2M8SA

Nmr structure of the cytoplasmic tail of the membrane form of heparin-binding egf-like growth factor (prohb-egf-ct) complexed with the ubiquitin homology domain of bcl-2-associated athanogene 1 from mus musculus (mbag-1-ubh)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nuclear Magnetic Resonance Structure of the Cytoplasmic Tail of Heparin Binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-Associated Athanogene 1 from Mus musculus (mBAG-1-UBH).
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone/membrane protein
molecule keywords BAG family molecular chaperone regulator 1
total genus 21
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m8sA00
2K1FA 2BGFA 2MLBA 3OJ4B 3H7PB 4FHJA 1HE8A 2JZZA 1VCBA 1EO6A 3NZUA 1XT9B 2C60A 5BO4B 3TMPB 1WX9A 5LXIB 3UQBA 3KUZA 2BKRB 4E71A 3K9OB 3QCAA 3PGEA 2LRUA 2PE9A 4AJYB 1L7YA 3RCZA 1E5WA 2KLGA 2O6VA 1GC7A 2IO2B 3I3TB 1WF9A 4BKTA 2RR9A 2KFKB 4BVUC 1WZ3A 2DYBA 3ZIMA 2M4NA 3SHQA 3ZKJC 1LFDA 4HVBA 3KUDB 2MSED 4IG7B 1V6EA 1J0GA 2AEHA 1RLFA 2Z59B 4NY0A 5GMVA 2G3QB 4ZDVA 2DX5B 2PE6B 4F7ZA 2C7MB 2WYQA 2ZNVC 1V9JA 2ZVOA 3L08A 1ISNA 2O6VD 2NBUA 2D11A 3IFWB 3L54A 2REXA 3QHTA 4KSLC 5JH5C 2KJHB 4B95A 4P7IA 2HE7A 1YX6B 2KO3A 4KIKA 2KDEB 4CHKA 5EDSA 3O65B 5CX3A 4ZRKA 3M95A 3DBHI 2KKCA 2XK5B 3PRMB 4MM3A 3A4RA 3VVWB 3ECIA 5E6PA 3AULA 2KJ6A 3MTNB 2EKEC 2VRRB 2YVCA 3Q3FA 1S3SG 2KWVB 2UYZB 1E8ZA 1SGHA 3VTWA 5CHVC 5D2MB 3VQIA 3N3KB 4GOCA 5D94A 4IM2A 3VDZA 1D3ZA 3ZRFA 5DPSA 4ZYNA 4EFOA 2J0JA 1EUVB 4RM9A 3AI5A 3EFUA 3HK0A 3RT3B 2D2QA 5KHQA 1E90A 4GN1A 4HCNB 4A20A 4IWQA 4HPMB 2KVRA 2J7QB 1GG3A 4PS3A 2KMAA 3B1LX 2O2VA 3QQ8B 5CTRC 3ZLZA 2LRWA 4E3CA 4PYUA 2R2QA 1Z2MA 1V5TA 5E6NA 4GXBA 3ZTCA 2UWQA 3DVGY 2G4SA 1WGHA 2N9XA 2NVUI 3ZNGC 4BBNF 1MG8A 4ZRIA 3WALA 4ICVA 5G55A 1IPGA 3TBLD 2KLCA 1UZXB 2DENB 4WJOA 4EKUA 2K6QA 2MBHA 2M17A 4FJZA 1P3QU 2MQJA 2LI5A 3DVNV 1M94A 3CSFA 1UGMA 2FCQA 3MJWA 2FCMA 1K8RB 2CKHB 3T9LA 2N1WA 4LCDE 2W9NA 5AZFA 2LGYA 1V2YA 1KJTA 1XD3B 4I6LB 1XQQA 5DCNA 2KDFB 2JT4B 1NDDA 1JRUA 3ZNHB 2D3GA 1P98A 3JSVA 1YIWA 4BKSD 1E8XA 4FADA 4G3XB 4TQ0A 2AYOB 3EC8A 1E8YA 1V81A 4GDLA 3PSEB 2KMCA 2KANA 4FULA 4MDKE 5DPRA 3TJPA 2DHZA 2IO0B 3V6CB 2K8CA 2A5UA 4HWIB 4J6IA 2LVPA 2MCNB 2LXCA 4IM3A 1E8WA 4M0WB 3PHXB 3Q3JA 1WGGA 3VFKA 3ZDMC 3A9KB 2XEWA 2L0FA 3PRPB 3ENEA 3U8ZA 3ZVVA 4DDGD 4RMAA 1WIAA 3BY4B 4FN2A 4DHJB 1LXDA 1Q1OA 1GNUA 1R4MI 4FHKA 1WGRA 2N9PC 2V4LA 2C9WB 4I6PA 2R2OA 4WAAA 2LXAA 1QZEA 2FCSA 2IY1B 3W1SA 4PS7A 1Q0WB 2ZPYA 2JPHA 2MRPA 4TV3A 4N9F4 2KQ7A 2MW5A 2DYOA 4II3B 2MBOA 3W1SC 3DPDA 2K25A 1WJ4A 3VUWA 3X0WA 3QC8B 3UF8A 1SIFA 2OOBB 3IG3A 3JW0X 4W9GA 3SU8X 2DAFA 2L3ZA 2WDTB 2RSUA 1YQBA 3HHMA 3OLMD 3ZNZB 1G6JA 1TBEA 3VAWA 4BOSC 4WQOB 1A5RA 2MA9B 4KVGB 4GMVA 4I6NB 4ICUA 2JUOA 2ZPNA 3LDZE 3RYTA 4W9FA 3T8MA 1WR6E 3X23A 2BYVE 2JZ3B 3PV1A 2NBVB 4KSKC 4ANUA 2EMTA 2LASA 2HD5B 1CMXB 2K8HA 4HCPB 1I42A 3WANA 3UIPB 3DQVA 4DHZE 2MX2A 1WMHA 2NBWB 3KYCD 1AARA 5C1ZA 2FIFA 2A4ZA 2I1JA 5CHFA 3VXWA 3LJ3A 1WR1A 2KQSA 2IY0B 1WFYA 4W9HA 4PS8A 2ASQA 2LVQA 3PVLA 4HK2A 1WMHB 1WXVA 4JL9A 4WJQA 4OVUA 1WX8A 1UELA 2JF5A 1WH3A 1P0RA 1YD8U 4CO7A 2N1VA 2LUEA 5DPTA 2BWFA 2MWSB 4W9CA 3A1QB 2Z0EB 3PREA 1E7VA 3DVGX 3NHEB 4FLHA 5CHWA 3RUIB 2LZ6A 2CS4A 2IZVB 1UBQA 5J18A 4HXDA 4MGYE 2KXJA 4JQWC 2C5LC 3VUXA 4LJPB 3NZSA 4IWOA 2LGXA 2XBBC 2KHWB 2N7DA 3APCA 4MELA 5L95C 1RRBA 3DBLI 2CHZA 2KOXA 4MSQB 3S2AA 3RZWC 2C7HA 1EF1A 1X1MA 4FJVB 2FUHB 1WGDA 4HDOA 3R7RA 1VD2A 4ASWC 2J0MA 3QA8A 4WJNA 4EZKA 2ZZPB 2AWTA 1KOTA 2MBEA 1ZKHA 1TZ1A 2M8SA 3PTFC 4HDQA 3KUCB 3SD5A 5LLIA 3APDA 4G11A 3TIXA 1NBFC 3WIMA 4K1RB 5JHBA 5D6JB 2IO3B 2BWES 3ZTDA 3H1UA 1LM8B 2JWZA 3AU4A 4PYZA 5AZHA 1GC6A 3B08A 3PS6A 2CHXA 5IA7A 3A1QA 2KFKA 2D07B 4KZCA 1Z5SB 4EOYA 4A3OA 2GBKA 2NR2A 3U7DA 2CHWA 4FA6A 4GDKA 2CR5A 2KJRA 3BINA 3ONSA 4X57B 3C0RB 3OJ3A 5AEKB 4K7SA 4ANXA 4ANVA 3ZW3A 4YL8A 4EUTA 3GZNI 2O2VB 3PHWB 2FIDA 2BPSA 4HJKA 1KLVA 4GDLB 5TR5A 5KHOA 4DK5A 1F9JA 4GB9A 1WGYA 2MBBB 2NPTA 1WM2A 3HM6X 3R7QA 4MJSB 4GGQA 1WY8A 5D7GA 3NS8A 4IW0A 3ZRCA 3DOWA 3WAOA 4IM0A 3EECA 2MP2B 2DZIA 3A9JB 3H6NA 2L00B 1WZ0A 3KVFB 3L16A 3ZO5B 3P2BA 2ZJDA 2KD0A 4JGHB 1E7UA 2G4DB 3PLUA 2JXXA 2MBQA 3CF6E 3V6EB 2L0TA 3HIZA 4IC7B 1ZGUB 3H9DA 1P1AA 1T0YA 1P9DU 2AL3A 2J0KA 2JVCA 1H4RA 2KC1A 2DAJA 3QWZB 2LJ5A 1Q5WB 4KIKB 3VH4B 4WWOA 3JSVB 4KDIC 4ANWA 3SDLC 2HJ8A 4TKNA 2KFJA 5JZEB 4NAWA 1S1QB 3CMMB 2KDIA 3RD2A 2PEAA 3NY5A 2IYDB 4WWNA 3OAWA 2LVOA 3V60A 4HLEA 4LJOB 4W9KA 3N32A 4IWPA 1YJ1A 4URKA 3B0AA 4EZLA 1I35A 2WX1A 1OQYA 1OGWA 1SE9A 4BKGA 1PQSA 4AUQC 1WJ6A 1LQBA 2WWZA 4NJ7A 5C23A 3ZUNA 2AL6A 2O6VB 2LD9A 4AP4C 3DDCB 2ZVNA 3A9KA 4DHZB 2KDBA 4DHJD 5FR6A 2GBNA 2DZMA 4XC2A 2DZKA 4NJ6A 4FJYA 2NCNA 3JYUA 4W9DA 2HTHA 5L83A 3PT2B 4WWPA 4II2B 3V62A 1TTNA 1WXSA 2KTFA 2RGFA 3DVNU 4LDTB 3IBEA 4BOZB 2BYFA 3PLVA 4GSWA 2BKFA 3GOEA 3L10B 2WX0A 2K8BA 1BT0A 3UQAA 2EMSA 3D32A 1WXAA 3ML9A 5IAAC 4W9IA 3L17A 3QARA 2YLMA 3ML8A 2GBJA 1Y8RC 4RM8A 4XZ4A 3W1YA 1R4NI 3R66C 3VH3B 4XX5A 4K81A 4G0NB 1GUAB 3NOBA 1YX5B 1KM7A 4DBGA 3A4SC 4G50A 2BYEA 2NS5A 4B6WA 4KZ0A 4MGIE 3VUYA 1GJZA 1V86A 4MH0E 3V61A 4EEWA 2M1MA 2K6DB 4MSMB 4W9JA 2L8JA 3JVZX 2XK5A 3MHSD 5LXHA 2KK8A 4AJWA 2D10A 2KX3A 2M0XA 2KNBA 2L7RA 1V49A 2ZEQA 3VTVA 3IHPC 4JIOU 4GDKB 2ZNVB 1V80A 3QX1A 3QK0A 2FNJB 2KZRA 3ALBA 3IVFA 5AZGA 4NNJB 1V5OA 1WYWB 1UD7A 1WE6A 1OEYA 2ZCBA 4DDID 1RFAA 3APFA 4NQKE 4E74A 1H8CA 2RD0A 2CU1A 1OTRB 3M63B 4A3PA 3PRZA 4GU2A 2FCNA 3TCAA 3DBSA 2KX0A 5DPWA 3K9PB 2K39A 2V1YA 2BF8B 2JRHA 4MEMA 4KDLB 4OVVA 3L0WB 4BKSA 3KW5B 2DZJA 3RULA 4JLCA 1WI0A 3AU5A 3KH0A 4DWFA 4F1SA 1EF5A 2KN5A 1WXMA 1L2NA 5G2NA 1TGZB 4KV2A 2B3AA 1WX7A 4CYEA 4NAWB 2FAZA 3WAPA 2N9EB 2NPTB 4K7UA 1J8CA 3DBRI 4NPNA 4FBJB 1IP9A 1IYFA 2IBIB 2ZCCA 3VTUA 2GBMA 3DCGA 2GOWA 2PPHA 2GMIC 3VHTC 2PJHA 4BBNC 3EHVA 4BFRA 2Y5BB 3KYDD 3ZNID 3HM3A 4IUMB 1C1YB 1WRDB 2LWPA 2IO1B 2MP2A 2GBRA 3A9JA 3R3MA 2I1KA 3WA0A 2QHOA 4HPLB 2N4FA 2KTRA 1UBIA 3M3JA 4EZJA 4TUUA 3N30A 4MJSA 4MGZE 1RAXA 3PPAA 3RZFA 4AWJA 4TQ1A 4ZRJA 3QJZA 1OEYJ 4LDTD 2JRIB 1FXTB 3PZDA 5HKHA 3AXCA 4M8MA 1C3TA 3TL5A 2C7NB 1U4AA 5J2RA 1NI2A 3UGBB 2Z0DB 3UIOB 3H7SA 1ZW7A 2LGDA 4NQLB 4GIVA 4DXAB 1UH6A 1WE7A 3ZDTA 3L13A 4W9EA 4M8NA 3QIJA 2L76A 4W9LA 5E6OA 3H7PA 2RPQA 2KWCA 5J17A 2DYMA 1WJUA 2JY6A 4K7WA 4AOFA 3WAMA 3CSTA 3QAQA 2L05A 2KTRB 2KC2A 3M62B 4WJPA 3A33B 3U30A 3UINB 1WM3A 2OJRA 4B9KA 4MGKE 2G45B 2N7EA 5JHAA 1J19A 2KWUB 2V3SA 4F8CB 1WJNA
chains in the Genus database with same CATH superfamily
