2L7RA

Solution nmr structure of n-terminal ubiquitin-like domain of fubi, a ribosomal protein s30 precursor from homo sapiens. northeast structural genomics consortium (nesg) target hr6166
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein FUBI
publication title Solution NMR structure of N-terminal Ubiquitin-like domain of FUBI, a ribosomal protein S30 precursor from Homo sapiens. NorthEast Structural Genomics consortium (NESG) target HR6166
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l7rA00
3ML8A 1WRDB 4LDTB 4BBNF 3ZW3A 2L7RA 3QAQA 2HD5B 3DOWA 3ZDMC 4AJWA 1WIAA 4X57B 3PHXB 4FHKA 2O2VA 3JYUA 1CMXB 4WWNA 1V9JA 4K7UA 4NPNA 3S2AA 4ANUA 1V86A 4EFOA 1TZ1A 2IY0B 2J7QB 1GNUA 2DZIA 3O65B 4LDTD 1Q5WB 3WIMA 1WR1A 2KHWB 2CHXA 3Q3JA 4HK2A 5G2NA 2LGYA 4IM2A 4MELA 3QWZB 4HDQA 1XQQA 2GOWA 5IAAC 3RUIB 4MGYE 1WM2A 4MJSB 3IG3A 4MH0E 2KJRA 3QA8A 3KVFB 4FHJA 2ZNVC 4TQ1A 4EZKA 3PRZA 2DZKA 2GBJA 3N32A 3AU5A 4MEMA 3DVGX 3L10B 2BF8B 4BKGA 1I42A 2K39A 1ISNA 1ZKHA 3H9DA 2BWFA 1UD7A 3NZUA 2JUOA 3DBRI 4GMVA 3VUYA 2RSUA 4TV3A 3R7RA 4GN1A 4DHJB 1WXAA 2KZRA 1H4RA 3EHVA 2GBKA 2KNBA 2N9XA 4HPLB 2KDBA 5D94A 3ZRCA 2KANA 2KTRA 4KV2A 2I1JA 1OEYJ 1P9DU 4A3OA 3V61A 3M63B 2WX0A 1WGYA 3UQBA 1I35A 1KJTA 3QARA 1OGWA 2KDEB 4M8MA 2KFJA 2KC2A 5G55A 1UH6A 3TBLD 1E8ZA 1V81A 2BYFA 2XK5A 1F9JA 4ZYNA 1V6EA 2BGFA 3H6NA 5EDSA 2BYEA 3UIPB 4DWFA 1WR6E 3A9JA 4DBGA 1YQBA 2IO1B 5C1ZA 2K8BA 3KYCD 4GDLA 2GBMA 2M17A 2JRHA 5FR6A 4FA6A 4GOCA 5JHBA 4FJVB 3V6EB 3HM3A 1E5WA 2J0KA 4ZRKA 2RR9A 3PREA 2OJRA 3APCA 4HCNB 3JVZX 4KZCA 3UF8A 4TQ0A 3TL5A 4OVUA 4IWQA 2JT4B 4GIVA 2KK8A 3WALA 2MP2B 4EUTA 2KDFB 1ZGUB 2KFKB 4MGZE 2LUEA 1WXVA 2GMIC 2KVRA 4JGHB 5DCNA 3TJPA 3V60A 1Q1OA 1Y8RC 3L16A 2MCNB 3RZWC 4GDKB 2KJHB 1WYWB 3NOBA 2KX0A 3DCGA 3ZTDA 4K81A 2L8JA 3R3MA 1P0RA 5KHQA 2ZJDA 2KKCA 4LCDE 4EZLA 2IZVB 2NR2A 2ZCCA 2HE7A 5CHVC 2LXAA 2MW5A 3ZUNA 4NNJB 4BKSA 3L17A 5JHAA 2IO0B 1WMHB 3MHSD 2ZVNA 3WAMA 2Z59B 2KLGA 4IM3A 4JQWC 4J6IA 2L0FA 1HE8A 1RFAA 1WZ0A 2D10A 2K6DB 4NAWA 2LVQA 1WJ6A 5DPTA 2AYOB 4N9F4 3PZDA 3CSFA 4ICVA 3TMPB 4NJ6A 3VQIA 4ANWA 4GB9A 2MQJA 1WX9A 3A1QB 3HM6X 5LLIA 5CX3A 3A4SC 3DPDA 2MBHA 4KIKA 4G0NB 2FIDA 4W9LA 3VUXA 3U7DA 3AULA 2J0JA 5E6NA 1V80A 4HXDA 5DPRA 2FNJB 3ZNZB 3RZFA 1WE7A 2MBOA 2O6VA 1TGZB 4W9DA 3ECIA 4BBNC 5IA7A 4KDLB 3QX1A 1IP9A 3U30A 2BKFA 1XD3B 1NDDA 4PS3A 1V5TA 2MLBA 2N4FA 1LQBA 4BVUC 1WI0A 1GJZA 1WFYA 1RLFA 1WJNA 2DAJA 2CHWA 2CHZA 3M62B 2MSED 3RT3B 2G3QB 4KSLC 4FADA 5DPWA 5CHWA 2FCNA 1WZ3A 1WX7A 2UWQA 2KLCA 2PEAA 4ZDVA 3GZNI 2R2QA 3OLMD 2KJ6A 3Q3FA 5JZEB 2LI5A 1WY8A 3LJ3A 4HJKA 2RPQA 3JSVB 3U8ZA 2IY1B 4IC7B 3UIOB 3VHTC 1M94A 2KWUB 4AP4C 4GGQA 5AZGA 2V1YA 3D32A 1E8XA 2LRWA 5D6JB 4ZRJA 1SIFA 4EKUA 2FAZA 2C60A 2KTFA 2LXCA 3B0AA 2L3ZA 3PRMB 3HIZA 2C5LC 1PQSA 2N1WA 4W9IA 4GXBA 2ZEQA 4MSQB 3T8MA 3N30A 1GC6A 2DHZA 4LJOB 2C7NB 2OOBB 3APDA 4PS8A 3W1YA 3NY5A 1UBQA 2MA9B 2K25A 4IG7B 4MDKE 5J17A 4A3PA 2LVOA 1E8WA 2I1KA 4TKNA 4M8NA 4XZ4A 1LFDA 2M8SA 4MGIE 3NZSA 3BINA 4BKTA 4JLCA 2KN5A 4M0WB 3QK0A 2FUHB 2RGFA 4II2B 1Z5SB 2CKHB 3IBEA 3R66C 4G3XB 2KMAA 2JRIB 4OVVA 1WXSA 3ZDTA 4ZRIA 2ZVOA 2JZ3B 1Z2MA 2MRPA 2V3SA 3WA0A 1WGRA 2PPHA 3VAWA 3B1LX 4B9KA 1GUAB 3PPAA 2ZNVB 3PRPB 1A5RA 5KHOA 5E6PA 2WYQA 2D07B 4ANVA 1UZXB 2DENB 3K9PB 1GG3A 3PV1A 4HWIB 3A9KB 1IYFA 4DDGD 3B08A 4K7WA 3DBHI 2LVPA 3V6CB 2KD0A 2M1MA 3DDCB 4WJPA 3H7SA 1YX6B 3CF6E 4JL9A 3MTNB 3ONSA 3ZTCA 4NQKE 2D3GA 3WANA 4AUQC 3W1SC 4WJOA 2CU1A 2FCMA 5BO4B 3PT2B 1WJ4A 1YJ1A 1OQYA 1BT0A 2GBRA 4BKSD 1SGHA 3M95A 4NAWB 3ZO5B 4BOZB 4IUMB 2N7DA 3BY4B 1QZEA 2IBIB 4W9HA 4NY0A 4DHZB 1S3SG 3VUWA 1MG8A 1U4AA 2ASQA 3DVNV 3ZNGC 1WGHA 3AI5A 4HVBA 1OEYA 3JW0X 4KIKB 3WAPA 1P1AA 3PGEA 1C1YB 1WM3A 3L0WB 2DYMA 3H7PA 2JY6A 3HHMA 2D2QA 5L83A 3NHEB 3TCAA 3QC8B 2Z0EB 4IWOA 3C0RB 2ZPYA 2O6VB 1KM7A 2A4ZA 1NBFC 1XT9B 3QCAA 4JIOU 1AARA 3VTUA 3QJZA 2JPHA 2K6QA 4K1RB 2XBBC 3ALBA 3ML9A 1UELA 2QHOA 2JXXA 2O6VD 1WH3A 3VFKA 2KFKA 1L2NA 1P3QU 4LJPB 1E7UA 3W1SA 1H8CA 2LGDA 2R2OA 2NBUA 2DAFA 4GDKA 2KQSA 4W9KA 3PSEB 3L08A 1OTRB 1WGDA 2B3AA 4CO7A 2DYOA 1D3ZA 2O2VB 3OAWA 4HCPB 3VH3B 2C7HA 2FIFA 1WMHA 4AWJA 4BFRA 4F7ZA 5E6OA 2ZPNA 1EF5A 2KXJA 4WAAA 5J18A 3EECA 4B6WA 3R7QA 3RULA 1V49A 5JH5C 1X1MA 2EMSA 4RM8A 4II3B 3CMMB 2K8HA 4I6PA 2NVUI 2KOXA 1V2YA 4FJZA 2IO2B 2KDIA 1JRUA 2DX5B 3PS6A 2XEWA 2MX2A 3A1QA 3OJ4B 4ANXA 1LM8B 3K9OB 4CHKA 2N9EB 5D2MB 4HDOA 3RYTA 5CHFA 1UGMA 1TBEA 3VVWB 1EF1A 4RM9A 2CS4A 1E90A 4WQOB 2KWVB 3ZRFA 2WX1A 2HTHA 4W9FA 3UQAA 2KTRB 2PE9A 3KUDB 2NPTA 4DHZE 3RCZA 4BOSC 3T9LA 5D7GA 3UGBB 2REXA 4E71A 3ZKJC 2A5UA 4HPMB 3VH4B 2JWZA 3WAOA 5HKHA 2AL6A 4WWPA 1J8CA 2DZJA 3GOEA 3SDLC 2ZZPB 2ZCBA 2KX3A 1K8RB 2XK5B 3SD5A 4DK5A 5J2RA 3QHTA 4TUUA 2L00B 1E7VA 2LGXA 2WDTB 4WWOA 5GMVA 4PS7A 5CTRC 3A9JB 1VCBA 4EZJA 4NQLB 2KO3A 3RD2A 4ASWC 4GDLB 3HK0A 4MM3A 2NBVB 4WJNA 3I3TB 3N3KB 3JSVA 2KC1A 4W9EA 2NBWB 3V62A 3SHQA 3IFWB 3P2BA 3ENEA 4ICUA 4IM0A 2EKEC 2KQ7A 3M3JA 5AZHA 3TIXA 4P7IA 5C23A 4MJSA 2BWES 3EFUA 1FXTB 1WJUA 2BKRB 3UINB 2G4SA 2L76A 1Q0WB 3KH0A 2KMCA 3AXCA 4G11A 1NI2A 2RD0A 3VXWA 4I6NB 4G50A 4XC2A 2V4LA 3CSTA 3IHPC 3OJ3A 3QQ8B 4DHJD 4FBJB 4IWPA 3KW5B 3LDZE 3SU8X 4KDIC 5LXIB 2G4DB 3ZLZA 2HJ8A 1C3TA 3ZVVA 3DVGY 2L0TA 4YL8A 2M0XA 3H7PB 3ZNHB 1G6JA 1EUVB 3DVNU 4FLHA 3APFA 4MSMB 1VD2A 2FCSA 3PTFC 2UYZB 2Y5BB 2IYDB 2N1VA 1EO6A 4A20A 4FJYA 1RRBA 1WF9A 2YLMA 3KUCB 1R4NI 2AEHA 3PLVA 4GSWA 4PYZA 2N9PC 3EC8A 2GBNA 2FCQA 2VRRB 4W9GA 3VTVA 4DDID 4PYUA 3A9KA 4AOFA 2LWPA 1ZW7A 2G45B 3DBSA 4F8CB 4HLEA 1WGGA 4E3CA 2JF5A 2PE6B 1RAXA 2W9NA 3DBLI 4W9CA 2C7MB 4GU2A 4URKA 2WWZA 2NS5A 2NCNA 4NJ7A 5LXHA 2LZ6A 1IPGA 1WX8A 2EMTA 4FULA 4CYEA 3NS8A 3L13A 1TTNA 2MP2A 3ZIMA 2Z0DB 4KSKC 2J0MA 1T0YA 1E8YA 2DZMA 4FN2A 4E74A 1P98A 5TR5A 2K8CA 1KLVA 4I6LB 3H1UA 2AL3A 2BYVE 1GC7A 3PHWB 3MJWA 3PVLA 1YIWA 2LD9A 3DQVA 2YVCA 1WE6A 4B95A 5DPSA 3L54A 2KWCA 1R4MI 3QIJA 3VTWA 4EOYA 4W9JA 4F1SA 2IO3B 2PJHA 4XX5A 3X23A 1S1QB 2MBBB 2C9WB 2MBEA 1LXDA 4DXAB 1YX5B 2K1FA 1UBIA 3A33B 1KOTA 2M4NA 5AZFA 1SE9A 1V5OA 2N7EA 3AU4A 4IW0A 2DYBA 2AWTA 3PLUA 4KVGB 2JZZA 4KZ0A 3KYDD 3A4RA 3IVFA 1J19A 1L7YA 4EEWA 2D11A 2NPTB 4K7SA 3KUZA 2BPSA 3VDZA 2JVCA 4AJYB 3X0WA 4WJQA 4RMAA 1J0GA 1WXMA 5AEKB 2CR5A 2MBQA 5L95C 3ZNID 1YD8U 2LRUA 2LASA 2MWSB 2LJ5A 4MGKE 2L05A
chains in the Genus database with same CATH superfamily
