4ZYNA

Crystal structure of parkin e3 ubiquitin ligase (linker deletion; delta 86-130)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
420
structure length
367
Chain Sequence
b'MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIACTDVRNPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVCPRPGCQGQTCEGCGFVFCRDCKEAYHCDSYRVDQRAAEQARWEEASKETKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords E3 ubiquitin-protein ligase parkin
publication title A Ubl/ubiquitin switch in the activation of Parkin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
total genus 73
structure length 367
sequence length 420
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zynA01
4LDTB 3QCAA 4E74A 2IO2B 1V9JA 1V80A 2DYOA 3AU4A 4EZLA 1EF1A 2JWZA 3APFA 5J18A 2KXJA 2O2VA 1UBQA 3PRMB 1KM7A 1WJNA 2HE7A 2KC2A 4HCNB 1U4AA 4WJNA 2W9NA 4B9KA 2NPTB 2LGYA 4KZ0A 4F1SA 3RCZA 3NHEB 3L54A 3UGBB 2ZPYA 4W9IA 4II2B 3ENEA 3NOBA 3AI5A 4I6NB 2KTRA 2KZRA 2L3ZA 1P9DU 4PS7A 2NR2A 2NVUI 2KC1A 4NAWA 2AL6A 5GMVA 4W9FA 3UINB 2DAFA 3NS8A 4GSWA 1KJTA 2CU1A 3S2AA 3IFWB 3ZW3A 1E7UA 4MH0E 1WE7A 2B3AA 2NS5A 4K7WA 4LJOB 4A20A 3VUWA 1WXVA 1TZ1A 2C7MB 3KUCB 2GBRA 4DBGA 4DXAB 2XEWA 1K8RB 2CHWA 2KO3A 3AXCA 4ANWA 2K6QA 2MBBB 1G6JA 2LGDA 1V5OA 2FCSA 3DBLI 2BYFA 4GU2A 4K7UA 2LXCA 2FIDA 4W9GA 1FXTB 1WGHA 2MW5A 3A1QA 2DZIA 2MBHA 2LXAA 1LM8B 2Z0DB 3H6NA 5IAAC 5J2RA 2J0MA 1J0GA 3HM3A 2PE9A 4KSLC 2KWCA 2UYZB 4HLEA 4W9HA 1RLFA 4GIVA 2BKFA 2DZKA 2MRPA 2NCNA 3PVLA 4ASWC 4DHZB 2JUOA 3H9DA 4MSMB 4PS3A 1WZ3A 4AJWA 3A9KA 5LLIA 2C7NB 1EO6A 1TTNA 4HPMB 2FCNA 5DCNA 3UQBA 1RAXA 4FULA 2J0KA 3MTNB 2KJRA 5FR6A 2KDEB 1E8XA 3TJPA 4EKUA 3TBLD 3D32A 2MCNB 1WF9A 3NZUA 1KLVA 4TKNA 4EOYA 1E7VA 4NAWB 4DHJD 4HVBA 3B0AA 5CHWA 3V61A 3VTUA 2JZZA 2QHOA 1LQBA 1E8ZA 4XX5A 4OVUA 4LJPB 4ICVA 3ZDMC 1Z5SB 4P7IA 1LFDA 4KIKA 1J19A 2DYBA 3PTFC 2LZ6A 3QK0A 4ZRKA 4URKA 4HJKA 4CHKA 1A5RA 4E71A 5C1ZA 3T8MA 4BFRA 5J17A 1WY8A 5L95C 4G3XB 3LJ3A 4WQOB 2D3GA 4MSQB 4N9F4 1TGZB 4WJQA 2PEAA 4FJZA 2KMCA 4IWOA 1P0RA 2RD0A 5D94A 2KKCA 3ZNGC 3EHVA 3NZSA 2ASQA 3A9KB 3KUZA 3WANA 2KQSA 5G2NA 2FCMA 4FJYA 4W9DA 5AEKB 5LXIB 4EEWA 3TCAA 3DBHI 4W9LA 3ZRFA 3R66C 2JRIB 2RSUA 4GN1A 5CX3A 3DDCB 3IG3A 4DK5A 4DHJB 2DZJA 4BOZB 2R2QA 2LJ5A 1EUVB 2IYDB 3CF6E 2J7QB 5L83A 4JGHB 3BINA 1ZKHA 1WM2A 4AOFA 1V5TA 2KOXA 4NJ6A 5AZHA 1YQBA 2O6VA 3PV1A 4DHZE 2BYEA 3N30A 1GC7A 2KDIA 2GBNA 1WE6A 3H7PA 5KHQA 2N9PC 3QX1A 2KQ7A 3L0WB 2N9EB 2O6VD 2JPHA 4KZCA 4NQKE 4KV2A 2IO0B 3O65B 3ONSA 3UIOB 5AZFA 4M8NA 4FA6A 3JSVA 2CR5A 4KIKB 4NQLB 5EDSA 4ZYNA 2RGFA 4W9EA 5CHVC 1KOTA 2D11A 4ANVA 2MLBA 4BKSD 1WGGA 1WXMA 4TQ0A 4MGIE 4W9JA 1WGRA 2WX1A 1R4MI 2KK8A 1H8CA 3DCGA 2KANA 3DVGX 3UQAA 2BGFA 2MP2B 3BY4B 2JZ3B 3KW5B 2IBIB 1V2YA 2M1MA 4HDOA 3VVWB 2KTFA 3NY5A 1WH3A 5D6JB 3W1SA 2HD5B 1WR1A 4NY0A 4BOSC 2N1VA 1WR6E 3B1LX 1GJZA 3WA0A 4GMVA 1ZW7A 3CMMB 4WWNA 3L17A 1WGYA 4PYZA 2M0XA 3VTVA 2UWQA 4K81A 2O6VB 2DX5B 4TUUA 3ML9A 4K1RB 1WRDB 2Z0EB 2ZZPB 3H7PB 1WMHB 3MJWA 4KDLB 1Y8RC 1YIWA 3TL5A 4AJYB 1V86A 3QC8B 2GBKA 2YVCA 3ECIA 4EUTA 5KHOA 3JSVB 4HWIB 2KWUB 2ZJDA 4FN2A 4HDQA 4ICUA 4BBNF 2KX3A 1E8YA 2VRRB 1Q1OA 1SGHA 3KYDD 2WWZA 3DBSA 4RM8A 5E6NA 4FJVB 1ZGUB 3IVFA 2KX0A 1WX8A 2O2VB 3V6EB 2BWFA 3N32A 1S1QB 2G4SA 5AZGA 3RUIB 4OVVA 1WJ6A 2DAJA 3RULA 3QQ8B 4MGKE 2CHZA 5IA7A 2M8SA 4M8MA 3EC8A 1LXDA 2JVCA 4G11A 4IM3A 4JIOU 4K7SA 3PSEB 4TV3A 3ZIMA 4FBJB 4GOCA 3L13A 3QHTA 4ANUA 2A4ZA 3PGEA 2KTRB 3HK0A 5JHAA 1I42A 1UH6A 4MDKE 1P1AA 1YD8U 2K6DB 3R7RA 3U8ZA 2OOBB 2M17A 2MX2A 3ZNZB 2XBBC 3M62B 2N9XA 2DZMA 3P2BA 4FLHA 4JLCA 4PS8A 1IP9A 3L16A 2FUHB 4GGQA 5JZEB 1L2NA 3OJ4B 2BYVE 3VUXA 5DPSA 4II3B 1RRBA 1UZXB 3V6CB 5JHBA 1P3QU 2MWSB 5TR5A 2L76A 2ZPNA 3PT2B 2K8BA 3DOWA 3Q3JA 3PS6A 4KDIC 1D3ZA 2HTHA 3A1QB 2MQJA 2ZVNA 3ZRCA 3I3TB 3DVGY 4M0WB 5JH5C 3RZWC 3VH3B 1GUAB 2EKEC 2FAZA 3VXWA 3PRZA 2Y5BB 2L05A 1L7YA 1WI0A 2LUEA 3HHMA 1NBFC 2N1WA 5HKHA 2KVRA 4XC2A 1UD7A 2M4NA 3U7DA 1E90A 3QIJA 4DWFA 1C1YB 3RD2A 3X23A 2WX0A 3UF8A 4W9KA 4KVGB 2A5UA 4E3CA 2JF5A 4ZDVA 2KHWB 2N7DA 3GZNI 3M3JA 1M94A 4GDKA 5D7GA 2DYMA 1CMXB 1WGDA 3IHPC 1AARA 2KDFB 2NBWB 3A4RA 2BKRB 2Z59B 1PQSA 1NI2A 4IM0A 2BPSA 2JY6A 2KD0A 3RYTA 2MSED 3B08A 1JRUA 4B6WA 3A33B 1Z2MA 1VCBA 4MELA 3RT3B 3ZTCA 2G45B 2LRWA 2JXXA 2N7EA 4GB9A 3PLVA 1X1MA 4BKSA 1GNUA 1OGWA 2GBMA 4W9CA 2D2QA 1C3TA 4EFOA 3H1UA 5DPRA 3V60A 2BF8B 2G3QB 2NBVB 4MGYE 2ZNVB 1WJUA 3ZNHB 2NBUA 2ZVOA 2N4FA 2MA9B 4ZRJA 3VQIA 2GMIC 2IO3B 2KLCA 4FHJA 4HPLB 1OTRB 1I35A 3SU8X 3C0RB 1Q5WB 3KH0A 4ANXA 4IWPA 2KNBA 2LRUA 4IUMB 2LVPA 2ZCBA 3TIXA 2AL3A 2V1YA 2V3SA 5C23A 4BKGA 2C9WB 3QAQA 4A3PA 2CKHB 4XZ4A 4J6IA 3M95A 1VD2A 3ZDTA 1RFAA 4HCPB 1WM3A 3VH4B 4F8CB 5CTRC 4GDLA 4WWPA 3ALBA 4EZKA 2RR9A 4IM2A 1IYFA 4GDKB 1J8CA 2V4LA 3L10B 2LGXA 4RM9A 3UIPB 3KVFB 2KN5A 2XK5A 3CSFA 2IY1B 1IPGA 2D07B 3ML8A 3PPAA 2K8HA 1WX9A 3OLMD 2G4DB 1WFYA 3PZDA 4MM3A 1XQQA 2L7RA 2L8JA 3QA8A 3HIZA 2IO1B 3L08A 3VAWA 4NPNA 3VTWA 1OEYA 3DBRI 2KFKA 4AWJA 2WDTB 2PJHA 4I6LB 3W1SC 5CHFA 3V62A 4MGZE 3QJZA 2CHXA 3VHTC 3ZTDA 3CSTA 3Q3FA 4WJOA 2L0FA 4NNJB 3DQVA 1HE8A 3SHQA 3ZKJC 4CYEA 5DPWA 3N3KB 3SD5A 5D2MB 3U30A 1TBEA 4I6PA 3K9OB 1Q0WB 1E8WA 1WXSA 3IBEA 3HM6X 3MHSD 3PHWB 2I1KA 1NDDA 3TMPB 1H4RA 4KSKC 4IWQA 2D10A 3R7QA 3W1YA 1V6EA 2JT4B 3A9JA 1ISNA 3DVNV 2KDBA 4GDLB 2HJ8A 1WXAA 2IY0B 2K8CA 3ZUNA 5G55A 3X0WA 2K1FA 3M63B 3ZVVA 2R2OA 5DPTA 3WIMA 4PYUA 4CO7A 2LASA 4JQWC 2XK5B 4WWOA 3R3MA 2EMTA 1WYWB 4IG7B 3KYCD 3WAOA 1XD3B 3K9PB 1OQYA 2REXA 4EZJA 5E6OA 2KWVB 2DHZA 2L00B 4DDGD 2DENB 2K25A 2EMSA 3APDA 2AYOB 2KFKB 4AP4C 2JRHA 3ZO5B 4MJSA 1YJ1A 2YLMA 3AU5A 2J0JA 2K39A 2L0TA 3VFKA 2LVOA 1YX6B 1GC6A 3EECA 2LD9A 4RMAA 2ZEQA 1R4NI 3JYUA 5LXHA 3WALA 4B95A 1GG3A 2C5LC 1E5WA 3KUDB 4DDID 1EF5A 3PRPB 1UBIA 3DPDA 1OEYJ 4G50A 2CS4A 2FIFA 2PPHA 1V49A 3GOEA 4NJ7A 1S3SG 4IW0A 4GXBA 4ZRIA 3A4SC 4LDTD 3QARA 1V81A 3A9JB 2GOWA 1YX5B 1QZEA 2C7HA 3JVZX 4MEMA 2C60A 2NPTA 2ZNVC 5E6PA 2MP2A 3WAPA 2LI5A 2IZVB 4F7ZA 4HK2A 2OJRA 4YL8A 3ZLZA 2FNJB 4A3OA 2AEHA 3OAWA 3PHXB 4AUQC 2MBQA 1WIAA 2GBJA 1WZ0A 4LCDE 3DVNU 2MBEA 3PLUA 4FADA 3WAMA 2RPQA 4BBNC 1XT9B 1UELA 4WJPA 1F9JA 1SE9A 3LDZE 3VDZA 2ZCCA 3PREA 2FCQA 1WJ4A 2LVQA 2KFJA 1SIFA 3QWZB 4TQ1A 1P98A 5BO4B 2MBOA 1BT0A 3VUYA 1T0YA 4BVUC 4MJSB 3EFUA 3SDLC 3ZNID 1WX7A 2KLGA 1UGMA 4BKTA 4G0NB 2WYQA 2PE6B 3JW0X 2BWES 4HXDA 2AWTA 3RZFA 3T9LA 3H7SA 4WAAA 1MG8A 1WMHA 3APCA 3AULA 2I1JA 3OJ3A 4JL9A 4X57B 2LWPA 4FHKA 4IC7B 2KMAA 2KJ6A 2KJHB
chains in the Genus database with same CATH superfamily