4C4VA 1PDXA 1Q10A 2MLBA 1ENFA 1VCBA 2WP9B 3NJTA 1JROA 5JXVA 2BT6A 3K9OB 2IPKD 2PE9A 2QILA 4AJYB 1E5WA 1IGCA 2GB1A 1KH0A 3AV8A 1WZ3A 3KQ4A 4BVUC 3ZIMA 3SHQA 4HVBA 5FR3A 2MSED 2ON8A 4IG7B 1J0GA 2JU6X 1RLFA 2Z59B 4NY0A 4ZDVA 4F7ZA 3LYYA 1FXAA 1ZXHA 3HRDD 2REXA 5JH5C 2HE7A 1GOZA 1YX6B 4KIKA 1GB4A 5EDSA 1QQRA 3DBHI 3M95A 2XK5B 3VVWB 3ECIA 3AULA 2QDFA 2KJ6A 3MTNB 2ACZB 2EKEC 1I4PA 4M00A 2OHFA 3W9CB 3SR6A 1SGHA 5CHVC 4IM2A 3FILB 1YQ4B 5DPSA 5EE3A 4ZYNA 2NTSA 4EFOA 4RM9A 3HK0A 3VR9B 1SSNA 2PVOD 4HCNB 4A20A 1FPYA 2J7QB 4TMAB 2H89B 3R8BA 3ZLZA 2LRWA 2KAJA 5E6NA 4GXBA 2UWQA 3DVGY 2G4SA 1MG8A 3FKYA 5G55A 1IPGA 5C3JB 3TBLD 2LGIA 4WJOA 4EKUA 2MBHA 1PFDA 1P3QU 1VZ7A 3GZNB 2LI5A 3DVNV 4IKGA 1NYQA 3CSFA 2FCMA 3T9LA 3NVWA 1PGBA 2LGYA 1V2YA 2KACA 1F0ZA 2JT4B 2D3GA 4FADA 4G3XB 1SIJA 3AEFB 1J7BA 2KMCA 2DBYA 2IO0B 1ET9A 5BMIA 2K5PA 4HWIB 2LVPA 4IM3A 4M0WB 3PHXB 3Q3JA 1WGGA 3A9KB 4HROA 2L0FA 1KLUD 3E56A 2WXJA 3MC9A 3ZVVA 4RMAA 1QOAA 1LXDA 4FHKA 4M02A 1L6UA 4WAAA 2LXAA 2FCSA 4OZCA 1ZP0B 4US9A 1Q0WB 2ZPYA 3GE3C 4N9F4 2DYOA 4ZHOA 1WWTA 2OOBB 4W9GA 2DAFA 2L3ZA 1RM6C 1G6JA 3VAWA 3BK2A 3R2TA 1A5RA 1OFFA 4KVGB 4GMVA 4I6NB 4ICUA 4YTPB 2ZPNA 1RYJA 2KVZA 2BYVE 2JZ3B 3BK1A 1T5XD 4ANUA 2HD5B 3DHHC 4HCPB 3SEBA 3HVDA 3DQVA 1N5WA 4B0EA 5C1ZA 1I4RA 4W9HA 4PS8A 1WYGA 1WMHB 4JL9A 2EKIA 1UELA 1WH3A 4XDCA 4CO7A 3TEXA 1SE3A 5DPTA 2MWSB 2KT7A 2Z0EB 3PREA 3DVGX 4FLHA 5CHWA 2LZ6A 2KXJA 2WXHA 4JQWC 2WLBA 3VUXA 4LJPB 2BB6A 4YTMB 2XBBC 2N7DA 2RMMA 4MELA 5L95C 1RRBA 3RPFC 3DBLI 2C7HA 2FUHB 1WGDA 3ZGZA 3ZXRA 4Q2JA 1P7EA 4WJNA 2AWTA 3ZQ4A 3PTFC 4HDQA 1TS2A 3V05A 1F2RI 3TIXA 3WIMA 5BMHA 1DOYA 1ACCA 1PGAA 3B08A 2KDMA 3A1QA 2BB5A 1JWMD 4EOYA 2NR2A 2QCZA 2KJRA 4K7SA 2V9HA 1N61A 2FIDA 1KLVA 5TR5A 1XO3A 3DHIC 1WGYA 3SFDB 2WXPA 1TZOA 1QT9A 1YN5A 4IW0A 3ZRCA 2HTME 2L00B 1N62A 2K0PA 3CF6E 2L0TA 4WAFA 3HIZA 3H9DA 2JYTA 3T3OA 1AYFA 4PT5A 2L32A 1HA5A 3OAWA 2JX5A 4IWPA 1XLQA 3IXSA 4XE0A 1ESFA 1WJ6A 2WWZA 3ZUNA 3AEDB 2QJLA 2GBNA 2DZKA 1I4XA 2NCNA 2HTHA 3PT2B 3P4SB 4WWPA 4A6QA 4GSWA 1K51A 2BKFA 4KKIA 1E9MA 3RNGC 3ML9A 3W1YA 4XZ4A 3KLSX 1VZ8A 4XX5A 3P1MA 4G0NB 2I2YA 1KM7A 4DBGA 4G50A 4KZ0A 3VUYA 1I7HA 3V61A 4EEWA 4HJGE 1FIQA 2LUMA 2KX3A 1F1HA 3IHPC 1YOVB 4JIOU 2PMVA 4GDKB 1V5OA 1OEYA 1J7AA 4EE2A 3APFA 4NQKE 1MPEA 2V0GA 2CU1A 4A3PA 2FCNA 3TCAA 1ZDXA 3AH7A 2DWQA 2KX0A 1UUPA 2K9XA 4ZRQA 3KW5B 2DZJA 2MHJA 1WI0A 4F1SA 1L2NA 2B3AA 4NAWB 2FAZA 2GI9A 3WAPA 2WXKA 3OG5A 3DBRI 1E10A 3CWIA 2GBMA 1JRPA 1TT5B 3DCGA 4MM3B 3VHTC 4LNIA 1BXTA 3J9CA 4BFRA 4L23A 1TY0A 2D3BA 3KYDD 2MEKA 3HM3A 1C1YB 2MP2A 5IN7A 4TUUA 3RZFA 1OQRA 4TQ1A 2KN4A 5G5HA 1SBBB 2JRIB 3AEEB 1C3TA 2N0SB 1NI2A 4C56C 3UGBB 3AEBB 1FM0D 3U2SC 3ZDTA 2CJNA 1TYGB 3QAQA 2R61A 3UINB 3VRAB 5JHAA 2KWUB 3AM9A 2V4IB 2BGFA 3OJ4B 3H7PB 2JZZA 3NZUA 3TUOA 5BO4B 2N9LA 2BKRB 3QCAA 3PGEA 2LRUA 1L0YB 3RCZA 1C4PA 1ROEA 2IO2B 5H92C 1WF9A 4LLGM 1I4HA 3LXFA 4YWGG 1LFDA 2DX5B 2C7MB 2ZVOA 2O6VD 2NBUA 2D11A 3IFWB 3L54A 4A9AA 5T8IA 2M19A 2OEDA 2WXRA 5CX3A 4ZRKA 1SJHD 3W5VB 4LTUA 2KWVB 2UYZB 1TY2A 1XCTL 2D3AA 3VTWA 4DXGA 1TS5A 2WXFA 3N3KB 1D3ZA 2MH7A 1VZ6A 1VJKA 3ABVB 1EUVB 1XXGA 3RT3B 2INCC 1E90A 5KHQA 4PS3A 2KMAA 3B1LX 2O2VA 3QQ8B 4PYUA 1J7CA 1R7SA 1V5TA 3ZTCA 1JWSD 3WALA 1BUIC 4BZAA 4HEA1 2KLCA 1DGJA 4XDDA 2DENB 1TKEA 5HFYA 2WXMA 2J53A 4FJZA 3VRBB 2ICIA 3DBHB 1K8RB 2CKHB 4REZA 4LCDE 5AZFA 1KJTA 1SE2A 4RH6A 1P98A 3JSVA 1YIWA 3NVYA 2G9HD 4GDLA 2QIEB 2DHZA 3T3NA 2WDRB 2MCNB 2B76B 1JWBD 1UWMA 1V8CA 2ZW1A 1FMAD 3AE1B 2WXOA 4DXFA 4XYCA 4A8XC 1UWXA 2VH2A 1SB3C 1GNUA 1KFYB 2V4LA 2R2OA 3HVZA 1DYQA 3RNAC 1QZEA 4PS7A 4DQOC 1ZE3D 4C80A 2VH1A 1EM7A 2MBOA 1LGRA 3QC8B 1SIFA 3IG3A 4DDID 3OLMD 3HHMA 4WQOB 3FILA 2MA9B 4MT5A 4JPSA 2FUG1 3RNCC 1T0SC 4W9FA 1WR6E 4KSKC 1L4ZB 3KYCD 2FIFA 5CHFA 3VXWA 2FE8A 2KQSA 2IY0B 1ZPSA 2WXQA 4HK2A 4WJQA 4OVUA 2KQ4X 1YD8U 1JCKB 3BYYB 3A1QB 3DBRB 3RUIB 2IZVB 3I5JC 4MGYE 1EU4A 3I57A 3NZSA 4IWOA 2LGXA 3APCA 2W82A 4YSYB 2KOXA 3S2AA 3RZWC 2OJWA 1N60A 2LJIA 1HTOA 1C78A 4WURA 2FBWB 3GB1A 1KOTA 2MBEA 1CQVA 3KUCB 1L0VB 5LLIA 3APDA 2WU2B 5JHBA 4K1RB 2IO3B 2BWES 1ZOYB 2JWZA 3O13A 1SF0A 1A70A 2IGHA 1GC6A 3MC8A 2D07B 4KZCA 1Z5SB 4A3OA 1FFUA 4GDKA 4X57B 3BINA 1GB1A 4ANVA 2PIAA 4EUTA 3ZXVA 3PHWB 1QOFA 2BPSA 4GDLB 2MBBB 3HM6X 2BQQA 5FKAC 4C4VB 1MHHE 3DOWA 2V3NA 3H6NA 3A9JB 1WZ0A 4BAXA 3V6EB 2JXXA 1D6EC 2QEJC 1P1AA 3R2IA 2AL3A 2J0KA 1QOBA 2JVCA 1H4RA 2DAJA 4KIKB 3SDLC 2HJ8A 1MI0A 3RD2A 2PEAA 3NY5A 4JE3B 1HQRD 2IYDB 4HLEA 2RDGA 3N32A 1YJ1A 4URKA 3B0AA 4EZLA 1UF0A 1OQYA 1SE9A 1PQSA 1AN8A 4NJ7A 1STEA 4RF1A 5FR6A 4XC2A 1M4VA 3JYUA 5L83A 4AQ7A 4YXDB 2W3SA 3V62A 1TTNA 4LDTB 3IBEA 2BYFA 3PLVA 1T0RC 2WX0A 1NI3A 4ACFA 2EMSA 4RGNA 1WXAA 3L17A 4RM8A 2YLMA 3ML8A 1R4NI 2ZW0A 1GUAB 1FO4A 1YX5B 4B6WA 3FC4A 2BYEA 2NS5A 1GJZA 4MGIE 4YSXB 1FNVA 2M1MA 2WDVB 1NYRA 4AJWA 3V3XA 2M0XA 3VTVA 3QK0A 2KZRA 2J4XA 3ALBA 5AZGA 4NNJB 1JALA 1H8CA 1RFAA 2D3CA 3PRZA 3GE8C 5BYSA 2IGGA 3E9SA 5DPWA 1B9RA 1IBXA 3K9PB 2BYTA 2BF8B 4BKSA 3N1ZC 4KDLB 3L0WB 3RULA 3AU5A 1IGDA 3Q69A 5G2NA 5LNK1 2N9EB 4B0MA 1J8CA 5AUIA 4NPNA 1IP9A 1IYFA 3EA6A 2PPHA 5MPOA 4P16A 2WXGA 3AEAB 2IO1B 1UGJA 1PYWD 2KTRA 3M3JA 1C4CA 2QSDA 3Q8FA 3NRZA 3QJZA 1OEYJ 1TS3A 3IAS1 1ZXIA 3TL5A 2V3PA 1VR9A 1U4AA 1EU3A 1HZ5A 1T0QC 4ZOHC 3H7SA 1ZW7A 2LGDA 4GIVA 1UH6A 1MVKA 2BS3B 3QIJA 2Y5PA 2L76A 2CJOA 4W9LA 5E6OA 3H7PA 2RPQA 2KWCA 2DYMA 2JY6A 4AOFA 2HJ1A 2L05A 3WCQA 3M62B 4WJPA 1QF6A 4B9KA 2OJRA 4XWWA 2G45B 2N7EA 4ITKA 1J19A 4F8CB 2Z8LA 4S0RA 2E3TA 1EO6A 1T3QA 4L2YA 2C60A 1WX9A 3KUZA 3BVGA 4E71A 4HKZE 4H2AA 2KLGA 3Q14C 1GC7A 4BKTA 3W2DA 2KFKB 2DYBA 2M4NA 3ZKJC 1I4GA 1TKYA 2UU7A 2AEHA 1R4MB 2PE6B 2WYQA 2ZNVC 3HUIA 4KGSA 4O1NA 1MHXA 2XNAC 4C7YA 3P4PB 5HHDG 3QHTA 4KSLC 2X38A 2KJHB 3Q8BA 4B95A 3O65B 2KKCA 4MH8A 4MM3A 3A4RA 5E6PA 4C00A 3TEWA 1WRIA 2VRRB 2YVCA 1N5XA 3Q3FA 1E8ZA 4IOIE 5D94A 3VDZA 1V1PB 1T6BX 1AWDA 2LGSA 1HZ6A 3AI5A 4GN1A 4IWQA 4HPMB 1GG3A 4A55A 4E3CA 5CTRC 1B1ZA 3L4PA 2R2QA 1Z2MA 1WGHA 2NVUI 3ZNGC 4BBNF 4ZRIA 1WSPA 1RFKA 1XCQL 1RWSA 2K6QA 2M17A 1PUTA 2MQJA 2VZKD 3FAHA 1M94A 1UGMA 5IO9A 4OZAA 4XWTA 2N1WA 1KTKA 2W9NA 1I4QA 4NZLB 4USAA 1CZPA 1JRUA 1F77A 3AEGB 2LHEA 4BKSD 1E8XA 3Q3MC 4TQ0A 1V81A 3IT6B 3PSEB 5DPRA 4FULA 3TJPA 4MDKE 1KF6B 5EE1A 3V6CB 4JX1C 2A5UA 4J6IA 2X8XX 2WQYB 1KLGD 2LXCA 1E8WA 1TIFA 1V1OA 2W54A 3RFZB 3VFKA 3ZDMC 3BVZA 4RNAA 2E6XA 2BS4B 3ENEA 3BY4B 4L1BA 4DHJB 1R4MI 2N9PC 2C9WB 3DWMA 3W1SA 1L0XB 2Q5WD 1L6VA 1MG4A 2KQ7A 4II3B 3W1SC 2K25A 3VUWA 4NJCA 2WXLA 2RPVA 3RNBC 4DWFA 1YQBA 3ZNZB 2JUOA 2NTTA 1E0ZA 2MJ3A 3PV1A 2NBVB 2J52A 1XLNA 3U7ZA 3BVMA 1CMXB 2K8HA 1I42A 3WANA 1IUEA 1AARA 2KWDA 4OZBA 2A4ZA 3AECB 1FD6A 1WR1A 2Y3AA 2ASQA 1V97A 3PVLA 5AUKA 3EFCA 2W55A 1WXVA 2KYWA 2JF5A 4UDUC 2BWFA 1E7VA 5J18A 2CS4A 1UBQA 4RF0A 4HXDA 2C5LC 4OHJA 1XLOA 1EF1A 4KX6B 4HDOA 3BZDB 1VD2A 4ASWC 1Y56A 4EZKA 5EE0A 2JQRB 4JWSC 1TZ1A 3SD5A 2DNFA 2QMTA 2K3UA 1NBFC 1SJED 5D6JB 3ZTDA 3H1UA 2RDBC 5AZHA 2CHXA 3ZYYX 4J3OD 2KFKA 2IGDA 3AE3B 3U7DA 2CHWA 3UI3A 1KRHA 5AEKB 2WU5B 3ZW3A 2INPE 4YL8A 2O2VB 4HJKA 2CU3A 4DK5A 3N1YC 3AE6B 4GB9A 5D3DA 2NPTA 4US8A 3R7QA 1NVID 4LNFA 2GLSA 5D7GA 3N1XC 2BTEA 3WAOA 2MP2B 2DZIA 3KVFB 2KD0A 1E7UA 4IC7B 3AB5A 1T0YA 1P9DU 2VZKB 1Q5WB 3AE8B 4YT0B 1N63A 1VDVA 3VH4B 4WWOA 3JSVB 4KDIC 5JZEB 2KFJA 1C79A 1YMHE 3MP9A 4NAWA 1S1QB 1HEZE 4WWNA 4LJOB 2W3RA 1I35A 4A90A 4XGAB 1OGWA 1XLPA 4AUQC 1LQBA 3KWLA 1QILA 4AP4C 2ZVNA 4DHZB 2GRIA 2PKOA 1FCLA 4C7ZA 3B2FA 4II2B 1WXSA 2RGFA 2D5GA 4BOZB 3L10B 1BT0A 3UQAA 3IAM1 3D32A 5IAAC 4W9IA 4NAMA 1JWAD 2GBJA 2J42A 4K81A 1K50A 3NOBA 3OWEB 3AMZA 1VLBA 2L8JA 3JVZX 2TSSA 2XK5A 3MHSD 1ZDVA 2ZEQA 4KKJA 4RGMA 1SEBD 1V80A 3QX1A 3IVFA 1WE6A 4E74A 3TEYA 4ZRPA 2WS3B 2MJEA 1OTRB 3M63B 5HG2A 1K53A 2MJDA 3DBSA 2K39A 1SXTA 3TSSA 2WXNA 3KH0A 2KN5A 1E7PB 1WXMA 1WX7A 5E6JA 3RNFC 2NPTB 4K7UA 4HKQA 2I38A 5D3IB 3C19A 