4YTNB 3W5UB 2L7RA 2KYWA 2HD5B 3DOWA 4S17A 1DOIA 1SF0A 2DBYA 3WIMA 1YQ4B 2EKIA 2KHWB 5G2NA 4HDQA 3BK2A 5C3JB 2D3CA 1WM2A 4MH0E 4WIPA 4FHJA 1LO5D 2ZNVC 4TQ1A 3DBRB 4LTUA 1FD6A 1FM0D 1I42A 3H9DA 3P63A 2JUOA 1JW9D 1HZ6A 2RSUA 4MT5A 2V0GA 1ZXIA 2GBKA 2KNBA 4HPLB 5D94A 4FXCA 1XLOA 1ZP0B 2R61A 1I4HA 1WGYA 3P4PB 1OQRA 3PZ8A 3QARA 2KFJA 4JWSC 1ZDXA 4ZRQA 2XK5A 3N1ZC 3UIPB 1WR6E 1Y56A 4DBGA 3L4PA 4OVZA 2GBMA 4FA6A 3V6EB 2RR9A 4KZCA 2OJRA 3Q3NC 1CK1A 4A55A 1XCQL 1TYGB 2KFKB 1NVID 1Y8RC 4GDKB 2PW9A 3DCGA 2BQQA 1P0RA 3Q2AC 2KKCA 3AEAB 4LCDE 2NR2A 2ZCCA 4BKSA 2LXAA 2MW5A 3Q8EA 1MI0A 4IM3A 4J6IA 2L0FA 4RF0A 4DXGA 5DPTA 2KMMA 2D3BA 4C00A 3CSFA 2W3RA 3NVZA 2MQJA 3A1QB 3A4SC 5D3DA 2DWQA 2J0JA 4J3OD 5E6NA 3IT6B 4HXDA 3RZFA 2MBOA 1JQ4A 4P16A 3QX1A 1L4ZB 1NDDA 3MHZA 4ZHOA 1GJZA 1WFYA 1RLFA 2CHZA 3H8HA 4NZLB 2UWQA 4IDIA 2PEAA 2KJ6A 2K22A 2WQYB 3GE3C 3U2SC 2WXNA 4KGTA 4AP4C 2KTFA 2C60A 2LXCA 3B0AA 1SE2A 2L3ZA 4M01A 2C5LC 1PQSA 4W9IA 1TY2A 4GXBA 2ZEQA 3T8MA 3B9JA 2OOBB 4PS8A 1PGBA 4P1BC 4MDKE 3PO0A 2I1KA 4TKNA 4M8NA 1LFDA 2M8SA 2JSVX 2KN5A 1Z5SB 3R66C 4OVVA 5IKCM 2ZVOA 4K3CA 1GAQB 2PPHA 3AE7B 3B1LX 4B9KA 1A5RA 2WYQA 1FEHA 1UZXB 2DENB 1GG3A 3PV1A 4YTMB 3V3XA 2LVPA 2LEKA 3MTNB 3ONSA 3WANA 2V3PA 1XO3A 2CU1A 3W5VB 3VRAB 3PT2B 1YJ1A 4BKSD 3BZDB 3GB1A 1I4RA 2K5PA 2QMTA 2KN4A 1KRHA 4W9HA 3AEDB 3DVNV 4LK0M 1WGHA 2WXFA 1NENB 2SAKA 3JW0X 4KIKB 3HVDA 2WP9B 3H7PA 3HHMA 3NHEB 3TCAA 2AQ2B 2Z0EB 1XCTL 4XGAB 4ARCA 3C0RB 2O6VB 2INCC 1KM7A 4JIOU 2Y5PA 3QJZA 1JALA 5HHDG 2QHOA 5BMGA 2KFKA 1L2NA 1P3QU 2H88B 2KVZA 4GDKA 2KQSA 3PSEB 1R4MB 1MG4A 2DYOA 1D3ZA 3R2IA 3OAWA 1YOVB 3VH3B 2C7HA 2FIFA 1QILA 2W3SA 4AQ7A 2ZPNA 1EF5A 1JCKB 3RMKC 1L0YB 2ACZB 3R7QA 1X1MA 3NVWA 2K8HA 2VZKB 2KOXA 3TSSA 4US8A 2DX5B 4KGSA 3A1QA 4ANXA 2IPKD 4CHKA 1MVKA 4HDOA 4YWGG 1EF1A 4RM9A 4WQOB 2KWVB 3ZRFA 4C4VB 4W9FA 2J53A 2KTRB 2WHIA 2NPTA 4DHZE 3Q14C 1RYJA 2ZW0A 4E71A 3AB5A 1D5MC 2AL6A 2W55A 1QOBA 4A6QA 1J8CA 1TS4A 1N63A 2ZCBA 3C19A 5GMVA 4EZJA 2KO3A 2N7JA 1WXQA 2NBVB 4WJNA 3N3KB 4W9EA 4IM0A 1C76A 2PIAA 2EKEC 3M3JA 5FKAC 1XXGA 1QOFA 3HVZA 3ZYYX 1WJUA 3AXCA 3N1XC 3Q8BA 1NEKB 1OFFA 3VXWA 1QLBB 2V4LA 4PT5A 3KW5B 2WNMA 3SU8X 2HJ8A 1C3TA 1KLGD 4YL8A 1TS3A 3DHGC 4P6VF 1G6JA 3Q3MC 1VD2A 2JXTA 1ZXHA 2N1VA 1J7CA 2L1AA 1EO6A 3J9CA 4A20A 1VLBA 2J42A 1RRBA 5IOIA 3KUCB 3P4RB 2RMMA 2YEPB 1ET6A 2M56B 2VRRB 3VTVA 2KAJA 1VDVA 2YEPF 4HLEA 1QT9A 1WGGA 4XDCA 4E3CA 2JF5A 2W9NA 1RAXA 3DBLI 4HROA 2C7MB 1D5ZC 1XLQA 4NJ7A 1T0SC 1IPGA 4TMAB 2EMTA 4FULA 2KACA 3L13A 1TTNA 2B76B 2MP2A 2Z0DB 1HTQA 2K8CA 1N62A 1SBBB 2WXHA 1N6ZA 2E6XA 4OZBA 3MJWA 2V3NA 2YVCA 4B95A 5G5GA 3VTWA 4RF1A 1S1QB 1TY0A 2MBBB 3IXSA 2K1FA 1KOTA 3NUHB 4OZAA 4WQMA 5AZFA 3MFGA 2N7EA 2AWTA 1T0RC 2JZZA 3Q3OC 2HDEA 1J19A 1L0VB 4K7SA 2WGSA 3I57A 1HXYD 4YSYB 5MPOA 3X0WA 1ZDVA 1E10A 1J0GA 2CR5A 1YD8U 2LASA 3P4QB 3ML8A 4LDTB 3ZW3A 3QAQA 3ZDMC 1M4VA 4K3BA 4X57B 1LGRA 3JYUA 2XNAC 1CMXB 1ROEA 4K7UA 1PFDA 1TZ1A 2IY0B 2J7QB 2DZIA 3N20C 3Q3JA 3TEYA 2LGYA 1Q10A 3QWZB 5IAAC 4MGYE 4LNIA 4MJSB 4EZKA 2DZKA 2GBJA 5HFYA 4WWMA 2BVCA 4BKGA 2RPVA 1ISNA 1ZKHA 3LYYA 5E6JA 4GN1A 3R7RA 1WXAA 1QOGA 1T0QC 3DHIC 2N9XA 3ZRCA 4A8XC 2J4XA 2KANA 2KTRA 2I1JA 2WX0A 1I35A 1KJTA 1OGWA 2KDEB 4M8MA 2KC2A 2LFIA 1V81A 2X38A 4ZYNA 1V6EA 2WDRB 3H6NA 3LXFA 1AW7A 2M17A 5FR6A 1XF5L 4FJVB 3HM3A 1E5WA 3APCA 4HCNB 2MJ3A 3TL5A 3WALA 4IWQA 2JT4B 4EUTA 1QOAA 2KDFB 1WXVA 1Q1OA 4LNNA 2KJHB 4N6EB 3SFDB 2LJIA 2KX0A 1QKZA 3ZTDA 2L8JA 3RN9C 2Q5WD 1J7AA 5CHVC 1TKYA 3BYYB 3ZUNA 3L17A 3MHSD 2PKOA 3WAMA 4YSZB 4JQWC 2D10A 1D4BA 1F2RC 4ICVA 3TMPB 3GP7A 2JX5A 4NJ6A 3N1YC 3CWIA 5CX3A 3AECB 2WXRA 1V80A 4HEA1 4P1CC 3ECIA 1EU4A 4KDLB 1F0ZA 2L52A 1IP9A 3U30A 4PS3A 1XD3B 3NG0A 1LQBA 4BVUC 1WI0A 3BK1A 1N60A 4L23A 1N5XA 2DAJA 1TJEA 1WZ3A 1K53A 2N9KA 5JZEB 3LJ3A 2IGDA 2NMQA 2RPQA 1PDXA 2IY1B 4CQNA 5G5HA 2LGSA 2V1YA 5D6JB 1E8XA 2LRWA 4YT0B 2FAZA 4M02A 1B9RA 2N1WA 2NTSA 1GC6A 2DHZA 3APDA 3W1YA 1ZPSA 3RNBC 3I5JC 2K25A 1EWCA 3CIRB 2LVOA 1E8WA 1MPEA 4XZ4A 3AV8A 1ENFA 3NZSA 2M19A 1YN3A 4JX1C 2BT6A 4O1NA 2LUMA 1OQQA 3RNGC 4ZRIA 2JZ3B 1SEBD 2MRPA 3WA0A 3RFZB 1DYQA 2WXIA 3PPAA 5KHOA 5E6PA 2D07B 2BS3B 3B08A 3V6CB 4WJPA 1YX6B 3CF6E 4JL9A 3ZTCA 4NQKE 2D3GA 3HUIA 4WJOA 2BYTA 5BO4B 1F52A 1WJ4A 2INDC 3W2DA 4B0MA 2WXMA 2KDMA 1FPYA 3M95A 4NAWB 1CZPA 3BY4B 3ZQ4A 1S3SG 3NVVA 1N61A 2ASQA 1BXTA 2N9LA 3EFCA 4WURA 3AI5A 1P1AA 3PGEA 3L0WB 2DYMA 3IAM1 1F77A 5L83A 4RGOS 2D5GA 4IWOA 4C7YA 4C56C 1NBFC 1AARA 5BYRA 4B0EA 2JPHA 2K6QA 3ML9A 3VFKA 2JXXA 1WH3A 2G9HD 1E7UA 2DAFA 3Q69A 1OTRB 1V1PB 2VH1A 5C2TB 4CO7A 1SXTA 1KH0A 4BFRA 4WH4A 5E6OA 3RI7C 4WAAA 1XEEA 2EMSA 4RM8A 1C77A 2QJLA 3T3NA 2KDIA 3PS6A 1K51A 3ZJTA 2QCZA 2N9EB 1I4QA 2L32A 2Z8LA 3VVWB 1P7EA 4KGRA 1E90A 1RFKA 3KUDB 5EE0A 1C4CA 2WXQA 3RCZA 4BOSC 3T9LA 5IN7A 3UGBB 3ZKJC 1YMHE 3VH4B 4HPMB 3U7ZA 4YSXB 2I2YA 2KWDA 3SDLC 1CJEA 2PLPA 3EA6A 4TUUA 2L00B 4WWOA 3A9JB 1VCBA 1JWSD 3HK0A 4JE3B 1JRPA 2PVGC 2NBWB 3P42A 3V62A 5BMHA 3SHQA 4ICUA 2KQ7A 2HJ1A 3TEWA 3TIXA 4N58A 2BWES 4XE0A 3UINB 2G4SA 2L76A 2LHDA 5LNK1 4C7ZA 3FILB 4XC2A 3OJ3A 4IWPA 5LXIB 2G4DB 3ZLZA 2I38A 2Y3AA 1EUVB 4FLHA 3APFA 1R4NB 2BS4B 2UYZB 1T6BX 1WF9A 2DNFA 3SR6A 1FNUA 4GSWA 4KKJA 4US9A 2GBNA 2FCQA 1SSNA 3T3OA 4AOFA 2LWPA 1ZW7A 2AX5A 2G45B 1WYGA 2PE6B 4W9CA 2OHFA 2WWZA 2HTME 5LXHA 1WX8A 3O13A 3NS8A 4HPPA 2J0MA 1E8YA 2DZMA 1N5WA 3H1UA 1GB4A 3IAS1 2BYVE 3PHWB 4DQOC 5T8IA 1AYFA 1ESFA 3PVLA 1YIWA 3BVGA 2V9HA 3DQVA 3AE3B 3L54A 2KWCA 3QIJA 4W9JA 4XX5A 3X23A 2C9WB 1LXDA 1YX5B 3A33B 1VR9A 1MFWA 2MEKA 3KWLA 3AU4A 2AQ1B 4KZ0A 3KYDD 3A4RA 4EEWA 2D11A 4H2AA 3VDZA 2LHEA 1F1HA 2OJWA 1WXMA 5AEKB 3RNAC 2IGHA 1GPXA 2K9XA 4FBJB 2L05A 4BBNF 1V1PA 2QC8A 2ICIA 3PHXB 1VJKA 4WWNA 4GLSC 1V9JA 4NPNA 5TSSA 3O65B 4S0RA 1Q5WB 1WR1A 2CHXA 2J52A 4HK2A 3VR9B 3RUIB 1YNTE 3BVMA 2CJOA 1XLNA 3IG3A 5FK9C 3KVFB 3PRZA 3N32A 3AU5A 3L10B 2BF8B 3RNEC 2K39A 3NZUA 1UD7A 3DBRI 3VUYA 4TV3A 2TSSA 4DHJB 2FBWB 1H4RA 3EHVA 2KDBA 5GXGB 4KV2A 4A3OA 1OEYJ 3M63B 1VZ6A 1YN5A 3UQBA 1A70A 5G55A 1EM7A 1UH6A 3AE8B 1C9FA 4C80A 5EDSA 2BYEA 3AEFB 4DWFA 3A9JA 2IO1B 5C1ZA 2K8BA 2JRHA 4JPSA 4TQ0A 2KK8A 1AWDA 3MJ5A 4MGZE 2LUEA 2GMIC 4JGHB 2KVRA 3TJPA 3V60A 2QSDA 4BAXA 2MCNB 3RZWC 3L16A 1KTKA 1T5XD 4K81A 3R3MA 5KHQA 1VZ8A 2IZVB 2IO0B 1WMHB 1KLUD 2Z59B 1HE8A 4XWWA 1WZ0A 1P7FA 2K6DB 1WJ6A 4N9F4 3VQIA 3MC9A 3HM6X 5LLIA 2WXOA 1HEZE 1FIQA 2JU6X 2MBHA 4KIKA 4G0NB 4OHJA 3VRBB 2FIDA 4YXDB 4W9LA 3U7DA 3AULA 1KF6B 3FAHA 2FNJB 3ZNZB 3AN1A 1WE7A 2K0PA 2O6VA 3ZXVA 4BBNC 4W9DA 5IA7A 1CQVA 2QEJC 1WJNA 2CHWA 3AE1B 2G3QB 3LB8C 4KSLC 4FADA 5DPWA 2FCNA 1VZ7A 1WX7A 1ZOYB 2EELA 3ZJVA 3OLMD 2R2QA 4ZYSA 3U52E 4HJKA 3EUB2 5BYQA 3U8ZA 4MACA 4IC7B 3OG5A 1IUEA 2MJDA 2INPE 4GGQA 4NAMA 3PRMB 2AQ3B 4MSQB 1C79A 3NY5A 1UBQA 2MA9B 4RCOA 5J17A 4A3PA 1FXIA 4C4VA 5FR3A 4MGIE 4TSSA 3BINA 5D3IB 4JLCA 2KQ4X 4M0WB 3QK0A 4HJGE 5D7GA 2CKHB 3IBEA 4G3XB 1QQRA 4XDDA 2V3SA 1WGRA 1L5PA 3SFEB 2ZNVB 4OZCA 3TEXA 3K9PB 4HWIB 3A9KB 4DDGD 3AM9A 1C4PA 4K7WA 3DBHI 1L6VA 3H7SA 2N0SB 4BZAA 4AUQC 3FKYA 1JWUD 1OQYA 1BT0A 2GBRA 3ZO5B 2BB6A 4BOZB 4IUMB 2N7DA 1QZEA 3VUWA 4XWTA 4KX6B 3ZNGC 3Q8CA 1IGDA 2W82A 1C1YB 1UNSA 2JY6A 1V1OA 2D2QA 2ZPYA 4AS1A 1ZUD2 1PGAA 2XBBC 5IO9A 1UWMA 2O6VD 1I4PA 2RDGA 1H8CA 2LGDA 2R2OA 2NBUA 3P1MA 2JQRB 4W9KA 3L08A 2RDBC 2QDFA 2B3AA 1SB3C 3TEZA 1SJED 2H89B 2O2VB 1FXAA 4HCPB 4AWJA 1WMHA 4F7ZA 2D3AA 5J18A 3EECA 4JWUC 4B6WA 3RULA 1V49A 5JH5C 2JYEA 1K52A 2WDVB 3MC8A 1FRRA 2DLBA 4FJZA 2WDQB 2IO2B 2GB1A 2KT7A 2CJNA 3OJ4B 1LM8B 2VZKD 3RYTA 1UGMA 1JWBD 3DWGC 2WX1A 3UQAA 1WSPA 2PVOD 2PE9A 3W9CB 3BWUD 1C4AA 1SIJA 5HKHA 2JWZA 3GOEA 3Q8AA 3ZXRA 2ZZPB 1TKGA 2GI9A 3SD5A 5J2RA 2WDTB 4ARIA 5CTRC 1HTOA 1UWXA 4NQLB 4ASWC 1TT5B 4GDLB 5BMIA 3I3TB 2WXJA 1UUPA 1D5XC 1J7BA 2KC1A 3IFWB 3ENEA 2BTEA 2V4IB 5AZHA 3I63C 5EE9A 4ITKA 4MJSA 5C23A 2VH2A 3KWVA 1IGCA 4G11A 1FNWA 1NI2A 4N59A 2RD0A 4I6NB 4DHJD 3LDZE 4KDIC 1BMLC 3ZVVA 4ZOHC 2L0TA 3H7PB 2OEDA 3ZNHB 3DVNU 3B2FA 4MSMB 3KLSX 2Y5BB 1UGJA 4M0WA 