2L7RA

Solution nmr structure of n-terminal ubiquitin-like domain of fubi, a ribosomal protein s30 precursor from homo sapiens. northeast structural genomics consortium (nesg) target hr6166
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
MQLFVRAQELHTFEVTGQETVAQIKAHVASLEGIAPEDQVVLLAGAPLEDEATLGQCGVEALTTLEVAGRMLGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Ubiquitin-like protein FUBI
publication title Solution NMR structure of N-terminal Ubiquitin-like domain of FUBI, a ribosomal protein S30 precursor from Homo sapiens. NorthEast Structural Genomics consortium (NESG) target HR6166
rcsb
source organism Homo sapiens
total genus 17
structure length 74
sequence length 74
ec nomenclature
pdb deposition date 2010-12-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00240 ubiquitin Ubiquitin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2l7rA00
1ISNA 2LVPA 4CHKA 4NAWA 2JUOA 4LJOB 4ZDVA 1WXMA 1J19A 1YQBA 4KIKA 1E8XA 4PS7A 3VH4B 3DVGX 3ZIMA 1WX7A 2KOXA 3SD5A 3VHTC 3MHSD 3CF6E 4NNJB 4W9JA 2AYOB 2DZJA 1OEYA 2KANA 1YIWA 2LGXA 1BT0A 3NZSA 3X0WA 4K81A 3A9JA 5L95C 3LDZE 2MRPA 3SDLC 3A9KA 2K25A 2ZPYA 4LCDE 4XZ4A 2R2OA 4GDKA 4KIKB 4K1RB 3VVWB 2DZKA 1IYFA 4LDTB 1D3ZA 3PLUA 4W9LA 2BF8B 4G0NB 1YX5B 1WE6A 2GOWA 2V1YA 1R4MI 4F8CB 3ZNZB 3PSEB 4W9HA 2V4LA 3QARA 1QZEA 3A9KB 4MGKE 2M4NA 3IFWB 3UQBA 4AJYB 3CSTA 2D07B 4W9EA 1KLVA 5JH5C 1WRDB 2YVCA 1ZKHA 2L0TA 2RSUA 3VQIA 3A33B 4IC7B 4MM3A 4E3CA 1Y8RC 2GBMA 4K7SA 1WGGA 2KVRA 1LQBA 3V6EB 4KDIC 4AWJA 1LXDA 3ML8A 3QX1A 3X23A 2CKHB 3ZW3A 4DHJD 2KK8A 3VFKA 4F1SA 4XX5A 3T8MA 1V6EA 3PRZA 1P98A 5DPRA 1KOTA 1GNUA 1KM7A 1OTRB 1TTNA 2NCNA 3L17A 3KUCB 2O6VD 1MG8A 4MGZE 5DPTA 3EFUA 2WX1A 2MWSB 3BY4B 3TJPA 2I1JA 4DDGD 2GBNA 1E7VA 2ZPNA 5E6PA 3L16A 3RD2A 3RT3B 2AWTA 4KSKC 3V61A 5CHWA 3H1UA 1X1MA 4W9KA 2Z0EB 3JSVB 2N7EA 1Q5WB 3PVLA 3RCZA 5JHBA 4IM3A 4B9KA 2AL3A 5CHFA 2IO2B 5AEKB 3DBSA 2V3SA 2MLBA 2OJRA 3K9PB 4IG7B 4K7WA 2D3GA 2IY0B 1JRUA 3R66C 3U8ZA 2YLMA 3L10B 3UGBB 3ZUNA 4HPLB 3GZNI 1I35A 3ZDTA 2CHWA 3L13A 2NBVB 1Q1OA 3PREA 4HVBA 4HWIB 2EMTA 1SIFA 1WR1A 2L8JA 2REXA 4FHKA 2MBEA 1WR6E 4BKGA 1WZ3A 4DHZE 2LXAA 4MGIE 3M63B 4DDID 4URKA 4HDOA 2IY1B 4WWOA 2C7NB 3OJ3A 2JWZA 4IWPA 2N1WA 2C7HA 3VTWA 4JGHB 1J8CA 4BBNF 4MEMA 4GDLA 2KC1A 3JVZX 2LGDA 2MP2A 2FCQA 3S2AA 1WE7A 5JHAA 1Z2MA 2XK5A 3DPDA 1WXAA 3T9LA 1I42A 3A4RA 2O2VA 4IWQA 1V2YA 4II3B 3EC8A 3V6CB 1V5OA 2LRUA 4NY0A 1P1AA 2BWES 4ZRKA 2VRRB 4AJWA 2LZ6A 4EZJA 4MDKE 4OVVA 4RMAA 2JXXA 4ANWA 1WX8A 1WXVA 2L05A 1WMHA 2G3QB 2MP2B 4ANUA 3ZDMC 3B08A 1S1QB 4I6LB 3VTUA 1FXTB 2JF5A 4BOZB 4BOSC 4EUTA 4GB9A 4BKTA 4KZCA 3PS6A 4P7IA 2KO3A 4ICVA 2DENB 1UBIA 3NHEB 4ANXA 4G50A 1Z5SB 1WF9A 3R3MA 2ZJDA 2MQJA 2LJ5A 2N4FA 4J6IA 3VAWA 1WM2A 2NS5A 3ZVVA 1WM3A 3NS8A 2GBKA 2RGFA 4WWNA 5AZGA 4IUMB 4PYUA 1RRBA 3AU5A 2IYDB 4NAWB 3M62B 3L54A 4MJSA 3VDZA 2KC2A 3QQ8B 3ZLZA 2PEAA 1WMHB 3L0WB 3WAMA 2RR9A 1L7YA 2RD0A 3QA8A 2KQSA 4DBGA 2L0FA 1F9JA 1WJNA 1XD3B 2PPHA 3VUWA 2G45B 3CSFA 3QHTA 4DXAB 1UD7A 2M1MA 5LXIB 3A9JB 2AL6A 3VUYA 4BBNC 4BFRA 2I1KA 3UIOB 1E8WA 2PE9A 3W1YA 3RULA 2BKRB 1IP9A 2J0KA 1Q0WB 2LVOA 2CU1A 1WI0A 1OGWA 2AEHA 3KVFB 1CMXB 4GU2A 4GDKB 4MJSB 4CO7A 2LUEA 4BVUC 4DHZB 2KNBA 1YX6B 3K9OB 3Q3JA 2KD0A 4IM2A 2C7MB 4PYZA 2JRHA 4N9F4 3DVNU 3L08A 5C23A 1UELA 2KFJA 1V86A 2JZZA 1LFDA 2KJRA 1HE8A 4GXBA 4ASWC 4FA6A 4TQ0A 2PJHA 2EKEC 2FCMA 1P0RA 1XQQA 2JY6A 1NDDA 4LDTD 3O65B 1UGMA 1UZXB 3PRPB 2OOBB 2ZCCA 2LASA 3Q3FA 5TR5A 4OVUA 2IO0B 1C3TA 2DYMA 2MBHA 2FUHB 5AZHA 3WANA 4B95A 5IA7A 2MBOA 2MSED 1WXSA 4W9IA 3ZKJC 4BKSA 3TBLD 3ZNHB 2KQ7A 4G11A 1GC6A 4ZRJA 5HKHA 2K6DB 2NBUA 2KLGA 3ENEA 3M3JA 5CX3A 2KLCA 3AI5A 3WAPA 2L7RA 3V62A 1KJTA 4AP4C 2LWPA 3VUXA 1UH6A 2G4SA 2N9EB 1NBFC 3MTNB 4HXDA 3U30A 2ZCBA 4WJNA 3PPAA 5CHVC 2QHOA 2KZRA 3PZDA 4ANVA 4WQOB 1WFYA 5E6NA 3KUZA 4FJYA 2DAFA 1EUVB 2M0XA 3GOEA 2L00B 2HE7A 5BO4B 2KHWB 4M8MA 2KTFA 2KKCA 4B6WA 3DVNV 2MBQA 2KDIA 3DOWA 4MSQB 1J0GA 4EZLA 3VXWA 3MJWA 2C5LC 2XBBC 3AULA 2JRIB 4TUUA 5GMVA 3SU8X 3QIJA 2MCNB 4ZYNA 3KYCD 3AXCA 3HM6X 3DQVA 4NQKE 4RM9A 3ZTCA 3H9DA 2ZZPB 2ASQA 4I6PA 1E8YA 2JT4B 2ZEQA 3HM3A 4KVGB 2LRWA 4W9FA 3RZFA 1WY8A 3LJ3A 4XC2A 2DYBA 4X57B 2NPTA 3TCAA 3ZO5B 2FCSA 2FNJB 3B1LX 3D32A 2L3ZA 2PE6B 2FAZA 5E6OA 5J2RA 5L83A 3WAOA 2L76A 3W1SA 2LXCA 3APFA 2MA9B 2KX3A 1V81A 2RPQA 4EOYA 1OEYJ 3OJ4B 1V80A 4A3PA 2DZIA 2GBRA 4K7UA 2Y5BB 3QJZA 1UBQA 1K8RB 1YD8U 4AUQC 2UWQA 4TKNA 2DX5B 2NPTB 1WX9A 5G55A 4GDLB 1WGDA 4FBJB 2HTHA 1WIAA 3N3KB 2KXJA 1IPGA 2NR2A 1VD2A 2XK5B 3DCGA 3H7PA 5D6JB 3TIXA 4FULA 3ALBA 4FLHA 2O2VB 3DBHI 2UYZB 3A4SC 4NPNA 1P9DU 2N9XA 2MW5A 3A1QA 3PHWB 3DBRI 4KSLC 3ML9A 2C9WB 3H7SA 5AZFA 1EF5A 3PT2B 3WIMA 4A20A 1AARA 1U4AA 4EZKA 4HJKA 5IAAC 2KWVB 4GSWA 2KTRA 4IWOA 2MX2A 1YJ1A 1EO6A 2K8BA 4M0WB 5FR6A 2N1VA 3W1SC 2W9NA 4DWFA 2MBBB 2LD9A 1WJ4A 4IW0A 3H7PB 5EDSA 4PS3A 2KJHB 4WJQA 5DPWA 4RM8A 4GIVA 1WZ0A 3JYUA 3C0RB 1TBEA 3PGEA 1NI2A 4MH0E 2KMAA 2K39A 2N7DA 3UINB 3A1QB 1EF1A 2O6VA 2BYFA 3H6NA 4EKUA 3ZNGC 3R7QA 5G2NA 3RZWC 3UIPB 2ZVOA 2LGYA 2R2QA 4DHJB 2DHZA 2KTRB 1RLFA 4WWPA 4E71A 3KW5B 3VH3B 4MELA 4EEWA 3R7RA 3TMPB 1V9JA 1XT9B 5J18A 3QK0A 2JVCA 3QC8B 5LLIA 4HK2A 3CMMB 2O6VB 3IHPC 2K8HA 4NQLB 4GN1A 3UF8A 2LI5A 4MSMB 3M95A 3ZRCA 2NBWB 3KYDD 2A4ZA 3U7DA 2KDBA 2B3AA 2XEWA 3N30A 3DBLI 3HHMA 1PQSA 4GOCA 2NVUI 1OQYA 2Z0DB 4TQ1A 2ZVNA 2IBIB 4NJ7A 2J0JA 2JPHA 3VTVA 2HD5B 1T0YA 2KDFB 2KWCA 3HK0A 3PRMB 4YL8A 3AU4A 3N32A 3PHXB 2HJ8A 2WX0A 3KH0A 3P2BA 4GMVA 4HDQA 1RFAA 4GGQA 2KJ6A 4MGYE 2BPSA 3IBEA 3NY5A 2D11A 2WDTB 3NOBA 2DAJA 1SE9A 1WJ6A 2BKFA 2CHXA 4KZ0A 3V60A 1S3SG 2WYQA 3WALA 1E7UA 3ZTDA 3ZRFA 1M94A 4WAAA 3JSVA 4II2B 3APDA 1GUAB 4PS8A 3ONSA 3RYTA 1WGHA 4HCNB 1L2NA 2IO1B 5JZEB 1GJZA 2GMIC 5C1ZA 3ECIA 5KHQA 2N9PC 4TV3A 4ICUA 3DVGY 2DYOA 1WJUA 4A3OA 1LM8B 1WGRA 3ZNID 5D94A 3EECA 3RUIB 5CTRC 2IZVB 2D10A 2K8CA 2CHZA 4HLEA 3UQAA 2K6QA 4FN2A 3TL5A 3BINA 2BWFA 4LJPB 2M8SA 1R4NI 3B0AA 1GG3A 3QWZB 5DPSA 3WA0A 4W9DA 4JIOU 4FADA 4FHJA 4KDLB 4WJOA 5KHOA 3PLVA 3PTFC 4JQWC 4JL9A 4JLCA 3OLMD 1E5WA 1SGHA 2J0MA 2D2QA 1ZGUB 2G4DB 1H8CA 1V5TA 2KN5A 2KFKA 1E8ZA 3PV1A 2KWUB 1WGYA 2KMCA 3QCAA 2KDEB 2CS4A 1WYWB 3IVFA 2M17A 4FJZA 4KV2A 1RAXA 4BKSD 4M8NA 2A5UA 4HPMB 1G6JA 2FCNA 2K1FA 2BYEA 3KUDB 1TZ1A 2ZNVB 4HCPB 5D7GA 4G3XB 1A5RA 4EFOA 1ZW7A 1TGZB 4I6NB 1V49A 4NJ6A 5D2MB 5J17A 2EMSA 3APCA 2KFKB 2GBJA 2BYVE 3I3TB 2C60A 3DDCB 3JW0X 2ZNVC 1H4RA 2J7QB 2KX0A 4W9CA 5DCNA 3QAQA 1C1YB 4ZRIA 2DZMA 4AOFA 4CYEA 3NZUA 1VCBA 2Z59B 4W9GA 4FJVB 4E74A 4F7ZA 4WJPA 2FIFA 2LVQA 4IM0A 2IO3B 2WWZA 2FIDA 3OAWA 1E90A 2JZ3B 1GC7A 1P3QU 2BGFA 3EHVA 3HIZA 1WH3A 3IG3A 3SHQA 4DK5A 2CR5A 5LXHA
chains in the Genus database with same CATH superfamily
