1AILA

N-terminal fragment of ns1 protein from influenza a virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
b'MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSTRUCTURAL PROTEIN NS1
publication title Crystal structure of the unique RNA-binding domain of the influenza virus NS1 protein.
pubmed doi rcsb
molecule tags Rna binding protein
total genus 29
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1997-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ailA00
2UXBO 1N36O 5A2QN 4JI3O 3O65A 1DK1A 4LF4O 1FYJA 2F4VO 1N32O 4DV5O 3T1YO 5BR8O 4LF9O 3R66A 4NXNO 2VQEO 4DV0O 4X66O 1HNWO 3M8AA 1YZBA 5IT9N 1J5EO 2AGAA 3J7AU 4B3SO 5BXZA 1HR0O 4DV6O 4LF7O 1X59A 4JI6O 5LL6Y 1FKAO 1G1XB 4LF5O 2HHHO 1IBKO 4K0KO 4LFBO 2N74A 1XMQO 5IWAO 4GKJO 2JRIA 4LFAO 4JV5O 2UXCO 4X62O 2ZM6O 4DV3O 4LFCO 4JI5O 2ZKOA 3F5TA 4X65O 2FKXA 2UUBO 4GKKO 1N33O 3J81N 2UU9O 4LF8O 1R6TA 2UUAO 2DJVA 3SDLA 1NS1A 4B3MO 4JI1O 5H5NA 5LMNO 1AB3A 4A5UB 3J80N 4OPAA 4YHHO 4JI2O 1I94O 4DR4O 1F7YA 3T1HO 4JYAO 2DOSA 4DR5O 4B3TO 4OX9O 4DV2O 2UUCO 1KUQA 4JI7O 1D2DA 1HNXO 1IBMO 4YY3O 4DR1O 4JI8O 4JI0O 4AQYO 4DV1O 3RT3C 4DV4O 3JAMN 1N34O 2Z0AA 1AILA 4LF6O 4B3RO 4DR3O 4JI4O 2VQFO 2UXDO 1R1BA 1IBLO 3OTOO 5LMUO 4DV7O 4DR6O 1A32A 4OPHA 5BY1A 4DR2O 4NXMO 2E5LO 1HNZO 1XNQO 4X64O 5FLXN 1XEQA 4DR7O 4KHPO 1XMOO 2LW7A 4DUZO 4DUYO 1XNRO 1FJGO
chains in the Genus database with same CATH superfamily
3CWBH 3E86A 4NXNB 1SQXH 1K97A 4LNUB 1JX9A 4FLVA 2QM4A 1GN6A 1TA8A 1FFXA 4J11A 1LUWA 5LXTA 4Q6GA 3B4SA 4WFHA 3ZHRA 1YCIA 4LF4B 4X62B 5IYBO 4DV6O 1VF5B 3UKMA 4MTOA 3ZHSA 1V9PA 4DV3B 2LQTA 2RN9A 3C3SA 1O9GA 2AZ0A 1ZL8A 3AK2A 3QF7A 5BZBA 4Z1MG 2IW5A 4H0LB 4ZKIA 2FKXA 2IU0A 5HFLA 3FFQA 1Z5WA 5CA1B 2XT9A 3TGUH 2DJVA 4JAAA 3OD4A 3AEIA 1HWYA 2YXHA 1SRYA 5A9GA 1IBMB 2DQ3A 4I9WA 1XQ8A 3I55V 2N04A 2ZE8A 4RQFA 3VQWA 4DV1B 4TT3G 2VWJA 3ABMB 1ZWIC 2WLLA 5LGUA 1IVSA 2CH7B 2KKWA 3K9AA 3OFNG 3HKEB 5EYPA 3QVNA 1ZLZA 2X7RB 1P7BA 1K7DA 2DE0X 4I0XA 3SYOA 4MVQA 5JVDA 4DK1A 2EIKC 5KMGB 4UVCA 2Z3YA 4GYCB 1K4DC 1N36B 4X64O 5KA5A 3ZRSA 4J7KA 3Q4HB 1XEQA 3A0HZ 4DR7O 2ZNJA 3OGCC 3ASOC 3E35A 1OCZB 1QR9A 4R50A 1XNRO 1BE3H 1K3EA 1NI8A 4CC6A 5A2QN 4X1IA 4JI3O 1QLEC 3E2EA 3AG2B 1AR1B 1HR0B 3FB5C 3PJSK 5BR8O 4RQEA 1S0VA 3OEEG 5EIBD 3CX5F 3EHBB 5LYJB 1YF2A 5KUMA 1YZBA 5EC2C 3K5NA 2KG7A 1XMQB 5IWAB 3T4ZA 3CRMA 2XNDG 1VQ7V 2QR4A 2WWWA 1R3KC 5KLVH 5H6RA 5CB4A 3L74H 5B1AC 2LJ2A 1P49A 4QNHB 1SERA 2JRIA 4LWSB 3UQ8A 4JV5O 1KMIZ 4GX0A 3CC2V 4C7UA 1MMMA 4B08A 3GWOA 1IURA 4GKKO 1YIJV 2BE3A 3X2QC 2UUCB 1BCCH 2XHBA 3G80A 1VQPV 1K5SA 4JI1O 2IJJA 4ZOLB 4BIUA 4WFFA 3JSLA 1CPYA 2A0LA 3K5LA 5IJ9A 4W4KA 1BHAA 4PDVA 1NVPD 2VRZA 4MTGA 2HP8A 1YXBA 3ETQA 2CGNA 1EFRG 3DXRB 3HB3B 1KC8W 3RT3C 4BAYA 3B09A 4P9PA 3EVKA 4WFAV 2EINC 4WFGA 3JATB 3RYHB 1NKDA 4JYBA 1SC5B 1WP7A 4KL1A 5CMUA 4DV4B 2X6BA 2WA4A 1VQNV 1XNQO 5L3GA 1RFYA 5KHGA 5IE9A 1MSWD 1MABG 1Q7YW 1EZJA 1S76D 2JGDA 3ABKC 5LHHA 1Y76B 2LFRA 2F4VO 2Q68A 2DMXA 2WLMA 4BIZA 3B40A 1J5EO 4F6EA 3W7XA 1Z2GA 4PA9A 1RM1C 4H13B 4MVUA 1B04A 3FYIB 2Q69A 5FL7G 1WNSA 4GZRB 1IDSA 1G1XB 3L71H 2UUBB 1EZVH 4YJ3A 5FNVB 2HLDG 4GKJO 4JGSA 1Y6XA 1WJZA 4JI5O 4U3JB 5GW7A 3SPCA 4UCUA 3FAVA 2IJHA 1ZAUA 1K73W 4CS4A 4JF3A 5LOVA 3N2KB 5H9CA 1GK9A 4NTXA 5K1XA 2CTQA 3L9DA 2YSUB 5IJ0B 1R3JC 4CH5A 1S5HC 2DW4A 2V7QG 3K79A 3ZRWA 4J9YB 1IBLB 4IIJA 3OTOB 3E8FA 4EB6B 2F43G 4CH3A 3SPJA 5TISZ 3AG3C 4N23A 3RYCB 2OTJV 1QHTA 3APOA 5DECA 1MNGA 3S3XA 3SR2C 5BMVB 3ZN0A 1AJNA 1RPRA 5JQGB 2FMLA 2ODMA 1MG1A 2UXBB 1BQ0A 3DSQA 3JASA 1GAXA 2AXTZ 1U96A 1B06A 2PZSA 5LA6A 2DYSB 4I5SA 2E5LB 4JTCB 1I5YA 2HKOA 4LF4O 1M4UA 2DYRC 4FMTA 3W7SA 1F4MA 2YI9A 1OCRC 5B1OA 2WA3A 3FD9A 1DTOA 3FX7A 1VQLV 1OCOB 5IT9N 3K58A 1E1QG 2Z5UA 5EBMC 4LFAB 4MT8A 5KUKA 4UFZA 1MZFA 2P4VA 4HAMA 3APQA 4JI6O 2PTMA 2UU9B 4LF8B 1M9NA 1YSCA 2WLIB 1FFXB 2CUGA 3WG7C 3DC5A 3C90A 4X89A 5EBLC 1XI1A 3U10A 5LXTB 2WLJA 4WFBV 4LFCO 1KP2A 3RYFA 3SDLA 4DV2B 1UPGA 2AHYA 3BA8A 4JI8B 4O2AA 1ZL8B 1WAZA 4JYAO 1N4CA 4PV1B 4UV9A 2E76B 3SJBC 4LC1A 1NT2B 5K1PA 1V55C 2JK5C 3W7UA 4AQYO 1JR9A 5FPRA 1QLNA 2Y69B 1UJWB 2YXLA 3ZHQA 3M99B 4IGGA 4D7SA 3IGAC 4LF6O 4TV9A 3P32A 4PDRA 1R6NA 3KCXA 3AG4C 2WLLB 1NTZH 4X1KA 3ICXA 5LMUO 4UCRA 1VQ8V 3HPLC 2RCVA 4NXMO 4J7JA 4NR1A 5EYPB 