3VTUA 5BYQA 2GOWA 3PZ8A 2PJHA 4BBNC 3EHVA 4AS1A 1GPXA 2Y5BB 4IUMB 4QAYA 2JXTA 2GBRA 1E6EB 3B9JA 3R3MA 3NVVA 2QHOA 4EZJA 1UBIA 4LNNA 3ZJUA 3N30A 4MGZE 3C8YA 1RAXA 3PPAA 1HTQA 4AWJA 4ZRJA 1FCCC 2IJ0A 4LDTD 1FXTB 3PZDA 3AXCA 3IT4B 4LK0M 3Q8AA 4M8MA 3DHGC 3BIID 5TSSA 1MJDA 5J2RA 5IOIA 1QKZA 2DLBA 3UIOB 4KGTA 4NQLB 2L1AA 3LB8C 4W9EA 4ZYSA 5J17A 1WJUA 4K7WA 3CSTA 2WNMA 5C2TB 2YEPF 2N7JA 2PW9A 2M56B 2K1FA 3EGRA 4FHJA 1R4NB 1HE8A 4OW0A 1XT9B 3TMPB 2INNE 5LXIB 2L83A 3UQBA 2JWUA 1YJJA 3RNEC 1L7YA 2JYEA 2O6VA 3I3TB 2RR9A 1IBXB 3KUDB 1V6EA 2G3QB 1YQ3B 5FK9C 1V9JA 3L08A 4ARIA 1ISNA 1F52A 3MJ5A 4P7IA 2KO3A 2KDEB 1K52A 4CHKA 4HPPA 5BMGA 4P1BC 2H88B 3PRMB 2XN9C 1S3SG 5HI1A 5D2MB 3VQIA 4GOCA 1FRRA 3ZRFA 4P1CC 2J0JA 3EFUA 2D2QA 3AE9B 4M01A 2KVRA 4D2KA 1CK1A 4PK1A 2N9XA 3H8HA 1D5ZC 4ICVA 1TKGA 3PZ7A 1UZXB 3KWVA 3AE7B 2BW2A 1EWYC 2SEBD 4N59A 2FCQA 1QOGA 1F2RC 3MJWA 3Q3OC 1JW9D 3P4QB 4M0WA 2RDHA 1XD3B 4I6LB 1XQQA 5DCNA 3MFGA 2KDFB 1NDDA 3ZNHB 2AQ2B 2AYOB 3EC8A 1E8YA 2KANA 2K8CA 2LHDA 1FNUA 1TJEA 2XEWA 2K22A 3PRPB 1JQ4A 4N58A 4TSSA 3U8ZA 4DDGD 1WIAA 4FN2A 1Q1OA 5BYRA 3GP7A 3I9V1 1WGRA 4LNKA 4R3DA 4YSZB 4I6PA 1FEHA 2IY1B 2AQ3B 4N6EB 4WIPA 2JPHA 2MRPA 1TS4A 1PGXA 4TV3A 2MW5A 3DPDA 1WJ4A 3X0WA 3UF8A 3Q3NC 3JW0X 3SU8X 2WDTB 2RSUA 1YN3A 1YJIA 1TBEA 1V1PA 4BOSC 2LMCA 3MHZA 3AE4B 5GXGB 2PVGC 3LDZE 4WH4A 3RYTA 2IDYA 2SAKA 3T8MA 3X23A 4GLSC 3P42A 2EMTA 2LASA 2ONQA 4RFBA 1GAQB 4RGOS 3UIPB 3NS1A 1SE4A 2MX2A 1WMHA 4DHZE 1LO5D 2NBWB 1FFVA 2I1JA 3NUHB 3LJ3A 4ARCA 1WFYA 2LVQA 3U4EG 1WX8A 1P0RA 2N1VA 2LUEA 2HDEA 3EUB2 4W9CA 5GMVA 3NHEB 4LNOA 4WWMA 3RI7C 1NENB 2KHWB 4ZHPA 3CIRB 4OVZA 2CHZA 3B2GA 1D5XC 4MSQB 3URYA 1X1MA 4FJVB 3R7RA 1MFWA 1VRAB 4KGRA 2J0MA 3PO0A 3QA8A 2ZZPB 1ZKHA 2M0AA 2M8SA 3Q8CA 2BS2B 4G11A 3I63C 3MC0B 2KMMA 1FXIA 2WDQB 2WXIA 1LM8B 3AU4A 4PYZA 3PS6A 5IA7A 3BYTB 4JWUC 2GBKA 4FA6A 2CR5A 4P6VF 3ONSA 3C0RB 3OJ3A 1QLBB 4ANXA 3GZNI 1D4BA 4IDIA 1P7FA 5KHOA 1F9JA 2Y5CA 1WM2A 4RGTA 4MJSB 4GGQA 1WY8A 3NS8A 4K3CA 4IM0A 3EECA 3L16A 3ZO5B 3P2BA 2ZJDA 4JGHB 2G4DB 3PLUA 2MBQA 2PLPA 1ZGUB 1XEEA 2JZPA 2WHIA 2LEKA 3GS2A 1DOXA 2KC1A 3QWZB 2LJ5A 3N9YC 3ETRA 4ANWA 4TKNA 3ZJVA 1C4AA 3W5UB 3ZJTA 4K3BA 3CMMB 2KDIA 2LVOA 3V60A 4W9KA 3NZ3A 2INDC 5G5GA 2G1EA 2WX1A 4BKGA 1ET6A 3Q2AC 4WQMA 3AE2B 5C23A 2AL6A 2EELA 5IP4D 2O6VB 4FXCA 2LD9A 3DDCB 3A9KA 2KDBA 1C77A 4DHJD 1FNWA 2DZMA 4NJ6A 4FJYA 3AN1A 3BWUD 4W9DA 1C9FA 1HXYD 2BBCA 1D5MC 3P4RB 2KTFA 3DVNU 2AX5A 3GOEA 3VR8B 2YEPB 2K8BA 1FRDA 5EE9A 4RCOA 3NG0A 3QARA 1Y8RC 3R66C 1N6ZA 3VH3B 1YN4A 1NEKB 4S17A 5HKHA 3A4SC 1WGKA 1WXQA 1XF5L 1V86A 4MH0E 1YNTE 2K6DB 1JMLA 4MSMB 4W9JA 5LXHA 2KK8A 3RN9C 2D10A 2KNBA 2L7RA 1V49A 4MACA 5IKCM 2ZNVB 4CQNA 2FNJB 1JWUD 5I4DA 1WYWB 1UD7A 2ZCBA 3P63A 2RD0A 4GU2A 1AW7A 1L4DB 1L5PA 2NMQA 2V1YA 2JRHA 4MEMA 4OVVA 4JLCA 5H8YE 1EF5A 1UNSA 2QC8A 1TGZB 4KV2A 4CYEA 2BVCA 1EWCA 3Q6BA 3N20C 3AE5B 3SFEB 4FBJB 2IBIB 2JSVX 2ZCCA 3TEZA 2GMIC 3NVZA 3ZNID 3RMKC 1WRDB 2AQ1B 2LWPA 3A9JA 2I1KA 3WA0A 4HPLB 1ZUD2 2N4FA 1CJEA 4MJSA 2L52A 1DOIA 3DBLB 1OQQA 2LFIA 2C7NB 2PTLA 3Q8EA 2Z0DB 1BMLC 3U52E 1C76A 4DXAB 1WE7A 3L13A 4YTNB 4M8NA 2N9KA 3DWGC 3WAMA 4HRSA 2KTRB 2KC2A 2WGSA 3A33B 3U30A 1WM3A 4MGKE 2V3SA 1WJNA
chains in the Genus database with same CATH topology
2K1FA 2BGFA 2MLBA 3OJ4B 3H7PB 4FHJA 1HE8A 2JZZA 1VCBA 1EO6A 3NZUA 1XT9B 2C60A 5BO4B 3TMPB 1WX9A 5LXIB 3UQBA 3KUZA 2BKRB 4E71A 3K9OB 3QCAA 3PGEA 2LRUA 2PE9A 4AJYB 1L7YA 3RCZA 1E5WA 2KLGA 2O6VA 1GC7A 2IO2B 3I3TB 1WF9A 4BKTA 2RR9A 2KFKB 4BVUC 1WZ3A 2DYBA 3ZIMA 2M4NA 3SHQA 3ZKJC 1LFDA 4HVBA 3KUDB 2MSED 4IG7B 1V6EA 1J0GA 2AEHA 1RLFA 2Z59B 4NY0A 5GMVA 2G3QB 4ZDVA 2DX5B 2PE6B 4F7ZA 2C7MB 2WYQA 2ZNVC 1V9JA 2ZVOA 3L08A 1ISNA 2O6VD 2NBUA 2D11A 3IFWB 3L54A 2REXA 3QHTA 4KSLC 5JH5C 2KJHB 4B95A 4P7IA 2HE7A 1YX6B 2KO3A 4KIKA 2KDEB 4CHKA 5EDSA 3O65B 5CX3A 4ZRKA 3M95A 3DBHI 2KKCA 2XK5B 3PRMB 4MM3A 3A4RA 3VVWB 3ECIA 5E6PA 3AULA 2KJ6A 3MTNB 2EKEC 2VRRB 2YVCA 3Q3FA 1S3SG 2KWVB 2UYZB 1E8ZA 1SGHA 3VTWA 5CHVC 5D2MB 3VQIA 3N3KB 4GOCA 5D94A 4IM2A 3VDZA 1D3ZA 3ZRFA 5DPSA 4ZYNA 4EFOA 2J0JA 1EUVB 4RM9A 3AI5A 3EFUA 3HK0A 3RT3B 2D2QA 5KHQA 1E90A 4GN1A 4HCNB 4A20A 4IWQA 4HPMB 2KVRA 2J7QB 1GG3A 4PS3A 2KMAA 3B1LX 2O2VA 3QQ8B 5CTRC 3ZLZA 2LRWA 4E3CA 4PYUA 2R2QA 1Z2MA 1V5TA 5E6NA 4GXBA 3ZTCA 2UWQA 3DVGY 2G4SA 1WGHA 2N9XA 2NVUI 3ZNGC 4BBNF 1MG8A 4ZRIA 3WALA 4ICVA 5G55A 1IPGA 3TBLD 2KLCA 1UZXB 2DENB 4WJOA 4EKUA 2K6QA 2MBHA 2M17A 4FJZA 1P3QU 2MQJA 2LI5A 3DVNV 1M94A 3CSFA 1UGMA 2FCQA 3MJWA 2FCMA 1K8RB 2CKHB 3T9LA 2N1WA 4LCDE 2W9NA 5AZFA 2LGYA 1V2YA 1KJTA 1XD3B 4I6LB 1XQQA 5DCNA 2KDFB 2JT4B 1NDDA 1JRUA 3ZNHB 2D3GA 1P98A 3JSVA 1YIWA 4BKSD 1E8XA 4FADA 4G3XB 4TQ0A 2AYOB 3EC8A 1E8YA 1V81A 4GDLA 3PSEB 2KMCA 2KANA 4FULA 4MDKE 5DPRA 3TJPA 2DHZA 2IO0B 3V6CB 2K8CA 2A5UA 4HWIB 4J6IA 2LVPA 2MCNB 2LXCA 4IM3A 1E8WA 4M0WB 3PHXB 3Q3JA 1WGGA 3VFKA 3ZDMC 3A9KB 2XEWA 2L0FA 3PRPB 3ENEA 3U8ZA 3ZVVA 4DDGD 4RMAA 1WIAA 3BY4B 4FN2A 4DHJB 1LXDA 1Q1OA 1GNUA 1R4MI 4FHKA 1WGRA 2N9PC 2V4LA 2C9WB 4I6PA 2R2OA 4WAAA 2LXAA 1QZEA 2FCSA 2IY1B 3W1SA 4PS7A 1Q0WB 2ZPYA 2JPHA 2MRPA 4TV3A 4N9F4 2KQ7A 2MW5A 2DYOA 4II3B 2MBOA 3W1SC 3DPDA 2K25A 1WJ4A 3VUWA 3X0WA 3QC8B 3UF8A 1SIFA 2OOBB 3IG3A 3JW0X 4W9GA 3SU8X 2DAFA 2L3ZA 2WDTB 2RSUA 1YQBA 3HHMA 3OLMD 3ZNZB 1G6JA 1TBEA 3VAWA 4BOSC 4WQOB 1A5RA 2MA9B 4KVGB 4GMVA 4I6NB 4ICUA 2JUOA 2ZPNA 3LDZE 3RYTA 4W9FA 3T8MA 1WR6E 3X23A 2BYVE 2JZ3B 3PV1A 2NBVB 4KSKC 4ANUA 2EMTA 2LASA 2HD5B 1CMXB 2K8HA 4HCPB 1I42A 3WANA 3UIPB 3DQVA 4DHZE 2MX2A 1WMHA 2NBWB 3KYCD 1AARA 5C1ZA 2FIFA 2A4ZA 2I1JA 5CHFA 3VXWA 3LJ3A 1WR1A 2KQSA 2IY0B 1WFYA 4W9HA 4PS8A 2ASQA 2LVQA 3PVLA 4HK2A 1WMHB 1WXVA 4JL9A 4WJQA 4OVUA 1WX8A 1UELA 2JF5A 1WH3A 1P0RA 1YD8U 4CO7A 2N1VA 2LUEA 5DPTA 2BWFA 2MWSB 4W9CA 3A1QB 2Z0EB 3PREA 1E7VA 3DVGX 3NHEB 4FLHA 5CHWA 3RUIB 2LZ6A 2CS4A 2IZVB 1UBQA 5J18A 4HXDA 4MGYE 2KXJA 4JQWC 2C5LC 3VUXA 4LJPB 3NZSA 4IWOA 2LGXA 2XBBC 2KHWB 2N7DA 3APCA 4MELA 5L95C 1RRBA 3DBLI 2CHZA 2KOXA 4MSQB 3S2AA 3RZWC 2C7HA 1EF1A 1X1MA 4FJVB 2FUHB 1WGDA 4HDOA 3R7RA 1VD2A 4ASWC 2J0MA 3QA8A 4WJNA 4EZKA 2ZZPB 2AWTA 1KOTA 2MBEA 1ZKHA 1TZ1A 2M8SA 3PTFC 4HDQA 3KUCB 3SD5A 5LLIA 3APDA 4G11A 3TIXA 1NBFC 3WIMA 4K1RB 5JHBA 5D6JB 2IO3B 2BWES 3ZTDA 3H1UA 1LM8B 2JWZA 3AU4A 4PYZA 5AZHA 1GC6A 3B08A 3PS6A 2CHXA 5IA7A 3A1QA 2KFKA 2D07B 4KZCA 1Z5SB 4EOYA 4A3OA 2GBKA 2NR2A 3U7DA 2CHWA 4FA6A 4GDKA 2CR5A 2KJRA 3BINA 3ONSA 4X57B 3C0RB 3OJ3A 5AEKB 4K7SA 4ANXA 4ANVA 3ZW3A 4YL8A 4EUTA 3GZNI 2O2VB 3PHWB 2FIDA 2BPSA 4HJKA 1KLVA 4GDLB 5TR5A 5KHOA 4DK5A 1F9JA 4GB9A 1WGYA 2MBBB 2NPTA 1WM2A 3HM6X 3R7QA 4MJSB 4GGQA 1WY8A 5D7GA 3NS8A 4IW0A 3ZRCA 3DOWA 3WAOA 4IM0A 3EECA 2MP2B 2DZIA 3A9JB 3H6NA 2L00B 1WZ0A 3KVFB 3L16A 3ZO5B 3P2BA 2ZJDA 2KD0A 4JGHB 1E7UA 2G4DB 3PLUA 2JXXA 2MBQA 3CF6E 3V6EB 2L0TA 3HIZA 4IC7B 1ZGUB 3H9DA 1P1AA 1T0YA 1P9DU 2AL3A 2J0KA 2JVCA 1H4RA 2KC1A 2DAJA 3QWZB 2LJ5A 1Q5WB 4KIKB 3VH4B 4WWOA 3JSVB 4KDIC 4ANWA 3SDLC 2HJ8A 4TKNA 2KFJA 5JZEB 4NAWA 1S1QB 3CMMB 2KDIA 3RD2A 2PEAA 3NY5A 2IYDB 4WWNA 3OAWA 2LVOA 3V60A 4HLEA 4LJOB 4W9KA 3N32A 4IWPA 1YJ1A 4URKA 3B0AA 4EZLA 1I35A 2WX1A 1OQYA 1OGWA 1SE9A 4BKGA 1PQSA 4AUQC 1WJ6A 1LQBA 2WWZA 4NJ7A 5C23A 