2AL3A

Solution structure and backbone dynamics of an n-terminal ubiquitin-like domain in the glut4-tethering protein, tug
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
76
structure length
76
Chain Sequence
SAVSVLAPNGRRHTVKVTPSTVLLQVLEDTCRRQDFNPSEYDLKFQRTVLDLSLQWRFANLPNNAKLEMVPVSRSR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Endocytosis/exocytosis
molecule keywords TUG long isoform
publication title Solution structure and backbone dynamics of an N-terminal ubiquitin-like domain in the GLUT4-regulating protein, TUG.
pubmed doi rcsb
source organism Mus musculus
total genus 16
structure length 76
sequence length 76
ec nomenclature
pdb deposition date 2005-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11470 TUG-UBL1 TUG ubiquitin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2al3A00
2O6VA 2N9EB 3NS8A 5D94A 4MH0E 3VUYA 4E3CA 3DQVA 1WJNA 3QC8B 2K8HA 3KYCD 1WMHB 3PHXB 4NNJB 3SDLC 1TZ1A 2K6DB 4DHJD 2ZVOA 1X1MA 3NOBA 1WJ4A 2LVPA 2MP2A 4TUUA 4ANUA 2LASA 4IM3A 3L08A 2ZNVC 4A3OA 4B95A 3A33B 2MSED 4EKUA 1OGWA 2KWVB 3ALBA 3L16A 4WAAA 4XZ4A 3U30A 3ZRCA 1WXVA 2D11A 3CSTA 3AI5A 2PE9A 2LJ5A 4GU2A 2B3AA 4W9FA 1E7VA 2IYDB 1UH6A 2KJRA 3QX1A 4FULA 4K7SA 5AZFA 3S2AA 2DHZA 2KMAA 1NDDA 3PTFC 3CSFA 4DDID 3UQAA 1WX9A 3RYTA 5C1ZA 2MBBB 3HM6X 4BKSA 3JYUA 5DPWA 2REXA 3UQBA 4BBNC 2MBQA 3BINA 1P98A 4GDKB 3OLMD 4JLCA 1P9DU 3ENEA 2JRIB 3DCGA 2KLCA 2KKCA 3PLUA 4AWJA 2C60A 1WY8A 2BGFA 4AJYB 1RLFA 2VRRB 2ZCBA 4ASWC 4DHZB 2NBWB 4TKNA 5DPSA 1E8XA 2C9WB 4WWPA 1OTRB 2LRUA 2I1KA 2JVCA 2NVUI 2PPHA 3IVFA 2KDFB 2NS5A 3PVLA 4KSLC 4MJSB 1R4NI 1YIWA 2DZIA 3VH4B 5AEKB 1NBFC 4TV3A 4FJVB 1WRDB 2N1WA 4URKA 1WH3A 4W9CA 3TMPB 1E8WA 4KVGB 2Z0DB 1YX6B 5J2RA 4A3PA 4LDTD 3TCAA 4MDKE 3PT2B 4HCPB 3L17A 1Y8RC 4GB9A 5LXHA 2BYEA 2BYFA 4MEMA 2IBIB 2XK5A 4EZLA 2KTRB 2GBNA 3SU8X 1UBQA 2L8JA 2EMTA 3RZFA 5JZEB 1H8CA 2DZKA 3QQ8B 1RFAA 4FJYA 1J8CA 4ZRKA 3ZIMA 3PSEB 4MGZE 4FLHA 5L83A 1GUAB 2DZMA 1WGYA 2FUHB 2ZPYA 4ANXA 4KZCA 2FIFA 3V60A 3O65B 2KHWB 2RR9A 5KHOA 1D3ZA 4NJ6A 4NAWA 5LLIA 2MA9B 2ZZPB 4A20A 3OJ3A 4DWFA 3KW5B 4F1SA 1WJ6A 1S3SG 3H7PB 3AU5A 3TIXA 4K7WA 2C7NB 2ASQA 3R7QA 4TQ0A 2W9NA 2MW5A 2MBHA 1H4RA 2WDTB 1LM8B 1Q0WB 2KO3A 4CYEA 3WA0A 2L05A 3ZNZB 4DHJB 3HIZA 5IAAC 4ANVA 3DVGY 2KOXA 3VTUA 4HXDA 5D2MB 4NAWB 2FCNA 2MRPA 2G3QB 1TGZB 4W9KA 2LVOA 4PS3A 1EUVB 2NPTA 3KYDD 4M0WB 3KUCB 4W9IA 5D6JB 3RD2A 1Q5WB 3ZDTA 3ML8A 2KFKA 3M63B 4I6NB 2JY6A 2BWES 1P0RA 2KQ7A 2L7RA 2L0TA 3B08A 2KDBA 5C23A 1S1QB 3PHWB 3WAOA 4HDOA 4WQOB 2XBBC 3I3TB 2JZZA 2WX1A 3Q3FA 2N9XA 4FN2A 2CHWA 1NI2A 4ICVA 4IG7B 1GC7A 3RCZA 4W9DA 4PYZA 3WAPA 4MGIE 3JSVA 2JXXA 2MCNB 4HK2A 4WWNA 2ZNVB 1YD8U 1EF5A 3VUWA 2JUOA 3L0WB 4X57B 2KFKB 3KUZA 2FAZA 3ZKJC 1LQBA 2LGDA 3PLVA 5G55A 1RAXA 4BOZB 2O2VB 1V5OA 2CKHB 2KX0A 4GXBA 4KZ0A 3APDA 2L76A 1WIAA 1SIFA 2LD9A 3WANA 3VQIA 3DPDA 3JSVB 2BF8B 1HE8A 3ZVVA 4HVBA 3N32A 2KDEB 3U7DA 3H7SA 2BWFA 5L95C 2O6VB 4BOSC 4BVUC 3H9DA 3VXWA 4NPNA 4P7IA 2GBKA 3UIOB 3SHQA 5J17A 1IYFA 2J0KA 3X0WA 3ZLZA 3QIJA 4FJZA 4KSKC 1E7UA 2MWSB 3M3JA 3VTWA 2J0MA 4WJOA 2LGYA 1FXTB 4JL9A 5J18A 1PQSA 4FHJA 2MP2B 1LXDA 2Z0EB 3ZTCA 1E5WA 2ZPNA 3APFA 3LJ3A 3PRZA 3DBHI 1OEYA 1A5RA 2BKFA 3WALA 3N3KB 1IP9A 1XT9B 4I6LB 3W1SC 4K7UA 2RGFA 4HPLB 1UGMA 2DENB 2J0JA 4HWIB 5CHWA 3K9OB 3PV1A 3HHMA 5CX3A 4G0NB 2FCQA 5E6OA 2XEWA 2AYOB 4WJPA 2EKEC 4B9KA 1ISNA 3V62A 3H1UA 1CMXB 4KDLB 1WFYA 3QWZB 4GN1A 4MSMB 3D32A 4IM0A 2C5LC 2RPQA 3PPAA 2PJHA 2KJ6A 1YQBA 3RT3B 3QCAA 2KC1A 1ZKHA 1Q1OA 1BT0A 3PGEA 4FA6A 3L54A 3NY5A 3SD5A 2C7HA 2PE6B 3NZUA 4IWQA 3V61A 3TBLD 1WX8A 2RD0A 3VDZA 3PZDA 4II2B 3A1QA 2JF5A 4JQWC 4ZRJA 2N9PC 1VD2A 4LJOB 1IPGA 2AEHA 3R3MA 4GMVA 1QZEA 2LXAA 3PRMB 4RM8A 3IHPC 4W9LA 1E8ZA 1SE9A 2D2QA 2FCMA 2N7DA 2FCSA 1SGHA 1WGRA 2HD5B 1V2YA 2V4LA 3QAQA 2M17A 3V6CB 2M1MA 2KVRA 4JGHB 1Z5SB 5E6PA 1KLVA 5CHFA 2DZJA 2KWUB 4KIKA 4DDGD 2KC2A 2XK5B 3IG3A 3VAWA 1WJUA 2YVCA 4K81A 4EZKA 3U8ZA 1C1YB 1WI0A 1I35A 4JIOU 4GGQA 1P3QU 4EZJA 4MM3A 1XD3B 2M0XA 2G4DB 3PRPB 2HE7A 2MQJA 2DAFA 2K8BA 2KFJA 4MSQB 3P2BA 3N30A 1YX5B 2CR5A 2R2OA 3NZSA 3DDCB 4G3XB 4IWPA 2IY0B 3AU4A 2DYBA 3ZUNA 1WZ0A 4LCDE 3APCA 4E71A 3RUIB 4AUQC 4HJKA 2WX0A 2GBMA 4AOFA 2KTFA 4EOYA 2KLGA 2D3GA 3M95A 2MBEA 2N4FA 2GBRA 4BBNF 4EUTA 2CS4A 4HPMB 1WM3A 2D07B 1JRUA 3X23A 1GG3A 4W9GA 2IO1B 2K1FA 2Z59B 1ZGUB 2AL6A 2YLMA 1LFDA 2L00B 3T9LA 1UBIA 1V9JA 3VH3B 2GBJA 2NBUA 1V80A 2NPTB 3A9KA 2C7MB 4W9EA 5HKHA 3QHTA 4MGYE 3TL5A 2BKRB 3MTNB 3ML9A 3UGBB 1XQQA 3K9PB 4G11A 2KJHB 2CHZA 4IC7B 3W1SA 4GSWA 1WGGA 4BKGA 3L13A 3KH0A 3ZDMC 3RZWC 4FADA 1TBEA 2DAJA 3JW0X 3OAWA 2KN5A 4NY0A 4NQLB 3DOWA 4GOCA 5D7GA 4HDQA 1WGDA 4XC2A 2ZEQA 3CMMB 2NR2A 2G45B 1EO6A 2LUEA 2WWZA 1C3TA 2LGXA 4IW0A 3TJPA 3PREA 3W1YA 2M4NA 2KDIA 2LRWA 2JPHA 2IO0B 5CHVC 4ZYNA 1RRBA 4MGKE 1WXAA 5E6NA 1T0YA 2BYVE 1UD7A 2JT4B 5G2NA 3A9JA 2LI5A 2K25A 3R66C 1K8RB 1WE7A 2KQSA 4LDTB 2MLBA 4E74A 1YJ1A 4GDLA 2V1YA 4ZDVA 2G4SA 4CHKA 2IY1B 4FBJB 4IM2A 2CHXA 4M8NA 5KHQA 5CTRC 1WXSA 4F7ZA 1U4AA 3NHEB 1I42A 2UWQA 4NQKE 3M62B 3ONSA 3VUXA 3A9JB 1F9JA 1WR1A 4MELA 2L0FA 5IA7A 4DXAB 3JVZX 4J6IA 3CF6E 2KX3A 4GDLB 4GDKA 1GJZA 2OJRA 3T8MA 2KNBA 1KM7A 4IUMB 2KANA 2KWCA 4F8CB 4WJQA 3ZNGC 5FR6A 4BKTA 4PS7A 1OEYJ 1UELA 1L7YA 1WF9A 1WYWB 2KZRA 2V3SA 2OOBB 3MJWA 4ICUA 3MHSD 2IZVB 2FNJB 3R7RA 2MX2A 3WIMA 4DBGA 1WR6E 3QK0A 1MG8A 2AL3A 4MJSA 4OVUA 4ZRIA 3HM3A 1V86A 3ZNID 5JH5C 1R4MI 3LDZE 5LXIB 1L2NA 3EFUA 1G6JA 3GOEA 4K1RB 5TR5A 2JRHA 3AXCA 4PYUA 3VVWB 1J19A 3DVNV 1WXMA 4II3B 4WWOA 2LZ6A 3VFKA 2LXCA 2KXJA 3C0RB 3IBEA 3UIPB 1P1AA 3A4RA 4KDIC 5AZHA 3WAMA 2KTRA 5JHBA 4M8MA 2Y5BB 4FHKA 5GMVA 3DBRI 2R2QA 4RMAA 1GNUA 3ZO5B 2O6VD 2PEAA 3ECIA 2WYQA 1WZ3A 3EECA 4KV2A 3A1QB 1E8YA 2EMSA 2KK8A 3GZNI 5DPTA 4GIVA 3BY4B 1WGHA 4IWOA 3ZNHB 2KD0A 5DPRA 1V49A 2K8CA 3UINB 2GMIC 2GOWA 1OQYA 4XX5A 1Z2MA 4AJWA 2ZCCA 3QARA 2JZ3B 1UZXB 1WE6A 2AWTA 2M8SA 1ZW7A 3EHVA 3QJZA 1M94A 3EC8A 3H7PA 4KIKB 2BPSA 3DBLI 3ZW3A 2IO3B 1WX7A 2L3ZA 3PS6A 3DBSA 4N9F4 2ZVNA 2RSUA 1V6EA 4YL8A 2LWPA 3RULA 2CU1A 3H6NA 4NJ7A 2K39A 4I6PA 4PS8A 1AARA 3ZTDA 2IO2B 2D10A 3QA8A 4AP4C 1WM2A 5JHAA 1EF1A 1TTNA 2NCNA 4BKSD 3A4SC 3B0AA 4HCNB 4TQ1A 4EFOA 2QHOA 5EDSA 5DCNA 2I1JA 4DK5A 3B1LX 3V6EB 4BFRA 1V81A 2MBOA 4B6WA 2A4ZA 2J7QB 1E90A 2K6QA 2DYMA 3ZRFA 3KUDB 3DVGX 2N7EA 3L10B 3KVFB 1J0GA 3OJ4B 2NBVB 4CO7A 3DVNU 4RM9A 4OVVA 4W9HA 2HJ8A 2ZJDA 4ANWA 1V5TA 2KMCA 4EEWA 1VCBA 4G50A 4WJNA 2DX5B 2O2VA 3IFWB 2UYZB 3UF8A 1WMHA 3AULA 3VHTC 4LJPB 5BO4B 4DHZE 1GC6A 3A9KB 3Q3JA 2A5UA 2HTHA 2JWZA 5AZGA 1KOTA 2FIDA 1KJTA 4W9JA 4HLEA 2LVQA 3HK0A 2DYOA 2N1VA 3VTVA
chains in the Genus database with same CATH superfamily
