1DOYA

1h and 15n sequential assignment, secondary structure and tertiary fold of [2fe-2s] ferredoxin from synechocystis sp. pcc 6803
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
96
structure length
96
Chain Sequence
b'ASYTVKLITPDGESSIECSDDTYILDAAEEAGLDLPYSCRAGACSTCAGKITAGSVDQSDQSFLDDDQIEAGYVLTCVAYPTSDCTIETHKEEDLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN [2FE-2S]
publication title 1H and 15N NMR sequential assignment, secondary structure, and tertiary fold of [2Fe-2S] ferredoxin from Synechocystis sp. PCC 6803.
pubmed doi rcsb
molecule tags Electron transport
total genus 4
structure length 96
sequence length 96
ec nomenclature
pdb deposition date 1995-09-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00111 Fer2 2Fe-2S iron-sulfur cluster binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.30 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 1doyA00
3LB8C 3AV8A 3AE2B 4US8A 3PO0A 1OFFA 2G1EA 1PFDA 3AE8B 1L6UA 4N6EB 3VRAB 1QF6A 2W3RA 3ABVB 1E9MA 1KFYB 1NI3A 3AEEB 1N5XA 3B9JA 4C7ZA 4ZHPA 5C3JB 1FXIA 3VRBB 3NRZA 4WWMA 3AE5B 1KF6B 3NVWA 1J7BA 2WP9B 4KX6B 3CWIA 1AYFA 5MPOA 2WU2B 4N59A 1QOAA 3DWMA 2WDQB 2EKIA 1TJEA 1JW9D 2JX5A 3AECB 3NVZA 1B9RA 5GXGB 3NVYA 5AUIA 5G5GA 5AUKA 1JQ4A 1FMAD 1XO3A 2K9XA 2L83A 4N58A 3AEBB 2JQRB 3SR6A 4YTMB 2ACZB 1FXAA 2B76B 2QJLA 3P63A 1R7SA 1L6VA 1FO4A 2LEKA 1FFUA 3AEAB 2KAJA 4YSXB 2PVGC 3B2GA 4ZOHC 1CZPA 3HVZA 3ETRA 4IDIA 4P6VF 3ZYYX 1OQQA 1PUTA 1KRHA 1YQ4B 2FBWB 2K5PA 1YJIA 2N0SB 2E3TA 1ZUD2 2Q5WD 2WQYB 4USAA 1J7CA 3AM9A 2W55A 1SB3C 2W54A 3P4RB 1RYJA 3CIRB 1DGJA 1FRDA 3AMZA 1XLPA 3KWLA 2WDRB 3AH7A 4YTPB 3SFEB 3AN1A 3LXFA 2DWQA 2KMMA 1EWYC 1XLOA 5EE3A 2BS3B 1I7HA 1NYQA 3W5VB 1E10A 1FFVA 2PVOD 3P4PB 4FXCA 2H88B 1J7AA 4US9A 5EE9A 3VR8B 2QIEB 1JWAD 1QLBB 2CJNA 4A9AA 1JRPA 3AB5A 1JROA 2WS3B 4YTNB 1T3QA 3AE1B 2BT6A 1DOYA 1N5WA 1TYGB 1QT9A 1VJKA 2Y5CA 1TKGA 1WXQA 4YT0B 1WYGA 2HTME 4ZHOA 3AEFB 1N60A 1N61A 2MH7A 2K22A 3EUB2 3SFDB 1QOFA 1V8CA 3NS1A 4HRSA 4JWUC 1JALA 5EE0A 1PDXA 3BIID 1SIJA 1VLBA 1VDVA 5H8YE 4YXDB 1YJJA 3FAHA 2PKOA 1NVID 1RM6C 1DOXA 3W9CB 1L5PA 1ROEA 1L0VB 4WQMA 2W3SA 4HROA 1DOIA 3P4SB 2L52A 1NEKB 2WLBA 3HUIA 4ITKA 3DWGC 1NENB 3AE3B 1NYRA 1XLNA 1N62A 2M19A 3NVVA 3P4QB 1QOGA 1OQRA 2M56B 3L4PA 2DBYA 1FM0D 1A70A 1FRRA 5EE1A 1N63A 4JWSC 1WGKA 2H89B 1E7PB 5H92C 3AEDB 2BS2B 4C80A 2MJDA 1QOBA 1TKYA 2PIAA 1RFKA 1IUEA 3AE4B 3AE7B 1TKEA 1SF0A 4LTUA 3AEGB 1WWTA 2CU3A 1ZOYB 1FIQA 4JX1C 1GPXA 2AX5A 3AE9B 1GAQB 2OHFA 2CJOA 1E6EB 1UWMA 1ZP0B 2BS4B 3HRDD 1ZXIA 3FC4A 4C7YA 2WDVB 4YSYB 2MJEA 2MJ3A 3B2FA 3P1MA 5G5HA 5C2TB 1JWBD 3RPFC 3WCQA 1CJEA 1WRIA 1F0ZA 1XLQA 1YQ3B 3W5UB 1E0ZA 2WU5B 3AE6B 4YSZB 3VR9B 1RWSA 1V97A 1AWDA
chains in the Genus database with same CATH superfamily
5L83A 3QQ8B 3R2TA 4R3DA 2JUOA 4B6WA 3VUYA 3ZJTA 3TEYA 1C4CA 2D3BA 1N6ZA 1VCBA 3NRZA 3L08A 3PV1A 2N7DA 3H7PA 1UUPA 2HTHA 4PS3A 5E6OA 2WYQA 1I35A 2JY6A 2N9EB 3IBEA 2HJ1A 2PE6B 2PPHA 3ML9A 4MEMA 1XF5L 4CQNA 1V2YA 1CK1A 1HA5A 2KX3A 3ZVVA 1KLVA 1PGAA 2K8HA 1FCLA 1EWYC 3BK2A 4IM0A 3P4PB 1C4AA 1CQVA 1F9JA 1TT5B 2INCC 4P1CC 4RM8A 3ZDTA 4LJPB 1T3QA 2BYEA 3DBRI 1ZPSA 3VH3B 4ACFA 2XK5B 1WMHA 1WYGA 2N9XA 2RMMA 3PRPB 3KH0A 3FILB 1JALA 2AQ2B 1SEBD 1WGRA 3W9CB 1WM3A 3AI5A 1L0VB 3Q8FA 4GDKA 3V6EB 2WX1A 1NENB 4K81A 1WH3A 2C7HA 2D10A 4WQOB 4XGAB 3ZNHB 4DK5A 1Y56A 3WALA 4A3PA 3ZUNA 4ANWA 4K7WA 1P7EA 4HCPB 2K8BA 1J0GA 3GS2A 2AX5A 2V4LA 3AE9B 5JH5C 2NCNA 2KOXA 3PGEA 4FN2A 3HM6X 2KFKB 4OVZA 3TL5A 1FD6A 4KZCA 3W5UB 4RGMA 5FK9C 1E0ZA 1E8XA 2D11A 3VR9B 5L95C 1IBXB 4NAWB 5JXVA 1JRUA 3GE8C 2RPVA 3OAWA 2GBMA 2DNFA 2WXFA 4EKUA 1ACCA 1J8CA 1TBEA 4ZHPA 4XYCA 2LI5A 3TSSA 2WDQB 1TJEA 1MG4A 1BUIC 2L0TA 2VZKD 3EFUA 1FCCC 1XO3A 4N58A 4WH4A 3VHTC 2ACZB 2B76B 2QJLA 3EA6A 3U8ZA 2OJWA 4M8NA 5I4DA 1HXYD 5IAAC 2M17A 3M63B 4B0EA 2QILA 4GLSC 1EF5A 2DZIA 1T0YA 2NVUI 2O6VD 3RYTA 1A5RA 1V5TA 2H88B 2X38A 2YEPF 2N9PC 2CHXA 2MBHA 2N1WA 3WIMA 1AARA 3EUB2 1MG8A 3DVNU 4BKSD 2R2OA 1VLBA 1YJJA 3KYDD 1D4BA 2LASA 3DQVA 5CHWA 1FXTB 4NAMA 4IUMB 5AZFA 2DBYA 4A20A 1E90A 2MCNB 2DZKA 2C7MB 1C79A 3NS8A 5C23A 2KDIA 2WHIA 1SJED 4XWTA 1ZOYB 1FIQA 1WGGA 2AQ3B 3AXCA 1UWMA 2LRUA 1C3TA 2MW5A 2N9KA 2Y5BB 1L2NA 2AYOB 3I9V1 2WU5B 2RSUA 2KQ4X 3A33B 1PGXA 4LNNA 1WR1A 1I42A 5IKCM 1PFDA 1WJ4A 1L6UA 4M00A 3Q8EA 2LVQA 4XDDA 3A9KA 4C7ZA 3AEEB 1N5XA 2JXTA 3IVFA 3Q3FA 1JWUD 3NVWA 1T0QC 4WJNA 2IZVB 5BMIA 3PZ7A 3B08A 1B9RA 1D5XC 4YL8A 1RRBA 4MGYE 2NBVB 3T9LA 1D5ZC 1CZPA 3ETRA 1CMXB 4W9DA 1YQ4B 1ZUD2 5G55A 1YNTE 4NJ6A 3QX1A 5HFYA 4A90A 3AMZA 4GIVA 3BWUD 3AH7A 4ARIA 3N9YC 2V3NA 2D2QA 2MX2A 2O6VA 1UELA 3N1YC 5E6JA 4EOYA 2DLBA 1UGMA 2MHJA 3BK1A 4HPMB 4ZHOA 1I4RA 3DVNV 3P42A 2LGYA 1QQRA 4BKSA 2IO1B 1GC6A 4OZAA 4RF1A 1NVID 4A6QA 4GDLB 2L76A 4OHJA 3P4SB 2WXPA 3KLSX 3P4QB 2WWZA 4X57B 1N63A 5H92C 1T5XD 1WXVA 2MSED 5E6PA 4KDIC 3S2AA 3T8MA 1SF0A 3NG0A 2V4IB 1X1MA 2AEHA 4B0MA 3IAS1 3KVFB 2MJEA 3B2FA 3P1MA 5C2TB 3RPFC 3Q2AC 2DHZA 3ZGZA 4DWFA 1MJDA 3ZXVA 3B1LX 2V0GA 3EC8A 2ZNVB 3L13A 3Q3NC 2I38A 4ICUA 3ZJUA 3TUOA 4IWQA 2IO0B 4IWOA 5AZHA 5G5GA 5AUKA 5GXGB 2NTTA 4M0WB 3KUZA 1PQSA 1WXMA 2CHZA 3AEAB 2ICIA 4W9JA 5IA7A 3VTVA 2FBWB 1UBQA 4JLCA 1P9DU 3UGBB 3TCAA 4C4VB 3BYYB 2IYDB 1E10A 1EO6A 2Y5PA 4ZRKA 1VRAB 4HKQA 3KW5B 1LQBA 4K7UA 2JYEA 2WS3B 3TEXA 2BT6A 1SBBB 2KN5A 4OZCA 3TIXA 1VJKA 4WJOA 2GBJA 3RZFA 3DDCB 3UQAA 4BOSC 3U2SC 2MQJA 2RGFA 1SIJA 1VDVA 1WIAA 1HZ6A 1DOXA 2IGHA 4K3CA 3V62A 2V9HA 3DBRB 2L00B 3L4PA 3K9OB 3I57A 1JWSD 1OQYA 3AE4B 3BVGA 1LGRA 2ZNVC 5D94A 1V1PA 1WY8A 2BYVE 3PPAA 2G3QB 3PLVA 4XX5A 1T6BX 3H6NA 1ESFA 4II2B 1XLQA 3WA0A 2KC2A 2ZW1A 