2Y69B

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2y69B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y69B02
2X87A 2YQBA 3DIVA 2X88A 1XB3A 3PXLA 3IN2A 1GY1A 4A2EA 4A2GA 3ABMB 4F2EA 1ET7A 1CYWA 1SF3A 5TK4A 1MZZA 2BWIA 1PNDA 5I6PA 1E67A 1PLCA 1BAWA 2VW6A 1OCZB 5LDUA 3UACA 2PP7A 1BXVA 1OF0A 5AFAA 1WAEA 3PCYA 3FU7B 4BDVA 2BZ7A 2XXGA 3JTBA 7PAZA 1PAZA 1NIFA 3QJQB 1AR1B 2GBAA 3X1EA 3AG4B 2IH8A 3NJIA 1QLEB 1XMEB 2QPDB 1V54B 3OMIB 1GW0A 1JZEA 2FNWA 3NJKA 2J55A 2YAPA 3UAEA 4BWUA 3QJRB 4GY4A 3BQVA 4A66A 1AIZA 1MDAA 4E9YA 4YSQA 1SNRA 3FSZA 3ZX1A 4HALA 4UF7C 1BQRA 3PAUA 4DP0X 1KGYE 2CUAA 1V10A 3AZUA 4MFHA 5I6KA 2B3IA 3ZIYA 2HRGA 1QNIA 3NSCA 2BP0A 3T6VA 3WKQA 3T9WA 1AANA 3NJFA 1TKWA 1PZBA 3NSYA 1BQ5A 4CSZA 3HEIB 1I53A 2UXTA 2EINB 3S3BB 1JERA 1JOIA 3WIAA 4KNTA 3FQ1A 3FU8A 1GR7A 4KOBA 1AZUA 1BYOA 2PP8A 2PPAA 3ABLB 1L9QA 3PAVA 4HCFA 2PP9A 4DP4X 3FPYA 1KBWA 2UXVA 1GSKA 1E5YA 4E9QA 3SBPA 1ASOA 1NDTA 1GS7A 1OE1A 2FJSA 2P80A 2I7SA 4HAKA 5B1AB 2VW4A 4KNUA 4A2FA 4QLWA 3GDCA 3H56A 2UX6A 7PCYA 4E9VA 2H5UA 5B1JA 3FQYA 4BDVB 2VW7A 3WNIA 2P80D 8PAZA 2BW5A 2HRHA 2WSDA 3FT0A 1J5CA 2XLLA 3EH4B 4A2HA 4CSPA 1AS7A 3DKHA 4YSDA 1NIEA 4YSOA 2IWKA 1ZPUA 5E9NA 3U25A 2IWFA 3NJMA 4M4RB 1OCRB 2HX7A 4W9ZA 1AS8A 1IKOP 1RZPA 1OOWA 1GS8A 2FQDA 2IDFA 2FTAA 2XVBA 2HXAA 4NAJA 2AFNA 2BW4A 3WI9A 5D4JA 2GHZA 1AG6A 3D12B 4YSSA 5FC9A 2QDVA 1J9QA 1A65A 2YAHA 2GC7C 4YSPA 2IH9A 3PPSA 2VM3A 1ZDSA 2QDWA 1AG0A 2AZAA 5TK2A 2YAEA 4FAAB 1IBZA 2DWSA 3CG8A 3AW5A 3CDZB 1AZRA 3HB3B 1CYXA 2H47C 3AG1B 1ETJA 2UX7A 4QKTA 1UATA 1WS7A 1JZHA 2E86A 3G5WA 4BXVA 1JZFA 3H4HA 3T71A 1NICA 1WA1X 3CZUB 4NERA 3TU6A 4DP6X 1DYZA 1JVLA 2VMJA 5B7EA 2BWDA 2EIJB 2IDSA 1IC0A 2BO0A 3CVBA 1AACA 2JXMA 2IDQA 1WA2X 1EHKB 4W1TA 5F7BA 4DP9X 3SBRA 3IBOA 4HCGA 3UGEA 4DP2X 3ASNB 4GXFA 2XU9A 2N0MA 1KDIA 3NP3A 2Y69B 5B1JC 4F7KA 1PY0A 2UXFA 3TBBA 5B7FA 1OV8A 2HLEB 1SFHA 2PPEA 3S8FB 3NJJA 4AKPA 5I6MA 4GP8B 1W8EA 2GC4C 3OD3A 1DZ0A 1ZIBA 4YSUA 2MTAA 1WA0X 2Y1AA 3UAAA 1ADWA 1ASPA 1NIAA 3GYRA 2TSAA 3QPKA 1RCYA 1EZLA 2DWTA 3QJSB 1AAJA 3QJTB 2EIMB 2PPCA 2GIMA 2HX8A 4FA7B 2W88A 1NZRA 4DPAX 2J5WA 3KW8A 4G7SB 2FT8A 1SHXA 3KW7A 4PAZA 4UAHA 2PPFA 2CCWA 1JVOA 2BP8A 2YXVA 2Q9OA 3FYIB 1NWPA 4L0PB 1BQKA 4BXSV 4YSTA 1BYPA 4E9XA 5I5IA 2EILB 2FQGA 3OQRA 5PCYA 3NJNA 2XXFA 1KV7A 2B08A 1J9RA 1VLXA 3IEAA 2OCCB 2Q5BA 2CBPA 2PCYA 1SHWA 4E9SA 1NIBA 1MG2C 4GP4B 1PF3A 1TEGA 2DYRB 4JHVA 2R7EA 3N2JA 2WO2B 5IY5B 3S3CB 4DP8X 1M56B 3EHBB 5I5MA 2MRYA 1E5ZA 2ZOOA 5ANHA 1ET8A 5B1KA 4KOCA 2IWEA 1FA4A 4A67A 5B1BB 4YVNA 4K9JA 4KO9A 2LLNA 1X9RA 2TSBA 3FSVA 4P5SA 3H4FA 1SFDA 2FWLB 1OCOB 1A4BA 2FQFA 2BZCA 3QJVB 1MZYA 3SQRA 3MX0B 4HIPA 4ENZA 2W8CA 4NB7A 4E9TA 2BP0B 1PMYA 2YAQA 1AOZA 3S3DB 2H3XC 3TASA 1TEFA 1FFTB 1AS6A 2BP8B 1CUOA 2HZHA 2PCFA 2IDTA 4HHWA 3FSAA 3V9EA 4F2FA 3T6WA 1IBYA 1NPNA 1L9SA 3FQ2A 2ZONA 3WG7B 4E9RA 4G7RB 1MG3C 3NJHA 3FU7A 1JZGA 1M9WA 2GI0A 4DP5X 2PPDA 2FQEA 3AY2A 4YVUA 5A7EA 1V55B 1T5KA 2XWZA 3NJGA 1OCCB 2VM4A 2CAKA 1SF5A 1NINA 1A4CA 1GS6X 9PCYA 4YSAA 1NPJA 1PZCA 1WS8A 5EHFA 3EH3B 1NTDA 2FT7A 2YAFA 3ASOB 1JZIA 3RYMA 5I6LA 4BWTA 3X1BA 3ZBMA 3CVCA 4AX3A 3N55A 3IN0A 1ILUA 1L9OA 3WNJA 4A68A 1BEXA 1ID2A 2AZUA 1GY2A 2DYSB 4Q89A 5B7MA 1JZJA 3L45A 2IAAC 1KCWA 3ERXA 1A3ZA 1SDDA 1TU2A 4YSRA 2AANA 4WTQA 5D4IA 1KCBA 3NP4A 4ZK8A 2GB2A 2ZXWB 2JKWA 3ZDWA 3NYKA 1YLBB 5I28A 1CC3A 1HAUA 4YSEA 4GYBA 1F56A 2DY2A 5D4HA 1JXFA 2I7OA 3NJLA 2CJ3A 3AG2B 2J57A 3OMAB 1AZNA 3FU9A 3NT0A 3FSWA 3T6ZA 1KDJA 4N4YB 2CALA 4HHGA 2XX1A 1E65A 1ZDQA 2OV0A 1GYCA 1W6WA 4DPBX 3ABKB 3FYEB 1X9UA 1ET5A 1AZBA 2XYBA 2VSKB 1JXGA 6PAZA 4HCIA 1HAWA 1E30A 3S8GB 1IUZA 1N70A 4TXVB 5PAZA 4EF3A 4Q8BA 1A8ZA 2RACA 4RH4A 4G70B 1ZIAA 1L9RA 4E9WA 4HZ1A 2AVFA 3OMNB 1OE2A 1SJMA 2XV0A 