1AILA

N-terminal fragment of ns1 protein from influenza a virus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
70
structure length
70
Chain Sequence
MDSNTVSSFQVDCFLWHVRKQVVDQELGDAPFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKILK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords NONSTRUCTURAL PROTEIN NS1
publication title Crystal structure of the unique RNA-binding domain of the influenza virus NS1 protein.
pubmed doi rcsb
molecule tags Rna binding protein
total genus 29
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 1997-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 1ailA00
3RT3C 1A32A 1IBKO 4DV6O 1G1XB 4X64O 4B3TO 1YZBA 4B3RO 3R66A 4NXNO 5IWAO 5BR8O 1HR0O 4DUYO 4X65O 4A5UB 4DV7O 1HNXO 4JI3O 4LF8O 4B3SO 2UU9O 5BXZA 1N36O 4LFAO 4LF4O 5LL6Y 4DR4O 4LF9O 1NS1A 4DR3O 4DR1O 2UUCO 4KHPO 2DJVA 4DR5O 4DUZO 3O65A 1DK1A 1X59A 1J5EO 2UXBO 4JI7O 5LMNO 1XEQA 1XNQO 5LMUO 2UUBO 2DOSA 4LF7O 3J81N 1XMQO 3JAMN 1N34O 4JI8O 3T1YO 2N74A 3F5TA 1R1BA 1AB3A 4DV3O 4LF6O 2UXDO 1R6TA 5FLXN 1N33O 4JYAO 2FKXA 4DR2O 4LFCO 1D2DA 4JI2O 4DR7O 4DR6O 4LF5O 2HHHO 4JI5O 5A2QN 2F4VO 1KUQA 5H5NA 2UXCO 4GKKO 2AGAA 2E5LO 2VQEO 4DV2O 1N32O 3J80N 1F7YA 3OTOO 4B3MO 3J7AU 2ZM6O 4NXMO 1FKAO 1FYJA 5BY1A 2UUAO 4OX9O 4JV5O 3SDLA 1HNWO 4YHHO 4JI1O 4AQYO 2JRIA 4X66O 4LFBO 4JI6O 1XMOO 3T1HO 4DV4O 4X62O 1FJGO 1HNZO 1AILA 4YY3O 1IBMO 2ZKOA 4JI0O 4GKJO 4JI4O 4DV0O 4OPAA 2LW7A 1XNRO 4DV1O 2Z0AA 2VQFO 3M8AA 1IBLO 4K0KO 4DV5O 5IT9N 4OPHA 1I94O
chains in the Genus database with same CATH superfamily
4NTYA 2GTSA 2JEUA 1VF6A 2CGOA 4PD4F 2JGUA 2GBOA 4QGPA 2O57A 2EJRA 3A0BZ 1PP9H 1OZ0A 5IE9A 3EHBB 3T4DA 4H0LB 1P7BA 5KAFZ 1V55B 1S77D 3LNMB 1DF4A 4FM2A 2WLMA 3IJ4A 4G27B 5LOVA 5CB4B 4EB6A 1S5JA 4E2LA 1F4MA 4GUNA 3K5OA 4FM1A 4J9YB 3QF7A 3KKYA 1QLEB 3SYOA 3K08A 4ASUG 4CH3A 4TQDA 3ETQA 3ZRXA 3R65A 1Z5VA 4FVMA 2YDEA 3RN4A 5FLXN 1NVPB 2UXDO 1BMFG 4PA7A 4ZKIA 3SYAA 2ZINA 1O9HA 1Q6UA 1EN4A 3AG4B 4FLYA 5CA0B 3UQ8A 4E4EA 2Z3YA 5KAIZ 4X65B 2E5LO 4QPJA 3ABLB 5EZYA 1HNXB 1OJHA 3THOA 5E79Z 1M9NA 4JPRA 2UU9B 5FNVA 1PNLA 1THZA 4WBNB 3CRMA 4LF4B 2UUAO 1RPRA 2EIMC 2NN4A 3JCZA 4O4IA 2F93B 2ZKOA 4UFZA 5A9GA 3ZN0A 3AG2C 3JARA 3IGAC 4Z2WA 1B3QA 1EM1A 1QVFU 4O4HB 4DV5O 1OCRB 1QU7A 3ZBHA 3U0ZA 1Y4MA 1OCCB 2PYLA 1H2KA 4X64O 1SQQH 5IWAO 1Q6HA 2QDOA 2BSKA 2IH1C 3FYIB 1Z5WA 2CK3G 4LF5B 3AEIA 2F4VB 3JALB 2N05A 2Q0OC 2ZDIA 2A7WA 5K1XA 1XBLA 2ZQMA 5IYCO 1BHBA 3D8CA 4IIJB 2XOKG 4W4LA 2V1DA 3WB1A 4I55A 1YDXA 2QE7G 1ZWIC 3CCSV 1DF5A 3OR6C 4R50A 4JAUA 3CXCU 4IGGA 1KP3A 5H6QA 3KCYA 1R3JC 3K9AA 3I55V 1HNWB 1AR1B 3JAWA 5LMUO 3T4ZA 1H2MA 3J81N 1K4CC 4H33A 1MZFA 4UCVA 2HJFC 1M90W 2ARHA 4DV3O 4MVZA 1PKXA 3W7XA 2IU0A 3UT5A 4UB6Z 4P2ZA 1IBKB 3CCJV 3UM7A 2RN9A 4GCZA 1F23A 3MDSA 4NXNB 4O4JA 1N0NA 3ZIAG 2HFEC 2UUBB 3G71V 3P3NA 2ZE5A 4NYKA 3CCQV 5JVDA 4X9QA 1Y74A 4B3MO 2XAJA 4CH5A 1TVKB 1YEWA 1SQVH 1KD1W 4K3AA 4DR3B 3ZHUA 4LH6A 1U97A 4O4LA 2CTWA 3ZN1A 1SF9A 4W4KA 1M57C 4N21A 2EILC 2YIDA 1N34B 4OPHA 4UV8A 4GX5A 5JH7B 1Q86W 5JQGB 3D36C 1H38A 1ZSPA 3IAYA 2ITCC 3C3SA 1K34A 1NQTA 1VQ6V 5BR8O 3EFFK 3K04A 2ZNJA 1QBZA 5LYJB 1WPBA 4AHCA 2Y48A 4MSWC 1WJZA 1Q5OA 5EC2C 1WP7A 1WPXA 1OCZB 1AVMA 3OT7A 2B5UA 1GN3A 2DQ0A 4I4TB 4LNUA 3B09A 2H3OA 1AR4A 3CC4V 1JX9A 4JV5B 4PDMA 4I9QA 4UVAA 3K5MA 2PGGA 5EBLC 2BOCC 2HP8A 4X1IB 2A06H 3N2KA 1IBMB 3FB6C 5EK0A 1KP2A 4TV9A 1VF5B 3E8GA 3VQXA 4K0KB 2ZE8A 1M4UA 2Q68A 4DV6B 1ZUQA 2JGDB 1FXHA 5HFLA 3ZRWB 2ADPA 2IJJA 4H44B 4LF8B 1YXBA 1EZJA 1FFXA 5BY1A 5L3EA 1SKVA 3JATA 5EYPB 2GUZB 1VQ8V 3EXAA 3JAKA 4O2BB 4IL6Z 3OMAB 3CRRA 2OCCB 3SGIA 3VOUA 2XAHA 5CBFA 3HKEB 2LJ2A 2EIKB 4NVPA 4OPAA 3A8TA 2Z0AA 3ZCCA 4BWAA 1Y67A 4TUYA 2W0FC 4GYCB 3I56V 4CS3A 1GRJA 2XT9A 1SQBH 2JEXA 2LO1A 3CC2V 2Q7HA 1QVGU 4RO2A 4QJFB 3B4SA 4X65O 4DR7B 2PF4E 1HNXO 3G4SV 2UU9O 4TV8A 3DSQA 3HR0A 3B2EE 4LF4O 2CTPA 3GWKC 4Q6GA 4ABMA 4RUFA 2IW5A 3JASA 4JZ2A 2VRZA 3F5WC 4BIOA 4WF9V 4B3RB 2AZ0A 1BSMA 2E74B 2Q0AA 2QGNA 1MABG 1P49A 4PDVA 1QNMA 3SJBC 1X4TA 2QA4V 4DV0B 4P9OA 1AI6A 4PDLA 1H2SB 1R6TA 2E76B 3OGCC 4DR4B 1ZLZA 2H94A 4LF5O 2QM7A 5B3SB 3L71H 2Q6AA 4DR5B 3AG1B 2BCCH 5KUKA 2F4VO 1S5LZ 1E1QG 5HFMA 3OAAG 2YXLA 2EZOA 1ZL8B 4H37A 1KBHA 4R7CA 2ZR3A 5CB4A 2YICA 4BAYA 3ZMTA 3L70H 1HNWO 4LF9B 4YHHO 1SS3A 1FS0G 