1OQRA 1SE4A 3KYCD 3SDLC 1TZ1A 2K6DB 2J53A 1X1MA 5AUIA 1VR9A 3NOBA 2LVPA 2LASA 4IM3A 2WDQB 3ZXVA 1TKEA 2MSED 1OGWA 3AEFB 2D11A 4KX6B 3CSTA 3NVZA 3AI5A 2PE9A 4GU2A 4HROA 2B3AA 1QILA 1D5XC 4ARIA 3TEXA 2DHZA 1NDDA 4DDID 2WXOA 2JWUA 2W3RA 1DOIA 4WIPA 3UQAA 3AM9A 3UQBA 3OLMD 4JLCA 3ENEA 1GB4A 1TKGA 2QDFA 2C60A 1RLFA 2ZCBA 2DLBA 2CJOA 2K9XA 1J7BA 1E8XA 3VR9B 2GI9A 1JWBD 2NS5A 2K3UA 4XGAB 3VH4B 5AEKB 1NBFC 3DWGC 1YN5A 3Q2AC 1YX6B 3PT2B 3LB8C 1SXTA 4HCPB 1Y8RC 4GB9A 4EZLA 4D2KA 1YOVB 1KLGD 3QQ8B 1QQRA 4ZRKA 3ZIMA 1TYGB 4YSXB 4O1NA 2ZPYA 2FIFA 2XN9C 1XLOA 2JSVX 3O65B 2RR9A 2RMMA 2ZZPB 2INCC 4WH4A 4DWFA 1C4CA 2IPKD 4F1SA 3AU5A 3R7QA 4N59A 1CJEA 4CYEA 3HIZA 5IAAC 4NJCA 2G3QB 5G5GA 3MP9A 4WURA 3KYDD 1Q5WB 3ZDTA 2KFKA 2WHIA 1P0RA 4K3BA 3B08A 3PHWB 4N6EB 2XBBC 1YQ3B 4S17A 3ZJUA 2MJDA 3GB1A 4FN2A 5FR3A 1NI2A 4MGIE 4XWWA 4WWNA 1EF5A 2ACZB 3EGRA 3VUWA 4X57B 4ITKA 1K50A 5G55A 2WU5B 4BAXA 2BS4B 2KX0A 4GXBA 4KZ0A 3APDA 3TSSA 2LD9A 3VQIA 3DPDA 2BF8B 2DNFA 3I5JC 3W5VB 2BTEA 3AE4B 1PFDA 4YSYB 1XLQA 2GBKA 4HEA1 1I4PA 2J0KA 1ZUD2 4KSKC 1E7UA 2MWSB 2LJIA 1PQSA 4KGTA 2MP2B 3DBHI 5HHDG 1KLUD 1B9RA 3W1SC 2VH2A 1FNVA 4HWIB 4G0NB 2FCQA 2XEWA 2VZKD 1ISNA 1BMLC 3H1UA 4KDLB 4GN1A 2C5LC 2PJHA 3RT3B 2KC1A 1ZKHA 2WXNA 1BT0A 1TS4A 3L54A 1RWSA 2CJNA 2C7HA 1J7CA 1V8CA 2PE6B 1UF0A 3L4PA 1WX8A 2RD0A 4USAA 1VD2A 3AEAB 3NJTA 4REZA 3H8HA 3IHPC 1E8ZA 1SE9A 2FCSA 1SGHA 1WGRA 1V2YA 2KVRA 5CHFA 2DZJA 4KIKA 2XK5B 1WJUA 2YVCA 1EWCA 3DHGC 4GGQA 2VH1A 1YN3A 4EZJA 2KYWA 4MM3A 2BBCA 2HE7A 3Q69A 3HVZA 3NUHB 3N30A 2R2OA 5HFYA 1QF6A 3APCA 5G5HA 4YTNB 3E56A 3RUIB 2KTFA 5I4DA 4RCOA 2L1AA 1QOGA 1C9FA 1IBXB 3CIRB 2GBRA 2OJWA 1UWMA 2CS4A 3AN1A 3P4RB 3X23A 3HVDA 1GG3A 2YLMA 1LFDA 1F0ZA 3R2TA 1IGDA 3VH3B 4HKQA 1EM7A 3QHTA 2BKRB 3MTNB 3ML9A 3AE6B 4IC7B 4GSWA 3ZDMC 4GLSC 1SB3C 2R61A 2VZKB 3Q6BA 4NY0A 3RN9C 4GOCA 1WGDA 2JYTA 4XC2A 3SFDB 1QOBA 3ZJVA 2JPHA 3U4EG 4ZYNA 5E6NA 2LI5A 3R66C 3BVGA 1WE7A 4LDTB 4E74A 2G4SA 1YNTE 1FCCC 1R7SA 3OG5A 1U4AA 3AMZA 1KTKA 2KACA 3ONSA 1QKZA 1CZPA 1AYFA 1CK1A 1SJED 2DBYA 4IUMB 2KANA 4BKTA 1MPEA 1FD6A 1L7YA 1WYWB 2OOBB 2AQ2B 3MHSD 2IZVB 1MG8A 4OVUA 2PMVA 5JH5C 4LNKA 3RMKC 1G6JA 3AXCA 4PYUA 1J19A 3OWEB 4WWOA 3VFKA 5AZHA 4M8MA 4EE2A 3DBRI 3AEBB 4RMAA 2WNMA 3A1QB 2EMSA 3GZNI 2IGGA 4A6QA 4GIVA 3U52E 4IWOA 1V49A 2GOWA 1DGJA 3FILA 2EKIA 4KGSA 4AJWA 1UZXB 2AQ3B 1ENFA 3QJZA 2EELA 3EC8A 1ZPSA 3AE1B 5EE0A 1L0VB 1GOZA 1ZP0B 2BPSA 3DBLI 4B0EA 4AQ7A 2OEDA 2RSUA 3RULA 3DBLB 3ZTDA 2K39A 4I6PA 4JWUC 2W54A 1L6UA 2ZW1A 1MVKA 4H2AA 4A9AA 3V6EB 2J7QB 1KF6B 1FXAA 2PTLA 2N7EA 3Q8EA 4RF1A 1Y56A 2HJ8A 1FNUA 2HJ1A 2JX5A 3KWVA 4G50A 4WJNA 3RPFC 3V3XA 2UYZB 3VHTC 4LJPB 5EE3A 5BO4B 1GC6A 2HTHA 1KOTA 1E7PB 1KJTA 4W9JA 2K0PA 2GB1A 2KQ4X 4K3CA 1QOFA 3E9SA 1YN4A 1TY0A 1OFFA 2K8HA 1WMHB 4NNJB 4RNAA 2ZVOA 1WYGA 2MP2A 2INPE 2ZNVC 4DXGA 5BMIA 3NRZA 5BYRA 3L16A 3U30A 2KT7A 2GRIA 3GE8C 1E7VA 1UH6A 3I57A 2D3AA 3N20C 4QAYA 2Y5PA 3HM6X 3JYUA 4GDKB 1P9DU 2GLSA 1FFUA 2JRIB 1T0SC 4AWJA 2IGHA 4DHZB 2W82A 1JCKB 2NBWB 2QILA 4TKNA 5DPSA 1OTRB 3PVLA 3GE3C 4URKA 1WH3A 4LTUA 3TMPB 4KVGB 2Z0DB 5J2RA 2J52A 3MC8A 2RPVA 2J42A 3VR8B 2BYEA 2Y5CA 2IBIB 2XK5A 2KTRB 4J3OD 3RZFA 1H8CA 3VRAB 4YWGG 1RFAA 2QMTA 1J8CA 2WXGA 4FLHA 3BVMA 2FUHB 4ANXA 4KZCA 1VJKA 3MC9A 1C78A 5KHOA 5D3DA 4A20A 1A70A 1FFVA 2WGSA 3KW5B 3ETRA 2LFIA 1S3SG 3H7PB 2ASQA 4TQ0A 2MBHA 2WDTB 1LM8B 3ZNZB 4ANVA 1E0ZA 2KOXA 4HXDA 3AB5A 5D2MB 4NAWB 1M4VA 5IP4D 3RD2A 3KUCB 3M63B 4I6NB 2JY6A 2BWES 2L7RA 2L0TA 5C23A 4HDOA 4C80A 4WQOB 3I3TB 3Q3FA 1L6VA 2IJ0A 4ICVA 1GC7A 3BYYB 2JXXA 4XDDA 4HK2A 1YD8U 3KUZA 1WXQA 2FAZA 2D5GA 2LGDA 1RAXA 3P63A 2L76A 1SIFA 3ZQ4A 3JSVB 3MC0B 3N32A 3N1ZC 2O6VB 4MH8A 3UIOB 3SHQA 5EE9A 3ZGZA 3ZLZA 1XLPA 4JX1C 4JWSC 3M3JA 3VTWA 2D3BA 2LGYA 4JL9A 2G1EA 4FHJA 2Z0EB 1LXDA 3PO0A 3AV8A 1E5WA 2ZPNA 3W2DA 3LJ3A 1A5RA 4RGTA 2XNAC 1XT9B 2RGFA 4RGMA 2DENB 1FO4A 1QT9A 5E6OA 2EKEC 4NAMA 1WFYA 4MSMB 4IM0A 2RDBC 4P6VF 2W55A 4FA6A 2ICIA 4LK0M 3N1XC 2NMQA 5BMHA 4IWQA 2SAKA 3A1QA 2JF5A 3T3OA 2HTME 4LJOB 4GMVA 1QZEA 2LXAA 4RM8A 1J7AA 4W9LA 1I4QA 2D2QA 2LEKA 2HD5B 2OHFA 3QAQA 2M17A 5HG2A 2M1MA 4JGHB 2TSSA 1KLVA 1STEA 2KWUB 3KLSX 3IG3A 3O13A 3U8ZA 1C1YB 1JROA 1I35A 1P3QU 2N9LA 2MQJA 3PRPB 2DAFA 4MSQB 2RDGA 2YEPF 1FRDA 3AU4A 2DYBA 3ZUNA 1FXIA 2V4IB 2WU2B 3ZJTA 4AUQC 4HJKA 2D3GA 1T0RC 2N4FA 3RFZB 4EUTA 1WM3A 2D07B 2K1FA 2AL6A 2GBJA 2NBUA 2NPTB 2C7MB 4MACA 5HKHA 5TSSA 4MGYE 3TL5A 5IN7A 4G11A 2BW2A 3RNBC 1TBEA 2KMMA 2DAJA 3CWIA 4NQLB 3DOWA 5D7GA 4HDQA 3NVWA 1ZXHA 3CMMB 2G45B 1EO6A 2LUEA 2LGXA 3AE9B 1GAQB 3PREA 3MFGA 2WDVB 2D3CA 1UD7A 2JT4B 2X38A 3NVVA 2K25A 1K8RB 3B2FA 4HRSA 1NYRA 1FM0D 1YJ1A 4GDLA 1WXSA 2LGSA 2UWQA 4IOIE 3Q3OC 3PZ7A 2FBWB 3A9JB 3DBHB 1WR1A 5IA7A 1V1PB 3JVZX 4J6IA 1NI3A 3CF6E 4GDKA 2OJRA 3I63C 2UU7A 3T8MA 2KNBA 3RNEC 5IOIA 3Q14C 4F8CB 1FEHA 5FR6A 2WLBA 1JALA 2SEBD 4YXDB 1WF9A 3MJWA 4KGRA 3R7RA 1B1ZA 2MX2A 4DBGA 3BZDB 1I4XA 3ZNID 1DOYA 1R4MI 3LDZE 2PVOD 2N9KA 1P1AA 2KTRA 1L0YB 2KDMA 3EECA 1SBBB 3U7ZA 2KK8A 1WGHA 3ZNHB 5DPRA 2K8CA 3AEGB 3SR6A 2GMIC 1OQYA 2ZCCA 2JZ3B 1WE6A 4OZCA 2AWTA 2M8SA 1ZW7A 1T5XD 3H7PA 1GPXA 3NVYA 3UI3A 1PUTA 3B9JA 3ZW3A 3I9V1 1WX7A 2D10A 1WM2A 1TTNA 3NG0A 2NCNA 3N9YC 3A4SC 3B0AA 5DCNA 1C4AA 4BFRA 1L4DB 2WXJA 1ACCA 1RM6C 2A4ZA 2K6QA 3ZRFA 3MJ5A 3KVFB 1E9MA 4CO7A 1JQ4A 2H88B 3DVNU 4RM9A 4OZAA 4OVVA 4W9HA 2ZJDA 1V5TA 2KMCA 3BK1A 1KH0A 2LUMA 1XLNA 4LNOA 2A5UA 2N7JA 4LNFA 3RNAC 2PLPA 2N1VA 3VTVA 1SE3A 1DYQA 2O6VA 1ESFA 5D94A 4C7ZA 4E3CA 1I4RA 3DQVA 3QC8B 1AWDA 1VDVA 3PHXB 1SE2A 4DHJD 4C00A 4XWTA 1XCQL 4ANUA 4ZRQA 1E6EB 3A33B 3ALBA 4WAAA 1T6BX 4XZ4A 3ZRCA 1GB1A 2LJ5A 2PVGC 5AZFA 2KJRA 3S2AA 2KN4A 3PTFC 1ROEA 5JXVA 1PGAA 2MBBB 1XF5L 2WXFA 4RFBA 4BKSA 4C4VB 3BINA 1P98A 1NENB 3GS2A 2KKCA 4R3DA 2BGFA 2VRRB 1N63A 2LMCA 1HZ6A 2K22A 4WWPA 1JW9D 2I1KA 2JVCA 1WSPA 1YIWA 2DZIA 1KRHA 1RYJA 3IT6B 2N1WA 1AW7A 3DBRB 1E8WA 1XCTL 1C4PA 2WXKA 4ARCA 3GZNB 3L17A 1N61A 4MEMA 5HI1A 2EMTA 1JWAD 5JZEB 2WQYB 1N62A 4FJYA 4Q2JA 3PSEB 4MGZE 1ZDXA 2PKOA 2IGDA 5L83A 1GUAB 1WGYA 4WAFA 2KHWB 5LLIA 1V1OA 1N6ZA 1F2RC 1D5ZC 4M02A 2INDC 1BUIC 2I2YA 3TIXA 2C7NB 2WXLA 2MW5A 1H4RA 1Q0WB 2KO3A 4DHJB 3DVGY 3VTUA 1Q10A 1TGZB 2LVOA 1EUVB 2NPTA 4M0WB 1N60A 4W9IA 1ZDVA 2WP9B 5D6JB 2WXRA 2KQ7A 2KDBA 1S1QB 3WAOA 4TSSA 2JZZA 4P16A 2Q5WD 4IG7B 4W9DA 2BQQA 2BB6A 3WAPA 3HRDD 4FXCA 2QIEB 2ZNVB 2JUOA 3L0WB 2KFKB 3ZKJC 1LQBA 1D4BA 3LYYA 2YEPB 1V5OA 2CKHB 1WIAA 2I38A 1HE8A 4HVBA 2KDEB 3U7DA 5H8YE 3H7SA 1JWSD 4BOSC 2FE8A 3H9DA 3VXWA 4NPNA 5C3JB 1I4GA 5J17A 1PGXA 2AX5A 2QJLA 3Q8AA 3X0WA 4FJZA 2LGIA 1V1PA 3B2GA 1N5XA 2J0MA 4WJOA 3BIID 2WDRB 5J18A 3Q8FA 3ZTCA 3W9CB 2NTSA 3APFA 4WWMA 3WALA 3AEDB 3N3KB 5GXGB 3AECB 4I6LB 1XEEA 3P4QB 4HPLB 3AH7A 2MJ3A 5CHWA 3HHMA 5CX3A 2AYOB 4B9KA 1T0QC 1CMXB 2H89B 2RPQA 3PPAA 5FK9C 1YQBA 1HEZE 3QCAA 1JRPA 1YJIA 3PGEA 1TKYA 3NY5A 1TY2A 3RNCC 3SD5A 3PZDA 4II2B 4ZRJA 3R3MA 3PRMB 5E6JA 2FCMA 4B0MA 1VZ8A 1Z5SB 5E6PA 2MH7A 2KC2A 3T3NA 4PT5A 1VLBA 4EZKA 4C7YA 4N58A 5C2TB 2M0XA 4US8A 3BVZA 3FC4A 1IBXA 1L0XB 4RGNA 3P2BA 1YX5B 4G3XB 3DDCB 4IWPA 2IY0B 2ONQA 3N1YC 1EWYC 1TJEA 2WX0A 4MM3B 2MBEA 3DHIC 2L83A 4HPMB 4W9GA 2IO1B 2RDHA 2L00B 1UBIA 1V9JA 1V80A 4JPSA 4W9EA 3K9PB 2CHZA 1TZOA 2WXHA 2KVZA 4P1CC 1K53A 1IUEA 1JMLA 3P4PB 4ZHOA 1QOAA 1MJDA 2ZEQA 2WWZA 2AQ1B 4IW0A 3TJPA 1IGCA 2LRWA 2IO0B 5CHVC 1D5MC 2BYVE 5G2NA 2MEKA 2KQSA 3C19A 2WS3B 4RF0A 3AE8B 2MLBA 4ZDVA 4CHKA 1FNWA 2IY1B 4M8NA 5KHQA 2BS3B 4F7ZA 3NHEB 3EA6A 4NQKE 4DXFA 1F9JA 1HQRD 4C4VA 1FCLA 2KX3A 1GJZA 1ZE3D 4DQOC 1EU3A 4XE0A 4WJQA 3AE5B 3IAM1 4PS7A 4RGOS 2KZRA 4HPPA 2FNJB 3WIMA 3ABVB 1WR6E 3BWUD 3HM3A 2QEJC 3GOEA 4K1RB 4KKIA 5TR5A 2JRHA 1TT5B 3P1MA 1HTQA 3IXSA 4II3B 2LZ6A 2LXCA 2KXJA 3C0RB 3IBEA 3KQ4A 