2M8SA

Nmr structure of the cytoplasmic tail of the membrane form of heparin-binding egf-like growth factor (prohb-egf-ct) complexed with the ubiquitin homology domain of bcl-2-associated athanogene 1 from mus musculus (mbag-1-ubh)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone/membrane protein
molecule keywords BAG family molecular chaperone regulator 1
publication title Nuclear Magnetic Resonance Structure of the Cytoplasmic Tail of Heparin Binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-Associated Athanogene 1 from Mus musculus (mBAG-1-UBH).
pubmed doi rcsb
source organism Mus musculus
total genus 21
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m8sA00
4DHZE 3RUIB 2FIDA 3KYDD 3RCZA 2O6VB 4XZ4A 3LJ3A 3W1SC 5JZEB 3A33B 3ALBA 4HDQA 3PLVA 2KWUB 2BYFA 2GMIC 3RD2A 3VUWA 4MSMB 2MLBA 3U7DA 4NJ6A 2K25A 1QZEA 2NS5A 3EFUA 4JQWC 3KYCD 2L0FA 2LRUA 2JRHA 1VD2A 3ZRCA 4KIKB 3H6NA 4DHJD 2K6QA 1TTNA 4LJPB 4IWPA 2DYOA 2ZVNA 4X57B 5D2MB 3NHEB 4TKNA 3R7RA 1LM8B 3L17A 1YD8U 3GOEA 1S3SG 4ANUA 2C7NB 3EHVA 3TBLD 2LWPA 4CHKA 1VCBA 1UZXB 2IZVB 2JT4B 3PREA 2CKHB 3ZVVA 2KWCA 4GGQA 1KJTA 2GBRA 1ISNA 3ZO5B 3I3TB 1SGHA 3PRPB 1YX5B 2KQ7A 2HJ8A 2LXCA 3KH0A 4MH0E 4NNJB 4HWIB 2L0TA 4HCPB 3P2BA 4LDTB 3A9KB 2L76A 4J6IA 1J8CA 3V60A 3QX1A 4FN2A 1ZKHA 2MA9B 3ZNGC 3QA8A 2N1WA 2REXA 4DWFA 2C60A 2KNBA 2N9EB 2RR9A 4BFRA 3L08A 1A5RA 4EZKA 2Z59B 4AWJA 2FCSA 4BBNF 3QIJA 3CSFA 1Z2MA 1Q0WB 4K7SA 2L00B 4BKGA 2Z0EB 2Z0DB 2KLCA 2R2QA 3IG3A 2KZRA 2NVUI 4GDKA 4RMAA 3VTVA 3VXWA 2BF8B 2FCMA 2RGFA 4W9KA 5L83A 4WAAA 4WQOB 1WZ0A 4GSWA 1UD7A 5EDSA 2A5UA 3VH4B 4WWPA 3K9PB 1WGHA 4HDOA 3QQ8B 1WJNA 1WXAA 1XD3B 3QHTA 4WWOA 3M62B 3NZSA 4E3CA 4MGZE 4IM3A 1R4MI 2KQSA 4GOCA 3B1LX 1R4NI 1RRBA 4WJPA 3VFKA 4JGHB 4TQ1A 4JL9A 3DDCB 4IUMB 4FJVB 4KDLB 1RAXA 1E8YA 3M63B 1H8CA 4KVGB 4PS7A 2AYOB 2MP2B 4GMVA 5D94A 2BGFA 2KMAA 1NBFC 1WMHA 4F8CB 2CHWA 2KDFB 2LVOA 5DCNA 4AJYB 4CO7A 4I6NB 2LUEA 5HKHA 2MBBB 1KM7A 1E8XA 3VH3B 3WANA 2K1FA 4IW0A 3U30A 2KX3A 1EO6A 3ML8A 1UBQA 4MDKE 2KKCA 1WXMA 1X1MA 2DX5B 2JUOA 3ZW3A 5GMVA 2M8SA 4TV3A 3CSTA 1UBIA 3TJPA 2DZKA 1MG8A 2MBQA 3UIPB 1WGDA 1WX8A 4XC2A 2JRIB 2ZNVB 1OGWA 4G0NB 3DBHI 2PE6B 4GDLB 5LXIB 2J0KA 4HJKA 4B6WA 3B0AA 1P1AA 1E8WA 2PPHA 3PT2B 4W9EA 4ZDVA 2NR2A 1WXVA 4WJNA 2KDEB 2VRRB 4EFOA 2EMTA 3PSEB 2BYVE 2MBOA 4IM2A 4WJOA 3W1SA 3WAOA 3ZRFA 2DYMA 2V1YA 5TR5A 2KJRA 3EC8A 4PYUA 4AJWA 4NQLB 2KTRA 2MRPA 3N32A 3V62A 2JVCA 2MBEA 4CYEA 2ZJDA 5J2RA 5E6NA 1H4RA 2RSUA 2JF5A 2LASA 4ASWC 3A9JA 4IWOA 1V5TA 2DZJA 3PGEA 3PZDA 4W9HA 4M8NA 2AL3A 1WM2A 2OJRA 3UF8A 2K8HA 3JYUA 4G11A 1V81A 2RPQA 1GJZA 2KTFA 1V6EA 4HCNB 4NAWA 4OVUA 2UYZB 3H7SA 1WI0A 4ICVA 1WJ4A 2ZCBA 2MX2A 3CF6E 1Q5WB 3SD5A 1D3ZA 4MM3A 2MW5A 3QARA 3ENEA 4ICUA 3A1QA 4ZYNA 3ZLZA 2HTHA 2GBJA 3L16A 4NQKE 3GZNI 4IC7B 3UGBB 2G4DB 3MJWA 2AL6A 4W9LA 1WRDB 5CX3A 2ASQA 2CHZA 3UQAA 1U4AA 2ZEQA 4GIVA 2B3AA 2BWFA 2DHZA 5D6JB 4A3OA 3KW5B 4KV2A 4B95A 2NPTA 5KHOA 2KFKA 3KVFB 3JVZX 3DCGA 1L2NA 1WF9A 3ZNZB 4K81A 1C1YB 1WE7A 4LCDE 2XK5A 3VHTC 4G3XB 1F9JA 1YX6B 2AEHA 3ZTDA 3AU5A 4MJSA 4N9F4 3D32A 2ZZPB 2M17A 1S1QB 3QC8B 2O2VA 4IM0A 2MCNB 2FAZA 4BVUC 5L95C 1WX7A 3DBRI 3DVNV 1E90A 3DVGY 2LVQA 3OJ3A 4DDGD 4ZRKA 4AUQC 4ANVA 1KLVA 3C0RB 2BYEA 5LXHA 1BT0A 3VQIA 2RD0A 4KDIC 4DHJB 1ZGUB 3OAWA 3ZNID 1P98A 1E8ZA 1RFAA 3PS6A 2LZ6A 2CU1A 2HD5B 2N7EA 3QWZB 3M95A 2G45B 2LRWA 2OOBB 5IA7A 3VDZA 2QHOA 3DOWA 1XQQA 4W9DA 5D7GA 4BOSC 3ZNHB 3R3MA 1WMHB 2L8JA 2XBBC 3HM3A 3K9OB 4FLHA 5AZHA 1GG3A 2PE9A 1OTRB 2UWQA 2JY6A 2LGXA 2D2QA 3H7PA 3SDLC 2KN5A 1EF1A 2MBHA 1WGRA 4XX5A 5CTRC 5JHAA 1E7UA 2DYBA 2LGDA 4ANXA 2C7MB 4I6LB 3ONSA 2KXJA 3AULA 3MTNB 2KO3A 2BPSA 2L7RA 3PHWB 3DQVA 2K6DB 2N7DA 4FULA 1EUVB 1OQYA 3O65B 2J0MA 3NOBA 3RULA 2JZ3B 1Q1OA 3JSVB 4KSKC 3V6EB 3VUXA 4RM9A 1WGYA 2FCNA 1V5OA 4JLCA 2FUHB 2MQJA 3CMMB 3V61A 3VTWA 1J19A 2WYQA 3ML9A 4PS3A 2KWVB 1CMXB 1WE6A 4GXBA 2KANA 3OJ4B 4HLEA 3PTFC 3APCA 3DBLI 4HVBA 1IYFA 2DAJA 3PVLA 3NS8A 2KTRB 1PQSA 5G2NA 4A3PA 3APDA 4DXAB 4EOYA 3B08A 2IO3B 2KLGA 4JIOU 4W9FA 1WR6E 4M8MA 2O6VD 4IG7B 4FHKA 4P7IA 3ZDMC 2GOWA 1WYWB 3HIZA 5AZGA 3IHPC 3NZUA 2KD0A 1GUAB 4MEMA 2NBUA 3LDZE 4ZRIA 3R7QA 2K8BA 3N30A 3WAPA 2LI5A 2KK8A 2FCQA 3ECIA 2ZPNA 1WX9A 3WALA 5AZFA 4MGYE 1RLFA 1SIFA 3QJZA 2A4ZA 5AEKB 3TMPB 5E6PA 5IAAC 2ZCCA 3PPAA 3HHMA 4W9GA 4GU2A 4HPMB 5CHFA 2W9NA 3VUYA 4FHJA 1Y8RC 1E5WA 5DPRA 1WY8A 3NY5A 3UIOB 4EUTA 1TGZB 2J0JA 1LXDA 2C9WB 2WX1A 5JHBA 2KMCA 2EKEC 4DBGA 2BWES 2KVRA 3BY4B 3T9LA 2YLMA 4ZRJA 3RZFA 3APFA 2I1JA 3PHXB 1I35A 4MELA 1P0RA 2NPTB 3OLMD 3EECA 4I6PA 2JZZA 3ZKJC 2DZMA 2ZNVC 1GC7A 1NDDA 1WR1A 2XK5B 4LDTD 1JRUA 3IFWB 5DPSA 2YVCA 3UQBA 1V2YA 2MWSB 1E7VA 2KDBA 4F1SA 4MJSB 1SE9A 5CHWA 4EZLA 2O2VB 3L10B 1M94A 1C3TA 1TZ1A 4NPNA 3ZTCA 4AOFA 3TIXA 4GB9A 2ZVOA 2I1KA 2O6VA 3PV1A 4DDID 3H9DA 1WM3A 2BKRB 2Y5BB 4BBNC 3KUZA 1YIWA 1WXSA 3R66C 5G55A 4IWQA 3PLUA 3PRZA 4GDKB 4E74A 1V9JA 1WJ6A 2HE7A 3AI5A 4HPLB 3TL5A 2N1VA 3L54A 1FXTB 3IVFA 2WX0A 3DVGX 4FA6A 3KUCB 4KIKA 2N9PC 5C23A 1XT9B 1YJ1A 1WGGA 2KFJA 2J7QB 4W9CA 1TBEA 3WA0A 3RZWC 1G6JA 1UGMA 4MGIE 4DHZB 2LJ5A 4FJYA 3IBEA 4LJOB 4EEWA 5KHQA 4M0WB 2IY0B 2JWZA 3H7PB 5LLIA 3ZUNA 3MHSD 2IO0B 4K1RB 4PYZA 4NJ7A 5J18A 3ZDTA 2K8CA 1T0YA 1OEYA 1V49A 2D11A 2EMSA 2KJ6A 4KZCA 2KC1A 2LD9A 2R2OA 3A9KA 3N3KB 2DZIA 2KX0A 3KUDB 1WH3A 1WZ3A 2GBMA 3DVNU 1Z5SB 1ZW7A 5JH5C 2AWTA 4PS8A 5DPTA 1OEYJ 1WIAA 2G4SA 3Q3FA 3W1YA 2KHWB 1AARA 2KJHB 2CHXA 4II3B 4AP4C 4HK2A 2NBWB 2K39A 2G3QB 2PJHA 2M0XA 4MSQB 3WAMA 4DK5A 4TUUA 4B9KA 4BOZB 3BINA 3JW0X 2C7HA 5E6OA 1V86A 2V3SA 3DBSA 4URKA 4KSLC 2N9XA 3H1UA 3WIMA 4BKSD 2NBVB 4BKTA 2C5LC 2MSED 4W9IA 3AU4A 3X23A 3AXCA 3PRMB 1UH6A 2IO2B 2KC2A 3VTUA 3M3JA 1GC6A 1I42A 1WJUA 2LGYA 4E71A 2BKFA 2IY1B 2KDIA 2WDTB 2LXAA 3QK0A 4K7UA 4K7WA 1UELA 2JXXA 2MP2A 4A20A 1V80A 2L05A 5FR6A 1GNUA 4FADA 2XEWA 1P3QU 4KZ0A 4YL8A 1LFDA 4EZJA 2DAFA 1IPGA 1EF5A 3VVWB 2L3ZA 2GBKA 4TQ0A 3A9JB 4WWNA 4RM8A 5BO4B 5J17A 5DPWA 2FNJB 3U8ZA 3ZIMA 2CS4A 4MGKE 4NY0A 4ANWA 2NCNA 1P9DU 3Q3JA 2D3GA 3A4RA 4G50A 2D10A 3L0WB 2KOXA 4OVVA 2FIFA 3SHQA 4FBJB 4NAWB 1IP9A 3QCAA 1NI2A 1WFYA 3JSVA 3VAWA 3S2AA 5C1ZA 3L13A 4WJQA 3TCAA 1YQBA 4W9JA 2N4FA 3DPDA 4HXDA 3HM6X 2WWZA 3X0WA 3A1QB 3T8MA 5CHVC 1LQBA 2LVPA 1HE8A 4GDLA 4GN1A 4F7ZA 3V6CB 1K8RB 2CR5A 3A4SC 2IYDB 3RT3B 1J0GA 2D07B 2DENB 2M1MA 2IBIB 1L7YA 3HK0A 1KOTA 2IO1B 3UINB 3RYTA 2GBNA 2ZPYA 3QAQA 4II2B 2JPHA 2M4NA 4BKSA 2PEAA 2KFKB 3SU8X 2V4LA 4EKUA 4FJZA
chains in the Genus database with same CATH superfamily