1ISNA 1HTOA 1WXMA 2OEDA 3ZQ4A 4PS7A 2LEKA 2KOXA 3CF6E 4NNJB 4W9JA 3J9CA 4WQMA 3AEFB 2PLPA 2H88B 3X0WA 5L95C 3A9KA 3ZYYX 1NENB 3VVWB 3P4QB 4ZHPA 4R3DA 1F0ZA 1IYFA 4C4VA 4W9LA 1WE6A 5IOIA 3TEZA 1QZEA 1LO5D 2M4NA 3IFWB 3UQBA 1KLVA 2YVCA 3T3OA 1ZKHA 1YN4A 1F1HA 1Y8RC 1F2RC 1WGGA 1LQBA 1QOBA 1C79A 2E6XA 1P98A 3GE3C 2PVOD 3NZ3A 3L17A 1MG8A 2WDQB 2VZKD 4YTMB 5G5GA 1FXIA 2I1JA 2GBNA 1E7VA 1OQQA 2AWTA 3V61A 4RGOS 2FE8A 2AQ1B 2Z0EB 3RCZA 5JHBA 3AV8A 1EU4A 4XWTA 1JRUA 2WXPA 2WXLA 4HPLB 1SE4A 3L13A 1NEKB 4L23A 2L8JA 2OJWA 2REXA 1FPYA 4KKJA 4MT5A 4BKGA 5BYQA 1T0SC 4URKA 3Q8CA 4OZAA 4HEA1 1DOXA 2VH2A 4IWPA 2N1WA 1VLBA 2V3NA 4GDLA 2INPE 3JVZX 2MP2A 2FCQA 3S2AA 5JHAA 1Z2MA 2CJNA 3T9LA 1FXAA 1JWBD 2O2VA 4IWQA 1V2YA 4II3B 3EC8A 1P1AA 4ZRKA 3OWEB 1ZXIA 2L05A 3VRBB 1FMAD 4BOSC 4GB9A 4KZCA 3NHEB 1K52A 2ZJDA 2MQJA 2N4FA 1J7CA 1L0XB 1GB4A 1QF6A 4PYUA 3B2GA 1F2RI 3L54A 3ZLZA 2PEAA 2GI9A 3L0WB 3DBHB 1WJNA 1XD3B 4IKGA 2PMVA 3CSFA 4BBNC 4BFRA 3UIOB 3KVFB 4GU2A 4MJSB 4JX1C 3BK1A 4DHZB 4LNKA 2Y5PA 1LFDA 1LGRA 2FCMA 3ZXVA 1NDDA 4LNIA 1TY2A 1UGMA 1UZXB 3FAHA 3ZJUA 4K3CA 4A6QA 3MP9A 4M01A 2MBHA 3WANA 4B95A 2MSED 4RCOA 4BKSA 4G11A 4ZRJA 5HKHA 2Y5CA 2KLGA 3V62A 2IGDA 1UH6A 1AW7A 1DGJA 3AN1A 3PPAA 3SFEB 1GAQB 4FJYA 1IBXA 3GOEA 2MJDA 5BO4B 1VZ7A 2KTFA 2EKIA 3AMZA 2VH1A 4JPSA 3DOWA 3MJWA 2C5LC 2JRIB 1T0QC 3Q2AC 5GMVA 4P1CC 4ZYNA 3AXCA 3DQVA 3AE1B 2AQ3B 3RZFA 1R4NB 1ACCA 1WY8A 3LJ3A 1KLGD 3BVGA 1IUEA 1FNVA 2FAZA 1C9FA 3W1SA 2RDHA 1V81A 3OJ4B 2INNE 2DZIA 2GBRA 3AE8B 1UBQA 3P4SB 4TKNA 2NPTB 4GDLB 1WGDA 4FBJB 2HTHA 3TIXA 4N6EB 1SE3A 3ALBA 2O2VB 3DBHI 1P9DU 3AEEB 5AZFA 2KACA 1JMLA 4ITKA 4A20A 3TEWA 2KTRA 1YJ1A 1EO6A 4KKIA 2N1VA 2WXKA 4DWFA 2LD9A 1KH0A 1KTKA 4AS1A 5EDSA 2KJHB 4BAXA 1FCLA 1L6VA 1TBEA 2KVZA 4A90A 4EKUA 4OZBA 5G2NA 1FNWA 2LGYA 2JSVX 2Y3AA 4E71A 3KW5B 2LFIA 3R7RA 1CQVA 1XT9B 4WWMA 5LLIA 2WXFA 4J3OD 4NQLB 4GN1A 2VZKB 1ZE3D 3ZRCA 2NBWB 1NYRA 4TQ1A 5HHDG 2IBIB 2J0JA 3VTVA 4YL8A 1R4MB 3TEYA 3N32A 4YSXB 2WX0A 4GMVA 3P2BA 1RFAA 4GGQA 2N7JA 3OG5A 2BPSA 3IBEA 3NY5A 2JU6X 3NOBA 2KDMA 1SE9A 1WJ6A 4N59A 2WNMA 4C56C 2WYQA 1E7UA 2IDYA 2PTLA 1C4CA 1WGHA 2WU2B 2IO1B 2WLBA 1GJZA 2GMIC 5KHQA 1YJJA 3CWIA 4ICUA 5D94A 3EECA 5CTRC 2QSDA 2K6QA 4LJPB 1R4NI 3B0AA 4FHJA 5KHOA 4WJOA 1IBXB 3PTFC 2NTTA 3MC0B 2D2QA 1ZGUB 2G4DB 3IAM1 2KFKA 2G1EA 4RGMA 2ONQA 2KDEB 1WYWB 4FJZA 1A70A 3SR6A 5EE9A 2FCNA 1SXTA 1TZ1A 3EUB2 1YQ3B 4L1BA 4G3XB 1A5RA 1TGZB 1V49A 5D2MB 1F52A 4YWGG 2Q5WD 2DBYA 3I3TB 3R8BA 2KX0A 4W9CA 2DZMA 1UWMA 2LVQA 1FFUA 2WWZA 2FIDA 1E90A 3EHVA 1GC7A 3HIZA 3IG3A 4DK5A 1E8WA 5LXHA 1XF5L 2LVPA 3NJTA 1XCTL 3VH4B 1DOIA 3SD5A 3VHTC 3KWVA 2KN4A 2WXMA 1TIFA 3A9JA 1VZ8A 2ZPYA 4XZ4A 1M4VA 3AE7B 4L2YA 1D3ZA 3W2DA 2BF8B 2PIAA 3TEXA 1QOGA 1R4MI 1PGXA 4A9AA 3QARA 2WHIA 1QOAA 3U4EG 4W9EA 2L0TA 3NRZA 4MM3A 1P7FA 2GBMA 4K7SA 2KVRA 2WXRA 4KDIC 1WRIA 4XDCA 1XEEA 1JROA 3QX1A 4XX5A 3T8MA 3PRZA 1KOTA 1KM7A 4YXDB 1TTNA 2MJ3A 3HVZA 3KUCB 4MGZE 3EFUA 1VZ6A 2MWSB 3BY4B 3RNCC 3TJPA 3ZGZA 5E6PA 4ZRQA 1C4PA 2BYTA 1N6ZA 3RT3B 4KSKC 1RYJA 4KGRA 4IM3A 3AEAB 1AN8A 2MJEA 5AEKB 1MFWA 1RWSA 3K9PB 4RGNA 3RPFC 2RDGA 2XNAC 3ZUNA 3I57A 2MEKA 2K9XA 1I35A 4WIPA 3ZDTA 2WXNA 5HI1A 1V8CA 4HVBA 2EMTA 1SIFA 2JX5A 3R2IA 1WZ3A 1Q10A 3MC9A 2LXAA 4MGIE 1XLPA 3M63B 1ESFA 2LGIA 4WWOA 1AWDA 2SEBD 2C7NB 2K0PA 2K5PA 2C7HA 1J8CA 4JGHB 4RNAA 2QEJC 1V97A 2KC1A 1SJHD 2LJIA 2PKOA 1I4GA 4NAMA 1QQRA 3ETRA 3R2TA 5H8YE 3V6CB 1V5OA 4NY0A 2BWES 4AJWA 2LZ6A 3DWMA 4UDUC 4OVVA 4RMAA 2JXXA 2LHEA 2IJ0A 2FUG1 3ZDMC 1AYFA 1S1QB 4I6LB 3VTUA 2WXIA 2JF5A 4P7IA 5H92C 3VAWA 3NS8A 2GBKA 1ZP0B 5AZGA 1RRBA 4D2KA 2IYDB 3M62B 4MJSA 3VDZA 3QQ8B 3QA8A 2PPHA 2G45B 3Q3NC 4OVZA 1PYWD 1PGBA 2M1MA 3A9JB 3VUYA 2I1KA 2PE9A 3W1YA 1L0YB 1Q0WB 2AEHA 1CMXB 1WGKA 5LNK1 4BVUC 2KNBA 1YX6B 3K9OB 3Q3JA 1FM0D 4PYZA 2KWDA 4N9F4 3DVNU 1T0RC 1SB3C 5C23A 2W54A 4N58A 2KFJA 3KLSX 1I4RA 1PFDA 5I4DA 1TZOA 1HZ6A 2JY6A 4LDTD 3O65B 4MM3B 4B0MA 4C00A 2WP9B 2LASA 3VRAB 4OVUA 2IO0B 2DYMA 2FUHB 1WXSA 1MHXA 3TBLD 4HRSA 3Q8AA 3ENEA 1VJKA 2L7RA 2LWPA 4USAA 3VUXA 1NI3A 3RNFC 3BK2A 3MTNB 3U30A 4WJNA 3AEGB 2ICIA 1E10A 1FIQA 4WQOB 2N9KA 3KUZA 2DAFA 1EUVB 4XGAB 2KHWB 4MSQB 4EZLA 3VXWA 2XBBC 4TUUA 1KFYB 3SU8X 1Y56A 3HM6X 4MH8A 2ZW1A 4NQKE 4LLGM 3H9DA 2ZZPB 3T3NA 1ET9A 1E8YA 1UGJA 3HM3A 5T8IA 1XLQA 2LRWA 3ZJVA 3NVYA 3TCAA 2NPTA 3MFGA 3ZO5B 2FCSA 2FNJB 3D32A 2L3ZA 2R61A 3NUHB 5E6OA 5L83A 2NTSA 2MA9B 3BWUD 2RPQA 1TS2A 4EOYA 2MHJA 1OEYJ 4A3PA 2WXJA 4IDIA 1K8RB 1YD8U 4AUQC 2UWQA 3FILA 1WX9A 3Q8BA 5GXGB 2I2YA 5D6JB 1T5XD 4TSSA 2MW5A 3PHWB 4KSLC 3ML9A 2C9WB 3PT2B 4C80A 4HJKA 4REZA 2KWVB 4GSWA 4IWOA 4WH4A 2K8BA 1WJ4A 1TJEA 2DWQA 4WJQA 1FNUA 4GIVA 3O13A 2WS3B 3PGEA 4MH0E 3UINB 3A1QB 1L5PA 2BYFA 3H6NA 3UIPB 3NG0A 1R7SA 5FR3A 1FRDA 1RLFA 3ABVB 2OHFA 4EEWA 1NYQA 1JW9D 1QKZA 5J18A 1VDVA 3Q8EA 5BMIA 2JVCA 1SF0A 4HK2A 5EE1A 3IHPC 4P1BC 3M95A 3KQ4A 2X38A 3BZDB 2B3AA 2XEWA 5FKAC 3HHMA 1PQSA 4GOCA 1OQYA 2K22A 2HD5B 2KWCA 3IT6B 4HDQA 4S0RA 3Q6BA 1ET6A 2D11A 3EFCA 4QAYA 4KZ0A 2JZPA 1S3SG 2HJ1A 3P42A 4II2B 1MPEA 5EE0A 1GUAB 4HCNB 5JZEB 1I4HA 1GOZA 3E56A 2L52A 3ECIA 4TV3A 4A3OA 3ZNID 1XO3A 1ZOYB 5D3IB 3RUIB 4M02A 4LTUA 3DHIC 3TL5A 3BINA 3QWZB 1GG3A 4KDLB 3GE8C 4JL9A 4JLCA 2E3TA 1C78A 1D5ZC 2ON8A 3BIID 3I5JC 1H8CA 1E8ZA 1JWSD 2BS3B 1WGYA 2INDC 1BMLC 2LUMA 1RAXA 4KV2A 2A5UA 3KWLA 3Q14C 1G6JA 4RGTA 1C76A 2K1FA 5D7GA 4EFOA 1ZW7A 4I6NB 1MHHE 2EMSA 3AE3B 2GBJA 2NMQA 2BYVE 4JWUC 1EU3A 2D3AA 1N5XA 1T6BX 4HPPA 2IGHA 2J7QB 1C1YB 4AOFA 1YQ4B 3NZUA 1VCBA 1V1PB 4WJPA 4IM0A 2IO3B 3OAWA 1P3QU 4MACA 3FILB 1X1MA 2CR5A 5TSSA 4NAWA 2JUOA 1E8XA 2G9HD 3AH7A 4JE3B 1OEYA 2KANA 4ARCA 4P6VF 2MH7A 1XXGA 2PW9A 3LDZE 4KIKB 2V9HA 2LMCA 2DZKA 4RF1A 4LDTB 3I9V1 3PLUA 3RFZB 1CK1A 4G0NB 1YX5B 3NVVA 4US8A 1XLOA 2V1YA 4F8CB 4O1NA 2V4LA 3BYYB 4AJYB 5JH5C 1WRDB 2RSUA 4IC7B 4E3CA 2AX5A 2M56B 1UWXA 3AEBB 4AWJA 1LXDA 3ML8A 1I4XA 1IGCA 4LK0M 4YT0B 4DHJD 2KK8A 3VFKA 4IOIE 3RNAC 1OTRB 2NCNA 5DPTA 2O6VD 3VR9B 4DDGD 3L16A 1TT5B 5CHWA 1TKEA 2N7EA 1Q5WB 1FFVA 4B9KA 1TY0A 4A8XC 2AL3A 5CHFA 2IO2B 2V3SA 4K7WA 1JWMD 2D3GA 3AE4B 4C7ZA 1JCKB 2CHWA 3H8HA 2AQ2B 3PREA 4HWIB 4FHKA 2MBEA 1WR6E 1CZPA 4HKQA 4EE2A 4DDID 4KGSA 4HDOA 3PZ8A 1J7AA 4LNFA 4MEMA 2IGGA 1YJIA 1HEZE 3DPDA 3A4RA 1SEBD 1HA5A 2J52A 2LRUA 3I63C 1WX8A 4ANUA 4TMAB 3B08A 2RMMA 1FXTB 2DENB 4YSZB 1Z5SB 1WF9A 3R3MA 2NS5A 3ZVVA 4BZAA 1WM3A 4OW0A 4WWNA 4WAFA 4XE0A 3N1XC 4NAWB 2KC2A 4YTNB 3AB5A 1WMHB 3WAMA 1L7YA 2KQSA 4DBGA 3VUWA 1F9JA 1FO4A 4DXAB 1UD7A 5LXIB 2FBWB 2BKRB 2CU3A 2LVOA 1WI0A 1OGWA 4CO7A 1TKYA 2LUEA 4KX6B 2L1AA 1I4PA 1KF6B 2KD0A 1HZ5A 2QILA 1YN3A 1MJDA 3DHHC 2D3BA 1UELA 1V86A 2JZZA 2WXQA 1D4BA 4GXBA 4FA6A 2EKEC 1D6EC 4YTPB 1P0RA 1XLNA 1XQQA 2W3RA 1HTQA 2ZCCA 1WXQA 1FCCC 5IA7A 2MBOA 4W9IA 3ZKJC 2KQ7A 1GC6A 1MVKA 2WDVB 4ARIA 3M3JA 5CX3A 3URYA 2KLCA 2RDBC 3VR8B 3WAPA 2JYTA 3W9CB 1C4AA 4LNNA 2N9EB 2G4SA 1NBFC 2YEPF 4HXDA 5CHVC 3PZDA 3Q3MC 1WFYA 3ZXRA 5E6NA 1ZDVA 3DWGC 2L00B 1L6UA 4B6WA 3DVNV 2MBQA 3TUOA 2KDIA 1J0GA 2QIEB 2L83A 3AULA 2MCNB 3KYCD 3GP7A 4XYCA 1L4ZB 2LHDA 2ZEQA 1PUTA 4HKZE 4XC2A 4X57B 3B1LX 1ZUD2 3WAOA 2L76A 2QCZA 1YMHE 3QJZA 3P4PB 3Q8FA 1WIAA 3N3KB 1IPGA 2NR2A 4FULA 1PGAA 4FLHA 4NPNA 2UYZB 3A1QA 2BB6A 3RNBC 1N5WA 3UI3A 4EZKA 2QJLA 4M0WB 5FR6A 2W9NA 1QLBB 2MBBB 4PK1A 3H7PB 5DPWA 4RM8A 3JYUA 1BXTA 1NI2A 2KMAA 2K39A 2N7DA 1DOYA 2ACZB 3GS2A 2ZVOA 4DHJB 2DHZA 1L4DB 1TS4A 4MELA 3AE9B 3TMPB 1V9JA 3QK0A 1YOVB 1TS5A 1QILA 1K51A 4C7YA 3CMMB 3EGRA 2O6VB 2K8HA 2EELA 5IO9A 3UF8A 3BVMA 3W5UB 2L32A 3KYDD 4B0EA 2J53A 2A4ZA 2W3SA 3U7DA 3CIRB 2JYEA 3AM9A 1B1ZA 3NVWA 2Z0DB 2ZVNA 2JPHA 5EE3A 2KDFB 3HK0A 4ZHOA 3BYTB 3AU4A 1P7EA 2HJ8A 4MGYE 3KH0A 5BYSA 1GB1A 2GRIA 3EA6A 