2IYDB 1DOXA 2MJEA 2L83A 3Q6BA 2AEHA 2WLBA 3FC4A 4PYZA 2N9PC 3DBLB 2RDHA 4OW0A 3EC8A 1FO4A 3DHHC 2IJ0A 1PYWD 3A9KA 3DBSA 1I7HA 2BBCA 4GU2A 4RGNA 4URKA 3UI3A 2NS5A 3NS1A 3R8BA 1FRDA 4CYEA 3NVYA 1ACCA 4USAA 3AE4B 3ZIMA 1IBXB 4KSKC 3E9SA 1T0YA 2FUG1 1P98A 5TR5A 4E74A 1KLVA 4I6LB 2AL3A 1T3QA 1E0ZA 1GC7A 1TIFA 2LD9A 3B2GA 4F1SA 4DXAB 1TS2A 1UBIA 4LNFA 1F2RI 2M4NA 4R3DA 4IW0A 1V5OA 3DWMA 3IVFA 2NPTB 3KUZA 2BPSA 5AUIA 4AJYB 4L1BA 4RMAA 5L95C 2MWSB 2LJ5A 4MGKE 1WRDB 1DOYA 4AJWA 3URYA 1WIAA 1L4DB 5IP4D 4FHKA 2O2VA 3S2AA 1AN8A 4EFOA 3BYTB 5HI1A 1V86A 4ANUA 2GRIA 1GNUA 4LDTD 2LGIA 1TKEA 4IM2A 4MELA 1FNVA 1XQQA 2GOWA 4M00A 3TUOA 4A9AA 2KJRA 3QA8A 5AUKA 3NZ3A 1WWTA 4WAFA 4MEMA 5EE1A 3DVGX 4MH8A 1DGJA 2BWFA 3AE5B 4GMVA 2IDYA 2KZRA 1HQRD 3KQ4A 4A90A 1P9DU 3V61A 3DBHB 3TBLD 2WXKA 1E8ZA 2BYFA 3AE6B 1F9JA 3EGRA 2BGFA 2MH7A 1YQBA 2JWUA 3KYCD 4GDLA 1VRAB 4IKGA 1ZE3D 4PK1A 4GOCA 5JHBA 2J0KA 3BIID 4ZRKA 3PREA 3JVZX 3UF8A 4OVUA 4GIVA 1C78A 2MP2B 2WXGA 1ZGUB 1JROA 1MJDA 5DCNA 1TZOA 1WYWB 3NOBA 1I4GA 4RGMA 2WXPA 3MC0B 1FMAD 2ZJDA 4EZLA 3VR8B 2HE7A 1E7PB 4NNJB 5JHAA 1L6UA 2ZVNA 1KFYB 1E6EB 2KLGA 1JWAD 1RFAA 5JXVA 4NAWA 2LVQA 2AYOB 4UDUC 1MHHE 3PZDA 4ANWA 4GB9A 4XYCA 1WX9A 3I9V1 1YN4A 3DPDA 3VUXA 1YJIA 5DPRA 1XLPA 4IOIE 1TGZB 1D6EC 4ZHPA 4RH6A 2BKFA 1V5TA 2MLBA 2N4FA 2W54A 1IBXA 1K50A 3AEGB 3M62B 2MSED 3RT3B 4Q2JA 1RWSA 3AE2B 5CHWA 1E9MA 1NI3A 3ZJUA 2KLCA 4ZDVA 3GZNI 2QIEB 3Q3FA 4MM3B 2LI5A 1MHXA 1WY8A 3JSVB 3UIOB 3VHTC 1M94A 2KWUB 5AZGA 3D32A 4LNOA 4ZRJA 4EKUA 1SIFA 4L2YA 5H8YE 3HIZA 1EU3A 2INNE 2LMCA 5I4DA 3BVZA 3N30A 3N9YC 4LJOB 2C7NB 2MHJA 3Q8FA 4HRSA 4IG7B 3ZGZA 4BKTA 2ZW1A 1RM6C 4II2B 2FUHB 2RGFA 4ACFA 1FFVA 3HRDD 2KMAA 2JRIB 1WXSA 3ZDTA 1Z2MA 3VAWA 1GUAB 3AEEB 3NRZA 1TS5A 3PRPB 3R2TA 3P4SB 4ANVA 1IYFA 3U4EG 2KD0A 2M1MA 3DDCB 2WXLA 2WU2B 2PTLA 3W1SC 2FCMA 3GS2A 2ONQA 4NJCA 2IGGA 1SGHA 1NYQA 1YJJA 3FILA 2IBIB 1I4XA 4NY0A 4DHZB 1MG8A 1U4AA 4HVBA 1V97A 1OEYA 3WAPA 1WM3A 3QC8B 1YQ3B 5H92C 2BS2B 2A4ZA 1XT9B 1PGXA 3QCAA 2Y5CA 1FFUA 3RNFC 3VTUA 4K1RB 3ALBA 1UELA 1B1ZA 1WGKA 4LJPB 3W1SA 1UF0A 2JYTA 1JMLA 1WGDA 3PZ7A 1NYRA 3AE9B 2K3UA 2QILA 4ZRPA 2KXJA 3IT4B 4LNKA 3MP9A 4II3B 3CMMB 4I6PA 2NVUI 1V2YA 1JRUA 2XEWA 2MX2A 3K9OB 5D2MB 5CHFA 3RNCC 1TBEA 2CS4A 3WCQA 2HTHA 1STEA 2XN9C 1EWYC 1V8CA 3V05A 4LLGM 2CU3A 5BYSA 2REXA 2A5UA 3WAOA 4WWPA 2DZJA 1WRIA 2KX3A 1K8RB 1QF6A 2XK5B 3AH7A 1FCCC 4DK5A 1SE4A 3QHTA 1FCLA 1JWMD 2LGXA 1E7VA 2X8XX 4PS7A 3E56A 3RD2A 4MM3A 4D2KA 3JSVA 4RGTA 3P2BA 3ETRA 2BW2A 2E3TA 4P7IA 1HZ5A 2ON8A 3RPFC 3EFUA 1FXTB 1HA5A 2BKRB 2FE8A 4QAYA 2SEBD 1Q0WB 3KH0A 2KMCA 3OWEB 4G50A 3IHPC 3CSTA 3QQ8B 1GB1A 2G1EA 2WU5B 3DVGY 2M0XA 4YTPB 1BUIC 2FCSA 2BB5A 3PTFC 1ET9A 4FJYA 1SJHD 2JZPA 2PMVA 2WS3B 2YLMA 2GLSA 1PUTA 3AEBB 1R4NI 3PLVA 4DXFA 4W9GA 4EE2A 4DDID 4PYUA 4REZA 3AMZA 4F8CB 5EE3A 2NCNA 2LZ6A 3C8YA 4HKQA 2M0AA 1R7SA 4FN2A 3ABVB 5HG2A 1GOZA 4RNAA 3SEBA 3NJTA 1WE6A 5DPSA 4EOYA 1R4MI 2IO3B 2PJHA 1L0XB 4HKZE 2MBEA 1SE3A 1SE9A 4KVGB 4KKIA 2DYBA 2NTTA 3GE8C 3PLUA 1L7YA 2JVCA 2UU7A 4RFBA 4WJQA 2MBQA 3ZNID 2LRUA 3GZNB
chains in the Genus database with same CATH topology
3ML8A 1WRDB 4LDTB 4BBNF 3ZW3A 2L7RA 3QAQA 2HD5B 3DOWA 3ZDMC 4AJWA 1WIAA 4X57B 3PHXB 4FHKA 2O2VA 3JYUA 1CMXB 4WWNA 1V9JA 4K7UA 4NPNA 3S2AA 4ANUA 1V86A 4EFOA 1TZ1A 2IY0B 2J7QB 1GNUA 2DZIA 3O65B 4LDTD 1Q5WB 3WIMA 1WR1A 2KHWB 2CHXA 3Q3JA 4HK2A 5G2NA 2LGYA 4IM2A 4MELA 3QWZB 4HDQA 1XQQA 2GOWA 5IAAC 3RUIB 4MGYE 1WM2A 4MJSB 3IG3A 4MH0E 2KJRA 3QA8A 3KVFB 4FHJA 2ZNVC 4TQ1A 4EZKA 3PRZA 2DZKA 2GBJA 3N32A 3AU5A 4MEMA 3DVGX 3L10B 2BF8B 4BKGA 1I42A 2K39A 1ISNA 1ZKHA 3H9DA 2BWFA 1UD7A 3NZUA 2JUOA 3DBRI 4GMVA 3VUYA 2RSUA 4TV3A 3R7RA 4GN1A 4DHJB 1WXAA 2KZRA 1H4RA 3EHVA 2GBKA 2KNBA 2N9XA 4HPLB 2KDBA 5D94A 3ZRCA 2KANA 2KTRA 4KV2A 2I1JA 1OEYJ 1P9DU 4A3OA 3V61A 3M63B 2WX0A 1WGYA 3UQBA 1I35A 1KJTA 3QARA 1OGWA 2KDEB 4M8MA 2KFJA 2KC2A 5G55A 1UH6A 3TBLD 1E8ZA 1V81A 2BYFA 2XK5A 1F9JA 4ZYNA 1V6EA 2BGFA 3H6NA 5EDSA 2BYEA 3UIPB 4DWFA 1WR6E 3A9JA 4DBGA 1YQBA 2IO1B 5C1ZA 2K8BA 3KYCD 4GDLA 2GBMA 2M17A 2JRHA 5FR6A 4FA6A 4GOCA 5JHBA 4FJVB 3V6EB 3HM3A 1E5WA 2J0KA 4ZRKA 2RR9A 3PREA 2OJRA 3APCA 4HCNB 3JVZX 4KZCA 3UF8A 4TQ0A 3TL5A 4OVUA 4IWQA 2JT4B 4GIVA 2KK8A 3WALA 2MP2B 4EUTA 2KDFB 1ZGUB 2KFKB 4MGZE 2LUEA 1WXVA 2GMIC 2KVRA 4JGHB 5DCNA 3TJPA 3V60A 1Q1OA 1Y8RC 3L16A 2MCNB 3RZWC 4GDKB 2KJHB 1WYWB 3NOBA 2KX0A 3DCGA 3ZTDA 4K81A 2L8JA 3R3MA 1P0RA 5KHQA 2ZJDA 2KKCA 4LCDE 4EZLA 2IZVB 2NR2A 2ZCCA 2HE7A 5CHVC 2LXAA 2MW5A 3ZUNA 4NNJB 4BKSA 3L17A 5JHAA 2IO0B 1WMHB 3MHSD 2ZVNA 3WAMA 2Z59B 2KLGA 4IM3A 4JQWC 4J6IA 2L0FA 1HE8A 1RFAA 1WZ0A 2D10A 2K6DB 4NAWA 2LVQA 1WJ6A 5DPTA 2AYOB 4N9F4 3PZDA 3CSFA 4ICVA 3TMPB 4NJ6A 3VQIA 4ANWA 4GB9A 2MQJA 1WX9A 3A1QB 3HM6X 5LLIA 5CX3A 3A4SC 3DPDA 2MBHA 4KIKA 4G0NB 2FIDA 4W9LA 3VUXA 3U7DA 3AULA 2J0JA 5E6NA 1V80A 4HXDA 5DPRA 2FNJB 3ZNZB 3RZFA 1WE7A 2MBOA 2O6VA 1TGZB 4W9DA 3ECIA 4BBNC 5IA7A 4KDLB 3QX1A 1IP9A 3U30A 2BKFA 1XD3B 1NDDA 4PS3A 1V5TA 2MLBA 2N4FA 1LQBA 4BVUC 1WI0A 1GJZA 1WFYA 1RLFA 1WJNA 2DAJA 2CHWA 2CHZA 3M62B 2MSED 3RT3B 2G3QB 4KSLC 4FADA 5DPWA 5CHWA 2FCNA 1WZ3A 1WX7A 2UWQA 2KLCA 2PEAA 4ZDVA 3GZNI 2R2QA 3OLMD 2KJ6A 3Q3FA 5JZEB 2LI5A 1WY8A 3LJ3A 4HJKA 2RPQA 3JSVB 3U8ZA 2IY1B 4IC7B 3UIOB 3VHTC 1M94A 2KWUB 4AP4C 4GGQA 5AZGA 2V1YA 3D32A 1E8XA 2LRWA 5D6JB 4ZRJA 1SIFA 4EKUA 2FAZA 2C60A 2KTFA 2LXCA 3B0AA 2L3ZA 3PRMB 3HIZA 2C5LC 1PQSA 2N1WA 4W9IA 4GXBA 2ZEQA 4MSQB 3T8MA 3N30A 1GC6A 2DHZA 4LJOB 2C7NB 2OOBB 3APDA 4PS8A 3W1YA 3NY5A 1UBQA 2MA9B 2K25A 4IG7B 4MDKE 5J17A 4A3PA 2LVOA 1E8WA 2I1KA 4TKNA 4M8NA 4XZ4A 1LFDA 2M8SA 4MGIE 3NZSA 3BINA 4BKTA 4JLCA 2KN5A 4M0WB 3QK0A 2FUHB 2RGFA 4II2B 1Z5SB 2CKHB 3IBEA 3R66C 4G3XB 2KMAA 2JRIB 4OVVA 1WXSA 3ZDTA 4ZRIA 2ZVOA 2JZ3B 1Z2MA 2MRPA 2V3SA 3WA0A 1WGRA 2PPHA 3VAWA 3B1LX 4B9KA 1GUAB 3PPAA 2ZNVB 3PRPB 1A5RA 5KHOA 5E6PA 2WYQA 2D07B 4ANVA 1UZXB 2DENB 3K9PB 1GG3A 3PV1A 4HWIB 3A9KB 1IYFA 4DDGD 3B08A 4K7WA 3DBHI 2LVPA 3V6CB 2KD0A 2M1MA 3DDCB 4WJPA 3H7SA 1YX6B 3CF6E 4JL9A 3MTNB 3ONSA 3ZTCA 4NQKE 2D3GA 3WANA 4AUQC 3W1SC 4WJOA 2CU1A 2FCMA 5BO4B 3PT2B 1WJ4A 1YJ1A 1OQYA 1BT0A 2GBRA 4BKSD 1SGHA 3M95A 4NAWB 3ZO5B 4BOZB 4IUMB 2N7DA 3BY4B 1QZEA 2IBIB 4W9HA 4NY0A 4DHZB 1S3SG 3VUWA 1MG8A 1U4AA 2ASQA 3DVNV 3ZNGC 1WGHA 3AI5A 4HVBA 1OEYA 3JW0X 4KIKB 3WAPA 1P1AA 3PGEA 1C1YB 1WM3A 3L0WB 2DYMA 3H7PA 2JY6A 3HHMA 2D2QA 5L83A 3NHEB 3TCAA 3QC8B 2Z0EB 4IWOA 3C0RB 2ZPYA 2O6VB 1KM7A 2A4ZA 1NBFC 1XT9B 3QCAA 4JIOU 1AARA 3VTUA 3QJZA 2JPHA 2K6QA 4K1RB 2XBBC 3ALBA 3ML9A 1UELA 2QHOA 2JXXA 2O6VD 1WH3A 3VFKA 2KFKA 1L2NA 1P3QU 4LJPB 1E7UA 3W1SA 1H8CA 2LGDA 2R2OA 2NBUA 2DAFA 4GDKA 2KQSA 4W9KA 3PSEB 3L08A 1OTRB 1WGDA 2B3AA 4CO7A 2DYOA 1D3ZA 2O2VB 3OAWA 4HCPB 3VH3B 2C7HA 2FIFA 1WMHA 4AWJA 4BFRA 4F7ZA 5E6OA 2ZPNA 1EF5A 2KXJA 4WAAA 5J18A 3EECA 4B6WA 3R7QA 3RULA 1V49A 5JH5C 1X1MA 2EMSA 4RM8A 4II3B 3CMMB 2K8HA 4I6PA 2NVUI 2KOXA 1V2YA 4FJZA 2IO2B 2KDIA 1JRUA 2DX5B 3PS6A 2XEWA 2MX2A 3A1QA 3OJ4B 4ANXA 1LM8B 3K9OB 4CHKA 2N9EB 5D2MB 4HDOA 3RYTA 5CHFA 1UGMA 1TBEA 3VVWB 1EF1A 4RM9A 2CS4A 1E90A 4WQOB 2KWVB 3ZRFA 2WX1A 2HTHA 4W9FA 3UQAA 2KTRB 2PE9A 3KUDB 2NPTA 4DHZE 3RCZA 4BOSC 