1DOYA 3KYDD 3RCZA 3Q8BA 2QEJC 3MC8A 1TKEA 2GMIC 1JQ4A 4MSMB 4NJ6A 2K25A 1QZEA 4JE3B 1NI3A 4KIKB 4DHJD 1IBXB 4YTNB 1IGDA 5D2MB 2KMMA 3R7RA 1LM8B 1S3SG 1JCKB 2LWPA 3E9SA 1SE2A 2EELA 1T0RC 1UZXB 3ZJUA 2CKHB 3ZVVA 4GGQA 1KJTA 1LO5D 1NEKB 1GOZA 4IKGA 2L0TA 3A9KB 1K52A 3N1YC 3QX1A 2N1WA 2REXA 3MC0B 4DWFA 2C60A 1KLGD 4EZKA 2FCSA 3DHIC 2R61A 1Q0WB 2AQ3B 4BKGA 2Z0DB 2KLCA 3VXWA 3ZYYX 2N0SB 4KGRA 1ZXIA 3QHTA 2M19A 3M62B 2J4XA 1PFDA 4P1CC 4TQ1A 4JL9A 1RAXA 2E6XA 4KVGB 4PS7A 4XYCA 4CQNA 3SR6A 2M0AA 3HUIA 1V1PA 2LVOA 5DCNA 4AJYB 4CO7A 3VRBB 3WANA 2HJ1A 1EO6A 4MDKE 3URYA 2JUOA 2LHDA 2M8SA 4YTPB 2DZKA 2JRIB 1C78A 2PE6B 5LXIB 3ZQ4A 4B6WA 2D3AA 1E6EB 3PT2B 4ZDVA 1WXVA 1N63A 2VRRB 4EFOA 2EMTA 4IM2A 4WJOA 3ZRFA 2DYMA 2KJRA 1XLNA 2KTRA 2MRPA 3N32A 1T3QA 1YOVB 3NVVA 1H4RA 2LASA 1RYJA 3LB8C 2MH7A 4W9HA 4M8NA 1FFUA 1JRPA 2OJRA 3W5VB 1FEHA 4L23A 1V81A 2BVCA 2SAKA 4KGSA 1F52A 3MC9A 3H7SA 1SIJA 1WI0A 2ZCBA 2MX2A 3SD5A 5C2TB 3QARA 4ZYNA 3A1QA 2GBJA 4NQKE 4M02A 4IC7B 3MJWA 5AUIA 4YTMB 4UDUC 3UQAA 4A3OA 4KV2A 5KHOA 1VLBA 1N5XA 1MG4A 2W55A 1L2NA 2I38A 4ZHOA 4K81A 3TUOA 4LCDE 2XK5A 4G3XB 2LJIA 4MJSA 4ZRQA 1B1ZA 3D32A 4IM0A 2O2VA 3EFCA 4BVUC 3DBRI 1L4DB 1FO4A 3DVNV 2LVQA 4P1BC 1IBXA 3VQIA 1HTOA 1WSPA 2PW9A 1P98A 1TS5A 2UU7A 1E8ZA 4NAMA 3QWZB 1Q10A 4TMAB 5IA7A 2QJLA 2N9LA 5BYQA 4W9DA 3VDZA 3Q14C 3R3MA 2BYTA 1LGRA 3UI3A 1I4HA 2WXKA 1GG3A 1OTRB 2LGXA 4M0WA 2XNAC 3AE7B 3SDLC 3AM9A 1WGRA 5CTRC 3ONSA 1UWMA 2BPSA 1TJEA 2WXQA 2K6DB 2N7DA 4WWMA 1OQYA 1UNSA 3VR9B 4KSKC 3B2FA 4RM9A 1V5OA 3CMMB 5IP4D 2WYQA 2K0PA 3ML9A 2KWVB 1CMXB 1F1HA 1DGJA 2Q5WD 2KANA 3DWGC 3PTFC 3DBLI 4HVBA 3PVLA 4JX1C 2INNE 3BVGA 5G2NA 1QKZA 3B08A 4W9FA 3HVDA 4OZAA 1YNTE 5IOIA 3HIZA 5AZGA 3I57A 3IHPC 3CWIA 4ZRIA 3LDZE 4MH8A 3U4EG 2LI5A 2KK8A 2FCQA 2VZKD 3T3NA 1OQQA 3TMPB 1HA5A 5E6PA 4W9GA 4GU2A 3MP9A 4HPMB 2W9NA 3TEZA 2QIEB 2KMCA 2EKEC 2BWES 2BS4B 2KVRA 3Q3OC 3APFA 2I1JA 3OLMD 3ZKJC 2ZNVC 1IUEA 4LDTD 1JRUA 3IFWB 5DPSA 2MWSB 2IDYA 5CHWA 1SSNA 3H9DA 5HFYA 2BKRB 2RDBC 4BBNC 3KUZA 1QOGA 1C4CA 1L6VA 1V9JA 3IVFA 3VRAB 3PO0A 3DVGX 3OWEB 4FA6A 3KUCB 1PUTA 1XT9B 1YJ1A 2H89B 2JWUA 4Q2JA 2FUG1 1G6JA 1UGMA 3AEAB 4DHZB 4US9A 1BUIC 5H8YE 3U2SC 1PGBA 4LJOB 3P4SB 3SEBA 5KHQA 3H7PB 5LLIA 4WAFA 2YEPF 2D11A 2ACZB 4BZAA 1WZ3A 2GBMA 4TSSA 5JH5C 3Q2AC 2WP9B 2GRIA 1AARA 1RFKA 4II3B 5IN7A 3ETRA 1JMLA 3SFEB 2IGHA 2VH1A 1SJHD 4B9KA 1VZ8A 3BINA 1GB1A 5E6OA 4URKA 3AEEB 4O1NA 3H1UA 2BBCA 1QOBA 2NBVB 2MSED 1UUPA 3PRMB 2IO2B 1MHHE 4E71A 2BKFA 2IY1B 3GE3C 4K7UA 1E9MA 1UELA 4A20A 2L05A 4YL8A 1IPGA 4TQ0A 2FNJB 3U8ZA 3ZIMA 5HI1A 4ANWA 3A4RA 4G50A 4OVVA 4B0MA 4LNNA 1WFYA 3VAWA 3S2AA 3L13A 1C79A 3TCAA 2N4FA 1EU4A 3DPDA 4HXDA 3HM6X 3Q6BA 1HE8A 4GN1A 3A4SC 1F77A 1FCCC 2WDQB 1QQRA 1M4VA 4OVZA 3AB5A 3RPFC 4OW0A 2JPHA 3P4PB 2PEAA 2KFKB 4M01A 2G9HD 2V4LA 2ZW0A 1XLQA 4XZ4A 3LJ3A 2BYFA 3RD2A 3VUWA 1MI0A 4JQWC 3KYCD 2L0FA 3ZXVA 4IWPA 2IGDA 2DYOA 4H2AA 3KLSX 2LUMA 3ZXRA 3L17A 3GOEA 1JWSD 1N5WA 4ANUA 4DQOC 2C7NB 1AWDA 3DHHC 5D3IB 2JT4B 1R4MB 3ZO5B 2L1AA 1SGHA 1YX5B 3KH0A 4MH0E 4NNJB 4HCPB 1WWTA 5G5GA 1J8CA 2K9XA 3V60A 4FN2A 1ZKHA 3QA8A 3FILB 1ET6A 2JYEA 2RR9A 4AWJA 3NS1A 2DLBA 3CSFA 4K7SA 4DDGD 3IG3A 1AN8A 4ITKA 2RGFA 3J9CA 1NVID 3NVWA 2H88B 2V4IB 5AUKA 4GSWA 3VH4B 3K9PB 1WGHA 2INDC 4WWOA 3NZSA 4E3CA 4YSYB 2BB5A 3DDCB 3AE1B 3DBHB 2AYOB 2QILA 5BMIA 1NBFC 4F8CB 2CHWA 1YN5A 1NENB 3BWUD 3N20C 2WDRB 2KDFB 1E8XA 4KX6B 2K1FA 3U30A 2KX3A 1UBQA 4ZRPA 1X1MA 3ZJVA 3ZW3A 1C9FA 5GMVA 1UBIA 4M00A 3WCQA 3UIPB 1WGDA 1WX8A 2K5PA 2ZNVB 4G0NB 1KH0A 5EE1A 2J0KA 1P1AA 1E8WA 1HQRD 3HRDD 4RF1A 2KDEB 3AE2B 1F2RI 3PSEB 2YEPB 3W1SA 3GZNB 1VR9A 5G5HA 1NYRA 4PYUA 4AJWA 5E6NA 2RSUA 4ASWC 2ON8A 4IWOA 1F2RC 1TY2A 1V5TA 3PGEA 3IAM1 3PZDA 3DWMA 1I4QA 2W82A 3BZDB 1XCQL 1V6EA 4S17A 4HCNB 2UYZB 2PVGC 2LHEA 2RDHA 2INCC 1Q5WB 4LNIA 3ZLZA 2AL6A 3Q8EA 2BWFA 3KW5B 2WXHA 4P16A 2NPTA 2KFKA 3ZGZA 3DCGA 1WF9A 3ZNZB 3VHTC 1F9JA 2X38A 2AEHA 1I4GA 2WXRA 3QC8B 1WX7A 3RNFC 1C76A 3W2DA 1E90A 3OJ3A 4ZRKA 4AUQC 3P4RB 1KLVA 2WXJA 2RD0A 1WXQA 1RFAA 2CU1A 1V1OA 1MPEA 3BIID 1TT5B 1WMHB 2ONQA 3K9OB 4ACFA 2UWQA 1GPXA 2KN5A 2Y3AA 4XX5A 3I9V1 3P4QB 1E7UA 2DYBA 2LGDA 4ANXA 2QSDA 2X8XX 3DQVA 4FULA 1TKYA 3RULA 3AEDB 1YN3A 3VR8B 2JZ3B 1Q1OA 2LFIA 3JSVB 3V6EB 1WGYA 2FUHB 3VTWA 3V61A 1J19A 1XXGA 4GXBA 4HLEA 1N62A 1AW7A 3RNCC 3NS8A 1PQSA 3AN1A 4IDIA 4DXAB 2QDFA 1XEEA 4JIOU 4M8MA 3RN9C 4FHKA 3NZUA 1A70A 2LGIA 1SB3C 2NBUA 1FD6A 2K8BA 3N30A 3ECIA 1EWYC 3Q69A 1WX9A 4WURA 4R3DA 2SEBD 5CHFA 3VUYA 4MM3B 3Q8CA 4A90A 1WY8A 3NY5A 4EUTA 4ARCA 5JHBA 3BVMA 3T9LA 5BYSA 2V9HA 3PHXB 1I35A 1I4PA 1MJDA 1NDDA 1TKGA 2GI9A 3DHGC 1KRHA 2YVCA 3UQBA 1V2YA 1E7VA 1SE9A 4EZLA 1M94A 3BK1A 1TZ1A 4NPNA 3ZTCA 4AOFA 2PKOA 1FIQA 1GAQB 2I1KA 2ZVOA 4GB9A 4RGNA 2BB6A 3RNGC 1OFFA 1YIWA 1WXSA 3R66C 2OJWA 4RGTA 3TL5A 1WJ6A 1TIFA 2N1VA 3L54A 1FXTB 5C3JB 1QLBB 4KIKA 1WGGA 2J7QB 4RGOS 3T3OA 3RZWC 1UF0A 2LJ5A 3IBEA 2JWZA 2IO0B 4NJ7A 1JWUD 5J18A 4XWWA 1T0YA 1V49A 1HZ5A 2KC1A 2RMMA 3A9KA 2L83A 3KUDB 4XDCA 1ZW7A 5DPTA 1MFWA 2G4SA 3W1YA 2CHXA 1K53A 4HK2A 4EE2A 2NBWB 2G3QB 2PJHA 2M0XA 1TZOA 4RH6A 1UGJA 1V86A 3DBSA 2AX5A 5IO9A 3WIMA 3X23A 2JU6X 2KC2A 2LGYA 5JXVA 2KDIA 2LXAA 1YMHE 2BQQA 4FADA 1P3QU 1LFDA 2DAFA 2L3ZA 3A9JB 4RM8A 5J17A 2CS4A 1P9DU 1E0ZA 4JPSA 2D10A 1XCTL 2FIFA 3QCAA 3N1ZC 3JSVA 3IAS1 1SE4A 1LQBA 1ACCA 3NVZA 2CR5A 3FKYA 2IYDB 4K3CA 3CIRB 4AQ7A 1J0GA 2IBIB 4MACA 1KOTA 2IO1B 1P7FA 2WHIA 2W54A 3RYTA 1YQ3B 2KYWA 1VJKA 4A55A 2FIDA 2O6VB 1TY0A 1T0QC 3ALBA 4HDQA 3PLVA 2KWUB 1L0YB 1ENFA 3P42A 2NS5A 3ZRCA 2JRHA 4YSZB 2MEKA 2K6QA 2ZW1A 1K50A 4X57B 3NHEB 4YSXB 4WIPA 3KWLA 4C7ZA 4RNAA 1VCBA 3B2GA 2IZVB 3PREA 2GBRA 1ISNA 1TS3A 1D5XC 1J7AA 1STEA 3PRPB 2HJ8A 2NMQA 4XGAB 2KQ4X 3B9JA 2N9EB 4KKJA 4BBNF 1C4PA 2WXPA 2WNMA 2Z0EB 2KZRA 2NVUI 2FCMA 2MHJA 4W9KA 1XLOA 1CQVA 5EDSA 2A5UA 1SE3A 3QQ8B 1WJNA 1XD3B 1N61A 1ET9A 4IM3A 2K3UA 2KQSA 3BK2A 4IUMB 1HEZE 4FJVB 5MPOA 3BYTB 2MP2B 3GP7A 2BGFA 1FNUA 3C8YA 2WDVB 1TS4A 4N6EB 4C4VB 3I63C 2LUEA 5HKHA 2MBBB 2PLPA 3VH3B 4LLGM 4IW0A 1FFVA 4DXGA 3V3XA 2KKCA 1WXMA 5BMGA 4A6QA 2GLSA 1FNVA 1L5PA 3RI7C 1VZ7A 1XLPA 2MJDA 1MG8A 1AYFA 1OGWA 2WXLA 4GDLB 2ICIA 3B0AA 2PPHA 4WJNA 3NJTA 4HJGE 3KQ4A 1PGAA 1KTKA 3AE9B 3H8HA 4C80A 5TR5A 1BMLC 1YQ4B 3EC8A 4CYEA 4JWSC 2KWDA 3A9JA 4PK1A 2V3PA 5E6JA 1ZE3D 4G11A 1RWSA 1ZDVA 2RPQA 1D4BA 2KTFA 3Q3NC 4OVUA 3DBRB 4ICVA 2LEKA 2HTHA 1V97A 2BTEA 2W3SA 2RPVA 1WRDB 1QOAA 3GB1A 5CX3A 2ASQA 1U4AA 2K22A 2DHZA 1C4AA 1FMAD 3L4PA 1IGCA 1C1YB 3Q8FA 3ZTDA 2ZZPB 2M17A 2MCNB 2FAZA 2MJEA 3LXFA 3TEWA 2QCZA 2B76B 3C0RB 2BYEA 5LXHA 1BT0A 4KDIC 4DHJB 1ZGUB 3OAWA 3AE4B 3ZNID 2GB1A 2HD5B 2N7EA 3M95A 2L32A 2MJ3A 2V0GA 2LRWA 4YT0B 2PIAA 4BOSC 3ZNHB 1DOXA 3MJ5A 1TYGB 1V1PB 3HM3A 1D5ZC 3I5JC 2M56B 4KKIA 2D2QA 3H7PA 3DBLB 1ROEA 2PTLA 1J7CA 2C7MB 2KXJA 3MTNB 2KO3A 1L0VB 2L7RA 4PT5A 3KWVA 1D5MC 4A9AA 2J0MA 3VUXA 2FCNA 2JSVX 2MQJA 4PS3A 1HXYD 5EE3A 3OJ4B 1VDVA 3APCA 2WXGA 2KTRB 4LTUA 3APDA 4EOYA 2IO3B 2KLGA 4L1BA 1WR6E 2J52A 5IKCM 2JZPA 4IG7B 1WYWB 4HKQA 2KD0A 4MEMA 2WU2B 1FRRA 3PZ8A 5AZFA 2DNFA 4MGYE 1SIFA 2DBYA 2IPKD 2ZCCA 3PPAA 3HHMA 2D5GA 1FRDA 4FHJA 1Y8RC 2J53A 2TSSA 1DYQA 2WX1A 4HROA 4DBGA 3AEFB 3BY4B 3ZJTA 2YLMA 4ZRJA 2L52A 4MELA 1P0RA 3EECA 1CK1A 4I6PA 4K3BA 2DZMA 1GC7A 3O13A 2XK5B 4AS1A 1XO3A 4F1SA 4MJSB 2BT6A 4IOIE 2O2VB 3L10B 1Y56A 1ZP0B 3PV1A 1WM3A 2Y5BB 5LNK1 4LNOA 5G55A 4IWQA 4GDKB 4E74A 2HE7A 3AMZA 1ESFA 2WX0A 4EKUA 3IXSA 2KFJA 4ZOHC 1TBEA 3WA0A 4MGIE 1QOFA 4FJYA 2OEDA 1I4XA 2INPE 4EEWA 4L2YA 2LMCA 4M0WB 1DOIA 3MHSD 2HDEA 4K1RB 4PYZA 3AE5B 3ZDTA 1ZPSA 2KJ6A 2EMSA 1V8CA 2LD9A 2R2OA 3NUHB 3TEYA 1JWMD 5T8IA 4N58A 1VZ6A 1Z5SB 3FILA 1OEYJ 1WIAA 5I4DA 1FM0D 3IT4B 2KHWB 1XF5L 4XDDA 3W9CB 5HHDG 4DK5A 4TUUA 4BOZB 2FE8A 2C7HA 3U52E 3AH7A 2V3SA 4KSLC 2N9XA 4BKSD 1KLUD 4P6VF 2C5LC 2E3TA 4W9IA 3AU4A 5GXGB 1MVKA 1KF6B 