3QCAA 1V9JA 1EF1A 2V3PA 4YTMB 2KC2A 1WJNA 2HE7A 1R4MB 4WJNA 2IJ0A 2LGYA 3AE9B 2X8XX 4F1SA 3P4RB 3L54A 4II2B 1FRRA 2KZRA 2L3ZA 3UINB 1BXTA 4GSWA 1KJTA 2WGSA 1F77A 1WE7A 4LJOB 3KUCB 5BMGA 1K52A 1FCCC 2ONQA 2BYFA 2FIDA 1FEHA 2DZIA 1SJED 3A1QA 2Z0DB 4C00A 4HLEA 4WURA 3HVDA 4RH6A 1NYRA 4PS3A 1WZ3A 3A9KA 3AV8A 5LLIA 4YSZB 4NZLB 4HPMB 5DCNA 3UQBA 1RAXA 3NVVA 4FULA 5FR6A 1FFVA 2J42A 3DHHC 1HQRD 3TBLD 2GI9A 4C7YA 4AQ7A 1JWSD 2LHEA 4NAWB 1HTOA 2JYTA 1SSNA 4HVBA 1FD6A 1N5WA 3O13A 3KWVA 4A6QA 1ET9A 4LJPB 4ICVA 4HKZE 3AH7A 1JW9D 4CQNA 4YXDB 3EFCA 2DYBA 1KLGD 2LZ6A 4MACA 4N9F4 3R2IA 3P1MA 2KT7A 5D94A 2IGGA 1PGXA 4XYCA 2JYEA 2HJ1A 1VR9A 2J52A 4W9DA 5LXIB 5GXGB 4EEWA 2WLBA 4W9LA 2JRIB 4GN1A 5CX3A 4C56C 2DZJA 2IYDB 1ZKHA 1WM2A 1V5TA 5D3DA 5AZHA 3B2GA 3PV1A 1XLQA 5G5HA 4ACFA 2BYEA 1WE6A 3H7PA 2Z8LA 2N9PC 3L0WB 1FPYA 4KZCA 4NQKE 4KV2A 4LNKA 1AW7A 1HZ6A 3JSVA 4IOIE 4A90A 1E7PB 3C8YA 1YQ4B 1KOTA 1N61A 1D6EC 3RNAC 1WXMA 3Q69A 4TQ0A 4OVZA 2WU2B 2KANA 3DCGA 4ZYSA 2BGFA 2MP2B 2IBIB 3P4QB 4NJCA 1V2YA 2BB5A 1MI0A 2KTFA 3NY5A 5D6JB 4DXGA 3BVMA 1WR1A 4BOSC 3B1LX 2RMMA 1SE3A 1T0SC 1TY0A 2M0XA 1HTQA 2O6VB 1KH0A 2DX5B 3ML9A 1WRDB 2Z0EB 2LGSA 2ZZPB 3H8HA 1C4PA 1Y8RC 3QC8B 2GBKA 3ECIA 4EUTA 4FN2A 3AEFB 4HDQA 3TEZA 1CK1A 2VRRB 3KYDD 3WCQA 4JWSC 4RM8A 1ZGUB 2KX0A 5IOIA 2BWFA 5AUIA 1GB4A 1QOAA 2DAJA 1QOBA 5IA7A 1IGDA 3GB1A 4OZCA 4TV3A 2K3UA 4FBJB 3Q3MC 3U8ZA 1PUTA 2VZKD 2AQ1B 2FUHB 5JZEB 2AX5A 3GE3C 3VUXA 4II3B 2MWSB 4L23A 5TR5A 3VR8B 3DOWA 2IGHA 1D3ZA 3A1QB 1WWTA 2MQJA 3Q3NC 1TKEA 2OJWA 5H8YE 3HHMA 5HKHA 2Y3AA 2D5GA 1C1YB 1N60A 2WX0A 3UF8A 1YNTE 1GAQB 2N7DA 3M3JA 4GDKA 4BZAA 1C4CA 1T0QC 1WGDA 1AARA 2BKRB 1R7SA 3BK2A 3W9CB 4IM0A 2BPSA 2X38A 1VCBA 4YTPB 1VRAB 2KAJA 4GB9A 3PLVA 5EE9A 1OGWA 2W55A 2D2QA 4O1NA 4XE0A 2ZNVB 1YOVB 2MA9B 4ZRJA 2GMIC 2JZPA 3BYTB 1DYQA 2V1YA 3V05A 4BKGA 3E9SA 3M95A 4J6IA 2WXLA 4HCPB 3MP9A 2I2YA 3MHZA 3L10B 1NYQA 1ZPSA 2KN5A 2L83A 2D07B 2B76B 2G4DB 4MM3A 2L7RA 2DLBA 1OEYA 3DBRI 5CHFA 1ZP0B 3CSTA 3DQVA 1EU3A 3N3KB 3U30A 3TSSA 4I6PA 3HM6X 1C76A 1YN5A 2LHDA 3PHWB 3FILA 2ZW0A 4ITKA 3AE8B 2JT4B 2W3RA 3SFEB 3ZVVA 1HXYD 2R61A 4PYUA 3T3OA 4JQWC 2EMTA 3N1YC 1WYWB 1C4AA 3WAOA 3CWIA 3C19A 1OQYA 1J7BA 4WIPA 2DENB 2EMSA 4RGOS 5HHDG 4AP4C 2M0AA 2JRHA 1YJ1A 2LFIA 3NUHB 2J0JA 1KTKA 2W54A 1HA5A 2M19A 3WALA 3TEXA 4DDID 3RI7C 1UBIA 1OEYJ 1SEBD 3MJ5A 1V49A 4AS1A 1S3SG 2KWDA 4LDTD 1E0ZA 1GOZA 2RDGA 3A9JB 1BMLC 5E6JA 2Y5CA 2C60A 1SB3C 2LI5A 3ZLZA 3OAWA 3PHXB 4AUQC 3DHGC 3P4SB 4A55A 2MBEA 4FADA 2ZCCA 2FCQA 3AN1A 2LVQA 2KFJA 2MBOA 3VUYA 4MJSB 3EFUA 3SDLC 2KLGA 1UGMA 4G0NB 1MG8A 4JL9A 1JWAD 4FHKA 2QSDA 2KMAA 2JWUA 3DWGC 4E74A 2BB6A 2DYOA 1JQ4A 1Y56A 3NVYA 1UBQA 2ACZB 1L4DB 4MH8A 2I38A 4KZ0A 3RCZA 1VZ6A 1XEEA 2ZPYA 2RDBC 1V97A 3ENEA 3NOBA 4KGTA 3AI5A 4DXFA 4ZOHC 2NTTA 2NR2A 4DQOC 4NAWA 1N63A 2DAFA 4QAYA 1YN3A 3S2AA 4RGMA 4MH0E 4A20A 2QILA 3VUWA 1WXVA 1TZ1A 2C7MB 4XDCA 2GBRA 2CHWA 2INDC 2KO3A 2LGDA 5KHOA 1LO5D 2QDFA 3W5UB 2LXCA 2MBHA 2LXAA 2PE9A 4LNIA 4OHJA 1XLOA 4GIVA 1UUPA 3RNGC 2V4IB 1T0RC 4DHZB 2JUOA 4MSMB 2H88B 2C7NB 1EO6A 1TTNA 1E10A 2FCNA 1ZE3D 2J0KA 3RMKC 1J7AA 2WXQA 4M00A 1LGRA 5IKCM 3TJPA 3D32A 2MCNB 3NZUA 2MHJA 4TKNA 4USAA 1E7VA 4DHJD 5CHWA 3V61A 1DGJA 3T3NA 3CIRB 2BS2B 3TEWA 4P7IA 1LFDA 3FILB 4ZRKA 1A5RA 4E71A 4ZHOA 1WY8A 4S0RA 5AUKA 4MT5A 2D3GA 2KVZA 4WJQA 4B0MA 1F1HA 4FJZA 2LMCA 4IWOA 1P0RA 4REZA 2KKCA 3ZNGC 2PVOD 3ZRFA 2RSUA 1MHXA 5LNK1 3IG3A 4DK5A 5T8IA 1EUVB 3BIID 3GZNB 3AEGB 4BAXA 3VRBB 2PKOA 3ZXVA 2O6VA 4DHZE 5I4DA 1QOFA 3N30A 5C3JB 2ON8A 5KHQA 3QX1A 2KQ7A 2JPHA 3BVGA 4JWUC 3UIOB 5AZFA 4KIKB 2ZW1A 4ZYNA 5CHVC 2MLBA 4P1CC 4MGIE 1I4QA 1R4MI 3DVGX 3KW5B 3Q6BA 1I4RA 4NY0A 3BVZA 2WDRB 3GP7A 1YJIA 5BYSA 5JXVA 1WGYA 4PYZA 1ZXIA 4K1RB 3TEYA 2KQ4X 3MJWA 3ZJUA 4KDLB 2QCZA 1YIWA 1RM6C 1V86A 2YVCA 1VLBA 1MJDA 4FXCA 2KX3A 2WWZA 3DBSA 4XDDA 4FJVB 3IVFA 1P7EA 3N32A 5AZGA 3RUIB 5IP4D 1WJ6A 3RULA 2M8SA 5G5GA 4IM3A 3ZIMA 3PSEB 3L13A 1ZDXA 5JHAA 1I42A 1UH6A 1YD8U 4HROA 1D4BA 2N9XA 1IP9A 5BMIA 3L16A 4GGQA 2DBYA 1YQ3B 2V9HA 5DPSA 1RRBA 3V6CB 1P3QU 1N62A 3PT2B 4RCOA 2ICIA 2ZVNA 3AE6B 3RZWC 1XF5L 1GUAB 2FAZA 3VXWA 2H89B 1JWBD 2L05A 2Y5BB 4ZRPA 2LUEA 3I57A 2WS3B 1NBFC 2WXJA 3RNEC 2BS4B 4PK1A 5FK9C 4DWFA 3RNBC 4W9KA 2A5UA 4S17A 1N5XA 1V8CA 1CMXB 4LNFA 3IHPC 4JPSA 1V1PB 1NI2A 2KD0A 3OWEB 2PMVA 1WSPA 2LRWA 1X1MA 1N6ZA 3VR9B 4W9CA 2RDHA 5EE0A 3W2DA 3H1UA 4HRSA 2N9KA 5DPRA 3V60A 2BF8B 2NBVB 1OQRA 4MGYE 2NBUA 1FNUA 1GPXA 1PYWD 2IO3B 2KLCA 4FHJA 4JE3B 1EM7A 1Q5WB 3SR6A 4IWPA 2KNBA 1J7CA 2V3SA 5C23A 2C9WB 1JWMD 1RFAA 3NVWA 3NVZA 5CTRC 1FM0D 3BWUD 4EZKA 1QT9A 3L4PA 3N20C 4RM9A 3KVFB 3CSFA 1SE2A 2FUG1 3ML8A 2BBCA 2K8HA 1WX9A 1SXTA 3AB5A 2EELA 3E56A 2IO1B 3L08A 3VAWA 3VTWA 2IDYA 4AWJA 2WDTB 3W1SC 3PZ7A 3MC9A 3VHTC 4US9A 4LLGM 4NNJB 3SHQA 1HE8A 5DPWA 1ZOYB 1TBEA 2L32A 3IAM1 3SEBA 3IBEA 3Q8CA 3MHSD 1NDDA 3DBLB 3GS2A 1EWCA 4KSKC 4P6VF 3R7QA 1V6EA 3A9JA 1ISNA 3DVNV 2KDBA 1SE4A 1JRPA 4M02A 2GB1A 2R2OA 5DPTA 1NVID 3WIMA 2XK5B 3KYCD 1OFFA 1XD3B 4EZJA 2L00B 4DDGD 2AYOB 2KFKB 4MJSA 4LK0M 2K39A 3AE7B 1TKGA 3ZJTA 3TUOA 2LD9A 4RNAA 5IN7A 2AQ2B 4ARCA 4B95A 1GG3A 1GB1A 4OZBA 4HEA1 1KRHA 2DNFA 4ZRIA 2WXIA 2PTLA 2GLSA 1JALA 3R2TA 3JVZX 4F7ZA 2OJRA 4A3OA 2AEHA 5BYRA 3DVNU 2J4XA 3PLUA 3DBHB 3WAMA 1XT9B 4KGRA 3RNCC 1SE9A 3VDZA 1UWXA 2WXRA 4BVUC 3I63C 1TS5A 1WX7A 4YT0B 2WXNA 4BKTA 4XGAB 3RZFA 1WMHA 3OJ3A 2LWPA 3AE5B 4IC7B 1KLUD 2N0SB 2RPVA 1TYGB 1EWYC 3AU4A 2JWZA 3EGRA 4Q2JA 4HCNB 1TY2A 2W9NA 4B9KA 1SF0A 2INNE 3P4PB 3UGBB 4W9IA 1KFYB 2KTRA 4HKQA 1B9RA 2NVUI 2KC1A 2JSVX 3NS8A 1SIJA 2CU1A 1YN4A 2KN4A 4K7WA 4WAFA 1ZDVA 2NTSA 5HFYA 4LNNA 4P1BC 4DBGA 2PVGC 2XEWA 1ZUD2 1K8RB 2KMMA 2MBBB 1V5OA 2FCSA 4W9GA 4GU2A 2LEKA 1FXTB 2HDEA 4GLSC 2FBWB 1LM8B 3H6NA 2J0MA 4WH4A 1J0GA 2KWCA 2UYZB 3OG5A 4W9HA 3AE2B 2BKFA 1F0ZA 2BTEA 2NCNA 4ASWC 4TSSA 1T6BX 2N7JA 2WDVB 1JROA 3MTNB 2W3SA 2YEPF 1FNWA 2OEDA 1WF9A 1VJKA 1I4XA 4IKGA 2QHOA 3RN9C 1LQBA 4XX5A 4A9AA 3Q3OC 4ZHPA 2KYWA 1L5PA 4KIKA 5IO9A 3PTFC 1TS3A 4URKA 4HJKA 4BFRA 5J17A 3N1XC 4G3XB 4WQOB 1XXGA 4MSQB 4R3DA 3BYYB 1TGZB 1RWSA 2KMCA 3NJTA 3EHVA 3NZSA 2ASQA 1QF6A 1L6UA 2KQSA 2FCMA 4FJYA 5G2NA 4M01A 3IXSA 1WGKA 2LJ5A 2R2QA 1YJJA 4J3OD 1I4HA 4JGHB 4ZRQA 1FRDA 4AOFA 2KOXA 4NJ6A 4YWGG 4C7ZA 1EU4A 2GBNA 2AQ3B 3DWMA 2O6VD 2IO0B 1I4GA 3ONSA 4M8NA 2CR5A 2RGFA 4W9EA 1FMAD 2D11A 4ANVA 1WGGA 3RFZB 4W9JA 1ACCA 2G1EA 2WX1A 1H8CA 1L0YB 1DOXA 3UQAA 2JQRB 1OQQA 2WHIA 2JZ3B 4B0EA 1VZ7A 1XLNA 2HD5B 1XLPA 2WXFA 3WA0A 1IBXB 1VDVA 3P63A 4WWNA 3L17A 3VTVA 2UWQA 4KGSA 1MVKA 4TUUA 2WDQB 1WMHB 3TL5A 4AJYB 2L52A 2KWUB 2ZJDA 4ICUA 3NRZA 1NI3A 1QILA 1Q1OA 1F2RI 1C9FA 2LJIA 3AE1B 3QQ8B 2CHZA 4M8MA 3EC8A 1LXDA 2JVCA 4G11A 4K7SA 1K53A 4GOCA 5H92C 2MH7A 3QHTA 2A4ZA 3PGEA 2KTRB 1D5XC 5BMHA 4N59A 2OOBB 2M17A 2MX2A 2XBBC 3M62B 3P2BA 1V1PA 4JLCA 3UI3A 3AEDB 1L2NA 3OJ4B 2BYVE 1UGJA 1UZXB 5JHBA 2ZPNA 3Q3JA 2HTHA 2XNAC 2SEBD 4C4VB 3ZRCA 3I3TB 4M0WB 4KX6B 5JH5C 3LYYA 1IGCA 1QQRA 1T5XD 1L7YA 2N1WA 3GE8C 3ZQ4A 4US8A 4XC2A 1R4NB 1UD7A 2M4NA 3U7DA 1E90A 3RD2A 4ZDVA 2KHWB 4OZAA 3GZNI 3I9V1 1MPEA 1L0VB 4RF1A 2M56B 2K5PA 2KDFB 3IT4B 3A4RA 2Z59B 2QJLA 1PQSA 2JY6A 1AYFA 1TJEA 4B6WA 1Z2MA 4MELA 2WXOA 3RT3B 3ZTCA 2QIEB 2JXXA 2GRIA 5HI1A 2GBMA 1C3TA 4EFOA 1I7HA 2G3QB 3ZNHB 1TIFA 1D5ZC 3VQIA 4HPLB 4K3CA 1OTRB 1I35A 3SU8X 3C0RB 3NS1A 3KH0A 4IUMB 2UU7A 2AL3A 4A3PA 2CKHB 4XZ4A 5MPOA 3ZDTA 3ZXRA 3VH4B 4F8CB 2JU6X 1FO4A 4WWPA 4IM2A 1IYFA 1J8CA 2V4LA 3UIPB 3LB8C 2XK5A 3ABVB 2IY1B 1SJHD 3OLMD 1WFYA 1XQQA 3HIZA 2JXTA 2KFKA 4I6LB 3ZGZA 3V62A 3AMZA 2CHXA 3ZTDA 3HUIA 4WJOA 3ZKJC 2WXPA 1XCTL 3NG0A 2QMTA 3KLSX 3K9OB 1E8WA 1WXSA 1ZXHA 2VH1A 2XN9C 3TMPB 1H4RA 2D10A 1D5MC 4GDLB 2K8CA 3AM9A 3ZUNA 2K1FA 3M63B 1L4ZB 1MHHE 4CO7A 2LASA 1ESFA 2WQYB 4IG7B 2W82A 2SAKA 4HPPA 3K9PB 5HG2A 1HEZE 4P16A 2G9HD 2REXA 2PIAA 2NMQA 5TSSA 2YLMA 1SBBB 