3T9LA 5D7GA 3UGBB 2REXA 4E71A 3ZKJC 2A5UA 4HPMB 3VH4B 2JWZA 3WAOA 5HKHA 2AL6A 4WWPA 1J8CA 2DZJA 3GOEA 3SDLC 2ZZPB 2ZCBA 2KX3A 1K8RB 2XK5B 3SD5A 4DK5A 5J2RA 3QHTA 4TUUA 2L00B 1E7VA 2LGXA 2WDTB 4WWOA 5GMVA 4PS7A 5CTRC 3A9JB 1VCBA 4EZJA 4NQLB 2KO3A 3RD2A 4ASWC 4GDLB 3HK0A 4MM3A 2NBVB 4WJNA 3I3TB 3N3KB 3JSVA 2KC1A 4W9EA 2NBWB 3V62A 3SHQA 3IFWB 3P2BA 3ENEA 4ICUA 4IM0A 2EKEC 2KQ7A 3M3JA 5AZHA 3TIXA 4P7IA 5C23A 4MJSA 2BWES 3EFUA 1FXTB 1WJUA 2BKRB 3UINB 2G4SA 2L76A 1Q0WB 3KH0A 2KMCA 3AXCA 4G11A 1NI2A 2RD0A 3VXWA 4I6NB 4G50A 4XC2A 2V4LA 3CSTA 3IHPC 3OJ3A 3QQ8B 4DHJD 4FBJB 4IWPA 3KW5B 3LDZE 3SU8X 4KDIC 5LXIB 2G4DB 3ZLZA 2HJ8A 1C3TA 3ZVVA 3DVGY 2L0TA 4YL8A 2M0XA 3H7PB 3ZNHB 1G6JA 1EUVB 3DVNU 4FLHA 3APFA 4MSMB 1VD2A 2FCSA 3PTFC 2UYZB 2Y5BB 2IYDB 2N1VA 1EO6A 4A20A 4FJYA 1RRBA 1WF9A 2YLMA 3KUCB 1R4NI 2AEHA 3PLVA 4GSWA 4PYZA 2N9PC 3EC8A 2GBNA 2FCQA 2VRRB 4W9GA 3VTVA 4DDID 4PYUA 3A9KA 4AOFA 2LWPA 1ZW7A 2G45B 3DBSA 4F8CB 4HLEA 1WGGA 4E3CA 2JF5A 2PE6B 1RAXA 2W9NA 3DBLI 4W9CA 2C7MB 4GU2A 4URKA 2WWZA 2NS5A 2NCNA 4NJ7A 5LXHA 2LZ6A 1IPGA 1WX8A 2EMTA 4FULA 4CYEA 3NS8A 3L13A 1TTNA 2MP2A 3ZIMA 2Z0DB 4KSKC 2J0MA 1T0YA 1E8YA 2DZMA 4FN2A 4E74A 1P98A 5TR5A 2K8CA 1KLVA 4I6LB 3H1UA 2AL3A 2BYVE 1GC7A 3PHWB 3MJWA 3PVLA 1YIWA 2LD9A 3DQVA 2YVCA 1WE6A 4B95A 5DPSA 3L54A 2KWCA 1R4MI 3QIJA 3VTWA 4EOYA 4W9JA 4F1SA 2IO3B 2PJHA 4XX5A 3X23A 1S1QB 2MBBB 2C9WB 2MBEA 1LXDA 4DXAB 1YX5B 2K1FA 1UBIA 3A33B 1KOTA 2M4NA 5AZFA 1SE9A 1V5OA 2N7EA 3AU4A 4IW0A 2DYBA 2AWTA 3PLUA 4KVGB 2JZZA 4KZ0A 3KYDD 3A4RA 3IVFA 1J19A 1L7YA 4EEWA 2D11A 2NPTB 4K7SA 3KUZA 2BPSA 3VDZA 2JVCA 4AJYB 3X0WA 4WJQA 4RMAA 1J0GA 1WXMA 5AEKB 2CR5A 2MBQA 5L95C 3ZNID 1YD8U 2LRUA 2LASA 2MWSB 2LJ5A 4MGKE 2L05A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ML8 A;  1WRD B;  4LDT B;  4BBN F;  3ZW3 A;  2L7R A;  3QAQ A;  2HD5 B;  3DOW A;  3ZDM C;  4AJW A;  1WIA A;  4X57 B;  3PHX B;  4FHK A;  2O2V A;  3JYU A;  1CMX B;  4WWN A;  1V9J A;  4K7U A;  4NPN A;  3S2A A;  4ANU A;  1V86 A;  4EFO A;  1TZ1 A;  2IY0 B;  2J7Q B;  1GNU A;  2DZI A;  3O65 B;  4LDT D;  1Q5W B;  3WIM A;  1WR1 A;  2KHW B;  2CHX A;  3Q3J A;  4HK2 A;  5G2N A;  2LGY A;  4IM2 A;  4MEL A;  3QWZ B;  4HDQ A;  1XQQ A;  2GOW A;  5IAA C;  3RUI B;  4MGY E;  1WM2 A;  4MJS B;  3IG3 A;  4MH0 E;  2KJR A;  3QA8 A;  3KVF B;  4FHJ A;  2ZNV C;  4TQ1 A;  4EZK A;  3PRZ A;  2DZK A;  2GBJ A;  3N32 A;  3AU5 A;  4MEM A;  3DVG X;  3L10 B;  2BF8 B;  4BKG A;  1I42 A;  2K39 A;  1ISN A;  1ZKH A;  3H9D A;  2BWF A;  1UD7 A;  3NZU A;  2JUO A;  3DBR I;  4GMV A;  3VUY A;  2RSU A;  4TV3 A;  3R7R A;  4GN1 A;  4DHJ B;  1WXA A;  2KZR A;  1H4R A;  3EHV A;  2GBK A;  2KNB A;  2N9X A;  4HPL B;  2KDB A;  5D94 A;  3ZRC A;  2KAN A;  2KTR A;  4KV2 A;  2I1J A;  1OEY J;  1P9D U;  4A3O A;  3V61 A;  3M63 B;  2WX0 A;  1WGY A;  3UQB A;  1I35 A;  1KJT A;  3QAR A;  1OGW A;  2KDE B;  4M8M A;  2KFJ A;  2KC2 A;  5G55 A;  1UH6 A;  3TBL D;  1E8Z A;  1V81 A;  2BYF A;  2XK5 A;  1F9J A;  4ZYN A;  1V6E A;  2BGF A;  3H6N A;  5EDS A;  2BYE A;  3UIP B;  4DWF A;  1WR6 E;  3A9J A;  4DBG A;  1YQB A;  2IO1 B;  5C1Z A;  2K8B A;  3KYC D;  4GDL A;  2GBM A;  2M17 A;  2JRH A;  5FR6 A;  4FA6 A;  4GOC A;  5JHB A;  4FJV B;  3V6E B;  3HM3 A;  1E5W A;  2J0K A;  4ZRK A;  2RR9 A;  3PRE A;  2OJR A;  3APC A;  4HCN B;  3JVZ X;  4KZC A;  3UF8 A;  4TQ0 A;  3TL5 A;  4OVU A;  4IWQ A;  2JT4 B;  4GIV A;  2KK8 A;  3WAL A;  2MP2 B;  4EUT A;  2KDF B;  1ZGU B;  2KFK B;  4MGZ E;  2LUE A;  1WXV A;  2GMI C;  2KVR A;  4JGH B;  5DCN A;  3TJP A;  3V60 A;  1Q1O A;  1Y8R C;  3L16 A;  2MCN B;  3RZW C;  4GDK B;  2KJH B;  1WYW B;  3NOB A;  2KX0 A;  3DCG A;  3ZTD A;  4K81 A;  2L8J A;  3R3M A;  1P0R A;  5KHQ A;  2ZJD A;  2KKC A;  4LCD E;  4EZL A;  2IZV B;  2NR2 A;  2ZCC A;  2HE7 A;  5CHV C;  2LXA A;  2MW5 A;  3ZUN A;  4NNJ B;  4BKS A;  3L17 A;  5JHA A;  2IO0 B;  1WMH B;  3MHS D;  2ZVN A;  3WAM A;  2Z59 B;  2KLG A;  4IM3 A;  4JQW C;  4J6I A;  2L0F A;  1HE8 A;  1RFA A;  1WZ0 A;  2D10 A;  2K6D B;  4NAW A;  2LVQ A;  1WJ6 A;  5DPT A;  2AYO B;  4N9F 4;  3PZD A;  3CSF A;  4ICV A;  3TMP B;  4NJ6 A;  3VQI A;  4ANW A;  4GB9 A;  2MQJ A;  1WX9 A;  3A1Q B;  3HM6 X;  5LLI A;  5CX3 A;  3A4S C;  3DPD A;  2MBH A;  4KIK A;  4G0N B;  2FID A;  4W9L A;  3VUX A;  3U7D A;  3AUL A;  2J0J A;  5E6N A;  1V80 A;  4HXD A;  5DPR A;  2FNJ B;  3ZNZ B;  3RZF A;  1WE7 A;  2MBO A;  2O6V A;  1TGZ B;  4W9D A;  3ECI A;  4BBN C;  5IA7 A;  4KDL B;  3QX1 A;  1IP9 A;  3U30 A;  2BKF A;  1XD3 B;  1NDD A;  4PS3 A;  1V5T A;  2MLB A;  2N4F A;  1LQB A;  4BVU C;  1WI0 A;  1GJZ A;  1WFY A;  1RLF A;  1WJN A;  2DAJ A;  2CHW A;  2CHZ A;  3M62 B;  2MSE D;  3RT3 B;  2G3Q B;  4KSL C;  4FAD A;  5DPW A;  5CHW A;  2FCN A;  1WZ3 A;  1WX7 A;  2UWQ A;  2KLC A;  2PEA A;  4ZDV A;  3GZN I;  2R2Q A;  3OLM D;  2KJ6 A;  3Q3F A;  5JZE B;  2LI5 A;  1WY8 A;  3LJ3 A;  4HJK A;  2RPQ A;  3JSV B;  3U8Z A;  2IY1 B;  4IC7 B;  3UIO B;  3VHT C;  1M94 A;  2KWU B;  4AP4 C;  4GGQ A;  5AZG A;  2V1Y A;  3D32 A;  1E8X A;  2LRW A;  5D6J B;  4ZRJ A;  1SIF A;  4EKU A;  2FAZ A;  2C60 A;  2KTF A;  2LXC A;  3B0A A;  2L3Z A;  3PRM B;  3HIZ A;  2C5L C;  1PQS A;  2N1W A;  4W9I A;  4GXB A;  2ZEQ A;  4MSQ B;  3T8M A;  3N30 A;  1GC6 A;  2DHZ A;  4LJO B;  2C7N B;  2OOB B;  3APD A;  4PS8 A;  3W1Y A;  3NY5 A;  1UBQ A;  2MA9 B;  2K25 A;  4IG7 B;  4MDK E;  5J17 A;  4A3P A;  2LVO A;  1E8W A;  2I1K A;  4TKN A;  4M8N A;  4XZ4 A;  1LFD A;  2M8S A;  4MGI E;  3NZS A;  3BIN A;  4BKT A;  4JLC A;  2KN5 A;  4M0W B;  3QK0 A;  2FUH B;  2RGF A;  4II2 B;  1Z5S B;  2CKH B;  3IBE A;  3R66 C;  4G3X B;  2KMA A;  2JRI B;  4OVV A;  1WXS A;  3ZDT A;  4ZRI A;  2ZVO A;  2JZ3 B;  1Z2M A;  2MRP A;  2V3S A;  3WA0 A;  1WGR A;  2PPH A;  3VAW A;  3B1L X;  4B9K A;  1GUA B;  3PPA A;  2ZNV B;  3PRP B;  1A5R A;  5KHO A;  5E6P A;  2WYQ A;  2D07 B;  4ANV A;  1UZX B;  2DEN B;  3K9P B;  1GG3 A;  3PV1 A;  4HWI B;  3A9K B;  1IYF A;  4DDG D;  3B08 A;  4K7W A;  3DBH I;  2LVP A;  3V6C B;  2KD0 A;  2M1M A;  3DDC B;  4WJP A;  3H7S A;  1YX6 B;  3CF6 E;  4JL9 A;  3MTN B;  3ONS A;  3ZTC A;  4NQK E;  2D3G A;  3WAN A;  4AUQ C;  3W1S C;  4WJO A;  2CU1 A;  2FCM A;  5BO4 B;  3PT2 B;  1WJ4 A;  1YJ1 A;  1OQY A;  1BT0 A;  2GBR A;  4BKS D;  1SGH A;  3M95 A;  4NAW B;  3ZO5 B;  4BOZ B;  4IUM B;  2N7D A;  3BY4 B;  1QZE A;  2IBI B;  4W9H A;  4NY0 A;  4DHZ B;  1S3S G;  3VUW A;  1MG8 A;  1U4A A;  2ASQ A;  3DVN V;  3ZNG C;  1WGH A;  3AI5 A;  4HVB A;  1OEY A;  3JW0 X;  4KIK B;  3WAP A;  1P1A A;  3PGE A;  1C1Y B;  1WM3 A;  3L0W B;  2DYM A;  3H7P A;  2JY6 A;  3HHM A;  2D2Q A;  5L83 A;  3NHE B;  3TCA A;  3QC8 B;  2Z0E B;  4IWO A;  3C0R B;  2ZPY A;  2O6V B;  1KM7 A;  2A4Z A;  1NBF C;  1XT9 B;  3QCA A;  4JIO U;  1AAR A;  3VTU A;  3QJZ A;  2JPH A;  2K6Q A;  4K1R B;  2XBB C;  3ALB A;  3ML9 A;  1UEL A;  2QHO A;  2JXX A;  2O6V D;  1WH3 A;  3VFK A;  2KFK A;  1L2N A;  1P3Q U;  4LJP B;  1E7U A;  3W1S A;  1H8C A;  2LGD A;  2R2O A;  2NBU A;  2DAF A;  4GDK A;  2KQS A;  4W9K A;  3PSE B;  3L08 A;  1OTR B;  1WGD A;  2B3A A;  4CO7 A;  2DYO A;  1D3Z A;  2O2V B;  3OAW A;  4HCP B;  3VH3 B;  