3VTUA 1GC6A 1WJUA 4K7WA 2WDTB 1L0XB 3QK0A 3MFGA 3NG0A 4EZJA 2AQ1B 1SF0A 3VVWB 1ZDXA 2GBKA 5BO4B 4REZA 2EKIA 4HPPA 2D3GA 3P63A 2KOXA 3SHQA 4FBJB 1YJIA 4NAWB 1IP9A 4RCOA 1KFYB 1NI2A 4WJQA 4N59A 2KVZA 4W9JA 1PGXA 1FXAA 3T8MA 5CHVC 2LVPA 2AQ2B 3V6CB 4US8A 1E10A 2WGSA 2D07B 2DENB 2M1MA 3HK0A 1CZPA 3UINB 2GBNA 3QAQA 4BKSA 1T6BX 3SU8X 4FJZA 4DHZE 3RUIB 4D2KA 2JX5A 3W1SC 5JZEB 1J7BA 3A33B 1F0ZA 3U7DA 2MLBA 4RGMA 5FKAC 1HTQA 3EFUA 2LRUA 1VD2A 2VZKB 3H6NA 1TTNA 4LJPB 1I4RA 2ZVNA 2KDMA 4TKNA 4HRSA 1YD8U 2WQYB 3EHVA 1SJED 3TBLD 4CHKA 3SFDB 3RMKC 1QILA 2KWCA 3I3TB 3EA6A 2KQ7A 3TEXA 2LXCA 3IT6B 4HWIB 2Z8LA 3FC4A 3P2BA 4LDTB 2L76A 4J6IA 5FK9C 4HEA1 1I7HA 2MA9B 3ZNGC 1OQRA 3AE8B 4C56C 3BVZA 2KNBA 2OHFA 4BFRA 3L08A 1A5RA 2Z59B 3QIJA 1Z2MA 1SXTA 2L00B 4GDKA 2R2QA 4RMAA 3VTVA 2BF8B 5L83A 3GE8C 4WAAA 4WQOB 3HVZA 1WZ0A 1JROA 1UD7A 3N9YC 4WWPA 3AE3B 4HDOA 1WXAA 2HTME 4MGZE 1R4MI 1EM7A 2IGGA 1TS2A 2KACA 4GOCA 3B1LX 1R4NI 1RRBA 1YJJA 2Y5CA 4JGHB 4WJPA 2BS2B 5EE0A 3VFKA 4KDLB 4LK0M 1E8YA 3M63B 4RFBA 1H8CA 1N60A 4USAA 4GMVA 5D94A 2KMAA 2JXTA 1WMHA 1RM6C 4I6NB 1KM7A 1L4ZB 4LNFA 3ML8A 3R2IA 2DWQA 2DX5B 2WU5B 2LGSA 4TV3A 3CSTA 4A8XC 3TJPA 2MBQA 4XC2A 3DBHI 4NZLB 1FCLA 4HJKA 1EU3A 4W9EA 2NR2A 4YXDB 3R2TA 1L6UA 2WXMA 2BYVE 2MBOA 3WAOA 1FXIA 3N1XC 2V1YA 2CJOA 4NQLB 3V62A 2JVCA 2MBEA 4JWUC 2ZJDA 5J2RA 2JF5A 3RNAC 4LNKA 2CJNA 2DZJA 3TSSA 2AL3A 1WM2A 4XE0A 3UF8A 2K8HA 3JYUA 2WLBA 1WRIA 2JYTA 4NJCA 4YWGG 1GJZA 3RNBC 4NAWA 3NRZA 4S0RA 1WJ4A 3CF6E 1D3ZA 4QAYA 4MM3A 2MW5A 3ENEA 4ICUA 3L16A 3GZNI 3UGBB 2G4DB 4C00A 4W9LA 3MHZA 2CHZA 4WQMA 2ZEQA 4GIVA 2B3AA 5D6JB 4C7YA 4B95A 1R7SA 4DXFA 3W5UB 2N9KA 3GS2A 3KVFB 3JVZX 3NZ3A 1WE7A 4RF0A 1YX6B 3OG5A 1UWXA 3AU5A 4N9F4 3PZ7A 1S1QB 5L95C 1E7PB 1PYWD 2KN4A 1JALA 3DVGY 3EGRA 4ANVA 2VH2A 4OZBA 5BMHA 1YN4A 3C19A 3AECB 3PS6A 2LZ6A 1JWBD 2G45B 1HZ6A 2OOBB 2WS3B 2BS3B 2QHOA 1XQQA 3DOWA 5D7GA 5EE9A 2J42A 4OZCA 2L8JA 2XBBC 4FLHA 2XN9C 5AZHA 2PE9A 2JY6A 1EF1A 3FAHA 2MBHA 5JHAA 2I2YA 4I6LB 2Y5PA 3AULA 3U7ZA 5D3DA 3PHWB 2QC8A 1QF6A 1EUVB 3O65B 3NOBA 5FR3A 3LYYA 2PMVA 4JLCA 1WE6A 4ARIA 3AEGB 1IYFA 3RNEC 2DAJA 1EWCA 4A3PA 2O6VD 1WGKA 4P7IA 3ZDMC 1GB4A 2GOWA 4ZHPA 1GUAB 3R7QA 3WAPA 2KT7A 2ZPNA 3WALA 1RLFA 3QJZA 2WXNA 2A4ZA 5AEKB 1SEBD 5IAAC 1E5WA 5DPRA 3UIOB 4MT5A 1TGZB 2J0JA 1LXDA 2C9WB 3RZFA 4OHJA 2NPTB 2D3CA 2JZZA 2CU3A 1T0SC 1WR1A 4WH4A 1VRAB 2G1EA 4B0EA 2KDBA 1MHXA 3NVYA 1C3TA 4XWTA 3TIXA 2O6VA 4DDID 4FXCA 1WYGA 3Q3MC 3PLUA 3PRZA 4BAXA 1B9RA 3AI5A 4HPLB 2PVOD 1PDXA 2KAJA 2V3NA 1ZUD2 5C23A 2N9PC 4W9CA 2IJ0A 3RFZB 1ZXHA 3AE6B 5BYRA 3AV8A 1R4NB 3Q8AA 3BYYB 1FNWA 2IY0B 3ZUNA 2K8CA 1OEYA 4KZCA 3N3KB 2DZIA 2KX0A 1WH3A 2NTSA 4HKZE 4KGTA 3DVNU 2AWTA 4PS8A 3Q3FA 1BXTA 2WXFA 2KJHB 4AP4C 1CJEA 4J3OD 2K39A 3AEBB 4MSQB 1FPYA 3WAMA 1N6ZA 1K51A 4ZYSA 1C77A 1QT9A 3JW0X 2BW2A 2JQRB 5H92C 4BKTA 1JWAD 3AXCA 1UH6A 3P1MA 1ZOYB 3M3JA 1I42A 2JXXA 2MP2A 1V80A 5FR6A 1GNUA 1JW9D 2N7JA 2XEWA 4KZ0A 2WXOA 3ABVB 1P7EA 2WXIA 3V05A 2FBWB 1EF5A 4C4VA 4WWNA 5DPWA 2QMTA 4GLSC 4MGKE 4NY0A 2NCNA 2D3BA 1T5XD 3Q3JA 3EUB2 3L0WB 5TSSA 3R8BA 2NTTA 5C1ZA 1YQBA 2RDGA 2WWZA 3X0WA 3A1QB 1NYQA 5HG2A 4GDLA 4F7ZA 1D6EC 1K8RB 3RT3B 3E56A 1L7YA 2ZPYA 4II2B 2M4NA 2W3RA 1SBBB
chains in the Genus database with same CATH topology
4DHZE 3RUIB 2FIDA 3KYDD 3RCZA 2O6VB 4XZ4A 3LJ3A 3W1SC 5JZEB 3A33B 3ALBA 4HDQA 3PLVA 2KWUB 2BYFA 2GMIC 3RD2A 3VUWA 4MSMB 2MLBA 3U7DA 4NJ6A 2K25A 1QZEA 2NS5A 3EFUA 4JQWC 3KYCD 2L0FA 2LRUA 2JRHA 1VD2A 3ZRCA 4KIKB 3H6NA 4DHJD 2K6QA 1TTNA 4LJPB 4IWPA 2DYOA 2ZVNA 4X57B 5D2MB 3NHEB 4TKNA 3R7RA 1LM8B 3L17A 1YD8U 3GOEA 1S3SG 4ANUA 2C7NB 3EHVA 3TBLD 2LWPA 4CHKA 1VCBA 1UZXB 2IZVB 2JT4B 3PREA 2CKHB 3ZVVA 2KWCA 4GGQA 1KJTA 2GBRA 1ISNA 3ZO5B 3I3TB 1SGHA 3PRPB 1YX5B 2KQ7A 2HJ8A 2LXCA 3KH0A 4MH0E 4NNJB 4HWIB 2L0TA 4HCPB 3P2BA 4LDTB 3A9KB 2L76A 4J6IA 1J8CA 3V60A 3QX1A 4FN2A 1ZKHA 2MA9B 3ZNGC 3QA8A 2N1WA 2REXA 4DWFA 2C60A 2KNBA 2N9EB 2RR9A 4BFRA 3L08A 1A5RA 4EZKA 2Z59B 4AWJA 2FCSA 4BBNF 3QIJA 3CSFA 1Z2MA 1Q0WB 4K7SA 2L00B 4BKGA 2Z0EB 2Z0DB 2KLCA 2R2QA 3IG3A 2KZRA 2NVUI 4GDKA 4RMAA 3VTVA 3VXWA 2BF8B 2FCMA 2RGFA 4W9KA 5L83A 4WAAA 4WQOB 1WZ0A 4GSWA 1UD7A 5EDSA 2A5UA 3VH4B 4WWPA 3K9PB 1WGHA 4HDOA 3QQ8B 1WJNA 1WXAA 1XD3B 3QHTA 4WWOA 3M62B 3NZSA 4E3CA 4MGZE 4IM3A 1R4MI 2KQSA 4GOCA 3B1LX 1R4NI 1RRBA 4WJPA 3VFKA 4JGHB 4TQ1A 4JL9A 3DDCB 4IUMB 4FJVB 4KDLB 1RAXA 1E8YA 3M63B 1H8CA 4KVGB 4PS7A 2AYOB 2MP2B 4GMVA 5D94A 2BGFA 2KMAA 1NBFC 1WMHA 4F8CB 2CHWA 2KDFB 2LVOA 5DCNA 4AJYB 4CO7A 4I6NB 2LUEA 5HKHA 2MBBB 1KM7A 1E8XA 3VH3B 3WANA 2K1FA 4IW0A 3U30A 2KX3A 1EO6A 3ML8A 1UBQA 4MDKE 2KKCA 1WXMA 1X1MA 2DX5B 2JUOA 3ZW3A 5GMVA 2M8SA 4TV3A 3CSTA 1UBIA 3TJPA 2DZKA 1MG8A 2MBQA 3UIPB 1WGDA 1WX8A 4XC2A 2JRIB 2ZNVB 1OGWA 4G0NB 3DBHI 2PE6B 4GDLB 5LXIB 2J0KA 4HJKA 4B6WA 3B0AA 1P1AA 1E8WA 2PPHA 3PT2B 4W9EA 4ZDVA 2NR2A 1WXVA 4WJNA 2KDEB 2VRRB 4EFOA 2EMTA 3PSEB 2BYVE 2MBOA 4IM2A 4WJOA 3W1SA 3WAOA 3ZRFA 2DYMA 2V1YA 5TR5A 2KJRA 3EC8A 4PYUA 4AJWA 4NQLB 2KTRA 2MRPA 3N32A 3V62A 2JVCA 2MBEA 4CYEA 2ZJDA 5J2RA 5E6NA 1H4RA 2RSUA 2JF5A 2LASA 4ASWC 3A9JA 4IWOA 1V5TA 2DZJA 3PGEA 3PZDA 4W9HA 4M8NA 2AL3A 1WM2A 2OJRA 3UF8A 2K8HA 3JYUA 4G11A 1V81A 2RPQA 1GJZA 2KTFA 1V6EA 4HCNB 4NAWA 4OVUA 2UYZB 3H7SA 1WI0A 4ICVA 1WJ4A 2ZCBA 2MX2A 3CF6E 1Q5WB 3SD5A 1D3ZA 4MM3A 2MW5A 3QARA 3ENEA 4ICUA 3A1QA 4ZYNA 3ZLZA 2HTHA 2GBJA 3L16A 4NQKE 3GZNI 4IC7B 3UGBB 2G4DB 3MJWA 2AL6A 4W9LA 1WRDB 5CX3A 2ASQA 2CHZA 3UQAA 1U4AA 2ZEQA 4GIVA 2B3AA 2BWFA 2DHZA 5D6JB 4A3OA 3KW5B 4KV2A 4B95A 2NPTA 5KHOA 2KFKA 3KVFB 3JVZX 3DCGA 1L2NA 1WF9A 3ZNZB 4K81A 1C1YB 1WE7A 4LCDE 2XK5A 3VHTC 4G3XB 1F9JA 1YX6B 2AEHA 3ZTDA 3AU5A 4MJSA 4N9F4 3D32A 2ZZPB 2M17A 1S1QB 3QC8B 2O2VA 4IM0A 2MCNB 2FAZA 4BVUC 5L95C 1WX7A 3DBRI 3DVNV 1E90A 3DVGY 2LVQA 3OJ3A 4DDGD 4ZRKA 4AUQC 4ANVA 1KLVA 3C0RB 2BYEA 5LXHA 1BT0A 3VQIA 2RD0A 4KDIC 4DHJB 1ZGUB 3OAWA 3ZNID 1P98A 1E8ZA 1RFAA 3PS6A 2LZ6A 2CU1A 2HD5B 2N7EA 3QWZB 3M95A 2G45B 2LRWA 2OOBB 5IA7A 3VDZA 2QHOA 3DOWA 1XQQA 4W9DA 5D7GA 4BOSC 3ZNHB 3R3MA 1WMHB 2L8JA 2XBBC 3HM3A 3K9OB 4FLHA 5AZHA 1GG3A 2PE9A 1OTRB 2UWQA 2JY6A 2LGXA 2D2QA 3H7PA 3SDLC 2KN5A 1EF1A 2MBHA 1WGRA 4XX5A 5CTRC 5JHAA 1E7UA 2DYBA 2LGDA 4ANXA 2C7MB 4I6LB 3ONSA 2KXJA 3AULA 3MTNB 2KO3A 2BPSA 2L7RA 3PHWB 3DQVA 2K6DB 2N7DA 4FULA 1EUVB 1OQYA 3O65B 2J0MA 3NOBA 3RULA 2JZ3B 1Q1OA 3JSVB 4KSKC 3V6EB 3VUXA 4RM9A 1WGYA 2FCNA 1V5OA 4JLCA 2FUHB 2MQJA 3CMMB 3V61A 3VTWA 1J19A 2WYQA 3ML9A 4PS3A 2KWVB 1CMXB 1WE6A 4GXBA 2KANA 3OJ4B 4HLEA 3PTFC 3APCA 3DBLI 4HVBA 1IYFA 2DAJA 3PVLA 3NS8A 2KTRB 1PQSA 5G2NA 4A3PA 3APDA 4DXAB 4EOYA 3B08A 2IO3B 2KLGA 4JIOU 4W9FA 1WR6E 4M8MA 2O6VD 4IG7B 4FHKA 4P7IA 3ZDMC 2GOWA 1WYWB 3HIZA 5AZGA 3IHPC 3NZUA 2KD0A 1GUAB 4MEMA 2NBUA 3LDZE 4ZRIA 3R7QA 2K8BA 3N30A 3WAPA 2LI5A 2KK8A 2FCQA 3ECIA 2ZPNA 1WX9A 3WALA 5AZFA 4MGYE 1RLFA 1SIFA 3QJZA 2A4ZA 5AEKB 3TMPB 5E6PA 5IAAC 2ZCCA 3PPAA 3HHMA 4W9GA 4GU2A 4HPMB 5CHFA 2W9NA 3VUYA 4FHJA 1Y8RC 1E5WA 5DPRA 1WY8A 3NY5A 3UIOB 4EUTA 1TGZB 2J0JA 1LXDA 2C9WB 2WX1A 5JHBA 2KMCA 2EKEC 4DBGA 2BWES 2KVRA 3BY4B 3T9LA 2YLMA 4ZRJA 3RZFA 3APFA 2I1JA 3PHXB 1I35A 4MELA 1P0RA 2NPTB 3OLMD 3EECA 4I6PA 2JZZA 3ZKJC 2DZMA 2ZNVC 1GC7A 