3AU5A 2L0TA 5EE1A 1YX6B 1GC6A 1FXAA 4RMAA 1DOIA 2PLPA 3JYUA 1V1OA 4RFBA 1E5WA 3SFDB 1PGBA 4G50A 1ENFA 2E6XA 2PPHA 3GOEA 4NJ7A 4IW0A 3A4SC 3QARA 1YX5B 1QZEA 4MEMA 4YTNB 3WAPA 4HK2A 2FNJB 5FKAC 4YSYB 2MBQA 2GBJA 1WZ0A 4LCDE 2PW9A 3MC8A 4WQMA 1XCQL 2RPQA 1UELA 4WJPA 3PREA 1WJ4A 1SIFA 1BT0A 2LGIA 3P42A 3ZNID 2E3TA 2OHFA 3AEAB 2PE6B 2WXKA 3H7SA 3APCA 3AULA 4X57B 1AWDA 3LXFA 5EE3A 2KJ6A 2CJOA 2HTME 3B9JA 4LDTB 2IO2B 1V80A 4EZLA 3VRAB 3APFA 4RF0A 1FIQA 5J18A 2KXJA 2O2VA 3PRMB 1KM7A 1WRIA 1U4AA 3EUB2 1M4VA 2NPTB 5C2TB 2QEJC 3NHEB 3KWLA 3DHIC 3NZ3A 2D3AA 4I6NB 4A8XC 3AEEB 3Q14C 3Q8BA 2WXGA 1P9DU 1TZOA 4PS7A 3FAHA 2AL6A 5GMVA 4W9FA 3IFWB 3ZW3A 1E7UA 2B3AA 2NS5A 1F2RC 4DXAB 3AXCA 4ANWA 3ETRA 2K6QA 1G6JA 3DBLI 4K7UA 1WGHA 2MW5A 2JX5A 5IAAC 3ZYYX 5J2RA 1E9MA 3HM3A 4KSLC 1RLFA 3U52E 2DZKA 2MRPA 3PVLA 4N58A 1WYGA 3H9DA 1PDXA 3W5VB 1C79A 3HRDD 2KJRA 2MEKA 3BK1A 2KDEB 2MJEA 1E8XA 1P7FA 4EKUA 3MC0B 1F52A 3U4EG 3V3XA 1KLVA 4EOYA 3B0AA 1TT5B 3VTUA 2JZZA 3RPFC 1E8ZA 1BUIC 2KDMA 4OVUA 1CZPA 3ZDMC 1CJEA 1Z5SB 1J19A 3QK0A 4CHKA 5C1ZA 3T8MA 1UWMA 5L95C 1NENB 3LJ3A 4N6EB 3AECB 4ARIA 1FFUA 2PEAA 2RD0A 2WXMA 4H2AA 3A9KB 3KUZA 3WANA 4OW0A 5AEKB 3TCAA 3DBHI 3N1ZC 3R66C 3DDCB 4DHJB 4BOZB 1IBXA 3CF6E 2J7QB 5L83A 4EE2A 3BINA 1YQBA 1GC7A 2KDIA 4C80A 1KF6B 2N9EB 4PT5A 3O65B 4RGNA 2WU5B 4FA6A 1B1ZA 1C78A 4JX1C 4NQLB 5EDSA 4BKSD 1K50A 1WGRA 1YMHE 2KK8A 2Q5WD 3BY4B 2M1MA 4HDOA 2K22A 3VVWB 2D3BA 1I4PA 1TKYA 1WH3A 3W1SA 1JMLA 2N1VA 3U2SC 2BQQA 1FNVA 1WR6E 3RNFC 2MJ3A 1GJZA 3MFGA 4GMVA 1ZW7A 3CMMB 4K81A 3Q8AA 2YEPB 2DWQA 2INPE 3H7PB 2Y5PA 3AE4B 2V3NA 3JSVB 4HWIB 4TMAB 3DBRB 4C4VA 2QC8A 4BBNF 1E8YA 4M0WA 3B2FA 1SGHA 3R8BA 5E6NA 1WX8A 2BYTA 2O2VB 3KQ4A 3V6EB 2BS3B 2BW2A 2KACA 1S1QB 4YSXB 2G4SA 2BVCA 4OVVA 4MGKE 2K9XA 3PO0A 4RGTA 3HVZA 4JIOU 3N9YC 1RFKA 4ANUA 2EKIA 3HK0A 4LNOA 4MDKE 1P1AA 2K6DB 3R7RA 3FKYA 3ZNZB 4PS8A 2DZMA 4FLHA 4KKJA 4L1BA 2L76A 2WNMA 4D2KA 2K8BA 1FCLA 3PS6A 4KDIC 1A70A 3AE3B 3DVGY 1NEKB 3VH3B 2EKEC 3PRZA 1WI0A 1RYJA 1STEA 2KVRA 2V0GA 1T3QA 2BT6A 1TS2A 3QIJA 1C77A 2D3CA 3X23A 4KVGB 4E3CA 2JF5A 1M94A 5D7GA 2DYMA 1E6EB 2NBWB 3J9CA 3PZ8A 3RYTA 2MSED 3B08A 1JRUA 3A33B 1PFDA 2G45B 2N7EA 4LTUA 4BKSA 1GNUA 3I5JC 4KKIA 1PGAA 1WJUA 4NAMA 2ZVOA 2N4FA 3ZJVA 1JCKB 4ANXA 2LRUA 2LVPA 2ZCBA 3TIXA 1MG4A 1VZ8A 3QAQA 1VD2A 4WWMA 1WM3A 1DOYA 4GDLA 3ALBA 2RR9A 4GDKB 2LGXA 4XWTA 1UNSA 1IPGA 3PPAA 3PZDA 3EA6A 2L8JA 3QA8A 4NPNA 4L2YA 2PJHA 5D3IB 2J53A 2TSSA 1Q10A 4MGZE 1UF0A 3QJZA 3Q3FA 2WP9B 2L0FA 4CYEA 3SD5A 1QLBB 5D2MB 1QOGA 1Q0WB 1QKZA 3U7ZA 2FE8A 2I1KA 2IPKD 4HJGE 4XWWA 3Q8EA 4IWQA 1WXQA 3W1YA 2K0PA 3Q8FA 2HJ8A 1WXAA 2IY0B 1TS4A 5G55A 3X0WA 4UDUC 3BZDB 4WWOA 3R3MA 3IT6B 3Q2AC 4MM3B 1ET6A 5E6OA 2KWVB 2DHZA 2K25A 3APDA 2LUMA 3ZO5B 3VFKA 2LVOA 2INCC 1IUEA 3EECA 2ZEQA 1R4NI 4IDIA 2CU3A 3URYA 5LXHA 1ROEA 2CJNA 2C5LC 2N9LA 3KUDB 1EF5A 3PRPB 1JWUD 3DPDA 1CQVA 2CS4A 1K51A 2FIFA 1XO3A 4AJWA 4GXBA 3IAS1 5FR3A 1L6VA 1V81A 2IGDA 2VZKB 2GOWA 2MJDA 2C7HA 5BYQA 2NPTA 2ZNVC 5E6PA 2MP2A 2IZVB 4YL8A 1MFWA 2VH2A 1WIAA 1AN8A 4BBNC 1F9JA 3LDZE 2WXHA 1HZ5A 3QWZB 1FXIA 4TQ1A 3AEBB 1P98A 3FC4A 5BO4B 1T0YA 2L1AA 2WYQA 4K3BA 3JW0X 2BWES 4HXDA 2AWTA 3T9LA 1L0XB 4WAAA 2I1JA 2KJHB
chains in the Genus database with same CATH topology
4LDTB 3QCAA 4E74A 2IO2B 1V9JA 1V80A 2DYOA 3AU4A 4EZLA 1EF1A 2JWZA 3APFA 5J18A 2KXJA 2O2VA 1UBQA 3PRMB 1KM7A 1WJNA 2HE7A 2KC2A 4HCNB 1U4AA 4WJNA 2W9NA 4B9KA 2NPTB 2LGYA 4KZ0A 4F1SA 3RCZA 3NHEB 3L54A 3UGBB 2ZPYA 4W9IA 4II2B 3ENEA 3NOBA 3AI5A 4I6NB 2KTRA 2KZRA 2L3ZA 1P9DU 4PS7A 2NR2A 2NVUI 2KC1A 4NAWA 2AL6A 5GMVA 4W9FA 3UINB 2DAFA 3NS8A 4GSWA 1KJTA 2CU1A 3S2AA 3IFWB 3ZW3A 1E7UA 4MH0E 1WE7A 2B3AA 2NS5A 4K7WA 4LJOB 4A20A 3VUWA 1WXVA 1TZ1A 2C7MB 3KUCB 2GBRA 4DBGA 4DXAB 2XEWA 1K8RB 2CHWA 2KO3A 3AXCA 4ANWA 2K6QA 2MBBB 1G6JA 2LGDA 1V5OA 2FCSA 3DBLI 2BYFA 4GU2A 4K7UA 2LXCA 2FIDA 4W9GA 1FXTB 1WGHA 2MW5A 3A1QA 2DZIA 2MBHA 2LXAA 1LM8B 2Z0DB 3H6NA 5IAAC 5J2RA 2J0MA 1J0GA 3HM3A 2PE9A 4KSLC 2KWCA 2UYZB 4HLEA 4W9HA 1RLFA 4GIVA 2BKFA 2DZKA 2MRPA 2NCNA 3PVLA 4ASWC 4DHZB 2JUOA 3H9DA 4MSMB 4PS3A 1WZ3A 4AJWA 3A9KA 5LLIA 2C7NB 1EO6A 1TTNA 4HPMB 2FCNA 5DCNA 3UQBA 1RAXA 4FULA 2J0KA 3MTNB 2KJRA 5FR6A 2KDEB 1E8XA 3TJPA 4EKUA 3TBLD 3D32A 2MCNB 1WF9A 3NZUA 1KLVA 4TKNA 4EOYA 1E7VA 4NAWB 4DHJD 4HVBA 3B0AA 5CHWA 3V61A 3VTUA 2JZZA 2QHOA 1LQBA 1E8ZA 4XX5A 4OVUA 4LJPB 4ICVA 3ZDMC 1Z5SB 4P7IA 1LFDA 4KIKA 1J19A 2DYBA 3PTFC 2LZ6A 3QK0A 4ZRKA 4URKA 4HJKA 4CHKA 1A5RA 4E71A 5C1ZA 3T8MA 4BFRA 5J17A 1WY8A 5L95C 4G3XB 3LJ3A 4WQOB 2D3GA 4MSQB 4N9F4 1TGZB 4WJQA 2PEAA 4FJZA 2KMCA 4IWOA 1P0RA 2RD0A 5D94A 2KKCA 3ZNGC 3EHVA 3NZSA 2ASQA 3A9KB 3KUZA 3WANA 2KQSA 5G2NA 2FCMA 4FJYA 4W9DA 5AEKB 5LXIB 4EEWA 3TCAA 3DBHI 4W9LA 3ZRFA 3R66C 2JRIB 2RSUA 4GN1A 5CX3A 3DDCB 3IG3A 4DK5A 4DHJB 2DZJA 4BOZB 2R2QA 2LJ5A 1EUVB 2IYDB 3CF6E 2J7QB 5L83A 4JGHB 3BINA 1ZKHA 1WM2A 4AOFA 1V5TA 2KOXA 4NJ6A 5AZHA 1YQBA 2O6VA 3PV1A 4DHZE 2BYEA 3N30A 1GC7A 2KDIA 2GBNA 1WE6A 3H7PA 5KHQA 2N9PC 3QX1A 2KQ7A 3L0WB 2N9EB 2O6VD 2JPHA 4KZCA 4NQKE 4KV2A 2IO0B 3O65B 3ONSA 3UIOB 5AZFA 4M8NA 4FA6A 3JSVA 2CR5A 4KIKB 4NQLB 5EDSA 4ZYNA 2RGFA 4W9EA 5CHVC 1KOTA 2D11A 4ANVA 2MLBA 4BKSD 1WGGA 1WXMA 4TQ0A 4MGIE 4W9JA 1WGRA 2WX1A 1R4MI 2KK8A 1H8CA 3DCGA 2KANA 3DVGX 3UQAA 2BGFA 2MP2B 3BY4B 2JZ3B 3KW5B 2IBIB 1V2YA 2M1MA 4HDOA 3VVWB 2KTFA 3NY5A 1WH3A 5D6JB 3W1SA 2HD5B 1WR1A 4NY0A 4BOSC 2N1VA 1WR6E 3B1LX 1GJZA 3WA0A 4GMVA 1ZW7A 3CMMB 4WWNA 3L17A 1WGYA 4PYZA 2M0XA 3VTVA 2UWQA 4K81A 2O6VB 2DX5B 4TUUA 3ML9A 4K1RB 1WRDB 2Z0EB 2ZZPB 3H7PB 1WMHB 3MJWA 4KDLB 1Y8RC 1YIWA 3TL5A 4AJYB 1V86A 3QC8B 2GBKA 2YVCA 3ECIA 4EUTA 5KHOA 3JSVB 4HWIB 2KWUB 2ZJDA 4FN2A 4HDQA 4ICUA 4BBNF 2KX3A 1E8YA 2VRRB 1Q1OA 1SGHA 3KYDD 2WWZA 3DBSA 4RM8A 5E6NA 4FJVB 1ZGUB 3IVFA 2KX0A 1WX8A 2O2VB 3V6EB 2BWFA 3N32A 1S1QB 2G4SA 5AZGA 3RUIB 4OVVA 1WJ6A 2DAJA 3RULA 3QQ8B 4MGKE 2CHZA 5IA7A 2M8SA 4M8MA 3EC8A 1LXDA 2JVCA 4G11A 4IM3A 4JIOU 4K7SA 3PSEB 4TV3A 3ZIMA 4FBJB 4GOCA 3L13A 3QHTA 4ANUA 2A4ZA 3PGEA 2KTRB 3HK0A 5JHAA 1I42A 1UH6A 4MDKE 1P1AA 1YD8U 2K6DB 3R7RA 3U8ZA 2OOBB 2M17A 2MX2A 3ZNZB 2XBBC 3M62B 2N9XA 2DZMA 3P2BA 4FLHA 4JLCA 4PS8A 1IP9A 3L16A 2FUHB 4GGQA 5JZEB 1L2NA 3OJ4B 2BYVE 3VUXA 5DPSA 4II3B 1RRBA 1UZXB 3V6CB 5JHBA 1P3QU 2MWSB 5TR5A 2L76A 2ZPNA 3PT2B 2K8BA 3DOWA 3Q3JA 3PS6A 4KDIC 1D3ZA 2HTHA 3A1QB 2MQJA 2ZVNA 3ZRCA 3I3TB 3DVGY 4M0WB 5JH5C 3RZWC 3VH3B 1GUAB 2EKEC 2FAZA 3VXWA 3PRZA 2Y5BB 2L05A 1L7YA 1WI0A 2LUEA 3HHMA 1NBFC 2N1WA 5HKHA 2KVRA 4XC2A 1UD7A 2M4NA 3U7DA 1E90A 3QIJA 4DWFA 1C1YB 3RD2A 3X23A 2WX0A 3UF8A 4W9KA 4KVGB 2A5UA 4E3CA 2JF5A 4ZDVA 2KHWB 2N7DA 3GZNI 3M3JA 1M94A 4GDKA 5D7GA 2DYMA 1CMXB 1WGDA 3IHPC 1AARA 2KDFB 2NBWB 3A4RA 2BKRB 2Z59B 1PQSA 1NI2A 4IM0A 2BPSA 2JY6A 2KD0A 3RYTA 2MSED 3B08A 1JRUA 4B6WA 3A33B 1Z2MA 1VCBA 4MELA 3RT3B 3ZTCA 2G45B 2LRWA 2JXXA 2N7EA 4GB9A 3PLVA 1X1MA 4BKSA 1GNUA 1OGWA 2GBMA 4W9CA 2D2QA 1C3TA 4EFOA 3H1UA 5DPRA 3V60A 2BF8B 2G3QB 2NBVB 4MGYE 2ZNVB 1WJUA 3ZNHB 2NBUA 2ZVOA 2N4FA 2MA9B 4ZRJA 3VQIA 2GMIC 2IO3B 2KLCA 4FHJA 4HPLB 1OTRB 1I35A 3SU8X 3C0RB 1Q5WB 3KH0A 4ANXA 4IWPA 2KNBA 2LRUA 4IUMB 2LVPA 2ZCBA 3TIXA 2AL3A 2V1YA 2V3SA 5C23A 4BKGA 2C9WB 3QAQA 