2KVZA 1WGDA 4TQ1A 2BTEA 2BVCA 3H8HA 3RNCC 1WX9A 1ET6A 4EZLA 4HDOA 1VR9A 3QK0A 4KX6B 4W9CA 3Q14C 3GP7A 2EKIA 3NVZA 5AUIA 2KTRB 3AEBB 5T8IA 4ZRPA 5CHVC 4ZYNA 1FXAA 2JRHA 4I6NB 2FAZA 5DPWA 1ZE3D 3O13A 2DZJA 2E3TA 2WQYB 1WX8A 3AM9A 1OEYA 2YLMA 4ZRIA 2KMAA 2VZKB 4B9KA 1E7VA 1XLOA 3ENEA 4P16A 1GNUA 2WXOA 3RNFC 4WAFA 3Q3JA 3TBLD 4MSQB 2PW9A 2W9NA 1HTOA 2HTME 2ONQA 2ZCBA 2M0XA 2MBOA 3RUIB 1P98A 3X23A 4I6LB 1ROEA 2GBNA 3HHMA 1R4MI 3AE3B 2MRPA 3DBSA 1FM0D 4JWSC 2BWFA 3B0AA 2N7JA 2WXHA 1KLUD 1I4GA 4IW0A 2CU3A 2Z0DB 1GAQB 4LJOB 1GC7A 4DHZE 2REXA 3KUCB 1L7YA 2YVCA 1K50A 1WRIA 4WJPA 3AE6B 2INNE 3R2IA 4G3XB 3RULA 4BOZB 2JSVX 3LB8C 4US8A 3NY5A 1QF6A 2HDEA 2OEDA 2BB6A 2INDC 3MP9A 2J42A 2D07B 3JSVB 3PZ8A 1NI2A 4ANUA 3TMPB 4AWJA 4FJVB 1LXDA 4IM2A 2WU2B 2INPE 3DBLB 4AS1A 2K9XA 2Z59B 1UWXA 3H1UA 3SR6A 3JYUA 4YSXB 1GUAB 2L8JA 4XC2A 2IBIB 2N0SB 2KC1A 4TQ0A 2KVRA 2CHWA 3CIRB 3KWLA 3SFEB 1I4HA 2DWQA 2KMMA 4QAYA 4XE0A 4TSSA 4FXCA 2GI9A 1AW7A 1F52A 1TIFA 2K3UA 5BYSA 3ZXRA 3RNBC 1BMLC 4KZ0A 3BVMA 1YN4A 2G9HD 3NHEB 3EGRA 4DBGA 2L0FA 5HHDG 2ZW0A 1C76A 2BW2A 1M4VA 2KO3A 3OWEB 3MC8A 4HKZE 4WJQA 4JL9A 3TEWA 3O65B 2KT7A 4LCDE 4I6PA 2LMCA 3BZDB 2PTLA 3AU4A 4J3OD 3ZNZB 4NY0A 1GG3A 3QHTA 3IXSA 1U4AA 3HRDD 2R2QA 2FIDA 4MJSB 2V3SA 3NZSA 2NPTA 2IGDA 5DPRA 1V6EA 4FULA 4BBNF 1FNUA 1YX6B 4N6EB 3VRAB 1WF9A 3KWVA 1MI0A 3ZRCA 3VRBB 2KANA 1T0SC 4ARCA 3HVDA 1HTQA 5HKHA 2XNAC 2L3ZA 3T3OA 2LFIA 2G4SA 4BKTA 1UNSA 2LWPA 2X8XX 2LD9A 4LNIA 1FFUA 3ZTCA 2PVGC 3HVZA 3ZYYX 3WAMA 5BO4B 2GRIA 4XZ4A 1PUTA 2LVPA 1V5OA 3A4RA 1WJUA 3L0WB 4C56C 1NYQA 2KLGA 1YJ1A 5GMVA 1YX5B 1IYFA 1E8YA 2WXQA 1JRPA 5D6JB 3RCZA 4YT0B 1YIWA 4BAXA 3A9JA 5EE0A 1PDXA 3BVZA 4P1BC 1WE6A 4MM3B 1MPEA 4JE3B 1DOIA 2L52A 4MH8A 1L4ZB 2M56B 4TUUA 2RDBC 1WR6E 1E8WA 3IHPC 2J0JA 4W9LA 2PIAA 4ANXA 4DHJD 1TKEA 2LHDA 2FCQA 3Q3MC 2JZPA 2FUG1 3ML8A 1WZ0A 2G4DB 3MFGA 2PMVA 4KGTA 4TKNA 3N32A 4MH0E 2JYTA 3AE2B 1LO5D 3WAPA 2BF8B 2PE9A 3WAOA 2KKCA 3APDA 1KM7A 3N30A 3B9JA 2K6DB 3EHVA 1VZ7A 2VH1A 5MPOA 3MC9A 4FJYA 2EMSA 3A1QB 4YWGG 5J2RA 2C9WB 3NVYA 4MELA 2L83A 2QHOA 4YTMB 3DBLI 2K0PA 2XBBC 3PHWB 1V49A 3RZWC 3W1SC 1OQQA 5CTRC 2CR5A 4CYEA 1F77A 1C77A 1RYJA 1DGJA 2WDRB 3TJPA 4PT5A 3EFCA 1SE4A 5EDSA 2O2VA 3V6CB 2UU7A 3U7ZA 1J7AA 2LJ5A 5EE9A 2FE8A 4W9GA 3T3NA 1JROA 3RNGC 1V80A 3VFKA 3OLMD 4C00A 1SXTA 3PREA 1Z2MA 4L2YA 3AEFB 3BY4B 4HXDA 3SFDB 3H7PB 4OW0A 4JWUC 4NQLB 3BIID 3EECA 4EE2A 2W3SA 2DYOA 3HUIA 4RH6A 1OQRA 2L1AA 3ZW3A 2QCZA 5LXHA 2E6XA 1E7PB 3ZTDA 1GJZA 4FBJB 4JQWC 2JPHA 1WRDB 3AEGB 1WWTA 1GPXA 2OHFA 2CJOA 3V60A 2BS4B 2KNBA 5TR5A 2GOWA 1R4MB 1JWBD 1YN5A 1CJEA 5CX3A 2N7EA 4RGNA 3JVZX 2BKFA 1RWSA 4KGRA 1WMHB 1JMLA 1TZ1A 5AEKB 2MWSB 2ZVNA 2FIFA 3HIZA 2G1EA 5BMHA 1C9FA 3AE5B 2L7RA 4J6IA 4GDKB 2LXAA 1AYFA 3IAM1 4PK1A 2JX5A 3DHHC 1P0RA 1LM8B 1WJ6A 2WGSA 4FJZA 4PS8A 1VD2A 3P63A 1L6VA 2NR2A 2LEKA 3B2GA 2LXCA 3M95A 3Q69A 2D3AA 1R4NB 4HK2A 2Q5WD 2MP2A 3ZRFA 1E8ZA 5JZEB 1G6JA 3CMMB 1Z5SB 1YQBA 2MBBB 5BYQA 2NBUA 1JWMD 2KDEB 2KDBA 3VQIA 2KWVB 4HCNB 4L1BA 2FUHB 2PVOD 5LXIB 4KVGB 4O1NA 1M94A 2PLPA 3QWZB 1TS5A 2IDYA 1N5WA 5KHQA 3DBHI 4LK0M 2K6QA 4ASWC 2J53A 3NS1A 4HRSA 2BYFA 3SHQA 2JVCA 1S3SG 3NOBA 4KKJA 4WWOA 3RNEC 3UI3A 1NEKB 4URKA 2J0MA 4GN1A 2M4NA 1QOGA 3KUDB 1A70A 2OOBB 5DCNA 4K3BA 3N1XC 3A9JB 1QOBA 1TZOA 2KHWB 4LTUA 3VTUA 4RGOS 1OTRB 4JX1C 2WDTB 3GZNI 1UBIA 4MACA 1KJTA 4G50A 2YEPB 4XDCA 2LGDA 3CF6E 1L0XB 3ZQ4A 2LZ6A 4KSLC 1E5WA 3QAQA 4HEA1 3LDZE 4G11A 5KHOA 1P7FA 3C0RB 2W3RA 2XK5A 3GOEA 4K1RB 3FILA 3E56A 1QZEA 5IP4D 3OJ4B 4WURA 4JGHB 2K8CA 1XXGA 3W2DA 4BFRA 2NBWB 4ZOHC 2NMQA 2K5PA 4KIKA 2LVOA 4MSMB 4HVBA 2IY1B 1WI0A 3MJ5A 2AQ1B 2BQQA 2B3AA 2C7NB 3ZLZA 2KFKA 1NDDA 1F2RI 2DYMA 1TS4A 2SAKA 2AL3A 2A4ZA 3K9PB 3A9KB 4GXBA 2MEKA 1Y8RC 1IBXA 3Q8AA 4NAWA 2G45B 4LNKA 1TS3A 4ZYSA 4IC7B 5BMGA 2LRWA 4A8XC 1I4PA 1HEZE 3MJWA 2CKHB 4LDTD 3V61A 3ZJVA 3LYYA 1FEHA 2KJHB 1Q5WB 3DWGC 4RF0A 4EUTA 2WXMA 1WGYA 3QJZA 3MHZA 4AP4C 1D3ZA 1TGZB 2KXJA 4FADA 2LGIA 1MVKA 1GB4A 3UIPB 2V3PA 3PTFC 5D7GA 1OEYJ 3R7QA 2O6VB 3VTWA 3Q3OC 2VRRB 4AOFA 1IGDA 2IPKD 2JWZA 3VVWB 3AU5A 4S0RA 5E6NA 3AE8B 1KFYB 1UD7A 2PEAA 1FNVA 2I1KA 3M3JA 2LGSA 1KF6B 3QA8A 3PT2B 2LJIA 4M8MA 2HD5B 3DWMA 4LNFA 1JW9D 2RR9A 3ZKJC 2J52A 4P7IA 4L23A 1SE9A 4MGKE 3U4EG 1RLFA 2D3CA 2KJ6A 3DCGA 2GBKA 1V1OA 3PLUA 1RAXA 2N4FA 1J7CA 4S17A 3IT4B 3P4RB 2UYZB 1R4NI 4MDKE 4DDID 2JT4B 2PJHA 4KKIA 2KACA 2KYWA 1KOTA 4MT5A 2QIEB 4HDQA 4WWPA 3RMKC 1L0YB 2J0KA 1SE2A 3VH4B 2MA9B 3Q8BA 3WANA 3U7DA 1I4XA 2XEWA 1VZ8A 3VDZA 3X0WA 2KQSA 3A4SC 3GB1A 4EFOA 4RNAA 1EF1A 2PKOA 2M8SA 3APFA 4TV3A 4RFBA 1L5PA 3D32A 4EEWA 1BXTA 4GMVA 4LLGM 1WGHA 3PHXB 1AN8A 2WXIA 3MC0B 1WGKA 3SD5A 3AEDB 2BS2B 4DDGD 1TKYA 1RFKA 1C4PA 1IUEA 5DPSA 2QDFA 3DVGY 3R8BA 1Q0WB 1E6EB 2AWTA 1P3QU 1MFWA 4C7YA 4EZKA 2BWES 3DOWA 3KYCD 2K1FA 2WXNA 4MGZE 3DHIC 2BGFA 1AWDA 4RMAA 3VUWA 3C8YA 2DENB 3NUHB 1MHHE 2GB1A 4OZBA 4IM3A 1BT0A 4WAAA 2JU6X 2BPSA 2A5UA 2QC8A 2RDGA 4NJCA 3AECB 1KLGD 3ZNID 1KH0A 4LNOA 2KK8A 3URYA 4GDLA 4NJ7A 1UH6A 4FLHA 1V1PB 3I3TB 1K53A 3SEBA 3QARA 2J7QB 2W54A 1WFYA 4YTPB 3QCAA 1XLPA 3AN1A 3M62B 1Q10A 3LXFA 1STEA 2VH2A 1IPGA 1J19A 4AQ7A 2CJNA 3AB5A 5J18A 4ICVA 4IWPA 4KIKB 4ZDVA 1TYGB 2RDHA 1TKGA 2MH7A 1N61A 2KD0A 4W9EA 2KWCA 5H8YE 1XT9B 3FAHA 2EMTA 1EU4A 1QILA 2KWDA 1C1YB 1EM7A 2NTSA 3NVVA 5EE1A 1RFAA 2LUEA 3DBHB 3H9DA 1EU3A 4M0WA 5JHBA 2W82A 3HM3A 5FR3A 1WM2A 2QMTA 4RM9A 2IJ0A 4F1SA 3UF8A 4C4VA 4E74A 1F0ZA 2KFJA 2MBEA 3FKYA 1F1HA 2JWUA 2ZVOA 2KMCA 3AV8A 2NS5A 3CSFA 3U52E 1OFFA 2TSSA 3QIJA 5JHAA 1GOZA 3GZNB 1EWCA 5G2NA 3N1ZC 2WX0A 1P1AA 4N59A 1H4RA 4W9FA 1IP9A 1FMAD 2IO3B 4GU2A 3V05A 3DPDA 