2L7RA

Solution nmr structure of n-terminal ubiquitin-like domain of fubi, a ribosomal protein s30 precursor from homo sapiens. northeast structural genomics consortium (nesg) target hr6166
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin-like protein FUBI
publication title Solution NMR structure of N-terminal Ubiquitin-like domain of FUBI, a ribosomal protein S30 precursor from Homo sapiens. NorthEast Structural Genomics consortium (NESG) target HR6166
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l7rA00
3VDZA 1UBIA 4B6WA 5AEKB 2JVCA 2WX1A 2FUHB 4WJQA 3Q3JA 2JRIB 2YVCA 3ZTDA 3ZVVA 1E7VA 2MBQA 1L7YA 4B95A 1OQYA 2NVUI 4IWQA 3B08A 2KO3A 5D7GA 1WXMA 3VAWA 4DHZB 1GG3A 3OJ3A 3VUWA 4FHJA 3QCAA 4II2B 2V4LA 2ZCCA 5KHQA 2W9NA 3PSEB 1YQBA 3PLUA 3SD5A 4IC7B 3DVNU 3AU5A 4II3B 1AARA 3ZNZB 4EZKA 2K39A 3KYDD 2N9PC 4DDID 5E6PA 1P3QU 1LFDA 5BO4B 4BKTA 4WJNA 1WGGA 1NI2A 3CSFA 4IUMB 1UH6A 3UGBB 3QC8B 2D07B 2MP2B 3BY4B 1V6EA 5FR6A 4JGHB 2LXCA 1V2YA 2MBHA 3R3MA 3JVZX 1EF1A 3BINA 3QK0A 4FJYA 3WA0A 4EOYA 1WY8A 3PV1A 2AEHA 4N9F4 3ZDTA 3EFUA 4MGIE 4MSMB 4TKNA 5D6JB 2IBIB 3DVGY 1V49A 3QJZA 2MP2A 2KXJA 2JY6A 3TMPB 5CX3A 3KYCD 5LXHA 2Z59B 4I6LB 2AL3A 3PRZA 5KHOA 2AL6A 4BKSA 2KDBA 1ZW7A 3AXCA 1WJ6A 2K6DB 1OEYJ 2DX5B 3VTVA 4ANXA 2K8HA 2O6VB 4GIVA 5LLIA 1FXTB 3DBSA 5J2RA 3R7RA 5DPTA 4I6NB 4IM2A 3Q3FA 4NQLB 1WGRA 2J0MA 3GZNI 2NBVB 2G3QB 1TZ1A 2MLBA 3SDLC 2O6VA 4MH0E 3V60A 3DVGX 1ISNA 3ML9A 3ZUNA 2ZVOA 3VH3B 2V1YA 2M17A 2WYQA 3JW0X 4DWFA 2KLGA 2IO3B 4BVUC 3L0WB 2ZEQA 1XQQA 4GOCA 5IAAC 1PQSA 3ML8A 1YX5B 2LRWA 4K81A 2JUOA 2DYOA 3X23A 1T0YA 4NY0A 4DK5A 4KV2A 4BKGA 2LVOA 2NPTB 3NZSA 4IM3A 4FHKA 4NAWB 2KX0A 3V62A 2GBRA 3QX1A 4WWOA 2AWTA 4FJVB 4DBGA 3T9LA 2KMCA 3M3JA 1Z5SB 5J18A 4LCDE 4M8NA 3L08A 4AUQC 3ZTCA 3M63B 4GB9A 4NAWA 5LXIB 2K25A 2NR2A 2JPHA 3APCA 2N1WA 1RLFA 1Q5WB 4ANUA 4WQOB 4F8CB 2WWZA 2LGYA 2KANA 5DPSA 2G4SA 4KVGB 1IP9A 4KSKC 3VH4B 2R2QA 3ECIA 2MWSB 4ZRKA 1TBEA 4F7ZA 1GC7A 2D2QA 2DZMA 2KC2A 5AZHA 3IFWB 1R4MI 1Z2MA 1IYFA 4JLCA 2OOBB 4WAAA 4FADA 2N9XA 4F1SA 2NBUA 1P9DU 2D10A 1GC6A 2C7NB 2GOWA 3KUZA 3NS8A 3EC8A 4IW0A 3LJ3A 1L2NA 2G45B 1V5OA 1WZ3A 2KK8A 2KZRA 3CF6E 1NDDA 4XX5A 3VXWA 5JH5C 4DHZE 1LQBA 3A4SC 2EMSA 1QZEA 3S2AA 1WX9A 2ZZPB 2DAFA 1LXDA 3APFA 1WXSA 4RM9A 3L17A 4EZJA 2PJHA 2ZPYA 4HJKA 2N1VA 2EMTA 4DHJD 2LGXA 1YJ1A 1WX8A 4YL8A 2RD0A 1VCBA 1V80A 2Y5BB 4HVBA 2PE9A 1MG8A 3ZRFA 2GBNA 3IVFA 2KTRB 2L76A 2LI5A 3QWZB 2I1JA 3L10B 3QARA 2BYVE 1NBFC 2KD0A 4MEMA 3OAWA 1WM3A 1WGHA 1U4AA 3ZNID 3ZDMC 2G4DB 3V6CB 3U7DA 3HM6X 1EUVB 2J0JA 1H4RA 2WX0A 4BBNF 3L54A 2N7DA 3TJPA 4NJ6A 2ZCBA 4GDLB 4HLEA 5C1ZA 1M94A 4ICUA 2IY0B 4HDQA 2BGFA 1J19A 2ZNVC 3ALBA 4MELA 2KFJA 4ZRIA 3X0WA 2FCNA 3MJWA 2KMAA 3PRPB 4GDLA 1UD7A 4AOFA 3UQAA 2A4ZA 4G11A 2L7RA 2MRPA 3QQ8B 5CHFA 3P2BA 4GXBA 3RZWC 4FA6A 3ZNHB 4EFOA 2VRRB 2WDTB 3A1QB 2CKHB 4PS3A 2JRHA 4CO7A 1E8ZA 1WX7A 4WJPA 1UZXB 5TR5A 4HPLB 1E8WA 1G6JA 2PE6B 1WRDB 3ONSA 2IO0B 4ANVA 2KJ6A 2ZVNA 3DBHI 2C60A 3T8MA 4DHJB 4W9HA 1WF9A 3H7PB 3QA8A 4XZ4A 1V9JA 3TBLD 3B0AA 1KM7A 4FBJB 3D32A 2KQ7A 2MBOA 2PEAA 3KVFB 1GNUA 2M0XA 4AJYB 1GUAB 2JZ3B 1WGDA 4OVVA 4A3PA 3B1LX 4G50A 4ZDVA 3IG3A 1KLVA 4NQKE 3H7PA 3K9PB 3QAQA 2BF8B 2BYEA 2MBBB 4EEWA 3LDZE 1KOTA 3ZNGC 2MBEA 2K8CA 4HK2A 2KJRA 3WALA 1C3TA 3RUIB 2MCNB 4CYEA 3PTFC 5HKHA 3AU4A 3RCZA 4EUTA 3PHXB 3MTNB 3JYUA 2K8BA 2L8JA 4NPNA 4G3XB 1Q0WB 2KJHB 3UQBA 3VTUA 1P98A 3NHEB 2A5UA 2CHWA 3ZW3A 2L0FA 4MJSB 3VQIA 1KJTA 3MHSD 4KDLB 3N30A 1RFAA 4WJOA 3V6EB 4DXAB 4TQ0A 2DHZA 4FLHA 1EO6A 1Q1OA 1UGMA 3QHTA 1WJUA 1WFYA 1UBQA 4GDKB 4E74A 4FULA 2ASQA 4K1RB 4JL9A 4MJSA 2DYBA 4W9EA 2KLCA 2NPTA 1YX6B 2LJ5A 2PPHA 1UELA 2IY1B 2Z0EB 5JZEB 4URKA 4LDTD 1GJZA 3KUCB 4IWPA 5D2MB 2KDFB 2BYFA 2KN5A 1R4NI 1H8CA 3N32A 5L83A 5DPWA 1J0GA 2C9WB 4GDKA 3UIPB 3U30A 3DQVA 3ZIMA 4HDOA 2DZKA 2J0KA 2N7EA 1WYWB 1Y8RC 3R66C 3ZLZA 2I1KA 2GBJA 4KZCA 3DCGA 1VD2A 4ASWC 4GGQA 1V81A 4KDIC 3UINB 2D3GA 3APDA 2IZVB 1HE8A 2GBMA 3HHMA 2LD9A 3I3TB 3PHWB 4KIKB 2L0TA 2CS4A 1WJNA 3DDCB 3WANA 2M8SA 3W1SC 2UWQA 2HE7A 1E7UA 4B9KA 1V86A 5IA7A 1WI0A 2YLMA 2FNJB 3EECA 4KIKA 5DPRA 1K8RB 3WIMA 3DOWA 2CR5A 4M0WB 2HTHA 3W1YA 2GBKA 1WR1A 4MGYE 1WJ4A 3R7QA 2LRUA 2FCMA 5DCNA 2DENB 1E8YA 3PS6A 3TL5A 4W9KA 3NOBA 3HK0A 4W9FA 2KWVB 4PYZA 3DBLI 3KH0A 4HXDA 4W9IA 5CHVC 2C7MB 3PT2B 4MGZE 1WGYA 3VVWB 2K1FA 3PRMB 1WE6A 2N9EB 2JF5A 1WR6E 1RAXA 4ZRJA 3QIJA 3ZO5B 4BFRA 2L05A 2L00B 3EHVA 2KTRA 2KDEB 2ZPNA 3GOEA 2KDIA 1EF5A 2LWPA 2REXA 3PZDA 4NNJB 4HCPB 3WAOA 2KKCA 3OJ4B 4LDTB 2N4FA 2HJ8A 1E5WA 3ZKJC 2KHWB 3O65B 3TCAA 5AZGA 1YD8U 3A9KB 1IPGA 1LM8B 3PPAA 4MSQB 4J6IA 2V3SA 4E71A 3AULA 3HM3A 3WAPA 2KNBA 3H9DA 5L95C 4W9JA 2KFKB 4ZYNA 5EDSA 2RR9A 1WMHB 1RRBA 3A33B 5AZFA 1A5RA 2MSED 5CTRC 2J7QB 2O2VB 3A9KA 3L16A 5G55A 3DBRI 4WWPA 1D3ZA 2KTFA 1ZKHA 4I6PA 2KFKA 2BWES 3IBEA 4PYUA 2FIDA 3CSTA 1XD3B 1WMHA 2BPSA 2IYDB 1SGHA 4LJOB 2KWCA 4JIOU 1F9JA 2GMIC 4PS7A 2JXXA 4GMVA 2O2VA 3M95A 2CHZA 2FCQA 2NS5A 3PLVA 3A1QA 4LJPB 4JQWC 3L13A 3UF8A 3DPDA 3ENEA 2M1MA 2MA9B 4BBNC 4W9GA 2KQSA 3RULA 1OTRB 1WXAA 1XT9B 1OGWA 3A4RA 4GN1A 2IO2B 4IM0A 4MDKE 4BOSC 5JHBA 4KZ0A 2D11A 4E3CA 1CMXB 1ZGUB 2EKEC 2RPQA 1WH3A 3K9OB 3TIXA 2CHXA 3UIOB 4ANWA 5G2NA 4CHKA 3C0RB 3PVLA 4TUUA 2LGDA 2L3ZA 1OEYA 2MX2A 1S3SG 5C23A 3PREA 3CMMB 1E90A 2K6QA 4X57B 1SE9A 2BWFA 4AJWA 2CU1A 2AYOB 4EZLA 3AI5A 4FN2A 4FJZA 3VUXA 2C7HA 3N3KB 2LVQA 4ICVA 2XBBC 4K7WA 1TTNA 3PGEA 2LXAA 3V61A 5GMVA 2RSUA 3KUDB 1C1YB 3DVNV 5E6OA 3VTWA 1WXVA 4A20A 2FAZA 2BKRB 3VUYA 4XC2A 2LASA 3OLMD 1E8XA 4WWNA 4W9CA 2KWUB 3ZRCA 4PS8A 2XK5B 3NY5A 2XEWA 3W1SA 4BOZB 4K7SA 4AP4C 4RM8A 1V5TA 2MQJA 1TGZB 2LZ6A 3M62B 1P0RA 2MW5A 5CHWA 4W9DA 3VFKA 2JZZA 3U8ZA 4IG7B 2Z0DB 4NJ7A 3A9JB 3NZUA 2DYMA 2XK5A 5D94A 2NBWB 1BT0A 4IWOA 1J8CA 1I35A 4HCNB 4K7UA 5J17A 4W9LA 4HPMB 3VHTC 2BKFA 2ZJDA 3RT3B 3WAMA 2FCSA 2DAJA 5JHAA 2JWZA 2FIFA 2KX3A 2R2OA 1S1QB 1WE7A 2RGFA 3A9JA 4P7IA 2LVPA 4GSWA 2NCNA 4EKUA 1WM2A 3SU8X 1WZ0A 4BKSD 3H1UA 3RZFA 2HD5B 2UYZB 2B3AA 4DDGD 2DZIA 1P1AA 2KVRA 2LUEA 3JSVB 1WIAA 5E6NA 3RYTA 2M4NA 3SHQA 4RMAA 4TQ1A 3KW5B 4KSLC 2ZNVB 1I42A 1X1MA 2IO1B 1SIFA 3H7SA 4M8MA 4OVUA 3H6NA 4GU2A 4A3OA 3RD2A 3HIZA 1YIWA 1JRUA 2OJRA 2DZJA 2JT4B 4HWIB 4MGKE 4TV3A 4G0NB 3JSVA 2O6VD 2QHOA 2C5LC 2KOXA 4MM3A 4AWJA 2KC1A 3IHPC
chains in the Genus database with same CATH superfamily
