2Y69B

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2y69B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y69B02
1WS7A 1IKOP 1CURA 1WA2X 4G72B 3NJGA 3FYEB 2HX7A 4HCFA 5B1JC 3FSWA 2AZUA 1BQRA 1JVOA 5TK4A 1TEFA 4GP8B 4E9WA 2J5WA 1KYAA 1AS8A 4E9RA 2FT6A 3EH4B 3S8FB 1E65A 3FPYA 4UF7C 3NYKA 1MZZA 4BWWA 1ASQA 1ADWA 3FSZA 4HCIA 3FSAA 1A3ZA 1M57B 5B3SB 3KW8A 3IEAA 4G70B 2GSMB 2IH8A 3SBQA 2J57A 2IDUA 2IDQA 2EILB 2DYRB 1WAEA 2VM3A 4DPCX 1HAUA 2DWTA 2X87A 1XMEB 1AAJA 3PAVA 4KO9A 1XB3A 2A3TA 3V9EA 4HCGA 1TEGA 3QPKA 2OJ1A 1MZYA 2PP7A 4X4KA 2H3XC 1KGYE 1GYCA 4RH4A 4DPBX 1BYPA 3T6XA 4YSAA 5B1BB 2BWIA 1NIDA 2BP0A 4UANA 2IWEA 4GXFA 4JKNA 5B1JA 3MX0B 2BP8A 2QPDB 2EIMB 1M9WA 2I7OA 2TSBA 5D4JA 1KBWA 3WNJA 1AOZA 1QHQA 3ERXA 3FPXA 3PLYA 4EF3A 3DTUB 1JZHA 1L9QA 2PP8A 4GP5B 4GY4A 2IDSA 1A4BA 2JFCA 2N0MA 4WKXA 3BQVA 5B1KA 2XLLA 4A2FA 1ZDSA 2GI0A 3QQXA 4AZUA 2QT6A 1AG0A 2QPEB 3CZUB 3X1NA 3NSYA 1AIZA 1TKWA 1ET7A 2VMJA 1T5KA 2AFNA 2HX8A 2HXAA 4UAHA 1GY1A 2XU9A 4AI7A 1IC0A 1SFHA 2R7EA 7PAZA 3HEIB 2DV6A 2XWZA 1W8EA 3FQ1A 5I5IA 4N4YB 3TU6A 1ET5A 2PCYA 2UXVA 3DKHA 1J9QA 4DP5X 1N70A 5I6PA 2IH9A 3GXUB 4HAKA 1BAWA 2B3IA 1W6LA 1L9OA 2FT8A 6PAZA 2WSDA 3NJIA 3OMIB 1BXUA 1V54B 1PF3A 1VLXA 1YLBB 4CSPA 1KDIA 2W8CA 5PCYA 4AKOA 2H47C 4A2EA 3PAZA 4YSQA 3PCYA 4HALA 3UAEA 2GBAA 5B7EA 4K9JA 2PPDA 1EHKB 4BDVA 4YL4A 3IN2A 4E9SA 3ABKB 1ZV2A 3EH5B 2JKWA 1J5DA 3S3CB 1SNRA 1AG6A 3WIAA 2YXWA 3AG4B 3OM3B 4ZK8A 1M56B 1AR1B 4YVUA 4G7SB 2ZONA 2Y69B 2EIKB 1PLAA 4TXVB 4DP1X 2B08A 3FU7A 2PCFA 1NZRA 1QLEB 2BO0A 3FT0A 1PLBA 1OV8A 1ID2A 4YSUA 3EH3B 3X1GA 3PXLA 1RZQA 3ABGA 1NICA 1OE3A 5IY5B 4G71B 3NJLA 4DPAX 1OCRB 2IDTA 1SJMA 1KCWA 1J9RA 2LLNA 2AANA 3DIVA 3WNIA 1BEXA 1MG3C 3T6WA 3EF4A 5LDUA 2FQFA 1JZFA 3CDZA 5ANHA 1XB6A 9PCYA 1SFDA 4AKPA 3PAUA 3GDCA 4DP0X 3QJVB 1ZDQA 1PLCA 3N2JA 1FWXA 4W9ZA 3TBCA 2FTAA 3D12B 2YAQA 3FS9A 1AANA 1SF5A 3AG1B 2XVBA 4KOCA 1FFTB 4BWUA 2VW7A 2XX0A 4KNSA 1NWPA 1E30A 2UXTA 2HRGA 3QJRB 3ABMB 1SHXA 4A68A 1XB8A 3NJNA 3JT2A 2W88A 2Y1AA 5FC9A 2PPEA 2AVFA 1JZIA 3CDZB 1NIEA 1CYXA 4JHVA 4YSCA 1OCZB 2J55A 5I5JA 2VSMB 3BVDB 2CJ3A 1IBZA 3L45A 2IDFA 4Q8BA 2HLEB 2YAMA 3QJTB 2CAKA 3NP3A 2J56A 4PCYA 3SQRA 1F56A 3ZDWA 2DYSB 1JZJA 4DP7X 3X1FA 4BXSV 1BXVA 1CUOA 7PCYA 2MRYA 1ILSA 3X1BA 1KCBA 1L9RA 1NTDA 2P80A 2HRHA 2QDVA 3QJSB 4A66A 3OQRA 1NIFA 3IN0A 3TBBA 4DP8X 4BK5C 3T71A 2PP9A 4Q89A 2YAPA 4L0PB 1OCOB 5A7EA 2I85A 2TSAA 3TA4D 1PY0A 1X9RA 1GS7A 2VN3A 3FU8A 1BYOA 3NSDA 1PZBA 4KOBA 2DY2A 2YARA 3FYIB 4YSRA 3GYRA 2IWFA 1ETJA 3NJJA 2IWKA 3H4FA 2YAHA 2XYBA 2BW5A 1KV7A 4FAAB 2PPFA 1A8ZA 3G5WA 1GW0A 5AFAA 3WG7B 4P5RA 4HIPA 1GS6X 3WI9A 1OOWA 1L9TA 4FA7B 4KO5A 1BQKA 1ASOA 2FJSA 3AG2B 3KW7A 2HZHA 4WTQA 3S3BB 1NIAA 3PPSA 1WS8A 4DP6X 2VW4A 1TU2A 2BP0B 1HFUA 3SBRA 3WKQA 4GP4B 2GC7C 2MTAA 1ASPA 4A67A 1NINA 1GR7A 2FNWA 3NT0A 5E9NA 4CSZA 2EIJB 1WA1X 1ZIAA 2GIMA 3EHBB 3S8GB 2XV2A 3ZBMA 4JHUA 4QKTA 1JOIA 2BW4A 3AW5A 2XV3A 3NSCA 2GC4C 1A65A 3U25A 3IE9A 3AZUA 2P80D 4HHGA 3NJKA 1NWOA 2CBPA 4E9XA 5D4IA 1AS7A 3FQ2A 2UX7A 3S3DB 1AS6A 2FQGA 1J5CA 3FU9A 1URIA 1E5ZA 3OD3A 1PAZA 1GSKA 1SF3A 2I7SA 1CYWA 1NPJA 1NPNA 5B7FA 2ZXWB 2YEVB 2GHZA 2CUAA 4GYBA 1EZLA 2XXFA 1AZBA 1ET8A 4E9QA 3OMNB 1L9PA 1ZIBA 3UGEA 4G7RB 4KNUA 3ASNB 4YVNA 3X1EA 3NSFA 2E86A 5I6OA 2OCCB 3H56A 3QJUB 4HZ1A 4E9YA 1AACA 2BP8B 2DWSA 1PZCA 4NB7A 4F2FA 3AG3B 2YAEA 4M3HA 1E5YA 1MG2C 3X2QB 2NRDA 1AZRA 3CVCA 1GY2A 1PMYA 1PNCA 2YAFA 1JZGA 1SDDB 4E9VA 1B3IA 1A4AA 2FWLB 3ZX1A 3AY2A 4ENZA 2VSKB 4YSSA 1CC3A 1R1CA 1ZPUA 4PAZA 1JVLA 3ZIYA 1I53A 2CCWA 2XXGA 1ILUA 1AZCA 2R7EB 1JZEA 1SDDA 4AX3A 2FQEA 2YAOA 3FU7B 4MFHA 4N8UA 5I5MA 1E67A 3JTBA 1J9SA 3CG8A 4A2DA 5I26A 2H5UA 1RCYA 1BXAA 4YSPA 1W6WA 2PPAA 2VW6A 1DZ0A 2HX9A 4P5SA 2GB2A 1JXGA 3MBWB 1JXFA 4DP9X 1PNDA 2UXGA 4KNTA 2X88A 6PCYA 1X9UA 2BZCA 2UXFA 3QJQB 5I6MA 2FT7A 4AKQA 1QNIA 2RACA 1A4CA 1OE1A 5B1AB 3SBPA 4NERA 4W1TA 4E9TA 2ZOOA 1HAWA 3ABLB 2WO2B 2JXMA 3IBOA 4YSOA 2ZWNA 4F2EA 3OMAB 2QDWA 1GS8A 1OF0A 4DP4X 4KO6A 4M4RB 5EHFA 4BDVB 4G7QB 3TASA 2YQBA 1PZAA 1AZUA 5AZUA 5I6KA 5TK2A 1DYZA 2WO3B 3NJFA 2CALA 3RYMA 1J9TA 2PPCA 1JXDA 1V10A 5I6LA 1AQ8A 1PCSA 3N55A 5I28A 4BWTA 1KDJA 1WA0X 2XV0A 4QLWA 1RKRA 1V55B 2BZ7A 5F7AA 1NIBA 2IAAC 2BHFA 1L9SA 5D4HA 3FSVA 5I6NA 4DP2X 2AZAA 2YXVA 3FQYA 4BXVA 1OE2A 3NP4A 4KO7A 5PAZA 1KBVA 4YSEA 1OCCB 5B7MA 4HHWA 4YSDA 3HB3B 1IUZA 1RZPA 2OV0A 3H4HA 8PAZA 3T6ZA 2XX1A 3V9CA 1FA4A 3C75A 2Q5BA 1BQ5A 4A2GA 3ASOB 1NDTA 1IBYA 3WKPA 3UABA 3NJHA 2BWDA 3T9WA 2FQDA 2PLTA 3UAAA 4F7KA 1MDAA 1JERA 4YSTA 2Q9OA 2VM4A 4A2HA 3NJMA 3T6VA 3UACA 2EINB 3CVDA 3UADA 1AZNA 3CVBA 2UX6A 1N68A 1SHWA 1UATA 5F7BA 4NAJA 2XUWA 5AKRA
chains in the Genus database with same CATH superfamily