3ZUNA 2AL6A 2O6VB 2LD9A 4AP4C 3DDCB 2ZVNA 3A9KA 4DHZB 2KDBA 4DHJD 5FR6A 2GBNA 2DZMA 4XC2A 2DZKA 4NJ6A 4FJYA 2NCNA 3JYUA 4W9DA 2HTHA 5L83A 3PT2B 4WWPA 4II2B 3V62A 1TTNA 1WXSA 2KTFA 2RGFA 3DVNU 4LDTB 3IBEA 4BOZB 2BYFA 3PLVA 4GSWA 2BKFA 3GOEA 3L10B 2WX0A 2K8BA 1BT0A 3UQAA 2EMSA 3D32A 1WXAA 3ML9A 5IAAC 4W9IA 3L17A 3QARA 2YLMA 3ML8A 2GBJA 1Y8RC 4RM8A 4XZ4A 3W1YA 1R4NI 3R66C 3VH3B 4XX5A 4K81A 4G0NB 1GUAB 3NOBA 1YX5B 1KM7A 4DBGA 3A4SC 4G50A 2BYEA 2NS5A 4B6WA 4KZ0A 4MGIE 3VUYA 1GJZA 1V86A 4MH0E 3V61A 4EEWA 2M1MA 2K6DB 4MSMB 4W9JA 2L8JA 3JVZX 2XK5A 3MHSD 5LXHA 2KK8A 4AJWA 2D10A 2KX3A 2M0XA 2KNBA 2L7RA 1V49A 2ZEQA 3VTVA 3IHPC 4JIOU 4GDKB 2ZNVB 1V80A 3QX1A 3QK0A 2FNJB 2KZRA 3ALBA 3IVFA 5AZGA 4NNJB 1V5OA 1WYWB 1UD7A 1WE6A 1OEYA 2ZCBA 4DDID 1RFAA 3APFA 4NQKE 4E74A 1H8CA 2RD0A 2CU1A 1OTRB 3M63B 4A3PA 3PRZA 4GU2A 2FCNA 3TCAA 3DBSA 2KX0A 5DPWA 3K9PB 2K39A 2V1YA 2BF8B 2JRHA 4MEMA 4KDLB 4OVVA 3L0WB 4BKSA 3KW5B 2DZJA 3RULA 4JLCA 1WI0A 3AU5A 3KH0A 4DWFA 4F1SA 1EF5A 2KN5A 1WXMA 1L2NA 5G2NA 1TGZB 4KV2A 2B3AA 1WX7A 4CYEA 4NAWB 2FAZA 3WAPA 2N9EB 2NPTB 4K7UA 1J8CA 3DBRI 4NPNA 4FBJB 1IP9A 1IYFA 2IBIB 2ZCCA 3VTUA 2GBMA 3DCGA 2GOWA 2PPHA 2GMIC 3VHTC 2PJHA 4BBNC 3EHVA 4BFRA 2Y5BB 3KYDD 3ZNID 3HM3A 4IUMB 1C1YB 1WRDB 2LWPA 2IO1B 2MP2A 2GBRA 3A9JA 3R3MA 2I1KA 3WA0A 2QHOA 4HPLB 2N4FA 2KTRA 1UBIA 3M3JA 4EZJA 4TUUA 3N30A 4MJSA 4MGZE 1RAXA 3PPAA 3RZFA 4AWJA 4TQ1A 4ZRJA 3QJZA 1OEYJ 4LDTD 2JRIB 1FXTB 3PZDA 5HKHA 3AXCA 4M8MA 1C3TA 3TL5A 2C7NB 1U4AA 5J2RA 1NI2A 3UGBB 2Z0DB 3UIOB 3H7SA 1ZW7A 2LGDA 4NQLB 4GIVA 4DXAB 1UH6A 1WE7A 3ZDTA 3L13A 4W9EA 4M8NA 3QIJA 2L76A 4W9LA 5E6OA 3H7PA 2RPQA 2KWCA 5J17A 2DYMA 1WJUA 2JY6A 4K7WA 4AOFA 3WAMA 3CSTA 3QAQA 2L05A 2KTRB 2KC2A 3M62B 4WJPA 3A33B 3U30A 3UINB 1WM3A 2OJRA 4B9KA 4MGKE 2G45B 2N7EA 5JHAA 1J19A 2KWUB 2V3SA 4F8CB 1WJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K1F A;  2BGF A;  2MLB A;  3OJ4 B;  3H7P B;  4FHJ A;  1HE8 A;  2JZZ A;  1VCB A;  1EO6 A;  3NZU A;  1XT9 B;  2C60 A;  5BO4 B;  3TMP B;  1WX9 A;  5LXI B;  3UQB A;  3KUZ A;  2BKR B;  4E71 A;  3K9O B;  3QCA A;  3PGE A;  2LRU A;  2PE9 A;  4AJY B;  1L7Y A;  3RCZ A;  1E5W A;  2KLG A;  2O6V A;  1GC7 A;  2IO2 B;  3I3T B;  1WF9 A;  4BKT A;  2RR9 A;  2KFK B;  4BVU C;  1WZ3 A;  2DYB A;  3ZIM A;  2M4N A;  3SHQ A;  3ZKJ C;  1LFD A;  4HVB A;  3KUD B;  2MSE D;  4IG7 B;  1V6E A;  1J0G A;  2AEH A;  1RLF A;  2Z59 B;  4NY0 A;  5GMV A;  2G3Q B;  4ZDV A;  2DX5 B;  2PE6 B;  4F7Z A;  2C7M B;  2WYQ A;  2ZNV C;  1V9J A;  2ZVO A;  3L08 A;  1ISN A;  2O6V D;  2NBU A;  2D11 A;  3IFW B;  3L54 A;  2REX A;  3QHT A;  4KSL C;  5JH5 C;  2KJH B;  4B95 A;  4P7I A;  2HE7 A;  1YX6 B;  2KO3 A;  4KIK A;  2KDE B;  4CHK A;  5EDS A;  3O65 B;  5CX3 A;  4ZRK A;  3M95 A;  3DBH I;  2KKC A;  2XK5 B;  3PRM B;  4MM3 A;  3A4R A;  3VVW B;  3ECI A;  5E6P A;  3AUL A;  2KJ6 A;  3MTN B;  2EKE C;  2VRR B;  2YVC A;  3Q3F A;  1S3S G;  2KWV B;  2UYZ B;  1E8Z A;  1SGH A;  3VTW A;  5CHV C;  5D2M B;  3VQI A;  3N3K B;  4GOC A;  5D94 A;  4IM2 A;  3VDZ A;  1D3Z A;  3ZRF A;  5DPS A;  4ZYN A;  4EFO A;  2J0J A;  1EUV B;  4RM9 A;  3AI5 A;  3EFU A;  3HK0 A;  3RT3 B;  2D2Q A;  5KHQ A;  1E90 A;  4GN1 A;  4HCN B;  4A20 A;  4IWQ A;  4HPM B;  2KVR A;  2J7Q B;  1GG3 A;  4PS3 A;  2KMA A;  3B1L X;  2O2V A;  3QQ8 B;  5CTR C;  3ZLZ A;  2LRW A;  4E3C A;  4PYU A;  2R2Q A;  1Z2M A;  1V5T A;  5E6N A;  4GXB A;  3ZTC A;  2UWQ A;  3DVG Y;  2G4S A;  1WGH A;  2N9X A;  2NVU I;  3ZNG C;  4BBN F;  1MG8 A;  4ZRI A;  3WAL A;  4ICV A;  5G55 A;  1IPG A;  3TBL D;  2KLC A;  1UZX B;  2DEN B;  4WJO A;  4EKU A;  2K6Q A;  2MBH A;  2M17 A;  4FJZ A;  1P3Q U;  2MQJ A;  2LI5 A;  3DVN V;  1M94 A;  3CSF A;  1UGM A;  2FCQ A;  3MJW A;  2FCM A;  1K8R B;  2CKH B;  3T9L A;  2N1W A;  4LCD E;  2W9N A;  5AZF A;  2LGY A;  1V2Y A;  1KJT A;  1XD3 B;  4I6L B;  1XQQ A;  5DCN A;  2KDF B;  2JT4 B;  1NDD A;  1JRU A;  3ZNH B;  2D3G A;  1P98 A;  3JSV A;  1YIW A;  4BKS D;  1E8X A;  4FAD A;  4G3X B;  4TQ0 A;  2AYO B;  3EC8 A;  1E8Y A;  1V81 A;  4GDL A;  3PSE B;  2KMC A;  2KAN A;  4FUL A;  4MDK E;  5DPR A;  3TJP A;  2DHZ A;  2IO0 B;  3V6C B;  2K8C A;  2A5U A;  4HWI B;  4J6I A;  2LVP A;  2MCN B;  2LXC A;  4IM3 A;  1E8W A;  4M0W B;  3PHX B;  3Q3J A;  1WGG A;  3VFK A;  3ZDM C;  3A9K B;  2XEW A;  2L0F A;  3PRP B;  3ENE A;  3U8Z A;  3ZVV A;  4DDG D;  4RMA A;  1WIA A;  3BY4 B;  4FN2 A;  4DHJ B;  1LXD A;  1Q1O A;  1GNU A;  1R4M I;  4FHK A;  1WGR A;  2N9P C;  2V4L A;  2C9W B;  4I6P A;  2R2O A;  4WAA A;  2LXA A;  1QZE A;  2FCS A;  2IY1 B;  3W1S A;  4PS7 A;  1Q0W B;  2ZPY A;  2JPH A;  2MRP A;  4TV3 A;  4N9F 4;  2KQ7 A;  2MW5 A;  2DYO A;  4II3 B;  2MBO A;  3W1S C;  3DPD A;  2K25 A;  1WJ4 A;  3VUW A;  3X0W A;  3QC8 B;  3UF8 A;  1SIF A;  2OOB B;  3IG3 A;  3JW0 X;  4W9G A;  3SU8 X;  2DAF A;  2L3Z A;  2WDT B;  2RSU A;  1YQB A;  3HHM A;  3OLM D;  3ZNZ B;  1G6J A;  1TBE A;  3VAW A;  4BOS C;  4WQO B;  1A5R A;  2MA9 B;  4KVG B;  4GMV A;  4I6N B;  4ICU A;  2JUO A;  2ZPN A;  3LDZ E;  3RYT A;  4W9F A;  3T8M A;  1WR6 E;  3X23 A;  2BYV E;  2JZ3 B;  3PV1 A;  2NBV B;  4KSK C;  4ANU A;  2EMT A;  2LAS A;  2HD5 B;  1CMX B;  2K8H A;  4HCP B;  1I42 A;  3WAN A;  3UIP B;  3DQV A;  4DHZ E;  2MX2 A;  1WMH A;  2NBW B;  3KYC D;  1AAR A;  5C1Z A;  2FIF A;  2A4Z A;  2I1J A;  5CHF A;  3VXW A;  3LJ3 A;  1WR1 A;  2KQS A;  2IY0 B;  1WFY A;  4W9H A;  4PS8 A;  2ASQ A;  2LVQ A;  3PVL A;  4HK2 A;  1WMH B;  1WXV A;  4JL9 A;  4WJQ A;  4OVU A;  1WX8 A;  1UEL A;  2JF5 A;  1WH3 A;  1P0R A;  1YD8 U;  4CO7 A;  2N1V A;  2LUE A;  5DPT A;  2BWF A;  2MWS B;  4W9C A;  3A1Q B;  2Z0E B;  3PRE A;  1E7V A;  3DVG X;  3NHE B;  4FLH A;  5CHW A;  3RUI B;  2LZ6 A;  2CS4 A;  2IZV B;  1UBQ A;  5J18 A;  4HXD A;  4MGY E;  2KXJ A;  4JQW C;  2C5L C;  3VUX A;  4LJP B;  3NZS A;  4IWO A;  2LGX A;  2XBB C;  2KHW B;  2N7D A;  3APC A;  4MEL A;  5L95 C;  1RRB A;  3DBL I;  2CHZ A;  2KOX A;  4MSQ B;  3S2A A;  3RZW C;  2C7H A;  1EF1 A;  1X1M A;  4FJV B;  2FUH B;  1WGD A;  4HDO A;  3R7R A;  1VD2 A;  4ASW C;  2J0M A;  3QA8 A;  4WJN A;  4EZK A;  2ZZP B;  2AWT A;  1KOT A;  2MBE A;  1ZKH A;  1TZ1 A;  2M8S A;  3PTF C;  4HDQ A;  3KUC B;  3SD5 A;  5LLI A;  3APD A;  4G11 A;  3TIX A;  1NBF C;  3WIM A;  4K1R B;  5JHB A;  5D6J B;  2IO3 B;  2BWE S;  3ZTD A;  3H1U A;  1LM8 B;  2JWZ A;  3AU4 A;  4PYZ A;  5AZH A;  1GC6 A;  3B08 A;  3PS6 A;  2CHX A;  5IA7 A;  3A1Q A;  2KFK A;  2D07 B;  4KZC A;  1Z5S B;  4EOY A;  4A3O A;  2GBK A;  2NR2 A;  3U7D A;  2CHW A;  4FA6 A;  4GDK A;  2CR5 A;  2KJR A;  3BIN A;  3ONS A;  4X57 B;  3C0R B;  3OJ3 A;  5AEK B;  4K7S A;  4ANX A;  4ANV A;  3ZW3 A;  4YL8 A;  4EUT A;  3GZN I;  2O2V B;  3PHW B;  2FID A;  2BPS A;  4HJK A;  1KLV A;  4GDL B;  5TR5 A;  5KHO A;  4DK5 A;  1F9J A;  4GB9 A;  1WGY A;  2MBB B;  2NPT A;  1WM2 A;  3HM6 X;  3R7Q A;  4MJS B;  4GGQ A;  1WY8 A;  5D7G A;  3NS8 A;  4IW0 A;  3ZRC A;  3DOW A;  3WAO A;  4IM0 A;  3EEC A;  2MP2 B;  2DZI A;  3A9J B;  3H6N A;  2L00 B;  1WZ0 A;  3KVF B;  3L16 A;  3ZO5 B;  3P2B A;  2ZJD A;  2KD0 A;  4JGH B;  1E7U A;  2G4D B;  3PLU A;  2JXX A;  2MBQ A;  3CF6 E;  3V6E B;  2L0T A;  3HIZ A;  