5LHIA 4FLUA 2KSDA 4WF9V 5EK0A 5LHGA 1F51A 4JYCA 1Q43A 4MSWC 4I0XB 1BT8A 2PYJA 4LR3A 5JVDB 2Q0AA 4U7NA 3SYAA 2GUZA 4R6ZA 3ASOB 3WB1A 3O65A 2V1DA 1QNMA 4X88A 1EBOA 5CBHA 3A8TA 3FKSG 2IJIA 3E22A 3ZMTA 1QLEB 4UCTA 1HNWO 2Q0OC 1F23A 2HHHB 1IBKB 4O4LA 4E2LA 3J7AU 2UXCB 1AROP 4X1IB 1FXVA 1XUQA 1XHZA 1KP3A 4LF7O 3K03A 1J95A 2Q67A 2R9IA 1XILA 4PA4A 3VBBA 2VWKA 2ZM6O 1JQ0A 5B1AB 2AHZA 2KG7B 1B6QA 5LGNA 1GTOA 2HJFC 4DR4B 2WLKA 1Y74A 4G28B 1G4YB 3SJAC 1L8DA 3AG1C 4LH7A 2A79B 2ZE5A 4NVPA 1XOUA 5CB4B 4DR1B 4JI2O 3X2QB 2Q6AA 4IHJA 1AI7A 3CSXA 2RQ6A 5EZYA 5HFMA 4GCZA 5AG2A 1TUEB 1JJ2U 4JI4B 1S3JA 1T5EA 3D8CA 3L75H 2ZXWC 4DV4O 3CE2A 3LDEA 5IJ9B 5KHIA 4O4IA 1YHQV 4QE9A 3ZHTA 2Q4PA 2HFEC 4FM1A 4HZ3A 3QO8A 3OT7A 3AK1A 1EN4A 3RBZA 2LW7A 1KBHA 3HKDA 3JCZA 4FZ1A 4D6TH 4PA6A 4BWAA 4WBNA 3UO3A 2JJ2G 4DV5O 4KHPB 4CZZA 3ABKB 4H33A 2VQEO 2GHYA 3M8AA 3BVOA 4UVAA 4JTDB 1NTKH 2ITCC 5DM6V 2JGDB 2Q7HA 3ETEA 3SYCA 2QM8A 2EILC 1Y67A 2D2CB 2JS3A 2EIJB 1RM1B 1CXZB 2UUAB 4I50A 2QSAA 1XL6A 5LMNB 3THOA 1S5JA 1Q6HA 2GSMB 4YHHB 2OCCB 2WLIA 2PI5A 1NR7A 5CN0A 2QKCA 3JSNA 3JD2A 4B3TB 4OX9B 3CEIA 2C2AA 3IC9A 1VQKV 4L8JA 4XDLA 3H1HH 3KZIZ 4YJ3B 4BW9A 5EBWC 1I94O 1NVPB 3H1JH 2QJ1A 2A7WA 4X9QA 3K5MA 1O9HA 2M7WA 4JI7O 4MW3A 4FLXA 5H6QA 3FAVB 1KU9A 2W0XA 5D5QA 3JARA 4O2BA 1S5LZ 5LOVB 1Q90D 1Q5OA 1K4CC 3RWRD 1ENVA 3TK1A 2VQFO 4HNAB 1QCEA 5CA0A 3CD6V 2P4KA 4U7OA 2RJZA 2PI4A 1Q6IA 4UB6Z 2GTSA 2HR3A 4DRXA 3U0ZA 4OPHA 3TXQA 3AG3B 3QTCA 1JJOA 3ZRWB 4OXSA 2MK3A 2E5LO 2MW2B 3BY6A 5B3SB 1R6KA 4IIJB 1HNZO 3F5WC 2P6JA 3RFRA 5LBQA 3SJQC 3D36A 1ROPA 3CCQV 3E83A 4X66B 2QA4V 2EIMB 2F93B 4H44B 1LR1A 2EX3A 2HG5C 3D36C 3K9SA 3K0GA 4RO2A 1G6UA 4Q20A 1AVMA 4LF9O 2Y4UA 3JASB 4DUYB 1B3QA 4MVRA 1PD3A 4DV0O 3AK3A 4DYLA 5LA6B 1Y66A 4K0KB 1OCRB 2UXNA 1WPXA 5L3DA 3TXSA 1OCCC 1GM8A 1LUVA 4KXRA 1AP6A 3H1KH 1K8AW 5F2VO 1P4RA 4JYYA 2ZKOA 4X65O 1I5XA 2W6JG 4FLTA 4WFEA 3WG7B 3T1HB 4PI0A 4BR6A 4IYIA 3CXCU 3DTUB 2XUMA 2ATKC 3W7TA 4IT5A 4CS3A 2QEXV 2A3QA 2BOBC 1KUQA 2QTSA 1HNXO 3BAAA 3RYFB 4B3MB 3RN4A 1X4TA 3QO7A 4JI0O 4MVOA 2H3OA 1IX9A 4DR5B 4O2AB 1HW7A 4DR6B 3P30A 4PJ0Z 1AJQA 2KQXA 4IL6Z 3ZX6A 5IY5C 3RW0A 4QJFB 4JAVA 1V54B 4J41A 4F4LA 1YI2V 2XAHA 4KUMA 3CCMV 1RSOA 1H2MA 1PV0A 4TV9B 2JIZG 5KA6A 1SQBH 1KKDA 2CTRA 3LSSA 4X1KB 2RNBA 4UCSA 2WLHA 2A9HA 4FLZA 3K06A 4X20A 1VMGA 1SZXA 4B3SB 1DF5A 1N32O 4XDJA 2D3OW 1VF6C 1P84F 3HKCA 5KX5A 2XTAA 4LFBB 1Q6UA 1GN2A 2FTKA 2GUZB 3ASNB 3T2MA 3OR7C 3LSQA 1U97A 4QE7A 1K9MW 3E22B 2Y0IA 3IFXA 1VP7A 4AI8A 4O4LB 1GMGA 1N33O 3STLC 4LF5B 4GT1A 5C93A 3OW2U 3AG1B 2DQ0A 4ZIBA 2DOSA 2QTOA 5LP6A 2EBOA 4JPRA 2QKSA 3P3NA 2P90A 1D2DA 2V4DA 1M57C 1Y74B 2QWQB 1QVFU 3ZEDA 4B3RB 3FB7C 2AW9A 1M93A 4PHZA 5LP6C 4R7CA 2RMKB 5E1AC 3JAMN 3ZRXA 2Z0AA 2BTOA 1JFFA 3S3WA 4DR3O 4IHJB 4JAUA 1BQZA 2FB5A 2B9ZA 5EZYB 4FFBA 3UT5A 1BL8A 4O4HB 3OAAG 4FM2A 4HNAA 2ZT9B 2CTPA 1FJGB 1NZ6A 3HR0A 3L73H 2BOCC 4P9OA 4ASUG 1M56C 4JTAB 1NH2D 3HKBA 4ABMA 4KHPO 2GDSA 2LP7A 4O4IB 4DUZO 3SPIA 3SYPA 4GX5A 3MD0A 4Z2WA 2Y4TA 4LP8A 3ABLB 1GM7A 4QPJA 4X1YA 2ZE6A 3STZC 4DV6B 2H94A 4FJCC 4NXNO 2JEUA 2JEXA 3HKDB 1EN6A 3BABA 1QU7A 4UV8A 4WBNB 3ABMC 3OM3B 3N27A 1WPBA 2YEVA 5JH7A 2B1GA 3D3QA 2N74A 4X62O 3LNNA 3MHHC 4DV3O 3CJHA 1DLBA 3GWKC 1H2SB 1NBMG 1H2GA 4UB8Z 4OPAA 3PN1A 1PM9A 3ZMSA 1VQ6V 4I50B 5KHJA 2RDCA 1KD1W 5CBFA 1IXMA 1S72V 1IBMO 4BW5A 2LGQA 4UUJC 4DW1A 4RWUA 5B66Z 1D5AA 3KCYA 2VS0A 1L0NH 2P5OA 4DV1O 1CEZA 3AG2C 3CXHF 2N05A 4X64B 2BCCH 1GN3A 2ZINA 2GV9A 4MVMA 3FYEB 3LUTB 4ZI7A 1YJ9V 5IDJA 4DR7B 4XBFA 1XNRB 2IH3C 1YJNV 2CGOA 3JARB 4O2BB 1EN5A 4LBEC 3ZS8C 4JI3B 1XBLA 5IYDO 1JOYA 3JYCA 3ZIAG 3VQYA 3SJCC 4DUYO 5CA0B 5BR8B 3CRCA 1YTFD 3UCSC 2ZR2A 3CRQA 1N36O 4DRXB 4RUFA 1XMOB 2ITDC 3CMEV 1TUBA 5LGTA 3I56V 2EIKB 2LGWA 3OTFA 2QWPB 2YIDA 4CH6A 3TETA 1SA0A 2YS8A 4RAIA 2R9AA 5C8YA 1HR0O 4JV5B 4OGQB 4PDMA 3T1YB 3ABUA 3R65A 2PYLA 1TAEA 1XHXA 1Q86W 3F7YC 4GKKB 2NNUA 1FXKA 3G6EV 1M5IA 1XMQO 5IWAO 5GTIZ 4CS2A 4FLYA 4JI1B 4MW8A 1D5NA 3LNMB 1IXBA 1LNQA 1FXKC 3RYIA 3ZMZA 2QGNA 1W0KG 3CC4V 2UXXA 4B3MO 4I7ZB 4EFEA 3GVMA 1H8EG 2IJKA 3DGEA 2ZIMA 1PL0A 1KYOF 4JASA 4NB5A 1F7YA 1VQOV 4TQDA 4DR5O 2UUCO 4FZ0A 4LH6A 1N0NA 2X6AA 1K34A 1RPOA 4MTFA 3WB2A 3M7MX 3ETDA 2H8PC 1JCHA 1TVKA 1XNQB 4PI2A 5J2UB 1AI4A 1W59A 3JD3A 