4ZYNA

Crystal structure of parkin e3 ubiquitin ligase (linker deletion; delta 86-130)
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
420
structure length
367
Chain Sequence
MIVFVRFNSSYGFPVEVDSDTSIFQLKEVVAKRQGVPADQLRVIFAGKELQNHLTVQNCDLEQQSIVHIVQRPKPTYHSFFVYCKGPCHKVQPGKLRVQCGTCRQATLTLAQGPSCWDDVLIPNRMSGECQSPDCPGTRAEFFFKCGAHPTSDKDTSVALNLITNNSRSIPCIACTDVRNPVLVFQCNHRHVICLDCFHLYCVTRLNDRQFVHDAQLGYSLPCVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVCPRPGCQGQTCEGCGFVFCRDCKEAYHCDSYRVDQRAAEQARWEEASKETKTTKPCPRCNVPIEKNGGCMHMKCPQPQCKLEWCWNCGCEWNRACMGDHWFDV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ubl/ubiquitin switch in the activation of Parkin.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Ligase
molecule keywords E3 ubiquitin-protein ligase parkin
total genus 73
structure length 367
sequence length 420
chains with identical sequence B
ec nomenclature ec 2.3.2.31: RBR-type E3 ubiquitin transferase.
pdb deposition date 2015-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
A PF01485 IBR IBR domain, a half RING-finger domain
A PF17976 zf-RING_12 RING/Ubox like zinc-binding domain
A PF17978 zf-RING_14 RING/Ubox like zinc-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4zynA01
2YVCA 3ZNHB 4LCDE 2C7HA 4F8CB 4WWOA 2GBNA 3A1QB 4KVGB 2XK5B 3M3JA 3EFUA 2DYMA 1EUVB 1SGHA 2KHWB 2ZZPB 1L7YA 2Z0DB 3ZDTA 1WI0A 3O65B 2C60A 3A1QA 2LI5A 4FBJB 1A5RA 4MSMB 1WH3A 1KJTA 2N9PC 3KUZA 2D10A 2WX0A 5GMVA 4GXBA 2M1MA 4BVUC 3ZTDA 2PJHA 4KDIC 3NOBA 4MGYE 4CHKA 2DX5B 2LWPA 4LJOB 2KWUB 4PYZA 4A3OA 2NPTA 3CF6E 4TQ1A 4HK2A 2KJ6A 2LRUA 2L76A 2KTRB 2NBVB 2ZPYA 4FJZA 4W9JA 3U30A 4AUQC 4TQ0A 2UWQA 1L2NA 4FADA 1UBQA 2FCMA 4W9DA 1K8RB 2LJ5A 3I3TB 4ZRJA 2ZNVC 3EHVA 2MA9B 3KW5B 3NS8A 1WX7A 4K7WA 4HPMB 3TMPB 4DDID 2D11A 2BPSA 1ISNA 1OQYA 2FAZA 3PGEA 4GSWA 3R7QA 4IG7B 2IO3B 1WJUA 3N3KB 1UGMA 3KUDB 4GMVA 3ZLZA 3DVNU 1V81A 2EMTA 3TBLD 3H7PA 2O2VB 4IWOA 3UIPB 4W9FA 3CSTA 4DK5A 3DVNV 2LGDA 1WR1A 1GC6A 2C7NB 2LD9A 1MG8A 2NPTB 3NZUA 4ANVA 2IBIB 2QHOA 2O2VA 3ENEA 4OVUA 2GMIC 4YL8A 4TV3A 4FHJA 2JWZA 2NR2A 2N4FA 4CO7A 4WQOB 1WM3A 3LJ3A 2I1JA 2O6VB 3ZW3A 3AU5A 4HJKA 4AOFA 4WJQA 3PSEB 4M0WB 2FCQA 1XT9B 4HLEA 3DBLI 3QHTA 2KJHB 2O6VA 3B08A 1OEYJ 4G3XB 3MJWA 2KLCA 2XK5A 1Q5WB 5AZHA 1E8ZA 2KC1A 4AJYB 1H8CA 3VUXA 1AARA 2XEWA 3VUYA 1WGDA 3PHXB 2N9EB 4DWFA 2HTHA 2K6QA 5D7GA 5IAAC 4K1RB 2D3GA 4KV2A 4ASWC 1R4MI 4RMAA 2BYEA 4HDQA 4WJOA 4WWNA 1KM7A 1WZ3A 2NBWB 2KDFB 2V1YA 4GDLB 4TUUA 1VCBA 2KN5A 2ZPNA 1Y8RC 2G3QB 3HM3A 2DZKA 4GIVA 2UYZB 3N30A 1J8CA 3PPAA 2KX3A 2K8BA 3PV1A 4GGQA 4BFRA 1RRBA 3SD5A 2DZJA 2HE7A 3KYCD 1P0RA 4NAWB 3PRPB 4CYEA 1KLVA 3ONSA 4ANXA 4RM8A 2C5LC 2DZMA 2RGFA 4GDKA 2IY1B 3WAMA 2A4ZA 3MHSD 1WE7A 2MWSB 5TR5A 5J18A 2PE6B 2G4SA 3AXCA 2XBBC 5D2MB 1I42A 1EO6A 2K39A 3CSFA 3MTNB 4AWJA 3A4SC 4GN1A 4EEWA 1UELA 1GUAB 3SHQA 1IYFA 1P9DU 2CHXA 3L54A 1P3QU 3Q3FA 1WJ4A 3NHEB 3R7RA 3PZDA 4B6WA 2PEAA 1E7UA 2DAJA 2BWFA 2ZVOA 2ASQA 3L0WB 4GDLA 5DPRA 4KSLC 2L8JA 3IVFA 3AULA 3UINB 2AL6A 2Z0EB 3W1YA 1J0GA 2G45B 2LVOA 4FHKA 4BKSA 3HIZA 4DHZB 2KTFA 4IUMB 4IM3A 2MW5A 4MEMA 3X0WA 3UQAA 1LFDA 3ZUNA 2KDBA 1TZ1A 3QK0A 3IBEA 4PS8A 1P98A 1LM8B 2WDTB 3PVLA 3HHMA 1WM2A 5G2NA 1Q0WB 2JPHA 3A33B 2MRPA 5C1ZA 2OOBB 3N32A 4KSKC 4JIOU 1Q1OA 3KYDD 3OAWA 2L0TA 2KNBA 1V5TA 5LLIA 5LXHA 2N7DA 4WWPA 2C7MB 1FXTB 5CHFA 3DCGA 4MH0E 1J19A 1WJNA 2CU1A 2JY6A 1OTRB 4BBNF 2L7RA 4BBNC 2KWCA 3ZO5B 2REXA 1S1QB 3PREA 1D3ZA 3RYTA 4M8NA 3ML8A 3PLVA 4BKSD 1RAXA 1YD8U 3PRMB 4ANWA 2WYQA 2WX1A 4FJYA 2N9XA 4WJPA 1WGRA 2RPQA 2LRWA 1EF5A 4NNJB 3VFKA 3L08A 2MBHA 2L0FA 1WXVA 3GZNI 4N9F4 4WAAA 4NAWA 1HE8A 3QJZA 1P1AA 1Z5SB 2GBKA 4K81A 2C9WB 3ALBA 4GDKB 4W9LA 3PHWB 4G11A 5D94A 1R4NI 2MBEA 3PS6A 3AU4A 3HK0A 4M8MA 5J2RA 1I35A 3SU8X 2M4NA 2KANA 2J7QB 4AJWA 1WX8A 2PPHA 3IG3A 2LZ6A 3UF8A 1E7VA 5JH5C 2M8SA 3QCAA 2IZVB 4BOZB 3NZSA 2K6DB 4HPLB 4MGIE 3WANA 2IO1B 2ZVNA 1TGZB 3WALA 1VD2A 4OVVA 2LVPA 3TJPA 2MSED 2DZIA 2BWES 4JLCA 2L3ZA 3V62A 2L00B 4EZKA 1NDDA 4BKTA 4IC7B 4II2B 2LGXA 2K8HA 1WF9A 2GBJA 2KD0A 4NPNA 4HDOA 4W9KA 5JHBA 3PLUA 1SIFA 1GC7A 3DBHI 1OGWA 2CR5A 1WMHB 2YLMA 4HWIB 4F7ZA 3VTUA 3UIOB 2VRRB 4W9CA 1LXDA 3CMMB 4A3PA 2EMSA 1X1MA 4GOCA 4EKUA 4ICUA 3RD2A 1GG3A 3W1SC 4MM3A 4XC2A 4WJNA 3H6NA 4ZYNA 4FN2A 4NJ6A 3T8MA 3VVWB 2GBRA 1YJ1A 2MP2A 3R66C 2FNJB 3D32A 1YQBA 4AP4C 3V6EB 5E6OA 2ZEQA 4EUTA 4FA6A 1WY8A 3ZDMC 4FLHA 3L10B 1WGYA 1WXMA 5BO4B 5IA7A 3QQ8B 3RZFA 1M94A 3A4RA 1E5WA 4KZ0A 3ECIA 4HCPB 4A20A 4G0NB 2JZ3B 1ZGUB 3JSVB 1WMHA 4XX5A 3R3MA 3ZNZB 2LGYA 1V49A 3DBRI 3A9KA 2KJRA 4LDTB 1E8YA 1GJZA 3JSVA 3PT2B 3QARA 3KUCB 1ZW7A 3VH4B 3A9KB 1SE9A 3GOEA 2KC2A 1WZ0A 2KO3A 2KXJA 1RFAA 3WA0A 2RSUA 5EDSA 2KLGA 1NBFC 2AEHA 2MP2B 3H9DA 3VQIA 1PQSA 1KOTA 2A5UA 2O6VD 4LJPB 4E74A 5L83A 1E90A 5DPWA 4NQLB 2D2QA 3VAWA 4URKA 1EF1A 2ZCCA 2KKCA 4F1SA 1Z2MA 4JGHB 3M62B 4II3B 1YX5B 3RZWC 3ZIMA 5C23A 4PS3A 3L16A 4ZRKA 3BY4B 5JHAA 5AEKB 1C3TA 1U4AA 2I1KA 2KOXA 2KQSA 1WE6A 1IP9A 2RD0A 5E6NA 4B9KA 2JF5A 1V5OA 3HM6X 3TL5A 4ANUA 2HD5B 4MDKE 4DDGD 3A9JA 4IM0A 5DCNA 2L05A 5CHWA 2BGFA 1XD3B 3KVFB 3L17A 5L95C 2KDEB 3L13A 4JL9A 2LUEA 4MJSA 2KVRA 1T0YA 3DVGX 4NY0A 4K7UA 4IM2A 4E3CA 4FULA 2AYOB 2MLBA 2WWZA 1C1YB 3IFWB 1UBIA 2FIFA 4PS7A 2CS4A 3M95A 5CHVC 1BT0A 3QA8A 2JVCA 4RM9A 2ZNVB 4K7SA 4NJ7A 3QX1A 3DBSA 3ZRFA 2KMAA 2FCNA 2PE9A 4IWPA 2K8CA 3RT3B 3JYUA 2DAFA 1CMXB 1WXAA 2JRHA 5FR6A 1TTNA 2D07B 4I6PA 2LVQA 3RULA 4E71A 3Q3JA 4X57B 3TCAA 2BKFA 3VTVA 2JZZA 3SDLC 1WX9A 3IHPC 2KDIA 5DPSA 2CHWA 2MBOA 4JQWC 2KZRA 3QAQA 2JXXA 4MELA 3OJ3A 5G55A 3U8ZA 2BKRB 1E8XA 2CHZA 2DYOA 3VHTC 3WIMA 3VTWA 4I6NB 1GNUA 2N1WA 3EC8A 3H7SA 3ML9A 3ZKJC 4W9GA 3APFA 2KFKA 4P7IA 1G6JA 3AI5A 2BF8B 4IWQA 2JT4B 3DVGY 4MGZE 1IPGA 2FCSA 3UQBA 1WXSA 4I6LB 3DDCB 2NVUI 2BYVE 2DYBA 1YIWA 1WGHA 2FUHB 3B0AA 3P2BA 2GOWA 2RR9A 3K9OB 2Z59B 5CTRC 1QZEA 4EZJA 3BINA 2OJRA 4HVBA 4XZ4A 2KWVB 1V6EA 4W9HA 2KQ7A 5E6PA 1WIAA 5CX3A 1WR6E 3V6CB 4B95A 5HKHA 4IW0A 2V3SA 2MBQA 3EECA 4ZDVA 3ZVVA 2R2QA 4MGKE 3VUWA 2W9NA 5J17A 3A9JB 1OEYA 2DHZA 2JUOA 3DOWA 5LXIB 1S3SG 4DXAB 2EKEC 3VH3B 1E8WA 2AWTA 2IO0B 3ZTCA 1V2YA 4MJSB 2G4DB 2R2OA 4BKGA 3APCA 4HXDA 3QC8B 2V4LA 1WJ6A 3X23A 4EOYA 3APDA 3QIJA 2NCNA 2MBBB 3NY5A 1UZXB 1NI2A 2AL3A 2MCNB 4DHJB 1WFYA 2B3AA 2CKHB 1TBEA 4ICVA 3TIXA 3PTFC 4KDLB 2MQJA 3JW0X 3VXWA 1XQQA 2K25A 2ZCBA 1JRUA 5KHQA 3U7DA 2J0JA 1V86A 2KTRA 3JVZX 3LDZE 2LXCA 2N7EA 3H1UA 3WAOA 1V80A 2Y5BB 2NS5A 4W9EA 4J6IA 3B1LX 1WGGA 3OLMD 4EFOA 5AZFA 4PYUA 1UH6A 2DENB 2M0XA 1ZKHA 5D6JB 3QWZB 4GU2A 3ZNID 2GBMA 4W9IA 1F9JA 2FIDA 5JZEB 1LQBA 4KIKA 3T9LA 2J0MA 2LXAA 3V60A 5AZGA 3RCZA 2M17A 5DPTA 3ZRCA 4EZLA 2HJ8A 4FJVB 3V61A 4DHZE 2JRIB 4DBGA 3ZNGC 1UD7A 2IO2B 4MSQB 2MX2A 2KFKB 3PRZA 4KIKB 4NQKE 2KX0A 3H7PB 4GB9A 2NBUA 3OJ4B 4HCNB 3M63B 1WYWB 1YX6B 2K1FA 4BOSC 4KZCA 4ZRIA 3S2AA 3W1SA 3KH0A 2IY0B 3K9PB 2BYFA 3DQVA 1RLFA 2IYDB 4LDTD 2LASA 2N1VA 2J0KA 1WRDB 2KFJA 5KHOA 3RUIB 2KMCA 4G50A 1V9JA 3C0RB 1H4RA 2KK8A 3UGBB 3DPDA 4TKNA 3WAPA 3VDZA 2ZJDA 4DHJD
chains in the Genus database with same CATH superfamily
2YVCA 4LCDE 4BZAA 3AEFB 4KX6B 3EUB2 4IKGA 2DYMA 2EKIA 2RDGA 4Q2JA 2Q5WD 2C60A 1A5RA 3TEZA 4KKIA 2D3BA 2MJDA 1FIQA 2D10A 1ENFA 4GXBA 3ETRA 3ZTDA 2PJHA 3NOBA 4A90A 2LWPA 4KKJA 1ZDVA 4HK2A 2KJ6A 4RFBA 2NBVB 1SXTA 1UBQA 5EE1A 2J42A 3KW5B 3NS8A 2MA9B 2D11A 4JX1C 4LLGM 4GSWA 2I2YA 3Q3MC 1XLQA 1HQRD 1FXIA 1K52A 3ZLZA 1ZUD2 3DVNU 4IWOA 4P1CC 4RGOS 2WNMA 2LD9A 2C7NB 2NPTB 2IBIB 2QHOA 3ENEA 1ET6A 4YL8A 2E3TA 4FHJA 3VRBB 1JW9D 1FCCC 2KVZA 3ZW3A 1JALA 2I1JA 3LJ3A 3PSEB 2FCQA 4HLEA 3DBLI 2O6VA 4G3XB 1Q5WB 5AZHA 4REZA 1PGBA 1F77A 1RYJA 3EGRA 2Y5PA 3AECB 1VR9A 2J53A 4RMAA 4WWNA 2KDFB 2ZPNA 1T0QC 1Y8RC 2DZKA 1JWSD 4DXGA 3PPAA 3PV1A 3P4SB 3SD5A 2DZJA 5H92C 4CYEA 1STEA 3ONSA 4RM8A 2DZMA 3MHSD 5J18A 2PE6B 2G4SA 1EO6A 4AWJA 3MTNB 1UELA 1GUAB 3BVGA 1YN4A 1WJ4A 2PEAA 3TEYA 2BWFA 2INDC 4KSLC 3AULA 2AL6A 3W1YA 4MEMA 3X0WA 1JROA 3ZUNA 4M0WA 5H8YE 3QK0A 3NVWA 1Q10A 3SR6A 4WIPA 3HHMA 1QLBB 3A33B 2MRPA 3P4RB 3V05A 4KSKC 3KYDD 3RNGC 4WWPA 4MH0E 5BYQA 1PDXA 3N9YC 3FAHA 1SF0A 3OWEB 2L7RA 1S1QB 2GRIA 1FNWA 3ML8A 3PLVA 1I4PA 1YD8U 4ANWA 5AUIA 2WYQA 4K3BA 2WX1A 2WXNA 2JZPA 1EF5A 1C79A 3GZNI 1HE8A 2GBKA 2ON8A 2C9WB 4W9LA 3PHWB 2WXMA 1WXQA 1R4NI 3AU4A 1WWTA 1HXYD 3IT6B 2KANA 2D3CA 2UU7A 1E7VA 5JH5C 2BW2A 2PVOD 2V0GA 4HPLB 1TGZB 4OVVA 2BWES 4TSSA 2SEBD 4BKTA 4IC7B 1GAQB 3DWMA 2K22A 2JWUA 3RMKC 5JHBA 1XF5L 1SIFA 4RF1A 1JCKB 4S17A 4F7ZA 3ZJUA 4KGRA 3CMMB 2K0PA 1UGJA 4ICUA 3RD2A 4YWGG 4ACFA 4WJNA 3H6NA 4FN2A 2GBRA 1FMAD 1YJ1A 1MVKA 1KF6B 3DWGC 2RMMA 4AP4C 3V6EB 2ZEQA 1FM0D 1JWMD 3GE3C 3LB8C 3CWIA 4RGTA 3L10B 1WGYA 5IP4D 2WP9B 3A4RA 1L0YB 5FR3A 3ECIA 1QOFA 4A20A 2JZ3B 1V97A 2V9HA 4XX5A 3R3MA 3KQ4A 1NI3A 1V49A 4MM3B 3A9KB 1FEHA 2KC2A 1WZ0A 1V1PA 2KXJA 3WA0A 2BS3B 2KLGA 2AEHA 3VQIA 3DHHC 1KOTA 2BVCA 4LJPB 5FKAC 2WXQA 5DPWA 4F1SA 1Z2MA 4II3B 5C23A 4ZRKA 1TKEA 2ZW0A 4RF0A 1IP9A 2QSDA 2RD0A 3HM6X 4ANUA 3BZDB 4IM0A 1OFFA 2BGFA 3ZGZA 4JL9A 4O1NA 2FE8A 4NJCA 1TY0A 4K7UA 4E3CA 1C1YB 2L1AA 1SIJA 2CJNA 3M95A 3UI3A 2JVCA 1FRDA 1TYGB 4NJ7A 2FCNA 4C4VB 1HZ5A 1TS4A 2PE9A 4IWPA 2K8CA 3RT3B 3JYUA 3NVVA 2LVQA 1BXTA 1KRHA 3SDLC 2KDIA 2MBOA 2HDEA 4JQWC 1D5ZC 5G55A 2BKRB 1PFDA 2DYOA 4BAXA 3VHTC 4M01A 1JWBD 4I6NB 1AYFA 3H7SA 1SEBD 2MH7A 3IXSA 4N6EB 1SBBB 4MGZE 4R3DA 2FCSA 1WXSA 4I6LB 1M4VA 3AB5A 2GOWA 2RR9A 3K9OB 1E0ZA 2D5GA 2FBWB 2Z59B 1QZEA 5HI1A 2KWVB 2GI9A 4LNKA 1N5XA 5CX3A 4B95A 2M56B 2V3SA 3WCQA 3EECA 4MGKE 1V8CA 2VZKD 2DHZA 4TMAB 2JUOA 1V2YA 4KGSA 2G4DB 2R2OA 1WJ6A 2OJWA 3NY5A 1P7EA 1UZXB 4IDIA 4DHJB 1WFYA 2QCZA 2MQJA 3VXWA 1XQQA 4US9A 3RPFC 1L5PA 2NTTA 3LDZE 2RDHA 3WAOA 1V80A 2Y5BB 2NS5A 1IGCA 3IAM1 4J6IA 4EFOA 5AZFA 1UH6A 1ZKHA 3AE8B 4W9IA 1YNTE 3T9LA 3V60A 4EZLA 1UD7A 2KFKB 2KQ4X 2KX0A 3H7PB 1TS5A 3AE6B 3OJ4B 4HRSA 3M63B 1WYWB 1YX6B 1PGXA 2K1FA 1ZPSA 4PT5A 2N1VA 5KHOA 3RUIB 2KMCA 3TUOA 1V9JA 4LTUA 2KK8A 4TKNA 2HJ1A 4F8CB 4KVGB 3A1QB 3NS1A 3M3JA 2PLPA 2KHWB 3ZDTA 1N63A 1CK1A 2LI5A 3A1QA 3RN9C 1QILA 4MSMB 3T3NA 3KUZA 1K50A 2DX5B 4PYZA 2WXIA 4A3OA 2NPTA 3CF6E 2JSVX 2PKOA 2L76A 3N1XC 4TQ0A 1L2NA 3B2FA 4W9DA 2LJ5A 3I3TB 2ZNVC 4K7WA 4LNOA 1WX7A 4HPMB 3TMPB 2BPSA 1ISNA 1OQYA 5AUKA 2WXGA 2FAZA 2KAJA 2G9HD 3I63C 3KUDB 3R2IA 2EMTA 3TBLD 3H7PA 2N9LA 3CSTA 3NZUA 1MG8A 1TT5B 3GB1A 2GMIC 4TV3A 1I4GA 4WQOB 1WM3A 3AU5A 1HEZE 2KJHB 3QHTA 4M00A 1LGRA 3BYYB 3MJWA 1MPEA 1TS2A 3AE1B 4J3OD 2W3RA 2QEJC 3VUXA 2XEWA 3VR8B 3OG5A 1F2RC 2WXKA 3Q8AA 4LNIA 2HTHA 1GB4A 2LGIA 5IAAC 4KV2A 4XDDA 3Q8CA 4GDLB 3AEAB 4ITKA 3HM3A 2KN5A 2BYTA 2UYZB 3RFZB 1C4AA 1E10A 4HJGE 4WAFA 4BFRA 1RRBA 4HEA1 3KYCD 1KLVA 4N58A 4NAWB 4JWSC 4ANXA 2A4ZA 1WE7A 4ZRPA 2MWSB 3AXCA 2XBBC 5D2MB 1RFKA 1DGJA 3L54A 4C7ZA 3R7RA 2BBCA 1K53A 4B6WA 1NEKB 3I5JC 1E7UA 2DAJA 2ZVOA 1FO4A 3L0WB 5DPRA 3R2TA 2ACZB 2Z0EB 2G45B 1N62A 4DHZB 2KTFA 4IM3A 2KDBA 1TZ1A 3IBEA 2AX5A 1LM8B 5G2NA 2NTSA 3ZJTA 2JPHA 3I57A 1Q1OA 4JPSA 4RGNA 5LXHA 1YN3A 2JXTA 2KT7A 2N7DA 2C7MB 1FXTB 1J19A 2CU1A 2H88B 2V3NA 2ONQA 4BBNC 3ZO5B 2REXA 1D3ZA 1ESFA 3PRMB 2JYEA 4GLSC 4NNJB 2RPQA 2LRWA 2J52A 1WXVA 3ZXVA 2W82A 4NAWA 1P1AA 1Z5SB 4K81A 3ALBA 4G11A 1ZP0B 3HK0A 2D3AA 3SU8X 4AJWA 4OZCA 3NZSA 3WALA 4JLCA 3V62A 2L00B 4EZKA 4C56C 2K8HA 2LGXA 2JU6X 2GBJA 1PUTA 2CR5A 4HWIB 2ZW1A 4W9CA 4ZHOA 1LXDA 3L4PA 3P42A 3NJTA 1BMLC 4XC2A 4NJ6A 4YSYB 3VVWB 1AWDA 1TKYA 1DYQA 4FLHA 3E56A 5IA7A 4OZAA 3RZFA 3LYYA 4KZ0A 3JSVB 1N5WA 1WMHA 4UDUC 3DBRI 1E8YA 2JX5A 3JSVA 3U4EG 3KUCB 1ZW7A 1XXGA 1T6BX 2BQQA 1YJJA 2RSUA 1F1HA 1GOZA 2A5UA 1AW7A 5L83A 1E90A 2D2QA 3PZ7A 3SEBA 3M62B 1J7BA 4PS3A 1B1ZA 3BY4B 1C3TA 1WSPA 2KOXA 2KQSA 1WE6A 4XDCA 4B9KA 2JF5A 2BTEA 2HD5B 1ZDXA 5C2TB 4DDGD 3NVYA 2L05A 5CHWA 1R4NB 3L17A 3V3XA 2LGSA 1C9FA 3L13A 1DOXA 1T0YA 2DLBA 3DVGX 1C77A 3AE9B 4ZYSA 1UBIA 2FIFA 4PS7A 5CHVC 1BT0A 4K7SA 3NUHB 2KMAA 2GB1A 3VR9B 1WXAA 5FR6A 1TTNA 2D07B 1KH0A 4I6PA 4LNNA 4E71A 1ET9A 2JZZA 1E8XA 2LHDA 1UWMA 1I4XA 1WRIA 3APFA 4W9GA 5BYRA 4P7IA 2JQRB 3AI5A 2Y3AA 4IWQA 3AE4B 3NVZA 3C8YA 1E6EB 3U7ZA 2NVUI 1YIWA 2FUHB 3B0AA 5IKCM 3P2BA 4MH8A 4WURA 1J7CA 4S0RA 5CTRC 3BINA 4P1BC 4W9HA 2KQ7A 3DHIC 4IW0A 3SFEB 2MBQA 3TSSA 4ZDVA 3ZVVA 1VZ7A 3VUWA 5LNK1 1OEYA 1E8WA 2AWTA 2IO0B 4JWUC 3APCA 3X23A 2V4LA 2BB5A 3QIJA 2MBBB 1NI2A 2AL3A 1FFVA 4ICVA 2LFIA 5EE3A 2K25A 2ZCBA 5KHQA 3U7DA 1V86A 3SFDB 3JVZX 3ZQ4A 3Q2AC 1T3QA 4YSZB 4W9EA 1JWAD 3B1LX 3OLMD 1LO5D 3LXFA 4PYUA 1DOYA 4GU2A 3IT4B 2GBMA 1LQBA 1ZE3D 4KIKA 2J0MA 2VZKB 2HJ8A 2WDVB 2IO2B 4MSQB 2NBUA 4BOSC 4ZRIA 3S2AA 2IY0B 3K9PB 1XCTL 2JYTA 1UUPA 3DBRB 1R4MB 3AM9A 1WGKA 4NZLB 3C0RB 1YQ4B 3DPDA 3UGBB 1P7FA 2MJ3A 1XLOA 3ZNHB 4WWOA 1TY2A 2GBNA 2XK5B 1T0SC 3Q3OC 4RNAA 1SGHA 1L7YA 1N61A 1ZXHA 2Z0DB 3RNCC 3O65B 4FBJB 1WH3A 2N9PC 1R7SA 1D5XC 2WX0A 2TSSA 4C80A 4KDIC 1GPXA 4CHKA 5G5HA 2BB6A 4LJOB 2KWUB 5E6JA 1F2RI 1FD6A 4TQ1A 4HPPA 2KTRB 2ZPYA 4FJZA 2AQ2B 2FCMA 1K8RB 2IPKD 4DQOC 3EHVA 1NYRA 1D5MC 1MG4A 2IGDA 1FFUA 2VH1A 3R7QA 4IG7B 2IO3B 1UGMA 2X8XX 2O2VB 4W9FA 2LGDA 2W54A 3AN1A 2O2VA 2JWZA 1FCLA 2NR2A 2N4FA 4CO7A 2O6VB 3N1ZC 2WDRB 4HJKA 4WJQA 4M0WB 1SSNA 4D2KA 1XO3A 2LUMA 2KLCA 1E9MA 2XK5A 1YJIA 2WXFA 1E8ZA 1L6VA 4AJYB 3H8HA 3VUYA 4HKQA 2WXJA 2PIAA 5D7GA 2D3GA 5HG2A 4ASWC 4WJOA 4HDQA 2W55A 2KWDA 2V1YA 4TUUA 5D3DA 3N30A 1MHHE 1NYQA 2RDBC 1J8CA 2K8BA 1NVID 2M0AA 1IBXB 2HE7A 3Q8EA 1P0RA 3ZJVA 3PRPB 3Q6BA 2RGFA 2IY1B 3WAMA 2K3UA 3C19A 3CSFA 4EEWA 3A4SC 4GN1A 4XE0A 3SHQA 2Z8LA 2V3PA 2VH2A 1P3QU 4RH6A 3MHZA 2WU2B 3W9CB 2FUG1 4GDLA 2KMMA 3HUIA 2W3SA 3IVFA 4ZRQA 2LVOA 4FHKA 4BKSA 3HIZA 4IUMB 2MW5A 3UQAA 3GS2A 1P98A 5EE0A 2WDTB 4A6QA 1WM2A 2L83A 3HRDD 3N32A 2N9KA 1QQRA 2L0TA 3AE3B 1V5TA 3OAWA 1HTQA 1QOAA 2JY6A 3DBHB 3BK1A 1OTRB 1IUEA 3B2GA 2KWCA 4A8XC 3PREA 3RYTA 3BVZA 4BKSD 1RAXA 2H89B 3BWUD 3NG0A 1WGRA 2L0FA 4WAAA 4N9F4 1V1OA 5D94A 3N1YC 1I35A 3AEEB 4M8MA 5J2RA 3FILA 2M4NA 3IG3A 4H2AA 3QCAA 2K6DB 3WANA 4MGIE 2IO1B 2ZVNA 1VD2A 2N7JA 2DZIA 2K9XA 1AN8A 1NDDA 1SE2A 2YEPB 4II2B 4P6VF 1WF9A 2KD0A 3KWLA 4HDOA 3PLUA 3KLSX 1OGWA 1WMHB 3P1MA 5BYSA 3R8BA 1B9RA 1CZPA 2VRRB 1GB1A 1T5XD 1ROEA 4USAA 2EMSA 1X1MA 4GOCA 4EKUA 3IAS1 3W1SC 1E7PB 1YN5A 1VDVA 4ZYNA 2MP2A 1EWYC 2FNJB 2INPE 3D32A 1KLGD 5EE9A 2LHEA 5E6OA 4EUTA 4FA6A 1WY8A 1VRAB 4OVZA 1TIFA 1N6ZA 3ZDMC 1WXMA 3DHGC 4ZOHC 1M94A 3AE2B 4HCPB 4M02A 4G0NB 1ZGUB 4CQNA 1ZXIA 1I4HA 3ZNZB 4YXDB 1UWXA 3P4PB 3A9KA 2KJRA 1GJZA 4WH4A 3QARA 1EWCA 3ZXRA 1DOIA 1I4RA 3VH4B 3AEGB 3URYA 3H9DA 1TS3A 1PQSA 2O6VD 4E74A 3W2DA 4NQLB 4LNFA 1FPYA 4JGHB 3RZWC 1YX5B 4XGAB 