4ZYNA

Crystal structure of parkin e3 ubiquitin ligase (linker deletion; delta 86-130)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
420
structure length
367
Chain Sequence
MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIACTDVRNPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVCPRPGCQGQTCEGCGFVFCRDCKEAYHCDSYRVDQRAAEQARWEEASKETKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
publication title A Ubl/ubiquitin switch in the activation of Parkin.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 73
structure length 367
sequence length 420
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zynA01
5KHOA 2IYDB 2NBUA 4M8MA 3LJ3A 2J7QB 1YJ1A 4GOCA 2AWTA 2CR5A 3P2BA 4IW0A 2PE6B 5DPWA 4ANVA 2D2QA 3R7QA 2UWQA 3RULA 4HPLB 1YX5B 1E5WA 3HIZA 4NJ6A 3QWZB 4JL9A 4JLCA 4HVBA 3ZW3A 2BPSA 4FULA 3ZNID 1J19A 4HCPB 2NR2A 4ZYNA 2KKCA 3RZFA 3T8MA 3TL5A 3W1SA 1RLFA 3HHMA 3IHPC 3SU8X 2IY0B 3DQVA 4HDOA 5JHAA 1WJUA 3MJWA 3QC8B 2JUOA 4TV3A 2J0MA 1IYFA 2ZCCA 5DPTA 2NCNA 2RPQA 3S2AA 2IO1B 5E6NA 4GDLA 3DCGA 4KDIC 3VTUA 5D7GA 2LVPA 2PE9A 2WDTB 4DHJB 2IO3B 3ZRFA 2LUEA 3Q3FA 4XX5A 2G4SA 4MEMA 3ZNGC 1E7UA 5CTRC 4KSLC 1WM2A 5DPRA 4LCDE 5JH5C 3U7DA 3D32A 4GIVA 4IWPA 2FCMA 4ZRJA 3TIXA 1P0RA 2MP2A 2KMAA 3ZO5B 4URKA 5CHWA 5HKHA 2KZRA 4KZ0A 4YL8A 1M94A 3ENEA 2M8SA 3R7RA 3V6EB 3UIOB 3DVGX 4EFOA 2L00B 2BGFA 2A5UA 2MA9B 1UH6A 1E8ZA 1FXTB 2Z0EB 1D3ZA 3RUIB 2OJRA 5AZGA 4DHJD 3ZDMC 2NPTA 3DBSA 2ZVOA 3LDZE 1YX6B 2BWFA 3VHTC 2LVQA 2KQ7A 1XT9B 3NOBA 3A9JB 3VQIA 3PREA 4FHKA 2MBOA 5GMVA 4AJYB 3M95A 4HCNB 3ML9A 3PHXB 2NBVB 4W9EA 3NZSA 3PS6A 4GDKB 2D07B 4BOSC 2C7MB 3H6NA 5E6OA 3L0WB 2UYZB 2L7RA 4K7UA 4HK2A 3VTVA 3L54A 3V62A 1E8YA 4BOZB 2KNBA 3PVLA 4B9KA 1E8XA 2REXA 2KANA 3QCAA 2GBNA 4IM0A 4ICUA 1GC7A 4FJZA 2BYEA 4FA6A 2DZKA 5J2RA 3BY4B 4IM2A 3DVNU 4NJ7A 2DZMA 2KDBA 3KUCB 1NI2A 2O6VB 4LJOB 3PGEA 4HWIB 4E3CA 3QA8A 4JQWC 5JHBA 3H1UA 3VTWA 4GN1A 4RM9A 3AXCA 3HM6X 1YD8U 1OGWA 3VUWA 2HD5B 1L7YA 4EOYA 2FUHB 1UZXB 1SE9A 1GG3A 3B0AA 2ZEQA 4K7WA 4PS7A 5G55A 3ZDTA 4ANXA 4DDID 2D11A 3L08A 2HE7A 2MBBB 1WM3A 4IG7B 2QHOA 3ZTDA 4FN2A 2N9PC 4MDKE 3DBRI 4B95A 3UQBA 2WWZA 4CHKA 4AWJA 2RD0A 2N7DA 3R66C 3VXWA 2K8HA 2O6VD 3H7SA 1J8CA 1HE8A 1V5TA 4BKSA 3A1QB 3KH0A 2D10A 4LDTB 1Y8RC 3RZWC 3U30A 5IA7A 3TCAA 1TBEA 4DK5A 1KLVA 2WYQA 2IY1B 2KVRA 3UGBB 2LWPA 2DAJA 3JW0X 2KLGA 2N9EB 3M62B 3VAWA 3NZUA 4MH0E 1K8RB 2CHWA 4ANUA 2HJ8A 2D3GA 4NPNA 3QARA 4WJPA 2MBHA 2KTFA 4I6NB 2YLMA 2LRUA 2CHZA 2KWCA 5D2MB 3V61A 1WJ6A 4WWNA 4M0WB 5AZHA 2RGFA 3BINA 3JYUA 2DYBA 2C9WB 3AI5A 1LFDA 3OLMD 4W9CA 4FLHA 4MM3A 1ZKHA 2V4LA 3HK0A 4LDTD 4PS3A 3ZIMA 1WH3A 3A9JA 3QAQA 1S3SG 3A33B 2IO2B 1WGHA 3TBLD 1RAXA 3Q3JA 4IC7B 3TMPB 3WAOA 4OVUA 2NS5A 2Z59B 2FIFA 4HDQA 4GMVA 2C7NB 3QQ8B 2XK5B 3PHWB 4NNJB 4GDKA 2M17A 3L17A 4BKTA 3U8ZA 4F1SA 4KV2A 1ISNA 1LQBA 2Z0DB 2NBWB 5TR5A 4TQ1A 1WI0A 4MSMB 4WJQA 3ALBA 1OQYA 3UF8A 4G3XB 4BBNC 2K6DB 4W9HA 5C1ZA 3QJZA 2NVUI 5BO4B 2O6VA 2JZ3B 4JIOU 4NAWB 3PRMB 2KDFB 3RT3B 2J0JA 1WGDA 4EUTA 2GOWA 2CU1A 3SD5A 1WX7A 3PLVA 1C1YB 4MGKE 4GXBA 2ASQA 1NDDA 4IUMB 1Q1OA 2IO0B 2MRPA 2C7HA 3W1YA 3WALA 2EMSA 2G45B 2PPHA 4II3B 1A5RA 3OJ4B 2WX0A 1E90A 2LVOA 2LXAA 3ML8A 3SHQA 3GZNI 2N1WA 2FIDA 2GBRA 1XQQA 3N3KB 4KDLB 3APFA 3VUXA 4BKSD 3RCZA 1WYWB 3WANA 4MJSB 3L13A 3WAMA 1VCBA 2JPHA 3NY5A 2Y5BB 2I1JA 1JRUA 1WXVA 4PYZA 2FCNA 2GBMA 1WIAA 2BF8B 3PPAA 2MBEA 3H7PB 1R4NI 2HTHA 2WX1A 4W9IA 4EZKA 3UQAA 1BT0A 3VH3B 2PEAA 3RD2A 4G0NB 2ZPNA 4F8CB 2PJHA 1WXSA 4K7SA 2G4DB 2L76A 4MGZE 3WIMA 2OOBB 2KWVB 5AEKB 1UGMA 1ZW7A 2FNJB 4BBNF 4EZJA 3X0WA 5J18A 4KZCA 2MW5A 2LZ6A 1KJTA 2GBJA 2XEWA 5KHQA 3CSTA 3QK0A 4WQOB 2KFKB 1C3TA 2IBIB 2J0KA 3L10B 2DAFA 2JF5A 5LLIA 3NS8A 4W9FA 1Z5SB 2JRHA 3A4RA 4DHZB 2MX2A 3VVWB 2ZPYA 3DBLI 2KJRA 3EC8A 3OAWA 4PS8A 4TUUA 4KVGB 1F9JA 1GUAB 3M63B 3IG3A 4I6LB 4IM3A 3RYTA 4MGYE 3VH4B 4AP4C 3PZDA 2XK5A 3N30A 2DYOA 4K81A 3VDZA 4EKUA 2RR9A 3EECA 2CKHB 4HJKA 4GSWA 4CYEA 1WGGA 1WRDB 2DZIA 2ZCBA 2RSUA 2V1YA 1OTRB 1X1MA 3AU4A 4LJPB 2N9XA 4E71A 4W9DA 2AYOB 4FBJB 2B3AA 3R3MA 1WY8A 1UD7A 1J0GA 4N9F4 1GJZA 2KHWB 2I1KA 1Q0WB 3ZNHB 5CX3A 1Z2MA 2KK8A 3KVFB 4NAWA 3NHEB 2KC2A 2L0TA 3W1SC 4ASWC 4BKGA 3L16A 1WXAA 2LGYA 1ZGUB 3EHVA 1YIWA 4MSQB 2FAZA 3ZKJC 2KTRB 2ZJDA 1LXDA 1WR1A 1WGRA 4GB9A 3IVFA 1P3QU 2LJ5A 1UBIA 1LM8B 2EMTA 2R2QA 3CF6E 3N32A 4HPMB 1L2NA 4ZRKA 4EZLA 2R2OA 2K8CA 1WMHB 4ANWA 2MQJA 1WE6A 4W9KA 4GGQA 2JZZA 4PYUA 1G6JA 5D6JB 5C23A 4MJSA 3APDA 4TQ0A 1WJ4A 1UELA 4G11A 1YQBA 3DOWA 5J17A 2JRIB 4WWPA 2KC1A 4NQKE 2MWSB 2LGDA 4F7ZA 2O2VB 2GBKA 2ZNVC 3H7PA 2MLBA 2BKRB 4A3OA 1KOTA 1S1QB 3DVGY 2AEHA 4WJNA 2LD9A 2KLCA 1PQSA 2KD0A 3H9DA 2K6QA 1TGZB 4HLEA 3ZRCA 1H8CA 2KQSA 2KDEB 3PRPB 1CMXB 3DDCB 3APCA 5D94A 3B08A 2MSED 4I6PA 1AARA 2M4NA 1V81A 3EFUA 4KIKB 1NBFC 4IWOA 4X57B 5JZEB 2KFKA 3WA0A 4E74A 3PRZA 1I35A 1OEYA 2KDIA 3CMMB 3JVZX 3DVNV 2KXJA 2KJ6A 2BKFA 3MHSD 3VUYA 3PT2B 2C60A 3JSVB 2N4FA 2KOXA 3KYCD 2DYMA 3K9OB 3KUDB 1IPGA 1T0YA 3A9KB 2BWES 3PTFC 4A20A 2MBQA 2LI5A 3QX1A 1WX9A 1GC6A 4DWFA 3T9LA 3KYDD 2M0XA 4J6IA 3ZLZA 1XD3B 2K39A 2LRWA 3MTNB 2JT4B 5IAAC 3SDLC 3ZNZB 3ECIA 1P1AA 3KUZA 2FCSA 4GU2A 1SGHA 3A1QA 5DCNA 4EEWA 2L0FA 4FADA 2KJHB 1QZEA 1WGYA 4W9JA 2KX0A 3B1LX 1V86A 2AL3A 2G3QB 3KW5B 1WE7A 3ZTCA 4RMAA 4AJWA 1OEYJ 3V6CB 3HM3A 4DDGD 4ZDVA 1H4RA 2IZVB 4CO7A 1MG8A 1V9JA 2A4ZA 3M3JA 4M8NA 3GOEA 4FJVB 2CS4A 2KTRA 4MGIE 3PSEB 2LASA 5L95C 2KX3A 4P7IA 3O65B 4KSKC 1SIFA 4W9LA 1V5OA 4MELA 3ONSA 2V3SA 2MCNB 5L83A 5DPSA 1V2YA 4NY0A 3QIJA 1WMHA 1WX8A 4ICVA 3WAPA 5CHVC 5LXHA 4DBGA 3UIPB 2L3ZA 3K9PB 1WR6E 4DHZE 1WF9A 4IWQA 4GDLB 4XZ4A 2GMIC 1V6EA 2K1FA 1WZ0A 1VD2A 2C5LC 4G50A 1I42A 1GNUA 2CHXA 4OVVA 2N7EA 3I3TB 2O2VA 1EO6A 1P98A 1P9DU 4HXDA 2KMCA 4II2B 1Q5WB 3VFKA 1U4AA 4JGHB 4FHJA 4BVUC 4W9GA 3AULA 3IFWB 2KO3A 1V80A 5CHFA 4WAAA 2VRRB 4AOFA 3IBEA 2L05A 2ZNVB 4WWOA 5EDSA 1KM7A 4FJYA 3TJPA 2LGXA 1TTNA 2M1MA 2MP2B 2FCQA 4TKNA 5FR6A 2L8JA 1EUVB 4ZRIA 4XC2A 3V60A 4KIKA 3OJ3A 1WJNA 2ZZPB 2DHZA 3ZVVA 4DXAB 3DPDA 1V49A 4NQLB 4AUQC 2EKEC 3DBHI 3C0RB 4A3PA 1WZ3A 3PLUA 4WJOA 1RFAA 1E8WA 4K1RB 1WFYA 3JSVA 2NPTB 2W9NA 3PV1A 1UBQA 2K25A 2JXXA 3QHTA 2DENB 2DZJA 2JWZA 2ZVNA 3A9KA 1E7VA 2DX5B 2LXCA 3UINB 1WXMA 5AZFA 1EF1A 1R4MI 5LXIB 1EF5A 2KN5A 2KFJA 2AL6A 3X23A 5E6PA 2BYVE 2JVCA 4B6WA 2N1VA 2YVCA 2KWUB 5G2NA 4RM8A 3AU5A 2BYFA 2XBBC 2K8BA 4BFRA 1RRBA 2JY6A 3ZUNA 1IP9A 3A4SC 1TZ1A 3CSFA
chains in the Genus database with same CATH superfamily