2WDTB 2DAJA 2BKFA 1TS3A 1V1OA 2CHXA 3V60A 3WALA 1N62A 3ZTDA 4WAAA 3JSVA 3APDA 3RYTA 1N63A 2V0GA 2N9PC 4ZYSA 2DYOA 1WJUA 1WGRA 2BVCA 2BW2A 2K8CA 2CHZA 4HLEA 3IXSA 4OZCA 4FN2A 2BWFA 4RFBA 3U52E 2M8SA 1J7BA 5DPSA 2JWUA 4JIOU 4FADA 3IT4B 2ZW0A 3OLMD 1E5WA 1SGHA 3PO0A 1V5TA 2KN5A 1K50A 3N20C 5FK9C 1SE2A 1E0ZA 2N9LA 3IVFA 2M17A 3RN9C 4BKSD 2N0SB 4M8NA 3GZNB 1ZPSA 5IKCM 1V1PA 4HCPB 5G5HA 4NJ6A 2W82A 1MI0A 2BTEA 4S17A 1UF0A 4A55A 3DDCB 2DLBA 1H4RA 4ZRIA 5HFYA 3C19A 4CYEA 4FJVB 1T3QA 1YN5A 2WXHA 1KRHA 1WH3A 1NVID 2BS2B 3HRDD 2YLMA 2GB1A 5C3JB 1TKGA 4CHKA 4ZDVA 4LJOB 1J19A 1YQBA 4KIKA 3ZIMA 3DVGX 1WX7A 1ZXHA 3MHSD 2JXTA 2AYOB 1GPXA 2DZJA 1YIWA 2LGXA 1BT0A 2HDEA 1ZDXA 3NZSA 5HG2A 1K53A 4K81A 3SDLC 2MRPA 2K25A 4LCDE 2R2OA 4GDKA 3P1MA 4K1RB 1BUIC 1MG4A 2KAJA 2WXGA 2GOWA 3L4PA 3ZNZB 3PSEB 3ZJTA 4W9HA 3A9KB 4MGKE 5AUIA 3HUIA 3IAS1 3CSTA 5BYRA 2D07B 1VRAB 1KLUD 3VQIA 3A33B 4C4VB 3V6EB 2SAKA 2WQYB 3X23A 2CKHB 3ZW3A 4XDDA 4F1SA 4K3BA 3B2FA 3Q69A 1V6EA 5DPRA 5C2TB 1GNUA 2KMMA 4LNOA 1C77A 1EWYC 3GB1A 4DXGA 3SFDB 1WWTA 2WX1A 5JXVA 4AQ7A 2ZPNA 2QMTA 3RD2A 3H1UA 4W9KA 3JSVB 3PVLA 4M00A 2B76B 3DBSA 2UU7A 2MLBA 2OJRA 4IG7B 4WURA 2IY0B 3R66C 3U8ZA 3N9YC 3L10B 3UGBB 4HJGE 3GZNI 2NBVB 1Q1OA 3U7ZA 2QC8A 1WR1A 3RI7C 4RH6A 2KT7A 3AE6B 3MC8A 4FXCA 4DHZE 3P4RB 2V3PA 1JWAD 2IY1B 3OJ3A 2JWZA 1SBBB 3VTWA 4XWWA 4BBNF 3HVDA 2LGDA 1WE7A 1DYQA 2XK5A 2BT6A 1WXAA 1I42A 2I38A 1XCQL 3V3XA 1HQRD 2VRRB 1YNTE 4EZJA 4KGTA 4MDKE 4HROA 2HTME 3TSSA 4ANWA 1WXVA 1WMHA 2G3QB 2MP2B 4YSYB 1D5XC 2J42A 1QOFA 3AE2B 4BOZB 4EUTA 4BKTA 3PS6A 2KO3A 2RPVA 4ICVA 4ANXA 1UBIA 1FRRA 4G50A 4J6IA 2M19A 2LJ5A 1WM2A 2RGFA 4IUMB 3LYYA 3AU5A 1JQ4A 2V4IB 3MHZA 2J4XA 3MJ5A 2RR9A 3SEBA 2RD0A 2PVGC 1JALA 2L0FA 3FC4A 3DBRB 2Z8LA 5MPOA 3QHTA 2AL6A 1SSNA 5IN7A 1SIJA 3RULA 1IP9A 2J0KA 2CU1A 1RM6C 4GDKB 1EWCA 4IM2A 2C7MB 2JRHA 4CQNA 4H2AA 3L08A 3AECB 2KJRA 4ASWC 1HE8A 4TQ0A 2PJHA 2H89B 3PRPB 2OOBB 3Q3FA 5TR5A 1C3TA 5AZHA 5IP4D 1VR9A 3LXFA 4ZOHC 4GLSC 3ZNHB 2D5GA 3DBLB 2K6DB 2NBUA 2TSSA 3AI5A 1KJTA 4AP4C 3BVZA 3RNGC 2ZCBA 2QHOA 2KZRA 4ANVA 2M0XA 3Q3OC 2HE7A 4M8MA 2KKCA 3PZ7A 3P63A 3QIJA 5BMGA 4PT5A 2WU5B 2JQRB 1EM7A 1F77A 4RM9A 3ZTCA 4I6PA 2ASQA 2JT4B 4KVGB 4W9FA 4ACFA 1OQRA 2DYBA 2YEPB 1RFKA 2QDFA 2PE6B 5J2RA 3LB8C 5AUKA 2LXCA 3APFA 2KX3A 5D3DA 1V80A 4K7UA 2Y5BB 2XN9C 2DX5B 5G55A 1B9RA 2WDRB 4M0WA 2KXJA 5BMHA 1UNSA 2XK5B 1VD2A 3H7PA 3DCGA 2D3CA 1PDXA 3NS1A 3NVZA 1N61A 3A4SC 2N9XA 3DBRI 1OFFA 3H7SA 3N1ZC 1EF5A 4Q2JA 3WIMA 1AARA 1U4AA 4RF0A 1E6EB 5IAAC 2IPKD 2BB5A 3E9SA 2MX2A 3W1SC 4NZLB 3V05A 4IW0A 4PS3A 2KYWA 3FKYA 1WZ0A 3C0RB 4OHJA 1EF1A 2O6VA 1I7HA 3ZNGC 3R7QA 3RMKC 1STEA 3RZWC 2LGSA 2R2QA 2KTRB 4WWPA 3VH3B 1L0VB 3WCQA 1ROEA 1CJEA 3QC8B 1FD6A 4P16A 2M0AA 2LI5A 4MSMB 2KQ4X 3N1YC 2KDBA 2BS4B 3N30A 1D5MC 3DBLI 2NVUI 1E7PB 4NJ7A 1HXYD 1IGDA 1T0YA 3PRMB 4JWSC 3PHXB 1SJED 4NJCA 3C8YA 2KJ6A 2GLSA 4DXFA 2BBCA 1QT9A 3ZRFA 1M94A 4PS8A 3ONSA 1ENFA 1L2NA 2K3UA 5C1ZA 3DVGY 2W55A 3RNEC 1FEHA 1WSPA 1LM8B 4US9A 2IZVB 2D10A 2DNFA 1N60A 2BQQA 3UQAA 2WGSA 5E6JA 1TYGB 3WA0A 4W9DA 2WXOA 4DQOC 3DHGC 3PLVA 1E9MA 4JQWC 2INCC 2J0MA 1JRPA 3PV1A 2KWUB 2KMCA 3QCAA 2CS4A 3B9JA 1WYGA 4HPMB 3U2SC 2BYEA 3KUDB 2ZNVB 3AE5B 5J17A 3APCA 1I4QA 2KFKB 3W5VB 2C60A 3JW0X 2X8XX 2ZNVC 5DCNA 3QAQA 1UUPA 4E74A 2Z59B 3AEDB 4W9GA 4F7ZA 2CJOA 2FIFA 4ZRPA 2JZ3B 3SHQA 2BGFA 1JWUD
chains in the Genus database with same CATH topology
1ISNA 2LVPA 4CHKA 4NAWA 2JUOA 4LJOB 4ZDVA 1WXMA 1J19A 1YQBA 4KIKA 1E8XA 4PS7A 3VH4B 3DVGX 3ZIMA 1WX7A 2KOXA 3SD5A 3VHTC 3MHSD 3CF6E 4NNJB 4W9JA 2AYOB 2DZJA 1OEYA 2KANA 1YIWA 2LGXA 1BT0A 3NZSA 3X0WA 4K81A 3A9JA 5L95C 3LDZE 2MRPA 3SDLC 3A9KA 2K25A 2ZPYA 4LCDE 4XZ4A 2R2OA 4GDKA 4KIKB 4K1RB 3VVWB 2DZKA 1IYFA 4LDTB 1D3ZA 3PLUA 4W9LA 2BF8B 4G0NB 1YX5B 1WE6A 2GOWA 2V1YA 1R4MI 4F8CB 3ZNZB 3PSEB 4W9HA 2V4LA 3QARA 1QZEA 3A9KB 4MGKE 2M4NA 3IFWB 3UQBA 4AJYB 3CSTA 2D07B 4W9EA 1KLVA 5JH5C 1WRDB 2YVCA 1ZKHA 2L0TA 2RSUA 3VQIA 3A33B 4IC7B 4MM3A 4E3CA 1Y8RC 2GBMA 4K7SA 1WGGA 2KVRA 1LQBA 3V6EB 4KDIC 4AWJA 1LXDA 3ML8A 3QX1A 3X23A 2CKHB 3ZW3A 4DHJD 2KK8A 3VFKA 4F1SA 4XX5A 3T8MA 1V6EA 3PRZA 1P98A 5DPRA 1KOTA 1GNUA 1KM7A 1OTRB 1TTNA 2NCNA 3L17A 3KUCB 2O6VD 1MG8A 4MGZE 5DPTA 3EFUA 2WX1A 2MWSB 3BY4B 3TJPA 2I1JA 4DDGD 2GBNA 1E7VA 2ZPNA 5E6PA 3L16A 3RD2A 3RT3B 2AWTA 4KSKC 3V61A 5CHWA 3H1UA 1X1MA 4W9KA 2Z0EB 3JSVB 2N7EA 1Q5WB 3PVLA 3RCZA 5JHBA 4IM3A 4B9KA 2AL3A 5CHFA 2IO2B 5AEKB 3DBSA 2V3SA 2MLBA 2OJRA 3K9PB 4IG7B 4K7WA 2D3GA 2IY0B 1JRUA 3R66C 3U8ZA 2YLMA 3L10B 3UGBB 3ZUNA 4HPLB 3GZNI 1I35A 3ZDTA 2CHWA 3L13A 2NBVB 1Q1OA 3PREA 4HVBA 4HWIB 2EMTA 1SIFA 1WR1A 2L8JA 2REXA 4FHKA 2MBEA 1WR6E 4BKGA 1WZ3A 4DHZE 2LXAA 4MGIE 3M63B 4DDID 4URKA 4HDOA 2IY1B 4WWOA 2C7NB 3OJ3A 2JWZA 4IWPA 2N1WA 2C7HA 3VTWA 4JGHB 1J8CA 4BBNF 4MEMA 4GDLA 2KC1A 3JVZX 2LGDA 2MP2A 2FCQA 3S2AA 1WE7A 5JHAA 1Z2MA 2XK5A 3DPDA 1WXAA 3T9LA 1I42A 3A4RA 2O2VA 4IWQA 1V2YA 4II3B 3EC8A 3V6CB 1V5OA 2LRUA 4NY0A 1P1AA 2BWES 4ZRKA 2VRRB 4AJWA 2LZ6A 4EZJA 4MDKE 4OVVA 4RMAA 2JXXA 4ANWA 1WX8A 1WXVA 2L05A 1WMHA 2G3QB 2MP2B 4ANUA 3ZDMC 3B08A 1S1QB 4I6LB 3VTUA 1FXTB 2JF5A 4BOZB 4BOSC 4EUTA 4GB9A 4BKTA 4KZCA 3PS6A 4P7IA 2KO3A 4ICVA 2DENB 1UBIA 3NHEB 4ANXA 4G50A 1Z5SB 1WF9A 3R3MA 2ZJDA 2MQJA 2LJ5A 2N4FA 4J6IA 3VAWA 1WM2A 2NS5A 3ZVVA 1WM3A 3NS8A 2GBKA 2RGFA 4WWNA 5AZGA 4IUMB 4PYUA 1RRBA 3AU5A 2IYDB 4NAWB 3M62B 3L54A 4MJSA 3VDZA 2KC2A 3QQ8B 3ZLZA 2PEAA 1WMHB 3L0WB 3WAMA 2RR9A 1L7YA 2RD0A 3QA8A 2KQSA 4DBGA 2L0FA 1F9JA 1WJNA 1XD3B 2PPHA 3VUWA 2G45B 3CSFA 3QHTA 4DXAB 1UD7A 2M1MA 5LXIB 3A9JB 2AL6A 3VUYA 4BBNC 4BFRA 2I1KA 3UIOB 1E8WA 2PE9A 3W1YA 3RULA 2BKRB 1IP9A 2J0KA 1Q0WB 2LVOA 2CU1A 1WI0A 1OGWA 2AEHA 3KVFB 1CMXB 4GU2A 4GDKB 4MJSB 4CO7A 2LUEA 4BVUC 4DHZB 2KNBA 1YX6B 3K9OB 3Q3JA 2KD0A 4IM2A 2C7MB 4PYZA 2JRHA 4N9F4 3DVNU 3L08A 5C23A 1UELA 2KFJA 1V86A 2JZZA 1LFDA 2KJRA 1HE8A 4GXBA 4ASWC 4FA6A 4TQ0A 2PJHA 2EKEC 2FCMA 1P0RA 1XQQA 2JY6A 1NDDA 4LDTD 3O65B 1UGMA 1UZXB 3PRPB 2OOBB 2ZCCA 2LASA 3Q3FA 5TR5A 4OVUA 2IO0B 1C3TA 2DYMA 2MBHA 2FUHB 5AZHA 3WANA 4B95A 5IA7A 2MBOA 2MSED 1WXSA 4W9IA 3ZKJC 4BKSA 3TBLD 3ZNHB 2KQ7A 4G11A 1GC6A 4ZRJA 5HKHA 2K6DB 2NBUA 2KLGA 3ENEA 3M3JA 5CX3A 2KLCA 3AI5A 3WAPA 2L7RA 3V62A 1KJTA 4AP4C 2LWPA 3VUXA 1UH6A 2G4SA 2N9EB 1NBFC 3MTNB 4HXDA 3U30A 2ZCBA 4WJNA 3PPAA 5CHVC 2QHOA 2KZRA 3PZDA 4ANVA 4WQOB 1WFYA 5E6NA 3KUZA 4FJYA 2DAFA 1EUVB 2M0XA 3GOEA 2L00B 2HE7A 5BO4B 2KHWB 4M8MA 2KTFA 2KKCA 4B6WA 3DVNV 2MBQA 2KDIA 3DOWA 4MSQB 1J0GA 4EZLA 3VXWA 3MJWA 2C5LC 2XBBC 3AULA 2JRIB 4TUUA 5GMVA 3SU8X 3QIJA 2MCNB 4ZYNA 3KYCD 3AXCA 3HM6X 3DQVA 4NQKE 4RM9A 3ZTCA 3H9DA 2ZZPB 2ASQA 4I6PA 1E8YA 2JT4B 2ZEQA 3HM3A 4KVGB 2LRWA 4W9FA 3RZFA 1WY8A 3LJ3A 4XC2A 2DYBA 4X57B 2NPTA 3TCAA 3ZO5B 2FCSA 2FNJB 3B1LX 3D32A 2L3ZA 2PE6B 2FAZA 5E6OA 5J2RA 5L83A 3WAOA 2L76A 3W1SA 2LXCA 3APFA 2MA9B 2KX3A 1V81A 2RPQA 4EOYA 1OEYJ 3OJ4B 1V80A 4A3PA 2DZIA 2GBRA 4K7UA 2Y5BB 3QJZA 1UBQA 1K8RB 1YD8U 4AUQC 2UWQA 4TKNA 2DX5B 2NPTB 1WX9A 5G55A 4GDLB 1WGDA 4FBJB 2HTHA 1WIAA 3N3KB 2KXJA 1IPGA 2NR2A 1VD2A 2XK5B 3DCGA 3H7PA 5D6JB 3TIXA 4FULA 3ALBA 4FLHA 2O2VB 3DBHI 2UYZB 3A4SC 4NPNA 1P9DU 2N9XA 2MW5A 3A1QA 3PHWB 3DBRI 4KSLC 3ML9A 2C9WB 3H7SA 5AZFA 1EF5A 