4CHKA 1UF0A 3NZUA 3R7RA 3E9SA 1UZXB 1K51A 1KRHA 1I4QA 2LHEA 4USAA 2K39A 1PYWD 4FA6A 4JIOU 4DXAB 2KZRA 1SJHD 3HK0A 2QEJC 2WNMA 4XWWA 5HI1A 3QC8B 4US9A 2KDMA 3OJ3A 3Q6BA 4NPNA 4OVUA 4A9AA 2J4XA 4ZRQA 4YTNB 3N20C 2DAJA 3MHSD 1WXQA 1WX7A 1JCKB 4OVVA 5J17A 3L10B 3PZDA 4JPSA 3UIOB 3BYTB 3IT6B 3BINA 1RM6C 1V81A 1NBFC 4A55A 2ZCCA 2D3GA 4W9IA 1NYRA 1XLNA 2BBCA 2ZEQA 2KTRA 4N9F4 3DVGX 2MJDA 4GB9A 2IY0B 4AJWA 3AE7B 2KLCA 1WZ3A 4LDTB 2IGGA 4BKGA 3RI7C 2DYBA 3SDLC 3ZIMA 1ZXIA 3FC4A 1ZKHA 3RT3B 3ZNGC 3RFZB 4BZAA 5DPTA 3PSEB 4E3CA 4PYUA 4RGTA 4PYZA 2UWQA 1E9MA 2GLSA 5C3JB 1TY0A 1K52A 2JRIB 1J7BA 2FNJB 1H8CA 2JQRB 2KWUB 3V3XA 2KAJA 3Q8CA 5LLIA 5C1ZA 2SEBD 4P6VF 2CU1A 1HQRD 5IN7A 2RPQA 1YJIA 2MBQA 3VUXA 1FRDA 1YN3A 2Y3AA 1PGBA 2NPTB 4WIPA 3ZDMC 1SSNA 2ZPYA 2JZ3B 1F2RC 2I2YA 1XQQA 2N1VA 3VR8B 1ZGUB 3C19A 3J9CA 4DHZB 2IO2B 1XCQL 3H7SA 2Z0EB 5FKAC 3U30A 1EUVB 1QOFA 2WXKA 1V9JA 4KV2A 4RCOA 1Q1OA 5IO9A 2BYTA 4YXDB 2Z8LA 3JSVA 4M02A 3AULA 3RN9C 2L05A 4IG7B 1WE7A 2KX0A 1FNWA 1UGJA 2DX5B 3I5JC 1C78A 1OGWA 4GSWA 4E71A 1TY2A 3UINB 2RD0A 2LUMA 3W1YA 4KGSA 3PRMB 2KQ7A 4HJKA 3L17A 2HJ8A 4HPLB 2WDVB 4YSYB 2KDFB 5G5HA 4YSZB 3NZ3A 5AZGA 1WSPA 3PO0A 5IOIA 2R61A 5D3DA 3ABVB 1NI3A 4D2KA 2BKRB 4WWMA 1XEEA 4FHJA 2WP9B 4KSKC 4F7ZA 3CWIA 3ZO5B 1QOAA 5HG2A 1LFDA 3UQBA 1L4DB 2GMIC 1QKZA 4BBNC 2ZPNA 1R7SA 4K7SA 1WYWB 1D5MC 1ZXHA 4IOIE 3KQ4A 4IDIA 2DZMA 2C5LC 3GE3C 3VXWA 1V86A 2W55A 1SB3C 1XCTL 3APCA 3ECIA 3L16A 4HLEA 4W9KA 4ZRJA 1YMHE 5EE3A 1ISNA 3W5VB 3RD2A 1FFVA 4CO7A 3JW0X 4PS7A 1JWAD 4MJSA 4NZLB 3AE1B 2L32A 1DOYA 2I1JA 1QT9A 2WXGA 3VAWA 1S1QB 4A3OA 1N60A 5D3IB 5CHFA 2K22A 5LNK1 2GBRA 2MLBA 4GGQA 3MTNB 1YOVB 4H2AA 4EZJA 4REZA 4HROA 2ON8A 4WWNA 4AJYB 2WLBA 2EKEC 4IKGA 2M19A 3PS6A 1DYQA 4C80A 1KTKA 3ALBA 1WXAA 1K8RB 2ASQA 2V1YA 2O2VB 1SGHA 4GOCA 1FPYA 4G0NB 3L54A 2ZJDA 4F8CB 3SU8X 1IGCA 1XD3B 3P2BA 3RNAC 3R66C 3W1SA 5BYRA 3TEZA 4BVUC 1FXIA 4HPPA 1D6EC 3OG5A 2JZZA 3CSTA 4II3B 1YD8U 2CS4A 4Q2JA 4MM3A 1B1ZA 1JQ4A 4TMAB 1ZDXA 4DXFA 1FO4A 4B95A 2BB5A 2WXJA 3DHGC 3I63C 2M1MA 5TSSA 4DHJB 1TTNA 4DQOC 1ET9A 2KJRA 2EELA 1WXSA 4FHKA 4KDLB 2N9LA 4HWIB 5FR6A 2JXXA 2BS3B 1I7HA 1E7UA 1ZDVA 2AL6A 3NJTA 3PVLA 3ONSA 1QLBB 2KTFA 1T0RC 2C60A 3N3KB 1ENFA 4AUQC 2FCNA 2KN4A 1SE3A 2Y5CA 1SIFA 4W9HA 2FCMA 1V8CA 4MGIE 2OJRA 3PRZA 1HZ5A 2HE7A 1TS2A 2DAFA 3IFWB 3R3MA 2K25A 2LGXA 4WQMA 2WXLA 4ITKA 4ANVA 2ZZPB 1N62A 3A1QA 2QSDA 1FRRA 2MP2B 2H89B 4NNJB 5D2MB 4UDUC 4DXGA 1ZW7A 2M0AA 2FCSA 1WJNA 3LJ3A 3IG3A 1GB1A 4NQKE 1ZP0B 2JF5A 2XN9C 4HJGE 2D5GA 2MJ3A 3WCQA 1VZ6A 4M01A 1YQ3B 1MHXA 1V97A 2WXRA 1HE8A
chains in the Genus database with same CATH topology
3H8HA 3AV8A 3U52E 3R2TA 1OFFA 2G1EA 1ET6A 2TSSA 4R3DA 5BMHA 3ZJTA 1C9FA 1VR9A 1GOZA 3TEYA 1C4CA 1EWCA 3NRZA 3AE5B 4GDKB 4KX6B 3GP7A 1AYFA 4N59A 3IAM1 1UUPA 2EKIA 2JX5A 3NVZA 5AUIA 1FMAD 3AEBB 5T8IA 4ZRPA 3P63A 1FXAA 1L6VA 2LEKA 3V05A 3B2GA 3E9SA 1K51A 1ZE3D 3Q69A 1KRHA 1I4QA 2Q5WD 2LHEA 3O13A 2E3TA 2WQYB 4USAA 1XF5L 3AM9A 4CQNA 1CK1A 1HA5A 1PYWD 1SJHD 2QEJC 2VZKB 1PGAA 2WNMA 5BYQA 1JWMD 1FCLA 1EWYC 1XLOA 3BK2A 4XWWA 3VQIA 4L1BA 2PVOD 4P16A 3P4PB 5HI1A 4O1NA 2WXOA 4US9A 2KDMA 1C4AA 1CQVA 4WAFA 2PLPA 4A9AA 2J4XA 4ZRQA 4YTNB 1T3QA 1TS5A 2IDYA 1N5WA 1ZPSA 2PW9A 1WXQA 1WYGA 2RMMA 2HTME 4LK0M 2ONQA 1JCKB 2J53A 3NS1A 3FILB 4HRSA 2BTEA 4JPSA 1JALA 2AQ2B 1SEBD 3BYTB 3IT6B 1RM6C 3W9CB 1ROEA 1L0VB 3Q8FA 4A55A 4KKJA 3UI3A 1NEKB 1NENB 3AE3B 1NYRA 1XLNA 2BBCA 1QOGA 1FM0D 1A70A 4JWSC 1Y56A 2MJDA 1QOBA 2N7JA 1TZOA 2WXHA 3AE7B 1KLUD 1P7EA 1I4GA 4LTUA 2IGGA 2CU3A 3GS2A 4RGOS 4JX1C 2AX5A 3AE9B 1GAQB 1ZXIA 3FC4A 4MACA 1K50A 4OVZA 2YEPB 1FD6A 4XDCA 1WRIA 3RFZB 1L0XB 3W5UB 4RGMA 5FK9C 3ZQ4A 1E0ZA 3AE6B 3VR9B 2INNE 3R2IA 1IBXB 4HEA1 2JSVX 4NAWB 3LB8C 5JXVA 2RPVA 4US8A 4RGTA 2WXFA 1P7FA 1QF6A 2HDEA 2OEDA 2W3RA 2BB6A 3MP9A 1ACCA 1E9MA 2J42A 5C3JB 4ZHPA 1TY0A 3PZ8A 1K52A 1J7BA 3FILA 3E56A 2WU2B 3TSSA 2WDQB 2INPE 1TJEA 1BUIC 2VZKD 4AS1A 4WURA 1FCCC 2K9XA 1XO3A 1UWXA 4N58A 4WH4A 2JQRB 3SR6A 2ACZB 1XXGA 2B76B 2QJLA 3EA6A 3V3XA 3W2DA 2KAJA 3Q8CA 4YSXB 2SEBD 4ZOHC 4P6VF 2NMQA 1HQRD 5I4DA 2K5PA 1HXYD 1YJIA 2N0SB 4TQ0A 4B0EA 3CIRB 1FRDA 1YN3A 3KWLA 2QILA 3MJ5A 2AQ1B 2Y3AA 3SFEB 4GLSC 1I4HA 1PGBA 2DWQA 2KMMA 1MHXA 4WIPA 4XE0A 1SSNA 4TSSA 4FXCA 1F2RC 2H88B 2I2YA 2GI9A 2X38A 3VR8B 1AW7A 2K3UA 2YEPF 5BYSA 1F2RI 2DYMA 3J9CA 1TS4A 1XCQL 2SAKA 2MEKA 5FKAC 1BMLC 1IBXA 3Q8AA 3BVMA 1YN4A 3EUB2 1QOFA 1TS3A 2G9HD 4ZYSA 2WXKA 3EGRA 5BMGA 4RCOA 4A8XC 1I4PA 1VLBA 1HEZE 2BYTA 4YXDB 1YJJA 3ZJVA 2Z8LA 3LYYA 1D4BA 5HHDG 2ZW0A 1FEHA 1C76A 2BW2A 1M4VA 3DWGC 4NAMA 4RF0A 1FNWA 2WXMA 3OWEB 3MHZA 4HKZE 2DBYA 1UGJA 3TEWA 1C78A 1C79A 2LMCA 1TY2A 3BZDB 2LGIA 1MVKA 2PTLA 4J3OD 1GB4A 2LUMA 4KGSA 2V3PA 1SJED 4XWTA 1ZOYB 1FIQA 3IXSA 5D7GA 2AQ3B 1UWMA 3HRDD 2WDVB 4YSYB 5G5HA 2N9KA 3I9V1 2WU5B 1IGDA 4YSZB 2IGDA 2IPKD 2KQ4X 3NZ3A 1PGXA 1WSPA 3PO0A 1FNUA 1PFDA 3AE8B 1L6UA 4N6EB 2R61A 3Q8EA 4XDDA 3VRAB 5D3DA 3ABVB 3KWVA 1KFYB 1NI3A 3AEEB 1N5XA 1MI0A 1FNVA 2JXTA 4D2KA 4C7ZA 3VRBB 4WWMA 1JWUD 1KF6B 1XEEA 3NVWA 2WP9B 2LJIA 3CWIA 5BMIA 3PZ7A 4ARCA 1QOAA 3HVDA 3DWMA 1JW9D 5HG2A 1B9RA 2XNAC 3T3OA 1L4DB 2J52A 2LFIA 1QKZA 1D5XC 1UNSA 4L23A 3U4EG 1R7SA 1FFUA 1D5ZC 2PVGC 1D5MC 1ZXHA 4IOIE 1CZPA 3HVZA 1V1OA 3ETRA 3KQ4A 4IDIA 3ZYYX 2GRIA 1PUTA 1YQ4B 1ZUD2 1J7CA 2W55A 1SB3C 1XCTL 1YNTE 3IT4B 3P4RB 5HFYA 4A90A 3AMZA 3BWUD 3AH7A 4ARIA 1YMHE 3N9YC 2V3NA 5EE3A 4C56C 1NYQA 3W5VB 4KKIA 1FFVA 2KACA 4MT5A 2QIEB 5E6JA 1JWAD 2WXQA 1JRPA 1L0YB 4NZLB 3AE1B 2L32A 1DOYA 1SE2A 2DLBA 1QT9A 2WXGA 4YT0B 3BK1A 3Q8BA 4ZHOA 1N60A 5D3IB 1I4RA 1I4XA 2K22A 1VZ8A 3P42A 5LNK1 1QQRA 5EE0A 1PDXA 