5HHDG 3FKYA 5AEKB 1U4AA 2BS2B 4YTNB 1JRPA 5E6NA 1MHXA 2YEPF 1V5OA 3A9JA 1XLPA 2WDQB 5DCNA 1XD3B 2ICIA 3GE8C 3KVFB 1T0RC 4HKZE 2LUEA 1XEEA 4MJSA 2KVRA 4RGMA 2DBYA 4RCOA 2PTLA 4NY0A 3Q8BA 2AYOB 2WWZA 3IFWB 4ARIA 2ZNVB 3QX1A 3BVMA 2J4XA 1RM6C 1CMXB 1HZ6A 2LJIA 5G5GA 3RULA 2PVGC 4B0MA 3Q3JA 4X57B 5TSSA 1WX9A 2IGHA 5DPSA 5BMGA 2WXHA 4MELA 3OJ3A 3MC0B 5IO9A 3U8ZA 3WIMA 2GLSA 3ML9A 3ZKJC 2KFKA 1V1PB 4C00A 3UQBA 3EFCA 3HVZA 3DDCB 4AS1A 2BYVE 2DYBA 2DNFA 3MJ5A 2OEDA 4EZJA 2OJRA 1SB3C 5HKHA 3RNFC 1VZ6A 1QT9A 5J17A 3A9JB 3J9CA 1I4QA 3DOWA 5LXIB 1S3SG 1C78A 4DXAB 2EKEC 3W5VB 3ZTCA 1C76A 1UNSA 3AMZA 4MJSB 1CQVA 1QF6A 3QC8B 4EOYA 3APDA 1D6EC 3DBLB 2B76B 2MCNB 2B3AA 2CKHB 1TBEA 3Q3NC 3TIXA 3PTFC 4KDLB 3JW0X 1QOBA 2INCC 3B9JA 2J0JA 3RNEC 4YTMB 2LXCA 2N7EA 2WXPA 2LEKA 1L0VB 3HVDA 5T8IA 4ARCA 2DENB 3KWVA 2QC8A 2FIDA 2KDMA 3N20C 4KGTA 2LXAA 5AZGA 2M17A 4FJVB 4DHZE 1HTOA 4DBGA 3ZNGC 2MX2A 4NQKE 4EE2A 2I38A 5BMHA 1SE4A 4KZCA 3W1SA 2BYFA 3DQVA 1OQRA 1F0ZA 1RLFA 2IYDB 2N0SB 4LDTD 4C7YA 2XNAC 1VZ8A 1H4RA 2WQYB 1FRRA 2ZJDA 4US8A 2C7HA 2G1EA 3U2SC 3EFUA 1EUVB 2OHFA 2ZZPB 1TZOA 1WI0A 3U52E 5MPOA 1KJTA 2DWQA 4XYCA 5GMVA 4BVUC 2M1MA 4MGYE 2EELA 2L52A 3MFGA 1TJEA 1FNUA 2LRUA 1FNVA 4JE3B 4W9JA 3U30A 4AUQC 2UWQA 1QOGA 4FADA 4ZRJA 1CJEA 3AV8A 1KLUD 4DDID 4N59A 5C3JB 1EM7A 3W5UB 3PGEA 2WS3B 1WJUA 3N3KB 2WGSA 2WXLA 4GMVA 2QDFA 1V81A 3UIPB 4DK5A 3DVNV 1QKZA 1WR1A 1GC6A 4ANVA 2LMCA 1XLNA 4OVUA 4AOFA 1Y56A 1XT9B 1IBXA 3B08A 1OEYJ 3FILB 4OW0A 1NENB 2QIEB 4YSXB 3Q8FA 2KC1A 2RPVA 1H8CA 4QAYA 1AARA 3MC8A 1WGDA 3AEBB 3PHXB 4B0EA 3RNBC 2N9EB 4DWFA 2K6QA 4K1RB 1R4MI 2BYEA 1A70A 1KM7A 1OQQA 1ACCA 1VJKA 1WZ3A 2NBWB 3BIID 1VCBA 2G3QB 4GIVA 1PGAA 2KX3A 4GGQA 2IJ0A 2C5LC 1BUIC 4GDKA 1EU4A 2KYWA 1YOVB 4NAMA 5TR5A 4A55A 4WWMA 3AE5B 2SAKA 1I42A 1J7AA 2K39A 2XN9C 1IYFA 1P9DU 1FXAA 2CHXA 3Q3FA 3NHEB 2MHJA 3PZDA 1TKGA 4ZHPA 2V4IB 1SJED 2ASQA 1JQ4A 1WYGA 1L4ZB 2QMTA 2L8JA 2M19A 3UINB 1J0GA 1LFDA 4PS8A 2CU3A 2WXRA 3PVLA 2INNE 1Q0WB 1ZOYB 5C1ZA 2OOBB 1RWSA 1K51A 4JIOU 3EA6A 2KNBA 5LLIA 5CHFA 4XWWA 3DCGA 5GXGB 1C4CA 1WJNA 1D4BA 2BS4B 1YMHE 4BBNF 2K5PA 3Q14C 2CJOA 2Y5CA 4M8NA 2IDYA 4FJYA 4WJPA 2N9XA 3VFKA 3L08A 2MBHA 3QJZA 1SE3A 4GDKB 2AQ1B 4L2YA 2R61A 2MBEA 3PS6A 5IOIA 1HA5A 2J7QB 1WX8A 2PPHA 2LZ6A 3UF8A 2M8SA 3T3OA 2IZVB 4LK0M 4BOZB 2WLBA 3PZ8A 1PYWD 4L23A 3TJPA 2LVPA 2MSED 2L3ZA 5FK9C 3P63A 1VLBA 4NPNA 4W9KA 1GC7A 4FXCA 3DBHI 2YLMA 3NZ3A 3VTUA 3UIOB 3BK2A 3ZYYX 4A3PA 1GG3A 1C4PA 4MM3A 5BMIA 3AE7B 3T8MA 3R66C 1YQBA 1IGDA 2WXOA 2X38A 5BO4B 3Q69A 3QQ8B 1JMLA 3BYTB 1E5WA 3NRZA 2AQ3B 2LGYA 4LDTB 1L0XB 3PT2B 2WHIA 3P4QB 1SE9A 3GOEA 4IOIE 3MP9A 2KO3A 1RFAA 5HFYA 5EDSA 1NBFC 2MP2B 3O13A 5JXVA 4URKA 3VAWA 1EF1A 1MJDA 2ZCCA 2MJEA 2KKCA 4A9AA 3ZIMA 1UF0A 1N60A 4C4VA 3L16A 5JHAA 2QILA 4OZBA 2I1KA 3GZNB 3TL5A 1KFYB 4MDKE 3GP7A 1XCQL 5L95C 2KDEB 2E6XA 4IM2A 4FULA 1KTKA 2MLBA 2KN4A 2CS4A 1SJHD 3QA8A 4RM9A 3ZRFA 3DBSA 4OHJA 4DXFA 1L6UA 3AH7A 2DAFA 2L32A 2JRHA 3CIRB 5I4DA 3E9SA 3VTVA 3TCAA 2BKFA 3IHPC 4K3CA 2CHWA 2QJLA 2KZRA 3QAQA 2JXXA 3VRAB 2CHZA 3VTWA 4WQMA 4MT5A 1GNUA 2N1WA 3EC8A 4YTPB 2BT6A 3AEDB 1G6JA 2BF8B 2JT4B 3DVGY 1IPGA 1WGHA 3MC9A 4HVBA 4XZ4A 1V6EA 5E6PA 1WIAA 3V6CB 1WR6E 1MI0A 2R2QA 2W9NA 1I7HA 4L1BA 3PO0A 3VH3B 3ABVB 2PMVA 4PK1A 3I9V1 2NMQA 4BKGA 4HXDA 2KACA 2NCNA 1JWUD 2IGGA 1F52A 2PW9A 1EU3A 1L4DB 1JRUA 1MFWA 2KTRA 2WU5B 3H1UA 3RI7C 1WGGA 3FC4A 4AQ7A 2M0XA 5D6JB 3QWZB 3ZNID 1F9JA 4P16A 5JZEB 3RCZA 3ZRCA 5DPTA 3V61A 2JRIB 1YQ3B 3PRZA 2MEKA 3TEXA 4KIKB 4GB9A 3TEWA 4HCNB 4MACA 3KH0A 4HROA 4XWTA 2LASA 2J0KA 1WRDB 2KFJA 4G50A 5IN7A 4YT0B 5D3IB 3RNAC 3WAPA 3VDZA 4DHJD 2HTME
chains in the Genus database with same CATH topology
2YVCA 3ZNHB 4LCDE 2C7HA 4F8CB 4WWOA 2GBNA 3A1QB 4KVGB 2XK5B 3M3JA 3EFUA 2DYMA 1EUVB 1SGHA 2KHWB 2ZZPB 1L7YA 2Z0DB 3ZDTA 1WI0A 3O65B 2C60A 3A1QA 2LI5A 4FBJB 1A5RA 4MSMB 1WH3A 1KJTA 2N9PC 3KUZA 2D10A 2WX0A 5GMVA 4GXBA 2M1MA 4BVUC 3ZTDA 2PJHA 4KDIC 3NOBA 4MGYE 4CHKA 2DX5B 2LWPA 4LJOB 2KWUB 4PYZA 4A3OA 2NPTA 3CF6E 4TQ1A 4HK2A 2KJ6A 2LRUA 2L76A 2KTRB 2NBVB 2ZPYA 4FJZA 4W9JA 3U30A 4AUQC 4TQ0A 2UWQA 1L2NA 4FADA 1UBQA 2FCMA 4W9DA 1K8RB 2LJ5A 3I3TB 4ZRJA 2ZNVC 3EHVA 2MA9B 3KW5B 3NS8A 1WX7A 4K7WA 4HPMB 3TMPB 4DDID 2D11A 2BPSA 1ISNA 1OQYA 2FAZA 3PGEA 4GSWA 3R7QA 4IG7B 2IO3B 1WJUA 3N3KB 1UGMA 3KUDB 4GMVA 3ZLZA 3DVNU 1V81A 2EMTA 3TBLD 3H7PA 2O2VB 4IWOA 3UIPB 4W9FA 3CSTA 4DK5A 3DVNV 2LGDA 1WR1A 1GC6A 2C7NB 2LD9A 1MG8A 2NPTB 3NZUA 4ANVA 2IBIB 2QHOA 2O2VA 3ENEA 4OVUA 2GMIC 4YL8A 4TV3A 4FHJA 2JWZA 2NR2A 2N4FA 4CO7A 4WQOB 1WM3A 3LJ3A 2I1JA 2O6VB 3ZW3A 3AU5A 4HJKA 4AOFA 4WJQA 3PSEB 4M0WB 2FCQA 1XT9B 4HLEA 3DBLI 3QHTA 2KJHB 2O6VA 3B08A 1OEYJ 4G3XB 3MJWA 2KLCA 2XK5A 1Q5WB 5AZHA 1E8ZA 2KC1A 4AJYB 1H8CA 3VUXA 1AARA 2XEWA 3VUYA 1WGDA 3PHXB 2N9EB 4DWFA 2HTHA 2K6QA 5D7GA 5IAAC 4K1RB 2D3GA 4KV2A 4ASWC 1R4MI 4RMAA 2BYEA 4HDQA 4WJOA 4WWNA 1KM7A 1WZ3A 2NBWB 2KDFB 2V1YA 4GDLB 4TUUA 1VCBA 2KN5A 2ZPNA 1Y8RC 2G3QB 3HM3A 2DZKA 4GIVA 2UYZB 3N30A 1J8CA 3PPAA 2KX3A 2K8BA 3PV1A 4GGQA 4BFRA 1RRBA 3SD5A 2DZJA 2HE7A 3KYCD 1P0RA 4NAWB 3PRPB 4CYEA 1KLVA 3ONSA 4ANXA 4RM8A 2C5LC 2DZMA 2RGFA 4GDKA 2IY1B 3WAMA 2A4ZA 3MHSD 1WE7A 2MWSB 5TR5A 5J18A 2PE6B 2G4SA 3AXCA 2XBBC 5D2MB 1I42A 1EO6A 2K39A 3CSFA 3MTNB 4AWJA 3A4SC 4GN1A 4EEWA 1UELA 1GUAB 3SHQA 1IYFA 1P9DU 2CHXA 3L54A 1P3QU 3Q3FA 1WJ4A 3NHEB 3R7RA 3PZDA 4B6WA 2PEAA 1E7UA 2DAJA 2BWFA 2ZVOA 2ASQA 3L0WB 4GDLA 5DPRA 4KSLC 2L8JA 3IVFA 3AULA 3UINB 2AL6A 2Z0EB 3W1YA 1J0GA 2G45B 2LVOA 4FHKA 4BKSA 3HIZA 4DHZB 2KTFA 4IUMB 4IM3A 2MW5A 4MEMA 3X0WA 3UQAA 1LFDA 3ZUNA 2KDBA 1TZ1A 3QK0A 3IBEA 4PS8A 1P98A 1LM8B 2WDTB 3PVLA 3HHMA 1WM2A 5G2NA 1Q0WB 2JPHA 3A33B 2MRPA 5C1ZA 2OOBB 3N32A 4KSKC 4JIOU 1Q1OA 3KYDD 3OAWA 2L0TA 2KNBA 1V5TA 5LLIA 5LXHA 2N7DA 4WWPA 2C7MB 1FXTB 5CHFA 3DCGA 4MH0E 1J19A 1WJNA 2CU1A 2JY6A 1OTRB 4BBNF 2L7RA 4BBNC 2KWCA 3ZO5B 2REXA 1S1QB 3PREA 1D3ZA 3RYTA 4M8NA 3ML8A 3PLVA 4BKSD 1RAXA 1YD8U 3PRMB 4ANWA 2WYQA 2WX1A 4FJYA 2N9XA 4WJPA 1WGRA 2RPQA 2LRWA 1EF5A 4NNJB 3VFKA 3L08A 2MBHA 2L0FA 1WXVA 3GZNI 4N9F4 4WAAA 4NAWA 1HE8A 3QJZA 1P1AA 1Z5SB 2GBKA 4K81A 2C9WB 3ALBA 4GDKB 4W9LA 3PHWB 4G11A 5D94A 1R4NI 2MBEA 3PS6A 3AU4A 3HK0A 4M8MA 5J2RA 1I35A 3SU8X 2M4NA 2KANA 2J7QB 4AJWA 1WX8A 2PPHA 3IG3A 2LZ6A 3UF8A 1E7VA 5JH5C 2M8SA 3QCAA 2IZVB 4BOZB 3NZSA 2K6DB 4HPLB 4MGIE 3WANA 2IO1B 2ZVNA 1TGZB 3WALA 1VD2A 4OVVA 2LVPA 3TJPA 2MSED 2DZIA 2BWES 4JLCA 2L3ZA 3V62A 2L00B 4EZKA 1NDDA 4BKTA 4IC7B 4II2B 2LGXA 2K8HA 1WF9A 2GBJA 2KD0A 4NPNA 4HDOA 4W9KA 5JHBA 3PLUA 1SIFA 1GC7A 3DBHI 1OGWA 2CR5A 1WMHB 2YLMA 4HWIB 4F7ZA 3VTUA 3UIOB 2VRRB 4W9CA 1LXDA 3CMMB 4A3PA 2EMSA 1X1MA 4GOCA 4EKUA 4ICUA 3RD2A 1GG3A 3W1SC 4MM3A 4XC2A 4WJNA 3H6NA 4ZYNA 4FN2A 4NJ6A 3T8MA 3VVWB 2GBRA 1YJ1A 2MP2A 3R66C 2FNJB 3D32A 1YQBA 4AP4C 3V6EB 5E6OA 2ZEQA 4EUTA 4FA6A 1WY8A 3ZDMC 4FLHA 3L10B 1WGYA 1WXMA 5BO4B 5IA7A 3QQ8B 3RZFA 1M94A 3A4RA 1E5WA 4KZ0A 3ECIA 4HCPB 4A20A 4G0NB 2JZ3B 1ZGUB 3JSVB 1WMHA 4XX5A 3R3MA 3ZNZB 2LGYA 1V49A 3DBRI 3A9KA 2KJRA 4LDTB 1E8YA 1GJZA 3JSVA 3PT2B 3QARA 3KUCB 1ZW7A 3VH4B 3A9KB 1SE9A 3GOEA 2KC2A 1WZ0A 2KO3A 2KXJA 1RFAA 3WA0A 2RSUA 5EDSA 2KLGA 1NBFC 2AEHA 2MP2B 3H9DA 3VQIA 1PQSA 1KOTA 2A5UA 2O6VD 4LJPB 4E74A 5L83A 1E90A 5DPWA 4NQLB 2D2QA 3VAWA 