2C7H A;  2FIF A;  1WMH A;  4AWJ A;  4BFR A;  4F7Z A;  5E6O A;  2ZPN A;  1EF5 A;  2KXJ A;  4WAA A;  5J18 A;  3EEC A;  4B6W A;  3R7Q A;  3RUL A;  1V49 A;  5JH5 C;  1X1M A;  2EMS A;  4RM8 A;  4II3 B;  3CMM B;  2K8H A;  4I6P A;  2NVU I;  2KOX A;  1V2Y A;  4FJZ A;  2IO2 B;  2KDI A;  1JRU A;  2DX5 B;  3PS6 A;  2XEW A;  2MX2 A;  3A1Q A;  3OJ4 B;  4ANX A;  1LM8 B;  3K9O B;  4CHK A;  2N9E B;  5D2M B;  4HDO A;  3RYT A;  5CHF A;  1UGM A;  1TBE A;  3VVW B;  1EF1 A;  4RM9 A;  2CS4 A;  1E90 A;  4WQO B;  2KWV B;  3ZRF A;  2WX1 A;  2HTH A;  4W9F A;  3UQA A;  2KTR B;  2PE9 A;  3KUD B;  2NPT A;  4DHZ E;  3RCZ A;  4BOS C;  3T9L A;  5D7G A;  3UGB B;  2REX A;  4E71 A;  3ZKJ C;  2A5U A;  4HPM B;  3VH4 B;  2JWZ A;  3WAO A;  5HKH A;  2AL6 A;  4WWP A;  1J8C A;  2DZJ A;  3GOE A;  3SDL C;  2ZZP B;  2ZCB A;  2KX3 A;  1K8R B;  2XK5 B;  3SD5 A;  4DK5 A;  5J2R A;  3QHT A;  4TUU A;  2L00 B;  1E7V A;  2LGX A;  2WDT B;  4WWO A;  5GMV A;  4PS7 A;  5CTR C;  3A9J B;  1VCB A;  4EZJ A;  4NQL B;  2KO3 A;  3RD2 A;  4ASW C;  4GDL B;  3HK0 A;  4MM3 A;  2NBV B;  4WJN A;  3I3T B;  3N3K B;  3JSV A;  2KC1 A;  4W9E A;  2NBW B;  3V62 A;  3SHQ A;  3IFW B;  3P2B A;  3ENE A;  4ICU A;  4IM0 A;  2EKE C;  2KQ7 A;  3M3J A;  5AZH A;  3TIX A;  4P7I A;  5C23 A;  4MJS A;  2BWE S;  3EFU A;  1FXT B;  1WJU A;  2BKR B;  3UIN B;  2G4S A;  2L76 A;  1Q0W B;  3KH0 A;  2KMC A;  3AXC A;  4G11 A;  1NI2 A;  2RD0 A;  3VXW A;  4I6N B;  4G50 A;  4XC2 A;  2V4L A;  3CST A;  3IHP C;  3OJ3 A;  3QQ8 B;  4DHJ D;  4FBJ B;  4IWP A;  3KW5 B;  3LDZ E;  3SU8 X;  4KDI C;  5LXI B;  2G4D B;  3ZLZ A;  2HJ8 A;  1C3T A;  3ZVV A;  3DVG Y;  2L0T A;  4YL8 A;  2M0X A;  3H7P B;  3ZNH B;  1G6J A;  1EUV B;  3DVN U;  4FLH A;  3APF A;  4MSM B;  1VD2 A;  2FCS A;  3PTF C;  2UYZ B;  2Y5B B;  2IYD B;  2N1V A;  1EO6 A;  4A20 A;  4FJY A;  1RRB A;  1WF9 A;  2YLM A;  3KUC B;  1R4N I;  2AEH A;  3PLV A;  4GSW A;  4PYZ A;  2N9P C;  3EC8 A;  2GBN A;  2FCQ A;  2VRR B;  4W9G A;  3VTV A;  4DDI D;  4PYU A;  3A9K A;  4AOF A;  2LWP A;  1ZW7 A;  2G45 B;  3DBS A;  4F8C B;  4HLE A;  1WGG A;  4E3C A;  2JF5 A;  2PE6 B;  1RAX A;  2W9N A;  3DBL I;  4W9C A;  2C7M B;  4GU2 A;  4URK A;  2WWZ A;  2NS5 A;  2NCN A;  4NJ7 A;  5LXH A;  2LZ6 A;  1IPG A;  1WX8 A;  2EMT A;  4FUL A;  4CYE A;  3NS8 A;  3L13 A;  1TTN A;  2MP2 A;  3ZIM A;  2Z0D B;  4KSK C;  2J0M A;  1T0Y A;  1E8Y A;  2DZM A;  4FN2 A;  4E74 A;  1P98 A;  5TR5 A;  2K8C A;  1KLV A;  4I6L B;  3H1U A;  2AL3 A;  2BYV E;  1GC7 A;  3PHW B;  3MJW A;  3PVL A;  1YIW A;  2LD9 A;  3DQV A;  2YVC A;  1WE6 A;  4B95 A;  5DPS A;  3L54 A;  2KWC A;  1R4M I;  3QIJ A;  3VTW A;  4EOY A;  4W9J A;  4F1S A;  2IO3 B;  2PJH A;  4XX5 A;  3X23 A;  1S1Q B;  2MBB B;  2C9W B;  2MBE A;  1LXD A;  4DXA B;  1YX5 B;  2K1F A;  1UBI A;  3A33 B;  1KOT A;  2M4N A;  5AZF A;  1SE9 A;  1V5O A;  2N7E A;  3AU4 A;  4IW0 A;  2DYB A;  2AWT A;  3PLU A;  4KVG B;  2JZZ A;  4KZ0 A;  3KYD D;  3A4R A;  3IVF A;  1J19 A;  1L7Y A;  4EEW A;  2D11 A;  2NPT B;  4K7S A;  3KUZ A;  2BPS A;  3VDZ A;  2JVC A;  4AJY B;  3X0W A;  4WJQ A;  4RMA A;  1J0G A;  1WXM A;  5AEK B;  2CR5 A;  2MBQ A;  5L95 C;  3ZNI D;  1YD8 U;  2LRU A;  2LAS A;  2MWS B;  2LJ5 A;  4MGK E;  2L05 A; 
#chains in the Genus database with same CATH topology
 4YTN B;  3W5U B;  2L7R A;  2KYW A;  2HD5 B;  3DOW A;  4S17 A;  1DOI A;  1SF0 A;  2DBY A;  3WIM A;  1YQ4 B;  2EKI A;  2KHW B;  5G2N A;  4HDQ A;  3BK2 A;  5C3J B;  2D3C A;  1WM2 A;  4MH0 E;  4WIP A;  4FHJ A;  1LO5 D;  2ZNV C;  4TQ1 A;  3DBR B;  4LTU A;  1FD6 A;  1FM0 D;  1I42 A;  3H9D A;  3P63 A;  2JUO A;  1JW9 D;  1HZ6 A;  2RSU A;  4MT5 A;  2V0G A;  1ZXI A;  2GBK A;  2KNB A;  4HPL B;  5D94 A;  4FXC A;  1XLO A;  1ZP0 B;  2R61 A;  1I4H A;  1WGY A;  3P4P B;  1OQR A;  3PZ8 A;  3QAR A;  2KFJ A;  4JWS C;  1ZDX A;  4ZRQ A;  2XK5 A;  3N1Z C;  3UIP B;  1WR6 E;  1Y56 A;  4DBG A;  3L4P A;  4OVZ A;  2GBM A;  4FA6 A;  3V6E B;  2RR9 A;  4KZC A;  2OJR A;  3Q3N C;  1CK1 A;  4A55 A;  1XCQ L;  1TYG B;  2KFK B;  1NVI D;  1Y8R C;  4GDK B;  2PW9 A;  3DCG A;  2BQQ A;  1P0R A;  3Q2A C;  2KKC A;  3AEA B;  4LCD E;  2NR2 A;  2ZCC A;  4BKS A;  2LXA A;  2MW5 A;  3Q8E A;  1MI0 A;  4IM3 A;  4J6I A;  2L0F A;  4RF0 A;  4DXG A;  5DPT A;  2KMM A;  2D3B A;  4C00 A;  3CSF A;  2W3R A;  3NVZ A;  2MQJ A;  3A1Q B;  3A4S C;  5D3D A;  2DWQ A;  2J0J A;  4J3O D;  5E6N A;  3IT6 B;  4HXD A;  3RZF A;  2MBO A;  1JQ4 A;  4P16 A;  3QX1 A;  1L4Z B;  1NDD A;  3MHZ A;  4ZHO A;  1GJZ A;  1WFY A;  1RLF A;  2CHZ A;  3H8H A;  4NZL B;  2UWQ A;  4IDI A;  2PEA A;  2KJ6 A;  2K22 A;  2WQY B;  3GE3 C;  3U2S C;  2WXN A;  4KGT A;  4AP4 C;  2KTF A;  2C60 A;  2LXC A;  3B0A A;  1SE2 A;  2L3Z A;  4M01 A;  2C5L C;  1PQS A;  4W9I A;  1TY2 A;  4GXB A;  2ZEQ A;  3T8M A;  3B9J A;  2OOB B;  4PS8 A;  1PGB A;  4P1B C;  4MDK E;  3PO0 A;  2I1K A;  4TKN A;  4M8N A;  1LFD A;  2M8S A;  2JSV X;  2KN5 A;  1Z5S B;  3R66 C;  4OVV A;  5IKC M;  2ZVO A;  4K3C A;  1GAQ B;  2PPH A;  3AE7 B;  3B1L X;  4B9K A;  1A5R A;  2WYQ A;  1FEH A;  1UZX B;  2DEN B;  1GG3 A;  3PV1 A;  4YTM B;  3V3X A;  2LVP A;  2LEK A;  3MTN B;  3ONS A;  3WAN A;  2V3P A;  1XO3 A;  2CU1 A;  3W5V B;  3VRA B;  3PT2 B;  1YJ1 A;  4BKS D;  3BZD B;  3GB1 A;  1I4R A;  2K5P A;  2QMT A;  2KN4 A;  1KRH A;  4W9H A;  3AED B;  3DVN V;  4LK0 M;  1WGH A;  2WXF A;  1NEN B;  2SAK A;  3JW0 X;  4KIK B;  3HVD A;  2WP9 B;  3H7P A;  3HHM A;  3NHE B;  3TCA A;  2AQ2 B;  2Z0E B;  1XCT L;  4XGA B;  4ARC A;  3C0R B;  2O6V B;  2INC C;  1KM7 A;  4JIO U;  2Y5P A;  3QJZ A;  1JAL A;  5HHD G;  2QHO A;  5BMG A;  2KFK A;  1L2N A;  1P3Q U;  2H88 B;  2KVZ A;  4GDK A;  2KQS A;  3PSE B;  1R4M B;  1MG4 A;  2DYO A;  1D3Z A;  3R2I A;  3OAW A;  1YOV B;  3VH3 B;  2C7H A;  2FIF A;  1QIL A;  2W3S A;  4AQ7 A;  2ZPN A;  1EF5 A;  1JCK B;  3RMK C;  1L0Y B;  2ACZ B;  3R7Q A;  1X1M A;  3NVW A;  2K8H A;  2VZK B;  2KOX A;  3TSS A;  4US8 A;  2DX5 B;  4KGS A;  3A1Q A;  4ANX A;  2IPK D;  4CHK A;  1MVK A;  4HDO A;  4YWG G;  1EF1 A;  4RM9 A;  4WQO B;  2KWV B;  3ZRF A;  4C4V B;  4W9F A;  2J53 A;  2KTR B;  2WHI A;  2NPT A;  4DHZ E;  3Q14 C;  1RYJ A;  2ZW0 A;  4E71 A;  3AB5 A;  1D5M C;  2AL6 A;  2W55 A;  1QOB A;  4A6Q A;  1J8C A;  1TS4 A;  1N63 A;  2ZCB A;  3C19 A;  5GMV A;  4EZJ A;  2KO3 A;  2N7J A;  1WXQ A;  2NBV B;  4WJN A;  3N3K B;  4W9E A;  4IM0 A;  1C76 A;  2PIA A;  2EKE C;  3M3J A;  5FKA C;  1XXG A;  1QOF A;  3HVZ A;  3ZYY X;  1WJU A;  3AXC A;  3N1X C;  3Q8B A;  1NEK B;  1OFF A;  3VXW A;  1QLB B;  2V4L A;  4PT5 A;  3KW5 B;  2WNM A;  3SU8 X;  2HJ8 A;  1C3T A;  1KLG D;  4YL8 A;  1TS3 A;  3DHG C;  4P6V F;  1G6J A;  3Q3M C;  1VD2 A;  2JXT A;  1ZXH A;  2N1V A;  1J7C A;  2L1A A;  1EO6 A;  3J9C A;  4A20 A;  1VLB A;  2J42 A;  1RRB A;  5IOI A;  3KUC B;  3P4R B;  2RMM A;  2YEP B;  1ET6 A;  2M56 B;  2VRR B;  3VTV A;  2KAJ A;  1VDV A;  2YEP F;  4HLE A;  1QT9 A;  1WGG A;  4XDC A;  4E3C A;  2JF5 A;  2W9N A;  1RAX A;  3DBL I;  4HRO A;  2C7M B;  1D5Z C;  1XLQ A;  4NJ7 A;  1T0S C;  1IPG A;  4TMA B;  2EMT A;  4FUL A;  2KAC A;  3L13 A;  1TTN A;  2B76 B;  2MP2 A;  2Z0D B;  1HTQ A;  2K8C A;  1N62 