3BVZA 3GB1A 4RNAA 4OZAA 2PKOA 1NVID 4H2AA 4MM3B 4RF1A 4A6QA 4RFBA 1MPEA 1L5PA 4KGRA 4GDLB 4JE3B 4OHJA 1BXTA 4REZA 4HROA 1DOIA 3P4SB 2ON8A 2L52A 4LLGM 4MH8A 2WLBA 4IKGA 2WXPA 1L4ZB 3KLSX 3P4QB 2M19A 1AN8A 2WXIA 2M56B 3MC0B 1DYQA 1N63A 1WGKA 5H92C 1T5XD 3AEDB 2BS2B 4C80A 1KTKA 1TKYA 1RFKA 1C4PA 1IUEA 2PIAA 1TKEA 2LHDA 1SF0A 2V4IB 2JZPA 4B0MA 3R8BA 3IAS1 2FUG1 1E6EB 4C7YA 2MJEA 3B2FA 3P1MA 5C2TB 3RPFC 3MFGA 2WXNA 2PMVA 4KGTA 1AWDA 2JYTA 3ZGZA 1IGCA 3AE2B 1LO5D 3C8YA 3NUHB 1MHHE 2V0GA 2GB1A 3W1SA 5BYRA 3TEZA 4OZBA 3B9JA 1FXIA 1D6EC 2JU6X 2I38A 1VZ7A 3ZJUA 2RDGA 5MPOA 3TUOA 4NJCA 4Q2JA 4YWGG 3AECB 1KLGD 5GXGB 3NVYA 1KH0A 1B1ZA 5AUKA 5G5GA 2L83A 2NTTA 1JQ4A 4TMAB 1ZDXA 3URYA 4DXFA 4YTMB 1FO4A 2BB5A 2WXJA 3AEAB 5TSSA 2ICIA 2K0PA 1V1PB 4DQOC 1ET9A 1OQQA 1K53A 2FBWB 3SEBA 2EELA 2W54A 1F77A 1C77A 1RYJA 1DGJA 4YTPB 2N9LA 1XLPA 2WDRB 3AN1A 3BYYB 1Q10A 3LXFA 4PT5A 1STEA 1E10A 2Y5PA 2BS3B 1I7HA 1SE4A 1VRAB 1ZDVA 4HKQA 3U7ZA 1J7AA 5EE9A 2FE8A 4AQ7A 1QLBB 2CJNA 3T3NA 3AB5A 1JROA 2JYEA 2WS3B 3TEXA 1ENFA 2BT6A 1SBBB 2KN4A 4OZCA 1SE3A 1SXTA 1TYGB 1VJKA 2Y5CA 2RDHA 1TKGA 4L2YA 2ZW1A 3AEFB 2MH7A 1N61A 3SFDB 1V8CA 3U2SC 4OW0A 4JWUC 1HZ5A 1TS2A 3BIID 1SIJA 1VDVA 5H8YE 4EE2A 1HZ6A 3FAHA 1DOXA 2IGHA 4WQMA 2W3SA 1EU4A 2WXLA 1QILA 2DYOA 2KWDA 3HUIA 4ITKA 1EM7A 2NTSA 4RH6A 1N62A 3NVVA 1OQRA 2QSDA 3L4PA 2L1AA 1FRRA 5EE1A 2E6XA 2H89B 1E7PB 1EU3A 4M0WA 4UDUC 2W82A 4DXGA 3I57A 1JWSD 3AE4B 3BVGA 2M0AA 1V1PA 3AEGB 5FR3A 1WWTA 1GPXA 2QMTA 2OHFA 1GB1A 2CJOA 1ZP0B 2BS4B 2IJ0A 1T6BX 2XN9C 4HJGE 2D5GA 2MJ3A 3WCQA 1JWBD 1YN5A 1VZ6A 1CJEA 1ESFA 1F0ZA 1XLQA 1YQ3B 4RGNA 2JWUA 1RWSA 1V97A 2WXRA 1JMLA 4TQ1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LB8 C;  3AV8 A;  3AE2 B;  4US8 A;  3PO0 A;  1OFF A;  2G1E A;  1PFD A;  3AE8 B;  1L6U A;  4N6E B;  3VRA B;  1QF6 A;  2W3R A;  3ABV B;  1E9M A;  1KFY B;  1NI3 A;  3AEE B;  1N5X A;  3B9J A;  4C7Z A;  4ZHP A;  5C3J B;  1FXI A;  3VRB B;  3NRZ A;  4WWM A;  3AE5 B;  1KF6 B;  3NVW A;  1J7B A;  2WP9 B;  4KX6 B;  3CWI A;  1AYF A;  5MPO A;  2WU2 B;  4N59 A;  1QOA A;  3DWM A;  2WDQ B;  2EKI A;  1TJE A;  1JW9 D;  2JX5 A;  3AEC B;  3NVZ A;  1B9R A;  5GXG B;  3NVY A;  5AUI A;  5G5G A;  5AUK A;  1JQ4 A;  1FMA D;  1XO3 A;  2K9X A;  2L83 A;  4N58 A;  3AEB B;  2JQR B;  3SR6 A;  4YTM B;  2ACZ B;  1FXA A;  2B76 B;  2QJL A;  3P63 A;  1R7S A;  1L6V A;  1FO4 A;  2LEK A;  1FFU A;  3AEA B;  2KAJ A;  4YSX B;  2PVG C;  3B2G A;  4ZOH C;  1CZP A;  3HVZ A;  3ETR A;  4IDI A;  4P6V F;  3ZYY X;  1OQQ A;  1PUT A;  1KRH A;  1YQ4 B;  2FBW B;  2K5P A;  1YJI A;  2N0S B;  2E3T A;  1ZUD 2;  2Q5W D;  2WQY B;  4USA A;  1J7C A;  3AM9 A;  2W55 A;  1SB3 C;  2W54 A;  3P4R B;  1RYJ A;  3CIR B;  1DGJ A;  1FRD A;  3AMZ A;  1XLP A;  3KWL A;  2WDR B;  3AH7 A;  4YTP B;  3SFE B;  3AN1 A;  3LXF A;  2DWQ A;  2KMM A;  1EWY C;  1XLO A;  5EE3 A;  2BS3 B;  1I7H A;  1NYQ A;  3W5V B;  1E10 A;  1FFV A;  2PVO D;  3P4P B;  4FXC A;  2H88 B;  1J7A A;  4US9 A;  5EE9 A;  3VR8 B;  2QIE B;  1JWA D;  1QLB B;  2CJN A;  4A9A A;  1JRP A;  3AB5 A;  1JRO A;  2WS3 B;  4YTN B;  1T3Q A;  3AE1 B;  2BT6 A;  1DOY A;  1N5W A;  1TYG B;  1QT9 A;  1VJK A;  2Y5C A;  1TKG A;  1WXQ A;  4YT0 B;  1WYG A;  2HTM E;  4ZHO A;  3AEF B;  1N60 A;  1N61 A;  2MH7 A;  2K22 A;  3EUB 2;  3SFD B;  1QOF A;  1V8C A;  3NS1 A;  4HRS A;  4JWU C;  1JAL A;  5EE0 A;  1PDX A;  3BII D;  1SIJ A;  1VLB A;  1VDV A;  5H8Y E;  4YXD B;  1YJJ A;  3FAH A;  2PKO A;  1NVI D;  1RM6 C;  1DOX A;  3W9C B;  1L5P A;  1ROE A;  1L0V B;  4WQM A;  2W3S A;  4HRO A;  1DOI A;  3P4S B;  2L52 A;  1NEK B;  2WLB A;  3HUI A;  4ITK A;  3DWG C;  1NEN B;  3AE3 B;  1NYR A;  1XLN A;  1N62 A;  2M19 A;  3NVV A;  3P4Q B;  1QOG A;  1OQR A;  2M56 B;  3L4P A;  2DBY A;  1FM0 D;  1A70 A;  1FRR A;  5EE1 A;  1N63 A;  4JWS C;  1WGK A;  2H89 B;  1E7P B;  5H92 C;  3AED B;  2BS2 B;  4C80 A;  2MJD A;  1QOB A;  1TKY A;  2PIA A;  1RFK A;  1IUE A;  3AE4 B;  3AE7 B;  1TKE A;  1SF0 A;  4LTU A;  3AEG B;  1WWT A;  2CU3 A;  1ZOY B;  1FIQ A;  4JX1 C;  1GPX A;  2AX5 A;  3AE9 B;  1GAQ B;  2OHF A;  2CJO A;  1E6E B;  1UWM A;  1ZP0 B;  2BS4 B;  3HRD D;  1ZXI A;  3FC4 A;  4C7Y A;  2WDV B;  4YSY B;  2MJE A;  2MJ3 A;  3B2F A;  3P1M A;  5G5H A;  5C2T B;  1JWB D;  3RPF C;  3WCQ A;  1CJE A;  1WRI A;  1F0Z A;  1XLQ A;  1YQ3 B;  3W5U B;  1E0Z A;  2WU5 B;  3AE6 B;  4YSZ B;  3VR9 B;  1RWS A;  1V97 A;  1AWD A; 
#chains in the Genus database with same CATH topology
 5L83 A;  3QQ8 B;  3R2T A;  4R3D A;  2JUO A;  4B6W A;  3VUY A;  3ZJT A;  3TEY A;  1C4C A;  2D3B A;  1N6Z A;  1VCB A;  3NRZ A;  3L08 A;  3PV1 A;  2N7D A;  3H7P A;  1UUP A;  2HTH A;  4PS3 A;  5E6O A;  2WYQ A;  1I35 A;  2JY6 A;  2N9E B;  3IBE A;  2HJ1 A;  2PE6 B;  2PPH A;  3ML9 A;  4MEM A;  1XF5 L;  4CQN A;  1V2Y A;  1CK1 A;  1HA5 A;  2KX3 A;  3ZVV A;  1KLV A;  1PGA A;  2K8H A;  1FCL A;  1EWY C;  3BK2 A;  4IM0 A;  3P4P B;  1C4A A;  1CQV A;  1F9J A;  1TT5 B;  2INC C;  4P1C C;  4RM8 A;  3ZDT A;  4LJP B;  1T3Q A;  2BYE A;  3DBR I;  1ZPS A;  3VH3 B;  4ACF A;  2XK5 B;  1WMH A;  1WYG A;  2N9X A;  2RMM A;  3PRP B;  3KH0 A;  3FIL B;  1JAL A;  2AQ2 B;  1SEB D;  1WGR A;  3W9C B;  1WM3 A;  3AI5 A;  1L0V B;  3Q8F A;  4GDK A;  3V6E B;  2WX1 A;  1NEN B;  4K81 A;  1WH3 A;  2C7H A;  2D10 A;  4WQO B;  4XGA B;  3ZNH B;  4DK5 A;  1Y56 A;  3WAL A;  4A3P A;  3ZUN A;  4ANW A;  4K7W A;  1P7E A;  4HCP B;  2K8B A;  1J0G A;  3GS2 A;  2AX5 A;  2V4L A;  3AE9 B;  5JH5 C;  2NCN A;  2KOX A;  3PGE A;  4FN2 A;  3HM6 X;  2KFK B;  4OVZ A;  3TL5 A;  1FD6 A;  4KZC A;  3W5U B;  4RGM A;  5FK9 C;  1E0Z A;  1E8X A;  