2IYDB 2J7QB 2IPKD 2CR5A 4ANVA 1HZ5A 3R7QA 2LFIA 4KX6B 1DOYA 3ZW3A 2BPSA 2MJ3A 4FULA 4HCPB 2KKCA 3T8MA 1RLFA 4KKIA 3FILB 5HFYA 3SU8X 2IY0B 4QAYA 1FNWA 2WS3B 2WXIA 1YN4A 1AWDA 2K9XA 3EFCA 5DPTA 3S2AA 4OVZA 2IO1B 3BWUD 4C56C 3Q8BA 5D7GA 2LVPA 3J9CA 2AQ2B 2WDTB 2IO3B 1JALA 4RF1A 5CTRC 5DPRA 2KDMA 3D32A 2RMMA 2X38A 1GB4A 1BUIC 1Y56A 4K3CA 5HKHA 3ENEA 2L00B 1T3QA 1WSPA 1E8ZA 1YJIA 2PW9A 3ZDMC 3DBSA 4MM3B 5BMIA 1XT9B 4C4VB 2MBOA 4AJYB 5T8IA 3ML9A 1YMHE 2NBVB 2LMCA 3NZSA 1MHHE 4GDKB 2D07B 4BOSC 2C7MB 3H6NA 1PFDA 5H92C 2UYZB 4JX1C 2L7RA 3U52E 3PVLA 2REXA 2GBNA 1UWMA 4IM0A 4ICUA 4IOIE 4FJZA 5J2RA 1TS4A 3BY4B 1CZPA 3DVNU 3KUCB 2O6VB 3HVZA 5I4DA 3PGEA 2WXOA 1L7YA 1UZXB 4TMAB 3B0AA 2D11A 2KAJA 4IG7B 1JCKB 3DBRI 2PVGC 4CHKA 2LHEA 3EA6A 1PGXA 3A1QB 1Y8RC 2WYQA 1D4BA 1IUEA 5FK9C 4M01A 3NZUA 4ANUA 4RGMA 2CJNA 2HJ8A 4JPSA 4HKQA 3UI3A 2LRUA 3PZ7A 5D2MB 1WJ6A 3BINA 1LFDA 2MJEA 4PS3A 3BVZA 3RNGC 3ZIMA 3A9JA 3CWIA 4HDQA 3CIRB 4HRSA 4WURA 2XK5B 2M17A 3L17A 4AQ7A 3MC8A 2INDC 1ENFA 3MC9A 1CJEA 4J3OD 3ALBA 4OZBA 1OQYA 4BBNC 4W9HA 1L4ZB 1HEZE 2KVZA 1K50A 2CJOA 4EUTA 1TS3A 2CU1A 1QILA 1I4XA 4MGKE 3RNCC 1NDDA 1Q1OA 2IO0B 2MRPA 3GS2A 2K22A 2EMSA 3L4PA 1A5RA 4II3B 5IOIA 2KN4A 3OJ4B 3ZJTA 1E90A 1SJED 2LXAA 1N5WA 3W2DA 3NVWA 4BKSD 1WYWB 3WANA 1E0ZA 1VCBA 4ZHOA 2I1JA 1LO5D 2GBMA 3PPAA 3H7PB 1R4NI 1N63A 4XE0A 2HTHA 4W9IA 1NYQA 4MACA 3VH3B 2PEAA 4G0NB 2PJHA 4K7SA 5AUKA 3BK2A 3WIMA 2OOBB 2DLBA 5AEKB 4EZJA 3X0WA 2WXHA 2LZ6A 2GBJA 3QK0A 2KFKB 5LLIA 1Z5SB 1YOVB 2MX2A 2H88B 1V1PA 1GUAB 3AEGB 3P63A 2DYOA 4JWUC 2QILA 1ET9A 4YSYB 3OG5A 1HTOA 2Z8LA 2DZIA 2V1YA 1OTRB 2XN9C 4LJPB 4BAXA 2M0AA 4FBJB 3R3MA 1YQ4B 2D3CA 3ZNHB 5CX3A 3KVFB 4NAWA 2LGYA 3KLSX 1YIWA 2FAZA 1MFWA 3ZKJC 5HHDG 2ZJDA 2MJDA 2G9HD 3R8BA 3IVFA 1UBIA 1LM8B 2EMTA 3N32A 4ZRKA 3W9CB 4ANWA 1WE6A 3B2GA 4GGQA 2JZZA 5D6JB 5C23A 3APDA 4P6VF 3OWEB 2JU6X 2M56B 3DOWA 4RGOS 5J17A 2JRIB 2JSVX 2O2VB 3N20C 2GBKA 2BKRB 4A3OA 2RPVA 4WJNA 1PQSA 2CU3A 2WXRA 2GLSA 2K6QA 4HLEA 1UUPA 1CMXB 4OZCA 4I6PA 4S0RA 1F77A 1AARA 2L32A 2QCZA 4USAA 4KIKB 2W82A 5BYQA 4KGRA 3URYA 1NBFC 1QT9A 3WA0A 3PRZA 1STEA 1HQRD 3CMMB 3JVZX 2FBWB 4OZAA 4XDDA 2C60A 2IGDA 2PKOA 4A9AA 2BWES 3PTFC 4A20A 1EWYC 3T9LA 2M0XA 3ZLZA 5H8YE 2LRWA 1XEEA 3GB1A 1K52A 3A1QA 5DCNA 4BZAA 4EEWA 2L0FA 4FADA 2KJHB 1QZEA 1WGYA 2KX0A 1V86A 2G3QB 3KW5B 4UDUC 1WE7A 2E6XA 1H4RA 3AE4B 2N0SB 3M3JA 4M8NA 4FJVB 3PSEB 2LASA 1MHXA 1B9RA 2WXPA 1QLBB 2R61A 5L83A 2V3SA 2Y5CA 3I9V1 1WMHA 4ICVA 4LNKA 1C76A 1DOXA 3UIPB 1WF9A 3GZNB 1ZDXA 5C3JB 1WZ0A 1VD2A 2C5LC 1XF5L 1I42A 2N7EA 1P98A 4RNAA 4II2B 4JGHB 5CHFA 2KO3A 2VRRB 3HRDD 3IBEA 2L05A 4WWOA 1ZOYB 3TJPA 4FJYA 4LNNA 1FIQA 3IAM1 4XC2A 3V60A 1WJNA 2ZZPB 4NQLB 2WXJA 1QKZA 1E8WA 1FNVA 2W9NA 2JXXA 2DENB 2ZVNA 2JWZA 1E7VA 2AX5A 2DX5B 3DBLB 4L23A 2KFJA 1L0XB 3KWVA 2FE8A 1FFUA 1E10A 3NG0A 4IW0A 3HIZA 4JL9A 1L0YB 4YXDB 1HTQA 3Q8FA 4JLCA 2GI9A 1T0RC 3ZNID 1TKYA 3W1SA 4ZYNA 3NVYA 4A6QA 4HPPA 1TKGA 3I5JC 4HDOA 4ZRPA 1KRHA 2VH1A 2WXMA 2RPQA 1FXAA 5E6NA 2WGSA 4GDLA 3DCGA 2W54A 2PE9A 1JMLA 4DHJB 3Q3FA 1NYRA 4XX5A 2G4SA 4MEMA 3ZNGC 1E7UA 4KSLC 1PDXA 2DNFA 2K5PA 2KMAA 3ZO5B 1T0QC 4URKA 5CHWA 4HROA 1M94A 3R7RA 3V6EB 3DVGX 4EFOA 2BGFA 2A5UA 2MA9B 1UH6A 4C7ZA 1SBBB 5AZGA 1SB3C 2NTTA 1L4DB 3VHTC 3A9JB 3VQIA 2RDGA 3PREA 4FHKA 1IGDA 1NVID 3PHXB 2I2YA 1SE4A 2SAKA 4W9EA 3PS6A 1GPXA 1HXYD 2L1AA 5IO9A 4IKGA 3AN1A 1E8XA 3AB5A 3P1MA 3QCAA 4ZHPA 2DZMA 4E3CA 4LNFA 4JQWC 3H1UA 4ACFA 3AE6B 3FAHA 2BQQA 3HM6X 1UGJA 3RI7C 2FUHB 4C80A 1GG3A 1MG4A 2ZEQA 4K7WA 4ANXA 2HE7A 1ZXHA 4MDKE 3UQBA 2WWZA 4C00A 2RD0A 2N7DA 4MT5A 1N61A 2O6VD 3LYYA 2NMQA 2KYWA 3P4RB 4BKSA 1WGKA 3KH0A 3RZWC 1KLVA 3TCAA 4DK5A 5HG2A 3UGBB 1RM6C 2KVRA 3VAWA 1K8RB 1WWTA 2CHWA 1TKEA 2J4XA 3QARA 3Q8AA 2MBHA 3AE7B 3N1XC 4I6NB 2YLMA 2KWCA 2KWDA 4KGSA 4WWNA 5AZHA 3RFZB 2RGFA 3JYUA 4FLHA 2H89B 2V4LA 4N6EB 3NUHB 2E3TA 1WGHA 2QEJC 3TBLD 3TMPB 1V1PB 4OVUA 1VJKA 3RMKC 3VR8B 4BKTA 2KMMA 4F1SA 1ISNA 3Q2AC 1R4MB 2WXQA 4TQ1A 5EE9A 1XLPA 1WI0A 4WJQA 1PUTA 2K6DB 4REZA 2PTLA 3ZYYX 3C19A 2PVOD 2YEPB 2JZ3B 3SFEB 4JIOU 4NAWB 3PRMB 1VRAB 3GP7A 4US8A 1BMLC 2GOWA 3DWMA 1WX7A 5IKCM 4IUMB 1FD6A 3W1YA 2C7HA 3WALA 5BYSA 2G45B 4YSZB 2WX0A 2J42A 3GZNI 2FIDA 2LJIA 3N3KB 3APFA 1TYGB 1JQ4A 2QIEB 1ACCA 3NY5A 2Y5BB 4PYZA 1EU3A 3AE1B 3UQAA 4XYCA 1J7CA 2D3BA 2WXLA 3EGRA 1A70A 1ZXIA 3AEEB 1E6EB 5BMHA 3BIID 1SXTA 1ZW7A 2FNJB 4K3BA 4KZCA 4M0WA 3CSTA 3AEFB 1ZE3D 2J0KA 2DAFA 2JF5A 1F2RC 2IJ0A 3ZJUA 3DBLI 3RN9C 2KJRA 4PS8A 4KVGB 1F9JA 3M63B 4IM3A 3RYTA 4MGYE 3N30A 4K81A 2CKHB 4HJKA 2W55A 4GSWA 1WRDB 1L6VA 4LK0M 4LLGM 3AU4A 1TJEA 2N9XA 4E71A 1C9FA 1KLGD 1WY8A 1J0GA 2KHWB 3MFGA 1Z2MA 3W1SC 1TZOA 2WU2B 4MSQB 4NZLB 2JQRB 4GB9A 4HPMB 1L2NA 4EZLA 1DOIA 1WMHB 4YTPB 3TSSA 2MQJA 4MJSA 2LGIA 4G11A 3ABVB 3TUOA 5LNK1 4NQKE 1J7AA 2MWSB 1AW7A 2ZNVC 1S1QB 3DVGY 2AEHA 2N9LA 3VRBB 3W5VB 2UU7A 3APCA 3B08A 2JXTA 1YQ3B 4X57B 3BZDB 3NVZA 5E6JA 3DVNV 3VUYA 3PT2B 3BVGA 3KUDB 1T0YA 3QX1A 5IP4D 2L52A 1GC6A 1NEKB 3RPFC 2BB6A 4LNIA 1VZ6A 4L2YA 1YNTE 3MTNB 3SDLC 3ZNZB 3FKYA 1FM0D 1OEYJ 1UWXA 3V6CB 4ZDVA 2IZVB 3E9SA 1SE3A 5L95C 1PGAA 1SIFA 4W9LA 2QJLA 2ONQA 1V2YA 3DHHC 3Q3MC 3QIJA 4NY0A 2VH2A 5CHVC 5LXHA 3NS1A 1L5PA 4DBGA 2L3ZA 1MVKA 3TEYA 3H8HA 4DHZE 4GDLB 1C77A 2BYTA 5FKAC 5G5GA 3I3TB 1EO6A 1P9DU 1U4AA 4BVUC 4FHJA 3AULA 3IFWB 3AMZA 4WAAA 1V1OA 2ZNVB 5EDSA 4GLSC 3B9JA 4ZRIA 3OJ3A 2DHZA 1SSNA 4DXAB 5IN7A 1TY0A 3C0RB 3PLUA 3JSVA 2Q5WD 3Q3NC 3PV1A 3AH7A 3A9KA 2LXCA 1R4MI 4P16A 2JVCA 2YVCA 2KWUB 3AE9B 1KFYB 2LHDA 2XBBC 3AV8A 2AQ3B 1IP9A 3TEWA 5KHOA 3Q3OC 3LJ3A 1IBXA 1YJ1A 4GOCA 2AWTA 2PE6B 2V9HA 3IXSA 5DPWA 2BS2B 1YX5B 1E5WA 4Q2JA 4YTMB 4HVBA 2MHJA 1J19A 3RZFA 3IT4B 3TL5A 5D3DA 4ZOHC 2LUMA 3DQVA 3IAS1 3MJWA 3QC8B 4O1NA 2JUOA 4TV3A 5G5HA 2PLPA 2ZCCA 4HEA1 2MEKA 4KDIC 2JZPA 2LUEA 3HUIA 1WM2A 5JH5C 1QOAA 3U7DA 4IWPA 2FCMA 4ZRJA 2MP2A 3LB8C 2KZRA 2V3NA 1VZ7A 4KZ0A 2M8SA 3UIOB 1FXTB 2M19A 1MI0A 2OJRA 3DWGC 4DHJD 2NPTA 4R3DA 3LDZE 2ZVOA 1YX6B 1OQRA 3V05A 2LVQA 2KQ7A 1TIFA 2EELA 3NOBA 3NRZA 1QOBA 5GMVA 3M95A 4HCNB 4OHJA 3E56A 4N58A 5E6OA 3L0WB 3L54A 3V62A 2KANA 2BYEA 4IM2A 1ZPSA 2K0PA 2KDBA 3U2SC 3U4EG 3QA8A 2JYTA 5JHBA 3N1ZC 4GN1A 1JWUD 1QOFA 3ZXVA 4WIPA 3AXCA 1YD8U 1KLUD 1I4PA 1OGWA 4IDIA 1SE9A 3ZDTA 3AEAB 1WM3A 3ZTDA 1FCCC 1GB1A 4B95A 4AWJA 3VXWA 3H7SA 3ZQ4A 4A8XC 4DQOC 4LDTB 2D10A 5IA7A 1TBEA 3MP9A 2IY1B 1SE2A 2LWPA 3JW0X 4KKJA 3M62B 2N7JA 1IGCA 2D3GA 2KT7A 4NPNA 1T6BX 2ACZB 4RFBA 3Q8CA 1LGRA 2CHZA 4M0WB 1D5ZC 2DYBA 1I4RA 4W9CA 1F2RI 3AI5A 1JRPA 3Q6BA 1WH3A 4RGTA 1S3SG 2WLBA 2IO2B 3A33B 3WAOA 1RAXA 3Q3JA 4IC7B 2FIFA 3PHWB 5FR3A 3U8ZA 1ET6A 5HI1A 5TR5A 4MSMB 3I57A 3SR6A 2NTSA 1E7PB 2NVUI 1YJJA 2KDFB 2J0JA 1WGDA 3SD5A 3PLVA 3BVMA 1C1YB 1XLOA 1RWSA 4GXBA 2ASQA 1GOZA 2J52A 3KWLA 2N1WA 2RDHA 3VUXA 3RCZA 4MJSB 3L13A 3WAMA 2JPHA 4MH8A 1JRUA 1WXVA 4EE2A 1WIAA 2BF8B 2WX1A 4EZKA 1BT0A 3SFDB 4F8CB 1RYJA 1E9MA 2G4DB 4MGZE 1UGMA 4BBNF 2N9KA 1F1HA 1Q10A 1KJTA 1N5XA 2GRIA 4ITKA 3L10B 3NS8A 4W9FA 3A4RA 2GB1A 3VVWB 1SEBD 3OAWA 4I6LB 3IG3A 3VH4B 4AP4C 3PZDA 3NZ3A 3VDZA 3EECA 2W3RA 4CYEA 1WGGA 2ZCBA 2RSUA 4W9DA 1UD7A 2ZW0A 1K53A 5AUIA 2HJ1A 2QC8A 3NJTA 3NHEB 2KC2A 2L0TA 4ASWC 2W3SA 3L16A 1TY2A 4NJCA 2I38A 1WR1A 1WGRA 1EM7A 3CF6E 1P7EA 2R2OA 4XWWA 3HVDA 2K8CA 3PO0A 4JE3B 4W9KA 4PYUA 1G6JA 3Q69A 3SEBA 1WJ4A 3ZGZA 1F0ZA 1YQBA 3LXFA 2OJWA 1TT5B 4WWPA 2KC1A 2LGDA 1I4HA 1ROEA 4F7ZA 4PT5A 2BVCA 2WXFA 2OHFA 5TSSA 2KD0A 3H9DA 2PMVA 3WCQA 1H8CA 1P7FA 2BTEA 3PRPB 2V0GA 2M4NA 1V81A 3EFUA 4IWOA 4E74A 3AECB 3MHSD 3JSVB 2JX5A 2N4FA 1D5XC 3KYCD 2DYMA 3K9OB 3A9KB 1N62A 4TSSA 2WNMA 4S17A 4J6IA 5BYRA 2XNAC 1XD3B 2K39A 5IAAC 3ECIA 4GU2A 1AN8A 2FCSA 1IBXB 2J53A 2AL3A 2OEDA 2LEKA 4RMAA 2INNE 1JWMD 2ICIA 4DDGD 4CO7A 1MG8A 1NENB 1EU4A 3GOEA 2CS4A 2KTRA 1SF0A 1V5OA 4KGTA 2Y5PA 1ZP0B 3ONSA 3BK1A 5DPSA 1WX8A 3WAPA 1UNSA 2KQ4X 4ZYSA 3ETRA 1I7HA 5EE0A 4RGNA 4WQMA 