1NDDA 1WR1A 2XK5B 4LDTD 1JRUA 3IFWB 5DPSA 2YVCA 3UQBA 1V2YA 2MWSB 1E7VA 2KDBA 4F1SA 4MJSB 1SE9A 5CHWA 4EZLA 2O2VB 3L10B 1M94A 1C3TA 1TZ1A 4NPNA 3ZTCA 4AOFA 3TIXA 4GB9A 2ZVOA 2I1KA 2O6VA 3PV1A 4DDID 3H9DA 1WM3A 2BKRB 2Y5BB 4BBNC 3KUZA 1YIWA 1WXSA 3R66C 5G55A 4IWQA 3PLUA 3PRZA 4GDKB 4E74A 1V9JA 1WJ6A 2HE7A 3AI5A 4HPLB 3TL5A 2N1VA 3L54A 1FXTB 3IVFA 2WX0A 3DVGX 4FA6A 3KUCB 4KIKA 2N9PC 5C23A 1XT9B 1YJ1A 1WGGA 2KFJA 2J7QB 4W9CA 1TBEA 3WA0A 3RZWC 1G6JA 1UGMA 4MGIE 4DHZB 2LJ5A 4FJYA 3IBEA 4LJOB 4EEWA 5KHQA 4M0WB 2IY0B 2JWZA 3H7PB 5LLIA 3ZUNA 3MHSD 2IO0B 4K1RB 4PYZA 4NJ7A 5J18A 3ZDTA 2K8CA 1T0YA 1OEYA 1V49A 2D11A 2EMSA 2KJ6A 4KZCA 2KC1A 2LD9A 2R2OA 3A9KA 3N3KB 2DZIA 2KX0A 3KUDB 1WH3A 1WZ3A 2GBMA 3DVNU 1Z5SB 1ZW7A 5JH5C 2AWTA 4PS8A 5DPTA 1OEYJ 1WIAA 2G4SA 3Q3FA 3W1YA 2KHWB 1AARA 2KJHB 2CHXA 4II3B 4AP4C 4HK2A 2NBWB 2K39A 2G3QB 2PJHA 2M0XA 4MSQB 3WAMA 4DK5A 4TUUA 4B9KA 4BOZB 3BINA 3JW0X 2C7HA 5E6OA 1V86A 2V3SA 3DBSA 4URKA 4KSLC 2N9XA 3H1UA 3WIMA 4BKSD 2NBVB 4BKTA 2C5LC 2MSED 4W9IA 3AU4A 3X23A 3AXCA 3PRMB 1UH6A 2IO2B 2KC2A 3VTUA 3M3JA 1GC6A 1I42A 1WJUA 2LGYA 4E71A 2BKFA 2IY1B 2KDIA 2WDTB 2LXAA 3QK0A 4K7UA 4K7WA 1UELA 2JXXA 2MP2A 4A20A 1V80A 2L05A 5FR6A 1GNUA 4FADA 2XEWA 1P3QU 4KZ0A 4YL8A 1LFDA 4EZJA 2DAFA 1IPGA 1EF5A 3VVWB 2L3ZA 2GBKA 4TQ0A 3A9JB 4WWNA 4RM8A 5BO4B 5J17A 5DPWA 2FNJB 3U8ZA 3ZIMA 2CS4A 4MGKE 4NY0A 4ANWA 2NCNA 1P9DU 3Q3JA 2D3GA 3A4RA 4G50A 2D10A 3L0WB 2KOXA 4OVVA 2FIFA 3SHQA 4FBJB 4NAWB 1IP9A 3QCAA 1NI2A 1WFYA 3JSVA 3VAWA 3S2AA 5C1ZA 3L13A 4WJQA 3TCAA 1YQBA 4W9JA 2N4FA 3DPDA 4HXDA 3HM6X 2WWZA 3X0WA 3A1QB 3T8MA 5CHVC 1LQBA 2LVPA 1HE8A 4GDLA 4GN1A 4F7ZA 3V6CB 1K8RB 2CR5A 3A4SC 2IYDB 3RT3B 1J0GA 2D07B 2DENB 2M1MA 2IBIB 1L7YA 3HK0A 1KOTA 2IO1B 3UINB 3RYTA 2GBNA 2ZPYA 3QAQA 4II2B 2JPHA 2M4NA 4BKSA 2PEAA 2KFKB 3SU8X 2V4LA 4EKUA 4FJZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DHZ E;  3RUI B;  2FID A;  3KYD D;  3RCZ A;  2O6V B;  4XZ4 A;  3LJ3 A;  3W1S C;  5JZE B;  3A33 B;  3ALB A;  4HDQ A;  3PLV A;  2KWU B;  2BYF A;  2GMI C;  3RD2 A;  3VUW A;  4MSM B;  2MLB A;  3U7D A;  4NJ6 A;  2K25 A;  1QZE A;  2NS5 A;  3EFU A;  4JQW C;  3KYC D;  2L0F A;  2LRU A;  2JRH A;  1VD2 A;  3ZRC A;  4KIK B;  3H6N A;  4DHJ D;  2K6Q A;  1TTN A;  4LJP B;  4IWP A;  2DYO A;  2ZVN A;  4X57 B;  5D2M B;  3NHE B;  4TKN A;  3R7R A;  1LM8 B;  3L17 A;  1YD8 U;  3GOE A;  1S3S G;  4ANU A;  2C7N B;  3EHV A;  3TBL D;  2LWP A;  4CHK A;  1VCB A;  1UZX B;  2IZV B;  2JT4 B;  3PRE A;  2CKH B;  3ZVV A;  2KWC A;  4GGQ A;  1KJT A;  2GBR A;  1ISN A;  3ZO5 B;  3I3T B;  1SGH A;  3PRP B;  1YX5 B;  2KQ7 A;  2HJ8 A;  2LXC A;  3KH0 A;  4MH0 E;  4NNJ B;  4HWI B;  2L0T A;  4HCP B;  3P2B A;  4LDT B;  3A9K B;  2L76 A;  4J6I A;  1J8C A;  3V60 A;  3QX1 A;  4FN2 A;  1ZKH A;  2MA9 B;  3ZNG C;  3QA8 A;  2N1W A;  2REX A;  4DWF A;  2C60 A;  2KNB A;  2N9E B;  2RR9 A;  4BFR A;  3L08 A;  1A5R A;  4EZK A;  2Z59 B;  4AWJ A;  2FCS A;  4BBN F;  3QIJ A;  3CSF A;  1Z2M A;  1Q0W B;  4K7S A;  2L00 B;  4BKG A;  2Z0E B;  2Z0D B;  2KLC A;  2R2Q A;  3IG3 A;  2KZR A;  2NVU I;  4GDK A;  4RMA A;  3VTV A;  3VXW A;  2BF8 B;  2FCM A;  2RGF A;  4W9K A;  5L83 A;  4WAA A;  4WQO B;  1WZ0 A;  4GSW A;  1UD7 A;  5EDS A;  2A5U A;  3VH4 B;  4WWP A;  3K9P B;  1WGH A;  4HDO A;  3QQ8 B;  1WJN A;  1WXA A;  1XD3 B;  3QHT A;  4WWO A;  3M62 B;  3NZS A;  4E3C A;  4MGZ E;  4IM3 A;  1R4M I;  2KQS A;  4GOC A;  3B1L X;  1R4N I;  1RRB A;  4WJP A;  3VFK A;  4JGH B;  4TQ1 A;  4JL9 A;  3DDC B;  4IUM B;  4FJV B;  4KDL B;  1RAX A;  1E8Y A;  3M63 B;  1H8C A;  4KVG B;  4PS7 A;  2AYO B;  2MP2 B;  4GMV A;  5D94 A;  2BGF A;  2KMA A;  1NBF C;  1WMH A;  4F8C B;  2CHW A;  2KDF B;  2LVO A;  5DCN A;  4AJY B;  4CO7 A;  4I6N B;  2LUE A;  5HKH A;  2MBB B;  1KM7 A;  1E8X A;  3VH3 B;  3WAN A;  2K1F A;  4IW0 A;  3U30 A;  2KX3 A;  1EO6 A;  3ML8 A;  1UBQ A;  4MDK E;  2KKC A;  1WXM A;  1X1M A;  2DX5 B;  2JUO A;  3ZW3 A;  5GMV A;  2M8S A;  4TV3 A;  3CST A;  1UBI A;  3TJP A;  2DZK A;  1MG8 A;  2MBQ A;  3UIP B;  1WGD A;  1WX8 A;  4XC2 A;  2JRI B;  2ZNV B;  1OGW A;  4G0N B;  3DBH I;  2PE6 B;  4GDL B;  5LXI B;  2J0K A;  4HJK A;  4B6W A;  3B0A A;  1P1A A;  1E8W A;  2PPH A;  3PT2 B;  4W9E A;  4ZDV A;  2NR2 A;  1WXV A;  4WJN A;  2KDE B;  2VRR B;  4EFO A;  2EMT A;  3PSE B;  2BYV E;  2MBO A;  4IM2 A;  4WJO A;  3W1S A;  3WAO A;  3ZRF A;  2DYM A;  2V1Y A;  5TR5 A;  2KJR A;  3EC8 A;  4PYU A;  4AJW A;  4NQL B;  2KTR A;  2MRP A;  3N32 A;  3V62 A;  2JVC A;  2MBE A;  4CYE A;  2ZJD A;  5J2R A;  5E6N A;  1H4R A;  2RSU A;  2JF5 A;  2LAS A;  4ASW C;  3A9J A;  4IWO A;  1V5T A;  2DZJ A;  3PGE A;  3PZD A;  4W9H A;  4M8N A;  2AL3 A;  1WM2 A;  2OJR A;  3UF8 A;  2K8H A;  3JYU A;  4G11 A;  1V81 A;  2RPQ A;  1GJZ A;  2KTF A;  1V6E A;  4HCN B;  4NAW A;  4OVU A;  2UYZ B;  3H7S A;  1WI0 A;  4ICV A;  1WJ4 A;  2ZCB A;  2MX2 A;  3CF6 E;  1Q5W B;  3SD5 A;  1D3Z A;  4MM3 A;  2MW5 A;  3QAR A;  3ENE A;  4ICU A;  3A1Q A;  4ZYN A;  3ZLZ A;  2HTH A;  2GBJ A;  3L16 A;  4NQK E;  3GZN I;  4IC7 B;  3UGB B;  2G4D B;  3MJW A;  2AL6 A;  4W9L A;  1WRD B;  5CX3 A;  2ASQ A;  2CHZ A;  3UQA A;  1U4A A;  2ZEQ A;  4GIV A;  2B3A A;  2BWF A;  2DHZ A;  5D6J B;  4A3O A;  3KW5 B;  4KV2 A;  4B95 A;  2NPT A;  5KHO A;  2KFK A;  3KVF B;  3JVZ X;  3DCG A;  1L2N A;  1WF9 A;  3ZNZ B;  4K81 A;  1C1Y B;  1WE7 A;  4LCD E;  2XK5 A;  3VHT C;  4G3X B;  1F9J A;  1YX6 B;  2AEH A;  3ZTD A;  3AU5 A;  4MJS A;  4N9F 4;  3D32 A;  2ZZP B;  2M17 A;  1S1Q B;  3QC8 B;  2O2V A;  4IM0 A;  2MCN B;  2FAZ A;  4BVU C;  5L95 C;  1WX7 A;  3DBR I;  3DVN V;  1E90 A;  3DVG Y;  2LVQ A;  3OJ3 A;  4DDG D;  4ZRK A;  4AUQ C;  4ANV A;  1KLV A;  3C0R B;  2BYE A;  5LXH A;  1BT0 A;  3VQI A;  2RD0 A;  4KDI C;  4DHJ B;  1ZGU B;  3OAW A;  3ZNI D;  1P98 A;  1E8Z A;  1RFA A;  3PS6 A;  2LZ6 A;  2CU1 A;  2HD5 B;  2N7E A;  3QWZ B;  3M95 A;  2G45 B;  2LRW A;  2OOB B;  5IA7 A;  3VDZ A;  2QHO A;  3DOW A;  1XQQ A;  4W9D A;  5D7G A;  4BOS C;  3ZNH B;  3R3M A;  1WMH B;  2L8J A;  2XBB C;  3HM3 A;  3K9O B;  4FLH A;  5AZH A;  1GG3 A;  2PE9 A;  1OTR B;  2UWQ A;  2JY6 A;  2LGX A;  2D2Q A;  3H7P A;  3SDL C;  2KN5 A;  1EF1 A;  2MBH A;  1WGR A;  4XX5 A;  5CTR C;  5JHA A;  1E7U A;  2DYB A;  2LGD A;  4ANX A;  2C7M B;  4I6L B;  3ONS A;  2KXJ A;  3AUL A;  3MTN B;  2KO3 A;  2BPS A;  2L7R A;  3PHW B;  3DQV A;  2K6D B;  2N7D A;  4FUL A;  1EUV B;  1OQY A;  3O65 B;  2J0M A;  3NOB A;  3RUL A;  2JZ3 B;  1Q1O A;  3JSV B;  4KSK C;  3V6E B;  3VUX A;  4RM9 A;  1WGY A;  2FCN A;  1V5O A;  4JLC A;  2FUH B;  2MQJ A;  3CMM B;  3V61 A;  3VTW A;  1J19 A;  2WYQ A;  3ML9 A;  4PS3 A;  2KWV B;  1CMX B;  1WE6 A;  4GXB A;  2KAN A;  3OJ4 B;  4HLE A;  3PTF C;  3APC A;  3DBL I;  4HVB A;  1IYF A;  2DAJ A;  3PVL A;  3NS8 A;  2KTR B;  1PQS A;  5G2N A;  4A3P A;  3APD A;  4DXA B;  4EOY A;  3B08 A;  2IO3 B;  2KLG A;  4JIO U;  4W9F A;  1WR6 E;  4M8M A;  2O6V D;  4IG7 B;  4FHK A;  4P7I A;  3ZDM C;  2GOW A;  1WYW B;  3HIZ A;  5AZG A;  3IHP C;  3NZU A;  2KD0 A;  1GUA B;  4MEM A;  2NBU A;  3LDZ E;  4ZRI A;  3R7Q A;  2K8B A;  3N30 A;  3WAP A;  2LI5 A;  2KK8 A;  2FCQ A;  3ECI A;  2ZPN A;  1WX9 