4KDIC 5JHBA 4ZYSA 1YJJA 1UUPA 2Y5BB 3BK2A 4FHKA 1GNUA 1ET6A 3ZO5B 1D6EC 4KV2A 3WCQA 4ACFA 2KD0A 1UWXA 3W5UB 3IT4B 4XX5A 4IKGA 5D3IB 3VRBB 3EHVA 1M94A 2QCZA 2WXQA 1LGRA 2L3ZA 4N9F4 3DBSA 2ZVNA 2LWPA 4IDIA 2CU1A 2KAJA 3FILB 3H6NA 4PS8A 1AARA 1UGJA 3V05A 5IKCM 3QA8A 4AP4C 4M0WA 5JHAA 4HCNB 4LNIA 4L1BA 4EFOA 2QHOA 5EDSA 3SEBA 3DWMA 2MBOA 2JYEA 4TMAB 4B6WA 1E90A 2DYMA 2BT6A 3KUDB 1I7HA 4M01A 2BS2B 2JXTA 4ANWA 4EEWA 2Z8LA 1MHHE 2WXPA 3TEYA 1WMHA 1MG4A 3AULA 2W3SA 3A9KB 5EE1A 5AZGA 4WQMA 1F1HA 2DYOA 1ZXIA 2ON8A 3AE7B 2JU6X 1CQVA 2N9EB 3NS8A 4MH0E 3VUYA 1WJNA 1T3QA 4OW0A 1WJ4A 1UNSA 1C79A 4TUUA 3L08A 3Q8BA 4A3OA 4B95A 2V9HA 4EKUA 2KWVB 1WXVA 2DWQA 4W9FA 2IYDB 3QX1A 4FULA 4K7SA 4BZAA 2V3NA 4UDUC 2KMAA 3CSFA 1WX9A 3RYTA 5C1ZA 2V0GA 1FIQA 3GP7A 4LLGM 3RI7C 4PK1A 5DPWA 2REXA 4BBNC 2MBQA 4MT5A 3DCGA 1AN8A 2KLCA 2L52A 3PLUA 1WY8A 1R4MB 2K5PA 4YTPB 4AJYB 4A55A 4ASWC 2LHEA 3RNGC 1HXYD 2C9WB 2LRUA 3IVFA 2PPHA 2NVUI 2KDFB 4KSLC 4MJSB 1R4NI 3TEWA 4TV3A 4FJVB 1WRDB 4YT0B 2WXIA 4W9CA 1R4NB 2B76B 4A3PA 4LDTD 3TCAA 4MDKE 5BMGA 5LXHA 2BYFA 2GBNA 3SU8X 1UBQA 2L8JA 4A90A 1VZ6A 1YMHE 2DZKA 3LXFA 4L2YA 2DZMA 1F52A 3V60A 1SJHD 1XO3A 1D3ZA 4NJ6A 1V97A 4NAWA 2LHDA 2MA9B 2JQRB 3OJ3A 1N5WA 4S0RA 1ZOYB 3C8YA 1WJ6A 1XXGA 4K7WA 3RNFC 2W9NA 3R2IA 1VRAB 2L05A 3WA0A 2FCNA 2MRPA 1NYQA 3R8BA 4W9KA 4PS3A 4ZOHC 1FRRA 3ML8A 4RH6A 1KFYB 2WX1A 3NS1A 4C56C 5T8IA 2M56B 2N9XA 2CHWA 1SSNA 1WWTA 3RCZA 2BYTA 4PYZA 1VZ7A 2MCNB 3JSVA 1BXTA 4L23A 3EFCA 3PLVA 4US9A 1F77A 1LO5D 4BOZB 2O2VB 5LNK1 3FKYA 3WANA 2QSDA 3ZVVA 1WRIA 2BWFA 5MPOA 5L95C 4BVUC 4P7IA 2M0AA 5AUKA 1IYFA 1MHXA 4YSZB 3DHHC 4M00A 3QIJA 1TS3A 2BVCA 4AS1A 2INNE 4NZLB 1FXTB 2BB5A 3PRZA 1OEYA 2BKFA 1IP9A 1DOXA 4XYCA 4OZBA 4K7UA 1UGMA 2J0JA 3K9OB 3PV1A 2X8XX 4WJPA 2QC8A 3V62A 1MFWA 3QWZB 3D32A 1SF0A 2KJ6A 3J9CA 1FPYA 1Q1OA 5BYQA 2N0SB 3P4SB 3TEZA 3ZXRA 2E6XA 3NZUA 1EU4A 3V61A 1JWUD 3TBLD 3VDZA 1F2RI 4JQWC 2N9PC 1IPGA 2AEHA 1ET9A 2N7DA 1OQQA 4A8XC 2V4LA 3U2SC 2JZPA 3V6CB 4KKJA 4DDGD 3VAWA 4K81A 1WI0A 2WXMA 4JIOU 4OHJA 1XD3B 3SFEB 2G4DB 3ZYYX 2K8BA 1NVID 2KFJA 1HA5A 4YTMB 2CR5A 3NZSA 1PYWD 1TS5A 3MHZA 1WZ0A 4LCDE 2IDYA 4JE3B 5IO9A 4E71A 2GBMA 3NZ3A 4AOFA 4EOYA 2KLGA 3M95A 4BBNF 5BYSA 2PIAA 1JRUA 2Z59B 1ZGUB 3T9LA 1C77A 3A9KA 3AEEB 3Q8CA 5H92C 3UGBB 1XQQA 1FMAD 2KJHB 3Q3NC 4HJGE 3W1SA 1WGGA 4BKGA 3L13A 3KH0A 3RZWC 4FADA 2CU3A 1YQ4B 3JW0X 3OAWA 2KN5A 4XDCA 2NR2A 1C3TA 3W1YA 2M4NA 2KDIA 1RRBA 4MGKE 1WXAA 4HKZE 1T0YA 3A9JA 3KWLA 2ZW0A 1WGKA 3BYTB 4ZRPA 1L4ZB 1HZ5A 2HDEA 2V1YA 1HTOA 2PW9A 4FBJB 4IM2A 2J4XA 2CHXA 5CTRC 1I42A 2V3PA 2KWDA 3M62B 3VUXA 4MELA 2L0FA 4DXAB 4GDLB 1KM7A 1P7EA 2KWCA 3ZNGC 2FUG1 1OEYJ 1UELA 4ICUA 2V3SA 3QK0A 4ZRIA 2AL3A 4MJSA 2Y3AA 1V86A 1P7FA 5LXIB 1L2NA 3EFUA 1RFKA 3PZ8A 3VVWB 3DVNV 1PDXA 1WXMA 2E3TA 1MI0A 3UIPB 3A4RA 3WAMA 3FAHA 5GMVA 2R2QA 2O6VD 2PEAA 3ECIA 2WYQA 1WZ3A 1E8YA 5DPTA 1L5PA 3BY4B 1QLBB 3UINB 2G9HD 1K51A 1I4HA 1SEBD 4ZHPA 1Z2MA 1SIJA 3QARA 4OVZA 4KIKB 1PGBA 2MHJA 1TS2A 2IO3B 3PS6A 3AE3B 3URYA 1V6EA 4YL8A 1NEKB 4NJ7A 1E10A 2IO2B 2NTTA 1EF1A 3AE2B 4BKSD 4TQ1A 2M19A 2MJEA 2I1JA 4DK5A 1JWMD 3B1LX 1V81A 5FKAC 3TUOA 3DVGX 3L10B 1TIFA 1J0GA 3OJ4B 2NBVB 1K52A 4CQNA 1C76A 3IAS1 1VCBA 4LNNA 2DX5B 2O2VA 3IFWB 3UF8A 4DHZE 3P42A 3Q3JA 3EUB2 3HUIA 4P1BC 2JWZA 2L32A 3Q3MC 2FIDA 4HLEA 2LVQA 3HK0A
chains in the Genus database with same CATH topology
2O6VA 2N9EB 3NS8A 5D94A 4MH0E 3VUYA 4E3CA 3DQVA 1WJNA 3QC8B 2K8HA 3KYCD 1WMHB 3PHXB 4NNJB 3SDLC 1TZ1A 2K6DB 4DHJD 2ZVOA 1X1MA 3NOBA 1WJ4A 2LVPA 2MP2A 4TUUA 4ANUA 2LASA 4IM3A 3L08A 2ZNVC 4A3OA 4B95A 3A33B 2MSED 4EKUA 1OGWA 2KWVB 3ALBA 3L16A 4WAAA 4XZ4A 3U30A 3ZRCA 1WXVA 2D11A 3CSTA 3AI5A 2PE9A 2LJ5A 4GU2A 2B3AA 4W9FA 1E7VA 2IYDB 1UH6A 2KJRA 3QX1A 4FULA 4K7SA 5AZFA 3S2AA 2DHZA 2KMAA 1NDDA 3PTFC 3CSFA 4DDID 3UQAA 1WX9A 3RYTA 5C1ZA 2MBBB 3HM6X 4BKSA 3JYUA 5DPWA 2REXA 3UQBA 4BBNC 2MBQA 3BINA 1P98A 4GDKB 3OLMD 4JLCA 1P9DU 3ENEA 2JRIB 3DCGA 2KLCA 2KKCA 3PLUA 4AWJA 2C60A 1WY8A 2BGFA 4AJYB 1RLFA 2VRRB 2ZCBA 4ASWC 4DHZB 2NBWB 4TKNA 5DPSA 1E8XA 2C9WB 4WWPA 1OTRB 2LRUA 2I1KA 2JVCA 2NVUI 2PPHA 3IVFA 2KDFB 2NS5A 3PVLA 4KSLC 4MJSB 1R4NI 1YIWA 2DZIA 3VH4B 5AEKB 1NBFC 4TV3A 4FJVB 1WRDB 2N1WA 4URKA 1WH3A 4W9CA 3TMPB 1E8WA 4KVGB 2Z0DB 1YX6B 5J2RA 4A3PA 4LDTD 3TCAA 4MDKE 3PT2B 4HCPB 3L17A 1Y8RC 4GB9A 5LXHA 2BYEA 2BYFA 4MEMA 2IBIB 2XK5A 4EZLA 2KTRB 2GBNA 3SU8X 1UBQA 2L8JA 2EMTA 3RZFA 5JZEB 1H8CA 2DZKA 3QQ8B 1RFAA 4FJYA 1J8CA 4ZRKA 3ZIMA 3PSEB 4MGZE 4FLHA 5L83A 1GUAB 2DZMA 1WGYA 2FUHB 2ZPYA 4ANXA 4KZCA 2FIFA 3V60A 3O65B 2KHWB 2RR9A 5KHOA 1D3ZA 4NJ6A 4NAWA 5LLIA 2MA9B 2ZZPB 4A20A 3OJ3A 4DWFA 3KW5B 4F1SA 1WJ6A 1S3SG 3H7PB 3AU5A 3TIXA 4K7WA 2C7NB 2ASQA 3R7QA 4TQ0A 2W9NA 2MW5A 2MBHA 1H4RA 2WDTB 1LM8B 1Q0WB 2KO3A 4CYEA 3WA0A 2L05A 3ZNZB 4DHJB 3HIZA 5IAAC 4ANVA 3DVGY 2KOXA 3VTUA 4HXDA 5D2MB 4NAWB 2FCNA 2MRPA 2G3QB 1TGZB 4W9KA 2LVOA 4PS3A 1EUVB 2NPTA 3KYDD 4M0WB 3KUCB 4W9IA 5D6JB 3RD2A 1Q5WB 3ZDTA 3ML8A 2KFKA 3M63B 4I6NB 2JY6A 2BWES 1P0RA 2KQ7A 2L7RA 2L0TA 3B08A 2KDBA 5C23A 1S1QB 3PHWB 3WAOA 4HDOA 4WQOB 2XBBC 3I3TB 2JZZA 2WX1A 3Q3FA 2N9XA 4FN2A 2CHWA 1NI2A 4ICVA 4IG7B 1GC7A 3RCZA 4W9DA 4PYZA 3WAPA 4MGIE 3JSVA 2JXXA 2MCNB 4HK2A 4WWNA 2ZNVB 1YD8U 1EF5A 3VUWA 2JUOA 3L0WB 4X57B 2KFKB 3KUZA 2FAZA 3ZKJC 1LQBA 2LGDA 3PLVA 5G55A 1RAXA 4BOZB 2O2VB 1V5OA 2CKHB 2KX0A 4GXBA 4KZ0A 3APDA 2L76A 1WIAA 1SIFA 2LD9A 3WANA 3VQIA 3DPDA 3JSVB 2BF8B 1HE8A 3ZVVA 4HVBA 3N32A 2KDEB 3U7DA 3H7SA 2BWFA 5L95C 2O6VB 4BOSC 4BVUC 3H9DA 3VXWA 4NPNA 4P7IA 2GBKA 3UIOB 3SHQA 5J17A 1IYFA 2J0KA 3X0WA 3ZLZA 3QIJA 4FJZA 4KSKC 1E7UA 2MWSB 3M3JA 3VTWA 2J0MA 4WJOA 2LGYA 1FXTB 4JL9A 5J18A 1PQSA 4FHJA 2MP2B 1LXDA 2Z0EB 3ZTCA 1E5WA 2ZPNA 3APFA 3LJ3A 3PRZA 3DBHI 1OEYA 1A5RA 2BKFA 3WALA 3N3KB 1IP9A 1XT9B 4I6LB 3W1SC 4K7UA 2RGFA 4HPLB 1UGMA 2DENB 2J0JA 4HWIB 5CHWA 3K9OB 3PV1A 3HHMA 5CX3A 4G0NB 2FCQA 5E6OA 2XEWA 2AYOB 4WJPA 2EKEC 4B9KA 1ISNA 3V62A 3H1UA 1CMXB 4KDLB 1WFYA 3QWZB 4GN1A 4MSMB 3D32A 4IM0A 2C5LC 2RPQA 3PPAA 2PJHA 2KJ6A 1YQBA 3RT3B 3QCAA 2KC1A 1ZKHA 1Q1OA 1BT0A 3PGEA 4FA6A 3L54A 3NY5A 3SD5A 2C7HA 2PE6B 3NZUA 4IWQA 3V61A 3TBLD 1WX8A 2RD0A 3VDZA 3PZDA 4II2B 3A1QA 2JF5A 4JQWC 4ZRJA 2N9PC 1VD2A 4LJOB 1IPGA 2AEHA 3R3MA 4GMVA 1QZEA 2LXAA 3PRMB 4RM8A 3IHPC 4W9LA 1E8ZA 1SE9A 2D2QA 2FCMA 2N7DA 2FCSA 1SGHA 1WGRA 2HD5B 1V2YA 2V4LA 3QAQA 2M17A 3V6CB 2M1MA 2KVRA 4JGHB 1Z5SB 5E6PA 1KLVA 5CHFA 2DZJA 2KWUB 4KIKA 4DDGD 2KC2A 2XK5B 3IG3A 3VAWA 1WJUA 2YVCA 4K81A 4EZKA 3U8ZA 1C1YB 1WI0A 1I35A 4JIOU 4GGQA 1P3QU 4EZJA 4MM3A 1XD3B 2M0XA 2G4DB 3PRPB 2HE7A 2MQJA 2DAFA 2K8BA 2KFJA 4MSQB 3P2BA 3N30A 1YX5B 2CR5A 2R2OA 3NZSA 3DDCB 4G3XB 4IWPA 2IY0B 3AU4A 2DYBA 3ZUNA 1WZ0A 4LCDE 3APCA 4E71A 3RUIB 4AUQC 4HJKA 2WX0A 2GBMA 4AOFA 2KTFA 4EOYA 2KLGA 2D3GA 3M95A 2MBEA 2N4FA 2GBRA 4BBNF 4EUTA 2CS4A 4HPMB 1WM3A 2D07B 1JRUA 3X23A 1GG3A 4W9GA 2IO1B 2K1FA 2Z59B 1ZGUB 2AL6A 2YLMA 1LFDA 2L00B 3T9LA 1UBIA 1V9JA 3VH3B 2GBJA 2NBUA 1V80A 2NPTB 3A9KA 2C7MB 4W9EA 5HKHA 3QHTA 4MGYE 3TL5A 2BKRB 3MTNB 3ML9A 3UGBB 1XQQA 3K9PB 4G11A 2KJHB 2CHZA 4IC7B 3W1SA 4GSWA 1WGGA 4BKGA 3L13A 3KH0A 3ZDMC 3RZWC 4FADA 1TBEA 2DAJA 3JW0X 3OAWA 2KN5A 4NY0A 4NQLB 3DOWA 4GOCA 5D7GA 4HDQA 1WGDA 