3PT2B 3WIMA 4A20A 1AARA 1U4AA 4EZKA 4HJKA 5IAAC 2KWVB 4GSWA 2KTRA 4IWOA 2MX2A 1YJ1A 1EO6A 2K8BA 4M0WB 5FR6A 2N1VA 3W1SC 2W9NA 4DWFA 2MBBB 2LD9A 1WJ4A 4IW0A 3H7PB 5EDSA 4PS3A 2KJHB 4WJQA 5DPWA 4RM8A 4GIVA 1WZ0A 3JYUA 3C0RB 1TBEA 3PGEA 1NI2A 4MH0E 2KMAA 2K39A 2N7DA 3UINB 3A1QB 1EF1A 2O6VA 2BYFA 3H6NA 4EKUA 3ZNGC 3R7QA 5G2NA 3RZWC 3UIPB 2ZVOA 2LGYA 2R2QA 4DHJB 2DHZA 2KTRB 1RLFA 4WWPA 4E71A 3KW5B 3VH3B 4MELA 4EEWA 3R7RA 3TMPB 1V9JA 1XT9B 5J18A 3QK0A 2JVCA 3QC8B 5LLIA 4HK2A 3CMMB 2O6VB 3IHPC 2K8HA 4NQLB 4GN1A 3UF8A 2LI5A 4MSMB 3M95A 3ZRCA 2NBWB 3KYDD 2A4ZA 3U7DA 2KDBA 2B3AA 2XEWA 3N30A 3DBLI 3HHMA 1PQSA 4GOCA 2NVUI 1OQYA 2Z0DB 4TQ1A 2ZVNA 2IBIB 4NJ7A 2J0JA 2JPHA 3VTVA 2HD5B 1T0YA 2KDFB 2KWCA 3HK0A 3PRMB 4YL8A 3AU4A 3N32A 3PHXB 2HJ8A 2WX0A 3KH0A 3P2BA 4GMVA 4HDQA 1RFAA 4GGQA 2KJ6A 4MGYE 2BPSA 3IBEA 3NY5A 2D11A 2WDTB 3NOBA 2DAJA 1SE9A 1WJ6A 2BKFA 2CHXA 4KZ0A 3V60A 1S3SG 2WYQA 3WALA 1E7UA 3ZTDA 3ZRFA 1M94A 4WAAA 3JSVA 4II2B 3APDA 1GUAB 4PS8A 3ONSA 3RYTA 1WGHA 4HCNB 1L2NA 2IO1B 5JZEB 1GJZA 2GMIC 5C1ZA 3ECIA 5KHQA 2N9PC 4TV3A 4ICUA 3DVGY 2DYOA 1WJUA 4A3OA 1LM8B 1WGRA 3ZNID 5D94A 3EECA 3RUIB 5CTRC 2IZVB 2D10A 2K8CA 2CHZA 4HLEA 3UQAA 2K6QA 4FN2A 3TL5A 3BINA 2BWFA 4LJPB 2M8SA 1R4NI 3B0AA 1GG3A 3QWZB 5DPSA 3WA0A 4W9DA 4JIOU 4FADA 4FHJA 4KDLB 4WJOA 5KHOA 3PLVA 3PTFC 4JQWC 4JL9A 4JLCA 3OLMD 1E5WA 1SGHA 2J0MA 2D2QA 1ZGUB 2G4DB 1H8CA 1V5TA 2KN5A 2KFKA 1E8ZA 3PV1A 2KWUB 1WGYA 2KMCA 3QCAA 2KDEB 2CS4A 1WYWB 3IVFA 2M17A 4FJZA 4KV2A 1RAXA 4BKSD 4M8NA 2A5UA 4HPMB 1G6JA 2FCNA 2K1FA 2BYEA 3KUDB 1TZ1A 2ZNVB 4HCPB 5D7GA 4G3XB 1A5RA 4EFOA 1ZW7A 1TGZB 4I6NB 1V49A 4NJ6A 5D2MB 5J17A 2EMSA 3APCA 2KFKB 2GBJA 2BYVE 3I3TB 2C60A 3DDCB 3JW0X 2ZNVC 1H4RA 2J7QB 2KX0A 4W9CA 5DCNA 3QAQA 1C1YB 4ZRIA 2DZMA 4AOFA 4CYEA 3NZUA 1VCBA 2Z59B 4W9GA 4FJVB 4E74A 4F7ZA 4WJPA 2FIFA 2LVQA 4IM0A 2IO3B 2WWZA 2FIDA 3OAWA 1E90A 2JZ3B 1GC7A 1P3QU 2BGFA 3EHVA 3HIZA 1WH3A 3IG3A 3SHQA 4DK5A 2CR5A 5LXHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ISN A;  2LVP A;  4CHK A;  4NAW A;  2JUO A;  4LJO B;  4ZDV A;  1WXM A;  1J19 A;  1YQB A;  4KIK A;  1E8X A;  4PS7 A;  3VH4 B;  3DVG X;  3ZIM A;  1WX7 A;  2KOX A;  3SD5 A;  3VHT C;  3MHS D;  3CF6 E;  4NNJ B;  4W9J A;  2AYO B;  2DZJ A;  1OEY A;  2KAN A;  1YIW A;  2LGX A;  1BT0 A;  3NZS A;  3X0W A;  4K81 A;  3A9J A;  5L95 C;  3LDZ E;  2MRP A;  3SDL C;  3A9K A;  2K25 A;  2ZPY A;  4LCD E;  4XZ4 A;  2R2O A;  4GDK A;  4KIK B;  4K1R B;  3VVW B;  2DZK A;  1IYF A;  4LDT B;  1D3Z A;  3PLU A;  4W9L A;  2BF8 B;  4G0N B;  1YX5 B;  1WE6 A;  2GOW A;  2V1Y A;  1R4M I;  4F8C B;  3ZNZ B;  3PSE B;  4W9H A;  2V4L A;  3QAR A;  1QZE A;  3A9K B;  4MGK E;  2M4N A;  3IFW B;  3UQB A;  4AJY B;  3CST A;  2D07 B;  4W9E A;  1KLV A;  5JH5 C;  1WRD B;  2YVC A;  1ZKH A;  2L0T A;  2RSU A;  3VQI A;  3A33 B;  4IC7 B;  4MM3 A;  4E3C A;  1Y8R C;  2GBM A;  4K7S A;  1WGG A;  2KVR A;  1LQB A;  3V6E B;  4KDI C;  4AWJ A;  1LXD A;  3ML8 A;  3QX1 A;  3X23 A;  2CKH B;  3ZW3 A;  4DHJ D;  2KK8 A;  3VFK A;  4F1S A;  4XX5 A;  3T8M A;  1V6E A;  3PRZ A;  1P98 A;  5DPR A;  1KOT A;  1GNU A;  1KM7 A;  1OTR B;  1TTN A;  2NCN A;  3L17 A;  3KUC B;  2O6V D;  1MG8 A;  4MGZ E;  5DPT A;  3EFU A;  2WX1 A;  2MWS B;  3BY4 B;  3TJP A;  2I1J A;  4DDG D;  2GBN A;  1E7V A;  2ZPN A;  5E6P A;  3L16 A;  3RD2 A;  3RT3 B;  2AWT A;  4KSK C;  3V61 A;  5CHW A;  3H1U A;  1X1M A;  4W9K A;  2Z0E B;  3JSV B;  2N7E A;  1Q5W B;  3PVL A;  3RCZ A;  5JHB A;  4IM3 A;  4B9K A;  2AL3 A;  5CHF A;  2IO2 B;  5AEK B;  3DBS A;  2V3S A;  2MLB A;  2OJR A;  3K9P B;  4IG7 B;  4K7W A;  2D3G A;  2IY0 B;  1JRU A;  3R66 C;  3U8Z A;  2YLM A;  3L10 B;  3UGB B;  3ZUN A;  4HPL B;  3GZN I;  1I35 A;  3ZDT A;  2CHW A;  3L13 A;  2NBV B;  1Q1O A;  3PRE A;  4HVB A;  4HWI B;  2EMT A;  1SIF A;  1WR1 A;  2L8J A;  2REX A;  4FHK A;  2MBE A;  1WR6 E;  4BKG A;  1WZ3 A;  4DHZ E;  2LXA A;  4MGI E;  3M63 B;  4DDI D;  4URK A;  4HDO A;  2IY1 B;  4WWO A;  2C7N B;  3OJ3 A;  2JWZ A;  4IWP A;  2N1W A;  2C7H A;  3VTW A;  4JGH B;  1J8C A;  4BBN F;  4MEM A;  4GDL A;  2KC1 A;  3JVZ X;  2LGD A;  2MP2 A;  2FCQ A;  3S2A A;  1WE7 A;  5JHA A;  1Z2M A;  2XK5 A;  3DPD A;  1WXA A;  3T9L A;  1I42 A;  3A4R A;  2O2V A;  4IWQ A;  1V2Y A;  4II3 B;  3EC8 A;  3V6C B;  1V5O A;  2LRU A;  4NY0 A;  1P1A A;  2BWE S;  4ZRK A;  2VRR B;  4AJW A;  2LZ6 A;  4EZJ A;  4MDK E;  4OVV A;  4RMA A;  2JXX A;  4ANW A;  1WX8 A;  1WXV A;  2L05 A;  1WMH A;  2G3Q B;  2MP2 B;  4ANU A;  3ZDM C;  3B08 A;  1S1Q B;  4I6L B;  3VTU A;  1FXT B;  2JF5 A;  4BOZ B;  4BOS C;  4EUT A;  4GB9 A;  4BKT A;  4KZC A;  3PS6 A;  4P7I A;  2KO3 A;  4ICV A;  2DEN B;  1UBI A;  3NHE B;  4ANX A;  4G50 A;  1Z5S B;  1WF9 A;  3R3M A;  2ZJD A;  2MQJ A;  2LJ5 A;  2N4F A;  4J6I A;  3VAW A;  1WM2 A;  2NS5 A;  3ZVV A;  1WM3 A;  3NS8 A;  2GBK A;  2RGF A;  4WWN A;  5AZG A;  4IUM B;  4PYU A;  1RRB A;  3AU5 A;  2IYD B;  4NAW B;  3M62 B;  3L54 A;  4MJS A;  3VDZ A;  2KC2 A;  3QQ8 B;  3ZLZ A;  2PEA A;  1WMH B;  3L0W B;  3WAM A;  2RR9 A;  1L7Y A;  2RD0 A;  3QA8 A;  2KQS A;  4DBG A;  2L0F A;  1F9J A;  1WJN A;  1XD3 B;  2PPH A;  3VUW A;  2G45 B;  3CSF A;  3QHT A;  4DXA B;  1UD7 A;  2M1M A;  5LXI B;  3A9J B;  2AL6 A;  3VUY A;  4BBN C;  4BFR A;  2I1K A;  3UIO B;  1E8W A;  2PE9 A;  3W1Y A;  3RUL A;  2BKR B;  1IP9 A;  2J0K A;  1Q0W B;  2LVO A;  2CU1 A;  1WI0 A;  1OGW A;  2AEH A;  3KVF B;  1CMX B;  4GU2 A;  4GDK B;  4MJS B;  4CO7 A;  2LUE A;  4BVU C;  4DHZ B;  2KNB A;  1YX6 B;  3K9O B;  3Q3J A;  2KD0 A;  4IM2 A;  2C7M B;  4PYZ A;  2JRH A;  4N9F 4;  3DVN U;  3L08 A;  5C23 A;  1UEL A;  2KFJ A;  1V86 A;  2JZZ A;  1LFD A;  2KJR A;  1HE8 A;  4GXB A;  4ASW C;  4FA6 A;  4TQ0 A;  2PJH A;  2EKE C;  2FCM A;  1P0R A;  1XQQ A;  2JY6 A;  1NDD A;  4LDT D;  3O65 B;  1UGM A;  1UZX B;  3PRP B;  2OOB B;  2ZCC A;  2LAS A;  3Q3F A;  5TR5 A;  4OVU A;  2IO0 B;  1C3T A;  2DYM A;  2MBH A;  2FUH B;  5AZH A;  3WAN A;  4B95 A;  5IA7 A;  2MBO A;  2MSE D;  1WXS A;  4W9I A;  3ZKJ C;  4BKS A;  3TBL D;  3ZNH B;  2KQ7 A;  4G11 A;  1GC6 A;  4ZRJ A;  5HKH A;  2K6D B;  2NBU A;  2KLG A;  3ENE A;  3M3J A;  5CX3 A;  2KLC A;  3AI5 A;  3WAP A;  2L7R A;  3V62 A;  1KJT A;  4AP4 C;  2LWP A;  3VUX A;  1UH6 A;  2G4S A;  2N9E B;  1NBF C;  3MTN B;  4HXD A;  3U30 A;  2ZCB A;  4WJN A;  3PPA A;  5CHV C;  2QHO A;  2KZR A;  3PZD A;  4ANV A;  4WQO B;  1WFY A;  5E6N A;  3KUZ A;  4FJY A;  2DAF A;  1EUV B;  2M0X A;  3GOE A;  2L00 B;  2HE7 A;  5BO4 B;  2KHW B;  4M8M A;  2KTF A;  2KKC A;  4B6W A;  3DVN V;  2MBQ A;  2KDI A;  3DOW A;  4MSQ B;  1J0G A;  4EZL A;  3VXW A;  3MJW A;  2C5L C;  2XBB C;  3AUL A;  2JRI B;  4TUU A;  5GMV A;  3SU8 X;  3QIJ A;  2MCN B;  4ZYN A;  3KYC D;  3AXC A;  3HM6 X;  3DQV A;  4NQK E;  4RM9 A;  3ZTC A;  3H9D A;  2ZZP B;  2ASQ A;  4I6P A;  1E8Y A;  2JT4 B;  2ZEQ A;  3HM3 A;  4KVG B;  2LRW A;  4W9F A;  3RZF A;  1WY8 A;  3LJ3 A;  4XC2 A;  2DYB A;  4X57 B;  2NPT A;  3TCA A;  3ZO5 B;  2FCS A;  2FNJ B;  3B1L X;  3D32 A;  2L3Z A;  2PE6 B;  2FAZ A;  5E6O A;  5J2R A;  5L83 A;  3WAO A;  2L76 A;  3W1S A;  2LXC A;  3APF A;  2MA9 B;  2KX3 A;  1V81 A;  2RPQ A;  4EOY A;  1OEY J;  3OJ4 B;  1V80 A;  4A3P