4A3PA 2CKHB 4XZ4A 4J6IA 3M95A 1VD2A 3ZDTA 1RFAA 4HCPB 1WM3A 3VH4B 4F8CB 5CTRC 4GDLA 4WWPA 3ALBA 4EZKA 2RR9A 4IM2A 1IYFA 4GDKB 1J8CA 2V4LA 3L10B 2LGXA 4RM9A 3UIPB 3KVFB 2KN5A 2XK5A 3CSFA 2IY1B 1IPGA 2D07B 3ML8A 3PPAA 2K8HA 1WX9A 3OLMD 2G4DB 1WFYA 3PZDA 4MM3A 1XQQA 2L7RA 2L8JA 3QA8A 3HIZA 2IO1B 3L08A 3VAWA 4NPNA 3VTWA 1OEYA 3DBRI 2KFKA 4AWJA 2WDTB 2PJHA 4I6LB 3W1SC 5CHFA 3V62A 4MGZE 3QJZA 2CHXA 3VHTC 3ZTDA 3CSTA 3Q3FA 4WJOA 2L0FA 4NNJB 3DQVA 1HE8A 3SHQA 3ZKJC 4CYEA 5DPWA 3N3KB 3SD5A 5D2MB 3U30A 1TBEA 4I6PA 3K9OB 1Q0WB 1E8WA 1WXSA 3IBEA 3HM6X 3MHSD 3PHWB 2I1KA 1NDDA 3TMPB 1H4RA 4KSKC 4IWQA 2D10A 3R7QA 3W1YA 1V6EA 2JT4B 3A9JA 1ISNA 3DVNV 2KDBA 4GDLB 2HJ8A 1WXAA 2IY0B 2K8CA 3ZUNA 5G55A 3X0WA 2K1FA 3M63B 3ZVVA 2R2OA 5DPTA 3WIMA 4PYUA 4CO7A 2LASA 4JQWC 2XK5B 4WWOA 3R3MA 2EMTA 1WYWB 4IG7B 3KYCD 3WAOA 1XD3B 3K9PB 1OQYA 2REXA 4EZJA 5E6OA 2KWVB 2DHZA 2L00B 4DDGD 2DENB 2K25A 2EMSA 3APDA 2AYOB 2KFKB 4AP4C 2JRHA 3ZO5B 4MJSA 1YJ1A 2YLMA 3AU5A 2J0JA 2K39A 2L0TA 3VFKA 2LVOA 1YX6B 1GC6A 3EECA 2LD9A 4RMAA 2ZEQA 1R4NI 3JYUA 5LXHA 3WALA 4B95A 1GG3A 2C5LC 1E5WA 3KUDB 4DDID 1EF5A 3PRPB 1UBIA 3DPDA 1OEYJ 4G50A 2CS4A 2FIFA 2PPHA 1V49A 3GOEA 4NJ7A 1S3SG 4IW0A 4GXBA 4ZRIA 3A4SC 4LDTD 3QARA 1V81A 3A9JB 2GOWA 1YX5B 1QZEA 2C7HA 3JVZX 4MEMA 2C60A 2NPTA 2ZNVC 5E6PA 2MP2A 3WAPA 2LI5A 2IZVB 4F7ZA 4HK2A 2OJRA 4YL8A 3ZLZA 2FNJB 4A3OA 2AEHA 3OAWA 3PHXB 4AUQC 2MBQA 1WIAA 2GBJA 1WZ0A 4LCDE 3DVNU 2MBEA 3PLUA 4FADA 3WAMA 2RPQA 4BBNC 1XT9B 1UELA 4WJPA 1F9JA 1SE9A 3LDZE 3VDZA 2ZCCA 3PREA 2FCQA 1WJ4A 2LVQA 2KFJA 1SIFA 3QWZB 4TQ1A 1P98A 5BO4B 2MBOA 1BT0A 3VUYA 1T0YA 4BVUC 4MJSB 3EFUA 3SDLC 3ZNID 1WX7A 2KLGA 1UGMA 4BKTA 4G0NB 2WYQA 2PE6B 3JW0X 2BWES 4HXDA 2AWTA 3RZFA 3T9LA 3H7SA 4WAAA 1MG8A 1WMHA 3APCA 3AULA 2I1JA 3OJ3A 4JL9A 4X57B 2LWPA 4FHKA 4IC7B 2KMAA 2KJ6A 2KJHB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LDT B;  3QCA A;  4E74 A;  2IO2 B;  1V9J A;  1V80 A;  2DYO A;  3AU4 A;  4EZL A;  1EF1 A;  2JWZ A;  3APF A;  5J18 A;  2KXJ A;  2O2V A;  1UBQ A;  3PRM B;  1KM7 A;  1WJN A;  2HE7 A;  2KC2 A;  4HCN B;  1U4A A;  4WJN A;  2W9N A;  4B9K A;  2NPT B;  2LGY A;  4KZ0 A;  4F1S A;  3RCZ A;  3NHE B;  3L54 A;  3UGB B;  2ZPY A;  4W9I A;  4II2 B;  3ENE A;  3NOB A;  3AI5 A;  4I6N B;  2KTR A;  2KZR A;  2L3Z A;  1P9D U;  4PS7 A;  2NR2 A;  2NVU I;  2KC1 A;  4NAW A;  2AL6 A;  5GMV A;  4W9F A;  3UIN B;  2DAF A;  3NS8 A;  4GSW A;  1KJT A;  2CU1 A;  3S2A A;  3IFW B;  3ZW3 A;  1E7U A;  4MH0 E;  1WE7 A;  2B3A A;  2NS5 A;  4K7W A;  4LJO B;  4A20 A;  3VUW A;  1WXV A;  1TZ1 A;  2C7M B;  3KUC B;  2GBR A;  4DBG A;  4DXA B;  2XEW A;  1K8R B;  2CHW A;  2KO3 A;  3AXC A;  4ANW A;  2K6Q A;  2MBB B;  1G6J A;  2LGD A;  1V5O A;  2FCS A;  3DBL I;  2BYF A;  4GU2 A;  4K7U A;  2LXC A;  2FID A;  4W9G A;  1FXT B;  1WGH A;  2MW5 A;  3A1Q A;  2DZI A;  2MBH A;  2LXA A;  1LM8 B;  2Z0D B;  3H6N A;  5IAA C;  5J2R A;  2J0M A;  1J0G A;  3HM3 A;  2PE9 A;  4KSL C;  2KWC A;  2UYZ B;  4HLE A;  4W9H A;  1RLF A;  4GIV A;  2BKF A;  2DZK A;  2MRP A;  2NCN A;  3PVL A;  4ASW C;  4DHZ B;  2JUO A;  3H9D A;  4MSM B;  4PS3 A;  1WZ3 A;  4AJW A;  3A9K A;  5LLI A;  2C7N B;  1EO6 A;  1TTN A;  4HPM B;  2FCN A;  5DCN A;  3UQB A;  1RAX A;  4FUL A;  2J0K A;  3MTN B;  2KJR A;  5FR6 A;  2KDE B;  1E8X A;  3TJP A;  4EKU A;  3TBL D;  3D32 A;  2MCN B;  1WF9 A;  3NZU A;  1KLV A;  4TKN A;  4EOY A;  1E7V A;  4NAW B;  4DHJ D;  4HVB A;  3B0A A;  5CHW A;  3V61 A;  3VTU A;  2JZZ A;  2QHO A;  1LQB A;  1E8Z A;  4XX5 A;  4OVU A;  4LJP B;  4ICV A;  3ZDM C;  1Z5S B;  4P7I A;  1LFD A;  4KIK A;  1J19 A;  2DYB A;  3PTF C;  2LZ6 A;  3QK0 A;  4ZRK A;  4URK A;  4HJK A;  4CHK A;  1A5R A;  4E71 A;  5C1Z A;  3T8M A;  4BFR A;  5J17 A;  1WY8 A;  5L95 C;  4G3X B;  3LJ3 A;  4WQO B;  2D3G A;  4MSQ B;  4N9F 4;  1TGZ B;  4WJQ A;  2PEA A;  4FJZ A;  2KMC A;  4IWO A;  1P0R A;  2RD0 A;  5D94 A;  2KKC A;  3ZNG C;  3EHV A;  3NZS A;  2ASQ A;  3A9K B;  3KUZ A;  3WAN A;  2KQS A;  5G2N A;  2FCM A;  4FJY A;  4W9D A;  5AEK B;  5LXI B;  4EEW A;  3TCA A;  3DBH I;  4W9L A;  3ZRF A;  3R66 C;  2JRI B;  2RSU A;  4GN1 A;  5CX3 A;  3DDC B;  3IG3 A;  4DK5 A;  4DHJ B;  2DZJ A;  4BOZ B;  2R2Q A;  2LJ5 A;  1EUV B;  2IYD B;  3CF6 E;  2J7Q B;  5L83 A;  4JGH B;  3BIN A;  1ZKH A;  1WM2 A;  4AOF A;  1V5T A;  2KOX A;  4NJ6 A;  5AZH A;  1YQB A;  2O6V A;  3PV1 A;  4DHZ E;  2BYE A;  3N30 A;  1GC7 A;  2KDI A;  2GBN A;  1WE6 A;  3H7P A;  5KHQ A;  2N9P C;  3QX1 A;  2KQ7 A;  3L0W B;  2N9E B;  2O6V D;  2JPH A;  4KZC A;  4NQK E;  4KV2 A;  2IO0 B;  3O65 B;  3ONS A;  3UIO B;  5AZF A;  4M8N A;  4FA6 A;  3JSV A;  2CR5 A;  4KIK B;  4NQL B;  5EDS A;  4ZYN A;  2RGF A;  4W9E A;  5CHV C;  1KOT A;  2D11 A;  4ANV A;  2MLB A;  4BKS D;  1WGG A;  1WXM A;  4TQ0 A;  4MGI E;  4W9J A;  1WGR A;  2WX1 A;  1R4M I;  2KK8 A;  1H8C A;  3DCG A;  2KAN A;  3DVG X;  3UQA A;  2BGF A;  2MP2 B;  3BY4 B;  2JZ3 B;  3KW5 B;  2IBI B;  1V2Y A;  2M1M A;  4HDO A;  3VVW B;  2KTF A;  3NY5 A;  1WH3 A;  5D6J B;  3W1S A;  2HD5 B;  1WR1 A;  4NY0 A;  4BOS C;  2N1V A;  1WR6 E;  3B1L X;  1GJZ A;  3WA0 A;  4GMV A;  1ZW7 A;  3CMM B;  4WWN A;  3L17 A;  1WGY A;  4PYZ A;  2M0X A;  3VTV A;  2UWQ A;  4K81 A;  2O6V B;  2DX5 B;  4TUU A;  3ML9 A;  4K1R B;  1WRD B;  2Z0E B;  2ZZP B;  3H7P B;  1WMH B;  3MJW A;  4KDL B;  1Y8R C;  1YIW A;  3TL5 A;  4AJY B;  1V86 A;  3QC8 B;  2GBK A;  2YVC A;  3ECI A;  4EUT A;  5KHO A;  3JSV B;  4HWI B;  2KWU B;  2ZJD A;  4FN2 A;  4HDQ A;  4ICU A;  4BBN F;  2KX3 A;  1E8Y A;  2VRR B;  1Q1O A;  1SGH A;  3KYD D;  2WWZ A;  3DBS A;  4RM8 A;  5E6N A;  4FJV B;  1ZGU B;  3IVF A;  2KX0 A;  1WX8 A;  2O2V B;  3V6E B;  2BWF A;  3N32 A;  1S1Q B;  2G4S A;  5AZG A;  3RUI B;  4OVV A;  1WJ6 A;  2DAJ A;  3RUL A;  3QQ8 B;  4MGK E;  2CHZ A;  5IA7 A;  2M8S A;  4M8M A;  3EC8 A;  1LXD A;  2JVC A;  4G11 A;  4IM3 A;  4JIO U;  4K7S A;  3PSE B;  4TV3 A;  3ZIM A;  4FBJ B;  4GOC A;  3L13 A;  3QHT A;  4ANU A;  2A4Z A;  3PGE A;  2KTR B;  3HK0 A;  5JHA A;  1I42 A;  1UH6 A;  4MDK E;  1P1A A;  1YD8 U;  2K6D B;  3R7R A;  3U8Z A;  2OOB B;  2M17 A;  2MX2 A;  3ZNZ B;  2XBB C;  3M62 B;  2N9X A;  2DZM A;  3P2B A;  4FLH A;  4JLC A;  4PS8 A;  1IP9 A;  3L16 A;  2FUH B;  4GGQ A;  5JZE B;  1L2N A;  3OJ4 B;  2BYV E;  3VUX A;  5DPS A;  4II3 B;  1RRB A;  1UZX B;  3V6C B;  5JHB A;  1P3Q U;  2MWS B;  5TR5 A;  2L76 A;  2ZPN A;  3PT2 B;  2K8B A;  3DOW A;  3Q3J A;  3PS6 A;  4KDI C;  1D3Z A;  2HTH A;  3A1Q B;  2MQJ A;  2ZVN A;  3ZRC A;  3I3T B;  3DVG Y;  4M0W B;  5JH5 C;  3RZW C;  3VH3 B;  1GUA B;  2EKE C;  2FAZ A;  3VXW A;  3PRZ A;  2Y5B B;  2L05 A;  1L7Y A;  1WI0 A;  2LUE A;  3HHM A;  1NBF C;  2N1W A;  5HKH A;  2KVR A;  4XC2 A;  1UD7 A;  2M4N A;  3U7D A;  1E90 A;  3QIJ A;  4DWF A;  1C1Y B;  3RD2 A;  3X23 A;  2WX0 A;  3UF8 A;  4W9K A;  4KVG B;  2A5U A;  4E3C A;  2JF5 A;  4ZDV A;  2KHW B;  2N7D A;  3GZN I;  3M3J A;  1M94 A;  4GDK A;  5D7G A;  2DYM A;  1CMX B;  1WGD A;  3IHP C;  1AAR A;  2KDF B;  2NBW B;  3A4R A;  2BKR B;  2Z59 B;  1PQS A;  1NI2 A;  4IM0 A;  2BPS A;  2JY6 A;  2KD0 A;  3RYT A;  2MSE D;  3B08 A;  1JRU A;  4B6W A;  3A33 B;  1Z2M A;  1VCB A;  