3RVZA 4DK0A 3AG7A 5JCOC 4O4HA 2OYQA 2UXDB 4PA3A 3A2FA 2F4VB 2JGUA 2ADQB 1W2BU 1ZUQA 4F6RA 3SYQA 1GKFA 2BTQA 4CBCA 1J5EB 1RSOB 3CCUV 2EINB 2LFSA 3T4DA 1UFIA 2Q8VA 4PA7A 2PY5A 3K08A 3WFVA 3CCJV 1G8MA 5L3CA 4GKJB 1Q81W 1COWG 5JWPA 5J9PC 3KKYA 1SQFA 4X20B 4DXWA 5J2TA 1Q82W 3OUSA 3QNEA 1FXHA 3ZBHA 4LF5O 2ZDIC 3T1CA 4MVSA 5FPOA 3C3TA 1MA1A 5KAFZ 3CMAV 2YDEA 3UO2A 3HKCB 5KX5B 2UUBO 4ZHQA 3BHPA 1H8HG 3L72H 3F7VC 5IYCO 3VOUA 3OMNB 1KKCA 3CYOA 3WU2Z 2E74B 4N21A 1XREA 1GO3F 3ETGA 5ITZA 5B1BC 4TUYA 4R8CA 3O9OA 2DYSC 3L70H 1ZX3A 1FAFA 3MDSA 1AILA 5LP6B 1SQPH 2L6LA 1N0JA 2ARHA 3B2EE 4GX2A 5KAIZ 2IH1C 1OCOC 1IBLO 3OTOO 5L3BA 4I55A 2XAQA 5L3EA 3ML0A 2GTAA 2B1IA 3WB0A 2QE7G 4FM0A 1PNKA 3G67A 2ILMA 3K04A 4YXWG 1JFFB 1FPOA 2EZPA 4ICGA 1SETA 2QWNB 2UXBO 4FFBB 2CAZC 3UT5B 3EXAA 4DR2B 3OMAB 1M56B 3G71V 3G4SV 3CB2A 1WLEA 1SF9A 4E4EA 4BIOA 1YJWV 1BMFG 1WN7A 2E75B 3A0BZ 3HKBB 4JI6B 1W0JG 1SQQH 2Q7EA 1VQ5V 2PF4E 2R70A 4PDLA 2WLNA 5H2FZ 3JAWA 4LFCB 1X59A 4X1YB 1FKAO 1KECA 3H9VA 1P7GA 3H01A 1VEWA 4TQFA 4LFAO 4Z1VA 4IYHA 3KG2A 3LDDA 2Y69C 4WCEV 3F5TA 2ZR3A 1XDCA 2L35A 3EFFK 1H2LA 2XAFA 3J81N 2DYRB 2UU9O 4LF8O 4JYAB 1R6TA 1PNMA 2HJDA 4PELA 2NN4A 2WPDG 2YEVB 5IYZA 4FLWA 4X8AA 2JJ1G 5JH7B 4HBNA 1AB3A 2YIBD 4TV8A 3GB7C 4AQYB 3JALA 4DV2O 4AHCA 1BS3A 3CJHB 2XAGA 2DN9A 4JI8O 2QWOB 4LF6B 1R73A 3CS5A 1WA8A 2R72A 4CC5A 5LMUB 2OIEA 1RP3B 2CDYA 1PL4A 4NXMB 5DEDA 2CK3G 3N2GA 3IAYA 1DGSA 5BY1A 1N34B 1NH2B 1VQMV 5J2UA 4GLXA 1SKVA 1WB7A 3JAKA 4I4TA 1XMOO 5EC1C 4DV7B 3E89A 1ZSPA 3RVYA 1JA8A 1V55B 3U11A 4J10A 4ZI7B 4K8XA 1KB9F 1HNWB 4B7KA 5GONA 1NQTA 1OHHG 2F66C 1FYJA 2QM7A 4J80A 3T1YO 3BEHA 4W4LA 1NR1A 3R66A 3ZMUA 1FS0G 1H2NA 4UCVA 3AG4B 4LF7B 3ZRVA 5L3FA 2BSKA 2AGAA 1WP8A 2ZNIA 1HDJA 3UM7A 2WAMA 4TWKA 4J9ZB 2ZM6B 2YIBA 3LDCA 2HHHO 3NR7A 4UVBA 1IBKO 1VF6A 2ZD9A 2JDIG 2HVKC 2UXCO 2Q7GA 4RUEA 1TUBB 3B8NA 4O4JA 1VF7A 3W7WA 2LO1A 4JI2B 3TCUA 1FFTB 1SA0B 5C8YB 2ZIOA 3K5OA 1MOFA 1ORQC 4B7EA 3J80N 3K0DA 1FXKB 2XASA 2FL4A 4DR4O 4P30A 1Q3EA 4FPPA 4KFMA 2ETNA 1M90W 2EULA 2HEPA 4DR1O 2PGGA 1H38A 3RYIB 2E3CA 3VQXA 4J7ZA 1JMKC 1QVGU 5CA3A 4NKGB 2ZE7A 1THZA 2NLJC 3E8BA 5EIBC 4EEQA 4YY3B 3I5DA 2LW1A 4JI4O 4YJ2A 2UXDO 3LSUA 1R1BA 3OUFA 1Z5VA 5JJEB 2CE4A 4LNUA 2Q9LA 3SPHA 1N8RW 1BHBA 2F1MA 3IJ4A 2ZCEA 4FIPC 2EIJC 2EJ7A 3MAQA 1YTFB 3JD1A 1TVKB 1L0LH 4CH4A 2K1EA 4ZBMA 4DV5B 4FFKA 4GUNA 2VQEB 3CC7V 2OCCC 2B5UA 3QO5A 1GRJA 2ZXWB 1H2KA 4NTWA 2XOKG 3CCLV 3FB6C 2HVJC 4F6RB 3G6BA 4QGPA 2OTLV 1GM9A 2BTQB 2AZ2A 5CA1A 3FB8C 3TJTA 1URFA 1ZTEA 2QDOA 2IBZH 1K33A 3K57A 2Y0PA 1MSDA 5E79Z 1NTMH 4U3FH 3B77A 1I94B 2Y48A 3BPZA 1I7FA 2X6CA 2UUAO 4TOIA 3BFRA 5J2TB 2CH7A 4JI7B 5LMNO 4H37A 1GH6A 4D7TA 4MVZA 3HKEA 4YHHO 1FD9A 1NU1H 2DWDC 5B3SC 3JD4A 3BA9A 4B3TO 4OX9O 1I0HA 3BCCH 2P67A 1XL4A 2EILB 3BRCA 4ZHQB 2QKAA 1EM1A 5KMGA 2VQFB 1BGYH 3CCVV 5B1BB 3P3PA 2QWRB 2YXYA 2EIMC 4GX1A 3CPWU 3Q4HA 3ZJZA 3CRAA 4J42A 4NYKA 1HNZB 2OCHA 2GBOA 1AJPA 5ITZB 4TUYB 1A32A 1F4NA 4DR2O 1OCZC 1BZKA 1K5QA 3SGIA 3OR6C 5LYJA 4UCOA 2W0FC 2F23A 4XDKA 4LF9B 2DWEC 4EFBA 2OWOA 4L87A 4PD4F 4DV0B 4P2ZA 4YIPA 4I55B 4FK5C 1Q8IA 2P06A 3CP1A 3RGBA 4LWSA 3MHSC 4X66O 1AP5A 1HP8A 1PP9H 2YICA 4K35A 3ZHVA 5JJJB 2ADPA 2WSSG 1QBZA 2YIAA 3ZCCA 4X65B 4ZOLA 4KP4A 4K0KO 4EKWA 2JS5A 1JPXA 2O57A 4DW0A 3OGIB 2R9RB 2Q73A 3JAWB 1VIBA 2EJRA 2XAJA 4DO2A 1YITV 1V54C 4MS2A 4K8ZA 5H5NA 3DXRA 3OMIB 1HNXB 1VQ9V 4A5UB 2X0LA 4JI0B 5JJNB 3T1HO 4JZGA 4QPKA 1AI6A 3JATA 5DN6G 3RYHA 1YDXA 1MZEA 1AR5A 1OCCB 1R3IC 3E8HA 1R3LC 5IYZB 2M6YA 3H1IH 1PPJH 4TV8B 2P7TC 1M1KW 1N34O 1PKXA 3JALB 3OE7G 4I9QA 1QR8A 1E79G 2F95B 2A06H 4FVMA 3SPGA 4DV7O 4DR6O 1VQ4V 1NJIW 1PNLA 3VQVA 1WA8B 3K59A 1Y76A 2FYUH 3ASNC 5FLXN 1CP9A 2IU3A 2YUAA 4G27B 2OIGA 1YEWA 1VARA 1N32B 2G38A 4JZ2A 5B1NA 3N2GB 1I08A 1SZTA 1YVWA 5JCOA 1DK1A 1SS3A 2NR5A 2JVDA 2OT5A 5KHKA 1SQVH 5CBGA 5FNVA 5IY5B 1WB8A 4LCUC 1QQCA 1Y4MA 3JAKB 2ZQMA 4I4TB 3H1LH 3ZN1A 2IM9A 4G2KA 4B3SO 5BXZA 4U3JA 2KB1A 2W6IG 5GONB 3NXSA 1BSMA 3E8GA 3CCEV 5LL6Y 3D3IA 3ZHUA 1N33B 1TGOA 3IC7A 4LFBO 4MTXA 3N2KA 1GN4A 5KHHA 2PUSA 2BSKB 3CCRV 5IJ0A 2Q5ZA 1K92A 1SESA 2YC0A 1IZ3A 4AILC 1NS1A 2ZDIA 2YI8A 4NTYA 4EB6A 4JI5B 1JVMA 3K3WA 3DC6A 4O4JB 3CHXA 3RYCA 2K9PA 3B8MA 3OEHG 4YIOA 1US6A 4YY3O 5BMVA 4DR3B 3ZMVA 1AR4A 5JQGA 2EZOA 2P22C 2CTWA 1S77D 3JD0A 3ABLC 4QIWF 1KQSU 3JCUZ 1OJHA 3QG5A 4B3RO 1DF4A 1SQGA 4TSFG 1L1FA 3A0RA 5GTHZ 1E1RG 1OZ0A 4DUZB 1AI5A 5B5EZ 4UXNA 3CRRA 4HYOA 4K3AA 3ABTA 5D5PA 1OV9A 1M57B 4YJ2B 1FJGO 3CCSV