4XC2A 2ZEQA 3CMMB 2NR2A 2G45B 1EO6A 2LUEA 2WWZA 1C3TA 2LGXA 4IW0A 3TJPA 3PREA 3W1YA 2M4NA 2KDIA 2LRWA 2JPHA 2IO0B 5CHVC 4ZYNA 1RRBA 4MGKE 1WXAA 5E6NA 1T0YA 2BYVE 1UD7A 2JT4B 5G2NA 3A9JA 2LI5A 2K25A 3R66C 1K8RB 1WE7A 2KQSA 4LDTB 2MLBA 4E74A 1YJ1A 4GDLA 2V1YA 4ZDVA 2G4SA 4CHKA 2IY1B 4FBJB 4IM2A 2CHXA 4M8NA 5KHQA 5CTRC 1WXSA 4F7ZA 1U4AA 3NHEB 1I42A 2UWQA 4NQKE 3M62B 3ONSA 3VUXA 3A9JB 1F9JA 1WR1A 4MELA 2L0FA 5IA7A 4DXAB 3JVZX 4J6IA 3CF6E 2KX3A 4GDLB 4GDKA 1GJZA 2OJRA 3T8MA 2KNBA 1KM7A 4IUMB 2KANA 2KWCA 4F8CB 4WJQA 3ZNGC 5FR6A 4BKTA 4PS7A 1OEYJ 1UELA 1L7YA 1WF9A 1WYWB 2KZRA 2V3SA 2OOBB 3MJWA 4ICUA 3MHSD 2IZVB 2FNJB 3R7RA 2MX2A 3WIMA 4DBGA 1WR6E 3QK0A 1MG8A 2AL3A 4MJSA 4OVUA 4ZRIA 3HM3A 1V86A 3ZNID 5JH5C 1R4MI 3LDZE 5LXIB 1L2NA 3EFUA 1G6JA 3GOEA 4K1RB 5TR5A 2JRHA 3AXCA 4PYUA 3VVWB 1J19A 3DVNV 1WXMA 4II3B 4WWOA 2LZ6A 3VFKA 2LXCA 2KXJA 3C0RB 3IBEA 3UIPB 1P1AA 3A4RA 4KDIC 5AZHA 3WAMA 2KTRA 5JHBA 4M8MA 2Y5BB 4FHKA 5GMVA 3DBRI 2R2QA 4RMAA 1GNUA 3ZO5B 2O6VD 2PEAA 3ECIA 2WYQA 1WZ3A 3EECA 4KV2A 3A1QB 1E8YA 2EMSA 2KK8A 3GZNI 5DPTA 4GIVA 3BY4B 1WGHA 4IWOA 3ZNHB 2KD0A 5DPRA 1V49A 2K8CA 3UINB 2GMIC 2GOWA 1OQYA 4XX5A 1Z2MA 4AJWA 2ZCCA 3QARA 2JZ3B 1UZXB 1WE6A 2AWTA 2M8SA 1ZW7A 3EHVA 3QJZA 1M94A 3EC8A 3H7PA 4KIKB 2BPSA 3DBLI 3ZW3A 2IO3B 1WX7A 2L3ZA 3PS6A 3DBSA 4N9F4 2ZVNA 2RSUA 1V6EA 4YL8A 2LWPA 3RULA 2CU1A 3H6NA 4NJ7A 2K39A 4I6PA 4PS8A 1AARA 3ZTDA 2IO2B 2D10A 3QA8A 4AP4C 1WM2A 5JHAA 1EF1A 1TTNA 2NCNA 4BKSD 3A4SC 3B0AA 4HCNB 4TQ1A 4EFOA 2QHOA 5EDSA 5DCNA 2I1JA 4DK5A 3B1LX 3V6EB 4BFRA 1V81A 2MBOA 4B6WA 2A4ZA 2J7QB 1E90A 2K6QA 2DYMA 3ZRFA 3KUDB 3DVGX 2N7EA 3L10B 3KVFB 1J0GA 3OJ4B 2NBVB 4CO7A 3DVNU 4RM9A 4OVVA 4W9HA 2HJ8A 2ZJDA 4ANWA 1V5TA 2KMCA 4EEWA 1VCBA 4G50A 4WJNA 2DX5B 2O2VA 3IFWB 2UYZB 3UF8A 1WMHA 3AULA 3VHTC 4LJPB 5BO4B 4DHZE 1GC6A 3A9KB 3Q3JA 2A5UA 2HTHA 2JWZA 5AZGA 1KOTA 2FIDA 1KJTA 4W9JA 4HLEA 2LVQA 3HK0A 2DYOA 2N1VA 3VTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O6V A;  2N9E B;  3NS8 A;  5D94 A;  4MH0 E;  3VUY A;  4E3C A;  3DQV A;  1WJN A;  3QC8 B;  2K8H A;  3KYC D;  1WMH B;  3PHX B;  4NNJ B;  3SDL C;  1TZ1 A;  2K6D B;  4DHJ D;  2ZVO A;  1X1M A;  3NOB A;  1WJ4 A;  2LVP A;  2MP2 A;  4TUU A;  4ANU A;  2LAS A;  4IM3 A;  3L08 A;  2ZNV C;  4A3O A;  4B95 A;  3A33 B;  2MSE D;  4EKU A;  1OGW A;  2KWV B;  3ALB A;  3L16 A;  4WAA A;  4XZ4 A;  3U30 A;  3ZRC A;  1WXV A;  2D11 A;  3CST A;  3AI5 A;  2PE9 A;  2LJ5 A;  4GU2 A;  2B3A A;  4W9F A;  1E7V A;  2IYD B;  1UH6 A;  2KJR A;  3QX1 A;  4FUL A;  4K7S A;  5AZF A;  3S2A A;  2DHZ A;  2KMA A;  1NDD A;  3PTF C;  3CSF A;  4DDI D;  3UQA A;  1WX9 A;  3RYT A;  5C1Z A;  2MBB B;  3HM6 X;  4BKS A;  3JYU A;  5DPW A;  2REX A;  3UQB A;  4BBN C;  2MBQ A;  3BIN A;  1P98 A;  4GDK B;  3OLM D;  4JLC A;  1P9D U;  3ENE A;  2JRI B;  3DCG A;  2KLC A;  2KKC A;  3PLU A;  4AWJ A;  2C60 A;  1WY8 A;  2BGF A;  4AJY B;  1RLF A;  2VRR B;  2ZCB A;  4ASW C;  4DHZ B;  2NBW B;  4TKN A;  5DPS A;  1E8X A;  2C9W B;  4WWP A;  1OTR B;  2LRU A;  2I1K A;  2JVC A;  2NVU I;  2PPH A;  3IVF A;  2KDF B;  2NS5 A;  3PVL A;  4KSL C;  4MJS B;  1R4N I;  1YIW A;  2DZI A;  3VH4 B;  5AEK B;  1NBF C;  4TV3 A;  4FJV B;  1WRD B;  2N1W A;  4URK A;  1WH3 A;  4W9C A;  3TMP B;  1E8W A;  4KVG B;  2Z0D B;  1YX6 B;  5J2R A;  4A3P A;  4LDT D;  3TCA A;  4MDK E;  3PT2 B;  4HCP B;  3L17 A;  1Y8R C;  4GB9 A;  5LXH A;  2BYE A;  2BYF A;  4MEM A;  2IBI B;  2XK5 A;  4EZL A;  2KTR B;  2GBN A;  3SU8 X;  1UBQ A;  2L8J A;  2EMT A;  3RZF A;  5JZE B;  1H8C A;  2DZK A;  3QQ8 B;  1RFA A;  4FJY A;  1J8C A;  4ZRK A;  3ZIM A;  3PSE B;  4MGZ E;  4FLH A;  5L83 A;  1GUA B;  2DZM A;  1WGY A;  2FUH B;  2ZPY A;  4ANX A;  4KZC A;  2FIF A;  3V60 A;  3O65 B;  2KHW B;  2RR9 A;  5KHO A;  1D3Z A;  4NJ6 A;  4NAW A;  5LLI A;  2MA9 B;  2ZZP B;  4A20 A;  3OJ3 A;  4DWF A;  3KW5 B;  4F1S A;  1WJ6 A;  1S3S G;  3H7P B;  3AU5 A;  3TIX A;  4K7W A;  2C7N B;  2ASQ A;  3R7Q A;  4TQ0 A;  2W9N A;  2MW5 A;  2MBH A;  1H4R A;  2WDT B;  1LM8 B;  1Q0W B;  2KO3 A;  4CYE A;  3WA0 A;  2L05 A;  3ZNZ B;  4DHJ B;  3HIZ A;  5IAA C;  4ANV A;  3DVG Y;  2KOX A;  3VTU A;  4HXD A;  5D2M B;  4NAW B;  2FCN A;  2MRP A;  2G3Q B;  1TGZ B;  4W9K A;  2LVO A;  4PS3 A;  1EUV B;  2NPT A;  3KYD D;  4M0W B;  3KUC B;  4W9I A;  5D6J B;  3RD2 A;  1Q5W B;  3ZDT A;  3ML8 A;  2KFK A;  3M63 B;  4I6N B;  2JY6 A;  2BWE S;  1P0R A;  2KQ7 A;  2L7R A;  2L0T A;  3B08 A;  2KDB A;  5C23 A;  1S1Q B;  3PHW B;  3WAO A;  4HDO A;  4WQO B;  2XBB C;  3I3T B;  2JZZ A;  2WX1 A;  3Q3F A;  2N9X A;  4FN2 A;  2CHW A;  1NI2 A;  4ICV A;  4IG7 B;  1GC7 A;  3RCZ A;  4W9D A;  4PYZ A;  3WAP A;  4MGI E;  3JSV A;  2JXX A;  2MCN B;  4HK2 A;  4WWN A;  2ZNV B;  1YD8 U;  1EF5 A;  3VUW A;  2JUO A;  3L0W B;  4X57 B;  2KFK B;  3KUZ A;  2FAZ A;  3ZKJ C;  1LQB A;  2LGD A;  3PLV A;  5G55 A;  1RAX A;  4BOZ B;  2O2V B;  1V5O A;  2CKH B;  2KX0 A;  4GXB A;  4KZ0 A;  3APD A;  2L76 A;  1WIA A;  1SIF A;  2LD9 A;  3WAN A;  3VQI A;  3DPD A;  3JSV B;  2BF8 B;  1HE8 A;  3ZVV A;  4HVB A;  3N32 A;  2KDE B;  3U7D A;  3H7S A;  2BWF A;  5L95 C;  2O6V B;  4BOS C;  4BVU C;  3H9D A;  3VXW A;  4NPN A;  4P7I A;  2GBK A;  3UIO B;  3SHQ A;  5J17 A;  1IYF A;  2J0K A;  3X0W A;  3ZLZ A;  3QIJ A;  4FJZ A;  4KSK C;  1E7U A;  2MWS B;  3M3J A;  3VTW A;  2J0M A;  4WJO A;  2LGY A;  1FXT B;  4JL9 A;  5J18 A;  1PQS A;  4FHJ A;  2MP2 B;  1LXD A;  2Z0E B;  3ZTC A;  1E5W A;  2ZPN A;  3APF A;  3LJ3 A;  3PRZ A;  3DBH I;  1OEY A;  1A5R A;  2BKF A;  3WAL A;  3N3K B;  1IP9 A;  1XT9 B;  4I6L B;  3W1S C;  4K7U A;  2RGF A;  4HPL B;  1UGM A;  2DEN B;  2J0J A;  4HWI B;  5CHW A;  3K9O B;  3PV1 A;  3HHM A;  5CX3 A;  4G0N B;  2FCQ A;  5E6O A;  2XEW A;  2AYO B;  4WJP A;  2EKE C;  4B9K A;  1ISN A;  3V62 A;  3H1U A;  1CMX B;  4KDL B;  1WFY A;  3QWZ B;  4GN1 A;  4MSM B;  3D32 A;  4IM0 A;  2C5L C;  2RPQ A;  3PPA A;  2PJH A;  2KJ6 A;  1YQB A;  3RT3 B;  3QCA A;  2KC1 A;  1ZKH A;  1Q1O A;  1BT0 A;  3PGE A;  4FA6 A;  3L54 A;  3NY5 A;  3SD5 A;  2C7H A;  2PE6 B;  3NZU A;  4IWQ A;  3V61 A;  3TBL D;  1WX8 A;  2RD0 A;  3VDZ A;  3PZD A;  4II2 B;  3A1Q A;  2JF5 A;  4JQW C;  4ZRJ A;  2N9P C;  1VD2 A;  4LJO B;  1IPG A;  2AEH A;  3R3M A;  4GMV A;  1QZE A;  2LXA A;  3PRM B;  4RM8 A;  3IHP C;  4W9L A;  1E8Z A;  1SE9 A;  2D2Q A;  2FCM A;  2N7D A;  2FCS A;  1SGH A;  1WGR A;  2HD5 B;  1V2Y A;  2V4L A;  3QAQ A;  2M17 A;  3V6C B;  2M1M A;  2KVR A;  4JGH B;  1Z5S B;  5E6P A;  1KLV A;  5CHF A;  2DZJ A;  2KWU B;  4KIK A;  4DDG D;  2KC2 A;  2XK5 B;  3IG3 A;  3VAW A;  1WJU A;  2YVC A;  4K81 A;  4EZK A;  3U8Z A;  1C1Y B;  1WI0 A;  1I35 A;  4JIO U;  4GGQ A;  1P3Q U;  4EZJ A;  4MM3 A;  1XD3 B;  2M0X A;  2G4D B;  3PRP B;  2HE7 A;  2MQJ A;  2DAF A;  2K8B A;  2KFJ A;  4MSQ B;  3P2B A;  3N30 A;  1YX5 B;  2CR5 A;  2R2O A;  3NZS A;  3DDC B;  4G3X B;  4IWP A;  2IY0 B;  3AU4 A;  2DYB A;  3ZUN A;  1WZ0 A;  4LCD E;  3APC A;  4E71 A;  3RUI B;  4AUQ C;  4HJK A;  2WX0 A;  2GBM A;  4AOF A;  2KTF A;  4EOY A;  2KLG A;  2D3G A;  3M95 A;  2MBE A;  2N4F A;  2GBR A;  4BBN F;  4EUT A;  2CS4 A;  4HPM B;  1WM3 A;  2D07 B;  1JRU A;  3X23 A;  1GG3 A;  4W9G A;  2IO1 B;  