1SDDB 3FS9A 5I26A 3AG3B 3EH5B 4PCYA 3ABGA 1A4AA 1BXUA 3PAZA 2XV2A 3C75A 1PCSA 3CDZA 4AKOA 2A3TA 3UABA 5I6OA 4AKQA 2EIKB 4DPCX 4WKXA 4A2DA 2J56A 2DV6A 2YEVB 1ILSA 3OM3B 1ASQA 1XB8A 5AKRA 1URIA 1ZV2A 1PLBA 3X2QB 1RZQA 1FWXA 4DP1X 1J9TA 1AQ8A 4YL4A 1OE3A 3QJUB 4DP7X 2VN3A 5AZUA 4UANA 2YAOA 2QPEB 4KO5A 3X1GA 1RKRA 1J5DA 4JKNA 3UADA 1XB6A 2YARA 1L9TA 2ZWNA 3TA4D 4KNSA 3T6XA 5I6NA 2BHFA 2I85A 1B3IA 2WO3B 3GXUB 2PLTA 3EF4A 2YAMA 4G72B 1CURA 3NSFA 4AZUA 2IDUA 3NSDA 4G71B 2XX0A 2NRDA 3CVDA 4X4KA 4KO7A 1KYAA 4AI7A 3IE9A 2R7EB 3QQXA 4JHUA 1M57B 2QT6A 2FT6A 4G7QB 3BVDB 1AZCA 4N8UA 1W6LA 2UXGA 3X1FA 2XUWA 4BWWA 3V9CA 1PNCA 1QHQA 2VSMB 3X1NA 1KBVA 1L9PA 3SBQA 1NWOA 5B3SB 1BXAA 4YSCA 1NIDA 3FPXA 1R1CA 1PZAA 1HFUA 3JT2A 3DTUB 3PLYA 2JFCA 4GP5B 2HX9A 5I5JA 3WKPA 1N68A 1PLAA 3MBWB 4P5RA 6PCYA 2OJ1A 5F7AA 3TBCA 4BK5C 4KO6A 1JXDA 2XV3A 2GSMB 4M3HA 1J9SA 2YXWA
chains in the Genus database with same CATH superfamily
5E8DL 2HFGH 2NYZA 2X87A 3GXPA 5I66B 4JFEB 4KX9A 3FFCA 1Q0XL 3U83A 4AQ1B 4MNGE 4XZUB 4FL4C 4M7LH 5FYLD 1PX8A 1K3ZA 3APFA 3S37H 1V05A 2AQNA 2ZCLH 1T1WB 3FFQA 1KPUA 5BMVB 2BWIA 4ZD3L 4BQCA 5A40E 2HRPL 1FO0H 3K5RA 4DUZO 4ZFFA 1KEGL 1N7MH 5DK2B 3ZRWB 2UUDH 4MVOA 1RURL 3HBQA 1WITA 2VUKA 2UZIH 4PJHA 3SE6A 4ASUG 3ZRFC 3IK2A 1XO8A 1WAEA 2ZX7A 1BVLB 4QYOA 5D70H 5JPMB 2X9XA 3G5VA 1UFGA 2YXFA 4IBSA 2CJTA 1Z9LA 1Q90D 2P7TC 2OJEA 3MMEA 3QNXA 5AZ2H 2QR0A 3ZZ1A 5CBEB 7PAZA 3KPSD 5EORH 3QEUB 1M7IB 1INEH 2BX5A 3N1QC 3LD8B 4L8SA 5D1XD 3M8OH 3PJSK 2AXGB 3ZN0A 5FNVB 1QLNA 3BUIA 3B5HA 2Y69C 3BQVA 3O3BA 3ARFD 1I9IL 1ZOXA 4P5KA 3EJRA 2WZ0A 3BQUA 2QE7G 1UJ3B 2XWXA 3EYVB 3KE0A 5IDJA 3KL0A 3FQUB 4NKDB 3SPVA 3VO0A 4MVUA 4U1MA 1JGIA 2ED6A 4GPVA 2CUAA 1EHNA 3BP5B 3QUMH 4R7CA 2EIZB 1MN4A 1W0JG 2H3OA 2FEDD 2V5RA 3BKCL 4X9YA 1KYUA 3QIUA 4TVPD 5DXWA 4UQ3B 1CGVA 2VRKA 2WUBH 3UC2A 3LNHA 2HJFA 4U6XA 1CD1A 4GG6A 4P3WA 1CT8A 5CMUA 1VACA 3BIAX 1U6AL 1WDAA 4AUUA 1L0NH 3TGUH 1L9QA 3OXSB 3TV8A 3DOSB 4LLYB 2G38A 4O4HB 4I1PA 2UXVA 4ZBJA 1ZT1A 2KQMA 4P2QD 4IMKC 4UBDD 3BA8A 1IQWL 2D4FA 2JCCA 4KTEL 1ASOA 2FD6L 4XRCA 3VGBA 1LO2H 2IPKA 5C0JB 5CJXA 1BG9A 2GJJA 4NUQA 3T04D 2FJSA 1ODAA 1KIQA 4PP2A 2ZD9A 5C0AD 4QHUB 2M83A 4A2FA 4EZJA 5H4ZA 1KFAH 4GMSL 1LDSA 3GO1H 2KPWA 2ARHA 1SLVA 4IBQA 2LFEA 4PFEA 3FNKA 3VRLE 4V1DE 2OCCC 3CC5B 4WGWB 3T3PB 4KZEL 1J5CA 5D1QA 3I5DA 4DN4H 2KKQA 2WQUA 3G9VA 2CUMA 1VRSA 5TDPB 5ID0B 1NIEA 1NCJA 2XNAB 4JRFA 1PKOA 3MI6A 3R8QA 3M7MX 2DIJA 4P5KB 3HG1E 4BH8B 5JNYB 1VPOL 3TBTA 3GKWH 1X5JA 3TA3C 3C87A 2EDQA 3UTTA 5IESH 4YUEH 3PUUA 1W72H 3F12B 3D8CA 2DQ0A 1R3KB 2AFNA 5TE6L 4LPWA 2BY1A 3FONA 4JM2B 1S7VB 3HR0A 43CAA 3G6BA 1MCHA 3D07A 2HJFB 3EFFB 5SWZA 1NKDA 3LUTB 5FV1L 3QK0A 5D6CB 3F7YA 1DJIA 1BF2A 4S2SA 3VH8G 1R3JC 4PJCB 1Z3GH 1MHCB 1D5RA 4GLRI 2Y7OA 1ZS8A 2DWSA 2VDRH 4JE4B 1B06A 4G5ZL 2EIDA 4XAWH 3WY2A 5EBWB 1ZT1B 3CDZB 2P44B 4XRCB 4QRUA 3UX9B 1T04B 1MMMA 3P0YL 5AVZB 5CA0B 2W38A 4PP2B 2VIRB 4ONOA 3JWOH 3H4HA 3MXWL 1QLRB 4RVBA 4JN1L 2WKLA 2ISDA 5EIIA 4JY5H 4WNQB 1I5XA 5EDXA 1RERA 4OFKA 4MYPA 2Q7HA 5AUMA 4G28B 5DZPA 1JFQH 3QEQA 5DRXB 3RW0A 2EIJB 4Q6IA 3RP1A 3OUFA 1IURA 1J5OL 1T1YA 4IEFB 1F8TH 2X6BA 3GEWB 2BSED 1DL7L 3ILPA 1NJIW 3QCTH 3IB4A 3BO8A 1G94A 2VZSA 1L0LH 2Y2YA 2ICWJ 1TTRA 1HC1A 3ZUCA 4I5BA 4TSCL 2AVGA 5IB2B 1MWOA 2SODB 4P9HL 4YDVB 3L2MA 5E4AA 4AKPA 2B9ZA 4KTDL 1MIMH 3HLAB 2XVKA 5AVUB 1OZ0A 1G7MB 1H2SB 3F7QA 3OD3A 1FHGA 5T1MB 4FKEA 3WU2Z 3FN9A 1AQKH 2EEAA 2PW1B 4NXNB 3LCYA 4X83A 5JO5A 1ADWA 3VFWA 1OB1A 2IANB 43CAB 3VBBA 5GZOC 4BCZA 2QHLA 3QPKA 4R8WL 5FGCB 1RCYA 1XGYH 5FPRA 3TA3D 5FKAA 2A79B 2AV1A 3SE9L 2R9AA 4WEMB 3TZVC 3QJSB 4FJCC 1X5AA 4HMDA 2DQGL 3RIAK 3P9LA 4UVCA 1UD4A 4LKCB 3RWDB 1GZQA 1JDDA 4RZKA 3AGVA 4FYSA 1WAZA 5C09B 1NC4D 1NZRA 2J5WA 3OPUA 