4MEL A;  3RT3 B;  3ZTC A;  2G45 B;  2LRW A;  2JXX A;  2N7E A;  4GB9 A;  3PLV A;  1X1M A;  4BKS A;  1GNU A;  1OGW A;  2GBM A;  4W9C A;  2D2Q A;  1C3T A;  4EFO A;  3H1U A;  5DPR A;  3V60 A;  2BF8 B;  2G3Q B;  2NBV B;  4MGY E;  2ZNV B;  1WJU A;  3ZNH B;  2NBU A;  2ZVO A;  2N4F A;  2MA9 B;  4ZRJ A;  3VQI A;  2GMI C;  2IO3 B;  2KLC A;  4FHJ A;  4HPL B;  1OTR B;  1I35 A;  3SU8 X;  3C0R B;  1Q5W B;  3KH0 A;  4ANX A;  4IWP A;  2KNB A;  2LRU A;  4IUM B;  2LVP A;  2ZCB A;  3TIX A;  2AL3 A;  2V1Y A;  2V3S A;  5C23 A;  4BKG A;  2C9W B;  3QAQ A;  4A3P A;  2CKH B;  4XZ4 A;  4J6I A;  3M95 A;  1VD2 A;  3ZDT A;  1RFA A;  4HCP B;  1WM3 A;  3VH4 B;  4F8C B;  5CTR C;  4GDL A;  4WWP A;  3ALB A;  4EZK A;  2RR9 A;  4IM2 A;  1IYF A;  4GDK B;  1J8C A;  2V4L A;  3L10 B;  2LGX A;  4RM9 A;  3UIP B;  3KVF B;  2KN5 A;  2XK5 A;  3CSF A;  2IY1 B;  1IPG A;  2D07 B;  3ML8 A;  3PPA A;  2K8H A;  1WX9 A;  3OLM D;  2G4D B;  1WFY A;  3PZD A;  4MM3 A;  1XQQ A;  2L7R A;  2L8J A;  3QA8 A;  3HIZ A;  2IO1 B;  3L08 A;  3VAW A;  4NPN A;  3VTW A;  1OEY A;  3DBR I;  2KFK A;  4AWJ A;  2WDT B;  2PJH A;  4I6L B;  3W1S C;  5CHF A;  3V62 A;  4MGZ E;  3QJZ A;  2CHX A;  3VHT C;  3ZTD A;  3CST A;  3Q3F A;  4WJO A;  2L0F A;  4NNJ B;  3DQV A;  1HE8 A;  3SHQ A;  3ZKJ C;  4CYE A;  5DPW A;  3N3K B;  3SD5 A;  5D2M B;  3U30 A;  1TBE A;  4I6P A;  3K9O B;  1Q0W B;  1E8W A;  1WXS A;  3IBE A;  3HM6 X;  3MHS D;  3PHW B;  2I1K A;  1NDD A;  3TMP B;  1H4R A;  4KSK C;  4IWQ A;  2D10 A;  3R7Q A;  3W1Y A;  1V6E A;  2JT4 B;  3A9J A;  1ISN A;  3DVN V;  2KDB A;  4GDL B;  2HJ8 A;  1WXA A;  2IY0 B;  2K8C A;  3ZUN A;  5G55 A;  3X0W A;  2K1F A;  3M63 B;  3ZVV A;  2R2O A;  5DPT A;  3WIM A;  4PYU A;  4CO7 A;  2LAS A;  4JQW C;  2XK5 B;  4WWO A;  3R3M A;  2EMT A;  1WYW B;  4IG7 B;  3KYC D;  3WAO A;  1XD3 B;  3K9P B;  1OQY A;  2REX A;  4EZJ A;  5E6O A;  2KWV B;  2DHZ A;  2L00 B;  4DDG D;  2DEN B;  2K25 A;  2EMS A;  3APD A;  2AYO B;  2KFK B;  4AP4 C;  2JRH A;  3ZO5 B;  4MJS A;  1YJ1 A;  2YLM A;  3AU5 A;  2J0J A;  2K39 A;  2L0T A;  3VFK A;  2LVO A;  1YX6 B;  1GC6 A;  3EEC A;  2LD9 A;  4RMA A;  2ZEQ A;  1R4N I;  3JYU A;  5LXH A;  3WAL A;  4B95 A;  1GG3 A;  2C5L C;  1E5W A;  3KUD B;  4DDI D;  1EF5 A;  3PRP B;  1UBI A;  3DPD A;  1OEY J;  4G50 A;  2CS4 A;  2FIF A;  2PPH A;  1V49 A;  3GOE A;  4NJ7 A;  1S3S G;  4IW0 A;  4GXB A;  4ZRI A;  3A4S C;  4LDT D;  3QAR A;  1V81 A;  3A9J B;  2GOW A;  1YX5 B;  1QZE A;  2C7H A;  3JVZ X;  4MEM A;  2C60 A;  2NPT A;  2ZNV C;  5E6P A;  2MP2 A;  3WAP A;  2LI5 A;  2IZV B;  4F7Z A;  4HK2 A;  2OJR A;  4YL8 A;  3ZLZ A;  2FNJ B;  4A3O A;  2AEH A;  3OAW A;  3PHX B;  4AUQ C;  2MBQ A;  1WIA A;  2GBJ A;  1WZ0 A;  4LCD E;  3DVN U;  2MBE A;  3PLU A;  4FAD A;  3WAM A;  2RPQ A;  4BBN C;  1XT9 B;  1UEL A;  4WJP A;  1F9J A;  1SE9 A;  3LDZ E;  3VDZ A;  2ZCC A;  3PRE A;  2FCQ A;  1WJ4 A;  2LVQ A;  2KFJ A;  1SIF A;  3QWZ B;  4TQ1 A;  1P98 A;  5BO4 B;  2MBO A;  1BT0 A;  3VUY A;  1T0Y A;  4BVU C;  4MJS B;  3EFU A;  3SDL C;  3ZNI D;  1WX7 A;  2KLG A;  1UGM A;  4BKT A;  4G0N B;  2WYQ A;  2PE6 B;  3JW0 X;  2BWE S;  4HXD A;  2AWT A;  3RZF A;  3T9L A;  3H7S A;  4WAA A;  1MG8 A;  1WMH A;  3APC A;  3AUL A;  2I1J A;  3OJ3 A;  4JL9 A;  4X57 B;  2LWP A;  4FHK A;  4IC7 B;  2KMA A;  2KJ6 A;  2KJH B; 
#chains in the Genus database with same CATH topology
 3QCA A;  1V9J A;  1EF1 A;  2V3P A;  4YTM B;  2KC2 A;  1WJN A;  2HE7 A;  1R4M B;  4WJN A;  2IJ0 A;  2LGY A;  3AE9 B;  2X8X X;  4F1S A;  3P4R B;  3L54 A;  4II2 B;  1FRR A;  2KZR A;  2L3Z A;  3UIN B;  1BXT A;  4GSW A;  1KJT A;  2WGS A;  1F77 A;  1WE7 A;  4LJO B;  3KUC B;  5BMG A;  1K52 A;  1FCC C;  2ONQ A;  2BYF A;  2FID A;  1FEH A;  2DZI A;  1SJE D;  3A1Q A;  2Z0D B;  4C00 A;  4HLE A;  4WUR A;  3HVD A;  4RH6 A;  1NYR A;  4PS3 A;  1WZ3 A;  3A9K A;  3AV8 A;  5LLI A;  4YSZ B;  4NZL B;  4HPM B;  5DCN A;  3UQB A;  1RAX A;  3NVV A;  4FUL A;  5FR6 A;  1FFV A;  2J42 A;  3DHH C;  1HQR D;  3TBL D;  2GI9 A;  4C7Y A;  4AQ7 A;  1JWS D;  2LHE A;  4NAW B;  1HTO A;  2JYT A;  1SSN A;  4HVB A;  1FD6 A;  1N5W A;  3O13 A;  3KWV A;  4A6Q A;  1ET9 A;  4LJP B;  4ICV A;  4HKZ E;  3AH7 A;  1JW9 D;  4CQN A;  4YXD B;  3EFC A;  2DYB A;  1KLG D;  2LZ6 A;  4MAC A;  4N9F 4;  3R2I A;  3P1M A;  2KT7 A;  5D94 A;  2IGG A;  1PGX A;  4XYC A;  2JYE A;  2HJ1 A;  1VR9 A;  2J52 A;  4W9D A;  5LXI B;  5GXG B;  4EEW A;  2WLB A;  4W9L A;  2JRI B;  4GN1 A;  5CX3 A;  4C56 C;  2DZJ A;  2IYD B;  1ZKH A;  1WM2 A;  1V5T A;  5D3D A;  5AZH A;  3B2G A;  3PV1 A;  1XLQ A;  5G5H A;  4ACF A;  2BYE A;  1WE6 A;  3H7P A;  2Z8L A;  2N9P C;  3L0W B;  1FPY A;  4KZC A;  4NQK E;  4KV2 A;  4LNK A;  1AW7 A;  1HZ6 A;  3JSV A;  4IOI E;  4A90 A;  1E7P B;  3C8Y A;  1YQ4 B;  1KOT A;  1N61 A;  1D6E C;  3RNA C;  1WXM A;  3Q69 A;  4TQ0 A;  4OVZ A;  2WU2 B;  2KAN A;  3DCG A;  4ZYS A;  2BGF A;  2MP2 B;  2IBI B;  3P4Q B;  4NJC A;  1V2Y A;  2BB5 A;  1MI0 A;  2KTF A;  3NY5 A;  5D6J B;  4DXG A;  3BVM A;  1WR1 A;  4BOS C;  3B1L X;  2RMM A;  1SE3 A;  1T0S C;  1TY0 A;  2M0X A;  1HTQ A;  2O6V B;  1KH0 A;  2DX5 B;  3ML9 A;  1WRD B;  2Z0E B;  2LGS A;  2ZZP B;  3H8H A;  1C4P A;  1Y8R C;  3QC8 B;  2GBK A;  3ECI A;  4EUT A;  4FN2 A;  3AEF B;  4HDQ A;  3TEZ A;  1CK1 A;  2VRR B;  3KYD D;  3WCQ A;  4JWS C;  4RM8 A;  1ZGU B;  2KX0 A;  5IOI A;  2BWF A;  5AUI A;  1GB4 A;  1QOA A;  2DAJ A;  1QOB A;  5IA7 A;  1IGD A;  3GB1 A;  4OZC A;  4TV3 A;  2K3U A;  4FBJ B;  3Q3M C;  3U8Z A;  1PUT A;  2VZK D;  2AQ1 B;  2FUH B;  5JZE B;  2AX5 A;  3GE3 C;  3VUX A;  4II3 B;  2MWS B;  4L23 A;  5TR5 A;  3VR8 B;  3DOW A;  2IGH A;  1D3Z A;  3A1Q B;  1WWT A;  2MQJ A;  3Q3N C;  1TKE A;  2OJW A;  5H8Y E;  3HHM A;  5HKH A;  2Y3A A;  2D5G A;  1C1Y B;  1N60 A;  2WX0 A;  3UF8 A;  1YNT E;  1GAQ B;  2N7D A;  3M3J A;  4GDK A;  4BZA A;  1C4C A;  1T0Q C;  1WGD A;  1AAR A;  2BKR B;  1R7S A;  3BK2 A;  3W9C B;  4IM0 A;  2BPS A;  2X38 A;  1VCB A;  4YTP B;  1VRA B;  2KAJ A;  4GB9 A;  3PLV A;  5EE9 A;  1OGW A;  2W55 A;  2D2Q A;  4O1N A;  4XE0 A;  2ZNV B;  1YOV B;  2MA9 B;  4ZRJ A;  2GMI C;  2JZP A;  3BYT B;  1DYQ A;  2V1Y A;  3V05 A;  4BKG A;  3E9S A;  3M95 A;  4J6I A;  2WXL A;  4HCP B;  3MP9 A;  2I2Y A;  3MHZ A;  3L10 B;  1NYQ A;  1ZPS A;  2KN5 A;  2L83 A;  2D07 B;  2B76 B;  2G4D B;  4MM3 A;  2L7R A;  2DLB A;  1OEY A;  3DBR I;  5CHF A;  1ZP0 B;  3CST A;  3DQV A;  1EU3 A;  3N3K B;  3U30 A;  3TSS A;  4I6P A;  3HM6 X;  1C76 A;  1YN5 A;  2LHD A;  3PHW B;  3FIL A;  2ZW0 A;  4ITK A;  3AE8 B;  2JT4 B;  2W3R A;  3SFE B;  3ZVV A;  1HXY D;  2R61 A;  4PYU A;  3T3O A;  4JQW C;  2EMT A;  3N1Y C;  1WYW B;  1C4A A;  3WAO A;  3CWI A;  3C19 A;  1OQY A;  1J7B A;  4WIP A;  2DEN B;  2EMS A;  4RGO S;  5HHD G;  4AP4 C;  2M0A A;  2JRH A;  1YJ1 A;  2LFI A;  3NUH B;  2J0J A;  1KTK A;  2W54 A;  1HA5 A;  2M19 A;  3WAL A;  3TEX A;  4DDI D;  3RI7 C;  1UBI A;  1OEY J;  1SEB D;  3MJ5 A;  1V49 A;  4AS1 A;  1S3S G;  2KWD A;  4LDT D;  1E0Z A;  1GOZ A;  2RDG A;  3A9J B;  1BML C;  5E6J A;  2Y5C A;  2C60 A;  1SB3 C;  2LI5 A;  3ZLZ A;  3OAW A;  3PHX B;  4AUQ C;  3DHG C;  3P4S B;  4A55 A;  2MBE A;  4FAD A;  2ZCC