2DWQA 1D5MC 1WR6E 2VZKB 2SEBD 4IWQA 4XZ4A 2GMIC 1V6EA 2K1FA 1DYQA 1C4CA 2WXNA 2CHXA 4HXDA 2KMCA 3VFKA 3AE3B 1V80A 1M4VA 2TSSA 4DXGA 2JWUA 1XLQA 1KM7A 2JYEA 2IDYA 2M1MA 2MP2B 4TKNA 1FRDA 1T0SC 5FR6A 2L8JA 3T3OA 1V49A 1AYFA 2EKEC 3RNBC 1WZ3A 1RFAA 2Y3AA 4K1RB 2NPTB 3QHTA 2DZJA 4M00A 2KACA 2WDRB 1WXMA 5AZFA 5LXIB 1EF5A 2KN5A 2QMTA 5EE3A 1FMAD 2K3UA 4RM8A 3AU5A 2BYFA 4ARIA 2K8BA 2JY6A 1R7SA 3A4SC 3UINB 2NBUA 4M8MA 1C79A 3P2BA 2D2QA 2UWQA 3RULA 4HPLB 4NJ6A 1C4PA 3QWZB 2BBCA 2PIAA 2NR2A 3HHMA 3IHPC 5JHAA 1WJUA 3IT6B 2J0MA 1IYFA 2NCNA 1B1ZA 3R2IA 3VTUA 3RNFC 2QDFA 1VZ8A 3ZRFA 1KF6B 1WRIA 1FO4A 2WU5B 1L0VB 4LCDE 3N1YC 1MJDA 4GIVA 3TIXA 1P0RA 1JWBD 4YL8A 3GE3C 1VDVA 2Z0EB 1J7BA 1D3ZA 3RUIB 2D5GA 3AE2B 1JWSD 2BWFA 3FC4A 4RCOA 4AS1A 3GE8C 4US9A 5JXVA 1N60A 1CQVA 4P1CC 4K7UA 3I63C 4HK2A 3VTVA 1VLBA 1E8YA 4BOZB 2HDEA 2KNBA 4B9KA 2D3AA 1GC7A 3P4SB 4FA6A 2DZKA 4YWGG 4NJ7A 1NI2A 3P4PB 1JW9D 4LJOB 4HWIB 3NVVA 1C4AA 3VTWA 4RM9A 3FILA 3P4QB 1PGBA 3VUWA 2HD5B 4EOYA 4PS7A 5G55A 4OW0A 1VR9A 4DDID 2L83A 3L08A 2MBBB 2QHOA 2WXKA 4FN2A 1RFKA 2N9PC 2RDBC 3T3NA 3R66C 3Q8EA 4B0MA 2K8HA 4P1BC 2WDQB 1J8CA 3O13A 1HE8A 1V5TA 1V97A 1GAQB 2BB5A 3U30A 2DAJA 2KLGA 2N9EB 4MH0E 2YEPF 5GXGB 4DXFA 2DBYA 4WJPA 2KTFA 4HKZE 2X8XX 3V61A 4A90A 3AEBB 2MH7A 2C9WB 1JROA 2QSDA 3OLMD 4MM3A 1ZKHA 4LDTD 3HK0A 2B76B 4C4VA 3QAQA 3DBHB 2BS3B 2WP9B 2NS5A 2Z59B 4GMVA 2C7NB 3BYTB 3QQ8B 4NNJB 4GDKA 1SJHD 2AQ1B 4H2AA 4D2KA 4KV2A 1LQBA 1F52A 2Z0DB 2NBWB 1EWCA 4A55A 1YN5A 3UF8A 4G3XB 4ZRQA 2FUG1 5C1ZA 1I4GA 3QJZA 5BO4B 2O6VA 5MPOA 3RT3B 1D6EC 3Q14C 1V8CA 4YSXB 2BS4B 1QF6A 2V4IB 3C8YA 2PPHA 1CK1A 2LVOA 3RNEC 3ML8A 3SHQA 4PK1A 2GBRA 3N9YC 4FXCA 1TS2A 1XQQA 4KDLB 1L6UA 4M02A 1WXQA 1SIJA 2BW2A 3MHZA 2FCNA 2MBEA 4WWMA 3AE5B 3KQ4A 3VR9B 4N59A 2EKIA 3AM9A 3RD2A 1BXTA 2ZPNA 1WXSA 4CQNA 2L76A 3RNAC 5D3IB 3DHGC 4JWSC 2KWVB 5J18A 2MW5A 2XEWA 5KHQA 3DHIC 4WQOB 1C3TA 2IBIB 4XGAB 4XDCA 2JRHA 4DHZB 1WYGA 2ZPYA 4L1BA 3EC8A 1MPEA 4TUUA 4B0EA 3P42A 3U7ZA 2XK5A 4EKUA 2RR9A 5C2TB 1X1MA 2AYOB 2B3AA 1GJZA 4N9F4 2I1KA 1Q0WB 2KK8A 1ZDVA 4BKGA 1WXAA 2V3PA 1ZGUB 3EHVA 2KTRB 1LXDA 1P3QU 2LJ5A 2R2QA 1YN3A 1HZ6A 2BT6A 2WQYB 1NI3A 2ON8A 1QQRA 3MC0B 4TQ0A 3V3XA 4ARCA 1UELA 2IGGA 1OFFA 4RF0A 1FFVA 3DBRB 1QOGA 3H7PA 2MLBA 1KOTA 1FRRA 2KLCA 2LD9A 1TGZB 3ZRCA 2KQSA 3TEZA 2KDEB 2IGHA 3DDCB 2WHIA 4C7YA 5D94A 2MSED 1C78A 5JZEB 1JWAD 2KFKA 2INPE 1I35A 1OEYA 2KDIA 2LGSA 1KTKA 2KXJA 2KJ6A 2BKFA 4WH4A 1K51A 2KOXA 3PZ8A 1XLNA 3R2TA 3ZXRA 1IPGA 1I4QA 1XXGA 2MBQA 1ZUD2 2LI5A 1UF0A 1WX9A 3MJ5A 4DWFA 1KH0A 3TEXA 1FEHA 3AE8B 3KYDD 2ZW1A 5BMGA 1T5XD 2JT4B 3B2FA 1P1AA 3KUZA 1SGHA 1PYWD 4W9JA 3B1LX 3ZTCA 4AJWA 3HM3A 1V9JA 2A4ZA 1XCTL 4MGIE 2KX3A 3AEDB 4P7IA 3O65B 3W5UB 4KSKC 3BYYB 4MELA 2MCNB 1XCQL 1FPYA 1TS5A 3K9PB 4YT0B 3EUB2 2HTME 1ESFA 2WXGA 4NAMA 4G50A 1GNUA 4OVVA 2O2VA 1Q5WB 4YTNB 4W9GA 1XO3A 4AOFA 4WAFA 4RH6A 1R4NB 2LGXA 1TTNA 2FCQA 1FNUA 1EUVB 4KIKA 3ZVVA 3ZJVA 3DPDA 2VZKD 4AUQC 2INCC 3DBHI 1FCLA 4A3PA 4WJOA 1N6ZA 1OQQA 1WFYA 1UBQA 2K25A 2G1EA 4XWTA 1EF1A 1HA5A 1DGJA 2AL6A 3X23A 5E6PA 2BYVE 4B6WA 2N1VA 5EE1A 2WDVB 3VRAB 1FXIA 5G2NA 4LTUA 4HJGE 4BFRA 4LNOA 1RRBA 3ZUNA 1TZ1A 3CSFA
chains in the Genus database with same CATH topology
5KHOA 2IYDB 2NBUA 4M8MA 3LJ3A 2J7QB 1YJ1A 4GOCA 2AWTA 2CR5A 3P2BA 4IW0A 2PE6B 5DPWA 4ANVA 2D2QA 3R7QA 2UWQA 3RULA 4HPLB 1YX5B 1E5WA 3HIZA 4NJ6A 3QWZB 4JL9A 4JLCA 4HVBA 3ZW3A 2BPSA 4FULA 3ZNID 1J19A 4HCPB 2NR2A 4ZYNA 2KKCA 3RZFA 3T8MA 3TL5A 3W1SA 1RLFA 3HHMA 3IHPC 3SU8X 2IY0B 3DQVA 4HDOA 5JHAA 1WJUA 3MJWA 3QC8B 2JUOA 4TV3A 2J0MA 1IYFA 2ZCCA 5DPTA 2NCNA 2RPQA 3S2AA 2IO1B 5E6NA 4GDLA 3DCGA 4KDIC 3VTUA 5D7GA 2LVPA 2PE9A 2WDTB 4DHJB 2IO3B 3ZRFA 2LUEA 3Q3FA 4XX5A 2G4SA 4MEMA 3ZNGC 1E7UA 5CTRC 4KSLC 1WM2A 5DPRA 4LCDE 5JH5C 3U7DA 3D32A 4GIVA 4IWPA 2FCMA 4ZRJA 3TIXA 1P0RA 2MP2A 2KMAA 3ZO5B 4URKA 5CHWA 5HKHA 2KZRA 4KZ0A 4YL8A 1M94A 3ENEA 2M8SA 3R7RA 3V6EB 3UIOB 3DVGX 4EFOA 2L00B 2BGFA 2A5UA 2MA9B 1UH6A 1E8ZA 1FXTB 2Z0EB 1D3ZA 3RUIB 2OJRA 5AZGA 4DHJD 3ZDMC 2NPTA 3DBSA 2ZVOA 3LDZE 1YX6B 2BWFA 3VHTC 2LVQA 2KQ7A 1XT9B 3NOBA 3A9JB 3VQIA 3PREA 4FHKA 2MBOA 5GMVA 4AJYB 3M95A 4HCNB 3ML9A 3PHXB 2NBVB 4W9EA 3NZSA 3PS6A 4GDKB 2D07B 4BOSC 2C7MB 3H6NA 5E6OA 3L0WB 2UYZB 2L7RA 4K7UA 4HK2A 3VTVA 3L54A 3V62A 1E8YA 4BOZB 2KNBA 3PVLA 4B9KA 1E8XA 2REXA 2KANA 3QCAA 2GBNA 4IM0A 4ICUA 1GC7A 4FJZA 2BYEA 4FA6A 2DZKA 5J2RA 3BY4B 4IM2A 3DVNU 4NJ7A 2DZMA 2KDBA 3KUCB 1NI2A 2O6VB 4LJOB 3PGEA 4HWIB 4E3CA 3QA8A 4JQWC 5JHBA 3H1UA 3VTWA 4GN1A 4RM9A 3AXCA 3HM6X 1YD8U 1OGWA 3VUWA 2HD5B 1L7YA 4EOYA 2FUHB 1UZXB 1SE9A 1GG3A 3B0AA 2ZEQA 4K7WA 4PS7A 5G55A 3ZDTA 4ANXA 4DDID 2D11A 3L08A 2HE7A 2MBBB 1WM3A 4IG7B 2QHOA 3ZTDA 4FN2A 2N9PC 4MDKE 3DBRI 4B95A 3UQBA 2WWZA 4CHKA 4AWJA 2RD0A 2N7DA 3R66C 3VXWA 2K8HA 2O6VD 3H7SA 1J8CA 1HE8A 1V5TA 4BKSA 3A1QB 3KH0A 2D10A 4LDTB 1Y8RC 3RZWC 3U30A 5IA7A 3TCAA 1TBEA 4DK5A 1KLVA 2WYQA 2IY1B 2KVRA 3UGBB 2LWPA 2DAJA 3JW0X 2KLGA 2N9EB 3M62B 3VAWA 3NZUA 4MH0E 1K8RB 2CHWA 4ANUA 2HJ8A 2D3GA 4NPNA 3QARA 4WJPA 2MBHA 2KTFA 4I6NB 2YLMA 2LRUA 2CHZA 2KWCA 5D2MB 3V61A 1WJ6A 4WWNA 4M0WB 5AZHA 2RGFA 3BINA 3JYUA 2DYBA 2C9WB 3AI5A 1LFDA 3OLMD 4W9CA 4FLHA 4MM3A 1ZKHA 2V4LA 3HK0A 4LDTD 4PS3A 3ZIMA 1WH3A 3A9JA 3QAQA 1S3SG 3A33B 2IO2B 1WGHA 3TBLD 1RAXA 3Q3JA 4IC7B 3TMPB 3WAOA 4OVUA 2NS5A 2Z59B 2FIFA 4HDQA 4GMVA 2C7NB 3QQ8B 2XK5B 3PHWB 4NNJB 4GDKA 2M17A 3L17A 4BKTA 3U8ZA 4F1SA 4KV2A 1ISNA 1LQBA 2Z0DB 2NBWB 5TR5A 4TQ1A 1WI0A 4MSMB 4WJQA 3ALBA 1OQYA 3UF8A 4G3XB 4BBNC 2K6DB 4W9HA 5C1ZA 3QJZA 2NVUI 5BO4B 2O6VA 2JZ3B 4JIOU 4NAWB 3PRMB 2KDFB 3RT3B 2J0JA 1WGDA 4EUTA 2GOWA 2CU1A 3SD5A 1WX7A 3PLVA 1C1YB 4MGKE 4GXBA 2ASQA 1NDDA 4IUMB 1Q1OA 2IO0B 2MRPA 2C7HA 3W1YA 3WALA 2EMSA 2G45B 2PPHA 4II3B 1A5RA 3OJ4B 2WX0A 1E90A 2LVOA 2LXAA 3ML8A 3SHQA 3GZNI 2N1WA 2FIDA 2GBRA 1XQQA 3N3KB 4KDLB 3APFA 3VUXA 4BKSD 3RCZA 1WYWB 3WANA 4MJSB 3L13A 3WAMA 1VCBA 2JPHA 3NY5A 2Y5BB 2I1JA 1JRUA 1WXVA 4PYZA 2FCNA 2GBMA 1WIAA 2BF8B 3PPAA 2MBEA 3H7PB 1R4NI 2HTHA 2WX1A 4W9IA 4EZKA 3UQAA 1BT0A 3VH3B 2PEAA 3RD2A 4G0NB 2ZPNA 4F8CB 2PJHA 1WXSA 4K7SA 2G4DB 2L76A 4MGZE 3WIMA 2OOBB 2KWVB 5AEKB 1UGMA 1ZW7A 2FNJB 4BBNF 4EZJA 3X0WA 5J18A 4KZCA 2MW5A 2LZ6A 1KJTA 2GBJA 2XEWA 5KHQA 3CSTA 3QK0A 4WQOB 2KFKB 1C3TA 2IBIB 2J0KA 3L10B 2DAFA 2JF5A 5LLIA 3NS8A 4W9FA 1Z5SB 2JRHA 3A4RA 4DHZB 2MX2A 3VVWB 2ZPYA 3DBLI 2KJRA 3EC8A 3OAWA 4PS8A 4TUUA 4KVGB 1F9JA 1GUAB 3M63B 3IG3A 4I6LB 4IM3A 3RYTA 4MGYE 3VH4B 4AP4C 3PZDA 2XK5A 3N30A 2DYOA 4K81A 3VDZA 4EKUA 2RR9A 3EECA 2CKHB 4HJKA 4GSWA 4CYEA 1WGGA 1WRDB 2DZIA 2ZCBA 2RSUA 2V1YA 1OTRB 1X1MA 3AU4A 4LJPB 2N9XA 4E71A 4W9DA 2AYOB 4FBJB 2B3AA 3R3MA 1WY8A 1UD7A 1J0GA 4N9F4 1GJZA 2KHWB 2I1KA 1Q0WB 3ZNHB 5CX3A 1Z2MA 2KK8A 3KVFB 4NAWA 3NHEB 2KC2A 2L0TA 3W1SC 4ASWC 4BKGA 3L16A 1WXAA 2LGYA 1ZGUB 3EHVA 1YIWA 4MSQB 2FAZA 3ZKJC 2KTRB 2ZJDA 1LXDA 1WR1A 1WGRA 4GB9A 3IVFA 1P3QU 2LJ5A 1UBIA 1LM8B 2EMTA 2R2QA 3CF6E 3N32A 4HPMB 1L2NA 4ZRKA 4EZLA 2R2OA 2K8CA 1WMHB 4ANWA 2MQJA 1WE6A 4W9KA 4GGQA 2JZZA 4PYUA 1G6JA 5D6JB 5C23A 4MJSA 3APDA 4TQ0A 1WJ4A 1UELA 4G11A 1YQBA 3DOWA 5J17A 2JRIB 4WWPA 2KC1A 4NQKE 2MWSB 2LGDA 4F7ZA 2O2VB 2GBKA 2ZNVC 3H7PA 2MLBA 2BKRB 