4HOMA 3EG9B 1MQKL 1WS7A 4FTDA 4F7TA 3L5XL 3G5ZA 4WTZG 5C71A 2DI7A 4G72B 4L4TE 3TURA 1UUSA 1ZT7B 3D33A 3PXJA 1W72B 3W7TA 3B1TA 1QRKA 3FB8A 1XQ4A 3K6NA 3QNFA 4JDZA 5DRZB 1F4AA 2X2IA 3MRHB 5FWQA 5IB1B 1BQRA 4PJ8A 4JANB 4PDVA 1UASA 4I0PC 5HHMB 2ZKWA 3CBJB 2CDGB 1AS8A 5FM8A 4TQIA 1BD2E 3QRGL 4AIOA 2EXWD 2BXYA 2F8VA 4RAUB 4HJ1A 5T5FL 4XMXA 1JMKC 3WN6A 1FYHB 1ZLVH 1M1SA 2YLHA 4NNYB 2CD0A 2FLRT 1MW3A 4HIEA 4LCYB 1ZE3H 2R23A 5JJJB 1A8JH 4G70B 1HVXA 4M4PA 3V52L 4AQYB 4O4IB 1T83C 1CU4L 3B2MA 2Z8WC 4NXKA 4XPHH 2OYPA 2WJ5A 4OJEH 1T6VN 2DWEC 2R0LH 2YPLB 4YUEL 1OGTB 4WAFA 2WGNB 1HI6A 2F54A 5I1EH 2X53A 4JG1L 4HCGA 2D31A 5FB8A 5BZDB 1U21A 5IJKC 2A1WH 3RUGF 4TQHA 2EKSB 4ONHA 4HPYH 5LNGA 1XAKA 4RIRA 2R9IA 3T1YO 2X9ZA 1GYCA 3CFMA 4ZUTA 1NBCA 3OHXC 4QEGA 1H15A 3FU3A 1IAIH 4P4RB 1G6RB 2IWEA 2C3VA 3HVDA 1MFNA 1FPOA 3MNVA 4WUKH 2OM5A 1MRDL 5DM6V 4UIKL 5BPPA 5EBWB 2NR5A 3E89A 3MLXL 4MRCA 3BE1H 5C6TH 3BEVB 3EH1A 2UUAB 4F7CB 4NFCA 1L9QA 4L1HA 2NDFA 3KLDA 4OGYL 1PZ2A 2IDSA 2FGWH 2YKLL 2ODHA 4P3WA 1ZA6A 3I6LE 4RFOH 1MAJA 3GMLB 3LKOB 3P30A 2GJ6D 1U8OB 5CSGA 1PG7W 4G3YH 4TSAL 5K39B 4P5KB 5HPOA 2D7QA 3Q44A 1EAJA 3TJEL 2VN4A 2VDML 1TJXA 1MHPL 1QWUA 3OG4B 3GS0A 3VM5A 1MY5A 1W8OA 4IHJB 1G7HA 1AROP 4HS6B 5LGHH 5KA6A 1G7LA 1HC1A 2J44A 4O4JA 3VW3L 2YD2A 1C8QA 4ZQKB 3QAZB 5IROC 4F7MB 1CF1A 4RWYH 2EULA 4Q7DA 3CHOA 1KJ2H 4J9YB 2R0WL 2FDBP 4XMKH 5K59E 4ODTL 1D5ZB 1JGVH 3MRNB 3REWB 3FUIA 2FO4A 5F6HI 2W80C 2W8CA 1RPQA 5C0IA 1INQA 5GZOA 2VWKA 4OGQB 4GXUN 2VLKA 1PJ9A 5J13B 2CDYA 2PETA 3UC0H 1ZCRA 4LO9A 1QASA 3NK4A 4NWUL 4RFNC 4WFHE 3X3GH 4F5CE 4DKTA 2WQ8A 4DFHA 4Z7OF 2A73B 1MXGA 3NIDB 4FFVD 1NUNB 2Q3ZA 1WITA 3AG4B 4OD3L 2WN2A 3VXRA 1NPUA 2XWBA 4KVNH 1F7YA 4S1QL 1FPTL 3PU7A 2NSQA 2JF1A 4YVUA 2ADQB 2HJFB 1RURL 2BNRA 2R29L 2ZONA 2K6ZA 1IEHA 1NANI 2AJSL 5CJQH 4D7PA 3EGXA 2C2AA 3N91A 3A5VA 2A74B 1U95A 1MCPL 5HHPA 1XEQA 1CLYH 1PLBA 4Y5XA 4YS4A 3OJDB 3RYCB 1RSFA 3VXSB 2PYEA 3T04D 2D7TH 4LDLB 2KL6A 1RZQA 3V6OE 2Q0AA 1OE3A 1JI2A 5IB3B 1YYML 1OCRB 1YEDA 3CVIL 4LEOA 3R0NA 3UBFA 1YEFH 2ZKMX 5CN1A 3NVQA 1T0OA 3LQAC 5D9SA 2TAAA 1U8MA 1Y76B 3CFKA 2EEXA 4LOUC 3CDZA 4HZLA 1XB6A 1FS0G 4TRPL 2CHXA 3RDTA 2G2PA 3FKUS 3N1QC 3QPXL 1U8LA 5I1KH 5CJ5A 3DUSA 2Y7QB 1EEZA 1XDCA 4JZJC 5DJAA 2XZAL 4FEMA 4O2FB 1NMCB 3HG5A 1ND0B 3TBCA 3SJCC 1UADC 3MOAL 2JLLA 3QJOA 1NS1A 1E2VA 4L87A 3KL5A 4P0DA 1AGBA 1WAZA 1JCHA 2P5PA 4GKLA 5H2BB 5KVFE 5IWAB 1EGJH 5FO9B 1RXLA 2X89A 3GZKA 4AQEB 1SXCA 4YGVA 4KU1A 4PJ7F 5ICZA 4PRBB 4A7TA 2EUVA 2AVFA 3JV6B 2XACC 1RP3B 1ZVSA 3A3YB 3CFNA 3H8NA 1U3HC 4MKMA 4MVZA 3UCRA 5IB5B 4CVZB 2MPAH 1M5IA 2VR9A 4FLVA 3MRCB 3RIKA 2HLEB 3QIUA 5L4MA 5KLVH 4YHIA 3ZDYB 1BG9A 5AAWA 4PCYA 3BO8A 4LPYA 4B50A 1K8DB 4FI7A 5FM5O 4IS6A 3G5YA 1AXTL 4UAOC 4X4YA 3U7WL 3WE6B 3SBWC 2QGBA 4CMMB 5KBPA 3V7AG 1HL9A 1I0HA 1K8IA 1YPZF 4AL8L 3C5SA 3KPNA 2HRHA 3QJSB 1FIEA 4MRBA 4KKCC 2JIXD 3O4LA 2WAMA 3SDYL 2PP9A 3CCUV 4J3OC 1F4MA 2XT1B 1DBML 1M57C 1Z1WA 4O2EB 4ICGA 2HMID 5A7EA 1J8SA 1MSWD 1MWAB 4BZYA 3WTYA 1K6QL 3H6AA 4J11A 1OAUH 4F8NA 1TYRA 4RMBA 3AXIA 2J6EL 1VEPA 1OGPA 5ABDE 5SV3A 2YARA 5FS5A 1KIUB 4M7LL 1BIIB 2P4KA 4LL4A 2PMZA 1MCNA 1QSEA 2UY7A 4LPXA 4OD3H 3O4OC 2AEPH 3I6GB 4OFQA 4HOZA 1P69B 4MYWB 1XCQA 4WBNA 3GSQB 1WJ3A 4JO2L 4M7JL 4F2ME 4OF0A 2N01B 5FKAB 5ADPL 1CZ8H 3TCLB 4KTYA 2MCMA 5A16B 4FDWA 3KPRE 1XBRA 2YD7A 4FZ8L 1WUZA 2WQRA 4WFFE 2EXSA 3KCWA 4TSBL 4ZZKA 3CVIH 1E1QG 3DVNA 4JO3L 1MHPH 4ZD3L 1BE3H 2RR3A 1I8IA 1MRFL 1NINA 1FYTD 1CLOL 2D3NA 1Q1JL 4QPKA 3H01A 3LS4L 3RI5K 1RZ7H 4J6RL 3RGHA 2VXQH 3WMQA 3L73H 2VQEB 2XQ0A 1XF4A 3HE6A 3M99B 3EYVB 3IJ9A 5D6DC 4B97A 1JNJA 3V0DA 4GT7A 3RPKA 4B3SO 2PWFA 3QSKB 4UILH 5A6LA 3K58A 2FMLA 2DTML 3C8KA 3IXTB 5CJOH 2YPLE 2GC4C 5KSUA 5DUPL 1ZANH 2JCWA 3JATA 1ZRUA 3AROA 1WHOA 5E8DL 4I18B 3T08A 3ESVF 2D7MA 4X5WA 3L5IA 1TU2B 4LNVA 3IJHA 5EZJA 4DCQB 5I1DB 3P3NA 4TOIA 5DJ0B 1AVAA 1LL1A 4XCCL 4C54A 5J2UA 2CE6A 4TQFA 1HK6A 3VWKC 2Z6FA 4JPQA 2LFGA 4L4TB 4K7PY 2HRPL 2H8PC 3F7LA 4X7TB 5IMKA 3MA7A 1MOFA 4YDJB 1BF2A 1PS3A 1H2GA 1YN7B 3IDGA 4IGBC 4Y4KB 4U1MA 4YNYA 4PJAF 4XPTL 1EZLA 1KYUA 1AZBA 5D6CA 1KPVB 5B1NA 2ATKC 2WKOF 3UGEA 2I27N 1YTFB 1DLHB 3QQ9D 4EIZC 1BFTA 4U1HA 1F45A 3W7XA 2ESVE 5CJQL 2ZOKA 4JM2B 4OZ4B 1FHNA 3BIAX 3CRQA 2EECA 4N6QA 1VQ5V 3LB6D 2A9DA 4MAUL 4I0XB 1JMZA 3OKNA 3APMA 4N8CL 3W11D 3ZUNC 3TF4A 1AGCA 3JTTB 4U6HB 2BSSB 3AG3B 4GG8A 3X13B 3OKOA 4W9HC 1CIUA 3TXSA 4Z78B 1EEYA 1WBZA 5LMUO 3KLQA 4AG4H 4Z7QE 2X1PA 4B0MB 1G6UA 1SBSL 4J12A 3DJ9A 3P4NB 1L6ZA 2J6EH 2SEBA 1YMMA 1SVBA 1JWMB 3ZQ9A 2DF3A 2W0FC 2P42B 1IAIL 3BAXA 2VAAB 1XEUA 1TVBB 3H85A 2AEPL 4UZUA 2XZAH 3A0RA 5D55A 4WFEE 2WTOA 5MEPA 2NZ9D 4XPFH 1SDDA 3RL2B 3DX9A 1O9ZA 4JRLA 4O4HB 3MBEB 2YAOA 3AS1A 5C0GA 4N8UA 2OQJA 5I5MA 4Z6AT 1LXMA 4X0KB 1AI5A 2VUOA 3GKZA 2JRIA 2WBJA 4G2AA 4NIYE 1MDTA 1TFPA 4K94L 4PREA 3T4YB 3U10A 1BXAA 4M4RA 3F7YC 3RJDA 1KB3A 3LRSB 3PJLA 3SKJH 1LE5B 5BV7L 3LS4H 3RWJA 4NC2B 4MJ6A 3O9WA 2FL5A 3K5SA 3U46A 3SKOA 4ZMXA 5KHIA 4IHBA 1LE9A 1WN7A 4X4ME 5GJTH 2Q10A 4D8OA 1JJ2U 2KHAA 5GZOC 3SBPA 4W1TA 2ZOOA 4HUWB 4UTAH 2M7WA 4YC2C 3MBXL 1L0XA 4JPKH 3T0AA 3N27A 2VR4A 3EYFB 1T66D 5IESL 4LAQH 5BW7A 3WEXA 4CNIB 2WXNA 2VT0A 4DV4O 3J07A 4JFXA 3FO1B 2YUVA 1FGNL 4ODUA 2N1KA 3MJWA 3RTQA 4PJIE 3FT9A 2DL9A 3ECUA 4IBTA 1AXIB 2WWWA 3IBEA 3ICXA 1I3GH 