A;  2FCQ A;  3AN1 A;  2LVQ A;  2KFJ A;  2MBO A;  3VUY A;  4MJS B;  3EFU A;  3SDL C;  2KLG A;  1UGM A;  4G0N B;  1MG8 A;  4JL9 A;  1JWA D;  4FHK A;  2QSD A;  2KMA A;  2JWU A;  3DWG C;  4E74 A;  2BB6 A;  2DYO A;  1JQ4 A;  1Y56 A;  3NVY A;  1UBQ A;  2ACZ B;  1L4D B;  4MH8 A;  2I38 A;  4KZ0 A;  3RCZ A;  1VZ6 A;  1XEE A;  2ZPY A;  2RDB C;  1V97 A;  3ENE A;  3NOB A;  4KGT A;  3AI5 A;  4DXF A;  4ZOH C;  2NTT A;  2NR2 A;  4DQO C;  4NAW A;  1N63 A;  2DAF A;  4QAY A;  1YN3 A;  3S2A A;  4RGM A;  4MH0 E;  4A20 A;  2QIL A;  3VUW A;  1WXV A;  1TZ1 A;  2C7M B;  4XDC A;  2GBR A;  2CHW A;  2IND C;  2KO3 A;  2LGD A;  5KHO A;  1LO5 D;  2QDF A;  3W5U B;  2LXC A;  2MBH A;  2LXA A;  2PE9 A;  4LNI A;  4OHJ A;  1XLO A;  4GIV A;  1UUP A;  3RNG C;  2V4I B;  1T0R C;  4DHZ B;  2JUO A;  4MSM B;  2H88 B;  2C7N B;  1EO6 A;  1TTN A;  1E10 A;  2FCN A;  1ZE3 D;  2J0K A;  3RMK C;  1J7A A;  2WXQ A;  4M00 A;  1LGR A;  5IKC M;  3TJP A;  3D32 A;  2MCN B;  3NZU A;  2MHJ A;  4TKN A;  4USA A;  1E7V A;  4DHJ D;  5CHW A;  3V61 A;  1DGJ A;  3T3N A;  3CIR B;  2BS2 B;  3TEW A;  4P7I A;  1LFD A;  3FIL B;  4ZRK A;  1A5R A;  4E71 A;  4ZHO A;  1WY8 A;  4S0R A;  5AUK A;  4MT5 A;  2D3G A;  2KVZ A;  4WJQ A;  4B0M A;  1F1H A;  4FJZ A;  2LMC A;  4IWO A;  1P0R A;  4REZ A;  2KKC A;  3ZNG C;  2PVO D;  3ZRF A;  2RSU A;  1MHX A;  5LNK 1;  3IG3 A;  4DK5 A;  5T8I A;  1EUV B;  3BII D;  3GZN B;  3AEG B;  4BAX A;  3VRB B;  2PKO A;  3ZXV A;  2O6V A;  4DHZ E;  5I4D A;  1QOF A;  3N30 A;  5C3J B;  2ON8 A;  5KHQ A;  3QX1 A;  2KQ7 A;  2JPH A;  3BVG A;  4JWU C;  3UIO B;  5AZF A;  4KIK B;  2ZW1 A;  4ZYN A;  5CHV C;  2MLB A;  4P1C C;  4MGI E;  1I4Q A;  1R4M I;  3DVG X;  3KW5 B;  3Q6B A;  1I4R A;  4NY0 A;  3BVZ A;  2WDR B;  3GP7 A;  1YJI A;  5BYS A;  5JXV A;  1WGY A;  4PYZ A;  1ZXI A;  4K1R B;  3TEY A;  2KQ4 X;  3MJW A;  3ZJU A;  4KDL B;  2QCZ A;  1YIW A;  1RM6 C;  1V86 A;  2YVC A;  1VLB A;  1MJD A;  4FXC A;  2KX3 A;  2WWZ A;  3DBS A;  4XDD A;  4FJV B;  3IVF A;  1P7E A;  3N32 A;  5AZG A;  3RUI B;  5IP4 D;  1WJ6 A;  3RUL A;  2M8S A;  5G5G A;  4IM3 A;  3ZIM A;  3PSE B;  3L13 A;  1ZDX A;  5JHA A;  1I42 A;  1UH6 A;  1YD8 U;  4HRO A;  1D4B A;  2N9X A;  1IP9 A;  5BMI A;  3L16 A;  4GGQ A;  2DBY A;  1YQ3 B;  2V9H A;  5DPS A;  1RRB A;  3V6C B;  1P3Q U;  1N62 A;  3PT2 B;  4RCO A;  2ICI A;  2ZVN A;  3AE6 B;  3RZW C;  1XF5 L;  1GUA B;  2FAZ A;  3VXW A;  2H89 B;  1JWB D;  2L05 A;  2Y5B B;  4ZRP A;  2LUE A;  3I57 A;  2WS3 B;  1NBF C;  2WXJ A;  3RNE C;  2BS4 B;  4PK1 A;  5FK9 C;  4DWF A;  3RNB C;  4W9K A;  2A5U A;  4S17 A;  1N5X A;  1V8C A;  1CMX B;  4LNF A;  3IHP C;  4JPS A;  1V1P B;  1NI2 A;  2KD0 A;  3OWE B;  2PMV A;  1WSP A;  2LRW A;  1X1M A;  1N6Z A;  3VR9 B;  4W9C A;  2RDH A;  5EE0 A;  3W2D A;  3H1U A;  4HRS A;  2N9K A;  5DPR A;  3V60 A;  2BF8 B;  2NBV B;  1OQR A;  4MGY E;  2NBU A;  1FNU A;  1GPX A;  1PYW D;  2IO3 B;  2KLC A;  4FHJ A;  4JE3 B;  1EM7 A;  1Q5W B;  3SR6 A;  4IWP A;  2KNB A;  1J7C A;  2V3S A;  5C23 A;  2C9W B;  1JWM D;  1RFA A;  3NVW A;  3NVZ A;  5CTR C;  1FM0 D;  3BWU D;  4EZK A;  1QT9 A;  3L4P A;  3N20 C;  4RM9 A;  3KVF B;  3CSF A;  1SE2 A;  2FUG 1;  3ML8 A;  2BBC A;  2K8H A;  1WX9 A;  1SXT A;  3AB5 A;  2EEL A;  3E56 A;  2IO1 B;  3L08 A;  3VAW A;  3VTW A;  2IDY A;  4AWJ A;  2WDT B;  3W1S C;  3PZ7 A;  3MC9 A;  3VHT C;  4US9 A;  4LLG M;  4NNJ B;  3SHQ A;  1HE8 A;  5DPW A;  1ZOY B;  1TBE A;  2L32 A;  3IAM 1;  3SEB A;  3IBE A;  3Q8C A;  3MHS D;  1NDD A;  3DBL B;  3GS2 A;  1EWC A;  4KSK C;  4P6V F;  3R7Q A;  1V6E A;  3A9J A;  1ISN A;  3DVN V;  2KDB A;  1SE4 A;  1JRP A;  4M02 A;  2GB1 A;  2R2O A;  5DPT A;  1NVI D;  3WIM A;  2XK5 B;  3KYC D;  1OFF A;  1XD3 B;  4EZJ A;  2L00 B;  4DDG D;  2AYO B;  2KFK B;  4MJS A;  4LK0 M;  2K39 A;  3AE7 B;  1TKG A;  3ZJT A;  3TUO A;  2LD9 A;  4RNA A;  5IN7 A;  2AQ2 B;  4ARC A;  4B95 A;  1GG3 A;  1GB1 A;  4OZB A;  4HEA 1;  1KRH A;  2DNF A;  4ZRI A;  2WXI A;  2PTL A;  2GLS A;  1JAL A;  3R2T A;  3JVZ X;  4F7Z A;  2OJR A;  4A3O A;  2AEH A;  5BYR A;  3DVN U;  2J4X A;  3PLU A;  3DBH B;  3WAM A;  1XT9 B;  4KGR A;  3RNC C;  1SE9 A;  3VDZ A;  1UWX A;  2WXR A;  4BVU C;  3I63 C;  1TS5 A;  1WX7 A;  4YT0 B;  2WXN A;  4BKT A;  4XGA B;  3RZF A;  1WMH A;  3OJ3 A;  2LWP A;  3AE5 B;  4IC7 B;  1KLU D;  2N0S B;  2RPV A;  1TYG B;  1EWY C;  3AU4 A;  2JWZ A;  3EGR A;  4Q2J A;  4HCN B;  1TY2 A;  2W9N A;  4B9K A;  1SF0 A;  2INN E;  3P4P B;  3UGB B;  4W9I A;  1KFY B;  2KTR A;  4HKQ A;  1B9R A;  2NVU I;  2KC1 A;  2JSV X;  3NS8 A;  1SIJ A;  2CU1 A;  1YN4 A;  2KN4 A;  4K7W A;  4WAF A;  1ZDV A;  2NTS A;  5HFY A;  4LNN A;  4P1B C;  4DBG A;  2PVG C;  2XEW A;  1ZUD 2;  1K8R B;  2KMM A;  2MBB B;  1V5O A;  2FCS A;  4W9G A;  4GU2 A;  2LEK A;  1FXT B;  2HDE A;  4GLS C;  2FBW B;  1LM8 B;  3H6N A;  2J0M A;  4WH4 A;  1J0G A;  2KWC A;  2UYZ B;  3OG5 A;  4W9H A;  3AE2 B;  2BKF A;  1F0Z A;  2BTE A;  2NCN A;  4ASW C;  4TSS A;  1T6B X;  2N7J A;  2WDV B;  1JRO A;  3MTN B;  2W3S A;  2YEP F;  1FNW A;  2OED A;  1WF9 A;  1VJK A;  1I4X A;  4IKG A;  2QHO A;  3RN9 C;  1LQB A;  4XX5 A;  4A9A A;  3Q3O C;  4ZHP A;  2KYW A;  1L5P A;  4KIK A;  5IO9 A;  3PTF C;  1TS3 A;  4URK A;  4HJK A;  4BFR A;  5J17 A;  3N1X C;  4G3X B;  4WQO B;  1XXG A;  4MSQ B;  4R3D A;  3BYY B;  1TGZ B;  1RWS A;  2KMC A;  3NJT A;  3EHV A;  3NZS A;  2ASQ A;  1QF6 A;  1L6U A;  2KQS A;  2FCM A;  4FJY A;  5G2N A;  4M01 A;  3IXS A;  1WGK A;  2LJ5 A;  2R2Q A;  1YJJ A;  4J3O D;  1I4H A;  4JGH B;  4ZRQ A;  1FRD A;  4AOF A;  2KOX A;  4NJ6 A;  4YWG G;  4C7Z A;  1EU4 A;  2GBN A;  2AQ3 B;  3DWM A;  2O6V D;  2IO0 B;  1I4G A;  3ONS A;  4M8N A;  2CR5 A;  2RGF A;  4W9E A;  1FMA D;  2D11 A;  4ANV A;  1WGG A;  3RFZ B;  4W9J A;  1ACC A;  2G1E A;  2WX1 A;  1H8C A;  1L0Y B;  1DOX A;  3UQA A;  2JQR B;  1OQQ A;  2WHI A;  2JZ3 B;  4B0E A;  1VZ7 A;  1XLN A;  2HD5 B;  1XLP A;  2WXF A;  3WA0 A;  1IBX B;  1VDV A;  3P63 A;  4WWN A;  3L17 A;  3VTV A;  2UWQ A;  4KGS A;  1MVK A;  4TUU A;  2WDQ B;  1WMH B;  3TL5 A;  4AJY B;  2L52 A;  2KWU B;  2ZJD A;  4ICU A;  3NRZ A;  1NI3 A;  1QIL A;  1Q1O A;  1F2R I;  1C9F A;  2LJI A;  3AE1 B;  3QQ8 B;  2CHZ A;  4M8M A;  3EC8 A;  1LXD A;  2JVC A;  4G11 A;  4K7S A;  1K53 A;  4GOC A;  5H92 C;  2MH7 A;  3QHT A;  2A4Z A;  3PGE A;  2KTR B;  1D5X C;  5BMH A;  4N59 A;  2OOB B;  2M17 A;  2MX2 A;  2XBB C;  3M62 B;  3P2B A;  1V1P A;  4JLC A;  3UI3 A;  3AED B;  1L2N A;  3OJ4 B;  2BYV E;  1UGJ A;  1UZX B;  5JHB A;  2ZPN A;  3Q3J A;  2HTH A;  2XNA C;  2SEB D;  4C4V B;  3ZRC A;  3I3T B;  4M0W B;  4KX6 B;  5JH5 C;  3LYY A;  1IGC A;  1QQR A;  1T5X D;  1L7Y A;  2N1W A;  3GE8 C;  3ZQ4 A;  4US8 A;  4XC2 A;  1R4N B;  1UD7 A;  2M4N A;  3U7D A;  1E90 A;  3RD2 A;  4ZDV A;  2KHW B;  4OZA A;  3GZN I;  3I9V 1;  1MPE A;  1L0V B;  4RF1 A;  2M56 B;  2K5P A;  2KDF B;  3IT4 B;  3A4R A;  2Z59 B;  2QJL A;  1PQS A;  2JY6 A;  1AYF A;  1TJE A;  4B6W A;  1Z2M A;  4MEL A;  2WXO A;  3RT3 B;  3ZTC A;  2QIE B;  2JXX A;  2GRI A;  5HI1 A;  2GBM A;  1C3T A;  4EFO A;  1I7H A;  2G3Q B;  3ZNH B;  1TIF A;  1D5Z C;  3VQI A;  4HPL B;  4K3C A;  1OTR B;  1I35 A;  3SU8 X;  