2D11 A;  3VR9 B;  5L95 C;  1IBX B;  4NAW B;  5JXV A;  1JRU A;  3GE8 C;  2RPV A;  3OAW A;  2GBM A;  2DNF A;  2WXF A;  4EKU A;  1ACC A;  1J8C A;  1TBE A;  4ZHP A;  4XYC A;  2LI5 A;  3TSS A;  2WDQ B;  1TJE A;  1MG4 A;  1BUI C;  2L0T A;  2VZK D;  3EFU A;  1FCC C;  1XO3 A;  4N58 A;  4WH4 A;  3VHT C;  2ACZ B;  2B76 B;  2QJL A;  3EA6 A;  3U8Z A;  2OJW A;  4M8N A;  5I4D A;  1HXY D;  5IAA C;  2M17 A;  3M63 B;  4B0E A;  2QIL A;  4GLS C;  1EF5 A;  2DZI A;  1T0Y A;  2NVU I;  2O6V D;  3RYT A;  1A5R A;  1V5T A;  2H88 B;  2X38 A;  2YEP F;  2N9P C;  2CHX A;  2MBH A;  2N1W A;  3WIM A;  1AAR A;  3EUB 2;  1MG8 A;  3DVN U;  4BKS D;  2R2O A;  1VLB A;  1YJJ A;  3KYD D;  1D4B A;  2LAS A;  3DQV A;  5CHW A;  1FXT B;  4NAM A;  4IUM B;  5AZF A;  2DBY A;  4A20 A;  1E90 A;  2MCN B;  2DZK A;  2C7M B;  1C79 A;  3NS8 A;  5C23 A;  2KDI A;  2WHI A;  1SJE D;  4XWT A;  1ZOY B;  1FIQ A;  1WGG A;  2AQ3 B;  3AXC A;  1UWM A;  2LRU A;  1C3T A;  2MW5 A;  2N9K A;  2Y5B B;  1L2N A;  2AYO B;  3I9V 1;  2WU5 B;  2RSU A;  2KQ4 X;  3A33 B;  1PGX A;  4LNN A;  1WR1 A;  1I42 A;  5IKC M;  1PFD A;  1WJ4 A;  1L6U A;  4M00 A;  3Q8E A;  2LVQ A;  4XDD A;  3A9K A;  4C7Z A;  3AEE B;  1N5X A;  2JXT A;  3IVF A;  3Q3F A;  1JWU D;  3NVW A;  1T0Q C;  4WJN A;  2IZV B;  5BMI A;  3PZ7 A;  3B08 A;  1B9R A;  1D5X C;  4YL8 A;  1RRB A;  4MGY E;  2NBV B;  3T9L A;  1D5Z C;  1CZP A;  3ETR A;  1CMX B;  4W9D A;  1YQ4 B;  1ZUD 2;  5G55 A;  1YNT E;  4NJ6 A;  3QX1 A;  5HFY A;  4A90 A;  3AMZ A;  4GIV A;  3BWU D;  3AH7 A;  4ARI A;  3N9Y C;  2V3N A;  2D2Q A;  2MX2 A;  2O6V A;  1UEL A;  3N1Y C;  5E6J A;  4EOY A;  2DLB A;  1UGM A;  2MHJ A;  3BK1 A;  4HPM B;  4ZHO A;  1I4R A;  3DVN V;  3P42 A;  2LGY A;  1QQR A;  4BKS A;  2IO1 B;  1GC6 A;  4OZA A;  4RF1 A;  1NVI D;  4A6Q A;  4GDL B;  2L76 A;  4OHJ A;  3P4S B;  2WXP A;  3KLS X;  3P4Q B;  2WWZ A;  4X57 B;  1N63 A;  5H92 C;  1T5X D;  1WXV A;  2MSE D;  5E6P A;  4KDI C;  3S2A A;  3T8M A;  1SF0 A;  3NG0 A;  2V4I B;  1X1M A;  2AEH A;  4B0M A;  3IAS 1;  3KVF B;  2MJE A;  3B2F A;  3P1M A;  5C2T B;  3RPF C;  3Q2A C;  2DHZ A;  3ZGZ A;  4DWF A;  1MJD A;  3ZXV A;  3B1L X;  2V0G A;  3EC8 A;  2ZNV B;  3L13 A;  3Q3N C;  2I38 A;  4ICU A;  3ZJU A;  3TUO A;  4IWQ A;  2IO0 B;  4IWO A;  5AZH A;  5G5G A;  5AUK A;  5GXG B;  2NTT A;  4M0W B;  3KUZ A;  1PQS A;  1WXM A;  2CHZ A;  3AEA B;  2ICI A;  4W9J A;  5IA7 A;  3VTV A;  2FBW B;  1UBQ A;  4JLC A;  1P9D U;  3UGB B;  3TCA A;  4C4V B;  3BYY B;  2IYD B;  1E10 A;  1EO6 A;  2Y5P A;  4ZRK A;  1VRA B;  4HKQ A;  3KW5 B;  1LQB A;  4K7U A;  2JYE A;  2WS3 B;  3TEX A;  2BT6 A;  1SBB B;  2KN5 A;  4OZC A;  3TIX A;  1VJK A;  4WJO A;  2GBJ A;  3RZF A;  3DDC B;  3UQA A;  4BOS C;  3U2S C;  2MQJ A;  2RGF A;  1SIJ A;  1VDV A;  1WIA A;  1HZ6 A;  1DOX A;  2IGH A;  4K3C A;  3V62 A;  2V9H A;  3DBR B;  2L00 B;  3L4P A;  3K9O B;  3I57 A;  1JWS D;  1OQY A;  3AE4 B;  3BVG A;  1LGR A;  2ZNV C;  5D94 A;  1V1P A;  1WY8 A;  2BYV E;  3PPA A;  2G3Q B;  3PLV A;  4XX5 A;  1T6B X;  3H6N A;  1ESF A;  4II2 B;  1XLQ A;  3WA0 A;  2KC2 A;  2ZW1 A;  2KVZ A;  1WGD A;  4TQ1 A;  2BTE A;  2BVC A;  3H8H A;  3RNC C;  1WX9 A;  1ET6 A;  4EZL A;  4HDO A;  1VR9 A;  3QK0 A;  4KX6 B;  4W9C A;  3Q14 C;  3GP7 A;  2EKI A;  3NVZ A;  5AUI A;  2KTR B;  3AEB B;  5T8I A;  4ZRP A;  5CHV C;  4ZYN A;  1FXA A;  2JRH A;  4I6N B;  2FAZ A;  5DPW A;  1ZE3 D;  3O13 A;  2DZJ A;  2E3T A;  2WQY B;  1WX8 A;  3AM9 A;  1OEY A;  2YLM A;  4ZRI A;  2KMA A;  2VZK B;  4B9K A;  1E7V A;  1XLO A;  3ENE A;  4P16 A;  1GNU A;  2WXO A;  3RNF C;  4WAF A;  3Q3J A;  3TBL D;  4MSQ B;  2PW9 A;  2W9N A;  1HTO A;  2HTM E;  2ONQ A;  2ZCB A;  2M0X A;  2MBO A;  3RUI B;  1P98 A;  3X23 A;  4I6L B;  1ROE A;  2GBN A;  3HHM A;  1R4M I;  3AE3 B;  2MRP A;  3DBS A;  1FM0 D;  4JWS C;  2BWF A;  3B0A A;  2N7J A;  2WXH A;  1KLU D;  1I4G A;  4IW0 A;  2CU3 A;  2Z0D B;  1GAQ B;  4LJO B;  1GC7 A;  4DHZ E;  2REX A;  3KUC B;  1L7Y A;  2YVC A;  1K50 A;  1WRI A;  4WJP A;  3AE6 B;  2INN E;  3R2I A;  4G3X B;  3RUL A;  4BOZ B;  2JSV X;  3LB8 C;  4US8 A;  3NY5 A;  1QF6 A;  2HDE A;  2OED A;  2BB6 A;  2IND C;  3MP9 A;  2J42 A;  2D07 B;  3JSV B;  3PZ8 A;  1NI2 A;  4ANU A;  3TMP B;  4AWJ A;  4FJV B;  1LXD A;  4IM2 A;  2WU2 B;  2INP E;  3DBL B;  4AS1 A;  2K9X A;  2Z59 B;  1UWX A;  3H1U A;  3SR6 A;  3JYU A;  4YSX B;  1GUA B;  2L8J A;  4XC2 A;  2IBI B;  2N0S B;  2KC1 A;  4TQ0 A;  2KVR A;  2CHW A;  3CIR B;  3KWL A;  3SFE B;  1I4H A;  2DWQ A;  2KMM A;  4QAY A;  4XE0 A;  4TSS A;  4FXC A;  2GI9 A;  1AW7 A;  1F52 A;  1TIF A;  2K3U A;  5BYS A;  3ZXR A;  3RNB C;  1BML C;  4KZ0 A;  3BVM A;  1YN4 A;  2G9H D;  3NHE B;  3EGR A;  4DBG A;  2L0F A;  5HHD G;  2ZW0 A;  1C76 A;  2BW2 A;  1M4V A;  2KO3 A;  3OWE B;  3MC8 A;  4HKZ E;  4WJQ A;  4JL9 A;  3TEW A;  3O65 B;  2KT7 A;  4LCD E;  4I6P A;  2LMC A;  3BZD B;  2PTL A;  3AU4 A;  4J3O D;  3ZNZ B;  4NY0 A;  1GG3 A;  3QHT A;  3IXS A;  1U4A A;  3HRD D;  2R2Q A;  2FID A;  4MJS B;  2V3S A;  3NZS A;  2NPT A;  2IGD A;  5DPR A;  1V6E A;  4FUL A;  4BBN F;  1FNU A;  1YX6 B;  4N6E B;  3VRA B;  1WF9 A;  3KWV A;  1MI0 A;  3ZRC A;  3VRB B;  2KAN A;  1T0S C;  4ARC A;  3HVD A;  1HTQ A;  5HKH A;  2XNA C;  2L3Z A;  3T3O A;  2LFI A;  2G4S A;  4BKT A;  1UNS A;  2LWP A;  2X8X X;  2LD9 A;  4LNI A;  1FFU A;  3ZTC A;  2PVG C;  3HVZ A;  3ZYY X;  3WAM A;  5BO4 B;  2GRI A;  4XZ4 A;  1PUT A;  2LVP A;  1V5O A;  3A4R A;  1WJU A;  3L0W B;  4C56 C;  1NYQ A;  2KLG A;  1YJ1 A;  5GMV A;  1YX5 B;  1IYF A;  1E8Y A;  2WXQ A;  1JRP A;  5D6J B;  3RCZ A;  4YT0 B;  1YIW A;  4BAX A;  3A9J A;  5EE0 A;  1PDX A;  