4A3OA 1KOTA 1S1QB 3DVGY 2AEHA 4WJNA 2LD9A 2KLCA 1PQSA 2KD0A 3H9DA 2K6QA 1TGZB 4HLEA 3ZRCA 1H8CA 2KQSA 2KDEB 3PRPB 1CMXB 3DDCB 3APCA 5D94A 3B08A 2MSED 4I6PA 1AARA 2M4NA 1V81A 3EFUA 4KIKB 1NBFC 4IWOA 4X57B 5JZEB 2KFKA 3WA0A 4E74A 3PRZA 1I35A 1OEYA 2KDIA 3CMMB 3JVZX 3DVNV 2KXJA 2KJ6A 2BKFA 3MHSD 3VUYA 3PT2B 2C60A 3JSVB 2N4FA 2KOXA 3KYCD 2DYMA 3K9OB 3KUDB 1IPGA 1T0YA 3A9KB 2BWES 3PTFC 4A20A 2MBQA 2LI5A 3QX1A 1WX9A 1GC6A 4DWFA 3T9LA 3KYDD 2M0XA 4J6IA 3ZLZA 1XD3B 2K39A 2LRWA 3MTNB 2JT4B 5IAAC 3SDLC 3ZNZB 3ECIA 1P1AA 3KUZA 2FCSA 4GU2A 1SGHA 3A1QA 5DCNA 4EEWA 2L0FA 4FADA 2KJHB 1QZEA 1WGYA 4W9JA 2KX0A 3B1LX 1V86A 2AL3A 2G3QB 3KW5B 1WE7A 3ZTCA 4RMAA 4AJWA 1OEYJ 3V6CB 3HM3A 4DDGD 4ZDVA 1H4RA 2IZVB 4CO7A 1MG8A 1V9JA 2A4ZA 3M3JA 4M8NA 3GOEA 4FJVB 2CS4A 2KTRA 4MGIE 3PSEB 2LASA 5L95C 2KX3A 4P7IA 3O65B 4KSKC 1SIFA 4W9LA 1V5OA 4MELA 3ONSA 2V3SA 2MCNB 5L83A 5DPSA 1V2YA 4NY0A 3QIJA 1WMHA 1WX8A 4ICVA 3WAPA 5CHVC 5LXHA 4DBGA 3UIPB 2L3ZA 3K9PB 1WR6E 4DHZE 1WF9A 4IWQA 4GDLB 4XZ4A 2GMIC 1V6EA 2K1FA 1WZ0A 1VD2A 2C5LC 4G50A 1I42A 1GNUA 2CHXA 4OVVA 2N7EA 3I3TB 2O2VA 1EO6A 1P98A 1P9DU 4HXDA 2KMCA 4II2B 1Q5WB 3VFKA 1U4AA 4JGHB 4FHJA 4BVUC 4W9GA 3AULA 3IFWB 2KO3A 1V80A 5CHFA 4WAAA 2VRRB 4AOFA 3IBEA 2L05A 2ZNVB 4WWOA 5EDSA 1KM7A 4FJYA 3TJPA 2LGXA 1TTNA 2M1MA 2MP2B 2FCQA 4TKNA 5FR6A 2L8JA 1EUVB 4ZRIA 4XC2A 3V60A 4KIKA 3OJ3A 1WJNA 2ZZPB 2DHZA 3ZVVA 4DXAB 3DPDA 1V49A 4NQLB 4AUQC 2EKEC 3DBHI 3C0RB 4A3PA 1WZ3A 3PLUA 4WJOA 1RFAA 1E8WA 4K1RB 1WFYA 3JSVA 2NPTB 2W9NA 3PV1A 1UBQA 2K25A 2JXXA 3QHTA 2DENB 2DZJA 2JWZA 2ZVNA 3A9KA 1E7VA 2DX5B 2LXCA 3UINB 1WXMA 5AZFA 1EF1A 1R4MI 5LXIB 1EF5A 2KN5A 2KFJA 2AL6A 3X23A 5E6PA 2BYVE 2JVCA 4B6WA 2N1VA 2YVCA 2KWUB 5G2NA 4RM8A 3AU5A 2BYFA 2XBBC 2K8BA 4BFRA 1RRBA 2JY6A 3ZUNA 1IP9A 3A4SC 1TZ1A 3CSFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KHO A;  2IYD B;  2NBU A;  4M8M A;  3LJ3 A;  2J7Q B;  1YJ1 A;  4GOC A;  2AWT A;  2CR5 A;  3P2B A;  4IW0 A;  2PE6 B;  5DPW A;  4ANV A;  2D2Q A;  3R7Q A;  2UWQ A;  3RUL A;  4HPL B;  1YX5 B;  1E5W A;  3HIZ A;  4NJ6 A;  3QWZ B;  4JL9 A;  4JLC A;  4HVB A;  3ZW3 A;  2BPS A;  4FUL A;  3ZNI D;  1J19 A;  4HCP B;  2NR2 A;  4ZYN A;  2KKC A;  3RZF A;  3T8M A;  3TL5 A;  3W1S A;  1RLF A;  3HHM A;  3IHP C;  3SU8 X;  2IY0 B;  3DQV A;  4HDO A;  5JHA A;  1WJU A;  3MJW A;  3QC8 B;  2JUO A;  4TV3 A;  2J0M A;  1IYF A;  2ZCC A;  5DPT A;  2NCN A;  2RPQ A;  3S2A A;  2IO1 B;  5E6N A;  4GDL A;  3DCG A;  4KDI C;  3VTU A;  5D7G A;  2LVP A;  2PE9 A;  2WDT B;  4DHJ B;  2IO3 B;  3ZRF A;  2LUE A;  3Q3F A;  4XX5 A;  2G4S A;  4MEM A;  3ZNG C;  1E7U A;  5CTR C;  4KSL C;  1WM2 A;  5DPR A;  4LCD E;  5JH5 C;  3U7D A;  3D32 A;  4GIV A;  4IWP A;  2FCM A;  4ZRJ A;  3TIX A;  1P0R A;  2MP2 A;  2KMA A;  3ZO5 B;  4URK A;  5CHW A;  5HKH A;  2KZR A;  4KZ0 A;  4YL8 A;  1M94 A;  3ENE A;  2M8S A;  3R7R A;  3V6E B;  3UIO B;  3DVG X;  4EFO A;  2L00 B;  2BGF A;  2A5U A;  2MA9 B;  1UH6 A;  1E8Z A;  1FXT B;  2Z0E B;  1D3Z A;  3RUI B;  2OJR A;  5AZG A;  4DHJ D;  3ZDM C;  2NPT A;  3DBS A;  2ZVO A;  3LDZ E;  1YX6 B;  2BWF A;  3VHT C;  2LVQ A;  2KQ7 A;  1XT9 B;  3NOB A;  3A9J B;  3VQI A;  3PRE A;  4FHK A;  2MBO A;  5GMV A;  4AJY B;  3M95 A;  4HCN B;  3ML9 A;  3PHX B;  2NBV B;  4W9E A;  3NZS A;  3PS6 A;  4GDK B;  2D07 B;  4BOS C;  2C7M B;  3H6N A;  5E6O A;  3L0W B;  2UYZ B;  2L7R A;  4K7U A;  4HK2 A;  3VTV A;  3L54 A;  3V62 A;  1E8Y A;  4BOZ B;  2KNB A;  3PVL A;  4B9K A;  1E8X A;  2REX A;  2KAN A;  3QCA A;  2GBN A;  4IM0 A;  4ICU A;  1GC7 A;  4FJZ A;  2BYE A;  4FA6 A;  2DZK A;  5J2R A;  3BY4 B;  4IM2 A;  3DVN U;  4NJ7 A;  2DZM A;  2KDB A;  3KUC B;  1NI2 A;  2O6V B;  4LJO B;  3PGE A;  4HWI B;  4E3C A;  3QA8 A;  4JQW C;  5JHB A;  3H1U A;  3VTW A;  4GN1 A;  4RM9 A;  3AXC A;  3HM6 X;  1YD8 U;  1OGW A;  3VUW A;  2HD5 B;  1L7Y A;  4EOY A;  2FUH B;  1UZX B;  1SE9 A;  1GG3 A;  3B0A A;  2ZEQ A;  4K7W A;  4PS7 A;  5G55 A;  3ZDT A;  4ANX A;  4DDI D;  2D11 A;  3L08 A;  2HE7 A;  2MBB B;  1WM3 A;  4IG7 B;  2QHO A;  3ZTD A;  4FN2 A;  2N9P C;  4MDK E;  3DBR I;  4B95 A;  3UQB A;  2WWZ A;  4CHK A;  4AWJ A;  2RD0 A;  2N7D A;  3R66 C;  3VXW A;  2K8H A;  2O6V D;  3H7S A;  1J8C A;  1HE8 A;  1V5T A;  4BKS A;  3A1Q B;  3KH0 A;  2D10 A;  4LDT B;  1Y8R C;  3RZW C;  3U30 A;  5IA7 A;  3TCA A;  1TBE A;  4DK5 A;  1KLV A;  2WYQ A;  2IY1 B;  2KVR A;  3UGB B;  2LWP A;  2DAJ A;  3JW0 X;  2KLG A;  2N9E B;  3M62 B;  3VAW A;  3NZU A;  4MH0 E;  1K8R B;  2CHW A;  4ANU A;  2HJ8 A;  2D3G A;  4NPN A;  3QAR A;  4WJP A;  2MBH A;  2KTF A;  4I6N B;  2YLM A;  2LRU A;  2CHZ A;  2KWC A;  5D2M B;  3V61 A;  1WJ6 A;  4WWN A;  4M0W B;  5AZH A;  2RGF A;  3BIN A;  3JYU A;  2DYB A;  2C9W B;  3AI5 A;  1LFD A;  3OLM D;  4W9C A;  4FLH A;  4MM3 A;  1ZKH A;  2V4L A;  3HK0 A;  4LDT D;  4PS3 A;  3ZIM A;  1WH3 A;  3A9J A;  3QAQ A;  1S3S G;  3A33 B;  2IO2 B;  1WGH A;  3TBL D;  1RAX A;  3Q3J A;  4IC7 B;  3TMP B;  3WAO A;  4OVU A;  2NS5 A;  2Z59 B;  2FIF A;  4HDQ A;  4GMV A;  2C7N B;  3QQ8 B;  2XK5 B;  3PHW B;  4NNJ B;  4GDK A;  2M17 A;  3L17 A;  4BKT A;  3U8Z A;  4F1S A;  4KV2 A;  1ISN A;  1LQB A;  2Z0D B;  2NBW B;  5TR5 A;  4TQ1 A;  1WI0 A;  4MSM B;  4WJQ A;  3ALB A;  1OQY A;  3UF8 A;  4G3X B;  4BBN C;  2K6D B;  4W9H A;  5C1Z A;  3QJZ A;  2NVU I;  5BO4 B;  2O6V A;  2JZ3 B;  4JIO U;  4NAW B;  3PRM B;  2KDF B;  3RT3 B;  2J0J A;  1WGD A;  4EUT A;  2GOW A;  2CU1 A;  3SD5 A;  1WX7 A;  3PLV A;  1C1Y B;  4MGK E;  4GXB A;  2ASQ A;  1NDD A;  4IUM B;  1Q1O A;  2IO0 B;  2MRP A;  2C7H A;  3W1Y A;  3WAL A;  2EMS A;  2G45 B;  2PPH A;  4II3 B;  1A5R A;  3OJ4 B;  2WX0 A;  1E90 A;  2LVO A;  2LXA A;  3ML8 A;  3SHQ A;  3GZN I;  2N1W A;  2FID A;  2GBR A;  1XQQ A;  3N3K B;  4KDL B;  3APF A;  3VUX A;  4BKS D;  3RCZ A;  1WYW B;  3WAN A;  4MJS B;  3L13 A;  3WAM A;  1VCB A;  2JPH A;  3NY5 A;  2Y5B B;  2I1J A;  1JRU A;  1WXV A;  4PYZ A;  2FCN A;  2GBM A;  1WIA A;  2BF8 B;  3PPA A;  2MBE A;  3H7P B;  1R4N I;  2HTH A;  2WX1 A;  4W9I A;  4EZK A;  3UQA A;  1BT0 A;  3VH3 B;  2PEA A;  3RD2 A;  4G0N B;  2ZPN A;  4F8C B;  2PJH A;  1WXS A;  4K7S A;  2G4D B;  2L76 A;  4MGZ E;  3WIM A;  2OOB B;  2KWV B;  5AEK B;  1UGM A;  1ZW7 A;  2FNJ B;  4BBN F;  4EZJ A;  3X0W A;  5J18 A;  4KZC A;  2MW5 A;  2LZ6 A;  1KJT A;  2GBJ A;  2XEW A;  5KHQ A;  3CST A;  3QK0 A;  4WQO B;  2KFK B;  1C3T A;  2IBI B;  2J0K A;  3L10 B;  2DAF A;  2JF5 A;  5LLI A;  3NS8 A;  4W9F A;  1Z5S B;  2JRH A;  3A4R A;  4DHZ B;  2MX2 A;  3VVW B;  2ZPY A;  3DBL I;  2KJR A;  3EC8 A;  3OAW A;  4PS8 A;  4TUU A;  4KVG B;  1F9J A;  1GUA B;  3M63 B;  3IG3 A;  4I6L B;  4IM3 A;  3RYT A;  4MGY E;  3VH4 B;  4AP4 C;  3PZD A;  2XK5 A;  3N30 A;  2DYO A;  4K81 A;  3VDZ A;  4EKU A;  2RR9 A;  3EEC A;  2CKH B;  4HJK A;  4GSW A;  4CYE A;  1WGG A;  1WRD B;  2DZI A;  2ZCB A;  2RSU A;  2V1Y A;  1OTR B;  1X1M A;  3AU4 A;  4LJP B;  2N9X A;  4E71 A;  4W9D A;  2AYO B;  4FBJ B;  2B3A A;  3R3M A;  1WY8 A;  1UD7 A;  1J0G A;  4N9F 4;  1GJZ A;  2KHW B;  2I1K A;  1Q0W B;  3ZNH B;  5CX3 A;  1Z2M A;  2KK8 A;  3KVF B;  4NAW A;  3NHE B;  2KC2 A;  2L0T A;  3W1S C;  4ASW C;  4BKG A;  3L16 A;  1WXA A;  2LGY A;  1ZGU B;  3EHV A;  1YIW A;  4MSQ B;  2FAZ A;  3ZKJ C;  2KTR B;  2ZJD A;  1LXD A;  1WR1 A;  1WGR A;  4GB9 A;  3IVF A;  1P3Q U;  2LJ5 A;  1UBI A;  1LM8 B;  2EMT A;  2R2Q A;  3CF6 E;  3N32 A;  4HPM B;  1L2N A;  4ZRK A;  4EZL A;  2R2O A;  2K8C A;  1WMH B;  4ANW A;  2MQJ A;  1WE6 A;  4W9K A;  4GGQ A;  2JZZ A;  4PYU A;  1G6J A;  5D6J B;  5C23 A;  4MJS A;  3APD A;  4TQ0 A;  1WJ4 A;  1UEL A;  4G11 A;  1YQB A;  3DOW A;  5J17 A;  2JRI B;  4WWP A;  2KC1 A;  4NQK E;  2MWS B;  2LGD A;  4F7Z A;  2O2V B;  2GBK A;  2ZNV C;  3H7P A;  2MLB A;  2BKR B;  4A3O A;  1KOT A;  1S1Q B;  3DVG Y;  2AEH A;  4WJN A;  2LD9 A;  2KLC A;  1PQS A;  2KD0 A;  3H9D A;  2K6Q A;  1TGZ B;  4HLE A;  3ZRC A;  1H8C A;  2KQS A;  2KDE B;  3PRP B;  1CMX B;  3DDC B;  3APC A;  5D94 A;  3B08 A;  2MSE D;  4I6P A;  1AAR A;  2M4N A;  1V81 A;  3EFU A;  4KIK B;  1NBF C;  4IWO A;  4X57 B;  5JZE B;  2KFK A;  3WA0 A;  4E74 A;  3PRZ A;  1I35 A;  1OEY A;  2KDI A;  3CMM B;  3JVZ X;  3DVN V;  2KXJ A;  2KJ6 A;  2BKF A;  3MHS D;  3VUY A;  3PT2 B;  2C60 A;  3JSV B;  2N4F A;  2KOX A;  3KYC D;  2DYM A;  3K9O B;  3KUD B;  1IPG A;  1T0Y A;  3A9K B;  2BWE S;  3PTF C;  4A20 A;  2MBQ A;  2LI5 A;  3QX1 A;  1WX9 A;  1GC6 A;  4DWF A;  3T9L A;  3KYD D;  2M0X A;  4J6I A;  3ZLZ A;  1XD3 B;  2K39 A;  2LRW A;  3MTN B;  2JT4 B;  5IAA C;  3SDL C;  3ZNZ B;  3ECI A;  1P1A A;  3KUZ A;  2FCS A;  4GU2 A;  1SGH A;  3A1Q A;  5DCN A;  4EEW A;  2L0F A;  4FAD A;  2KJH B;  1QZE A;  1WGY A;  4W9J A;  2KX0 A;  3B1L X;  1V86 A;  2AL3 A;  2G3Q B;  3KW5 B;  1WE7 A;  3ZTC A;  4RMA A;  4AJW A;  1OEY J;  3V6C B;  3HM3 A;  4DDG D;  4ZDV A;  1H4R A;  2IZV B;  4CO7 A;  1MG8 A;  1V9J A;  2A4Z A;  3M3J A;  4M8N A;  3GOE A;  4FJV B;  2CS4 A;  2KTR A;  4MGI E;  3PSE B;  2LAS A;  5L95 C;  2KX3 A;  4P7I A;  3O65 B;  4KSK C;  1SIF A;  4W9L A;  1V5O A;  4MEL A;  3ONS A;  2V3S A;  2MCN B;  5L83 A;  5DPS A;  1V2Y A;  4NY0 A;  3QIJ A;  1WMH A;  1WX8 A;  4ICV A;  3WAP A;  5CHV C;  5LXH A;  4DBG A;  3UIP B;  2L3Z A;  3K9P B;  1WR6 E;  4DHZ E;  1WF9 A;  4IWQ A;  4GDL B;  4XZ4 A;  2GMI C;  1V6E A;  2K1F A;  1WZ0 A;  1VD2 A;  2C5L C;  4G50 A;  1I42 A;  1GNU A;  2CHX A;  4OVV A;  2N7E A;  3I3T B;  2O2V A;  1EO6 A;  1P98 A;  1P9D U;  4HXD A;  2KMC A;  4II2 B;  1Q5W B;  3VFK A;  1U4A A;  4JGH B;  4FHJ A;  4BVU C;  4W9G A;  3AUL A;  3IFW B;  2KO3 A;  1V80 A;  5CHF A;  4WAA A;  2VRR B;  4AOF A;  3IBE A;  2L05 A;  2ZNV B;  4WWO A;  5EDS A;  1KM7 A;  4FJY A;  3TJP A;  2LGX A;  1TTN A;  2M1M A;  2MP2 B;  2FCQ A;  4TKN A;  5FR6 A;  2L8J A;  1EUV B;  4ZRI A;  4XC2 A;  3V60 A;  4KIK A;  3OJ3 A;  1WJN A;  2ZZP B;  2DHZ A;  3ZVV A;  4DXA B;  3DPD A;  1V49 A;  4NQL B;  4AUQ C;  2EKE C;  3DBH I;  3C0R B;  4A3P A;  1WZ3 A;  3PLU A;  4WJO A;  1RFA A;  1E8W A;  4K1R B;  1WFY A;  3JSV A;  2NPT B;  2W9N A;  3PV1 A;  1UBQ A;  2K25 A;  2JXX A;  3QHT A;  2DEN B;  2DZJ A;  2JWZ A;  2ZVN A;  3A9K A;  1E7V A;  2DX5 B;  2LXC A;  3UIN B;  1WXM A;  5AZF A;  1EF1 A;  1R4M I;  5LXI B;  1EF5 A;  2KN5 A;  2KFJ A;  2AL6 A;  3X23 A;  5E6P A;  2BYV E;  2JVC A;  4B6W A;  2N1V A;  2YVC A;  2KWU B;  5G2N A;  4RM8 A;  3AU5 A;  2BYF A;  2XBB C;  2K8B A;  4BFR A;  1RRB A;  2JY6 A;  3ZUN A;  1IP9 A;  3A4S C;  1TZ1 A;  3CSF A; 
#chains in the Genus database with same CATH topology
 2IYD B;  2J7Q B;  2IPK D;  2CR5 A;  4ANV A;  1HZ5 A;  3R7Q A;  2LFI A;  4KX6 B;  1DOY A;  3ZW3 A;  2BPS A;  2MJ3 A;  4FUL A;  4HCP B;  2KKC A;  3T8M A;  1RLF A;  4KKI A;  3FIL B;  5HFY A;  3SU8 X;  2IY0 B;  4QAY A;  1FNW A;  2WS3 B;  2WXI A;  1YN4 A;  1AWD A;  2K9X A;  3EFC A;  5DPT A;  3S2A A;  4OVZ A;  2IO1 B;  3BWU D;  4C56 C;  3Q8B A;  5D7G A;  2LVP A;  3J9C A;  2AQ2 B;  2WDT B;  2IO3 B;  1JAL A;  4RF1 A;  5CTR C;  5DPR A;  2KDM A;  3D32 A;  2RMM A;  2X38 A;  1GB4 A;  1BUI C;  1Y56 A;  4K3C A;  5HKH A;  3ENE A;  2L00 B;  1T3Q A;  1WSP A;  1E8Z A;  1YJI A;  2PW9 A;  3ZDM C;  3DBS A;  4MM3 B;  5BMI A;  1XT9 B;  4C4V B;  2MBO A;  4AJY B;  5T8I A;  3ML9 A;  1YMH E;  2NBV B;  2LMC A;  3NZS A;  1MHH E;  4GDK B;  2D07 B;  4BOS C;  2C7M B;  3H6N A;  1PFD A;  5H92 C;  2UYZ B;  4JX1 C;  2L7R A;  3U52 E;  3PVL A;  2REX A;  2GBN A;  1UWM A;  4IM0 A;  4ICU A;  4IOI E;  4FJZ A;  5J2R A;  1TS4 A;  3BY4 B;  1CZP A;  3DVN U;  3KUC B;  2O6V B;  3HVZ A;  5I4D A;  3PGE A;  2WXO A;  1L7Y A;  1UZX B;  4TMA B;  3B0A A;  2D11 A;  2KAJ A;  4IG7 B;  1JCK B;  3DBR I;  2PVG C;  4CHK A;  2LHE A;  3EA6 A;  1PGX A;  3A1Q B;  1Y8R C;  2WYQ A;  1D4B A;  1IUE A;  5FK9 C;  4M01 A;  3NZU A;  4ANU A;  4RGM A;  2CJN A;  2HJ8 A;  4JPS A;  4HKQ A;  3UI3 A;  2LRU A;  3PZ7 A;  5D2M B;  1WJ6 A;  3BIN A;  1LFD A;  2MJE A;  4PS3 A;  3BVZ A;  3RNG C;  3ZIM A;  3A9J A;  3CWI A;  4HDQ A;  3CIR B;  4HRS A;  4WUR A;  2XK5 B;  2M17 A;  3L17 A;  4AQ7 A;  3MC8 A;  2IND C;  1ENF A;  3MC9 A;  1CJE A;  4J3O D;  3ALB A;  4OZB A;  1OQY A;  4BBN C;  4W9H A;  1L4Z B;  1HEZ E;  2KVZ A;  1K50 A;  2CJO A;  4EUT A;  1TS3 A;  2CU1 A;  1QIL A;  1I4X A;  4MGK E;  3RNC C;  1NDD A;  1Q1O A;  2IO0 B;  2MRP A;  3GS2 A;  2K22 A;  2EMS A;  3L4P A;  1A5R A;  4II3 B;  5IOI A;  2KN4 A;  3OJ4 B;  3ZJT A;  1E90 A;  1SJE D;  2LXA A;  1N5W A;  3W2D A;  3NVW A;  4BKS D;  1WYW B;  3WAN A;  1E0Z A;  1VCB A;  4ZHO A;  2I1J A;  1LO5 D;  2GBM A;  3PPA A;  3H7P B;  1R4N I;  1N63 A;  4XE0 A;  2HTH A;  4W9I A;  1NYQ A;  4MAC A;  3VH3 B;  2PEA A;  4G0N B;  2PJH A;  4K7S A;  5AUK A;  3BK2 A;  3WIM A;  2OOB B;  2DLB A;  5AEK B;  4EZJ A;  3X0W A;  2WXH A;  2LZ6 A;  2GBJ A;  3QK0 A;  2KFK B;  5LLI A;  1Z5S B;  1YOV B;  2MX2 A;  2H88 B;  1V1P A;  1GUA B;  3AEG B;  3P63 A;  2DYO A;  4JWU C;  2QIL A;  1ET9 A;  4YSY B;  3OG5 A;  1HTO A;  2Z8L A;  2DZI A;  2V1Y A;  1OTR B;  2XN9 C;  4LJP B;  4BAX A;  2M0A A;  4FBJ B;  3R3M A;  1YQ4 B;  2D3C A;  3ZNH B;  5CX3 A;  3KVF B;  4NAW A;  2LGY A;  3KLS X;  1YIW A;  2FAZ A;  1MFW A;  3ZKJ C;  5HHD G;  2ZJD A;  2MJD A;  2G9H D;  3R8B A;  3IVF A;  1UBI A;  1LM8 B;  2EMT A;  3N32 A;  4ZRK A;  3W9C B;  4ANW A;  1WE6 A;  3B2G A;  4GGQ A;  2JZZ A;  5D6J B;  5C23 A;  3APD A;  4P6V F;  3OWE B;  2JU6 X;  2M56 B;  3DOW A;  4RGO S;  5J17 A;  2JRI B;  2JSV X;  2O2V B;  3N20 C;  2GBK A;  2BKR B;  4A3O A;  2RPV A;  4WJN A;  1PQS A;  2CU3 A;  2WXR A;  2GLS A;  2K6Q A;  4HLE A;  1UUP A;  1CMX B;  4OZC A;  4I6P A;  4S0R A;  1F77 A;  1AAR A;  2L32 A;  2QCZ A;  4USA A;  4KIK B;  2W82 A;  5BYQ A;  4KGR A;  3URY A;  1NBF C;  1QT9 A;  3WA0 A;  3PRZ A;  1STE A;  1HQR D;  3CMM B;  3JVZ X;  2FBW B;  4OZA A;  4XDD A;  2C60 A;  2IGD A;  2PKO A;  4A9A A;  2BWE S;  3PTF C;  4A20 A;  1EWY C;  3T9L A;  2M0X A;  3ZLZ A;  5H8Y E;  2LRW A;  1XEE A;  3GB1 A;  1K52 A;  3A1Q A;  5DCN A;  4BZA A;  4EEW A;  2L0F A;  4FAD A;  2KJH B;  1QZE A;  1WGY A;  2KX0 A;  1V86 A;  2G3Q B;  3KW5 B;  4UDU C;  1WE7 A;  2E6X A;  1H4R A;  3AE4 B;  2N0S B;  3M3J A;  4M8N A;  4FJV B;  3PSE B;  2LAS A;  1MHX A;  1B9R A;  2WXP A;  1QLB B;  2R61 A;  5L83 A;  2V3S A;  2Y5C A;  3I9V 1;  1WMH A;  4ICV A;  4LNK A;  1C76 A;  1DOX A;  3UIP B;  1WF9 A;  3GZN B;  1ZDX A;  5C3J