4B6WA 1HEZE 1UBIA 3BVZA 4LLGM 2FUHB 4M02A 3Q3JA 2MBQA 4B95A 5D7GA 1YN4A 3RN9C 1FO4A 2WXKA 3KLSX 2W9NA 4ITKA 1YQBA 2GLSA 4C56C 5IKCM 3AU5A 3ZNZB 1T6BX 4EZKA 4DDID 5E6PA 1F0ZA 1P3QU 1V8CA 5BO4B 3CSFA 4IUMB 3UGBB 3BY4B 2KDMA 2MBHA 3R3MA 3BINA 3WA0A 3DBLB 3PV1A 5I4DA 2AEHA 2BS4B 3ZDTA 3EFUA 4JWUC 1E9MA 1KH0A 5LNK1 3EA6A 2MP2A 2JY6A 3BYYB 3Q69A 4I6LB 2AL3A 1FNWA 4JPSA 2ZW0A 2DX5B 2K8HA 3DBSA 3ZXRA 5J2RA 3Q3FA 4NQLB 2SAKA 3SDLC 4MH0E 1E10A 3DVGX 1VDVA 1P7FA 2KLGA 2R61A 2IO3B 2PLPA 4GOCA 3ML8A 5TSSA 2JZPA 3ZJTA 2JUOA 1N63A 2BB5A 4NY0A 2NPTB 1NYRA 4IM3A 1SJHD 4DBGA 3T9LA 5J18A 1L6UA 3ZTCA 2BBCA 1ET6A 4GB9A 1NEKB 3GZNB 2K25A 2NR2A 2OEDA 5DPSA 1ET9A 5HFYA 4ZRKA 1GC7A 2D2QA 2KC2A 2YEPB 2WXPA 1R4MI 4JLCA 2OOBB 4FADA 2PVOD 4F1SA 1GC6A 3KUZA 1L2NA 4IW0A 2G45B 4ZRQA 1WZ3A 1TY0A 1SJED 1NDDA 2WXRA 3U4EG 4RFBA 4WAFA 1WX9A 5FK9C 4M00A 1BMLC 4Q2JA 2N1VA 1WX8A 4HVBA 2KTRB 2L76A 2I1JA 1NBFC 3LB8C 2KD0A 2BTEA 3U2SC 1RM6C 4BAXA 3U7DA 1VJKA 4JX1C 2ZCBA 2KAJA 4HLEA 5C1ZA 2LGIA 1M94A 4ARIA 4ICUA 4HDQA 3ALBA 4GLSC 4RGNA 4WURA 1PFDA 4NJCA 3IAS1 4C7YA 3BK2A 2KT7A 4G11A 1PUTA 3RZWC 4FA6A 1I4RA 3ZNHB 2CKHB 1IUEA 1QQRA 1SXTA 1D4BA 3DHIC 2DNFA 3GP7A 2WHIA 3RPFC 4ANVA 3BVGA 2ZVNA 4W9HA 3H7PB 1N60A 1VZ6A 3D32A 2MBOA 3P4QB 3TSSA 2JZ3B 1OFFA 5G5HA 4OVVA 2K0PA 2INDC 2BYEA 3LDZE 3PTFC 4US9A 2K8BA 3HUIA 4G3XB 2KJHB 1P98A 2MJDA 3NHEB 2A5UA 2M0AA 3VQIA 2QSDA 4KDLB 3GE3C 4XWTA 4WJOA 4LNFA 4PT5A 2IGHA 3BYTB 2WXNA 2DYBA 2KLCA 2IY1B 4URKA 1GJZA 2ZW1A 1MFWA 5DPWA 1J0GA 2C9WB 3DQVA 3MC9A 2J0KA 2I1KA 4GGQA 4KDIC 4RH6A 2D3GA 4DXFA 2IZVB 2WDVB 3KWVA 2CS4A 1WJNA 3DDCB 1TS4A 3TUOA 2UWQA 4B9KA 3IT6B 2FNJB 3WIMA 1JWUD 2CR5A 3W1YA 1R7SA 2GBKA 2KYWA 3R7QA 2LRUA 2DENB 4W9KA 1I7HA 3TEXA 4PYZA 1NYQA 2HTME 5CHVC 3PT2B 4MGZE 1WR6E 1RAXA 3ZO5B 1VLBA 2L00B 2MJEA 4HKZE 1HA5A 3GB1A 5D3DA 1EF5A 3R2IA 1V1PB 2N4FA 2KACA 3ZKJC 4PK1A 3O65B 3DHGC 5AZGA 1BUIC 5L95C 5EE0A 1QILA 3AN1A 4HJGE 5C3JB 1FMAD 5GXGB 4YWGG 2O2VB 4A6QA 4WWPA 2HJ1A 1D3ZA 2JWUA 4C4VB 4I6PA 2KFKA 3PZ7A 1KTKA 1XEEA 2IYDB 4KGRA 3NVYA 4XE0A 1J7BA 4WWMA 2FCQA 2NS5A 3A1QA 3CIRB 3DPDA 1STEA 3MJ5A 4LNKA 3A4RA 4GN1A 4BOSC 1MPEA 4KZ0A 5JHBA 3UI3A 3LYYA 2CHXA 4TUUA 2Y5PA 2MX2A 1ZXHA 5HG2A 3PREA 2K6QA 4A9AA 4FN2A 3R8BA 2D3AA 2NTSA 3RFZB 4WIPA 1MVKA 3V61A 5GMVA 2KVZA 1KRHA 1AW7A 1T5XD 1N61A 5E6OA 1WXVA 2W55A 4A20A 2FAZA 4OW0A 1WGKA 1FFVA 4AS1A 1FNUA 3NY5A 4N58A 1ENFA 2BVCA 4RM8A 3M62B 4LNNA 4IG7B 3E9SA 3NVZA 2Z0DB 4YSYB 3NZUA 2DYMA 2XK5A 4HCNB 1XLOA 2QC8A 1K52A 1GB4A 3HVDA 1WE7A 2RGFA 4TSSA 4P7IA 5HI1A 3RNAC 2NCNA 1WM2A 5EE1A 3H1UA 4DDGD 3KWLA 2KVRA 2LUEA 3SHQA 4RMAA 1X1MA 3AH7A 3H7SA 1GAQB 4KX6B 4M8MA 4GU2A 4OVUA 1IBXA 1ZE3D 3HIZA 2LEKA 4HWIB 4G0NB 2O6VD 2QHOA 4MM3A 3HRDD 3VDZA 4RF0A 1D6EC 4ZOHC 1MJDA 2JRIB 3ZVVA 1E7VA 1OQYA 3BVMA 3NRZA 2D5GA 3VAWA 1GG3A 3QCAA 2V4LA 5KHQA 3SD5A 2N9PC 1LFDA 4LTUA 1T0SC 2V9HA 1NI2A 1FXIA 2D07B 1VZ7A 3NVWA 5FR6A 1OQRA 3JVZX 2JXTA 1MHHE 1WY8A 4N9F4 4MGIE 4MSMB 4TKNA 2IBIB 1T3QA 1V49A 3QJZA 2KXJA 4HEA1 5CX3A 3KYCD 2MHJA 4BKSA 2KDBA 1D5MC 3V05A 1OEYJ 2O6VB 5LLIA 1FXTB 1C79A 2CJNA 2N0SB 4I6NB 3GE8C 1XCQL 2JX5A 4OHJA 4RGMA 1RYJA 2J0MA 1TZ1A 3FILB 4YXDB 4O1NA 1ISNA 3ML9A 3ZUNA 1DOYA 1GOZA 3AE9B 1QOGA 2ICIA 4UDUC 2J52A 3C8YA 3IAM1 2J4XA 4KGSA 4RCOA 1XQQA 1KLGD 3AE3B 5C2TB 1JROA 2LRWA 3AE6B 1T0YA 1K53A 4DK5A 1XO3A 4KV2A 3BIID 2N7JA 3Q3NC 1FXAA 4FJVB 3M3JA 1HZ6A 4LCDE 1OQQA 4AUQC 3SEBA 4USAA 5LXIB 1RLFA 1Q5WB 2WWZA 4TMAB 2KANA 2BW2A 2R2QA 2X8XX 2WLBA 2WXMA 1JRPA 4F7ZA 2DZMA 4K3BA 4AQ7A 3VRBB 2C7NB 3EC8A 4US8A 2BS3B 3VXWA 2YEPF 1NI3A 4DHZE 1YOVB 3A4SC 2EMSA 1QZEA 2ZZPB 1LXDA 5BMGA 1WXSA 1QOAA 4RM9A 4P16A 3P4SB 2PJHA 4EZJA 1UWXA 3AV8A 3AEFB 1K50A 2PIAA 1VCBA 2RD0A 2Y5BB 3ETRA 1UUPA 3IVFA 2LI5A 3L10B 3QARA 2BYVE 3OAWA 3V6CB 1EUVB 2J0JA 1H4RA 4BBNF 2KQ4X 4N59A 4GDLB 1R4MB 2JQRB 2MEKA 2IY0B 2BGFA 1J19A 4ZRIA 4A55A 3EFCA 1YN5A 3Q8FA 4YTPB 2KMAA 1N5XA 2A4ZA 2L7RA 2MRPA 5CHFA 3LXFA 4GXBA 2FBWB 2K3UA 1I4HA 2VRRB 1WX7A 1ROEA 1UZXB 4HPLB 1WRDB 3J9CA 2IO0B 3NZ3A 3DBHI 3T8MA 4XZ4A 1A70A 1V9JA 4MACA 1EM7A 3TBLD 1XCTL 4FBJB 2KN4A 1GNUA 2M0XA 4AJYB 3IG3A 1L6VA 4NQKE 3H7PA 4EEWA 3ZNGC 2RPVA 2MCNB 3MTNB 3JYUA 1Q0WB 1E7PB 3UQBA 2DWQA 4ACFA 1SEBD 2CHWA 4MJSB 1FD6A 1SSNA 3P42A 4L23A 1UBQA 4E74A 2H88B 4JL9A 2D3BA 4W9EA 1L0XB 4NZLB 1F2RI 1HXYD 1ZUD2 4LDTD 4C00A 3KUCB 1YJIA 2KN5A 1H8CA 2SEBD 4N6EB 3U30A 3H8HA 3AMZA 2DZKA 3R66C 1Y8RC 3ZXVA 2WXLA 4ASWC 2ON8A 2WXHA 5T8IA 4KIKB 4P6VF 2WNMA 4XYCA 3W1SC 2HE7A 1V86A 1ACCA 3OG5A 1K8RB 4M0WB 2AX5A 2JU6X 1WJ4A 2FCMA 1E8YA 3PS6A 3NOBA 3HK0A 2M56B 3P4PB 1PGBA 1TJEA 3DBLI 3BWUD 4HXDA 2C7MB 1WGYA 4ZRJA 3QIJA 4BFRA 2KDIA 3IT4B 1TZOA 2LWPA 3OJ4B 4LDTB 2WS3B 1MI0A 2KHWB 2FE8A 1V1OA 1YD8U 3A9KB 1LM8B 2LJIA 3EUB2 3AULA 3HM3A 1KLUD 1V1PA 1RRBA 3A33B 2MSED 3L16A 3AM9A 1TY2A 3DBRI 3NUHB 4PYUA 2FIDA 3CSTA 1SGHA 2JXXA 3Q8EA 2O2VA 3W5UB 2CHZA 3PLVA 4C4VA 4JQWC 3UF8A 1MG4A 3ENEA 2M1MA 1NENB 3RI7C 3RULA 3ZGZA 1OTRB 3VR9B 4MDKE 1QOFA 2G1EA 1EU3A 2K9XA 4CHKA 5G2NA 1OEYA 5C23A 1XLNA 1FCLA 1NVID 1L4ZB 1C76A 4ZRPA 1TS2A 3VUXA 3N3KB 2XBBC 5MPOA 2IGDA 2QCZA 1C1YB 3DVNV 1WXQA 3R2TA 3N1XC 4B0EA 1J7AA 1KFYB 1PGAA 3NJTA 1VZ8A 1WSPA 4XC2A 2LASA 1HQRD 3DWMA 3AEEB 3W1SA 2DLBA 2XNAC 3RNBC 4AP4C 5BYRA 3MC0B 1EU4A 2WXIA 2MW5A 3VFKA 2JZZA 3U8ZA 4NJ7A 3A9JB 1J8CA 2NBWB 1BT0A 4IWOA 4K7UA 1JWMD 5J17A 3RT3B 2DAJA 2JWZA 1S1QB 4B0MA 4CQNA 2V4IB 4EKUA 3SU8X 2HD5B 2B3AA 3AE5B 5BMIA 1P1AA 2AQ1B 4TQ1A 1C78A 1UF0A 2OJRA 3Q3OC 2JT4B 4MGKE 1R4NB 3N1YC 4TQ0A 3I57A 2KC1A 3IHPC 1F77A 5H92C 1ZP0B 2JVCA 4WJQA 2YVCA 1L7YA 1TKGA 2NVUI 4IWQA 4DHZB 4RGTA 4FHJA 5IN7A 2QDFA 3W2DA 2K39A 3EGRA 1ZDXA 1E0ZA 1QKZA 4WJNA 1UH6A 1FRRA 2LXCA 1V2YA 3QK0A 1Y56A 3TMPB 4L2YA 5LXHA 2Z59B 5KHOA 4XGAB 1C4AA 3Q6BA 1ZW7A 4GIVA 5DPTA 1JWBD 2PMVA 2V3PA 2NBVB 2MLBA 2O6VA 2ZVOA 2WGSA 2V1YA 4DWFA 4OZCA 4BVUC 3L0WB 2ZEQA 3AB5A 1FPYA 5E6JA 1PQSA 3X23A 1JQ4A 2QIEB 3BK1A 5EE3A 4BKGA 5AUIA 1PDXA 3NZSA 4NAWB 3QX1A 2QJLA 3N9YC 1JMLA 4M8NA 3L08A 2KWDA 2INPE 1WRIA 3M63B 2WU5B 2JPHA 1VR9A 3APCA 4ANUA 4F8CB 1XLQA 2E3TA 2G4SA 4KVGB 1IP9A 4KSKC 1AYFA 3ECIA 1N6ZA 1E6EB 1TBEA 4S0RA 1I4PA 4REZA 1Z2MA 4WAAA 2N9XA 1TS5A 2NBUA 2GOWA 3NS8A 1EWCA 3LJ3A 3CF6E 2KZRA 2BB6A 3S2AA 1FCCC 2DAFA 4HRSA 2ZPYA 2JYTA 4DHJD 1YJ1A 2BQQA 4YL8A 1MG8A 4MT5A 3ZRFA 2GBNA 3P63A 3QWZB 1WM3A 1XXGA 1PYWD 3ZNID 3ZDMC 4LNOA 3TEYA 2WX0A 2N7DA 3TJPA 1FNVA 3OWEB 3SR6A 3ZYYX 2W82A 5FR3A 3FKYA 3MFGA 2NMQA 2LGSA 2ZNVC 4MELA 3MJWA 4GDLA 1UD7A 3UQAA 3QQ8B 3P2BA 2QILA 2WDTB 3A1QB 4PS3A 2JRHA 4CO7A 2L1AA 1E8ZA 4WJPA 2PE6B 3ONSA 4RNAA 1TYGB 2KJ6A 2C60A 4DHJB 4YSZB 1WF9A 3QA8A 3B0AA 1HZ5A 2KQ7A 3KVFB 4IOIE 1UNSA 3W9CB 1WGDA 4A3PA 1ZPSA 4ZDVA 3DHHC 3K9PB 3QAQA 2BF8B 2MBBB 1KOTA 3P1MA 5BMHA 4HK2A 1C3TA 3RUIB 2LHDA 4CYEA 1SB3C 3AU4A 2L8JA 4NPNA 3TEWA 4JE3B 3ZW3A 2L0FA 1RFAA 4YTNB 4ZHOA 4MH8A 4LNIA 4DXAB 4ARCA 2DHZA 4FLHA 1EO6A 2UU7A 1WJUA 2VZKD 4GDKB 4FULA 4K1RB 4MJSA 4EE2A 2J42A 2NPTA 2PPHA 2LJ5A 1UELA 3DBHB 2L52A 4P1CC 5L83A 4NAMA 1TKYA 3ZIMA 3BZDB 4HDOA 4J3OD 2N7EA 1WYWB 2PW9A 4KZCA 3DCGA 1V81A 3AEAB 3APDA 1DYQA 2GBMA 3I9V1 3I3TB 3PHWB 2L0TA 3WANA 1L4DB 1WI0A 2YLMA 4KIKA 3DOWA 2WXGA 1WR1A 3AE4B 1LO5D 4IDIA 3TL5A 4MM3B 2G9HD 2RDGA 3AECB 1HTOA 2KWVB 4M0WA 2K1FA 3PRMB 1GB1A 2JF5A 2WU2B 2VZKB 3PO0A 3EHVA 2KTRA 4C80A 2REXA 3PZDA 2KKCA 3Q2AC 3MHZA 2M19A 1E5WA 1IGDA 3MP9A 3TCAA 1L5PA 4OZBA 3PPAA 4MSQB 4J6IA 4E71A 3WAPA 4ZYNA 5EDSA 2GI9A 4WH4A 1WMHB 2AQ3B 1L0YB 2WXJA 3A9KA 1JW9D 5G55A 2CJOA 2GRIA 2D3CA 1FM0D 1ZKHA 2BWES 2W3RA 3IBEA 4LJOB 2KWCA 1D5XC 1F9JA 1P7EA 4GMVA 1QF6A 3M95A 2EELA 3P4RB 3L13A 1B9RA 1C9FA 4W9GA 1WXAA 1OGWA 4IM0A 2IO2B 2L83A 2D11A 4E3CA 1CMXB 1ZGUB 2PVGC 3TIXA 1F1HA 2VH1A 3C0RB 1I4GA 2JSVX 2L3ZA 1S3SG 4X57B 1E90A 1SE9A 4AJWA 2CU1A 2AYOB 2W3SA 3AI5A 4EZLA 3DBRB 4FJZA 3N1ZC 2C7HA 3GS2A 2LVQA 4ICVA 4K7WA 4XDDA 1TTNA 3PGEA 2LXAA 2ACZB 2RSUA 1SIJA 4LK0M 3VTWA 3VUYA 3OLMD 4WWNA 2Y3AA 4W9CA 3ZRCA 2XEWA 1GPXA 5FKAC 3W5VB 2WDQB 1V5TA 2X38A 