1QEXA 4M6MH 1DQKA 1NFIA 2VC2H 3QEUA 5A2BA 5C70A 3TV8A 5E4OA 1K4DA 4K23L 1ZSDB 5I28A 4EZMA 1KDJA 1UACH 3MR9A 4JREB 3OV6A 2EC9T 3KWUA 4ATWA 1SOXA 5ESVB 1UM6L 1MEXH 3CK0L 1D5BB 3A8TA 5I1LA 5AYTA 1OCRC 3IF1A 3D0AA 4WI2A 3A23A 2ZUSA 2X1XR 3SYQA 3SJQC 1RHHB 4R26H 4HJ0C 1QKZH 4KO7A 2BOCC 4YSEA 3V6FA 1XGPB 1VACA 2OV0A 3WDIA 2EO7A 3ZRWA 2XFGB 4MAYD 1EFQA 1KYFA 2Q5BA 3Q01A 3CCRV 2WXGA 3VXUA 5CN3A 3MRPB 5D1ZC 1CGVA 3U82B 1ZEAH 2A6IB 4HWZB 4WFGA 5KSBF 4OX9B 2FQDA 3TV3H 3UZQB 5KBKA 5JW3H 4DW1A 5D71L 2QV2A 2W0XA 5CB4B 2VM4A 1KP2A 2AXGB 3HN5A 4LSRL 1PL3A 3K1DA 5I1KL 1GM7A 1R46A 2EINB 3CVDA 3QYNA 4L3FA 1A7RH 1DUZB 3O2WL 1OY3B 2UX6A 3JQOB 3L3HB 1WVZA 1ZE3C 3MV01 4GI8A 1BFOA 2AXJA 2RIKA 4KRLB 3BPLB 2ZT9B 2Z35B 3J8F7 3NRPA 4L37A 1N0XH 3X14A 4QR7A 3S2AA 5DJ6B 4UNUA 4ABQA 1YEWA 1D7BA 2HJDA 3LIUA 3HG1B 1XGUB 3QR2A 4ZHQA 4L3CB 2FKXA 2WBWB 3L16A 3B9KC 4X66B 5IW1A 1VQ8V 3B43A 3ZTJG 2B7DT 2F08A 3V0GA 3N9GH 4OQ1A 4UM8B 1IC4H 2Z4TA 4QXGL 3RPIA 4XP5H 5CSBA 3KJ4B 4QO1A 3TO4B 4M6OL 1FN4B 5HYJE 2VJXA 2M83A 3ATFA 5EU3A 2ENJA 2HKHL 2V5MA 3LEVL 2C9RA 5IG7B 5IK3B 1NI8A 4M5TA 3N43B 5DUML 1LUVA 5IGXH 4RLDA 1EHLL 1DQQA 3K6FA 2O93L 4BFGA 3DA0A 2HKFH 2HJLB 2FD6L 3H55A 4JFYA 2G2RA 3L4XA 1MCPH 5IZ7A 2PI5A 3HMXA 2BFVL 2C3HA 3NSJA 2R4RH 4KRMB 3O3BB 1H8NA 2F8OA 2XKSA 3N40P 2V9QA 4X65B 2NNCA 5A2FA 1R0AL 1GTFA 4K3GA 2ZXAA 1N5AB 2HVJA 4CS2A 1D5MA 1GAFL 1WT5C 3D51A 4JFZH 4YE4H 4U0QB 1OPOA 1GSMA 1WFUA 5HHOA 5GGVL 1MZFA 1Y1DA 2EKJA 3QAQA 4HFWB 3QPQD 3JAWA 1TTCA 4UQEA 3JSSA 3MLPA 2CTRA 1MUJB 3DK0A 4M8RA 4B3MO 4S1SH 5KTEL 4NTYA 3X12A 4PJCB 3TT3L 2H7WA 3IFXA 1UM6H 2C8NA 4OCSH 4KQ3L 4TNWK 4ZNCD 5EDSA 2YOCA 3TBTA 1B88A 5FA4A 3STLC 2P7TC 1UA6H 2C3WA 5DLLA 4GQ9H 1QKZL 2V7QG 3UG3A 2PP8A 2X70B 3W9DB 2GBOA 4KJYA 1KB9J 4Y1SA 1FKAO 5CJXA 3QNYA 3ZYOA 4Y16A 1S9KC 3BCCH 1RIUH 5B1KA 2J71A 2CDEA 1IXMA 4LLMA 2CDFA 3WU1A 5E6ZA 4N23A 1IC7L 3H1IH 1TTAA 4TQEH 1EM1A 3J7AU 3BUYA 3OPUA 1UC6A 5DU7A 5AW9B 1JAEA 2AP2A 4HJGB 7PAZA 3JCZA 3SQOL 1G5AA 3CE1A 3VWJB 1SUHA 3TNMB 5EC2B 1E8WA 3X17A 4UT9H 3LIZA 1O75A 2PNDA 4OJCA 3TCXA 2DLGA 4YLQT 2OYLA 1J8HA 1J8KA 2F0CA 3X2QC 4TT3G 4HAKA 1SJEA 4HIIB 5SX5K 5LMNB 3FFCB 5E08H 1B06A 5C8YB 2YUWA 3RX8A 3VGHA 3CQFA 2X7LB 4WI5A 3Q5OA 1MQKH 2X1QA 4MX7A 6PAZA 3LXUX 2XV6B 3O2VH 4MS8D 3VFSB 3PNWB 3Q4HA 4QIRA 4UV9A 3WHXA 1TZIB 1T04A 4LPUA 2AV7A 3QIBC 4QHPA 3U6RB 3MO1B 1NGPH 1UXLA 2APTA 1W8NA 2ZCKL 2F19L 3UAEA 4HLJA 4WKZB 3CN2A 5H6RA 2WIIA 2Z4QA 3O11B 4BDVA 4YL4A 2RGSA 2VLME 2ZXGA 3F58L 3BW9B 1KCRL 2DIBA 1KACB 3EH5B 1P6AB 4IMLB 4ODXA 2PTUA 5J12B 1OSPH 3GSRB 1GN2A 1VPOH 2B4CH 3T8VA 4ZT1A 3QDMB 3ET9F 1YCIA 5KN5A 5E9DA 4QAMB 1S7TA 1I8MB 2JKTM 5HHQA 4JN1L 5E6IA 1ZLWK 3WO4C 2H8PB 4F9PC 2D4DA 2Y69B 1PLAA 3FCGA 5C7XH 1QTPA 2EDNA 2CU9A 4ZMAT 2CHWA 3ALWA 4PB9L 4DQOH 5HYSB 4W9EC 2X0VA 3TX4A 2ZUXA 1ETB1 3L4ZA 2QHRH 2GITA 3E35A 1ZLUK 3O65A 1VENA 2BINA 3M17B 3N0PB 3ABGA 4WV1C 3RX5A 1QSFD 5INDA 5JNYB 5IQ9B 3QC6X 3LKNA 3ZKXC 3CMEV 4PJ6A 3RA7H 4ODSL 3QO1B 3OGCA 1XDTT 3VWJC 5HP5A 4HEMA 3L1GA 3QB7C 1T1YA 4DUYO 3UYOD 3VXMD 3GBMH 3VFVA 2BIQA 3OTOB 4JFDB 5LDUA 1WRFA 2FQFA 1NCGA 5BVPL 3BWSA 5FKPB 4N0UE 2Z5UA 1BT8A 2R0KH 5DJCB 3QJVB 3KCPA 2AQ2A 3QEQD 1XH1A 4K7PH 4WNJA 1MCOH 2AMUA 1ECYA 2WXRA 1HH6A 2EQDA 3T8XA 2E5LO 4G8EB 4PR5B 3NZHH 2R9AA 5FGCE 1HHGA 2F74A 1VA9A 2FSEB 1L5GA 1NWPA 3DGGB 2R1YB 4C56B 2YWZA 1Q6HA 3IU3B 1TSRA 3TXAA 2B5UA 3RT3C 3CSFA 1H2SB 2V17L 3DPDA 1I31A 1I1RA 2BOLA 3QI9A 1NMAH 1B4JL 5D93B 5AKSA 3UZEC 4ZO7A 2VN5A 3BWAA 5EO0B 1Q9KB 2Y5QA 3NCBB 5C8JA 3U0PB 2J7LA 2X6MA 2ZSWB 5GGUA 1E79G 3LD8C 4EIBA 4OCYH 1XL6A 4ZZFA 1PG7H 3MLSH 3MU3A 1N36O 2DYPD 5DYFA 1OD7A 4BFRA 5HYQB 4F1SA 5BVJA 1JRHI 1NKGA 3M45A 1VGKA 5ALCL 1UGNA 4AK1A 1NEUA 4BHUI 1Y18A 3GINA 5BRZD 2H32B 2VO5A 2Q6WA 4KNQA 2GJ6B 1QO3A 3ARRA 3PIQA 3WEBA 5KMGB 1HWYA 4RDQF 5DFVC 3RWGB 4F8OA 2CBOA 4A6YL 1BQLL 3CX5K 2QHLA 2TSAA 2E6QA 3DOHA 4Y1AB 5ID1A 1ONQA 2YDEA 5GS0L 1TCRA 3HE6C 1RY7B 1KCRH 2A9NH 2JI2A 2F1EA 5E5UB 3FYIB 3Q6GL 1KG0B 1RPKA 1ETJA 2EH7L 2XWXA 4PJDA 4WEBH 5TDNA 2YGVA 1KGJA 2K78A 2YAHA 3KXFA 1V7NL 1XZ0B 3QFGA 1QG3A 1C5DA 3EO1A 2Q76B 4LFCO 3G5WA 2A6DA 4RA3A 2Y7OA 4QHKI 1CGWA 1HR0O 3KS0J 3DBXA 4JCLA 2EH8L 3MJ9H 3TBVB 1BQKA 3FQUA 4FULA 1YEHH 1TVKA 3QUXB 4MD5B 3S3BB 4PYHA 2XPZA 4X5XA 1O7VA 3HG1D 3LHAA 1ANUA 3KVPA 3GI8L 2JGDA 1KZQA 2CLRA 3AM8C 4MS8C 4OIIL 3VFNB 2QTVA 2P5OA 4H25A 4AXWB 2V2TB 4GKNA 3HZ3A 3E6HB 3R06B 2HPTA 5E9NA 3RBGA 5HYSG 4N24A 4AJWA 5AD0A 3PDDA 2GIMA 2NT0A 3HNSH 2BY3A 4G9DA 1AXSA 1L9NA 2XV2A 1HNYA 1KCVH 2APXA 2EYRB 3B5GA 4NFBA 5HFLA 3C09C 4ORGB 4MXWH 5DSCA 3WE1A 1IQDB 2HG5B 3NZHL 5I1AA 4XMVA 1XI1A 1DN0B 1HEZA 3AJ7A 4P30A 4IOIB 4X4XB 4KK6C 4YOKA 1X5AA 4FL4C 3G6JE 3U4EA 4OLUL 4ZSOA 3L75H 4LF5B 4N8VB 4NI3A 1Y6NR 5DHDA 3ZE2F 2XBZA 4DO4A 3RHWK 5DQJB 4P2RB 5JJNB 4RSVA 4MNQD 1HWHB 2PR4L 3T77B 1WLHA 5FPRA 4NO3A 4LCIH 3GEFA 1H19A 1QUPA 1SF3A 2NY3B 2O30A 4RBPK 3QG7H 3BRDA 2WKLA 2AJXH 4WTZA 1UACL 3CXFA 2VDKB 1YNTF 3FFQA 1J0HA 1YNTB 3O6ML 5DHMC 5CEYB 4FA6A 1ET8A 1N6QH 1FYTE 