chains in the Genus database with same CATH topology
2UXBO 1N36O 5A2QN 4JI3O 3O65A 1DK1A 4LF4O 1FYJA 2F4VO 1N32O 4DV5O 3T1YO 5BR8O 4LF9O 3R66A 4NXNO 2VQEO 4DV0O 4X66O 1HNWO 3M8AA 1YZBA 5IT9N 1J5EO 2AGAA 3J7AU 4B3SO 5BXZA 1HR0O 4DV6O 4LF7O 1X59A 4JI6O 5LL6Y 1FKAO 1G1XB 4LF5O 2HHHO 1IBKO 4K0KO 4LFBO 2N74A 1XMQO 5IWAO 4GKJO 2JRIA 4LFAO 4JV5O 2UXCO 4X62O 2ZM6O 4DV3O 4LFCO 4JI5O 2ZKOA 3F5TA 4X65O 2FKXA 2UUBO 4GKKO 1N33O 3J81N 2UU9O 4LF8O 1R6TA 2UUAO 2DJVA 3SDLA 1NS1A 4B3MO 4JI1O 5H5NA 5LMNO 1AB3A 4A5UB 3J80N 4OPAA 4YHHO 4JI2O 1I94O 4DR4O 1F7YA 3T1HO 4JYAO 2DOSA 4DR5O 4B3TO 4OX9O 4DV2O 2UUCO 1KUQA 4JI7O 1D2DA 1HNXO 1IBMO 4YY3O 4DR1O 4JI8O 4JI0O 4AQYO 4DV1O 3RT3C 4DV4O 3JAMN 1N34O 2Z0AA 1AILA 4LF6O 4B3RO 4DR3O 4JI4O 2VQFO 2UXDO 1R1BA 1IBLO 3OTOO 5LMUO 4DV7O 4DR6O 1A32A 4OPHA 5BY1A 4DR2O 4NXMO 2E5LO 1HNZO 1XNQO 4X64O 5FLXN 1XEQA 4DR7O 4KHPO 1XMOO 2LW7A 4DUZO 4DUYO 1XNRO 1FJGO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXB O;  1N36 O;  5A2Q N;  4JI3 O;  3O65 A;  1DK1 A;  4LF4 O;  1FYJ A;  2F4V O;  1N32 O;  4DV5 O;  3T1Y O;  5BR8 O;  4LF9 O;  3R66 A;  4NXN O;  2VQE O;  4DV0 O;  4X66 O;  1HNW O;  3M8A A;  1YZB A;  5IT9 N;  1J5E O;  2AGA A;  3J7A U;  4B3S O;  5BXZ A;  1HR0 O;  4DV6 O;  4LF7 O;  1X59 A;  4JI6 O;  5LL6 Y;  1FKA O;  1G1X B;  4LF5 O;  2HHH O;  1IBK O;  4K0K O;  4LFB O;  2N74 A;  1XMQ O;  5IWA O;  4GKJ O;  2JRI A;  4LFA O;  4JV5 O;  2UXC O;  4X62 O;  2ZM6 O;  4DV3 O;  4LFC O;  4JI5 O;  2ZKO A;  3F5T A;  4X65 O;  2FKX A;  2UUB O;  4GKK O;  1N33 O;  3J81 N;  2UU9 O;  4LF8 O;  1R6T A;  2UUA O;  2DJV A;  3SDL A;  1NS1 A;  4B3M O;  4JI1 O;  5H5N A;  5LMN O;  1AB3 A;  4A5U B;  3J80 N;  4OPA A;  4YHH O;  4JI2 O;  1I94 O;  4DR4 O;  1F7Y A;  3T1H O;  4JYA O;  2DOS A;  4DR5 O;  4B3T O;  4OX9 O;  4DV2 O;  2UUC O;  1KUQ A;  4JI7 O;  1D2D A;  1HNX O;  1IBM O;  4YY3 O;  4DR1 O;  4JI8 O;  4JI0 O;  4AQY O;  4DV1 O;  3RT3 C;  4DV4 O;  3JAM N;  1N34 O;  2Z0A A;  1AIL A;  4LF6 O;  4B3R O;  4DR3 O;  4JI4 O;  2VQF O;  2UXD O;  1R1B A;  1IBL O;  3OTO O;  5LMU O;  4DV7 O;  4DR6 O;  1A32 A;  4OPH A;  5BY1 A;  4DR2 O;  4NXM O;  2E5L O;  1HNZ O;  1XNQ O;  4X64 O;  5FLX N;  1XEQ A;  4DR7 O;  4KHP O;  1XMO O;  2LW7 A;  4DUZ O;  4DUY O;  1XNR O;  1FJG O; 
#chains in the Genus database with same CATH topology
 3CWB H;  3E86 A;  4NXN B;  1SQX H;  1K97 A;  4LNU B;  1JX9 A;  4FLV A;  2QM4 A;  1GN6 A;  1TA8 A;  1FFX A;  4J11 A;  1LUW A;  5LXT A;  4Q6G A;  3B4S A;  4WFH A;  3ZHR A;  1YCI A;  4LF4 B;  4X62 B;  5IYB O;  4DV6 O;  1VF5 B;  3UKM A;  4MTO A;  3ZHS A;  1V9P A;  4DV3 B;  2LQT A;  2RN9 A;  3C3S A;  1O9G A;  2AZ0 A;  1ZL8 A;  3AK2 A;  3QF7 A;  5BZB A;  4Z1M G;  2IW5 A;  4H0L B;  4ZKI A;  2FKX A;  2IU0 A;  5HFL A;  3FFQ A;  1Z5W A;  5CA1 B;  2XT9 A;  3TGU H;  2DJV A;  4JAA A;  3OD4 A;  3AEI A;  1HWY A;  2YXH A;  1SRY A;  5A9G A;  1IBM B;  2DQ3 A;  4I9W A;  1XQ8 A;  3I55 V;  2N04 A;  2ZE8 A;  4RQF A;  3VQW A;  4DV1 B;  4TT3 G;  2VWJ A;  3ABM B;  1ZWI C;  2WLL A;  5LGU A;  1IVS A;  2CH7 B;  2KKW A;  3K9A A;  3OFN G;  3HKE B;  5EYP A;  3QVN A;  1ZLZ A;  2X7R B;  1P7B A;  1K7D A;  2DE0 X;  4I0X A;  3SYO A;  4MVQ A;  5JVD A;  4DK1 A;  2EIK C;  5KMG B;  4UVC A;  2Z3Y A;  4GYC B;  1K4D C;  1N36 B;  4X64 O;  5KA5 A;  3ZRS A;  4J7K A;  3Q4H B;  1XEQ A;  3A0H Z;  4DR7 O;  2ZNJ A;  3OGC C;  3ASO C;  3E35 A;  1OCZ B;  1QR9 A;  4R50 A;  1XNR O;  1BE3 H;  1K3E A;  1NI8 A;  4CC6 A;  5A2Q N;  4X1I A;  4JI3 O;  1QLE C;  3E2E A;  3AG2 B;  1AR1 B;  1HR0 B;  3FB5 C;  3PJS K;  5BR8 O;  4RQE A;  1S0V A;  3OEE G;  5EIB D;  3CX5 F;  3EHB B;  5LYJ B;  1YF2 A;  5KUM A;  1YZB A;  5EC2 C;  3K5N A;  2KG7 A;  1XMQ B;  5IWA B;  3T4Z A;  3CRM A;  2XND G;  1VQ7 V;  2QR4 A;  2WWW A;  1R3K C;  5KLV H;  5H6R A;  5CB4 A;  3L74 H;  5B1A C;  2LJ2 A;  1P49 A;  4QNH B;  1SER A;  2JRI A;  4LWS B;  3UQ8 A;  4JV5 O;  1KMI Z;  4GX0 A;  3CC2 V;  4C7U A;  1MMM A;  4B08 A;  3GWO A;  1IUR A;  4GKK O;  1YIJ V;  2BE3 A;  3X2Q C;  2UUC B;  1BCC H;  2XHB A;  3G80 