A;  3WAL A;  5AZF A;  4MGY E;  1RLF A;  1SIF A;  3QJZ A;  2A4Z A;  5AEK B;  3TMP B;  5E6P A;  5IAA C;  2ZCC A;  3PPA A;  3HHM A;  4W9G A;  4GU2 A;  4HPM B;  5CHF A;  2W9N A;  3VUY A;  4FHJ A;  1Y8R C;  1E5W A;  5DPR A;  1WY8 A;  3NY5 A;  3UIO B;  4EUT A;  1TGZ B;  2J0J A;  1LXD A;  2C9W B;  2WX1 A;  5JHB A;  2KMC A;  2EKE C;  4DBG A;  2BWE S;  2KVR A;  3BY4 B;  3T9L A;  2YLM A;  4ZRJ A;  3RZF A;  3APF A;  2I1J A;  3PHX B;  1I35 A;  4MEL A;  1P0R A;  2NPT B;  3OLM D;  3EEC A;  4I6P A;  2JZZ A;  3ZKJ C;  2DZM A;  2ZNV C;  1GC7 A;  1NDD A;  1WR1 A;  2XK5 B;  4LDT D;  1JRU A;  3IFW B;  5DPS A;  2YVC A;  3UQB A;  1V2Y A;  2MWS B;  1E7V A;  2KDB A;  4F1S A;  4MJS B;  1SE9 A;  5CHW A;  4EZL A;  2O2V B;  3L10 B;  1M94 A;  1C3T A;  1TZ1 A;  4NPN A;  3ZTC A;  4AOF A;  3TIX A;  4GB9 A;  2ZVO A;  2I1K A;  2O6V A;  3PV1 A;  4DDI D;  3H9D A;  1WM3 A;  2BKR B;  2Y5B B;  4BBN C;  3KUZ A;  1YIW A;  1WXS A;  3R66 C;  5G55 A;  4IWQ A;  3PLU A;  3PRZ A;  4GDK B;  4E74 A;  1V9J A;  1WJ6 A;  2HE7 A;  3AI5 A;  4HPL B;  3TL5 A;  2N1V A;  3L54 A;  1FXT B;  3IVF A;  2WX0 A;  3DVG X;  4FA6 A;  3KUC B;  4KIK A;  2N9P C;  5C23 A;  1XT9 B;  1YJ1 A;  1WGG A;  2KFJ A;  2J7Q B;  4W9C A;  1TBE A;  3WA0 A;  3RZW C;  1G6J A;  1UGM A;  4MGI E;  4DHZ B;  2LJ5 A;  4FJY A;  3IBE A;  4LJO B;  4EEW A;  5KHQ A;  4M0W B;  2IY0 B;  2JWZ A;  3H7P B;  5LLI A;  3ZUN A;  3MHS D;  2IO0 B;  4K1R B;  4PYZ A;  4NJ7 A;  5J18 A;  3ZDT A;  2K8C A;  1T0Y A;  1OEY A;  1V49 A;  2D11 A;  2EMS A;  2KJ6 A;  4KZC A;  2KC1 A;  2LD9 A;  2R2O A;  3A9K A;  3N3K B;  2DZI A;  2KX0 A;  3KUD B;  1WH3 A;  1WZ3 A;  2GBM A;  3DVN U;  1Z5S B;  1ZW7 A;  5JH5 C;  2AWT A;  4PS8 A;  5DPT A;  1OEY J;  1WIA A;  2G4S A;  3Q3F A;  3W1Y A;  2KHW B;  1AAR A;  2KJH B;  2CHX A;  4II3 B;  4AP4 C;  4HK2 A;  2NBW B;  2K39 A;  2G3Q B;  2PJH A;  2M0X A;  4MSQ B;  3WAM A;  4DK5 A;  4TUU A;  4B9K A;  4BOZ B;  3BIN A;  3JW0 X;  2C7H A;  5E6O A;  1V86 A;  2V3S A;  3DBS A;  4URK A;  4KSL C;  2N9X A;  3H1U A;  3WIM A;  4BKS D;  2NBV B;  4BKT A;  2C5L C;  2MSE D;  4W9I A;  3AU4 A;  3X23 A;  3AXC A;  3PRM B;  1UH6 A;  2IO2 B;  2KC2 A;  3VTU A;  3M3J A;  1GC6 A;  1I42 A;  1WJU A;  2LGY A;  4E71 A;  2BKF A;  2IY1 B;  2KDI A;  2WDT B;  2LXA A;  3QK0 A;  4K7U A;  4K7W A;  1UEL A;  2JXX A;  2MP2 A;  4A20 A;  1V80 A;  2L05 A;  5FR6 A;  1GNU A;  4FAD A;  2XEW A;  1P3Q U;  4KZ0 A;  4YL8 A;  1LFD A;  4EZJ A;  2DAF A;  1IPG A;  1EF5 A;  3VVW B;  2L3Z A;  2GBK A;  4TQ0 A;  3A9J B;  4WWN A;  4RM8 A;  5BO4 B;  5J17 A;  5DPW A;  2FNJ B;  3U8Z A;  3ZIM A;  2CS4 A;  4MGK E;  4NY0 A;  4ANW A;  2NCN A;  1P9D U;  3Q3J A;  2D3G A;  3A4R A;  4G50 A;  2D10 A;  3L0W B;  2KOX A;  4OVV A;  2FIF A;  3SHQ A;  4FBJ B;  4NAW B;  1IP9 A;  3QCA A;  1NI2 A;  1WFY A;  3JSV A;  3VAW A;  3S2A A;  5C1Z A;  3L13 A;  4WJQ A;  3TCA A;  1YQB A;  4W9J A;  2N4F A;  3DPD A;  4HXD A;  3HM6 X;  2WWZ A;  3X0W A;  3A1Q B;  3T8M A;  5CHV C;  1LQB A;  2LVP A;  1HE8 A;  4GDL A;  4GN1 A;  4F7Z A;  3V6C B;  1K8R B;  2CR5 A;  3A4S C;  2IYD B;  3RT3 B;  1J0G A;  2D07 B;  2DEN B;  2M1M A;  2IBI B;  1L7Y A;  3HK0 A;  1KOT A;  2IO1 B;  3UIN B;  3RYT A;  2GBN A;  2ZPY A;  3QAQ A;  4II2 B;  2JPH A;  2M4N A;  4BKS A;  2PEA A;  2KFK B;  3SU8 X;  2V4L A;  4EKU A;  4FJZ A; 
#chains in the Genus database with same CATH topology
 1DOY A;  3KYD D;  3RCZ A;  3Q8B A;  2QEJ C;  3MC8 A;  1TKE A;  2GMI C;  1JQ4 A;  4MSM B;  4NJ6 A;  2K25 A;  1QZE A;  4JE3 B;  1NI3 A;  4KIK B;  4DHJ D;  1IBX B;  4YTN B;  1IGD A;  5D2M B;  2KMM A;  3R7R A;  1LM8 B;  1S3S G;  1JCK B;  2LWP A;  3E9S A;  1SE2 A;  2EEL A;  1T0R C;  1UZX B;  3ZJU A;  2CKH B;  3ZVV A;  4GGQ A;  1KJT A;  1LO5 D;  1NEK B;  1GOZ A;  4IKG A;  2L0T A;  3A9K B;  1K52 A;  3N1Y C;  3QX1 A;  2N1W A;  2REX A;  3MC0 B;  4DWF A;  2C60 A;  1KLG D;  4EZK A;  2FCS A;  3DHI C;  2R61 A;  1Q0W B;  2AQ3 B;  4BKG A;  2Z0D B;  2KLC A;  3VXW A;  3ZYY X;  2N0S B;  4KGR A;  1ZXI A;  3QHT A;  2M19 A;  3M62 B;  2J4X A;  1PFD A;  4P1C C;  4TQ1 A;  4JL9 A;  1RAX A;  2E6X A;  4KVG B;  4PS7 A;  4XYC A;  4CQN A;  3SR6 A;  2M0A A;  3HUI A;  1V1P A;  2LVO A;  5DCN A;  4AJY B;  4CO7 A;  3VRB B;  3WAN A;  2HJ1 A;  1EO6 A;  4MDK E;  3URY A;  2JUO A;  2LHD A;  2M8S A;  4YTP B;  2DZK A;  2JRI B;  1C78 A;  2PE6 B;  5LXI B;  3ZQ4 A;  4B6W A;  2D3A A;  1E6E B;  3PT2 B;  4ZDV A;  1WXV A;  1N63 A;  2VRR B;  4EFO A;  2EMT A;  4IM2 A;  4WJO A;  3ZRF A;  2DYM A;  2KJR A;  1XLN A;  2KTR A;  2MRP A;  3N32 A;  1T3Q A;  1YOV B;  3NVV A;  1H4R A;  2LAS A;  1RYJ A;  3LB8 C;  2MH7 A;  4W9H A;  4M8N A;  1FFU A;  1JRP A;  2OJR A;  3W5V B;  1FEH A;  4L23 A;  1V81 A;  2BVC A;  2SAK A;  4KGS A;  1F52 A;  3MC9 A;  3H7S A;  1SIJ A;  1WI0 A;  2ZCB A;  2MX2 A;  3SD5 A;  5C2T B;  3QAR A;  4ZYN A;  3A1Q A;  2GBJ A;  4NQK E;  4M02 A;  4IC7 B;  3MJW A;  5AUI A;  4YTM B;  4UDU C;  3UQA A;  4A3O A;  4KV2 A;  5KHO A;  1VLB A;  1N5X A;  1MG4 A;  2W55 A;  1L2N A;  2I38 A;  4ZHO A;  4K81 A;  3TUO A;  4LCD E;  2XK5 A;  4G3X B;  2LJI A;  4MJS A;  4ZRQ A;  1B1Z A;  3D32 A;  4IM0 A;  2O2V A;  3EFC A;  4BVU C;  3DBR I;  1L4D B;  1FO4 A;  3DVN V;  2LVQ A;  4P1B C;  1IBX A;  3VQI A;  1HTO A;  1WSP A;  2PW9 A;  1P98 A;  1TS5 A;  2UU7 A;  1E8Z A;  4NAM A;  3QWZ B;  1Q10 A;  4TMA B;  5IA7 A;  2QJL A;  2N9L A;  5BYQ A;  4W9D A;  3VDZ A;  3Q14 C;  3R3M A;  2BYT A;  1LGR A;  3UI3 A;  1I4H A;  2WXK A;  1GG3 A;  1OTR B;  2LGX A;  4M0W A;  2XNA C;  3AE7 B;  3SDL C;  3AM9 A;  1WGR A;  5CTR C;  3ONS A;  1UWM A;  2BPS A;  1TJE A;  2WXQ A;  2K6D B;  2N7D A;  4WWM A;  1OQY A;  1UNS A;  3VR9 B;  4KSK C;  3B2F A;  4RM9 A;  1V5O A;  3CMM B;  5IP4 D;  2WYQ A;  2K0P A;  3ML9 A;  2KWV B;  1CMX B;  1F1H A;  1DGJ A;  2Q5W D;  2KAN A;  3DWG C;  3PTF C;  3DBL I;  4HVB A;  3PVL A;  4JX1 C;  2INN E;  3BVG A;  5G2N A;  1QKZ A;  3B08 A;  4W9F A;  3HVD A;  4OZA A;  1YNT E;  5IOI A;  3HIZ A;  5AZG A;  3I57 A;  3IHP C;  3CWI A;  4ZRI A;  3LDZ E;  4MH8 A;  3U4E G;  2LI5 A;  2KK8 A;  2FCQ A;  2VZK D;  3T3N A;  1OQQ A;  3TMP B;  1HA5 A;  5E6P A;  4W9G A;  4GU2 A;  3MP9 A;  4HPM B;  2W9N A;  3TEZ A;  2QIE B;  2KMC A;  2EKE C;  2BWE S;  2BS4 B;  2KVR A;  3Q3O C;  3APF A;  2I1J A;  3OLM D;  3ZKJ C;  2ZNV C;  1IUE A;  4LDT D;  1JRU A;  3IFW B;  5DPS A;  2MWS B;  2IDY A;  5CHW A;  1SSN A;  3H9D A;  5HFY A;  2BKR B;  2RDB C;  4BBN C;  3KUZ A;  1QOG A;  1C4C A;  1L6V A;  1V9J A;  3IVF A;  3VRA B;  3PO0 A;  3DVG X;  3OWE B;  4FA6 A;  3KUC B;  1PUT A;  1XT9 B;  1YJ1 A;  2H89 B;  2JWU A;  4Q2J A;  2FUG 1;  1G6J A;  1UGM A;  3AEA B;  4DHZ B;  4US9 A;  1BUI C;  5H8Y E;  3U2S C;  1PGB A;  4LJO B;  3P4S B;  3SEB A;  5KHQ A;  3H7P B;  5LLI A;  4WAF A;  2YEP F;  2D11 A;  2ACZ B;  4BZA A;  1WZ3 A;  2GBM A;  4TSS A;  5JH5 C;  3Q2A C;  2WP9 B;  2GRI A;  1AAR A;  1RFK A;  4II3 B;  5IN7 A;  3ETR A;  1JML A;  3SFE B;  2IGH A;  2VH1 A;  1SJH D;  4B9K A;  1VZ8 A;  3BIN A;  1GB1 A;  5E6O A;  4URK A;  3AEE B;  4O1N A;  3H1U A;  2BBC A;  1QOB A;  2NBV B;  2MSE D;  1UUP A;  3PRM B;  2IO2 B;  1MHH E;  4E71 A;  2BKF A;  2IY1 B;  3GE3 C;  4K7U A;  