4DV0O 5DQDL 3DX0A 5CP7B 1QQDB 3UDWC 2ERJB 2BNQA 1G4MA 4HNAB 3BVOA 2WLLA 1H0DA 1MNUH 4PW3A 1SOKA 4MHHG 3MRDA 1QKZH 2HKFH 3MCKB 1PX3A 5CZVL 4ZMWA 5CD5C 5I66A 2B08A 4YX2H 5LXTA 2NLJC 3IJSA 4QRSB 4ZMOA 3IAYA 3ILPB 4DOHB 2ZJSL 5I71C 1AZZC 2DYRB 2YFOA 1HWGB 3BAJA 3RU8L 2AHZA 4X6FA 1L1FA 4OZFG 3DVFA 4XI5C 1JDCA 5E9DD 4NZFA 5GGUB 4DP8X 4JI2O 5E94A 2GUZB 1IGIL 3MUGB 5E1GA 2K7QA 1WAAE 1BVNT 1V3KA 2ZAGA 5B21A 3GXTA 1THCA 4DVBA 5H4YA 1MQKH 5ISZD 4WRLA 1T5XA 3MROA 2R8SL 1A6WH 1AQMA 1OAUH 5DWUL 3DV4A 4YPJA 1QLEH 4L4TE 4P99A 1JK9B 2WGXA 1I9JL 4NN7C 3CFCH 2FQFA 1EZVH 4IIQC 4F92B 5LQBH 1AGDA 1OXYA 1GZQB 5DUPL 3ZU8A 4PTTB 1ZV9A 3ZZSA 3K0WA 3D3QA 1GSMA 3K0DA 3D08A 1VZHA 5GZOD 2X7RB 3EOYG 4QXGL 1Q81W 2H0EA 4YHKL 1P53A 4TNVF 2H3XC 3SDXE 3MV8B 2RR3A 3TZVD 1JFFA 3CUPB 3QZLA 1T20B 3WIFA 2PI5A 1SYSA 2X0LA 4C59B 4PW4A 2DN9A 3NIDB 3FAVB 4ZFOA 1USZA 1P7BA 4TVUA 4TRPH 2G60H 3WFEH 5E2VH 4Z3FA 4Z0BH 4RUEA 4FFZA 3ZTNH 2A6KB 3WTYA 2B1OA 3DGGB 1Q6UA 5G55A 3CFUA 4MNHA 2UXXA 1I8LA 3N1PC 4FQIH 1M9WA 2H6UA 2QWOB 1LD9B 3RHWK 4CSTA 4FJYA 4MLSA 2QVTA 3MC0A 4R0LA 2XA3A 5LA6A 2VM4A 1DBBH 1R3IC 5CD5D 5E7BA 2YQ2A 4PQXA 3RQ3A 5DMGC 3MGAA 1AHWB 3SGDI 1AKJB 3O41B 4BZ1A 3MJ8A 4JRXA 5SX5H 1U97A 1E1QG 1NGZA 4E41E 1S5HB 2C3WA 1T5XB 4K3DH 1EFRG 2QM4A 1YN6A 3KPPA 1BZ7A 2C9UA 3IN0A 1WWWX 1B0RB 1ONQA 1QO3B 1K33A 4XNDA 4KV5F 5C3TA 3JV6A 4PJEA 5EOQH 1KJ2H 1XEDA 2BIHA 1T7XA 1EM1A 4OTXH 4KZCA 1ID2A 2VL5B 2IAMD 5ADPH 3QUXB 1MCPH 1DK1A 2X28A 2ZTBA 1R6NA 2K9PA 4MRBA 4TQEL 4ICGA 1RSOA 4LF9B 2AANA 2F7QA 4XP6H 4TUKL 5I1AA 1OAYH 1XNRO 3O6KH 1L5GA 1KEML 1JFFB 3GB7C 2QQKL 5HGGS 3U46A 3WIFB 4GKZA 4YHNB 2ZKHL 4I1NB 5IHZA 1P7QA 4RRPA 3V6FA 1E90A 2DJ4A 2GYSA 3HFFA 4JHAL 2VDOL 3TXSA 1CICB 1HH9A 2MPAH 4MNHB 5DD5H 1K2DB 1YUHA 2NNAB 3OMAB 2D3VA 3KGSA 3WAJA 5DYFA 2L8AA 4R0LB 1G9EA 4XCEB 5LA6B 5J6HA 5DZNA 5JW4R 1XMQO 4HHGA 3VD3A 4HJEA 2H8PC 5T3ZE 5I6XB 4Z7VE 2HG5B 1QVFU 3ISWA 3T0WA 3CIQA 3AK1A 3GMQB 3MJ8B 4AG4H 4JRXB 1JL8A 4XCYA 1GH6A 1OZUA 3ABKB 3T1YO 5LL6Y 2QZQA 3ILEA 1K7DA 3FB7C 2XYBA 4NP4L 1YN6B 3KPPB 4Z1VA 4L8DA 1GTFA 3DX8B 4HCIA 4S1SL 3RFRA 4R3SA 1EXUB 4HWEH 1TJGH 4YJ3A 2D0GA 1OGPA 4IL6Z 3JV6B 4PJEB 4J27A 4YHLH 5I1HH 1SBBA 3CZGA 3DJZA 4KGLA 4E9WA 2AVFA 1JNHA 1RSOB 3AXLB 3NRQA 3E9UA 4MAUH 3LNFA 2ZP0T 4KU1A 3WLWC 4BHUI 1FVEB 2B8OT 1BM3L 2OL3A 2YBRB 1CXIA 4N5EC 2NUTA 1L5GB 1C7SA 1A4AA 1BD2D 3OJVC 4HKXA 1WBYA 4F24A 1N0XH 3C8KA 1TVDA 1T89C 5IHZB 5JH7A 4AEIL 3II3A 1IJNA 2EIKB 4FFTA 1MY7A 1Y76B 3EOTH 2LO1A 4A2DA 3VI3A 3GUTA 4NQTA 5CILL 2VJ8A 3HN8A 5H2FZ 2X0UA 4QTIH 4FFYL 3S97C 3VFTB 3A22A 3GJFH 1U8QB 1B3QA 3DX1A 4LU5L 2ZAIA 2OX5B 3LDBC 1FS0G 4EZKA 3WO4B 3PP3H 4MD5A 1BGYH 2RNBA 4P46C 2XKSA 4I9WE 1TJIH 3IMVA 1IV8A 4HWUA 2ZXAA 5IV2A 4M9PA 1F6LL 3M7OA 4F37F 3CZJA 4OSUH 1CL7H 1Q9KA 4UM9A 5FF6A 4NQDA 1PJWA 1E4XH 2KB1A 5DJZA 5CCKL 1TQCC 3MJ6A 1MEXH 4LEXL 2ZKMX 5A6LA 3MCG1 3NZ8B 5K39B 4S11A 2J3SA 1FDLL 3R8BB 4JG1H 1BOGA 3C2AL 3FCSB 4LSDA 4OLYH 4NOBA 3MFFA 2P52A 4OCRH 4YJ3B 5IYDO 1CDJA 2XN9E 2Q68A 3S5LA 1XEQA 3QQXA 4RO2A 3S5ZA 3H01A 5F21B 1PYWA 2YSSB 4G6JH 3ZMEA 4AH2A 4MNQE 1OCRC 4B27A 5MEPA 3VTMA 3FQTB 3IVKB 5IWAO 4OGAC 1CGTA 3SZKC 5C0CE 4JFDD 1ZLZA 3BESR 1JNHB 4OQTH 3UTPD 3H3KA 4L3ED 1N6VA 2G4EA 3LEYH 4MRCA 4HSAC 3OT7A 2AK4E 2VLRE 2NUTB 2ZUQC 1I1AC 3MBXL 4B3SB 4HKXB 1WBYB 2APSA 3QHZL 4Z5RA 3S4SA 4EDWL 2G0KA 1H8HG 4R4NC 5DLMH 4K55A 2LR4A 2LV4A 3VQLA 3HS0B 2NQDA 1R5VA 1NH2D 2VLJD 1YNLL 3L1EA 2NNRA 4L5FH 4NWUH 4PV1C 3GTNA 2Z64C 4Y4KA 4KXCA 4WFHD 3BH4A 4N5ED 4YZFE 1L3NA 4HS3A 1A7OH 1C08B 4K7PH 5KVEL 2UUCO 3CH1A 1QSFB 4UTAA 4F80A 4YHYB 4NNPL 4JZOA 3GSQB 1CXEA 3AT9A 2Q86B 3ULUL 5INDA 1UWGH 4YIQB 5BY1A 5GSRA 5IV2B 3N2GB 4FERA 4Y5VC 3UT5A 4ZTEA 1E3ZA 1X5ZA 3CSGA 2XV6B 1Q9KB 4UM9B 3NPZB 3IGUA 4H26A 3VI4A 