2QEXV 4HZ3A 2Y0PA 1VQKV 2Q8VA 4DXWA 1Q81W 1GAXA 2GDSA 2JS5A 3H9VA 3ZRVA 3H1IH 1M1KW 3H1HH 2VQFO 4TT3G 2JJ1G 2ZT9B 5KHGA 1R3KC 1IBKO 5CA0A 4PI2A 2PZSA 1QCEA 4JYAB 4DK0A 4NXNO 1BQ0A 4MW3A 1L8DA 1QR9A 5LXTB 2DW4A 3C90A 4I50B 3CRAA 1R6KA 2NLJC 3PN1A 4WBNA 2KQXA 3HKBB 5EC1C 1VF6C 1MNGA 2PUSA 1FD9A 3MAQA 1K73W 4LH7A 4DR3O 1S72V 3VQVA 1AP6A 4ICGA 4NXMB 2M7WA 2R72A 5KX5B 3OGIB 2Q7EA 4YIPA 1L0NH 2YUAA 3CWBH 1COWG 4J7JA 1N34O 2QM4A 1AJQA 5KHIA 4MVQA 1JFFB 3ASNC 2FKXA 1D2DA 3SJQC 5TISZ 2CUGA 3JALA 5KLVH 2OTLV 4NR1A 1MSDA 5D5QA 5KHHA 4X8AA 4IIJA 2GHYA 3L75H 3ABMC 3K03A 1EFRG 2KSDA 1N36B 2G38A 3OUSA 2ZXWC 4JV5O 2YIBD 4QE7A 3BVOA 3DC5A 1SRYA 5B1BB 1RP3B 5KHJA 1IBMO 3G80A 2WAMA 2DYRC 4JI7B 5DN6G 3G6EV 1XNQB 4BW5A 3F7VC 4NKGB 3M99B 4K0KO 2WLNA 1JCHA 3GVMA 1VQLV 3QG5A 4H13B 4JTDB 2LGQA 1XL4A 4DV6O 4TOIA 1RFYA 3E89A 4PDRA 3R66A 3VBBA 4X89A 3ZMZA 3JD3A 4RQEA 1G6UA 4UCSA 4LF8O 1M56C 1TVKA 4YJ2B 2BTOA 4GKKB 4MTXA 5LL6Y 3SYCA 3G6BA 3HB3B 4FMTA 1QHTA 5JJJB 1K92A 1M93A 2AHZA 3AK3A 2ZNIA 3SJCC 5B1AC 2WLJA 2ZDIC 2WA3A 2DOSA 5D5PA 3T1HB 5IY5B 5AG2A 1IX9A 3LDEA 5JH7A 4RAIA 4L8JA 4JI4B 4J7KA 2IH3C 2PYJA 2Y69B 1XQ8A 2P06A 1IBLB 3E22B 4EFBA 2YXYA 3QTCA 4X1YB 3ETDA 5LYJA 4DR1B 4DR7O 1OCOC 3WFVA 4Q20A 3GWOA 3FB5C 1IZ3A 5H2FZ 4J11A 4XDLA 2OTJV 2DN9A 1TUEB 4I4TA 1YVWA 3ZRSA 4JI3B 4MW8A 3ABKC 3J7AU 1Y76B 2WPDG 4JZGA 2EZPA 4D7TA 4X1IA 4IYIA 1QQCA 2P67A 3S3XA 1VQNV 2GV9A 4DV0O 3AG1C 1B04A 2A79B 2PI4A 4UXNA 5LP6B 4IHJA 4FLXA 2W6IG 3UO3A 4J9ZB 2DE0X 4LF6B 5JJNB 3WB2A 1EN6A 3ZRWA 4JI1B 2F43G 4DR2B 5F2VO 5BZBA 2EIJB 4LCUC 5EYPA 2GUZA 2VQEB 4O2BA 4LF9O 3CHXA 4FFBA 3NXSA 3A0HZ 1U96A 3BHPA 4IYHA 1N32B 4CH6A 5CBHA 2DYSB 2WLHA 3HKEA 1NTKH 5IJ9B 5B1NA 3H1LH 4JTCB 1AI4A 3O65A 5J2TA 4CBCA 2UXXA 1WP8A 2ATKC 2R9RB 2X6CA 4P30A 4U3JB 1FXKB 4AILC 3X2QC 4F6RB 2HKOA 5H9CA 4BIUA 2QWQB 3BFRA 5ITZB 1XNRB 1YJNV 1RM1C 2OT5A 1CEZA 1VARA 2Y4UA 2LFSA 2AZ2A 4JYAO 4MVRA 3JCUZ 1GO3F 5EIBC 3ZMVA 1W2BU 4K8XA 1OV9A 2BOBC 4Z1MG 4CC5A 1WNSA 3CP1A 1NT2B 3JD0A 4P9PA 2YI9A 3ZHTA 4NXMO 1MG1A 1XI1A 3AG3B 3FAVB 1Q43A 4GLXA 4FLVA 1FPOA 4UCTA 3K5LA 2Q9LA 3FB7C 3WG7C 1XHZA 3UCSC 4YY3O 2UXBB 2P22C 1H2NA 1H2GA 2CAZC 2RJZA 2X0LA 3RBZA 3S3WA 2HVJC 4CS2A 2VS0A 3K06A 1K9MW 4KXRA 1S0VA 1K7DA 2IJKA 3M8AA 3CE2A 1WAZA 4JI8B 1P7GA 1XDCA 5EBMC 1RPOA 3CEIA 2EINB 4U7NA 1B06A 3HKCB 5JWPA 3DXRB 1ZL8A 4DV7O 2CE4A 2QKAA 3VQWA 3OEEG 1KKCA 2JIZG 3LDCA 1N36O 5L3FA 4YJ3B 3E8HA 1S76D 3RYHB 4DV2B 1NS1A 1H2LA 3B8MA 4TSFG 2KB1A 2XHBA 4DK1A 1BZKA 3MD0A 4KUMA 1AI7A 2QKSA 3UO2A 4JI7O 4B7EA 3H1KH 1XNQO 1MMMA 2Q67A 2HG5C 4UVCA 1GN4A 1S3JA 1Q82W 2A3QA 5LA6B 1V54C 1YSCA 1R1BA 4DV1B 5J2UB 4LFAB 1SZXA 1N33O 2CDYA 2ZR2A 5LXTA 3NR7A 4WFEA 3CJHB 4O2AB 3HKBA 3N2GA 4R6ZA 1P84F 4GKKO 3ASOB 1P4RA 4RUEA 3LNNA 3LUTB 3BPZA 4KP4A 3SPCA 5KX5A 1V55C 2M6YA 1I5YA 2CTQA 4RQFA 1E1RG 3SDLA 2GTAA 3CCLV 3P32A 4J7ZA 2RNBA 3CS5A 5LGNA 4DW1A 4LFCB 3T1HO 4KHPB 1GN2A 3WB0A 2QWRB 1PD3A 5LHGA 3AG7A 3ABTA 3ML0A 4QE9A 5LMNB 4JI4O 4HNAA 2HJDA 1JFFA 5EBWC 3BAAA 4JF3A 1IBLO 3DGEA 4PHZA 4ZHQB 5C8YB 1BHAA 1YF2A 3LSUA 4FLUA 5JCOC 5EZYB 1QLEC 3SJAC 2FL4A 1NZ6A 3A0RA 1NI8A 3E35A 2OCHA 3LSQA 4UV9A 2HHHB 2X7RB 2RQ6A 1SESA 4JI3O 1NTZH 3AG4C 3M7MX 3CCVV 5LHHA 1ENVA 3JARB 5IYZB 1B6QA 3ABLC 1AJNA 2F1MA 2LFRA 2ZM6B 2XTAA 1ROPA 4WFFA 2B9ZA 4NB5A 4FLTA 2ZE7A 2H8PC 4NTXA 3BRCA 1R3LC 1XMOB 4DV4B 5FL7G 3RYIB 4YXWG 3ABUA 1MOFA 1UPGA 3CCMV 3OTFA 4LF6O 3QO7A 1VQ5V 4DR2O 3K57A 1OCRC 1WA8B 2X6AA 2CTRA 3CMEV 1OCCC 4B3TB 3ZEDA 3CSXA 5GONB 3LDDA 1HR0B 1K5SA 1JVMA 1JOYA 4ZOLB 3U11A 2VQEO 3JAWB 1JJ2U 1FAFA 1N32O 4B3SB 3UKMA 4G28B 1ORQC 5BMVB 3CCEV 1UFIA 4MT8A 1YJ9V 1AILA 1SETA 5KUMA 1XNRO 3CC7V 2QKCA 5CA1B 1R6NA 1TA8A 3E22A 3ZHQA 4X1YA 4D7SA 1XOUA 1TUBB 4L87A 3ICXA 3OR7C 3ETGA 2OYQA 1NBMG 3FX7A 5CN0A 5JCOA 1NTMH 1VF7A 2CH7B 4A5UB 5H6RA 4N23A 1AROP 2E75B 5BXZA 4J80A 2UXCB 1YIJV 3KZIZ 5GTHZ 3H01A 4O4LB 2EIMB 4FK5C 2BTQB 3ZMSA 3JD2A 4OXSA 2YEVB 3OEHG 3L9DA 2XUMA 3IC9A 2UXBO 1NH2D 1HW7A 3MHSC 3AG2B 3GB7C 4AQYB 5LP6A 2UUBO 1JR9A 4YIOA 4JI6B 1XHXA 4LWSB 4JYCA 2FYUH 4JYBA 3JAMN 4JI8O 1CPYA 2PY5A 3F5TA 2Q69A 4D6TH 1BT8A 1H8EG 3OMIB 1R73A 1L1FA 3QO5A 1SC5B 1I5XA 3TETA 2IBZH 4O4HA 1JQ0A 4DV2O 3C3TA 4GX2A 4JYYA 4UCRA 1K8AW 5IJ9A 3K0GA 3P30A 2WLIB 3RYFB 1OCZC 3RGBA 5J9PC 3SR2C 4U3JA 1RSOB 