1TGZB 2LZ6A 5CHWA 1T0RC 3AEGB 2FUG1 1I35A 4W9LA 4HPMB 2BKFA 2ZJDA 3WAMA 2FIFA 2KX3A 4A8XC 3A9JA 2V0GA 3JSVB 4OZAA 3RYTA 2M4NA 2B76B 4KSLC 1C4PA 2ZNVB 1I42A 2IO1B 3ABVB 1SIFA 5JXVA 4A3OA 4H2AA 3O13A 2DZJA 3ZJVA 2KOXA 3RNEC 4XDCA 5AEKB 2WX1A 3AE7B 3ZTDA 3B08A 2KO3A 2XN9C 1WXMA 4FXCA 3OJ3A 1BXTA 3VUWA 4II2B 4YSXB 4HKQA 2ZCCA 2WXOA 3PSEB 3PLUA 4IC7B 3DVNU 1AN8A 2VH2A 1ZOYB 4II3B 1AARA 3KYDD 2WDRB 4BKTA 1WGGA 3QC8B 2MP2B 3AEDB 1V6EA 1XLPA 4D2KA 4L1BA 4JGHB 1EF1A 4FJYA 4EOYA 2HDEA 3C19A 5D6JB 1FIQA 3DVGY 4RF1A 3PRZA 2AL6A 2INCC 3U7ZA 3AXCA 1WJ6A 2K6DB 2KMMA 3VTVA 4ANXA 2Z8LA 1V97A 1K51A 3R7RA 4IM2A 2IDYA 1WGRA 3GZNI 2G3QB 4RGOS 1TKEA 3V60A 4M01A 1T0QC 3VH3B 5D3IB 4KKJA 1JCKB 2M17A 2WYQA 3JW0X 1FRDA 3T3OA 2H89B 2MJ3A 5IAAC 3E56A 5IO9A 1YX5B 4K81A 2DYOA 2WXFA 3PZ8A 3CWIA 3Q8BA 2LVOA 1RWSA 3I5JC 1DOIA 4FHKA 2IJ0A 2KX0A 3V62A 2GBRA 4WWOA 2AWTA 3SFEB 2KMCA 1Z5SB 3I63C 1UGJA 4NAWA 3WCQA 1F52A 2N1WA 4WQOB 2LGYA 4KGTA 3B2GA 1SE2A 3VH4B 3L4PA 2MWSB 4XWWA 5HHDG 1SE4A 1DGJA 5AZHA 3IFWB 1IYFA 1JWSD 4DQOC 1P9DU 2D10A 2TSSA 1V5OA 2KK8A 5JH5C 4XX5A 1LQBA 1CZPA 3APFA 1M4VA 3L17A 3FC4A 2WP9B 4HJKA 1HTQA 2EMTA 2LGXA 1FFUA 1XF5L 1V80A 2J53A 3RNCC 2PE9A 1AWDA 3URYA 4MEMA 1WGHA 1U4AA 1FEHA 2G4DB 4C7ZA 3HM6X 3L54A 4NJ6A 1WWTA 3B2FA 1I4QA 1QOBA 1DOXA 1SF0A 3X0WA 2KFJA 4P1BC 2FCNA 1PGXA 4KKIA 3DWGC 3PRPB 1YN3A 1F2RC 4AOFA 2IPKD 1ESFA 2Y5CA 1D5ZC 4EFOA 2PTLA 3MC8A 5TR5A 3AE8B 1E8WA 1G6JA 2ONQA 5EE9A 3RNFC 1I4XA 1SBBB 1LGRA 1KM7A 1YNTE 1QLBB 2PEAA 3RMKC 1GUAB 1VRAB 3B1LX 4G50A 3FAHA 2RDHA 4JWSC 1KLVA 3FILA 4ZYSA 2MBEA 2K8CA 2KJRA 3WALA 5HKHA 3RCZA 4EUTA 3PHXB 2I2YA 5IOIA 4YTMB 3VTUA 1SE3A 1KJTA 3MHSD 1N62A 3N30A 1YQ3B 2EKIA 3V6EB 1Q1OA 1CJEA 1UGMA 3QHTA 1WFYA 1IGCA 2ASQA 4QAYA 2LMCA 1UWMA 5JZEB 1YX6B 3VRAB 2Z0EB 4ZHPA 4IWPA 5D2MB 5BYQA 1N5WA 2KDFB 2BYFA 1R4NI 1YMHE 3N32A 2AQ2B 1ZDVA 4GDKA 3UIPB 5H8YE 1YJJA 3ZLZA 2GBJA 1VD2A 2K5PA 3UINB 2QEJC 1HE8A 3HHMA 2LD9A 2JYEA 2L32A 4HPPA 2CU3A 5IP4D 2M8SA 1E7UA 1TT5B 3NS1A 5IA7A 4YT0B 3ZQ4A 3EECA 2W54A 5DPRA 2E6XA 1B1ZA 4DXGA 2WQYB 2HTHA 3HVZA 4MGYE 4OVZA 5DCNA 3B9JA 2BS2B 2N9LA 2PKOA 4W9FA 1C4CA 3KH0A 4W9IA 3VVWB 5BYSA 1CK1A 1WE6A 2N9EB 2IGGA 2L05A 3ZJUA 1C77A 2KDEB 2ZPNA 3GOEA 2LUMA 4K3CA 2N9KA 1QT9A 4HCPB 4NNJB 3WAOA 2HJ8A 4R3DA 3Q8AA 1IPGA 2RDBC 2V3SA 1TIFA 2KNBA 3H9DA 4W9JA 2KFKB 2RR9A 5AZFA 1A5RA 1TS3A 4A90A 5CTRC 1JALA 2J7QB 3U52E 2RMMA 2KTFA 3VR8B 2MH7A 1XD3B 1WMHA 2BPSA 3AE2B 4JIOU 2GMIC 4PS7A 1ZXIA 2GB1A 1Q10A 2WXQA 2NTTA 3N20C 2DBYA 4LJPB 1CQVA 2MA9B 4BBNC 2KQSA 3TEZA 3Q14C 4S17A 1XT9B 2I38A 4BZAA 2EKEC 2RPQA 1WH3A 3K9OB 3UIOB 4ANWA 3PVLA 2LGDA 2LFIA 2LHEA 3KQ4A 3CMMB 2BWFA 2Q5WD 2OJWA 3V3XA 3RNGC 3NVVA 3KUDB 3IXSA 3Q3MC 2INNE 1J7CA 2BKRB 1E8XA 2KWUB 4PS8A 2XK5B 4BOZB 4K7SA 1RFKA 1JWAD 5AUKA 2K22A 2MQJA 1P0RA 4W9DA 1KF6B 3Q8CA 5D94A 2OHFA 2QMTA 3VHTC 1WYGA 3NG0A 2FCSA 5JHAA 2BT6A 2R2OA 3AEBB 4IKGA 3AE1B 2LVPA 4GSWA 3T3NA 1IBXB 1WZ0A 4BKSD 3RZFA 3SFDB 2UYZB 2DZIA 1WIAA 5E6NA 1EWYC 3KW5B 2V3NA 1YQ4B 3H6NA 4HROA 3RD2A 1YIWA 1L0VB 1JRUA 1MHXA 2BYTA 4TV3A 3JSVA 2C5LC 4AWJA 5G5GA 4WQMA
chains in the Genus database with same CATH topology
3VDZA 1UBIA 4B6WA 5AEKB 2JVCA 2WX1A 2FUHB 4WJQA 3Q3JA 2JRIB 2YVCA 3ZTDA 3ZVVA 1E7VA 2MBQA 1L7YA 4B95A 1OQYA 2NVUI 4IWQA 3B08A 2KO3A 5D7GA 1WXMA 3VAWA 4DHZB 1GG3A 3OJ3A 3VUWA 4FHJA 3QCAA 4II2B 2V4LA 2ZCCA 5KHQA 2W9NA 3PSEB 1YQBA 3PLUA 3SD5A 4IC7B 3DVNU 3AU5A 4II3B 1AARA 3ZNZB 4EZKA 2K39A 3KYDD 2N9PC 4DDID 5E6PA 1P3QU 1LFDA 5BO4B 4BKTA 4WJNA 1WGGA 1NI2A 3CSFA 4IUMB 1UH6A 3UGBB 3QC8B 2D07B 2MP2B 3BY4B 1V6EA 5FR6A 4JGHB 2LXCA 1V2YA 2MBHA 3R3MA 3JVZX 1EF1A 3BINA 3QK0A 4FJYA 3WA0A 4EOYA 1WY8A 3PV1A 2AEHA 4N9F4 3ZDTA 3EFUA 4MGIE 4MSMB 4TKNA 5D6JB 2IBIB 3DVGY 1V49A 3QJZA 2MP2A 2KXJA 2JY6A 3TMPB 5CX3A 3KYCD 5LXHA 2Z59B 4I6LB 2AL3A 3PRZA 5KHOA 2AL6A 4BKSA 2KDBA 1ZW7A 3AXCA 1WJ6A 2K6DB 1OEYJ 2DX5B 3VTVA 4ANXA 2K8HA 2O6VB 4GIVA 5LLIA 1FXTB 3DBSA 5J2RA 3R7RA 5DPTA 4I6NB 4IM2A 3Q3FA 4NQLB 1WGRA 2J0MA 3GZNI 2NBVB 2G3QB 1TZ1A 2MLBA 3SDLC 2O6VA 4MH0E 3V60A 3DVGX 1ISNA 3ML9A 3ZUNA 2ZVOA 3VH3B 2V1YA 2M17A 2WYQA 3JW0X 4DWFA 2KLGA 2IO3B 4BVUC 3L0WB 2ZEQA 1XQQA 4GOCA 5IAAC 1PQSA 3ML8A 1YX5B 2LRWA 4K81A 2JUOA 2DYOA 3X23A 1T0YA 4NY0A 4DK5A 4KV2A 4BKGA 2LVOA 2NPTB 3NZSA 4IM3A 4FHKA 4NAWB 2KX0A 3V62A 2GBRA 3QX1A 4WWOA 2AWTA 4FJVB 4DBGA 3T9LA 2KMCA 3M3JA 1Z5SB 5J18A 4LCDE 4M8NA 3L08A 4AUQC 3ZTCA 3M63B 4GB9A 4NAWA 5LXIB 2K25A 2NR2A 2JPHA 3APCA 2N1WA 1RLFA 1Q5WB 4ANUA 4WQOB 4F8CB 2WWZA 2LGYA 2KANA 5DPSA 2G4SA 4KVGB 1IP9A 4KSKC 3VH4B 2R2QA 3ECIA 2MWSB 4ZRKA 1TBEA 4F7ZA 1GC7A 2D2QA 2DZMA 2KC2A 5AZHA 3IFWB 1R4MI 1Z2MA 1IYFA 4JLCA 2OOBB 4WAAA 4FADA 2N9XA 4F1SA 2NBUA 1P9DU 2D10A 1GC6A 2C7NB 2GOWA 3KUZA 3NS8A 3EC8A 4IW0A 3LJ3A 1L2NA 2G45B 1V5OA 1WZ3A 2KK8A 2KZRA 3CF6E 1NDDA 4XX5A 3VXWA 5JH5C 4DHZE 1LQBA 3A4SC 2EMSA 1QZEA 3S2AA 1WX9A 2ZZPB 2DAFA 1LXDA 3APFA 1WXSA 4RM9A 3L17A 4EZJA 2PJHA 2ZPYA 4HJKA 2N1VA 2EMTA 4DHJD 2LGXA 1YJ1A 1WX8A 4YL8A 2RD0A 1VCBA 1V80A 2Y5BB 4HVBA 2PE9A 1MG8A 3ZRFA 2GBNA 3IVFA 2KTRB 2L76A 2LI5A 3QWZB 2I1JA 3L10B 3QARA 2BYVE 1NBFC 2KD0A 4MEMA 3OAWA 1WM3A 1WGHA 1U4AA 3ZNID 3ZDMC 2G4DB 3V6CB 3U7DA 3HM6X 1EUVB 2J0JA 1H4RA 2WX0A 4BBNF 3L54A 2N7DA 3TJPA 4NJ6A 2ZCBA 4GDLB 4HLEA 5C1ZA 1M94A 4ICUA 2IY0B 4HDQA 2BGFA 1J19A 2ZNVC 3ALBA 4MELA 2KFJA 4ZRIA 3X0WA 2FCNA 3MJWA 2KMAA 3PRPB 4GDLA 1UD7A 4AOFA 3UQAA 2A4ZA 4G11A 2L7RA 2MRPA 3QQ8B 5CHFA 3P2BA 4GXBA 3RZWC 4FA6A 3ZNHB 4EFOA 2VRRB 2WDTB 3A1QB 2CKHB 4PS3A 2JRHA 4CO7A 1E8ZA 1WX7A 4WJPA 1UZXB 5TR5A 4HPLB 1E8WA 1G6JA 2PE6B 1WRDB 3ONSA 2IO0B 4ANVA 2KJ6A 2ZVNA 3DBHI 2C60A 3T8MA 4DHJB 4W9HA 1WF9A 3H7PB 3QA8A 4XZ4A 1V9JA 3TBLD 3B0AA 1KM7A 4FBJB 3D32A 2KQ7A 2MBOA 2PEAA 3KVFB 1GNUA 2M0XA 4AJYB 1GUAB 2JZ3B 1WGDA 4OVVA 4A3PA 3B1LX 4G50A 4ZDVA 3IG3A 1KLVA 4NQKE 3H7PA 3K9PB 3QAQA 2BF8B 2BYEA 2MBBB 4EEWA 3LDZE 1KOTA 3ZNGC 2MBEA 2K8CA 4HK2A 2KJRA 3WALA 1C3TA 3RUIB 2MCNB 4CYEA 3PTFC 5HKHA 3AU4A 3RCZA 4EUTA 3PHXB 3MTNB 3JYUA 2K8BA 2L8JA 4NPNA 4G3XB 1Q0WB 2KJHB 3UQBA 3VTUA 1P98A 3NHEB 2A5UA 2CHWA 3ZW3A 2L0FA 4MJSB 3VQIA 1KJTA 3MHSD 4KDLB 3N30A 1RFAA 4WJOA 3V6EB 4DXAB 4TQ0A 2DHZA 4FLHA 1EO6A 1Q1OA 1UGMA 3QHTA 1WJUA 1WFYA 1UBQA 4GDKB 4E74A 4FULA 2ASQA 4K1RB 4JL9A 4MJSA 2DYBA 4W9EA 2KLCA 2NPTA 1YX6B 2LJ5A 2PPHA 1UELA 2IY1B 2Z0EB 5JZEB 4URKA 4LDTD 1GJZA 3KUCB 4IWPA 5D2MB 2KDFB 2BYFA 2KN5A 1R4NI 1H8CA 3N32A 5L83A 5DPWA 1J0GA 2C9WB 4GDKA 3UIPB 3U30A 3DQVA 3ZIMA 4HDOA 2DZKA 2J0KA 2N7EA 1WYWB 1Y8RC 3R66C 3ZLZA 2I1KA 2GBJA 4KZCA 3DCGA 1VD2A 4ASWC 4GGQA 1V81A 4KDIC 3UINB 2D3GA 3APDA 2IZVB 1HE8A 2GBMA 3HHMA 2LD9A 3I3TB 3PHWB 4KIKB 2L0TA 2CS4A 1WJNA 3DDCB 3WANA 2M8SA 3W1SC 2UWQA 2HE7A 1E7UA 4B9KA 1V86A 5IA7A 1WI0A 2YLMA 2FNJB 3EECA 4KIKA 5DPRA 1K8RB 3WIMA 3DOWA 2CR5A 4M0WB 2HTHA 3W1YA 2GBKA 1WR1A 4MGYE 1WJ4A 3R7QA 2LRUA 2FCMA 5DCNA 2DENB 1E8YA 3PS6A 3TL5A 4W9KA 3NOBA 3HK0A 4W9FA 2KWVB 4PYZA 3DBLI 3KH0A 4HXDA 4W9IA 5CHVC 2C7MB 3PT2B 4MGZE 1WGYA 3VVWB 2K1FA 3PRMB 1WE6A 2N9EB 2JF5A 1WR6E 1RAXA 4ZRJA 3QIJA 3ZO5B 4BFRA 2L05A 2L00B 3EHVA 2KTRA 2KDEB 2ZPNA 3GOEA 2KDIA 1EF5A 2LWPA 2REXA 3PZDA 4NNJB 4HCPB 3WAOA 2KKCA 3OJ4B 4LDTB 2N4FA 2HJ8A 1E5WA 