A;  1SBB B;  2WXH A;  1N6Z A;  2E6X A;  4OZB A;  3MJW A;  2V3N A;  2YVC A;  4B95 A;  5G5G A;  3VTW A;  4RF1 A;  1S1Q B;  1TY0 A;  2MBB B;  3IXS A;  2K1F A;  1KOT A;  3NUH B;  4OZA A;  4WQM A;  5AZF A;  3MFG A;  2N7E A;  2AWT A;  1T0R C;  2JZZ A;  3Q3O C;  2HDE A;  1J19 A;  1L0V B;  4K7S A;  2WGS A;  3I57 A;  1HXY D;  4YSY B;  5MPO A;  3X0W A;  1ZDV A;  1E10 A;  1J0G A;  2CR5 A;  1YD8 U;  2LAS A;  3P4Q B;  3ML8 A;  4LDT B;  3ZW3 A;  3QAQ A;  3ZDM C;  1M4V A;  4K3B A;  4X57 B;  1LGR A;  3JYU A;  2XNA C;  1CMX B;  1ROE A;  4K7U A;  1PFD A;  1TZ1 A;  2IY0 B;  2J7Q B;  2DZI A;  3N20 C;  3Q3J A;  3TEY A;  2LGY A;  1Q10 A;  3QWZ B;  5IAA C;  4MGY E;  4LNI A;  4MJS B;  4EZK A;  2DZK A;  2GBJ A;  5HFY A;  4WWM A;  2BVC A;  4BKG A;  2RPV A;  1ISN A;  1ZKH A;  3LYY A;  5E6J A;  4GN1 A;  3R7R A;  1WXA A;  1QOG A;  1T0Q C;  3DHI C;  2N9X A;  3ZRC A;  4A8X C;  2J4X A;  2KAN A;  2KTR A;  2I1J A;  2WX0 A;  1I35 A;  1KJT A;  1OGW A;  2KDE B;  4M8M A;  2KC2 A;  2LFI A;  1V81 A;  2X38 A;  4ZYN A;  1V6E A;  2WDR B;  3H6N A;  3LXF A;  1AW7 A;  2M17 A;  5FR6 A;  1XF5 L;  4FJV B;  3HM3 A;  1E5W A;  3APC A;  4HCN B;  2MJ3 A;  3TL5 A;  3WAL A;  4IWQ A;  2JT4 B;  4EUT A;  1QOA A;  2KDF B;  1WXV A;  1Q1O A;  4LNN A;  2KJH B;  4N6E B;  3SFD B;  2LJI A;  2KX0 A;  1QKZ A;  3ZTD A;  2L8J A;  3RN9 C;  2Q5W D;  1J7A A;  5CHV C;  1TKY A;  3BYY B;  3ZUN A;  3L17 A;  3MHS D;  2PKO A;  3WAM A;  4YSZ B;  4JQW C;  2D10 A;  1D4B A;  1F2R C;  4ICV A;  3TMP B;  3GP7 A;  2JX5 A;  4NJ6 A;  3N1Y C;  3CWI A;  5CX3 A;  3AEC B;  2WXR A;  1V80 A;  4HEA 1;  4P1C C;  3ECI A;  1EU4 A;  4KDL B;  1F0Z A;  2L52 A;  1IP9 A;  3U30 A;  4PS3 A;  1XD3 B;  3NG0 A;  1LQB A;  4BVU C;  1WI0 A;  3BK1 A;  1N60 A;  4L23 A;  1N5X A;  2DAJ A;  1TJE A;  1WZ3 A;  1K53 A;  2N9K A;  5JZE B;  3LJ3 A;  2IGD A;  2NMQ A;  2RPQ A;  1PDX A;  2IY1 B;  4CQN A;  5G5H A;  2LGS A;  2V1Y A;  5D6J B;  1E8X A;  2LRW A;  4YT0 B;  2FAZ A;  4M02 A;  1B9R A;  2N1W A;  2NTS A;  1GC6 A;  2DHZ A;  3APD A;  3W1Y A;  1ZPS A;  3RNB C;  3I5J C;  2K25 A;  1EWC A;  3CIR B;  2LVO A;  1E8W A;  1MPE A;  4XZ4 A;  3AV8 A;  1ENF A;  3NZS A;  2M19 A;  1YN3 A;  4JX1 C;  2BT6 A;  4O1N A;  2LUM A;  1OQQ A;  3RNG C;  4ZRI A;  2JZ3 B;  1SEB D;  2MRP A;  3WA0 A;  3RFZ B;  1DYQ A;  2WXI A;  3PPA A;  5KHO A;  5E6P A;  2D07 B;  2BS3 B;  3B08 A;  3V6C B;  4WJP A;  1YX6 B;  3CF6 E;  4JL9 A;  3ZTC A;  4NQK E;  2D3G A;  3HUI A;  4WJO A;  2BYT A;  5BO4 B;  1F52 A;  1WJ4 A;  2IND C;  3W2D A;  4B0M A;  2WXM A;  2KDM A;  1FPY A;  3M95 A;  4NAW B;  1CZP A;  3BY4 B;  3ZQ4 A;  1S3S G;  3NVV A;  1N61 A;  2ASQ A;  1BXT A;  2N9L A;  3EFC A;  4WUR A;  3AI5 A;  1P1A A;  3PGE A;  3L0W B;  2DYM A;  3IAM 1;  1F77 A;  5L83 A;  4RGO S;  2D5G A;  4IWO A;  4C7Y A;  4C56 C;  1NBF C;  1AAR A;  5BYR A;  4B0E A;  2JPH A;  2K6Q A;  3ML9 A;  3VFK A;  2JXX A;  1WH3 A;  2G9H D;  1E7U A;  2DAF A;  3Q69 A;  1OTR B;  1V1P B;  2VH1 A;  5C2T B;  4CO7 A;  1SXT A;  1KH0 A;  4BFR A;  4WH4 A;  5E6O A;  3RI7 C;  4WAA A;  1XEE A;  2EMS A;  4RM8 A;  1C77 A;  2QJL A;  3T3N A;  2KDI A;  3PS6 A;  1K51 A;  3ZJT A;  2QCZ A;  2N9E B;  1I4Q A;  2L32 A;  2Z8L A;  3VVW B;  1P7E A;  4KGR A;  1E90 A;  1RFK A;  3KUD B;  5EE0 A;  1C4C A;  2WXQ A;  3RCZ A;  4BOS C;  3T9L A;  5IN7 A;  3UGB B;  3ZKJ C;  1YMH E;  3VH4 B;  4HPM B;  3U7Z A;  4YSX B;  2I2Y A;  2KWD A;  3SDL C;  1CJE A;  2PLP A;  3EA6 A;  4TUU A;  2L00 B;  4WWO A;  3A9J B;  1VCB A;  1JWS D;  3HK0 A;  4JE3 B;  1JRP A;  2PVG C;  2NBW B;  3P42 A;  3V62 A;  5BMH A;  3SHQ A;  4ICU A;  2KQ7 A;  2HJ1 A;  3TEW A;  3TIX A;  4N58 A;  2BWE S;  4XE0 A;  3UIN B;  2G4S A;  2L76 A;  2LHD A;  5LNK 1;  4C7Z A;  3FIL B;  4XC2 A;  3OJ3 A;  4IWP A;  5LXI B;  2G4D B;  3ZLZ A;  2I38 A;  2Y3A A;  1EUV B;  4FLH A;  3APF A;  1R4N B;  2BS4 B;  2UYZ B;  1T6B X;  1WF9 A;  2DNF A;  3SR6 A;  1FNU A;  4GSW A;  4KKJ A;  4US9 A;  2GBN A;  2FCQ A;  1SSN A;  3T3O A;  4AOF A;  2LWP A;  1ZW7 A;  2AX5 A;  2G45 B;  1WYG A;  2PE6 B;  4W9C A;  2OHF A;  2WWZ A;  2HTM E;  5LXH A;  1WX8 A;  3O13 A;  3NS8 A;  4HPP A;  2J0M A;  1E8Y A;  2DZM A;  1N5W A;  3H1U A;  1GB4 A;  3IAS 1;  2BYV E;  3PHW B;  4DQO C;  5T8I A;  1AYF A;  1ESF A;  3PVL A;  1YIW A;  3BVG A;  2V9H A;  3DQV A;  3AE3 B;  3L54 A;  2KWC A;  3QIJ A;  4W9J A;  4XX5 A;  3X23 A;  2C9W B;  1LXD A;  1YX5 B;  3A33 B;  1VR9 A;  1MFW A;  2MEK A;  3KWL A;  3AU4 A;  2AQ1 B;  4KZ0 A;  3KYD D;  3A4R A;  4EEW A;  2D11 A;  4H2A A;  3VDZ A;  2LHE A;  1F1H A;  2OJW A;  1WXM A;  5AEK B;  3RNA C;  2IGH A;  1GPX A;  2K9X A;  4FBJ B;  2L05 A;  4BBN F;  1V1P A;  2QC8 A;  2ICI A;  3PHX B;  1VJK A;  4WWN A;  4GLS C;  1V9J A;  4NPN A;  5TSS A;  3O65 B;  4S0R A;  1Q5W B;  1WR1 A;  2CHX A;  2J52 A;  4HK2 A;  3VR9 B;  3RUI B;  1YNT E;  3BVM A;  2CJO A;  1XLN A;  3IG3 A;  5FK9 C;  3KVF B;  3PRZ A;  3N32 A;  3AU5 A;  3L10 B;  2BF8 B;  3RNE C;  2K39 A;  3NZU A;  1UD7 A;  3DBR I;  3VUY A;  4TV3 A;  2TSS A;  4DHJ B;  2FBW B;  1H4R A;  3EHV A;  2KDB A;  5GXG B;  4KV2 A;  4A3O A;  1OEY J;  3M63 B;  1VZ6 A;  1YN5 A;  3UQB A;  1A70 A;  5G55 A;  1EM7 A;  1UH6 A;  3AE8 B;  1C9F A;  4C80 A;  5EDS A;  2BYE A;  3AEF B;  4DWF A;  3A9J A;  2IO1 B;  5C1Z A;  2K8B A;  2JRH A;  4JPS A;  4TQ0 A;  2KK8 A;  1AWD A;  3MJ5 A;  4MGZ E;  2LUE A;  2GMI C;  4JGH B;  2KVR A;  3TJP A;  3V60 A;  2QSD A;  4BAX A;  2MCN B;  3RZW C;  3L16 A;  1KTK A;  1T5X D;  4K81 A;  3R3M A;  5KHQ A;  1VZ8 A;  2IZV B;  2IO0 B;  1WMH B;  1KLU D;  2Z59 B;  1HE8 A;  4XWW A;  1WZ0 A;  1P7F A;  2K6D B;  1WJ6 A;  4N9F 4;  3VQI A;  3MC9 A;  3HM6 X;  5LLI A;  2WXO A;  1HEZ E;  1FIQ A;  2JU6 X;  2MBH A;  4KIK A;  4G0N B;  4OHJ A;  3VRB B;  2FID A;  4YXD B;  4W9L A;  3U7D A;  3AUL A;  1KF6 B;  3FAH A;  2FNJ B;  3ZNZ B;  3AN1 A;  1WE7 A;  2K0P A;  2O6V A;  3ZXV A;  4BBN C;  4W9D A;  5IA7 A;  1CQV A;  2QEJ C;  1WJN A;  2CHW A;  3AE1 B;  2G3Q B;  3LB8 C;  4KSL C;  4FAD A;  5DPW A;  2FCN A;  1VZ7 A;  1WX7 A;  1ZOY B;  2EEL A;  3ZJV A;  3OLM D;  2R2Q A;  4ZYS A;  3U52 E;  4HJK A;  3EUB 2;  5BYQ A;  3U8Z A;  4MAC A;  4IC7 B;  3OG5 A;  1IUE A;  2MJD A;  2INP E;  4GGQ A;  4NAM A;  3PRM B;  2AQ3 B;  4MSQ B;  1C79 A;  3NY5 A;  1UBQ A;  2MA9 B;  4RCO A;  5J17 A;  4A3P A;  1FXI A;  4C4V A;  5FR3 A;  4MGI E;  4TSS A;  3BIN A;  5D3I B;  4JLC A;  2KQ4 X;  4M0W B;  3QK0 A;  4HJG E;  5D7G A;  2CKH B;  3IBE A;  4G3X B;  1QQR A;  4XDD A;  2V3S A;  1WGR A;  1L5P A;  3SFE B;  2ZNV B;  4OZC A;  3TEX A;  3K9P B;  4HWI B;  3A9K B;  4DDG D;  3AM9 A;  1C4P A;  4K7W A;  3DBH I;  1L6V A;  3H7S A;  2N0S B;  4BZA A;  4AUQ C;  3FKY A;  1JWU D;  1OQY A;  1BT0 A;  2GBR A;  3ZO5 B;  2BB6 A;  4BOZ B;  4IUM B;  2N7D A;  1QZE A;  3VUW A;  4XWT A;  4KX6 B;  3ZNG C;  3Q8C A;  1IGD A;  2W82 A;  1C1Y B;  1UNS A;  2JY6 A;  1V1O A;  2D2Q A;  2ZPY A;  4AS1 A;  1ZUD 2;  1PGA A;  2XBB C;  5IO9 A;  1UWM A;  2O6V D;  1I4P A;  2RDG A;  1H8C A;  2LGD A;  2R2O A;  2NBU A;  3P1M A;  2JQR B;  4W9K A;  3L08 A;  2RDB C;  2QDF A;  2B3A A;  1SB3 C;  3TEZ A;  1SJE D;  2H89 B;  2O2V B;  1FXA A;  4HCP B;  4AWJ A;  1WMH A;  4F7Z A;  2D3A A;  5J18 A;  3EEC A;  4JWU C;  4B6W A;  3RUL A;  1V49 A;  5JH5 C;  2JYE A;  1K52 A;  2WDV B;  3MC8 A;  1FRR A;  2DLB A;  4FJZ A;  2WDQ B;  2IO2 B;  2GB1 A;  2KT7 A;  2CJN A;  3OJ4 B;  1LM8 B;  2VZK D;  3RYT A;  1UGM A;  1JWB D;  3DWG C;  2WX1 A;  3UQA A;  1WSP A;  2PVO D;  2PE9 A;  3W9C B;  3BWU D;  1C4A A;  1SIJ A;  5HKH A;  2JWZ A;  3GOE A;  3Q8A A;  3ZXR A;  2ZZP B;  1TKG A;  2GI9 A;  3SD5 A;  5J2R A;  2WDT B;  4ARI A;  5CTR C;  1HTO A;  1UWX A;  4NQL B;  4ASW C;  1TT5 B;  4GDL B;  5BMI A;  3I3T B;  2WXJ A;  1UUP A;  1D5X C;  1J7B A;  2KC1 A;  3IFW B;  3ENE A;  2BTE A;  2V4I B;  5AZH A;  3I63 C;  5EE9 A;  4ITK A;  4MJS A;  5C23 A;  2VH2 A;  3KWV A;  1IGC A;  4G11 A;  1FNW A;  1NI2 A;  4N59 A;  2RD0 A;  4I6N B;  4DHJ D;  3LDZ E;  4KDI C;  1BML C;  3ZVV A;  4ZOH C;  2L0T A;  3H7P B;  2OED A;  3ZNH B;  3DVN U;  3B2F A;  4MSM B;  3KLS X;  2Y5B B;  1UGJ A;  4M0W A;  2IYD B;  1DOX A;  2MJE A;  2L83 A;  3Q6B A;  2AEH A;  2WLB A;  3FC4 A;  4PYZ A;  2N9P C;  3DBL B;  2RDH A;  4OW0 A;  3EC8 A;  1FO4 A;  3DHH C;  2IJ0 A;  1PYW D;  3A9K A;  3DBS A;  1I7H A;  2BBC A;  4GU2 A;  4RGN A;  4URK A;  3UI3 A;  2NS5 A;  3NS1 A;  3R8B A;  1FRD A;  4CYE A;  3NVY A;  1ACC A;  4USA A;  3AE4 B;  3ZIM A;  1IBX B;  4KSK C;  3E9S A;  1T0Y A;  2FUG 1;  1P98 A;  5TR5 A;  4E74 A;  1KLV A;  4I6L B;  2AL3 A;  1T3Q A;  1E0Z A;  1GC7 A;  1TIF A;  2LD9 A;  3B2G A;  4F1S A;  4DXA B;  1TS2 A;  1UBI A;  4LNF A;  1F2R I;  2M4N A;  4R3D A;  4IW0 A;  1V5O A;  3DWM A;  3IVF A;  2NPT B;  3KUZ A;  2BPS A;  5AUI A;  4AJY B;  4L1B A;  4RMA A;  5L95 C;  2MWS B;  2LJ5 A;  4MGK E;  1WRD B;  1DOY A;  4AJW A;  3URY A;  1WIA A;  1L4D B;  5IP4 D;  4FHK A;  2O2V A;  3S2A A;  1AN8 A;  4EFO A;  3BYT B;  5HI1 A;  1V86 A;  4ANU A;  2GRI A;  1GNU A;  4LDT D;  2LGI A;  1TKE A;  4IM2 A;  4MEL A;  1FNV A;  1XQQ A;  2GOW A;  4M00 A;  3TUO A;  4A9A A;  2KJR A;  3QA8 A;  5AUK A;  3NZ3 A;  1WWT A;  4WAF A;  4MEM A;  5EE1 A;  3DVG X;  4MH8 A;  1DGJ A;  2BWF A;  3AE5 B;  4GMV A;  2IDY A;  2KZR A;  1HQR D;  3KQ4 A;  4A90 A;  1P9D U;  3V61 A;  3DBH B;  3TBL D;  2WXK A;  1E8Z A;  2BYF A;  3AE6 B;  1F9J A;  3EGR A;  2BGF A;  2MH7 A;  1YQB A;  2JWU A;  3KYC D;  4GDL A;  1VRA B;  4IKG A;  1ZE3 D;  4PK1 A;  4GOC A;  5JHB A;  2J0K A;  3BII D;  4ZRK A;  3PRE A;  3JVZ X;  3UF8 A;  4OVU A;  4GIV A;  1C78 A;  2MP2 B;  2WXG A;  1ZGU B;  1JRO A;  1MJD A;  5DCN A;  1TZO A;  1WYW B;  3NOB A;  1I4G A;  4RGM A;  2WXP A;  3MC0 B;  1FMA D;  2ZJD A;  4EZL A;  3VR8 B;  2HE7 A;  1E7P B;  4NNJ B;  5JHA A;  1L6U A;  2ZVN A;  1KFY B;  1E6E B;  2KLG A;  1JWA D;  1RFA A;  5JXV A;  4NAW A;  2LVQ A;  2AYO B;  4UDU C;  1MHH E;  3PZD A;  4ANW A;  4GB9 A;  4XYC A;  1WX9 A;  3I9V 1;  1YN4 A;  3DPD A;  3VUX A;  1YJI A;  5DPR A;  1XLP A;  4IOI E;  1TGZ B;  1D6E C;  4ZHP A;  4RH6 A;  2BKF A;  1V5T A;  2MLB A;  2N4F A;  2W54 A;  1IBX A;  1K50 A;  3AEG B;  3M62 B;  2MSE D;  3RT3 B;  4Q2J A;  1RWS A;  3AE2 B;  5CHW A;  1E9M A;  1NI3 A;  3ZJU A;  2KLC A;  4ZDV A;  3GZN I;  2QIE B;  3Q3F A;  4MM3 B;  2LI5 A;  1MHX A;  1WY8 A;  3JSV B;  3UIO B;  3VHT C;  1M94 A;  2KWU B;  5AZG A;  3D32 A;  4LNO A;  4ZRJ A;  4EKU A;  1SIF A;  4L2Y A;  5H8Y E;  3HIZ A;  1EU3 A;  2INN E;  2LMC A;  5I4D A;  3BVZ A;  3N30 A;  3N9Y C;  4LJO B;  2C7N B;  2MHJ A;  3Q8F A;  4HRS A;  4IG7 B;  3ZGZ A;  4BKT A;  2ZW1 A;  1RM6 C;  4II2 B;  2FUH B;  2RGF A;  4ACF A;  1FFV A;  3HRD D;  2KMA A;  2JRI B;  1WXS A;  3ZDT A;  1Z2M A;  3VAW A;  1GUA B;  3AEE B;  3NRZ A;  1TS5 A;  3PRP B;  3R2T A;  3P4S B;  4ANV A;  1IYF A;  3U4E G;  2KD0 A;  2M1M A;  3DDC B;  2WXL A;  2WU2 B;  2PTL A;  3W1S C;  2FCM A;  3GS2 A;  2ONQ A;  4NJC A;  2IGG A;  1SGH A;  1NYQ A;  1YJJ A;  3FIL A;  2IBI B;  1I4X A;  4NY0 A;  4DHZ B;  1MG8 A;  1U4A A;  4HVB A;  1V97 A;  1OEY A;  3WAP A;  1WM3 A;  3QC8 B;  1YQ3 B;  5H92 C;  2BS2 B;  2A4Z A;  1XT9 B;  1PGX A;  3QCA A;  2Y5C A;  1FFU A;  3RNF C;  3VTU A;  4K1R B;  3ALB A;  1UEL A;  1B1Z A;  1WGK A;  4LJP B;  3W1S A;  1UF0 A;  2JYT A;  1JML A;  1WGD A;  3PZ7 A;  1NYR A;  3AE9 B;  2K3U A;  2QIL A;  4ZRP A;  2KXJ A;  3IT4 B;  4LNK A;  3MP9 A;  4II3 B;  3CMM B;  4I6P A;  2NVU I;  1V2Y A;  1JRU A;  2XEW A;  2MX2 A;  3K9O B;  5D2M B;  5CHF A;  3RNC C;  1TBE A;  2CS4 A;  3WCQ A;  2HTH A;  1STE A;  2XN9 C;  1EWY C;  1V8C A;  3V05 A;  4LLG M;  2CU3 A;  5BYS A;  2REX A;  2A5U A;  3WAO A;  4WWP A;  2DZJ A;  1WRI A;  2KX3 A;  1K8R B;  1QF6 A;  2XK5 B;  3AH7 A;  1FCC C;  4DK5 A;  1SE4 A;  3QHT A;  1FCL A;  1JWM D;  2LGX A;  1E7V A;  2X8X X;  4PS7 A;  3E56 A;  3RD2 A;  4MM3 A;  4D2K A;  3JSV A;  4RGT A;  3P2B A;  3ETR A;  2BW2 A;  2E3T A;  4P7I A;  1HZ5 A;  2ON8 A;  3RPF C;  3EFU A;  1FXT B;  1HA5 A;  2BKR B;  2FE8 A;  4QAY A;  2SEB D;  1Q0W B;  3KH0 A;  2KMC A;  3OWE B;  4G50 A;  3IHP C;  3CST A;  3QQ8 B;  1GB1 A;  2G1E A;  2WU5 B;  3DVG Y;  2M0X A;  4YTP B;  1BUI C;  2FCS A;  2BB5 A;  3PTF C;  1ET9 A;  4FJY A;  1SJH D;  2JZP A;  2PMV A;  2WS3 B;  2YLM A;  2GLS A;  1PUT A;  3AEB B;  1R4N I;  3PLV A;  4DXF A;  4W9G A;  4EE2 A;  4DDI D;  4PYU A;  4REZ A;  3AMZ A;  4F8C B;  5EE3 A;  2NCN A;  2LZ6 A;  3C8Y A;  4HKQ A;  2M0A A;  1R7S A;  4FN2 A;  3ABV B;  5HG2 A;  1GOZ A;  4RNA A;  3SEB A;  3NJT A;  1WE6 A;  5DPS A;  4EOY A;  1R4M I;  2IO3 B;  2PJH A;  1L0X B;  4HKZ E;  2MBE A;  1SE3 A;  1SE9 A;  4KVG B;  4KKI A;  2DYB A;  2NTT A;  3GE8 C;  3PLU A;  1L7Y A;  2JVC A;  2UU7 A;  4RFB A;  4WJQ A;  2MBQ A;  3ZNI D;  2LRU A;  3GZN B; 
#chains in the Genus database with same CATH homology
 3ML8 A;  1WRD B;  4LDT B;  4BBN F;  3ZW3 A;  2L7R A;  3QAQ A;  2HD5 B;  3DOW A;  3ZDM C;  4AJW A;  1WIA A;  4X57 B;  3PHX B;  4FHK A;  2O2V A;  3JYU A;  1CMX B;  4WWN A;  1V9J A;  4K7U A;  4NPN A;  3S2A A;  4ANU A;  1V86 A;  4EFO A;  1TZ1 A;  2IY0 B;  2J7Q B;  1GNU A;  2DZI A;  3O65 B;  4LDT D;  1Q5W B;  3WIM A;  1WR1 A;  2KHW B;  2CHX A;  3Q3J A;  4HK2 A;  5G2N A;  2LGY A;  4IM2 A;  4MEL A;  3QWZ B;  4HDQ A;  1XQQ A;  2GOW A;  5IAA C;  3RUI B;  4MGY E;  1WM2 A;  4MJS B;  3IG3 A;  4MH0 E;  2KJR A;  3QA8 A;  3KVF B;  4FHJ A;  2ZNV C;  4TQ1 A;  4EZK A;  3PRZ A;  2DZK A;  2GBJ A;  3N32 A;  3AU5 A;  4MEM A;  3DVG X;  3L10 B;  2BF8 B;  4BKG A;  1I42 A;  2K39 A;  1ISN A;  1ZKH A;  3H9D A;  2BWF A;  1UD7 A;  3NZU A;  2JUO A;  3DBR I;  4GMV A;  3VUY A;  2RSU A;  4TV3 A;  3R7R A;  4GN1 A;  4DHJ B;  1WXA A;  2KZR A;  1H4R A;  3EHV A;  2GBK A;  2KNB A;  2N9X A;  4HPL B;  2KDB A;  5D94 A;  3ZRC A;  2KAN A;  2KTR A;  4KV2 A;  2I1J A;  1OEY J;  1P9D U;  4A3O A;  3V61 A;  3M63 B;  2WX0 A;  1WGY A;  3UQB A;  1I35 A;  1KJT A;  3QAR A;  1OGW A;  2KDE B;  4M8M A;  2KFJ A;  2KC2 A;  5G55 A;  1UH6 A;  3TBL D;  1E8Z A;  1V81 A;  2BYF A;  2XK5 A;  1F9J A;  4ZYN A;  1V6E A;  2BGF A;  3H6N A;  5EDS A;  2BYE A;  3UIP B;  4DWF A;  1WR6 E;  3A9J A;  4DBG A;  1YQB A;  2IO1 B;  5C1Z A;  2K8B A;  3KYC D;  4GDL A;  2GBM A;  2M17 A;  2JRH A;  5FR6 A;  4FA6 A;  4GOC A;  5JHB A;  4FJV B;  3V6E B;  3HM3 A;  1E5W A;  2J0K A;  4ZRK A;  2RR9 A;  3PRE