3BVZ A;  4P1B C;  1WE6 A;  4MM3 B;  1MPE A;  4JE3 B;  1DOI A;  2L52 A;  4MH8 A;  1L4Z B;  2M56 B;  4TUU A;  2RDB C;  1WR6 E;  1E8W A;  3IHP C;  2J0J A;  4W9L A;  2PIA A;  4ANX A;  4DHJ D;  1TKE A;  2LHD A;  2FCQ A;  3Q3M C;  2JZP A;  2FUG 1;  3ML8 A;  1WZ0 A;  2G4D B;  3MFG A;  2PMV A;  4KGT A;  4TKN A;  3N32 A;  4MH0 E;  2JYT A;  3AE2 B;  1LO5 D;  3WAP A;  2BF8 B;  2PE9 A;  3WAO A;  2KKC A;  3APD A;  1KM7 A;  3N30 A;  3B9J A;  2K6D B;  3EHV A;  1VZ7 A;  2VH1 A;  5MPO A;  3MC9 A;  4FJY A;  2EMS A;  3A1Q B;  4YWG G;  5J2R A;  2C9W B;  3NVY A;  4MEL A;  2L83 A;  2QHO A;  4YTM B;  3DBL I;  2K0P A;  2XBB C;  3PHW B;  1V49 A;  3RZW C;  3W1S C;  1OQQ A;  5CTR C;  2CR5 A;  4CYE A;  1F77 A;  1C77 A;  1RYJ A;  1DGJ A;  2WDR B;  3TJP A;  4PT5 A;  3EFC A;  1SE4 A;  5EDS A;  2O2V A;  3V6C B;  2UU7 A;  3U7Z A;  1J7A A;  2LJ5 A;  5EE9 A;  2FE8 A;  4W9G A;  3T3N A;  1JRO A;  3RNG C;  1V80 A;  3VFK A;  3OLM D;  4C00 A;  1SXT A;  3PRE A;  1Z2M A;  4L2Y A;  3AEF B;  3BY4 B;  4HXD A;  3SFD B;  3H7P B;  4OW0 A;  4JWU C;  4NQL B;  3BII D;  3EEC A;  4EE2 A;  2W3S A;  2DYO A;  3HUI A;  4RH6 A;  1OQR A;  2L1A A;  3ZW3 A;  2QCZ A;  5LXH A;  2E6X A;  1E7P B;  3ZTD A;  1GJZ A;  4FBJ B;  4JQW C;  2JPH A;  1WRD B;  3AEG B;  1WWT A;  1GPX A;  2OHF A;  2CJO A;  3V60 A;  2BS4 B;  2KNB A;  5TR5 A;  2GOW A;  1R4M B;  1JWB D;  1YN5 A;  1CJE A;  5CX3 A;  2N7E A;  4RGN A;  3JVZ X;  2BKF A;  1RWS A;  4KGR A;  1WMH B;  1JML A;  1TZ1 A;  5AEK B;  2MWS B;  2ZVN A;  2FIF A;  3HIZ A;  2G1E A;  5BMH A;  1C9F A;  3AE5 B;  2L7R A;  4J6I A;  4GDK B;  2LXA A;  1AYF A;  3IAM 1;  4PK1 A;  2JX5 A;  3DHH C;  1P0R A;  1LM8 B;  1WJ6 A;  2WGS A;  4FJZ A;  4PS8 A;  1VD2 A;  3P63 A;  1L6V A;  2NR2 A;  2LEK A;  3B2G A;  2LXC A;  3M95 A;  3Q69 A;  2D3A A;  1R4N B;  4HK2 A;  2Q5W D;  2MP2 A;  3ZRF A;  1E8Z A;  5JZE B;  1G6J A;  3CMM B;  1Z5S B;  1YQB A;  2MBB B;  5BYQ A;  2NBU A;  1JWM D;  2KDE B;  2KDB A;  3VQI A;  2KWV B;  4HCN B;  4L1B A;  2FUH B;  2PVO D;  5LXI B;  4KVG B;  4O1N A;  1M94 A;  2PLP A;  3QWZ B;  1TS5 A;  2IDY A;  1N5W A;  5KHQ A;  3DBH I;  4LK0 M;  2K6Q A;  4ASW C;  2J53 A;  3NS1 A;  4HRS A;  2BYF A;  3SHQ A;  2JVC A;  1S3S G;  3NOB A;  4KKJ A;  4WWO A;  3RNE C;  3UI3 A;  1NEK B;  4URK A;  2J0M A;  4GN1 A;  2M4N A;  1QOG A;  3KUD B;  1A70 A;  2OOB B;  5DCN A;  4K3B A;  3N1X C;  3A9J B;  1QOB A;  1TZO A;  2KHW B;  4LTU A;  3VTU A;  4RGO S;  1OTR B;  4JX1 C;  2WDT B;  3GZN I;  1UBI A;  4MAC A;  1KJT A;  4G50 A;  2YEP B;  4XDC A;  2LGD A;  3CF6 E;  1L0X B;  3ZQ4 A;  2LZ6 A;  4KSL C;  1E5W A;  3QAQ A;  4HEA 1;  3LDZ E;  4G11 A;  5KHO A;  1P7F A;  3C0R B;  2W3R A;  2XK5 A;  3GOE A;  4K1R B;  3FIL A;  3E56 A;  1QZE A;  5IP4 D;  3OJ4 B;  4WUR A;  4JGH B;  2K8C A;  1XXG A;  3W2D A;  4BFR A;  2NBW B;  4ZOH C;  2NMQ A;  2K5P A;  4KIK A;  2LVO A;  4MSM B;  4HVB A;  2IY1 B;  1WI0 A;  3MJ5 A;  2AQ1 B;  2BQQ A;  2B3A A;  2C7N B;  3ZLZ A;  2KFK A;  1NDD A;  1F2R I;  2DYM A;  1TS4 A;  2SAK A;  2AL3 A;  2A4Z A;  3K9P B;  3A9K B;  4GXB A;  2MEK A;  1Y8R C;  1IBX A;  3Q8A A;  4NAW A;  2G45 B;  4LNK A;  1TS3 A;  4ZYS A;  4IC7 B;  5BMG A;  2LRW A;  4A8X C;  1I4P A;  1HEZ E;  3MJW A;  2CKH B;  4LDT D;  3V61 A;  3ZJV A;  3LYY A;  1FEH A;  2KJH B;  1Q5W B;  3DWG C;  4RF0 A;  4EUT A;  2WXM A;  1WGY A;  3QJZ A;  3MHZ A;  4AP4 C;  1D3Z A;  1TGZ B;  2KXJ A;  4FAD A;  2LGI A;  1MVK A;  1GB4 A;  3UIP B;  2V3P A;  3PTF C;  5D7G A;  1OEY J;  3R7Q A;  2O6V B;  3VTW A;  3Q3O C;  2VRR B;  4AOF A;  1IGD A;  2IPK D;  2JWZ A;  3VVW B;  3AU5 A;  4S0R A;  5E6N A;  3AE8 B;  1KFY B;  1UD7 A;  2PEA A;  1FNV A;  2I1K A;  3M3J A;  2LGS A;  1KF6 B;  3QA8 A;  3PT2 B;  2LJI A;  4M8M A;  2HD5 B;  3DWM A;  4LNF A;  1JW9 D;  2RR9 A;  3ZKJ C;  2J52 A;  4P7I A;  4L23 A;  1SE9 A;  4MGK E;  3U4E G;  1RLF A;  2D3C A;  2KJ6 A;  3DCG A;  2GBK A;  1V1O A;  3PLU A;  1RAX A;  2N4F A;  1J7C A;  4S17 A;  3IT4 B;  3P4R B;  2UYZ B;  1R4N I;  4MDK E;  4DDI D;  2JT4 B;  2PJH A;  4KKI A;  2KAC A;  2KYW A;  1KOT A;  4MT5 A;  2QIE B;  4HDQ A;  4WWP A;  3RMK C;  1L0Y B;  2J0K A;  1SE2 A;  3VH4 B;  2MA9 B;  3Q8B A;  3WAN A;  3U7D A;  1I4X A;  2XEW A;  1VZ8 A;  3VDZ A;  3X0W A;  2KQS A;  3A4S C;  3GB1 A;  4EFO A;  4RNA A;  1EF1 A;  2PKO A;  2M8S A;  3APF A;  4TV3 A;  4RFB A;  1L5P A;  3D32 A;  4EEW A;  1BXT A;  4GMV A;  4LLG M;  1WGH A;  3PHX B;  1AN8 A;  2WXI A;  3MC0 B;  1WGK A;  3SD5 A;  3AED B;  2BS2 B;  4DDG D;  1TKY A;  1RFK A;  1C4P A;  1IUE A;  5DPS A;  2QDF A;  3DVG Y;  3R8B A;  1Q0W B;  1E6E B;  2AWT A;  1P3Q U;  1MFW A;  4C7Y A;  4EZK A;  2BWE S;  3DOW A;  3KYC D;  2K1F A;  2WXN A;  4MGZ E;  3DHI C;  2BGF A;  1AWD A;  4RMA A;  3VUW A;  3C8Y A;  2DEN B;  3NUH B;  1MHH E;  2GB1 A;  4OZB A;  4IM3 A;  1BT0 A;  4WAA A;  2JU6 X;  2BPS A;  2A5U A;  2QC8 A;  2RDG A;  4NJC A;  3AEC B;  1KLG D;  3ZNI D;  1KH0 A;  4LNO A;  2KK8 A;  3URY A;  4GDL A;  4NJ7 A;  1UH6 A;  4FLH A;  1V1P B;  3I3T B;  1K53 A;  3SEB A;  3QAR A;  2J7Q B;  2W54 A;  1WFY A;  4YTP B;  3QCA A;  1XLP A;  3AN1 A;  3M62 B;  1Q10 A;  3LXF A;  1STE A;  2VH2 A;  1IPG A;  1J19 A;  4AQ7 A;  2CJN A;  3AB5 A;  5J18 A;  4ICV A;  4IWP A;  4KIK B;  4ZDV A;  1TYG B;  2RDH A;  1TKG A;  2MH7 A;  1N61 A;  2KD0 A;  4W9E A;  2KWC A;  5H8Y E;  1XT9 B;  3FAH A;  2EMT A;  1EU4 A;  1QIL A;  2KWD A;  1C1Y B;  1EM7 A;  2NTS A;  3NVV A;  5EE1 A;  1RFA A;  2LUE A;  3DBH B;  3H9D A;  1EU3 A;  4M0W A;  5JHB A;  2W82 A;  3HM3 A;  5FR3 A;  1WM2 A;  2QMT A;  4RM9 A;  2IJ0 A;  4F1S A;  3UF8 A;  4C4V A;  4E74 A;  1F0Z A;  2KFJ A;  2MBE