1MCFA 1H2LA 1NC2B 2AVGA 3H7BA 1RURH 5F7NC 2IXQA 2Z7YA 2H9GA 3BH8B 1D6EA 4LDOB 3HR0A 3FRUA 1J0ZA 3KYOA 5TTRA 3IGAB 1LDPH 2E74B 3TO2B 3WTUA 4XNXL 5JQ6L 2WPDG 2NW2B 4F9LC 2GSIB 5CLWA 5K9JL 2QVTA 4WW1A 4JE4B 3D07A 4P9MH 5DVLA 2BMKA 3TN0D 5IHZA 5KYWB 3NA9L 1WJZA 4BELD 5IVXB 2E7LA 5H37H 2ZXQA 2IAMC 1B2YA 5G4OA 2BHUA 1J5OL 5KZCB 3ILQC 5IIEB 3RUGB 1WP8A 4FP8L 2L7UA 2IGFH 2ADFL 4HKZA 5E00B 3WUWA 4KHPB 1S5IL 4DR2O 3KXFE 4S2SB 5KYNA 3RZCA 1IM3B 1KBBA 3P73B 4K7PX 4R4FH 4YR6A 1S7SB 1IXBA 5C0ND 5BVPH 3D18B 5F6HJ 5E8OB 3HKBA 1I53A 1PD6A 2WVVA 2FRGP 4JQIL 4XXWA 4GXUM 2UWEA 4WHTB 4DV6O 3MXWH 4DPRA 5I1GL 5JMOC 4ZX4A 1DO6A 4TUKL 1ZA3B 3K06A 2VERN 1N0XL 1KKCA 3CDCA 1J9SA 4PJ9A 1JV5B 2ZQKA 3JVGC 1R5IA 3RG1C 5HY9A 3WIFB 2ZT9C 1NMAL 4M02A 1TG8A 3CC5A 1Z0MA 5HHVH 4MTXA 4OM1H 4PRAA 1BREA 1YECH 5DS8A 4X9GA 4F3FB 2E7CA 4WGWB 4HP5A 4CC6A 1JCVA 5DEGA 4IRJD 1AVMA 2DQTH 3CSTA 1OGSA 1QNIA 4M3KB 4Z2WA 1OE1A 3NGBC 5B1AB 2JVUA 3CZLA 1JNNH 4MA8L 3QG6A 4F91B 1C8PA 4DV2B 4MZ2A 4OD2A 2QQNL 4K07A 1RFDL 4K15A 2P8MB 4K3EH 4XRCA 3RYHA 3DC6A 2J12B 1MQ8A 2PTVA 4DV1O 1NBYA 1CD1B 3WEOA 4D2NA 3DXAD 4BKTC 4G1EA 5FNVB 5C0FB 5CUSH 4NQCA 4X6CB 3VI3E 3LVTA 4OI7A 4PY8I 3NJFA 3HRZB 5I66A 4TUJA 3TVMD 2UUDH 4K5NA 2Y3AA 4ILDA 2OXGA 1YQVH 1UM4L 2B1AH 1NGZB 3C6LC 3GMPB 3VGAB 1IBDA 1E6JH 4MZRA 4Z3IA 1OL0A 4I4WB 3JSLA 5F1OB 4F33A 4WI8A 4I5SA 2Q7EA 1NFAA 2JK5A 2NY3D 5A43C 1JTOA 4JI3O 3MLZL 1T03H 3VWKB 3HHMA 2MSPA 3MROB 4C56E 3ZO9A 4ZBJA 1YEKL 2J8UF 4DR5O 1W0WB 2YXVA 3C60A 2IH1B 3BUPA 3F8UB 3HMWL 3MGAA 4P2OD 3CVHA 4WW2A 1COBA 3GUFA 2BZDA 4H44B 4KUZL 1PKXA 1OCCB 2J8OA 3M8OH 5B7MA 3UROR 1X9LA 5KYYB 5DUJA 4OLYL 2QGDA 4PTUA 3FTZA 2NY2C 3TF7C 2FGZA 3IETB 3CXHJ 4GUPA 4MQSB 4XVOA 3KNBB 3DX2A 4UCVA 1C9SA 4JO4H 5FYJE 2LOEA 4PVLA 2IQAA 5FECB 4J4PC 4R2GB 1ZHNA 2BM3A 5E24E 5IYBO 2HT2D 1O5PA 3NJMA 4PD4K 2IVFC 3VXUD 3VW3H 1KCVL 2HR3A 1XQ8A 3VXOB 1INEH 3WY3A 3QCVL 1BLNB 1SKVA 3F12B 3IJ7A 5F7BA 3VD0A 2H4EA 3W9EB 3LPPA 2ZJSL 4MASA 2A99A 3NCXA 1D5IL 4JKMA 1WA2X 2QL1A 3A6OA 4KXBA 4K7FB 3EBAA 4PGEA 4H8WH 3ES6B 4F2MB 3V4LA 4PJHF 5FYLL 2WBKA 2X4QA 4UV4L 3QWOB 2OMUA 4WZ9A 3VGBA 1Q94B 4TMPA 1T3FA 1WUNT 4ZX3A 1EQWA 2YIAA 2QR0A 4I2XE 2DIJA 4OLZL 3V7AE 2FT6A 3L6FA 4Z5RB 2F5BL 1J0IA 1D6VL 4N2NA 1E65A 5C3IA 5MHSD 3U36A 3F7VC 2R8SL 2W1NA 4LVNC 2HFEA 4OZHE 1JNHA 3IEAA 1EEUA 2GJZB 1WLEA 1YJDC 3WD5H 4QRPD 3FB5C 2ERJC 2VISA 4LVEA 3VGGA 4MAUH 4LSSH 2OULB 3K5MA 3UTZB 3GIZH 2VM3A 2DTSA 4I7ZC 5KOMC 1VKXB 2EXWC 1XB3A 1N2RB 2CO6A 3SPIA 1NEZG 1NAML 1JDAA 3P4MA 4M5SA 4R9HA 4BQ6A 2DBLH 5KVFL 1KCSL 3CH1A 2KZKA 1IAKB 1UH3A 2VC2L 4CZZA 4LQFL 5JHDD 3MN8A 1DTUA 4RH4A 3ZDYE 4G9FD 4K9EH 4JN2B 1U2HA 4NHUA 3T6XA 5E99H 4PVBA 1ZLSH 3ZKSD 2V9RA 2I07B 1Q0XL 1D7FA 2ZAHA 1IC1A 3HE7C 4WU7B 5F72S 2Q68A 4WWKA 4AH2A 4RZKA 4BEIA 4EI6B 1R24A 3POCA 4KV5E 5IT2L 1S7WB 1CEZA 5LNEA 1ID5I 1XVSA 5GHWH 3DSQA 3OR6A 4HIQA 2I26N 1GKFA 2KH2B 4XVTL 5I1GH 5EC1B 3ERXA 1F4HA 4G7YL 3BWZA 3MTXA 5AZ2H 2AABL 3DTUB 1JZHA 1N18A 1YY8B 3L3DB 3BXNB 4LSDA 3H9ZA 5T1LB 5IMOB 5ISZE 4W6WB 1NCWH 4LBEB 4NB5A 4PW3A 4DK1A 2EDTA 1S0VA 1AD9B 2RH0A 2XLLA 4LH6A 3NFPA 2X38A 1TTBA 3RWEB 1EN4A 4NRYB 4OCXL 5HI4C 4HQQL 2VMJA 4G6KL 5C6PB 1DSWA 2AFNA 1B9ZA 2AEQH 4G8IA 3UJIL 2Q7AA 2GY7B 4PRPB 2PCXA 5ANME 3VCLB 4AENA 3OE7G 4HYTB 3QUXC 3FX7A 1QI4A 4LF6B 1PLGL 2GSGA 2NR6A 2EYTB 1BMZA 2PCYA 3GSXB 3H9SD 5AVUB 1IB5A 5M95B 4DP5X 3DYOA 4DV5B 3BOVA 4U2YA 4HJUA 2VMEA 4CH4A 5F71A 2CJSA 4PY7B 4DR3O 3MOBL 1BGXH 1IBKO 4TNFA 4XWGL 2X0UA 3O3DA 4XBEL 2VLJD 5F9WB 1SETA 1CGYA 4PD4J 3OMIB 3T3PE 4BCZA 2R29A 5TFSL 1PZ3A 1FGNH 3WTXA 3UMNA 1TR7A 1A14L 1EZVH 4I9QA 2YSSA 2XWJB 1HQRA 2D9CA 4GAFB 3LZFH 1F3DH 1G5GA 2E59A 2QQKH 2P5EE 3P3SA 4EI5C 1DFXA 3MGTA 3W37A 2VZ1A 1YSOA 4L1SA 2WMPA 5HDOA 3A4AA 4E9LA 1EN6A 3HKCB 5AOIA 5DVPA 2FHBA 4TNVK 5JHLA 4JK0D 4WEBL 2RDCA 2L0DA 4GKSB 5DVKA 4ZK8A 4BGLA 1YDPB 4UT7L 3EFOA 2OTJV 4NQEE 3G5XB 3VVVA 3GGWB 4LKCA 2G5BA 3L3JA 3P9LA 2AGJL 4MJ4A 4U05A 1D2DA 1AKJA 1U8KA 1K92A 3MXVH 1SJXA 2OR9H 1AP5A 2RJMA 5JUEL 2GDSA 4BSJA 3L7EB 3WY4A 2CKBH 5C6WH 2AAVA 1R3JB 4HWNA 1AJNA 3FAVB 5EBLC 4B7KA 1TF4A 4R7DA 2RQEA 5BMFL 4I3RH 5F7YC 3HZYA 3KWTA 2VLKE 4XZUB 2XTAA 2GJPA 1GGTA 1P84F 3ZHLA 1JTPA 2ZE0A 3ALXA 3QARA 3KE0A 4JRYD 4LBAA 3V4VA 4MMZB 1N32B 2AXWA 2Q7YA 5FGCB 1X59A 3CC7V 2JKNA 1JFFB 2LFEA 3LEYH 2XQYA 1A7RL 2EIZA 2ZM6O 4R4BB 3EJCA 2BIHA 3PWPA 4PV8A 4O00A 4EKJA 1C08A 2R15A 5LBQA 2YAQA 1RAMA 2ZJSH 5DA4A 4H0GA 4WDIB 3LNDA 1FVEB 5GONA 1FL5B 2UXTA 5E2WL 3ZEDA 1PQZA 2HRGA 4PJ7E 1KENL 1Z3GH 1MW2A 3HS0A 4A68A 2OMBA 4IHOB 4UWQB 1HDJA 5C0BE 2Y1AA 3HC4L 2PR4H 3PWPD 3EDEA 2WVSA 5T3XL 2GUOA 2G3NA 4MS6A 5DWUL 1A7NL 1HL5A 2WWMC 4FL4B 4JHVA 2Y4UA 1EVUA 5I5JA 3FTUA 1KB5A 1VQ7V 3NH7H 3K3WA 3MNZB 1CDCA 2RN9A 2DQEL 4PV9A 3TIEB 2C5DC 4X42A 5IOKA 5LB1A 3ZPDA 4U1LA 3WFZA 4M93B 5HI3C 3TP4A 4F7EB 3CD6V 4S1DD 1BJMA 1L6PA 2MRYA 1MCJA 3MBED 4L9DA 4NN6B 2QR4A 5H4YA 2O5ZL 4O4LB 3DX7A 1HYRC 5ICUA 3AITA 3WN5C 3WFHB 3OQRA 1RFYA 1N12A 1E40A 3BCDA 3TYGH 5F7EL 4YE4L 3IDIB 3LEXA 4X1IA 1F4XH 