2M8SA

Nmr structure of the cytoplasmic tail of the membrane form of heparin-binding egf-like growth factor (prohb-egf-ct) complexed with the ubiquitin homology domain of bcl-2-associated athanogene 1 from mus musculus (mbag-1-ubh)
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
97
structure length
97
Chain Sequence
b'MAKTEEMVQTEEMETPRLSVIVTHSNERYDLLVTPQQGNSEPVVQDLAQLVEEATGVPLPFQKLIFKGKSLKEMETPLSALGMQNGCRVMLIGEKSN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BAG family molecular chaperone regulator 1
publication title Nuclear Magnetic Resonance Structure of the Cytoplasmic Tail of Heparin Binding EGF-like Growth Factor (proHB-EGF-CT) Complexed with the Ubiquitin Homology Domain of Bcl-2-Associated Athanogene 1 from Mus musculus (mBAG-1-UBH).
pubmed doi rcsb
source organism Mus musculus
molecule tags Chaperone/membrane protein
total genus 21
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2013-06-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2m8sA00
2ZCCA 2K8BA 3B08A 1YIWA 3W1YA 4DHZB 4GDKB 4IWPA 4MJSB 1WM3A 2UYZB 4EEWA 4E3CA 4ZYNA 3A9JB 2AEHA 2KDEB 3TMPB 1UH6A 1UBIA 2KANA 3L08A 4BKTA 5JHBA 3R66C 2EMTA 1OEYA 3ONSA 2NPTA 1NBFC 2YVCA 2W9NA 3PRPB 4AUQC 5JHAA 2XK5A 2DAFA 4I6LB 3RCZA 3RZWC 1U4AA 3APDA 2N9PC 2Y5BB 5LXIB 2JF5A 4G3XB 4NNJB 2AYOB 3HK0A 4CHKA 3PS6A 2G4SA 3ZNGC 3AXCA 3NY5A 4FBJB 2L05A 2IO3B 2NPTB 3QWZB 1IP9A 3V62A 4HVBA 4WJNA 3APFA 1GJZA 2FCQA 2R2OA 2LRUA 4WJQA 3UF8A 4KSLC 3IVFA 2ZPYA 2LI5A 2O6VD 3ZRCA 1ISNA 1WFYA 1WYWB 2DZKA 1PQSA 2DAJA 2IY1B 4HJKA 4NAWA 3UQAA 2L00B 1OTRB 4GN1A 2V3SA 3X0WA 3TJPA 3B0AA 4RM8A 4W9KA 5AZHA 5L83A 1L2NA 2G3QB 1E90A 4MGYE 1LM8B 2RPQA 5D2MB 4ZDVA 2KX0A 1P0RA 2Z0EB 3NS8A 4KVGB 4AJWA 4BKSD 5JZEB 1WZ0A 4DBGA 4IG7B 3OJ4B 4NAWB 2KO3A 2JZZA 2LGYA 3H7SA 4HPLB 1Q0WB 2M0XA 3GOEA 2G4DB 3QARA 1LFDA 3VQIA 2K8HA 5EDSA 3ECIA 2KWUB 3KVFB 2C7HA 4NQKE 2NBVB 4WWPA 3PZDA 3JYUA 5E6OA 1WX7A 5CHVC 3R7RA 4WQOB 1EO6A 3U7DA 4W9DA 3QCAA 2R2QA 1E8XA 1UELA 2JWZA 2FIDA 3KYCD 4ZRJA 1OEYJ 3TIXA 1E5WA 4HXDA 3DVNU 2MA9B 3SHQA 3CMMB 4ICUA 4KDIC 3V61A 4AWJA 1SIFA 3EHVA 1WJNA 3ALBA 3U30A 3C0RB 4GOCA 3KUZA 2KTRA 3ZNZB 4DK5A 4EOYA 4W9EA 2L0FA 5JH5C 4NQLB 1D3ZA 3A1QB 4WJOA 1WJ4A 2PEAA 2HE7A 1E8ZA 3L0WB 3UQBA 3KH0A 2K8CA 2M4NA 1RLFA 1WXVA 2KDFB 2KTRB 4URKA 1XD3B 2KNBA 3ZUNA 2CS4A 3R7QA 2OOBB 2DZIA 2FCMA 4I6NB 3WA0A 3DPDA 2KTFA 2FCSA 1WM2A 2FNJB 2PE6B 4P7IA 3VH4B 4GDLA 1GNUA 3APCA 5G55A 3K9PB 2CR5A 2KMAA 3NZUA 4X57B 1WGYA 5CX3A 1SE9A 2NCNA 1Q1OA 1UD7A 3A9KA 2XEWA 3IG3A 3PREA 1KM7A 1LQBA 2FIFA 3CF6E 4ICVA 3BINA 1C3TA 4GDLB 3QQ8B 2BYEA 3RYTA 2JZ3B 2ZPNA 3OAWA 2KVRA 2D3GA 3OJ3A 2K6QA 3A9KB 4W9GA 2L76A 4TQ1A 2ZNVC 4RMAA 4MSMB 1ZW7A 2MBBB 4TUUA 5GMVA 1J0GA 4AOFA 2G45B 3IBEA 3DVGX 3HM3A 3VTVA 3KUDB 1WF9A 2KJRA 4EKUA 3A4RA 2C60A 3T8MA 4HK2A 2D07B 1WE7A 2BPSA 4RM9A 3ZKJC 5AEKB 1WI0A 2LGXA 1K8RB 2D10A 5FR6A 2KQSA 3VUYA 1OGWA 4BVUC 1V49A 4IM2A 1RFAA 2LUEA 2LVOA 2MBOA 4KDLB 1VCBA 4J6IA 1ZGUB 3ENEA 1E8YA 3MHSD 2IO0B 2A4ZA 4IWOA 2C7MB 4FN2A 4PYUA 3MJWA 1WZ3A 2K1FA 2N4FA 2BYFA 2ZNVB 4JQWC 1WR1A 1YD8U 2EMSA 3KYDD 1TZ1A 3LJ3A 4M0WB 3RULA 2BWES 3VVWB 2CHWA 2C9WB 3ML8A 2O2VA 4IUMB 2N9EB 3AU5A 4IM3A 3VTWA 2LJ5A 2UWQA 1WMHA 4BOZB 2CU1A 3DVGY 4DHZE 4ZRKA 2XK5B 3DBHI 5KHOA 3NHEB 4FJVB 2LD9A 3QC8B 4TV3A 3NOBA 2ZCBA 5C1ZA 1T0YA 4PYZA 2O2VB 3OLMD 3UIPB 2GMIC 2LXCA 2RGFA 3PRMB 3WANA 3X23A 4DHJB 2IY0B 1WMHB 1E7VA 1Z2MA 1P3QU 1KLVA 4WWOA 3A33B 1CMXB 1E7UA 1GC6A 4MDKE 4I6PA 3TBLD 3ZDMC 2KZRA 2RSUA 2MCNB 4AP4C 2KK8A 2WX0A 4ANVA 4II3B 1EUVB 1LXDA 2L0TA 4NJ6A 4JGHB 4NPNA 4WAAA 4XC2A 2MBQA 2JRIB 1WE6A 2NS5A 3KW5B 5J18A 4F1SA 3M95A 2ZVNA 1EF5A 4A3PA 5D6JB 2Z0DB 2LASA 3PT2B 5AZFA 5DPTA 3VHTC 1RAXA 1UBQA 1WX8A 2NBUA 3GZNI 4M8MA 1UZXB 2KOXA 1G6JA 2B3AA 5D7GA 4F7ZA 5CHWA 1P9DU 1R4MI 2M8SA 2ZJDA 5L95C 2KMCA 1V5TA 4FLHA 3H6NA 2M17A 1EF1A 4PS8A 2AWTA 3M63B 3ZTDA 2HJ8A 4ASWC 1YQBA 1I42A 1FXTB 4GXBA 1WX9A 2PE9A 2MW5A 1MG8A 4W9IA 3N3KB 2JVCA 2FAZA 4WJPA 4ANXA 2Z59B 4MGKE 5CHFA 4MGZE 1Y8RC 2GBKA 3AULA 2MWSB 2C5LC 3L17A 1S3SG 2MLBA 2J0MA 4BOSC 4EZJA 3JSVA 2LGDA 2AL3A 2J0JA 4G0NB 4MELA 4W9HA 5HKHA 3QAQA 5G2NA 4MEMA 3Q3JA 3H1UA 4EFOA 2JY6A 4PS3A 5E6PA 2I1KA 3UIOB 3DBSA 4HPMB 3VTUA 3ZW3A 4WWNA 4IW0A 3V60A 3JSVB 3B1LX 5J2RA 1E8WA 3RT3B 1TBEA 3DOWA 3L54A 2KWCA 3PGEA 3VFKA 4BFRA 2KDIA 3T9LA 2XBBC 2MBEA 3U8ZA 1R4NI 1WH3A 3VXWA 3DCGA 1V6EA 3EFUA 2V4LA 4KIKA 3PLUA 4ANWA 4CYEA 2HTHA 3EECA 2HD5B 2I1JA 2M1MA 1YX6B 3DBRI 3HM6X 2DENB 1XT9B 3ZTCA 3ZVVA 2N1VA 2CHXA 4KV2A 5LLIA 2LRWA 1YJ1A 2BKFA 4KIKB 3PLVA 3TL5A 4EZLA 2L8JA 3M3JA 2J7QB 4BBNF 5C23A 3H7PA 2KLCA 3CSTA 4KSKC 4MM3A 2KKCA 3AI5A 2JUOA 2MSED 4G50A 1QZEA 4HDOA 5BO4B 1KJTA 3DBLI 4NJ7A 1V80A 2IO1B 5D94A 1V86A 5DPSA 3SU8X 5LXHA 2KXJA 3R3MA 3QA8A 1WJ6A 3H7PB 2DZJA 4DDGD 2PPHA 2N7DA 2NVUI 1J8CA 1WGDA 2JXXA 2MBHA 4LDTB 4K7WA 2K39A 4EUTA 1P98A 2MQJA 4FA6A 3RUIB 1S1QB 2LVPA 3IFWB 4W9CA 2L3ZA 1NDDA 1WR6E 4CO7A 2REXA 1RRBA 2CKHB 4E71A 4A20A 3QIJA 4GSWA 4DHJD 4W9LA 2YLMA 3PV1A 2RD0A 4M8NA 3HHMA 4FJZA 3L16A 4KZ0A 3W1SC 3KUCB 2A5UA 3JW0X 1WGHA 2KD0A 1IPGA 2MRPA 5E6NA 2KFJA 2DYOA 3PTFC 3ZIMA 2NBWB 4IC7B 4F8CB 4GGQA 4HLEA 2KN5A 2KHWB 3MTNB 3W1SA 4JLCA 2KQ7A 3QHTA 2KC1A 1V2YA 2ZEQA 4IM0A 2D11A 2D2QA 4K81A 4MH0E 4ZRIA 3L13A 3A4SC 4OVUA 2GBJA 4K7SA 2RR9A 5DPRA 4B6WA 3WAPA 4GMVA 4HCNB 2MX2A 2IO2B 2IZVB 3K9OB 4N9F4 3ML9A 3S2AA 3PVLA 2VRRB 1C1YB 4FULA 1TTNA 2C7NB 4II2B 1XQQA 1WIAA 4B9KA 3DQVA 3VH3B 2N9XA 3SDLC 4HDQA 5IA7A 1WXAA 3N30A 2O6VA 4GU2A 5CTRC 3VUXA 1YX5B 2LVQA 3JVZX 1H8CA 3PHWB 2WX1A 2WWZA 3IHPC 1TGZB 2KFKA 1P1AA 1X1MA 2N1WA 4XX5A 3SD5A 4JIOU 4KZCA 3ZO5B 4JL9A 1V9JA 4FHKA 4HWIB 3M62B 2LWPA 3H9DA 2O6VB 4BKGA 3ZRFA 4OVVA 4BKSA 2GBMA 4FJYA 4TKNA 2KC2A 2DYBA 1GC7A 1VD2A 2ASQA 2KWVB 3LDZE 2GOWA 4MGIE 4NY0A 2KFKB 2GBNA 3Q3FA 4BBNC 1F9JA 3WIMA 3WALA 5KHQA 4A3OA 1V81A 4DDID 4DXAB 3QK0A 3D32A 3V6CB 3P2BA 3PRZA 5IAAC 1SGHA 3RZFA 4W9FA 2WDTB 1J19A 2GBRA 3NZSA 3TCAA 1V5OA 2EKEC 2JRHA 3CSFA 5DCNA 3ZDTA 2JT4B 1M94A 2DX5B 1GUAB 1L7YA 1Q5WB 3PSEB 3UINB 3UGBB 1WRDB 1I35A 4PS7A 3A1QA 4YL8A 1JRUA 2BF8B 2DHZA 2K25A 3WAOA 2PJHA 4K7UA 2L7RA 2KJHB 4LCDE 1OQYA 3RD2A 4HCPB 1WGRA 2BWFA 4W9JA 1WJUA 3PHXB 3PPAA 1IYFA 1A5RA 1Z5SB 2OJRA 3QJZA 1GG3A 4B95A 3N32A 5TR5A 2AL6A 3ZNHB 4IWQA 2QHOA 3AU4A 5DPWA 4XZ4A 4MSQB 1H4RA 2KX3A 2DYMA 1UGMA 4FHJA 4TQ0A 2LZ6A 2ZZPB 4ANUA 4FADA 3VAWA 3I3TB 4LJPB 2IYDB 1NI2A 3WAMA 4AJYB 3ZNID 3QX1A 1WY8A 2J0KA 4LJOB 2V1YA 3ZLZA 3VUWA 2KJ6A 1WXMA 2FUHB 3HIZA 3BY4B 1HE8A 2KLGA 3VDZA 2ZVOA 2K6DB 1WGGA 4LDTD 2KDBA 2CHZA 4E74A 3EC8A 1AARA 1KOTA 1BT0A 2IBIB 4EZKA 1ZKHA 2DZMA 3DDCB 4DWFA 2BKRB 2MP2A 2NR2A 3L10B 4GB9A 2WYQA 4GIVA 3DVNV 1WXSA 2LXAA 2FCNA 4GDKA 4G11A 2BYVE 4MJSA 3A9JA 3O65B 3V6EB 2N7EA 2MP2B 4K1RB 5AZGA 2JPHA 2BGFA 5J17A
chains in the Genus database with same CATH superfamily