A;  2OJR A;  3APC A;  4HCN B;  3JVZ X;  4KZC A;  3UF8 A;  4TQ0 A;  3TL5 A;  4OVU A;  4IWQ A;  2JT4 B;  4GIV A;  2KK8 A;  3WAL A;  2MP2 B;  4EUT A;  2KDF B;  1ZGU B;  2KFK B;  4MGZ E;  2LUE A;  1WXV A;  2GMI C;  2KVR A;  4JGH B;  5DCN A;  3TJP A;  3V60 A;  1Q1O A;  1Y8R C;  3L16 A;  2MCN B;  3RZW C;  4GDK B;  2KJH B;  1WYW B;  3NOB A;  2KX0 A;  3DCG A;  3ZTD A;  4K81 A;  2L8J A;  3R3M A;  1P0R A;  5KHQ A;  2ZJD A;  2KKC A;  4LCD E;  4EZL A;  2IZV B;  2NR2 A;  2ZCC A;  2HE7 A;  5CHV C;  2LXA A;  2MW5 A;  3ZUN A;  4NNJ B;  4BKS A;  3L17 A;  5JHA A;  2IO0 B;  1WMH B;  3MHS D;  2ZVN A;  3WAM A;  2Z59 B;  2KLG A;  4IM3 A;  4JQW C;  4J6I A;  2L0F A;  1HE8 A;  1RFA A;  1WZ0 A;  2D10 A;  2K6D B;  4NAW A;  2LVQ A;  1WJ6 A;  5DPT A;  2AYO B;  4N9F 4;  3PZD A;  3CSF A;  4ICV A;  3TMP B;  4NJ6 A;  3VQI A;  4ANW A;  4GB9 A;  2MQJ A;  1WX9 A;  3A1Q B;  3HM6 X;  5LLI A;  5CX3 A;  3A4S C;  3DPD A;  2MBH A;  4KIK A;  4G0N B;  2FID A;  4W9L A;  3VUX A;  3U7D A;  3AUL A;  2J0J A;  5E6N A;  1V80 A;  4HXD A;  5DPR A;  2FNJ B;  3ZNZ B;  3RZF A;  1WE7 A;  2MBO A;  2O6V A;  1TGZ B;  4W9D A;  3ECI A;  4BBN C;  5IA7 A;  4KDL B;  3QX1 A;  1IP9 A;  3U30 A;  2BKF A;  1XD3 B;  1NDD A;  4PS3 A;  1V5T A;  2MLB A;  2N4F A;  1LQB A;  4BVU C;  1WI0 A;  1GJZ A;  1WFY A;  1RLF A;  1WJN A;  2DAJ A;  2CHW A;  2CHZ A;  3M62 B;  2MSE D;  3RT3 B;  2G3Q B;  4KSL C;  4FAD A;  5DPW A;  5CHW A;  2FCN A;  1WZ3 A;  1WX7 A;  2UWQ A;  2KLC A;  2PEA A;  4ZDV A;  3GZN I;  2R2Q A;  3OLM D;  2KJ6 A;  3Q3F A;  5JZE B;  2LI5 A;  1WY8 A;  3LJ3 A;  4HJK A;  2RPQ A;  3JSV B;  3U8Z A;  2IY1 B;  4IC7 B;  3UIO B;  3VHT C;  1M94 A;  2KWU B;  4AP4 C;  4GGQ A;  5AZG A;  2V1Y A;  3D32 A;  1E8X A;  2LRW A;  5D6J B;  4ZRJ A;  1SIF A;  4EKU A;  2FAZ A;  2C60 A;  2KTF A;  2LXC A;  3B0A A;  2L3Z A;  3PRM B;  3HIZ A;  2C5L C;  1PQS A;  2N1W A;  4W9I A;  4GXB A;  2ZEQ A;  4MSQ B;  3T8M A;  3N30 A;  1GC6 A;  2DHZ A;  4LJO B;  2C7N B;  2OOB B;  3APD A;  4PS8 A;  3W1Y A;  3NY5 A;  1UBQ A;  2MA9 B;  2K25 A;  4IG7 B;  4MDK E;  5J17 A;  4A3P A;  2LVO A;  1E8W A;  2I1K A;  4TKN A;  4M8N A;  4XZ4 A;  1LFD A;  2M8S A;  4MGI E;  3NZS A;  3BIN A;  4BKT A;  4JLC A;  2KN5 A;  4M0W B;  3QK0 A;  2FUH B;  2RGF A;  4II2 B;  1Z5S B;  2CKH B;  3IBE A;  3R66 C;  4G3X B;  2KMA A;  2JRI B;  4OVV A;  1WXS A;  3ZDT A;  4ZRI A;  2ZVO A;  2JZ3 B;  1Z2M A;  2MRP A;  2V3S A;  3WA0 A;  1WGR A;  2PPH A;  3VAW A;  3B1L X;  4B9K A;  1GUA B;  3PPA A;  2ZNV B;  3PRP B;  1A5R A;  5KHO A;  5E6P A;  2WYQ A;  2D07 B;  4ANV A;  1UZX B;  2DEN B;  3K9P B;  1GG3 A;  3PV1 A;  4HWI B;  3A9K B;  1IYF A;  4DDG D;  3B08 A;  4K7W A;  3DBH I;  2LVP A;  3V6C B;  2KD0 A;  2M1M A;  3DDC B;  4WJP A;  3H7S A;  1YX6 B;  3CF6 E;  4JL9 A;  3MTN B;  3ONS A;  3ZTC A;  4NQK E;  2D3G A;  3WAN A;  4AUQ C;  3W1S C;  4WJO A;  2CU1 A;  2FCM A;  5BO4 B;  3PT2 B;  1WJ4 A;  1YJ1 A;  1OQY A;  1BT0 A;  2GBR A;  4BKS D;  1SGH A;  3M95 A;  4NAW B;  3ZO5 B;  4BOZ B;  4IUM B;  2N7D A;  3BY4 B;  1QZE A;  2IBI B;  4W9H A;  4NY0 A;  4DHZ B;  1S3S G;  3VUW A;  1MG8 A;  1U4A A;  2ASQ A;  3DVN V;  3ZNG C;  1WGH A;  3AI5 A;  4HVB A;  1OEY A;  3JW0 X;  4KIK B;  3WAP A;  1P1A A;  3PGE A;  1C1Y B;  1WM3 A;  3L0W B;  2DYM A;  3H7P A;  2JY6 A;  3HHM A;  2D2Q A;  5L83 A;  3NHE B;  3TCA A;  3QC8 B;  2Z0E B;  4IWO A;  3C0R B;  2ZPY A;  2O6V B;  1KM7 A;  2A4Z A;  1NBF C;  1XT9 B;  3QCA A;  4JIO U;  1AAR A;  3VTU A;  3QJZ A;  2JPH A;  2K6Q A;  4K1R B;  2XBB C;  3ALB A;  3ML9 A;  1UEL A;  2QHO A;  2JXX A;  2O6V D;  1WH3 A;  3VFK A;  2KFK A;  1L2N A;  1P3Q U;  4LJP B;  1E7U A;  3W1S A;  1H8C A;  2LGD A;  2R2O A;  2NBU A;  2DAF A;  4GDK A;  2KQS A;  4W9K A;  3PSE B;  3L08 A;  1OTR B;  1WGD A;  2B3A A;  4CO7 A;  2DYO A;  1D3Z A;  2O2V B;  3OAW A;  4HCP B;  3VH3 B;  2C7H A;  2FIF A;  1WMH A;  4AWJ A;  4BFR A;  4F7Z A;  5E6O A;  2ZPN A;  1EF5 A;  2KXJ A;  4WAA A;  5J18 A;  3EEC A;  4B6W A;  3R7Q A;  3RUL A;  1V49 A;  5JH5 C;  1X1M A;  2EMS A;  4RM8 A;  4II3 B;  3CMM B;  2K8H A;  4I6P A;  2NVU I;  2KOX A;  1V2Y A;  4FJZ A;  2IO2 B;  2KDI A;  1JRU A;  2DX5 B;  3PS6 A;  2XEW A;  2MX2 A;  3A1Q A;  3OJ4 B;  4ANX A;  1LM8 B;  3K9O B;  4CHK A;  2N9E B;  5D2M B;  4HDO A;  3RYT A;  5CHF A;  1UGM A;  1TBE A;  3VVW B;  1EF1 A;  4RM9 A;  2CS4 A;  1E90 A;  4WQO B;  2KWV B;  3ZRF A;  2WX1 A;  2HTH A;  4W9F A;  3UQA A;  2KTR B;  2PE9 A;  3KUD B;  2NPT A;  4DHZ E;  3RCZ A;  4BOS C;  3T9L A;  5D7G A;  3UGB B;  2REX A;  4E71 A;  3ZKJ C;  2A5U A;  4HPM B;  3VH4 B;  2JWZ A;  3WAO A;  5HKH A;  2AL6 A;  4WWP A;  1J8C A;  2DZJ A;  3GOE A;  3SDL C;  2ZZP B;  2ZCB A;  2KX3 A;  1K8R B;  2XK5 B;  3SD5 A;  4DK5 A;  5J2R A;  3QHT A;  4TUU A;  2L00 B;  1E7V A;  2LGX A;  2WDT B;  4WWO A;  5GMV A;  4PS7 A;  5CTR C;  3A9J B;  1VCB A;  4EZJ A;  4NQL B;  2KO3 A;  3RD2 A;  4ASW C;  4GDL B;  3HK0 A;  4MM3 A;  2NBV B;  4WJN A;  3I3T B;  3N3K B;  3JSV A;  2KC1 A;  4W9E A;  2NBW B;  3V62 A;  3SHQ A;  3IFW B;  3P2B A;  3ENE A;  4ICU A;  4IM0 A;  2EKE C;  2KQ7 A;  3M3J A;  5AZH A;  3TIX A;  4P7I A;  5C23 A;  4MJS A;  2BWE S;  3EFU A;  1FXT B;  1WJU A;  2BKR B;  3UIN B;  2G4S A;  2L76 A;  1Q0W B;  3KH0 A;  2KMC A;  3AXC A;  4G11 A;  1NI2 A;  2RD0 A;  3VXW A;  4I6N B;  4G50 A;  4XC2 A;  2V4L A;  3CST A;  3IHP C;  3OJ3 A;  3QQ8 B;  4DHJ D;  4FBJ B;  4IWP A;  3KW5 B;  3LDZ E;  3SU8 X;  4KDI C;  5LXI B;  2G4D B;  3ZLZ A;  2HJ8 A;  1C3T A;  3ZVV A;  3DVG Y;  2L0T A;  4YL8 A;  2M0X A;  3H7P B;  3ZNH B;  1G6J A;  1EUV B;  3DVN U;  4FLH A;  3APF A;  4MSM B;  1VD2 A;  2FCS A;  3PTF C;  2UYZ B;  2Y5B B;  2IYD B;  2N1V A;  1EO6 A;  4A20 A;  4FJY A;  1RRB A;  1WF9 A;  2YLM A;  3KUC B;  1R4N I;  2AEH A;  3PLV A;  4GSW A;  4PYZ A;  2N9P C;  3EC8 A;  2GBN A;  2FCQ A;  2VRR B;  4W9G A;  3VTV A;  4DDI D;  4PYU A;  3A9K A;  4AOF A;  2LWP A;  1ZW7 A;  2G45 B;  3DBS A;  4F8C B;  4HLE A;  1WGG A;  4E3C A;  2JF5 A;  2PE6 B;  1RAX A;  2W9N A;  3DBL I;  4W9C A;  2C7M B;  4GU2 A;  4URK A;  2WWZ A;  2NS5 A;  2NCN A;  4NJ7 A;  5LXH A;  2LZ6 A;  1IPG A;  1WX8 A;  2EMT A;  4FUL A;  4CYE A;  3NS8 A;  3L13 A;  1TTN A;  2MP2 A;  3ZIM A;  2Z0D B;  4KSK C;  2J0M A;  1T0Y A;  1E8Y A;  2DZM A;  4FN2 A;  4E74 A;  1P98 A;  5TR5 A;  2K8C A;  1KLV A;  4I6L B;  3H1U A;  2AL3 A;  2BYV E;  1GC7 A;  3PHW B;  3MJW A;  3PVL A;  1YIW A;  2LD9 A;  3DQV A;  2YVC A;  1WE6 A;  4B95 A;  5DPS A;  3L54 A;  2KWC A;  1R4M I;  3QIJ A;  3VTW A;  4EOY A;  4W9J A;  4F1S A;  2IO3 B;  2PJH A;  4XX5 A;  3X23 A;  1S1Q B;  2MBB B;  2C9W B;  2MBE A;  1LXD A;  4DXA B;  1YX5 B;  2K1F A;  1UBI A;  3A33 B;  1KOT A;  2M4N A;  5AZF A;  1SE9 A;  1V5O A;  2N7E A;  3AU4 A;  4IW0 A;  2DYB A;  2AWT A;  3PLU A;  4KVG B;  2JZZ A;  4KZ0 A;  3KYD D;  3A4R A;  3IVF A;  1J19 A;  1L7Y A;  4EEW A;  2D11 A;  2NPT B;  4K7S A;  3KUZ A;  2BPS A;  3VDZ A;  2JVC A;  4AJY B;  3X0W A;  4WJQ A;  4RMA A;  1J0G A;  1WXM A;  5AEK B;  2CR5 A;  2MBQ A;  5L95 C;  3ZNI D;  1YD8 U;  2LRU A;  2LAS A;  2MWS B;  2LJ5 A;  4MGK E;  2L05 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...