2K1F A;  2Z59 B;  1ZGU B;  2AL6 A;  2YLM A;  1LFD A;  2L00 B;  3T9L A;  1UBI A;  1V9J A;  3VH3 B;  2GBJ A;  2NBU A;  1V80 A;  2NPT B;  3A9K A;  2C7M B;  4W9E A;  5HKH A;  3QHT A;  4MGY E;  3TL5 A;  2BKR B;  3MTN B;  3ML9 A;  3UGB B;  1XQQ A;  3K9P B;  4G11 A;  2KJH B;  2CHZ A;  4IC7 B;  3W1S A;  4GSW A;  1WGG A;  4BKG A;  3L13 A;  3KH0 A;  3ZDM C;  3RZW C;  4FAD A;  1TBE A;  2DAJ A;  3JW0 X;  3OAW A;  2KN5 A;  4NY0 A;  4NQL B;  3DOW A;  4GOC A;  5D7G A;  4HDQ A;  1WGD A;  4XC2 A;  2ZEQ A;  3CMM B;  2NR2 A;  2G45 B;  1EO6 A;  2LUE A;  2WWZ A;  1C3T A;  2LGX A;  4IW0 A;  3TJP A;  3PRE A;  3W1Y A;  2M4N A;  2KDI A;  2LRW A;  2JPH A;  2IO0 B;  5CHV C;  4ZYN A;  1RRB A;  4MGK E;  1WXA A;  5E6N A;  1T0Y A;  2BYV E;  1UD7 A;  2JT4 B;  5G2N A;  3A9J A;  2LI5 A;  2K25 A;  3R66 C;  1K8R B;  1WE7 A;  2KQS A;  4LDT B;  2MLB A;  4E74 A;  1YJ1 A;  4GDL A;  2V1Y A;  4ZDV A;  2G4S A;  4CHK A;  2IY1 B;  4FBJ B;  4IM2 A;  2CHX A;  4M8N A;  5KHQ A;  5CTR C;  1WXS A;  4F7Z A;  1U4A A;  3NHE B;  1I42 A;  2UWQ A;  4NQK E;  3M62 B;  3ONS A;  3VUX A;  3A9J B;  1F9J A;  1WR1 A;  4MEL A;  2L0F A;  5IA7 A;  4DXA B;  3JVZ X;  4J6I A;  3CF6 E;  2KX3 A;  4GDL B;  4GDK A;  1GJZ A;  2OJR A;  3T8M A;  2KNB A;  1KM7 A;  4IUM B;  2KAN A;  2KWC A;  4F8C B;  4WJQ A;  3ZNG C;  5FR6 A;  4BKT A;  4PS7 A;  1OEY J;  1UEL A;  1L7Y A;  1WF9 A;  1WYW B;  2KZR A;  2V3S A;  2OOB B;  3MJW A;  4ICU A;  3MHS D;  2IZV B;  2FNJ B;  3R7R A;  2MX2 A;  3WIM A;  4DBG A;  1WR6 E;  3QK0 A;  1MG8 A;  2AL3 A;  4MJS A;  4OVU A;  4ZRI A;  3HM3 A;  1V86 A;  3ZNI D;  5JH5 C;  1R4M I;  3LDZ E;  5LXI B;  1L2N A;  3EFU A;  1G6J A;  3GOE A;  4K1R B;  5TR5 A;  2JRH A;  3AXC A;  4PYU A;  3VVW B;  1J19 A;  3DVN V;  1WXM A;  4II3 B;  4WWO A;  2LZ6 A;  3VFK A;  2LXC A;  2KXJ A;  3C0R B;  3IBE A;  3UIP B;  1P1A A;  3A4R A;  4KDI C;  5AZH A;  3WAM A;  2KTR A;  5JHB A;  4M8M A;  2Y5B B;  4FHK A;  5GMV A;  3DBR I;  2R2Q A;  4RMA A;  1GNU A;  3ZO5 B;  2O6V D;  2PEA A;  3ECI A;  2WYQ A;  1WZ3 A;  3EEC A;  4KV2 A;  3A1Q B;  1E8Y A;  2EMS A;  2KK8 A;  3GZN I;  5DPT A;  4GIV A;  3BY4 B;  1WGH A;  4IWO A;  3ZNH B;  2KD0 A;  5DPR A;  1V49 A;  2K8C A;  3UIN B;  2GMI C;  2GOW A;  1OQY A;  4XX5 A;  1Z2M A;  4AJW A;  2ZCC A;  3QAR A;  2JZ3 B;  1UZX B;  1WE6 A;  2AWT A;  2M8S A;  1ZW7 A;  3EHV A;  3QJZ A;  1M94 A;  3EC8 A;  3H7P A;  4KIK B;  2BPS A;  3DBL I;  3ZW3 A;  2IO3 B;  1WX7 A;  2L3Z A;  3PS6 A;  3DBS A;  4N9F 4;  2ZVN A;  2RSU A;  1V6E A;  4YL8 A;  2LWP A;  3RUL A;  2CU1 A;  3H6N A;  4NJ7 A;  2K39 A;  4I6P A;  4PS8 A;  1AAR A;  3ZTD A;  2IO2 B;  2D10 A;  3QA8 A;  4AP4 C;  1WM2 A;  5JHA A;  1EF1 A;  1TTN A;  2NCN A;  4BKS D;  3A4S C;  3B0A A;  4HCN B;  4TQ1 A;  4EFO A;  2QHO A;  5EDS A;  5DCN A;  2I1J A;  4DK5 A;  3B1L X;  3V6E B;  4BFR A;  1V81 A;  2MBO A;  4B6W A;  2A4Z A;  2J7Q B;  1E90 A;  2K6Q A;  2DYM A;  3ZRF A;  3KUD B;  3DVG X;  2N7E A;  3L10 B;  3KVF B;  1J0G A;  3OJ4 B;  2NBV B;  4CO7 A;  3DVN U;  4RM9 A;  4OVV A;  4W9H A;  2HJ8 A;  2ZJD A;  4ANW A;  1V5T A;  2KMC A;  4EEW A;  1VCB A;  4G50 A;  4WJN A;  2DX5 B;  2O2V A;  3IFW B;  2UYZ B;  3UF8 A;  1WMH A;  3AUL A;  3VHT C;  4LJP B;  5BO4 B;  4DHZ E;  1GC6 A;  3A9K B;  3Q3J A;  2A5U A;  2HTH A;  2JWZ A;  5AZG A;  1KOT A;  2FID A;  1KJT A;  4W9J A;  4HLE A;  2LVQ A;  3HK0 A;  2DYO A;  2N1V A;  3VTV A; 
#chains in the Genus database with same CATH topology
 1OQR A;  1SE4 A;  3KYC D;  3SDL C;  1TZ1 A;  2K6D B;  2J53 A;  1X1M A;  5AUI A;  1VR9 A;  3NOB A;  2LVP A;  2LAS A;  4IM3 A;  2WDQ B;  3ZXV A;  1TKE A;  2MSE D;  1OGW A;  3AEF B;  2D11 A;  4KX6 B;  3CST A;  3NVZ A;  3AI5 A;  2PE9 A;  4GU2 A;  4HRO A;  2B3A A;  1QIL A;  1D5X C;  4ARI A;  3TEX A;  2DHZ A;  1NDD A;  4DDI D;  2WXO A;  2JWU A;  2W3R A;  1DOI A;  4WIP A;  3UQA A;  3AM9 A;  3UQB A;  3OLM D;  4JLC A;  3ENE A;  1GB4 A;  1TKG A;  2QDF A;  2C60 A;  1RLF A;  2ZCB A;  2DLB A;  2CJO A;  2K9X A;  1J7B A;  1E8X A;  3VR9 B;  2GI9 A;  1JWB D;  2NS5 A;  2K3U A;  4XGA B;  3VH4 B;  5AEK B;  1NBF C;  3DWG C;  1YN5 A;  3Q2A C;  1YX6 B;  3PT2 B;  3LB8 C;  1SXT A;  4HCP B;  1Y8R C;  4GB9 A;  4EZL A;  4D2K A;  1YOV B;  1KLG D;  3QQ8 B;  1QQR A;  4ZRK A;  3ZIM A;  1TYG B;  4YSX B;  4O1N A;  2ZPY A;  2FIF A;  2XN9 C;  1XLO A;  2JSV X;  3O65 B;  2RR9 A;  2RMM A;  2ZZP B;  2INC C;  4WH4 A;  4DWF A;  1C4C A;  2IPK D;  4F1S A;  3AU5 A;  3R7Q A;  4N59 A;  1CJE A;  4CYE A;  3HIZ A;  5IAA C;  4NJC A;  2G3Q B;  5G5G A;  3MP9 A;  4WUR A;  3KYD D;  1Q5W B;  3ZDT A;  2KFK A;  2WHI A;  1P0R A;  4K3B A;  3B08 A;  3PHW B;  4N6E B;  2XBB C;  1YQ3 B;  4S17 A;  3ZJU A;  2MJD A;  3GB1 A;  4FN2 A;  5FR3 A;  1NI2 A;  4MGI E;  4XWW A;  4WWN A;  1EF5 A;  2ACZ B;  3EGR A;  3VUW A;  4X57 B;  4ITK A;  1K50 A;  5G55 A;  2WU5 B;  4BAX A;  2BS4 B;  2KX0 A;  4GXB A;  4KZ0 A;  3APD A;  3TSS A;  2LD9 A;  3VQI A;  3DPD A;  2BF8 B;  2DNF A;  3I5J C;  3W5V B;  2BTE A;  3AE4 B;  1PFD A;  4YSY B;  1XLQ A;  2GBK A;  4HEA 1;  1I4P A;  2J0K A;  1ZUD 2;  4KSK C;  1E7U A;  2MWS B;  2LJI A;  1PQS A;  4KGT A;  2MP2 B;  3DBH I;  5HHD G;  1KLU D;  1B9R A;  3W1S C;  2VH2 A;  1FNV A;  4HWI B;  4G0N B;  2FCQ A;  2XEW A;  2VZK D;  1ISN A;  1BML C;  3H1U A;  4KDL B;  4GN1 A;  2C5L C;  2PJH A;  3RT3 B;  2KC1 A;  1ZKH A;  2WXN A;  1BT0 A;  1TS4 A;  3L54 A;  1RWS A;  2CJN A;  2C7H A;  1J7C A;  1V8C A;  2PE6 B;  1UF0 A;  3L4P A;  1WX8 A;  2RD0 A;  4USA A;  1VD2 A;  3AEA B;  3NJT A;  4REZ A;  3H8H A;  3IHP C;  1E8Z A;  1SE9 A;  2FCS A;  1SGH A;  1WGR A;  1V2Y A;  2KVR A;  5CHF A;  2DZJ A;  4KIK A;  2XK5 B;  1WJU A;  2YVC A;  1EWC A;  3DHG C;  4GGQ A;  2VH1 A;  1YN3 A;  4EZJ A;  2KYW A;  4MM3 A;  2BBC A;  2HE7 A;  3Q69 A;  3HVZ A;  3NUH B;  3N30 A;  2R2O A;  5HFY A;  1QF6 A;  3APC A;  5G5H A;  4YTN B;  3E56 A;  3RUI B;  2KTF A;  5I4D A;  4RCO A;  2L1A A;  1QOG A;  1C9F A;  1IBX B;  3CIR B;  2GBR A;  2OJW A;  1UWM A;  2CS4 A;  3AN1 A;  3P4R B;  3X23 A;  3HVD A;  1GG3 A;  2YLM A;  1LFD A;  1F0Z A;  3R2T A;  1IGD A;  3VH3 B;  4HKQ A;  1EM7 A;  3QHT A;  2BKR B;  3MTN B;  3ML9 A;  3AE6 B;  4IC7 B;  4GSW A;  3ZDM C;  4GLS C;  1SB3 C;  2R61 A;  2VZK B;  3Q6B A;  4NY0 A;  3RN9 C;  4GOC A;  1WGD A;  2JYT A;  4XC2 A;  3SFD B;  1QOB A;  3ZJV A;  2JPH A;  3U4E G;  4ZYN A;  5E6N A;  2LI5 A;  3R66 C;  3BVG A;  1WE7 A;  4LDT B;  4E74 A;  2G4S A;  1YNT E;  1FCC C;  1R7S A;  3OG5 A;  1U4A A;  3AMZ A;  1KTK A;  2KAC A;  3ONS A;  1QKZ A;  1CZP A;  1AYF A;  1CK1 A;  1SJE D;  2DBY A;  4IUM B;  2KAN A;  4BKT A;  1MPE A;  1FD6 A;  1L7Y A;  1WYW B;  2OOB B;  2AQ2 B;  3MHS D;  2IZV B;  1MG8 A;  4OVU A;  2PMV A;  5JH5 C;  4LNK A;  3RMK C;  1G6J A;  3AXC A;  4PYU A;  1J19 A;  3OWE B;  4WWO A;  3VFK A;  5AZH A;  4M8M A;  4EE2 A;  3DBR I;  3AEB B;  4RMA A;  2WNM A;  3A1Q B;  2EMS A;  3GZN I;  2IGG A;  4A6Q A;  4GIV A;  3U52 E;  4IWO A;  1V49 A;  2GOW A;  1DGJ A;  3FIL A;  2EKI A;  4KGS A;  4AJW A;  1UZX B;  2AQ3 B;  1ENF A;  3QJZ A;  2EEL A;  3EC8 A;  1ZPS A;  3AE1 B;  5EE0 A;  1L0V B;  1GOZ A;  1ZP0 B;  2BPS A;  3DBL I;  4B0E A;  4AQ7 A;  2OED A;  2RSU A;  3RUL A;  3DBL B;  3ZTD