4GDKB 4MJSB 2UYZB 1SXTA 3AH7A 3Q3NC 3ONSA 1N60A 5HHDG 2W9NA 4AUQC 1IBXB 2DAFA 2Y5BB 5LNK1 1KTKA 4CHKA 3ZNGC 2GRIA 1NENB 4WJNA 3APFA 1GJZA 2FCQA 2E6XA 2ZPYA 2O6VD 3ZRCA 1WFYA 3ZXVA 1PQSA 3UQAA 2PW9A 3RNBC 3TUOA 2M19A 1MJDA 2V3SA 3TJPA 2G3QB 4B0EA 1L4ZB 4MGYE 4AQ7A 5D2MB 3P4RB 4ZDVA 2Z0EB 4BKSD 1NYRA 4NAWB 2JZZA 3H7SA 2AX5A 3GOEA 2VH2A 2WDQB 2KWUB 1MI0A 2C7HA 1FNWA 1HQRD 3ABVB 1ZPSA 3R7RA 4WQOB 2IGHA 3MC9A 1RM6C 1KRHA 2JWZA 1UELA 1FCLA 1YQ3B 4HKQA 2WXIA 4HXDA 1L6UA 3RFZB 3BYYB 3V61A 1WJNA 3U30A 4WIPA 3Q14C 2WXGA 1FXIA 3IAM1 4Q2JA 5JH5C 3A1QB 3N9YC 1WJ4A 4L1BA 2PEAA 3UQBA 2BB5A 2M4NA 1V97A 1XD3B 3R7QA 2OOBB 2LGSA 2V3PA 2INDC 4GDLA 1GNUA 4QAYA 3NZUA 1SE9A 2NCNA 1Q1OA 3PREA 1LQBA 1C3TA 2BYEA 3RYTA 2JZ3B 1GB4A 1SEBD 2ZPNA 2D3GA 1KH0A 4W9GA 1XF5L 1ZW7A 4AOFA 5BYRA 4WH4A 3SFDB 2KJRA 2C60A 5G5GA 1BMLC 4XYCA 4OVZA 1WE7A 3ZKJC 4M0WA 5AEKB 2D10A 3RNAC 4IM2A 2YEPB 1VCBA 1JWBD 2X8XX 1WR1A 3KYDD 2EMSA 3LJ3A 3FAHA 3RULA 4MH8A 3VVWB 4JE3B 4ARIA 2O2VA 2HDEA 3AU5A 4IM3A 3AEBB 2IPKD 2LJ5A 2UWQA 1YJJA 1WMHA 4BOZB 3DVGY 1B1ZA 2YEPF 1WWTA 2ZCBA 5EE3A 2D3CA 2LXCA 4C56C 1E7VA 1MG4A 1KLVA 4KGSA 2BS4B 4AP4C 2MCNB 3AB5A 2WX0A 4NJ6A 3AECB 2MBQA 1WE6A 2NS5A 3M95A 1QOAA 2Z0DB 2QILA 2NBUA 3GZNI 2WXHA 2MHJA 3RNFC 4FLHA 4M01A 3H6NA 4YTNB 4ASWC 1FXTB 1EWCA 2JZPA 2PE9A 4WJPA 1D4BA 2JVCA 2INPE 5CHFA 4MGZE 1Y8RC 1J7BA 1ZE3D 2K22A 2W3RA 3AULA 3IT6B 2J0MA 3HVZA 5D3IB 2J0JA 4G0NB 4MELA 4W9HA 5HKHA 3QAQA 3H1UA 1TS3A 1N62A 4PK1A 2D3BA 3ZW3A 1TBEA 3DOWA 3L54A 2XBBC 1R4NI 1WH3A 3B2GA 2RDHA 2CJNA 1FEHA 4ANWA 2MH7A 2HD5B 4RFBA 2DENB 3ZVVA 3IT4B 1NI3A 4EZLA 2L8JA 3M3JA 3H7PA 4KSKC 3FILB 4MM3A 2FBWB 3AI5A 1T5XD 5BO4B 2LMCA 4NJ7A 3LB8C 1MHXA 3AEEB 5LXHA 3AM9A 3R3MA 3PZ8A 3QA8A 1NYQA 1J8CA 1WGDA 3AE3B 4LDTB 4K7WA 4YWGG 2PVGC 4FA6A 1TYGB 4DXFA 4RGMA 3IFWB 1WR6E 3DHGC 4B0MA 2REXA 4P1CC 3QIJA 4GSWA 3PV1A 3HHMA 1OQRA 1PFDA 4J3OD 2WHIA 5I4DA 2MRPA 3PTFC 5JXVA 2NBWB 4L23A 4F8CB 2KQ7A 2KC1A 2ZEQA 3AE7B 4IM0A 2WU2B 3L13A 2FUG1 3HUIA 2MX2A 1K50A 3K9OB 4DQOC 1K51A 3ML9A 3AEDB 2UU7A 4FULA 1TTNA 3U2SC 2M0AA 5IKCM 1SF0A 2LVQA 2K9XA 2FE8A 1C4CA 1H8CA 2WX1A 1DOYA 1TGZB 3AEAB 1P1AA 3KWLA 1I7HA 5IO9A 1SE3A 2O6VB 1AN8A 2WNMA 2NTTA 4MGIE 1M4VA 1VD2A 2XNAC 3Q3FA 1F1HA 1EM7A 1N63A 4OZCA 4DXAB 3P2BA 5IAAC 3NZSA 1Q5WB 3A1QA 4YL8A 4HRSA 2K25A 1OQYA 1SE4A 3PHXB 1Z5SB 4LTUA 2JXTA 3ZNHB 1F52A 1CJEA 2QHOA 1H4RA 2KX3A 2DYMA 3AE4B 4FHJA 4AJYB 2J0KA 2V1YA 3VUWA 3GE3C 1WXMA 3BY4B 2KLGA 4K3CA 2JQRB 5EE9A 2KDBA 1AARA 2WS3B 2BB6A 4RGNA 3AE6B 4EZKA 3DDCB 1UGJA 1HZ6A 3L4PA 2BKRB 3N1YC 3V3XA 1VZ8A 2NR2A 4GB9A 1KLUD 2PLPA 2BYVE 2OHFA 3A9JA 3V6EB 4WQMA 2QMTA 3RNGC 4P16A 2LZ6A 1GB1A 3W1YA 5IN7A 2N9LA 4EEWA 1FFVA 2KDEB 3FC4A 3TMPB 4BKTA 1FMAD 3R66C 3R8BA 2EMTA 1OEYA 1HEZE 1C77A 1NBFC 2YVCA 5JHAA 1DGJA 3RCZA 2N9PC 5LXIB 2JF5A 4G3XB 2G4SA 3AXCA 2NPTB 1GOZA 4M02A 1YJIA 4WJQA 3IVFA 1JWAD 2BYTA 1F77A 2DZKA 4HJKA 2L00B 1JWMD 4RM8A 5AZHA 1L2NA 1E90A 1ZP0B 2RPQA 4C80A 3NS8A 3Q69A 4AJWA 2V4IB 1WZ0A 5H8YE 4LNKA 1TS5A 2G4DB 3QARA 4XGAB 2NBVB 2WGSA 4WWPA 1I4PA 3PZDA 2KYWA 1FFUA 4PT5A 5CHVC 1EO6A 4RF1A 4W9DA 3QCAA 2KQ4X 2QJLA 2R2QA 1E8XA 4C4VB 3NZ3A 3N1ZC 3TIXA 4RCOA 1E5WA 3R2TA 3DVNU 3SHQA 3CMMB 1SIFA 3NRZA 1QILA 2LEKA 4BAXA 4EOYA 2L0FA 4ITKA 1QLBB 1ROEA 3L0WB 1QOGA 1K53A 4NZLB 1WXVA 2KTRB 2KNBA 3ZUNA 4BZAA 2CS4A 2DZIA 3AEFB 3DPDA 1XXGA 2KTFA 2FCSA 2FNJB 2PE6B 1RFKA 2N9KA 3VH4B 5G55A 2KMAA 2QCZA 2Y5PA 3A9KA 3IG3A 1KM7A 3EUB2 2KAJA 3DWGC 4A55A 2AQ2B 3QQ8B 4FXCA 3AMZA 4OZBA 2KVRA 2K6QA 3GE8C 3SFEB 4RMAA 2G45B 2WQYB 3DWMA 1WSPA 1WF9A 2KN4A 4RM9A 1WI0A 2LGXA 3BK1A 3VUYA 1C4PA 4BVUC 5IOIA 1V49A 1RFAA 2LUEA 4KDLB 4J6IA 3ENEA 2IO0B 1D5MC 4IWOA 4FN2A 2RMMA 4PYUA 3MJWA 2K1FA 2N4FA 2LHDA 1QF6A 1D6EC 3CWIA 1L0XB 2Y3AA 1E6EB 2CU1A 3BZDB 4DHZE 1ESFA 4FJVB 1KF6B 4N58A 3NOBA 3BVGA 3LXFA 4PYZA 3Q8CA 3ZGZA 1Z2MA 1P3QU 1AW7A 4MDKE 2JU6X 3ZDMC 1XLQA 3P4SB 2KZRA 3AE5B 3Q3MC 4ANVA 3ZYYX 4NPNA 4XC2A 2JRIB 2VZKB 3GB1A 5G5HA 1J7AA 1DOXA 4IDIA 1EF5A 1D5ZC 2BTEA 4ZYSA 5AZFA 1VRAB 2SEBD 3AE9B 1UZXB 2KOXA 2M8SA 2ZJDA 3ETRA 1EF1A 4PS8A 5BYSA 3M63B 3DBHB 4LLGM 1YN5A 4YTPB 3GS2A 1D5XC 1WX9A 1I4RA 2Z59B 3NVZA 4A9AA 1C9FA 3J9CA 2XN9C 2C5LC 2L32A 4BOSC 1OQQA 3ZJTA 3JSVA 2WDVB 3SEBA 4LNFA 1TT5B 4N59A 4RGOS 4EFOA 2JY6A 4PS3A 3UIOB 3AE8B 4RNAA 4HPMB 3RT3B 3PGEA 3VFKA 3T9LA 3MFGA 4EE2A 3EFUA 4KIKA 3PLUA 1R4MB 4IKGA 2L1AA 2HTHA 1V1PB 2W55A 2ACZB 2ON8A 3RPFC 1ENFA 2WXKA 2CHXA 4KV2A 2LRWA 3PLVA 1TS2A 5C23A 2D5GA 2KKCA 2MSED 3I5JC 1QZEA 1F0ZA 1KJTA 1PGAA 3W9CB 2INNE 2N7DA 1JRPA 4EUTA 2LJIA 4RGTA 4W9CA 1NDDA 1RRBA 4HROA 2EELA 3MHZA 4DHJD 3OWEB 3W1SC 2A5UA 3DBRB 3DHHC 1WGHA 2K0PA 5E6NA 2DYOA 3MP9A 1VDVA 3U7ZA 4CQNA 1PGBA 2MEKA 4HLEA 2KN5A 1V2YA 4REZA 4JWUC 4K81A 4ZRIA 2GBJA 4GMVA 4KGTA 4N9F4 3S2AA 3PVLA 1C1YB 4II2B 1MFWA 1XQQA 2G1EA 1WIAA 3VH3B 2N9XA 4HDQA 2LGIA 1YX5B 4JPSA 2KFKA 2N1WA 3SD5A 4KZCA 4A8XC 1V9JA 1PGXA 1TY0A 3KLSX 3ZRFA 4FJYA 2KC2A 2TSSA 2KWVB 5E6JA 4BBNC 4C4VA 4YTMB 3WIMA 1TKEA 5KHQA 2IJ0A 2KACA 4W9FA 3C19A 1J19A 1XCQL 3TCAA 2EKEC 3ZDTA 3CSFA 5DCNA 2DX5B 4USAA 3IXSA 4PS7A 2BF8B 2PJHA 2L7RA 3MJ5A 1FNVA 2OEDA 1RYJA 3KWVA 5DPWA 3CIRB 1UGMA 1PUTA 3P4QB 1N61A 3WAMA 4KX6B 5HG2A 1FRRA 5GXGB 3ZLZA 1A70A 2DLBA 5EE1A 2H89B 2FUHB 3R2IA 1HXYD 1WGGA 4E74A 1J7CA 3EC8A 1TS4A 1K52A 2M56B 2DZMA 4DWFA 2PTLA 2BT6A 3URYA 2WYQA 4GIVA 2RPVA 3BVMA 1VZ7A 4GDKA 4MJSA 1JROA 2MP2B 1T3QA 1N5XA 4MT5A 2K8BA 5H92C 1YIWA 1IBXA 4DHZB 4E3CA 4ZYNA 1UBIA 1E10A 2KANA 4M00A 3N1XC 4XWTA 4NNJB 2X38A 3W2DA 2IO3B 3QWZB 4YSYB 3V62A 3VRAB 2R2OA 2RDGA 2MJ3A 1UF0A 2LI5A 1ISNA 1WYWB 4NAWA 2IY1B 1OTRB 4GN1A 2GB1A 4W9KA 4ZHOA 1PYWD 1LM8B 2KX0A 3LYYA 4KVGB 5JZEB 4DBGA 3OJ4B 3NVYA 2KO3A 1FXAA 1BUIC 4HPLB 2M0XA 5EDSA 5MPOA 2K8HA 4NQKE 3KVFB 2AQ3B 3NUHB 1XLNA 2I2YA 4XDDA 3P4PB 1B9RA 3KYCD 1L5PA 4YT0B 1OEYJ 1TIFA 2J4XA 4KDIC 4AWJA 3C0RB 3KUZA 2WP9B 4RH6A 1QT9A 4W9EA 4WJOA 2HE7A 1E8ZA 3P1MA 3KH0A 2KDFB 3VRBB 1R7SA 3ZJUA 2FCMA 5IP4D 1E0ZA 2WXNA 3U52E 1WM2A 3K9PB 2CR5A 4ZRPA 1WGYA 2HJ1A 1UD7A 2XEWA 1T6BX 2LUMA 3CF6E 4ICVA 2JSVX 3BINA 3P42A 4GDLB 2WXQA 1WGKA 5HI1A 3I9V1 3OJ3A 2SAKA 2L76A 2JX5A 4MSMB 1TJEA 4TUUA 5GMVA 2ICIA 3RN9C 3DVGX 3ZJVA 3VTVA 4WAFA 3A4RA 4L2YA 2B76B 2D07B 4RF0A 1TZOA 2BPSA 1K8RB 5FR6A 2LVOA 2MBOA 1FRDA 3MHSD 3NVWA 3BWUD 2A4ZA 1CQVA 2C7MB 1WZ3A 2BYFA 2ZNVB 4JQWC 1YD8U 1ET6A 4M0WB 1TZ1A 2RDBC 4C00A 2BWES 2CHWA 2C9WB 3ML8A 2W54A 4MACA 4IUMB 4ARCA 3VTWA 1FD6A 1V1OA 4TMAB 2OJWA 2XK5B 3DBHI 1FNUA 5KHOA 3NHEB 2LD9A 3RNEC 3QC8B 2JYTA 4TV3A 1IGCA 5C1ZA 3BVZA 5BYQA 1T0YA 2QIEB 4IOIE 2O2VB 3UIPB 3WANA 2GMIC 2RGFA 3DHIC 4DHJB 4UDUC 2BBCA 1WMHB 1CMXB 1E7UA 1GC6A 3NVVA 2RSUA 1C76A 3B2FA 4WAAA 3KW5B 2GI9A 2ZVNA 1VR9A 3OG5A 3VHTC 5C3JB 1RAXA 1UBQA 1WX8A 3BYTB 1LO5D 4XWWA 1UNSA 3NS1A 5D7GA 4F7ZA 1P9DU 1R4MI 5L95C 2D3AA 1F2RI 2Y5CA 2AWTA 2HJ8A 3AE2B 1YQBA 4GXBA 1XLOA 3NJTA 4YXDB 4W9IA 4WWMA 4ANXA 4MGKE 1MPEA 2GBKA 4YSXB 1PDXA 3Q8EA 2PIAA 1F2RC 4EZJA 2LHEA 2BS2B 4KGRA 3Q3JA 1Y56A 1AWDA 2WXLA 5E6PA 2I1KA 1EU4A 3VTUA 3V60A 1GPXA 2MBEA 1E7PB 3VXWA 1GAQB 1SSNA 2V4LA 4O1NA 4CYEA 3FILA 2M1MA 1UUPA 3DBRI 3ZTCA 3PO0A 5LLIA 1YJ1A 2BKFA 2E3TA 1NEKB 3Q8FA 3CSTA 1QQRA 2WXMA 2JUOA 1V80A 2IO1B 5D94A 1V86A 5DPSA 3SU8X 2KXJA 3H7PB 2PPHA 5FK9C 4MM3B 1ZDXA 3VR9B 2K39A 2K5PA 1P98A 2MQJA 1XO3A 4ACFA 2LVPA 2L3ZA 4CO7A 2J53A 2CKHB 4HPPA 2K3UA 1C4AA 2YLMA 4XE0A 4M8NA 3L16A 4KZ0A 3KUCB 1ZXHA 1MVKA 5HFYA 4NAMA 3ZIMA 1KFYB 3BIID 4IC7B 4GGQA 1YN3A 2KHWB 3GP7A 3W1SA 4JLCA 3QHTA 2MJDA 2D2QA 2N0SB 4MH0E 2WXRA 3U4EG 3A4SC 3DBLB 4K7SA 3WAPA 4HCNB 1L0YB 2IZVB 1I4XA 3TEXA 3VR8B 1N5WA 2C7NB 4A6QA 1DOIA 3DQVA 