4URKA 1EF1A 2ZCCA 2KKCA 4F1SA 1Z2MA 4JGHB 3M62B 4II3B 1YX5B 3RZWC 3ZIMA 5C23A 4PS3A 3L16A 4ZRKA 3BY4B 5JHAA 5AEKB 1C3TA 1U4AA 2I1KA 2KOXA 2KQSA 1WE6A 1IP9A 2RD0A 5E6NA 4B9KA 2JF5A 1V5OA 3HM6X 3TL5A 4ANUA 2HD5B 4MDKE 4DDGD 3A9JA 4IM0A 5DCNA 2L05A 5CHWA 2BGFA 1XD3B 3KVFB 3L17A 5L95C 2KDEB 3L13A 4JL9A 2LUEA 4MJSA 2KVRA 1T0YA 3DVGX 4NY0A 4K7UA 4IM2A 4E3CA 4FULA 2AYOB 2MLBA 2WWZA 1C1YB 3IFWB 1UBIA 2FIFA 4PS7A 2CS4A 3M95A 5CHVC 1BT0A 3QA8A 2JVCA 4RM9A 2ZNVB 4K7SA 4NJ7A 3QX1A 3DBSA 3ZRFA 2KMAA 2FCNA 2PE9A 4IWPA 2K8CA 3RT3B 3JYUA 2DAFA 1CMXB 1WXAA 2JRHA 5FR6A 1TTNA 2D07B 4I6PA 2LVQA 3RULA 4E71A 3Q3JA 4X57B 3TCAA 2BKFA 3VTVA 2JZZA 3SDLC 1WX9A 3IHPC 2KDIA 5DPSA 2CHWA 2MBOA 4JQWC 2KZRA 3QAQA 2JXXA 4MELA 3OJ3A 5G55A 3U8ZA 2BKRB 1E8XA 2CHZA 2DYOA 3VHTC 3WIMA 3VTWA 4I6NB 1GNUA 2N1WA 3EC8A 3H7SA 3ML9A 3ZKJC 4W9GA 3APFA 2KFKA 4P7IA 1G6JA 3AI5A 2BF8B 4IWQA 2JT4B 3DVGY 4MGZE 1IPGA 2FCSA 3UQBA 1WXSA 4I6LB 3DDCB 2NVUI 2BYVE 2DYBA 1YIWA 1WGHA 2FUHB 3B0AA 3P2BA 2GOWA 2RR9A 3K9OB 2Z59B 5CTRC 1QZEA 4EZJA 3BINA 2OJRA 4HVBA 4XZ4A 2KWVB 1V6EA 4W9HA 2KQ7A 5E6PA 1WIAA 5CX3A 1WR6E 3V6CB 4B95A 5HKHA 4IW0A 2V3SA 2MBQA 3EECA 4ZDVA 3ZVVA 2R2QA 4MGKE 3VUWA 2W9NA 5J17A 3A9JB 1OEYA 2DHZA 2JUOA 3DOWA 5LXIB 1S3SG 4DXAB 2EKEC 3VH3B 1E8WA 2AWTA 2IO0B 3ZTCA 1V2YA 4MJSB 2G4DB 2R2OA 4BKGA 3APCA 4HXDA 3QC8B 2V4LA 1WJ6A 3X23A 4EOYA 3APDA 3QIJA 2NCNA 2MBBB 3NY5A 1UZXB 1NI2A 2AL3A 2MCNB 4DHJB 1WFYA 2B3AA 2CKHB 1TBEA 4ICVA 3TIXA 3PTFC 4KDLB 2MQJA 3JW0X 3VXWA 1XQQA 2K25A 2ZCBA 1JRUA 5KHQA 3U7DA 2J0JA 1V86A 2KTRA 3JVZX 3LDZE 2LXCA 2N7EA 3H1UA 3WAOA 1V80A 2Y5BB 2NS5A 4W9EA 4J6IA 3B1LX 1WGGA 3OLMD 4EFOA 5AZFA 4PYUA 1UH6A 2DENB 2M0XA 1ZKHA 5D6JB 3QWZB 4GU2A 3ZNID 2GBMA 4W9IA 1F9JA 2FIDA 5JZEB 1LQBA 4KIKA 3T9LA 2J0MA 2LXAA 3V60A 5AZGA 3RCZA 2M17A 5DPTA 3ZRCA 4EZLA 2HJ8A 4FJVB 3V61A 4DHZE 2JRIB 4DBGA 3ZNGC 1UD7A 2IO2B 4MSQB 2MX2A 2KFKB 3PRZA 4KIKB 4NQKE 2KX0A 3H7PB 4GB9A 2NBUA 3OJ4B 4HCNB 3M63B 1WYWB 1YX6B 2K1FA 4BOSC 4KZCA 4ZRIA 3S2AA 3W1SA 3KH0A 2IY0B 3K9PB 2BYFA 3DQVA 1RLFA 2IYDB 4LDTD 2LASA 2N1VA 2J0KA 1WRDB 2KFJA 5KHOA 3RUIB 2KMCA 4G50A 1V9JA 3C0RB 1H4RA 2KK8A 3UGBB 3DPDA 4TKNA 3WAPA 3VDZA 2ZJDA 4DHJD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YVC A;  3ZNH B;  4LCD E;  2C7H A;  4F8C B;  4WWO A;  2GBN A;  3A1Q B;  4KVG B;  2XK5 B;  3M3J A;  3EFU A;  2DYM A;  1EUV B;  1SGH A;  2KHW B;  2ZZP B;  1L7Y A;  2Z0D B;  3ZDT A;  1WI0 A;  3O65 B;  2C60 A;  3A1Q A;  2LI5 A;  4FBJ B;  1A5R A;  4MSM B;  1WH3 A;  1KJT A;  2N9P C;  3KUZ A;  2D10 A;  2WX0 A;  5GMV A;  4GXB A;  2M1M A;  4BVU C;  3ZTD A;  2PJH A;  4KDI C;  3NOB A;  4MGY E;  4CHK A;  2DX5 B;  2LWP A;  4LJO B;  2KWU B;  4PYZ A;  4A3O A;  2NPT A;  3CF6 E;  4TQ1 A;  4HK2 A;  2KJ6 A;  2LRU A;  2L76 A;  2KTR B;  2NBV B;  2ZPY A;  4FJZ A;  4W9J A;  3U30 A;  4AUQ C;  4TQ0 A;  2UWQ A;  1L2N A;  4FAD A;  1UBQ A;  2FCM A;  4W9D A;  1K8R B;  2LJ5 A;  3I3T B;  4ZRJ A;  2ZNV C;  3EHV A;  2MA9 B;  3KW5 B;  3NS8 A;  1WX7 A;  4K7W A;  4HPM B;  3TMP B;  4DDI D;  2D11 A;  2BPS A;  1ISN A;  1OQY A;  2FAZ A;  3PGE A;  4GSW A;  3R7Q A;  4IG7 B;  2IO3 B;  1WJU A;  3N3K B;  1UGM A;  3KUD B;  4GMV A;  3ZLZ A;  3DVN U;  1V81 A;  2EMT A;  3TBL D;  3H7P A;  2O2V B;  4IWO A;  3UIP B;  4W9F A;  3CST A;  4DK5 A;  3DVN V;  2LGD A;  1WR1 A;  1GC6 A;  2C7N B;  2LD9 A;  1MG8 A;  2NPT B;  3NZU A;  4ANV A;  2IBI B;  2QHO A;  2O2V A;  3ENE A;  4OVU A;  2GMI C;  4YL8 A;  4TV3 A;  4FHJ A;  2JWZ A;  2NR2 A;  2N4F A;  4CO7 A;  4WQO B;  1WM3 A;  3LJ3 A;  2I1J A;  2O6V B;  3ZW3 A;  3AU5 A;  4HJK A;  4AOF A;  4WJQ A;  3PSE B;  4M0W B;  2FCQ A;  1XT9 B;  4HLE A;  3DBL I;  3QHT A;  2KJH B;  2O6V A;  3B08 A;  1OEY J;  4G3X B;  3MJW A;  2KLC A;  2XK5 A;  1Q5W B;  5AZH A;  1E8Z A;  2KC1 A;  4AJY B;  1H8C A;  3VUX A;  1AAR A;  2XEW A;  3VUY A;  1WGD A;  3PHX B;  2N9E B;  4DWF A;  2HTH A;  2K6Q A;  5D7G A;  5IAA C;  4K1R B;  2D3G A;  4KV2 A;  4ASW C;  1R4M I;  4RMA A;  2BYE A;  4HDQ A;  4WJO A;  4WWN A;  1KM7 A;  1WZ3 A;  2NBW B;  2KDF B;  2V1Y A;  4GDL B;  4TUU A;  1VCB A;  2KN5 A;  2ZPN A;  1Y8R C;  2G3Q B;  3HM3 A;  2DZK A;  4GIV A;  2UYZ B;  3N30 A;  1J8C A;  3PPA A;  2KX3 A;  2K8B A;  3PV1 A;  4GGQ A;  4BFR A;  1RRB A;  3SD5 A;  2DZJ A;  2HE7 A;  3KYC D;  1P0R A;  4NAW B;  3PRP B;  4CYE A;  1KLV A;  3ONS A;  4ANX A;  4RM8 A;  2C5L C;  2DZM A;  2RGF A;  4GDK A;  2IY1 B;  3WAM A;  2A4Z A;  3MHS D;  1WE7 A;  2MWS B;  5TR5 A;  5J18 A;  2PE6 B;  2G4S A;  3AXC A;  2XBB C;  5D2M B;  1I42 A;  1EO6 A;  2K39 A;  3CSF A;  3MTN B;  4AWJ A;  3A4S C;  4GN1 A;  4EEW A;  1UEL A;  1GUA B;  3SHQ A;  1IYF A;  1P9D U;  2CHX A;  3L54 A;  1P3Q U;  3Q3F A;  1WJ4 A;  3NHE B;  3R7R A;  3PZD A;  4B6W A;  2PEA A;  1E7U A;  2DAJ A;  2BWF A;  2ZVO A;  2ASQ A;  3L0W B;  4GDL A;  5DPR A;  4KSL C;  2L8J A;  3IVF A;  3AUL A;  3UIN B;  2AL6 A;  2Z0E B;  3W1Y A;  1J0G A;  2G45 B;  2LVO A;  4FHK A;  4BKS A;  3HIZ A;  4DHZ B;  2KTF A;  4IUM B;  4IM3 A;  2MW5 A;  4MEM A;  3X0W A;  3UQA A;  1LFD A;  3ZUN A;  2KDB A;  1TZ1 A;  3QK0 A;  3IBE A;  4PS8 A;  1P98 A;  1LM8 B;  2WDT B;  3PVL A;  3HHM A;  1WM2 A;  5G2N A;  1Q0W B;  2JPH A;  3A33 B;  2MRP A;  5C1Z A;  2OOB B;  3N32 A;  4KSK C;  4JIO U;  1Q1O A;  3KYD D;  3OAW A;  2L0T A;  2KNB A;  1V5T A;  5LLI A;  5LXH A;  2N7D A;  4WWP A;  2C7M B;  1FXT B;  5CHF A;  3DCG A;  4MH0 E;  1J19 A;  1WJN A;  2CU1 A;  2JY6 A;  1OTR B;  4BBN F;  2L7R A;  4BBN C;  2KWC A;  3ZO5 B;  2REX A;  1S1Q B;  3PRE A;  1D3Z A;  3RYT A;  4M8N A;  3ML8 A;  3PLV A;  4BKS D;  1RAX A;  1YD8 U;  3PRM B;  4ANW A;  2WYQ A;  2WX1 A;  4FJY A;  2N9X A;  4WJP A;  1WGR A;  2RPQ A;  2LRW A;  1EF5 A;  4NNJ B;  3VFK A;  3L08 A;  2MBH A;  2L0F A;  1WXV A;  3GZN I;  4N9F 4;  4WAA A;  4NAW A;  1HE8 A;  3QJZ A;  1P1A A;  1Z5S B;  2GBK A;  4K81 A;  2C9W B;  3ALB A;  4GDK B;  4W9L A;  3PHW B;  4G11 A;  5D94 A;  1R4N I;  2MBE A;  3PS6 A;  3AU4 A;  3HK0 A;  4M8M A;  5J2R A;  1I35 A;  3SU8 X;  2M4N A;  2KAN A;  2J7Q B;  4AJW A;  1WX8 A;  2PPH A;  3IG3 A;  2LZ6 A;  3UF8 A;  1E7V A;  5JH5 C;  2M8S A;  3QCA A;  2IZV B;  4BOZ B;  3NZS A;  2K6D B;  4HPL B;  4MGI E;  3WAN A;  2IO1 B;  2ZVN A;  1TGZ B;  3WAL A;  1VD2 A;  4OVV A;  2LVP A;  3TJP A;  2MSE D;  2DZI A;  2BWE S;  4JLC A;  2L3Z A;  3V62 A;  2L00 B;  4EZK A;  1NDD A;  4BKT A;  4IC7 B;  4II2 B;  2LGX A;  2K8H A;  1WF9 A;  2GBJ A;  2KD0 A;  4NPN A;  4HDO A;  4W9K A;  5JHB A;  3PLU A;  1SIF A;  1GC7 A;  3DBH I;  1OGW A;  2CR5 A;  1WMH B;  2YLM A;  4HWI B;  4F7Z A;  3VTU A;  3UIO B;  2VRR B;  4W9C A;  1LXD A;  3CMM B;  4A3P A;  2EMS A;  1X1M A;  4GOC A;  4EKU A;  4ICU A;  3RD2 A;  1GG3 A;  3W1S C;  4MM3 A;  4XC2 A;  4WJN A;  3H6N A;  4ZYN A;  4FN2 A;  4NJ6 A;  3T8M A;  3VVW B;  2GBR A;  1YJ1 A;  2MP2 A;  3R66 C;  2FNJ B;  3D32 A;  1YQB A;  4AP4 C;  3V6E B;  5E6O A;  2ZEQ A;  4EUT A;  4FA6 A;  1WY8 A;  3ZDM C;  4FLH A;  3L10 B;  1WGY A;  1WXM A;  5BO4 B;  5IA7 A;  3QQ8 B;  3RZF A;  1M94 A;  3A4R A;  1E5W A;  4KZ0 A;  3ECI A;  4HCP B;  4A20 A;  4G0N B;  2JZ3 B;  1ZGU B;  3JSV B;  1WMH A;  4XX5 A;  3R3M A;  3ZNZ B;  2LGY A;  1V49 A;  3DBR I;  3A9K A;  2KJR A;  4LDT B;  1E8Y A;  1GJZ A;  3JSV A;  