  2K6D B;  3CSF A;  2GBR A;  3N3K B;  4GN1 A;  3APF A;  4HPL B;  2FUH B;  2GOW A;  3SHQ A;  4FN2 A;  4IUM B;  2GBN A;  2G4S A;  3SD5 A;  2L05 A;  1WRD B;  4PYU A;  1RRB A;  3P2B A;  2KLG A;  1L7Y A;  2JZZ A;  3AXC A;  3ZNZ B;  4KVG B;  4NQL B;  3PRM B;  1YIW A;  2KC2 A;  2KO3 A;  4AP4 C;  3KUC B;  2MP2 B;  3H7S A;  3ZUN A;  4ZDV A;  3PGE A;  1NI2 A;  4EZJ A;  1SIF A;  1WJU A;  2C5L C;  3H6N A;  4IWO A;  2N9X A;  2CHX A;  3JYU A;  3A9J A;  4TV3 A;  1H8C A;  3L16 A;  3ML8 A;  3ZTC A;  4M8N A;  2R2Q A;  2KJH B;  5C1Z A;  3MTN B;  1WZ3 A;  2MQJ A;  1C1Y B;  1Y8R C;  3A33 B;  4W9C A;  2I1K A;  3N30 A;  1YX6 B;  2I1J A;  4MEL A;  2DZJ A;  2EKE C;  2PPH A;  4AOF A;  3UQA A;  2IZV B;  2MLB A;  4HWI B;  5KHO A;  5G55 A;  5G2N A;  2N1V A;  3N32 A;  1E7V A;  1WM2 A;  1WE7 A;  4JLC A;  4K81 A;  5DCN A;  3TIX A;  3PLV A;  2D07 B;  1JRU A;  2KDB A;  2BYF A;  2MW5 A;  5D6J B;  5JHA A;  3WAN A;  1S1Q B;  1WM3 A;  3RZF A;  1E8Z A;  1WFY A;  2N7E A;  3TMP B;  2O6V D;  3CST A;  2JPH A;  5E6N A;  4JQW C;  2KN5 A;  2YVC A;  4HK2 A;  4W9D A;  3ZDM C;  2CKH B;  1LQB A;  2MP2 A;  4OVU A;  4CO7 A;  3B08 A;  4A3O A;  2HD5 B;  4ICU A;  2KJR A;  2V4L A;  5DPT A;  3M95 A;  2IBI B;  2VRR B;  4IG7 B;  4II3 B;  1WH3 A;  3QX1 A;  4HLE A;  4TQ1 A;  1WXM A;  5TR5 A;  4GU2 A;  2K6Q A;  1TBE A;  2J0K A;  2KDI A;  3JW0 X;  3V6E B;  4XZ4 A;  4FA6 A;  2KDE B;  2RSU A;  3IG3 A;  4P7I A;  3LJ3 A;  2V3S A;  4EUT A;  2FCM A;  2WX1 A;  2NBU A;  4FJV B;  3ZNG C;  4B95 A;  4PS7 A;  3QK0 A;  5JZE B;  2M4N A;  3OJ3 A;  2REX A;  1Q1O A;  1LFD A;  3V62 A;  2DEN B;  2KVR A;  2N1W A;  4G3X B;  2O6V A;  2ZVO A;  3H7P B;  2AEH A;  3DCG A;  2GBK A;  3Q3F A;  5IA7 A;  2ZVN A;  4ZYN A;  2PEA A;  2FID A;  2K8C A;  2LWP A;  3T9L A;  3VUX A;  3R3M A;  1EO6 A;  2FNJ B;  3JVZ X;  4MH0 E;  4WJN A;  1MG8 A;  1KJT A;  2CR5 A;  2N9P C;  3WAP A;  1YQB A;  4GDL B;  2DYB A;  3PV1 A;  4LJO B;  2K1F A;  4I6L B;  2LZ6 A;  3VQI A;  3ENE A;  2N4F A;  1AAR A;  4AUQ C;  4BOS C;  3PRZ A;  1YD8 U;  2IO0 B;  3QIJ A;  3WAM A;  5EDS A;  3TL5 A;  2JXX A;  2KQS A;  1OQY A;  4GOC A;  3APD A;  4JL9 A;  2CU1 A;  3W1Y A;  2J7Q B;  3RUI B;  2ZPN A;  2ZEQ A;  4II2 B;  1V49 A;  2DYO A;  3IBE A;  2K8H A;  2HE7 A;  4ANW A;  4BKG A;  2KXJ A;  5BO4 B;  2BYV E;  4KSK C;  2J0J A;  2KZR A;  5C23 A;  4MGY E;  1ZW7 A;  3ZLZ A;  3PTF C;  2NCN A;  1SE9 A;  2KTF A;  2Y5B B;  3TCA A;  3V60 A;  3VAW A;  4BFR A;  3VH4 B;  2BWF A;  4KIK A;  2ZNV C;  4E71 A;  3CF6 E;  4W9H A;  4KSL C;  4CHK A;  3U7D A;  4EOY A;  4B9K A;  3ZRC A;  3JSV A;  2RGF A;  2LGX A;  1XQQ A;  5E6P A;  3VXW A;  1UBI A;  2KKC A;  3NHE B;  2JZ3 B;  2LI5 A;  4I6P A;  3ZVV A;  4NJ6 A;  4HVB A;  4W9K A;  1P0R A;  3IHP C;  4MGZ E;  3ZO5 B;  2K39 A;  2KTR A;  1KM7 A;  4DDI D;  3BIN A;  2UYZ B;  2XEW A;  4DWF A;  4IWQ A;  4EFO A;  4GXB A;  3QAR A;  5DPW A;  1IP9 A;  3PZD A;  3EC8 A;  3ZNI D;  2NBW B;  4LJP B;  2MBE A;  4K1R B;  2BKF A;  3HK0 A;  3A1Q A;  1V5O A;  1F9J A;  3NY5 A;  4AJW A;  4M8M A;  2FCS A;  1UGM A;  1P1A A;  2HTH A;  4HDO A;  2D10 A;  3EEC A;  3UIO B;  4FHJ A;  1E8Y A;  1V86 A;  2AYO B;  1T0Y A;  2KJ6 A;  2GBJ A;  4MM3 A;  1Z5S B;  4KZ0 A;  3PT2 B;  2N9E B;  3A9J B;  3L08 A;  4F1S A;  4RM8 A;  4WWN A;  1KLV A;  1X1M A;  3PSE B;  4NQK E;  4NAW B;  3NZS A;  2QHO A;  2YLM A;  1WR1 A;  1V5T A;  2PE9 A;  4WAA A;  3TBL D;  4W9I A;  1EF5 A;  4WQO B;  3RCZ A;  3RD2 A;  3VUY A;  2WYQ A;  3GZN I;  3I3T B;  2GMI C;  3KH0 A;  1HE8 A;  3V6C B;  4TUU A;  3QHT A;  1XT9 B;  1WGH A;  2JT4 B;  4G0N B;  4KV2 A;  4ZRK A;  2KHW B;  1PQS A;  2LVO A;  4NNJ B;  1LXD A;  2RPQ A;  3DBR I;  4GDK B;  1V9J A;  1RFA A;  4LDT D;  3LDZ E;  4WJQ A;  2FCQ A;  4FBJ B;  4F7Z A;  1WGD A;  2BPS A;  2C7M B;  1WMH A;  1YX5 B;  4URK A;  2ZZP B;  2Z0E B;  1WMH B;  2AWT A;  2JY6 A;  2C9W B;  3ONS A;  2PE6 B;  2MRP A;  3BY4 B;  3PLU A;  4ICV A;  3R7R A;  2V1Y A;  4DHZ B;  2LVP A;  2L0T A;  3L17 A;  5IAA C;  3ZIM A;  1WYW B;  1TZ1 A;  2DHZ A;  3O65 B;  5FR6 A;  1H4R A;  3WAL A;  2KWC A;  3NS8 A;  3PPA A;  5L95 C;  2M0X A;  3C0R B;  2D11 A;  4WWP A;  1ISN A;  3PRP B;  4N9F 4;  4TKN A;  1ZGU B;  3T8M A;  3OJ4 B;  4E3C A;  4A3P A;  2BKR B;  2KDF B;  1NBF C;  2L3Z A;  2BF8 B;  4GB9 A;  4K7S A;  3VFK A;  2L8J A;  3UIN B;  3VDZ A;  2KD0 A;  2G4D B;  4BVU C;  2EMS A;  2ZPY A;  3A1Q B;  1RLF A;  1WR6 E; 
#chains in the Genus database with same CATH topology
 2KMC A;  2ZJD A;  1BT0 A;  3KYC D;  5CX3 A;  3Q3N C;  4ITK A;  5EE0 A;  4YTM B;  3NVY A;  1D3Z A;  3NS1 A;  1I35 A;  4JE3 B;  3L10 B;  1D5M C;  1FXT B;  3AEA B;  4LNF A;  4HDQ A;  2RR9 A;  3P4P B;  1C77 A;  3AE6 B;  2QC8 A;  3GB1 A;  1FEH A;  3H7P A;  2RD0 A;  2LAS A;  3VHT C;  2WP9 B;  2KFK A;  1NI3 A;  1ZOY B;  1U4A A;  2AQ3 B;  4R3D A;  2JWZ A;  1WZ0 A;  4CYE A;  4ASW C;  4FAD A;  1VZ8 A;  4ZRP A;  4AS1 A;  3MFG A;  4F8C B;  4XC2 A;  3HHM A;  2IO1 B;  3HM6 X;  2BBC A;  4ZOH C;  2L7R A;  2KYW A;  2BGF A;  5E6O A;  2WWZ A;  3PRE A;  2V4I B;  1GUA B;  2KQ7 A;  3MJ5 A;  2WXR A;  4BOZ B;  3AU4 A;  1I4X A;  3R66 C;  3QWZ B;  2JRI B;  4TSS A;  1FFV A;  2INP E;  2PKO A;  1JWU D;  3O13 A;  5LXI B;  4XWT A;  1FCL A;  1EWC A;  5LLI A;  3RT3 B;  4BKS D;  1B9R A;  1S3S G;  1EF1 A;  3RNF C;  5IKC M;  2C7N B;  3OAW A;  3QQ8 B;  4NJC A;  4LNK A;  4MJS B;  4LCD E;  4HJK A;  3VTU A;  1K52 A;  2GLS A;  2WXJ A;  3RNE C;  2WDT B;  3KWV A;  3AE3 B;  4JIO U;  3S2A A;  1E7U A;  3K9P B;  2OJR A;  4HXD A;  1TT5 B;  1RFK A;  1V1P B;  2EKI A;  3FAH A;  2BS2 B;  3IVF A;  3ZXR A;  2GI9 A;  2KN4 A;  3SFD B;  2R61 A;  4L2Y A;  3N9Y C;  1XLN A;  2WXN A;  1V8C A;  2MJ3 A;  2ZCB A;  2JQR B;  3DHI C;  2YEP B;  4AWJ A;  1QKZ A;  1XEE A;  4P6V F;  1OGW A;  4REZ A;  3M62 B;  2J0M A;  1V1P A;  1V80 A;  3B2F A;  2MCN B;  1YJ1 A;  4JGH B;  1R4M B;  1XF5 L;  5C3J B;  2KT7 A;  4USA A;  2KOX A;  2AL3 A;  1T0S C;  1ET9 A;  4AJY B;  1I42 A;  3ZJV A;  5JH5 C;  5CTR C;  1EM7 A;  4KDL B;  1XCT L;  4RM9 A;  1N63 A;  4HRS A;  3X23 A;  2DNF A;  4P1C C;  2WX0 A;  4K7U A;  2SEB D;  1YQ4 B;  4CQN A;  2KFK B;  2QJL A;  2XBB C;  3ML9 A;  3AE4 B;  2ICI A;  2M17 A;  1J7A A;  1OQR A;  3V05 A;  2OOB B;  3UIP B;  4HJG E;  4IWP A;  1UWM A;  4LK0 M;  3A4R A;  3KVF B;  2DLB A;  3DVN U;  2H88 B;  3SDL C;  1L4Z B;  4QAY A;  3DBL I;  1XLQ A;  2MHJ A;  1MHX A;  2J53 A;  1I7H A;  2ZW1 A;  3L0W B;  1N60 A;  3AED B;  2LEK A;  2MBO A;  3BK2 A;  2INC C;  4W9L A;  1ROE A;  3IAS 1;  1E8X A;  2D3G A;  3B9J A;  1CMX B;  5DPS A;  3HRD D;  4FHK A;  2L52 A;  4RGN A;  3OLM D;  2K5P A;  3CMM B;  4GN1 A;  2GOW A;  2GBN A;  1L6V A;  1TKG A;  1I4R A;  2IGG A;  4NQL B;  2KO3 A;  4AP4 C;  3H7S A;  1NYQ A;  1NI2 A;  2VH1 A;  1SIF A;  3W5U B;  2N9X A;  3JYU A;  1H8C A;  5AUI A;  3ZTC A;  4M8N A;  3ZGZ A;  2KJH B;  5C1Z A;  1WZ3 A;  1D5X C;  1QLB B;  1NEK B;  4FXC A;  1ZE3 D;  1YX6 B;  5EE1 A;  3UQA A;  2IZV B;  5KHO A;  5G55 A;  1WM2 A;  5DCN A;  1FRD A;  3BII D;  3RNB C;  3RZF A;  4N59 A;  1KFY B;  2JPH A;  3GZN B;  3MC9 A;  2IDY A;  1AYF A;  3DBH B;  3ZDM C;  1E7P B;  2CKH B;  2PTL A;  1IGD A;  3B08 A;  2HD5 B;  4ICU A;  4KKI A;  2FUG 1;  1MVK A;  4II3 B;  3TEY A;  2X8X X;  2INN E;  3V6E B;  3JW0 X;  2FCM A;  2NBU A;  1FMA D;  4B95 A;  4PS7 A;  2KAJ A;  2B76 B;  1I4H A;  3Q3M C;  2AEH A;  2ZVN A;  2K8C A;  3R3M A;  1EO6 A;  2FNJ B;  4MH0 E;  1MG8 A;  1KJT A;  