3C0R B;  3NS1 A;  3KH0 A;  4IUM B;  2UU7 A;  2AL3 A;  4A3P A;  2CKH B;  4XZ4 A;  5MPO A;  3ZDT A;  3ZXR A;  3VH4 B;  4F8C B;  2JU6 X;  1FO4 A;  4WWP A;  4IM2 A;  1IYF A;  1J8C A;  2V4L A;  3UIP B;  3LB8 C;  2XK5 A;  3ABV B;  2IY1 B;  1SJH D;  3OLM D;  1WFY A;  1XQQ A;  3HIZ A;  2JXT A;  2KFK A;  4I6L B;  3ZGZ A;  3V62 A;  3AMZ A;  2CHX A;  3ZTD A;  3HUI A;  4WJO A;  3ZKJ C;  2WXP A;  1XCT L;  3NG0 A;  2QMT A;  3KLS X;  3K9O B;  1E8W A;  1WXS A;  1ZXH A;  2VH1 A;  2XN9 C;  3TMP B;  1H4R A;  2D10 A;  1D5M C;  4GDL B;  2K8C A;  3AM9 A;  3ZUN A;  2K1F A;  3M63 B;  1L4Z B;  1MHH E;  4CO7 A;  2LAS A;  1ESF A;  2WQY B;  4IG7 B;  2W82 A;  2SAK A;  4HPP A;  3K9P B;  5HG2 A;  1HEZ E;  4P16 A;  2G9H D;  2REX A;  2PIA A;  2NMQ A;  5TSS A;  2YLM A;  1SBB B;  3AU5 A;  2L0T A;  5EE1 A;  1YX6 B;  1GC6 A;  1FXA A;  4RMA A;  1DOI A;  2PLP A;  3JYU A;  1V1O A;  4RFB A;  1E5W A;  3SFD B;  1PGB A;  4G50 A;  1ENF A;  2E6X A;  2PPH A;  3GOE A;  4NJ7 A;  4IW0 A;  3A4S C;  3QAR A;  1YX5 B;  1QZE A;  4MEM A;  4YTN B;  3WAP A;  4HK2 A;  2FNJ B;  5FKA C;  4YSY B;  2MBQ A;  2GBJ A;  1WZ0 A;  4LCD E;  2PW9 A;  3MC8 A;  4WQM A;  1XCQ L;  2RPQ A;  1UEL A;  4WJP A;  3PRE A;  1WJ4 A;  1SIF A;  1BT0 A;  2LGI A;  3P42 A;  3ZNI D;  2E3T A;  2OHF A;  3AEA B;  2PE6 B;  2WXK A;  3H7S A;  3APC A;  3AUL A;  4X57 B;  1AWD A;  3LXF A;  5EE3 A;  2KJ6 A;  2CJO A;  2HTM E;  3B9J A;  4LDT B;  2IO2 B;  1V80 A;  4EZL A;  3VRA B;  3APF A;  4RF0 A;  1FIQ A;  5J18 A;  2KXJ A;  2O2V A;  3PRM B;  1KM7 A;  1WRI A;  1U4A A;  3EUB 2;  1M4V A;  2NPT B;  5C2T B;  2QEJ C;  3NHE B;  3KWL A;  3DHI C;  3NZ3 A;  2D3A A;  4I6N B;  4A8X C;  3AEE B;  3Q14 C;  3Q8B A;  2WXG A;  1P9D U;  1TZO A;  4PS7 A;  3FAH A;  2AL6 A;  5GMV A;  4W9F A;  3IFW B;  3ZW3 A;  1E7U A;  2B3A A;  2NS5 A;  1F2R C;  4DXA B;  3AXC A;  4ANW A;  3ETR A;  2K6Q A;  1G6J A;  3DBL I;  4K7U A;  1WGH A;  2MW5 A;  2JX5 A;  5IAA C;  3ZYY X;  5J2R A;  1E9M A;  3HM3 A;  4KSL C;  1RLF A;  3U52 E;  2DZK A;  2MRP A;  3PVL A;  4N58 A;  1WYG A;  3H9D A;  1PDX A;  3W5V B;  1C79 A;  3HRD D;  2KJR A;  2MEK A;  3BK1 A;  2KDE B;  2MJE A;  1E8X A;  1P7F A;  4EKU A;  3MC0 B;  1F52 A;  3U4E G;  3V3X A;  1KLV A;  4EOY A;  3B0A A;  1TT5 B;  3VTU A;  2JZZ A;  3RPF C;  1E8Z A;  1BUI C;  2KDM A;  4OVU A;  1CZP A;  3ZDM C;  1CJE A;  1Z5S B;  1J19 A;  3QK0 A;  4CHK A;  5C1Z A;  3T8M A;  1UWM A;  5L95 C;  1NEN B;  3LJ3 A;  4N6E B;  3AEC B;  4ARI A;  1FFU A;  2PEA A;  2RD0 A;  2WXM A;  4H2A A;  3A9K B;  3KUZ A;  3WAN A;  4OW0 A;  5AEK B;  3TCA A;  3DBH I;  3N1Z C;  3R66 C;  3DDC B;  4DHJ B;  4BOZ B;  1IBX A;  3CF6 E;  2J7Q B;  5L83 A;  4EE2 A;  3BIN A;  1YQB A;  1GC7 A;  2KDI A;  4C80 A;  1KF6 B;  2N9E B;  4PT5 A;  3O65 B;  4RGN A;  2WU5 B;  4FA6 A;  1B1Z A;  1C78 A;  4JX1 C;  4NQL B;  5EDS A;  4BKS D;  1K50 A;  1WGR A;  1YMH E;  2KK8 A;  2Q5W D;  3BY4 B;  2M1M A;  4HDO A;  2K22 A;  3VVW B;  2D3B A;  1I4P A;  1TKY A;  1WH3 A;  3W1S A;  1JML A;  2N1V A;  3U2S C;  2BQQ A;  1FNV A;  1WR6 E;  3RNF C;  2MJ3 A;  1GJZ A;  3MFG A;  4GMV A;  1ZW7 A;  3CMM B;  4K81 A;  3Q8A A;  2YEP B;  2DWQ A;  2INP E;  3H7P B;  2Y5P A;  3AE4 B;  2V3N A;  3JSV B;  4HWI B;  4TMA B;  3DBR B;  4C4V A;  2QC8 A;  4BBN F;  1E8Y A;  4M0W A;  3B2F A;  1SGH A;  3R8B A;  5E6N A;  1WX8 A;  2BYT A;  2O2V B;  3KQ4 A;  3V6E B;  2BS3 B;  2BW2 A;  2KAC A;  1S1Q B;  4YSX B;  2G4S A;  2BVC A;  4OVV A;  4MGK E;  2K9X A;  3PO0 A;  4RGT A;  3HVZ A;  4JIO U;  3N9Y C;  1RFK A;  4ANU A;  2EKI A;  3HK0 A;  4LNO A;  4MDK E;  1P1A A;  2K6D B;  3R7R A;  3FKY A;  3ZNZ B;  4PS8 A;  2DZM A;  4FLH A;  4KKJ A;  4L1B A;  2L76 A;  2WNM A;  4D2K A;  2K8B A;  1FCL A;  3PS6 A;  4KDI C;  1A70 A;  3AE3 B;  3DVG Y;  1NEK B;  3VH3 B;  2EKE C;  3PRZ A;  1WI0 A;  1RYJ A;  1STE A;  2KVR A;  2V0G A;  1T3Q A;  2BT6 A;  1TS2 A;  3QIJ A;  1C77 A;  2D3C A;  3X23 A;  4KVG B;  4E3C A;  2JF5 A;  1M94 A;  5D7G A;  2DYM A;  1E6E B;  2NBW B;  3J9C A;  3PZ8 A;  3RYT A;  2MSE D;  3B08 A;  1JRU A;  3A33 B;  1PFD A;  2G45 B;  2N7E A;  4LTU A;  4BKS A;  1GNU A;  3I5J C;  4KKI A;  1PGA A;  1WJU A;  4NAM A;  2ZVO A;  2N4F A;  3ZJV A;  1JCK B;  4ANX A;  2LRU A;  2LVP A;  2ZCB A;  3TIX A;  1MG4 A;  1VZ8 A;  3QAQ A;  1VD2 A;  4WWM A;  1WM3 A;  1DOY A;  4GDL A;  3ALB A;  2RR9 A;  4GDK B;  2LGX A;  4XWT A;  1UNS A;  1IPG A;  3PPA A;  3PZD A;  3EA6 A;  2L8J A;  3QA8 A;  4NPN A;  4L2Y A;  2PJH A;  5D3I B;  2J53 A;  2TSS A;  1Q10 A;  4MGZ E;  1UF0 A;  3QJZ A;  3Q3F A;  2WP9 B;  2L0F A;  4CYE A;  3SD5 A;  1QLB B;  5D2M B;  1QOG A;  1Q0W B;  1QKZ A;  3U7Z A;  2FE8 A;  2I1K A;  2IPK D;  4HJG E;  4XWW A;  3Q8E A;  4IWQ A;  1WXQ A;  3W1Y A;  2K0P A;  3Q8F A;  2HJ8 A;  1WXA A;  2IY0 B;  1TS4 A;  5G55 A;  3X0W A;  4UDU C;  3BZD B;  4WWO A;  3R3M A;  3IT6 B;  3Q2A C;  4MM3 B;  1ET6 A;  5E6O A;  2KWV B;  2DHZ A;  2K25 A;  3APD A;  2LUM A;  3ZO5 B;  3VFK A;  2LVO A;  2INC C;  1IUE A;  3EEC A;  2ZEQ A;  1R4N I;  4IDI A;  2CU3 A;  3URY A;  5LXH A;  1ROE A;  2CJN A;  2C5L C;  2N9L A;  3KUD B;  1EF5 A;  3PRP B;  1JWU D;  3DPD A;  1CQV A;  2CS4 A;  1K51 A;  2FIF A;  1XO3 A;  4AJW A;  4GXB A;  3IAS 1;  5FR3 A;  1L6V A;  1V81 A;  2IGD A;  2VZK B;  2GOW A;  2MJD A;  2C7H A;  5BYQ A;  2NPT A;  2ZNV C;  5E6P A;  2MP2 A;  2IZV B;  4YL8 A;  1MFW A;  2VH2 A;  1WIA A;  1AN8 A;  4BBN C;  1F9J A;  3LDZ E;  2WXH A;  1HZ5 A;  3QWZ B;  1FXI A;  4TQ1 A;  3AEB B;  1P98 A;  3FC4 A;  5BO4 B;  1T0Y A;  2L1A A;  2WYQ A;  4K3B A;  3JW0 X;  2BWE S;  4HXD A;  2AWT A;  3T9L A;  1L0X B;  4WAA A;  2I1J A;  2KJH B; 
#chains in the Genus database with same CATH homology
 4LDT B;  3QCA A;  4E74 A;  2IO2 B;  1V9J A;  1V80 A;  2DYO A;  3AU4 A;  4EZL A;  1EF1 A;  2JWZ A;  3APF A;  5J18 A;  2KXJ A;  2O2V A;  1UBQ A;  3PRM B;  1KM7 A;  1WJN A;  2HE7 A;  2KC2 A;  4HCN B;  1U4A A;  4WJN A;  2W9N A;  4B9K A;  2NPT B;  2LGY A;  4KZ0 A;  4F1S A;  3RCZ A;  3NHE B;  3L54 A;  3UGB B;  2ZPY A;  4W9I A;  4II2 B;  3ENE A;  3NOB A;  3AI5 A;  4I6N B;  2KTR A;  2KZR A;  2L3Z A;  1P9D U;  4PS7 A;  2NR2 A;  2NVU I;  2KC1 A;  4NAW A;  2AL6 A;  5GMV A;  4W9F A;  3UIN B;  2DAF A;  3NS8 A;  4GSW A;  1KJT A;  2CU1 A;  3S2A A;  3IFW B;  3ZW3 A;  1E7U A;  4MH0 E;  1WE7 A;  2B3A A;  2NS5 A;  4K7W A;  4LJO B;  4A20 A;  3VUW A;  1WXV A;  1TZ1 A;  2C7M B;  3KUC B;  2GBR A;  4DBG A;  4DXA B;  2XEW A;  1K8R B;  2CHW A;  2KO3 A;  3AXC A;  4ANW A;  2K6Q A;  2MBB B;  1G6J A;  2LGD A;  1V5O A;  2FCS A;  3DBL I;  2BYF A;  4GU2 A;  4K7U A;  2LXC A;  2FID A;  4W9G A;  1FXT B;  1WGH A;  2MW5 A;  3A1Q A;  2DZI A;  2MBH A;  2LXA A;  1LM8 B;  2Z0D B;  3H6N A;  5IAA C;  5J2R A;  2J0M A;  1J0G A;  3HM3 A;  2PE9 A;  4KSL C;  2KWC A;  2UYZ B;  4HLE A;  4W9H A;  1RLF A;  4GIV A;  2BKF A;  2DZK A;  2MRP A;  2NCN A;  3PVL A;  4ASW C;  4DHZ B;  2JUO A;  3H9D A;  4MSM B;  4PS3 A;  1WZ3 A;  4AJW A;  3A9K A;  5LLI A;  2C7N B;  1EO6 A;  1TTN A;  4HPM B;  2FCN A;  5DCN A;  3UQB A;  1RAX A;  4FUL A;  2J0K A;  3MTN B;  2KJR A;  5FR6 A;  2KDE B;  1E8X A;  3TJP A;  4EKU A;  3TBL D;  3D32 A;  2MCN B;  1WF9 A;  3NZU A;  1KLV