3PT2 B;  3QAR A;  3KUC B;  1ZW7 A;  3VH4 B;  3A9K B;  1SE9 A;  3GOE A;  2KC2 A;  1WZ0 A;  2KO3 A;  2KXJ A;  1RFA A;  3WA0 A;  2RSU A;  5EDS A;  2KLG A;  1NBF C;  2AEH A;  2MP2 B;  3H9D A;  3VQI A;  1PQS A;  1KOT A;  2A5U A;  2O6V D;  4LJP B;  4E74 A;  5L83 A;  1E90 A;  5DPW A;  4NQL B;  2D2Q A;  3VAW A;  4URK A;  1EF1 A;  2ZCC A;  2KKC A;  4F1S A;  1Z2M A;  4JGH B;  3M62 B;  4II3 B;  1YX5 B;  3RZW C;  3ZIM A;  5C23 A;  4PS3 A;  3L16 A;  4ZRK A;  3BY4 B;  5JHA A;  5AEK B;  1C3T A;  1U4A A;  2I1K A;  2KOX A;  2KQS A;  1WE6 A;  1IP9 A;  2RD0 A;  5E6N A;  4B9K A;  2JF5 A;  1V5O A;  3HM6 X;  3TL5 A;  4ANU A;  2HD5 B;  4MDK E;  4DDG D;  3A9J A;  4IM0 A;  5DCN A;  2L05 A;  5CHW A;  2BGF A;  1XD3 B;  3KVF B;  3L17 A;  5L95 C;  2KDE B;  3L13 A;  4JL9 A;  2LUE A;  4MJS A;  2KVR A;  1T0Y A;  3DVG X;  4NY0 A;  4K7U A;  4IM2 A;  4E3C A;  4FUL A;  2AYO B;  2MLB A;  2WWZ A;  1C1Y B;  3IFW B;  1UBI A;  2FIF A;  4PS7 A;  2CS4 A;  3M95 A;  5CHV C;  1BT0 A;  3QA8 A;  2JVC A;  4RM9 A;  2ZNV B;  4K7S A;  4NJ7 A;  3QX1 A;  3DBS A;  3ZRF A;  2KMA A;  2FCN A;  2PE9 A;  4IWP A;  2K8C A;  3RT3 B;  3JYU A;  2DAF A;  1CMX B;  1WXA A;  2JRH A;  5FR6 A;  1TTN A;  2D07 B;  4I6P A;  2LVQ A;  3RUL A;  4E71 A;  3Q3J A;  4X57 B;  3TCA A;  2BKF A;  3VTV A;  2JZZ A;  3SDL C;  1WX9 A;  3IHP C;  2KDI A;  5DPS A;  2CHW A;  2MBO A;  4JQW C;  2KZR A;  3QAQ A;  2JXX A;  4MEL A;  3OJ3 A;  5G55 A;  3U8Z A;  2BKR B;  1E8X A;  2CHZ A;  2DYO A;  3VHT C;  3WIM A;  3VTW A;  4I6N B;  1GNU A;  2N1W A;  3EC8 A;  3H7S A;  3ML9 A;  3ZKJ C;  4W9G A;  3APF A;  2KFK A;  4P7I A;  1G6J A;  3AI5 A;  2BF8 B;  4IWQ A;  2JT4 B;  3DVG Y;  4MGZ E;  1IPG A;  2FCS A;  3UQB A;  1WXS A;  4I6L B;  3DDC B;  2NVU I;  2BYV E;  2DYB A;  1YIW A;  1WGH A;  2FUH B;  3B0A A;  3P2B A;  2GOW A;  2RR9 A;  3K9O B;  2Z59 B;  5CTR C;  1QZE A;  4EZJ A;  3BIN A;  2OJR A;  4HVB A;  4XZ4 A;  2KWV B;  1V6E A;  4W9H A;  2KQ7 A;  5E6P A;  1WIA A;  5CX3 A;  1WR6 E;  3V6C B;  4B95 A;  5HKH A;  4IW0 A;  2V3S A;  2MBQ A;  3EEC A;  4ZDV A;  3ZVV A;  2R2Q A;  4MGK E;  3VUW A;  2W9N A;  5J17 A;  3A9J B;  1OEY A;  2DHZ A;  2JUO A;  3DOW A;  5LXI B;  1S3S G;  4DXA B;  2EKE C;  3VH3 B;  1E8W A;  2AWT A;  2IO0 B;  3ZTC A;  1V2Y A;  4MJS B;  2G4D B;  2R2O A;  4BKG A;  3APC A;  4HXD A;  3QC8 B;  2V4L A;  1WJ6 A;  3X23 A;  4EOY A;  3APD A;  3QIJ A;  2NCN A;  2MBB B;  3NY5 A;  1UZX B;  1NI2 A;  2AL3 A;  2MCN B;  4DHJ B;  1WFY A;  2B3A A;  2CKH B;  1TBE A;  4ICV A;  3TIX A;  3PTF C;  4KDL B;  2MQJ A;  3JW0 X;  3VXW A;  1XQQ A;  2K25 A;  2ZCB A;  1JRU A;  5KHQ A;  3U7D A;  2J0J A;  1V86 A;  2KTR A;  3JVZ X;  3LDZ E;  2LXC A;  2N7E A;  3H1U A;  3WAO A;  1V80 A;  2Y5B B;  2NS5 A;  4W9E A;  4J6I A;  3B1L X;  1WGG A;  3OLM D;  4EFO A;  5AZF A;  4PYU A;  1UH6 A;  2DEN B;  2M0X A;  1ZKH A;  5D6J B;  3QWZ B;  4GU2 A;  3ZNI D;  2GBM A;  4W9I A;  1F9J A;  2FID A;  5JZE B;  1LQB A;  4KIK A;  3T9L A;  2J0M A;  2LXA A;  3V60 A;  5AZG A;  3RCZ A;  2M17 A;  5DPT A;  3ZRC A;  4EZL A;  2HJ8 A;  4FJV B;  3V61 A;  4DHZ E;  2JRI B;  4DBG A;  3ZNG C;  1UD7 A;  2IO2 B;  4MSQ B;  2MX2 A;  2KFK B;  3PRZ A;  4KIK B;  4NQK E;  2KX0 A;  3H7P B;  4GB9 A;  2NBU A;  3OJ4 B;  4HCN B;  3M63 B;  1WYW B;  1YX6 B;  2K1F A;  4BOS C;  4KZC A;  4ZRI A;  3S2A A;  3W1S A;  3KH0 A;  2IY0 B;  3K9P B;  2BYF A;  3DQV A;  1RLF A;  2IYD B;  4LDT D;  2LAS A;  2N1V A;  2J0K A;  1WRD B;  2KFJ A;  5KHO A;  3RUI B;  2KMC A;  4G50 A;  1V9J A;  3C0R B;  1H4R A;  2KK8 A;  3UGB B;  3DPD A;  4TKN A;  3WAP A;  3VDZ A;  2ZJD A;  4DHJ D; 
#chains in the Genus database with same CATH topology
 2YVC A;  4LCD E;  4BZA A;  3AEF B;  4KX6 B;  3EUB 2;  4IKG A;  2DYM A;  2EKI A;  2RDG A;  4Q2J A;  2Q5W D;  2C60 A;  1A5R A;  3TEZ A;  4KKI A;  2D3B A;  2MJD A;  1FIQ A;  2D10 A;  1ENF A;  4GXB A;  3ETR A;  3ZTD A;  2PJH A;  3NOB A;  4A90 A;  2LWP A;  4KKJ A;  1ZDV A;  4HK2 A;  2KJ6 A;  4RFB A;  2NBV B;  1SXT A;  1UBQ A;  5EE1 A;  2J42 A;  3KW5 B;  3NS8 A;  2MA9 B;  2D11 A;  4JX1 C;  4LLG M;  4GSW A;  2I2Y A;  3Q3M C;  1XLQ A;  1HQR D;  1FXI A;  1K52 A;  3ZLZ A;  1ZUD 2;  3DVN U;  4IWO A;  4P1C C;  4RGO S;  2WNM A;  2LD9 A;  2C7N B;  2NPT B;  2IBI B;  2QHO A;  3ENE A;  1ET6 A;  4YL8 A;  2E3T A;  4FHJ A;  3VRB B;  1JW9 D;  1FCC C;  2KVZ A;  3ZW3 A;  1JAL A;  2I1J A;  3LJ3 A;  3PSE B;  2FCQ A;  4HLE A;  3DBL I;  2O6V A;  4G3X B;  1Q5W B;  5AZH A;  4REZ A;  1PGB A;  1F77 A;  1RYJ A;  3EGR A;  2Y5P A;  3AEC B;  1VR9 A;  2J53 A;  4RMA A;  4WWN A;  2KDF B;  2ZPN A;  1T0Q C;  1Y8R C;  2DZK A;  1JWS D;  4DXG A;  3PPA A;  3PV1 A;  3P4S B;  3SD5 A;  2DZJ A;  5H92 C;  4CYE A;  1STE A;  3ONS A;  4RM8 A;  2DZM A;  3MHS D;  5J18 A;  2PE6 B;  2G4S A;  1EO6 A;  4AWJ A;  3MTN B;  1UEL A;  1GUA B;  3BVG A;  1YN4 A;  1WJ4 A;  2PEA A;  3TEY A;  2BWF A;  2IND C;  4KSL C;  3AUL A;  2AL6 A;  3W1Y A;  4MEM A;  3X0W A;  1JRO A;  3ZUN A;  4M0W A;  5H8Y E;  3QK0 A;  3NVW A;  1Q10 A;  3SR6 A;  4WIP A;  3HHM A;  1QLB B;  3A33 B;  2MRP A;  3P4R B;  3V05 A;  4KSK C;  3KYD D;  3RNG C;  4WWP A;  4MH0 E;  5BYQ A;  1PDX A;  3N9Y C;  3FAH A;  1SF0 A;  3OWE B;  2L7R A;  1S1Q B;  2GRI A;  1FNW A;  3ML8 A;  3PLV A;  1I4P A;  1YD8 U;  4ANW A;  5AUI A;  2WYQ A;  4K3B A;  2WX1 A;  2WXN A;  2JZP A;  1EF5 A;  1C79 A;  3GZN I;  1HE8 A;  2GBK A;  2ON8 A;  2C9W B;  4W9L A;  3PHW B;  2WXM A;  1WXQ A;  1R4N I;  3AU4 A;  1WWT A;  1HXY D;  3IT6 B;  2KAN A;  2D3C A;  2UU7 A;  1E7V A;  5JH5 C;  2BW2 A;  2PVO D;  2V0G A;  4HPL B;  1TGZ B;  4OVV A;  2BWE S;  4TSS A;  2SEB D;  4BKT A;  4IC7 B;  1GAQ B;  3DWM A;  2K22 A;  2JWU A;  3RMK C;  5JHB A;  1XF5 L;  1SIF A;  4RF1 A;  1JCK B;  4S17 A;  4F7Z A;  3ZJU A;  4KGR A;  3CMM B;  2K0P A;  1UGJ A;  4ICU A;  3RD2 A;  4YWG G;  4ACF A;  4WJN A;  3H6N A;  4FN2 A;  2GBR A;  1FMA D;  1YJ1 A;  1MVK A;  1KF6 B;  3DWG C;  2RMM A;  4AP4 C;  3V6E B;  2ZEQ A;  1FM0 D;  1JWM D;  3GE3 C;  3LB8 C;  3CWI A;  4RGT A;  3L10 B;  1WGY A;  5IP4 D;  2WP9 B;  3A4R A;  1L0Y B;  5FR3 A;  3ECI A;  1QOF A;  4A20 A;  2JZ3 B;  1V97 A;  2V9H A;  4XX5 A;  3R3M A;  3KQ4 A;  1NI3 A;  1V49 A;  4MM3 B;  3A9K B;  1FEH A;  2KC2 A;  1WZ0 A;  1V1P A;  2KXJ A;  3WA0 A;  2BS3 B;  2KLG A;  2AEH A;  3VQI A;  3DHH C;  1KOT A;  2BVC A;  4LJP B;  5FKA C;  2WXQ A;  5DPW A;  4F1S A;  1Z2M A;  4II3 B;  5C23 A;  4ZRK A;  1TKE A;  2ZW0 A;  4RF0 A;  1IP9 A;  2QSD A;  2RD0 A;  3HM6 X;  4ANU A;  3BZD B;  4IM0 A;  1OFF A;  2BGF A;  3ZGZ A;  4JL9 A;  4O1N A;  2FE8 A;  4NJC A;  1TY0 A;  4K7U A;  4E3C A;  1C1Y B;  2L1A A;  1SIJ A;  2CJN A;  3M95 A;  3UI3 A;  2JVC A;  1FRD A;  1TYG B;  4NJ7 A;  2FCN A;  4C4V B;  1HZ5 A;  1TS4 A;  2PE9 A;  4IWP A;  2K8C A;  3RT3 B;  3JYU A;  3NVV A;  2LVQ A;  1BXT A;  1KRH A;  3SDL C;  2KDI A;  2MBO A;  2HDE A;  4JQW C;  1D5Z C;  5G55 A;  2BKR B;  1PFD A;  2DYO A;  4BAX A;  3VHT C;  4M01 A;  1JWB D;  4I6N B;  1AYF A;  3H7S A;  1SEB D;  2MH7 A;  3IXS A;  4N6E B;  1SBB B;  4MGZ E;  4R3D A;  2FCS A;  1WXS A;  4I6L B;  1M4V A;  3AB5 A;  2GOW A;  2RR9 A;  3K9O B;  1E0Z A;  2D5G A;  2FBW B;  2Z59 B;  1QZE A;  5HI1 A;  2KWV B;  2GI9 A;  4LNK A;  1N5X A;  5CX3 A;  4B95 A;  2M56 B;  