2N9P C;  5IO9 A;  3WAP A;  1YQB A;  4OZB A;  4GDL B;  2HTM E;  3PV1 A;  1JWB D;  3VQI A;  1SF0 A;  2WGS A;  3BYT B;  2V3N A;  1L5P A;  1V49 A;  2PVO D;  3IBE A;  2HE7 A;  4KSK C;  4A90 A;  3ZLZ A;  3PTF C;  1D4B A;  2NCN A;  2N0S B;  3V60 A;  3TCA A;  4RGM A;  1QF6 A;  4KIK A;  3TSS A;  1I4P A;  3IT6 B;  4KSL C;  3U7D A;  3C8Y A;  4B9K A;  1LGR A;  2W3R A;  1KF6 B;  2LGX A;  2KKC A;  3NHE B;  4NAM A;  2JZ3 B;  2BB6 A;  2LI5 A;  2WDQ B;  1P0R A;  4MGZ E;  3ZO5 B;  4KGR A;  1XXG A;  1KM7 A;  2L32 A;  4DDI D;  1GAQ B;  2XEW A;  4IWQ A;  4GXB A;  2QDF A;  3EC8 A;  1QIL A;  2LJI A;  4N6E B;  3A1Q A;  1V5O A;  3NY5 A;  1QOA A;  4JWU C;  1K51 A;  1E8Y A;  2BS3 B;  2GBJ A;  4RFB A;  2N9E B;  3L08 A;  4RM8 A;  2BS4 B;  2D3B A;  3OG5 A;  3PSE B;  1GPX A;  4A8X C;  1WR1 A;  1V5T A;  2WXH A;  3RD2 A;  3RCZ A;  3NJT A;  1WYG A;  3GZN I;  2GMI C;  3V6C B;  3QHT A;  1WGH A;  1PGA A;  3PO0 A;  4G0N B;  4KV2 A;  3VR8 B;  3CWI A;  4C4V A;  4URK A;  1F2R I;  1YX5 B;  1LO5 D;  2G1E A;  2AWT A;  2JY6 A;  3P1M A;  2C9W B;  5D3I B;  3IT4 B;  5IAA C;  4MM3 B;  2WXL A;  3PPA A;  5L95 C;  1CK1 A;  2D11 A;  4WWP A;  1D6E C;  2BKR B;  1B1Z A;  1NBF C;  3AE7 B;  4GB9 A;  4K7S A;  2L8J A;  3VDZ A;  2G4D B;  3AH7 A;  2JXT A;  1RLF A;  1VD2 A;  3N20 C;  3VR9 B;  1V2Y A;  4BAX A;  4WWM A;  4B6W A;  2LUM A;  2O2V B;  2G45 B;  2WXP A;  4GGQ A;  4W9E A;  4WJO A;  4GIV A;  3U30 A;  3KUZ A;  4DK5 A;  2KTR B;  4FLH A;  1HEZ E;  2Y5C A;  4IM2 A;  2VZK B;  4XGA B;  1L2N A;  2QCZ A;  1K8R B;  4I6N B;  4IOI E;  2JRH A;  4IW0 A;  3RPF C;  4MSQ B;  4ZRJ A;  2KX3 A;  2KWU B;  1I4G A;  1FO4 A;  4N58 A;  4MGI E;  1WXS A;  1SB3 C;  2KAC A;  3U52 E;  4DHJ B;  2JVC A;  2XK5 B;  3QC8 B;  3PVL A;  1WWT A;  5BYR A;  3P4Q B;  2LVQ A;  2A4Z A;  2WU5 B;  1AWD A;  2CU3 A;  3DDC B;  3N1Z C;  1WI0 A;  4NZL B;  4GMV A;  1WY8 A;  5IN7 A;  2ON8 A;  2N7D A;  1K50 A;  1XLP A;  4MSM B;  1WJ6 A;  1DGJ A;  3WAO A;  1R4M I;  1AN8 A;  4EZL A;  1V97 A;  3AEB B;  1RYJ A;  2D5G A;  2WNM A;  4DXG A;  1E6E B;  2BWE S;  1FNU A;  3WIM A;  4YTN B;  2M1M A;  1IGC A;  4FJZ A;  3WCQ A;  2BYE A;  1GC7 A;  3W9C B;  5BMI A;  2R2O A;  5D2M B;  5BYQ A;  1J7B A;  4M0W A;  3DVG Y;  4WH4 A;  2DX5 B;  3KWL A;  2JWU A;  3QA8 A;  3T3O A;  1R4N I;  2UWQ A;  4PK1 A;  3AEG B;  2FCN A;  4NAW A;  1N5X A;  4XDD A;  1QT9 A;  5LXH A;  2GB1 A;  2I38 A;  2PMV A;  5CHW A;  3EFU A;  4MDK E;  2LD9 A;  3TEW A;  4S17 A;  2WU2 B;  3Q8B A;  1WE6 A;  3GS2 A;  1P9D U;  3H1U A;  2Z0D B;  5L83 A;  4M0W B;  3ZRF A;  2MBB B;  3DQV A;  3HIZ A;  4DBG A;  3MC8 A;  1KOT A;  3EHV A;  3NRZ A;  2MBH A;  2DZI A;  1Z2M A;  4JX1 C;  2MJD A;  2BYT A;  2WDR B;  1UEL A;  1A70 A;  2K8B A;  3ECI A;  1MHH E;  4NY0 A;  4IC7 B;  2KVZ A;  4RMA A;  3MHS D;  3V61 A;  2KAN A;  4C00 A;  1NEN B;  2BVC A;  5T8I A;  1ZXI A;  5CHV C;  1NYR A;  1ACC A;  1WSP A;  1ESF A;  3NOB A;  2ZCC A;  3VTV A;  1XD3 B;  2G9H D;  2KK8 A;  4WQM A;  4XX5 A;  3BVZ A;  3AV8 A;  3MJW A;  1F2R C;  1SEB D;  1HTQ A;  3QAQ A;  3DBH I;  4MJS A;  1JML A;  2ONQ A;  3L4P A;  3DPD A;  3FC4 A;  1FD6 A;  2DAJ A;  2FE8 A;  1LM8 B;  5D3D A;  3MHZ A;  1VCB A;  3VH3 B;  3N1Y C;  2WQY B;  1L0X B;  3DOW A;  4WIP A;  5TSS A;  1IYF A;  4KX6 B;  1ET6 A;  2LXA A;  4RH6 A;  3QJZ A;  1PGX A;  2IYD B;  3Q69 A;  4IKG A;  3SHQ A;  2K22 A;  1JAL A;  2G4S A;  2L05 A;  2BB5 A;  3Q8F A;  4PYU A;  3P2B A;  1K53 A;  1UUP A;  4KVG B;  1V1O A;  2KC2 A;  1C4A A;  2HDE A;  2JX5 A;  2MP2 B;  3ZUN A;  3Q6B A;  4YSY B;  1P7F A;  4IWO A;  2CHX A;  2K0P A;  3ABV B;  4TV3 A;  4KKJ A;  1SXT A;  1UGJ A;  2R2Q A;  2MQJ A;  1TJE A;  1C1Y B;  1ENF A;  1Y8R C;  4C56 C;  1TIF A;  1R4N