1Z5LA 2LTQC 3DSFH 5CD3A 4JPVL 4ZAKA 12E8L 4RAVA 1X9RA 1E4WL 2OSWA 3VFMA 3N41B 1OGTA 1KYOF 1UKSA 1MHEA 4ZQTA 5I5RA 2P46B 3T2PA 4JYYA 1N9PA 4XMLH 5FO2A 5DI8A 1S78C 4OV5B 5IFJB 4APQB 2AERT 3H4FA 3QQDA 2HUHA 4DKAA 4LKXB 4JDTH 5E6YA 4KHPO 2BNRE 1NOAA 1H15B 4A39A 2IAND 1I5XA 2E7BA 4EDXA 5AFAA 3WG7B 2HVKB 2VZUA 3P77A 5GS3A 4TS6A 1IMHC 3JYBA 1SMAA 5D2NB 5GS0D 1SXNA 3L9YA 3RGVA 5BS0D 4IOSD 3NFNB 3SDCA 3L70H 4FQ2H 5CINH 1MRCL 1FH5H 2BH0A 1R3KC 3AB0C 5CGYC 1WS8A 3FH8A 2VQFB 4J3UA 4F7CA 3O4LE 4JI6O 1C5BH 3SJVB 1KC5L 4RQQA 2IANE 3ARYA 2OT5A 3O6FA 4YC2B 4G43B 4ANUA 4E42A 4PY8J 3OR7A 2CO4A 3NT0A 3HKZA 3VRLE 2PF6A 1E50A 2VDLH 4OKDA 1RK1A 2OJZL 1KIQB 3DC0A 4OZHB 2XPGA 2ADGA 4RRPM 1CL7I 5T1KA 2YFOA 3CHQA 5J6HA 5SWZA 3QCTL 5JOPE 3S8GB 3ECBB 3KPOB 4QOKE 3RYFB 4Y89A 3ZKNC 3V10A 3CCEV 4TLSA 3TBSB 2MPVA 2BVQA 1TQCC 3SDXA 1G7LB 2XXCB 4M7ZC 1G1YA 3E8UL 3IDNA 3QR0A 5DD1H 1P0SE 4LAQL 2C1PB 2CHNA 3QS3A 5SX4H 1HILB 2IU0A 2AQTA 4KKAC 1H0DB 5JVDA 1FAKT 4WENB 4OFKA 3EGSA 1IVTA 1Z7JA 3EJUA 4DR2B 4LVOB 4PRHE 5EU6B 5HVHC 3BD5A 3RWHA 3DURA 3KLSA 3SKNA 3VTTA 5F7FA 2BTQB 1ZLUH 4Q2ZA 2NYKA 2ZCZA 3BLBA 2OL3A 1CYWA 3QUMH 4XI5D 3UP6A 5ACLA 1BQHB 1S9WB 3PE9A 2GHZA 1KQSU 2DQJH 3EFFA 2F93B 1JCKA 1E4KC 4GYBA 4L9LC 4AZ8A 3BUIA 2XXFA 3VXNB 3WSQL 3EVKA 2NXYD 1WGVA 4XAWL 4EEQA 5GZNA 1R47A 2MHAA 3H7LA 4V1DB 3EBIA 4Y9EA 4F24A 1GZPB 3CLEH 1R3KB 3LDCA 3OUSA 3AB0B 5IQLA 1G8MA 1KGXA 2BP8B 4UU9A 4BIKA 5B39B 4OZGE 1JZDC 1MVYA 3KBHE 4PJEA 3BT2L 2WZ0A 1R0AH 3S88H 1E9QB 2PXYA 2V3EA 4L4VB 1OF2B 5LN8A 3UJTH 2ZUQB 3FFCE 5IVXF 5F0LB 1K4DC 5FA3A 3QQ9C 3JAKA 3L1EA 4J3XA 4MJIB 3EOAB 4Y19A 3BZEA 1CE1L 1EERB 1TMQA 3B7UX 4R7XA 1XMOO 2C9AA 2GIXA 4Y5YA 2XVLA 5E99L 2ARHA 4M7LH 4TRPH 5TGBA 3NCCB 4HUCA 1YEDB 3HE6D 3HG3A 3W11C 4LSRH 1R1CA 1LHZA 2CUHA 2BNQE 3LEYL 4NEHB 1V7NH 4LLVA 4NO0B 3ZRXA 1AZCA 1J1PL 1Z2KA 4B3VA 1Q0YH 3UXFA 3EUUA 4ELDA 1Q9LA 1FXHA 5F96H 4RQFA 1BIHA 1E4KA 4L9LA 4AE0A 2NY0C 1J5EB 5KAIZ 1IGCH 2P5EB 1J0YA 3KJ6H 1P4IH 3DROB 3QUYC 2AQ3A 4POYA 3N1FC 4ZJ9A 4DEUA 1BVLB 4PCSA 2MFNA 3MV8A 3TBWA 3L7FB 5D7JD 5EWIL 4HUVA 2HX9A 3H9SA 4IGGA 4P5SA 4JM2C 4BH7B 2EVGA 3T0ED 3AUWB 4WJKB 4Z7NB 5K33A 4DP9X 1N5YH 1FVDB 1T1ZB 3BVTA 2EDMA 3ZMVA 1U3NA 2J72A 3FOLA 4QYOB 4KZEH 5CBAB 4Y1AE 5F9AC 4I18C 3MX0A 2B5IC 1DSYA 1OM3H 4QRRB 2YI8A 1EJOH 3QF7A 2E9GA 1T22A 2G75A 3WN5B 4LPCA 1A3LH 3AACA 3E9TA 2NY6B 3WFDL 3SDDA 4QE7A 1HAWA 5GRJH 5IB5A 4OGZA 2P8LA 4JFOA 1NAMB 3I3EA 4UT9A 1S46A 3NABL 4WFEA 1IM9D 1D9KC 1WAPA 1XIWA 4F15B 1USZA 2CIKA 2EXYD 3BO8B 4OD1H 4U1GC 3B9KA 3IFNH 4G1MB 2BIMA 5C07E 2X12A 5A3IC 1ZTXL 3IAPA 3I6KB 1WNSA 4A7SA 5I73C 4IIQB 1UURA 4KAQH 1E5AA 4UZSA 1Y67A 1X4YA 2HSIA 1D5RA 3H0TA 3T3MF 3D2TA 3OB0K 3VXMA 3WLBA 3DLQR 5G4MA 4BWTA 3RFZA 1G9MH 3OLIA 5BMVB 1U93A 4O2EA 4XP4H 4U7OA 4XO4A 1OT2A 1B0RA 2VXUL 3FF7A 1P84J 1V55B 3UKMA 1JGEA 1GJWA 1G9NH 1QBML 3O9WD 3POHA 2VMCA 3VAEA 3WGVB 3WTWA 1K97A 1RPRA 2Q3AA 3C3SA 3CRCA 4JYAO 1UXSB 3ISYA 3L3OB 2AZAA 2NUPB 3CPUA 4H8QA 2AGJH 2ITCC 3UO3A 1FL6A 4GLRI 4X6FA 2AABH 1YEEH 3ZGIA 2OL3H 2DEWX 2ENSA 4W6YB 3BH9A 1SXSA 3BC9A 5GIRA 5BRZA 2GI7A 3NUKA 4MMZC 3QDGD 4NKMA 1K5QA 4GW5B 4MQXC 4UCRA 5CM1A 1N0NA 1DCLA 3C9NA 3NRFA 5CBFA 3FB6B 3WKML 2QQLH 1AZVA 1MI5E 5IEKA 5AWNL 4TTGA 3Q2VA 1HCYA 2OWOA 2Z31B 3C6EA 3CJHB 3D39E 4ZXBB 4OFPA 2VJ0A 4UUJC 3D4GA 3V6BR 3G6AA 5KVEH 4LE8A 4AYBA 2VSCA 1U91A 1T7ZA 1ZHKB 4Z1MG 1JV2B 3G80A 3KBPA 4DWHA 4JB9H 1I8LA 3P9WB 1CPYA 5IJ9B 1S76D 4PJAE 1IGYB 2LGQA 3ZBHA 1DBBL 1FJGB 3BSGA 2VDPB 2QSVA 5D96C 3UYPB 4TUYA 2DLFH 4J80A 3QO8A 4DR1O 1IKOP 1FVCA 4GAJH 2FIKA 4NM4L 4CMHC 3AY4C 3QDJA 4NC1E 1IGJB 4HMEA 1WB7A 1D9KB 5BS0A 1FBIH 3L3OC 1MELA 5IWLA 5KYXB 2P3YA 1ZS8B 4RGOL 1S78D 1VSCA 5TF1H 4UAOB 5KSBA 3WXVL 3P2BA 3BN9C 3SCMA 2GFBA 4O2AA 4PW4A 4HAMA 5D4QA 5ITFA 2J5WA 5FYKH 3AU1A 3FQWA 4LP5A 4R97C 4Q56A 2FNBA 4KDTA 5CEZD 4I48B 1NGWA 5LBSL 3S8FB 1LEGA 2MOQA 1XSIA 2J4WH 4FLSA 1YN7A 1J88A 4W9JC 3FSAA 5L88H 3ULUL 4A7VA 2FJGB 3IVKB 5AAMA 4M62H 2ED9A 1X5LA 4L8SA 2APBA 4PB9H 3IDXH 2Y0IA 5H9CA 2A77L 4WK4B 4PELA 3C6SB 1FFRA 4L4TD 1OTSD 1NGYA 5ETUB 1M6OA 5E2VH 4OZ4A 1ORQA 1UXWA 4CC4C 4LCUA 2Z92B 3DIFA 3VFTB 3PV6B 3ZKQD 4IEFA 1U8PB 1GMIA 1TEGA 1F5WA 1QBAA 4B3RB 1F1AA 3L2MA 1I1YA 2DWXA 1M2VA 2BSSA 2YJQA 4JM4H 4L29B 3JWNH 5GGRA 1K4CA 5CLZA 1EN5A 4Q97A 1H3VA 5KZCD 1K5NB 1A6PA 4KI5E 3L9RB 2NTFB 2WXPA 2XN9A 1AQMA 1QR8A 4OW6A 1QBMH 1RZKC 2A74C 1PTZA 5FYJD 1FFOB 3U1QA 4Z7WE 1M9WA 1KB5L 2CR3A 3CCSV 1CICD 1JK8A 5DEDA 4JO8A 4Y2DB 4X6BA 1KYOJ 1YEIH 4LSUH 2VAAA 4Z0BL 4J7JA 1FGVH 2X2JA 2VDQL 3HLAB 4NQXB 4AYFB 5DD5L 3BQVA 1G7PA 3CMGA 4EB6B 3T5WA 3CIAA 1ZDSA 1JGDB 3OGCC 2QBWA 2QPEB 2YXLA 3O41A 2ZOWA 4ETYA 1AIZA 2DN7A 3CDGA 3HC4H 1MJJA 1H9DA 3ASNC 5FOBA 2EIKC 4I4TA 3QXUA 3WS3A 2YLKA 3RNQB 4JHZA 1UZ8A 5AG9A 1QFPA 2CJUH 1OAKH 4WTXA 2DWEA 2JNZA 2VZOA 4W9CC 3U0TA 5JIDA 5C0CB 5CEZE 4YMPA 1W8EA 1A1NB 2X3BA 3GBNH 4XPBH 3NIGE 1WIUA 3F7YA 3D3IA 1AHWA 2AW9A 2CGNA 1T4KB 4UTAL 5BOPA 2H41A 1P2CA 3BA9A 4OFYA 4ZNEE 3QIWD 5DUPH 1W6LA 4FQ1L 3SKOB 4ANKA 3BKCL 