1I5YA 1CGXA 1N5YL 2ZXDA 2IW5A 3TX4A 2YGNA 4P46D 4J4PA 4XPGL 5DJZB 1SEQH 5EOCL 4DCQB 4DKEH 4ES9A 2HN7A 1WICA 4YE0A 3CSBA 1JUFA 5AZEL 3VFOA 3KWVA 4AIZA 3KNBB 3RWHB 1EJ6A 4TSFG 1URFA 3GWOA 3K71B 1ORSB 1ZT4A 3IKKA 3RGVA 2Y3AA 5C7XL 1JOYA 3BLPX 4LVEA 1U8MA 4UCRA 5DRNB 1S3RA 5F6HJ 3ZTCC 3RWJA 4I0XB 1PYWB 4Z7OE 1T2QL 5CINL 5I76A 1XCTA 2EE9A 4PJBB 2DDQL 1KN4H 1RK1A 2E7LA 2NN4A 3N40F 2OP4H 3CK0L 4JDTL 4JM4H 4HCRH 1P9MA 5C07E 1N4XH 1L0PA 4L4JA 2PTMA 3KPTA 4XP4L 2K8QA 2Z5UA 2CJUH 3EJJX 4B0MB 4GZRB 1E9QA 3BPOB 3LZOA 3QAZB 3X13A 3T9WA 2LFRA 4OD3H 1AANA 4AJVA 3IT8D 1R5VB 4G8AC 1L7TH 2CKBH 1UCBH 1LO4H 3LXUX 1JHKL 1JOIA 2VAAA 3LS5H 1OGAD 3PNRB 3MV7D 4L1SA 1I1AD 4FLWA 2FWSA 4QYAA 4WWKA 2WIIB 4FRWA 4R4ND 1CE6B 3IJ9A 3OZLA 2W5PA 3BVXA 4HUNB 4XHJC 3VGAC 1V7MH 1WT5C 2DW4A 5GW7A 2Z35A 4J6RL 3CQPA 3W9EA 1RUKL 1KCUH 3SBPA 4W9GC 5DURB 4AQEA 1M71B 2XN0A 1CLCA 5EU6B 4JF3A 1U3HD 1UPGA 4H26B 2X0WA 4KXZH 1DN0A 5IHLB 4KNUA 4KKLC 1MSPA 1I3GH 3ZTEA 3MRFA 5BJTA 2AJXH 2E0PA 3HNSH 3GDCA 4I7ZC 5T5FH 2GPZA 4OZHE 3BE1L 3E80A 2VXQA 1JUFB 1RLWA 5DT1L 3ZO0A 2X70A 5KHKA 3HE6B 2QWQB 4F20A 1MFCH 2VZ3A 2WIMA 3VXMA 1C7TA 1ZT4B 4BHUA 2EUXA 5GTIZ 2VAJA 5JJNB 1U8MB 4PLOB 1DBKH 1KKCA 2PYFA 1H8OA 5I76B 4LRNH 4V1DD 3LZLA 4HJGB 5DD3L 4RMVA 3VSVA 3FULA 3U6XA 4LO9A 1G9NH 5L6YL 5D2NA 1MCLA 7FABL 3F83A 4PGEB 4OJYA 2DWDB 3ZJZA 3KL3A 4TQPA 2PETA 1QSED 2LU4A 2WJ7A 2B5IC 4LFBO 4DK3A 1A3LH 3GRWL 4K7PX 1A6UL 1UG9A 1I7UB 3IS0X 4NGHH 2MH4A 1S7SB 3ML0A 1FLRH 1QNZL 3HG1D 1RJLA 4K2UL 1JR9A 1A14L 3P3TA 1PTZA 2QKSA 3ABZA 4N2AA 4G82A 2A83B 3RJOA 4HUXA 1VMGA 4CH4A 3VQVA 4NCC1 1TTAA 1BIHA 4NO2B 3LHPL 3QJFA 1L9MA 4J3OG 4FAAB 3UJIH 5T1KB 3QQDB 5JUEL 3OKKA 2PCXA 1A7QH 1M90W 2DOCA 5FM5M 3HB3B 1DQTA 1ETJA 3QAQA 5IEHB 4G1MA 3VXNB 5H6QA 2JMRA 3OAYK 1XOUA 4YHZH 1DN0B 1UM5H 4HXBL 3L13A 5K59F 1M7DA 2LLGA 1VERA 3S3WA 2N4IA 2PABA 2ZYHA 3MRMA 2AMGA 4XHJD 3CHXA 1HKLH 1MLCB 3A5VA 4JTCB 3OR7B 3HZVA 1E2WA 3WHXA 2A99A 2BTOA 5B7EA 4FA8A 4O51A 3SSGA 2AJVH 4LHQB 3KGTA 4BA0A 5ERWB 2PYFB 1S7UA 1HDMB 2YPLB 5F7BA 4JFFB 4ZO6A 2Z31A 3H1ZA 4JG0L 1ZLUK 3FF8A 3CRMA 5K9JL 5T1JA 1W0WB 4LMQI 3X11A 2IBZY 1Q9LB 4EEQA 5IW1A 1VP7A 1O0VA 2KDYA 1PZ5A 2UUBO 1KTLA 2A77H 2WOYA 3OQ3B 4F3FA 4ZYKA 2IJJA 4QJFB 2KBGA 4PY8I 1EDQA 2FHBA 1YEHL 6CGTA 3ZDYE 4YPGA 1SXBA 4X7TB 5F7EL 1YMME 5D1ZI 4H4NA 1INQB 2DZEA 2FWOB 5D7LA 3SE3A 1ZK5A 3DGCR 2FO4B 3LRHA 4QXUL 5F9OL 4L5FE 2DM4A 2DYSC 1MUJA 1UJWB 3Q6GH 5F7FA 5DZLA 5JW3L 3OJDA 4BFGA 3IM1A 3QJTB 2WVVB 5DF0A 2R83A 5CKAA 2GIMA 3STLC 4QWWC 2BSSB 1OEZW 3EJSA 3KCPB 4U2ZA 2VDMB 3FTVA 3E22A 5EU3B 1UM6H 4PJGE 4W4KA 1IGJB 2BIMA 2PPFA 5LG6A 3RI5F 5LXVA 2O61B 1O75A 3DJSA 4X6DA 1ZK9A 2R4RH 1M4KA 1UH2A 1JV5A 5C08E 2EXSA 3HZVB 3WHXB 4HK3N 4BYHA 5DRZA 4YFDB 4XWGL 1MXGA 1IL1A 1JNLL 1U92A 2OXGA 1MA1A 4KKRA 3ZDZE 4AL8H 4EXKA 3GMRA 4JTDB 4NQCB 1AD0A 3VFUA 2Z31B 5HDBB 1DBML 2F2HA 3U7YL 3X11B 3QNZB 3TF4A 3HRZC 4HIXL 2QGDA 1PZ5B 2R0WL 1P0SE 1PZSA 4XOAA 3T2MA 3BZ4A 2FIKB 3IMRA 4ZYKB 5D93C 3X12A 4F93B 5HFMA 1XD1A 2VLKA 4ZSOB 4FP8H 3CN4A 3WLBB 1NBQA 4KUCF 2Y72A 2V17H 1KMGA 2E9BA 1AI1L 1Y66A 4I77H 5EEWA 2LLNA 3GBNL 2EEXA 4B9PA 5HDRA 1S5IL 1ADQH 4U1LA 3FUNA 3L5JA 5IR1B 4L87A 1CYGA 2X1WL 1EBOA 1FFXA 1B88A 1MZYA 2H32B 3EIFA 4ESKA 5HY9B 2KLTA 3OJDB 1MCFA 2CMRH 4M6NL 2ZIMA 3PN1A 1HIMH 5CBAB 2W8CA 3KLAA 2J1WA 1VIBA 1MAJA 1D6EA 3RYHA 1EGJL 1AOZA 3IFXA 1HDJA 1HYRC 1KF9B 1U2YA 1AR2A 4CC0A 3L75H 1YTFD 2F7PA 3U0PB 3JWOC 4HJ1A 4O58H 5C71A 3EDEA 4G9FE 4OM1L 5KBMA 2IV8A 4QWWD 1A7NH 1W15A 1DQDH 1JV5B 3GBEA 3IDIB 4X5XA 2NTFA 2DMGA 4NKMA 1OP3K 1IGML 3V8OA 1GGIL 3FU7A 5B5EZ 4DR6B 1IL1B 3T0ED 1WZ1H 2ZAHA 4Q20A 1SHSA 5FYJH 1N2RA 1N36O 4MB4A 3W9DA 2J1KA 1T5WA 2FBJL 5T5NF 4P4KA 2F5AH 3X12B 4A6YH 1AR1D 5AW5B 4K3JL 4UUJC 4KROD 1LEKA 3CHPA 3WMPA 