B;  1WZ0 A;  1VD2 A;  2C5L C;  1XF5 L;  1I42 A;  2N7E A;  1P98 A;  4RNA A;  4II2 B;  4JGH B;  5CHF A;  2KO3 A;  2VRR B;  3HRD D;  3IBE A;  2L05 A;  4WWO A;  1ZOY B;  3TJP A;  4FJY A;  4LNN A;  1FIQ A;  3IAM 1;  4XC2 A;  3V60 A;  1WJN A;  2ZZP B;  4NQL B;  2WXJ A;  1QKZ A;  1E8W A;  1FNV A;  2W9N A;  2JXX A;  2DEN B;  2ZVN A;  2JWZ A;  1E7V A;  2AX5 A;  2DX5 B;  3DBL B;  4L23 A;  2KFJ A;  1L0X B;  3KWV A;  2FE8 A;  1FFU A;  1E10 A;  3NG0 A;  4IW0 A;  3HIZ A;  4JL9 A;  1L0Y B;  4YXD B;  1HTQ A;  3Q8F A;  4JLC A;  2GI9 A;  1T0R C;  3ZNI D;  1TKY A;  3W1S A;  4ZYN A;  3NVY A;  4A6Q A;  4HPP A;  1TKG A;  3I5J C;  4HDO A;  4ZRP A;  1KRH A;  2VH1 A;  2WXM A;  2RPQ A;  1FXA A;  5E6N A;  2WGS A;  4GDL A;  3DCG A;  2W54 A;  2PE9 A;  1JML A;  4DHJ B;  3Q3F A;  1NYR A;  4XX5 A;  2G4S A;  4MEM A;  3ZNG C;  1E7U A;  4KSL C;  1PDX A;  2DNF A;  2K5P A;  2KMA A;  3ZO5 B;  1T0Q C;  4URK A;  5CHW A;  4HRO A;  1M94 A;  3R7R A;  3V6E B;  3DVG X;  4EFO A;  2BGF A;  2A5U A;  2MA9 B;  1UH6 A;  4C7Z A;  1SBB B;  5AZG A;  1SB3 C;  2NTT A;  1L4D B;  3VHT C;  3A9J B;  3VQI A;  2RDG A;  3PRE A;  4FHK A;  1IGD A;  1NVI D;  3PHX B;  2I2Y A;  1SE4 A;  2SAK A;  4W9E A;  3PS6 A;  1GPX A;  1HXY D;  2L1A A;  5IO9 A;  4IKG A;  3AN1 A;  1E8X A;  3AB5 A;  3P1M A;  3QCA A;  4ZHP A;  2DZM A;  4E3C A;  4LNF A;  4JQW C;  3H1U A;  4ACF A;  3AE6 B;  3FAH A;  2BQQ A;  3HM6 X;  1UGJ A;  3RI7 C;  2FUH B;  4C80 A;  1GG3 A;  1MG4 A;  2ZEQ A;  4K7W A;  4ANX A;  2HE7 A;  1ZXH A;  4MDK E;  3UQB A;  2WWZ A;  4C00 A;  2RD0 A;  2N7D A;  4MT5 A;  1N61 A;  2O6V D;  3LYY A;  2NMQ A;  2KYW A;  3P4R B;  4BKS A;  1WGK A;  3KH0 A;  3RZW C;  1KLV A;  3TCA A;  4DK5 A;  5HG2 A;  3UGB B;  1RM6 C;  2KVR A;  3VAW A;  1K8R B;  1WWT A;  2CHW A;  1TKE A;  2J4X A;  3QAR A;  3Q8A A;  2MBH A;  3AE7 B;  3N1X C;  4I6N B;  2YLM A;  2KWC A;  2KWD A;  4KGS A;  4WWN A;  5AZH A;  3RFZ B;  2RGF A;  3JYU A;  4FLH A;  2H89 B;  2V4L A;  4N6E B;  3NUH B;  2E3T A;  1WGH A;  2QEJ C;  3TBL D;  3TMP B;  1V1P B;  4OVU A;  1VJK A;  3RMK C;  3VR8 B;  4BKT A;  2KMM A;  4F1S A;  1ISN A;  3Q2A C;  1R4M B;  2WXQ A;  4TQ1 A;  5EE9 A;  1XLP A;  1WI0 A;  4WJQ A;  1PUT A;  2K6D B;  4REZ A;  2PTL A;  3ZYY X;  3C19 A;  2PVO D;  2YEP B;  2JZ3 B;  3SFE B;  4JIO U;  4NAW B;  3PRM B;  1VRA B;  3GP7 A;  4US8 A;  1BML C;  2GOW A;  3DWM A;  1WX7 A;  5IKC M;  4IUM B;  1FD6 A;  3W1Y A;  2C7H A;  3WAL A;  5BYS A;  2G45 B;  4YSZ B;  2WX0 A;  2J42 A;  3GZN I;  2FID A;  2LJI A;  3N3K B;  3APF A;  1TYG B;  1JQ4 A;  2QIE B;  1ACC A;  3NY5 A;  2Y5B B;  4PYZ A;  1EU3 A;  3AE1 B;  3UQA A;  4XYC A;  1J7C A;  2D3B A;  2WXL A;  3EGR A;  1A70 A;  1ZXI A;  3AEE B;  1E6E B;  5BMH A;  3BII D;  1SXT A;  1ZW7 A;  2FNJ B;  4K3B A;  4KZC A;  4M0W A;  3CST A;  3AEF B;  1ZE3 D;  2J0K A;  2DAF A;  2JF5 A;  1F2R C;  2IJ0 A;  3ZJU A;  3DBL I;  3RN9 C;  2KJR A;  4PS8 A;  4KVG B;  1F9J A;  3M63 B;  4IM3 A;  3RYT A;  4MGY E;  3N30 A;  4K81 A;  2CKH B;  4HJK A;  2W55 A;  4GSW A;  1WRD B;  1L6V A;  4LK0 M;  4LLG M;  3AU4 A;  1TJE A;  2N9X A;  4E71 A;  1C9F A;  1KLG D;  1WY8 A;  1J0G A;  2KHW B;  3MFG A;  1Z2M A;  3W1S C;  1TZO A;  2WU2 B;  4MSQ B;  4NZL B;  2JQR B;  4GB9 A;  4HPM B;  1L2N A;  4EZL A;  1DOI A;  1WMH B;  4YTP B;  3TSS A;  2MQJ A;  4MJS A;  2LGI A;  4G11 A;  3ABV B;  3TUO A;  5LNK 1;  4NQK E;  1J7A A;  2MWS B;  1AW7 A;  2ZNV C;  1S1Q B;  3DVG Y;  2AEH A;  2N9L A;  3VRB B;  3W5V B;  2UU7 A;  3APC A;  3B08 A;  2JXT A;  1YQ3 B;  4X57 B;  3BZD B;  3NVZ A;  5E6J A;  3DVN V;  3VUY A;  3PT2 B;  3BVG A;  3KUD B;  1T0Y A;  3QX1 A;  5IP4 D;  2L52 A;  1GC6 A;  1NEK B;  3RPF C;  2BB6 A;  4LNI A;  1VZ6 A;  4L2Y A;  1YNT E;  3MTN B;  3SDL C;  3ZNZ B;  3FKY A;  1FM0 D;  1OEY J;  1UWX A;  3V6C B;  4ZDV A;  2IZV B;  3E9S A;  1SE3 A;  5L95 C;  1PGA A;  1SIF A;  4W9L A;  2QJL A;  2ONQ A;  1V2Y A;  3DHH C;  3Q3M C;  3QIJ A;  4NY0 A;  2VH2 A;  5CHV C;  5LXH A;  3NS1 A;  1L5P A;  4DBG A;  2L3Z A;  1MVK A;  3TEY A;  3H8H A;  4DHZ E;  4GDL B;  1C77 A;  2BYT A;  5FKA C;  5G5G A;  3I3T B;  1EO6 A;  1P9D U;  1U4A A;  4BVU C;  4FHJ A;  3AUL A;  3IFW B;  3AMZ A;  4WAA A;  1V1O A;  2ZNV B;  5EDS A;  4GLS C;  3B9J A;  4ZRI A;  3OJ3 A;  2DHZ A;  1SSN A;  4DXA B;  5IN7 A;  1TY0 A;  3C0R B;  3PLU A;  3JSV A;  2Q5W D;  3Q3N C;  3PV1 A;  3AH7 A;  3A9K A;  2LXC A;  1R4M I;  4P16 A;  2JVC A;  2YVC A;  2KWU B;  3AE9 B;  1KFY B;  2LHD A;  2XBB C;  3AV8 A;  2AQ3 B;  1IP9 A;  3TEW A;  5KHO A;  3Q3O C;  3LJ3 A;  1IBX A;  1YJ1 A;  4GOC A;  2AWT A;  2PE6 B;  2V9H A;  3IXS A;  5DPW A;  2BS2 B;  1YX5 B;  1E5W A;  4Q2J A;  4YTM B;  4HVB A;  2MHJ A;  1J19 A;  3RZF A;  3IT4 B;  3TL5 A;  5D3D A;  4ZOH C;  2LUM A;  3DQV A;  3IAS 1;  3MJW A;  3QC8 B;  4O1N A;  2JUO A;  4TV3 A;  5G5H A;  2PLP A;  2ZCC A;  4HEA 1;  2MEK A;  4KDI C;  2JZP A;  2LUE A;  3HUI A;  1WM2 A;  5JH5 C;  1QOA A;  3U7D A;  4IWP A;  2FCM A;  4ZRJ A;  2MP2 A;  3LB8 C;  2KZR A;  2V3N A;  1VZ7 A;  4KZ0 A;  2M8S A;  3UIO B;  1FXT B;  2M19 A;  1MI0 A;  2OJR A;  3DWG C;  4DHJ D;  2NPT A;  4R3D A;  3LDZ E;  2ZVO A;  1YX6 B;  1OQR A;  3V05 A;  2LVQ A;  2KQ7 A;  1TIF A;  2EEL A;  3NOB A;  3NRZ A;  1QOB A;  5GMV A;  3M95 A;  4HCN B;  4OHJ A;  3E56 A;  4N58 A;  5E6O A;  3L0W B;  3L54 A;  3V62 A;  2KAN A;  2BYE A;  4IM2 A;  1ZPS A;  2K0P A;  2KDB A;  3U2S C;  3U4E G;  3QA8 A;  2JYT A;  5JHB A;  3N1Z C;  4GN1 A;  1JWU D;  1QOF A;  3ZXV A;  4WIP A;  3AXC A;  1YD8 U;  1KLU D;  1I4P A;  1OGW A;  4IDI A;  1SE9 A;  3ZDT A;  3AEA B;  1WM3 A;  3ZTD A;  1FCC C;  1GB1 A;  4B95 A;  4AWJ A;  3VXW A;  3H7S A;  3ZQ4 A;  4A8X C;  4DQO C;  4LDT B;  2D10 A;  5IA7 A;  1TBE A;  3MP9 A;  2IY1 B;  1SE2 A;  2LWP A;  3JW0 X;  4KKJ A;  3M62 B;  2N7J A;  1IGC A;  2D3G A;  2KT7 A;  4NPN A;  1T6B X;  2ACZ B;  4RFB A;  3Q8C A;  1LGR A;  2CHZ A;  4M0W B;  1D5Z C;  2DYB A;  1I4R A;  4W9C A;  1F2R I;  3AI5 A;  1JRP A;  3Q6B A;  1WH3 A;  4RGT A;  1S3S G;  2WLB A;  2IO2 B;  3A33 B;  3WAO A;  1RAX A;  3Q3J A;  4IC7 B;  2FIF A;  3PHW B;  5FR3 A;  3U8Z A;  1ET6 A;  5HI1 A;  5TR5 A;  4MSM B;  3I57 A;  3SR6 A;  2NTS A;  1E7P B;  2NVU I;  1YJJ A;  2KDF B;  2J0J A;  1WGD A;  3SD5 A;  3PLV A;  3BVM A;  1C1Y B;  1XLO A;  1RWS A;  4GXB A;  2ASQ A;  1GOZ A;  2J52 A;  3KWL A;  2N1W A;  2RDH A;  3VUX A;  3RCZ A;  4MJS B;  3L13 A;  3WAM A;  2JPH A;  4MH8 A;  1JRU A;  1WXV A;  4EE2 A;  1WIA A;  2BF8 B;  2WX1 A;  4EZK A;  1BT0 A;  3SFD B;  4F8C B;  1RYJ A;  1E9M A;  2G4D B;  4MGZ E;  1UGM A;  4BBN F;  2N9K A;  1F1H A;  1Q10 A;  1KJT A;  1N5X A;  2GRI A;  4ITK A;  3L10 B;  3NS8 A;  4W9F A;  3A4R A;  2GB1 A;  3VVW B;  1SEB D;  3OAW A;  4I6L B;  3IG3 A;  3VH4 B;  4AP4 C;  3PZD A;  3NZ3 A;  3VDZ A;  3EEC A;  2W3R A;  4CYE A;  1WGG A;  2ZCB A;  2RSU A;  4W9D A;  1UD7 A;  2ZW0 A;  1K53 A;  5AUI A;  2HJ1 A;  2QC8 A;  3NJT A;  3NHE B;  2KC2 A;  2L0T A;  4ASW C;  2W3S A;  3L16 A;  1TY2 A;  4NJC A;  2I38 A;  1WR1 A;  1WGR A;  1EM7 A;  3CF6 E;  1P7E A;  2R2O A;  4XWW A;  3HVD A;  2K8C A;  3PO0 A;  4JE3 B;  4W9K A;  4PYU A;  1G6J A;  3Q69 A;  3SEB A;  1WJ4 A;  3ZGZ A;  