4L4VE 1NSNL 4FIPC 1TT6A 4MMYB 5EOCJ 4L48A 5HVGB 4P99A 4Y4FA 1YLBB 4NM4H 4LLAA 5AW2B 4CC0A 3ARSA 2O61A 2HTKD 1CJYA 5LAXB 4BSWA 4K3DL 2DQIL 1Q0EA 4P3DB 5AL8A 5I19L 1NBQA 2LGNA 1XNRO 1DVXA 4LSQH 1BQLH 4JZJA 2Y6SC 3K74B 4L3EE 4AQ1C 3KGRA 1EHKB 3E22A 5BQ7A 4N86A 4X89A 3U0WH 4DOHB 3ZRCC 4UCUA 1MIML 1RVFH 3QCUH 1IL1A 4R4ND 4WW2C 3CFCL 4HHAA 1Q86W 3AS2A 1I7UB 3ZZ1A 3HC2A 1Q4NX 4JDTL 2Z0UA 3U30C 3WTTA 2IBZH 1R3HA 4GRWH 1TUEB 4LVOC 4UTCA 5HVHB 5TDOA 3RP1A 1J8HE 1Y6MR 3SKUD 3TPUA 5F1NB 4FNQA 1KEGH 5IP4A 2IQ9L 5I1LB 1RUQH 2XKNA 2YKKA 1JNLH 2GCYB 1IM9A 3EH3B 4PJGB 1I7ZB 2ATPA 3MV9E 4YHHO 4YBLB 3UBGA 1GC1C 3B6SB 2WB1A 1A6TB 2KZWA 3WG7C 4FM2A 2HFFB 3KEHA 4HWBL 5A40E 2HYMA 5L3EA 1RK7A 3DX8A 5AWNH 4KK5C 3T0WA 5L9DL 2IDTA 1I1AB 5J1AB 4XVJH 2BOCA 3INOA 3QIWB 1KKDA 3DIVA 3MNMA 5I8OH 4CW1B 2H32H 4BW9A 1I3VA 4E0RA 2JKLA 1U8HB 2FBJH 4OB5L 2Y07L 5B38A 4GG6A 3TT3H 3PAUA 4PJ8C 2VDRH 4GLXA 2B59B 1J48A 2Q67A 3S6CA 3EOTL 4CA4A 3T1FA 1BAFH 1OTTD 3TFKC 4Z3FA 4DO6A 2H3KA 1PY9A 4NZJA 1NH2B 3D12B 1P6FA 4R3SB 4H33A 1M7XA 4ZYKA 4EVNA 2W6JG 4JQXC 1K33A 3VRLF 3DXAA 1BM3H 4OLXH 1IAII 3ABMB 2OJEB 3D34A 5L4JA 1XB8A 3VYNA 2KDYA 4L37B 3W0WE 1QRNA 2VR3A 2KPWA 3D9AL 3FUNA 2OK0H 4OCXH 1BQ0A 4FD0A 1JZIA 4X5QA 4JAMA 4OM1L 4ICXA 3ARFB 4G59C 5FYKL 8FABA 4WFAV 1KC8W 2CJ3A 2YRZA 3BDYL 1WO2A 4L8DA 2BSRA 5LYJA 1PVHA 1DQLH 2QKIA 4WF9V 2EAEA 2CAKA 3BY6A 2Y3NA 4E41E 5IJ0B 2EDLA 1YUHA 3RYIA 1ZJAA 3PDOB 2MW2B 2PI4A 3Q05A 2AK4A 2C26A 4WNSA 4Y4HD 4JQIA 3HFML 3DO7A 1EFXA 5KHHA 3OTOO 1RFDH 1KJ2L 4WSGA 2Q8AL 4MNHA 7PCYA 4U0RB 2I9TA 2ZDIA 5L2KD 3K8MA 4N8CH 1G1CA 4FLZA 3E2EA 2BVPB 5FFOA 3V6OC 1AB3A 1DVFA 1F86A 2NNAA 3BUQA 3D0LB 2WXLA 5H94A 1R4XA 2WLYA 5AVRB 4JFEA 1T7WA 2DBLL 4B96A 1OSYA 4ZX6A 5GGVH 2CPUA 4P2AA 5J06A 4TSCL 4H8HA 4B53A 1REIA 4FLRA 2ZYSA 1F1DA 1KJ3H 4KDVA 3V0VA 4IGBA 1TQBB 1S7XA 3O0RH 3SPVA 5F88A 25C8H 3SO3B 3MV7D 3D85A 4UQ2A 4UQ3B 1FO0L 5IHUL 4AE1A 4U1KB 3T0VA 4AMKL 4MCZA 2Q8VA 4JRXB 4BYHA 1CD9B 3ARFD 1YEEL 1LK2B 3ABTA 3TBTB 4OLWH 2D2OA 2CCLA 4Q6YA 1NIAA 5AVQB 3HCVB 4JJHA 2VS0A 3AXLA 3VXTB 3FQXB 3WKQA 1L7TH 3B5HA 4GP4B 5I0XA 5JDJA 2ZUYA 5LGKA 4A67A 3UTTD 5F89A 3L72H 4D3CH 3DGEA 1AQKL 1ULVA 1RU9L 5DRZA 3K91A 4IRSC 4YHKH 1OB0A 4GB9A 2Y07H 1RZFL 1OAZL 2E5LB 3IPBA 3D39B 3LZQA 4OAWB 3UTQA 3Q8AA 3QNZA 4JHUA 4QKTA 3LPGA 1JOIA 3EBHA 4X62B 3FZUD 1AGEA 2R1XB 2QQNH 2A9BA 3FL7A 4FQ1H 3KBEA 1O6VA 1YJDL 3RB5A 1RZKL 1QHTA 1X7SA 4XMZA 3MV11 4X8JA 3UJJH 2EBOA 4HUNB 4P57B 1M05A 4LF3B 3K6SB 3O2VL 4X50A 2D7NA 3IFPA 5ISZB 4WW2F 2B1HL 3ZMRA 1RMFH 4B9IA 1ZTXH 1WBXB 2G5UA 3F7PC 4NNPH 3HNVH 3FU9A 2VLRD 2HHHB 2K3TA 3MRIB 4DK5A 1OZ0A 5BO1L 1N6UA 3CZNA 5JPMA 5JA8B 4M1CC 3MODH 1XH3A 3GMRB 3NCJL 2KG7B 1SOQA 4MSWC 3CFCH 5LDSA 3WTVA 5G5DB 3CFJB 1E7UA 3CBKB 4RRPA 3TYFA 1USQA 3VFRB 2OMXA 4MLSA 1KN4H 2BVTA 2FJFB 4XGZA 4DGVL 2O6EA 5ANMB 1RERA 3HPLB 3PDGA 4X8GA 3DRTB 1DN2A 1CFMA 4IRSA 1U6AL 2CA3A 1WSST 5LOVA 1I85A 4FYRA 1RUKH 1X44A 2QKCA 3CC2V 3TXQA 1NDGA 1ZAGA 3MRGB 4NENA 4TVSa 1L7IH 3T3ME 4JDEB 2A9CA 3ZHNA 3OF6A 1HOCA 2NYYC 5FIEA 2KBGA 4MVQA 5FPIA 3LDBB 1F00I 5E1AA 1CICA 3BIKB 3IKCA 1G4YB 5EFIB 3H6JA 4FABL 3EYQC 4J2XA 2ADJA 1V8HA 1W59A 3LRHA 4YSSA 1CC3A 4R0LA 4PAZA 4LVHC 5FUZL 2DD8L 1VP7A 1YF2A 2CMRH 2X42A 2XXGA 4U6YA 3SE8L 1BYNA 1FRGL 4NAQA 3US1A 1JZEA 1LD9A 2J8UB 3QHFL 2R51A 1AZZC 5DURB 3U1PA 5KVGL 4JY6B 4MSWB 3MV7B 4PJDB 3ABKC 4N0YL 4DO5A 5KJ7E 5C92A 2VR8A 1CG9B 2ARWA 1S8DB 1HSAB 2FSEA 1KC5H 1S7VA 3TO4D 2R1YA 4FMFA 5FDYA 3UZVA 3WXVH 2BVUA 1QLEH 2B2XH 1J1OL 2VLLB 4QT5A 4QXTA 5JOEA 2H0PA 2DM4A 4YHOH 3H1KH 2AJUL 1G7JA 4LLYA 3KS0H 4TUOB 1EBAA 4MVMA 3MJ8B 4ZI7A 1JVKA 4JZ2A 4X1KA 1NJ9B 2X3CA 4IKLA 4KQ4L 3BWAB 1I8UA 4ELKA 1NJIW 3EJYC 3FBQA 5HYIA 4LL1A 1I9IL 3HR5A 2QDWA 2F7PA 3VE0A 4EEEA 3ZQWA 2UU9B 1UJ3B 3OVUB 4NQUA 3ATBA 4P23A 4PGDA 1DJHA 4L8CB 2XWTA 3OEHG 4XAKE 2GTWB 5T3XE 5E4EB 3QUKA 4LNRB 1FZMA 3S35L 5AZUA 5L3DA 4FHBD 3ZMTA 5JXEC 1DYZA 4Y5XB 2P24B 3ARGB 1YAZA 2F61A 1BV8A 3QNXB 3RWCA 2KT6A 1QQDA 3OL2A 3QAZC 4Q58C 5DURD 1KLUA 3T3MB 2XXMB 3B2VL 3ULVF 4JRYE 2F5AL 4ERSL 3QXDB 2XV0A 4JZOB 2YR3A 4LT7A 5INCB 2IJ0C 3RL1A 4NUJB 4U1JB 3N2GB 4N90D 3T1HB 1TCRB 2WNWA 3KPPA 1DBJL 4JVPA 4PBVC 2VLKD 3GXTA 3CB2A 1LNUB 4LARL 1XH0A 1CDHA 2PO6A 3SSGA 1NH2D 4H5SB 4ORZC 1A6VL 4IIQC 4C4KO 2FLBT 1HCZA 5DJAB 4HBQA 2CKBL 2P5WD 2WGXA 1IKNC 4QUOA 1K2DB 3BJ91 2ZP9A 1S6NA 2DJSA 4FXTA 5AYUH 1KPUB 2J20A 1I9RL 4KROD 4CJ0A 3EGDA 5AW3B 5IHLB 1UKTA 1W0VA 1M53A 3GKWH 3HG0A 3ZYZA 1YDXA 4G5AA 4DGYL 4FG2A 4H1LA 5ILTL 1GTOA 2EJ7A 5DZ9A 4HDIB 2WLLB 2WQUA 3ESPA 1THAA 1TVHB 4QNHB 3DPBA 1MDAA 1QFWH 4G7VL 1FDLH 1GGCL 1AP2B 2XFXB 1WDAA 4XPFL 3RTLA 1BD2B 4JDVA 2XIBA 1ZANL 2PW2B 5EOCH 4E4EA 2ITEA 1XD1A 2V5TA 3DBSA 3ZQXA 1XCWA 2LFSA 2EYRA 5AKVA 5C08A 3V7MA 2K3HA 3NJGA 5TFSH 5DMJB 3Q13A 2FEJA 3BPNB 3EJQA 4ODVL 1UWYA 5I1AB 2ADYA 2NCEA 4H7VA 1DBKL 3SDXF 1W0JG 2XQBH 3UDWC 2GEQA 5D5QA 1UVQA 4B41A 2KPNA 2Q20A 1G6RA 2A4CA 4ZOEA 3SJVE 4E9WA 4GX5A 2WP3O 3RAJH 2AJXL 3ML0A 3GUTB 1JPGB 5HYJD 3VQ2C 1JS4A 1AJPA 3Q06A 3CBRA 