5IM7A 2VLKB 1LNUB 2G0LA 2ED9A 1J0YA 1GGBL 4NM8H 5IJ0B 3EO0B 1LYQA 1LEGB 2VO5A 4RLDA 5EUKA 5FYKU 3N55A 4FM0A 4ELMF 1JF1A 3MBEC 1XGTA 2OR9H 4R7XA 1FIGH 5GGVL 4E41D 1DZBA 3LYRA 1A3RL 2XXCB 3U2SA 1E8XA 5KVDE 1FFXB 4LF7O 1OW0A 2V2XA 4PJXE 2CU9A 2BVYA 2YIHA 1UD8A 5CXPA 4UIMB 5I15L 4IW4C 4P3DB 1MY5A 3GI8H 3UFIA 2EXWC 3LQMA 3V0VA 2VDQB 1WWCA 2V4DA 3RYHB 4PCKA 5E5MB 1ESOA 1EHLH 4KJWC 5IK3A 5JW5B 1JWMB 5EO1A 1GCYA 1CTOA 4HC1A 3TESA 1RP9A 1KXHA 3HMWL 3SE4A 1MJ7L 1VFAB 2H6OA 4NO5A 2Z0UA 1U8KA 3WTTA 5I0ZA 3G6JF 1G43A 1HSAB 1IO4C 3ETTA 1T83C 2BMKA 4MCNA 1CE1H 3MREA 2KL6A 2DJUA 2WWMC 2PW2A 3CDCA 5C6PB 5IGXH 2QTOA 3BP4A 5KAIZ 3CMGA 1PQZA 2D0HA 3NJLA 4FULA 4M61A 1UT2A 8CGTA 1CXFA 1NT2B 4FLVA 3QT2A 5EBLB 1HE8A 1H2NA 3S96B 4JAUA 4TQHA 3FHQA 5D1ZA 2DB8A 2VO8A 2HT2C 3HKDB 1N2RB 1QMUA 2CALA 4OCSH 4CVUA 1T5WB 3TN0B 1HXMB 2CTWA 2OI9B 1BGXH 4K94L 4P4KB 4EB6A 3IJEA 4Z78A 3V6ZA 5JA9A 1NGPH 4LFAO 2NR6C 1A7PL 5IM7B 5E8EA 1YNKL 3IFOB 4ONFL 3HNVL 3ZRVA 3FYEB 3ULSA 2BVUA 2J5LB 3P3UA 5CM1A 2JXMB 1A1NA 1S3KH 3Q3GB 1NCDL 5EUKB 3D25B 1QLEC 1AZVA 1V54C 1XGTB 4MD4A 4IYKA 3SGJA 1MNGA 1Q9OB 1QX1A 3IGFA 2Y24A 3DETC 1I7RA 2X4QA 4X6EA 2PTUA 4KRNA 1XH0A 5ESAA 4X9BA 4HJSA 3NABH 3MBED 1MRDH 2XPYA 4NRZB 2JCCF 1WVZA 1XL6A 2Y0IA 1P2CB 1DANT 2P24B 4XO8A 5EO1B 3DX7A 1C12A 4UNTA 4A04A 3GM0A 4I0CC 3QUZD 4MJ5B 1YZBA 1MREH 4JO1H 3S98A 3MUY1 1D7BA 5GGTL 1G5AA 1NJ9B 2IPTH 1TMQA 1ZVYA 5D72H 2Z7YA 3V4PH 5TH2B 4PJ5E 2F53A 2EXWD 3DOIA 4DPCX 1XHXA 1WPCA 2QSCH 2BMKB 1F97A 3QJOA 5FYKD 3MJ9H 5J2UA 4KJWD 1L0XA 4UM8A 1QEXA 1LDPH 1H5BB 4XTRC 3G3LA 2VERA 1Z5LB 2YC1B 2KERA 4AYSA 1J5EO 1NOFA 1OE3A 2X4TA 4H25A 4O4YH 4FQXB 1JZDC 4TULH 3RVWC 4HJJL 5EU5B 2WWMD 5B1AC 3B2DC 3EF7A 5I1IH 4EB6B 4LLMB 3V6ZB 2Y4TA 3OSVA 1WJ3A 2WNWA 2K6ZA 3DGDA 2NY4C 5E8EB 5KJ4A 1YMHB 1SPDA 3IE4A 3JASB 1BZ9A 4ANXA 5F97E 3C9NB 1IC7H 4LR3A 2HT2D 3QCVH 4K23L 1I1FA 1RZ7H 2IDUA 2NMSA 5DJAA 4O9HL 2HVKA 4YEEA 1G9MH 4AI7A 4L0YA 4PI2A 2YFNA 2B16A 4TSAL 4DW1A 3KAAA 4YFEA 3QI9A 2QVKA 4N0UA 4TN9A 1CD9B 4QRTB 5KW9H 2K3TA 2XN9D 3DTXA 3NR7A 1ZTXH 3KH3A 4QNHB 4PJDA 1FVCA 1SQGA 4NO3A 4OLUH 1QACA 4NZJA 3I9PA 5BUAA 3U36B 4HIEA 1IZ3A 3DX7B 4B7IA 5E2UH 3Q8CA 4GNKB 2EH7H 4XXDA 5JLZA 2BNRE 5F7LB 4WWOA 3TT3L 5LGHH 4LWSA 4Q6GA 4ZHQA 1GM9A 1HL4A 5F44A 5AQ0A 3UZQA 4OJFL 5IQ7H 1VQKV 4LNVA 2R29L 4ZUTB 2V1DA 2WBJB 1NMBH 2YPVH 5BZXA 3WTXA 2MK3A 1UXLA 3IJ7A 5L7XL 2EX3A 4Y2LA 1N34B 3PXLA 1TEYA 4NENB 3TVMC 4PI0A 4N2HA 2LVCA 3T1WA 3V4VH 1MAMH 1MZZA 4PBVC 4XAKE 2AQQA 2JWYA 5FYJE 1BAWA 4WJKB 4HWBL 4KK8C 4U6VL 4QRRD 4XTRD 5B8CC 3A2FA 4N26A 2DQ6A 3UTQA 2M6YA 2F8XC 3AU1A 2J72A 3E8UL 4ZUUA 5JQGA 5AFAA 5EYPB 1FFRA 2L7UA 2CRIA 3EDKA 2JIXD 3RVWD 5FW6A 1H3UA 2VXSH 4PVBA 4FS0A 5ESVB 1PAZA 4K73A 3QPQC 5DJAB 5DO8A 5D4QA 3RAJL 3B43A 1IE4A 3X1EA 4PWJA 4AGLA 2DQDH 2SEBA 4XCNA 1DQJA 4TUJA 1TPXB 3RTQB 3NJKA 3BPLB 1E4WH 2GW5A 3QJRB 3SGKA 3OJMB 1GA2A 3WUWB 1TOXA 1L3WA 3DTXB 1ES0B 4Y5YB 4GKOA 2B9BA 1SNRA 1HINL 2B1AL 5F6IB 4NO3B 3WFDL 3EJPA 3BUTA 1BQRA 1UT1A 5HI3D 5ADOL 1MFBL 4X8AA 5CEZL 2Q76B 4KHTH 2HRGA 1AQHA 1WO2A 4J3WA 2WWKO 2O5YH 1YVWA 4K0KO 4XVJH 1QFOA 5GRXG 4EQ3A 2Y5TB 2KLSA 3SDCC 1DQQB 3O6FB 3V0JA 2G3XA 4LSRL 1V3MA 5KAQG 1BXXA 1MFDL 2JJSA 5CD3A 1BYOA 4DV5O 2WTPA 2F43G 4FTVE 2DQEH 5EH1A 4P5TD 3L5XL 3ARUA 5I30L 4UTBH 1T7YA 3Q4HA 4Y4HA 5I1LA 3C6SB 3F6LA 2K8MA 3SKMB 3BP7A 4TLTA 3QQ3B 1BFSA 1KELH 4ZPTA 2J8UA 2GJ6E 3B2UC 3UTQB 1J12A 4GKLA 5DGQA 3TVMD 2EILC 2UX6A 2J12B 1KC5H 2P8MA 1IDSA 4NI6A 2OT5A 4WBNA 3B40A 3EFDL 4MTFA 2D0FA 1EH9A 2C1OB 1DUZA 3SDYH 2BW5A 2WSDA 3OGCA 4XC3L 4N2IA 2WLIB 1EUTA 3N06B 1TJHL 1T7WA 4X5LA 1PW3A 3GUFA 4YSOA 1AP2A 4WWPA 5E9NA 3S3SA 1PIFA 4L1BA 4G27B 4NRXA 3WIHL 2HX7A 3EVKA 1DFBL 3TO4D 2Q0AA 1BEYH 4DF9A 3GRGA 1AO7A 3H3PH 3NDZE 2R39A 3Q1SH 