A;  2K39 A;  4I6P A;  4JWU C;  2W54 A;  1L6U A;  2ZW1 A;  1MVK A;  4H2A A;  4A9A A;  3V6E B;  2J7Q B;  1KF6 B;  1FXA A;  2PTL A;  2N7E A;  3Q8E A;  4RF1 A;  1Y56 A;  2HJ8 A;  1FNU A;  2HJ1 A;  2JX5 A;  3KWV A;  4G50 A;  4WJN A;  3RPF C;  3V3X A;  2UYZ B;  3VHT C;  4LJP B;  5EE3 A;  5BO4 B;  1GC6 A;  2HTH A;  1KOT A;  1E7P B;  1KJT A;  4W9J A;  2K0P A;  2GB1 A;  2KQ4 X;  4K3C A;  1QOF A;  3E9S A;  1YN4 A;  1TY0 A;  1OFF A;  2K8H A;  1WMH B;  4NNJ B;  4RNA A;  2ZVO A;  1WYG A;  2MP2 A;  2INP E;  2ZNV C;  4DXG A;  5BMI A;  3NRZ A;  5BYR A;  3L16 A;  3U30 A;  2KT7 A;  2GRI A;  3GE8 C;  1E7V A;  1UH6 A;  3I57 A;  2D3A A;  3N20 C;  4QAY A;  2Y5P A;  3HM6 X;  3JYU A;  4GDK B;  1P9D U;  2GLS A;  1FFU A;  2JRI B;  1T0S C;  4AWJ A;  2IGH A;  4DHZ B;  2W82 A;  1JCK B;  2NBW B;  2QIL A;  4TKN A;  5DPS A;  1OTR B;  3PVL A;  3GE3 C;  4URK A;  1WH3 A;  4LTU A;  3TMP B;  4KVG B;  2Z0D B;  5J2R A;  2J52 A;  3MC8 A;  2RPV A;  2J42 A;  3VR8 B;  2BYE A;  2Y5C A;  2IBI B;  2XK5 A;  2KTR B;  4J3O D;  3RZF A;  1H8C A;  3VRA B;  4YWG G;  1RFA A;  2QMT A;  1J8C A;  2WXG A;  4FLH A;  3BVM A;  2FUH B;  4ANX A;  4KZC A;  1VJK A;  3MC9 A;  1C78 A;  5KHO A;  5D3D A;  4A20 A;  1A70 A;  1FFV A;  2WGS A;  3KW5 B;  3ETR A;  2LFI A;  1S3S G;  3H7P B;  2ASQ A;  4TQ0 A;  2MBH A;  2WDT B;  1LM8 B;  3ZNZ B;  4ANV A;  1E0Z A;  2KOX A;  4HXD A;  3AB5 A;  5D2M B;  4NAW B;  1M4V A;  5IP4 D;  3RD2 A;  3KUC B;  3M63 B;  4I6N B;  2JY6 A;  2BWE S;  2L7R A;  2L0T A;  5C23 A;  4HDO A;  4C80 A;  4WQO B;  3I3T B;  3Q3F A;  1L6V A;  2IJ0 A;  4ICV A;  1GC7 A;  3BYY B;  2JXX A;  4XDD A;  4HK2 A;  1YD8 U;  3KUZ A;  1WXQ A;  2FAZ A;  2D5G A;  2LGD A;  1RAX A;  3P63 A;  2L76 A;  1SIF A;  3ZQ4 A;  3JSV B;  3MC0 B;  3N32 A;  3N1Z C;  2O6V B;  4MH8 A;  3UIO B;  3SHQ A;  5EE9 A;  3ZGZ A;  3ZLZ A;  1XLP A;  4JX1 C;  4JWS C;  3M3J A;  3VTW A;  2D3B A;  2LGY A;  4JL9 A;  2G1E A;  4FHJ A;  2Z0E B;  1LXD A;  3PO0 A;  3AV8 A;  1E5W A;  2ZPN A;  3W2D A;  3LJ3 A;  1A5R A;  4RGT A;  2XNA C;  1XT9 B;  2RGF A;  4RGM A;  2DEN B;  1FO4 A;  1QT9 A;  5E6O A;  2EKE C;  4NAM A;  1WFY A;  4MSM B;  4IM0 A;  2RDB C;  4P6V F;  2W55 A;  4FA6 A;  2ICI A;  4LK0 M;  3N1X C;  2NMQ A;  5BMH A;  4IWQ A;  2SAK A;  3A1Q A;  2JF5 A;  3T3O A;  2HTM E;  4LJO B;  4GMV A;  1QZE A;  2LXA A;  4RM8 A;  1J7A A;  4W9L A;  1I4Q A;  2D2Q A;  2LEK A;  2HD5 B;  2OHF A;  3QAQ A;  2M17 A;  5HG2 A;  2M1M A;  4JGH B;  2TSS A;  1KLV A;  1STE A;  2KWU B;  3KLS X;  3IG3 A;  3O13 A;  3U8Z A;  1C1Y B;  1JRO A;  1I35 A;  1P3Q U;  2N9L A;  2MQJ A;  3PRP B;  2DAF A;  4MSQ B;  2RDG A;  2YEP F;  1FRD A;  3AU4 A;  2DYB A;  3ZUN A;  1FXI A;  2V4I B;  2WU2 B;  3ZJT A;  4AUQ C;  4HJK A;  2D3G A;  1T0R C;  2N4F A;  3RFZ B;  4EUT A;  1WM3 A;  2D07 B;  2K1F A;  2AL6 A;  2GBJ A;  2NBU A;  2NPT B;  2C7M B;  4MAC A;  5HKH A;  5TSS A;  4MGY E;  3TL5 A;  5IN7 A;  4G11 A;  2BW2 A;  3RNB C;  1TBE A;  2KMM A;  2DAJ A;  3CWI A;  4NQL B;  3DOW A;  5D7G A;  4HDQ A;  3NVW A;  1ZXH A;  3CMM B;  2G45 B;  1EO6 A;  2LUE A;  2LGX A;  3AE9 B;  1GAQ B;  3PRE A;  3MFG A;  2WDV B;  2D3C A;  1UD7 A;  2JT4 B;  2X38 A;  3NVV A;  2K25 A;  1K8R B;  3B2F A;  4HRS A;  1NYR A;  1FM0 D;  1YJ1 A;  4GDL A;  1WXS A;  2LGS A;  2UWQ A;  4IOI E;  3Q3O C;  3PZ7 A;  2FBW B;  3A9J B;  3DBH B;  1WR1 A;  5IA7 A;  1V1P B;  3JVZ X;  4J6I A;  1NI3 A;  3CF6 E;  4GDK A;  2OJR A;  3I63 C;  2UU7 A;  3T8M A;  2KNB A;  3RNE C;  5IOI A;  3Q14 C;  4F8C B;  1FEH A;  5FR6 A;  2WLB A;  1JAL A;  2SEB D;  4YXD B;  1WF9 A;  3MJW A;  4KGR A;  3R7R A;  1B1Z A;  2MX2 A;  4DBG A;  3BZD B;  1I4X A;  3ZNI D;  1DOY A;  1R4M I;  3LDZ E;  2PVO D;  2N9K A;  1P1A A;  2KTR A;  1L0Y B;  2KDM A;  3EEC A;  1SBB B;  3U7Z A;  2KK8 A;  1WGH A;  3ZNH B;  5DPR A;  2K8C A;  3AEG B;  3SR6 A;  2GMI C;  1OQY A;  2ZCC A;  2JZ3 B;  1WE6 A;  4OZC A;  2AWT A;  2M8S A;  1ZW7 A;  1T5X D;  3H7P A;  1GPX A;  3NVY A;  3UI3 A;  1PUT A;  3B9J A;  3ZW3 A;  3I9V 1;  1WX7 A;  2D10 A;  1WM2 A;  1TTN A;  3NG0 A;  2NCN A;  3N9Y C;  3A4S C;  3B0A A;  5DCN A;  1C4A A;  4BFR A;  1L4D B;  2WXJ A;  1ACC A;  1RM6 C;  2A4Z A;  2K6Q A;  3ZRF A;  3MJ5 A;  3KVF B;  1E9M A;  4CO7 A;  1JQ4 A;  2H88 B;  3DVN U;  4RM9 A;  4OZA A;  4OVV A;  4W9H A;  2ZJD A;  1V5T A;  2KMC A;  3BK1 A;  1KH0 A;  2LUM A;  1XLN A;  4LNO A;  2A5U A;  2N7J A;  4LNF A;  3RNA C;  2PLP A;  2N1V A;  3VTV A;  1SE3 A;  1DYQ A;  2O6V A;  1ESF A;  5D94 A;  4C7Z A;  4E3C A;  1I4R A;  3DQV A;  3QC8 B;  1AWD A;  1VDV A;  3PHX B;  1SE2 A;  4DHJ D;  4C00 A;  4XWT A;  1XCQ L;  4ANU A;  4ZRQ A;  1E6E B;  3A33 B;  3ALB A;  4WAA A;  1T6B X;  4XZ4 A;  3ZRC A;  1GB1 A;  2LJ5 A;  2PVG C;  5AZF A;  2KJR A;  3S2A A;  2KN4 A;  3PTF C;  1ROE A;  5JXV A;  1PGA A;  2MBB B;  1XF5 L;  2WXF A;  4RFB A;  4BKS A;  4C4V B;  3BIN A;  1P98 A;  1NEN B;  3GS2 A;  2KKC A;  4R3D A;  2BGF A;  2VRR B;  1N63 A;  2LMC A;  1HZ6 A;  2K22 A;  4WWP A;  1JW9 D;  2I1K A;  2JVC A;  1WSP A;  1YIW A;  2DZI A;  1KRH A;  1RYJ A;  3IT6 B;  2N1W A;  1AW7 A;  3DBR B;  1E8W A;  1XCT L;  1C4P A;  2WXK A;  4ARC A;  3GZN B;  3L17 A;  1N61 A;  4MEM A;  5HI1 A;  2EMT A;  1JWA D;  5JZE B;  2WQY B;  1N62 A;  4FJY A;  4Q2J A;  3PSE B;  4MGZ E;  1ZDX A;  2PKO A;  2IGD A;  5L83 A;  1GUA B;  1WGY A;  4WAF A;  2KHW B;  5LLI A;  1V1O A;  1N6Z A;  1F2R C;  1D5Z C;  4M02 A;  2IND C;  1BUI C;  2I2Y A;  3TIX A;  2C7N B;  2WXL A;  2MW5 A;  1H4R A;  1Q0W B;  2KO3 A;  4DHJ B;  3DVG Y;  3VTU A;  1Q10 A;  1TGZ B;  2LVO A;  1EUV B;  2NPT A;  4M0W B;  1N60 A;  4W9I A;  1ZDV A;  2WP9 B;  5D6J B;  2WXR A;  2KQ7 A;  2KDB A;  1S1Q B;  3WAO A;  4TSS A;  2JZZ A;  4P16 A;  2Q5W D;  4IG7 B;  4W9D A;  2BQQ A;  2BB6 A;  3WAP A;  3HRD D;  4FXC A;  2QIE B;  2ZNV B;  2JUO A;  3L0W B;  2KFK B;  3ZKJ C;  1LQB A;  1D4B A;  3LYY A;  2YEP B;  1V5O A;  2CKH B;  1WIA A;  2I38 A;  1HE8 A;  4HVB A;  2KDE B;  3U7D A;  5H8Y E;  3H7S A;  1JWS D;  4BOS C;  2FE8 A;  3H9D A;  3VXW A;  4NPN A;  5C3J B;  1I4G A;  5J17 A;  1PGX A;  2AX5 A;  2QJL A;  3Q8A A;  3X0W A;  4FJZ A;  2LGI A;  1V1P A;  3B2G A;  1N5X A;  2J0M A;  4WJO A;  3BII D;  2WDR B;  5J18 A;  3Q8F A;  3ZTC A;  3W9C B;  2NTS A;  3APF A;  4WWM A;  3WAL A;  3AED B;  3N3K B;  5GXG B;  3AEC B;  4I6L B;  1XEE A;  3P4Q B;  4HPL B;  3AH7 A;  2MJ3 A;  5CHW A;  3HHM A;  5CX3 A;  2AYO B;  4B9K A;  1T0Q C;  1CMX B;  2H89 B;  2RPQ A;  3PPA A;  5FK9 C;  1YQB A;  1HEZ E;  3QCA A;  1JRP A;  1YJI A;  3PGE A;  1TKY A;  3NY5 A;  1TY2 A;  3RNC C;  3SD5 A;  3PZD A;  4II2 B;  4ZRJ A;  3R3M A;  3PRM B;  5E6J A;  2FCM A;  4B0M A;  1VZ8 A;  1Z5S B;  5E6P A;  2MH7 A;  2KC2 A;  3T3N A;  4PT5 A;  1VLB A;  4EZK A;  4C7Y A;  4N58 A;  5C2T B;  2M0X A;  4US8 A;  3BVZ A;  3FC4 A;  1IBX A;  1L0X B;  4RGN A;  3P2B A;  1YX5 B;  4G3X B;  3DDC B;  4IWP A;  2IY0 B;  2ONQ A;  3N1Y C;  1EWY C;  1TJE A;  2WX0 A;  4MM3 B;  2MBE A;  3DHI C;  2L83 A;  4HPM B;  4W9G A;  2IO1 B;  2RDH A;  2L00 B;  1UBI A;  1V9J A;  1V80 A;  4JPS A;  4W9E A;  3K9P B;  2CHZ A;  1TZO A;  2WXH A;  2KVZ A;  4P1C C;  1K53 A;  1IUE A;  1JML A;  3P4P B;  4ZHO A;  1QOA A;  1MJD A;  2ZEQ A;  