2V3S A;  3WCQ A;  3EEC A;  4MGK E;  1V8C A;  2VZK D;  2DHZ A;  4TMA B;  2JUO A;  1V2Y A;  4KGS A;  2G4D B;  2R2O A;  1WJ6 A;  2OJW A;  3NY5 A;  1P7E A;  1UZX B;  4IDI A;  4DHJ B;  1WFY A;  2QCZ A;  2MQJ A;  3VXW A;  1XQQ A;  4US9 A;  3RPF C;  1L5P A;  2NTT A;  3LDZ E;  2RDH A;  3WAO A;  1V80 A;  2Y5B B;  2NS5 A;  1IGC A;  3IAM 1;  4J6I A;  4EFO A;  5AZF A;  1UH6 A;  1ZKH A;  3AE8 B;  4W9I A;  1YNT E;  3T9L A;  3V60 A;  4EZL A;  1UD7 A;  2KFK B;  2KQ4 X;  2KX0 A;  3H7P B;  1TS5 A;  3AE6 B;  3OJ4 B;  4HRS A;  3M63 B;  1WYW B;  1YX6 B;  1PGX A;  2K1F A;  1ZPS A;  4PT5 A;  2N1V A;  5KHO A;  3RUI B;  2KMC A;  3TUO A;  1V9J A;  4LTU A;  2KK8 A;  4TKN A;  2HJ1 A;  4F8C B;  4KVG B;  3A1Q B;  3NS1 A;  3M3J A;  2PLP A;  2KHW B;  3ZDT A;  1N63 A;  1CK1 A;  2LI5 A;  3A1Q A;  3RN9 C;  1QIL A;  4MSM B;  3T3N A;  3KUZ A;  1K50 A;  2DX5 B;  4PYZ A;  2WXI A;  4A3O A;  2NPT A;  3CF6 E;  2JSV X;  2PKO A;  2L76 A;  3N1X C;  4TQ0 A;  1L2N A;  3B2F A;  4W9D A;  2LJ5 A;  3I3T B;  2ZNV C;  4K7W A;  4LNO A;  1WX7 A;  4HPM B;  3TMP B;  2BPS A;  1ISN A;  1OQY A;  5AUK A;  2WXG A;  2FAZ A;  2KAJ A;  2G9H D;  3I63 C;  3KUD B;  3R2I A;  2EMT A;  3TBL D;  3H7P A;  2N9L A;  3CST A;  3NZU A;  1MG8 A;  1TT5 B;  3GB1 A;  2GMI C;  4TV3 A;  1I4G A;  4WQO B;  1WM3 A;  3AU5 A;  1HEZ E;  2KJH B;  3QHT A;  4M00 A;  1LGR A;  3BYY B;  3MJW A;  1MPE A;  1TS2 A;  3AE1 B;  4J3O D;  2W3R A;  2QEJ C;  3VUX A;  2XEW A;  3VR8 B;  3OG5 A;  1F2R C;  2WXK A;  3Q8A A;  4LNI A;  2HTH A;  1GB4 A;  2LGI A;  5IAA C;  4KV2 A;  4XDD A;  3Q8C A;  4GDL B;  3AEA B;  4ITK A;  3HM3 A;  2KN5 A;  2BYT A;  2UYZ B;  3RFZ B;  1C4A A;  1E10 A;  4HJG E;  4WAF A;  4BFR A;  1RRB A;  4HEA 1;  3KYC D;  1KLV A;  4N58 A;  4NAW B;  4JWS C;  4ANX A;  2A4Z A;  1WE7 A;  4ZRP A;  2MWS B;  3AXC A;  2XBB C;  5D2M B;  1RFK A;  1DGJ A;  3L54 A;  4C7Z A;  3R7R A;  2BBC A;  1K53 A;  4B6W A;  1NEK B;  3I5J C;  1E7U A;  2DAJ A;  2ZVO A;  1FO4 A;  3L0W B;  5DPR A;  3R2T A;  2ACZ B;  2Z0E B;  2G45 B;  1N62 A;  4DHZ B;  2KTF A;  4IM3 A;  2KDB A;  1TZ1 A;  3IBE A;  2AX5 A;  1LM8 B;  5G2N A;  2NTS A;  3ZJT A;  2JPH A;  3I57 A;  1Q1O A;  4JPS A;  4RGN A;  5LXH A;  1YN3 A;  2JXT A;  2KT7 A;  2N7D A;  2C7M B;  1FXT B;  1J19 A;  2CU1 A;  2H88 B;  2V3N A;  2ONQ A;  4BBN C;  3ZO5 B;  2REX A;  1D3Z A;  1ESF A;  3PRM B;  2JYE A;  4GLS C;  4NNJ B;  2RPQ A;  2LRW A;  2J52 A;  1WXV A;  3ZXV A;  2W82 A;  4NAW A;  1P1A A;  1Z5S B;  4K81 A;  3ALB A;  4G11 A;  1ZP0 B;  3HK0 A;  2D3A A;  3SU8 X;  4AJW A;  4OZC A;  3NZS A;  3WAL A;  4JLC A;  3V62 A;  2L00 B;  4EZK A;  4C56 C;  2K8H A;  2LGX A;  2JU6 X;  2GBJ A;  1PUT A;  2CR5 A;  4HWI B;  2ZW1 A;  4W9C A;  4ZHO A;  1LXD A;  3L4P A;  3P42 A;  3NJT A;  1BML C;  4XC2 A;  4NJ6 A;  4YSY B;  3VVW B;  1AWD A;  1TKY A;  1DYQ A;  4FLH A;  3E56 A;  5IA7 A;  4OZA A;  3RZF A;  3LYY A;  4KZ0 A;  3JSV B;  1N5W A;  1WMH A;  4UDU C;  3DBR I;  1E8Y A;  2JX5 A;  3JSV A;  3U4E G;  3KUC B;  1ZW7 A;  1XXG A;  1T6B X;  2BQQ A;  1YJJ A;  2RSU A;  1F1H A;  1GOZ A;  2A5U A;  1AW7 A;  5L83 A;  1E90 A;  2D2Q A;  3PZ7 A;  3SEB A;  3M62 B;  1J7B A;  4PS3 A;  1B1Z A;  3BY4 B;  1C3T A;  1WSP A;  2KOX A;  2KQS A;  1WE6 A;  4XDC A;  4B9K A;  2JF5 A;  2BTE A;  2HD5 B;  1ZDX A;  5C2T B;  4DDG D;  3NVY A;  2L05 A;  5CHW A;  1R4N B;  3L17 A;  3V3X A;  2LGS A;  1C9F A;  3L13 A;  1DOX A;  1T0Y A;  2DLB A;  3DVG X;  1C77 A;  3AE9 B;  4ZYS A;  1UBI A;  2FIF A;  4PS7 A;  5CHV C;  1BT0 A;  4K7S A;  3NUH B;  2KMA A;  2GB1 A;  3VR9 B;  1WXA A;  5FR6 A;  1TTN A;  2D07 B;  1KH0 A;  4I6P A;  4LNN A;  4E71 A;  1ET9 A;  2JZZ A;  1E8X A;  2LHD A;  1UWM A;  1I4X A;  1WRI A;  3APF A;  4W9G A;  5BYR A;  4P7I A;  2JQR B;  3AI5 A;  2Y3A A;  4IWQ A;  3AE4 B;  3NVZ A;  3C8Y A;  1E6E B;  3U7Z A;  2NVU I;  1YIW A;  2FUH B;  3B0A A;  5IKC M;  3P2B A;  4MH8 A;  4WUR A;  1J7C A;  4S0R A;  5CTR C;  3BIN A;  4P1B C;  4W9H A;  2KQ7 A;  3DHI C;  4IW0 A;  3SFE B;  2MBQ A;  3TSS A;  4ZDV A;  3ZVV A;  1VZ7 A;  3VUW A;  5LNK 1;  1OEY A;  1E8W A;  2AWT A;  2IO0 B;  4JWU C;  3APC A;  3X23 A;  2V4L A;  2BB5 A;  3QIJ A;  2MBB B;  1NI2 A;  2AL3 A;  1FFV A;  4ICV A;  2LFI A;  5EE3 A;  2K25 A;  2ZCB A;  5KHQ A;  3U7D A;  1V86 A;  3SFD B;  3JVZ X;  3ZQ4 A;  3Q2A C;  1T3Q A;  4YSZ B;  4W9E A;  1JWA D;  3B1L X;  3OLM D;  1LO5 D;  3LXF A;  4PYU A;  1DOY A;  4GU2 A;  3IT4 B;  2GBM A;  1LQB A;  1ZE3 D;  4KIK A;  2J0M A;  2VZK B;  2HJ8 A;  2WDV B;  2IO2 B;  4MSQ B;  2NBU A;  4BOS C;  4ZRI A;  3S2A A;  2IY0 B;  3K9P B;  1XCT L;  2JYT A;  1UUP A;  3DBR B;  1R4M B;  3AM9 A;  1WGK A;  4NZL B;  3C0R B;  1YQ4 B;  3DPD A;  3UGB B;  1P7F A;  2MJ3 A;  1XLO A;  3ZNH B;  4WWO A;  1TY2 A;  2GBN A;  2XK5 B;  1T0S C;  3Q3O C;  4RNA A;  1SGH A;  1L7Y A;  1N61 A;  1ZXH A;  2Z0D B;  3RNC C;  3O65 B;  4FBJ B;  1WH3 A;  2N9P C;  1R7S A;  1D5X C;  2WX0 A;  2TSS A;  4C80 A;  4KDI C;  1GPX A;  4CHK A;  5G5H A;  2BB6 A;  4LJO B;  2KWU B;  5E6J A;  1F2R I;  1FD6 A;  4TQ1 A;  4HPP A;  2KTR B;  2ZPY A;  4FJZ A;  2AQ2 B;  2FCM A;  1K8R B;  2IPK D;  4DQO C;  3EHV A;  1NYR A;  1D5M C;  1MG4 A;  2IGD A;  1FFU A;  2VH1 A;  3R7Q A;  4IG7 B;  2IO3 B;  1UGM A;  2X8X X;  2O2V B;  4W9F A;  2LGD A;  2W54 A;  3AN1 A;  2O2V A;  2JWZ A;  1FCL A;  2NR2 A;  2N4F A;  4CO7 A;  2O6V B;  3N1Z C;  2WDR B;  4HJK A;  4WJQ A;  4M0W B;  1SSN A;  4D2K A;  1XO3 A;  2LUM A;  2KLC A;  1E9M A;  2XK5 A;  1YJI A;  2WXF A;  1E8Z A;  1L6V A;  4AJY B;  3H8H A;  3VUY A;  4HKQ A;  2WXJ A;  2PIA A;  5D7G A;  2D3G A;  5HG2 A;  4ASW C;  4WJO A;  4HDQ A;  2W55 A;  2KWD A;  2V1Y A;  4TUU A;  5D3D A;  3N30 A;  1MHH E;  1NYQ A;  2RDB C;  1J8C A;  2K8B A;  1NVI D;  2M0A A;  1IBX B;  2HE7 A;  3Q8E A;  1P0R A;  3ZJV A;  3PRP B;  3Q6B A;  2RGF A;  2IY1 B;  3WAM A;  2K3U A;  3C19 A;  3CSF A;  4EEW A;  3A4S C;  4GN1 A;  4XE0 A;  3SHQ A;  2Z8L A;  2V3P A;  2VH2 A;  1P3Q U;  4RH6 A;  3MHZ A;  2WU2 B;  3W9C B;  2FUG 1;  4GDL A;  2KMM A;  3HUI A;  2W3S A;  3IVF A;  4ZRQ A;  2LVO A;  4FHK A;  4BKS A;  3HIZ A;  4IUM B;  2MW5 A;  3UQA A;  3GS2 A;  1P98 A;  5EE0 A;  2WDT B;  4A6Q A;  1WM2 A;  2L83 A;  3HRD D;  3N32 A;  2N9K A;  1QQR A;  2L0T A;  3AE3 B;  1V5T A;  3OAW A;  1HTQ A;  1QOA A;  2JY6 A;  3DBH B;  3BK1 A;  1OTR B;  1IUE A;  3B2G A;  2KWC A;  4A8X C;  3PRE A;  3RYT A;  3BVZ A;  4BKS D;  1RAX A;  2H89 B;  3BWU D;  3NG0 A;  1WGR A;  2L0F A;  4WAA A;  4N9F 4;  1V1O A;  5D94 A;  3N1Y C;  1I35 A;  3AEE B;  4M8M A;  5J2R A;  3FIL A;  2M4N A;  3IG3 A;  4H2A A;  3QCA A;  2K6D B;  3WAN A;  4MGI E;  2IO1 B;  2ZVN A;  1VD2 A;  2N7J A;  2DZI A;  2K9X A;  1AN8 A;  1NDD A;  1SE2 A;  2YEP B;  4II2 B;  4P6V F;  1WF9 A;  2KD0 A;  3KWL A;  4HDO A;  3PLU A;  3KLS X;  1OGW A;  1WMH B;  3P1M A;  5BYS A;  3R8B A;  1B9R A;  1CZP A;  2VRR B;  1GB1 A;  1T5X D;  1ROE A;  4USA A;  2EMS A;  1X1M A;  4GOC A;  4EKU A;  3IAS 1;  3W1S C;  1E7P B;  1YN5 A;  1VDV A;  4ZYN A;  2MP2 A;  1EWY C;  2FNJ B;  2INP E;  3D32 A;  1KLG D;  5EE9 A;  2LHE A;  5E6O A;  4EUT A;  4FA6 A;  1WY8 A;  1VRA B;  4OVZ A;  1TIF A;  1N6Z A;  3ZDM C;  1WXM A;  3DHG C;  4ZOH C;  1M94 A;  3AE2 B;  4HCP B;  4M02 A;  4G0N B;  1ZGU B;  4CQN A;  