A;  4TKN A;  4EOY A;  1E7V A;  4NAW B;  4DHJ D;  4HVB A;  3B0A A;  5CHW A;  3V61 A;  3VTU A;  2JZZ A;  2QHO A;  1LQB A;  1E8Z A;  4XX5 A;  4OVU A;  4LJP B;  4ICV A;  3ZDM C;  1Z5S B;  4P7I A;  1LFD A;  4KIK A;  1J19 A;  2DYB A;  3PTF C;  2LZ6 A;  3QK0 A;  4ZRK A;  4URK A;  4HJK A;  4CHK A;  1A5R A;  4E71 A;  5C1Z A;  3T8M A;  4BFR A;  5J17 A;  1WY8 A;  5L95 C;  4G3X B;  3LJ3 A;  4WQO B;  2D3G A;  4MSQ B;  4N9F 4;  1TGZ B;  4WJQ A;  2PEA A;  4FJZ A;  2KMC A;  4IWO A;  1P0R A;  2RD0 A;  5D94 A;  2KKC A;  3ZNG C;  3EHV A;  3NZS A;  2ASQ A;  3A9K B;  3KUZ A;  3WAN A;  2KQS A;  5G2N A;  2FCM A;  4FJY A;  4W9D A;  5AEK B;  5LXI B;  4EEW A;  3TCA A;  3DBH I;  4W9L A;  3ZRF A;  3R66 C;  2JRI B;  2RSU A;  4GN1 A;  5CX3 A;  3DDC B;  3IG3 A;  4DK5 A;  4DHJ B;  2DZJ A;  4BOZ B;  2R2Q A;  2LJ5 A;  1EUV B;  2IYD B;  3CF6 E;  2J7Q B;  5L83 A;  4JGH B;  3BIN A;  1ZKH A;  1WM2 A;  4AOF A;  1V5T A;  2KOX A;  4NJ6 A;  5AZH A;  1YQB A;  2O6V A;  3PV1 A;  4DHZ E;  2BYE A;  3N30 A;  1GC7 A;  2KDI A;  2GBN A;  1WE6 A;  3H7P A;  5KHQ A;  2N9P C;  3QX1 A;  2KQ7 A;  3L0W B;  2N9E B;  2O6V D;  2JPH A;  4KZC A;  4NQK E;  4KV2 A;  2IO0 B;  3O65 B;  3ONS A;  3UIO B;  5AZF A;  4M8N A;  4FA6 A;  3JSV A;  2CR5 A;  4KIK B;  4NQL B;  5EDS A;  4ZYN A;  2RGF A;  4W9E A;  5CHV C;  1KOT A;  2D11 A;  4ANV A;  2MLB A;  4BKS D;  1WGG A;  1WXM A;  4TQ0 A;  4MGI E;  4W9J A;  1WGR A;  2WX1 A;  1R4M I;  2KK8 A;  1H8C A;  3DCG A;  2KAN A;  3DVG X;  3UQA A;  2BGF A;  2MP2 B;  3BY4 B;  2JZ3 B;  3KW5 B;  2IBI B;  1V2Y A;  2M1M A;  4HDO A;  3VVW B;  2KTF A;  3NY5 A;  1WH3 A;  5D6J B;  3W1S A;  2HD5 B;  1WR1 A;  4NY0 A;  4BOS C;  2N1V A;  1WR6 E;  3B1L X;  1GJZ A;  3WA0 A;  4GMV A;  1ZW7 A;  3CMM B;  4WWN A;  3L17 A;  1WGY A;  4PYZ A;  2M0X A;  3VTV A;  2UWQ A;  4K81 A;  2O6V B;  2DX5 B;  4TUU A;  3ML9 A;  4K1R B;  1WRD B;  2Z0E B;  2ZZP B;  3H7P B;  1WMH B;  3MJW A;  4KDL B;  1Y8R C;  1YIW A;  3TL5 A;  4AJY B;  1V86 A;  3QC8 B;  2GBK A;  2YVC A;  3ECI A;  4EUT A;  5KHO A;  3JSV B;  4HWI B;  2KWU B;  2ZJD A;  4FN2 A;  4HDQ A;  4ICU A;  4BBN F;  2KX3 A;  1E8Y A;  2VRR B;  1Q1O A;  1SGH A;  3KYD D;  2WWZ A;  3DBS A;  4RM8 A;  5E6N A;  4FJV B;  1ZGU B;  3IVF A;  2KX0 A;  1WX8 A;  2O2V B;  3V6E B;  2BWF A;  3N32 A;  1S1Q B;  2G4S A;  5AZG A;  3RUI B;  4OVV A;  1WJ6 A;  2DAJ A;  3RUL A;  3QQ8 B;  4MGK E;  2CHZ A;  5IA7 A;  2M8S A;  4M8M A;  3EC8 A;  1LXD A;  2JVC A;  4G11 A;  4IM3 A;  4JIO U;  4K7S A;  3PSE B;  4TV3 A;  3ZIM A;  4FBJ B;  4GOC A;  3L13 A;  3QHT A;  4ANU A;  2A4Z A;  3PGE A;  2KTR B;  3HK0 A;  5JHA A;  1I42 A;  1UH6 A;  4MDK E;  1P1A A;  1YD8 U;  2K6D B;  3R7R A;  3U8Z A;  2OOB B;  2M17 A;  2MX2 A;  3ZNZ B;  2XBB C;  3M62 B;  2N9X A;  2DZM A;  3P2B A;  4FLH A;  4JLC A;  4PS8 A;  1IP9 A;  3L16 A;  2FUH B;  4GGQ A;  5JZE B;  1L2N A;  3OJ4 B;  2BYV E;  3VUX A;  5DPS A;  4II3 B;  1RRB A;  1UZX B;  3V6C B;  5JHB A;  1P3Q U;  2MWS B;  5TR5 A;  2L76 A;  2ZPN A;  3PT2 B;  2K8B A;  3DOW A;  3Q3J A;  3PS6 A;  4KDI C;  1D3Z A;  2HTH A;  3A1Q B;  2MQJ A;  2ZVN A;  3ZRC A;  3I3T B;  3DVG Y;  4M0W B;  5JH5 C;  3RZW C;  3VH3 B;  1GUA B;  2EKE C;  2FAZ A;  3VXW A;  3PRZ A;  2Y5B B;  2L05 A;  1L7Y A;  1WI0 A;  2LUE A;  3HHM A;  1NBF C;  2N1W A;  5HKH A;  2KVR A;  4XC2 A;  1UD7 A;  2M4N A;  3U7D A;  1E90 A;  3QIJ A;  4DWF A;  1C1Y B;  3RD2 A;  3X23 A;  2WX0 A;  3UF8 A;  4W9K A;  4KVG B;  2A5U A;  4E3C A;  2JF5 A;  4ZDV A;  2KHW B;  2N7D A;  3GZN I;  3M3J A;  1M94 A;  4GDK A;  5D7G A;  2DYM A;  1CMX B;  1WGD A;  3IHP C;  1AAR A;  2KDF B;  2NBW B;  3A4R A;  2BKR B;  2Z59 B;  1PQS A;  1NI2 A;  4IM0 A;  2BPS A;  2JY6 A;  2KD0 A;  3RYT A;  2MSE D;  3B08 A;  1JRU A;  4B6W A;  3A33 B;  1Z2M A;  1VCB A;  4MEL A;  3RT3 B;  3ZTC A;  2G45 B;  2LRW A;  2JXX A;  2N7E A;  4GB9 A;  3PLV A;  1X1M A;  4BKS A;  1GNU A;  1OGW A;  2GBM A;  4W9C A;  2D2Q A;  1C3T A;  4EFO A;  3H1U A;  5DPR A;  3V60 A;  2BF8 B;  2G3Q B;  2NBV B;  4MGY E;  2ZNV B;  1WJU A;  3ZNH B;  2NBU A;  2ZVO A;  2N4F A;  2MA9 B;  4ZRJ A;  3VQI A;  2GMI C;  2IO3 B;  2KLC A;  4FHJ A;  4HPL B;  1OTR B;  1I35 A;  3SU8 X;  3C0R B;  1Q5W B;  3KH0 A;  4ANX A;  4IWP A;  2KNB A;  2LRU A;  4IUM B;  2LVP A;  2ZCB A;  3TIX A;  2AL3 A;  2V1Y A;  2V3S A;  5C23 A;  4BKG A;  2C9W B;  3QAQ A;  4A3P A;  2CKH B;  4XZ4 A;  4J6I A;  3M95 A;  1VD2 A;  3ZDT A;  1RFA A;  4HCP B;  1WM3 A;  3VH4 B;  4F8C B;  5CTR C;  4GDL A;  4WWP A;  3ALB A;  4EZK A;  2RR9 A;  4IM2 A;  1IYF A;  4GDK B;  1J8C A;  2V4L A;  3L10 B;  2LGX A;  4RM9 A;  3UIP B;  3KVF B;  2KN5 A;  2XK5 A;  3CSF A;  2IY1 B;  1IPG A;  2D07 B;  3ML8 A;  3PPA A;  2K8H A;  1WX9 A;  3OLM D;  2G4D B;  1WFY A;  3PZD A;  4MM3 A;  1XQQ A;  2L7R A;  2L8J A;  3QA8 A;  3HIZ A;  2IO1 B;  3L08 A;  3VAW A;  4NPN A;  3VTW A;  1OEY A;  3DBR I;  2KFK A;  4AWJ A;  2WDT B;  2PJH A;  4I6L B;  3W1S C;  5CHF A;  3V62 A;  4MGZ E;  3QJZ A;  2CHX A;  3VHT C;  3ZTD A;  3CST A;  3Q3F A;  4WJO A;  2L0F A;  4NNJ B;  3DQV A;  1HE8 A;  3SHQ A;  3ZKJ C;  4CYE A;  5DPW A;  3N3K B;  3SD5 A;  5D2M B;  3U30 A;  1TBE A;  4I6P A;  3K9O B;  1Q0W B;  1E8W A;  1WXS A;  3IBE A;  3HM6 X;  3MHS D;  3PHW B;  2I1K A;  1NDD A;  3TMP B;  1H4R A;  4KSK C;  4IWQ A;  2D10 A;  3R7Q A;  3W1Y A;  1V6E A;  2JT4 B;  3A9J A;  1ISN A;  3DVN V;  2KDB A;  4GDL B;  2HJ8 A;  1WXA A;  2IY0 B;  2K8C A;  3ZUN A;  5G55 A;  3X0W A;  2K1F A;  3M63 B;  3ZVV A;  2R2O A;  5DPT A;  3WIM A;  4PYU A;  4CO7 A;  2LAS A;  4JQW C;  2XK5 B;  4WWO A;  3R3M A;  2EMT A;  1WYW B;  4IG7 B;  3KYC D;  3WAO A;  1XD3 B;  3K9P B;  1OQY A;  2REX A;  4EZJ A;  5E6O A;  2KWV B;  2DHZ A;  2L00 B;  4DDG D;  2DEN B;  2K25 A;  2EMS A;  3APD A;  2AYO B;  2KFK B;  4AP4 C;  2JRH A;  3ZO5 B;  4MJS A;  1YJ1 A;  2YLM A;  3AU5 A;  2J0J A;  2K39 A;  2L0T A;  3VFK A;  2LVO A;  1YX6 B;  1GC6 A;  3EEC A;  2LD9 A;  4RMA A;  2ZEQ A;  1R4N I;  3JYU A;  5LXH A;  3WAL A;  4B95 A;  1GG3 A;  2C5L C;  1E5W A;  3KUD B;  4DDI D;  1EF5 A;  3PRP B;  1UBI A;  3DPD A;  1OEY J;  4G50 A;  2CS4 A;  2FIF A;  2PPH A;  1V49 A;  3GOE A;  4NJ7 A;  1S3S G;  4IW0 A;  4GXB A;  4ZRI A;  3A4S C;  4LDT D;  3QAR A;  1V81 A;  3A9J B;  2GOW A;  1YX5 B;  1QZE A;  2C7H A;  3JVZ X;  4MEM A;  2C60 A;  2NPT A;  2ZNV C;  5E6P A;  2MP2 A;  3WAP A;  2LI5 A;  2IZV B;  4F7Z A;  4HK2 A;  2OJR A;  4YL8 A;  3ZLZ A;  2FNJ B;  4A3O A;  2AEH A;  3OAW A;  3PHX B;  4AUQ C;  2MBQ A;  1WIA A;  2GBJ A;  1WZ0 A;  4LCD E;  3DVN U;  2MBE A;  3PLU A;  4FAD A;  3WAM A;  2RPQ A;  4BBN C;  1XT9 B;  1UEL A;  4WJP A;  1F9J A;  1SE9 A;  3LDZ E;  3VDZ A;  2ZCC A;  3PRE A;  2FCQ A;  1WJ4 A;  2LVQ A;  2KFJ A;  1SIF A;  3QWZ B;  4TQ1 A;  1P98 A;  5BO4 B;  2MBO A;  1BT0 A;  3VUY A;  1T0Y A;  4BVU C;  4MJS B;  3EFU A;  3SDL C;  3ZNI D;  1WX7 A;  2KLG A;  1UGM A;  4BKT A;  4G0N B;  2WYQ A;  2PE6 B;  3JW0 X;  2BWE S;  4HXD A;  2AWT A;  3RZF A;  3T9L A;  3H7S A;  4WAA A;  1MG8 A;  1WMH A;  3APC A;  3AUL A;  2I1J A;  3OJ3 A;  4JL9 A;  4X57 B;  2LWP A;  4FHK A;  4IC7 B;  2KMA A;  2KJ6 A;  2KJH B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...