1E9M A;  1UEL A;  4A20 A;  2L05 A;  4YL8 A;  1IPG A;  4TQ0 A;  2FNJ B;  3U8Z A;  3ZIM A;  5HI1 A;  4ANW A;  3A4R A;  4G50 A;  4OVV A;  4B0M A;  4LNN A;  1WFY A;  3VAW A;  3S2A A;  3L13 A;  1C79 A;  3TCA A;  2N4F A;  1EU4 A;  3DPD A;  4HXD A;  3HM6 X;  3Q6B A;  1HE8 A;  4GN1 A;  3A4S C;  1F77 A;  1FCC C;  2WDQ B;  1QQR A;  1M4V A;  4OVZ A;  3AB5 A;  3RPF C;  4OW0 A;  2JPH A;  3P4P B;  2PEA A;  2KFK B;  4M01 A;  2G9H D;  2V4L A;  2ZW0 A;  1XLQ A;  4XZ4 A;  3LJ3 A;  2BYF A;  3RD2 A;  3VUW A;  1MI0 A;  4JQW C;  3KYC D;  2L0F A;  3ZXV A;  4IWP A;  2IGD A;  2DYO A;  4H2A A;  3KLS X;  2LUM A;  3ZXR A;  3L17 A;  3GOE A;  1JWS D;  1N5W A;  4ANU A;  4DQO C;  2C7N B;  1AWD A;  3DHH C;  5D3I B;  2JT4 B;  1R4M B;  3ZO5 B;  2L1A A;  1SGH A;  1YX5 B;  3KH0 A;  4MH0 E;  4NNJ B;  4HCP B;  1WWT A;  5G5G A;  1J8C A;  2K9X A;  3V60 A;  4FN2 A;  1ZKH A;  3QA8 A;  3FIL B;  1ET6 A;  2JYE A;  2RR9 A;  4AWJ A;  3NS1 A;  2DLB A;  3CSF A;  4K7S A;  4DDG D;  3IG3 A;  1AN8 A;  4ITK A;  2RGF A;  3J9C A;  1NVI D;  3NVW A;  2H88 B;  2V4I B;  5AUK A;  4GSW A;  3VH4 B;  3K9P B;  1WGH A;  2IND C;  4WWO A;  3NZS A;  4E3C A;  4YSY B;  2BB5 A;  3DDC B;  3AE1 B;  3DBH B;  2AYO B;  2QIL A;  5BMI A;  1NBF C;  4F8C B;  2CHW A;  1YN5 A;  1NEN B;  3BWU D;  3N20 C;  2WDR B;  2KDF B;  1E8X A;  4KX6 B;  2K1F A;  3U30 A;  2KX3 A;  1UBQ A;  4ZRP A;  1X1M A;  3ZJV A;  3ZW3 A;  1C9F A;  5GMV A;  1UBI A;  4M00 A;  3WCQ A;  3UIP B;  1WGD A;  1WX8 A;  2K5P A;  2ZNV B;  4G0N B;  1KH0 A;  5EE1 A;  2J0K A;  1P1A A;  1E8W A;  1HQR D;  3HRD D;  4RF1 A;  2KDE B;  3AE2 B;  1F2R I;  3PSE B;  2YEP B;  3W1S A;  3GZN B;  1VR9 A;  5G5H A;  1NYR A;  4PYU A;  4AJW A;  5E6N A;  2RSU A;  4ASW C;  2ON8 A;  4IWO A;  1F2R C;  1TY2 A;  1V5T A;  3PGE A;  3IAM 1;  3PZD A;  3DWM A;  1I4Q A;  2W82 A;  3BZD B;  1XCQ L;  1V6E A;  4S17 A;  4HCN B;  2UYZ B;  2PVG C;  2LHE A;  2RDH A;  2INC C;  1Q5W B;  4LNI A;  3ZLZ A;  2AL6 A;  3Q8E A;  2BWF A;  3KW5 B;  2WXH A;  4P16 A;  2NPT A;  2KFK A;  3ZGZ A;  3DCG A;  1WF9 A;  3ZNZ B;  3VHT C;  1F9J A;  2X38 A;  2AEH A;  1I4G A;  2WXR A;  3QC8 B;  1WX7 A;  3RNF C;  1C76 A;  3W2D A;  1E90 A;  3OJ3 A;  4ZRK A;  4AUQ C;  3P4R B;  1KLV A;  2WXJ A;  2RD0 A;  1WXQ A;  1RFA A;  2CU1 A;  1V1O A;  1MPE A;  3BII D;  1TT5 B;  1WMH B;  2ONQ A;  3K9O B;  4ACF A;  2UWQ A;  1GPX A;  2KN5 A;  2Y3A A;  4XX5 A;  3I9V 1;  3P4Q B;  1E7U A;  2DYB A;  2LGD A;  4ANX A;  2QSD A;  2X8X X;  3DQV A;  4FUL A;  1TKY A;  3RUL A;  3AED B;  1YN3 A;  3VR8 B;  2JZ3 B;  1Q1O A;  2LFI A;  3JSV B;  3V6E B;  1WGY A;  2FUH B;  3VTW A;  3V61 A;  1J19 A;  1XXG A;  4GXB A;  4HLE A;  1N62 A;  1AW7 A;  3RNC C;  3NS8 A;  1PQS A;  3AN1 A;  4IDI A;  4DXA B;  2QDF A;  1XEE A;  4JIO U;  4M8M A;  3RN9 C;  4FHK A;  3NZU A;  1A70 A;  2LGI A;  1SB3 C;  2NBU A;  1FD6 A;  2K8B A;  3N30 A;  3ECI A;  1EWY C;  3Q69 A;  1WX9 A;  4WUR A;  4R3D A;  2SEB D;  5CHF A;  3VUY A;  4MM3 B;  3Q8C A;  4A90 A;  1WY8 A;  3NY5 A;  4EUT A;  4ARC A;  5JHB A;  3BVM A;  3T9L A;  5BYS A;  2V9H A;  3PHX B;  1I35 A;  1I4P A;  1MJD A;  1NDD A;  1TKG A;  2GI9 A;  3DHG C;  1KRH A;  2YVC A;  3UQB A;  1V2Y A;  1E7V A;  1SE9 A;  4EZL A;  1M94 A;  3BK1 A;  1TZ1 A;  4NPN A;  3ZTC A;  4AOF A;  2PKO A;  1FIQ A;  1GAQ B;  2I1K A;  2ZVO A;  4GB9 A;  4RGN A;  2BB6 A;  3RNG C;  1OFF A;  1YIW A;  1WXS A;  3R66 C;  2OJW A;  4RGT A;  3TL5 A;  1WJ6 A;  1TIF A;  2N1V A;  3L54 A;  1FXT B;  5C3J B;  1QLB B;  4KIK A;  1WGG A;  2J7Q B;  4RGO S;  3T3O A;  3RZW C;  1UF0 A;  2LJ5 A;  3IBE A;  2JWZ A;  2IO0 B;  4NJ7 A;  1JWU D;  5J18 A;  4XWW A;  1T0Y A;  1V49 A;  1HZ5 A;  2KC1 A;  2RMM A;  3A9K A;  2L83 A;  3KUD B;  4XDC A;  1ZW7 A;  5DPT A;  1MFW A;  2G4S A;  3W1Y A;  2CHX A;  1K53 A;  4HK2 A;  4EE2 A;  2NBW B;  2G3Q B;  2PJH A;  2M0X A;  1TZO A;  4RH6 A;  1UGJ A;  1V86 A;  3DBS A;  2AX5 A;  5IO9 A;  3WIM A;  3X23 A;  2JU6 X;  2KC2 A;  2LGY A;  5JXV A;  2KDI A;  2LXA A;  1YMH E;  2BQQ A;  4FAD A;  1P3Q U;  1LFD A;  2DAF A;  2L3Z A;  3A9J B;  4RM8 A;  5J17 A;  2CS4 A;  1P9D U;  1E0Z A;  4JPS A;  2D10 A;  1XCT L;  2FIF A;  3QCA A;  3N1Z C;  3JSV A;  3IAS 1;  1SE4 A;  1LQB A;  1ACC A;  3NVZ A;  2CR5 A;  3FKY A;  2IYD B;  4K3C A;  3CIR B;  4AQ7 A;  1J0G A;  2IBI B;  4MAC A;  1KOT A;  2IO1 B;  1P7F A;  2WHI A;  2W54 A;  3RYT A;  1YQ3 B;  2KYW A;  1VJK A;  4A55 A;  2FID A;  2O6V B;  1TY0 A;  1T0Q C;  3ALB A;  4HDQ A;  3PLV A;  2KWU B;  1L0Y B;  1ENF A;  3P42 A;  2NS5 A;  3ZRC A;  2JRH A;  4YSZ B;  2MEK A;  2K6Q A;  2ZW1 A;  1K50 A;  4X57 B;  3NHE B;  4YSX B;  4WIP A;  3KWL A;  4C7Z A;  4RNA A;  1VCB A;  3B2G A;  2IZV B;  3PRE A;  2GBR A;  1ISN A;  1TS3 A;  1D5X C;  1J7A A;  1STE A;  3PRP B;  2HJ8 A;  2NMQ A;  4XGA B;  2KQ4 X;  3B9J A;  2N9E B;  4KKJ A;  4BBN F;  1C4P A;  2WXP A;  2WNM A;  2Z0E B;  2KZR A;  2NVU I;  2FCM A;  2MHJ A;  4W9K A;  1XLO A;  1CQV A;  5EDS A;  2A5U A;  1SE3 A;  3QQ8 B;  1WJN A;  1XD3 B;  1N61 A;  1ET9 A;  4IM3 A;  2K3U A;  2KQS A;  3BK2 A;  4IUM B;  1HEZ E;  4FJV B;  5MPO A;  3BYT B;  2MP2 B;  3GP7 A;  2BGF A;  1FNU A;  3C8Y A;  2WDV B;  1TS4 A;  4N6E B;  4C4V B;  3I63 C;  2LUE A;  5HKH A;  2MBB B;  2PLP A;  3VH3 B;  4LLG M;  4IW0 A;  1FFV A;  4DXG A;  3V3X A;  2KKC A;  1WXM A;  5BMG A;  4A6Q A;  2GLS A;  1FNV A;  1L5P A;  3RI7 C;  1VZ7 A;  1XLP A;  2MJD A;  1MG8 A;  1AYF A;  1OGW A;  2WXL A;  4GDL B;  2ICI A;  3B0A A;  2PPH A;  4WJN A;  3NJT A;  4HJG E;  3KQ4 A;  1PGA A;  1KTK A;  3AE9 B;  3H8H A;  4C80 A;  5TR5 A;  1BML C;  1YQ4 B;  3EC8 A;  4CYE A;  4JWS C;  2KWD A;  3A9J A;  4PK1 A;  2V3P A;  5E6J A;  1ZE3 D;  4G11 A;  1RWS A;  1ZDV A;  2RPQ A;  1D4B A;  2KTF A;  3Q3N C;  4OVU A;  3DBR B;  4ICV A;  2LEK A;  2HTH A;  1V97 A;  2BTE A;  2W3S A;  2RPV A;  1WRD B;  1QOA A;  3GB1 A;  5CX3 A;  2ASQ A;  1U4A A;  2K22 A;  2DHZ A;  1C4A A;  1FMA D;  3L4P A;  1IGC A;  1C1Y B;  3Q8F A;  3ZTD A;  2ZZP B;  2M17 A;  2MCN B;  2FAZ A;  2MJE A;  3LXF A;  3TEW A;  2QCZ A;  2B76 B;  3C0R B;  2BYE A;  5LXH A;  1BT0 A;  4KDI C;  4DHJ B;  1ZGU B;  3OAW A;  3AE4 B;  3ZNI D;  2GB1 A;  2HD5 B;  2N7E A;  3M95 A;  2L32 A;  2MJ3 A;  2V0G A;  2LRW A;  4YT0 B;  2PIA A;  4BOS C;  3ZNH B;  1DOX A;  3MJ5 A;  1TYG B;  1V1P B;  3HM3 A;  1D5Z C;  3I5J C;  2M56 B;  4KKI A;  2D2Q A;  3H7P A;  3DBL B;  1ROE A;  2PTL A;  1J7C A;  2C7M B;  2KXJ A;  3MTN B;  2KO3 A;  1L0V B;  2L7R A;  4PT5 A;  3KWV A;  1D5M C;  4A9A A;  2J0M A;  3VUX A;  2FCN A;  2JSV X;  2MQJ A;  4PS3 A;  1HXY D;  5EE3 A;  3OJ4 B;  1VDV A;  3APC A;  2WXG A;  2KTR B;  4LTU A;  3APD A;  4EOY A;  2IO3 B;  2KLG A;  4L1B A;  1WR6 E;  2J52 A;  5IKC M;  2JZP A;  4IG7 B;  1WYW B;  4HKQ A;  2KD0 A;  4MEM A;  2WU2 B;  1FRR A;  3PZ8 A;  5AZF A;  2DNF A;  4MGY E;  1SIF A;  2DBY A;  2IPK D;  2ZCC A;  3PPA A;  3HHM A;  2D5G A;  1FRD A;  4FHJ A;  1Y8R C;  2J53 A;  2TSS A;  1DYQ A;  2WX1 A;  4HRO A;  4DBG A;  3AEF B;  3BY4 B;  3ZJT A;  2YLM A;  4ZRJ A;  2L52 A;  4MEL A;  1P0R A;  3EEC A;  1CK1 A;  4I6P A;  4K3B A;  2DZM A;  1GC7 A;  3O13 A;  2XK5 B;  4AS1 A;  1XO3 A;  4F1S A;  4MJS B;  2BT6 A;  4IOI E;  2O2V