4IC7 B;  1ZGU B;  3H9D A;  1P1A A;  1T0Y A;  1P9D U;  2AL3 A;  2J0K A;  2JVC A;  1H4R A;  2KC1 A;  2DAJ A;  3QWZ B;  2LJ5 A;  1Q5W B;  4KIK B;  3VH4 B;  4WWO A;  3JSV B;  4KDI C;  4ANW A;  3SDL C;  2HJ8 A;  4TKN A;  2KFJ A;  5JZE B;  4NAW A;  1S1Q B;  3CMM B;  2KDI A;  3RD2 A;  2PEA A;  3NY5 A;  2IYD B;  4WWN A;  3OAW A;  2LVO A;  3V60 A;  4HLE A;  4LJO B;  4W9K A;  3N32 A;  4IWP A;  1YJ1 A;  4URK A;  3B0A A;  4EZL A;  1I35 A;  2WX1 A;  1OQY A;  1OGW A;  1SE9 A;  4BKG A;  1PQS A;  4AUQ C;  1WJ6 A;  1LQB A;  2WWZ A;  4NJ7 A;  5C23 A;  3ZUN A;  2AL6 A;  2O6V B;  2LD9 A;  4AP4 C;  3DDC B;  2ZVN A;  3A9K A;  4DHZ B;  2KDB A;  4DHJ D;  5FR6 A;  2GBN A;  2DZM A;  4XC2 A;  2DZK A;  4NJ6 A;  4FJY A;  2NCN A;  3JYU A;  4W9D A;  2HTH A;  5L83 A;  3PT2 B;  4WWP A;  4II2 B;  3V62 A;  1TTN A;  1WXS A;  2KTF A;  2RGF A;  3DVN U;  4LDT B;  3IBE A;  4BOZ B;  2BYF A;  3PLV A;  4GSW A;  2BKF A;  3GOE A;  3L10 B;  2WX0 A;  2K8B A;  1BT0 A;  3UQA A;  2EMS A;  3D32 A;  1WXA A;  3ML9 A;  5IAA C;  4W9I A;  3L17 A;  3QAR A;  2YLM A;  3ML8 A;  2GBJ A;  1Y8R C;  4RM8 A;  4XZ4 A;  3W1Y A;  1R4N I;  3R66 C;  3VH3 B;  4XX5 A;  4K81 A;  4G0N B;  1GUA B;  3NOB A;  1YX5 B;  1KM7 A;  4DBG A;  3A4S C;  4G50 A;  2BYE A;  2NS5 A;  4B6W A;  4KZ0 A;  4MGI E;  3VUY A;  1GJZ A;  1V86 A;  4MH0 E;  3V61 A;  4EEW A;  2M1M A;  2K6D B;  4MSM B;  4W9J A;  2L8J A;  3JVZ X;  2XK5 A;  3MHS D;  5LXH A;  2KK8 A;  4AJW A;  2D10 A;  2KX3 A;  2M0X A;  2KNB A;  2L7R A;  1V49 A;  2ZEQ A;  3VTV A;  3IHP C;  4JIO U;  4GDK B;  2ZNV B;  1V80 A;  3QX1 A;  3QK0 A;  2FNJ B;  2KZR A;  3ALB A;  3IVF A;  5AZG A;  4NNJ B;  1V5O A;  1WYW B;  1UD7 A;  1WE6 A;  1OEY A;  2ZCB A;  4DDI D;  1RFA A;  3APF A;  4NQK E;  4E74 A;  1H8C A;  2RD0 A;  2CU1 A;  1OTR B;  3M63 B;  4A3P A;  3PRZ A;  4GU2 A;  2FCN A;  3TCA A;  3DBS A;  2KX0 A;  5DPW A;  3K9P B;  2K39 A;  2V1Y A;  2BF8 B;  2JRH A;  4MEM A;  4KDL B;  4OVV A;  3L0W B;  4BKS A;  3KW5 B;  2DZJ A;  3RUL A;  4JLC A;  1WI0 A;  3AU5 A;  3KH0 A;  4DWF A;  4F1S A;  1EF5 A;  2KN5 A;  1WXM A;  1L2N A;  5G2N A;  1TGZ B;  4KV2 A;  2B3A A;  1WX7 A;  4CYE A;  4NAW B;  2FAZ A;  3WAP A;  2N9E B;  2NPT B;  4K7U A;  1J8C A;  3DBR I;  4NPN A;  4FBJ B;  1IP9 A;  1IYF A;  2IBI B;  2ZCC A;  3VTU A;  2GBM A;  3DCG A;  2GOW A;  2PPH A;  2GMI C;  3VHT C;  2PJH A;  4BBN C;  3EHV A;  4BFR A;  2Y5B B;  3KYD D;  3ZNI D;  3HM3 A;  4IUM B;  1C1Y B;  1WRD B;  2LWP A;  2IO1 B;  2MP2 A;  2GBR A;  3A9J A;  3R3M A;  2I1K A;  3WA0 A;  2QHO A;  4HPL B;  2N4F A;  2KTR A;  1UBI A;  3M3J A;  4EZJ A;  4TUU A;  3N30 A;  4MJS A;  4MGZ E;  1RAX A;  3PPA A;  3RZF A;  4AWJ A;  4TQ1 A;  4ZRJ A;  3QJZ A;  1OEY J;  4LDT D;  2JRI B;  1FXT B;  3PZD A;  5HKH A;  3AXC A;  4M8M A;  1C3T A;  3TL5 A;  2C7N B;  1U4A A;  5J2R A;  1NI2 A;  3UGB B;  2Z0D B;  3UIO B;  3H7S A;  1ZW7 A;  2LGD A;  4NQL B;  4GIV A;  4DXA B;  1UH6 A;  1WE7 A;  3ZDT A;  3L13 A;  4W9E A;  4M8N A;  3QIJ A;  2L76 A;  4W9L A;  5E6O A;  3H7P A;  2RPQ A;  2KWC A;  5J17 A;  2DYM A;  1WJU A;  2JY6 A;  4K7W A;  4AOF A;  3WAM A;  3CST A;  3QAQ A;  2L05 A;  2KTR B;  2KC2 A;  3M62 B;  4WJP A;  3A33 B;  3U30 A;  3UIN B;  1WM3 A;  2OJR A;  4B9K A;  4MGK E;  2G45 B;  2N7E A;  5JHA A;  1J19 A;  2KWU B;  2V3S A;  4F8C B;  1WJN A; 
#chains in the Genus database with same CATH topology
 4C4V A;  1PDX A;  1Q10 A;  2MLB A;  1ENF A;  1VCB A;  2WP9 B;  3NJT A;  1JRO A;  5JXV A;  2BT6 A;  3K9O B;  2IPK D;  2PE9 A;  2QIL A;  4AJY B;  1E5W A;  1IGC A;  2GB1 A;  1KH0 A;  3AV8 A;  1WZ3 A;  3KQ4 A;  4BVU C;  3ZIM A;  3SHQ A;  4HVB A;  5FR3 A;  2MSE D;  2ON8 A;  4IG7 B;  1J0G A;  2JU6 X;  1RLF A;  2Z59 B;  4NY0 A;  4ZDV A;  4F7Z A;  3LYY A;  1FXA A;  1ZXH A;  3HRD D;  2REX A;  5JH5 C;  2HE7 A;  1GOZ A;  1YX6 B;  4KIK A;  1GB4 A;  5EDS A;  1QQR A;  3DBH I;  3M95 A;  2XK5 B;  3VVW B;  3ECI A;  3AUL A;  2QDF A;  2KJ6 A;  3MTN B;  2ACZ B;  2EKE C;  1I4P A;  4M00 A;  2OHF A;  3W9C B;  3SR6 A;  1SGH A;  5CHV C;  4IM2 A;  3FIL B;  1YQ4 B;  5DPS A;  5EE3 A;  4ZYN A;  2NTS A;  4EFO A;  4RM9 A;  3HK0 A;  3VR9 B;  1SSN A;  2PVO D;  4HCN B;  4A20 A;  1FPY A;  2J7Q B;  4TMA B;  2H89 B;  3R8B A;  3ZLZ A;  2LRW A;  2KAJ A;  5E6N A;  4GXB A;  2UWQ A;  3DVG Y;  2G4S A;  1MG8 A;  3FKY A;  5G55 A;  1IPG A;  5C3J B;  3TBL D;  2LGI A;  4WJO A;  4EKU A;  2MBH A;  1PFD A;  1P3Q U;  1VZ7 A;  3GZN B;  2LI5 A;  3DVN V;  4IKG A;  1NYQ A;  3CSF A;  2FCM A;  3T9L A;  3NVW A;  1PGB A;  2LGY A;  1V2Y A;  2KAC A;  1F0Z A;  2JT4 B;  2D3G A;  4FAD A;  4G3X B;  1SIJ A;  3AEF B;  1J7B A;  2KMC A;  2DBY A;  2IO0 B;  1ET9 A;  5BMI A;  2K5P A;  4HWI B;  2LVP A;  4IM3 A;  4M0W B;  3PHX B;  3Q3J A;  1WGG A;  3A9K B;  4HRO A;  2L0F A;  1KLU D;  3E56 A;  2WXJ A;  3MC9 A;  3ZVV A;  4RMA A;  1QOA A;  1LXD A;  4FHK A;  4M02 A;  1L6U A;  4WAA A;  2LXA A;  2FCS A;  4OZC A;  1ZP0 B;  4US9 A;  1Q0W B;  2ZPY A;  3GE3 C;  4N9F 4;  2DYO A;  4ZHO A;  1WWT A;  2OOB B;  4W9G A;  2DAF A;  2L3Z A;  1RM6 C;  1G6J A;  3VAW A;  3BK2 A;  3R2T A;  1A5R A;  1OFF A;  4KVG B;  4GMV A;  4I6N B;  4ICU A;  4YTP B;  2ZPN A;  1RYJ A;  2KVZ A;  2BYV E;  2JZ3 B;  3BK1 A;  1T5X D;  4ANU A;  2HD5 B;  3DHH C;  4HCP B;  3SEB A;  3HVD A;  3DQV A;  1N5W A;  4B0E A;  5C1Z A;  1I4R A;  4W9H A;  4PS8 A;  1WYG A;  1WMH B;  4JL9 A;  2EKI A;  1UEL A;  1WH3 A;  4XDC A;  4CO7 A;  3TEX A;  1SE3 A;  5DPT A;  2MWS B;  2KT7 A;  2Z0E B;  3PRE A;  3DVG X;  4FLH A;  5CHW A;  2LZ6 A;  2KXJ A;  2WXH A;  4JQW C;  2WLB A;  3VUX A;  4LJP B;  2BB6 A;  4YTM B;  2XBB C;  2N7D A;  2RMM A;  4MEL A;  5L95 C;  1RRB A;  3RPF C;  3DBL I;  2C7H A;  2FUH B;  1WGD A;  3ZGZ A;  3ZXR A;  4Q2J A;  1P7E A;  4WJN A;  2AWT A;  3ZQ4 A;  3PTF C;  4HDQ A;  1TS2 A;  3V05 A;  1F2R I;  3TIX A;  3WIM A;  5BMH A;  1DOY A;  1ACC A;  1PGA A;  3B08 A;  2KDM A;  3A1Q A;  2BB5 A;  1JWM D;  4EOY A;  2NR2 A;  2QCZ A;  2KJR A;  4K7S A;  2V9H A;  1N61 A;  2FID A;  1KLV A;  5TR5 A;  1XO3 A;  3DHI C;  1WGY A;  3SFD B;  2WXP A;  1TZO A;  1QT9 A;  1YN5 A;  4IW0 A;  3ZRC A;  2HTM E;  2L00 B;  1N62 A;  2K0P A;  3CF6 E;  2L0T A;  4WAF A;  3HIZ A;  3H9D A;  2JYT A;  3T3O A;  1AYF A;  4PT5 A;  2L32 A;  1HA5 A;  3OAW A;  2JX5 A;  4IWP A;  1XLQ A;  3IXS A;  4XE0 A;  1ESF A;  1WJ6 A;  2WWZ A;  3ZUN A;  3AED B;  2QJL A;  2GBN A;  2DZK A;  1I4X A;  2NCN A;  2HTH A;  3PT2 B;  3P4S B;  4WWP A;  4A6Q A;  4GSW A;  1K51 A;  2BKF A;  4KKI A;  1E9M A;  3RNG C;  3ML9 A;  3W1Y A;  4XZ4 A;  3KLS X;  1VZ8 A;  4XX5 A;  3P1M A;  4G0N B;  2I2Y A;  1KM7 A;  4DBG A;  4G50 A;  4KZ0 A;  3VUY A;  1I7H A;  3V61 A;  4EEW A;  4HJG E;  1FIQ A;  2LUM A;  2KX3 A;  1F1H A;  3IHP C;  1YOV B;  4JIO U;  2PMV A;  4GDK B;  1V5O A;  1OEY A;  1J7A A;  4EE2 A;  3APF A;  4NQK E;  1MPE A;  2V0G A;  2CU1 A;  4A3P A;  2FCN A;  3TCA A;  1ZDX A;  3AH7 A;  2DWQ A;  2KX0 A;  1UUP A;  2K9X A;  4ZRQ A;  3KW5 B;  2DZJ A;  2MHJ A;  1WI0 A;  4F1S A;  1L2N A;  2B3A A;  4NAW B;  2FAZ A;  2GI9 A;  3WAP A;  2WXK A;  3OG5 A;  3DBR I;  1E10 A;  3CWI A;  2GBM A;  1JRP A;  1TT5 B;  3DCG A;  4MM3 B;  3VHT C;  4LNI A;  1BXT A;  3J9C