A;  2DZI A;  2GBR A;  4K7U A;  2Y5B B;  3QJZ A;  1UBQ A;  1K8R B;  1YD8 U;  4AUQ C;  2UWQ A;  4TKN A;  2DX5 B;  2NPT B;  1WX9 A;  5G55 A;  4GDL B;  1WGD A;  4FBJ B;  2HTH A;  1WIA A;  3N3K B;  2KXJ A;  1IPG A;  2NR2 A;  1VD2 A;  2XK5 B;  3DCG A;  3H7P A;  5D6J B;  3TIX A;  4FUL A;  3ALB A;  4FLH A;  2O2V B;  3DBH I;  2UYZ B;  3A4S C;  4NPN A;  1P9D U;  2N9X A;  2MW5 A;  3A1Q A;  3PHW B;  3DBR I;  4KSL C;  3ML9 A;  2C9W B;  3H7S A;  5AZF A;  1EF5 A;  3PT2 B;  3WIM A;  4A20 A;  1AAR A;  1U4A A;  4EZK A;  4HJK A;  5IAA C;  2KWV B;  4GSW A;  2KTR A;  4IWO A;  2MX2 A;  1YJ1 A;  1EO6 A;  2K8B A;  4M0W B;  5FR6 A;  2N1V A;  3W1S C;  2W9N A;  4DWF A;  2MBB B;  2LD9 A;  1WJ4 A;  4IW0 A;  3H7P B;  5EDS A;  4PS3 A;  2KJH B;  4WJQ A;  5DPW A;  4RM8 A;  4GIV A;  1WZ0 A;  3JYU A;  3C0R B;  1TBE A;  3PGE A;  1NI2 A;  4MH0 E;  2KMA A;  2K39 A;  2N7D A;  3UIN B;  3A1Q B;  1EF1 A;  2O6V A;  2BYF A;  3H6N A;  4EKU A;  3ZNG C;  3R7Q A;  5G2N A;  3RZW C;  3UIP B;  2ZVO A;  2LGY A;  2R2Q A;  4DHJ B;  2DHZ A;  2KTR B;  1RLF A;  4WWP A;  4E71 A;  3KW5 B;  3VH3 B;  4MEL A;  4EEW A;  3R7R A;  3TMP B;  1V9J A;  1XT9 B;  5J18 A;  3QK0 A;  2JVC A;  3QC8 B;  5LLI A;  4HK2 A;  3CMM B;  2O6V B;  3IHP C;  2K8H A;  4NQL B;  4GN1 A;  3UF8 A;  2LI5 A;  4MSM B;  3M95 A;  3ZRC A;  2NBW B;  3KYD D;  2A4Z A;  3U7D A;  2KDB A;  2B3A A;  2XEW A;  3N30 A;  3DBL I;  3HHM A;  1PQS A;  4GOC A;  2NVU I;  1OQY A;  2Z0D B;  4TQ1 A;  2ZVN A;  2IBI B;  4NJ7 A;  2J0J A;  2JPH A;  3VTV A;  2HD5 B;  1T0Y A;  2KDF B;  2KWC A;  3HK0 A;  3PRM B;  4YL8 A;  3AU4 A;  3N32 A;  3PHX B;  2HJ8 A;  2WX0 A;  3KH0 A;  3P2B A;  4GMV A;  4HDQ A;  1RFA A;  4GGQ A;  2KJ6 A;  4MGY E;  2BPS A;  3IBE A;  3NY5 A;  2D11 A;  2WDT B;  3NOB A;  2DAJ A;  1SE9 A;  1WJ6 A;  2BKF A;  2CHX A;  4KZ0 A;  3V60 A;  1S3S G;  2WYQ A;  3WAL A;  1E7U A;  3ZTD A;  3ZRF A;  1M94 A;  4WAA A;  3JSV A;  4II2 B;  3APD A;  1GUA B;  4PS8 A;  3ONS A;  3RYT A;  1WGH A;  4HCN B;  1L2N A;  2IO1 B;  5JZE B;  1GJZ A;  2GMI C;  5C1Z A;  3ECI A;  5KHQ A;  2N9P C;  4TV3 A;  4ICU A;  3DVG Y;  2DYO A;  1WJU A;  4A3O A;  1LM8 B;  1WGR A;  3ZNI D;  5D94 A;  3EEC A;  3RUI B;  5CTR C;  2IZV B;  2D10 A;  2K8C A;  2CHZ A;  4HLE A;  3UQA A;  2K6Q A;  4FN2 A;  3TL5 A;  3BIN A;  2BWF A;  4LJP B;  2M8S A;  1R4N I;  3B0A A;  1GG3 A;  3QWZ B;  5DPS A;  3WA0 A;  4W9D A;  4JIO U;  4FAD A;  4FHJ A;  4KDL B;  4WJO A;  5KHO A;  3PLV A;  3PTF C;  4JQW C;  4JL9 A;  4JLC A;  3OLM D;  1E5W A;  1SGH A;  2J0M A;  2D2Q A;  1ZGU B;  2G4D B;  1H8C A;  1V5T A;  2KN5 A;  2KFK A;  1E8Z A;  3PV1 A;  2KWU B;  1WGY A;  2KMC A;  3QCA A;  2KDE B;  2CS4 A;  1WYW B;  3IVF A;  2M17 A;  4FJZ A;  4KV2 A;  1RAX A;  4BKS D;  4M8N A;  2A5U A;  4HPM B;  1G6J A;  2FCN A;  2K1F A;  2BYE A;  3KUD B;  1TZ1 A;  2ZNV B;  4HCP B;  5D7G A;  4G3X B;  1A5R A;  4EFO A;  1ZW7 A;  1TGZ B;  4I6N B;  1V49 A;  4NJ6 A;  5D2M B;  5J17 A;  2EMS A;  3APC A;  2KFK B;  2GBJ A;  2BYV E;  3I3T B;  2C60 A;  3DDC B;  3JW0 X;  2ZNV C;  1H4R A;  2J7Q B;  2KX0 A;  4W9C A;  5DCN A;  3QAQ A;  1C1Y B;  4ZRI A;  2DZM A;  4AOF A;  4CYE A;  3NZU A;  1VCB A;  2Z59 B;  4W9G A;  4FJV B;  4E74 A;  4F7Z A;  4WJP A;  2FIF A;  2LVQ A;  4IM0 A;  2IO3 B;  2WWZ A;  2FID A;  3OAW A;  1E90 A;  2JZ3 B;  1GC7 A;  1P3Q U;  2BGF A;  3EHV A;  3HIZ A;  1WH3 A;  3IG3 A;  3SHQ A;  4DK5 A;  2CR5 A;  5LXH A; 
#chains in the Genus database with same CATH topology
 1ISN A;  1HTO A;  1WXM A;  2OED A;  3ZQ4 A;  4PS7 A;  2LEK A;  2KOX A;  3CF6 E;  4NNJ B;  4W9J A;  3J9C A;  4WQM A;  3AEF B;  2PLP A;  2H88 B;  3X0W A;  5L95 C;  3A9K A;  3ZYY X;  1NEN B;  3VVW B;  3P4Q B;  4ZHP A;  4R3D A;  1F0Z A;  1IYF A;  4C4V A;  4W9L A;  1WE6 A;  5IOI A;  3TEZ A;  1QZE A;  1LO5 D;  2M4N A;  3IFW B;  3UQB A;  1KLV A;  2YVC A;  3T3O A;  1ZKH A;  1YN4 A;  1F1H A;  1Y8R C;  1F2R C;  1WGG A;  1LQB A;  1QOB A;  1C79 A;  2E6X A;  1P98 A;  3GE3 C;  2PVO D;  3NZ3 A;  3L17 A;  1MG8 A;  2WDQ B;  2VZK D;  4YTM B;  5G5G A;  1FXI A;  2I1J A;  2GBN A;  1E7V A;  1OQQ A;  2AWT A;  3V61 A;  4RGO S;  2FE8 A;  2AQ1 B;  2Z0E B;  3RCZ A;  5JHB A;  3AV8 A;  1EU4 A;  4XWT A;  1JRU A;  2WXP A;  2WXL A;  4HPL B;  1SE4 A;  3L13 A;  1NEK B;  4L23 A;  2L8J A;  2OJW A;  2REX A;  1FPY A;  4KKJ A;  4MT5 A;  4BKG A;  5BYQ A;  1T0S C;  4URK A;  3Q8C A;  4OZA A;  4HEA 1;  1DOX A;  2VH2 A;  4IWP A;  2N1W A;  1VLB A;  2V3N A;  4GDL A;  2INP E;  3JVZ X;  2MP2 A;  2FCQ A;  3S2A A;  5JHA A;  1Z2M A;  2CJN A;  3T9L A;  1FXA A;  1JWB D;  2O2V A;  4IWQ A;  1V2Y A;  4II3 B;  3EC8 A;  1P1A A;  4ZRK A;  3OWE B;  1ZXI A;  2L05 A;  3VRB B;  1FMA D;  4BOS C;  4GB9 A;  4KZC A;  3NHE B;  1K52 A;  2ZJD A;  2MQJ A;  2N4F A;  1J7C A;  1L0X B;  1GB4 A;  1QF6 A;  4PYU A;  3B2G A;  1F2R I;  3L54 A;  3ZLZ A;  2PEA A;  2GI9 A;  3L0W B;  3DBH B;  1WJN A;  1XD3 B;  4IKG A;  2PMV A;  3CSF A;  4BBN C;  4BFR A;  3UIO B;  3KVF B;  4GU2 A;  4MJS B;  4JX1 C;  3BK1 A;  4DHZ B;  4LNK A;  2Y5P A;  1LFD A;  1LGR A;  2FCM A;  3ZXV A;  1NDD A;  4LNI A;  1TY2 A;  1UGM A;  1UZX B;  3FAH A;  3ZJU A;  4K3C A;  4A6Q A;  3MP9 A;  4M01 A;  2MBH A;  3WAN A;  4B95 A;  2MSE D;  4RCO A;  4BKS A;  4G11 A;  4ZRJ A;  5HKH A;  2Y5C A;  2KLG A;  3V62 A;  2IGD A;  1UH6 A;  1AW7 A;  1DGJ A;  3AN1 A;  3PPA A;  3SFE B;  1GAQ B;  4FJY A;  1IBX A;  3GOE A;  2MJD A;  5BO4 B;  1VZ7 A;  2KTF A;  2EKI A;  3AMZ A;  2VH1 A;  4JPS A;  3DOW A;  3MJW A;  2C5L C;  2JRI B;  1T0Q C;  3Q2A C;  5GMV A;  4P1C C;  4ZYN A;  3AXC A;  3DQV A;  3AE1 B;  2AQ3 B;  3RZF A;  1R4N B;  1ACC A;  1WY8 A;  3LJ3 A;  1KLG D;  3BVG A;  1IUE A;  1FNV A;  2FAZ A;  1C9F A;  3W1S A;  2RDH A;  1V81 A;  3OJ4 B;  2INN E;  2DZI A;  2GBR A;  3AE8 B;  1UBQ A;  3P4S B;  4TKN A;  2NPT B;  4GDL B;  1WGD A;  4FBJ B;  2HTH A;  3TIX A;  4N6E B;  1SE3 A;  3ALB A;  2O2V B;  3DBH I;  1P9D U;  3AEE B;  5AZF A;  2KAC A;  1JML A;  4ITK A;  4A20 A;  3TEW A;  2KTR A;  1YJ1 A;  1EO6 A;  4KKI A;  2N1V A;  2WXK A;  4DWF A;  2LD9 A;  1KH0 A;  1KTK A;  4AS1 A;  5EDS A;  2KJH B;  4BAX A;  1FCL A;  1L6V A;  1TBE A;  2KVZ A;  4A90 A;  4EKU A;  4OZB A;  5G2N A;  1FNW A;  2LGY A;  2JSV X;  2Y3A A;  4E71 A;  3KW5 B;  2LFI A;  3R7R A;  1CQV A;  1XT9 B;  4WWM A;  5LLI A;  2WXF A;  4J3O D;  4NQL B;  4GN1 A;  2VZK B;  1ZE3 D;  3ZRC A;  2NBW B;  1NYR A;  4TQ1 A;  5HHD G;  2IBI B;  2J0J A;  3VTV A;  4YL8 A;  1R4M B;  3TEY A;  3N32 A;  4YSX B;  2WX0 A;  4GMV A;  3P2B A;  1RFA A;  4GGQ A;  2N7J A;  3OG5 A;  2BPS A;  3IBE A;  3NY5 A;  2JU6 X;  3NOB A;  2KDM A;  1SE9 A;  1WJ6 A;  4N59 A;  2WNM A;  4C56 C;  2WYQ A;  1E7U A;  2IDY A;  2PTL A;  1C4C A;  1WGH A;  2WU2 B;  2IO1 B;  2WLB A;  1GJZ A;  2GMI C;  5KHQ A;  1YJJ A;  3CWI A;  4ICU A;  5D94 A;  3EEC A;  5CTR C;  2QSD A;  2K6Q A;  4LJP B;  1R4N I;  3B0A A;  4FHJ A;  5KHO A;  4WJO A;  1IBX B;  3PTF C;  2NTT A;  3MC0 B;  2D2Q A;  1ZGU B;  2G4D B;  3IAM 1;  2KFK A;  2G1E A;  4RGM A;  2ONQ A;  2KDE B;  1WYW B;  4FJZ A;  1A70 A;  3SR6 A;  5EE9 A;  2FCN A;  1SXT A;  1TZ1 A;  3EUB 2;  1YQ3 B;  4L1B A;  4G3X B;  1A5R A;  1TGZ B;  1V49 A;  5D2M B;  1F52 A;  4YWG G;  2Q5W