3ZKJC 2KHWB 3O65B 3TCAA 5AZGA 1YD8U 3A9KB 1IPGA 1LM8B 3PPAA 4MSQB 4J6IA 2V3SA 4E71A 3AULA 3HM3A 3WAPA 2KNBA 3H9DA 5L95C 4W9JA 2KFKB 4ZYNA 5EDSA 2RR9A 1WMHB 1RRBA 3A33B 5AZFA 1A5RA 2MSED 5CTRC 2J7QB 2O2VB 3A9KA 3L16A 5G55A 3DBRI 4WWPA 1D3ZA 2KTFA 1ZKHA 4I6PA 2KFKA 2BWES 3IBEA 4PYUA 2FIDA 3CSTA 1XD3B 1WMHA 2BPSA 2IYDB 1SGHA 4LJOB 2KWCA 4JIOU 1F9JA 2GMIC 4PS7A 2JXXA 4GMVA 2O2VA 3M95A 2CHZA 2FCQA 2NS5A 3PLVA 3A1QA 4LJPB 4JQWC 3L13A 3UF8A 3DPDA 3ENEA 2M1MA 2MA9B 4BBNC 4W9GA 2KQSA 3RULA 1OTRB 1WXAA 1XT9B 1OGWA 3A4RA 4GN1A 2IO2B 4IM0A 4MDKE 4BOSC 5JHBA 4KZ0A 2D11A 4E3CA 1CMXB 1ZGUB 2EKEC 2RPQA 1WH3A 3K9OB 3TIXA 2CHXA 3UIOB 4ANWA 5G2NA 4CHKA 3C0RB 3PVLA 4TUUA 2LGDA 2L3ZA 1OEYA 2MX2A 1S3SG 5C23A 3PREA 3CMMB 1E90A 2K6QA 4X57B 1SE9A 2BWFA 4AJWA 2CU1A 2AYOB 4EZLA 3AI5A 4FN2A 4FJZA 3VUXA 2C7HA 3N3KB 2LVQA 4ICVA 2XBBC 4K7WA 1TTNA 3PGEA 2LXAA 3V61A 5GMVA 2RSUA 3KUDB 1C1YB 3DVNV 5E6OA 3VTWA 1WXVA 4A20A 2FAZA 2BKRB 3VUYA 4XC2A 2LASA 3OLMD 1E8XA 4WWNA 4W9CA 2KWUB 3ZRCA 4PS8A 2XK5B 3NY5A 2XEWA 3W1SA 4BOZB 4K7SA 4AP4C 4RM8A 1V5TA 2MQJA 1TGZB 2LZ6A 3M62B 1P0RA 2MW5A 5CHWA 4W9DA 3VFKA 2JZZA 3U8ZA 4IG7B 2Z0DB 4NJ7A 3A9JB 3NZUA 2DYMA 2XK5A 5D94A 2NBWB 1BT0A 4IWOA 1J8CA 1I35A 4HCNB 4K7UA 5J17A 4W9LA 4HPMB 3VHTC 2BKFA 2ZJDA 3RT3B 3WAMA 2FCSA 2DAJA 5JHAA 2JWZA 2FIFA 2KX3A 2R2OA 1S1QB 1WE7A 2RGFA 3A9JA 4P7IA 2LVPA 4GSWA 2NCNA 4EKUA 1WM2A 3SU8X 1WZ0A 4BKSD 3H1UA 3RZFA 2HD5B 2UYZB 2B3AA 4DDGD 2DZIA 1P1AA 2KVRA 2LUEA 3JSVB 1WIAA 5E6NA 3RYTA 2M4NA 3SHQA 4RMAA 4TQ1A 3KW5B 4KSLC 2ZNVB 1I42A 1X1MA 2IO1B 1SIFA 3H7SA 4M8MA 4OVUA 3H6NA 4GU2A 4A3OA 3RD2A 3HIZA 1YIWA 1JRUA 2OJRA 2DZJA 2JT4B 4HWIB 4MGKE 4TV3A 4G0NB 3JSVA 2O6VD 2QHOA 2C5LC 2KOXA 4MM3A 4AWJA 2KC1A 3IHPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VDZ A;  1UBI A;  4B6W A;  5AEK B;  2JVC A;  2WX1 A;  2FUH B;  4WJQ A;  3Q3J A;  2JRI B;  2YVC A;  3ZTD A;  3ZVV A;  1E7V A;  2MBQ A;  1L7Y A;  4B95 A;  1OQY A;  2NVU I;  4IWQ A;  3B08 A;  2KO3 A;  5D7G A;  1WXM A;  3VAW A;  4DHZ B;  1GG3 A;  3OJ3 A;  3VUW A;  4FHJ A;  3QCA A;  4II2 B;  2V4L A;  2ZCC A;  5KHQ A;  2W9N A;  3PSE B;  1YQB A;  3PLU A;  3SD5 A;  4IC7 B;  3DVN U;  3AU5 A;  4II3 B;  1AAR A;  3ZNZ B;  4EZK A;  2K39 A;  3KYD D;  2N9P C;  4DDI D;  5E6P A;  1P3Q U;  1LFD A;  5BO4 B;  4BKT A;  4WJN A;  1WGG A;  1NI2 A;  3CSF A;  4IUM B;  1UH6 A;  3UGB B;  3QC8 B;  2D07 B;  2MP2 B;  3BY4 B;  1V6E A;  5FR6 A;  4JGH B;  2LXC A;  1V2Y A;  2MBH A;  3R3M A;  3JVZ X;  1EF1 A;  3BIN A;  3QK0 A;  4FJY A;  3WA0 A;  4EOY A;  1WY8 A;  3PV1 A;  2AEH A;  4N9F 4;  3ZDT A;  3EFU A;  4MGI E;  4MSM B;  4TKN A;  5D6J B;  2IBI B;  3DVG Y;  1V49 A;  3QJZ A;  2MP2 A;  2KXJ A;  2JY6 A;  3TMP B;  5CX3 A;  3KYC D;  5LXH A;  2Z59 B;  4I6L B;  2AL3 A;  3PRZ A;  5KHO A;  2AL6 A;  4BKS A;  2KDB A;  1ZW7 A;  3AXC A;  1WJ6 A;  2K6D B;  1OEY J;  2DX5 B;  3VTV A;  4ANX A;  2K8H A;  2O6V B;  4GIV A;  5LLI A;  1FXT B;  3DBS A;  5J2R A;  3R7R A;  5DPT A;  4I6N B;  4IM2 A;  3Q3F A;  4NQL B;  1WGR A;  2J0M A;  3GZN I;  2NBV B;  2G3Q B;  1TZ1 A;  2MLB A;  3SDL C;  2O6V A;  4MH0 E;  3V60 A;  3DVG X;  1ISN A;  3ML9 A;  3ZUN A;  2ZVO A;  3VH3 B;  2V1Y A;  2M17 A;  2WYQ A;  3JW0 X;  4DWF A;  2KLG A;  2IO3 B;  4BVU C;  3L0W B;  2ZEQ A;  1XQQ A;  4GOC A;  5IAA C;  1PQS A;  3ML8 A;  1YX5 B;  2LRW A;  4K81 A;  2JUO A;  2DYO A;  3X23 A;  1T0Y A;  4NY0 A;  4DK5 A;  4KV2 A;  4BKG A;  2LVO A;  2NPT B;  3NZS A;  4IM3 A;  4FHK A;  4NAW B;  2KX0 A;  3V62 A;  2GBR A;  3QX1 A;  4WWO A;  2AWT A;  4FJV B;  4DBG A;  3T9L A;  2KMC A;  3M3J A;  1Z5S B;  5J18 A;  4LCD E;  4M8N A;  3L08 A;  4AUQ C;  3ZTC A;  3M63 B;  4GB9 A;  4NAW A;  5LXI B;  2K25 A;  2NR2 A;  2JPH A;  3APC A;  2N1W A;  1RLF A;  1Q5W B;  4ANU A;  4WQO B;  4F8C B;  2WWZ A;  2LGY A;  2KAN A;  5DPS A;  2G4S A;  4KVG B;  1IP9 A;  4KSK C;  3VH4 B;  2R2Q A;  3ECI A;  2MWS B;  4ZRK A;  1TBE A;  4F7Z A;  1GC7 A;  2D2Q A;  2DZM A;  2KC2 A;  5AZH A;  3IFW B;  1R4M I;  1Z2M A;  1IYF A;  4JLC A;  2OOB B;  4WAA A;  4FAD A;  2N9X A;  4F1S A;  2NBU A;  1P9D U;  2D10 A;  1GC6 A;  2C7N B;  2GOW A;  3KUZ A;  3NS8 A;  3EC8 A;  4IW0 A;  3LJ3 A;  1L2N A;  2G45 B;  1V5O A;  1WZ3 A;  2KK8 A;  2KZR A;  3CF6 E;  1NDD A;  4XX5 A;  3VXW A;  5JH5 C;  4DHZ E;  1LQB A;  3A4S C;  2EMS A;  1QZE A;  3S2A A;  1WX9 A;  2ZZP B;  2DAF A;  1LXD A;  3APF A;  1WXS A;  4RM9 A;  3L17 A;  4EZJ A;  2PJH A;  2ZPY A;  4HJK A;  2N1V A;  2EMT A;  4DHJ D;  2LGX A;  1YJ1 A;  1WX8 A;  4YL8 A;  2RD0 A;  1VCB A;  1V80 A;  2Y5B B;  4HVB A;  2PE9 A;  1MG8 A;  3ZRF A;  2GBN A;  3IVF A;  2KTR B;  2L76 A;  2LI5 A;  3QWZ B;  2I1J A;  3L10 B;  3QAR A;  2BYV E;  1NBF C;  2KD0 A;  4MEM A;  3OAW A;  1WM3 A;  1WGH A;  1U4A A;  3ZNI D;  3ZDM C;  2G4D B;  3V6C B;  3U7D A;  3HM6 X;  1EUV B;  2J0J A;  1H4R A;  2WX0 A;  4BBN F;  3L54 A;  2N7D A;  3TJP A;  4NJ6 A;  2ZCB A;  4GDL B;  4HLE A;  5C1Z A;  1M94 A;  4ICU A;  2IY0 B;  4HDQ A;  2BGF A;  1J19 A;  2ZNV C;  3ALB A;  4MEL A;  2KFJ A;  4ZRI A;  3X0W A;  2FCN A;  3MJW A;  2KMA A;  3PRP B;  4GDL A;  1UD7 A;  4AOF A;  3UQA A;  2A4Z A;  4G11 A;  2L7R A;  2MRP A;  3QQ8 B;  5CHF A;  3P2B A;  4GXB A;  3RZW C;  4FA6 A;  3ZNH B;  4EFO A;  2VRR B;  2WDT B;  3A1Q B;  2CKH B;  4PS3 A;  2JRH A;  4CO7 A;  1E8Z A;  1WX7 A;  4WJP A;  1UZX B;  5TR5 A;  4HPL B;  1E8W A;  1G6J A;  2PE6 B;  1WRD B;  3ONS A;  2IO0 B;  4ANV A;  2KJ6 A;  2ZVN A;  3DBH I;  2C60 A;  3T8M A;  4DHJ B;  4W9H A;  1WF9 A;  3H7P B;  3QA8 A;  4XZ4 A;  1V9J A;  3TBL D;  3B0A A;  1KM7 A;  4FBJ B;  3D32 A;  2KQ7 A;  2MBO A;  2PEA A;  3KVF B;  1GNU A;  2M0X A;  4AJY B;  1GUA B;  2JZ3 B;  1WGD A;  4OVV A;  4A3P A;  3B1L X;  4G50 A;  4ZDV A;  3IG3 A;  1KLV A;  4NQK E;  3H7P A;  3K9P B;  3QAQ A;  2BF8 B;  2BYE A;  2MBB B;  4EEW A;  3LDZ E;  1KOT A;  3ZNG C;  2MBE A;  2K8C A;  4HK2 A;  2KJR A;  3WAL A;  1C3T A;  3RUI B;  2MCN B;  4CYE A;  3PTF C;  5HKH A;  3AU4 A;  3RCZ A;  4EUT A;  3PHX B;  3MTN B;  3JYU A;  2K8B A;  2L8J A;  4NPN A;  4G3X B;  1Q0W B;  2KJH B;  3UQB A;  3VTU A;  1P98 A;  3NHE B;  2A5U A;  2CHW A;  3ZW3 A;  2L0F A;  4MJS B;  3VQI A;  1KJT A;  3MHS D;  4KDL B;  3N30 A;  1RFA A;  4WJO A;  3V6E B;  4DXA B;  4TQ0 A;  2DHZ A;  4FLH A;  1EO6 A;  1Q1O A;  1UGM A;  3QHT A;  1WJU A;  1WFY A;  1UBQ A;  4GDK B;  4E74 A;  4FUL A;  2ASQ A;  4K1R B;  4JL9 A;  4MJS A;  2DYB A;  4W9E A;  2KLC A;  2NPT A;  1YX6 B;  2LJ5 A;  2PPH A;  1UEL A;  2IY1 B;  2Z0E B;  5JZE B;  4URK A;  4LDT D;  1GJZ A;  3KUC B;  4IWP A;  5D2M B;  2KDF B;  2BYF A;  2KN5 A;  1R4N I;  1H8C A;  3N32 A;  5L83 A;  5DPW A;  1J0G A;  2C9W B;  4GDK A;  3UIP B;  3U30 A;  3DQV A;  3ZIM A;  4HDO A;  2DZK A;  2J0K A;  2N7E A;  1WYW B;  1Y8R C;  3R66 C;  3ZLZ A;  2I1K A;  2GBJ A;  4KZC A;  3DCG A;  1VD2 A;  4ASW C;  4GGQ A;  1V81 A;  4KDI C;  3UIN B;  2D3G A;  3APD A;  2IZV B;  1HE8 A;  2GBM A;  3HHM A;  2LD9 A;  3I3T B;  3PHW B;  4KIK B;  2L0T A;  2CS4 A;  1WJN A;  3DDC B;  3WAN A;  2M8S A;  3W1S C;  2UWQ A;  2HE7 A;  1E7U A;  4B9K A;  1V86 A;  5IA7 A;  1WI0 A;  2YLM A;  2FNJ B;  3EEC A;  4KIK A;  5DPR