4FYTA 2XVBA 5HP5A 4ZTOH 3A0RA 2ROYA 2J6EL 4TPRH 2QFRA 4NPYB 1B4RA 1BZEA 2XA8H 4F7TB 4ZAKC 1TCRB 4X7SL 4C57C 3F6IA 2R9RB 3HOGA 3ZKQD 4PRNB 5C0BB 3UBXI 4AM0B 3EGDB 3UO3A 3U0WL 2X05A 2GTZB 4IK6A 3MRBA 4NM4L 2GAZB 3DMMA 1JWSA 5K9KA 1RUAH 1G4YB 2WAMA 2AJ3B 4IJ3C 2J1YA 2D7MA 1GOHA 2R0ZL 4I2XA 5I1LB 4X9QA 5DD1L 3ZL4H 5EIVA 3KPRE 3KHOA 3LS4L 3ESNA 4B9IA 2E86A 1QFUH 3Q8FA 2QADC 3FH5A 4GAGL 3VQ1C 1J05B 1NSNH 1NICA 4IRSD 1MCNA 2HFTA 1CLOL 4NS0A 4W9JC 4CA4A 2HKHL 3NFNB 2AI0L 4K8RL 4U4BA 1TVKA 3DPDA 3WG7C 5DTFA 3TCXA 4DP6X 2ZUXA 2PXYB 3L9EA 3L54A 4G6AC 2IALA 3VJ6A 2VMJA 1BDYA 2IF7A 1TITA 4M5YL 1X5XA 1F6AB 3QNYB 3B2UD 3KZIZ 1JE6A 2YD0A 3UZEA 3ULVL 1NFDF 3OUSA 5CP3A 1C9SA 5E5UB 2AEWA 1JPFA 3ATFA 4F7KA 2HTKD 1ZTXE 3BWZA 2I69A 3MLVL 2A9NH 5JIQA 4K5NA 4HIHA 4BKSC 1ZAUA 4XMUA 4W6WB 2GC4C 3CJHB 2J88H 1MCDA 2MNJB 4Z77B 3HG4A 3MRIB 1ASPA 1OAZH 2XBZA 4LHUG 5K69A 1E1RG 5E56A 4FQJH 5K9KB 3ZYJA 4MQ7A 4KJQC 2R23A 4GUPA 5E6SB 3UYRL 1ML0A 1K4DA 4HWZB 2PPCA 4KUZL 4ZAKD 5IG7B 3FX7A 3JV5A 3BGMA 4GS7B 2H1PH 5KYNA 1XBRA 5JOEA 5GRUH 3SJVB 1KCKA 2Y2TA 4LCWD 3K6DA 4PG2C 4JO3L 4TV3A 1MFMA 3QDGE 3UCSC 3OZKA 3VXRA 3LN4B 5F88B 1J11A 4H13B 2FX8L 1BYPA 3OKDA 5KYYB 5IEKA 1E3XA 4RIRA 3CX5F 4DXWA 2L7JA 3U30B 2X6AA 4K7FB 1GTNA 3L16A 2CBPA 5EN3A 4YDMA 2JI3A 3JT0A 2GK0A 5H37G 1XZ0A 1OHQA 2XVGA 3I02A 3NFPB 1TZIB 2NUPA 5EWIL 4TSBL 1G9NC 2KYIA 2Z93A 1S78C 1CF8L 2BOBC 3COOA 1WYJA 5DVKA 1KXQA 1TTFA 2E8YA 3WDJA 1M56B 5BS0A 5C6TH 4KK5C 3E38A 2Z3FA 2YHGA 3BPCA 4HIHB 1ZWIC 1MCSA 1T7ZA 4R96B 4JQXC 2ZXCA 3GT6A 3TT1H 3E7JA 4P3CH 5GPRA 1R73A 4JRYE 2EYSA 2F8IA 3I9GH 4WCEV 1K5WA 4LB8A 4MQ7B 5FKPA 5IJKC 2CR6A 2Z4QA 3ORJA 3ZE1E 3A47A 4ZUVA 2FYUH 5LNGA 3L7FB 4MZ2A 4P4RA 3MUJA 5CUSL 2DWEA 3G08A 4FQHA 1TKWB 3ZR5A 2X10A 2Y7MA 4QRPA 4DGVH 2EUZA 3BKYL 4PGZA 3MACH 3VXRB 4DV7O 3CXFA 5HYJE 1Q86W 5EEXA 1AGFA 1ZGLP 1M7UA 4GOSA 1B90A 1GN2A 4RISH 5IEKB 5CLYA 2DMBA 4RIRB 5CEXB 4E9RA 2CGNA 1YEIH 5KSBA 2FL4A 4X0KA 5F89B 1KZYA 4HPOL 5ALCH 4ONHB 1YNTF 5M95B 2KZKA 4DV2B 2W94A 3KWXA 3QYCA 4RSVA 2FUTA 1V55B 2EQDA 2EDYA 1JS4A 4HPYL 1JDAA 3PHSA 15C8H 2K4AA 2VUYA 4IBZA 5F8RC 3MJWA 3UBXA 4F7CA 3JSNA 1SF5A 2QMKA 1CIUA 3OLGA 2AJZA 3JARB 2ZPKL 4MLIA 3K0YA 3SD2A 5TJWK 1ZX3A 2DL2A 1S78D 3CFKA 4GRWH 4XWOC 4BWTA 4J3SA 5HHMB 4L1LA 4YO0A 1PKQA 1U3ZA 1KEGH 4PJFE 4MGXA 2WYHA 2VGLM 3UAJD 1RURH 4F58H 2XWRA 2X53A 2WXIA 3OAUL 4BGLA 2FL5B 3LKNA 1DVZA 5GGRB 1QBBA 3ISYA 5B7MA 3OKNB 1EXGA 5J6GB 5B3SC 2XKNA 3B9KC 3FRPB 5B39A 4F5CA 4KDWA 3G08B 4FQHB 3DBXA 3WSQL 3VYPA 2JKWA 1HNWB 1D5ZB 3OJ2C 2OK0L 4P23B 4ZX3A 5I0XA 1S77D 3LH8A 4WO4D 1V7NL 2QQNH 1HSBA 2WHVA 3NPSB 4GO8A 5C7ZA 1NL0L 1IBLB 1R75A 5IB5A 3Q06A 3RX5A 4M8QB 3IF1A 2R51A 4X8XA 4X0KB 2CJ3A 1HCFX 3UERA 3GMOA 3DI2B 5JVDA 1I1CA 2K78A 4AL8C 4D8PB 3EOBA 3NT0A 4EKJA 4ELMB 3OEHG 5IROA 1JXJA 1DEDA 1E65A 3H9SE 5H94B 2YN3A 4FCAA 4G6FB 2VQEB 4JQIA 3UM7A 3O3AA 2XTJE 3UP6A 3MV9E 3ARBC 3FT3A 2YQGA 3CFKB 2R69L 2XTSA 3B4SA 3PV6A 1IQWH 4HHAB 3GSOB 4EUPA 1FZKB 2FD6H 6PAZA 3AG4C 1PKQB 2FHFA 4M03A 3M45A 3K2KA 1Z7JA 2B2XH 3FOLA 1N70A 4P2RE 4P2CG 1ZANL 2GG1A 3PXJA 4GMSH 1ZHKB 2BFVH 2I5YH 4F8PA 4TNWK 2MPVA 1AH1A 3G6JB 4OBRA 1PPJH 4XWOD 1AHKA 3WEMA 4NUMA 1U3JA 4KZEH 3TPKA 3W38A 1RFDH 1RI8A 3L3GA 3RG1C 1W0VA 3TIDA 3CLWA 5LCVH 4DRXA 4LF3A 2N04A 4I18B 1HILA 3R06A 2O5NA 3NN8B 1S7WA 5FYJU 1WPXA 2BDNL 4HIIA 4BSVB 1CBVL 3CN3A 2H0PA 3BVWA 3B9KD 4GQQA 1VPOH 4JYBA 1ASQA 2A6IA 4JREB 4ZFOL 4AK1A 2GTSA 2QLVB 3FBQA 4FFZL 4PJ5D 4G80A 3F6JA 3QDMB 1DJHA 4Q9RL 1KB5A 3OB0K 1XGUA 1W80A 3UG5A 5CA3A 3D3VE 3DVGB 4HWNA 3C5XA 3HPJA 2Z92B 4IK7A 2OMNA 1CLVA 4XP9L 5JW4Q 3PL6B 3ZE2F 2D7QA 1I8MA 2Z0AA 2YGQA 4EI6A 4Z7UA 2LW1A 4FABH 2V2WA 5JW4M 3SDDC 1FV1B 2BPBA 2HVJA 5I6NA 2ENPA 3WEXB 4BZ1L 1FRGH 3ELAT 4EUPB 3CBKB 3RZCC 3P0YH 