1ZXI A;  1I4H A;  3ZNZ B;  4YXD B;  1UWX A;  3P4P B;  3A9K A;  2KJR A;  1GJZ A;  4WH4 A;  3QAR A;  1EWC A;  3ZXR A;  1DOI A;  1I4R A;  3VH4 B;  3AEG B;  3URY A;  3H9D A;  1TS3 A;  1PQS A;  2O6V D;  4E74 A;  3W2D A;  4NQL B;  4LNF A;  1FPY A;  4JGH B;  3RZW C;  1YX5 B;  4XGA B;  5HHD G;  3FKY A;  5AEK B;  1U4A A;  2BS2 B;  4YTN B;  1JRP A;  5E6N A;  1MHX A;  2YEP F;  1V5O A;  3A9J A;  1XLP A;  2WDQ B;  5DCN A;  1XD3 B;  2ICI A;  3GE8 C;  3KVF B;  1T0R C;  4HKZ E;  2LUE A;  1XEE A;  4MJS A;  2KVR A;  4RGM A;  2DBY A;  4RCO A;  2PTL A;  4NY0 A;  3Q8B A;  2AYO B;  2WWZ A;  3IFW B;  4ARI A;  2ZNV B;  3QX1 A;  3BVM A;  2J4X A;  1RM6 C;  1CMX B;  1HZ6 A;  2LJI A;  5G5G A;  3RUL A;  2PVG C;  4B0M A;  3Q3J A;  4X57 B;  5TSS A;  1WX9 A;  2IGH A;  5DPS A;  5BMG A;  2WXH A;  4MEL A;  3OJ3 A;  3MC0 B;  5IO9 A;  3U8Z A;  3WIM A;  2GLS A;  3ML9 A;  3ZKJ C;  2KFK A;  1V1P B;  4C00 A;  3UQB A;  3EFC A;  3HVZ A;  3DDC B;  4AS1 A;  2BYV E;  2DYB A;  2DNF A;  3MJ5 A;  2OED A;  4EZJ A;  2OJR A;  1SB3 C;  5HKH A;  3RNF C;  1VZ6 A;  1QT9 A;  5J17 A;  3A9J B;  3J9C A;  1I4Q A;  3DOW A;  5LXI B;  1S3S G;  1C78 A;  4DXA B;  2EKE C;  3W5V B;  3ZTC A;  1C76 A;  1UNS A;  3AMZ A;  4MJS B;  1CQV A;  1QF6 A;  3QC8 B;  4EOY A;  3APD A;  1D6E C;  3DBL B;  2B76 B;  2MCN B;  2B3A A;  2CKH B;  1TBE A;  3Q3N C;  3TIX A;  3PTF C;  4KDL B;  3JW0 X;  1QOB A;  2INC C;  3B9J A;  2J0J A;  3RNE C;  4YTM B;  2LXC A;  2N7E A;  2WXP A;  2LEK A;  1L0V B;  3HVD A;  5T8I A;  4ARC A;  2DEN B;  3KWV A;  2QC8 A;  2FID A;  2KDM A;  3N20 C;  4KGT A;  2LXA A;  5AZG A;  2M17 A;  4FJV B;  4DHZ E;  1HTO A;  4DBG A;  3ZNG C;  2MX2 A;  4NQK E;  4EE2 A;  2I38 A;  5BMH A;  1SE4 A;  4KZC A;  3W1S A;  2BYF A;  3DQV A;  1OQR A;  1F0Z A;  1RLF A;  2IYD B;  2N0S B;  4LDT D;  4C7Y A;  2XNA C;  1VZ8 A;  1H4R A;  2WQY B;  1FRR A;  2ZJD A;  4US8 A;  2C7H A;  2G1E A;  3U2S C;  3EFU A;  1EUV B;  2OHF A;  2ZZP B;  1TZO A;  1WI0 A;  3U52 E;  5MPO A;  1KJT A;  2DWQ A;  4XYC A;  5GMV A;  4BVU C;  2M1M A;  4MGY E;  2EEL A;  2L52 A;  3MFG A;  1TJE A;  1FNU A;  2LRU A;  1FNV A;  4JE3 B;  4W9J A;  3U30 A;  4AUQ C;  2UWQ A;  1QOG A;  4FAD A;  4ZRJ A;  1CJE A;  3AV8 A;  1KLU D;  4DDI D;  4N59 A;  5C3J B;  1EM7 A;  3W5U B;  3PGE A;  2WS3 B;  1WJU A;  3N3K B;  2WGS A;  2WXL A;  4GMV A;  2QDF A;  1V81 A;  3UIP B;  4DK5 A;  3DVN V;  1QKZ A;  1WR1 A;  1GC6 A;  4ANV A;  2LMC A;  1XLN A;  4OVU A;  4AOF A;  1Y56 A;  1XT9 B;  1IBX A;  3B08 A;  1OEY J;  3FIL B;  4OW0 A;  1NEN B;  2QIE B;  4YSX B;  3Q8F A;  2KC1 A;  2RPV A;  1H8C A;  4QAY A;  1AAR A;  3MC8 A;  1WGD A;  3AEB B;  3PHX B;  4B0E A;  3RNB C;  2N9E B;  4DWF A;  2K6Q A;  4K1R B;  1R4M I;  2BYE A;  1A70 A;  1KM7 A;  1OQQ A;  1ACC A;  1VJK A;  1WZ3 A;  2NBW B;  3BII D;  1VCB A;  2G3Q B;  4GIV A;  1PGA A;  2KX3 A;  4GGQ A;  2IJ0 A;  2C5L C;  1BUI C;  4GDK A;  1EU4 A;  2KYW A;  1YOV B;  4NAM A;  5TR5 A;  4A55 A;  4WWM A;  3AE5 B;  2SAK A;  1I42 A;  1J7A A;  2K39 A;  2XN9 C;  1IYF A;  1P9D U;  1FXA A;  2CHX A;  3Q3F A;  3NHE B;  2MHJ A;  3PZD A;  1TKG A;  4ZHP A;  2V4I B;  1SJE D;  2ASQ A;  1JQ4 A;  1WYG A;  1L4Z B;  2QMT A;  2L8J A;  2M19 A;  3UIN B;  1J0G A;  1LFD A;  4PS8 A;  2CU3 A;  2WXR A;  3PVL A;  2INN E;  1Q0W B;  1ZOY B;  5C1Z A;  2OOB B;  1RWS A;  1K51 A;  4JIO U;  3EA6 A;  2KNB A;  5LLI A;  5CHF A;  4XWW A;  3DCG A;  5GXG B;  1C4C A;  1WJN A;  1D4B A;  2BS4 B;  1YMH E;  4BBN F;  2K5P A;  3Q14 C;  2CJO A;  2Y5C A;  4M8N A;  2IDY A;  4FJY A;  4WJP A;  2N9X A;  3VFK A;  3L08 A;  2MBH A;  3QJZ A;  1SE3 A;  4GDK B;  2AQ1 B;  4L2Y A;  2R61 A;  2MBE A;  3PS6 A;  5IOI A;  1HA5 A;  2J7Q B;  1WX8 A;  2PPH A;  2LZ6 A;  3UF8 A;  2M8S A;  3T3O A;  2IZV B;  4LK0 M;  4BOZ B;  2WLB A;  3PZ8 A;  1PYW D;  4L23 A;  3TJP A;  2LVP A;  2MSE D;  2L3Z A;  5FK9 C;  3P63 A;  1VLB A;  4NPN A;  4W9K A;  1GC7 A;  4FXC A;  3DBH I;  2YLM A;  3NZ3 A;  3VTU A;  3UIO B;  3BK2 A;  3ZYY X;  4A3P A;  1GG3 A;  1C4P A;  4MM3 A;  5BMI A;  3AE7 B;  3T8M A;  3R66 C;  1YQB A;  1IGD A;  2WXO A;  2X38 A;  5BO4 B;  3Q69 A;  3QQ8 B;  1JML A;  3BYT B;  1E5W A;  3NRZ A;  2AQ3 B;  2LGY A;  4LDT B;  1L0X B;  3PT2 B;  2WHI A;  3P4Q B;  1SE9 A;  3GOE A;  4IOI E;  3MP9 A;  2KO3 A;  1RFA A;  5HFY A;  5EDS A;  1NBF C;  2MP2 B;  3O13 A;  5JXV A;  4URK A;  3VAW A;  1EF1 A;  1MJD A;  2ZCC A;  2MJE A;  2KKC A;  4A9A A;  3ZIM A;  1UF0 A;  1N60 A;  4C4V A;  3L16 A;  5JHA A;  2QIL A;  4OZB A;  2I1K A;  3GZN B;  3TL5 A;  1KFY B;  4MDK E;  3GP7 A;  1XCQ L;  5L95 C;  2KDE B;  2E6X A;  4IM2 A;  4FUL A;  1KTK A;  2MLB A;  2KN4 A;  2CS4 A;  1SJH D;  3QA8 A;  4RM9 A;  3ZRF A;  3DBS A;  4OHJ A;  4DXF A;  1L6U A;  3AH7 A;  2DAF A;  2L32 A;  2JRH A;  3CIR B;  5I4D A;  3E9S A;  3VTV A;  3TCA A;  2BKF A;  3IHP C;  4K3C A;  2CHW A;  2QJL A;  2KZR A;  3QAQ A;  2JXX A;  3VRA B;  2CHZ A;  3VTW A;  4WQM A;  4MT5 A;  1GNU A;  2N1W A;  3EC8 A;  4YTP B;  2BT6 A;  3AED B;  1G6J A;  2BF8 B;  2JT4 B;  3DVG Y;  1IPG A;  1WGH A;  3MC9 A;  4HVB A;  4XZ4 A;  1V6E A;  5E6P A;  1WIA A;  3V6C B;  1WR6 E;  1MI0 A;  2R2Q A;  2W9N A;  1I7H A;  4L1B A;  3PO0 A;  3VH3 B;  3ABV B;  2PMV A;  4PK1 A;  3I9V 1;  2NMQ A;  4BKG A;  4HXD A;  2KAC A;  2NCN A;  1JWU D;  2IGG A;  1F52 A;  2PW9 A;  1EU3 A;  1L4D B;  1JRU A;  1MFW A;  2KTR A;  2WU5 B;  3H1U A;  3RI7 C;  1WGG A;  3FC4 A;  4AQ7 A;  2M0X A;  5D6J B;  3QWZ B;  3ZNI D;  1F9J A;  4P16 A;  5JZE B;  3RCZ A;  3ZRC A;  5DPT A;  3V61 A;  2JRI B;  1YQ3 B;  3PRZ A;  2MEK A;  3TEX A;  4KIK B;  4GB9 A;  3TEW A;  4HCN B;  4MAC A;  3KH0 A;  4HRO A;  4XWT A;  2LAS A;  2J0K A;  1WRD B;  2KFJ A;  4G50 A;  5IN7 A;  4YT0 B;  5D3I B;  3RNA C;  3WAP A;  3VDZ A;  4DHJ D;  2HTM E; 
#chains in the Genus database with same CATH homology
 2YVC A;  3ZNH B;  4LCD E;  2C7H A;  4F8C B;  4WWO A;  2GBN A;  3A1Q B;  4KVG B;  2XK5 B;  3M3J A;  3EFU A;  2DYM A;  1EUV B;  1SGH A;  2KHW B;  2ZZP B;  1L7Y A;  2Z0D B;  3ZDT A;  1WI0 A;  3O65 B;  2C60 A;  3A1Q A;  2LI5 A;  4FBJ B;  1A5R A;  4MSM B;  1WH3 A;  1KJT A;  2N9P C;  3KUZ A;  2D10 A;  2WX0 A;  5GMV A;  4GXB A;  2M1M A;  4BVU C;  3ZTD A;  2PJH A;  4KDI C;  3NOB A;  4MGY E;  4CHK A;  2DX5 B;  2LWP A;  4LJO B;  2KWU B;  4PYZ A;  4A3O A;  2NPT A;  3CF6 E;  4TQ1 A;  4HK2 A;  2KJ6 A;  2LRU A;  2L76 A;  2KTR B;  2NBV B;  2ZPY A;  4FJZ A;  4W9J A;  3U30 A;  4AUQ C;  4TQ0 A;  2UWQ A;  1L2N A;  4FAD A;  1UBQ A;  2FCM A;  4W9D A;  1K8R B;  2LJ5 A;  3I3T B;  4ZRJ A;  2ZNV C;  3EHV A;  2MA9 B;  3KW5 B;  3NS8 A;  1WX7 A;  4K7W A;  4HPM B;  3TMP B;  4DDI D;  2D11 A;  2BPS A;  1ISN A;  1OQY A;  2FAZ A;  3PGE A;  4GSW A;  3R7Q A;  4IG7 B;  2IO3 B;  1WJU A;  3N3K B;  1UGM A;  3KUD B;  4GMV A;  3ZLZ A;  3DVN U;  1V81 A;  2EMT A;  3TBL D;  3H7P A;  2O2V B;  4IWO A;  3UIP B;  4W9F A;  3CST A;  4DK5 A;  3DVN V;  2LGD A;  1WR1 A;  1GC6 A;  2C7N B;  2LD9 A;  1MG8 A;  2NPT B;  3NZU A;  4ANV A;  2IBI B;  2QHO A;  2O2V A;  3ENE A;  4OVU A;  2GMI C;  4YL8 A;  4TV3 A;  4FHJ A;  2JWZ A;  2NR2 A;  2N4F A;  4CO7 A;  4WQO B;  1WM3 A;  3LJ3 A;  2I1J A;  2O6V B;  3ZW3 A;  3AU5 A;  4HJK A;  4AOF A;  4WJQ A;  3PSE B;  4M0W B;  2FCQ A;  1XT9 B;  4HLE A;  