A;  1K8R B;  3WIM A;  3DOW A;  2CR5 A;  4M0W B;  2HTH A;  3W1Y A;  2GBK A;  1WR1 A;  4MGY E;  1WJ4 A;  3R7Q A;  2LRU A;  2FCM A;  5DCN A;  2DEN B;  1E8Y A;  3PS6 A;  3TL5 A;  4W9K A;  3NOB A;  3HK0 A;  4W9F A;  2KWV B;  4PYZ A;  3DBL I;  3KH0 A;  4HXD A;  4W9I A;  5CHV C;  2C7M B;  3PT2 B;  4MGZ E;  1WGY A;  3VVW B;  2K1F A;  3PRM B;  1WE6 A;  2N9E B;  2JF5 A;  1WR6 E;  1RAX A;  4ZRJ A;  3QIJ A;  3ZO5 B;  4BFR A;  2L05 A;  2L00 B;  3EHV A;  2KTR A;  2KDE B;  2ZPN A;  3GOE A;  2KDI A;  1EF5 A;  2LWP A;  2REX A;  3PZD A;  4NNJ B;  4HCP B;  3WAO A;  2KKC A;  3OJ4 B;  4LDT B;  2N4F A;  2HJ8 A;  1E5W A;  3ZKJ C;  2KHW B;  3O65 B;  3TCA A;  5AZG A;  1YD8 U;  3A9K B;  1IPG A;  1LM8 B;  3PPA A;  4MSQ B;  4J6I A;  2V3S A;  4E71 A;  3AUL A;  3HM3 A;  3WAP A;  2KNB A;  3H9D A;  5L95 C;  4W9J A;  2KFK B;  4ZYN A;  5EDS A;  2RR9 A;  1WMH B;  1RRB A;  3A33 B;  5AZF A;  1A5R A;  2MSE D;  5CTR C;  2J7Q B;  2O2V B;  3A9K A;  3L16 A;  5G55 A;  3DBR I;  4WWP A;  1D3Z A;  2KTF A;  1ZKH A;  4I6P A;  2KFK A;  2BWE S;  3IBE A;  4PYU A;  2FID A;  3CST A;  1XD3 B;  1WMH A;  2BPS A;  2IYD B;  1SGH A;  4LJO B;  2KWC A;  4JIO U;  1F9J A;  2GMI C;  4PS7 A;  2JXX A;  4GMV A;  2O2V A;  3M95 A;  2CHZ A;  2FCQ A;  2NS5 A;  3PLV A;  3A1Q A;  4LJP B;  4JQW C;  3L13 A;  3UF8 A;  3DPD A;  3ENE A;  2M1M A;  2MA9 B;  4BBN C;  4W9G A;  2KQS A;  3RUL A;  1OTR B;  1WXA A;  1XT9 B;  1OGW A;  3A4R A;  4GN1 A;  2IO2 B;  4IM0 A;  4MDK E;  4BOS C;  5JHB A;  4KZ0 A;  2D11 A;  4E3C A;  1CMX B;  1ZGU B;  2EKE C;  2RPQ A;  1WH3 A;  3K9O B;  3TIX A;  2CHX A;  3UIO B;  4ANW A;  5G2N A;  4CHK A;  3C0R B;  3PVL A;  4TUU A;  2LGD A;  2L3Z A;  1OEY A;  2MX2 A;  1S3S G;  5C23 A;  3PRE A;  3CMM B;  1E90 A;  2K6Q A;  4X57 B;  1SE9 A;  2BWF A;  4AJW A;  2CU1 A;  2AYO B;  4EZL A;  3AI5 A;  4FN2 A;  4FJZ A;  3VUX A;  2C7H A;  3N3K B;  2LVQ A;  4ICV A;  2XBB C;  4K7W A;  1TTN A;  3PGE A;  2LXA A;  3V61 A;  5GMV A;  2RSU A;  3KUD B;  1C1Y B;  3DVN V;  5E6O A;  3VTW A;  1WXV A;  4A20 A;  2FAZ A;  2BKR B;  3VUY A;  4XC2 A;  2LAS A;  3OLM D;  1E8X A;  4WWN A;  4W9C A;  2KWU B;  3ZRC A;  4PS8 A;  2XK5 B;  3NY5 A;  2XEW A;  3W1S A;  4BOZ B;  4K7S A;  4AP4 C;  4RM8 A;  1V5T A;  2MQJ A;  1TGZ B;  2LZ6 A;  3M62 B;  1P0R A;  2MW5 A;  5CHW A;  4W9D A;  3VFK A;  2JZZ A;  3U8Z A;  4IG7 B;  2Z0D B;  4NJ7 A;  3A9J B;  3NZU A;  2DYM A;  2XK5 A;  5D94 A;  2NBW B;  1BT0 A;  4IWO A;  1J8C A;  1I35 A;  4HCN B;  4K7U A;  5J17 A;  4W9L A;  4HPM B;  3VHT C;  2BKF A;  2ZJD A;  3RT3 B;  3WAM A;  2FCS A;  2DAJ A;  5JHA A;  2JWZ A;  2FIF A;  2KX3 A;  2R2O A;  1S1Q B;  1WE7 A;  2RGF A;  3A9J A;  4P7I A;  2LVP A;  4GSW A;  2NCN A;  4EKU A;  1WM2 A;  3SU8 X;  1WZ0 A;  4BKS D;  3H1U A;  3RZF A;  2HD5 B;  2UYZ B;  2B3A A;  4DDG D;  2DZI A;  1P1A A;  2KVR A;  2LUE A;  3JSV B;  1WIA A;  5E6N A;  3RYT A;  2M4N A;  3SHQ A;  4RMA A;  4TQ1 A;  3KW5 B;  4KSL C;  2ZNV B;  1I42 A;  1X1M A;  2IO1 B;  1SIF A;  3H7S A;  4M8M A;  4OVU A;  3H6N A;  4GU2 A;  4A3O A;  3RD2 A;  3HIZ A;  1YIW A;  1JRU A;  2OJR A;  2DZJ A;  2JT4 B;  4HWI B;  4MGK E;  4TV3 A;  4G0N B;  3JSV A;  2O6V D;  2QHO A;  2C5L C;  2KOX A;  4MM3 A;  4AWJ A;  2KC1 A;  3IHP C; 
#chains in the Genus database with same CATH topology
 4B6W A;  1HEZ E;  1UBI A;  3BVZ A;  4LLG M;  2FUH B;  4M02 A;  3Q3J A;  2MBQ A;  4B95 A;  5D7G A;  1YN4 A;  3RN9 C;  1FO4 A;  2WXK A;  3KLS X;  2W9N A;  4ITK A;  1YQB A;  2GLS A;  4C56 C;  5IKC M;  3AU5 A;  3ZNZ B;  1T6B X;  4EZK A;  4DDI D;  5E6P A;  1F0Z A;  1P3Q U;  1V8C A;  5BO4 B;  3CSF A;  4IUM B;  3UGB B;  3BY4 B;  2KDM A;  2MBH A;  3R3M A;  3BIN A;  3WA0 A;  3DBL B;  3PV1 A;  5I4D A;  2AEH A;  2BS4 B;  3ZDT A;  3EFU A;  4JWU C;  1E9M A;  1KH0 A;  5LNK 1;  3EA6 A;  2MP2 A;  2JY6 A;  3BYY B;  3Q69 A;  4I6L B;  2AL3 A;  1FNW A;  4JPS A;  2ZW0 A;  2DX5 B;  2K8H A;  3DBS A;  3ZXR A;  5J2R A;  3Q3F A;  4NQL B;  2SAK A;  3SDL C;  4MH0 E;  1E10 A;  3DVG X;  1VDV A;  1P7F A;  2KLG A;  2R61 A;  2IO3 B;  2PLP A;  4GOC A;  3ML8 A;  5TSS A;  2JZP A;  3ZJT A;  2JUO A;  1N63 A;  2BB5 A;  4NY0 A;  2NPT B;  1NYR A;  4IM3 A;  1SJH D;  4DBG A;  3T9L A;  5J18 A;  1L6U A;  3ZTC A;  2BBC A;  1ET6 A;  4GB9 A;  1NEK B;  3GZN B;  2K25 A;  2NR2 A;  2OED A;  5DPS A;  1ET9 A;  5HFY A;  4ZRK A;  1GC7 A;  2D2Q A;  2KC2 A;  2YEP B;  2WXP A;  1R4M I;  4JLC A;  2OOB B;  4FAD A;  2PVO D;  4F1S A;  1GC6 A;  3KUZ A;  1L2N A;  4IW0 A;  2G45 B;  4ZRQ A;  1WZ3 A;  1TY0 A;  1SJE D;  1NDD A;  2WXR A;  3U4E G;  4RFB A;  4WAF A;  1WX9 A;  5FK9 C;  4M00 A;  1BML C;  4Q2J A;  2N1V A;  1WX8 A;  4HVB A;  2KTR B;  2L76 A;  2I1J A;  1NBF C;  3LB8 C;  2KD0 A;  2BTE A;  3U2S C;  1RM6 C;  4BAX A;  3U7D A;  1VJK A;  4JX1 C;  2ZCB A;  2KAJ A;  4HLE A;  5C1Z A;  2LGI A;  1M94 A;  4ARI A;  4ICU A;  4HDQ A;  3ALB A;  4GLS C;  4RGN A;  4WUR A;  1PFD A;  4NJC A;  3IAS 1;  4C7Y A;  3BK2 A;  2KT7 A;  4G11 A;  1PUT A;  3RZW C;  4FA6 A;  1I4R A;  3ZNH B;  2CKH B;  1IUE A;  1QQR A;  1SXT A;  1D4B A;  3DHI C;  2DNF A;  3GP7 A;  2WHI A;  3RPF C;  4ANV A;  3BVG A;  2ZVN A;  4W9H A;  3H7P B;  1N60 A;  1VZ6 A;  3D32 A;  2MBO A;  3P4Q B;  3TSS A;  2JZ3 B;  1OFF A;  5G5H A;  4OVV A;  2K0P A;  2IND C;  2BYE A;  3LDZ E;  3PTF C;  4US9 A;  2K8B A;  3HUI A;  4G3X B;  2KJH B;  1P98 A;  2MJD A;  3NHE B;  2A5U A;  2M0A A;  3VQI A;  2QSD A;  4KDL B;  3GE3 C;  4XWT A;  4WJO A;  4LNF A;  4PT5 A;  2IGH A;  3BYT B;  2WXN A;  2DYB A;  2KLC A;  2IY1 B;  4URK A;  1GJZ A;  2ZW1 A;  1MFW A;  5DPW A;  1J0G A;  2C9W B;  3DQV A;  3MC9 A;  2J0K A;  2I1K A;  4GGQ A;  4KDI C;  4RH6 A;  2D3G A;  4DXF A;  2IZV B;  2WDV B;  3KWV A;  2CS4 A;  1WJN A;  3DDC B;  1TS4 A;  3TUO A;  2UWQ A;  4B9K A;  3IT6 B;  2FNJ B;  3WIM A;  1JWU D;  2CR5 A;  3W1Y A;  1R7S A;  2GBK A;  2KYW A;  3R7Q A;  2LRU A;  2DEN B;  4W9K A;  1I7H A;  3TEX A;  4PYZ A;  1NYQ A;  2HTM E;  5CHV C;  3PT2 B;  4MGZ E;  1WR6 E;  1RAX A;  3ZO5 B;  1VLB A;  2L00 B;  2MJE A;  4HKZ E;  1HA5 A;  3GB1 A;  5D3D A;  1EF5 A;  3R2I A;  1V1P B;  2N4F A;  2KAC A;  3ZKJ C;  4PK1 A;  3O65 B;  3DHG C;  5AZG A;  1BUI C;  5L95 C;  5EE0 A;  1QIL A;  3AN1 A;  4HJG E;  5C3J B;  1FMA D;  5GXG B;  4YWG G;  2O2V B;  4A6Q A;  4WWP A;  2HJ1 A;  1D3Z A;  2JWU A;  4C4V B;  4I6P A;  2KFK A;  3PZ7 A;  1KTK A;  1XEE A;  2IYD B;  4KGR A;  3NVY A;  4XE0 A;  1J7B A;  4WWM A;  2FCQ A;  2NS5 A;  3A1Q A;  3CIR B;  3DPD A;  1STE A;  3MJ5 A;  4LNK A;  3A4R A;  4GN1 A;  4BOS C;  1MPE A;  4KZ0 A;  5JHB A;  3UI3 A;  3LYY A;  2CHX A;  4TUU A;  2Y5P A;  2MX2 A;  1ZXH A;  5HG2 A;  3PRE A;  2K6Q A;  4A9A A;  4FN2 A;  3R8B A;  2D3A A;  2NTS A;  3RFZ B;  4WIP A;  1MVK A;  3V61 A;  5GMV A;  2KVZ A;  1KRH A;  1AW7 A;  1T5X D;  1N61 A;  5E6O A;  1WXV A;  2W55 A;  4A20 A;  2FAZ A;  4OW0 A;  1WGK A;  1FFV A;  4AS1 A;  1FNU A;  3NY5 A;  4N58 A;  1ENF A;  2BVC A;  4RM8 A;  3M62 B;  4LNN A;  4IG7 B;  3E9S A;  3NVZ A;  2Z0D B;  4YSY B;  3NZU A;  2DYM A;  2XK5 A;  4HCN B;  1XLO A;  2QC8 A;  1K52 A;  1GB4 A;  3HVD A;  1WE7 A;  2RGF A;  4TSS A;  4P7I A;  5HI1 A;  3RNA C;  2NCN A;  