A;  1VQP V;  1K5S A;  4JI1 O;  2IJJ A;  4ZOL B;  4BIU A;  4WFF A;  3JSL A;  1CPY A;  2A0L A;  3K5L A;  5IJ9 A;  4W4K A;  1BHA A;  4PDV A;  1NVP D;  2VRZ A;  4MTG A;  2HP8 A;  1YXB A;  3ETQ A;  2CGN A;  1EFR G;  3DXR B;  3HB3 B;  1KC8 W;  3RT3 C;  4BAY A;  3B09 A;  4P9P A;  3EVK A;  4WFA V;  2EIN C;  4WFG A;  3JAT B;  3RYH B;  1NKD A;  4JYB A;  1SC5 B;  1WP7 A;  4KL1 A;  5CMU A;  4DV4 B;  2X6B A;  2WA4 A;  1VQN V;  1XNQ O;  5L3G A;  1RFY A;  5KHG A;  5IE9 A;  1MSW D;  1MAB G;  1Q7Y W;  1EZJ A;  1S76 D;  2JGD A;  3ABK C;  5LHH A;  1Y76 B;  2LFR A;  2F4V O;  2Q68 A;  2DMX A;  2WLM A;  4BIZ A;  3B40 A;  1J5E O;  4F6E A;  3W7X A;  1Z2G A;  4PA9 A;  1RM1 C;  4H13 B;  4MVU A;  1B04 A;  3FYI B;  2Q69 A;  5FL7 G;  1WNS A;  4GZR B;  1IDS A;  1G1X B;  3L71 H;  2UUB B;  1EZV H;  4YJ3 A;  5FNV B;  2HLD G;  4GKJ O;  4JGS A;  1Y6X A;  1WJZ A;  4JI5 O;  4U3J B;  5GW7 A;  3SPC A;  4UCU A;  3FAV A;  2IJH A;  1ZAU A;  1K73 W;  4CS4 A;  4JF3 A;  5LOV A;  3N2K B;  5H9C A;  1GK9 A;  4NTX A;  5K1X A;  2CTQ A;  3L9D A;  2YSU B;  5IJ0 B;  1R3J C;  4CH5 A;  1S5H C;  2DW4 A;  2V7Q G;  3K79 A;  3ZRW A;  4J9Y B;  1IBL B;  4IIJ A;  3OTO B;  3E8F A;  4EB6 B;  2F43 G;  4CH3 A;  3SPJ A;  5TIS Z;  3AG3 C;  4N23 A;  3RYC B;  2OTJ V;  1QHT A;  3APO A;  5DEC A;  1MNG A;  3S3X A;  3SR2 C;  5BMV B;  3ZN0 A;  1AJN A;  1RPR A;  5JQG B;  2FML A;  2ODM A;  1MG1 A;  2UXB B;  1BQ0 A;  3DSQ A;  3JAS A;  1GAX A;  2AXT Z;  1U96 A;  1B06 A;  2PZS A;  5LA6 A;  2DYS B;  4I5S A;  2E5L B;  4JTC B;  1I5Y A;  2HKO A;  4LF4 O;  1M4U A;  2DYR C;  4FMT A;  3W7S A;  1F4M A;  2YI9 A;  1OCR C;  5B1O A;  2WA3 A;  3FD9 A;  1DTO A;  3FX7 A;  1VQL V;  1OCO B;  5IT9 N;  3K58 A;  1E1Q G;  2Z5U A;  5EBM C;  4LFA B;  4MT8 A;  5KUK A;  4UFZ A;  1MZF A;  2P4V A;  4HAM A;  3APQ A;  4JI6 O;  2PTM A;  2UU9 B;  4LF8 B;  1M9N A;  1YSC A;  2WLI B;  1FFX B;  2CUG A;  3WG7 C;  3DC5 A;  3C90 A;  4X89 A;  5EBL C;  1XI1 A;  3U10 A;  5LXT B;  2WLJ A;  4WFB V;  4LFC O;  1KP2 A;  3RYF A;  3SDL A;  4DV2 B;  1UPG A;  2AHY A;  3BA8 A;  4JI8 B;  4O2A A;  1ZL8 B;  1WAZ A;  4JYA O;  1N4C A;  4PV1 B;  4UV9 A;  2E76 B;  3SJB C;  4LC1 A;  1NT2 B;  5K1P A;  1V55 C;  2JK5 C;  3W7U A;  4AQY O;  1JR9 A;  5FPR A;  1QLN A;  2Y69 B;  1UJW B;  2YXL A;  3ZHQ A;  3M99 B;  4IGG A;  4D7S A;  3IGA C;  4LF6 O;  4TV9 A;  3P32 A;  4PDR A;  1R6N A;  3KCX A;  3AG4 C;  2WLL B;  1NTZ H;  4X1K A;  3ICX A;  5LMU O;  4UCR A;  1VQ8 V;  3HPL C;  2RCV A;  4NXM O;  4J7J A;  4NR1 A;  5EYP B;  5LHI A;  4FLU A;  2KSD A;  4WF9 V;  5EK0 A;  5LHG A;  1F51 A;  4JYC A;  1Q43 A;  4MSW C;  4I0X B;  1BT8 A;  2PYJ A;  4LR3 A;  5JVD B;  2Q0A A;  4U7N A;  3SYA A;  2GUZ A;  4R6Z A;  3ASO B;  3WB1 A;  3O65 A;  2V1D A;  1QNM A;  4X88 A;  1EBO A;  5CBH A;  3A8T A;  3FKS G;  2IJI A;  3E22 A;  3ZMT A;  1QLE B;  4UCT A;  1HNW O;  2Q0O C;  1F23 A;  2HHH B;  1IBK B;  4O4L A;  4E2L A;  3J7A U;  2UXC B;  1ARO P;  4X1I B;  1FXV A;  1XUQ A;  1XHZ A;  1KP3 A;  4LF7 O;  3K03 A;  1J95 A;  2Q67 A;  2R9I A;  1XIL A;  4PA4 A;  3VBB A;  2VWK A;  2ZM6 O;  1JQ0 A;  5B1A B;  2AHZ A;  2KG7 B;  1B6Q A;  5LGN A;  1GTO A;  2HJF C;  4DR4 B;  2WLK A;  1Y74 A;  4G28 B;  1G4Y B;  3SJA C;  1L8D A;  3AG1 C;  4LH7 A;  2A79 B;  2ZE5 A;  4NVP A;  1XOU A;  5CB4 B;  4DR1 B;  4JI2 O;  3X2Q B;  2Q6A A;  4IHJ A;  1AI7 A;  3CSX A;  2RQ6 A;  5EZY A;  5HFM A;  4GCZ A;  5AG2 A;  1TUE B;  1JJ2 U;  4JI4 B;  1S3J A;  1T5E A;  3D8C A;  3L75 H;  2ZXW C;  4DV4 O;  3CE2 A;  3LDE A;  5IJ9 B;  5KHI A;  4O4I A;  1YHQ V;  4QE9 A;  3ZHT A;  2Q4P A;  2HFE C;  4FM1 A;  4HZ3 A;  3QO8 A;  3OT7 A;  3AK1 A;  1EN4 A;  3RBZ A;  2LW7 A;  1KBH A;  3HKD A;  3JCZ A;  4FZ1 A;  4D6T H;  4PA6 A;  4BWA A;  4WBN A;  3UO3 A;  2JJ2 G;  4DV5 O;  4KHP B;  4CZZ A;  3ABK B;  4H33 A;  2VQE O;  2GHY A;  3M8A A;  3BVO A;  4UVA A;  4JTD B;  1NTK H;  2ITC C;  5DM6 V;  2JGD B;  2Q7H A;  3ETE A;  3SYC A;  2QM8 A;  2EIL C;  1Y67 A;  2D2C B;  2JS3 A;  2EIJ B;  1RM1 B;  1CXZ B;  2UUA B;  4I50 A;  2QSA A;  1XL6 A;  5LMN B;  3THO A;  1S5J A;  1Q6H A;  2GSM B;  4YHH B;  2OCC B;  2WLI A;  2PI5 A;  1NR7 A;  5CN0 A;  2QKC A;  3JSN A;  3JD2 A;  4B3T B;  4OX9 B;  3CEI A;  2C2A A;  3IC9 A;  1VQK V;  4L8J A;  4XDL A;  