B;  4MEL A;  2EKE C;  2PPH A;  1J7C A;  1P7E A;  5G2N A;  3N32 A;  4K81 A;  3P4S B;  2D07 B;  2KDB A;  2MW5 A;  3EGR A;  5JHA A;  1S1Q B;  1E8Z A;  3CST A;  1I4Q A;  1YN4 A;  5E6N A;  4JQW C;  4HK2 A;  4W9D A;  1LQB A;  4A3O A;  3M95 A;  2LHE A;  1AW7 A;  4HKQ A;  5TR5 A;  4GU2 A;  2K6Q A;  1TBE A;  2J0K A;  2KDI A;  3I63 C;  1SE3 A;  3IG3 A;  3LJ3 A;  2V3S A;  4EUT A;  3ZNG C;  2DEN B;  2CJN A;  2N1W A;  1JW9 D;  3CIR B;  2ZVO A;  1XLO A;  3H7P B;  2TSS A;  3T9L A;  2K9X A;  3R2I A;  2K1F A;  4YSZ B;  1AAR A;  4AUQ C;  3PRZ A;  4YSX B;  3WAM A;  5EDS A;  4OZA A;  2E3T A;  2JXX A;  4IDI A;  3APD A;  3W1Y A;  4II2 B;  1TS2 A;  1YN5 A;  2DYO A;  2PVG C;  1C9F A;  4ANW A;  5IOI A;  2KZR A;  5C23 A;  4MGY E;  2VZK D;  4M00 A;  3RI7 C;  2KTF A;  3VAW A;  2BWF A;  2K3U A;  3PZ7 A;  1T6B X;  4CHK A;  1N62 A;  3ZRC A;  3JSV A;  1IBX A;  2RGF A;  4I6P A;  4NJ6 A;  1MJD A;  2K39 A;  4ZYS A;  2UYZ B;  2NMQ A;  4EFO A;  3QAR A;  2IJ0 A;  5IP4 D;  1E0Z A;  3ZNI D;  2NBW B;  5GXG B;  1F9J A;  4AJW A;  1P1A A;  2HTH A;  3I5J C;  2D10 A;  1HA5 A;  2KJ6 A;  1FRR A;  4KZ0 A;  3Q14 C;  3PT2 B;  3Q3O C;  3EA6 A;  4YXD B;  2BTE A;  2Y5P A;  2PE9 A;  4WAA A;  4W9I A;  1EF5 A;  4WQO B;  3I3T B;  2Q5W D;  4H2A A;  4LTU A;  2KHW B;  1MFW A;  1LXD A;  2RPQ A;  4GDK B;  1JRP A;  1V9J A;  3LDZ E;  3TEX A;  2FCQ A;  4F7Z A;  2BPS A;  1WMH A;  2ZZP B;  2Z0E B;  1E9M A;  4ICV A;  1L4D B;  2DWQ A;  3L17 A;  1WYW B;  3O65 B;  2PIA A;  2KWD A;  5FR6 A;  5HFY A;  1TZO A;  2M0X A;  4TKN A;  1ISN A;  3T8M A;  3OJ4 B;  3N1X C;  5H92 C;  3VFK A;  1N5W A;  3UIN B;  1FXA A;  5G5H A;  2OED A;  1C76 A;  4ARI A;  1WR6 E;  4ARC A;  5J18 A;  3DBR B;  3AI5 A;  4WJP A;  2AL6 A;  2BW2 A;  1E5W A;  2ACZ B;  1FPY A;  1YN3 A;  3GE3 C;  2KC1 A;  3AU5 A;  2W55 A;  4YT0 B;  1FM0 D;  3VUW A;  2LUE A;  1KLU D;  4LNI A;  5AZH A;  2N7J A;  4XWW A;  3DVN V;  4WAF A;  3TEZ A;  4MGK E;  2ASQ A;  1L0Y B;  2N9L A;  2KNB A;  4HCP B;  3L13 A;  1HXY D;  2DAF A;  3JSV B;  3HUI A;  5MPO A;  1WX9 A;  3GOE A;  2WXK A;  1J19 A;  2L76 A;  2CHW A;  3DHG C;  2ZW0 A;  3QCA A;  3NZU A;  3ZDT A;  3M63 B;  3A9K B;  2MBQ A;  5D7G A;  4EE2 A;  2LGY A;  2MEK A;  2K25 A;  4OVV A;  2B3A A;  3IAM 1;  2MH7 A;  1L6U A;  1RWS A;  3H9D A;  4DHZ E;  4GDL A;  3R7Q A;  4DHJ D;  1WX7 A;  4K3C A;  1TS4 A;  3BK1 A;  4NPN A;  1QOG A;  2XN9 C;  3ZW3 A;  3A9K A;  3M3J A;  2RDH A;  3R8B A;  4FJY A;  2MX2 A;  3WA0 A;  2KMA A;  1C4P A;  1YOV B;  2O6V B;  4GDK A;  3IFW B;  3ZXV A;  3E56 A;  1UD7 A;  1WXA A;  3PHX B;  1CJE A;  2AQ1 B;  2RPV A;  1RM6 C;  1EUV B;  3Q3J A;  4BKT A;  4A20 A;  1OEY A;  1E90 A;  2IY0 B;  1Q5W B;  4YL8 A;  5JXV A;  2MWS B;  1SJE D;  2NBV B;  3B1L X;  1WXV A;  4IM3 A;  3HVZ A;  1OEY J;  5JHB A;  2C7H A;  4W9F A;  3BVG A;  3AE1 B;  1F0Z A;  1Q0W B;  3DWG C;  3KW5 B;  2JSV X;  2XK5 A;  1WGR A;  4NJ7 A;  1N61 A;  3B0A A;  4TQ0 A;  4M02 A;  3AEF B;  1XCQ L;  1WGG A;  1GC6 A;  1A5R A;  1EU4 A;  2N9K A;  4W9G A;  3UF8 A;  4C7Y A;  1C3T A;  4K7W A;  3RUL A;  1VJK A;  4OW0 A;  4ZRI A;  3A4S C;  2CHZ A;  1T0R C;  4ZRQ A;  4PS8 A;  3Q8C A;  2OHF A;  4EZK A;  3APC A;  3ZYY X;  4RF0 A;  2LRU A;  3AEE B;  2LRW A;  1GG3 A;  1ZKH A;  2BQQ A;  3UI3 A;  1C79 A;  4O1N A;  2C60 A;  3MP9 A;  4KIK B;  4BBN F;  2NR2 A;  2HJ8 A;  1FIQ A;  2LMC A;  2CJO A;  1TTN A;  2WLB A;  2XNA C;  1WXQ A;  4OZC A;  2SAK A;  2PJH A;  1IUE A;  1V6E A;  1F52 A;  1M94 A;  4B0E A;  3KUD B;  1RAX A;  2DYM A;  3SU8 X;  1P3Q U;  2NS5 A;  4PS3 A;  2NVU I;  2LHD A;  1Y56 A;  4KZC A;  2IGD A;  1WF9 A;  3VTW A;  1PGB A;  1WJ4 A;  1FXI A;  2M19 A;  1WIA A;  3N3K B;  2GBR A;  4HPL B;  3APF A;  4IUM B;  