5IA7A 3SDLC 3SR6A 2O6VA 1P7EA 4GU2A 2WXJA 3JVZX 3IHPC 4XX5A 4JIOU 5EE0A 4FHKA 3T3OA 4HWIB 3B9JA 1FM0D 4BKGA 4OVVA 4BKSA 2GBMA 4TKNA 1GC7A 1TKGA 2ASQA 3LDZE 2GBNA 4LNNA 4D2KA 1F9JA 3WALA 2WLBA 1V81A 4DDID 4US8A 3PRZA 3RZFA 1SGHA 2WDTB 1V5OA 2JT4B 1M94A 2CU3A 1JRUA 2DHZA 3WAOA 1N6ZA 2KJHB 3Q6BA 4HCPB 4W9JA 1IYFA 2H88B 4B95A 3N32A 5TR5A 2AL6A 4IWQA 1QKZA 3Q3OC 2ZZPB 4ANUA 4A90A 3VAWA 4LJPB 2IYDB 1NI2A 2BW2A 3ZNID 2BVCA 1HZ5A 3HIZA 2IGGA 2K6DB 5AUKA 2IGDA 3I63C 4C7ZA 1ZDVA 1JMLA 1BT0A 3EFCA 3DVNV 1WXSA 2LXAA 3ZXRA 2FCNA 4G11A 2QC8A 5AZGA 1L4DB 2BGFA 1IUEA 5J17A 2ZCCA 1SB3C 1UWMA 3B08A 3H8HA 4IWPA 1WM3A 1YQ4B 3A9JB 1MHHE 2AEHA 1UH6A 5BMIA 1WXQA 5JHBA 3L08A 3T3NA 2NPTA 4P6VF 3PRPB 1HTOA 2XK5A 4I6LB 3RZWC 1U4AA 3APDA 4NJCA 3UI3A 2AYOB 3HK0A 3PS6A 4KKIA 5TSSA 3NY5A 4FBJB 2L05A 1IP9A 4HVBA 2R61A 2NTSA 3RNCC 2G9HD 2LRUA 3UF8A 4KSLC 4OW0A 2DAJA 4TSSA 3X0WA 3B0AA 5L83A 3W5VB 1P0RA 4IG7B 1JQ4A 4GLSC 1T0RC 2LGYA 1Q0WB 1ACCA 1LFDA 3VQIA 2PVOD 3ECIA 3HVDA 3JYUA 5E6OA 1JWSD 1WX7A 1CK1A 3U7DA 1WYGA 3WCQA 3NG0A 2DBYA 4H2AA 1KLGD 2FIDA 4ZRJA 1YOVB 1XLPA 2MA9B 4ICUA 3EHVA 3ALBA 4GOCA 2KTRA 4LNOA 3ZNZB 4DK5A 5BMHA 1XEEA 3EGRA 4NQLB 1D3ZA 2K8CA 1RLFA 4ZRQA 4URKA 2KWDA 4WURA 4I6NB 3WA0A 1T0SC 4P7IA 3KQ4A 2WDRB 3APCA 2KMMA 4X57B 5CX3A 5T8IA 2FIFA 2IDYA 2INCC 4HJGE 1STEA 1WRIA 4ZHPA 3OAWA 3A9KB 1E9MA 4TQ1A 2ZNVC 4OZAA 1C78A 2MBBB 1J0GA 2DNFA 2JWUA 3IBEA 1I4GA 3HM3A 5BMGA 3KUDB 4EKUA 4US9A 3T8MA 4HK2A 1NVID 3TEYA 1EWYC 2KQSA 1OGWA 3ZQ4A 1ZGUB 2ZW0A 1E8YA 1FO4A 1Q10A 2PKOA 4C7YA 4S0RA 3EA6A 2N9EB 2CJOA 2V3NA 2AQ1B 2BS3B 5FR3A 4ZRKA 2JYEA 1T0QC 3OLMD 3X23A 3PRMB 2VZKD 2IY0B 4WWOA 3A33B 2BQQA 4I6PA 3TBLD 1JCKB 2KK8A 4II3B 1EUVB 2WXOA 1LXDA 1SJHD 1JWUD 2L0TA 4JGHB 5J18A 1DYQA 4F1SA 1OFFA 4A3PA 4OHJA 5D6JB 2LASA 3PT2B 1SIJA 3N20C 5DPTA 4M8MA 1HA5A 1G6JA 3P63A 2B3AA 2KVZA 5CHWA 3V05A 2KMCA 1V5TA 2M17A 1JALA 1L6VA 3ZTDA 1I42A 4ZOHC 2MW5A 1MG8A 4KKJA 3N3KB 2FAZA 2N7JA 2W82A 1BXTA 1L0VB 1QOBA 2HTME 2MWSB 3L17A 1S3SG 2MLBA 4YSZB 2LGDA 2AL3A 2QDFA 4JWSC 5G2NA 4MEMA 2MJEA 1ZUD2 1EU3A 3DBSA 4WWNA 4IW0A 3JSVB 1V1PA 3B1LX 5J2RA 1E8WA 2KWCA 4BFRA 2KDIA 3U8ZA 3TSSA 3GZNB 3DCGA 1YN4A 1FIQA 1V6EA 2LFIA 3Q8AA 2V0GA 2KDMA 1UWXA 3EECA 2I1JA 1YX6B 3HM6X 3AN1A 4N6EB 1XT9B 1YNTE 2N1VA 3TL5A 3HRDD 4KIKB 4DXGA 2J7QB 4BBNF 2W3SA 2KLCA 1V8CA 2ONQA 4G50A 4HDOA 1I4QA 1VLBA 3DBLI 2EKIA 1I4HA 2NMQA 4HKZE 1WJ6A 4DDGD 2DZJA 1JW9D 2J52A 2WU5B 2NVUI 2JXXA 2MBHA 1SBBB 4LNIA 1VJKA 2VH1A 3TEZA 3RUIB 1S1QB 1R4NB 2Q5WD 4E71A 4A20A 4W9LA 3FKYA 5D3DA 2RD0A 4FJZA 2ZW1A 3JW0X 2KD0A 1IPGA 2KFJA 3W5UB 3MTNB 5C2TB 3PZ7A 1AYFA 1XCTL 2D11A 3Q2AC 4OVUA 2RR9A 5DPRA 4B6WA 2I38A 2IO2B 3AE1B 3BK2A 2VRRB 3AV8A 1ZXIA 4S17A 4B9KA 3Q8BA 1WXAA 3N30A 3C8YA 5CTRC 2KT7A 3VUXA 3PHWB 2WWZA 1X1MA 2QEJC 3ZO5B 1P7FA 2V9HA 1FPYA 4JL9A 3RMKC 3E9SA 3M62B 2L83A 2LWPA 1FCCC 3H9DA 2GLSA 4LK0M 2DYBA 2GOWA 4NY0A 2KFKB 4K3BA 4A3OA 2DWQA 3D32A 3QK0A 3V6CB 2GBRA 3IAS1 2JRHA 1TKYA 3PSEB 1GUAB 1L7YA 3O13A 3UINB 3UGBB 1WRDB 1I35A 1SE2A 4K7UA 1ET9A 4LCDE 3RD2A 4AS1A 1WGRA 2WXFA 2BWFA 1WJUA 3PPAA 1CZPA 1A5RA 2OJRA 2QSDA 3QJZA 1GG3A 1LGRA 1C79A 3AU4A 3AEGB 4XZ4A 1HTQA 4MSQB 5FKAC 4TQ0A 1IGDA 3I57A 4FADA 3I3TB 3QX1A 1WY8A 2WXPA 2J42A 1TY2A 4LJOB 5AUIA 1YMHE 2KJ6A 4JX1C 3VDZA 1HE8A 2ZVOA 2PMVA 4HEA1 4XDCA 4LDTD 2CHZA 3TEWA 3MC8A 1QOFA 1SJED 1KOTA 1RWSA 2IBIB 1ZKHA 2MP2A 3L10B 3E56A 4R3DA 3O65B 3MC0B 4P1BC 2N7EA 1VZ6A 4K1RB 3RI7C 1ZOYB 2L52A 2JPHA 2Z8LA
chains in the Genus database with same CATH topology
2ZCCA 2K8BA 3B08A 1YIWA 3W1YA 4DHZB 4GDKB 4IWPA 4MJSB 1WM3A 2UYZB 4EEWA 4E3CA 4ZYNA 3A9JB 2AEHA 2KDEB 3TMPB 1UH6A 1UBIA 2KANA 3L08A 4BKTA 5JHBA 3R66C 2EMTA 1OEYA 3ONSA 2NPTA 1NBFC 2YVCA 2W9NA 3PRPB 4AUQC 5JHAA 2XK5A 2DAFA 4I6LB 3RCZA 3RZWC 1U4AA 3APDA 2N9PC 2Y5BB 5LXIB 2JF5A 4G3XB 4NNJB 2AYOB 3HK0A 4CHKA 3PS6A 2G4SA 3ZNGC 3AXCA 3NY5A 4FBJB 2L05A 2IO3B 2NPTB 3QWZB 1IP9A 3V62A 4HVBA 4WJNA 3APFA 1GJZA 2FCQA 2R2OA 2LRUA 4WJQA 3UF8A 4KSLC 3IVFA 2ZPYA 2LI5A 2O6VD 3ZRCA 1ISNA 1WFYA 1WYWB 2DZKA 1PQSA 2DAJA 2IY1B 4HJKA 4NAWA 3UQAA 2L00B 1OTRB 4GN1A 2V3SA 3X0WA 3TJPA 3B0AA 4RM8A 4W9KA 5AZHA 5L83A 1L2NA 2G3QB 1E90A 4MGYE 1LM8B 2RPQA 5D2MB 4ZDVA 2KX0A 1P0RA 2Z0EB 3NS8A 4KVGB 4AJWA 4BKSD 5JZEB 1WZ0A 4DBGA 4IG7B 3OJ4B 4NAWB 2KO3A 2JZZA 2LGYA 3H7SA 4HPLB 1Q0WB 2M0XA 3GOEA 2G4DB 3QARA 1LFDA 3VQIA 2K8HA 5EDSA 3ECIA 2KWUB 3KVFB 2C7HA 4NQKE 2NBVB 4WWPA 3PZDA 3JYUA 5E6OA 1WX7A 5CHVC 3R7RA 4WQOB 1EO6A 3U7DA 4W9DA 3QCAA 2R2QA 1E8XA 1UELA 2JWZA 2FIDA 3KYCD 4ZRJA 1OEYJ 3TIXA 1E5WA 4HXDA 3DVNU 2MA9B 3SHQA 3CMMB 4ICUA 4KDIC 3V61A 4AWJA 1SIFA 3EHVA 1WJNA 3ALBA 3U30A 3C0RB 4GOCA 3KUZA 2KTRA 3ZNZB 4DK5A 4EOYA 4W9EA 2L0FA 5JH5C 4NQLB 1D3ZA 3A1QB 4WJOA 1WJ4A 2PEAA 2HE7A 1E8ZA 3L0WB 3UQBA 3KH0A 2K8CA 2M4NA 1RLFA 1WXVA 2KDFB 2KTRB 4URKA 1XD3B 2KNBA 3ZUNA 2CS4A 3R7QA 2OOBB 2DZIA 2FCMA 4I6NB 3WA0A 3DPDA 2KTFA 2FCSA 1WM2A 2FNJB 2PE6B 4P7IA 3VH4B 4GDLA 1GNUA 3APCA 5G55A 3K9PB 2CR5A 2KMAA 3NZUA 4X57B 1WGYA 5CX3A 1SE9A 2NCNA 1Q1OA 1UD7A 3A9KA 2XEWA 3IG3A 3PREA 1KM7A 1LQBA 2FIFA 3CF6E 4ICVA 3BINA 1C3TA 4GDLB 3QQ8B 2BYEA 3RYTA 2JZ3B 2ZPNA 3OAWA 2KVRA 2D3GA 3OJ3A 2K6QA 3A9KB 4W9GA 2L76A 4TQ1A 2ZNVC 4RMAA 4MSMB 1ZW7A 2MBBB 4TUUA 5GMVA 1J0GA 4AOFA 2G45B 3IBEA 3DVGX 3HM3A 3VTVA 3KUDB 1WF9A 2KJRA 4EKUA 3A4RA 2C60A 3T8MA 4HK2A 2D07B 1WE7A 2BPSA 4RM9A 3ZKJC 5AEKB 1WI0A 2LGXA 1K8RB 2D10A 5FR6A 2KQSA 3VUYA 1OGWA 4BVUC 1V49A 4IM2A 1RFAA 2LUEA 2LVOA 2MBOA 4KDLB 1VCBA 4J6IA 1ZGUB 3ENEA 1E8YA 3MHSD 2IO0B 2A4ZA 4IWOA 2C7MB 4FN2A 4PYUA 3MJWA 1WZ3A 2K1FA 2N4FA 2BYFA 2ZNVB 4JQWC 1WR1A 1YD8U 2EMSA 3KYDD 1TZ1A 3LJ3A 4M0WB 3RULA 2BWES 3VVWB 2CHWA 2C9WB 3ML8A 2O2VA 4IUMB 2N9EB 3AU5A 4IM3A 3VTWA 2LJ5A 2UWQA 1WMHA 4BOZB 2CU1A 3DVGY 4DHZE 4ZRKA 2XK5B 3DBHI 5KHOA 3NHEB 4FJVB 2LD9A 3QC8B 4TV3A 3NOBA 2ZCBA 5C1ZA 1T0YA 4PYZA 2O2VB 3OLMD 3UIPB 2GMIC 2LXCA 2RGFA 3PRMB 3WANA 3X23A 4DHJB 2IY0B 1WMHB 1E7VA 1Z2MA 1P3QU 1KLVA 4WWOA 3A33B 1CMXB 1E7UA 1GC6A 4MDKE 4I6PA 3TBLD 3ZDMC 2KZRA 2RSUA 2MCNB 4AP4C 2KK8A 2WX0A 4ANVA 4II3B 1EUVB 1LXDA 2L0TA 4NJ6A 4JGHB 4NPNA 4WAAA 4XC2A 2MBQA 2JRIB 1WE6A 2NS5A 3KW5B 5J18A 4F1SA 3M95A 2ZVNA 1EF5A 4A3PA 5D6JB 2Z0DB 2LASA 3PT2B 5AZFA 5DPTA 3VHTC 1RAXA 1UBQA 1WX8A 2NBUA 3GZNI 4M8MA 1UZXB 2KOXA 1G6JA 2B3AA 5D7GA 4F7ZA 5CHWA 1P9DU 1R4MI 2M8SA 2ZJDA 5L95C 2KMCA 1V5TA 4FLHA 3H6NA 2M17A 1EF1A 4PS8A 2AWTA 3M63B 3ZTDA 2HJ8A 4ASWC 1YQBA 1I42A 1FXTB 4GXBA 1WX9A 2PE9A 2MW5A 1MG8A 4W9IA 3N3KB 2JVCA 2FAZA 4WJPA 4ANXA 2Z59B 4MGKE 5CHFA 4MGZE 1Y8RC 2GBKA 3AULA 2MWSB 2C5LC 3L17A 1S3SG 2MLBA 2J0MA 4BOSC 4EZJA 3JSVA 2LGDA 2AL3A 2J0JA 4G0NB 4MELA 4W9HA 5HKHA 3QAQA 5G2NA 4MEMA 3Q3JA 3H1UA 4EFOA 2JY6A 4PS3A 5E6PA 2I1KA 3UIOB 3DBSA 4HPMB 3VTUA 3ZW3A 4WWNA 4IW0A 3V60A 3JSVB 3B1LX 5J2RA 1E8WA 3RT3B 1TBEA 3DOWA 3L54A 2KWCA 3PGEA 3VFKA 4BFRA 2KDIA 3T9LA 2XBBC 2MBEA 3U8ZA 1R4NI 1WH3A 3VXWA 3DCGA 1V6EA 3EFUA 2V4LA 4KIKA 3PLUA 4ANWA 4CYEA 2HTHA 3EECA 2HD5B 2I1JA 2M1MA 1YX6B 3DBRI 3HM6X 2DENB 1XT9B 3ZTCA 3ZVVA 2N1VA 2CHXA 4KV2A 5LLIA 2LRWA 1YJ1A 2BKFA 4KIKB 3PLVA 3TL5A 4EZLA 2L8JA 3M3JA 2J7QB 4BBNF 5C23A 3H7PA 2KLCA 3CSTA 4KSKC 4MM3A 2KKCA 3AI5A 2JUOA 2MSED 4G50A 1QZEA 4HDOA 5BO4B 1KJTA 3DBLI 4NJ7A 1V80A 2IO1B 5D94A 1V86A 