3H1H H;  3KZI Z;  4YJ3 B;  4BW9 A;  5EBW C;  1I94 O;  1NVP B;  3H1J H;  2QJ1 A;  2A7W A;  4X9Q A;  3K5M A;  1O9H A;  2M7W A;  4JI7 O;  4MW3 A;  4FLX A;  5H6Q A;  3FAV B;  1KU9 A;  2W0X A;  5D5Q A;  3JAR A;  4O2B A;  1S5L Z;  5LOV B;  1Q90 D;  1Q5O A;  1K4C C;  3RWR D;  1ENV A;  3TK1 A;  2VQF O;  4HNA B;  1QCE A;  5CA0 A;  3CD6 V;  2P4K A;  4U7O A;  2RJZ A;  2PI4 A;  1Q6I A;  4UB6 Z;  2GTS A;  2HR3 A;  4DRX A;  3U0Z A;  4OPH A;  3TXQ A;  3AG3 B;  3QTC A;  1JJO A;  3ZRW B;  4OXS A;  2MK3 A;  2E5L O;  2MW2 B;  3BY6 A;  5B3S B;  1R6K A;  4IIJ B;  1HNZ O;  3F5W C;  2P6J A;  3RFR A;  5LBQ A;  3SJQ C;  3D36 A;  1ROP A;  3CCQ V;  3E83 A;  4X66 B;  2QA4 V;  2EIM B;  2F93 B;  4H44 B;  1LR1 A;  2EX3 A;  2HG5 C;  3D36 C;  3K9S A;  3K0G A;  4RO2 A;  1G6U A;  4Q20 A;  1AVM A;  4LF9 O;  2Y4U A;  3JAS B;  4DUY B;  1B3Q A;  4MVR A;  1PD3 A;  4DV0 O;  3AK3 A;  4DYL A;  5LA6 B;  1Y66 A;  4K0K B;  1OCR B;  2UXN A;  1WPX A;  5L3D A;  3TXS A;  1OCC C;  1GM8 A;  1LUV A;  4KXR A;  1AP6 A;  3H1K H;  1K8A W;  5F2V O;  1P4R A;  4JYY A;  2ZKO A;  4X65 O;  1I5X A;  2W6J G;  4FLT A;  4WFE A;  3WG7 B;  3T1H B;  4PI0 A;  4BR6 A;  4IYI A;  3CXC U;  3DTU B;  2XUM A;  2ATK C;  3W7T A;  4IT5 A;  4CS3 A;  2QEX V;  2A3Q A;  2BOB C;  1KUQ A;  2QTS A;  1HNX O;  3BAA A;  3RYF B;  4B3M B;  3RN4 A;  1X4T A;  3QO7 A;  4JI0 O;  4MVO A;  2H3O A;  1IX9 A;  4DR5 B;  4O2A B;  1HW7 A;  4DR6 B;  3P30 A;  4PJ0 Z;  1AJQ A;  2KQX A;  4IL6 Z;  3ZX6 A;  5IY5 C;  3RW0 A;  4QJF B;  4JAV A;  1V54 B;  4J41 A;  4F4L A;  1YI2 V;  2XAH A;  4KUM A;  3CCM V;  1RSO A;  1H2M A;  1PV0 A;  4TV9 B;  2JIZ G;  5KA6 A;  1SQB H;  1KKD A;  2CTR A;  3LSS A;  4X1K B;  2RNB A;  4UCS A;  2WLH A;  2A9H A;  4FLZ A;  3K06 A;  4X20 A;  1VMG A;  1SZX A;  4B3S B;  1DF5 A;  1N32 O;  4XDJ A;  2D3O W;  1VF6 C;  1P84 F;  3HKC A;  5KX5 A;  2XTA A;  4LFB B;  1Q6U A;  1GN2 A;  2FTK A;  2GUZ B;  3ASN B;  3T2M A;  3OR7 C;  3LSQ A;  1U97 A;  4QE7 A;  1K9M W;  3E22 B;  2Y0I A;  3IFX A;  1VP7 A;  4AI8 A;  4O4L B;  1GMG A;  1N33 O;  3STL C;  4LF5 B;  4GT1 A;  5C93 A;  3OW2 U;  3AG1 B;  2DQ0 A;  4ZIB A;  2DOS A;  2QTO A;  5LP6 A;  2EBO A;  4JPR A;  2QKS A;  3P3N A;  2P90 A;  1D2D A;  2V4D A;  1M57 C;  1Y74 B;  2QWQ B;  1QVF U;  3ZED A;  4B3R B;  3FB7 C;  2AW9 A;  1M93 A;  4PHZ A;  5LP6 C;  4R7C A;  2RMK B;  5E1A C;  3JAM N;  3ZRX A;  2Z0A A;  2BTO A;  1JFF A;  3S3W A;  4DR3 O;  4IHJ B;  4JAU A;  1BQZ A;  2FB5 A;  2B9Z A;  5EZY B;  4FFB A;  3UT5 A;  1BL8 A;  4O4H B;  3OAA G;  4FM2 A;  4HNA A;  2ZT9 B;  2CTP A;  1FJG B;  1NZ6 A;  3HR0 A;  3L73 H;  2BOC C;  4P9O A;  4ASU G;  1M56 C;  4JTA B;  1NH2 D;  3HKB A;  4ABM A;  4KHP O;  2GDS A;  2LP7 A;  4O4I B;  4DUZ O;  3SPI A;  3SYP A;  4GX5 A;  3MD0 A;  4Z2W A;  2Y4T A;  4LP8 A;  3ABL B;  1GM7 A;  4QPJ A;  4X1Y A;  2ZE6 A;  3STZ C;  4DV6 B;  2H94 A;  4FJC C;  4NXN O;  2JEU A;  2JEX A;  3HKD B;  1EN6 A;  3BAB A;  1QU7 A;  4UV8 A;  4WBN B;  3ABM C;  3OM3 B;  3N27 A;  1WPB A;  2YEV A;  5JH7 A;  2B1G A;  3D3Q A;  2N74 A;  4X62 O;  3LNN A;  3MHH C;  4DV3 O;  3CJH A;  1DLB A;  3GWK C;  1H2S B;  1NBM G;  1H2G A;  4UB8 Z;  4OPA A;  3PN1 A;  1PM9 A;  3ZMS A;  1VQ6 V;  4I50 B;  5KHJ A;  2RDC A;  1KD1 W;  5CBF A;  1IXM A;  1S72 V;  1IBM O;  4BW5 A;  2LGQ A;  4UUJ C;  4DW1 A;  4RWU A;  5B66 Z;  1D5A A;  3KCY A;  2VS0 A;  1L0N H;  2P5O A;  4DV1 O;  1CEZ A;  3AG2 C;  3CXH F;  2N05 A;  4X64 B;  2BCC H;  1GN3 A;  2ZIN A;  2GV9 A;  4MVM A;  3FYE B;  3LUT B;  4ZI7 A;  1YJ9 V;  5IDJ A;  4DR7 B;  4XBF A;  1XNR B;  2IH3 C;  1YJN V;  2CGO A;  3JAR B;  4O2B B;  1EN5 A;  4LBE C;  3ZS8 C;  4JI3 B;  1XBL A;  5IYD O;  1JOY A;  3JYC A;  3ZIA G;  3VQY A;  3SJC C;  4DUY O;  5CA0 B;  5BR8 B;  3CRC A;  1YTF D;  3UCS C;  2ZR2 A;  3CRQ A;  1N36 O;  4DRX B;  4RUF A;  1XMO B;  2ITD C;  3CME V;  1TUB A;  5LGT A;  3I56 V;  2EIK B;  2LGW A;  3OTF A;  2QWP B;  2YID A;  4CH6 A;  3TET A;  1SA0 A;  2YS8 A;  4RAI A;  2R9A A;  5C8Y A;  1HR0 O;  4JV5 B;  4OGQ B;  4PDM A;  3T1Y B;  3ABU A;  3R65 A;  2PYL A;  1TAE A;  1XHX A;  1Q86 W;  3F7Y C;  4GKK B;  2NNU A;  1FXK A;  3G6E V;  1M5I A;  1XMQ O;  5IWA O;  5GTI Z;  4CS2 A;  4FLY A;  4JI1 B;  4MW8 A;  1D5N A;  3LNM B;  1IXB A;  1LNQ A;  1FXK C;  