2Y3A A;  1RRB A;  1L7Y A;  5E6J A;  3ZNZ B;  3PRM B;  1JRO A;  1YMH E;  4ZDV A;  3J9C A;  1WJU A;  3H6N A;  3A9J A;  1JCK B;  2LFI A;  1KLG D;  3ML8 A;  4KGT A;  1STE A;  3MTN B;  3ZJT A;  3A33 B;  2I1K A;  3N30 A;  2I1J A;  4AOF A;  1R7S A;  2MLB A;  4HWI B;  2NTS A;  2N1V A;  1E7V A;  1WE7 A;  4JLC A;  3PLV A;  4B0M A;  1JRU A;  1MI0 A;  1YQ3 B;  5D6J B;  1DOY A;  3WAN A;  3ETR A;  1WM3 A;  2M56 B;  1WFY A;  2N7E A;  2O6V D;  1YJI A;  3R2T A;  1GOZ A;  2YVC A;  2MP2 A;  4OVU A;  2JYT A;  2KJR A;  5DPT A;  3Q8E A;  1KRH A;  2IBI B;  3RNC C;  2VRR B;  3DWM A;  4IG7 B;  1DYQ A;  5EE3 A;  1F1H A;  2QSD A;  4HLE A;  1WXM A;  3AM9 A;  4XZ4 A;  4FA6 A;  2KDE B;  1SE2 A;  2HJ1 A;  3QK0 A;  5JZE B;  3OJ3 A;  2REX A;  4L23 A;  3V62 A;  2KVR A;  1UNS A;  1OQQ A;  4G3X B;  4A6Q A;  5G5G A;  2VH2 A;  3DCG A;  2GBK A;  3Q3F A;  4UDU C;  2FID A;  2LWP A;  3VUX A;  3JVZ X;  2CR5 A;  1C78 A;  1PDX A;  4LJO B;  4I6L B;  3NVW A;  3KLS X;  3ENE A;  2N4F A;  4M01 A;  4GLS C;  1YD8 U;  3QIJ A;  3TL5 A;  4GOC A;  2J7Q B;  4XDC A;  2ZPN A;  3BVM A;  1TY0 A;  4RCO A;  5BO4 B;  1FNW A;  5C2T B;  2BYV E;  3Q8A A;  3B2G A;  1ZW7 A;  5BMH A;  3IXS A;  2Y5B B;  4BFR A;  2LGS A;  1MG4 A;  4JPS A;  4LLG M;  3VH4 B;  3CF6 E;  4W9H A;  4EOY A;  1M4V A;  1XQQ A;  3C19 A;  5BMG A;  3VXW A;  1UBI A;  1HZ6 A;  1YJJ A;  3VRA B;  4HVB A;  4W9K A;  1PUT A;  4DWF A;  3FIL A;  4DXF A;  5DPW A;  1IP9 A;  3PZD A;  1CQV A;  2V9H A;  2MBE A;  2BKF A;  3HK0 A;  1Q10 A;  2D3A A;  4M8M A;  4HDO A;  3UIO B;  4FHJ A;  2AYO B;  5FKA C;  3P4R B;  1Z5S B;  3A9J B;  4NQK E;  4NAW B;  2QHO A;  4DQO C;  2YLM A;  1IBX B;  4A9A A;  3VUY A;  2WYQ A;  4OHJ A;  3KH0 A;  3E9S A;  1HTO A;  1KTK A;  1XT9 B;  3I9V 1;  2LVO A;  4K3B A;  1PYW D;  1RFA A;  4BZA A;  3SR6 A;  1WGD A;  2WXM A;  4C4V B;  4RNA A;  3LYY A;  1C4C A;  3MC0 B;  4Q2J A;  3BY4 B;  3PLU A;  4XE0 A;  3TUO A;  2DHZ A;  3WAL A;  1ZXH A;  4US8 A;  2MJE A;  3PZ8 A;  1N6Z A;  2IGH A;  3EFC A;  4E3C A;  3AB5 A;  5HG2 A;  1BUI C;  2KD0 A;  4P16 A;  4BVU C;  2EMS A;  3RZW C;  1DOI A;  3ZNH B;  1G6J A;  3RYT A;  4ZHP A;  5D94 A;  2O2V A;  5KHQ A;  3DVG X;  4J6I A;  1BML C;  2H89 B;  2IO3 B;  5J2R A;  2Z8L A;  3NZ3 A;  2KDM A;  4YTP B;  1SGH A;  1UZX B;  5DPR A;  2KX0 A;  4EEW A;  3URY A;  3HM3 A;  1FCC C;  3RMK C;  4P1B C;  4WUR A;  1OTR B;  2J52 A;  2QIL A;  5AZF A;  2A5U A;  4X57 B;  3DBL B;  3ZTD A;  1VLB A;  5HHD G;  5AEK B;  4LNO A;  4ZHO A;  2NPT B;  2NTT A;  5AUK A;  2EMT A;  4ANX A;  1JWS D;  4G11 A;  3EUB 2;  2M0A A;  3TJP A;  2L83 A;  3W1S A;  3VRB B;  2M8S A;  4BKS A;  1GB4 A;  1J0G A;  3HVD A;  4G50 A;  1CZP A;  3NG0 A;  1SE4 A;  2KWV B;  5I4D A;  1NDD A;  3SEB A;  4PYZ A;  2L00 B;  1QOF A;  2LGD A;  1P98 A;  4EKU A;  1WJN A;  4AQ7 A;  3PS6 A;  1SIJ A;  4MH8 A;  1UH6 A;  2KQ4 X;  5J17 A;  5HKH A;  1TY2 A;  2Z59 B;  4PT5 A;  3D32 A;  3AUL A;  1GNU A;  1KH0 A;  2WXF A;  4FUL A;  2QMT A;  3NVZ A;  2CS4 A;  3AE2 B;  4LDT B;  3SFE B;  2X38 A;  3W1S C;  2WXI A;  4ANU A;  3UGB B;  4E74 A;  2WXO A;  4WWO A;  1JQ4 A;  2GBM A;  3U8Z A;  3X0W A;  3ZQ4 A;  1TS3 A;  4BBN C;  2RDG A;  1GJZ A;  3GE8 C;  3NVV A;  1J8C A;  4W9J A;  1ZUD 2;  4HCN B;  5LNK 1;  1ZP0 B;  3L54 A;  5BYS A;  3ZJU A;  1NVI D;  1V81 A;  1T5X D;  3RFZ B;  2V0G A;  2MSE D;  1FFU A;  4DDG D;  4LNN A;  2PLP A;  3AE9 B;  3DHH C;  2AQ2 B;  1VRA B;  2WS3 B;  2JUO A;  4KDI C;  2I2Y A;  4HPM B;  4OVZ A;  5FK9 C;  2QIE B;  3ALB A;  3BYY B;  2YEP F;  3AE8 B;  2W9N A;  4IM0 A;  3W5V B;  2MA9 B;  1ZPS A;  2JZP A;  1TYG B;  1QQR A;  1UBQ A;  3I57 A;  2JF5 A;  3LB8 C;  2L1A A;  3PHW B;  5AZG A;  4HRO A;  2KFJ A;  2FIF A;  2ZNV B;  