1WM2 A;  5EE1 A;  3H1U A;  4DDG D;  3KWL A;  2KVR A;  2LUE A;  3SHQ A;  4RMA A;  1X1M A;  3AH7 A;  3H7S A;  1GAQ B;  4KX6 B;  4M8M A;  4GU2 A;  4OVU A;  1IBX A;  1ZE3 D;  3HIZ A;  2LEK A;  4HWI B;  4G0N B;  2O6V D;  2QHO A;  4MM3 A;  3HRD D;  3VDZ A;  4RF0 A;  1D6E C;  4ZOH C;  1MJD A;  2JRI B;  3ZVV A;  1E7V A;  1OQY A;  3BVM A;  3NRZ A;  2D5G A;  3VAW A;  1GG3 A;  3QCA A;  2V4L A;  5KHQ A;  3SD5 A;  2N9P C;  1LFD A;  4LTU A;  1T0S C;  2V9H A;  1NI2 A;  1FXI A;  2D07 B;  1VZ7 A;  3NVW A;  5FR6 A;  1OQR A;  3JVZ X;  2JXT A;  1MHH E;  1WY8 A;  4N9F 4;  4MGI E;  4MSM B;  4TKN A;  2IBI B;  1T3Q A;  1V49 A;  3QJZ A;  2KXJ A;  4HEA 1;  5CX3 A;  3KYC D;  2MHJ A;  4BKS A;  2KDB A;  1D5M C;  3V05 A;  1OEY J;  2O6V B;  5LLI A;  1FXT B;  1C79 A;  2CJN A;  2N0S B;  4I6N B;  3GE8 C;  1XCQ L;  2JX5 A;  4OHJ A;  4RGM A;  1RYJ A;  2J0M A;  1TZ1 A;  3FIL B;  4YXD B;  4O1N A;  1ISN A;  3ML9 A;  3ZUN A;  1DOY A;  1GOZ A;  3AE9 B;  1QOG A;  2ICI A;  4UDU C;  2J52 A;  3C8Y A;  3IAM 1;  2J4X A;  4KGS A;  4RCO A;  1XQQ A;  1KLG D;  3AE3 B;  5C2T B;  1JRO A;  2LRW A;  3AE6 B;  1T0Y A;  1K53 A;  4DK5 A;  1XO3 A;  4KV2 A;  3BII D;  2N7J A;  3Q3N C;  1FXA A;  4FJV B;  3M3J A;  1HZ6 A;  4LCD E;  1OQQ A;  4AUQ C;  3SEB A;  4USA A;  5LXI B;  1RLF A;  1Q5W B;  2WWZ A;  4TMA B;  2KAN A;  2BW2 A;  2R2Q A;  2X8X X;  2WLB A;  2WXM A;  1JRP A;  4F7Z A;  2DZM A;  4K3B A;  4AQ7 A;  3VRB B;  2C7N B;  3EC8 A;  4US8 A;  2BS3 B;  3VXW A;  2YEP F;  1NI3 A;  4DHZ E;  1YOV B;  3A4S C;  2EMS A;  1QZE A;  2ZZP B;  1LXD A;  5BMG A;  1WXS A;  1QOA A;  4RM9 A;  4P16 A;  3P4S B;  2PJH A;  4EZJ A;  1UWX A;  3AV8 A;  3AEF B;  1K50 A;  2PIA A;  1VCB A;  2RD0 A;  2Y5B B;  3ETR A;  1UUP A;  3IVF A;  2LI5 A;  3L10 B;  3QAR A;  2BYV E;  3OAW A;  3V6C B;  1EUV B;  2J0J A;  1H4R A;  4BBN F;  2KQ4 X;  4N59 A;  4GDL B;  1R4M B;  2JQR B;  2MEK A;  2IY0 B;  2BGF A;  1J19 A;  4ZRI A;  4A55 A;  3EFC A;  1YN5 A;  3Q8F A;  4YTP B;  2KMA A;  1N5X A;  2A4Z A;  2L7R A;  2MRP A;  5CHF A;  3LXF A;  4GXB A;  2FBW B;  2K3U A;  1I4H A;  2VRR B;  1WX7 A;  1ROE A;  1UZX B;  4HPL B;  1WRD B;  3J9C A;  2IO0 B;  3NZ3 A;  3DBH I;  3T8M A;  4XZ4 A;  1A70 A;  1V9J A;  4MAC A;  1EM7 A;  3TBL D;  1XCT L;  4FBJ B;  2KN4 A;  1GNU A;  2M0X A;  4AJY B;  3IG3 A;  1L6V A;  4NQK E;  3H7P A;  4EEW A;  3ZNG C;  2RPV A;  2MCN B;  3MTN B;  3JYU A;  1Q0W B;  1E7P B;  3UQB A;  2DWQ A;  4ACF A;  1SEB D;  2CHW A;  4MJS B;  1FD6 A;  1SSN A;  3P42 A;  4L23 A;  1UBQ A;  4E74 A;  2H88 B;  4JL9 A;  2D3B A;  4W9E A;  1L0X B;  4NZL B;  1F2R I;  1HXY D;  1ZUD 2;  4LDT D;  4C00 A;  3KUC B;  1YJI A;  2KN5 A;  1H8C A;  2SEB D;  4N6E B;  3U30 A;  3H8H A;  3AMZ A;  2DZK A;  3R66 C;  1Y8R C;  3ZXV A;  2WXL A;  4ASW C;  2ON8 A;  2WXH A;  5T8I A;  4KIK B;  4P6V F;  2WNM A;  4XYC A;  3W1S C;  2HE7 A;  1V86 A;  1ACC A;  3OG5 A;  1K8R B;  4M0W B;  2AX5 A;  2JU6 X;  1WJ4 A;  2FCM A;  1E8Y A;  3PS6 A;  3NOB A;  3HK0 A;  2M56 B;  3P4P B;  1PGB A;  1TJE A;  3DBL I;  3BWU D;  4HXD A;  2C7M B;  1WGY A;  4ZRJ A;  3QIJ A;  4BFR A;  2KDI A;  3IT4 B;  1TZO A;  2LWP A;  3OJ4 B;  4LDT B;  2WS3 B;  1MI0 A;  2KHW B;  2FE8 A;  1V1O A;  1YD8 U;  3A9K B;  1LM8 B;  2LJI A;  3EUB 2;  3AUL A;  3HM3 A;  1KLU D;  1V1P A;  1RRB A;  3A33 B;  2MSE D;  3L16 A;  3AM9 A;  1TY2 A;  3DBR I;  3NUH B;  4PYU A;  2FID A;  3CST A;  1SGH A;  2JXX A;  3Q8E A;  2O2V A;  3W5U B;  2CHZ A;  3PLV A;  4C4V A;  4JQW C;  3UF8 A;  1MG4 A;  3ENE A;  2M1M A;  1NEN B;  3RI7 C;  3RUL A;  3ZGZ A;  1OTR B;  3VR9 B;  4MDK E;  1QOF A;  2G1E A;  1EU3 A;  2K9X A;  4CHK A;  5G2N A;  1OEY A;  5C23 A;  1XLN A;  1FCL A;  1NVI D;  1L4Z B;  1C76 A;  4ZRP A;  1TS2 A;  3VUX A;  3N3K B;  2XBB C;  5MPO A;  2IGD A;  2QCZ A;  1C1Y B;  3DVN V;  1WXQ A;  3R2T A;  3N1X C;  4B0E A;  1J7A A;  1KFY B;  1PGA A;  3NJT A;  1VZ8 A;  1WSP A;  4XC2 A;  2LAS A;  1HQR D;  3DWM A;  3AEE B;  3W1S A;  2DLB A;  2XNA C;  3RNB C;  4AP4 C;  5BYR A;  3MC0 B;  1EU4 A;  2WXI A;  2MW5 A;  3VFK A;  2JZZ A;  3U8Z A;  4NJ7 A;  3A9J B;  1J8C A;  2NBW B;  1BT0 A;  4IWO A;  4K7U A;  1JWM D;  5J17 A;  3RT3 B;  2DAJ A;  2JWZ A;  1S1Q B;  4B0M A;  4CQN A;  2V4I B;  4EKU A;  3SU8 X;  2HD5 B;  2B3A A;  3AE5 B;  5BMI A;  1P1A A;  2AQ1 B;  4TQ1 A;  1C78 A;  1UF0 A;  2OJR A;  3Q3O C;  2JT4 B;  4MGK E;  1R4N B;  3N1Y C;  4TQ0 A;  3I57 A;  2KC1 A;  3IHP C;  1F77 A;  5H92 C;  1ZP0 B;  2JVC A;  4WJQ A;  2YVC A;  1L7Y A;  1TKG A;  2NVU I;  4IWQ A;  4DHZ B;  4RGT A;  4FHJ A;  5IN7 A;  2QDF A;  3W2D A;  2K39 A;  3EGR A;  1ZDX A;  1E0Z A;  1QKZ A;  4WJN A;  1UH6 A;  1FRR A;  2LXC A;  1V2Y A;  3QK0 A;  1Y56 A;  3TMP B;  4L2Y A;  5LXH A;  2Z59 B;  5KHO A;  4XGA B;  1C4A A;  3Q6B A;  1ZW7 A;  4GIV A;  5DPT A;  1JWB D;  2PMV A;  2V3P A;  2NBV B;  2MLB A;  2O6V A;  2ZVO A;  2WGS A;  2V1Y A;  4DWF A;  4OZC A;  4BVU C;  3L0W B;  2ZEQ A;  3AB5 A;  1FPY A;  5E6J A;  1PQS A;  3X23 A;  1JQ4 A;  2QIE B;  3BK1 A;  5EE3 A;  4BKG A;  5AUI A;  1PDX A;  3NZS A;  4NAW B;  3QX1 A;  2QJL A;  3N9Y C;  1JML A;  4M8N A;  3L08 A;  2KWD A;  2INP E;  1WRI A;  3M63 B;  2WU5 B;  2JPH A;  1VR9 A;  3APC A;  4ANU A;  4F8C B;  1XLQ A;  2E3T A;  2G4S A;  4KVG B;  1IP9 A;  4KSK C;  1AYF A;  3ECI A;  1N6Z A;  1E6E B;  1TBE A;  4S0R A;  1I4P A;  4REZ A;  1Z2M A;  4WAA A;  2N9X A;  1TS5 A;  2NBU A;  2GOW A;  3NS8 A;  1EWC A;  3LJ3 A;  3CF6 E;  2KZR A;  2BB6 A;  3S2A A;  1FCC C;  2DAF A;  4HRS A;  2ZPY A;  2JYT A;  4DHJ D;  1YJ1 A;  2BQQ A;  4YL8 A;  1MG8 A;  4MT5 A;  3ZRF A;  2GBN A;  3P63 A;  3QWZ B;  1WM3 A;  1XXG A;  1PYW D;  3ZNI D;  3ZDM C;  4LNO A;  3TEY A;  2WX0 A;  2N7D A;  3TJP A;  1FNV A;  3OWE B;  3SR6 A;  3ZYY X;  2W82 A;  5FR3 A;  3FKY A;  3MFG A;  2NMQ A;  2LGS A;  2ZNV C;  4MEL A;  3MJW A;  4GDL A;  1UD7 A;  3UQA A;  3QQ8 B;  3P2B A;  2QIL A;  2WDT B;  3A1Q B;  4PS3 A;  2JRH A;  4CO7 A;  2L1A A;  1E8Z A;  4WJP A;  2PE6 B;  3ONS A;  4RNA A;  1TYG B;  2KJ6 A;  2C60 A;  4DHJ B;  4YSZ B;  1WF9 A;  3QA8 A;  3B0A A;  1HZ5 A;  2KQ7 A;  3KVF B;  4IOI E;  1UNS A;  3W9C B;  1WGD A;  4A3P A;  1ZPS A;  4ZDV A;  3DHH C;  3K9P B;  3QAQ A;  2BF8 B;  2MBB B;  1KOT A;  3P1M A;  5BMH A;  4HK2 A;  1C3T A;  3RUI B;  2LHD A;  4CYE A;  1SB3 C;  3AU4 A;  2L8J A;  4NPN A;  3TEW A;  4JE3 B;  3ZW3 A;  2L0F A;  1RFA A;  4YTN B;  4ZHO A;  4MH8 A;  4LNI A;  4DXA B;  4ARC A;  2DHZ A;  4FLH A;  1EO6 A;  2UU7 A;  1WJU A;  2VZK D;  4GDK B;  4FUL A;  4K1R B;  4MJS A;  4EE2 A;  2J42 A;  2NPT A;  2PPH A;  2LJ5 A;  1UEL A;  3DBH B;  2L52 A;  4P1C C;  5L83 A;  4NAM A;  1TKY A;  3ZIM A;  3BZD B;  4HDO A;  4J3O D;  2N7E A;  1WYW B;  2PW9 A;  4KZC A;  3DCG A;  1V81 A;  3AEA B;  3APD A;  1DYQ A;  2GBM A;  3I9V 1;  3I3T B;  3PHW B;  2L0T A;  3WAN A;  1L4D B;  1WI0 A;  2YLM A;  4KIK A;  3DOW A;  2WXG A;  1WR1 A;  3AE4 B;  1LO5 D;  4IDI A;  3TL5 A;  4MM3 B;  2G9H D;  2RDG A;  3AEC B;  1HTO A;  2KWV B;  4M0W A;  2K1F A;  3PRM B;  1GB1 A;  2JF5 A;  2WU2 B;  2VZK B;  3PO0 A;  3EHV A;  2KTR A;  4C80 A;  2REX A;  3PZD A;  2KKC A;  3Q2A C;  3MHZ A;  2M19 A;  1E5W A;  1IGD A;  