1F0Z A;  1YQB A;  3LXF A;  2OJW A;  1TT5 B;  4WWP A;  2KC1 A;  2LGD A;  1I4H A;  1ROE A;  4F7Z A;  4PT5 A;  2BVC A;  2WXF A;  2OHF A;  5TSS A;  2KD0 A;  3H9D A;  2PMV A;  3WCQ A;  1H8C A;  1P7F A;  2BTE A;  3PRP B;  2V0G A;  2M4N A;  1V81 A;  3EFU A;  4IWO A;  4E74 A;  3AEC B;  3MHS D;  3JSV B;  2JX5 A;  2N4F A;  1D5X C;  3KYC D;  2DYM A;  3K9O B;  3A9K B;  1N62 A;  4TSS A;  2WNM A;  4S17 A;  4J6I A;  5BYR A;  2XNA C;  1XD3 B;  2K39 A;  5IAA C;  3ECI A;  4GU2 A;  1AN8 A;  2FCS A;  1IBX B;  2J53 A;  2AL3 A;  2OED A;  2LEK A;  4RMA A;  2INN E;  1JWM D;  2ICI A;  4DDG D;  4CO7 A;  1MG8 A;  1NEN B;  1EU4 A;  3GOE A;  2CS4 A;  2KTR A;  1SF0 A;  1V5O A;  4KGT A;  2Y5P A;  1ZP0 B;  3ONS A;  3BK1 A;  5DPS A;  1WX8 A;  3WAP A;  1UNS A;  2KQ4 X;  4ZYS A;  3ETR A;  1I7H A;  5EE0 A;  4RGN A;  4WQM A;  2DWQ A;  1D5M C;  1WR6 E;  2VZK B;  2SEB D;  4IWQ A;  4XZ4 A;  2GMI C;  1V6E A;  2K1F A;  1DYQ A;  1C4C A;  2WXN A;  2CHX A;  4HXD A;  2KMC A;  3VFK A;  3AE3 B;  1V80 A;  1M4V A;  2TSS A;  4DXG A;  2JWU A;  1XLQ A;  1KM7 A;  2JYE A;  2IDY A;  2M1M A;  2MP2 B;  4TKN A;  1FRD A;  1T0S C;  5FR6 A;  2L8J A;  3T3O A;  1V49 A;  1AYF A;  2EKE C;  3RNB C;  1WZ3 A;  1RFA A;  2Y3A A;  4K1R B;  2NPT B;  3QHT A;  2DZJ A;  4M00 A;  2KAC A;  2WDR B;  1WXM A;  5AZF A;  5LXI B;  1EF5 A;  2KN5 A;  2QMT A;  5EE3 A;  1FMA D;  2K3U A;  4RM8 A;  3AU5 A;  2BYF A;  4ARI A;  2K8B A;  2JY6 A;  1R7S A;  3A4S C;  3UIN B;  2NBU A;  4M8M A;  1C79 A;  3P2B A;  2D2Q A;  2UWQ A;  3RUL A;  4HPL B;  4NJ6 A;  1C4P A;  3QWZ B;  2BBC A;  2PIA A;  2NR2 A;  3HHM A;  3IHP C;  5JHA A;  1WJU A;  3IT6 B;  2J0M A;  1IYF A;  2NCN A;  1B1Z A;  3R2I A;  3VTU A;  3RNF C;  2QDF A;  1VZ8 A;  3ZRF A;  1KF6 B;  1WRI A;  1FO4 A;  2WU5 B;  1L0V B;  4LCD E;  3N1Y C;  1MJD A;  4GIV A;  3TIX A;  1P0R A;  1JWB D;  4YL8 A;  3GE3 C;  1VDV A;  2Z0E B;  1J7B A;  1D3Z A;  3RUI B;  2D5G A;  3AE2 B;  1JWS D;  2BWF A;  3FC4 A;  4RCO A;  4AS1 A;  3GE8 C;  4US9 A;  5JXV A;  1N60 A;  1CQV A;  4P1C C;  4K7U A;  3I63 C;  4HK2 A;  3VTV A;  1VLB A;  1E8Y A;  4BOZ B;  2HDE A;  2KNB A;  4B9K A;  2D3A A;  1GC7 A;  3P4S B;  4FA6 A;  2DZK A;  4YWG G;  4NJ7 A;  1NI2 A;  3P4P B;  1JW9 D;  4LJO B;  4HWI B;  3NVV A;  1C4A A;  3VTW A;  4RM9 A;  3FIL A;  3P4Q B;  1PGB A;  3VUW A;  2HD5 B;  4EOY A;  4PS7 A;  5G55 A;  4OW0 A;  1VR9 A;  4DDI D;  2L83 A;  3L08 A;  2MBB B;  2QHO A;  2WXK A;  4FN2 A;  1RFK A;  2N9P C;  2RDB C;  3T3N A;  3R66 C;  3Q8E A;  4B0M A;  2K8H A;  4P1B C;  2WDQ B;  1J8C A;  3O13 A;  1HE8 A;  1V5T A;  1V97 A;  1GAQ B;  2BB5 A;  3U30 A;  2DAJ A;  2KLG A;  2N9E B;  4MH0 E;  2YEP F;  5GXG B;  4DXF A;  2DBY A;  4WJP A;  2KTF A;  4HKZ E;  2X8X X;  3V61 A;  4A90 A;  3AEB B;  2MH7 A;  2C9W B;  1JRO A;  2QSD A;  3OLM D;  4MM3 A;  1ZKH A;  4LDT D;  3HK0 A;  2B76 B;  4C4V A;  3QAQ A;  3DBH B;  2BS3 B;  2WP9 B;  2NS5 A;  2Z59 B;  4GMV A;  2C7N B;  3BYT B;  3QQ8 B;  4NNJ B;  4GDK A;  1SJH D;  2AQ1 B;  4H2A A;  4D2K A;  4KV2 A;  1LQB A;  1F52 A;  2Z0D B;  2NBW B;  1EWC A;  4A55 A;  1YN5 A;  3UF8 A;  4G3X B;  4ZRQ A;  2FUG 1;  5C1Z A;  1I4G A;  3QJZ A;  5BO4 B;  2O6V A;  5MPO A;  3RT3 B;  1D6E C;  3Q14 C;  1V8C A;  4YSX B;  2BS4 B;  1QF6 A;  2V4I B;  3C8Y A;  2PPH A;  1CK1 A;  2LVO A;  3RNE C;  3ML8 A;  3SHQ A;  4PK1 A;  2GBR A;  3N9Y C;  4FXC A;  1TS2 A;  1XQQ A;  4KDL B;  1L6U A;  4M02 A;  1WXQ A;  1SIJ A;  2BW2 A;  3MHZ A;  2FCN A;  2MBE A;  4WWM A;  3AE5 B;  3KQ4 A;  3VR9 B;  4N59 A;  2EKI A;  3AM9 A;  3RD2 A;  1BXT A;  2ZPN A;  1WXS A;  4CQN A;  2L76 A;  3RNA C;  5D3I B;  3DHG C;  4JWS C;  2KWV B;  5J18 A;  2MW5 A;  2XEW A;  5KHQ A;  3DHI C;  4WQO B;  1C3T A;  2IBI B;  4XGA B;  4XDC A;  2JRH A;  4DHZ B;  1WYG A;  2ZPY A;  4L1B A;  3EC8 A;  1MPE A;  4TUU A;  4B0E A;  3P42 A;  3U7Z A;  2XK5 A;  4EKU A;  2RR9 A;  5C2T B;  1X1M A;  2AYO B;  2B3A A;  1GJZ A;  4N9F 4;  2I1K A;  1Q0W B;  2KK8 A;  1ZDV A;  4BKG A;  1WXA A;  2V3P A;  1ZGU B;  3EHV A;  2KTR B;  1LXD A;  1P3Q U;  2LJ5 A;  2R2Q A;  1YN3 A;  1HZ6 A;  2BT6 A;  2WQY B;  1NI3 A;  2ON8 A;  1QQR A;  3MC0 B;  4TQ0 A;  3V3X A;  4ARC A;  1UEL A;  2IGG A;  1OFF A;  4RF0 A;  1FFV A;  3DBR B;  1QOG A;  3H7P A;  2MLB A;  1KOT A;  1FRR A;  2KLC A;  2LD9 A;  1TGZ B;  3ZRC A;  2KQS A;  3TEZ A;  2KDE B;  2IGH A;  3DDC B;  2WHI A;  4C7Y A;  5D94 A;  2MSE D;  1C78 A;  5JZE B;  1JWA D;  2KFK A;  2INP E;  1I35 A;  1OEY A;  2KDI A;  2LGS A;  1KTK A;  2KXJ A;  2KJ6 A;  2BKF A;  4WH4 A;  1K51 A;  2KOX A;  3PZ8 A;  1XLN A;  3R2T A;  3ZXR A;  1IPG A;  1I4Q A;  1XXG A;  2MBQ A;  1ZUD 2;  2LI5 A;  1UF0 A;  1WX9 A;  3MJ5 A;  4DWF A;  1KH0 A;  3TEX A;  1FEH A;  3AE8 B;  3KYD D;  2ZW1 A;  5BMG A;  1T5X D;  2JT4 B;  3B2F A;  1P1A A;  3KUZ A;  1SGH A;  1PYW D;  4W9J A;  3B1L X;  3ZTC A;  4AJW A;  3HM3 A;  1V9J A;  2A4Z A;  1XCT L;  4MGI E;  2KX3 A;  3AED B;  4P7I A;  3O65 B;  3W5U B;  4KSK C;  3BYY B;  4MEL A;  2MCN B;  1XCQ L;  1FPY A;  1TS5 A;  3K9P B;  4YT0 B;  3EUB 2;  2HTM E;  1ESF A;  2WXG A;  4NAM A;  4G50 A;  1GNU A;  4OVV A;  2O2V A;  1Q5W B;  4YTN B;  4W9G A;  1XO3 A;  4AOF A;  4WAF A;  4RH6 A;  1R4N B;  2LGX A;  1TTN A;  2FCQ A;  1FNU A;  1EUV B;  4KIK A;  3ZVV A;  3ZJV A;  3DPD A;  2VZK D;  4AUQ C;  2INC C;  3DBH I;  1FCL A;  4A3P A;  4WJO A;  1N6Z A;  1OQQ A;  1WFY A;  1UBQ A;  2K25 A;  2G1E A;  4XWT A;  1EF1 A;  1HA5 A;  1DGJ A;  2AL6 A;  3X23 A;  5E6P A;  2BYV E;  4B6W A;  2N1V A;  5EE1 A;  2WDV B;  3VRA B;  1FXI A;  5G2N A;  4LTU A;  4HJG E;  4BFR A;  4LNO A;  1RRB A;  3ZUN A;  1TZ1 A;  3CSF A; 
#chains in the Genus database with same CATH homology
 5KHO A;  2IYD B;  2NBU A;  4M8M A;  3LJ3 A;  2J7Q B;  1YJ1 A;  4GOC A;  2AWT A;  2CR5 A;  3P2B A;  4IW0 A;  2PE6 B;  5DPW A;  4ANV A;  2D2Q A;  3R7Q A;  2UWQ A;  3RUL A;  4HPL B;  1YX5 B;  1E5W A;  3HIZ A;  4NJ6 A;  3QWZ B;  4JL9 A;  4JLC A;  4HVB A;  3ZW3 A;  2BPS A;  4FUL A;  3ZNI D;  1J19 A;  4HCP B;  2NR2 A;  4ZYN A;  2KKC A;  3RZF A;  3T8M A;  3TL5 A;  3W1S A;  1RLF A;  3HHM A;  3IHP C;  3SU8 X;  2IY0 B;  3DQV A;  4HDO A;  5JHA A;  1WJU A;  3MJW A;  3QC8 B;  2JUO A;  4TV3 A;  2J0M A;  1IYF A;  2ZCC A;  5DPT A;  2NCN A;  2RPQ A;  3S2A A;  2IO1 B;  5E6N A;  4GDL A;  3DCG A;  4KDI C;  3VTU A;  5D7G A;  2LVP A;  2PE9 A;  2WDT B;  4DHJ B;  2IO3 B;  3ZRF A;  2LUE A;  3Q3F A;  4XX5 A;  2G4S A;  4MEM A;  3ZNG C;  1E7U A;  5CTR C;  4KSL C;  1WM2 A;  5DPR A;  4LCD E;  5JH5 C;  3U7D A;  3D32 A;  4GIV A;  4IWP A;  2FCM A;  4ZRJ A;  3TIX A;  1P0R A;  2MP2 A;  2KMA A;  3ZO5 B;  4URK A;  5CHW A;  5HKH A;  2KZR A;  4KZ0 A;  4YL8 A;  1M94 A;  3ENE A;  2M8S A;  3R7R A;  3V6E B;  3UIO B;  3DVG X;  4EFO A;  2L00 B;  2BGF A;  2A5U A;  2MA9 B;  1UH6 A;  1E8Z A;  1FXT B;  2Z0E B;  1D3Z A;  3RUI B;  2OJR A;  5AZG A;  4DHJ D;  3ZDM C;  2NPT A;  3DBS A;  2ZVO A;  3LDZ E;  1YX6 B;  2BWF A;  3VHT C;  2LVQ A;  2KQ7 A;  1XT9 B;  3NOB A;  3A9J B;  3VQI A;  3PRE A;  4FHK A;  2MBO A;  5GMV A;  4AJY B;  3M95 A;  4HCN B;  3ML9 A;  3PHX B;  2NBV B;  4W9E A;  3NZS A;  3PS6 A;  4GDK B;  2D07 B;  4BOS C;  2C7M B;  3H6N A;  5E6O A;  