D;  2DBY A;  3I3T B;  3R8B A;  2KX0 A;  4W9C A;  2DZM A;  1UWM A;  2LVQ A;  1FFU A;  2WWZ A;  2FID A;  1E90 A;  3EHV A;  1GC7 A;  3HIZ A;  3IG3 A;  4DK5 A;  1E8W A;  5LXH A;  1XF5 L;  2LVP A;  3NJT A;  1XCT L;  3VH4 B;  1DOI A;  3SD5 A;  3VHT C;  3KWV A;  2KN4 A;  2WXM A;  1TIF A;  3A9J A;  1VZ8 A;  2ZPY A;  4XZ4 A;  1M4V A;  3AE7 B;  4L2Y A;  1D3Z A;  3W2D A;  2BF8 B;  2PIA A;  3TEX A;  1QOG A;  1R4M I;  1PGX A;  4A9A A;  3QAR A;  2WHI A;  1QOA A;  3U4E G;  4W9E A;  2L0T A;  3NRZ A;  4MM3 A;  1P7F A;  2GBM A;  4K7S A;  2KVR A;  2WXR A;  4KDI C;  1WRI A;  4XDC A;  1XEE A;  1JRO A;  3QX1 A;  4XX5 A;  3T8M A;  3PRZ A;  1KOT A;  1KM7 A;  4YXD B;  1TTN A;  2MJ3 A;  3HVZ A;  3KUC B;  4MGZ E;  3EFU A;  1VZ6 A;  2MWS B;  3BY4 B;  3RNC C;  3TJP A;  3ZGZ A;  5E6P A;  4ZRQ A;  1C4P A;  2BYT A;  1N6Z A;  3RT3 B;  4KSK C;  1RYJ A;  4KGR A;  4IM3 A;  3AEA B;  1AN8 A;  2MJE A;  5AEK B;  1MFW A;  1RWS A;  3K9P B;  4RGN A;  3RPF C;  2RDG A;  2XNA C;  3ZUN A;  3I57 A;  2MEK A;  2K9X A;  1I35 A;  4WIP A;  3ZDT A;  2WXN A;  5HI1 A;  1V8C A;  4HVB A;  2EMT A;  1SIF A;  2JX5 A;  3R2I A;  1WZ3 A;  1Q10 A;  3MC9 A;  2LXA A;  4MGI E;  1XLP A;  3M63 B;  1ESF A;  2LGI A;  4WWO A;  1AWD A;  2SEB D;  2C7N B;  2K0P A;  2K5P A;  2C7H A;  1J8C A;  4JGH B;  4RNA A;  2QEJ C;  1V97 A;  2KC1 A;  1SJH D;  2LJI A;  2PKO A;  1I4G A;  4NAM A;  1QQR A;  3ETR A;  3R2T A;  5H8Y E;  3V6C B;  1V5O A;  4NY0 A;  2BWE S;  4AJW A;  2LZ6 A;  3DWM A;  4UDU C;  4OVV A;  4RMA A;  2JXX A;  2LHE A;  2IJ0 A;  2FUG 1;  3ZDM C;  1AYF A;  1S1Q B;  4I6L B;  3VTU A;  2WXI A;  2JF5 A;  4P7I A;  5H92 C;  3VAW A;  3NS8 A;  2GBK A;  1ZP0 B;  5AZG A;  1RRB A;  4D2K A;  2IYD B;  3M62 B;  4MJS A;  3VDZ A;  3QQ8 B;  3QA8 A;  2PPH A;  2G45 B;  3Q3N C;  4OVZ A;  1PYW D;  1PGB A;  2M1M A;  3A9J B;  3VUY A;  2I1K A;  2PE9 A;  3W1Y A;  1L0Y B;  1Q0W B;  2AEH A;  1CMX B;  1WGK A;  5LNK 1;  4BVU C;  2KNB A;  1YX6 B;  3K9O B;  3Q3J A;  1FM0 D;  4PYZ A;  2KWD A;  4N9F 4;  3DVN U;  1T0R C;  1SB3 C;  5C23 A;  2W54 A;  4N58 A;  2KFJ A;  3KLS X;  1I4R A;  1PFD A;  5I4D A;  1TZO A;  1HZ6 A;  2JY6 A;  4LDT D;  3O65 B;  4MM3 B;  4B0M A;  4C00 A;  2WP9 B;  2LAS A;  3VRA B;  4OVU A;  2IO0 B;  2DYM A;  2FUH B;  1WXS A;  1MHX A;  3TBL D;  4HRS A;  3Q8A A;  3ENE A;  1VJK A;  2L7R A;  2LWP A;  4USA A;  3VUX A;  1NI3 A;  3RNF C;  3BK2 A;  3MTN B;  3U30 A;  4WJN A;  3AEG B;  2ICI A;  1E10 A;  1FIQ A;  4WQO B;  2N9K A;  3KUZ A;  2DAF A;  1EUV B;  4XGA B;  2KHW B;  4MSQ B;  4EZL A;  3VXW A;  2XBB C;  4TUU A;  1KFY B;  3SU8 X;  1Y56 A;  3HM6 X;  4MH8 A;  2ZW1 A;  4NQK E;  4LLG M;  3H9D A;  2ZZP B;  3T3N A;  1ET9 A;  1E8Y A;  1UGJ A;  3HM3 A;  5T8I A;  1XLQ A;  2LRW A;  3ZJV A;  3NVY A;  3TCA A;  2NPT A;  3MFG A;  3ZO5 B;  2FCS A;  2FNJ B;  3D32 A;  2L3Z A;  2R61 A;  3NUH B;  5E6O A;  5L83 A;  2NTS A;  2MA9 B;  3BWU D;  2RPQ A;  1TS2 A;  4EOY A;  2MHJ A;  1OEY J;  4A3P A;  2WXJ A;  4IDI A;  1K8R B;  1YD8 U;  4AUQ C;  2UWQ A;  3FIL A;  1WX9 A;  3Q8B A;  5GXG B;  2I2Y A;  5D6J B;  1T5X D;  4TSS A;  2MW5 A;  3PHW B;  4KSL C;  3ML9 A;  2C9W B;  3PT2 B;  4C80 A;  4HJK A;  4REZ A;  2KWV B;  4GSW A;  4IWO A;  4WH4 A;  2K8B A;  1WJ4 A;  1TJE A;  2DWQ A;  4WJQ A;  1FNU A;  4GIV A;  3O13 A;  2WS3 B;  3PGE A;  4MH0 E;  3UIN B;  3A1Q B;  1L5P A;  2BYF A;  3H6N A;  3UIP B;  3NG0 A;  1R7S A;  5FR3 A;  1FRD A;  1RLF A;  3ABV B;  2OHF A;  4EEW A;  1NYQ A;  1JW9 D;  1QKZ A;  5J18 A;  1VDV A;  3Q8E A;  5BMI A;  2JVC A;  1SF0 A;  4HK2 A;  5EE1 A;  3IHP C;  4P1B C;  3M95 A;  3KQ4 A;  2X38 A;  3BZD B;  2B3A A;  2XEW A;  5FKA C;  3HHM A;  1PQS A;  4GOC A;  1OQY A;  2K22 A;  2HD5 B;  2KWC A;  3IT6 B;  4HDQ A;  4S0R A;  3Q6B A;  1ET6 A;  2D11 A;  3EFC A;  4QAY A;  4KZ0 A;  2JZP A;  1S3S G;  2HJ1 A;  3P42 A;  4II2 B;  1MPE A;  5EE0 A;  1GUA B;  4HCN B;  5JZE B;  1I4H A;  1GOZ A;  3E56 A;  2L52 A;  3ECI A;  4TV3 A;  4A3O A;  3ZNI D;  1XO3 A;  1ZOY B;  5D3I B;  3RUI B;  4M02 A;  4LTU A;  3DHI C;  3TL5 A;  3BIN A;  3QWZ B;  1GG3 A;  4KDL B;  3GE8 C;  4JL9 A;  4JLC A;  2E3T A;  1C78 A;  1D5Z C;  2ON8 A;  3BII D;  3I5J C;  1H8C A;  1E8Z A;  1JWS D;  2BS3 B;  1WGY A;  2IND C;  1BML C;  2LUM A;  1RAX A;  4KV2 A;  2A5U A;  3KWL A;  3Q14 C;  1G6J A;  4RGT A;  1C76 A;  2K1F A;  5D7G A;  4EFO A;  1ZW7 A;  4I6N B;  1MHH E;  2EMS A;  3AE3 B;  2GBJ A;  2NMQ A;  2BYV E;  4JWU C;  1EU3 A;  2D3A A;  1N5X A;  1T6B X;  4HPP A;  2IGH A;  2J7Q B;  1C1Y B;  4AOF A;  1YQ4 B;  3NZU A;  1VCB A;  1V1P B;  4WJP A;  4IM0 A;  2IO3 B;  3OAW A;  1P3Q U;  4MAC A;  3FIL B;  1X1M A;  2CR5 A;  5TSS A;  4NAW A;  2JUO A;  1E8X A;  2G9H D;  3AH7 A;  4JE3 B;  1OEY A;  2KAN A;  4ARC A;  4P6V F;  2MH7 A;  1XXG A;  2PW9 A;  3LDZ E;  4KIK B;  2V9H A;  2LMC A;  2DZK A;  4RF1 A;  4LDT B;  3I9V 1;  3PLU A;  3RFZ B;  1CK1 A;  4G0N B;  1YX5 B;  3NVV A;  4US8 A;  1XLO A;  2V1Y A;  4F8C B;  4O1N A;  2V4L A;  3BYY B;  4AJY B;  5JH5 C;  1WRD B;  2RSU A;  4IC7 B;  4E3C A;  2AX5 A;  2M56 B;  1UWX A;  3AEB B;  4AWJ A;  1LXD A;  3ML8 A;  1I4X A;  1IGC A;  4LK0 M;  4YT0 B;  4DHJ D;  2KK8 A;  3VFK A;  4IOI E;  3RNA C;  1OTR B;  2NCN A;  5DPT A;  2O6V D;  3VR9 B;  4DDG D;  3L16 A;  1TT5 B;  5CHW A;  1TKE A;  2N7E A;  1Q5W B;  1FFV A;  4B9K A;  1TY0 A;  4A8X C;  2AL3 A;  5CHF A;  2IO2 B;  2V3S A;  4K7W A;  1JWM D;  2D3G A;  3AE4 B;  4C7Z A;  1JCK B;  2CHW A;  3H8H A;  2AQ2 B;  3PRE A;  4HWI B;  4FHK A;  2MBE A;  1WR6 E;  1CZP A;  4HKQ A;  4EE2 A;  4DDI D;  4KGS A;  4HDO A;  3PZ8 A;  1J7A A;  4LNF A;  4MEM A;  2IGG A;  1YJI A;  1HEZ E;  3DPD A;  3A4R A;  1SEB D;  1HA5 A;  2J52 A;  2LRU A;  3I63 C;  1WX8 A;  4ANU A;  4TMA B;  3B08 A;  2RMM A;  1FXT B;  2DEN B;  4YSZ B;  1Z5S B;  1WF9 A;  3R3M A;  2NS5 A;  3ZVV A;  4BZA A;  1WM3 A;  4OW0 A;  4WWN A;  4WAF A;  4XE0 A;  3N1X C;  4NAW B;  2KC2 A;  4YTN B;  3AB5 A;  1WMH B;  3WAM A;  1L7Y A;  2KQS A;  4DBG A;  3VUW A;  1F9J A;  1FO4 A;  4DXA B;  1UD7 A;  5LXI B;  2FBW B;  2BKR B;  2CU3 A;  2LVO A;  1WI0 A;  1OGW A;  4CO7 A;  1TKY A;  2LUE A;  4KX6 B;  2L1A A;  1I4P A;  1KF6 B;  2KD0 A;  1HZ5 A;  2QIL A;  1YN3 A;  1MJD A;  3DHH C;  2D3B A;  1UEL A;  1V86 A;  2JZZ A;  2WXQ A;  1D4B A;  4GXB A;  4FA6 A;  2EKE C;  1D6E C;  4YTP B;  1P0R A;  1XLN A;  1XQQ A;  2W3R A;  1HTQ A;  2ZCC A;  1WXQ A;  1FCC C;  5IA7 A;  2MBO A;  4W9I A;  3ZKJ C;  2KQ7 A;  1GC6 A;  1MVK A;  2WDV B;  4ARI A;  3M3J A;  5CX3 A;  3URY A;  2KLC A;  2RDB C;  3VR8 B;  3WAP A;  2JYT A;  3W9C B;  1C4A A;  4LNN A;  2N9E B;  2G4S A;  1NBF C;  2YEP F;  4HXD A;  5CHV C;  3PZD A;  3Q3M C;  1WFY A;  3ZXR A;  5E6N A;  1ZDV A;  3DWG C;  2L00 B;  1L6U A;  4B6W A;  3DVN V;  2MBQ A;  3TUO A;  2KDI A;  1J0G A;  2QIE B;  2L83 A;  3AUL A;  2MCN B;  3KYC D;  3GP7 A;  4XYC A;  1L4Z B;  2LHD A;  2ZEQ A;  1PUT A;  4HKZ E;  4XC2 A;  4X57 B;  3B1L X;  1ZUD 2;  3WAO A;  2L76 A;  2QCZ A;  1YMH E;  3QJZ A;  3P4P B;  3Q8F A;  1WIA A;  3N3K B;  1IPG A;  2NR2 A;  4FUL A;  1PGA A;  4FLH A;  4NPN A;  2UYZ B;  3A1Q A;  2BB6 A;  3RNB C;  1N5W A;  3UI3 A;  4EZK A;  2QJL A;  4M0W B;  5FR6 A;  2W9N A;  1QLB B;  2MBB B;  4PK1 