B;  3L10 B;  1Y56 A;  1ZP0 B;  3PV1 A;  1WM3 A;  2Y5B B;  5LNK 1;  4LNO A;  5G55 A;  4IWQ A;  4GDK B;  4E74 A;  2HE7 A;  3AMZ A;  1ESF A;  2WX0 A;  4EKU A;  3IXS A;  2KFJ A;  4ZOH C;  1TBE A;  3WA0 A;  4MGI E;  1QOF A;  4FJY A;  2OED A;  1I4X A;  2INP E;  4EEW A;  4L2Y A;  2LMC A;  4M0W B;  1DOI A;  3MHS D;  2HDE A;  4K1R B;  4PYZ A;  3AE5 B;  3ZDT A;  1ZPS A;  2KJ6 A;  2EMS A;  1V8C A;  2LD9 A;  2R2O A;  3NUH B;  3TEY A;  1JWM D;  5T8I A;  4N58 A;  1VZ6 A;  1Z5S B;  3FIL A;  1OEY J;  1WIA A;  5I4D A;  1FM0 D;  3IT4 B;  2KHW B;  1XF5 L;  4XDD A;  3W9C B;  5HHD G;  4DK5 A;  4TUU A;  4BOZ B;  2FE8 A;  2C7H A;  3U52 E;  3AH7 A;  2V3S A;  4KSL C;  2N9X A;  4BKS D;  1KLU D;  4P6V F;  2C5L C;  2E3T A;  4W9I A;  3AU4 A;  5GXG B;  1MVK A;  1KF6 B;  3VTU A;  1GC6 A;  1WJU A;  4K7W A;  2WDT B;  1L0X B;  3QK0 A;  3MFG A;  3NG0 A;  4EZJ A;  2AQ1 B;  1SF0 A;  3VVW B;  1ZDX A;  2GBK A;  5BO4 B;  4REZ A;  2EKI A;  4HPP A;  2D3G A;  3P63 A;  2KOX A;  3SHQ A;  4FBJ B;  1YJI A;  4NAW B;  1IP9 A;  4RCO A;  1KFY B;  1NI2 A;  4WJQ A;  4N59 A;  2KVZ A;  4W9J A;  1PGX A;  1FXA A;  3T8M A;  5CHV C;  2LVP A;  2AQ2 B;  3V6C B;  4US8 A;  1E10 A;  2WGS A;  2D07 B;  2DEN B;  2M1M A;  3HK0 A;  1CZP A;  3UIN B;  2GBN A;  3QAQ A;  4BKS A;  1T6B X;  3SU8 X;  4FJZ A;  4DHZ E;  3RUI B;  4D2K A;  2JX5 A;  3W1S C;  5JZE B;  1J7B A;  3A33 B;  1F0Z A;  3U7D A;  2MLB A;  4RGM A;  5FKA C;  1HTQ A;  3EFU A;  2LRU A;  1VD2 A;  2VZK B;  3H6N A;  1TTN A;  4LJP B;  1I4R A;  2ZVN A;  2KDM A;  4TKN A;  4HRS A;  1YD8 U;  2WQY B;  3EHV A;  1SJE D;  3TBL D;  4CHK A;  3SFD B;  3RMK C;  1QIL A;  2KWC A;  3I3T B;  3EA6 A;  2KQ7 A;  3TEX A;  2LXC A;  3IT6 B;  4HWI B;  2Z8L A;  3FC4 A;  3P2B A;  4LDT B;  2L76 A;  4J6I A;  5FK9 C;  4HEA 1;  1I7H A;  2MA9 B;  3ZNG C;  1OQR A;  3AE8 B;  4C56 C;  3BVZ A;  2KNB A;  2OHF A;  4BFR A;  3L08 A;  1A5R A;  2Z59 B;  3QIJ A;  1Z2M A;  1SXT A;  2L00 B;  4GDK A;  2R2Q A;  4RMA A;  3VTV A;  2BF8 B;  5L83 A;  3GE8 C;  4WAA A;  4WQO B;  3HVZ A;  1WZ0 A;  1JRO A;  1UD7 A;  3N9Y C;  4WWP A;  3AE3 B;  4HDO A;  1WXA A;  2HTM E;  4MGZ E;  1R4M I;  1EM7 A;  2IGG A;  1TS2 A;  2KAC A;  4GOC A;  3B1L X;  1R4N I;  1RRB A;  1YJJ A;  2Y5C A;  4JGH B;  4WJP A;  2BS2 B;  5EE0 A;  3VFK A;  4KDL B;  4LK0 M;  1E8Y A;  3M63 B;  4RFB A;  1H8C A;  1N60 A;  4USA A;  4GMV A;  5D94 A;  2KMA A;  2JXT A;  1WMH A;  1RM6 C;  4I6N B;  1KM7 A;  1L4Z B;  4LNF A;  3ML8 A;  3R2I A;  2DWQ A;  2DX5 B;  2WU5 B;  2LGS A;  4TV3 A;  3CST A;  4A8X C;  3TJP A;  2MBQ A;  4XC2 A;  3DBH I;  4NZL B;  1FCL A;  4HJK A;  1EU3 A;  4W9E A;  2NR2 A;  4YXD B;  3R2T A;  1L6U A;  2WXM A;  2BYV E;  2MBO A;  3WAO A;  1FXI A;  3N1X C;  2V1Y A;  2CJO A;  4NQL B;  3V62 A;  2JVC A;  2MBE A;  4JWU C;  2ZJD A;  5J2R A;  2JF5 A;  3RNA C;  4LNK A;  2CJN A;  2DZJ A;  3TSS A;  2AL3 A;  1WM2 A;  4XE0 A;  3UF8 A;  2K8H A;  3JYU A;  2WLB A;  1WRI A;  2JYT A;  4NJC A;  4YWG G;  1GJZ A;  3RNB C;  4NAW A;  3NRZ A;  4S0R A;  1WJ4 A;  3CF6 E;  1D3Z A;  4QAY A;  4MM3 A;  2MW5 A;  3ENE A;  4ICU A;  3L16 A;  3GZN I;  3UGB B;  2G4D B;  4C00 A;  4W9L A;  3MHZ A;  2CHZ A;  4WQM A;  2ZEQ A;  4GIV A;  2B3A A;  5D6J B;  4C7Y A;  4B95 A;  1R7S A;  4DXF A;  3W5U B;  2N9K A;  3GS2 A;  3KVF B;  3JVZ X;  3NZ3 A;  1WE7 A;  4RF0 A;  1YX6 B;  3OG5 A;  1UWX A;  3AU5 A;  4N9F 4;  3PZ7 A;  1S1Q B;  5L95 C;  1E7P B;  1PYW D;  2KN4 A;  1JAL A;  3DVG Y;  3EGR A;  4ANV A;  2VH2 A;  4OZB A;  5BMH A;  1YN4 A;  3C19 A;  3AEC B;  3PS6 A;  2LZ6 A;  1JWB D;  2G45 B;  1HZ6 A;  2OOB B;  2WS3 B;  2BS3 B;  2QHO A;  1XQQ A;  3DOW A;  5D7G A;  5EE9 A;  2J42 A;  4OZC A;  2L8J A;  2XBB C;  4FLH A;  2XN9 C;  5AZH A;  2PE9 A;  2JY6 A;  1EF1 A;  3FAH A;  2MBH A;  5JHA A;  2I2Y A;  4I6L B;  2Y5P A;  3AUL A;  3U7Z A;  5D3D A;  3PHW B;  2QC8 A;  1QF6 A;  1EUV B;  3O65 B;  3NOB A;  5FR3 A;  3LYY A;  2PMV A;  4JLC A;  1WE6 A;  4ARI A;  3AEG B;  1IYF A;  3RNE C;  2DAJ A;  1EWC A;  4A3P A;  2O6V D;  1WGK A;  4P7I A;  3ZDM C;  1GB4 A;  2GOW A;  4ZHP A;  1GUA B;  3R7Q A;  3WAP A;  2KT7 A;  2ZPN A;  3WAL A;  1RLF A;  3QJZ A;  2WXN A;  2A4Z A;  5AEK B;  1SEB D;  5IAA C;  1E5W A;  5DPR A;  3UIO B;  4MT5 A;  1TGZ B;  2J0J A;  1LXD A;  2C9W B;  3RZF A;  4OHJ A;  2NPT B;  2D3C A;  2JZZ A;  2CU3 A;  1T0S C;  1WR1 A;  4WH4 A;  1VRA B;  2G1E A;  4B0E A;  2KDB A;  1MHX A;  3NVY A;  1C3T A;  4XWT A;  3TIX A;  2O6V A;  4DDI D;  4FXC A;  1WYG A;  3Q3M C;  3PLU A;  3PRZ A;  4BAX A;  1B9R A;  3AI5 A;  4HPL B;  2PVO D;  1PDX A;  2KAJ A;  2V3N A;  1ZUD 2;  5C23 A;  2N9P C;  4W9C A;  2IJ0 A;  3RFZ B;  1ZXH A;  3AE6 B;  5BYR A;  3AV8 A;  1R4N B;  3Q8A A;  3BYY B;  1FNW A;  2IY0 B;  3ZUN A;  2K8C A;  1OEY A;  4KZC A;  3N3K B;  2DZI A;  2KX0 A;  1WH3 A;  2NTS A;  4HKZ E;  4KGT A;  3DVN U;  2AWT A;  4PS8 A;  3Q3F A;  1BXT A;  2WXF A;  2KJH B;  4AP4 C;  1CJE A;  4J3O D;  2K39 A;  3AEB B;  4MSQ B;  1FPY A;  3WAM A;  1N6Z A;  1K51 A;  4ZYS A;  1C77 A;  1QT9 A;  3JW0 X;  2BW2 A;  2JQR B;  5H92 C;  4BKT A;  1JWA D;  3AXC A;  1UH6 A;  3P1M A;  1ZOY B;  3M3J A;  1I42 A;  2JXX A;  2MP2 A;  1V80 A;  5FR6 A;  1GNU A;  1JW9 D;  2N7J A;  2XEW A;  4KZ0 A;  2WXO A;  3ABV B;  1P7E A;  2WXI A;  3V05 A;  2FBW B;  1EF5 A;  4C4V A;  4WWN A;  5DPW A;  2QMT A;  4GLS C;  4MGK E;  4NY0 A;  2NCN A;  2D3B A;  1T5X D;  3Q3J A;  3EUB 2;  3L0W B;  5TSS A;  3R8B A;  2NTT A;  5C1Z A;  1YQB A;  2RDG A;  2WWZ A;  3X0W A;  3A1Q B;  1NYQ A;  5HG2 A;  4GDL A;  4F7Z A;  1D6E C;  1K8R B;  3RT3 B;  3E56 A;  1L7Y A;  2ZPY A;  4II2 B;  2M4N A;  2W3R A;  1SBB B; 
#chains in the Genus database with same CATH homology
 4DHZ E;  3RUI B;  2FID A;  3KYD D;  3RCZ A;  2O6V B;  4XZ4 A;  3LJ3 A;  3W1S C;  5JZE B;  3A33 B;  3ALB A;  4HDQ A;  3PLV A;  2KWU B;  2BYF A;  2GMI C;  3RD2 A;  3VUW A;  4MSM B;  2MLB A;  3U7D A;  4NJ6 A;  2K25 A;  1QZE A;  2NS5 A;  3EFU A;  4JQW C;  3KYC D;  2L0F A;  2LRU A;  2JRH A;  1VD2 A;  3ZRC A;  4KIK B;  3H6N A;  4DHJ D;  2K6Q A;  1TTN A;  4LJP B;  4IWP A;  2DYO A;  2ZVN A;  4X57 B;  5D2M B;  3NHE B;  4TKN A;  3R7R A;  1LM8 B;  3L17 A;  1YD8 U;  3GOE A;  1S3S G;  4ANU A;  2C7N B;  3EHV A;  3TBL D;  2LWP A;  4CHK A;  1VCB A;  1UZX B;  2IZV B;  2JT4 B;  3PRE A;  2CKH B;  3ZVV A;  2KWC A;  4GGQ A;  1KJT A;  2GBR A;  1ISN A;  3ZO5 B;  3I3T B;  1SGH A;  3PRP B;  1YX5 B;  2KQ7 A;  2HJ8 A;  2LXC A;  3KH0 A;  4MH0 E;  4NNJ B;  4HWI B;  2L0T A;  4HCP B;  3P2B A;  4LDT B;  3A9K B;  2L76 A;  4J6I A;  1J8C A;  3V60 A;  3QX1 A;  4FN2 A;  1ZKH A;  2MA9 B;  3ZNG C;  3QA8 A;  2N1W A;  2REX A;  4DWF A;  2C60 A;  2KNB A;  2N9E B;  2RR9 A;  4BFR A;  3L08 A;  1A5R A;  4EZK A;  2Z59 B;  4AWJ A;  2FCS A;  4BBN F;  3QIJ A;  3CSF A;  1Z2M A;  1Q0W B;  4K7S A;  2L00 B;  4BKG A;  2Z0E B;  2Z0D B;  2KLC A;  2R2Q A;  3IG3 A;  2KZR A;  2NVU I;  4GDK A;  4RMA A;  3VTV A;  3VXW A;  2BF8 B;  2FCM A;  2RGF A;  4W9K A;  5L83 A;  4WAA A;  4WQO B;  1WZ0 A;  4GSW A;  1UD7 A;  5EDS A;  2A5U A;  3VH4 B;  4WWP A;  3K9P B;  1WGH A;  4HDO A;  3QQ8 B;  1WJN A;  1WXA A;  1XD3 B;  3QHT A;  4WWO A;  3M62 B;  3NZS A;  4E3C A;  