1FXKA 1PNMA 4LC1A 4F6RA 2YSUB 3W7SA 1O9GA 4GZRB 2XASA 4TWKA 4F4LA 5ITZA 3QO8A 3O9OA 4KFMA 4DV1O 4K35A 2YIAA 3K58A 5IYDO 1DLBA 1Q90D 5L3DA 4B3MB 3OE7G 1YZBA 2Q4PA 1Q7YW 1M5IA 2YS8A 4PV1B 2FB5A 3JAKB 2RDCA 4JI5B 1PNKA 2K1EA 2D2CB 3FAVA 2P4KA 3WU2Z 1VMGA 3K5NA 4MVOA 1Q3EA 2JVDA 4I0XB 1LUWA 5L3CA 3JD1A 4KHPO 4C7UA 5LMNO 1QLNA 3CCRV 3JSNA 1M57B 2HR3A 2EILB 3CCUV 2ZIOA 1HNZB 2OCCC 1XILA 1NH2B 1LNQA 1MA1A 1SA0B 2ETNA 2EIKC 4HYOA 3HKCA 2Q73A 3DXRA 1T5EA 1KB9F 2ZIMA 2HHHO 1VQMV 4BR6A 3K0DA 3CRQA 1US6A 3U10A 3B77A 3JASB 4YJ3A 3RYCB 3RYHA 3D3QA 2WSSG 2OIGA 5JQGA 1BL8A 3FYEB 2HLDG 1G8MA 2ZM6O 3D3IA 3IC7A 3OW2U 3B8NA 3L74H 2C2AA 1XMOO 2AW9A 4DV4O 5LA6A 1KU9A 1D5NA 5CBGA 3CRCA 3SPIA 3STZC 5J2UA 1KKDA 3RW0A 1VQ7V 1NJIW 4LBEC 4UB8Z 4JASA 4WCEV 1D5AA 5IT9N 2AXTZ 3Q4HB 4PA3A 3CJHA 4O2AA 1YTFD 4DRXB 3FD9A 1TAEA 5GTIZ 4B3TO 4B3RO 2X6BA 5JJEB 1HR0O 4DR6B 1SQFA 3K3WA 4J10A 2ODMA 2F95B 5B3SC 3ZJZA 4B3SO 2CGNA 1SERA 4J41A 2YI8A 2EJ7A 3KCXA 4DW0A 5DEDA 3HKDB 5DM6V 4K8ZA 4DR4O 3ZS8C 3CMAV 3ZHRA 5FPOA 2AHYA 3BABA 3OTOB 1TGOA 2Q5ZA 4JAAA 2QSAA 4DR5O 2JGDA 5IYBO 2P6JA 1BCCH 2B1IA 5E1AC 1XEQA 3L73H 4DYLA 4X66B 1CXZB 4WFAV 3JD4A 4ZHQA 2WLLB 4X20B 5C8YA 4X62B 3ETEA 2W6JG 1JPXA 1GM8A 3ZX6A 4FZ0A 4MVSA 1XUQA 1BE3H 1VQPV 4MTFA 5C93A 1I94B 2WLKA 2DWDC 2D3OW 1Y6XA 1N4CA 2F23A 4ZI7B 1VQOV 4MVMA 1V9PA 2UXCO 4DUYB 3FB8C 4UCOA 5IYZA 4GX0A 1ZAUA 3OUFA 4R8CA 2XAGA 1F7YA 1VQ9V 1FKAO 2QTSA 4HBNA 4AQYO 1GN6A 5B5EZ 4JI6O 3IFXA 5IJ0B 4PA9A 2GSMB 1J95A 3RYIA 2F66C 2Y4TA 3RVYA 2QWNB 3ZHSA 3PJSK 3AK1A 4LF7B 4QNHB 1XMQB 1E79G 3T1YB 1WA8A 1QR8A 3SPJA 3RT3C 3CD6V 1I0HA 2IU3A 1LUVA 4CC6A 4HAMA 4JTAB 5GONA 2P7TC 4NTWA 4OGQB 4YHHB 4ZOLA 2VWJA 1VQ4V 2DQ3A 4JI2B 2RMKB 3HPLC 1YTFB 1IVSA 2JJ2G 2UXNA 4X1KB 5KA6A 3QVNA 5BMVA 1XL6A 4IT5A 2MK3A 4WFHA 2VQFB 3E8FA 2DMXA 2ZD9A 5GW7A 1KQSU 1DK1A 2ITDC 1JA8A 2R9AA 1KC8W 5CA1A 4LFBB 2KG7B 4EKWA 3MHHC 4RWUA 5B1BC 5FPRA 2N74A 2V7QG 4JI0B 4GKJB 1TUBA 4PELA 2ZCEA 4FFKA 2W0XA 4I5SA 1W0KG 4CS4A 3TXQA 4PA6A 1AB3A 4I7ZB 3K79A 1GTOA 2CH7A 1H8HG 3CB2A 5KMGB 4JI5O 5L3GA 2IM9A 2LQTA 1KUQA 5DECA 4J42A 2BTQA 3EVKA 3JYCA 1JJOA 3BEHA 3A2FA 2R70A 2YEVA 4MVUA 4TQFA 2WA4A 3OMNB 1GKFA 4I50A 2UUCB 4LWSA 1HNZO 2A9HA 4UVBA 5LOVB 4DUZB 1J5EB 4EB6B 1PL4A 1HP8A 4JAVA 2LW7A 1R3IC 3ASNB 3VQYA 2QM8A 3APQA 4QPKA 4U7OA 5KHKA 5IY5C 5LGUA 2MW2B 1DGSA 1KECA 2LGWA 2Y69C 2OIEA 3FKSG 4Z1VA 5LGTA 1I7FA 3ABMB 2EBOA 2ZXWB 2QJ1A 2WLIA 3RYFA 1IDSA 4FJCC 3W7WA 2ADQB 1RSOA 4DR1O 1EN5A 1N0JA 2DJVA 1NU1H 5FNVB 4IHJB 2DYRB 1Y66A 4OX9B 4UUJC 2RCVA 3BA8A 1X59A 4CH4A 1Z2GA 1K5QA 4FLWA 2E3CA 2K9PA 1GM9A 4UCUA 3TJTA 1FJGB 4O4IB 1FXVA 4LP8A 2LP7A 1W59A 4B7KA 5IDJA 4GX1A 3E8BA 1OHHG 5LP6C 1NR7A 4FFBB 4PA4A 4DR6O 5B1OA 1WLEA 1M56B 2ILMA 4ZIBA 5J2TB 1YI2V 2JS3A 2AGAA 2BSKB 4I0XA 3J80N 4I9WA 3OTOO 2YC0A 2EIJC 3T2MA 2OWOA 3W7UA 5B1AB 4MTOA 2NNUA 3W7TA 4CZZA 4JI1O 1BQZA 2JRIA 4X66O 3CX5F 3FFQA 2XAFA 3I5DA 3AK2A 4X62O 3K9SA 2DYSC 4I55B 3D36A 4YJ2A 1AR5A 2JK5C 1SA0A 1GMGA 1W0JG 5EIBD 3SYQA 2EX3A 3RFRA 1BS3A 4PI0A 1FXKC 1YITV 1I94O 1OCOB 3TGUH 4F6EA 2N04A 4FPPA 3TXSA 1SQXH 4BIZA 3TK1A 2UXDB 2QR4A 4B08A 4MS2A 1IURA 2EULA 3RYCA 4FZ1A 1N8RW 2V4DA 4DUYO 3UT5B 3T1CA 1K3EA 3BCCH 3ABKB 1DTOA 5CA3A 1NR1A 1IXBA 4O4JB 3QNEA 5KA5A 2E5LB 3ZMUA 5K1PA 1MZEA 2PI5A 3G67A 1YJWV 4XDJA 4FLZA 5JVDB 1Y74B 1ZTEA 2UUAB 4WFGA 3AG3C 4ZBMA 1IXMA 1Q6IA 1LR1A 3Q4HA 4LF7O 1XMQO 1GK9A 3T1YO 1Y76A 4EFEA 4DRXA 3BY6A 2R9IA 1HWYA 3CXHF 1GM7A 3ZHVA 3TCUA 4DV5B 1PV0A 4JI2O 1MSWD 1JMKC 2NR5A 2YIBA 3OM3B 5L3BA 3APOA 5A2QN 2L6LA 4X64B 1KMIZ 2EINC 1EBOA 4G2KA 1KYOF 1PM9A 2QWPB 5IWAB 3HKDA 3SPHA 4XDKA 3JSLA 1NKDA 4EEQA 4MTGA 2DWEC 1K33A 2A0LA 1G4YB 3L72H 4PJ0Z 2KKWA 2Q7GA 1AI5A 2YXHA 1GH6A 4LFBO 1BGYH 1I08A 1Q8IA 2WLLA 4LNUB 4X20A 2XNDG 3X2QB 1WB8A 2JDIG 4JI0O 4GKJO 1F4NA 1RM1B 1ZX3A 2BE3A 3N2GB 5LHIA 5LMUB 1F51A 1YCIA 3STLC 1PL0A 2LW1A 1K97A 3N2KB 1A32A 3RVZA 3B40A 4ZI7A 1G1XB 4DV3B 2WWWA 4TV9B 1PPJH 2VWKA 2PTMA 2IJHA 1UJWB 3H1JH 4LR3A 4X88A 3N27A 3F7YC 4YY3B 3SYPA 4GT1A 1XREA 4LFAO 2XAQA 4HNAB 3WG7B 1YHQV 3ASOC 3OD4A 5IJ0A 2UUCO 2Z5UA 5B66Z 1HDJA 1FFXB 4DUZO 1WB7A 1J5EO 3E2EA 3JATB 4AI8A 1SQPH 4QIWF 2HEPA 4FM0A 2Y0IA 2FMLA 1NVPD 2FTKA 4DV7B 4DO2A 4FIPC 2P90A 5CMUA 2IJIA 1K4DC 3E86A 1VEWA 3DC6A 4LFCO 1SQGA 4TUYB 2P5OA 4X1KA 1VP7A 3KG2A 3K59A 1CP9A 2P4VA 1SZTA 5H5NA 5BR8B 4KL1A 4XBFA 4U3FH 3CYOA 1EZVH 2L35A 4TV8B 1AJPA 1FYJA 3E83A 2HVKC 4OX9O 3LSSA 3CPWU 1S5HC 2QWOB 1AP5A 3BA9A 4WFBV 1N33B 2KG7A 3RWRD 2B1GA 2QTOA 3SPGA 1L0LH 4BW9A 1FJGO 3OFNG 3P3PA 1V54B 4JGSA 1WN7A 1VIBA 1URFA 3DTUB 5LBQA 1FFTB 5KMGA 2ZE6A