1TGZ B;  2QEJ C;  2KMM A;  3DBS A;  3K9O B;  2D2Q A;  3AN1 A;  1FNV A;  1F77 A;  3UQB A;  3KYD D;  3RNA C;  1SJH D;  2NPT A;  1YNT E;  3NUH B;  2LXC A;  2DZM A;  1D5Z C;  2G3Q B;  1E8W A;  2IY1 B;  3H8H A;  1WGY A;  4GSW A;  1WX8 A;  2FAZ A;  3VVW B;  5FR3 A;  5GMV A;  2KLC A;  1IPG A;  2AX5 A;  2LJ5 A;  4MEM A;  2IO2 B;  1OFF A;  4MAC A;  1QZE A;  2L0F A;  2DZK A;  4DXA B;  2IND C;  3RN9 C;  5CHF A;  4J3O D;  2W54 A;  3BZD B;  1WRI A;  3ZKJ C;  4ANV A;  2K6D B;  3CSF A;  2FUH B;  2OJW A;  4FN2 A;  3W2D A;  3SD5 A;  4L1B A;  3U2S C;  1WRD B;  1UWX A;  2KLG A;  2JZZ A;  3AEC B;  3AXC A;  1YIW A;  3KUC B;  3PGE A;  4EZJ A;  2C5L C;  4A55 A;  1BXT A;  3L16 A;  4RGT A;  2WHI A;  4W9C A;  4MT5 A;  2IPK D;  2DZJ A;  4D2K A;  1MPE A;  3OWE B;  3TIX A;  1ZDX A;  2BYF A;  3V3X A;  3BWU D;  3P63 A;  3TMP B;  2EEL A;  1VZ7 A;  5EE9 A;  1SSN A;  1T3Q A;  2BT6 A;  2GRI A;  2V3P A;  2KN5 A;  4S0R A;  4CO7 A;  2V4L A;  4RGO S;  4HPP A;  1L0V B;  1WH3 A;  3QX1 A;  1TKY A;  4TQ1 A;  5HI1 A;  2DBY A;  1HQR D;  2RSU A;  4P7I A;  2WX1 A;  4FJV B;  5H8Y E;  4C7Z A;  2M4N A;  1Q1O A;  1LFD A;  3U7Z A;  2J42 A;  4XYC A;  2O6V A;  4HKZ E;  5IA7 A;  4ZYN A;  1SBB B;  2PEA A;  4US9 A;  2W3S A;  4WJN A;  4C80 A;  1VR9 A;  2DYB A;  2LZ6 A;  2JYE A;  4BOS C;  2IO0 B;  4HEA 1;  2KQS A;  1OQY A;  4JL9 A;  2CU1 A;  3RUI B;  2ZEQ A;  3P42 A;  2K8H A;  4BKG A;  2KXJ A;  2J0J A;  1PFD A;  1SE9 A;  2J4X A;  1EWY C;  2ZNV C;  4E71 A;  2WXG A;  1UF0 A;  5E6P A;  2FBW B;  3RNG C;  3ZVV A;  3IHP C;  2KTR A;  2WDV B;  3KQ4 A;  3BIN A;  4LJP B;  1EU3 A;  1VDV A;  4K1R B;  3Q2A C;  1ZDV A;  2FCS A;  1UGM A;  1TS5 A;  3EEC A;  2LGI A;  1V86 A;  2JU6 X;  1T0Y A;  4MM3 A;  4F1S A;  4WWN A;  1KLV A;  4RF1 A;  1GB1 A;  1X1M A;  1JWA D;  1T0Q C;  3NZS A;  3T3N A;  3TBL D;  1WGK A;  1VZ6 A;  3U4E G;  4KGS A;  1HE8 A;  1QOB A;  2W82 A;  3FKY A;  2WXQ A;  4YWG G;  2RDB C;  4TUU A;  2D3C A;  2JT4 B;  4ZRK A;  1PQS A;  4NNJ B;  3FIL B;  3DBR I;  3GP7 A;  4WJQ A;  4LDT D;  2RMM A;  1E10 A;  4FBJ B;  2C7M B;  4JWS C;  1WMH B;  3LXF A;  1TKE A;  1HZ5 A;  2PE6 B;  3ONS A;  2MRP A;  3R7R A;  2V1Y A;  4DHZ B;  2LVP A;  4TMA B;  2L0T A;  3ZIM A;  1TZ1 A;  2UU7 A;  1H4R A;  1DOX A;  2KWC A;  3NS8 A;  3C0R B;  3AMZ A;  4N9F 4;  3PRP B;  1ZGU B;  2E6X A;  3AE5 B;  4A3P A;  2KDF B;  2L3Z A;  2BF8 B;  4ACF A;  1XO3 A;  2PW9 A;  2ZPY A;  3A1Q B;  1JWM D; 
#chains in the Genus database with same CATH homology
 2KMC A;  1VD2 A;  2ZJD A;  5J18 A;  1BT0 A;  3AI5 A;  3KYC D;  4WJP A;  5CX3 A;  3ZNH B;  3RYT A;  2AL6 A;  1G6J A;  1V2Y A;  5D94 A;  2O2V A;  4B6W A;  5KHQ A;  3DVG X;  1D3Z A;  1E5W A;  4J6I A;  1I35 A;  2O2V B;  2G45 B;  4GGQ A;  4W9E A;  4WJO A;  2IO3 B;  5J2R A;  4GIV A;  2KC1 A;  3U30 A;  3L10 B;  3AU5 A;  3KUZ A;  4DK5 A;  1FXT B;  1SGH A;  2KTR B;  4FLH A;  1UZX B;  4HDQ A;  4IM2 A;  3VUW A;  5DPR A;  1L2N A;  2RR9 A;  1K8R B;  2KX0 A;  2LUE A;  4I6N B;  5AZH A;  2JRH A;  4IW0 A;  4EEW A;  3HM3 A;  3DVN V;  3H7P A;  1OTR B;  4MSQ B;  4ZRJ A;  2KX3 A;  5AZF A;  2RD0 A;  2KWU B;  2A5U A;  2LAS A;  4X57 B;  3VHT C;  4MGK E;  2ASQ A;  2KFK A;  3ZTD A;  2KNB A;  4HCP B;  4MGI E;  3L13 A;  1U4A A;  1WXS A;  4DHJ B;  5AEK B;  2JVC A;  2JWZ A;  2DAF A;  2XK5 B;  3JSV B;  1WZ0 A;  1WX9 A;  4CYE A;  4ASW C;  4FAD A;  3QC8 B;  3PVL A;  2NPT B;  3GOE A;  2EMT A;  4ANX A;  2LVQ A;  4G11 A;  1J19 A;  4F8C B;  2L76 A;  4XC2 A;  2CHW A;  2A4Z A;  3HHM A;  2IO1 B;  3TJP A;  3HM6 X;  3W1S A;  3DDC B;  2M8S A;  4BKS A;  1WI0 A;  1J0G A;  3QCA A;  2L7R A;  3NZU A;  4GMV A;  1WY8 A;  3ZDT A;  2BGF A;  3M63 B;  4G50 A;  2N7D A;  5E6O A;  3A9K B;  2WWZ A;  4MSM B;  1WJ6 A;  3PRE A;  2MBQ A;  3WAO A;  1R4M I;  2KWV B;  1GUA B;  5D7G A;  2KQ7 A;  2LGY A;  1NDD A;  4EZL A;  4PYZ A;  2L00 B;  2K25 A;  4BOZ B;  4OVV A;  2B3A A;  3AU4 A;  2LGD A;  3R66 C;  1P98 A;  4EKU A;  3QWZ B;  3H9D A;  2BWE S;  4DHZ E;  2JRI B;  1WJN A;  4GDL A;  3R7Q A;  4DHJ D;  3WIM A;  3PS6 A;  5LXI B;  1WX7 A;  1UH6 A;  2M1M A;  4NPN A;  4FJZ A;  3ZW3 A;  2BYE A;  1GC7 A;  5HKH A;  5J17 A;  2Z59 B;  3A9K A;  3M3J A;  3RZW C;  3D32 A;  5LLI A;  3RT3 B;  4BKS D;  2R2O A;  3AUL A;  5D2M B;  4FJY A;  1GNU A;  4FUL A;  1S3S G;  1EF1 A;  2MX2 A;  2C7N B;  2CS4 A;  2KMA A;  3OAW A;  3QQ8 B;  4LDT B;  3WA0 A;  3DVG Y;  4MJS B;  2DX5 B;  2O6V B;  4GDK A;  3IFW B;  4LCD E;  4HJK A;  3QA8 A;  3W1S C;  3VTU A;  1UD7 A;  1WXA A;  2WDT B;  3PHX B;  4ANU A;  1R4N I;  4JIO U;  2UWQ A;  3UGB B;  3S2A A;  2FCN A;  1E7U A;  4E74 A;  1EUV B;  3Q3J A;  4NAW A;  4WWO A;  3K9P B;  2GBM A;  3U8Z A;  3X0W A;  4BKT A;  2OJR A;  4HXD A;  4BBN C;  5LXH A;  1GJZ A;  4A20 A;  1OEY A;  5CHW A;  1J8C A;  3EFU A;  4MDK E;  1E90 A;  4W9J A;  2LD9 A;  3IVF A;  4HCN B;  2IY0 B;  3L54 A;  1Q5W B;  4YL8 A;  1WE6 A;  1V81 A;  2MWS B;  2NBV B;  1P9D U;  3H1U A;  2Z0D B;  3B1L X;  5L83 A;  4M0W B;  1WXV A;  3ZRF A;  2MSE D;  2MBB B;  4IM3 A;  3DQV A;  3HIZ A;  4DDG D;  4DBG A;  2ZCB A;  1KOT A;  1OEY J;  5JHB A;  2C7H A;  3EHV A;  4AWJ A;  4KDI C;  2JUO A;  2MBH A;  4W9F A;  2DZI A;  1Z2M A;  4HPM B;  1Q0W B;  1OGW A;  3KW5 B;  1UEL A;  2XK5 A;  3M62 B;  3ALB A;  2J0M A;  2K8B A;  3ECI A;  1V80 A;  1WGR A;  2MCN B;  4NJ7 A;  3B0A A;  4TQ0 A;  2W9N A;  1YJ1 A;  4NY0 A;  4JGH B;  4IM0 A;  4IC7 B;  1WGG A;  1GC6 A;  2MA9 B;  1A5R A;  4RMA A;  3MHS D;  2KOX A;  3V61 A;  2AL3 A;  4W9G A;  3UF8 A;  1C3T A;  4K7W A;  3RUL A;  4AJY B;  1I42 A;  2KAN A;  5JH5 C;  5CTR C;  4ZRI A;  3A4S C;  4KDL B;  5CHV C;  2CHZ A;  1UBQ A;  4PS8 A;  2JF5 A;  4RM9 A;  4EZK A;  3APC A;  3X23 A;  2WX0 A;  4K7U A;  2LRU A;  2LRW A;  1GG3 A;  3PHW B;  3NOB A;  2ZCC A;  1ZKH A;  2KFK B;  5AZG A;  3VTV A;  1XD3 B;  2XBB C;  3ML9 A;  2KFJ A;  2FIF A;  2ZNV B;  1TGZ B;  3K9O B;  3DBS A;  2KK8 A;  2M17 A;  2C60 A;  2D2Q A;  2OOB B;  3UIP B;  3UQB A;  4KIK B;  3KYD D;  4IWP A;  4BBN F;  2NPT A;  2NR2 A;  3A4R A;  3KVF B;  4XX5 A;  2HJ8 A;  3DVN U;  3MJW A;  1TTN A;  2LXC A;  2DZM A;  2G3Q B;  3DBH I;  3QAQ A;  4MJS A;  3SDL C;  3DPD A;  3DBL I;  1E8W A;  2IY1 B;  2PJH A;  2DAJ A;  1V6E A;  1WGY A;  4GSW A;  1LM8 B;  1WX8 A;  2FAZ A;  1M94 A;  1VCB A;  3L0W B;  3VH3 B;  3KUD B;  3VVW B;  1RAX A;  5GMV A;  2DYM A;  2KLC A;  3SU8 X;  2MBO A;  1IPG A;  1P3Q U;  2LJ5 A;  4MEM A;  2NS5 A;  4PS3 A;  3DOW A;  4W9L A;  2IO2 B;  1IYF A;  1E8X A;  2NVU I;  1QZE A;  2L0F A;  2D3G A;  2DZK A;  4DXA B;  4KZC A;  2LXA A;  5CHF A;  3QJZ A;  1WF9 A;  3VTW A;  1CMX B;  5DPS A;  4FHK A;  1WJ4 A;  2IYD B;  3ZKJ C;  4ANV A;  3OLM D;  1WIA A;  3CMM B;  2K6D B;  3CSF A;  2GBR A;  3N3K B;  4GN1 A;  3APF A;  4HPL B;  2FUH B;  2GOW A;  3SHQ A;  4FN2 A;  4IUM B;  2GBN A;  2G4S A;  3SD5 A;  2L05 A;  1WRD B;  4PYU A;  1RRB A;  3P2B A;  2KLG A;  1L7Y A;  2JZZ A;  3AXC A;  3ZNZ B;  4KVG B;  4NQL B;  3PRM B;  1YIW A;  2KC2 A;  2KO3 A;  4AP4 C;  3KUC B;  2MP2 B;  3H7S A;  3ZUN A;  4ZDV A;  3PGE A;  1NI2 A;  4EZJ A;  1SIF A;  1WJU A;  2C5L C;  3H6N A;  4IWO A;  2N9X A;  2CHX A;  3JYU A;  3A9J A;  4TV3 A;  1H8C A;  3L16 A;  3ML8 A;  3ZTC A;  4M8N A;  2R2Q A;  2KJH B;  5C1Z A;  3MTN B;  1WZ3 A;  2MQJ A;  1C1Y B;  1Y8R C;  3A33 B;  4W9C A;  2I1K A;  3N30 A;  1YX6 B;  2I1J A;  4MEL A;  2DZJ A;  2EKE C;  2PPH A;  4AOF A;  3UQA A;  2IZV B;  2MLB A;  4HWI B;  5KHO A;  