4MGZ E;  4IM3 A;  1R4M I;  2KQS A;  4GOC A;  3B1L X;  1R4N I;  1RRB A;  4WJP A;  3VFK A;  4JGH B;  4TQ1 A;  4JL9 A;  3DDC B;  4IUM B;  4FJV B;  4KDL B;  1RAX A;  1E8Y A;  3M63 B;  1H8C A;  4KVG B;  4PS7 A;  2AYO B;  2MP2 B;  4GMV A;  5D94 A;  2BGF A;  2KMA A;  1NBF C;  1WMH A;  4F8C B;  2CHW A;  2KDF B;  2LVO A;  5DCN A;  4AJY B;  4CO7 A;  4I6N B;  2LUE A;  5HKH A;  2MBB B;  1KM7 A;  1E8X A;  3VH3 B;  3WAN A;  2K1F A;  4IW0 A;  3U30 A;  2KX3 A;  1EO6 A;  3ML8 A;  1UBQ A;  4MDK E;  2KKC A;  1WXM A;  1X1M A;  2DX5 B;  2JUO A;  3ZW3 A;  5GMV A;  2M8S A;  4TV3 A;  3CST A;  1UBI A;  3TJP A;  2DZK A;  1MG8 A;  2MBQ A;  3UIP B;  1WGD A;  1WX8 A;  4XC2 A;  2JRI B;  2ZNV B;  1OGW A;  4G0N B;  3DBH I;  2PE6 B;  4GDL B;  5LXI B;  2J0K A;  4HJK A;  4B6W A;  3B0A A;  1P1A A;  1E8W A;  2PPH A;  3PT2 B;  4W9E A;  4ZDV A;  2NR2 A;  1WXV A;  4WJN A;  2KDE B;  2VRR B;  4EFO A;  2EMT A;  3PSE B;  2BYV E;  2MBO A;  4IM2 A;  4WJO A;  3W1S A;  3WAO A;  3ZRF A;  2DYM A;  2V1Y A;  5TR5 A;  2KJR A;  3EC8 A;  4PYU A;  4AJW A;  4NQL B;  2KTR A;  2MRP A;  3N32 A;  3V62 A;  2JVC A;  2MBE A;  4CYE A;  2ZJD A;  5J2R A;  5E6N A;  1H4R A;  2RSU A;  2JF5 A;  2LAS A;  4ASW C;  3A9J A;  4IWO A;  1V5T A;  2DZJ A;  3PGE A;  3PZD A;  4W9H A;  4M8N A;  2AL3 A;  1WM2 A;  2OJR A;  3UF8 A;  2K8H A;  3JYU A;  4G11 A;  1V81 A;  2RPQ A;  1GJZ A;  2KTF A;  1V6E A;  4HCN B;  4NAW A;  4OVU A;  2UYZ B;  3H7S A;  1WI0 A;  4ICV A;  1WJ4 A;  2ZCB A;  2MX2 A;  3CF6 E;  1Q5W B;  3SD5 A;  1D3Z A;  4MM3 A;  2MW5 A;  3QAR A;  3ENE A;  4ICU A;  3A1Q A;  4ZYN A;  3ZLZ A;  2HTH A;  2GBJ A;  3L16 A;  4NQK E;  3GZN I;  4IC7 B;  3UGB B;  2G4D B;  3MJW A;  2AL6 A;  4W9L A;  1WRD B;  5CX3 A;  2ASQ A;  2CHZ A;  3UQA A;  1U4A A;  2ZEQ A;  4GIV A;  2B3A A;  2BWF A;  2DHZ A;  5D6J B;  4A3O A;  3KW5 B;  4KV2 A;  4B95 A;  2NPT A;  5KHO A;  2KFK A;  3KVF B;  3JVZ X;  3DCG A;  1L2N A;  1WF9 A;  3ZNZ B;  4K81 A;  1C1Y B;  1WE7 A;  4LCD E;  2XK5 A;  3VHT C;  4G3X B;  1F9J A;  1YX6 B;  2AEH A;  3ZTD A;  3AU5 A;  4MJS A;  4N9F 4;  3D32 A;  2ZZP B;  2M17 A;  1S1Q B;  3QC8 B;  2O2V A;  4IM0 A;  2MCN B;  2FAZ A;  4BVU C;  5L95 C;  1WX7 A;  3DBR I;  3DVN V;  1E90 A;  3DVG Y;  2LVQ A;  3OJ3 A;  4DDG D;  4ZRK A;  4AUQ C;  4ANV A;  1KLV A;  3C0R B;  2BYE A;  5LXH A;  1BT0 A;  3VQI A;  2RD0 A;  4KDI C;  4DHJ B;  1ZGU B;  3OAW A;  3ZNI D;  1P98 A;  1E8Z A;  1RFA A;  3PS6 A;  2LZ6 A;  2CU1 A;  2HD5 B;  2N7E A;  3QWZ B;  3M95 A;  2G45 B;  2LRW A;  2OOB B;  5IA7 A;  3VDZ A;  2QHO A;  3DOW A;  1XQQ A;  4W9D A;  5D7G A;  4BOS C;  3ZNH B;  3R3M A;  1WMH B;  2L8J A;  2XBB C;  3HM3 A;  3K9O B;  4FLH A;  5AZH A;  1GG3 A;  2PE9 A;  1OTR B;  2UWQ A;  2JY6 A;  2LGX A;  2D2Q A;  3H7P A;  3SDL C;  2KN5 A;  1EF1 A;  2MBH A;  1WGR A;  4XX5 A;  5CTR C;  5JHA A;  1E7U A;  2DYB A;  2LGD A;  4ANX A;  2C7M B;  4I6L B;  3ONS A;  2KXJ A;  3AUL A;  3MTN B;  2KO3 A;  2BPS A;  2L7R A;  3PHW B;  3DQV A;  2K6D B;  2N7D A;  4FUL A;  1EUV B;  1OQY A;  3O65 B;  2J0M A;  3NOB A;  3RUL A;  2JZ3 B;  1Q1O A;  3JSV B;  4KSK C;  3V6E B;  3VUX A;  4RM9 A;  1WGY A;  2FCN A;  1V5O A;  4JLC A;  2FUH B;  2MQJ A;  3CMM B;  3V61 A;  3VTW A;  1J19 A;  2WYQ A;  3ML9 A;  4PS3 A;  2KWV B;  1CMX B;  1WE6 A;  4GXB A;  2KAN A;  3OJ4 B;  4HLE A;  3PTF C;  3APC A;  3DBL I;  4HVB A;  1IYF A;  2DAJ A;  3PVL A;  3NS8 A;  2KTR B;  1PQS A;  5G2N A;  4A3P A;  3APD A;  4DXA B;  4EOY A;  3B08 A;  2IO3 B;  2KLG A;  4JIO U;  4W9F A;  1WR6 E;  4M8M A;  2O6V D;  4IG7 B;  4FHK A;  4P7I A;  3ZDM C;  2GOW A;  1WYW B;  3HIZ A;  5AZG A;  3IHP C;  3NZU A;  2KD0 A;  1GUA B;  4MEM A;  2NBU A;  3LDZ E;  4ZRI A;  3R7Q A;  2K8B A;  3N30 A;  3WAP A;  2LI5 A;  2KK8 A;  2FCQ A;  3ECI A;  2ZPN A;  1WX9 A;  3WAL A;  5AZF A;  4MGY E;  1RLF A;  1SIF A;  3QJZ A;  2A4Z A;  5AEK B;  3TMP B;  5E6P A;  5IAA C;  2ZCC A;  3PPA A;  3HHM A;  4W9G A;  4GU2 A;  4HPM B;  5CHF A;  2W9N A;  3VUY A;  4FHJ A;  1Y8R C;  1E5W A;  5DPR A;  1WY8 A;  3NY5 A;  3UIO B;  4EUT A;  1TGZ B;  2J0J A;  1LXD A;  2C9W B;  2WX1 A;  5JHB A;  2KMC A;  2EKE C;  4DBG A;  2BWE S;  2KVR A;  3BY4 B;  3T9L A;  2YLM A;  4ZRJ A;  3RZF A;  3APF A;  2I1J A;  3PHX B;  1I35 A;  4MEL A;  1P0R A;  2NPT B;  3OLM D;  3EEC A;  4I6P A;  2JZZ A;  3ZKJ C;  2DZM A;  2ZNV C;  1GC7 A;  1NDD A;  1WR1 A;  2XK5 B;  4LDT D;  1JRU A;  3IFW B;  5DPS A;  2YVC A;  3UQB A;  1V2Y A;  2MWS B;  1E7V A;  2KDB A;  4F1S A;  4MJS B;  1SE9 A;  5CHW A;  4EZL A;  2O2V B;  3L10 B;  1M94 A;  1C3T A;  1TZ1 A;  4NPN A;  3ZTC A;  4AOF A;  3TIX A;  4GB9 A;  2ZVO A;  2I1K A;  2O6V A;  3PV1 A;  4DDI D;  3H9D A;  1WM3 A;  2BKR B;  2Y5B B;  4BBN C;  3KUZ A;  1YIW A;  1WXS A;  3R66 C;  5G55 A;  4IWQ A;  3PLU A;  3PRZ A;  4GDK B;  4E74 A;  1V9J A;  1WJ6 A;  2HE7 A;  3AI5 A;  4HPL B;  3TL5 A;  2N1V A;  3L54 A;  1FXT B;  3IVF A;  2WX0 A;  3DVG X;  4FA6 A;  3KUC B;  4KIK A;  2N9P C;  5C23 A;  1XT9 B;  1YJ1 A;  1WGG A;  2KFJ A;  2J7Q B;  4W9C A;  1TBE A;  3WA0 A;  3RZW C;  1G6J A;  1UGM A;  4MGI E;  4DHZ B;  2LJ5 A;  4FJY A;  3IBE A;  4LJO B;  4EEW A;  5KHQ A;  4M0W B;  2IY0 B;  2JWZ A;  3H7P B;  5LLI A;  3ZUN A;  3MHS D;  2IO0 B;  4K1R B;  4PYZ A;  4NJ7 A;  5J18 A;  3ZDT A;  2K8C A;  1T0Y A;  1OEY A;  1V49 A;  2D11 A;  2EMS A;  2KJ6 A;  4KZC A;  2KC1 A;  2LD9 A;  2R2O A;  3A9K A;  3N3K B;  2DZI A;  2KX0 A;  3KUD B;  1WH3 A;  1WZ3 A;  2GBM A;  3DVN U;  1Z5S B;  1ZW7 A;  5JH5 C;  2AWT A;  4PS8 A;  5DPT A;  1OEY J;  1WIA A;  2G4S A;  3Q3F A;  3W1Y A;  2KHW B;  1AAR A;  2KJH B;  2CHX A;  4II3 B;  4AP4 C;  4HK2 A;  2NBW B;  2K39 A;  2G3Q B;  2PJH A;  2M0X A;  4MSQ B;  3WAM A;  4DK5 A;  4TUU A;  4B9K A;  4BOZ B;  3BIN A;  3JW0 X;  2C7H A;  5E6O A;  1V86 A;  2V3S A;  3DBS A;  4URK A;  4KSL C;  2N9X A;  3H1U A;  3WIM A;  4BKS D;  2NBV B;  4BKT A;  2C5L C;  2MSE D;  4W9I A;  3AU4 A;  3X23 A;  3AXC A;  3PRM B;  1UH6 A;  2IO2 B;  2KC2 A;  3VTU A;  3M3J A;  1GC6 A;  1I42 A;  1WJU A;  2LGY A;  4E71 A;  2BKF A;  2IY1 B;  2KDI A;  2WDT B;  2LXA A;  3QK0 A;  4K7U A;  4K7W A;  1UEL A;  2JXX A;  2MP2 A;  4A20 A;  1V80 A;  2L05 A;  5FR6 A;  1GNU A;  4FAD A;  2XEW A;  1P3Q U;  4KZ0 A;  4YL8 A;  1LFD A;  4EZJ A;  2DAF A;  1IPG A;  1EF5 A;  3VVW B;  2L3Z A;  2GBK A;  4TQ0 A;  3A9J B;  4WWN A;  4RM8 A;  5BO4 B;  5J17 A;  5DPW A;  2FNJ B;  3U8Z A;  3ZIM A;  2CS4 A;  4MGK E;  4NY0 A;  4ANW A;  2NCN A;  1P9D U;  3Q3J A;  2D3G A;  3A4R A;  4G50 A;  2D10 A;  3L0W B;  2KOX A;  4OVV A;  2FIF A;  3SHQ A;  4FBJ B;  4NAW B;  1IP9 A;  3QCA A;  1NI2 A;  1WFY A;  3JSV A;  3VAW A;  3S2A A;  5C1Z A;  3L13 A;  4WJQ A;  3TCA A;  1YQB A;  4W9J A;  2N4F A;  3DPD A;  4HXD A;  3HM6 X;  2WWZ A;  3X0W A;  3A1Q B;  3T8M A;  5CHV C;  1LQB A;  2LVP A;  1HE8 A;  4GDL A;  4GN1 A;  4F7Z A;  3V6C B;  1K8R B;  2CR5 A;  3A4S C;  2IYD B;  3RT3 B;  1J0G A;  2D07 B;  2DEN B;  2M1M A;  2IBI B;  1L7Y A;  3HK0 A;  1KOT A;  2IO1 B;  3UIN B;  3RYT A;  2GBN A;  2ZPY A;  3QAQ A;  4II2 B;  2JPH A;  2M4N A;  4BKS A;  2PEA A;  2KFK B;  3SU8 X;  2V4L A;  4EKU A;  4FJZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...