A;  3FKY A;  1F1H A;  2JWU A;  2ZVO A;  2KMC A;  3AV8 A;  2NS5 A;  3CSF A;  3U52 E;  1OFF A;  2TSS A;  3QIJ A;  5JHA A;  1GOZ A;  3GZN B;  1EWC A;  5G2N A;  3N1Z C;  2WX0 A;  1P1A A;  4N59 A;  1H4R A;  4W9F A;  1IP9 A;  1FMA D;  2IO3 B;  4GU2 A;  3V05 A;  3DPD A;  4CHK A;  1UF0 A;  3NZU A;  3R7R A;  3E9S A;  1UZX B;  1K51 A;  1KRH A;  1I4Q A;  2LHE A;  4USA A;  2K39 A;  1PYW D;  4FA6 A;  4JIO U;  4DXA B;  2KZR A;  1SJH D;  3HK0 A;  2QEJ C;  2WNM A;  4XWW A;  5HI1 A;  3QC8 B;  4US9 A;  2KDM A;  3OJ3 A;  3Q6B A;  4NPN A;  4OVU A;  4A9A A;  2J4X A;  4ZRQ A;  4YTN B;  3N20 C;  2DAJ A;  3MHS D;  1WXQ A;  1WX7 A;  1JCK B;  4OVV A;  5J17 A;  3L10 B;  3PZD A;  4JPS A;  3UIO B;  3BYT B;  3IT6 B;  3BIN A;  1RM6 C;  1V81 A;  1NBF C;  4A55 A;  2ZCC A;  2D3G A;  4W9I A;  1NYR A;  1XLN A;  2BBC A;  2ZEQ A;  2KTR A;  4N9F 4;  3DVG X;  2MJD A;  4GB9 A;  2IY0 B;  4AJW A;  3AE7 B;  2KLC A;  1WZ3 A;  4LDT B;  2IGG A;  4BKG A;  3RI7 C;  2DYB A;  3SDL C;  3ZIM A;  1ZXI A;  3FC4 A;  1ZKH A;  3RT3 B;  3ZNG C;  3RFZ B;  4BZA A;  5DPT A;  3PSE B;  4E3C A;  4PYU A;  4RGT A;  4PYZ A;  2UWQ A;  1E9M A;  2GLS A;  5C3J B;  1TY0 A;  1K52 A;  2JRI B;  1J7B A;  2FNJ B;  1H8C A;  2JQR B;  2KWU B;  3V3X A;  2KAJ A;  3Q8C A;  5LLI A;  5C1Z A;  2SEB D;  4P6V F;  2CU1 A;  1HQR D;  5IN7 A;  2RPQ A;  1YJI A;  2MBQ A;  3VUX A;  1FRD A;  1YN3 A;  2Y3A A;  1PGB A;  2NPT B;  4WIP A;  3ZDM C;  1SSN A;  2ZPY A;  2JZ3 B;  1F2R C;  2I2Y A;  1XQQ A;  2N1V A;  3VR8 B;  1ZGU B;  3C19 A;  3J9C A;  4DHZ B;  2IO2 B;  1XCQ L;  3H7S A;  2Z0E B;  5FKA C;  3U30 A;  1EUV B;  1QOF A;  2WXK A;  1V9J A;  4KV2 A;  4RCO A;  1Q1O A;  5IO9 A;  2BYT A;  4YXD B;  2Z8L A;  3JSV A;  4M02 A;  3AUL A;  3RN9 C;  2L05 A;  4IG7 B;  1WE7 A;  2KX0 A;  1FNW A;  1UGJ A;  2DX5 B;  3I5J C;  1C78 A;  1OGW A;  4GSW A;  4E71 A;  1TY2 A;  3UIN B;  2RD0 A;  2LUM A;  3W1Y A;  4KGS A;  3PRM B;  2KQ7 A;  4HJK A;  3L17 A;  2HJ8 A;  4HPL B;  2WDV B;  4YSY B;  2KDF B;  5G5H A;  4YSZ B;  3NZ3 A;  5AZG A;  1WSP A;  3PO0 A;  5IOI A;  2R61 A;  5D3D A;  3ABV B;  1NI3 A;  4D2K A;  2BKR B;  4WWM A;  1XEE A;  4FHJ A;  2WP9 B;  4KSK C;  4F7Z A;  3CWI A;  3ZO5 B;  1QOA A;  5HG2 A;  1LFD A;  3UQB A;  1L4D B;  2GMI C;  1QKZ A;  4BBN C;  2ZPN A;  1R7S A;  4K7S A;  1WYW B;  1D5M C;  1ZXH A;  4IOI E;  3KQ4 A;  4IDI A;  2DZM A;  2C5L C;  3GE3 C;  3VXW A;  1V86 A;  2W55 A;  1SB3 C;  1XCT L;  3APC A;  3ECI A;  3L16 A;  4HLE A;  4W9K A;  4ZRJ A;  1YMH E;  5EE3 A;  1ISN A;  3W5V B;  3RD2 A;  1FFV A;  4CO7 A;  3JW0 X;  4PS7 A;  1JWA D;  4MJS A;  4NZL B;  3AE1 B;  2L32 A;  1DOY A;  2I1J A;  1QT9 A;  2WXG A;  3VAW A;  1S1Q B;  4A3O A;  1N60 A;  5D3I B;  5CHF A;  2K22 A;  5LNK 1;  2GBR A;  2MLB A;  4GGQ A;  3MTN B;  1YOV B;  4H2A A;  4EZJ A;  4REZ A;  4HRO A;  2ON8 A;  4WWN A;  4AJY B;  2WLB A;  2EKE C;  4IKG A;  2M19 A;  3PS6 A;  1DYQ A;  4C80 A;  1KTK A;  3ALB A;  1WXA A;  1K8R B;  2ASQ A;  2V1Y A;  2O2V B;  1SGH A;  4GOC A;  1FPY A;  4G0N B;  3L54 A;  2ZJD A;  4F8C B;  3SU8 X;  1IGC A;  1XD3 B;  3P2B A;  3RNA C;  3R66 C;  3W1S A;  5BYR A;  3TEZ A;  4BVU C;  1FXI A;  4HPP A;  1D6E C;  3OG5 A;  2JZZ A;  3CST A;  4II3 B;  1YD8 U;  2CS4 A;  4Q2J A;  4MM3 A;  1B1Z A;  1JQ4 A;  4TMA B;  1ZDX A;  4DXF A;  1FO4 A;  4B95 A;  2BB5 A;  2WXJ A;  3DHG C;  3I63 C;  2M1M A;  5TSS A;  4DHJ B;  1TTN A;  4DQO C;  1ET9 A;  2KJR A;  2EEL A;  1WXS A;  4FHK A;  4KDL B;  2N9L A;  4HWI B;  5FR6 A;  2JXX A;  2BS3 B;  1I7H A;  1E7U A;  1ZDV A;  2AL6 A;  3NJT A;  3PVL A;  3ONS A;  1QLB B;  2KTF A;  1T0R C;  2C60 A;  3N3K B;  1ENF A;  4AUQ C;  2FCN A;  2KN4 A;  1SE3 A;  2Y5C A;  1SIF A;  4W9H A;  2FCM A;  1V8C A;  4MGI E;  2OJR A;  3PRZ A;  1HZ5 A;  2HE7 A;  1TS2 A;  2DAF A;  3IFW B;  3R3M A;  2K25 A;  2LGX A;  4WQM A;  2WXL A;  4ITK A;  4ANV A;  2ZZP B;  1N62 A;  3A1Q A;  2QSD A;  1FRR A;  2MP2 B;  2H89 B;  4NNJ B;  5D2M B;  4UDU C;  4DXG A;  1ZW7 A;  2M0A A;  2FCS A;  1WJN A;  3LJ3 A;  3IG3 A;  1GB1 A;  4NQK E;  1ZP0 B;  2JF5 A;  2XN9 C;  4HJG E;  2D5G A;  2MJ3 A;  3WCQ A;  1VZ6 A;  4M01 A;  1YQ3 B;  1MHX A;  1V97 A;  2WXR A;  1HE8 A; 
#chains in the Genus database with same CATH homology
 3H8H A;  3AV8 A;  3U52 E;  3R2T A;  1OFF A;  2G1E A;  1ET6 A;  2TSS A;  4R3D A;  5BMH A;  3ZJT A;  1C9F A;  1VR9 A;  1GOZ A;  3TEY A;  1C4C A;  1EWC A;  3NRZ A;  3AE5 B;  4GDK B;  4KX6 B;  3GP7 A;  1AYF A;  4N59 A;  3IAM 1;  1UUP A;  2EKI A;  2JX5 A;  3NVZ A;  5AUI A;  1FMA D;  3AEB B;  5T8I A;  4ZRP A;  3P63 A;  1FXA A;  1L6V A;  2LEK A;  3V05 A;  3B2G A;  3E9S A;  1K51 A;  1ZE3 D;  3Q69 A;  1KRH A;  1I4Q A;  2Q5W D;  2LHE A;  3O13 A;  2E3T A;  2WQY B;  4USA A;  1XF5 L;  3AM9 A;  4CQN A;  1CK1 A;  1HA5 A;  1PYW D;  1SJH D;  2QEJ C;  2VZK B;  1PGA A;  2WNM A;  5BYQ A;  1JWM D;  1FCL A;  1EWY C;  1XLO A;  3BK2 A;  4XWW A;  3VQI A;  4L1B A;  2PVO D;  4P16 A;  3P4P B;  5HI1 A;  4O1N A;  2WXO A;  4US9 A;  2KDM A;  1C4A A;  1CQV A;  4WAF A;  2PLP A;  4A9A A;  2J4X A;  4ZRQ A;  4YTN B;  1T3Q A;  1TS5 A;  2IDY A;  1N5W A;  1ZPS A;  2PW9 A;  1WXQ A;  1WYG A;  2RMM A;  2HTM E;  4LK0 M;  2ONQ A;  1JCK B;  2J53 A;  3NS1 A;  3FIL B;  4HRS A;  2BTE A;  4JPS A;  1JAL A;  2AQ2 B;  1SEB D;  3BYT B;  3IT6 B;  1RM6 C;  3W9C B;  1ROE A;  1L0V B;  3Q8F A;  4A55 A;  4KKJ A;  3UI3 A;  1NEK B;  1NEN B;  3AE3 B;  1NYR A;  1XLN A;  2BBC A;  1QOG A;  1FM0 D;  1A70 A;  4JWS C;  1Y56 A;  2MJD A;  1QOB A;  2N7J A;  1TZO A;  2WXH A;  3AE7 B;  1KLU D;  1P7E A;  1I4G A;  4LTU A;  2IGG A;  2CU3 A;  3GS2 A;  4RGO S;  4JX1 C;  2AX5 A;  3AE9 B;  