3C12A 5F9OL 3NYKA 3ARFC 3BVXA 3NCFB 1ADWA 3NEOA 4JUSA 4UCFA 5FOJA 3VQMA 2DEXX 1NOFA 3GMQB 1SJVA 5CLXA 4YGAB 3W2DH 3ZTNL 4IOFD 4XNXH 3BISA 3H7BB 4GQPH 3QRFM 2A06H 2YI9A 3CCMV 1WFMA 4OCRL 2JWYA 2A6KB 3PAVA 4YHYC 1QZ1A 3BEWA 1YNLL 2XPYA 1VIWA 1WWBX 5FKAA 3FFDA 1UB6A 4IKJA 1MZYA 1HH9B 1OPGH 2Z65C 3I2CL 2H3XC 3GJFA 1FG9C 3EJPA 1BYPA 5JLZA 2FATH 4HULB 2ZE7A 5B1BB 1CWVA 2CRIA 2A83A 2B1OA 3NCYP 4KBPA 4PLOB 4AIZA 4JKNA 3GB7A 3D39D 3NN8A 1N32O 4Y88A 3UO8B 1I8IB 1BVOA 5GRUH 2QPDB 3FONA 3SGEH 1TTFA 2DI8A 1ACCA 2AKRB 1JK9A 5F3FA 4S2SA 3FTVA 5HHOD 3RZCB 2NW3A 4F9PA 1S7SA 4G80B 4Y4FC 3CPLB 1UG9A 5IVZA 3IFOB 2VLKB 3F6IA 3K79A 2AQ1A 5J6GA 3HI6L 1FLRL 1SOKA 2ICWB 3KJ6L 2FJHB 4XVSL 1PFOA 1ZWIC 2CH7B 1RZIA 4HSAC 3CZFB 4I2XB 4DV7O 3HE7D 1XR8B 1H3WM 4I18A 5LP6A 2GAZA 3RWDA 3UTSE 1TKWA 2R9HC 3OW2U 2PF4E 4MB1A 3JD4A 2D7PA 3ENEA 4XBPB 1SN2A 1FL3A 3SYCA 2DYPB 3P3RA 5TDPB 4CU7A 5JH7A 1FSKB 1KZYA 2HKAA 4CKVX 4FJCC 1HQ4A 1EV2E 1DP0A 5B66Z 1A1MA 3OBAA 4JB9L 4KQ4H 3J7HA 1SQFA 5ABZA 2J1WA 4TSFG 2DLHA 4YNYB 4Y5XC 4Z7VA 5DEGB 5C0EA 2IADA 3IJEB 2I25N 1TETH 4GKKB 4FVMA 1MLBA 4Z7IA 1CFNB 4F27A 3QG6B 1A1OB 5IB3A 1F11B 1KT2B 4OF8A 4A2EA 3L5HA 5F7EH 2WINB 3PGDB 1U8CB 4HALA 3JUYA 4FI8A 2NXZC 4I0XA 4NNPL 1RUPH 1UD8A 1BFSA 1SY6L 3JTTA 4UXNA 3IN2A 3ZMZA 1HDMB 4LC1A 2DW4A 2JKWA 2G3MA 2K7QA 3E2HB 2UXBB 5KAFZ 4HMCA 3WIAA 5I66B 1FNEA 1QFWM 1SN5A 3LEVH 4UM9B 5T1DL 1ZSHA 2WW8A 3K2UL 1XXFC 1QHPA 4QRQA 2VSDA 4B9KC 2EIKB 2IFFH 4WK2B 5AVVB 3AK1A 3OAYH 4AQYO 3QI9C 4OM0L 1Q3EA 4R26L 2XG5A 4ZOAA 5DFVD 1CU4H 5E5MA 1U3JA 5AVSB 1YHQV 1F58L 1KJ2A 2ITCA 4U3FH 1CZ8L 4GYCB 5IMLA 4DV5O 2RJZA 5J12C 3TVMB 1AIFA 1BMFG 1FH5L 3LQZA 1J11A 1W0WA 1C12A 2W0PA 5I1EL 2X9XA 4UB6Z 2ARJA 5GS1A 4LSPH 4XH2A 4FEIA 1MWOA 2XNAB 2HWZH 1IE4A 1P7QD 1HCFX 4WK0B 1SJMA 3DMMA 4XOBA 5I8EA 1KD1W 3BVOA 2EILC 3GVMA 3D06A 2NZ1A 3P11L 5E0FA 3ZZSA 5TE7H 5IB2A 5ANHA 3C87A 3HPLC 3LIZL 4OVUA 3CRMA 2K0RA 2WUBH 3WE6A 4DP0X 1PYWA 1QSFA 3ZHKA 3D69B 2DTMH 2ENPA 4MJ6B 4DUXA 3QCVH 1IGTB 4LU5L 5D5ME 4XNDA 1A21A 7TAAA 3O4LB 3F62A 1UJWB 3EW3B 4GKJO 2GPZA 1INDL 4ALAC 4D94A 2LW1A 1TUBB 1E30A 1LK3L 4IMKC 4AMXA 1OAYL 5CAYB 4LNUA 5CA3A 1FNHA 3KPLB 3MRLA 4K94H 1EMTL 2EVFA 3ZE2B 1OARH 5DDHA 1A4KB 4BR6A 1E2ZA 2EIEA 1M6UA 1KNOB 4PS8A 3NAAL 1KB9K 2R72A 3I75A 4QCIA 3ZMUA 2Y5TB 1VARA 2J55A 3BWUC 2XZQL 1NC2D 4JFQA 4ZW6A 2JQZA 2DMHA 1TZAA 4NO2B 3QJHB 3U9PH 5DZPA 3ZDYF 1Y0LA 2J56A 2QR0B 4M56A 3DGDA 1JDCA 1JZJA 4N2FA 1MHCB 2COQA 4Y2DD 4XX5A 4N0CD 3EYOA 2XAFA 1QNMA 3X1BA 5EO1B 1FD9A 2YEQA 2ZUVA 1F4WH 2XZCH 3DVNB 4XCEB 2ZM6B 5JIKA 4BK5C 2P49B 2RFXA 1RHHA 2Q4PA 3LHPH 1G94A 3T3PF 4DFIA 5AW5B 1CQYA 2ZQMA 5E95B 5CZVL 3TA4D 5J56B 5IKCA 3I55V 3PFQA 5L2KA 4R7CA 2ZOUA 1VACB 2KKQA 2MTPA 5C93A 5L7XH 5AB0A 1WK0A 2EEAA 5GPRA 5A2JH 4HH8A 5EZYA 4M9OA 4HC1A 4YSRA 5E2UH 2H26A 1F3RB 2IWKA 1QUNA 4B3RO 1NBZA 4NCDA 4A2LA 4N2EA 1P4BH 2FWSA 1KV7A 5ENWA 1K5WA 4NQEA 3U2SA 4NHUB 4FQCL 2H3NB 3P0VH 4Z7AA 2JVDA 5CCJA 3K6OA 1NLDL 3A67H 3FOMA 5DHXB 5IJBC 1F58H 1BOGB 3KPRD 4KP4A 3HI6H 1QX1A 1S7WA 3HKDB 4L4TA 5TQ2H 2F7QA 1NUFA 3DJSA 4N0YH 2VIRB 4WI0A 2NZIA 3MA7B 1OLZA 1MCWM 3OB0H 3ZDXF 5CEXA 2Y69C 1NFKA 4JFDD 2XSKA 3JD1A 3PGCB 2HRLA 1C7SA 2R1WB 4U1SB 4XNAA 5A2IH 4H8UA 4Y1TA 3ORJA 1A66A 1MH5B 4OJAA 2C3XA 3V4PH 5G4NA 4PA7A 3S96A 5DRXA 1HKLL 2HH0L 2ZOKB 1M1KW 1S9XA 5GSRB 4LFAO 4BRVA 2CPCA 2UXDO 3NESA 1RJCA 3TBYA 3ZBMA 2GJJA 2XICA 2QELA 3JASB 4QO1B 1KPRA 3MBXH 4NSKB 5EU3B 2IAMA 4OUOA 4XBEH 3GSXA 2KZBA 3HAEB 4GG8B 5FO8A 4IU2A 5HBBA 3OMZA 5KVDE 1A4JB 2V5SA 1FIGL 1UOKA 2IEPA 5F1IA 1BZ8A 4MJ5B 3T2OA 4AYID 5KJRH 4JFYB 3SGEI 1AS6A 5I76A 2NY5H 1IAOB 1HOEA 3S5YA 3T0BA 4PRPD 3VG9B 2BRQA 4H13C 1AI1H 4HUXB 1K72A 2HVJB 1N34O 1QFUL 1U8QB 4MQ7A 2K7PA 1QBLL 1SEBB 3JWNE 3UTTE 4QHUA 3FO9A 2R29H 3MAWA 4IBZA 3B09A 2EUWA 1U8JA 1H6TA 5KOVC 3QFJD 3ULUH 2OS7A 3Q1SH 1ZLVK 2V5RA 2G9KA 3SDXE 3VTAA 4Y2NA 3IDJB 4NXNB 3UTSB 2N04A 3ECQA 4N0FB 4DEPC 2YAEA 3ULVE 4PWFA 3MJGX 3V4PA 2CGYA 4OZFB 4CL7A 1MG2C 2AI0H 3W9DA 4FLWA 1VIBA 4OCNC 3SD2A 2Q69A 2EC9U 2K9FB 3MRRA 2COVD 3MMEB 1MLCB 1P1ZB 4LDEB 1LQSR 4CMHB 1FZJB 1HXYB 5D7KE 1DGSA 1Q90D 2VXTH 2ZYIA 1V54C 3OF6D 3AG2C 3TETA 2OI9B 3HJ0A 5CBEA 4UV8A 3JWDL 1N8ZA 2JSFA 1ILUA 3HBZA 4DR6O 2WHVA 4CC5A 4DOHE 4PRHB 5EU6E 5BXFA 3P54A 4KI5C 5I1HL 3MA9L 5ID0A 2YC1A 3B56A 5A2CA 3T2NH 2VDKL 2EJ1A 4ZFOB 1FFXB 4ZXBC 2CKBA 4HT1L 1NH6A 5E56A 4H0IA 4WDIA 3WAKA 3IS1X 1ZSDA 2A7BA 2OMTB 2GB2A 4G6KH 3PNWA 1MF2H 4EZJA 1ZS2A 1NR1A 4AHCA 3F6JA 4OKVB 5F9JA 3ETEA 4HK0A 4GRLD 3LN9A 1BZQK 1ZGLP 2C7UB 1CFSA 3JWNC 3A24A 4YBQC 2NY0D 1XSKA 3MJ7B 5F97E 2UVEA 3K57A 3ARWA 3IK2A 5L88L 3ABLB 3B7SA 2APFA 1HHKA 2ZWNA 1KULA 1CVSC 4XBGB 4A7UA 3W2DL 1M1XB 2O5ZH 4PYGA 5HHQB 4J9ZB 5D72H 5I15H 1F4WL 4U1IB 1P5UB 5BZXA 3VRJB 3GHEL 3VG0H 5JXAH 5TH2A 4NN7C 5LVEA 2QGNA 3VXUB 5JOFA 2YQBA 1RHFA 4XXWC 2BRRL 4MXVE 2DQIH 2XT9A 1CBVH 3ZE0B 2WO3B 1WBYB 4PP1D 2CALA 2IH1C 1KCSH 3P9MB 1WZLA 5L8LB 1SOSA 3H9SE 1FG2B 1PCSA 2EUZA 1TZHA 3IJSA 5DJ8A 5J3HC 3T0EA 2IH3A 1Z5LB 2CGOA 4UVAA 1VQ9V 