A;  4BFR A;  4L23 A;  1TY0 A;  2D3B A;  3KYD D;  2MEK A;  3HM3 A;  1C1Y B;  2MP2 A;  5IN7 A;  4TUU A;  3RZF A;  1OQR A;  4TQ1 A;  2KN4 A;  5G5H A;  1SBB B;  2JRI B;  3AEE B;  1C3T A;  2N0S B;  1NI2 A;  4C56 C;  3UGB B;  3AEB B;  1FM0 D;  3U2S C;  3ZDT A;  2CJN A;  1TYG B;  3QAQ A;  2R61 A;  3UIN B;  3VRA B;  5JHA A;  2KWU B;  3AM9 A;  2V4I B;  2BGF A;  3OJ4 B;  3H7P B;  2JZZ A;  3NZU A;  3TUO A;  5BO4 B;  2N9L A;  2BKR B;  3QCA A;  3PGE A;  2LRU A;  1L0Y B;  3RCZ A;  1C4P A;  1ROE A;  2IO2 B;  5H92 C;  1WF9 A;  4LLG M;  1I4H A;  3LXF A;  4YWG G;  1LFD A;  2DX5 B;  2C7M B;  2ZVO A;  2O6V D;  2NBU A;  2D11 A;  3IFW B;  3L54 A;  4A9A A;  5T8I A;  2M19 A;  2OED A;  2WXR A;  5CX3 A;  4ZRK A;  1SJH D;  3W5V B;  4LTU A;  2KWV B;  2UYZ B;  1TY2 A;  1XCT L;  2D3A A;  3VTW A;  4DXG A;  1TS5 A;  2WXF A;  3N3K B;  1D3Z A;  2MH7 A;  1VZ6 A;  1VJK A;  3ABV B;  1EUV B;  1XXG A;  3RT3 B;  2INC C;  1E90 A;  5KHQ A;  4PS3 A;  2KMA A;  3B1L X;  2O2V A;  3QQ8 B;  4PYU A;  1J7C A;  1R7S A;  1V5T A;  3ZTC A;  1JWS D;  3WAL A;  1BUI C;  4BZA A;  4HEA 1;  2KLC A;  1DGJ A;  4XDD A;  2DEN B;  1TKE A;  5HFY A;  2WXM A;  2J53 A;  4FJZ A;  3VRB B;  2ICI A;  3DBH B;  1K8R B;  2CKH B;  4REZ A;  4LCD E;  5AZF A;  1KJT A;  1SE2 A;  4RH6 A;  1P98 A;  3JSV A;  1YIW A;  3NVY A;  2G9H D;  4GDL A;  2QIE B;  2DHZ A;  3T3N A;  2WDR B;  2MCN B;  2B76 B;  1JWB D;  1UWM A;  1V8C A;  2ZW1 A;  1FMA D;  3AE1 B;  2WXO A;  4DXF A;  4XYC A;  4A8X C;  1UWX A;  2VH2 A;  1SB3 C;  1GNU A;  1KFY B;  2V4L A;  2R2O A;  3HVZ A;  1DYQ A;  3RNA C;  1QZE A;  4PS7 A;  4DQO C;  1ZE3 D;  4C80 A;  2VH1 A;  1EM7 A;  2MBO A;  1LGR A;  3QC8 B;  1SIF A;  3IG3 A;  4DDI D;  3OLM D;  3HHM A;  4WQO B;  3FIL A;  2MA9 B;  4MT5 A;  4JPS A;  2FUG 1;  3RNC C;  1T0S C;  4W9F A;  1WR6 E;  4KSK C;  1L4Z B;  3KYC D;  2FIF A;  5CHF A;  3VXW A;  2FE8 A;  2KQS A;  2IY0 B;  1ZPS A;  2WXQ A;  4HK2 A;  4WJQ A;  4OVU A;  2KQ4 X;  1YD8 U;  1JCK B;  3BYY B;  3A1Q B;  3DBR B;  3RUI B;  2IZV B;  3I5J C;  4MGY E;  1EU4 A;  3I57 A;  3NZS A;  4IWO A;  2LGX A;  3APC A;  2W82 A;  4YSY B;  2KOX A;  3S2A A;  3RZW C;  2OJW A;  1N60 A;  2LJI A;  1HTO A;  1C78 A;  4WUR A;  2FBW B;  3GB1 A;  1KOT A;  2MBE A;  1CQV A;  3KUC B;  1L0V B;  5LLI A;  3APD A;  2WU2 B;  5JHB A;  4K1R B;  2IO3 B;  2BWE S;  1ZOY B;  2JWZ A;  3O13 A;  1SF0 A;  1A70 A;  2IGH A;  1GC6 A;  3MC8 A;  2D07 B;  4KZC A;  1Z5S B;  4A3O A;  1FFU A;  4GDK A;  4X57 B;  3BIN A;  1GB1 A;  4ANV A;  2PIA A;  4EUT A;  3ZXV A;  3PHW B;  1QOF A;  2BPS A;  4GDL B;  2MBB B;  3HM6 X;  2BQQ A;  5FKA C;  4C4V B;  1MHH E;  3DOW A;  2V3N A;  3H6N A;  3A9J B;  1WZ0 A;  4BAX A;  3V6E B;  2JXX A;  1D6E C;  2QEJ C;  1P1A A;  3R2I A;  2AL3 A;  2J0K A;  1QOB A;  2JVC A;  1H4R A;  2DAJ A;  4KIK B;  3SDL C;  2HJ8 A;  1MI0 A;  3RD2 A;  2PEA A;  3NY5 A;  4JE3 B;  1HQR D;  2IYD B;  4HLE A;  2RDG A;  3N32 A;  1YJ1 A;  4URK A;  3B0A A;  4EZL A;  1UF0 A;  1OQY A;  1SE9 A;  1PQS A;  1AN8 A;  4NJ7 A;  1STE A;  4RF1 A;  5FR6 A;  4XC2 A;  1M4V A;  3JYU A;  5L83 A;  4AQ7 A;  4YXD B;  2W3S A;  3V62 A;  1TTN A;  4LDT B;  3IBE A;  2BYF A;  3PLV A;  1T0R C;  2WX0 A;  1NI3 A;  4ACF A;  2EMS A;  4RGN A;  1WXA A;  3L17 A;  4RM8 A;  2YLM A;  3ML8 A;  1R4N I;  2ZW0 A;  1GUA B;  1FO4 A;  1YX5 B;  4B6W A;  3FC4 A;  2BYE A;  2NS5 A;  1GJZ A;  4MGI E;  4YSX B;  1FNV A;  2M1M A;  2WDV B;  1NYR A;  4AJW A;  3V3X A;  2M0X A;  3VTV A;  3QK0 A;  2KZR A;  2J4X A;  3ALB A;  5AZG A;  4NNJ B;  1JAL A;  1H8C A;  1RFA A;  2D3C A;  3PRZ A;  3GE8 C;  5BYS A;  2IGG A;  3E9S A;  5DPW A;  1B9R A;  1IBX A;  3K9P B;  2BYT A;  2BF8 B;  4BKS A;  3N1Z C;  4KDL B;  3L0W B;  3RUL A;  3AU5 A;  1IGD A;  3Q69 A;  5G2N A;  5LNK 1;  2N9E B;  4B0M A;  1J8C A;  5AUI A;  4NPN A;  1IP9 A;  1IYF A;  3EA6 A;  2PPH A;  5MPO A;  4P16 A;  2WXG A;  3AEA B;  2IO1 B;  1UGJ A;  1PYW D;  2KTR A;  3M3J A;  1C4C A;  2QSD A;  3Q8F A;  3NRZ A;  3QJZ A;  1OEY J;  1TS3 A;  3IAS 1;  1ZXI A;  3TL5 A;  2V3P A;  1VR9 A;  1U4A A;  1EU3 A;  1HZ5 A;  1T0Q C;  4ZOH C;  3H7S A;  1ZW7 A;  2LGD A;  4GIV A;  1UH6 A;  1MVK A;  2BS3 B;  3QIJ A;  2Y5P A;  2L76 A;  2CJO A;  4W9L A;  5E6O A;  3H7P A;  2RPQ A;  2KWC A;  2DYM A;  2JY6 A;  4AOF A;  2HJ1 A;  2L05 A;  3WCQ A;  3M62 B;  4WJP A;  1QF6 A;  4B9K A;  2OJR A;  4XWW A;  2G45 B;  2N7E A;  4ITK A;  1J19 A;  4F8C B;  2Z8L A;  4S0R A;  2E3T A;  1EO6 A;  1T3Q A;  4L2Y A;  2C60 A;  1WX9 A;  3KUZ A;  3BVG A;  4E71 A;  4HKZ E;  4H2A A;  2KLG A;  3Q14 C;  1GC7 A;  4BKT A;  3W2D A;  2KFK B;  2DYB A;  2M4N A;  3ZKJ C;  1I4G A;  1TKY A;  2UU7 A;  2AEH A;  1R4M B;  2PE6 B;  2WYQ A;  2ZNV C;  3HUI A;  4KGS A;  4O1N A;  1MHX A;  2XNA C;  4C7Y A;  3P4P B;  5HHD G;  3QHT A;  4KSL C;  2X38 A;  2KJH B;  3Q8B A;  4B95 A;  3O65 B;  2KKC A;  4MH8 A;  4MM3 A;  3A4R A;  5E6P A;  4C00 A;  3TEW A;  1WRI A;  2VRR B;  2YVC A;  1N5X A;  3Q3F A;  1E8Z A;  4IOI E;  5D94 A;  3VDZ A;  1V1P B;  1T6B X;  1AWD A;  2LGS A;  1HZ6 A;  3AI5 A;  4GN1 A;  4IWQ A;  4HPM B;  1GG3 A;  4A55 A;  4E3C A;  5CTR C;  1B1Z A;  3L4P A;  2R2Q A;  1Z2M A;  1WGH A;  2NVU I;  3ZNG C;  4BBN F;  4ZRI A;  1WSP A;  1RFK A;  1XCQ L;  1RWS A;  2K6Q A;  2M17 A;  1PUT A;  2MQJ A;  2VZK D;  3FAH A;  1M94 A;  1UGM A;  5IO9 A;  4OZA A;  4XWT A;  2N1W A;  1KTK A;  2W9N A;  1I4Q A;  4NZL B;  4USA A;  1CZP A;  1JRU A;  1F77 A;  3AEG B;  2LHE A;  4BKS D;  1E8X A;  3Q3M C;  4TQ0 A;  1V81 A;  3IT6 B;  3PSE B;  5DPR A;  4FUL A;  3TJP A;  4MDK E;  1KF6 B;  5EE1 A;  3V6C B;  4JX1 C;  2A5U A;  4J6I A;  2X8X X;  2WQY B;  1KLG D;  2LXC A;  1E8W A;  1TIF A;  1V1O A;  2W54 A;  3RFZ B;  3VFK A;  3ZDM C;  3BVZ A;  4RNA A;  2E6X A;  2BS4 B;  3ENE A;  3BY4 B;  4L1B A;  4DHJ B;  1R4M I;  2N9P C;  2C9W B;  3DWM A;  3W1S A;  1L0X B;  2Q5W D;  1L6V A;  1MG4 A;  2KQ7 A;  4II3 B;  3W1S C;  2K25 A;  3VUW A;  4NJC A;  2WXL A;  2RPV A;  3RNB C;  4DWF A;  1YQB A;  3ZNZ B;  2JUO A;  2NTT A;  1E0Z A;  2MJ3 A;  3PV1 A;  2NBV B;  2J52 A;  1XLN A;  3U7Z A;  3BVM A;  1CMX B;  2K8H A;  1I42 A;  3WAN A;  1IUE A;  1AAR A;  2KWD A;  4OZB A;  2A4Z A;  3AEC B;  1FD6 A;  1WR1 A;  2Y3A A;  2ASQ A;  1V97 A;  3PVL A;  5AUK A;  3EFC A;  2W55 A;  1WXV A;  2KYW A;  2JF5 A;  4UDU C;  2BWF A;  1E7V A;  5J18 A;  2CS4 A;  1UBQ A;  4RF0 A;  4HXD A;  2C5L C;  4OHJ A;  1XLO A;  1EF1 A;  4KX6 B;  4HDO A;  3BZD B;  1VD2 A;  4ASW C;  1Y56 A;  4EZK A;  5EE0 A;  2JQR B;  4JWS C;  1TZ1 A;  3SD5 A;  2DNF A;  2QMT A;  2K3U A;  1NBF C;  1SJE D;  5D6J B;  3ZTD A;  3H1U A;  2RDB C;  5AZH A;  2CHX A;  3ZYY X;  4J3O D;  2KFK A;  2IGD A;  3AE3 B;  3U7D A;  2CHW A;  3UI3 A;  1KRH A;  5AEK B;  2WU5 B;  3ZW3 A;  2INP E;  4YL8 A;  2O2V B;  4HJK A;  2CU3 A;  4DK5 A;  3N1Y C;  3AE6 B;  4GB9 A;  5D3D A;  2NPT A;  4US8 A;  3R7Q A;  1NVI D;  4LNF A;  2GLS A;  5D7G A;  3N1X C;  2BTE A;  3WAO A;  2MP2 B;  2DZI A;  3KVF B;  2KD0 A;  1E7U A;  4IC7 B;  3AB5 A;  1T0Y A;  1P9D U;  2VZK B;  1Q5W B;  3AE8 B;  4YT0 B;  1N63 A;  1VDV A;  3VH4 B;  4WWO A;  3JSV B;  4KDI C;  5JZE B;  2KFJ A;  1C79 A;  1YMH E;  3MP9 A;  4NAW A;  1S1Q B;  1HEZ E;  