A;  3H7P B;  5DPW A;  4RM8 A;  3JYU A;  1BXT A;  1NI2 A;  2KMA A;  2K39 A;  2N7D A;  1DOY A;  2ACZ B;  3GS2 A;  2ZVO A;  4DHJ B;  2DHZ A;  1L4D B;  1TS4 A;  4MEL A;  3AE9 B;  3TMP B;  1V9J A;  3QK0 A;  1YOV B;  1TS5 A;  1QIL A;  1K51 A;  4C7Y A;  3CMM B;  3EGR A;  2O6V B;  2K8H A;  2EEL A;  5IO9 A;  3UF8 A;  3BVM A;  3W5U B;  2L32 A;  3KYD D;  4B0E A;  2J53 A;  2A4Z A;  2W3S A;  3U7D A;  3CIR B;  2JYE A;  3AM9 A;  1B1Z A;  3NVW A;  2Z0D B;  2ZVN A;  2JPH A;  5EE3 A;  2KDF B;  3HK0 A;  4ZHO A;  3BYT B;  3AU4 A;  1P7E A;  2HJ8 A;  4MGY E;  3KH0 A;  5BYS A;  1GB1 A;  2GRI A;  3EA6 A;  2WDT B;  2DAJ A;  2BKF A;  1TS3 A;  1V1O A;  2CHX A;  3V60 A;  3WAL A;  1N62 A;  3ZTD A;  4WAA A;  3JSV A;  3APD A;  3RYT A;  1N63 A;  2V0G A;  2N9P C;  4ZYS A;  2DYO A;  1WJU A;  1WGR A;  2BVC A;  2BW2 A;  2K8C A;  2CHZ A;  4HLE A;  3IXS A;  4OZC A;  4FN2 A;  2BWF A;  4RFB A;  3U52 E;  2M8S A;  1J7B A;  5DPS A;  2JWU A;  4JIO U;  4FAD A;  3IT4 B;  2ZW0 A;  3OLM D;  1E5W A;  1SGH A;  3PO0 A;  1V5T A;  2KN5 A;  1K50 A;  3N20 C;  5FK9 C;  1SE2 A;  1E0Z A;  2N9L A;  3IVF A;  2M17 A;  3RN9 C;  4BKS D;  2N0S B;  4M8N A;  3GZN B;  1ZPS A;  5IKC M;  1V1P A;  4HCP B;  5G5H A;  4NJ6 A;  2W82 A;  1MI0 A;  2BTE A;  4S17 A;  1UF0 A;  4A55 A;  3DDC B;  2DLB A;  1H4R A;  4ZRI A;  5HFY A;  3C19 A;  4CYE A;  4FJV B;  1T3Q A;  1YN5 A;  2WXH A;  1KRH A;  1WH3 A;  1NVI D;  2BS2 B;  3HRD D;  2YLM A;  2GB1 A;  5C3J B;  1TKG A;  4CHK A;  4ZDV A;  4LJO B;  1J19 A;  1YQB A;  4KIK A;  3ZIM A;  3DVG X;  1WX7 A;  1ZXH A;  3MHS D;  2JXT A;  2AYO B;  1GPX A;  2DZJ A;  1YIW A;  2LGX A;  1BT0 A;  2HDE A;  1ZDX A;  3NZS A;  5HG2 A;  1K53 A;  4K81 A;  3SDL C;  2MRP A;  2K25 A;  4LCD E;  2R2O A;  4GDK A;  3P1M A;  4K1R B;  1BUI C;  1MG4 A;  2KAJ A;  2WXG A;  2GOW A;  3L4P A;  3ZNZ B;  3PSE B;  3ZJT A;  4W9H A;  3A9K B;  4MGK E;  5AUI A;  3HUI A;  3IAS 1;  3CST A;  5BYR A;  2D07 B;  1VRA B;  1KLU D;  3VQI A;  3A33 B;  4C4V B;  3V6E B;  2SAK A;  2WQY B;  3X23 A;  2CKH B;  3ZW3 A;  4XDD A;  4F1S A;  4K3B A;  3B2F A;  3Q69 A;  1V6E A;  5DPR A;  5C2T B;  1GNU A;  2KMM A;  4LNO A;  1C77 A;  1EWY C;  3GB1 A;  4DXG A;  3SFD B;  1WWT A;  2WX1 A;  5JXV A;  4AQ7 A;  2ZPN A;  2QMT A;  3RD2 A;  3H1U A;  4W9K A;  3JSV B;  3PVL A;  4M00 A;  2B76 B;  3DBS A;  2UU7 A;  2MLB A;  2OJR A;  4IG7 B;  4WUR A;  2IY0 B;  3R66 C;  3U8Z A;  3N9Y C;  3L10 B;  3UGB B;  4HJG E;  3GZN I;  2NBV B;  1Q1O A;  3U7Z A;  2QC8 A;  1WR1 A;  3RI7 C;  4RH6 A;  2KT7 A;  3AE6 B;  3MC8 A;  4FXC A;  4DHZ E;  3P4R B;  2V3P A;  1JWA D;  2IY1 B;  3OJ3 A;  2JWZ A;  1SBB B;  3VTW A;  4XWW A;  4BBN F;  3HVD A;  2LGD A;  1WE7 A;  1DYQ A;  2XK5 A;  2BT6 A;  1WXA A;  1I42 A;  2I38 A;  1XCQ L;  3V3X A;  1HQR D;  2VRR B;  1YNT E;  4EZJ A;  4KGT A;  4MDK E;  4HRO A;  2HTM E;  3TSS A;  4ANW A;  1WXV A;  1WMH A;  2G3Q B;  2MP2 B;  4YSY B;  1D5X C;  2J42 A;  1QOF A;  3AE2 B;  4BOZ B;  4EUT A;  4BKT A;  3PS6 A;  2KO3 A;  2RPV A;  4ICV A;  4ANX A;  1UBI A;  1FRR A;  4G50 A;  4J6I A;  2M19 A;  2LJ5 A;  1WM2 A;  2RGF A;  4IUM B;  3LYY A;  3AU5 A;  1JQ4 A;  2V4I B;  3MHZ A;  2J4X A;  3MJ5 A;  2RR9 A;  3SEB A;  2RD0 A;  2PVG C;  1JAL A;  2L0F A;  3FC4 A;  3DBR B;  2Z8L A;  5MPO A;  3QHT A;  2AL6 A;  1SSN A;  5IN7 A;  1SIJ A;  3RUL A;  1IP9 A;  2J0K A;  2CU1 A;  1RM6 C;  4GDK B;  1EWC A;  4IM2 A;  2C7M B;  2JRH A;  4CQN A;  4H2A A;  3L08 A;  3AEC B;  2KJR A;  4ASW C;  1HE8 A;  4TQ0 A;  2PJH A;  2H89 B;  3PRP B;  2OOB B;  3Q3F A;  5TR5 A;  1C3T A;  5AZH A;  5IP4 D;  1VR9 A;  3LXF A;  4ZOH C;  4GLS C;  3ZNH B;  2D5G A;  3DBL B;  2K6D B;  2NBU A;  2TSS A;  3AI5 A;  1KJT A;  4AP4 C;  3BVZ A;  3RNG C;  2ZCB A;  2QHO A;  2KZR A;  4ANV A;  2M0X A;  3Q3O C;  2HE7 A;  4M8M A;  2KKC A;  3PZ7 A;  3P63 A;  3QIJ A;  5BMG A;  4PT5 A;  2WU5 B;  2JQR B;  1EM7 A;  1F77 A;  4RM9 A;  3ZTC A;  4I6P A;  2ASQ A;  2JT4 B;  4KVG B;  4W9F A;  4ACF A;  1OQR A;  2DYB A;  2YEP B;  1RFK A;  2QDF A;  2PE6 B;  5J2R A;  3LB8 C;  5AUK A;  2LXC A;  3APF A;  2KX3 A;  5D3D A;  1V80 A;  4K7U A;  2Y5B B;  2XN9 C;  2DX5 B;  5G55 A;  1B9R A;  2WDR B;  4M0W A;  2KXJ A;  5BMH A;  1UNS A;  2XK5 B;  1VD2 A;  3H7P A;  3DCG A;  2D3C A;  1PDX A;  3NS1 A;  3NVZ A;  1N61 A;  3A4S C;  2N9X A;  3DBR I;  1OFF A;  3H7S A;  3N1Z C;  1EF5 A;  4Q2J A;  3WIM A;  1AAR A;  1U4A A;  4RF0 A;  1E6E B;  5IAA C;  2IPK D;  2BB5 A;  3E9S A;  2MX2 A;  3W1S C;  4NZL B;  3V05 A;  4IW0 A;  4PS3 A;  2KYW A;  3FKY A;  1WZ0 A;  3C0R B;  4OHJ A;  1EF1 A;  2O6V A;  1I7H A;  3ZNG C;  3R7Q A;  3RMK C;  1STE A;  3RZW C;  2LGS A;  2R2Q A;  2KTR B;  4WWP A;  3VH3 B;  1L0V B;  3WCQ A;  1ROE A;  1CJE A;  3QC8 B;  1FD6 A;  4P16 A;  2M0A A;  2LI5 A;  4MSM B;  2KQ4 X;  3N1Y C;  2KDB A;  2BS4 B;  3N30 A;  1D5M C;  3DBL I;  2NVU I;  1E7P B;  4NJ7 A;  1HXY D;  1IGD A;  1T0Y A;  3PRM B;  4JWS C;  3PHX B;  1SJE D;  4NJC A;  3C8Y A;  2KJ6 A;  2GLS A;  4DXF A;  2BBC A;  1QT9 A;  3ZRF A;  1M94 A;  4PS8 A;  3ONS A;  1ENF A;  1L2N A;  2K3U A;  5C1Z A;  3DVG Y;  2W55 A;  3RNE C;  1FEH A;  1WSP A;  1LM8 B;  4US9 A;  2IZV B;  2D10 A;  2DNF A;  1N60 A;  2BQQ A;  3UQA A;  2WGS A;  5E6J A;  1TYG B;  3WA0 A;  4W9D A;  2WXO A;  4DQO C;  3DHG C;  3PLV A;  1E9M A;  4JQW C;  2INC C;  2J0M A;  1JRP A;  3PV1 A;  2KWU B;  2KMC A;  3QCA A;  2CS4 A;  3B9J A;  1WYG A;  4HPM B;  3U2S C;  2BYE A;  3KUD B;  2ZNV B;  3AE5 B;  5J17 A;  3APC A;  1I4Q A;  2KFK B;  3W5V B;  2C60 A;  3JW0 X;  2X8X X;  2ZNV C;  5DCN A;  3QAQ A;  1UUP A;  4E74 A;  2Z59 B;  3AED B;  4W9G A;  4F7Z A;  2CJO A;  2FIF A;  4ZRP A;  2JZ3 B;  3SHQ A;  2BGF A;  1JWU D; 
#chains in the Genus database with same CATH homology
 1ISN A;  2LVP A;  4CHK A;  4NAW A;  2JUO A;  4LJO B;  4ZDV A;  1WXM A;  1J19 A;  1YQB A;  4KIK A;  1E8X A;  4PS7 A;  3VH4 B;  3DVG X;  3ZIM A;  1WX7 A;  2KOX A;  3SD5 A;  3VHT C;  3MHS D;  3CF6 E;  4NNJ B;  4W9J A;  2AYO B;  2DZJ A;  1OEY A;  2KAN A;  1YIW A;  2LGX A;  1BT0 A;  3NZS A;  3X0W A;  4K81 A;  3A9J A;  5L95 C;  3LDZ E;  2MRP A;  3SDL C;  3A9K A;  2K25 A;  2ZPY A;  4LCD E;  4XZ4 A;  2R2O A;  4GDK A;  4KIK B;  4K1R B;  3VVW B;  2DZK A;  1IYF A;  4LDT B;  1D3Z A;  3PLU A;  4W9L A;  2BF8 B;  4G0N B;  1YX5 B;  1WE6 A;  2GOW A;  2V1Y A;  1R4M I;  4F8C B;  3ZNZ B;  3PSE B;  4W9H A;  2V4L A;  3QAR A;  1QZE A;  3A9K B;  4MGK E;  2M4N A;  3IFW B;  3UQB A;  4AJY B;  3CST A;  2D07 B;  4W9E A;  1KLV A;  5JH5 C;  1WRD B;  2YVC A;  1ZKH A;  2L0T A;  2RSU A;  3VQI A;  3A33 B;  4IC7 B;  4MM3 A;  4E3C A;  1Y8R C;  2GBM A;  4K7S A;  1WGG A;  2KVR A;  1LQB A;  3V6E B;  4KDI C;  4AWJ A;  1LXD A;  3ML8 A;  3QX1 A;  3X23 A;  2CKH B;  3ZW3 A;  4DHJ D;  2KK8 A;  3VFK A;  4F1S A;  4XX5 A;  3T8M A;  1V6E A;  3PRZ A;  1P98 A;  5DPR A;  1KOT A;  1GNU A;  1KM7 A;  1OTR B;  1TTN A;  2NCN A;  3L17 A;  3KUC B;  2O6V D;  1MG8 A;  4MGZ E;  5DPT A;  3EFU A;  2WX1 A;  2MWS B;  3BY4 B;  3TJP A;  2I1J A;  4DDG D;  2GBN A;  1E7V A;  2ZPN A;  5E6P A;  3L16 A;  3RD2 A;  3RT3 B;  2AWT A;  4KSK C;  3V61 A;  5CHW A;  3H1U A;  1X1M A;  4W9K A;  2Z0E B;  3JSV B;  2N7E A;  1Q5W B;  3PVL A;  3RCZ A;  5JHB