5G55 A;  5G2N A;  2N1V A;  3N32 A;  1E7V A;  1WM2 A;  1WE7 A;  4JLC A;  4K81 A;  5DCN A;  3TIX A;  3PLV A;  2D07 B;  1JRU A;  2KDB A;  2BYF A;  2MW5 A;  5D6J B;  5JHA A;  3WAN A;  1S1Q B;  1WM3 A;  3RZF A;  1E8Z A;  1WFY A;  2N7E A;  3TMP B;  2O6V D;  3CST A;  2JPH A;  5E6N A;  4JQW C;  2KN5 A;  2YVC A;  4HK2 A;  4W9D A;  3ZDM C;  2CKH B;  1LQB A;  2MP2 A;  4OVU A;  4CO7 A;  3B08 A;  4A3O A;  2HD5 B;  4ICU A;  2KJR A;  2V4L A;  5DPT A;  3M95 A;  2IBI B;  2VRR B;  4IG7 B;  4II3 B;  1WH3 A;  3QX1 A;  4HLE A;  4TQ1 A;  1WXM A;  5TR5 A;  4GU2 A;  2K6Q A;  1TBE A;  2J0K A;  2KDI A;  3JW0 X;  3V6E B;  4XZ4 A;  4FA6 A;  2KDE B;  2RSU A;  3IG3 A;  4P7I A;  3LJ3 A;  2V3S A;  4EUT A;  2FCM A;  2WX1 A;  2NBU A;  4FJV B;  3ZNG C;  4B95 A;  4PS7 A;  3QK0 A;  5JZE B;  2M4N A;  3OJ3 A;  2REX A;  1Q1O A;  1LFD A;  3V62 A;  2DEN B;  2KVR A;  2N1W A;  4G3X B;  2O6V A;  2ZVO A;  3H7P B;  2AEH A;  3DCG A;  2GBK A;  3Q3F A;  5IA7 A;  2ZVN A;  4ZYN A;  2PEA A;  2FID A;  2K8C A;  2LWP A;  3T9L A;  3VUX A;  3R3M A;  1EO6 A;  2FNJ B;  3JVZ X;  4MH0 E;  4WJN A;  1MG8 A;  1KJT A;  2CR5 A;  2N9P C;  3WAP A;  1YQB A;  4GDL B;  2DYB A;  3PV1 A;  4LJO B;  2K1F A;  4I6L B;  2LZ6 A;  3VQI A;  3ENE A;  2N4F A;  1AAR A;  4AUQ C;  4BOS C;  3PRZ A;  1YD8 U;  2IO0 B;  3QIJ A;  3WAM A;  5EDS A;  3TL5 A;  2JXX A;  2KQS A;  1OQY A;  4GOC A;  3APD A;  4JL9 A;  2CU1 A;  3W1Y A;  2J7Q B;  3RUI B;  2ZPN A;  2ZEQ A;  4II2 B;  1V49 A;  2DYO A;  3IBE A;  2K8H A;  2HE7 A;  4ANW A;  4BKG A;  2KXJ A;  5BO4 B;  2BYV E;  4KSK C;  2J0J A;  2KZR A;  5C23 A;  4MGY E;  1ZW7 A;  3ZLZ A;  3PTF C;  2NCN A;  1SE9 A;  2KTF A;  2Y5B B;  3TCA A;  3V60 A;  3VAW A;  4BFR A;  3VH4 B;  2BWF A;  4KIK A;  2ZNV C;  4E71 A;  3CF6 E;  4W9H A;  4KSL C;  4CHK A;  3U7D A;  4EOY A;  4B9K A;  3ZRC A;  3JSV A;  2RGF A;  2LGX A;  1XQQ A;  5E6P A;  3VXW A;  1UBI A;  2KKC A;  3NHE B;  2JZ3 B;  2LI5 A;  4I6P A;  3ZVV A;  4NJ6 A;  4HVB A;  4W9K A;  1P0R A;  3IHP C;  4MGZ E;  3ZO5 B;  2K39 A;  2KTR A;  1KM7 A;  4DDI D;  3BIN A;  2UYZ B;  2XEW A;  4DWF A;  4IWQ A;  4EFO A;  4GXB A;  3QAR A;  5DPW A;  1IP9 A;  3PZD A;  3EC8 A;  3ZNI D;  2NBW B;  4LJP B;  2MBE A;  4K1R B;  2BKF A;  3HK0 A;  3A1Q A;  1V5O A;  1F9J A;  3NY5 A;  4AJW A;  4M8M A;  2FCS A;  1UGM A;  1P1A A;  2HTH A;  4HDO A;  2D10 A;  3EEC A;  3UIO B;  4FHJ A;  1E8Y A;  1V86 A;  2AYO B;  1T0Y A;  2KJ6 A;  2GBJ A;  4MM3 A;  1Z5S B;  4KZ0 A;  3PT2 B;  2N9E B;  3A9J B;  3L08 A;  4F1S A;  4RM8 A;  4WWN A;  1KLV A;  1X1M A;  3PSE B;  4NQK E;  4NAW B;  3NZS A;  2QHO A;  2YLM A;  1WR1 A;  1V5T A;  2PE9 A;  4WAA A;  3TBL D;  4W9I A;  1EF5 A;  4WQO B;  3RCZ A;  3RD2 A;  3VUY A;  2WYQ A;  3GZN I;  3I3T B;  2GMI C;  3KH0 A;  1HE8 A;  3V6C B;  4TUU A;  3QHT A;  1XT9 B;  1WGH A;  2JT4 B;  4G0N B;  4KV2 A;  4ZRK A;  2KHW B;  1PQS A;  2LVO A;  4NNJ B;  1LXD A;  2RPQ A;  3DBR I;  4GDK B;  1V9J A;  1RFA A;  4LDT D;  3LDZ E;  4WJQ A;  2FCQ A;  4FBJ B;  4F7Z A;  1WGD A;  2BPS A;  2C7M B;  1WMH A;  1YX5 B;  4URK A;  2ZZP B;  2Z0E B;  1WMH B;  2AWT A;  2JY6 A;  2C9W B;  3ONS A;  2PE6 B;  2MRP A;  3BY4 B;  3PLU A;  4ICV A;  3R7R A;  2V1Y A;  4DHZ B;  2LVP A;  2L0T A;  3L17 A;  5IAA C;  3ZIM A;  1WYW B;  1TZ1 A;  2DHZ A;  3O65 B;  5FR6 A;  1H4R A;  3WAL A;  2KWC A;  3NS8 A;  3PPA A;  5L95 C;  2M0X A;  3C0R B;  2D11 A;  4WWP A;  1ISN A;  3PRP B;  4N9F 4;  4TKN A;  1ZGU B;  3T8M A;  3OJ4 B;  4E3C A;  4A3P A;  2BKR B;  2KDF B;  1NBF C;  2L3Z A;  2BF8 B;  4GB9 A;  4K7S A;  3VFK A;  2L8J A;  3UIN B;  3VDZ A;  2KD0 A;  2G4D B;  4BVU C;  2EMS A;  2ZPY A;  3A1Q B;  1RLF A;  1WR6 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...