5DPSA 3SU8X 5LXHA 2KXJA 3R3MA 3QA8A 1WJ6A 3H7PB 2DZJA 4DDGD 2PPHA 2N7DA 2NVUI 1J8CA 1WGDA 2JXXA 2MBHA 4LDTB 4K7WA 2K39A 4EUTA 1P98A 2MQJA 4FA6A 3RUIB 1S1QB 2LVPA 3IFWB 4W9CA 2L3ZA 1NDDA 1WR6E 4CO7A 2REXA 1RRBA 2CKHB 4E71A 4A20A 3QIJA 4GSWA 4DHJD 4W9LA 2YLMA 3PV1A 2RD0A 4M8NA 3HHMA 4FJZA 3L16A 4KZ0A 3W1SC 3KUCB 2A5UA 3JW0X 1WGHA 2KD0A 1IPGA 2MRPA 5E6NA 2KFJA 2DYOA 3PTFC 3ZIMA 2NBWB 4IC7B 4F8CB 4GGQA 4HLEA 2KN5A 2KHWB 3MTNB 3W1SA 4JLCA 2KQ7A 3QHTA 2KC1A 1V2YA 2ZEQA 4IM0A 2D11A 2D2QA 4K81A 4MH0E 4ZRIA 3L13A 3A4SC 4OVUA 2GBJA 4K7SA 2RR9A 5DPRA 4B6WA 3WAPA 4GMVA 4HCNB 2MX2A 2IO2B 2IZVB 3K9OB 4N9F4 3ML9A 3S2AA 3PVLA 2VRRB 1C1YB 4FULA 1TTNA 2C7NB 4II2B 1XQQA 1WIAA 4B9KA 3DQVA 3VH3B 2N9XA 3SDLC 4HDQA 5IA7A 1WXAA 3N30A 2O6VA 4GU2A 5CTRC 3VUXA 1YX5B 2LVQA 3JVZX 1H8CA 3PHWB 2WX1A 2WWZA 3IHPC 1TGZB 2KFKA 1P1AA 1X1MA 2N1WA 4XX5A 3SD5A 4JIOU 4KZCA 3ZO5B 4JL9A 1V9JA 4FHKA 4HWIB 3M62B 2LWPA 3H9DA 2O6VB 4BKGA 3ZRFA 4OVVA 4BKSA 2GBMA 4FJYA 4TKNA 2KC2A 2DYBA 1GC7A 1VD2A 2ASQA 2KWVB 3LDZE 2GOWA 4MGIE 4NY0A 2KFKB 2GBNA 3Q3FA 4BBNC 1F9JA 3WIMA 3WALA 5KHQA 4A3OA 1V81A 4DDID 4DXAB 3QK0A 3D32A 3V6CB 3P2BA 3PRZA 5IAAC 1SGHA 3RZFA 4W9FA 2WDTB 1J19A 2GBRA 3NZSA 3TCAA 1V5OA 2EKEC 2JRHA 3CSFA 5DCNA 3ZDTA 2JT4B 1M94A 2DX5B 1GUAB 1L7YA 1Q5WB 3PSEB 3UINB 3UGBB 1WRDB 1I35A 4PS7A 3A1QA 4YL8A 1JRUA 2BF8B 2DHZA 2K25A 3WAOA 2PJHA 4K7UA 2L7RA 2KJHB 4LCDE 1OQYA 3RD2A 4HCPB 1WGRA 2BWFA 4W9JA 1WJUA 3PHXB 3PPAA 1IYFA 1A5RA 1Z5SB 2OJRA 3QJZA 1GG3A 4B95A 3N32A 5TR5A 2AL6A 3ZNHB 4IWQA 2QHOA 3AU4A 5DPWA 4XZ4A 4MSQB 1H4RA 2KX3A 2DYMA 1UGMA 4FHJA 4TQ0A 2LZ6A 2ZZPB 4ANUA 4FADA 3VAWA 3I3TB 4LJPB 2IYDB 1NI2A 3WAMA 4AJYB 3ZNID 3QX1A 1WY8A 2J0KA 4LJOB 2V1YA 3ZLZA 3VUWA 2KJ6A 1WXMA 2FUHB 3HIZA 3BY4B 1HE8A 2KLGA 3VDZA 2ZVOA 2K6DB 1WGGA 4LDTD 2KDBA 2CHZA 4E74A 3EC8A 1AARA 1KOTA 1BT0A 2IBIB 4EZKA 1ZKHA 2DZMA 3DDCB 4DWFA 2BKRB 2MP2A 2NR2A 3L10B 4GB9A 2WYQA 4GIVA 3DVNV 1WXSA 2LXAA 2FCNA 4GDKA 4G11A 2BYVE 4MJSA 3A9JA 3O65B 3V6EB 2N7EA 2MP2B 4K1RB 5AZGA 2JPHA 2BGFA 5J17A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZCC A;  2K8B A;  3B08 A;  1YIW A;  3W1Y A;  4DHZ B;  4GDK B;  4IWP A;  4MJS B;  1WM3 A;  2UYZ B;  4EEW A;  4E3C A;  4ZYN A;  3A9J B;  2AEH A;  2KDE B;  3TMP B;  1UH6 A;  1UBI A;  2KAN A;  3L08 A;  4BKT A;  5JHB A;  3R66 C;  2EMT A;  1OEY A;  3ONS A;  2NPT A;  1NBF C;  2YVC A;  2W9N A;  3PRP B;  4AUQ C;  5JHA A;  2XK5 A;  2DAF A;  4I6L B;  3RCZ A;  3RZW C;  1U4A A;  3APD A;  2N9P C;  2Y5B B;  5LXI B;  2JF5 A;  4G3X B;  4NNJ B;  2AYO B;  3HK0 A;  4CHK A;  3PS6 A;  2G4S A;  3ZNG C;  3AXC A;  3NY5 A;  4FBJ B;  2L05 A;  2IO3 B;  2NPT B;  3QWZ B;  1IP9 A;  3V62 A;  4HVB A;  4WJN A;  3APF A;  1GJZ A;  2FCQ A;  2R2O A;  2LRU A;  4WJQ A;  3UF8 A;  4KSL C;  3IVF A;  2ZPY A;  2LI5 A;  2O6V D;  3ZRC A;  1ISN A;  1WFY A;  1WYW B;  2DZK A;  1PQS A;  2DAJ A;  2IY1 B;  4HJK A;  4NAW A;  3UQA A;  2L00 B;  1OTR B;  4GN1 A;  2V3S A;  3X0W A;  3TJP A;  3B0A A;  4RM8 A;  4W9K A;  5AZH A;  5L83 A;  1L2N A;  2G3Q B;  1E90 A;  4MGY E;  1LM8 B;  2RPQ A;  5D2M B;  4ZDV A;  2KX0 A;  1P0R A;  2Z0E B;  3NS8 A;  4KVG B;  4AJW A;  4BKS D;  5JZE B;  1WZ0 A;  4DBG A;  4IG7 B;  3OJ4 B;  4NAW B;  2KO3 A;  2JZZ A;  2LGY A;  3H7S A;  4HPL B;  1Q0W B;  2M0X A;  3GOE A;  2G4D B;  3QAR A;  1LFD A;  3VQI A;  2K8H A;  5EDS A;  3ECI A;  2KWU B;  3KVF B;  2C7H A;  4NQK E;  2NBV B;  4WWP A;  3PZD A;  3JYU A;  5E6O A;  1WX7 A;  5CHV C;  3R7R A;  4WQO B;  1EO6 A;  3U7D A;  4W9D A;  3QCA A;  2R2Q A;  1E8X A;  1UEL A;  2JWZ A;  2FID A;  3KYC D;  4ZRJ A;  1OEY J;  3TIX A;  1E5W A;  4HXD A;  3DVN U;  2MA9 B;  3SHQ A;  3CMM B;  4ICU A;  4KDI C;  3V61 A;  4AWJ A;  1SIF A;  3EHV A;  1WJN A;  3ALB A;  3U30 A;  3C0R B;  4GOC A;  3KUZ A;  2KTR A;  3ZNZ B;  4DK5 A;  4EOY A;  4W9E A;  2L0F A;  5JH5 C;  4NQL B;  1D3Z A;  3A1Q B;  4WJO A;  1WJ4 A;  2PEA A;  2HE7 A;  1E8Z A;  3L0W B;  3UQB A;  3KH0 A;  2K8C A;  2M4N A;  1RLF A;  1WXV A;  2KDF B;  2KTR B;  4URK A;  1XD3 B;  2KNB A;  3ZUN A;  2CS4 A;  3R7Q A;  2OOB B;  2DZI A;  2FCM A;  4I6N B;  3WA0 A;  3DPD A;  2KTF A;  2FCS A;  1WM2 A;  2FNJ B;  2PE6 B;  4P7I A;  3VH4 B;  4GDL A;  1GNU A;  3APC A;  5G55 A;  3K9P B;  2CR5 A;  2KMA A;  3NZU A;  4X57 B;  1WGY A;  5CX3 A;  1SE9 A;  2NCN A;  1Q1O A;  1UD7 A;  3A9K A;  2XEW A;  3IG3 A;  3PRE A;  1KM7 A;  1LQB A;  2FIF A;  3CF6 E;  4ICV A;  3BIN A;  1C3T A;  4GDL B;  3QQ8 B;  2BYE A;  3RYT A;  2JZ3 B;  2ZPN A;  3OAW A;  2KVR A;  2D3G A;  3OJ3 A;  2K6Q A;  3A9K B;  4W9G A;  2L76 A;  4TQ1 A;  2ZNV C;  4RMA A;  4MSM B;  1ZW7 A;  2MBB B;  4TUU A;  5GMV A;  1J0G A;  4AOF A;  2G45 B;  3IBE A;  3DVG X;  3HM3 A;  3VTV A;  3KUD B;  1WF9 A;  2KJR A;  4EKU A;  3A4R A;  2C60 A;  3T8M A;  4HK2 A;  2D07 B;  1WE7 A;  2BPS A;  4RM9 A;  3ZKJ C;  5AEK B;  1WI0 A;  2LGX A;  1K8R B;  2D10 A;  5FR6 A;  2KQS A;  3VUY A;  1OGW A;  4BVU C;  1V49 A;  4IM2 A;  1RFA A;  2LUE A;  2LVO A;  2MBO A;  4KDL B;  1VCB A;  4J6I A;  1ZGU B;  3ENE A;  1E8Y A;  3MHS D;  2IO0 B;  2A4Z A;  4IWO A;  2C7M B;  4FN2 A;  4PYU A;  3MJW A;  1WZ3 A;  2K1F A;  2N4F A;  2BYF A;  2ZNV B;  4JQW C;  1WR1 A;  1YD8 U;  2EMS A;  3KYD D;  1TZ1 A;  3LJ3 A;  4M0W B;  3RUL A;  2BWE S;  3VVW B;  2CHW A;  2C9W B;  3ML8 A;  2O2V A;  4IUM B;  2N9E B;  3AU5 A;  4IM3 A;  3VTW A;  2LJ5 A;  2UWQ A;  1WMH A;  4BOZ B;  2CU1 A;  3DVG Y;  4DHZ E;  4ZRK A;  2XK5 B;  3DBH I;  5KHO A;  3NHE B;  4FJV B;  2LD9 A;  3QC8 B;  4TV3 A;  3NOB A;  2ZCB A;  5C1Z A;  1T0Y A;  4PYZ A;  2O2V B;  3OLM D;  3UIP B;  2GMI C;  2LXC A;  2RGF A;  3PRM B;  3WAN A;  3X23 A;  4DHJ B;  2IY0 B;  1WMH B;  1E7V A;  1Z2M A;  1P3Q U;  1KLV A;  4WWO A;  3A33 B;  1CMX B;  1E7U A;  1GC6 A;  4MDK E;  4I6P A;  3TBL D;  3ZDM C;  2KZR A;  2RSU A;  2MCN B;  4AP4 C;  2KK8 A;  2WX0 A;  4ANV A;  4II3 B;  1EUV B;  1LXD A;  2L0T A;  4NJ6 A;  4JGH B;  4NPN A;  4WAA A;  4XC2 A;  2MBQ A;  2JRI B;  1WE6 A;  2NS5 A;  3KW5 B;  5J18 A;  4F1S A;  3M95 A;  2ZVN A;  1EF5 A;  4A3P A;  5D6J B;  2Z0D B;  2LAS A;  3PT2 B;  5AZF A;  5DPT A;  3VHT C;  1RAX A;  1UBQ A;  1WX8 A;  2NBU A;  3GZN I;  4M8M A;  1UZX B;  2KOX A;  1G6J A;  2B3A A;  5D7G A;  4F7Z A;  5CHW A;  1P9D U;  1R4M I;  2M8S A;  2ZJD A;  5L95 C;  2KMC A;  1V5T A;  4FLH A;  3H6N A;  2M17 A;  1EF1 A;  4PS8 A;  2AWT A;  3M63 B;  3ZTD A;  2HJ8 A;  4ASW C;  1YQB A;  1I42 A;  1FXT B;  4GXB A;  1WX9 A;  2PE9 A;  2MW5 A;  1MG8 A;  4W9I A;  3N3K B;  2JVC A;  2FAZ A;  4WJP A;  4ANX A;  2Z59 B;  4MGK E;  5CHF A;  4MGZ E;  1Y8R C;  2GBK A;  3AUL A;  2MWS B;  2C5L C;  3L17 A;  1S3S G;  2MLB A;  2J0M A;  4BOS C;  4EZJ A;  3JSV A;  2LGD A;  2AL3 A;  2J0J A;  4G0N B;  4MEL A;  4W9H A;  5HKH A;  3QAQ A;  5G2N A;  4MEM A;  3Q3J A;  3H1U A;  4EFO A;  2JY6 A;  4PS3 A;  5E6P A;  2I1K A;  3UIO B;  3DBS A;  4HPM B;  3VTU A;  3ZW3 A;  4WWN A;  4IW0 A;  3V60 A;  3JSV B;  3B1L X;  5J2R A;  1E8W A;  3RT3 B;  1TBE A;  3DOW A;  3L54 A;  2KWC A;  3PGE A;  3VFK A;  4BFR A;  2KDI A;  3T9L A;  2XBB C;  2MBE A;  3U8Z A;  1R4N I;  1WH3 A;  3VXW A;  3DCG A;  1V6E A;  3EFU A;  2V4L A;  4KIK A;  3PLU A;  4ANW A;  4CYE A;  2HTH A;  3EEC A;  2HD5 B;  