3MP9 A;  3TCA A;  1L5P A;  4OZB A;  3PPA A;  4MSQ B;  4J6I A;  4E71 A;  3WAP A;  4ZYN A;  5EDS A;  2GI9 A;  4WH4 A;  1WMH B;  2AQ3 B;  1L0Y B;  2WXJ A;  3A9K A;  1JW9 D;  5G55 A;  2CJO A;  2GRI A;  2D3C A;  1FM0 D;  1ZKH A;  2BWE S;  2W3R A;  3IBE A;  4LJO B;  2KWC A;  1D5X C;  1F9J A;  1P7E A;  4GMV A;  1QF6 A;  3M95 A;  2EEL A;  3P4R B;  3L13 A;  1B9R A;  1C9F A;  4W9G A;  1WXA A;  1OGW A;  4IM0 A;  2IO2 B;  2L83 A;  2D11 A;  4E3C A;  1CMX B;  1ZGU B;  2PVG C;  3TIX A;  1F1H A;  2VH1 A;  3C0R B;  1I4G A;  2JSV X;  2L3Z A;  1S3S G;  4X57 B;  1E90 A;  1SE9 A;  4AJW A;  2CU1 A;  2AYO B;  2W3S A;  3AI5 A;  4EZL A;  3DBR B;  4FJZ A;  3N1Z C;  2C7H A;  3GS2 A;  2LVQ A;  4ICV A;  4K7W A;  4XDD A;  1TTN A;  3PGE A;  2LXA A;  2ACZ B;  2RSU A;  1SIJ A;  4LK0 M;  3VTW A;  3VUY A;  3OLM D;  4WWN A;  2Y3A A;  4W9C A;  3ZRC A;  2XEW A;  1GPX A;  5FKA C;  3W5V B;  2WDQ B;  1V5T A;  2X38 A;  1TGZ B;  2LZ6 A;  5CHW A;  1T0R C;  3AEG B;  2FUG 1;  1I35 A;  4W9L A;  4HPM B;  2BKF A;  2ZJD A;  3WAM A;  2FIF A;  2KX3 A;  4A8X C;  3A9J A;  2V0G A;  3JSV B;  4OZA A;  3RYT A;  2M4N A;  2B76 B;  4KSL C;  1C4P A;  2ZNV B;  1I42 A;  2IO1 B;  3ABV B;  1SIF A;  5JXV A;  4A3O A;  4H2A A;  3O13 A;  2DZJ A;  3ZJV A;  2KOX A;  3RNE C;  4XDC A;  5AEK B;  2WX1 A;  3AE7 B;  3ZTD A;  3B08 A;  2KO3 A;  2XN9 C;  1WXM A;  4FXC A;  3OJ3 A;  1BXT A;  3VUW A;  4II2 B;  4YSX B;  4HKQ A;  2ZCC A;  2WXO A;  3PSE B;  3PLU A;  4IC7 B;  3DVN U;  1AN8 A;  2VH2 A;  1ZOY B;  4II3 B;  1AAR A;  3KYD D;  2WDR B;  4BKT A;  1WGG A;  3QC8 B;  2MP2 B;  3AED B;  1V6E A;  1XLP A;  4D2K A;  4L1B A;  4JGH B;  1EF1 A;  4FJY A;  4EOY A;  2HDE A;  3C19 A;  5D6J B;  1FIQ A;  3DVG Y;  4RF1 A;  3PRZ A;  2AL6 A;  2INC C;  3U7Z A;  3AXC A;  1WJ6 A;  2K6D B;  2KMM A;  3VTV A;  4ANX A;  2Z8L A;  1V97 A;  1K51 A;  3R7R A;  4IM2 A;  2IDY A;  1WGR A;  3GZN I;  2G3Q B;  4RGO S;  1TKE A;  3V60 A;  4M01 A;  1T0Q C;  3VH3 B;  5D3I B;  4KKJ A;  1JCK B;  2M17 A;  2WYQ A;  3JW0 X;  1FRD A;  3T3O A;  2H89 B;  2MJ3 A;  5IAA C;  3E56 A;  5IO9 A;  1YX5 B;  4K81 A;  2DYO A;  2WXF A;  3PZ8 A;  3CWI A;  3Q8B A;  2LVO A;  1RWS A;  3I5J C;  1DOI A;  4FHK A;  2IJ0 A;  2KX0 A;  3V62 A;  2GBR A;  4WWO A;  2AWT A;  3SFE B;  2KMC A;  1Z5S B;  3I63 C;  1UGJ A;  4NAW A;  3WCQ A;  1F52 A;  2N1W A;  4WQO B;  2LGY A;  4KGT A;  3B2G A;  1SE2 A;  3VH4 B;  3L4P A;  2MWS B;  4XWW A;  5HHD G;  1SE4 A;  1DGJ A;  5AZH A;  3IFW B;  1IYF A;  1JWS D;  4DQO C;  1P9D U;  2D10 A;  2TSS A;  1V5O A;  2KK8 A;  5JH5 C;  4XX5 A;  1LQB A;  1CZP A;  3APF A;  1M4V A;  3L17 A;  3FC4 A;  2WP9 B;  4HJK A;  1HTQ A;  2EMT A;  2LGX A;  1FFU A;  1XF5 L;  1V80 A;  2J53 A;  3RNC C;  2PE9 A;  1AWD A;  3URY A;  4MEM A;  1WGH A;  1U4A A;  1FEH A;  2G4D B;  4C7Z A;  3HM6 X;  3L54 A;  4NJ6 A;  1WWT A;  3B2F A;  1I4Q A;  1QOB A;  1DOX A;  1SF0 A;  3X0W A;  2KFJ A;  4P1B C;  2FCN A;  1PGX A;  4KKI A;  3DWG C;  3PRP B;  1YN3 A;  1F2R C;  4AOF A;  2IPK D;  1ESF A;  2Y5C A;  1D5Z C;  4EFO A;  2PTL A;  3MC8 A;  5TR5 A;  3AE8 B;  1E8W A;  1G6J A;  2ONQ A;  5EE9 A;  3RNF C;  1I4X A;  1SBB B;  1LGR A;  1KM7 A;  1YNT E;  1QLB B;  2PEA A;  3RMK C;  1GUA B;  1VRA B;  3B1L X;  4G50 A;  3FAH A;  2RDH A;  4JWS C;  1KLV A;  3FIL A;  4ZYS A;  2MBE A;  2K8C A;  2KJR A;  3WAL A;  5HKH A;  3RCZ A;  4EUT A;  3PHX B;  2I2Y A;  5IOI A;  4YTM B;  3VTU A;  1SE3 A;  1KJT A;  3MHS D;  1N62 A;  3N30 A;  1YQ3 B;  2EKI A;  3V6E B;  1Q1O A;  1CJE A;  1UGM A;  3QHT A;  1WFY A;  1IGC A;  2ASQ A;  4QAY A;  2LMC A;  1UWM A;  5JZE B;  1YX6 B;  3VRA B;  2Z0E B;  4ZHP A;  4IWP A;  5D2M B;  5BYQ A;  1N5W A;  2KDF B;  2BYF A;  1R4N I;  1YMH E;  3N32 A;  2AQ2 B;  1ZDV A;  4GDK A;  3UIP B;  5H8Y E;  1YJJ A;  3ZLZ A;  2GBJ A;  1VD2 A;  2K5P A;  3UIN B;  2QEJ C;  1HE8 A;  3HHM A;  2LD9 A;  2JYE A;  2L32 A;  4HPP A;  2CU3 A;  5IP4 D;  2M8S A;  1E7U A;  1TT5 B;  3NS1 A;  5IA7 A;  4YT0 B;  3ZQ4 A;  3EEC A;  2W54 A;  5DPR A;  2E6X A;  1B1Z A;  4DXG A;  2WQY B;  2HTH A;  3HVZ A;  4MGY E;  4OVZ A;  5DCN A;  3B9J A;  2BS2 B;  2N9L A;  2PKO A;  4W9F A;  1C4C A;  3KH0 A;  4W9I A;  3VVW B;  5BYS A;  1CK1 A;  1WE6 A;  2N9E B;  2IGG A;  2L05 A;  3ZJU A;  1C77 A;  2KDE B;  2ZPN A;  3GOE A;  2LUM A;  4K3C A;  2N9K A;  1QT9 A;  4HCP B;  4NNJ B;  3WAO A;  2HJ8 A;  4R3D A;  3Q8A A;  1IPG A;  2RDB C;  2V3S A;  1TIF A;  2KNB A;  3H9D A;  4W9J A;  2KFK B;  2RR9 A;  5AZF A;  1A5R A;  1TS3 A;  4A90 A;  5CTR C;  1JAL A;  2J7Q B;  3U52 E;  2RMM A;  2KTF A;  3VR8 B;  2MH7 A;  1XD3 B;  1WMH A;  2BPS A;  3AE2 B;  4JIO U;  2GMI C;  4PS7 A;  1ZXI A;  2GB1 A;  1Q10 A;  2WXQ A;  2NTT A;  3N20 C;  2DBY A;  4LJP B;  1CQV A;  2MA9 B;  4BBN C;  2KQS A;  3TEZ A;  3Q14 C;  4S17 A;  1XT9 B;  2I38 A;  4BZA A;  2EKE C;  2RPQ A;  1WH3 A;  3K9O B;  3UIO B;  4ANW A;  3PVL A;  2LGD A;  2LFI A;  2LHE A;  3KQ4 A;  3CMM B;  2BWF A;  2Q5W D;  2OJW A;  3V3X A;  3RNG C;  3NVV A;  3KUD B;  3IXS A;  3Q3M C;  2INN E;  1J7C A;  2BKR B;  1E8X A;  2KWU B;  4PS8 A;  2XK5 B;  4BOZ B;  4K7S A;  1RFK A;  1JWA D;  5AUK A;  2K22 A;  2MQJ A;  1P0R A;  4W9D A;  1KF6 B;  3Q8C A;  5D94 A;  2OHF A;  2QMT A;  3VHT C;  1WYG A;  3NG0 A;  2FCS A;  5JHA A;  2BT6 A;  2R2O A;  3AEB B;  4IKG A;  3AE1 B;  2LVP A;  4GSW A;  3T3N A;  1IBX B;  1WZ0 A;  4BKS D;  3RZF A;  3SFD B;  2UYZ B;  2DZI A;  1WIA A;  5E6N A;  1EWY C;  3KW5 B;  2V3N A;  1YQ4 B;  3H6N A;  4HRO A;  3RD2 A;  1YIW A;  1L0V B;  1JRU A;  1MHX A;  2BYT A;  4TV3 A;  3JSV A;  2C5L C;  4AWJ A;  5G5G A;  4WQM A; 
#chains in the Genus database with same CATH homology
 3VDZ A;  1UBI A;  4B6W A;  5AEK B;  2JVC A;  2WX1 A;  2FUH B;  4WJQ A;  3Q3J A;  2JRI B;  2YVC A;  3ZTD A;  3ZVV A;  1E7V A;  2MBQ A;  1L7Y A;  4B95 A;  1OQY A;  2NVU I;  4IWQ A;  3B08 A;  2KO3 A;  5D7G A;  1WXM A;  3VAW A;  4DHZ B;  1GG3 A;  3OJ3 A;  3VUW A;  4FHJ A;  3QCA A;  4II2 B;  2V4L A;  2ZCC A;  5KHQ A;  2W9N A;  3PSE B;  1YQB A;  3PLU A;  3SD5 A;  4IC7 B;  3DVN U;  3AU5 A;  4II3 B;  1AAR A;  3ZNZ B;  4EZK A;  2K39 A;  3KYD D;  2N9P C;  4DDI D;  5E6P A;  1P3Q U;  1LFD A;  5BO4 B;  4BKT A;  4WJN A;  1WGG A;  1NI2 A;  3CSF A;  4IUM B;  1UH6 A;  3UGB B;  3QC8 B;  2D07 B;  2MP2 B;  3BY4 B;  1V6E A;  5FR6 A;  4JGH B;  2LXC A;  1V2Y A;  2MBH A;  3R3M A;  3JVZ X;  1EF1 A;  3BIN A;  3QK0 A;  4FJY A;  3WA0 A;  4EOY A;  1WY8 A;  3PV1 A;  2AEH A;  4N9F 4;  3ZDT A;  3EFU A;  4MGI E;  4MSM B;  4TKN A;  5D6J B;  2IBI B;  3DVG Y;  1V49 A;  3QJZ A;  2MP2 A;  2KXJ A;  2JY6 A;  3TMP B;  5CX3 A;  3KYC D;  5LXH A;  2Z59 B;  4I6L B;  2AL3 A;  3PRZ A;  5KHO A;  2AL6 A;  4BKS A;  2KDB A;  1ZW7 A;  3AXC A;  1WJ6 A;  2K6D B;  1OEY J;  2DX5 B;  3VTV A;  4ANX A;  2K8H A;  2O6V B;  4GIV A;  5LLI A;  1FXT B;  3DBS A;  5J2R A;  3R7R A;  5DPT A;  4I6N B;  4IM2 A;  3Q3F A;  4NQL B;  1WGR A;  2J0M A;  3GZN I;  2NBV B;  2G3Q B;  1TZ1 A;  2MLB A;  3SDL C;  2O6V A;  4MH0 E;  3V60 A;  3DVG X;  1ISN A;  3ML9 A;  3ZUN A;  2ZVO A;  3VH3 B;  2V1Y A;  2M17 A;  2WYQ A;  3JW0 X;  4DWF A;  2KLG A;  2IO3 B;  4BVU C;  3L0W B;  2ZEQ A;  1XQQ A;  4GOC