3L0W B;  2UYZ B;  2L7R A;  4K7U A;  4HK2 A;  3VTV A;  3L54 A;  3V62 A;  1E8Y A;  4BOZ B;  2KNB A;  3PVL A;  4B9K A;  1E8X A;  2REX A;  2KAN A;  3QCA A;  2GBN A;  4IM0 A;  4ICU A;  1GC7 A;  4FJZ A;  2BYE A;  4FA6 A;  2DZK A;  5J2R A;  3BY4 B;  4IM2 A;  3DVN U;  4NJ7 A;  2DZM A;  2KDB A;  3KUC B;  1NI2 A;  2O6V B;  4LJO B;  3PGE A;  4HWI B;  4E3C A;  3QA8 A;  4JQW C;  5JHB A;  3H1U A;  3VTW A;  4GN1 A;  4RM9 A;  3AXC A;  3HM6 X;  1YD8 U;  1OGW A;  3VUW A;  2HD5 B;  1L7Y A;  4EOY A;  2FUH B;  1UZX B;  1SE9 A;  1GG3 A;  3B0A A;  2ZEQ A;  4K7W A;  4PS7 A;  5G55 A;  3ZDT A;  4ANX A;  4DDI D;  2D11 A;  3L08 A;  2HE7 A;  2MBB B;  1WM3 A;  4IG7 B;  2QHO A;  3ZTD A;  4FN2 A;  2N9P C;  4MDK E;  3DBR I;  4B95 A;  3UQB A;  2WWZ A;  4CHK A;  4AWJ A;  2RD0 A;  2N7D A;  3R66 C;  3VXW A;  2K8H A;  2O6V D;  3H7S A;  1J8C A;  1HE8 A;  1V5T A;  4BKS A;  3A1Q B;  3KH0 A;  2D10 A;  4LDT B;  1Y8R C;  3RZW C;  3U30 A;  5IA7 A;  3TCA A;  1TBE A;  4DK5 A;  1KLV A;  2WYQ A;  2IY1 B;  2KVR A;  3UGB B;  2LWP A;  2DAJ A;  3JW0 X;  2KLG A;  2N9E B;  3M62 B;  3VAW A;  3NZU A;  4MH0 E;  1K8R B;  2CHW A;  4ANU A;  2HJ8 A;  2D3G A;  4NPN A;  3QAR A;  4WJP A;  2MBH A;  2KTF A;  4I6N B;  2YLM A;  2LRU A;  2CHZ A;  2KWC A;  5D2M B;  3V61 A;  1WJ6 A;  4WWN A;  4M0W B;  5AZH A;  2RGF A;  3BIN A;  3JYU A;  2DYB A;  2C9W B;  3AI5 A;  1LFD A;  3OLM D;  4W9C A;  4FLH A;  4MM3 A;  1ZKH A;  2V4L A;  3HK0 A;  4LDT D;  4PS3 A;  3ZIM A;  1WH3 A;  3A9J A;  3QAQ A;  1S3S G;  3A33 B;  2IO2 B;  1WGH A;  3TBL D;  1RAX A;  3Q3J A;  4IC7 B;  3TMP B;  3WAO A;  4OVU A;  2NS5 A;  2Z59 B;  2FIF A;  4HDQ A;  4GMV A;  2C7N B;  3QQ8 B;  2XK5 B;  3PHW B;  4NNJ B;  4GDK A;  2M17 A;  3L17 A;  4BKT A;  3U8Z A;  4F1S A;  4KV2 A;  1ISN A;  1LQB A;  2Z0D B;  2NBW B;  5TR5 A;  4TQ1 A;  1WI0 A;  4MSM B;  4WJQ A;  3ALB A;  1OQY A;  3UF8 A;  4G3X B;  4BBN C;  2K6D B;  4W9H A;  5C1Z A;  3QJZ A;  2NVU I;  5BO4 B;  2O6V A;  2JZ3 B;  4JIO U;  4NAW B;  3PRM B;  2KDF B;  3RT3 B;  2J0J A;  1WGD A;  4EUT A;  2GOW A;  2CU1 A;  3SD5 A;  1WX7 A;  3PLV A;  1C1Y B;  4MGK E;  4GXB A;  2ASQ A;  1NDD A;  4IUM B;  1Q1O A;  2IO0 B;  2MRP A;  2C7H A;  3W1Y A;  3WAL A;  2EMS A;  2G45 B;  2PPH A;  4II3 B;  1A5R A;  3OJ4 B;  2WX0 A;  1E90 A;  2LVO A;  2LXA A;  3ML8 A;  3SHQ A;  3GZN I;  2N1W A;  2FID A;  2GBR A;  1XQQ A;  3N3K B;  4KDL B;  3APF A;  3VUX A;  4BKS D;  3RCZ A;  1WYW B;  3WAN A;  4MJS B;  3L13 A;  3WAM A;  1VCB A;  2JPH A;  3NY5 A;  2Y5B B;  2I1J A;  1JRU A;  1WXV A;  4PYZ A;  2FCN A;  2GBM A;  1WIA A;  2BF8 B;  3PPA A;  2MBE A;  3H7P B;  1R4N I;  2HTH A;  2WX1 A;  4W9I A;  4EZK A;  3UQA A;  1BT0 A;  3VH3 B;  2PEA A;  3RD2 A;  4G0N B;  2ZPN A;  4F8C B;  2PJH A;  1WXS A;  4K7S A;  2G4D B;  2L76 A;  4MGZ E;  3WIM A;  2OOB B;  2KWV B;  5AEK B;  1UGM A;  1ZW7 A;  2FNJ B;  4BBN F;  4EZJ A;  3X0W A;  5J18 A;  4KZC A;  2MW5 A;  2LZ6 A;  1KJT A;  2GBJ A;  2XEW A;  5KHQ A;  3CST A;  3QK0 A;  4WQO B;  2KFK B;  1C3T A;  2IBI B;  2J0K A;  3L10 B;  2DAF A;  2JF5 A;  5LLI A;  3NS8 A;  4W9F A;  1Z5S B;  2JRH A;  3A4R A;  4DHZ B;  2MX2 A;  3VVW B;  2ZPY A;  3DBL I;  2KJR A;  3EC8 A;  3OAW A;  4PS8 A;  4TUU A;  4KVG B;  1F9J A;  1GUA B;  3M63 B;  3IG3 A;  4I6L B;  4IM3 A;  3RYT A;  4MGY E;  3VH4 B;  4AP4 C;  3PZD A;  2XK5 A;  3N30 A;  2DYO A;  4K81 A;  3VDZ A;  4EKU A;  2RR9 A;  3EEC A;  2CKH B;  4HJK A;  4GSW A;  4CYE A;  1WGG A;  1WRD B;  2DZI A;  2ZCB A;  2RSU A;  2V1Y A;  1OTR B;  1X1M A;  3AU4 A;  4LJP B;  2N9X A;  4E71 A;  4W9D A;  2AYO B;  4FBJ B;  2B3A A;  3R3M A;  1WY8 A;  1UD7 A;  1J0G A;  4N9F 4;  1GJZ A;  2KHW B;  2I1K A;  1Q0W B;  3ZNH B;  5CX3 A;  1Z2M A;  2KK8 A;  3KVF B;  4NAW A;  3NHE B;  2KC2 A;  2L0T A;  3W1S C;  4ASW C;  4BKG A;  3L16 A;  1WXA A;  2LGY A;  1ZGU B;  3EHV A;  1YIW A;  4MSQ B;  2FAZ A;  3ZKJ C;  2KTR B;  2ZJD A;  1LXD A;  1WR1 A;  1WGR A;  4GB9 A;  3IVF A;  1P3Q U;  2LJ5 A;  1UBI A;  1LM8 B;  2EMT A;  2R2Q A;  3CF6 E;  3N32 A;  4HPM B;  1L2N A;  4ZRK A;  4EZL A;  2R2O A;  2K8C A;  1WMH B;  4ANW A;  2MQJ A;  1WE6 A;  4W9K A;  4GGQ A;  2JZZ A;  4PYU A;  1G6J A;  5D6J B;  5C23 A;  4MJS A;  3APD A;  4TQ0 A;  1WJ4 A;  1UEL A;  4G11 A;  1YQB A;  3DOW A;  5J17 A;  2JRI B;  4WWP A;  2KC1 A;  4NQK E;  2MWS B;  2LGD A;  4F7Z A;  2O2V B;  2GBK A;  2ZNV C;  3H7P A;  2MLB A;  2BKR B;  4A3O A;  1KOT A;  1S1Q B;  3DVG Y;  2AEH A;  4WJN A;  2LD9 A;  2KLC A;  1PQS A;  2KD0 A;  3H9D A;  2K6Q A;  1TGZ B;  4HLE A;  3ZRC A;  1H8C A;  2KQS A;  2KDE B;  3PRP B;  1CMX B;  3DDC B;  3APC A;  5D94 A;  3B08 A;  2MSE D;  4I6P A;  1AAR A;  2M4N A;  1V81 A;  3EFU A;  4KIK B;  1NBF C;  4IWO A;  4X57 B;  5JZE B;  2KFK A;  3WA0 A;  4E74 A;  3PRZ A;  1I35 A;  1OEY A;  2KDI A;  3CMM B;  3JVZ X;  3DVN V;  2KXJ A;  2KJ6 A;  2BKF A;  3MHS D;  3VUY A;  3PT2 B;  2C60 A;  3JSV B;  2N4F A;  2KOX A;  3KYC D;  2DYM A;  3K9O B;  3KUD B;  1IPG A;  1T0Y A;  3A9K B;  2BWE S;  3PTF C;  4A20 A;  2MBQ A;  2LI5 A;  3QX1 A;  1WX9 A;  1GC6 A;  4DWF A;  3T9L A;  3KYD D;  2M0X A;  4J6I A;  3ZLZ A;  1XD3 B;  2K39 A;  2LRW A;  3MTN B;  2JT4 B;  5IAA C;  3SDL C;  3ZNZ B;  3ECI A;  1P1A A;  3KUZ A;  2FCS A;  4GU2 A;  1SGH A;  3A1Q A;  5DCN A;  4EEW A;  2L0F A;  4FAD A;  2KJH B;  1QZE A;  1WGY A;  4W9J A;  2KX0 A;  3B1L X;  1V86 A;  2AL3 A;  2G3Q B;  3KW5 B;  1WE7 A;  3ZTC A;  4RMA A;  4AJW A;  1OEY J;  3V6C B;  3HM3 A;  4DDG D;  4ZDV A;  1H4R A;  2IZV B;  4CO7 A;  1MG8 A;  1V9J A;  2A4Z A;  3M3J A;  4M8N A;  3GOE A;  4FJV B;  2CS4 A;  2KTR A;  4MGI E;  3PSE B;  2LAS A;  5L95 C;  2KX3 A;  4P7I A;  3O65 B;  4KSK C;  1SIF A;  4W9L A;  1V5O A;  4MEL A;  3ONS A;  2V3S A;  2MCN B;  5L83 A;  5DPS A;  1V2Y A;  4NY0 A;  3QIJ A;  1WMH A;  1WX8 A;  4ICV A;  3WAP A;  5CHV C;  5LXH A;  4DBG A;  3UIP B;  2L3Z A;  3K9P B;  1WR6 E;  4DHZ E;  1WF9 A;  4IWQ A;  4GDL B;  4XZ4 A;  2GMI C;  1V6E A;  2K1F A;  1WZ0 A;  1VD2 A;  2C5L C;  4G50 A;  1I42 A;  1GNU A;  2CHX A;  4OVV A;  2N7E A;  3I3T B;  2O2V A;  1EO6 A;  1P98 A;  1P9D U;  4HXD A;  2KMC A;  4II2 B;  1Q5W B;  3VFK A;  1U4A A;  4JGH B;  4FHJ A;  4BVU C;  4W9G A;  3AUL A;  3IFW B;  2KO3 A;  1V80 A;  5CHF A;  4WAA A;  2VRR B;  4AOF A;  3IBE A;  2L05 A;  2ZNV B;  4WWO A;  5EDS A;  1KM7 A;  4FJY A;  3TJP A;  2LGX A;  1TTN A;  2M1M A;  2MP2 B;  2FCQ A;  4TKN A;  5FR6 A;  2L8J A;  1EUV B;  4ZRI A;  4XC2 A;  3V60 A;  4KIK A;  3OJ3 A;  1WJN A;  2ZZP B;  2DHZ A;  3ZVV A;  4DXA B;  3DPD A;  1V49 A;  4NQL B;  4AUQ C;  2EKE C;  3DBH I;  3C0R B;  4A3P A;  1WZ3 A;  3PLU A;  4WJO A;  1RFA A;  1E8W A;  4K1R B;  1WFY A;  3JSV A;  2NPT B;  2W9N A;  3PV1 A;  1UBQ A;  2K25 A;  2JXX A;  3QHT A;  2DEN B;  2DZJ A;  2JWZ A;  2ZVN A;  3A9K A;  1E7V A;  2DX5 B;  2LXC A;  3UIN B;  1WXM A;  5AZF A;  1EF1 A;  1R4M I;  5LXI B;  1EF5 A;  2KN5 A;  2KFJ A;  2AL6 A;  3X23 A;  5E6P A;  2BYV E;  2JVC A;  4B6W A;  2N1V A;  2YVC A;  2KWU B;  5G2N A;  4RM8 A;  3AU5 A;  2BYF A;  2XBB C;  2K8B A;  4BFR A;  1RRB A;  2JY6 A;  3ZUN A;  1IP9 A;  3A4S C;  1TZ1 A;  3CSF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...