chains in the Genus database with same CATH topology
3RT3C 1A32A 1IBKO 4DV6O 1G1XB 4X64O 4B3TO 1YZBA 4B3RO 3R66A 4NXNO 5IWAO 5BR8O 1HR0O 4DUYO 4X65O 4A5UB 4DV7O 1HNXO 4JI3O 4LF8O 4B3SO 2UU9O 5BXZA 1N36O 4LFAO 4LF4O 5LL6Y 4DR4O 4LF9O 1NS1A 4DR3O 4DR1O 2UUCO 4KHPO 2DJVA 4DR5O 4DUZO 3O65A 1DK1A 1X59A 1J5EO 2UXBO 4JI7O 5LMNO 1XEQA 1XNQO 5LMUO 2UUBO 2DOSA 4LF7O 3J81N 1XMQO 3JAMN 1N34O 4JI8O 3T1YO 2N74A 3F5TA 1R1BA 1AB3A 4DV3O 4LF6O 2UXDO 1R6TA 5FLXN 1N33O 4JYAO 2FKXA 4DR2O 4LFCO 1D2DA 4JI2O 4DR7O 4DR6O 4LF5O 2HHHO 4JI5O 5A2QN 2F4VO 1KUQA 5H5NA 2UXCO 4GKKO 2AGAA 2E5LO 2VQEO 4DV2O 1N32O 3J80N 1F7YA 3OTOO 4B3MO 3J7AU 2ZM6O 4NXMO 1FKAO 1FYJA 5BY1A 2UUAO 4OX9O 4JV5O 3SDLA 1HNWO 4YHHO 4JI1O 4AQYO 2JRIA 4X66O 4LFBO 4JI6O 1XMOO 3T1HO 4DV4O 4X62O 1FJGO 1HNZO 1AILA 4YY3O 1IBMO 2ZKOA 4JI0O 4GKJO 4JI4O 4DV0O 4OPAA 2LW7A 1XNRO 4DV1O 2Z0AA 2VQFO 3M8AA 1IBLO 4K0KO 4DV5O 5IT9N 4OPHA 1I94O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RT3 C;  1A32 A;  1IBK O;  4DV6 O;  1G1X B;  4X64 O;  4B3T O;  1YZB A;  4B3R O;  3R66 A;  4NXN O;  5IWA O;  5BR8 O;  1HR0 O;  4DUY O;  4X65 O;  4A5U B;  4DV7 O;  1HNX O;  4JI3 O;  4LF8 O;  4B3S O;  2UU9 O;  5BXZ A;  1N36 O;  4LFA O;  4LF4 O;  5LL6 Y;  4DR4 O;  4LF9 O;  1NS1 A;  4DR3 O;  4DR1 O;  2UUC O;  4KHP O;  2DJV A;  4DR5 O;  4DUZ O;  3O65 A;  1DK1 A;  1X59 A;  1J5E O;  2UXB O;  4JI7 O;  5LMN O;  1XEQ A;  1XNQ O;  5LMU O;  2UUB O;  2DOS A;  4LF7 O;  3J81 N;  1XMQ O;  3JAM N;  1N34 O;  4JI8 O;  3T1Y O;  2N74 A;  3F5T A;  1R1B A;  1AB3 A;  4DV3 O;  4LF6 O;  2UXD O;  1R6T A;  5FLX N;  1N33 O;  4JYA O;  2FKX A;  4DR2 O;  4LFC O;  1D2D A;  4JI2 O;  4DR7 O;  4DR6 O;  4LF5 O;  2HHH O;  4JI5 O;  5A2Q N;  2F4V O;  1KUQ A;  5H5N A;  2UXC O;  4GKK O;  2AGA A;  2E5L O;  2VQE O;  4DV2 O;  1N32 O;  3J80 N;  1F7Y A;  3OTO O;  4B3M O;  3J7A U;  2ZM6 O;  4NXM O;  1FKA O;  1FYJ A;  5BY1 A;  2UUA O;  4OX9 O;  4JV5 O;  3SDL A;  1HNW O;  4YHH O;  4JI1 O;  4AQY O;  2JRI A;  4X66 O;  4LFB O;  4JI6 O;  1XMO O;  3T1H O;  4DV4 O;  4X62 O;  1FJG O;  1HNZ O;  1AIL A;  4YY3 O;  1IBM O;  2ZKO A;  4JI0 O;  4GKJ O;  4JI4 O;  4DV0 O;  4OPA A;  2LW7 A;  1XNR O;  4DV1 O;  2Z0A A;  2VQF O;  3M8A A;  1IBL O;  4K0K O;  4DV5 O;  5IT9 N;  4OPH A;  1I94 O; 
#chains in the Genus database with same CATH topology
 4NTY A;  2GTS A;  2JEU A;  1VF6 A;  2CGO A;  4PD4 F;  2JGU A;  2GBO A;  4QGP A;  2O57 A;  2EJR A;  3A0B Z;  1PP9 H;  1OZ0 A;  5IE9 A;  3EHB B;  3T4D A;  4H0L B;  1P7B A;  5KAF Z;  1V55 B;  1S77 D;  3LNM B;  1DF4 A;  4FM2 A;  2WLM A;  3IJ4 A;  4G27 B;  5LOV A;  5CB4 B;  4EB6 A;  1S5J A;  4E2L A;  1F4M A;  4GUN A;  3K5O A;  4FM1 A;  4J9Y B;  3QF7 A;  3KKY A;  1QLE B;  3SYO A;  3K08 A;  4ASU G;  4CH3 A;  4TQD A;  3ETQ A;  3ZRX A;  3R65 A;  1Z5V A;  4FVM A;  2YDE A;  3RN4 A;  5FLX N;  1NVP B;  2UXD O;  1BMF G;  4PA7 A;  4ZKI A;  3SYA A;  2ZIN A;  1O9H A;  1Q6U A;  1EN4 A;  3AG4 B;  4FLY A;  5CA0 B;  3UQ8 A;  4E4E A;  2Z3Y A;  5KAI Z;  4X65 B;  2E5L O;  4QPJ A;  3ABL B;  5EZY A;  1HNX B;  1OJH A;  3THO A;  5E79 Z;  1M9N A;  4JPR A;  2UU9 B;  5FNV A;  1PNL A;  1THZ A;  4WBN B;  3CRM A;  4LF4 B;  2UUA O;  1RPR A;  2EIM C;  2NN4 A;  3JCZ A;  4O4I A;  2F93 B;  2ZKO A;  4UFZ A;  5A9G A;  3ZN0 A;  3AG2 C;  3JAR A;  3IGA C;  4Z2W A;  1B3Q A;  1EM1 A;  1QVF U;  4O4H B;  4DV5 O;  1OCR B;  1QU7 A;  3ZBH A;  3U0Z A;  1Y4M A;  1OCC B;  2PYL A;  1H2K A;  4X64 O;  1SQQ H;  5IWA O;  1Q6H A;  2QDO A;  2BSK A;  2IH1 C;  3FYI B;  1Z5W A;  2CK3 G;  4LF5 B;  3AEI A;  2F4V B;  3JAL B;  2N05 A;  2Q0O C;  2ZDI A;  2A7W A;  5K1X A;  1XBL A;  2ZQM A;  5IYC O;  1BHB A;  3D8C A;  4IIJ B;  2XOK G;  4W4L A;  2V1D A;  3WB1 A;  4I55 A;  1YDX A;  2QE7 G;  1ZWI C;  3CCS V;  1DF5 A;  3OR6 C;  4R50 A;  4JAU A;  3CXC U;  4IGG A;  1KP3 A;  5H6Q A;  3KCY A;  1R3J C;  3K9A A;  3I55 V;  1HNW B;  1AR1 B;  3JAW A;  5LMU O;  3T4Z A;  1H2M A;  3J81 N;  1K4C C;  4H33 A;  1MZF A;  4UCV A;  