2I1J A;  2M1M A;  1YX6 B;  3DBR I;  3HM6 X;  2DEN B;  1XT9 B;  3ZTC A;  3ZVV A;  2N1V A;  2CHX A;  4KV2 A;  5LLI A;  2LRW A;  1YJ1 A;  2BKF A;  4KIK B;  3PLV A;  3TL5 A;  4EZL A;  2L8J A;  3M3J A;  2J7Q B;  4BBN F;  5C23 A;  3H7P A;  2KLC A;  3CST A;  4KSK C;  4MM3 A;  2KKC A;  3AI5 A;  2JUO A;  2MSE D;  4G50 A;  1QZE A;  4HDO A;  5BO4 B;  1KJT A;  3DBL I;  4NJ7 A;  1V80 A;  2IO1 B;  5D94 A;  1V86 A;  5DPS A;  3SU8 X;  5LXH A;  2KXJ A;  3R3M A;  3QA8 A;  1WJ6 A;  3H7P B;  2DZJ A;  4DDG D;  2PPH A;  2N7D A;  2NVU I;  1J8C A;  1WGD A;  2JXX A;  2MBH A;  4LDT B;  4K7W A;  2K39 A;  4EUT A;  1P98 A;  2MQJ A;  4FA6 A;  3RUI B;  1S1Q B;  2LVP A;  3IFW B;  4W9C A;  2L3Z A;  1NDD A;  1WR6 E;  4CO7 A;  2REX A;  1RRB A;  2CKH B;  4E71 A;  4A20 A;  3QIJ A;  4GSW A;  4DHJ D;  4W9L A;  2YLM A;  3PV1 A;  2RD0 A;  4M8N A;  3HHM A;  4FJZ A;  3L16 A;  4KZ0 A;  3W1S C;  3KUC B;  2A5U A;  3JW0 X;  1WGH A;  2KD0 A;  1IPG A;  2MRP A;  5E6N A;  2KFJ A;  2DYO A;  3PTF C;  3ZIM A;  2NBW B;  4IC7 B;  4F8C B;  4GGQ A;  4HLE A;  2KN5 A;  2KHW B;  3MTN B;  3W1S A;  4JLC A;  2KQ7 A;  3QHT A;  2KC1 A;  1V2Y A;  2ZEQ A;  4IM0 A;  2D11 A;  2D2Q A;  4K81 A;  4MH0 E;  4ZRI A;  3L13 A;  3A4S C;  4OVU A;  2GBJ A;  4K7S A;  2RR9 A;  5DPR A;  4B6W A;  3WAP A;  4GMV A;  4HCN B;  2MX2 A;  2IO2 B;  2IZV B;  3K9O B;  4N9F 4;  3ML9 A;  3S2A A;  3PVL A;  2VRR B;  1C1Y B;  4FUL A;  1TTN A;  2C7N B;  4II2 B;  1XQQ A;  1WIA A;  4B9K A;  3DQV A;  3VH3 B;  2N9X A;  3SDL C;  4HDQ A;  5IA7 A;  1WXA A;  3N30 A;  2O6V A;  4GU2 A;  5CTR C;  3VUX A;  1YX5 B;  2LVQ A;  3JVZ X;  1H8C A;  3PHW B;  2WX1 A;  2WWZ A;  3IHP C;  1TGZ B;  2KFK A;  1P1A A;  1X1M A;  2N1W A;  4XX5 A;  3SD5 A;  4JIO U;  4KZC A;  3ZO5 B;  4JL9 A;  1V9J A;  4FHK A;  4HWI B;  3M62 B;  2LWP A;  3H9D A;  2O6V B;  4BKG A;  3ZRF A;  4OVV A;  4BKS A;  2GBM A;  4FJY A;  4TKN A;  2KC2 A;  2DYB A;  1GC7 A;  1VD2 A;  2ASQ A;  2KWV B;  3LDZ E;  2GOW A;  4MGI E;  4NY0 A;  2KFK B;  2GBN A;  3Q3F A;  4BBN C;  1F9J A;  3WIM A;  3WAL A;  5KHQ A;  4A3O A;  1V81 A;  4DDI D;  4DXA B;  3QK0 A;  3D32 A;  3V6C B;  3P2B A;  3PRZ A;  5IAA C;  1SGH A;  3RZF A;  4W9F A;  2WDT B;  1J19 A;  2GBR A;  3NZS A;  3TCA A;  1V5O A;  2EKE C;  2JRH A;  3CSF A;  5DCN A;  3ZDT A;  2JT4 B;  1M94 A;  2DX5 B;  1GUA B;  1L7Y A;  1Q5W B;  3PSE B;  3UIN B;  3UGB B;  1WRD B;  1I35 A;  4PS7 A;  3A1Q A;  4YL8 A;  1JRU A;  2BF8 B;  2DHZ A;  2K25 A;  3WAO A;  2PJH A;  4K7U A;  2L7R A;  2KJH B;  4LCD E;  1OQY A;  3RD2 A;  4HCP B;  1WGR A;  2BWF A;  4W9J A;  1WJU A;  3PHX B;  3PPA A;  1IYF A;  1A5R A;  1Z5S B;  2OJR A;  3QJZ A;  1GG3 A;  4B95 A;  3N32 A;  5TR5 A;  2AL6 A;  3ZNH B;  4IWQ A;  2QHO A;  3AU4 A;  5DPW A;  4XZ4 A;  4MSQ B;  1H4R A;  2KX3 A;  2DYM A;  1UGM A;  4FHJ A;  4TQ0 A;  2LZ6 A;  2ZZP B;  4ANU A;  4FAD A;  3VAW A;  3I3T B;  4LJP B;  2IYD B;  1NI2 A;  3WAM A;  4AJY B;  3ZNI D;  3QX1 A;  1WY8 A;  2J0K A;  4LJO B;  2V1Y A;  3ZLZ A;  3VUW A;  2KJ6 A;  1WXM A;  2FUH B;  3HIZ A;  3BY4 B;  1HE8 A;  2KLG A;  3VDZ A;  2ZVO A;  2K6D B;  1WGG A;  4LDT D;  2KDB A;  2CHZ A;  4E74 A;  3EC8 A;  1AAR A;  1KOT A;  1BT0 A;  2IBI B;  4EZK A;  1ZKH A;  2DZM A;  3DDC B;  4DWF A;  2BKR B;  2MP2 A;  2NR2 A;  3L10 B;  4GB9 A;  2WYQ A;  4GIV A;  3DVN V;  1WXS A;  2LXA A;  2FCN A;  4GDK A;  4G11 A;  2BYV E;  4MJS A;  3A9J A;  3O65 B;  3V6E B;  2N7E A;  2MP2 B;  4K1R B;  5AZG A;  2JPH A;  2BGF A;  5J17 A; 
#chains in the Genus database with same CATH topology
 4GDK B;  4MJS B;  2UYZ B;  1SXT A;  3AH7 A;  3Q3N C;  3ONS A;  1N60 A;  5HHD G;  2W9N A;  4AUQ C;  1IBX B;  2DAF A;  2Y5B B;  5LNK 1;  1KTK A;  4CHK A;  3ZNG C;  2GRI A;  1NEN B;  4WJN A;  3APF A;  1GJZ A;  2FCQ A;  2E6X A;  2ZPY A;  2O6V D;  3ZRC A;  1WFY A;  3ZXV A;  1PQS A;  3UQA A;  2PW9 A;  3RNB C;  3TUO A;  2M19 A;  1MJD A;  2V3S A;  3TJP A;  2G3Q B;  4B0E A;  1L4Z B;  4MGY E;  4AQ7 A;  5D2M B;  3P4R B;  4ZDV A;  2Z0E B;  4BKS D;  1NYR A;  4NAW B;  2JZZ A;  3H7S A;  2AX5 A;  3GOE A;  2VH2 A;  2WDQ B;  2KWU B;  1MI0 A;  2C7H A;  1FNW A;  1HQR D;  3ABV B;  1ZPS A;  3R7R A;  4WQO B;  2IGH A;  3MC9 A;  1RM6 C;  1KRH A;  2JWZ A;  1UEL A;  1FCL A;  1YQ3 B;  4HKQ A;  2WXI A;  4HXD A;  1L6U A;  3RFZ B;  3BYY B;  3V61 A;  1WJN A;  3U30 A;  4WIP A;  3Q14 C;  2WXG A;  1FXI A;  3IAM 1;  4Q2J A;  5JH5 C;  3A1Q B;  3N9Y C;  1WJ4 A;  4L1B A;  2PEA A;  3UQB A;  2BB5 A;  2M4N A;  1V97 A;  1XD3 B;  3R7Q A;  2OOB B;  2LGS A;  2V3P A;  2IND C;  4GDL A;  1GNU A;  4QAY A;  3NZU A;  1SE9 A;  2NCN A;  1Q1O A;  3PRE A;  1LQB A;  1C3T A;  2BYE A;  3RYT A;  2JZ3 B;  1GB4 A;  1SEB D;  2ZPN A;  2D3G A;  1KH0 A;  4W9G A;  1XF5 L;  1ZW7 A;  4AOF A;  5BYR A;  4WH4 A;  3SFD B;  2KJR A;  2C60 A;  5G5G A;  1BML C;  4XYC A;  4OVZ A;  1WE7 A;  3ZKJ C;  4M0W A;  5AEK B;  2D10 A;  3RNA C;  4IM2 A;  2YEP B;  1VCB A;  1JWB D;  2X8X X;  1WR1 A;  3KYD D;  2EMS A;  3LJ3 A;  3FAH A;  3RUL A;  4MH8 A;  3VVW B;  4JE3 B;  4ARI A;  2O2V A;  2HDE A;  3AU5 A;  4IM3 A;  3AEB B;  2IPK D;  2LJ5 A;  2UWQ A;  1YJJ A;  1WMH A;  4BOZ B;  3DVG Y;  1B1Z A;  2YEP F;  1WWT A;  2ZCB A;  5EE3 A;  2D3C A;  2LXC A;  4C56 C;  1E7V A;  1MG4 A;  1KLV A;  4KGS A;  2BS4 B;  4AP4 C;  2MCN B;  3AB5 A;  2WX0 A;  4NJ6 A;  3AEC B;  2MBQ A;  1WE6 A;  2NS5 A;  3M95 A;  1QOA A;  2Z0D B;  2QIL A;  2NBU A;  3GZN I;  2WXH A;  2MHJ A;  3RNF C;  4FLH A;  4M01 A;  3H6N A;  4YTN B;  4ASW C;  1FXT B;  1EWC A;  2JZP A;  2PE9 A;  4WJP A;  1D4B A;  2JVC A;  2INP E;  5CHF A;  4MGZ E;  1Y8R C;  1J7B A;  1ZE3 D;  2K22 A;  2W3R A;  3AUL A;  3IT6 B;  2J0M A;  3HVZ A;  5D3I B;  2J0J A;  4G0N B;  4MEL A;  4W9H A;  5HKH A;  3QAQ A;  3H1U A;  1TS3 A;  1N62 A;  4PK1 A;  2D3B A;  3ZW3 A;  1TBE A;  3DOW A;  3L54 A;  2XBB C;  1R4N I;  1WH3 A;  3B2G A;  2RDH A;  2CJN A;  1FEH A;  4ANW A;  2MH7 A;  2HD5 B;  4RFB A;  2DEN B;  3ZVV A;  3IT4 B;  1NI3 A;  4EZL A;  2L8J A;  3M3J A;  3H7P A;  4KSK C;  3FIL B;  4MM3 A;  2FBW B;  3AI5 A;  1T5X D;  5BO4 B;  2LMC A;  4NJ7 A;  3LB8 C;  1MHX A;  3AEE B;  5LXH A;  3AM9 A;  3R3M A;  3PZ8 A;  3QA8 A;  1NYQ A;  1J8C A;  1WGD A;  3AE3 B;  4LDT B;  4K7W A;  4YWG G;  2PVG C;  4FA6 A;  1TYG B;  4DXF A;  4RGM A;  3IFW B;  1WR6 E;  3DHG C;  4B0M A;  2REX A;  4P1C C;  3QIJ A;  4GSW A;  3PV1 A;  3HHM A;  1OQR A;  1PFD A;  4J3O D;  2WHI A;  5I4D A;  2MRP A;  3PTF C;  5JXV A;  2NBW B;  4L23 A;  4F8C B;  2KQ7 A;  2KC1 A;  2ZEQ A;  3AE7 B;  4IM0 A;  2WU2 B;  3L13 A;  2FUG 1;  3HUI A;  2MX2 A;  1K50 A;  3K9O B;  4DQO C;  1K51 A;  3ML9 A;  3AED B;  2UU7 A;  4FUL A;  1TTN A;  3U2S C;  2M0A A;  5IKC M;  1SF0 A;  2LVQ A;  2K9X A;  2FE8 A;  1C4C A;  1H8C A;  2WX1 A;  1DOY A;  1TGZ B;  3AEA B;  1P1A A;  3KWL A;  1I7H A;  5IO9 A;  1SE3 A;  2O6V B;  1AN8 A;  2WNM A;  2NTT A;  4MGI E;  1M4V A;  1VD2 A;  2XNA C;  3Q3F A;  1F1H A;  1EM7 A;  1N63 A;  4OZC A;  4DXA B;  3P2B A;  5IAA C;  3NZS A;  1Q5W B;  3A1Q A;  4YL8 A;  4HRS A;  2K25 A;  1OQY A;  1SE4 A;  3PHX B;  1Z5S B;  4LTU A;  2JXT A;  3ZNH B;  1F52 A;  1CJE A;  2QHO A;  1H4R A;  2KX3 A;  2DYM A;  3AE4 B;  4FHJ A;  4AJY B;  2J0K A;  2V1Y A;  3VUW A;  3GE3 