3RYI A;  3ZMZ A;  2QGN A;  1W0K G;  3CC4 V;  2UXX A;  4B3M O;  4I7Z B;  4EFE A;  3GVM A;  1H8E G;  2IJK A;  3DGE A;  2ZIM A;  1PL0 A;  1KYO F;  4JAS A;  4NB5 A;  1F7Y A;  1VQO V;  4TQD A;  4DR5 O;  2UUC O;  4FZ0 A;  4LH6 A;  1N0N A;  2X6A A;  1K34 A;  1RPO A;  4MTF A;  3WB2 A;  3M7M X;  3ETD A;  2H8P C;  1JCH A;  1TVK A;  1XNQ B;  4PI2 A;  5J2U B;  1AI4 A;  1W59 A;  3JD3 A;  3RVZ A;  4DK0 A;  3AG7 A;  5JCO C;  4O4H A;  2OYQ A;  2UXD B;  4PA3 A;  3A2F A;  2F4V B;  2JGU A;  2ADQ B;  1W2B U;  1ZUQ A;  4F6R A;  3SYQ A;  1GKF A;  2BTQ A;  4CBC A;  1J5E B;  1RSO B;  3CCU V;  2EIN B;  2LFS A;  3T4D A;  1UFI A;  2Q8V A;  4PA7 A;  2PY5 A;  3K08 A;  3WFV A;  3CCJ V;  1G8M A;  5L3C A;  4GKJ B;  1Q81 W;  1COW G;  5JWP A;  5J9P C;  3KKY A;  1SQF A;  4X20 B;  4DXW A;  5J2T A;  1Q82 W;  3OUS A;  3QNE A;  1FXH A;  3ZBH A;  4LF5 O;  2ZDI C;  3T1C A;  4MVS A;  5FPO A;  3C3T A;  1MA1 A;  5KAF Z;  3CMA V;  2YDE A;  3UO2 A;  3HKC B;  5KX5 B;  2UUB O;  4ZHQ A;  3BHP A;  1H8H G;  3L72 H;  3F7V C;  5IYC O;  3VOU A;  3OMN B;  1KKC A;  3CYO A;  3WU2 Z;  2E74 B;  4N21 A;  1XRE A;  1GO3 F;  3ETG A;  5ITZ A;  5B1B C;  4TUY A;  4R8C A;  3O9O A;  2DYS C;  3L70 H;  1ZX3 A;  1FAF A;  3MDS A;  1AIL A;  5LP6 B;  1SQP H;  2L6L A;  1N0J A;  2ARH A;  3B2E E;  4GX2 A;  5KAI Z;  2IH1 C;  1OCO C;  1IBL O;  3OTO O;  5L3B A;  4I55 A;  2XAQ A;  5L3E A;  3ML0 A;  2GTA A;  2B1I A;  3WB0 A;  2QE7 G;  4FM0 A;  1PNK A;  3G67 A;  2ILM A;  3K04 A;  4YXW G;  1JFF B;  1FPO A;  2EZP A;  4ICG A;  1SET A;  2QWN B;  2UXB O;  4FFB B;  2CAZ C;  3UT5 B;  3EXA A;  4DR2 B;  3OMA B;  1M56 B;  3G71 V;  3G4S V;  3CB2 A;  1WLE A;  1SF9 A;  4E4E A;  4BIO A;  1YJW V;  1BMF G;  1WN7 A;  2E75 B;  3A0B Z;  3HKB B;  4JI6 B;  1W0J G;  1SQQ H;  2Q7E A;  1VQ5 V;  2PF4 E;  2R70 A;  4PDL A;  2WLN A;  5H2F Z;  3JAW A;  4LFC B;  1X59 A;  4X1Y B;  1FKA O;  1KEC A;  3H9V A;  1P7G A;  3H01 A;  1VEW A;  4TQF A;  4LFA O;  4Z1V A;  4IYH A;  3KG2 A;  3LDD A;  2Y69 C;  4WCE V;  3F5T A;  2ZR3 A;  1XDC A;  2L35 A;  3EFF K;  1H2L A;  2XAF A;  3J81 N;  2DYR B;  2UU9 O;  4LF8 O;  4JYA B;  1R6T A;  1PNM A;  2HJD A;  4PEL A;  2NN4 A;  2WPD G;  2YEV B;  5IYZ A;  4FLW A;  4X8A A;  2JJ1 G;  5JH7 B;  4HBN A;  1AB3 A;  2YIB D;  4TV8 A;  3GB7 C;  4AQY B;  3JAL A;  4DV2 O;  4AHC A;  1BS3 A;  3CJH B;  2XAG A;  2DN9 A;  4JI8 O;  2QWO B;  4LF6 B;  1R73 A;  3CS5 A;  1WA8 A;  2R72 A;  4CC5 A;  5LMU B;  2OIE A;  1RP3 B;  2CDY A;  1PL4 A;  4NXM B;  5DED A;  2CK3 G;  3N2G A;  3IAY A;  1DGS A;  5BY1 A;  1N34 B;  1NH2 B;  1VQM V;  5J2U A;  4GLX A;  1SKV A;  1WB7 A;  3JAK A;  4I4T A;  1XMO O;  5EC1 C;  4DV7 B;  3E89 A;  1ZSP A;  3RVY A;  1JA8 A;  1V55 B;  3U11 A;  4J10 A;  4ZI7 B;  4K8X A;  1KB9 F;  1HNW B;  4B7K A;  5GON A;  1NQT A;  1OHH G;  2F66 C;  1FYJ A;  2QM7 A;  4J80 A;  3T1Y O;  3BEH A;  4W4L A;  1NR1 A;  3R66 A;  3ZMU A;  1FS0 G;  1H2N A;  4UCV A;  3AG4 B;  4LF7 B;  3ZRV A;  5L3F A;  2BSK A;  2AGA A;  1WP8 A;  2ZNI A;  1HDJ A;  3UM7 A;  2WAM A;  4TWK A;  4J9Z B;  2ZM6 B;  2YIB A;  3LDC A;  2HHH O;  3NR7 A;  4UVB A;  1IBK O;  1VF6 A;  2ZD9 A;  2JDI G;  2HVK C;  2UXC O;  2Q7G A;  4RUE A;  1TUB B;  3B8N A;  4O4J A;  1VF7 A;  3W7W A;  2LO1 A;  4JI2 B;  3TCU A;  1FFT B;  1SA0 B;  5C8Y B;  2ZIO A;  3K5O A;  1MOF A;  1ORQ C;  4B7E A;  3J80 N;  3K0D A;  1FXK B;  2XAS A;  2FL4 A;  4DR4 O;  4P30 A;  1Q3E A;  4FPP A;  4KFM A;  2ETN A;  1M90 W;  2EUL A;  2HEP A;  4DR1 O;  2PGG A;  1H38 A;  3RYI B;  2E3C A;  3VQX A;  4J7Z A;  1JMK C;  1QVG U;  5CA3 A;  4NKG B;  2ZE7 A;  1THZ A;  2NLJ C;  3E8B A;  5EIB C;  4EEQ A;  4YY3 B;  3I5D A;  2LW1 A;  4JI4 O;  4YJ2 A;  2UXD O;  3LSU A;  1R1B A;  3OUF A;  1Z5V A;  5JJE B;  2CE4 A;  4LNU A;  2Q9L A;  3SPH A;  1N8R W;  1BHB A;  2F1M A;  3IJ4 A;  2ZCE A;  4FIP C;  2EIJ C;  2EJ7 A;  3MAQ A;  1YTF B;  3JD1 A;  1TVK B;  1L0L H;  4CH4 A;  2K1E A;  4ZBM A;  4DV5 B;  4FFK A;  4GUN A;  2VQE B;  3CC7 V;  2OCC C;  2B5U A;  3QO5 A;  1GRJ A;  2ZXW B;  1H2K A;  4NTW A;  2XOK G;  3CCL V;  3FB6 C;  2HVJ C;  4F6R B;  3G6B A;  4QGP A;  2OTL V;  1GM9 A;  2BTQ B;  2AZ2 A;  5CA1 A;  3FB8 C;  3TJT A;  1URF A;  1ZTE A;  2QDO A;  2IBZ H;  1K33 A;  3K57 A;  2Y0P A;  1MSD A;  5E79 Z;  1NTM