2HJF C;  1M90 W;  2ARH A;  4DV3 O;  4MVZ A;  1PKX A;  3W7X A;  2IU0 A;  3UT5 A;  4UB6 Z;  4P2Z A;  1IBK B;  3CCJ V;  3UM7 A;  2RN9 A;  4GCZ A;  1F23 A;  3MDS A;  4NXN B;  4O4J A;  1N0N A;  3ZIA G;  2HFE C;  2UUB B;  3G71 V;  3P3N A;  2ZE5 A;  4NYK A;  3CCQ V;  5JVD A;  4X9Q A;  1Y74 A;  4B3M O;  2XAJ A;  4CH5 A;  1TVK B;  1YEW A;  1SQV H;  1KD1 W;  4K3A A;  4DR3 B;  3ZHU A;  4LH6 A;  1U97 A;  4O4L A;  2CTW A;  3ZN1 A;  1SF9 A;  4W4K A;  1M57 C;  4N21 A;  2EIL C;  2YID A;  1N34 B;  4OPH A;  4UV8 A;  4GX5 A;  5JH7 B;  1Q86 W;  5JQG B;  3D36 C;  1H38 A;  1ZSP A;  3IAY A;  2ITC C;  3C3S A;  1K34 A;  1NQT A;  1VQ6 V;  5BR8 O;  3EFF K;  3K04 A;  2ZNJ A;  1QBZ A;  5LYJ B;  1WPB A;  4AHC A;  2Y48 A;  4MSW C;  1WJZ A;  1Q5O A;  5EC2 C;  1WP7 A;  1WPX A;  1OCZ B;  1AVM A;  3OT7 A;  2B5U A;  1GN3 A;  2DQ0 A;  4I4T B;  4LNU A;  3B09 A;  2H3O A;  1AR4 A;  3CC4 V;  1JX9 A;  4JV5 B;  4PDM A;  4I9Q A;  4UVA A;  3K5M A;  2PGG A;  5EBL C;  2BOC C;  2HP8 A;  4X1I B;  2A06 H;  3N2K A;  1IBM B;  3FB6 C;  5EK0 A;  1KP2 A;  4TV9 A;  1VF5 B;  3E8G A;  3VQX A;  4K0K B;  2ZE8 A;  1M4U A;  2Q68 A;  4DV6 B;  1ZUQ A;  2JGD B;  1FXH A;  5HFL A;  3ZRW B;  2ADP A;  2IJJ A;  4H44 B;  4LF8 B;  1YXB A;  1EZJ A;  1FFX A;  5BY1 A;  5L3E A;  1SKV A;  3JAT A;  5EYP B;  2GUZ B;  1VQ8 V;  3EXA A;  3JAK A;  4O2B B;  4IL6 Z;  3OMA B;  3CRR A;  2OCC B;  3SGI A;  3VOU A;  2XAH A;  5CBF A;  3HKE B;  2LJ2 A;  2EIK B;  4NVP A;  4OPA A;  3A8T A;  2Z0A A;  3ZCC A;  4BWA A;  1Y67 A;  4TUY A;  2W0F C;  4GYC B;  3I56 V;  4CS3 A;  1GRJ A;  2XT9 A;  1SQB H;  2JEX A;  2LO1 A;  3CC2 V;  2Q7H A;  1QVG U;  4RO2 A;  4QJF B;  3B4S A;  4X65 O;  4DR7 B;  2PF4 E;  1HNX O;  3G4S V;  2UU9 O;  4TV8 A;  3DSQ A;  3HR0 A;  3B2E E;  4LF4 O;  2CTP A;  3GWK C;  4Q6G A;  4ABM A;  4RUF A;  2IW5 A;  3JAS A;  4JZ2 A;  2VRZ A;  3F5W C;  4BIO A;  4WF9 V;  4B3R B;  2AZ0 A;  1BSM A;  2E74 B;  2Q0A A;  2QGN A;  1MAB G;  1P49 A;  4PDV A;  1QNM A;  3SJB C;  1X4T A;  2QA4 V;  4DV0 B;  4P9O A;  1AI6 A;  4PDL A;  1H2S B;  1R6T A;  2E76 B;  3OGC C;  4DR4 B;  1ZLZ A;  2H94 A;  4LF5 O;  2QM7 A;  5B3S B;  3L71 H;  2Q6A A;  4DR5 B;  3AG1 B;  2BCC H;  5KUK A;  2F4V O;  1S5L Z;  1E1Q G;  5HFM A;  3OAA G;  2YXL A;  2EZO A;  1ZL8 B;  4H37 A;  1KBH A;  4R7C A;  2ZR3 A;  5CB4 A;  2YIC A;  4BAY A;  3ZMT A;  3L70 H;  1HNW O;  4LF9 B;  4YHH O;  1SS3 A;  1FS0 G;  2QEX V;  4HZ3 A;  2Y0P A;  1VQK V;  2Q8V A;  4DXW A;  1Q81 W;  1GAX A;  2GDS A;  2JS5 A;  3H9V A;  3ZRV A;  3H1I H;  1M1K W;  3H1H H;  2VQF O;  4TT3 G;  2JJ1 G;  2ZT9 B;  5KHG A;  1R3K C;  1IBK O;  5CA0 A;  4PI2 A;  2PZS A;  1QCE A;  4JYA B;  4DK0 A;  4NXN O;  1BQ0 A;  4MW3 A;  1L8D A;  1QR9 A;  5LXT B;  2DW4 A;  3C90 A;  4I50 B;  3CRA A;  1R6K A;  2NLJ C;  3PN1 A;  4WBN A;  2KQX A;  3HKB B;  5EC1 C;  1VF6 C;  1MNG A;  2PUS A;  1FD9 A;  3MAQ A;  1K73 W;  4LH7 A;  4DR3 O;  1S72 V;  3VQV A;  1AP6 A;  4ICG A;  4NXM B;  2M7W A;  2R72 A;  5KX5 B;  3OGI B;  2Q7E A;  4YIP A;  1L0N H;  2YUA A;  3CWB H;  1COW G;  4J7J A;  1N34 O;  2QM4 A;  1AJQ A;  5KHI A;  4MVQ A;  1JFF B;  3ASN C;  2FKX A;  1D2D A;  3SJQ C;  5TIS Z;  2CUG A;  3JAL A;  5KLV H;  2OTL V;  4NR1 A;  1MSD A;  5D5Q A;  5KHH A;  4X8A A;  4IIJ A;  2GHY A;  3L75 H;  3ABM C;  3K03 A;  1EFR G;  2KSD A;  1N36 B;  2G38 A;  3OUS A;  2ZXW C;  4JV5 O;  2YIB D;  4QE7 A;  3BVO A;  3DC5 A;  1SRY A;  5B1B B;  1RP3 B;  5KHJ A;  1IBM O;  3G80 A;  2WAM A;  2DYR C;  4JI7 B;  5DN6 G;  3G6E V;  1XNQ B;  4BW5 A;  3F7V C;  4NKG B;  3M99 B;  4K0K O;  2WLN A;  1JCH A;  3GVM A;  1VQL V;  3QG5 A;  4H13 B;  4JTD B;  2LGQ A;  1XL4 A;  4DV6 O;  4TOI A;  1RFY A;  3E89 A;  4PDR A;  3R66 A;  3VBB A;  4X89 A;  3ZMZ A;  3JD3 A;  4RQE A;  1G6U A;  4UCS A;  4LF8 O;  1M56 C;  1TVK A;  4YJ2 B;  2BTO A;  4GKK B;  4MTX A;  5LL6 Y;  3SYC A;  3G6B A;  3HB3 B;  4FMT A;  1QHT A;  5JJJ B;  1K92 A;  1M93 A;  2AHZ A;  3AK3 A;  2ZNI A;  3SJC C;  5B1A C;  2WLJ A;  2ZDI C;  2WA3 A;  2DOS A;  5D5P A;  3T1H B;  5IY5 B;  5AG2 A;  1IX9 A;  3LDE A;  5JH7 A;  4RAI A;  4L8J A;  4JI4 B;  4J7K A;  2IH3 C;  2PYJ A;  2Y69 B;  1XQ8 A;  2P06 A;  1IBL B;  3E22 B;  4EFB A;  2YXY A;  3QTC A;  4X1Y B;  3ETD A;  5LYJ A;  4DR1 B;  4DR7 O;  1OCO C;  3WFV A;  4Q20 