2WWZ A;  2AQ1 B;  4IW0 A;  3TJP A;  1IGC A;  2LRW A;  2IO0 B;  5CHV C;  1D5M C;  2BYV E;  5G2N A;  2MEK A;  2KQS A;  3C19 A;  2WS3 B;  4RF0 A;  3AE8 B;  2MLB A;  4ZDV A;  4CHK A;  1FNW A;  2IY1 B;  4M8N A;  5KHQ A;  2BS3 B;  4F7Z A;  3NHE B;  3EA6 A;  4NQK E;  4DXF A;  1F9J A;  1HQR D;  4C4V A;  1FCL A;  2KX3 A;  1GJZ A;  1ZE3 D;  4DQO C;  1EU3 A;  4XE0 A;  4WJQ A;  3AE5 B;  3IAM 1;  4PS7 A;  4RGO S;  2KZR A;  4HPP A;  2FNJ B;  3WIM A;  3ABV B;  1WR6 E;  3BWU D;  3HM3 A;  2QEJ C;  3GOE A;  4K1R B;  4KKI A;  5TR5 A;  2JRH A;  1TT5 B;  3P1M A;  1HTQ A;  3IXS A;  4II3 B;  2LZ6 A;  2LXC A;  2KXJ A;  3C0R B;  3IBE A;  3KQ4 A;  4KDI C;  5JHB A;  4ZYS A;  1YJJ A;  1UUP A;  2Y5B B;  3BK2 A;  4FHK A;  1GNU A;  1ET6 A;  3ZO5 B;  1D6E C;  4KV2 A;  3WCQ A;  4ACF A;  2KD0 A;  1UWX A;  3W5U B;  3IT4 B;  4XX5 A;  4IKG A;  5D3I B;  3VRB B;  3EHV A;  1M94 A;  2QCZ A;  2WXQ A;  1LGR A;  2L3Z A;  4N9F 4;  3DBS A;  2ZVN A;  2LWP A;  4IDI A;  2CU1 A;  2KAJ A;  3FIL B;  3H6N A;  4PS8 A;  1AAR A;  1UGJ A;  3V05 A;  5IKC M;  3QA8 A;  4AP4 C;  4M0W A;  5JHA A;  4HCN B;  4LNI A;  4L1B A;  4EFO A;  2QHO A;  5EDS A;  3SEB A;  3DWM A;  2MBO A;  2JYE A;  4TMA B;  4B6W A;  1E90 A;  2DYM A;  2BT6 A;  3KUD B;  1I7H A;  4M01 A;  2BS2 B;  2JXT A;  4ANW A;  4EEW A;  2Z8L A;  1MHH E;  2WXP A;  3TEY A;  1WMH A;  1MG4 A;  3AUL A;  2W3S A;  3A9K B;  5EE1 A;  5AZG A;  4WQM A;  1F1H A;  2DYO A;  1ZXI A;  2ON8 A;  3AE7 B;  2JU6 X;  1CQV A;  2N9E B;  3NS8 A;  4MH0 E;  3VUY A;  1WJN A;  1T3Q A;  4OW0 A;  1WJ4 A;  1UNS A;  1C79 A;  4TUU A;  3L08 A;  3Q8B A;  4A3O A;  4B95 A;  2V9H A;  4EKU A;  2KWV B;  1WXV A;  2DWQ A;  4W9F A;  2IYD B;  3QX1 A;  4FUL A;  4K7S A;  4BZA A;  2V3N A;  4UDU C;  2KMA A;  3CSF A;  1WX9 A;  3RYT A;  5C1Z A;  2V0G A;  1FIQ A;  3GP7 A;  4LLG M;  3RI7 C;  4PK1 A;  5DPW A;  2REX A;  4BBN C;  2MBQ A;  4MT5 A;  3DCG A;  1AN8 A;  2KLC A;  2L52 A;  3PLU A;  1WY8 A;  1R4M B;  2K5P A;  4YTP B;  4AJY B;  4A55 A;  4ASW C;  2LHE A;  3RNG C;  1HXY D;  2C9W B;  2LRU A;  3IVF A;  2PPH A;  2NVU I;  2KDF B;  4KSL C;  4MJS B;  1R4N I;  3TEW A;  4TV3 A;  4FJV B;  1WRD B;  4YT0 B;  2WXI A;  4W9C A;  1R4N B;  2B76 B;  4A3P A;  4LDT D;  3TCA A;  4MDK E;  5BMG A;  5LXH A;  2BYF A;  2GBN A;  3SU8 X;  1UBQ A;  2L8J A;  4A90 A;  1VZ6 A;  1YMH E;  2DZK A;  3LXF A;  4L2Y A;  2DZM A;  1F52 A;  3V60 A;  1SJH D;  1XO3 A;  1D3Z A;  4NJ6 A;  1V97 A;  4NAW A;  2LHD A;  2MA9 B;  2JQR B;  3OJ3 A;  1N5W A;  4S0R A;  1ZOY B;  3C8Y A;  1WJ6 A;  1XXG A;  4K7W A;  3RNF C;  2W9N A;  3R2I A;  1VRA B;  2L05 A;  3WA0 A;  2FCN A;  2MRP A;  1NYQ A;  3R8B A;  4W9K A;  4PS3 A;  4ZOH C;  1FRR A;  3ML8 A;  4RH6 A;  1KFY B;  2WX1 A;  3NS1 A;  4C56 C;  5T8I A;  2M56 B;  2N9X A;  2CHW A;  1SSN A;  1WWT A;  3RCZ A;  2BYT A;  4PYZ A;  1VZ7 A;  2MCN B;  3JSV A;  1BXT A;  4L23 A;  3EFC A;  3PLV A;  4US9 A;  1F77 A;  1LO5 D;  4BOZ B;  2O2V B;  5LNK 1;  3FKY A;  3WAN A;  2QSD A;  3ZVV A;  1WRI A;  2BWF A;  5MPO A;  5L95 C;  4BVU C;  4P7I A;  2M0A A;  5AUK A;  1IYF A;  1MHX A;  4YSZ B;  3DHH C;  4M00 A;  3QIJ A;  1TS3 A;  2BVC A;  4AS1 A;  2INN E;  4NZL B;  1FXT B;  2BB5 A;  3PRZ A;  1OEY A;  2BKF A;  1IP9 A;  1DOX A;  4XYC A;  4OZB A;  4K7U A;  1UGM A;  2J0J A;  3K9O B;  3PV1 A;  2X8X X;  4WJP A;  2QC8 A;  3V62 A;  1MFW A;  3QWZ B;  3D32 A;  1SF0 A;  2KJ6 A;  3J9C A;  1FPY A;  1Q1O A;  5BYQ A;  2N0S B;  3P4S B;  3TEZ A;  3ZXR A;  2E6X A;  3NZU A;  1EU4 A;  3V61 A;  1JWU D;  3TBL D;  3VDZ A;  1F2R I;  4JQW C;  2N9P C;  1IPG A;  2AEH A;  1ET9 A;  2N7D A;  1OQQ A;  4A8X C;  2V4L A;  3U2S C;  2JZP A;  3V6C B;  4KKJ A;  4DDG D;  3VAW A;  4K81 A;  1WI0 A;  2WXM A;  4JIO U;  4OHJ A;  1XD3 B;  3SFE B;  2G4D B;  3ZYY X;  2K8B A;  1NVI D;  2KFJ A;  1HA5 A;  4YTM B;  2CR5 A;  3NZS A;  1PYW D;  1TS5 A;  3MHZ A;  1WZ0 A;  4LCD E;  2IDY A;  4JE3 B;  5IO9 A;  4E71 A;  2GBM A;  3NZ3 A;  4AOF A;  4EOY A;  2KLG A;  3M95 A;  4BBN F;  5BYS A;  2PIA A;  1JRU A;  2Z59 B;  1ZGU B;  3T9L A;  1C77 A;  3A9K A;  3AEE B;  3Q8C A;  5H92 C;  3UGB B;  1XQQ A;  1FMA D;  2KJH B;  3Q3N C;  4HJG E;  3W1S A;  1WGG A;  4BKG A;  3L13 A;  3KH0 A;  3RZW C;  4FAD A;  2CU3 A;  1YQ4 B;  3JW0 X;  3OAW A;  2KN5 A;  4XDC A;  2NR2 A;  1C3T A;  3W1Y A;  2M4N A;  2KDI A;  1RRB A;  4MGK E;  1WXA A;  4HKZ E;  1T0Y A;  3A9J A;  3KWL A;  2ZW0 A;  1WGK A;  3BYT B;  4ZRP A;  1L4Z B;  1HZ5 A;  2HDE A;  2V1Y A;  1HTO A;  2PW9 A;  4FBJ B;  4IM2 A;  2J4X A;  2CHX A;  5CTR C;  1I42 A;  2V3P A;  2KWD A;  3M62 B;  3VUX A;  4MEL A;  2L0F A;  4DXA B;  4GDL B;  1KM7 A;  1P7E A;  2KWC A;  3ZNG C;  2FUG 1;  1OEY J;  1UEL A;  4ICU A;  2V3S A;  3QK0 A;  4ZRI A;  2AL3 A;  4MJS A;  2Y3A A;  1V86 A;  1P7F A;  5LXI B;  1L2N A;  3EFU A;  1RFK A;  3PZ8 A;  3VVW B;  3DVN V;  1PDX A;  1WXM A;  2E3T A;  1MI0 A;  3UIP B;  3A4R A;  3WAM A;  3FAH A;  5GMV A;  2R2Q A;  2O6V D;  2PEA A;  3ECI A;  2WYQ A;  1WZ3 A;  1E8Y A;  5DPT A;  1L5P A;  3BY4 B;  1QLB B;  3UIN B;  2G9H D;  1K51 A;  1I4H A;  1SEB D;  4ZHP A;  1Z2M A;  1SIJ A;  3QAR A;  4OVZ A;  4KIK B;  1PGB A;  2MHJ A;  1TS2 A;  2IO3 B;  3PS6 A;  3AE3 B;  3URY A;  1V6E A;  4YL8 A;  1NEK B;  4NJ7 A;  1E10 A;  2IO2 B;  2NTT A;  1EF1 A;  3AE2 B;  4BKS D;  4TQ1 A;  2M19 A;  2MJE A;  2I1J A;  4DK5 A;  1JWM D;  3B1L X;  1V81 A;  5FKA C;  3TUO A;  3DVG X;  3L10 B;  1TIF A;  1J0G A;  3OJ4 B;  2NBV B;  1K52 A;  4CQN A;  1C76 A;  3IAS 1;  1VCB A;  4LNN A;  2DX5 B;  2O2V A;  3IFW B;  3UF8 A;  4DHZ E;  3P42 A;  3Q3J A;  3EUB 2;  3HUI A;  4P1B C;  2JWZ A;  2L32 A;  3Q3M C;  2FID A;  4HLE A;  2LVQ A;  3HK0 A; 
#chains in the Genus database with same CATH homology
 2O6V A;  2N9E B;  3NS8 A;  5D94 A;  4MH0 E;  3VUY A;  4E3C A;  3DQV A;  1WJN A;  3QC8 B;  2K8H A;  3KYC D;  1WMH B;  3PHX B;  4NNJ B;  3SDL C;  1TZ1 A;  2K6D B;  4DHJ D;  2ZVO A;  1X1M A;  3NOB A;  1WJ4 A;  2LVP A;  2MP2 A;  4TUU A;  4ANU A;  2LAS A;  4IM3 A;  3L08 A;  2ZNV C;  4A3O A;  4B95 A;  3A33 B;  2MSE D;  4EKU A;  1OGW A;  2KWV B;  3ALB A;  3L16 A;  4WAA A;  4XZ4 A;  3U30 A;  3ZRC A;  1WXV A;  2D11 A;  3CST A;  3AI5 A;  2PE9 A;  2LJ5 A;  4GU2 A;  2B3A A;  4W9F A;  1E7V A;  2IYD B;  1UH6 A;  2KJR A;  3QX1 A;  4FUL A;  4K7S A;  5AZF A;  3S2A A;  2DHZ A;  2KMA A;  1NDD A;  3PTF C;  3CSF A;  4DDI D;  3UQA A;  1WX9 A;  3RYT A;  5C1Z A;  2MBB B;  3HM6 X;  4BKS A;  3JYU A;  5DPW A;  2REX A;  3UQB A;  4BBN C;  2MBQ A;  3BIN A;  1P98 A;  4GDK B;  3OLM D;  4JLC A;  1P9D U;  3ENE A;  2JRI B;  3DCG A;  2KLC A;  2KKC A;  3PLU A;  4AWJ A;  2C60 A;  1WY8 A;  2BGF A;  4AJY B;  1RLF A;  2VRR B;  2ZCB A;  4ASW C;  4DHZ B;  2NBW B;  4TKN A;  5DPS A;  1E8X A;  2C9W B;  4WWP A;  1OTR B;  2LRU A;  2I1K A;  2JVC A;  2NVU I;  2PPH A;  3IVF A;  2KDF B;  2NS5 A;  3PVL A;  4KSL C;  4MJS B;  1R4N I;  1YIW A;  2DZI A;  3VH4 B;  5AEK B;  1NBF C;  4TV3 A;  4FJV B;  1WRD B;  2N1W A;  4URK A;  1WH3 A;  4W9C A;  3TMP B;  1E8W A;  4KVG B;  2Z0D B;  1YX6 B;  5J2R A;  4A3P A;  4LDT D;  3TCA A;  4MDK E;  3PT2 B;  4HCP B;  3L17 A;  1Y8R C;  4GB9 A;  5LXH A;  2BYE A;  2BYF A;  4MEM A;  2IBI B;  2XK5 A;  