C;  1WXM A;  3BY4 B;  2KLG A;  4K3C A;  2JQR B;  5EE9 A;  2KDB A;  1AAR A;  2WS3 B;  2BB6 A;  4RGN A;  3AE6 B;  4EZK A;  3DDC B;  1UGJ A;  1HZ6 A;  3L4P A;  2BKR B;  3N1Y C;  3V3X A;  1VZ8 A;  2NR2 A;  4GB9 A;  1KLU D;  2PLP A;  2BYV E;  2OHF A;  3A9J A;  3V6E B;  4WQM A;  2QMT A;  3RNG C;  4P16 A;  2LZ6 A;  1GB1 A;  3W1Y A;  5IN7 A;  2N9L A;  4EEW A;  1FFV A;  2KDE B;  3FC4 A;  3TMP B;  4BKT A;  1FMA D;  3R66 C;  3R8B A;  2EMT A;  1OEY A;  1HEZ E;  1C77 A;  1NBF C;  2YVC A;  5JHA A;  1DGJ A;  3RCZ A;  2N9P C;  5LXI B;  2JF5 A;  4G3X B;  2G4S A;  3AXC A;  2NPT B;  1GOZ A;  4M02 A;  1YJI A;  4WJQ A;  3IVF A;  1JWA D;  2BYT A;  1F77 A;  2DZK A;  4HJK A;  2L00 B;  1JWM D;  4RM8 A;  5AZH A;  1L2N A;  1E90 A;  1ZP0 B;  2RPQ A;  4C80 A;  3NS8 A;  3Q69 A;  4AJW A;  2V4I B;  1WZ0 A;  5H8Y E;  4LNK A;  1TS5 A;  2G4D B;  3QAR A;  4XGA B;  2NBV B;  2WGS A;  4WWP A;  1I4P A;  3PZD A;  2KYW A;  1FFU A;  4PT5 A;  5CHV C;  1EO6 A;  4RF1 A;  4W9D A;  3QCA A;  2KQ4 X;  2QJL A;  2R2Q A;  1E8X A;  4C4V B;  3NZ3 A;  3N1Z C;  3TIX A;  4RCO A;  1E5W A;  3R2T A;  3DVN U;  3SHQ A;  3CMM B;  1SIF A;  3NRZ A;  1QIL A;  2LEK A;  4BAX A;  4EOY A;  2L0F A;  4ITK A;  1QLB B;  1ROE A;  3L0W B;  1QOG A;  1K53 A;  4NZL B;  1WXV A;  2KTR B;  2KNB A;  3ZUN A;  4BZA A;  2CS4 A;  2DZI A;  3AEF B;  3DPD A;  1XXG A;  2KTF A;  2FCS A;  2FNJ B;  2PE6 B;  1RFK A;  2N9K A;  3VH4 B;  5G55 A;  2KMA A;  2QCZ A;  2Y5P A;  3A9K A;  3IG3 A;  1KM7 A;  3EUB 2;  2KAJ A;  3DWG C;  4A55 A;  2AQ2 B;  3QQ8 B;  4FXC A;  3AMZ A;  4OZB A;  2KVR A;  2K6Q A;  3GE8 C;  3SFE B;  4RMA A;  2G45 B;  2WQY B;  3DWM A;  1WSP A;  1WF9 A;  2KN4 A;  4RM9 A;  1WI0 A;  2LGX A;  3BK1 A;  3VUY A;  1C4P A;  4BVU C;  5IOI A;  1V49 A;  1RFA A;  2LUE A;  4KDL B;  4J6I A;  3ENE A;  2IO0 B;  1D5M C;  4IWO A;  4FN2 A;  2RMM A;  4PYU A;  3MJW A;  2K1F A;  2N4F A;  2LHD A;  1QF6 A;  1D6E C;  3CWI A;  1L0X B;  2Y3A A;  1E6E B;  2CU1 A;  3BZD B;  4DHZ E;  1ESF A;  4FJV B;  1KF6 B;  4N58 A;  3NOB A;  3BVG A;  3LXF A;  4PYZ A;  3Q8C A;  3ZGZ A;  1Z2M A;  1P3Q U;  1AW7 A;  4MDK E;  2JU6 X;  3ZDM C;  1XLQ A;  3P4S B;  2KZR A;  3AE5 B;  3Q3M C;  4ANV A;  3ZYY X;  4NPN A;  4XC2 A;  2JRI B;  2VZK B;  3GB1 A;  5G5H A;  1J7A A;  1DOX A;  4IDI A;  1EF5 A;  1D5Z C;  2BTE A;  4ZYS A;  5AZF A;  1VRA B;  2SEB D;  3AE9 B;  1UZX B;  2KOX A;  2M8S A;  2ZJD A;  3ETR A;  1EF1 A;  4PS8 A;  5BYS A;  3M63 B;  3DBH B;  4LLG M;  1YN5 A;  4YTP B;  3GS2 A;  1D5X C;  1WX9 A;  1I4R A;  2Z59 B;  3NVZ A;  4A9A A;  1C9F A;  3J9C A;  2XN9 C;  2C5L C;  2L32 A;  4BOS C;  1OQQ A;  3ZJT A;  3JSV A;  2WDV B;  3SEB A;  4LNF A;  1TT5 B;  4N59 A;  4RGO S;  4EFO A;  2JY6 A;  4PS3 A;  3UIO B;  3AE8 B;  4RNA A;  4HPM B;  3RT3 B;  3PGE A;  3VFK A;  3T9L A;  3MFG A;  4EE2 A;  3EFU A;  4KIK A;  3PLU A;  1R4M B;  4IKG A;  2L1A A;  2HTH A;  1V1P B;  2W55 A;  2ACZ B;  2ON8 A;  3RPF C;  1ENF A;  2WXK A;  2CHX A;  4KV2 A;  2LRW A;  3PLV A;  1TS2 A;  5C23 A;  2D5G A;  2KKC A;  2MSE D;  3I5J C;  1QZE A;  1F0Z A;  1KJT A;  1PGA A;  3W9C B;  2INN E;  2N7D A;  1JRP A;  4EUT A;  2LJI A;  4RGT A;  4W9C A;  1NDD A;  1RRB A;  4HRO A;  2EEL A;  3MHZ A;  4DHJ D;  3OWE B;  3W1S C;  2A5U A;  3DBR B;  3DHH C;  1WGH A;  2K0P A;  5E6N A;  2DYO A;  3MP9 A;  1VDV A;  3U7Z A;  4CQN A;  1PGB A;  2MEK A;  4HLE A;  2KN5 A;  1V2Y A;  4REZ A;  4JWU C;  4K81 A;  4ZRI A;  2GBJ A;  4GMV A;  4KGT A;  4N9F 4;  3S2A A;  3PVL A;  1C1Y B;  4II2 B;  1MFW A;  1XQQ A;  2G1E A;  1WIA A;  3VH3 B;  2N9X A;  4HDQ A;  2LGI A;  1YX5 B;  4JPS A;  2KFK A;  2N1W A;  3SD5 A;  4KZC A;  4A8X C;  1V9J A;  1PGX A;  1TY0 A;  3KLS X;  3ZRF A;  4FJY A;  2KC2 A;  2TSS A;  2KWV B;  5E6J A;  4BBN C;  4C4V A;  4YTM B;  3WIM A;  1TKE A;  5KHQ A;  2IJ0 A;  2KAC A;  4W9F A;  3C19 A;  1J19 A;  1XCQ L;  3TCA A;  2EKE C;  3ZDT A;  3CSF A;  5DCN A;  2DX5 B;  4USA A;  3IXS A;  4PS7 A;  2BF8 B;  2PJH A;  2L7R A;  3MJ5 A;  1FNV A;  2OED A;  1RYJ A;  3KWV A;  5DPW A;  3CIR B;  1UGM A;  1PUT A;  3P4Q B;  1N61 A;  3WAM A;  4KX6 B;  5HG2 A;  1FRR A;  5GXG B;  3ZLZ A;  1A70 A;  2DLB A;  5EE1 A;  2H89 B;  2FUH B;  3R2I A;  1HXY D;  1WGG A;  4E74 A;  1J7C A;  3EC8 A;  1TS4 A;  1K52 A;  2M56 B;  2DZM A;  4DWF A;  2PTL A;  2BT6 A;  3URY A;  2WYQ A;  4GIV A;  2RPV A;  3BVM A;  1VZ7 A;  4GDK A;  4MJS A;  1JRO A;  2MP2 B;  1T3Q A;  1N5X A;  4MT5 A;  2K8B A;  5H92 C;  1YIW A;  1IBX A;  4DHZ B;  4E3C A;  4ZYN A;  1UBI A;  1E10 A;  2KAN A;  4M00 A;  3N1X C;  4XWT A;  4NNJ B;  2X38 A;  3W2D A;  2IO3 B;  3QWZ B;  4YSY B;  3V62 A;  3VRA B;  2R2O A;  2RDG A;  2MJ3 A;  1UF0 A;  2LI5 A;  1ISN A;  1WYW B;  4NAW A;  2IY1 B;  1OTR B;  4GN1 A;  2GB1 A;  4W9K A;  4ZHO A;  1PYW D;  1LM8 B;  2KX0 A;  3LYY A;  4KVG B;  5JZE B;  4DBG A;  3OJ4 B;  3NVY A;  2KO3 A;  1FXA A;  1BUI C;  4HPL B;  2M0X A;  5EDS A;  5MPO A;  2K8H A;  4NQK E;  3KVF B;  2AQ3 B;  3NUH B;  1XLN A;  2I2Y A;  4XDD A;  3P4P B;  1B9R A;  3KYC D;  1L5P A;  4YT0 B;  1OEY J;  1TIF A;  2J4X A;  4KDI C;  4AWJ A;  3C0R B;  3KUZ A;  2WP9 B;  4RH6 A;  1QT9 A;  4W9E A;  4WJO A;  2HE7 A;  1E8Z A;  3P1M A;  3KH0 A;  2KDF B;  3VRB B;  1R7S A;  3ZJU A;  2FCM A;  5IP4 D;  1E0Z A;  2WXN A;  3U52 E;  1WM2 A;  3K9P B;  2CR5 A;  4ZRP A;  1WGY A;  2HJ1 A;  1UD7 A;  2XEW A;  1T6B X;  2LUM A;  3CF6 E;  4ICV A;  2JSV X;  3BIN A;  3P42 A;  4GDL B;  2WXQ A;  1WGK A;  5HI1 A;  3I9V 1;  3OJ3 A;  2SAK A;  2L76 A;  2JX5 A;  4MSM B;  1TJE A;  4TUU A;  5GMV A;  2ICI A;  3RN9 C;  3DVG X;  3ZJV A;  3VTV A;  4WAF A;  3A4R A;  4L2Y A;  2B76 B;  2D07 B;  4RF0 A;  1TZO A;  2BPS A;  1K8R B;  5FR6 A;  2LVO A;  2MBO A;  1FRD A;  3MHS D;  3NVW A;  3BWU D;  2A4Z A;  1CQV A;  2C7M B;  1WZ3 A;  2BYF A;  2ZNV B;  4JQW C;  1YD8 U;  1ET6 A;  4M0W B;  1TZ1 A;  2RDB C;  4C00 A;  2BWE S;  2CHW A;  2C9W B;  3ML8 A;  2W54 A;  4MAC A;  4IUM B;  4ARC A;  3VTW A;  1FD6 A;  1V1O A;  4TMA B;  2OJW A;  2XK5 B;  3DBH I;  1FNU A;  5KHO A;  3NHE B;  2LD9 A;  3RNE C;  3QC8 B;  2JYT A;  4TV3 A;  1IGC A;  5C1Z A;  3BVZ A;  5BYQ A;  1T0Y A;  2QIE B;  4IOI E;  2O2V B;  3UIP B;  3WAN A;  2GMI C;  2RGF A;  3DHI C;  4DHJ B;  4UDU C;  2BBC A;  1WMH B;  1CMX B;  1E7U A;  1GC6 A;  3NVV A;  2RSU A;  1C76 A;  3B2F A;  4WAA A;  3KW5 B;  2GI9 A;  2ZVN A;  1VR9 A;  3OG5 A;  3VHT C;  5C3J B;  1RAX A;  1UBQ A;  1WX8 A;  3BYT B;  1LO5 D;  4XWW A;  1UNS A;  3NS1 A;  5D7G A;  4F7Z A;  1P9D U;  1R4M I;  5L95 C;  2D3A A;  1F2R I;  2Y5C A;  2AWT A;  2HJ8 A;  3AE2 B;  1YQB A;  4GXB A;  1XLO A;  3NJT A;  4YXD B;  4W9I A;  4WWM A;  4ANX A;  4MGK E;  1MPE A;  2GBK A;  4YSX B;  1PDX A;  3Q8E A;  2PIA A;  1F2R C;  4EZJ A;  2LHE A;  2BS2 B;  4KGR A;  3Q3J A;  1Y56 A;  1AWD A;  2WXL A;  5E6P A;  2I1K A;  1EU4 A;  3VTU A;  3V60 A;  1GPX A;  2MBE A;  1E7P B;  3VXW A;  1GAQ B;  1SSN A;  2V4L A;  4O1N A;  4CYE A;  3FIL A;  2M1M A;  1UUP A;  3DBR I;  3ZTC A;  3PO0 A;  5LLI A;  1YJ1 A;  2BKF A;  2E3T A;  1NEK B;  3Q8F A;  3CST A;  1QQR A;  2WXM A;  2JUO A;  1V80 A;  2IO1 B;  5D94 A;  1V86 A;  5DPS A;  3SU8 X;  2KXJ A;  3H7P B;  2PPH A;  5FK9 C;  4MM3 B;  1ZDX A;  3VR9 B;  2K39 A;  2K5P A;  1P98 