4WWN A;  4LJO B;  2W3R A;  1I35 A;  4A90 A;  4XGA B;  1OGW A;  1XLP A;  4AUQ C;  1LQB A;  3KWL A;  1QIL A;  4AP4 C;  2ZVN A;  4DHZ B;  2GRI A;  2PKO A;  1FCL A;  4C7Z A;  3B2F A;  4II2 B;  1WXS A;  2RGF A;  2D5G A;  4BOZ B;  3L10 B;  1BT0 A;  3UQA A;  3IAM 1;  3D32 A;  5IAA C;  4W9I A;  4NAM A;  1JWA D;  2GBJ A;  2J42 A;  4K81 A;  1K50 A;  3NOB A;  3OWE B;  3AMZ A;  1VLB A;  2L8J A;  3JVZ X;  2TSS A;  2XK5 A;  3MHS D;  1ZDV A;  2ZEQ A;  4KKJ A;  4RGM A;  1SEB D;  1V80 A;  3QX1 A;  3IVF A;  1WE6 A;  4E74 A;  3TEY A;  4ZRP A;  2WS3 B;  2MJE A;  1OTR B;  3M63 B;  5HG2 A;  1K53 A;  2MJD A;  3DBS A;  2K39 A;  1SXT A;  3TSS A;  2WXN A;  3KH0 A;  2KN5 A;  1E7P B;  1WXM A;  1WX7 A;  5E6J A;  3RNF C;  2NPT B;  4K7U A;  4HKQ A;  2I38 A;  5D3I B;  3C19 A;  3VTU A;  5BYQ A;  2GOW A;  3PZ8 A;  2PJH A;  4BBN C;  3EHV A;  4AS1 A;  1GPX A;  2Y5B B;  4IUM B;  4QAY A;  2JXT A;  2GBR A;  1E6E B;  3B9J A;  3R3M A;  3NVV A;  2QHO A;  4EZJ A;  1UBI A;  4LNN A;  3ZJU A;  3N30 A;  4MGZ E;  3C8Y A;  1RAX A;  3PPA A;  1HTQ A;  4AWJ A;  4ZRJ A;  1FCC C;  2IJ0 A;  4LDT D;  1FXT B;  3PZD A;  3AXC A;  3IT4 B;  4LK0 M;  3Q8A A;  4M8M A;  3DHG C;  3BII D;  5TSS A;  1MJD A;  5J2R A;  5IOI A;  1QKZ A;  2DLB A;  3UIO B;  4KGT A;  4NQL B;  2L1A A;  3LB8 C;  4W9E A;  4ZYS A;  5J17 A;  1WJU A;  4K7W A;  3CST A;  2WNM A;  5C2T B;  2YEP F;  2N7J A;  2PW9 A;  2M56 B;  2K1F A;  3EGR A;  4FHJ A;  1R4N B;  1HE8 A;  4OW0 A;  1XT9 B;  3TMP B;  2INN E;  5LXI B;  2L83 A;  3UQB A;  2JWU A;  1YJJ A;  3RNE C;  1L7Y A;  2JYE A;  2O6V A;  3I3T B;  2RR9 A;  1IBX B;  3KUD B;  1V6E A;  2G3Q B;  1YQ3 B;  5FK9 C;  1V9J A;  3L08 A;  4ARI A;  1ISN A;  1F52 A;  3MJ5 A;  4P7I A;  2KO3 A;  2KDE B;  1K52 A;  4CHK A;  4HPP A;  5BMG A;  4P1B C;  2H88 B;  3PRM B;  2XN9 C;  1S3S G;  5HI1 A;  5D2M B;  3VQI A;  4GOC A;  1FRR A;  3ZRF A;  4P1C C;  2J0J A;  3EFU A;  2D2Q A;  3AE9 B;  4M01 A;  2KVR A;  4D2K A;  1CK1 A;  4PK1 A;  2N9X A;  3H8H A;  1D5Z C;  4ICV A;  1TKG A;  3PZ7 A;  1UZX B;  3KWV A;  3AE7 B;  2BW2 A;  1EWY C;  2SEB D;  4N59 A;  2FCQ A;  1QOG A;  1F2R C;  3MJW A;  3Q3O C;  1JW9 D;  3P4Q B;  4M0W A;  2RDH A;  1XD3 B;  4I6L B;  1XQQ A;  5DCN A;  3MFG A;  2KDF B;  1NDD A;  3ZNH B;  2AQ2 B;  2AYO B;  3EC8 A;  1E8Y A;  2KAN A;  2K8C A;  2LHD A;  1FNU A;  1TJE A;  2XEW A;  2K22 A;  3PRP B;  1JQ4 A;  4N58 A;  4TSS A;  3U8Z A;  4DDG D;  1WIA A;  4FN2 A;  1Q1O A;  5BYR A;  3GP7 A;  3I9V 1;  1WGR A;  4LNK A;  4R3D A;  4YSZ B;  4I6P A;  1FEH A;  2IY1 B;  2AQ3 B;  4N6E B;  4WIP A;  2JPH A;  2MRP A;  1TS4 A;  1PGX A;  4TV3 A;  2MW5 A;  3DPD A;  1WJ4 A;  3X0W A;  3UF8 A;  3Q3N C;  3JW0 X;  3SU8 X;  2WDT B;  2RSU A;  1YN3 A;  1YJI A;  1TBE A;  1V1P A;  4BOS C;  2LMC A;  3MHZ A;  3AE4 B;  5GXG B;  2PVG C;  3LDZ E;  4WH4 A;  3RYT A;  2IDY A;  2SAK A;  3T8M A;  3X23 A;  4GLS C;  3P42 A;  2EMT A;  2LAS A;  2ONQ A;  4RFB A;  1GAQ B;  4RGO S;  3UIP B;  3NS1 A;  1SE4 A;  2MX2 A;  1WMH A;  4DHZ E;  1LO5 D;  2NBW B;  1FFV A;  2I1J A;  3NUH B;  3LJ3 A;  4ARC A;  1WFY A;  2LVQ A;  3U4E G;  1WX8 A;  1P0R A;  2N1V A;  2LUE A;  2HDE A;  3EUB 2;  4W9C A;  5GMV A;  3NHE B;  4LNO A;  4WWM A;  3RI7 C;  1NEN B;  2KHW B;  4ZHP A;  3CIR B;  4OVZ A;  2CHZ A;  3B2G A;  1D5X C;  4MSQ B;  3URY A;  1X1M A;  4FJV B;  3R7R A;  1MFW A;  1VRA B;  4KGR A;  2J0M A;  3PO0 A;  3QA8 A;  2ZZP B;  1ZKH A;  2M0A A;  2M8S A;  3Q8C A;  2BS2 B;  4G11 A;  3I63 C;  3MC0 B;  2KMM A;  1FXI A;  2WDQ B;  2WXI A;  1LM8 B;  3AU4 A;  4PYZ A;  3PS6 A;  5IA7 A;  3BYT B;  4JWU C;  2GBK A;  4FA6 A;  2CR5 A;  4P6V F;  3ONS A;  3C0R B;  3OJ3 A;  1QLB B;  4ANX A;  3GZN I;  1D4B A;  4IDI A;  1P7F A;  5KHO A;  1F9J A;  2Y5C A;  1WM2 A;  4RGT A;  4MJS B;  4GGQ A;  1WY8 A;  3NS8 A;  4K3C A;  4IM0 A;  3EEC A;  3L16 A;  3ZO5 B;  3P2B A;  2ZJD A;  4JGH B;  2G4D B;  3PLU A;  2MBQ A;  2PLP A;  1ZGU B;  1XEE A;  2JZP A;  2WHI A;  2LEK A;  3GS2 A;  1DOX A;  2KC1 A;  3QWZ B;  2LJ5 A;  3N9Y C;  3ETR A;  4ANW A;  4TKN A;  3ZJV A;  1C4A A;  3W5U B;  3ZJT A;  4K3B A;  3CMM B;  2KDI A;  2LVO A;  3V60 A;  4W9K A;  3NZ3 A;  2IND C;  5G5G A;  2G1E A;  2WX1 A;  4BKG A;  1ET6 A;  3Q2A C;  4WQM A;  3AE2 B;  5C23 A;  2AL6 A;  2EEL A;  5IP4 D;  2O6V B;  4FXC A;  2LD9 A;  3DDC B;  3A9K A;  2KDB A;  1C77 A;  4DHJ D;  1FNW A;  2DZM A;  4NJ6 A;  4FJY A;  3AN1 A;  3BWU D;  4W9D A;  1C9F A;  1HXY D;  2BBC A;  1D5M C;  3P4R B;  2KTF A;  3DVN U;  2AX5 A;  3GOE A;  3VR8 B;  2YEP B;  2K8B A;  1FRD A;  5EE9 A;  4RCO A;  3NG0 A;  3QAR A;  1Y8R C;  3R66 C;  1N6Z A;  3VH3 B;  1YN4 A;  1NEK B;  4S17 A;  5HKH A;  3A4S C;  1WGK A;  1WXQ A;  1XF5 L;  1V86 A;  4MH0 E;  1YNT E;  2K6D B;  1JML A;  4MSM B;  4W9J A;  5LXH A;  2KK8 A;  3RN9 C;  2D10 A;  2KNB A;  2L7R A;  1V49 A;  4MAC A;  5IKC M;  2ZNV B;  4CQN A;  2FNJ B;  1JWU D;  5I4D A;  1WYW B;  1UD7 A;  2ZCB A;  3P63 A;  2RD0 A;  4GU2 A;  1AW7 A;  1L4D B;  1L5P A;  2NMQ A;  2V1Y A;  2JRH A;  4MEM A;  4OVV A;  4JLC A;  5H8Y E;  1EF5 A;  1UNS A;  2QC8 A;  1TGZ B;  4KV2 A;  4CYE A;  2BVC A;  1EWC A;  3Q6B A;  3N20 C;  3AE5 B;  3SFE B;  4FBJ B;  2IBI B;  2JSV X;  2ZCC A;  3TEZ A;  2GMI C;  3NVZ A;  3ZNI D;  3RMK C;  1WRD B;  2AQ1 B;  2LWP A;  3A9J A;  2I1K A;  3WA0 A;  4HPL B;  1ZUD 2;  2N4F A;  1CJE A;  4MJS A;  2L52 A;  1DOI A;  3DBL B;  1OQQ A;  2LFI A;  2C7N B;  2PTL A;  3Q8E A;  2Z0D B;  1BML C;  3U52 E;  1C76 A;  4DXA B;  1WE7 A;  3L13 A;  4YTN B;  4M8N A;  2N9K A;  3DWG C;  3WAM A;  4HRS A;  2KTR B;  2KC2 A;  2WGS A;  3A33 B;  3U30 A;  1WM3 A;  4MGK E;  2V3S A;  1WJN A; 
#chains in the Genus database with same CATH homology
 2K1F A;  2BGF A;  2MLB A;  3OJ4 B;  3H7P B;  4FHJ A;  1HE8 A;  2JZZ A;  1VCB A;  1EO6 A;  3NZU A;  1XT9 B;  2C60 A;  5BO4 B;  3TMP B;  1WX9 A;  5LXI B;  3UQB A;  3KUZ A;  2BKR B;  4E71 A;  3K9O B;  3QCA A;  3PGE A;  2LRU A;  2PE9 A;  4AJY B;  1L7Y A;  3RCZ A;  1E5W A;  2KLG A;  2O6V A;  1GC7 A;  2IO2 B;  3I3T B;  1WF9 A;  4BKT A;  2RR9 A;  2KFK B;  4BVU C;  1WZ3 A;  2DYB A;  3ZIM A;  2M4N A;  3SHQ A;  3ZKJ C;  1LFD A;  4HVB A;  3KUD B;  2MSE D;  4IG7 B;  1V6E A;  1J0G A;  2AEH A;  1RLF A;  2Z59 B;  4NY0 A;  5GMV A;  2G3Q B;  4ZDV A;  2DX5 B;  2PE6 B;  4F7Z A;  2C7M B;  2WYQ A;  2ZNV C;  1V9J A;  2ZVO A;  3L08 A;  1ISN A;  2O6V D;  2NBU A;  2D11 A;  3IFW B;  3L54 A;  2REX A;  3QHT A;  4KSL C;  5JH5 C;  2KJH B;  4B95 A;  4P7I A;  2HE7 A;  1YX6 B;  2KO3 A;  4KIK A;  2KDE B;  4CHK A;  5EDS A;  3O65 B;  5CX3 A;  4ZRK A;  3M95 A;  3DBH I;  2KKC A;  2XK5 B;  3PRM B;  4MM3 A;  3A4R A;  3VVW B;  3ECI A;  5E6P A;  3AUL A;  2KJ6 A;  3MTN B;  2EKE C;  2VRR B;  2YVC A;  3Q3F A;  1S3S G;  2KWV B;  2UYZ B;  1E8Z A;  1SGH A;  3VTW A;  5CHV C;  5D2M B;  3VQI A;  3N3K B;  4GOC A;  5D94 A;  4IM2 A;  3VDZ A;  1D3Z A;  3ZRF A;  5DPS A;  4ZYN A;  4EFO A;  2J0J A;  1EUV B;  4RM9 A;  3AI5 A;  3EFU A;  3HK0 A;  3RT3 B;  2D2Q A;  5KHQ A;  1E90 A;  4GN1 A;  4HCN B;  4A20 A;  4IWQ A;  4HPM B;  2KVR A;  2J7Q B;  1GG3 A;  4PS3 A;  2KMA A;  3B1L X;  2O2V A;  3QQ8 B;  5CTR C;  3ZLZ A;  2LRW A;  4E3C A;  4PYU A;  2R2Q A;  