1GAQ B;  1ZXI A;  3FC4 A;  4MAC A;  1K50 A;  4OVZ A;  2YEP B;  1FD6 A;  4XDC A;  1WRI A;  3RFZ B;  1L0X B;  3W5U B;  4RGM A;  5FK9 C;  3ZQ4 A;  1E0Z A;  3AE6 B;  3VR9 B;  2INN E;  3R2I A;  1IBX B;  4HEA 1;  2JSV X;  4NAW B;  3LB8 C;  5JXV A;  2RPV A;  4US8 A;  4RGT A;  2WXF A;  1P7F A;  1QF6 A;  2HDE A;  2OED A;  2W3R A;  2BB6 A;  3MP9 A;  1ACC A;  1E9M A;  2J42 A;  5C3J B;  4ZHP A;  1TY0 A;  3PZ8 A;  1K52 A;  1J7B A;  3FIL A;  3E56 A;  2WU2 B;  3TSS A;  2WDQ B;  2INP E;  1TJE A;  1BUI C;  2VZK D;  4AS1 A;  4WUR A;  1FCC C;  2K9X A;  1XO3 A;  1UWX A;  4N58 A;  4WH4 A;  2JQR B;  3SR6 A;  2ACZ B;  1XXG A;  2B76 B;  2QJL A;  3EA6 A;  3V3X A;  3W2D A;  2KAJ A;  3Q8C A;  4YSX B;  2SEB D;  4ZOH C;  4P6V F;  2NMQ A;  1HQR D;  5I4D A;  2K5P A;  1HXY D;  1YJI A;  2N0S B;  4TQ0 A;  4B0E A;  3CIR B;  1FRD A;  1YN3 A;  3KWL A;  2QIL A;  3MJ5 A;  2AQ1 B;  2Y3A A;  3SFE B;  4GLS C;  1I4H A;  1PGB A;  2DWQ A;  2KMM A;  1MHX A;  4WIP A;  4XE0 A;  1SSN A;  4TSS A;  4FXC A;  1F2R C;  2H88 B;  2I2Y A;  2GI9 A;  2X38 A;  3VR8 B;  1AW7 A;  2K3U A;  2YEP F;  5BYS A;  1F2R I;  2DYM A;  3J9C A;  1TS4 A;  1XCQ L;  2SAK A;  2MEK A;  5FKA C;  1BML C;  1IBX A;  3Q8A A;  3BVM A;  1YN4 A;  3EUB 2;  1QOF A;  1TS3 A;  2G9H D;  4ZYS A;  2WXK A;  3EGR A;  5BMG A;  4RCO A;  4A8X C;  1I4P A;  1VLB A;  1HEZ E;  2BYT A;  4YXD B;  1YJJ A;  3ZJV A;  2Z8L A;  3LYY A;  1D4B A;  5HHD G;  2ZW0 A;  1FEH A;  1C76 A;  2BW2 A;  1M4V A;  3DWG C;  4NAM A;  4RF0 A;  1FNW A;  2WXM A;  3OWE B;  3MHZ A;  4HKZ E;  2DBY A;  1UGJ A;  3TEW A;  1C78 A;  1C79 A;  2LMC A;  1TY2 A;  3BZD B;  2LGI A;  1MVK A;  2PTL A;  4J3O D;  1GB4 A;  2LUM A;  4KGS A;  2V3P A;  1SJE D;  4XWT A;  1ZOY B;  1FIQ A;  3IXS A;  5D7G A;  2AQ3 B;  1UWM A;  3HRD D;  2WDV B;  4YSY B;  5G5H A;  2N9K A;  3I9V 1;  2WU5 B;  1IGD A;  4YSZ B;  2IGD A;  2IPK D;  2KQ4 X;  3NZ3 A;  1PGX A;  1WSP A;  3PO0 A;  1FNU A;  1PFD A;  3AE8 B;  1L6U A;  4N6E B;  2R61 A;  3Q8E A;  4XDD A;  3VRA B;  5D3D A;  3ABV B;  3KWV A;  1KFY B;  1NI3 A;  3AEE B;  1N5X A;  1MI0 A;  1FNV A;  2JXT A;  4D2K A;  4C7Z A;  3VRB B;  4WWM A;  1JWU D;  1KF6 B;  1XEE A;  3NVW A;  2WP9 B;  2LJI A;  3CWI A;  5BMI A;  3PZ7 A;  4ARC A;  1QOA A;  3HVD A;  3DWM A;  1JW9 D;  5HG2 A;  1B9R A;  2XNA C;  3T3O A;  1L4D B;  2J52 A;  2LFI A;  1QKZ A;  1D5X C;  1UNS A;  4L23 A;  3U4E G;  1R7S A;  1FFU A;  1D5Z C;  2PVG C;  1D5M C;  1ZXH A;  4IOI E;  1CZP A;  3HVZ A;  1V1O A;  3ETR A;  3KQ4 A;  4IDI A;  3ZYY X;  2GRI A;  1PUT A;  1YQ4 B;  1ZUD 2;  1J7C A;  2W55 A;  1SB3 C;  1XCT L;  1YNT E;  3IT4 B;  3P4R B;  5HFY A;  4A90 A;  3AMZ A;  3BWU D;  3AH7 A;  4ARI A;  1YMH E;  3N9Y C;  2V3N A;  5EE3 A;  4C56 C;  1NYQ A;  3W5V B;  4KKI A;  1FFV A;  2KAC A;  4MT5 A;  2QIE B;  5E6J A;  1JWA D;  2WXQ A;  1JRP A;  1L0Y B;  4NZL B;  3AE1 B;  2L32 A;  1DOY A;  1SE2 A;  2DLB A;  1QT9 A;  2WXG A;  4YT0 B;  3BK1 A;  3Q8B A;  4ZHO A;  1N60 A;  5D3I B;  1I4R A;  1I4X A;  2K22 A;  1VZ8 A;  3P42 A;  5LNK 1;  1QQR A;  5EE0 A;  1PDX A;  3BVZ A;  3GB1 A;  4RNA A;  4OZA A;  2PKO A;  1NVI D;  4H2A A;  4MM3 B;  4RF1 A;  4A6Q A;  4RFB A;  1MPE A;  1L5P A;  4KGR A;  4GDL B;  4JE3 B;  4OHJ A;  1BXT A;  4REZ A;  4HRO A;  1DOI A;  3P4S B;  2ON8 A;  2L52 A;  4LLG M;  4MH8 A;  2WLB A;  4IKG A;  2WXP A;  1L4Z B;  3KLS X;  3P4Q B;  2M19 A;  1AN8 A;  2WXI A;  2M56 B;  3MC0 B;  1DYQ A;  1N63 A;  1WGK A;  5H92 C;  1T5X D;  3AED B;  2BS2 B;  4C80 A;  1KTK A;  1TKY A;  1RFK A;  1C4P A;  1IUE A;  2PIA A;  1TKE A;  2LHD A;  1SF0 A;  2V4I B;  2JZP A;  4B0M A;  3R8B A;  3IAS 1;  2FUG 1;  1E6E B;  4C7Y A;  2MJE A;  3B2F A;  3P1M A;  5C2T B;  3RPF C;  3MFG A;  2WXN A;  2PMV A;  4KGT A;  1AWD A;  2JYT A;  3ZGZ A;  1IGC A;  3AE2 B;  1LO5 D;  3C8Y A;  3NUH B;  1MHH E;  2V0G A;  2GB1 A;  3W1S A;  5BYR A;  3TEZ A;  4OZB A;  3B9J A;  1FXI A;  1D6E C;  2JU6 X;  2I38 A;  1VZ7 A;  3ZJU A;  2RDG A;  5MPO A;  3TUO A;  4NJC A;  4Q2J A;  4YWG G;  3AEC B;  1KLG D;  5GXG B;  3NVY A;  1KH0 A;  1B1Z A;  5AUK A;  5G5G A;  2L83 A;  2NTT A;  1JQ4 A;  4TMA B;  1ZDX A;  3URY A;  4DXF A;  4YTM B;  1FO4 A;  2BB5 A;  2WXJ A;  3AEA B;  5TSS A;  2ICI A;  2K0P A;  1V1P B;  4DQO C;  1ET9 A;  1OQQ A;  1K53 A;  2FBW B;  3SEB A;  2EEL A;  2W54 A;  1F77 A;  1C77 A;  1RYJ A;  1DGJ A;  4YTP B;  2N9L A;  1XLP A;  2WDR B;  3AN1 A;  3BYY B;  1Q10 A;  3LXF A;  4PT5 A;  1STE A;  1E10 A;  2Y5P A;  2BS3 B;  1I7H A;  1SE4 A;  1VRA B;  1ZDV A;  4HKQ A;  3U7Z A;  1J7A A;  5EE9 A;  2FE8 A;  4AQ7 A;  1QLB B;  2CJN A;  3T3N A;  3AB5 A;  1JRO A;  2JYE A;  2WS3 B;  3TEX A;  1ENF A;  2BT6 A;  1SBB B;  2KN4 A;  4OZC A;  1SE3 A;  1SXT A;  1TYG B;  1VJK A;  2Y5C A;  2RDH A;  1TKG A;  4L2Y A;  2ZW1 A;  3AEF B;  2MH7 A;  1N61 A;  3SFD B;  1V8C A;  3U2S C;  4OW0 A;  4JWU C;  1HZ5 A;  1TS2 A;  3BII D;  1SIJ A;  1VDV A;  5H8Y E;  4EE2 A;  1HZ6 A;  3FAH A;  1DOX A;  2IGH A;  4WQM A;  2W3S A;  1EU4 A;  2WXL A;  1QIL A;  2DYO A;  2KWD A;  3HUI A;  4ITK A;  1EM7 A;  2NTS A;  4RH6 A;  1N62 A;  3NVV A;  1OQR A;  2QSD A;  3L4P A;  2L1A A;  1FRR A;  5EE1 A;  2E6X A;  2H89 B;  1E7P B;  1EU3 A;  4M0W A;  4UDU C;  2W82 A;  4DXG A;  3I57 A;  1JWS D;  3AE4 B;  3BVG A;  2M0A A;  1V1P A;  3AEG B;  5FR3 A;  1WWT A;  1GPX A;  2QMT A;  2OHF A;  1GB1 A;  2CJO A;  1ZP0 B;  2BS4 B;  2IJ0 A;  1T6B X;  2XN9 C;  4HJG E;  2D5G A;  2MJ3 A;  3WCQ A;  1JWB D;  1YN5 A;  1VZ6 A;  1CJE A;  1ESF A;  1F0Z A;  1XLQ A;  1YQ3 B;  4RGN A;  2JWU A;  1RWS A;  1V97 A;  2WXR A;  1JML A;  4TQ1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...