A;  2MQJ A;  1XO3 A;  4ACF A;  2LVP A;  2L3Z A;  4CO7 A;  2J53 A;  2CKH B;  4HPP A;  2K3U A;  1C4A A;  2YLM A;  4XE0 A;  4M8N A;  3L16 A;  4KZ0 A;  3KUC B;  1ZXH A;  1MVK A;  5HFY A;  4NAM A;  3ZIM A;  1KFY B;  3BII D;  4IC7 B;  4GGQ A;  1YN3 A;  2KHW B;  3GP7 A;  3W1S A;  4JLC A;  3QHT A;  2MJD A;  2D2Q A;  2N0S B;  4MH0 E;  2WXR A;  3U4E G;  3A4S C;  3DBL B;  4K7S A;  3WAP A;  4HCN B;  1L0Y B;  2IZV B;  1I4X A;  3TEX A;  3VR8 B;  1N5W A;  2C7N B;  4A6Q A;  1DOI A;  3DQV A;  5IA7 A;  3SDL C;  3SR6 A;  2O6V A;  1P7E A;  4GU2 A;  2WXJ A;  3JVZ X;  3IHP C;  4XX5 A;  4JIO U;  5EE0 A;  4FHK A;  3T3O A;  4HWI B;  3B9J A;  1FM0 D;  4BKG A;  4OVV A;  4BKS A;  2GBM A;  4TKN A;  1GC7 A;  1TKG A;  2ASQ A;  3LDZ E;  2GBN A;  4LNN A;  4D2K A;  1F9J A;  3WAL A;  2WLB A;  1V81 A;  4DDI D;  4US8 A;  3PRZ A;  3RZF A;  1SGH A;  2WDT B;  1V5O A;  2JT4 B;  1M94 A;  2CU3 A;  1JRU A;  2DHZ A;  3WAO A;  1N6Z A;  2KJH B;  3Q6B A;  4HCP B;  4W9J A;  1IYF A;  2H88 B;  4B95 A;  3N32 A;  5TR5 A;  2AL6 A;  4IWQ A;  1QKZ A;  3Q3O C;  2ZZP B;  4ANU A;  4A90 A;  3VAW A;  4LJP B;  2IYD B;  1NI2 A;  2BW2 A;  3ZNI D;  2BVC A;  1HZ5 A;  3HIZ A;  2IGG A;  2K6D B;  5AUK A;  2IGD A;  3I63 C;  4C7Z A;  1ZDV A;  1JML A;  1BT0 A;  3EFC A;  3DVN V;  1WXS A;  2LXA A;  3ZXR A;  2FCN A;  4G11 A;  2QC8 A;  5AZG A;  1L4D B;  2BGF A;  1IUE A;  5J17 A;  2ZCC A;  1SB3 C;  1UWM A;  3B08 A;  3H8H A;  4IWP A;  1WM3 A;  1YQ4 B;  3A9J B;  1MHH E;  2AEH A;  1UH6 A;  5BMI A;  1WXQ A;  5JHB A;  3L08 A;  3T3N A;  2NPT A;  4P6V F;  3PRP B;  1HTO A;  2XK5 A;  4I6L B;  3RZW C;  1U4A A;  3APD A;  4NJC A;  3UI3 A;  2AYO B;  3HK0 A;  3PS6 A;  4KKI A;  5TSS A;  3NY5 A;  4FBJ B;  2L05 A;  1IP9 A;  4HVB A;  2R61 A;  2NTS A;  3RNC C;  2G9H D;  2LRU A;  3UF8 A;  4KSL C;  4OW0 A;  2DAJ A;  4TSS A;  3X0W A;  3B0A A;  5L83 A;  3W5V B;  1P0R A;  4IG7 B;  1JQ4 A;  4GLS C;  1T0R C;  2LGY A;  1Q0W B;  1ACC A;  1LFD A;  3VQI A;  2PVO D;  3ECI A;  3HVD A;  3JYU A;  5E6O A;  1JWS D;  1WX7 A;  1CK1 A;  3U7D A;  1WYG A;  3WCQ A;  3NG0 A;  2DBY A;  4H2A A;  1KLG D;  2FID A;  4ZRJ A;  1YOV B;  1XLP A;  2MA9 B;  4ICU A;  3EHV A;  3ALB A;  4GOC A;  2KTR A;  4LNO A;  3ZNZ B;  4DK5 A;  5BMH A;  1XEE A;  3EGR A;  4NQL B;  1D3Z A;  2K8C A;  1RLF A;  4ZRQ A;  4URK A;  2KWD A;  4WUR A;  4I6N B;  3WA0 A;  1T0S C;  4P7I A;  3KQ4 A;  2WDR B;  3APC A;  2KMM A;  4X57 B;  5CX3 A;  5T8I A;  2FIF A;  2IDY A;  2INC C;  4HJG E;  1STE A;  1WRI A;  4ZHP A;  3OAW A;  3A9K B;  1E9M A;  4TQ1 A;  2ZNV C;  4OZA A;  1C78 A;  2MBB B;  1J0G A;  2DNF A;  2JWU A;  3IBE A;  1I4G A;  3HM3 A;  5BMG A;  3KUD B;  4EKU A;  4US9 A;  3T8M A;  4HK2 A;  1NVI D;  3TEY A;  1EWY C;  2KQS A;  1OGW A;  3ZQ4 A;  1ZGU B;  2ZW0 A;  1E8Y A;  1FO4 A;  1Q10 A;  2PKO A;  4C7Y A;  4S0R A;  3EA6 A;  2N9E B;  2CJO A;  2V3N A;  2AQ1 B;  2BS3 B;  5FR3 A;  4ZRK A;  2JYE A;  1T0Q C;  3OLM D;  3X23 A;  3PRM B;  2VZK D;  2IY0 B;  4WWO A;  3A33 B;  2BQQ A;  4I6P A;  3TBL D;  1JCK B;  2KK8 A;  4II3 B;  1EUV B;  2WXO A;  1LXD A;  1SJH D;  1JWU D;  2L0T A;  4JGH B;  5J18 A;  1DYQ A;  4F1S A;  1OFF A;  4A3P A;  4OHJ A;  5D6J B;  2LAS A;  3PT2 B;  1SIJ A;  3N20 C;  5DPT A;  4M8M A;  1HA5 A;  1G6J A;  3P63 A;  2B3A A;  2KVZ A;  5CHW A;  3V05 A;  2KMC A;  1V5T A;  2M17 A;  1JAL A;  1L6V A;  3ZTD A;  1I42 A;  4ZOH C;  2MW5 A;  1MG8 A;  4KKJ A;  3N3K B;  2FAZ A;  2N7J A;  2W82 A;  1BXT A;  1L0V B;  1QOB A;  2HTM E;  2MWS B;  3L17 A;  1S3S G;  2MLB A;  4YSZ B;  2LGD A;  2AL3 A;  2QDF A;  4JWS C;  5G2N A;  4MEM A;  2MJE A;  1ZUD 2;  1EU3 A;  3DBS A;  4WWN A;  4IW0 A;  3JSV B;  1V1P A;  3B1L X;  5J2R A;  1E8W A;  2KWC A;  4BFR A;  2KDI A;  3U8Z A;  3TSS A;  3GZN B;  3DCG A;  1YN4 A;  1FIQ A;  1V6E A;  2LFI A;  3Q8A A;  2V0G A;  2KDM A;  1UWX A;  3EEC A;  2I1J A;  1YX6 B;  3HM6 X;  3AN1 A;  4N6E B;  1XT9 B;  1YNT E;  2N1V A;  3TL5 A;  3HRD D;  4KIK B;  4DXG A;  2J7Q B;  4BBN F;  2W3S A;  2KLC A;  1V8C A;  2ONQ A;  4G50 A;  4HDO A;  1I4Q A;  1VLB A;  3DBL I;  2EKI A;  1I4H A;  2NMQ A;  4HKZ E;  1WJ6 A;  4DDG D;  2DZJ A;  1JW9 D;  2J52 A;  2WU5 B;  2NVU I;  2JXX A;  2MBH A;  1SBB B;  4LNI A;  1VJK A;  2VH1 A;  3TEZ A;  3RUI B;  1S1Q B;  1R4N B;  2Q5W D;  4E71 A;  4A20 A;  4W9L A;  3FKY A;  5D3D A;  2RD0 A;  4FJZ A;  2ZW1 A;  3JW0 X;  2KD0 A;  1IPG A;  2KFJ A;  3W5U B;  3MTN B;  5C2T B;  3PZ7 A;  1AYF A;  1XCT L;  2D11 A;  3Q2A C;  4OVU A;  2RR9 A;  5DPR A;  4B6W A;  2I38 A;  2IO2 B;  3AE1 B;  3BK2 A;  2VRR B;  3AV8 A;  1ZXI A;  4S17 A;  4B9K A;  3Q8B A;  1WXA A;  3N30 A;  3C8Y A;  5CTR C;  2KT7 A;  3VUX A;  3PHW B;  2WWZ A;  1X1M A;  2QEJ C;  3ZO5 B;  1P7F A;  2V9H A;  1FPY A;  4JL9 A;  3RMK C;  3E9S A;  3M62 B;  2L83 A;  2LWP A;  1FCC C;  3H9D A;  2GLS A;  4LK0 M;  2DYB A;  2GOW A;  4NY0 A;  2KFK B;  4K3B A;  4A3O A;  2DWQ A;  3D32 A;  3QK0 A;  3V6C B;  2GBR A;  3IAS 1;  2JRH A;  1TKY A;  3PSE B;  1GUA B;  1L7Y A;  3O13 A;  3UIN B;  3UGB B;  1WRD B;  1I35 A;  1SE2 A;  4K7U A;  1ET9 A;  4LCD E;  3RD2 A;  4AS1 A;  1WGR A;  2WXF A;  2BWF A;  1WJU A;  3PPA A;  1CZP A;  1A5R A;  2OJR A;  2QSD A;  3QJZ A;  1GG3 A;  1LGR A;  1C79 A;  3AU4 A;  3AEG B;  4XZ4 A;  1HTQ A;  4MSQ B;  5FKA C;  4TQ0 A;  1IGD A;  3I57 A;  4FAD A;  3I3T B;  3QX1 A;  1WY8 A;  2WXP A;  2J42 A;  1TY2 A;  4LJO B;  5AUI A;  1YMH E;  2KJ6 A;  4JX1 C;  3VDZ A;  1HE8 A;  2ZVO A;  2PMV A;  4HEA 1;  4XDC A;  4LDT D;  2CHZ A;  3TEW A;  3MC8 A;  1QOF A;  1SJE D;  1KOT A;  1RWS A;  2IBI B;  1ZKH A;  2MP2 A;  3L10 B;  3E56 A;  4R3D A;  3O65 B;  3MC0 B;  4P1B C;  2N7E A;  1VZ6 A;  4K1R B;  3RI7 C;  1ZOY B;  2L52 A;  2JPH A;  2Z8L A; 
#chains in the Genus database with same CATH homology
 2ZCC A;  2K8B A;  3B08 A;  1YIW A;  3W1Y A;  4DHZ B;  4GDK B;  4IWP A;  4MJS B;  1WM3 A;  2UYZ B;  4EEW A;  4E3C A;  4ZYN A;  3A9J B;  2AEH A;  2KDE B;  3TMP B;  1UH6 A;  1UBI A;  2KAN A;  3L08 A;  4BKT A;  5JHB A;  3R66 C;  2EMT A;  1OEY A;  3ONS A;  2NPT A;  1NBF C;  2YVC A;  2W9N A;  3PRP B;  4AUQ C;  5JHA A;  2XK5 A;  2DAF A;  4I6L B;  3RCZ A;  3RZW C;  1U4A A;  3APD A;  2N9P C;  2Y5B B;  5LXI B;  2JF5 A;  4G3X B;  4NNJ B;  2AYO B;  3HK0 A;  4CHK A;  3PS6 A;  2G4S A;  3ZNG C;  3AXC A;  3NY5 A;  4FBJ B;  2L05 A;  2IO3 B;  2NPT B;  3QWZ B;  1IP9 A;  3V62 A;  4HVB A;  4WJN A;  3APF A;  1GJZ A;  2FCQ A;  2R2O A;  2LRU A;  4WJQ A;  3UF8 A;  4KSL C;  3IVF A;  2ZPY A;  2LI5 A;  2O6V D;  3ZRC A;  1ISN A;  1WFY A;  1WYW B;  2DZK A;  1PQS A;  2DAJ A;  2IY1 B;  4HJK A;  4NAW A;  3UQA A;  2L00 B;  1OTR B;  4GN1 A;  2V3S A;  3X0W A;  3TJP A;  3B0A A;  4RM8 A;  4W9K A;  5AZH A;  5L83 A;  1L2N A;  2G3Q B;  1E90 A;  4MGY E;  1LM8 B;  2RPQ A;  5D2M B;  4ZDV A;  2KX0 A;  1P0R A;  2Z0E B;  3NS8 A;  4KVG B;  4AJW A;  4BKS D;  5JZE B;  1WZ0 A;  4DBG A;  4IG7 B;  3OJ4 B;  4NAW B;  2KO3 A;  2JZZ A;  2LGY A;  3H7S A;  4HPL B;  1Q0W B;  2M0X A;  3GOE A;  2G4D B;  3QAR A;  1LFD A;  3VQI A;  2K8H A;  5EDS A;  3ECI A;  2KWU B;  3KVF B;  2C7H A;  4NQK E;  2NBV B;  4WWP A;  3PZD A;  3JYU A;  5E6O A;  1WX7 A;  5CHV C;  3R7R A;  4WQO B;  1EO6 A;  3U7D A;  4W9D A;  3QCA A;  2R2Q A;  