A;  4IM3 A;  4B9K A;  2AL3 A;  5CHF A;  2IO2 B;  5AEK B;  3DBS A;  2V3S A;  2MLB A;  2OJR A;  3K9P B;  4IG7 B;  4K7W A;  2D3G A;  2IY0 B;  1JRU A;  3R66 C;  3U8Z A;  2YLM A;  3L10 B;  3UGB B;  3ZUN A;  4HPL B;  3GZN I;  1I35 A;  3ZDT A;  2CHW A;  3L13 A;  2NBV B;  1Q1O A;  3PRE A;  4HVB A;  4HWI B;  2EMT A;  1SIF A;  1WR1 A;  2L8J A;  2REX A;  4FHK A;  2MBE A;  1WR6 E;  4BKG A;  1WZ3 A;  4DHZ E;  2LXA A;  4MGI E;  3M63 B;  4DDI D;  4URK A;  4HDO A;  2IY1 B;  4WWO A;  2C7N B;  3OJ3 A;  2JWZ A;  4IWP A;  2N1W A;  2C7H A;  3VTW A;  4JGH B;  1J8C A;  4BBN F;  4MEM A;  4GDL A;  2KC1 A;  3JVZ X;  2LGD A;  2MP2 A;  2FCQ A;  3S2A A;  1WE7 A;  5JHA A;  1Z2M A;  2XK5 A;  3DPD A;  1WXA A;  3T9L A;  1I42 A;  3A4R A;  2O2V A;  4IWQ A;  1V2Y A;  4II3 B;  3EC8 A;  3V6C B;  1V5O A;  2LRU A;  4NY0 A;  1P1A A;  2BWE S;  4ZRK A;  2VRR B;  4AJW A;  2LZ6 A;  4EZJ A;  4MDK E;  4OVV A;  4RMA A;  2JXX A;  4ANW A;  1WX8 A;  1WXV A;  2L05 A;  1WMH A;  2G3Q B;  2MP2 B;  4ANU A;  3ZDM C;  3B08 A;  1S1Q B;  4I6L B;  3VTU A;  1FXT B;  2JF5 A;  4BOZ B;  4BOS C;  4EUT A;  4GB9 A;  4BKT A;  4KZC A;  3PS6 A;  4P7I A;  2KO3 A;  4ICV A;  2DEN B;  1UBI A;  3NHE B;  4ANX A;  4G50 A;  1Z5S B;  1WF9 A;  3R3M A;  2ZJD A;  2MQJ A;  2LJ5 A;  2N4F A;  4J6I A;  3VAW A;  1WM2 A;  2NS5 A;  3ZVV A;  1WM3 A;  3NS8 A;  2GBK A;  2RGF A;  4WWN A;  5AZG A;  4IUM B;  4PYU A;  1RRB A;  3AU5 A;  2IYD B;  4NAW B;  3M62 B;  3L54 A;  4MJS A;  3VDZ A;  2KC2 A;  3QQ8 B;  3ZLZ A;  2PEA A;  1WMH B;  3L0W B;  3WAM A;  2RR9 A;  1L7Y A;  2RD0 A;  3QA8 A;  2KQS A;  4DBG A;  2L0F A;  1F9J A;  1WJN A;  1XD3 B;  2PPH A;  3VUW A;  2G45 B;  3CSF A;  3QHT A;  4DXA B;  1UD7 A;  2M1M A;  5LXI B;  3A9J B;  2AL6 A;  3VUY A;  4BBN C;  4BFR A;  2I1K A;  3UIO B;  1E8W A;  2PE9 A;  3W1Y A;  3RUL A;  2BKR B;  1IP9 A;  2J0K A;  1Q0W B;  2LVO A;  2CU1 A;  1WI0 A;  1OGW A;  2AEH A;  3KVF B;  1CMX B;  4GU2 A;  4GDK B;  4MJS B;  4CO7 A;  2LUE A;  4BVU C;  4DHZ B;  2KNB A;  1YX6 B;  3K9O B;  3Q3J A;  2KD0 A;  4IM2 A;  2C7M B;  4PYZ A;  2JRH A;  4N9F 4;  3DVN U;  3L08 A;  5C23 A;  1UEL A;  2KFJ A;  1V86 A;  2JZZ A;  1LFD A;  2KJR A;  1HE8 A;  4GXB A;  4ASW C;  4FA6 A;  4TQ0 A;  2PJH A;  2EKE C;  2FCM A;  1P0R A;  1XQQ A;  2JY6 A;  1NDD A;  4LDT D;  3O65 B;  1UGM A;  1UZX B;  3PRP B;  2OOB B;  2ZCC A;  2LAS A;  3Q3F A;  5TR5 A;  4OVU A;  2IO0 B;  1C3T A;  2DYM A;  2MBH A;  2FUH B;  5AZH A;  3WAN A;  4B95 A;  5IA7 A;  2MBO A;  2MSE D;  1WXS A;  4W9I A;  3ZKJ C;  4BKS A;  3TBL D;  3ZNH B;  2KQ7 A;  4G11 A;  1GC6 A;  4ZRJ A;  5HKH A;  2K6D B;  2NBU A;  2KLG A;  3ENE A;  3M3J A;  5CX3 A;  2KLC A;  3AI5 A;  3WAP A;  2L7R A;  3V62 A;  1KJT A;  4AP4 C;  2LWP A;  3VUX A;  1UH6 A;  2G4S A;  2N9E B;  1NBF C;  3MTN B;  4HXD A;  3U30 A;  2ZCB A;  4WJN A;  3PPA A;  5CHV C;  2QHO A;  2KZR A;  3PZD A;  4ANV A;  4WQO B;  1WFY A;  5E6N A;  3KUZ A;  4FJY A;  2DAF A;  1EUV B;  2M0X A;  3GOE A;  2L00 B;  2HE7 A;  5BO4 B;  2KHW B;  4M8M A;  2KTF A;  2KKC A;  4B6W A;  3DVN V;  2MBQ A;  2KDI A;  3DOW A;  4MSQ B;  1J0G A;  4EZL A;  3VXW A;  3MJW A;  2C5L C;  2XBB C;  3AUL A;  2JRI B;  4TUU A;  5GMV A;  3SU8 X;  3QIJ A;  2MCN B;  4ZYN A;  3KYC D;  3AXC A;  3HM6 X;  3DQV A;  4NQK E;  4RM9 A;  3ZTC A;  3H9D A;  2ZZP B;  2ASQ A;  4I6P A;  1E8Y A;  2JT4 B;  2ZEQ A;  3HM3 A;  4KVG B;  2LRW A;  4W9F A;  3RZF A;  1WY8 A;  3LJ3 A;  4XC2 A;  2DYB A;  4X57 B;  2NPT A;  3TCA A;  3ZO5 B;  2FCS A;  2FNJ B;  3B1L X;  3D32 A;  2L3Z A;  2PE6 B;  2FAZ A;  5E6O A;  5J2R A;  5L83 A;  3WAO A;  2L76 A;  3W1S A;  2LXC A;  3APF A;  2MA9 B;  2KX3 A;  1V81 A;  2RPQ A;  4EOY A;  1OEY J;  3OJ4 B;  1V80 A;  4A3P A;  2DZI A;  2GBR A;  4K7U A;  2Y5B B;  3QJZ A;  1UBQ A;  1K8R B;  1YD8 U;  4AUQ C;  2UWQ A;  4TKN A;  2DX5 B;  2NPT B;  1WX9 A;  5G55 A;  4GDL B;  1WGD A;  4FBJ B;  2HTH A;  1WIA A;  3N3K B;  2KXJ A;  1IPG A;  2NR2 A;  1VD2 A;  2XK5 B;  3DCG A;  3H7P A;  5D6J B;  3TIX A;  4FUL A;  3ALB A;  4FLH A;  2O2V B;  3DBH I;  2UYZ B;  3A4S C;  4NPN A;  1P9D U;  2N9X A;  2MW5 A;  3A1Q A;  3PHW B;  3DBR I;  4KSL C;  3ML9 A;  2C9W B;  3H7S A;  5AZF A;  1EF5 A;  3PT2 B;  3WIM A;  4A20 A;  1AAR A;  1U4A A;  4EZK A;  4HJK A;  5IAA C;  2KWV B;  4GSW A;  2KTR A;  4IWO A;  2MX2 A;  1YJ1 A;  1EO6 A;  2K8B A;  4M0W B;  5FR6 A;  2N1V A;  3W1S C;  2W9N A;  4DWF A;  2MBB B;  2LD9 A;  1WJ4 A;  4IW0 A;  3H7P B;  5EDS A;  4PS3 A;  2KJH B;  4WJQ A;  5DPW A;  4RM8 A;  4GIV A;  1WZ0 A;  3JYU A;  3C0R B;  1TBE A;  3PGE A;  1NI2 A;  4MH0 E;  2KMA A;  2K39 A;  2N7D A;  3UIN B;  3A1Q B;  1EF1 A;  2O6V A;  2BYF A;  3H6N A;  4EKU A;  3ZNG C;  3R7Q A;  5G2N A;  3RZW C;  3UIP B;  2ZVO A;  2LGY A;  2R2Q A;  4DHJ B;  2DHZ A;  2KTR B;  1RLF A;  4WWP A;  4E71 A;  3KW5 B;  3VH3 B;  4MEL A;  4EEW A;  3R7R A;  3TMP B;  1V9J A;  1XT9 B;  5J18 A;  3QK0 A;  2JVC A;  3QC8 B;  5LLI A;  4HK2 A;  3CMM B;  2O6V B;  3IHP C;  2K8H A;  4NQL B;  4GN1 A;  3UF8 A;  2LI5 A;  4MSM B;  3M95 A;  3ZRC A;  2NBW B;  3KYD D;  2A4Z A;  3U7D A;  2KDB A;  2B3A A;  2XEW A;  3N30 A;  3DBL I;  3HHM A;  1PQS A;  4GOC A;  2NVU I;  1OQY A;  2Z0D B;  4TQ1 A;  2ZVN A;  2IBI B;  4NJ7 A;  2J0J A;  2JPH A;  3VTV A;  2HD5 B;  1T0Y A;  2KDF B;  2KWC A;  3HK0 A;  3PRM B;  4YL8 A;  3AU4 A;  3N32 A;  3PHX B;  2HJ8 A;  2WX0 A;  3KH0 A;  3P2B A;  4GMV A;  4HDQ A;  1RFA A;  4GGQ A;  2KJ6 A;  4MGY E;  2BPS A;  3IBE A;  3NY5 A;  2D11 A;  2WDT B;  3NOB A;  2DAJ A;  1SE9 A;  1WJ6 A;  2BKF A;  2CHX A;  4KZ0 A;  3V60 A;  1S3S G;  2WYQ A;  3WAL A;  1E7U A;  3ZTD A;  3ZRF A;  1M94 A;  4WAA A;  3JSV A;  4II2 B;  3APD A;  1GUA B;  4PS8 A;  3ONS A;  3RYT A;  1WGH A;  4HCN B;  1L2N A;  2IO1 B;  5JZE B;  1GJZ A;  2GMI C;  5C1Z A;  3ECI A;  5KHQ A;  2N9P C;  4TV3 A;  4ICU A;  3DVG Y;  2DYO A;  1WJU A;  4A3O A;  1LM8 B;  1WGR A;  3ZNI D;  5D94 A;  3EEC A;  3RUI B;  5CTR C;  2IZV B;  2D10 A;  2K8C A;  2CHZ A;  4HLE A;  3UQA A;  2K6Q A;  4FN2 A;  3TL5 A;  3BIN A;  2BWF A;  4LJP B;  2M8S A;  1R4N I;  3B0A A;  1GG3 A;  3QWZ B;  5DPS A;  3WA0 A;  4W9D A;  4JIO U;  4FAD A;  4FHJ A;  4KDL B;  4WJO A;  5KHO A;  3PLV A;  3PTF C;  4JQW C;  4JL9 A;  4JLC A;  3OLM D;  1E5W A;  1SGH A;  2J0M A;  2D2Q A;  1ZGU B;  2G4D B;  1H8C A;  1V5T A;  2KN5 A;  2KFK A;  1E8Z A;  3PV1 A;  2KWU B;  1WGY A;  2KMC A;  3QCA A;  2KDE B;  2CS4 A;  1WYW B;  3IVF A;  2M17 A;  4FJZ A;  4KV2 A;  1RAX A;  4BKS D;  4M8N A;  2A5U A;  4HPM B;  1G6J A;  2FCN A;  2K1F A;  2BYE A;  3KUD B;  1TZ1 A;  2ZNV B;  4HCP B;  5D7G A;  4G3X B;  1A5R A;  4EFO A;  1ZW7 A;  1TGZ B;  4I6N B;  1V49 A;  4NJ6 A;  5D2M B;  5J17 A;  2EMS A;  3APC A;  2KFK B;  2GBJ A;  2BYV E;  3I3T B;  2C60 A;  3DDC B;  3JW0 X;  2ZNV C;  1H4R A;  2J7Q B;  2KX0 A;  4W9C A;  5DCN A;  3QAQ A;  1C1Y B;  4ZRI A;  2DZM A;  4AOF A;  4CYE A;  3NZU A;  1VCB A;  2Z59 B;  4W9G A;  4FJV B;  4E74 A;  4F7Z A;  4WJP A;  2FIF A;  2LVQ A;  4IM0 A;  2IO3 B;  2WWZ A;  2FID A;  3OAW A;  1E90 A;  2JZ3 B;  1GC7 A;  1P3Q U;  2BGF A;  3EHV A;  3HIZ A;  1WH3 A;  3IG3 A;  3SHQ A;  4DK5 A;  2CR5 A;  5LXH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...