4EZL A;  2KTR B;  2GBN A;  3SU8 X;  1UBQ A;  2L8J A;  2EMT A;  3RZF A;  5JZE B;  1H8C A;  2DZK A;  3QQ8 B;  1RFA A;  4FJY A;  1J8C A;  4ZRK A;  3ZIM A;  3PSE B;  4MGZ E;  4FLH A;  5L83 A;  1GUA B;  2DZM A;  1WGY A;  2FUH B;  2ZPY A;  4ANX A;  4KZC A;  2FIF A;  3V60 A;  3O65 B;  2KHW B;  2RR9 A;  5KHO A;  1D3Z A;  4NJ6 A;  4NAW A;  5LLI A;  2MA9 B;  2ZZP B;  4A20 A;  3OJ3 A;  4DWF A;  3KW5 B;  4F1S A;  1WJ6 A;  1S3S G;  3H7P B;  3AU5 A;  3TIX A;  4K7W A;  2C7N B;  2ASQ A;  3R7Q A;  4TQ0 A;  2W9N A;  2MW5 A;  2MBH A;  1H4R A;  2WDT B;  1LM8 B;  1Q0W B;  2KO3 A;  4CYE A;  3WA0 A;  2L05 A;  3ZNZ B;  4DHJ B;  3HIZ A;  5IAA C;  4ANV A;  3DVG Y;  2KOX A;  3VTU A;  4HXD A;  5D2M B;  4NAW B;  2FCN A;  2MRP A;  2G3Q B;  1TGZ B;  4W9K A;  2LVO A;  4PS3 A;  1EUV B;  2NPT A;  3KYD D;  4M0W B;  3KUC B;  4W9I A;  5D6J B;  3RD2 A;  1Q5W B;  3ZDT A;  3ML8 A;  2KFK A;  3M63 B;  4I6N B;  2JY6 A;  2BWE S;  1P0R A;  2KQ7 A;  2L7R A;  2L0T A;  3B08 A;  2KDB A;  5C23 A;  1S1Q B;  3PHW B;  3WAO A;  4HDO A;  4WQO B;  2XBB C;  3I3T B;  2JZZ A;  2WX1 A;  3Q3F A;  2N9X A;  4FN2 A;  2CHW A;  1NI2 A;  4ICV A;  4IG7 B;  1GC7 A;  3RCZ A;  4W9D A;  4PYZ A;  3WAP A;  4MGI E;  3JSV A;  2JXX A;  2MCN B;  4HK2 A;  4WWN A;  2ZNV B;  1YD8 U;  1EF5 A;  3VUW A;  2JUO A;  3L0W B;  4X57 B;  2KFK B;  3KUZ A;  2FAZ A;  3ZKJ C;  1LQB A;  2LGD A;  3PLV A;  5G55 A;  1RAX A;  4BOZ B;  2O2V B;  1V5O A;  2CKH B;  2KX0 A;  4GXB A;  4KZ0 A;  3APD A;  2L76 A;  1WIA A;  1SIF A;  2LD9 A;  3WAN A;  3VQI A;  3DPD A;  3JSV B;  2BF8 B;  1HE8 A;  3ZVV A;  4HVB A;  3N32 A;  2KDE B;  3U7D A;  3H7S A;  2BWF A;  5L95 C;  2O6V B;  4BOS C;  4BVU C;  3H9D A;  3VXW A;  4NPN A;  4P7I A;  2GBK A;  3UIO B;  3SHQ A;  5J17 A;  1IYF A;  2J0K A;  3X0W A;  3ZLZ A;  3QIJ A;  4FJZ A;  4KSK C;  1E7U A;  2MWS B;  3M3J A;  3VTW A;  2J0M A;  4WJO A;  2LGY A;  1FXT B;  4JL9 A;  5J18 A;  1PQS A;  4FHJ A;  2MP2 B;  1LXD A;  2Z0E B;  3ZTC A;  1E5W A;  2ZPN A;  3APF A;  3LJ3 A;  3PRZ A;  3DBH I;  1OEY A;  1A5R A;  2BKF A;  3WAL A;  3N3K B;  1IP9 A;  1XT9 B;  4I6L B;  3W1S C;  4K7U A;  2RGF A;  4HPL B;  1UGM A;  2DEN B;  2J0J A;  4HWI B;  5CHW A;  3K9O B;  3PV1 A;  3HHM A;  5CX3 A;  4G0N B;  2FCQ A;  5E6O A;  2XEW A;  2AYO B;  4WJP A;  2EKE C;  4B9K A;  1ISN A;  3V62 A;  3H1U A;  1CMX B;  4KDL B;  1WFY A;  3QWZ B;  4GN1 A;  4MSM B;  3D32 A;  4IM0 A;  2C5L C;  2RPQ A;  3PPA A;  2PJH A;  2KJ6 A;  1YQB A;  3RT3 B;  3QCA A;  2KC1 A;  1ZKH A;  1Q1O A;  1BT0 A;  3PGE A;  4FA6 A;  3L54 A;  3NY5 A;  3SD5 A;  2C7H A;  2PE6 B;  3NZU A;  4IWQ A;  3V61 A;  3TBL D;  1WX8 A;  2RD0 A;  3VDZ A;  3PZD A;  4II2 B;  3A1Q A;  2JF5 A;  4JQW C;  4ZRJ A;  2N9P C;  1VD2 A;  4LJO B;  1IPG A;  2AEH A;  3R3M A;  4GMV A;  1QZE A;  2LXA A;  3PRM B;  4RM8 A;  3IHP C;  4W9L A;  1E8Z A;  1SE9 A;  2D2Q A;  2FCM A;  2N7D A;  2FCS A;  1SGH A;  1WGR A;  2HD5 B;  1V2Y A;  2V4L A;  3QAQ A;  2M17 A;  3V6C B;  2M1M A;  2KVR A;  4JGH B;  1Z5S B;  5E6P A;  1KLV A;  5CHF A;  2DZJ A;  2KWU B;  4KIK A;  4DDG D;  2KC2 A;  2XK5 B;  3IG3 A;  3VAW A;  1WJU A;  2YVC A;  4K81 A;  4EZK A;  3U8Z A;  1C1Y B;  1WI0 A;  1I35 A;  4JIO U;  4GGQ A;  1P3Q U;  4EZJ A;  4MM3 A;  1XD3 B;  2M0X A;  2G4D B;  3PRP B;  2HE7 A;  2MQJ A;  2DAF A;  2K8B A;  2KFJ A;  4MSQ B;  3P2B A;  3N30 A;  1YX5 B;  2CR5 A;  2R2O A;  3NZS A;  3DDC B;  4G3X B;  4IWP A;  2IY0 B;  3AU4 A;  2DYB A;  3ZUN A;  1WZ0 A;  4LCD E;  3APC A;  4E71 A;  3RUI B;  4AUQ C;  4HJK A;  2WX0 A;  2GBM A;  4AOF A;  2KTF A;  4EOY A;  2KLG A;  2D3G A;  3M95 A;  2MBE A;  2N4F A;  2GBR A;  4BBN F;  4EUT A;  2CS4 A;  4HPM B;  1WM3 A;  2D07 B;  1JRU A;  3X23 A;  1GG3 A;  4W9G A;  2IO1 B;  2K1F A;  2Z59 B;  1ZGU B;  2AL6 A;  2YLM A;  1LFD A;  2L00 B;  3T9L A;  1UBI A;  1V9J A;  3VH3 B;  2GBJ A;  2NBU A;  1V80 A;  2NPT B;  3A9K A;  2C7M B;  4W9E A;  5HKH A;  3QHT A;  4MGY E;  3TL5 A;  2BKR B;  3MTN B;  3ML9 A;  3UGB B;  1XQQ A;  3K9P B;  4G11 A;  2KJH B;  2CHZ A;  4IC7 B;  3W1S A;  4GSW A;  1WGG A;  4BKG A;  3L13 A;  3KH0 A;  3ZDM C;  3RZW C;  4FAD A;  1TBE A;  2DAJ A;  3JW0 X;  3OAW A;  2KN5 A;  4NY0 A;  4NQL B;  3DOW A;  4GOC A;  5D7G A;  4HDQ A;  1WGD A;  4XC2 A;  2ZEQ A;  3CMM B;  2NR2 A;  2G45 B;  1EO6 A;  2LUE A;  2WWZ A;  1C3T A;  2LGX A;  4IW0 A;  3TJP A;  3PRE A;  3W1Y A;  2M4N A;  2KDI A;  2LRW A;  2JPH A;  2IO0 B;  5CHV C;  4ZYN A;  1RRB A;  4MGK E;  1WXA A;  5E6N A;  1T0Y A;  2BYV E;  1UD7 A;  2JT4 B;  5G2N A;  3A9J A;  2LI5 A;  2K25 A;  3R66 C;  1K8R B;  1WE7 A;  2KQS A;  4LDT B;  2MLB A;  4E74 A;  1YJ1 A;  4GDL A;  2V1Y A;  4ZDV A;  2G4S A;  4CHK A;  2IY1 B;  4FBJ B;  4IM2 A;  2CHX A;  4M8N A;  5KHQ A;  5CTR C;  1WXS A;  4F7Z A;  1U4A A;  3NHE B;  1I42 A;  2UWQ A;  4NQK E;  3M62 B;  3ONS A;  3VUX A;  3A9J B;  1F9J A;  1WR1 A;  4MEL A;  2L0F A;  5IA7 A;  4DXA B;  3JVZ X;  4J6I A;  3CF6 E;  2KX3 A;  4GDL B;  4GDK A;  1GJZ A;  2OJR A;  3T8M A;  2KNB A;  1KM7 A;  4IUM B;  2KAN A;  2KWC A;  4F8C B;  4WJQ A;  3ZNG C;  5FR6 A;  4BKT A;  4PS7 A;  1OEY J;  1UEL A;  1L7Y A;  1WF9 A;  1WYW B;  2KZR A;  2V3S A;  2OOB B;  3MJW A;  4ICU A;  3MHS D;  2IZV B;  2FNJ B;  3R7R A;  2MX2 A;  3WIM A;  4DBG A;  1WR6 E;  3QK0 A;  1MG8 A;  2AL3 A;  4MJS A;  4OVU A;  4ZRI A;  3HM3 A;  1V86 A;  3ZNI D;  5JH5 C;  1R4M I;  3LDZ E;  5LXI B;  1L2N A;  3EFU A;  1G6J A;  3GOE A;  4K1R B;  5TR5 A;  2JRH A;  3AXC A;  4PYU A;  3VVW B;  1J19 A;  3DVN V;  1WXM A;  4II3 B;  4WWO A;  2LZ6 A;  3VFK A;  2LXC A;  2KXJ A;  3C0R B;  3IBE A;  3UIP B;  1P1A A;  3A4R A;  4KDI C;  5AZH A;  3WAM A;  2KTR A;  5JHB A;  4M8M A;  2Y5B B;  4FHK A;  5GMV A;  3DBR I;  2R2Q A;  4RMA A;  1GNU A;  3ZO5 B;  2O6V D;  2PEA A;  3ECI A;  2WYQ A;  1WZ3 A;  3EEC A;  4KV2 A;  3A1Q B;  1E8Y A;  2EMS A;  2KK8 A;  3GZN I;  5DPT A;  4GIV A;  3BY4 B;  1WGH A;  4IWO A;  3ZNH B;  2KD0 A;  5DPR A;  1V49 A;  2K8C A;  3UIN B;  2GMI C;  2GOW A;  1OQY A;  4XX5 A;  1Z2M A;  4AJW A;  2ZCC A;  3QAR A;  2JZ3 B;  1UZX B;  1WE6 A;  2AWT A;  2M8S A;  1ZW7 A;  3EHV A;  3QJZ A;  1M94 A;  3EC8 A;  3H7P A;  4KIK B;  2BPS A;  3DBL I;  3ZW3 A;  2IO3 B;  1WX7 A;  2L3Z A;  3PS6 A;  3DBS A;  4N9F 4;  2ZVN A;  2RSU A;  1V6E A;  4YL8 A;  2LWP A;  3RUL A;  2CU1 A;  3H6N A;  4NJ7 A;  2K39 A;  4I6P A;  4PS8 A;  1AAR A;  3ZTD A;  2IO2 B;  2D10 A;  3QA8 A;  4AP4 C;  1WM2 A;  5JHA A;  1EF1 A;  1TTN A;  2NCN A;  4BKS D;  3A4S C;  3B0A A;  4HCN B;  4TQ1 A;  4EFO A;  2QHO A;  5EDS A;  5DCN A;  2I1J A;  4DK5 A;  3B1L X;  3V6E B;  4BFR A;  1V81 A;  2MBO A;  4B6W A;  2A4Z A;  2J7Q B;  1E90 A;  2K6Q A;  2DYM A;  3ZRF A;  3KUD B;  3DVG X;  2N7E A;  3L10 B;  3KVF B;  1J0G A;  3OJ4 B;  2NBV B;  4CO7 A;  3DVN U;  4RM9 A;  4OVV A;  4W9H A;  2HJ8 A;  2ZJD A;  4ANW A;  1V5T A;  2KMC A;  4EEW A;  1VCB A;  4G50 A;  4WJN A;  2DX5 B;  2O2V A;  3IFW B;  2UYZ B;  3UF8 A;  1WMH A;  3AUL A;  3VHT C;  4LJP B;  5BO4 B;  4DHZ E;  1GC6 A;  3A9K B;  3Q3J A;  2A5U A;  2HTH A;  2JWZ A;  5AZG A;  1KOT A;  2FID A;  1KJT A;  4W9J A;  4HLE A;  2LVQ A;  3HK0 A;  2DYO A;  2N1V A;  3VTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...