3W0WB 1YJWV 2VITA 3PWNB 3QYMA 4RWHA 1LEKA 2V1DA 3GT6A 3L95A 1T2XA 3VFVB 2F2HA 2R0ZL 1J05A 5DLML 4CBPA 4DF9A 4HWEL 4PJXE 4W9KC 1H6EA 2O1AA 2HFEC 5FWRA 4AI8A 3G9VA 4L3CA 1IBFA 4N5UA 4LPWA 4D0DB 4I3GA 2DM2A 4OLWL 4Z7VF 3FULA 4QTFA 3V4VH 5ISZD 1NEZB 3PAYA 2OBGA 4Y2LA 5JJEB 5HDBF 5JIHA 3D8CA 3F5WC 5EF0A 3T1HO 3DGGA 3RA7L 3ME0A 4LSPL 1NDTA 2NY1B 2CRYA 3GNML 3RGVC 2ZNIA 1IFHL 1OW0C 5ESAA 3QZBA 5EUOB 2W59A 4MJ2A 3PP4L 1JYVA 3QXWA 4XPAH 1XMQO 4QRRD 2XQYK 4YSTA 4NN6C 4NVPA 3IMUA 2W60A 2UXXA 1VFOA 4FG4A 4BBWA 1UD6A 2P4AB 2QADB 4LIQL 5DVMA 4GX0A 2PN5A 1T20A 3BKCH 2A6JB 4JI0B 4KX9A 3CEIA 2WA3A 1NGQH 1MFMA 3V0JA 4NIKB 3BZ4B 4G6JL 1WT5A 5CD5C 3MUGA 3OKMB 4JRXE 5KW9H 1I8AA 3L8QA 3QIWC 1GN4A 1OZUA 1SZNA 4HCFA 1JGIA 3I9AA 1SYVB 1VGKB 5B1JC 4JKWA 3PQYD 1UUNA 1JVOA 5LBVA 3U9UB 4M93C 2LABA 3MRQA 1XZWA 2X4NB 1ZXQA 3B2XA 5BZWB 5EOTA 3N1PC 1YI2V 1BFVH 2KQMA 4LLWB 5EF2A 3F01A 4ZPTB 5HHNB 1IT9L 1RIVH 2ZKHH 3EH4B 2WYHA 1LMKA 3G5VA 3VB8A 1MABG 1GH7A 3STZA 1ONQB 1N6QL 5LCVH 5A6MA 1OSZB 1ASQA 4D6TH 3PQYA 4OUUB 4P9PA 2X70A 3O3AB 5GRJL 5B3SB 4XCNA 1HNXO 3G5ZB 3U2JA 3MJ6A 2KLTA 2IWGA 5SWSA 3NG5A 4PJAA 3V6ZA 5MP6L 3FB8B 4X8AA 4MT8A 2IDQA 1BZDA 2ZNWA 5H35B 4LLMB 2IAMD 2DYRB 2BHYA 7FABL 4HMDA 5FV1L 4DPCX 3GMMA 5LXTA 3MBEC 3ASOC 3NEEA 3S35H 3NFSH 1HHJB 2NPLX 2A9MH 4HX1A 5D1ZA 2YQ3A 3UT5B 5GS0C 2YPKA 3GZPA 3LXCA 2BPBA 4LOEA 3QZWG 1NANH 4EOWH 4NO5B 3GBML 4HIEB 4JV5B 2R23B 4OB5H 3KHOA 3OQ3B 4HJ0D 4ZFFB 3JAKB 4WEEA 4L2LA 4PJXA 4H2AA 1J1PH 2HAZA 4WEUD 4QHMA 3RWFA 2BY0A 4OT1H 4E2OA 1AOZA 1SLVA 1RJZB 1QHQA 1GN3A 4JI5O 2ALAA 1YA5A 1RULL 2CUIA 4GP5B 4JI2O 2R2BB 3U6RA 1DCEA 5KSAC 1A5FL 5K9QI 3L2LA 4LFBO 4KC3B 2N0MA 2HHHO 4PHZA 4K3JL 4O4YH 3A6CH 5FB8B 1KENH 4PWEA 1QOKA 5FF6B 1AG0A 1DVSA 2VDNL 5DO2C 1US6A 4JFTA 1FNGB 2HX8A 2HXAA 3HJEA 3QXVA 1N7ML 5T1KD 3ZKMC 4CBZA 2L7EA 2A38A 4NRZB 3MNVB 5DK2A 3QH3B 2R7EA 3LV3B 3U4BL 3PHOB 1ROWA 1Q6UA 1YN6A 1QFWL 3NH7L 1K7DA 1ERNA 3RX9A 1P53A 1VQ4V 2ZOTA 3V5KB 4F7PA 1WIOA 1FJ1B 1ADQA 1N6VA 1U92B 4PA3A 1U42A 4WO4D 3RVVC 2EE9A 3UG5A 4B9GA 1YAIA 2ESVA 3ROLA 3WDHA 3BFWA 4FERA 4ZOLA 4XN1A 1QWHA 1YNTA 4B27A 3NIFB 1U8OA 4JRXD 3UJJL 1ACXA 1AO7A 1NGQL 1NCCH 3HIZA 5INDB 3DX1A 1M42A 4Q4EA 3BZFB 1UWFA 4FN0A 3H9YA 3QDJE 4EO5A 1H3PL 1H3TA 1QACA 2WPGA 1DJWA 1LGVA 3CSYB 4OJFL 1CBJA 4UQAA 5F7DA 3VYPA 3UAJA 4AEEA 1IC4L 3MCG1 2PPDA 3VD5A 3DRQB 1FYJA 2W0LA 3HUJA 1DQTA 5DHEA 3BPCA 2PR9A 5FKPA 4X62O 2AV1B 3CMOL 4WJ5A 4NR1A 3QFJA 4OLZH 5DJCA 4ZS7H 1YPZA 2FTKA 3EDKA 4WI6A 4TVPL 4IIQA 5I71B 1BCCH 5D7LE 4CDHA 3CLFH 4KMTH 2IALB 4XI5C 1X5JA 4UNVA 3WLBB 3RKDD 4HF5L 1L5GB 3TN0A 3E83A 2XJLA 2E7LC 2QSQA 4MD0B 1INQB 5C97A 4KV5F 5HHXH 1BAGA 3EJZD 1Q7YW 1GAXA 1UWXH 2FYYA 2K4WA 2CLVB 5IV2A 3B1UA 5IYDO 4Q0XL 1CXEA 4BKLA 4HIHA 4YSUA 1P4RA 3L3GA 4UM9D 4UYQA 3KYMA 1M71A 2OMVB 5E8EA 1NOLA 1IRAY 1E0OB 2NUPA 3WNMA 5KG9A 4PJHA 1GM9A 1YG9A 2DB8A 3WY2A 4EIGB 3NJLA 1NL0H 4NZ8A 5EB9A 5FUCC 3HBPA 3KLAB 3NBNA 4Y2OA 2G2NA 1N4XH 2XWBB 2EDDA 3QXAA 2AANA 3TTYA 2OMWB 2PTTA 5JQGA 2PWGA 3GQFA 1MG3C 2BNRB 4JG0L 5EU5A 3X11A 1W91A 4R5TA 4CADB 4Y9FA 2HT3C 4RDQG 1GIGL 2ZF8A 1WCBA 2Z64C 1M7IA 1PLCA 1MWAH 3U7YL 1JWUA 2OYKA 1YYLH 4BFIA 2FTAA 1DBBH 3G6AB 3GF8A 3QEHB 3ISRA 2OYQA 4D9QD 5CSZA 2FEEI 5LGNA 1QLRB 3L48A 5GGVY 4B0MM 2XX0A 4IJ3B 5C07D 3OAAG 1FNSH 3NIGF 3BAKA 4G2KA 5KMGA 4PN6A 2QSCH 2YKLH 4Q6IB 3WEAA 3MZGB 1H6FA 4NGHL 3GM8A 2IOOA 1CGSH 2X2HA 3ULVC 2P7TB 5FYLH 3QEQB 3ZRSA 1ZLDA 3QDME 1O7DE 3GLEA 3P4LA 1Y76A 1O9WA 3CFKB 4DKFL 1NBYB 3AK3A 3CDZB 1OTTC 3N1GC 4HZLB 3T4AA 3DUUB 2E76B 1VQPV 1BFVL 1HTYA 3Q2NA 1U30A 1YNKH 4GBXB 1GH6A 1NCHA 3SDAD 3DUSB 4MJHA 2NXYB 4X4ZA 4FQLH 3BCFA 1NDMA 2WSPA 3K4AA 4YHPA 2WLMA 4XC1L 4QRUB 5HD8D 4F1ZA 1MZEA 4XAWH 1F42A 3II1A 1F56A 3K5OA 3TBVA 5L3CA 3VX1A 3DYPA 4XWGH 4AY0A 3H9VA 4KUMA 2VNCA 1NGWB 1ILSA 5EIVA 1NBVL 4X7FC 1CB4A 3U83A 4K3EL 5KAQF 3EF7A 1KEMH 1TQBC 1L9RA 2VTFA 2UXCO 2E75B 1Q9WA 2R0LL 3OAZH 4FQHB 2E46A 3DX0A 4A66A 2WQVA 3C90A 3IN0A 3FB7B 1RUKL 1V05A 3P32A 2CBQA 2WVUA 4YDMA 4DP8X 3CX5J 2HJKB 3GSWB 3EKCA 4FJ6A 1RM1B 4JHWH 5E51A 5KANI 4PJBA 4QTIH 3V5DA 4YFLF 1EAQA 3LRLA 5B38G 3FU8A 1BYOA 1WZ1L 2FBOJ 2G30A 2FX7H 1AXSB 2PYFA 5IYZA 2I9LB 4BUHA 3VWKD 4TVPH 2ZR3A 1OB1B 4MDJB 2KLSA 5AOJA 1KCLA 3KNBA 1IQDA 1FXKA 4UOQA 2XYBA 3BHBB 3ILPA 5E5LA 4NZTL 1II4E 5C9JA 4DUZB 3QZPA 2VL5B 1GJIA 1QCEA 5LP6C 2WLIB 3EXAA 4MXVF 1WD8A 4Q9BA 3SY0B 4KMLB 4W9GC 2W9LA 2HUEA 2PCPB 4LR3A 5D1QA 4OH2A 3BPLC 3OXRA 4K3JH 4LF6O 2AQRA 3RKDC 4QJ4B 3D7PA 4PPTA 5IFHL 5ACMA 2ZKOA 5EPMA 5AYUL 3KPMB 2X3AA 4JRYB 4ZW3A 2YC0A 1ASPA 4AYFA 2J25A 3NIDE 2AXFB 2FNWA 3T1CA 4IBYA 1TNMA 2W38A 3VXQA 4JO1H 1FAIL 1QBBA 2VDQB 4PH8A 5I30H 3S5ZA 3BKML 3MLUH 4X5PA 1JUFA 4W81A 2JLPA 4Z5RA 4S0TD 5HXMA 2EDOA 1M3JA 4HGKC 2NX5A 2BMKB 4MTOA 3MLRL 3BA8A 1IKFL 1E2WA 5CIPH 4G11A 3SBWA 4JFUA 3GJEA 1IEBA 4AM0A 4LHUA 3K9SA 3TIDB 3GI9L 4APXA 3EJZC 4LAJH 2VISB 2DEYX 1JHTA 4XN2A 3DJRA 2QQKL 2XZZA 4LCCB 4JGNA 2JJWA 1QU7A 4L5FH 4WUUE 3X3GL 2O61B 2WTRA 1RLWA 4ZDHB 4ZFGL 1VKXA 4ZW8A 5EEYA 4W9IC