A;  3GWO A;  3FB5 C;  1IZ3 A;  5H2F Z;  4J11 A;  4XDL A;  2OTJ V;  2DN9 A;  1TUE B;  4I4T A;  1YVW A;  3ZRS A;  4JI3 B;  4MW8 A;  3ABK C;  3J7A U;  1Y76 B;  2WPD G;  4JZG A;  2EZP A;  4D7T A;  4X1I A;  4IYI A;  1QQC A;  2P67 A;  3S3X A;  1VQN V;  2GV9 A;  4DV0 O;  3AG1 C;  1B04 A;  2A79 B;  2PI4 A;  4UXN A;  5LP6 B;  4IHJ A;  4FLX A;  2W6I G;  3UO3 A;  4J9Z B;  2DE0 X;  4LF6 B;  5JJN B;  3WB2 A;  1EN6 A;  3ZRW A;  4JI1 B;  2F43 G;  4DR2 B;  5F2V O;  5BZB A;  2EIJ B;  4LCU C;  5EYP A;  2GUZ A;  2VQE B;  4O2B A;  4LF9 O;  3CHX A;  4FFB A;  3NXS A;  3A0H Z;  1U96 A;  3BHP A;  4IYH A;  1N32 B;  4CH6 A;  5CBH A;  2DYS B;  2WLH A;  3HKE A;  1NTK H;  5IJ9 B;  5B1N A;  3H1L H;  4JTC B;  1AI4 A;  3O65 A;  5J2T A;  4CBC A;  2UXX A;  1WP8 A;  2ATK C;  2R9R B;  2X6C A;  4P30 A;  4U3J B;  1FXK B;  4AIL C;  3X2Q C;  4F6R B;  2HKO A;  5H9C A;  4BIU A;  2QWQ B;  3BFR A;  5ITZ B;  1XNR B;  1YJN V;  1RM1 C;  2OT5 A;  1CEZ A;  1VAR A;  2Y4U A;  2LFS A;  2AZ2 A;  4JYA O;  4MVR A;  3JCU Z;  1GO3 F;  5EIB C;  3ZMV A;  1W2B U;  4K8X A;  1OV9 A;  2BOB C;  4Z1M G;  4CC5 A;  1WNS A;  3CP1 A;  1NT2 B;  3JD0 A;  4P9P A;  2YI9 A;  3ZHT A;  4NXM O;  1MG1 A;  1XI1 A;  3AG3 B;  3FAV B;  1Q43 A;  4GLX A;  4FLV A;  1FPO A;  4UCT A;  3K5L A;  2Q9L A;  3FB7 C;  3WG7 C;  1XHZ A;  3UCS C;  4YY3 O;  2UXB B;  2P22 C;  1H2N A;  1H2G A;  2CAZ C;  2RJZ A;  2X0L A;  3RBZ A;  3S3W A;  2HVJ C;  4CS2 A;  2VS0 A;  3K06 A;  1K9M W;  4KXR A;  1S0V A;  1K7D A;  2IJK A;  3M8A A;  3CE2 A;  1WAZ A;  4JI8 B;  1P7G A;  1XDC A;  5EBM C;  1RPO A;  3CEI A;  2EIN B;  4U7N A;  1B06 A;  3HKC B;  5JWP A;  3DXR B;  1ZL8 A;  4DV7 O;  2CE4 A;  2QKA A;  3VQW A;  3OEE G;  1KKC A;  2JIZ G;  3LDC A;  1N36 O;  5L3F A;  4YJ3 B;  3E8H A;  1S76 D;  3RYH B;  4DV2 B;  1NS1 A;  1H2L A;  3B8M A;  4TSF G;  2KB1 A;  2XHB A;  4DK1 A;  1BZK A;  3MD0 A;  4KUM A;  1AI7 A;  2QKS A;  3UO2 A;  4JI7 O;  4B7E A;  3H1K H;  1XNQ O;  1MMM A;  2Q67 A;  2HG5 C;  4UVC A;  1GN4 A;  1S3J A;  1Q82 W;  2A3Q A;  5LA6 B;  1V54 C;  1YSC A;  1R1B A;  4DV1 B;  5J2U B;  4LFA B;  1SZX A;  1N33 O;  2CDY A;  2ZR2 A;  5LXT A;  3NR7 A;  4WFE A;  3CJH B;  4O2A B;  3HKB A;  3N2G A;  4R6Z A;  1P84 F;  4GKK O;  3ASO B;  1P4R A;  4RUE A;  3LNN A;  3LUT B;  3BPZ A;  4KP4 A;  3SPC A;  5KX5 A;  1V55 C;  2M6Y A;  1I5Y A;  2CTQ A;  4RQF A;  1E1R G;  3SDL A;  2GTA A;  3CCL V;  3P32 A;  4J7Z A;  2RNB A;  3CS5 A;  5LGN A;  4DW1 A;  4LFC B;  3T1H O;  4KHP B;  1GN2 A;  3WB0 A;  2QWR B;  1PD3 A;  5LHG A;  3AG7 A;  3ABT A;  3ML0 A;  4QE9 A;  5LMN B;  4JI4 O;  4HNA A;  2HJD A;  1JFF A;  5EBW C;  3BAA A;  4JF3 A;  1IBL O;  3DGE A;  4PHZ A;  4ZHQ B;  5C8Y B;  1BHA A;  1YF2 A;  3LSU A;  4FLU A;  5JCO C;  5EZY B;  1QLE C;  3SJA C;  2FL4 A;  1NZ6 A;  3A0R A;  1NI8 A;  3E35 A;  2OCH A;  3LSQ A;  4UV9 A;  2HHH B;  2X7R B;  2RQ6 A;  1SES A;  4JI3 O;  1NTZ H;  3AG4 C;  3M7M X;  3CCV V;  5LHH A;  1ENV A;  3JAR B;  5IYZ B;  1B6Q A;  3ABL C;  1AJN A;  2F1M A;  2LFR A;  2ZM6 B;  2XTA A;  1ROP A;  4WFF A;  2B9Z A;  4NB5 A;  4FLT A;  2ZE7 A;  2H8P C;  4NTX A;  3BRC A;  1R3L C;  1XMO B;  4DV4 B;  5FL7 G;  3RYI B;  4YXW G;  3ABU A;  1MOF A;  1UPG A;  3CCM V;  3OTF A;  4LF6 O;  3QO7 A;  1VQ5 V;  4DR2 O;  3K57 A;  1OCR C;  1WA8 B;  2X6A A;  2CTR A;  3CME V;  1OCC C;  4B3T B;  3ZED A;  3CSX A;  5GON B;  3LDD A;  1HR0 B;  1K5S A;  1JVM A;  1JOY A;  4ZOL B;  3U11 A;  2VQE O;  3JAW B;  1JJ2 U;  1FAF A;  1N32 O;  4B3S B;  3UKM A;  4G28 B;  1ORQ C;  5BMV B;  3CCE V;  1UFI A;  4MT8 A;  1YJ9 V;  1AIL A;  1SET A;  5KUM A;  1XNR O;  3CC7 V;  2QKC A;  5CA1 B;  1R6N A;  1TA8 A;  3E22 A;  3ZHQ A;  4X1Y A;  4D7S A;  1XOU A;  1TUB B;  4L87 A;  3ICX A;  3OR7 C;  3ETG A;  2OYQ A;  1NBM G;  3FX7 A;  5CN0 A;  5JCO A;  1NTM H;  1VF7 A;  2CH7 B;  4A5U B;  5H6R A;  4N23 A;  1ARO P;  2E75 B;  5BXZ A;  4J80 A;  2UXC B;  1YIJ V;  3KZI Z;  5GTH Z;  3H01 A;  4O4L B;  2EIM B;  4FK5 C;  2BTQ B;  3ZMS A;  3JD2 A;  4OXS A;  2YEV B;  3OEH G;  3L9D A;  2XUM A;  3IC9 A;  2UXB O;  1NH2 D;  1HW7 A;  3MHS C;  3AG2 B;  3GB7 C;  4AQY B;  5LP6 A;  2UUB O;  1JR9 A;  4YIO A;  4JI6 B;  1XHX A;  4LWS B;  4JYC A;  2FYU H;  4JYB A;  3JAM N;  4JI8 O;  1CPY A;  2PY5 A;  3F5T A;  2Q69 A;  4D6T H;  1BT8 A;  1H8E G;  3OMI B;  1R73 A;  1L1F A;  3QO5 A;  1SC5 B;  1I5X A;  3TET A;  2IBZ H;  4O4H A;  1JQ0 A;  4DV2 O;  3C3T A;  4GX2 A;  4JYY A;  4UCR A;  1K8A W;  5IJ9 A;  3K0G A;  3P30 A;  2WLI B;  3RYF B;  1OCZ C;  3RGB A;  5J9P C;  3SR2 C;  4U3J A;  1RSO B;  1FXK A;  1PNM A;  4LC1 A;  4F6R A;  2YSU B;  3W7S A;  1O9G A;  4GZR B;  2XAS A;  4TWK A;  4F4L A;  5ITZ A;  3QO8 A;  3O9O A;  4KFM A;  4DV1 O;  4K35 A;  2YIA A;  3K58 A;  5IYD O;  1DLB A;  1Q90 D;  5L3D A;  4B3M B;  3OE7 G;  1YZB A;  2Q4P A;  1Q7Y W;  1M5I A;  2YS8 A;  4PV1 B;  2FB5 A;  3JAK B;  2RDC A;  4JI5 B;  1PNK A;  2K1E A;  2D2C B;  3FAV A;  2P4K A;  3WU2 Z;  1VMG A;  3K5N A;  4MVO A;  1Q3E A;  2JVD A;  4I0X B;  1LUW A;  5L3C A;  3JD1 A;  4KHP O;  4C7U A;  5LMN O;  1QLN A;  3CCR V;  3JSN A;  1M57 B;  2HR3 A;  2EIL B;  3CCU V;  2ZIO A;  1HNZ B;  2OCC C;  1XIL A;  1NH2 B;  1LNQ A;  1MA1 A;  1SA0 B;  2ETN A;  2EIK C;  4HYO A;  3HKC A;  2Q73 A;  3DXR A;  1T5E A;  1KB9 F;  2ZIM A;  2HHH O;  1VQM V;  4BR6 A;  3K0D A;  3CRQ A;  1US6 A;  3U10 A;  3B77 A;  3JAS B;  4YJ3 A;  3RYC B;  3RYH A;  3D3Q A;  2WSS G;  2OIG A;  5JQG A;  1BL8 A;  3FYE B;  2HLD G;  1G8M A;  2ZM6 O;  3D3I A;  3IC7 A;  3OW2 U;  3B8N A;  3L74 H;  2C2A A;  1XMO O;  2AW9 A;  4DV4 O;  5LA6 A;  1KU9 A;  1D5N A;  5CBG A;  3CRC A;  3SPI A;  3STZ C;  5J2U A;  1KKD A;  3RW0 A;  1VQ7 V;  1NJI W;  4LBE C;  4UB8 Z;  4JAS A;  4WCE V;  1D5A A;  5IT9 N;  2AXT Z;  3Q4H B;  4PA3 A;  3CJH A;  4O2A A;  1YTF D;  4DRX B;  3FD9 A;  1TAE A;  5GTI Z;  4B3T O;  4B3R O;  2X6B A;  5JJE B;  1HR0 O;  4DR6 B;  1SQF A;  3K3W A;  4J10 A;  2ODM A;  2F95 B;  5B3S C;  3ZJZ A;  4B3S O;  2CGN A;  1SER A;  4J41 A;  2YI8 A;  2EJ7 A;  3KCX A;  4DW0 A;  5DED A;  3HKD B;  5DM6 V;  4K8Z A;  4DR4 O;  3ZS8 C;  3CMA V;  3ZHR A;  5FPO A;  2AHY A;  3BAB A;  3OTO B;  1TGO A;  2Q5Z A;  4JAA A;  2QSA A;  4DR5 O;  2JGD A;  5IYB O;  2P6J A;  1BCC H;  2B1I A;  5E1A C;  1XEQ A;  3L73 H;  4DYL A;  4X66 B;  1CXZ B;  4WFA V;  3JD4 A;  4ZHQ A;  2WLL B;  4X20 B;  5C8Y A;  4X62 B;  3ETE A;  2W6J G;  1JPX A;  1GM8 A;  3ZX6 A;  4FZ0 A;  4MVS A;  1XUQ A;  1BE3 H;  1VQP V;  4MTF A;  5C93 A;  1I94 B;  2WLK A;  2DWD C;  2D3O W;  1Y6X A;  1N4C A;  2F23 A;  4ZI7 B;  1VQO V;  4MVM A;  1V9P A;  2UXC O;  4DUY B;  3FB8 C;  4UCO A;  5IYZ A;  4GX0 A;  1ZAU A;  3OUF A;  4R8C A;  2XAG A;  1F7Y A;  1VQ9 V;  1FKA O;  2QTS A;  4HBN A;  4AQY O;  1GN6 A;  5B5E Z;  4JI6 O;  3IFX A;  5IJ0 B;  4PA9 A;  2GSM B;  1J95 A;  3RYI A;  2F66 C;  2Y4T A;  3RVY A;  2QWN B;  3ZHS A;  3PJS K;  3AK1 A;  4LF7 B;  4QNH B;  1XMQ B;  1E79 G;  3T1Y B;  1WA8 A;  1QR8 A;  3SPJ A;  3RT3 C;  3CD6 V;  1I0H A;  2IU3 A;  1LUV A;  4CC6 A;  4HAM A;  4JTA B;  5GON A;  2P7T C;  4NTW A;  4OGQ B;  4YHH B;  4ZOL A;  2VWJ A;  1VQ4 V;  2DQ3 A;  4JI2 B;  2RMK B;  3HPL C;  1YTF B;  1IVS A;  2JJ2 G;  2UXN A;  4X1K B;  5KA6 A;  3QVN A;  5BMV A;  1XL6 A;  4IT5 A;  2MK3 A;  4WFH A;  2VQF B;  3E8F A;  2DMX A;  2ZD9 A;  5GW7 A;  1KQS U;  1DK1 A;  2ITD C;  1JA8 A;  2R9A A;  1KC8 W;  5CA1 A;  4LFB B;  2KG7 B;  4EKW A;  3MHH C;  4RWU A;  5B1B C;  5FPR A;  2N74 A;  2V7Q G;  4JI0 B;  4GKJ B;  1TUB A;  4PEL A;  2ZCE A;  4FFK A;  2W0X A;  4I5S A;  1W0K G;  4CS4 A;  3TXQ A;  4PA6 A;  1AB3 A;  4I7Z B;  3K79 A;  1GTO A;  2CH7 A;  1H8H G;  3CB2 A;  5KMG B;  4JI5 O;  5L3G A;  2IM9 A;  2LQT A;  1KUQ A;  5DEC A;  4J42 A;  2BTQ A;  3EVK A;  3JYC A;  1JJO A;  3BEH A;  3A2F A;  2R70 A;  2YEV A;  4MVU A;  4TQF A;  2WA4 A;  3OMN B;  1GKF A;  4I50 A;  2UUC B;  4LWS A;  1HNZ O;  2A9H A;  4UVB A;  5LOV B;  4DUZ B;  1J5E B;  4EB6 B;  1PL4 A;  1HP8 A;  4JAV A;  2LW7 A;  1R3I C;  3ASN B;  3VQY A;  2QM8 A;  3APQ A;  4QPK A;  4U7O A;  5KHK A;  5IY5 C;  5LGU A;  2MW2 B;  1DGS A;  1KEC A;  2LGW A;  2Y69 C;  2OIE A;  3FKS G;  4Z1V A;  5LGT A;  1I7F A;  3ABM B;  2EBO A;  2ZXW B;  2QJ1 A;  2WLI A;  3RYF A;  1IDS A;  4FJC C;  3W7W A;  2ADQ B;  1RSO A;  4DR1 O;  1EN5 A;  1N0J A;  2DJV A;  1NU1 H;  5FNV B;  4IHJ B;  2DYR B;  1Y66 A;  4OX9 B;  4UUJ C;  2RCV A;  3BA8 A;  1X59 A;  4CH4 A;  1Z2G A;  1K5Q A;  4FLW A;  2E3C A;  2K9P A;  1GM9 A;  4UCU A;  3TJT A;  1FJG B;  4O4I B;  1FXV A;  4LP8 A;  2LP7 A;  1W59 A;  4B7K A;  5IDJ A;  4GX1 A;  3E8B