3DBL I;  3QHT A;  2KJH B;  2O6V A;  3B08 A;  1OEY J;  4G3X B;  3MJW A;  2KLC A;  2XK5 A;  1Q5W B;  5AZH A;  1E8Z A;  2KC1 A;  4AJY B;  1H8C A;  3VUX A;  1AAR A;  2XEW A;  3VUY A;  1WGD A;  3PHX B;  2N9E B;  4DWF A;  2HTH A;  2K6Q A;  5D7G A;  5IAA C;  4K1R B;  2D3G A;  4KV2 A;  4ASW C;  1R4M I;  4RMA A;  2BYE A;  4HDQ A;  4WJO A;  4WWN A;  1KM7 A;  1WZ3 A;  2NBW B;  2KDF B;  2V1Y A;  4GDL B;  4TUU A;  1VCB A;  2KN5 A;  2ZPN A;  1Y8R C;  2G3Q B;  3HM3 A;  2DZK A;  4GIV A;  2UYZ B;  3N30 A;  1J8C A;  3PPA A;  2KX3 A;  2K8B A;  3PV1 A;  4GGQ A;  4BFR A;  1RRB A;  3SD5 A;  2DZJ A;  2HE7 A;  3KYC D;  1P0R A;  4NAW B;  3PRP B;  4CYE A;  1KLV A;  3ONS A;  4ANX A;  4RM8 A;  2C5L C;  2DZM A;  2RGF A;  4GDK A;  2IY1 B;  3WAM A;  2A4Z A;  3MHS D;  1WE7 A;  2MWS B;  5TR5 A;  5J18 A;  2PE6 B;  2G4S A;  3AXC A;  2XBB C;  5D2M B;  1I42 A;  1EO6 A;  2K39 A;  3CSF A;  3MTN B;  4AWJ A;  3A4S C;  4GN1 A;  4EEW A;  1UEL A;  1GUA B;  3SHQ A;  1IYF A;  1P9D U;  2CHX A;  3L54 A;  1P3Q U;  3Q3F A;  1WJ4 A;  3NHE B;  3R7R A;  3PZD A;  4B6W A;  2PEA A;  1E7U A;  2DAJ A;  2BWF A;  2ZVO A;  2ASQ A;  3L0W B;  4GDL A;  5DPR A;  4KSL C;  2L8J A;  3IVF A;  3AUL A;  3UIN B;  2AL6 A;  2Z0E B;  3W1Y A;  1J0G A;  2G45 B;  2LVO A;  4FHK A;  4BKS A;  3HIZ A;  4DHZ B;  2KTF A;  4IUM B;  4IM3 A;  2MW5 A;  4MEM A;  3X0W A;  3UQA A;  1LFD A;  3ZUN A;  2KDB A;  1TZ1 A;  3QK0 A;  3IBE A;  4PS8 A;  1P98 A;  1LM8 B;  2WDT B;  3PVL A;  3HHM A;  1WM2 A;  5G2N A;  1Q0W B;  2JPH A;  3A33 B;  2MRP A;  5C1Z A;  2OOB B;  3N32 A;  4KSK C;  4JIO U;  1Q1O A;  3KYD D;  3OAW A;  2L0T A;  2KNB A;  1V5T A;  5LLI A;  5LXH A;  2N7D A;  4WWP A;  2C7M B;  1FXT B;  5CHF A;  3DCG A;  4MH0 E;  1J19 A;  1WJN A;  2CU1 A;  2JY6 A;  1OTR B;  4BBN F;  2L7R A;  4BBN C;  2KWC A;  3ZO5 B;  2REX A;  1S1Q B;  3PRE A;  1D3Z A;  3RYT A;  4M8N A;  3ML8 A;  3PLV A;  4BKS D;  1RAX A;  1YD8 U;  3PRM B;  4ANW A;  2WYQ A;  2WX1 A;  4FJY A;  2N9X A;  4WJP A;  1WGR A;  2RPQ A;  2LRW A;  1EF5 A;  4NNJ B;  3VFK A;  3L08 A;  2MBH A;  2L0F A;  1WXV A;  3GZN I;  4N9F 4;  4WAA A;  4NAW A;  1HE8 A;  3QJZ A;  1P1A A;  1Z5S B;  2GBK A;  4K81 A;  2C9W B;  3ALB A;  4GDK B;  4W9L A;  3PHW B;  4G11 A;  5D94 A;  1R4N I;  2MBE A;  3PS6 A;  3AU4 A;  3HK0 A;  4M8M A;  5J2R A;  1I35 A;  3SU8 X;  2M4N A;  2KAN A;  2J7Q B;  4AJW A;  1WX8 A;  2PPH A;  3IG3 A;  2LZ6 A;  3UF8 A;  1E7V A;  5JH5 C;  2M8S A;  3QCA A;  2IZV B;  4BOZ B;  3NZS A;  2K6D B;  4HPL B;  4MGI E;  3WAN A;  2IO1 B;  2ZVN A;  1TGZ B;  3WAL A;  1VD2 A;  4OVV A;  2LVP A;  3TJP A;  2MSE D;  2DZI A;  2BWE S;  4JLC A;  2L3Z A;  3V62 A;  2L00 B;  4EZK A;  1NDD A;  4BKT A;  4IC7 B;  4II2 B;  2LGX A;  2K8H A;  1WF9 A;  2GBJ A;  2KD0 A;  4NPN A;  4HDO A;  4W9K A;  5JHB A;  3PLU A;  1SIF A;  1GC7 A;  3DBH I;  1OGW A;  2CR5 A;  1WMH B;  2YLM A;  4HWI B;  4F7Z A;  3VTU A;  3UIO B;  2VRR B;  4W9C A;  1LXD A;  3CMM B;  4A3P A;  2EMS A;  1X1M A;  4GOC A;  4EKU A;  4ICU A;  3RD2 A;  1GG3 A;  3W1S C;  4MM3 A;  4XC2 A;  4WJN A;  3H6N A;  4ZYN A;  4FN2 A;  4NJ6 A;  3T8M A;  3VVW B;  2GBR A;  1YJ1 A;  2MP2 A;  3R66 C;  2FNJ B;  3D32 A;  1YQB A;  4AP4 C;  3V6E B;  5E6O A;  2ZEQ A;  4EUT A;  4FA6 A;  1WY8 A;  3ZDM C;  4FLH A;  3L10 B;  1WGY A;  1WXM A;  5BO4 B;  5IA7 A;  3QQ8 B;  3RZF A;  1M94 A;  3A4R A;  1E5W A;  4KZ0 A;  3ECI A;  4HCP B;  4A20 A;  4G0N B;  2JZ3 B;  1ZGU B;  3JSV B;  1WMH A;  4XX5 A;  3R3M A;  3ZNZ B;  2LGY A;  1V49 A;  3DBR I;  3A9K A;  2KJR A;  4LDT B;  1E8Y A;  1GJZ A;  3JSV A;  3PT2 B;  3QAR A;  3KUC B;  1ZW7 A;  3VH4 B;  3A9K B;  1SE9 A;  3GOE A;  2KC2 A;  1WZ0 A;  2KO3 A;  2KXJ A;  1RFA A;  3WA0 A;  2RSU A;  5EDS A;  2KLG A;  1NBF C;  2AEH A;  2MP2 B;  3H9D A;  3VQI A;  1PQS A;  1KOT A;  2A5U A;  2O6V D;  4LJP B;  4E74 A;  5L83 A;  1E90 A;  5DPW A;  4NQL B;  2D2Q A;  3VAW A;  4URK A;  1EF1 A;  2ZCC A;  2KKC A;  4F1S A;  1Z2M A;  4JGH B;  3M62 B;  4II3 B;  1YX5 B;  3RZW C;  3ZIM A;  5C23 A;  4PS3 A;  3L16 A;  4ZRK A;  3BY4 B;  5JHA A;  5AEK B;  1C3T A;  1U4A A;  2I1K A;  2KOX A;  2KQS A;  1WE6 A;  1IP9 A;  2RD0 A;  5E6N A;  4B9K A;  2JF5 A;  1V5O A;  3HM6 X;  3TL5 A;  4ANU A;  2HD5 B;  4MDK E;  4DDG D;  3A9J A;  4IM0 A;  5DCN A;  2L05 A;  5CHW A;  2BGF A;  1XD3 B;  3KVF B;  3L17 A;  5L95 C;  2KDE B;  3L13 A;  4JL9 A;  2LUE A;  4MJS A;  2KVR A;  1T0Y A;  3DVG X;  4NY0 A;  4K7U A;  4IM2 A;  4E3C A;  4FUL A;  2AYO B;  2MLB A;  2WWZ A;  1C1Y B;  3IFW B;  1UBI A;  2FIF A;  4PS7 A;  2CS4 A;  3M95 A;  5CHV C;  1BT0 A;  3QA8 A;  2JVC A;  4RM9 A;  2ZNV B;  4K7S A;  4NJ7 A;  3QX1 A;  3DBS A;  3ZRF A;  2KMA A;  2FCN A;  2PE9 A;  4IWP A;  2K8C A;  3RT3 B;  3JYU A;  2DAF A;  1CMX B;  1WXA A;  2JRH A;  5FR6 A;  1TTN A;  2D07 B;  4I6P A;  2LVQ A;  3RUL A;  4E71 A;  3Q3J A;  4X57 B;  3TCA A;  2BKF A;  3VTV A;  2JZZ A;  3SDL C;  1WX9 A;  3IHP C;  2KDI A;  5DPS A;  2CHW A;  2MBO A;  4JQW C;  2KZR A;  3QAQ A;  2JXX A;  4MEL A;  3OJ3 A;  5G55 A;  3U8Z A;  2BKR B;  1E8X A;  2CHZ A;  2DYO A;  3VHT C;  3WIM A;  3VTW A;  4I6N B;  1GNU A;  2N1W A;  3EC8 A;  3H7S A;  3ML9 A;  3ZKJ C;  4W9G A;  3APF A;  2KFK A;  4P7I A;  1G6J A;  3AI5 A;  2BF8 B;  4IWQ A;  2JT4 B;  3DVG Y;  4MGZ E;  1IPG A;  2FCS A;  3UQB A;  1WXS A;  4I6L B;  3DDC B;  2NVU I;  2BYV E;  2DYB A;  1YIW A;  1WGH A;  2FUH B;  3B0A A;  3P2B A;  2GOW A;  2RR9 A;  3K9O B;  2Z59 B;  5CTR C;  1QZE A;  4EZJ A;  3BIN A;  2OJR A;  4HVB A;  4XZ4 A;  2KWV B;  1V6E A;  4W9H A;  2KQ7 A;  5E6P A;  1WIA A;  5CX3 A;  1WR6 E;  3V6C B;  4B95 A;  5HKH A;  4IW0 A;  2V3S A;  2MBQ A;  3EEC A;  4ZDV A;  3ZVV A;  2R2Q A;  4MGK E;  3VUW A;  2W9N A;  5J17 A;  3A9J B;  1OEY A;  2DHZ A;  2JUO A;  3DOW A;  5LXI B;  1S3S G;  4DXA B;  2EKE C;  3VH3 B;  1E8W A;  2AWT A;  2IO0 B;  3ZTC A;  1V2Y A;  4MJS B;  2G4D B;  2R2O A;  4BKG A;  3APC A;  4HXD A;  3QC8 B;  2V4L A;  1WJ6 A;  3X23 A;  4EOY A;  3APD A;  3QIJ A;  2NCN A;  2MBB B;  3NY5 A;  1UZX B;  1NI2 A;  2AL3 A;  2MCN B;  4DHJ B;  1WFY A;  2B3A A;  2CKH B;  1TBE A;  4ICV A;  3TIX A;  3PTF C;  4KDL B;  2MQJ A;  3JW0 X;  3VXW A;  1XQQ A;  2K25 A;  2ZCB A;  1JRU A;  5KHQ A;  3U7D A;  2J0J A;  1V86 A;  2KTR A;  3JVZ X;  3LDZ E;  2LXC A;  2N7E A;  3H1U A;  3WAO A;  1V80 A;  2Y5B B;  2NS5 A;  4W9E A;  4J6I A;  3B1L X;  1WGG A;  3OLM D;  4EFO A;  5AZF A;  4PYU A;  1UH6 A;  2DEN B;  2M0X A;  1ZKH A;  5D6J B;  3QWZ B;  4GU2 A;  3ZNI D;  2GBM A;  4W9I A;  1F9J A;  2FID A;  5JZE B;  1LQB A;  4KIK A;  3T9L A;  2J0M A;  2LXA A;  3V60 A;  5AZG A;  3RCZ A;  2M17 A;  5DPT A;  3ZRC A;  4EZL A;  2HJ8 A;  4FJV B;  3V61 A;  4DHZ E;  2JRI B;  4DBG A;  3ZNG C;  1UD7 A;  2IO2 B;  4MSQ B;  2MX2 A;  2KFK B;  3PRZ A;  4KIK B;  4NQK E;  2KX0 A;  3H7P B;  4GB9 A;  2NBU A;  3OJ4 B;  4HCN B;  3M63 B;  1WYW B;  1YX6 B;  2K1F A;  4BOS C;  4KZC A;  4ZRI A;  3S2A A;  3W1S A;  3KH0 A;  2IY0 B;  3K9P B;  2BYF A;  3DQV A;  1RLF A;  2IYD B;  4LDT D;  2LAS A;  2N1V A;  2J0K A;  1WRD B;  2KFJ A;  5KHO A;  3RUI B;  2KMC A;  4G50 A;  1V9J A;  3C0R B;  1H4R A;  2KK8 A;  3UGB B;  3DPD A;  4TKN A;  3WAP A;  3VDZ A;  2ZJD A;  4DHJ D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...