1Z2M A;  1V5T A;  5E6N A;  4GXB A;  3ZTC A;  2UWQ A;  3DVG Y;  2G4S A;  1WGH A;  2N9X A;  2NVU I;  3ZNG C;  4BBN F;  1MG8 A;  4ZRI A;  3WAL A;  4ICV A;  5G55 A;  1IPG A;  3TBL D;  2KLC A;  1UZX B;  2DEN B;  4WJO A;  4EKU A;  2K6Q A;  2MBH A;  2M17 A;  4FJZ A;  1P3Q U;  2MQJ A;  2LI5 A;  3DVN V;  1M94 A;  3CSF A;  1UGM A;  2FCQ A;  3MJW A;  2FCM A;  1K8R B;  2CKH B;  3T9L A;  2N1W A;  4LCD E;  2W9N A;  5AZF A;  2LGY A;  1V2Y A;  1KJT A;  1XD3 B;  4I6L B;  1XQQ A;  5DCN A;  2KDF B;  2JT4 B;  1NDD A;  1JRU A;  3ZNH B;  2D3G A;  1P98 A;  3JSV A;  1YIW A;  4BKS D;  1E8X A;  4FAD A;  4G3X B;  4TQ0 A;  2AYO B;  3EC8 A;  1E8Y A;  1V81 A;  4GDL A;  3PSE B;  2KMC A;  2KAN A;  4FUL A;  4MDK E;  5DPR A;  3TJP A;  2DHZ A;  2IO0 B;  3V6C B;  2K8C A;  2A5U A;  4HWI B;  4J6I A;  2LVP A;  2MCN B;  2LXC A;  4IM3 A;  1E8W A;  4M0W B;  3PHX B;  3Q3J A;  1WGG A;  3VFK A;  3ZDM C;  3A9K B;  2XEW A;  2L0F A;  3PRP B;  3ENE A;  3U8Z A;  3ZVV A;  4DDG D;  4RMA A;  1WIA A;  3BY4 B;  4FN2 A;  4DHJ B;  1LXD A;  1Q1O A;  1GNU A;  1R4M I;  4FHK A;  1WGR A;  2N9P C;  2V4L A;  2C9W B;  4I6P A;  2R2O A;  4WAA A;  2LXA A;  1QZE A;  2FCS A;  2IY1 B;  3W1S A;  4PS7 A;  1Q0W B;  2ZPY A;  2JPH A;  2MRP A;  4TV3 A;  4N9F 4;  2KQ7 A;  2MW5 A;  2DYO A;  4II3 B;  2MBO A;  3W1S C;  3DPD A;  2K25 A;  1WJ4 A;  3VUW A;  3X0W A;  3QC8 B;  3UF8 A;  1SIF A;  2OOB B;  3IG3 A;  3JW0 X;  4W9G A;  3SU8 X;  2DAF A;  2L3Z A;  2WDT B;  2RSU A;  1YQB A;  3HHM A;  3OLM D;  3ZNZ B;  1G6J A;  1TBE A;  3VAW A;  4BOS C;  4WQO B;  1A5R A;  2MA9 B;  4KVG B;  4GMV A;  4I6N B;  4ICU A;  2JUO A;  2ZPN A;  3LDZ E;  3RYT A;  4W9F A;  3T8M A;  1WR6 E;  3X23 A;  2BYV E;  2JZ3 B;  3PV1 A;  2NBV B;  4KSK C;  4ANU A;  2EMT A;  2LAS A;  2HD5 B;  1CMX B;  2K8H A;  4HCP B;  1I42 A;  3WAN A;  3UIP B;  3DQV A;  4DHZ E;  2MX2 A;  1WMH A;  2NBW B;  3KYC D;  1AAR A;  5C1Z A;  2FIF A;  2A4Z A;  2I1J A;  5CHF A;  3VXW A;  3LJ3 A;  1WR1 A;  2KQS A;  2IY0 B;  1WFY A;  4W9H A;  4PS8 A;  2ASQ A;  2LVQ A;  3PVL A;  4HK2 A;  1WMH B;  1WXV A;  4JL9 A;  4WJQ A;  4OVU A;  1WX8 A;  1UEL A;  2JF5 A;  1WH3 A;  1P0R A;  1YD8 U;  4CO7 A;  2N1V A;  2LUE A;  5DPT A;  2BWF A;  2MWS B;  4W9C A;  3A1Q B;  2Z0E B;  3PRE A;  1E7V A;  3DVG X;  3NHE B;  4FLH A;  5CHW A;  3RUI B;  2LZ6 A;  2CS4 A;  2IZV B;  1UBQ A;  5J18 A;  4HXD A;  4MGY E;  2KXJ A;  4JQW C;  2C5L C;  3VUX A;  4LJP B;  3NZS A;  4IWO A;  2LGX A;  2XBB C;  2KHW B;  2N7D A;  3APC A;  4MEL A;  5L95 C;  1RRB A;  3DBL I;  2CHZ A;  2KOX A;  4MSQ B;  3S2A A;  3RZW C;  2C7H A;  1EF1 A;  1X1M A;  4FJV B;  2FUH B;  1WGD A;  4HDO A;  3R7R A;  1VD2 A;  4ASW C;  2J0M A;  3QA8 A;  4WJN A;  4EZK A;  2ZZP B;  2AWT A;  1KOT A;  2MBE A;  1ZKH A;  1TZ1 A;  2M8S A;  3PTF C;  4HDQ A;  3KUC B;  3SD5 A;  5LLI A;  3APD A;  4G11 A;  3TIX A;  1NBF C;  3WIM A;  4K1R B;  5JHB A;  5D6J B;  2IO3 B;  2BWE S;  3ZTD A;  3H1U A;  1LM8 B;  2JWZ A;  3AU4 A;  4PYZ A;  5AZH A;  1GC6 A;  3B08 A;  3PS6 A;  2CHX A;  5IA7 A;  3A1Q A;  2KFK A;  2D07 B;  4KZC A;  1Z5S B;  4EOY A;  4A3O A;  2GBK A;  2NR2 A;  3U7D A;  2CHW A;  4FA6 A;  4GDK A;  2CR5 A;  2KJR A;  3BIN A;  3ONS A;  4X57 B;  3C0R B;  3OJ3 A;  5AEK B;  4K7S A;  4ANX A;  4ANV A;  3ZW3 A;  4YL8 A;  4EUT A;  3GZN I;  2O2V B;  3PHW B;  2FID A;  2BPS A;  4HJK A;  1KLV A;  4GDL B;  5TR5 A;  5KHO A;  4DK5 A;  1F9J A;  4GB9 A;  1WGY A;  2MBB B;  2NPT A;  1WM2 A;  3HM6 X;  3R7Q A;  4MJS B;  4GGQ A;  1WY8 A;  5D7G A;  3NS8 A;  4IW0 A;  3ZRC A;  3DOW A;  3WAO A;  4IM0 A;  3EEC A;  2MP2 B;  2DZI A;  3A9J B;  3H6N A;  2L00 B;  1WZ0 A;  3KVF B;  3L16 A;  3ZO5 B;  3P2B A;  2ZJD A;  2KD0 A;  4JGH B;  1E7U A;  2G4D B;  3PLU A;  2JXX A;  2MBQ A;  3CF6 E;  3V6E B;  2L0T A;  3HIZ A;  4IC7 B;  1ZGU B;  3H9D A;  1P1A A;  1T0Y A;  1P9D U;  2AL3 A;  2J0K A;  2JVC A;  1H4R A;  2KC1 A;  2DAJ A;  3QWZ B;  2LJ5 A;  1Q5W B;  4KIK B;  3VH4 B;  4WWO A;  3JSV B;  4KDI C;  4ANW A;  3SDL C;  2HJ8 A;  4TKN A;  2KFJ A;  5JZE B;  4NAW A;  1S1Q B;  3CMM B;  2KDI A;  3RD2 A;  2PEA A;  3NY5 A;  2IYD B;  4WWN A;  3OAW A;  2LVO A;  3V60 A;  4HLE A;  4LJO B;  4W9K A;  3N32 A;  4IWP A;  1YJ1 A;  4URK A;  3B0A A;  4EZL A;  1I35 A;  2WX1 A;  1OQY A;  1OGW A;  1SE9 A;  4BKG A;  1PQS A;  4AUQ C;  1WJ6 A;  1LQB A;  2WWZ A;  4NJ7 A;  5C23 A;  3ZUN A;  2AL6 A;  2O6V B;  2LD9 A;  4AP4 C;  3DDC B;  2ZVN A;  3A9K A;  4DHZ B;  2KDB A;  4DHJ D;  5FR6 A;  2GBN A;  2DZM A;  4XC2 A;  2DZK A;  4NJ6 A;  4FJY A;  2NCN A;  3JYU A;  4W9D A;  2HTH A;  5L83 A;  3PT2 B;  4WWP A;  4II2 B;  3V62 A;  1TTN A;  1WXS A;  2KTF A;  2RGF A;  3DVN U;  4LDT B;  3IBE A;  4BOZ B;  2BYF A;  3PLV A;  4GSW A;  2BKF A;  3GOE A;  3L10 B;  2WX0 A;  2K8B A;  1BT0 A;  3UQA A;  2EMS A;  3D32 A;  1WXA A;  3ML9 A;  5IAA C;  4W9I A;  3L17 A;  3QAR A;  2YLM A;  3ML8 A;  2GBJ A;  1Y8R C;  4RM8 A;  4XZ4 A;  3W1Y A;  1R4N I;  3R66 C;  3VH3 B;  4XX5 A;  4K81 A;  4G0N B;  1GUA B;  3NOB A;  1YX5 B;  1KM7 A;  4DBG A;  3A4S C;  4G50 A;  2BYE A;  2NS5 A;  4B6W A;  4KZ0 A;  4MGI E;  3VUY A;  1GJZ A;  1V86 A;  4MH0 E;  3V61 A;  4EEW A;  2M1M A;  2K6D B;  4MSM B;  4W9J A;  2L8J A;  3JVZ X;  2XK5 A;  3MHS D;  5LXH A;  2KK8 A;  4AJW A;  2D10 A;  2KX3 A;  2M0X A;  2KNB A;  2L7R A;  1V49 A;  2ZEQ A;  3VTV A;  3IHP C;  4JIO U;  4GDK B;  2ZNV B;  1V80 A;  3QX1 A;  3QK0 A;  2FNJ B;  2KZR A;  3ALB A;  3IVF A;  5AZG A;  4NNJ B;  1V5O A;  1WYW B;  1UD7 A;  1WE6 A;  1OEY A;  2ZCB A;  4DDI D;  1RFA A;  3APF A;  4NQK E;  4E74 A;  1H8C A;  2RD0 A;  2CU1 A;  1OTR B;  3M63 B;  4A3P A;  3PRZ A;  4GU2 A;  2FCN A;  3TCA A;  3DBS A;  2KX0 A;  5DPW A;  3K9P B;  2K39 A;  2V1Y A;  2BF8 B;  2JRH A;  4MEM A;  4KDL B;  4OVV A;  3L0W B;  4BKS A;  3KW5 B;  2DZJ A;  3RUL A;  4JLC A;  1WI0 A;  3AU5 A;  3KH0 A;  4DWF A;  4F1S A;  1EF5 A;  2KN5 A;  1WXM A;  1L2N A;  5G2N A;  1TGZ B;  4KV2 A;  2B3A A;  1WX7 A;  4CYE A;  4NAW B;  2FAZ A;  3WAP A;  2N9E B;  2NPT B;  4K7U A;  1J8C A;  3DBR I;  4NPN A;  4FBJ B;  1IP9 A;  1IYF A;  2IBI B;  2ZCC A;  3VTU A;  2GBM A;  3DCG A;  2GOW A;  2PPH A;  2GMI C;  3VHT C;  2PJH A;  4BBN C;  3EHV A;  4BFR A;  2Y5B B;  3KYD D;  3ZNI D;  3HM3 A;  4IUM B;  1C1Y B;  1WRD B;  2LWP A;  2IO1 B;  2MP2 A;  2GBR A;  3A9J A;  3R3M A;  2I1K A;  3WA0 A;  2QHO A;  4HPL B;  2N4F A;  2KTR A;  1UBI A;  3M3J A;  4EZJ A;  4TUU A;  3N30 A;  4MJS A;  4MGZ E;  1RAX A;  3PPA A;  3RZF A;  4AWJ A;  4TQ1 A;  4ZRJ A;  3QJZ A;  1OEY J;  4LDT D;  2JRI B;  1FXT B;  3PZD A;  5HKH A;  3AXC A;  4M8M A;  1C3T A;  3TL5 A;  2C7N B;  1U4A A;  5J2R A;  1NI2 A;  3UGB B;  2Z0D B;  3UIO B;  3H7S A;  1ZW7 A;  2LGD A;  4NQL B;  4GIV A;  4DXA B;  1UH6 A;  1WE7 A;  3ZDT A;  3L13 A;  4W9E A;  4M8N A;  3QIJ A;  2L76 A;  4W9L A;  5E6O A;  3H7P A;  2RPQ A;  2KWC A;  5J17 A;  2DYM A;  1WJU A;  2JY6 A;  4K7W A;  4AOF A;  3WAM A;  3CST A;  3QAQ A;  2L05 A;  2KTR B;  2KC2 A;  3M62 B;  4WJP A;  3A33 B;  3U30 A;  3UIN B;  1WM3 A;  2OJR A;  4B9K A;  4MGK E;  2G45 B;  2N7E A;  5JHA A;  1J19 A;  2KWU B;  2V3S A;  4F8C B;  1WJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...