A;  5IAA C;  1PQS A;  3ML8 A;  1YX5 B;  2LRW A;  4K81 A;  2JUO A;  2DYO A;  3X23 A;  1T0Y A;  4NY0 A;  4DK5 A;  4KV2 A;  4BKG A;  2LVO A;  2NPT B;  3NZS A;  4IM3 A;  4FHK A;  4NAW B;  2KX0 A;  3V62 A;  2GBR A;  3QX1 A;  4WWO A;  2AWT A;  4FJV B;  4DBG A;  3T9L A;  2KMC A;  3M3J A;  1Z5S B;  5J18 A;  4LCD E;  4M8N A;  3L08 A;  4AUQ C;  3ZTC A;  3M63 B;  4GB9 A;  4NAW A;  5LXI B;  2K25 A;  2NR2 A;  2JPH A;  3APC A;  2N1W A;  1RLF A;  1Q5W B;  4ANU A;  4WQO B;  4F8C B;  2WWZ A;  2LGY A;  2KAN A;  5DPS A;  2G4S A;  4KVG B;  1IP9 A;  4KSK C;  3VH4 B;  2R2Q A;  3ECI A;  2MWS B;  4ZRK A;  1TBE A;  4F7Z A;  1GC7 A;  2D2Q A;  2DZM A;  2KC2 A;  5AZH A;  3IFW B;  1R4M I;  1Z2M A;  1IYF A;  4JLC A;  2OOB B;  4WAA A;  4FAD A;  2N9X A;  4F1S A;  2NBU A;  1P9D U;  2D10 A;  1GC6 A;  2C7N B;  2GOW A;  3KUZ A;  3NS8 A;  3EC8 A;  4IW0 A;  3LJ3 A;  1L2N A;  2G45 B;  1V5O A;  1WZ3 A;  2KK8 A;  2KZR A;  3CF6 E;  1NDD A;  4XX5 A;  3VXW A;  5JH5 C;  4DHZ E;  1LQB A;  3A4S C;  2EMS A;  1QZE A;  3S2A A;  1WX9 A;  2ZZP B;  2DAF A;  1LXD A;  3APF A;  1WXS A;  4RM9 A;  3L17 A;  4EZJ A;  2PJH A;  2ZPY A;  4HJK A;  2N1V A;  2EMT A;  4DHJ D;  2LGX A;  1YJ1 A;  1WX8 A;  4YL8 A;  2RD0 A;  1VCB A;  1V80 A;  2Y5B B;  4HVB A;  2PE9 A;  1MG8 A;  3ZRF A;  2GBN A;  3IVF A;  2KTR B;  2L76 A;  2LI5 A;  3QWZ B;  2I1J A;  3L10 B;  3QAR A;  2BYV E;  1NBF C;  2KD0 A;  4MEM A;  3OAW A;  1WM3 A;  1WGH A;  1U4A A;  3ZNI D;  3ZDM C;  2G4D B;  3V6C B;  3U7D A;  3HM6 X;  1EUV B;  2J0J A;  1H4R A;  2WX0 A;  4BBN F;  3L54 A;  2N7D A;  3TJP A;  4NJ6 A;  2ZCB A;  4GDL B;  4HLE A;  5C1Z A;  1M94 A;  4ICU A;  2IY0 B;  4HDQ A;  2BGF A;  1J19 A;  2ZNV C;  3ALB A;  4MEL A;  2KFJ A;  4ZRI A;  3X0W A;  2FCN A;  3MJW A;  2KMA A;  3PRP B;  4GDL A;  1UD7 A;  4AOF A;  3UQA A;  2A4Z A;  4G11 A;  2L7R A;  2MRP A;  3QQ8 B;  5CHF A;  3P2B A;  4GXB A;  3RZW C;  4FA6 A;  3ZNH B;  4EFO A;  2VRR B;  2WDT B;  3A1Q B;  2CKH B;  4PS3 A;  2JRH A;  4CO7 A;  1E8Z A;  1WX7 A;  4WJP A;  1UZX B;  5TR5 A;  4HPL B;  1E8W A;  1G6J A;  2PE6 B;  1WRD B;  3ONS A;  2IO0 B;  4ANV A;  2KJ6 A;  2ZVN A;  3DBH I;  2C60 A;  3T8M A;  4DHJ B;  4W9H A;  1WF9 A;  3H7P B;  3QA8 A;  4XZ4 A;  1V9J A;  3TBL D;  3B0A A;  1KM7 A;  4FBJ B;  3D32 A;  2KQ7 A;  2MBO A;  2PEA A;  3KVF B;  1GNU A;  2M0X A;  4AJY B;  1GUA B;  2JZ3 B;  1WGD A;  4OVV A;  4A3P A;  3B1L X;  4G50 A;  4ZDV A;  3IG3 A;  1KLV A;  4NQK E;  3H7P A;  3K9P B;  3QAQ A;  2BF8 B;  2BYE A;  2MBB B;  4EEW A;  3LDZ E;  1KOT A;  3ZNG C;  2MBE A;  2K8C A;  4HK2 A;  2KJR A;  3WAL A;  1C3T A;  3RUI B;  2MCN B;  4CYE A;  3PTF C;  5HKH A;  3AU4 A;  3RCZ A;  4EUT A;  3PHX B;  3MTN B;  3JYU A;  2K8B A;  2L8J A;  4NPN A;  4G3X B;  1Q0W B;  2KJH B;  3UQB A;  3VTU A;  1P98 A;  3NHE B;  2A5U A;  2CHW A;  3ZW3 A;  2L0F A;  4MJS B;  3VQI A;  1KJT A;  3MHS D;  4KDL B;  3N30 A;  1RFA A;  4WJO A;  3V6E B;  4DXA B;  4TQ0 A;  2DHZ A;  4FLH A;  1EO6 A;  1Q1O A;  1UGM A;  3QHT A;  1WJU A;  1WFY A;  1UBQ A;  4GDK B;  4E74 A;  4FUL A;  2ASQ A;  4K1R B;  4JL9 A;  4MJS A;  2DYB A;  4W9E A;  2KLC A;  2NPT A;  1YX6 B;  2LJ5 A;  2PPH A;  1UEL A;  2IY1 B;  2Z0E B;  5JZE B;  4URK A;  4LDT D;  1GJZ A;  3KUC B;  4IWP A;  5D2M B;  2KDF B;  2BYF A;  2KN5 A;  1R4N I;  1H8C A;  3N32 A;  5L83 A;  5DPW A;  1J0G A;  2C9W B;  4GDK A;  3UIP B;  3U30 A;  3DQV A;  3ZIM A;  4HDO A;  2DZK A;  2J0K A;  2N7E A;  1WYW B;  1Y8R C;  3R66 C;  3ZLZ A;  2I1K A;  2GBJ A;  4KZC A;  3DCG A;  1VD2 A;  4ASW C;  4GGQ A;  1V81 A;  4KDI C;  3UIN B;  2D3G A;  3APD A;  2IZV B;  1HE8 A;  2GBM A;  3HHM A;  2LD9 A;  3I3T B;  3PHW B;  4KIK B;  2L0T A;  2CS4 A;  1WJN A;  3DDC B;  3WAN A;  2M8S A;  3W1S C;  2UWQ A;  2HE7 A;  1E7U A;  4B9K A;  1V86 A;  5IA7 A;  1WI0 A;  2YLM A;  2FNJ B;  3EEC A;  4KIK A;  5DPR A;  1K8R B;  3WIM A;  3DOW A;  2CR5 A;  4M0W B;  2HTH A;  3W1Y A;  2GBK A;  1WR1 A;  4MGY E;  1WJ4 A;  3R7Q A;  2LRU A;  2FCM A;  5DCN A;  2DEN B;  1E8Y A;  3PS6 A;  3TL5 A;  4W9K A;  3NOB A;  3HK0 A;  4W9F A;  2KWV B;  4PYZ A;  3DBL I;  3KH0 A;  4HXD A;  4W9I A;  5CHV C;  2C7M B;  3PT2 B;  4MGZ E;  1WGY A;  3VVW B;  2K1F A;  3PRM B;  1WE6 A;  2N9E B;  2JF5 A;  1WR6 E;  1RAX A;  4ZRJ A;  3QIJ A;  3ZO5 B;  4BFR A;  2L05 A;  2L00 B;  3EHV A;  2KTR A;  2KDE B;  2ZPN A;  3GOE A;  2KDI A;  1EF5 A;  2LWP A;  2REX A;  3PZD A;  4NNJ B;  4HCP B;  3WAO A;  2KKC A;  3OJ4 B;  4LDT B;  2N4F A;  2HJ8 A;  1E5W A;  3ZKJ C;  2KHW B;  3O65 B;  3TCA A;  5AZG A;  1YD8 U;  3A9K B;  1IPG A;  1LM8 B;  3PPA A;  4MSQ B;  4J6I A;  2V3S A;  4E71 A;  3AUL A;  3HM3 A;  3WAP A;  2KNB A;  3H9D A;  5L95 C;  4W9J A;  2KFK B;  4ZYN A;  5EDS A;  2RR9 A;  1WMH B;  1RRB A;  3A33 B;  5AZF A;  1A5R A;  2MSE D;  5CTR C;  2J7Q B;  2O2V B;  3A9K A;  3L16 A;  5G55 A;  3DBR I;  4WWP A;  1D3Z A;  2KTF A;  1ZKH A;  4I6P A;  2KFK A;  2BWE S;  3IBE A;  4PYU A;  2FID A;  3CST A;  1XD3 B;  1WMH A;  2BPS A;  2IYD B;  1SGH A;  4LJO B;  2KWC A;  4JIO U;  1F9J A;  2GMI C;  4PS7 A;  2JXX A;  4GMV A;  2O2V A;  3M95 A;  2CHZ A;  2FCQ A;  2NS5 A;  3PLV A;  3A1Q A;  4LJP B;  4JQW C;  3L13 A;  3UF8 A;  3DPD A;  3ENE A;  2M1M A;  2MA9 B;  4BBN C;  4W9G A;  2KQS A;  3RUL A;  1OTR B;  1WXA A;  1XT9 B;  1OGW A;  3A4R A;  4GN1 A;  2IO2 B;  4IM0 A;  4MDK E;  4BOS C;  5JHB A;  4KZ0 A;  2D11 A;  4E3C A;  1CMX B;  1ZGU B;  2EKE C;  2RPQ A;  1WH3 A;  3K9O B;  3TIX A;  2CHX A;  3UIO B;  4ANW A;  5G2N A;  4CHK A;  3C0R B;  3PVL A;  4TUU A;  2LGD A;  2L3Z A;  1OEY A;  2MX2 A;  1S3S G;  5C23 A;  3PRE A;  3CMM B;  1E90 A;  2K6Q A;  4X57 B;  1SE9 A;  2BWF A;  4AJW A;  2CU1 A;  2AYO B;  4EZL A;  3AI5 A;  4FN2 A;  4FJZ A;  3VUX A;  2C7H A;  3N3K B;  2LVQ A;  4ICV A;  2XBB C;  4K7W A;  1TTN A;  3PGE A;  2LXA A;  3V61 A;  5GMV A;  2RSU A;  3KUD B;  1C1Y B;  3DVN V;  5E6O A;  3VTW A;  1WXV A;  4A20 A;  2FAZ A;  2BKR B;  3VUY A;  4XC2 A;  2LAS A;  3OLM D;  1E8X A;  4WWN A;  4W9C A;  2KWU B;  3ZRC A;  4PS8 A;  2XK5 B;  3NY5 A;  2XEW A;  3W1S A;  4BOZ B;  4K7S A;  4AP4 C;  4RM8 A;  1V5T A;  2MQJ A;  1TGZ B;  2LZ6 A;  3M62 B;  1P0R A;  2MW5 A;  5CHW A;  4W9D A;  3VFK A;  2JZZ A;  3U8Z A;  4IG7 B;  2Z0D B;  4NJ7 A;  3A9J B;  3NZU A;  2DYM A;  2XK5 A;  5D94 A;  2NBW B;  1BT0 A;  4IWO A;  1J8C A;  1I35 A;  4HCN B;  4K7U A;  5J17 A;  4W9L A;  4HPM B;  3VHT C;  2BKF A;  2ZJD A;  3RT3 B;  3WAM A;  2FCS A;  2DAJ A;  5JHA A;  2JWZ A;  2FIF A;  2KX3 A;  2R2O A;  1S1Q B;  1WE7 A;  2RGF A;  3A9J A;  4P7I A;  2LVP A;  4GSW A;  2NCN A;  4EKU A;  1WM2 A;  3SU8 X;  1WZ0 A;  4BKS D;  3H1U A;  3RZF A;  2HD5 B;  2UYZ B;  2B3A A;  4DDG D;  2DZI A;  1P1A A;  2KVR A;  2LUE A;  3JSV B;  1WIA A;  5E6N A;  3RYT A;  2M4N A;  3SHQ A;  4RMA A;  4TQ1 A;  3KW5 B;  4KSL C;  2ZNV B;  1I42 A;  1X1M A;  2IO1 B;  1SIF A;  3H7S A;  4M8M A;  4OVU A;  3H6N A;  4GU2 A;  4A3O A;  3RD2 A;  3HIZ A;  1YIW A;  1JRU A;  2OJR A;  2DZJ A;  2JT4 B;  4HWI B;  4MGK E;  4TV3 A;  4G0N B;  3JSV A;  2O6V D;  2QHO A;  2C5L C;  2KOX A;  4MM3 A;  4AWJ A;  2KC1 A;  3IHP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...