5ICZB 4LLAA 1GMEA 2VWJA 4WGKA 4IBLT 4G7YL 2R7EB 4IU2A 5FOBB 5IQMA 4HOZA 2VLLA 2NY2B 1OCOC 3ARBD 3OTTA 1F23A 4JAVA 4HBCL 2UXGA 3VB9A 4R6UA 5C8YA 1DBJL 4JFTA 2OZNA 3ARGC 2XUWA 3FL7A 3ZHUA 2VSMB 4K15A 1B0GA 4YHHO 1ECZA 4N1HB 1LWHA 1DL7H 1HTYA 2HJKB 3IWUA 4NYLA 3DO7B 3JWDL 1AKPA 1HR0O 1F4XL 3FW6A 2VJ0A 4PLJC 4QT5B 5KS9F 2G5UA 3LZFH 4XXCC 1EFXD 2Q7YA 4UQEA 1R6TA 3DX9A 3QB7C 1KWKA 4WI3A 1MHHB 2A6IB 1QBMH 1JXDA 3L2LA 2BP3A 3WMSA 1DFXA 1I8KA 1YJNV 2A9DA 3TTSA 5ACZA 3CD6V 2CA4A 4WHDA 4TUYA 1RPQA 3QEHB 1T03H 5KBDA 1GJWA 1SF3A 2E59A 4UYQA 2TAAA 3MRRA 1OAXL 1F4HA 5I18L 1I8MB 3SE9H 1Q6HA 3JUYA 1TG8A 4Z7UB 5BVJA 1F4YL 3RFZC 1MIEL 2V2WB 3KPSA 3F7LA 3MLWL 2UZXB 3EDDA 1DEEA 2P4KA 4OZGE 2HVJB 5D1XA 1BSIA 1Q0YL 3JAKB 4WNSA 4ES8A 2W9DH 5GJSL 4ORZC 3ASOC 1H15A 1Y18B 4GRWE 2WAQA 3CCLV 3ARFA 3QJQB 4NBZB 5C0RL 3L9DA 3VWKC 3SY6A 3IS1X 3ATBA 1QRNA 3DHUA 4AQ8C 3SDDD 3EHBD 2ZNXA 2YAPA 4N0FB 4LF8B 1GCFA 1WCBA 1IX2A 5LP6A 3RZCD 1Q9WA 4ZMXA 4XMZA 3LTVA 4BQ8A 3QHFH 4M8UA 4PJ7A 4C4KO 1U41A 1XILA 4GT1A 1C8QA 2PR4L 4V2CB 1FXKB 2ZJSH 2VR4A 3L3OC 3GHEL 1M1XA 4MA1C 4AEEA 1WEJL 3HZMA 1UGKA 3D05A 2QQQA 3NIGB 4CRPA 3ARGD 3LPFA 1N32B 3FTWA 2NX5E 3MNDA 2Q7YB 4JZJB 3SYAA 5A2QN 2ZP8A 4MJID 2LVEA 3R0MA 2YXYA 1KP3A 3A24A 4OF6A 1NCBH 2YKLH 1GR7A 1I8KB 2MNWA 3KYNB 4P2QA 2Q0OC 1FYHB 5DMIL 5ACZB 3G6AA 3CFQA 4QAMB 3CMOL 4ILDA 4PLJD 3VAEA 2PPAA 2CDGB 1GZPB 1NCHA 2NW2A 5C0AA 4ZBMA 2OTUB 2O57A 2QSVA 3F8UB 4R7NA 1U91A 1B0WA 4OF5A 2A4CA 4Y2DD 5DWUH 3O4LE 2FJGA 1QCEA 1C16A 1KPVA 2Q2LA 4Q58C 2JS5A 3CDGB 2QVFB 1F2QA 3BWAB 1EAJA 3T4AC 3KPSB 5DUPH 4OLEA 5KHGA 2FHCA 5IJVA 5D1XB 2ZT9B 1OSPL 4RWYL 3VWJD 4WWID 5K9OB 1WTGT 1E5AA 2Y0SA 3HAEH 3RURA 1G9MC 3ARFB 5EU7C 3N91A 1F41A 3WKMH 2CBQA 2B5UA 3H2QA 4FKKA 4YSDA 2F1BA 4Y9BA 4AW7A 3JXAA 3MNVA 5IY5C 4GSDH 4RRPG 2NTSP 3M86A 3GS0A 4PG9A 3DC5A 4Z3TA 4KQ3L 4Y1AB 4F7PA 2WYZA 4GJTB 1B4LA 3VWKD 4X7DC 4BFIA 5I73B 4GW1B 4BGDA 1U8OA 3WKNA 1XMOO 2IDFA 3BRGC 4CMHC 3HZMB 1JPSL 2WZPA 4CNIA 4UVBA 5EF3A 4WVRA 4CS4A 1NAMA 4Y2OA 3W0WE 3DXAE 4UNVA 1A65A 2CPUA 5HVHB 2GC7C 4J7RA 5AVQB 3KXFE 4RGOH 4OI8A 4RMUA 1CGUA 4P2QB 1CP9A 5B3JE 5FO8A 5C0AB 4HBQA 2MCPL 4UTAL 1WA8A 3CG8A 1U91B 3POCA 4WV1C 3AG1B 2FJGB 4ANUA 1XSIA 2AQ3A 3C6LC 4AGMA 3I6LE 3S88L 1C16B 4X7EC 3FCGA 3AB0B 4PRIA 1AIFB 5GS2H 4LDCA 1J18A 1UA6H 5SWQA 1IBGH 3HUJA 1JVMA 2D3NA 1NA8A 5H6RA 2LQRA 3R1GH 5FCUH 3OKMB 1KLUB 5M7QA 1IT9H 4TUKH 2F15A 4RQEA 4P5MA 4AK2A 5T33L 2Y07L 1KEMH 4GQ9L 2P7TB 1R3LA 1WG3A 3LKPB 2ZKHH 1WA2X 2Y2WA 3B6SB 3WE1A 3ZT5A 4JNXA 1VKXB 2E4TA 3MNVB 4Y4FC 5JXAH 3WYRA 4JHAH 1O7DE 2VDOH 4Y19D 2IH1A 4UV4L 4XMXA 4ZNEE 1KDIA 5TISZ 2Y69B 3RVTD 5JHMA 1K4CC 2UXFA 4IRZL 2CDFA 5LMUO 2FEEI 3L6FA 4BFIB 1OCWL 2HLEB 4J7JA 3M6DA 1MHPL 3VRIA 1EIBA 2VC2L 1KCSH 5E6YA 5IMKB 4P48A 3TA3A 2DQCL 5IB1A 1LEIA 1YPZE 5HFLA 1R4XA 3US9A 3FO0H 1WA0X 3V0GA 3OF6D 1L7IL 1J48A 4JI8B 1OF2B 4F7EB 1O5DT 5B4MD 2XETA 4UB0L 2R2EA 3LN5A 4MBOA 3VDCA 1HVXA 1NKRA 3BLKA 5DUBA 5FO8B 3N50A 5KAFZ 4NP4H 3DIDA 1WA8B 4I3SH 2BCCH 4DPAX 1YA5A 3RNQB 4G7SB 2VRAA 3CLFH 1Y6XA 1G1YA 2VQFB 4DQAA 5F0JB 2H0FA 1OL0A 3S5LG 1EZUA 3GMMB 5FHAH 3LRLA 1BX2A 2YXVA 4MT8A 2AQRA 3TBVB 3N85H 4LSTL 2XWBA 2ATPB 1XBDA 5E79Z 5DEFA 1S3JA 1BM3H 4WTZA 3QDGD 2VXQL 3HVDA 4UDTB 1OM9A 4GAYB 5IUCA 2OCCB 1WBZB 3FUJA 5CSZA 2K1EA 1XTLA 5E9DA 3WIIL 1JJOA 2ZXGA 4JRLA 2F54B 2O4EA 4RBPK 5CILH 3CAFA 4WUUB 4JQVA 5F9DC 4UCFA 1DLFH 4FFYH 1SZXA 2NT0A 5JHDD 4HZLA 1F00I 4LU5H 5ISZA 2CDFB 1K6QL 1QBAA 3AC0A 1XR8A 1KTJA 5HPMB 4QXWA 2CHWA 1NCIA 2VDNB 3VRIB 4CW1A 4YDKH 5J57B 2ZOOA 5LLIC 2XFXB 3TA3B 1FA4A 2A6DB 3I75A 3BFOA 4U33A 4NQEE 4WCYH 3Q13A 4KO9A 5E4EC 3OZ9L 2IIJA 5FECB 4C58B 3QRGL 2V5MA 2Y6SC 5CGBA 1M05B 1NC4B 1Z5YD 4LLVB 4OU3A 1DJZA 2WKOF 2NXYC 5CCKH 3F2LA 5H9CA 4LGRB 3RX9A 