A;  1OHH G;  5LP6 C;  1NR7 A;  4FFB B;  4PA4 A;  4DR6 O;  5B1O A;  1WLE A;  1M56 B;  2ILM A;  4ZIB A;  5J2T B;  1YI2 V;  2JS3 A;  2AGA A;  2BSK B;  4I0X A;  3J80 N;  4I9W A;  3OTO O;  2YC0 A;  2EIJ C;  3T2M A;  2OWO A;  3W7U A;  5B1A B;  4MTO A;  2NNU A;  3W7T A;  4CZZ A;  4JI1 O;  1BQZ A;  2JRI A;  4X66 O;  3CX5 F;  3FFQ A;  2XAF A;  3I5D A;  3AK2 A;  4X62 O;  3K9S A;  2DYS C;  4I55 B;  3D36 A;  4YJ2 A;  1AR5 A;  2JK5 C;  1SA0 A;  1GMG A;  1W0J G;  5EIB D;  3SYQ A;  2EX3 A;  3RFR A;  1BS3 A;  4PI0 A;  1FXK C;  1YIT V;  1I94 O;  1OCO B;  3TGU H;  4F6E A;  2N04 A;  4FPP A;  3TXS A;  1SQX H;  4BIZ A;  3TK1 A;  2UXD B;  2QR4 A;  4B08 A;  4MS2 A;  1IUR A;  2EUL A;  3RYC A;  4FZ1 A;  1N8R W;  2V4D A;  4DUY O;  3UT5 B;  3T1C A;  1K3E A;  3BCC H;  3ABK B;  1DTO A;  5CA3 A;  1NR1 A;  1IXB A;  4O4J B;  3QNE A;  5KA5 A;  2E5L B;  3ZMU A;  5K1P A;  1MZE A;  2PI5 A;  3G67 A;  1YJW V;  4XDJ A;  4FLZ A;  5JVD B;  1Y74 B;  1ZTE A;  2UUA B;  4WFG A;  3AG3 C;  4ZBM A;  1IXM A;  1Q6I A;  1LR1 A;  3Q4H A;  4LF7 O;  1XMQ O;  1GK9 A;  3T1Y O;  1Y76 A;  4EFE A;  4DRX A;  3BY6 A;  2R9I A;  1HWY A;  3CXH F;  1GM7 A;  3ZHV A;  3TCU A;  4DV5 B;  1PV0 A;  4JI2 O;  1MSW D;  1JMK C;  2NR5 A;  2YIB A;  3OM3 B;  5L3B A;  3APO A;  5A2Q N;  2L6L A;  4X64 B;  1KMI Z;  2EIN C;  1EBO A;  4G2K A;  1KYO F;  1PM9 A;  2QWP B;  5IWA B;  3HKD A;  3SPH A;  4XDK A;  3JSL A;  1NKD A;  4EEQ A;  4MTG A;  2DWE C;  1K33 A;  2A0L A;  1G4Y B;  3L72 H;  4PJ0 Z;  2KKW A;  2Q7G A;  1AI5 A;  2YXH A;  1GH6 A;  4LFB O;  1BGY H;  1I08 A;  1Q8I A;  2WLL A;  4LNU B;  4X20 A;  2XND G;  3X2Q B;  1WB8 A;  2JDI G;  4JI0 O;  4GKJ O;  1F4N A;  1RM1 B;  1ZX3 A;  2BE3 A;  3N2G B;  5LHI A;  5LMU B;  1F51 A;  1YCI A;  3STL C;  1PL0 A;  2LW1 A;  1K97 A;  3N2K B;  1A32 A;  3RVZ A;  3B40 A;  4ZI7 A;  1G1X B;  4DV3 B;  2WWW A;  4TV9 B;  1PPJ H;  2VWK A;  2PTM A;  2IJH A;  1UJW B;  3H1J H;  4LR3 A;  4X88 A;  3N27 A;  3F7Y C;  4YY3 B;  3SYP A;  4GT1 A;  1XRE A;  4LFA O;  2XAQ A;  4HNA B;  3WG7 B;  1YHQ V;  3ASO C;  3OD4 A;  5IJ0 A;  2UUC O;  2Z5U A;  5B66 Z;  1HDJ A;  1FFX B;  4DUZ O;  1WB7 A;  1J5E O;  3E2E A;  3JAT B;  4AI8 A;  1SQP H;  4QIW F;  2HEP A;  4FM0 A;  2Y0I A;  2FML A;  1NVP D;  2FTK A;  4DV7 B;  4DO2 A;  4FIP C;  2P90 A;  5CMU A;  2IJI A;  1K4D C;  3E86 A;  1VEW A;  3DC6 A;  4LFC O;  1SQG A;  4TUY B;  2P5O A;  4X1K A;  1VP7 A;  3KG2 A;  3K59 A;  1CP9 A;  2P4V A;  1SZT A;  5H5N A;  5BR8 B;  4KL1 A;  4XBF A;  4U3F H;  3CYO A;  1EZV H;  2L35 A;  4TV8 B;  1AJP A;  1FYJ A;  3E83 A;  2HVK C;  4OX9 O;  3LSS A;  3CPW U;  1S5H C;  2QWO B;  1AP5 A;  3BA9 A;  4WFB V;  1N33 B;  2KG7 A;  3RWR D;  2B1G A;  2QTO A;  3SPG A;  1L0L H;  4BW9 A;  1FJG O;  3OFN G;  3P3P A;  1V54 B;  4JGS A;  1WN7 A;  1VIB A;  1URF A;  3DTU B;  5LBQ A;  1FFT B;  5KMG A;  2ZE6 A; 
#chains in the Genus database with same CATH homology
 3RT3 C;  1A32 A;  1IBK O;  4DV6 O;  1G1X B;  4X64 O;  4B3T O;  1YZB A;  4B3R O;  3R66 A;  4NXN O;  5IWA O;  5BR8 O;  1HR0 O;  4DUY O;  4X65 O;  4A5U B;  4DV7 O;  1HNX O;  4JI3 O;  4LF8 O;  4B3S O;  2UU9 O;  5BXZ A;  1N36 O;  4LFA O;  4LF4 O;  5LL6 Y;  4DR4 O;  4LF9 O;  1NS1 A;  4DR3 O;  4DR1 O;  2UUC O;  4KHP O;  2DJV A;  4DR5 O;  4DUZ O;  3O65 A;  1DK1 A;  1X59 A;  1J5E O;  2UXB O;  4JI7 O;  5LMN O;  1XEQ A;  1XNQ O;  5LMU O;  2UUB O;  2DOS A;  4LF7 O;  3J81 N;  1XMQ O;  3JAM N;  1N34 O;  4JI8 O;  3T1Y O;  2N74 A;  3F5T A;  1R1B A;  1AB3 A;  4DV3 O;  4LF6 O;  2UXD O;  1R6T A;  5FLX N;  1N33 O;  4JYA O;  2FKX A;  4DR2 O;  4LFC O;  1D2D A;  4JI2 O;  4DR7 O;  4DR6 O;  4LF5 O;  2HHH O;  4JI5 O;  5A2Q N;  2F4V O;  1KUQ A;  5H5N A;  2UXC O;  4GKK O;  2AGA A;  2E5L O;  2VQE O;  4DV2 O;  1N32 O;  3J80 N;  1F7Y A;  3OTO O;  4B3M O;  3J7A U;  2ZM6 O;  4NXM O;  1FKA O;  1FYJ A;  5BY1 A;  2UUA O;  4OX9 O;  4JV5 O;  3SDL A;  1HNW O;  4YHH O;  4JI1 O;  4AQY O;  2JRI A;  4X66 O;  4LFB O;  4JI6 O;  1XMO O;  3T1H O;  4DV4 O;  4X62 O;  1FJG O;  1HNZ O;  1AIL A;  4YY3 O;  1IBM O;  2ZKO A;  4JI0 O;  4GKJ O;  4JI4 O;  4DV0 O;  4OPA A;  2LW7 A;  1XNR O;  4DV1 O;  2Z0A A;  2VQF O;  3M8A A;  1IBL O;  4K0K O;  4DV5 O;  5IT9 N;  4OPH A;  1I94 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...