H;  4U3F H;  3B77 A;  1I94 B;  2Y48 A;  3BPZ A;  1I7F A;  2X6C A;  2UUA O;  4TOI A;  3BFR A;  5J2T B;  2CH7 A;  4JI7 B;  5LMN O;  4H37 A;  1GH6 A;  4D7T A;  4MVZ A;  3HKE A;  4YHH O;  1FD9 A;  1NU1 H;  2DWD C;  5B3S C;  3JD4 A;  3BA9 A;  4B3T O;  4OX9 O;  1I0H A;  3BCC H;  2P67 A;  1XL4 A;  2EIL B;  3BRC A;  4ZHQ B;  2QKA A;  1EM1 A;  5KMG A;  2VQF B;  1BGY H;  3CCV V;  5B1B B;  3P3P A;  2QWR B;  2YXY A;  2EIM C;  4GX1 A;  3CPW U;  3Q4H A;  3ZJZ A;  3CRA A;  4J42 A;  4NYK A;  1HNZ B;  2OCH A;  2GBO A;  1AJP A;  5ITZ B;  4TUY B;  1A32 A;  1F4N A;  4DR2 O;  1OCZ C;  1BZK A;  1K5Q A;  3SGI A;  3OR6 C;  5LYJ A;  4UCO A;  2W0F C;  2F23 A;  4XDK A;  4LF9 B;  2DWE C;  4EFB A;  2OWO A;  4L87 A;  4PD4 F;  4DV0 B;  4P2Z A;  4YIP A;  4I55 B;  4FK5 C;  1Q8I A;  2P06 A;  3CP1 A;  3RGB A;  4LWS A;  3MHS C;  4X66 O;  1AP5 A;  1HP8 A;  1PP9 H;  2YIC A;  4K35 A;  3ZHV A;  5JJJ B;  2ADP A;  2WSS G;  1QBZ A;  2YIA A;  3ZCC A;  4X65 B;  4ZOL A;  4KP4 A;  4K0K O;  4EKW A;  2JS5 A;  1JPX A;  2O57 A;  4DW0 A;  3OGI B;  2R9R B;  2Q73 A;  3JAW B;  1VIB A;  2EJR A;  2XAJ A;  4DO2 A;  1YIT V;  1V54 C;  4MS2 A;  4K8Z A;  5H5N A;  3DXR A;  3OMI B;  1HNX B;  1VQ9 V;  4A5U B;  2X0L A;  4JI0 B;  5JJN B;  3T1H O;  4JZG A;  4QPK A;  1AI6 A;  3JAT A;  5DN6 G;  3RYH A;  1YDX A;  1MZE A;  1AR5 A;  1OCC B;  1R3I C;  3E8H A;  1R3L C;  5IYZ B;  2M6Y A;  3H1I H;  1PPJ H;  4TV8 B;  2P7T C;  1M1K W;  1N34 O;  1PKX A;  3JAL B;  3OE7 G;  4I9Q A;  1QR8 A;  1E79 G;  2F95 B;  2A06 H;  4FVM A;  3SPG A;  4DV7 O;  4DR6 O;  1VQ4 V;  1NJI W;  1PNL A;  3VQV A;  1WA8 B;  3K59 A;  1Y76 A;  2FYU H;  3ASN C;  5FLX N;  1CP9 A;  2IU3 A;  2YUA A;  4G27 B;  2OIG A;  1YEW A;  1VAR A;  1N32 B;  2G38 A;  4JZ2 A;  5B1N A;  3N2G B;  1I08 A;  1SZT A;  1YVW A;  5JCO A;  1DK1 A;  1SS3 A;  2NR5 A;  2JVD A;  2OT5 A;  5KHK A;  1SQV H;  5CBG A;  5FNV A;  5IY5 B;  1WB8 A;  4LCU C;  1QQC A;  1Y4M A;  3JAK B;  2ZQM A;  4I4T B;  3H1L H;  3ZN1 A;  2IM9 A;  4G2K A;  4B3S O;  5BXZ A;  4U3J A;  2KB1 A;  2W6I G;  5GON B;  3NXS A;  1BSM A;  3E8G A;  3CCE V;  5LL6 Y;  3D3I A;  3ZHU A;  1N33 B;  1TGO A;  3IC7 A;  4LFB O;  4MTX A;  3N2K A;  1GN4 A;  5KHH A;  2PUS A;  2BSK B;  3CCR V;  5IJ0 A;  2Q5Z A;  1K92 A;  1SES A;  2YC0 A;  1IZ3 A;  4AIL C;  1NS1 A;  2ZDI A;  2YI8 A;  4NTY A;  4EB6 A;  4JI5 B;  1JVM A;  3K3W A;  3DC6 A;  4O4J B;  3CHX A;  3RYC A;  2K9P A;  3B8M A;  3OEH G;  4YIO A;  1US6 A;  4YY3 O;  5BMV A;  4DR3 B;  3ZMV A;  1AR4 A;  5JQG A;  2EZO A;  2P22 C;  2CTW A;  1S77 D;  3JD0 A;  3ABL C;  4QIW F;  1KQS U;  3JCU Z;  1OJH A;  3QG5 A;  4B3R O;  1DF4 A;  1SQG A;  4TSF G;  1L1F A;  3A0R A;  5GTH Z;  1E1R G;  1OZ0 A;  4DUZ B;  1AI5 A;  5B5E Z;  4UXN A;  3CRR A;  4HYO A;  4K3A A;  3ABT A;  5D5P A;  1OV9 A;  1M57 B;  4YJ2 B;  1FJG O;  3CCS V; 
#chains in the Genus database with same CATH homology
 2UXB O;  1N36 O;  5A2Q N;  4JI3 O;  3O65 A;  1DK1 A;  4LF4 O;  1FYJ A;  2F4V O;  1N32 O;  4DV5 O;  3T1Y O;  5BR8 O;  4LF9 O;  3R66 A;  4NXN O;  2VQE O;  4DV0 O;  4X66 O;  1HNW O;  3M8A A;  1YZB A;  5IT9 N;  1J5E O;  2AGA A;  3J7A U;  4B3S O;  5BXZ A;  1HR0 O;  4DV6 O;  4LF7 O;  1X59 A;  4JI6 O;  5LL6 Y;  1FKA O;  1G1X B;  4LF5 O;  2HHH O;  1IBK O;  4K0K O;  4LFB O;  2N74 A;  1XMQ O;  5IWA O;  4GKJ O;  2JRI A;  4LFA O;  4JV5 O;  2UXC O;  4X62 O;  2ZM6 O;  4DV3 O;  4LFC O;  4JI5 O;  2ZKO A;  3F5T A;  4X65 O;  2FKX A;  2UUB O;  4GKK O;  1N33 O;  3J81 N;  2UU9 O;  4LF8 O;  1R6T A;  2UUA O;  2DJV A;  3SDL A;  1NS1 A;  4B3M O;  4JI1 O;  5H5N A;  5LMN O;  1AB3 A;  4A5U B;  3J80 N;  4OPA A;  4YHH O;  4JI2 O;  1I94 O;  4DR4 O;  1F7Y A;  3T1H O;  4JYA O;  2DOS A;  4DR5 O;  4B3T O;  4OX9 O;  4DV2 O;  2UUC O;  1KUQ A;  4JI7 O;  1D2D A;  1HNX O;  1IBM O;  4YY3 O;  4DR1 O;  4JI8 O;  4JI0 O;  4AQY O;  4DV1 O;  3RT3 C;  4DV4 O;  3JAM N;  1N34 O;  2Z0A A;  1AIL A;  4LF6 O;  4B3R O;  4DR3 O;  4JI4 O;  2VQF O;  2UXD O;  1R1B A;  1IBL O;  3OTO O;  5LMU O;  4DV7 O;  4DR6 O;  1A32 A;  4OPH A;  5BY1 A;  4DR2 O;  4NXM O;  2E5L O;  1HNZ O;  1XNQ O;  4X64 O;  5FLX N;  1XEQ A;  4DR7 O;  4KHP O;  1XMO O;  2LW7 A;  4DUZ O;  4DUY O;  1XNR O;  1FJG O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...