1E8X A;  1UEL A;  2JWZ A;  2FID A;  3KYC D;  4ZRJ A;  1OEY J;  3TIX A;  1E5W A;  4HXD A;  3DVN U;  2MA9 B;  3SHQ A;  3CMM B;  4ICU A;  4KDI C;  3V61 A;  4AWJ A;  1SIF A;  3EHV A;  1WJN A;  3ALB A;  3U30 A;  3C0R B;  4GOC A;  3KUZ A;  2KTR A;  3ZNZ B;  4DK5 A;  4EOY A;  4W9E A;  2L0F A;  5JH5 C;  4NQL B;  1D3Z A;  3A1Q B;  4WJO A;  1WJ4 A;  2PEA A;  2HE7 A;  1E8Z A;  3L0W B;  3UQB A;  3KH0 A;  2K8C A;  2M4N A;  1RLF A;  1WXV A;  2KDF B;  2KTR B;  4URK A;  1XD3 B;  2KNB A;  3ZUN A;  2CS4 A;  3R7Q A;  2OOB B;  2DZI A;  2FCM A;  4I6N B;  3WA0 A;  3DPD A;  2KTF A;  2FCS A;  1WM2 A;  2FNJ B;  2PE6 B;  4P7I A;  3VH4 B;  4GDL A;  1GNU A;  3APC A;  5G55 A;  3K9P B;  2CR5 A;  2KMA A;  3NZU A;  4X57 B;  1WGY A;  5CX3 A;  1SE9 A;  2NCN A;  1Q1O A;  1UD7 A;  3A9K A;  2XEW A;  3IG3 A;  3PRE A;  1KM7 A;  1LQB A;  2FIF A;  3CF6 E;  4ICV A;  3BIN A;  1C3T A;  4GDL B;  3QQ8 B;  2BYE A;  3RYT A;  2JZ3 B;  2ZPN A;  3OAW A;  2KVR A;  2D3G A;  3OJ3 A;  2K6Q A;  3A9K B;  4W9G A;  2L76 A;  4TQ1 A;  2ZNV C;  4RMA A;  4MSM B;  1ZW7 A;  2MBB B;  4TUU A;  5GMV A;  1J0G A;  4AOF A;  2G45 B;  3IBE A;  3DVG X;  3HM3 A;  3VTV A;  3KUD B;  1WF9 A;  2KJR A;  4EKU A;  3A4R A;  2C60 A;  3T8M A;  4HK2 A;  2D07 B;  1WE7 A;  2BPS A;  4RM9 A;  3ZKJ C;  5AEK B;  1WI0 A;  2LGX A;  1K8R B;  2D10 A;  5FR6 A;  2KQS A;  3VUY A;  1OGW A;  4BVU C;  1V49 A;  4IM2 A;  1RFA A;  2LUE A;  2LVO A;  2MBO A;  4KDL B;  1VCB A;  4J6I A;  1ZGU B;  3ENE A;  1E8Y A;  3MHS D;  2IO0 B;  2A4Z A;  4IWO A;  2C7M B;  4FN2 A;  4PYU A;  3MJW A;  1WZ3 A;  2K1F A;  2N4F A;  2BYF A;  2ZNV B;  4JQW C;  1WR1 A;  1YD8 U;  2EMS A;  3KYD D;  1TZ1 A;  3LJ3 A;  4M0W B;  3RUL A;  2BWE S;  3VVW B;  2CHW A;  2C9W B;  3ML8 A;  2O2V A;  4IUM B;  2N9E B;  3AU5 A;  4IM3 A;  3VTW A;  2LJ5 A;  2UWQ A;  1WMH A;  4BOZ B;  2CU1 A;  3DVG Y;  4DHZ E;  4ZRK A;  2XK5 B;  3DBH I;  5KHO A;  3NHE B;  4FJV B;  2LD9 A;  3QC8 B;  4TV3 A;  3NOB A;  2ZCB A;  5C1Z A;  1T0Y A;  4PYZ A;  2O2V B;  3OLM D;  3UIP B;  2GMI C;  2LXC A;  2RGF A;  3PRM B;  3WAN A;  3X23 A;  4DHJ B;  2IY0 B;  1WMH B;  1E7V A;  1Z2M A;  1P3Q U;  1KLV A;  4WWO A;  3A33 B;  1CMX B;  1E7U A;  1GC6 A;  4MDK E;  4I6P A;  3TBL D;  3ZDM C;  2KZR A;  2RSU A;  2MCN B;  4AP4 C;  2KK8 A;  2WX0 A;  4ANV A;  4II3 B;  1EUV B;  1LXD A;  2L0T A;  4NJ6 A;  4JGH B;  4NPN A;  4WAA A;  4XC2 A;  2MBQ A;  2JRI B;  1WE6 A;  2NS5 A;  3KW5 B;  5J18 A;  4F1S A;  3M95 A;  2ZVN A;  1EF5 A;  4A3P A;  5D6J B;  2Z0D B;  2LAS A;  3PT2 B;  5AZF A;  5DPT A;  3VHT C;  1RAX A;  1UBQ A;  1WX8 A;  2NBU A;  3GZN I;  4M8M A;  1UZX B;  2KOX A;  1G6J A;  2B3A A;  5D7G A;  4F7Z A;  5CHW A;  1P9D U;  1R4M I;  2M8S A;  2ZJD A;  5L95 C;  2KMC A;  1V5T A;  4FLH A;  3H6N A;  2M17 A;  1EF1 A;  4PS8 A;  2AWT A;  3M63 B;  3ZTD A;  2HJ8 A;  4ASW C;  1YQB A;  1I42 A;  1FXT B;  4GXB A;  1WX9 A;  2PE9 A;  2MW5 A;  1MG8 A;  4W9I A;  3N3K B;  2JVC A;  2FAZ A;  4WJP A;  4ANX A;  2Z59 B;  4MGK E;  5CHF A;  4MGZ E;  1Y8R C;  2GBK A;  3AUL A;  2MWS B;  2C5L C;  3L17 A;  1S3S G;  2MLB A;  2J0M A;  4BOS C;  4EZJ A;  3JSV A;  2LGD A;  2AL3 A;  2J0J A;  4G0N B;  4MEL A;  4W9H A;  5HKH A;  3QAQ A;  5G2N A;  4MEM A;  3Q3J A;  3H1U A;  4EFO A;  2JY6 A;  4PS3 A;  5E6P A;  2I1K A;  3UIO B;  3DBS A;  4HPM B;  3VTU A;  3ZW3 A;  4WWN A;  4IW0 A;  3V60 A;  3JSV B;  3B1L X;  5J2R A;  1E8W A;  3RT3 B;  1TBE A;  3DOW A;  3L54 A;  2KWC A;  3PGE A;  3VFK A;  4BFR A;  2KDI A;  3T9L A;  2XBB C;  2MBE A;  3U8Z A;  1R4N I;  1WH3 A;  3VXW A;  3DCG A;  1V6E A;  3EFU A;  2V4L A;  4KIK A;  3PLU A;  4ANW A;  4CYE A;  2HTH A;  3EEC A;  2HD5 B;  2I1J A;  2M1M A;  1YX6 B;  3DBR I;  3HM6 X;  2DEN B;  1XT9 B;  3ZTC A;  3ZVV A;  2N1V A;  2CHX A;  4KV2 A;  5LLI A;  2LRW A;  1YJ1 A;  2BKF A;  4KIK B;  3PLV A;  3TL5 A;  4EZL A;  2L8J A;  3M3J A;  2J7Q B;  4BBN F;  5C23 A;  3H7P A;  2KLC A;  3CST A;  4KSK C;  4MM3 A;  2KKC A;  3AI5 A;  2JUO A;  2MSE D;  4G50 A;  1QZE A;  4HDO A;  5BO4 B;  1KJT A;  3DBL I;  4NJ7 A;  1V80 A;  2IO1 B;  5D94 A;  1V86 A;  5DPS A;  3SU8 X;  5LXH A;  2KXJ A;  3R3M A;  3QA8 A;  1WJ6 A;  3H7P B;  2DZJ A;  4DDG D;  2PPH A;  2N7D A;  2NVU I;  1J8C A;  1WGD A;  2JXX A;  2MBH A;  4LDT B;  4K7W A;  2K39 A;  4EUT A;  1P98 A;  2MQJ A;  4FA6 A;  3RUI B;  1S1Q B;  2LVP A;  3IFW B;  4W9C A;  2L3Z A;  1NDD A;  1WR6 E;  4CO7 A;  2REX A;  1RRB A;  2CKH B;  4E71 A;  4A20 A;  3QIJ A;  4GSW A;  4DHJ D;  4W9L A;  2YLM A;  3PV1 A;  2RD0 A;  4M8N A;  3HHM A;  4FJZ A;  3L16 A;  4KZ0 A;  3W1S C;  3KUC B;  2A5U A;  3JW0 X;  1WGH A;  2KD0 A;  1IPG A;  2MRP A;  5E6N A;  2KFJ A;  2DYO A;  3PTF C;  3ZIM A;  2NBW B;  4IC7 B;  4F8C B;  4GGQ A;  4HLE A;  2KN5 A;  2KHW B;  3MTN B;  3W1S A;  4JLC A;  2KQ7 A;  3QHT A;  2KC1 A;  1V2Y A;  2ZEQ A;  4IM0 A;  2D11 A;  2D2Q A;  4K81 A;  4MH0 E;  4ZRI A;  3L13 A;  3A4S C;  4OVU A;  2GBJ A;  4K7S A;  2RR9 A;  5DPR A;  4B6W A;  3WAP A;  4GMV A;  4HCN B;  2MX2 A;  2IO2 B;  2IZV B;  3K9O B;  4N9F 4;  3ML9 A;  3S2A A;  3PVL A;  2VRR B;  1C1Y B;  4FUL A;  1TTN A;  2C7N B;  4II2 B;  1XQQ A;  1WIA A;  4B9K A;  3DQV A;  3VH3 B;  2N9X A;  3SDL C;  4HDQ A;  5IA7 A;  1WXA A;  3N30 A;  2O6V A;  4GU2 A;  5CTR C;  3VUX A;  1YX5 B;  2LVQ A;  3JVZ X;  1H8C A;  3PHW B;  2WX1 A;  2WWZ A;  3IHP C;  1TGZ B;  2KFK A;  1P1A A;  1X1M A;  2N1W A;  4XX5 A;  3SD5 A;  4JIO U;  4KZC A;  3ZO5 B;  4JL9 A;  1V9J A;  4FHK A;  4HWI B;  3M62 B;  2LWP A;  3H9D A;  2O6V B;  4BKG A;  3ZRF A;  4OVV A;  4BKS A;  2GBM A;  4FJY A;  4TKN A;  2KC2 A;  2DYB A;  1GC7 A;  1VD2 A;  2ASQ A;  2KWV B;  3LDZ E;  2GOW A;  4MGI E;  4NY0 A;  2KFK B;  2GBN A;  3Q3F A;  4BBN C;  1F9J A;  3WIM A;  3WAL A;  5KHQ A;  4A3O A;  1V81 A;  4DDI D;  4DXA B;  3QK0 A;  3D32 A;  3V6C B;  3P2B A;  3PRZ A;  5IAA C;  1SGH A;  3RZF A;  4W9F A;  2WDT B;  1J19 A;  2GBR A;  3NZS A;  3TCA A;  1V5O A;  2EKE C;  2JRH A;  3CSF A;  5DCN A;  3ZDT A;  2JT4 B;  1M94 A;  2DX5 B;  1GUA B;  1L7Y A;  1Q5W B;  3PSE B;  3UIN B;  3UGB B;  1WRD B;  1I35 A;  4PS7 A;  3A1Q A;  4YL8 A;  1JRU A;  2BF8 B;  2DHZ A;  2K25 A;  3WAO A;  2PJH A;  4K7U A;  2L7R A;  2KJH B;  4LCD E;  1OQY A;  3RD2 A;  4HCP B;  1WGR A;  2BWF A;  4W9J A;  1WJU A;  3PHX B;  3PPA A;  1IYF A;  1A5R A;  1Z5S B;  2OJR A;  3QJZ A;  1GG3 A;  4B95 A;  3N32 A;  5TR5 A;  2AL6 A;  3ZNH B;  4IWQ A;  2QHO A;  3AU4 A;  5DPW A;  4XZ4 A;  4MSQ B;  1H4R A;  2KX3 A;  2DYM A;  1UGM A;  4FHJ A;  4TQ0 A;  2LZ6 A;  2ZZP B;  4ANU A;  4FAD A;  3VAW A;  3I3T B;  4LJP B;  2IYD B;  1NI2 A;  3WAM A;  4AJY B;  3ZNI D;  3QX1 A;  1WY8 A;  2J0K A;  4LJO B;  2V1Y A;  3ZLZ A;  3VUW A;  2KJ6 A;  1WXM A;  2FUH B;  3HIZ A;  3BY4 B;  1HE8 A;  2KLG A;  3VDZ A;  2ZVO A;  2K6D B;  1WGG A;  4LDT D;  2KDB A;  2CHZ A;  4E74 A;  3EC8 A;  1AAR A;  1KOT A;  1BT0 A;  2IBI B;  4EZK A;  1ZKH A;  2DZM A;  3DDC B;  4DWF A;  2BKR B;  2MP2 A;  2NR2 A;  3L10 B;  4GB9 A;  2WYQ A;  4GIV A;  3DVN V;  1WXS A;  2LXA A;  2FCN A;  4GDK A;  4G11 A;  2BYV E;  4MJS A;  3A9J A;  3O65 B;  3V6E B;  2N7E A;  2MP2 B;  4K1R B;  5AZG A;  2JPH A;  2BGF A;  5J17 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...