1FNLA 3EYUH 1WAAF 4PY7A 4ENZA 1H6EA 1BCIA 1FDLH 1Q38A 1QD0A 4JRYD 3TZVA 1R3JB 3AG3C 3B8NA 2BP0B 5IQ9B 1GN3A 4F8QA 4JI3B 1WGOA 2VDML 2ZQKA 4YHOL 5EUOA 3VYNA 4OCNC 1AS6A 1QSZA 3S35H 2P48B 2DEYX 4WK4B 1TQUA 5LAPA 4BH7A 3TFBA 2Z1PA 4J3TA 3QE5A 3P11L 2NW3A 4JPVL 5EG6C 3TV3H 5IJ9A 1VZIA 2ZCHH 1S9WB 3CCHB 1U8NA 1NPNA 1L9SA 2KH2B 2IV9A 2PYEA 3GSRB 4H8WH 4KVNL 4X6CE 2RB8A 1U58A 2C9SA 1MG3C 4KHXL 5EEUA 1K92A 2XBTA 1ED3A 4EDWH 5CSZB 1NQBA 5LWYL 5DJXB 3JTSA 5HI4D 1F58L 2XWZA 1YECL 4M1GL 1P4BH 4EIBA 3M07A 2OTWA 2P42B 5D7IB 4HOWA 4HZLB 2XTJC 4X62O 3GF8A 3K46A 5F93C 4BD4A 4NNPH 4DZBB 2DQIL 1WS8A 3K57A 1F5WA 1I8IB 3BT2L 3EH3B 4UT6A 3I75B 4YL9A 2YDEA 2K1MA 1CFNA 3BEHA 3D36C 2IAMA 2P8LA 4FG6D 2G2RA 4F8LA 1AQDA 1KG0B 1N5YH 4QO1A 2OMTA 1DVFC 3OLEA 4TUOA 2Z4TA 5EZIL 3TZVB 1JZJA 1IBBA 1TCMA 4I4WA 1FCCA 3ZPDA 4KI1A 5BVPL 2Y6SD 4AMXA 5EBWC 4ZK8A 1IJ9A 4AC4A 1QR8A 1T2QH 2NXYD 3MLSL 5EUOB 2OS7A 1YNTB 1G1OA 5JCOA 2DDQH 3FT4A 4JKPL 3B9AA 1U30A 3GEFA 2OMXB 2XAFA 4JDTH 2F93B 2EDBA 4AYGA 3K59A 3RJQB 2J25A 4IIJB 1U8NB 1ROCA 2JKLA 2X40A 4P8QA 2YEQA 3EH2A 3TWYA 1KGXA 2NLJB 4PJAA 1TZHB 5HJBA 3KYMB 1PZDA 5TDNA 1Y7VA 1FNGA 3BKJH 3RILA 1JHKH 4I50B 3OTOB 5DSCA 4X50A 4KY1L 3PNWB 5L4IA 5L9DL 1NMAL 5HD8C 2ZIDA 4FJ6A 1FPTH 4ALAL 5EZOL 1IVLA 2VZUA 3ECVA 4RMQA 5DHXB 3M1BB 4GG8B 3ZCCA 4U6HA 4U7OA 3FUMA 4HZ3A 1IGFL 4NDMA 5DHEA 1JP5A 1TFPA 4PS8A 3INUH 3MA9H 4UIKH 3PDOA 3S8GB 1AQDB 1TUEB 3QXAA 1BF5A 3S35X 4MSWC 1GYUA 2FX9L 4PUBH 4QO1B 1OAKH 5IHUH 5AKTA 3B2XA 2OMTB 3BE1H 4NN7B 2IOOA 1MAKA 4IIQB 4TUOB 3MHHC 4MTGA 1BD2A 2JQAA 3J2PA 1DQVA 1OE2A 2F19L 4I4WB 5DZOA 3VXUA 4GAAA 2IFFH 2H6PB 2G2PA 2L7EA 4EN2A 3JV0A 1JGEB 1SY6A 4PCYA 1LM8V 5LXGL 3B3BA 2VDQL 4IBYA 3BD4A 5BMFL 2LTQB 3P3NA 1U95A 2OULB 3ZSSA 3IFPA 5I6OA 1ZGLB 4W93A 3LRKA 1MLBA 2B4CL 1UJTA 2QGCA 5KSUA 1ILSA 1LP9B 4O2EB 4RAIA 4U1SB 3GRWH 3NZHL 3QYNA 3K5SA 4X9IA 3MOBL 4X5RA 3L1OH 3ABLC 4FQ1H 4HS8L 2ZCZA 3H9HB 1FNGB 4UT9L 1T80A 1FFOA 2G30A 5DSCB 2EP6A 2FGWL 2DYRC 1E4KC 1BZOA 4AE0A 4JZGA 2VSCA 1J10A 5DR5L 1PBYA 2X6VA 4ZQKB 2UVEA 3ZX6A 4DR1B 1ZV5A 1XB6A 2JJTC 3LHPH 2IXQA 1L9TA 2DN7A 3D3VD 1K85A 2MCG1 4NNYB 5HYQA 1FN4A 4FYRA 4QRQA 5JUEH 2F5BL 3LV3B 1REIA 3GSNH 3HBGA 3PWPE 4WFFD 4XX1G 3TH3T 1VQ9V 3TK1A 1CLZL 1E5BA 3GJEB 3EZ8A 1IBHA 4FQ2L 2JGDB 3BYYA 2YIDA 4PN6A 4JFDA 4RNRB 3VB8A 1RZJL 4L3EA 4O2BA 3BIKA 1J88A 3R7QA 3RRQA 5E8PB 1JPXA 2N0KA 3JTTB 1FL3A 5BRZE 4EVNA 4U3SB 1H3PH 2VJXA 2BFGA 2WQVA 4PW9A 1A32A 1RHFA 3L5HA 4M8VA 1YG9A 2IAND 2VLJA 4PGDB 5EPMA 1FI8C 3UJTL 4JFYB 1YYMH 4WFHA 2NCEA 1U95B 4JG0H 4DERA 3DJRA 3IFPB 4PRHE 2GHYA 3GB7B 3II2A 4RZCB 5JIDA 1U8CB 4HC1L 1PLAA 3NA4A 5DHVA 1T89A 1KCRL 4NAQA 3P2TA 4KPHH 1FZOA 2VB5A 1UT9A 1YEHH 4X4XA 5D5MA 1JYNA 1XI1A 2CLRA 4BFJA 5F7EH 3MJ7A 3HC3H 4A2GA 4QEGA 3C60C 4KP4A 4P46A 4XNYL 1DQIA 1B2WL 1FFOB 2Q7AA 3KPQB 3BP6A 5DC4B 1IAIH 4L4VE 3REWA 1G87A 4QXUH 5F9OH 1QWHA 2J73A 3K5OA 1XR9A 3ZBHA 1I4FA 2AITA 1C1EL 2IXQB 2Y06L 3IDJA 1E7UA 5JW3H 2H8PB 5GS1C 3CCRV 4XBGB 3HJEA 2ADJA 1FN4B 2QEXV 1HCZA 2XFGB 3ML9A 1NFAA 4Z7QE 4LP8A 5EFIB 4CBPA 3CVHA 3RUGA 3NJXA 1N8ZB 3FB7B 5F9JA 4ETQA 4LF6O 1PKXA 5JDJA 3QFDA 1YEEL 5CB4B 3BIKB 1THAA 4BWUA 5KS9B 2ZKWA 4PY8J 1E9PA 1I75A 2EECA 3DUUB 4IHOB 5IF0B 4K9EL 1SMAA 1EDYA 1F42A 1WFNA 1XF4A 3M17A 1NH2B 4XWGH 2VLJB 3FQXA 5MHSD 1JNLH 3NOIA 3FXIC 1OGAA 2Z8SA 3MV7A 4Z7OF 3F00A 3K8MA 4OCXL 2QPSA 1DBMH 5F0MB 3QIWC 5GS0H 2I07B 3NJFA 3EJYC 1H6TA 5E7FA 4FFBA 1KIPB 1Y6MR 2R0WH 1XGRB 4G1EA 4ZI8A 3LY6A 2Z8WC 4F9PC 3EKCA 1BVKB 1OO2A 4LSVL 4QHKI 4ABWA 1OTSC 4X4XB 4NUGH 2NX5D 3ZHDA 4WI9A 3FMGL 3MV8D 5DI8A 1AZUA 4BUHA 4GUQA 4MNGB 1HEHC 1U3HA 5AD0B 3LDBB 4XB3A 5IVZB 1FLTX 4DP4X 1LWJA 3TYFA 3FPYA 4P46B 3AUWB 5E0FA 3BP6B 4AV0A 5J1AA 1S5IH 4E9QA 5IP4A 3L3DB 1TENA 3AFLA 1A7RL 2QWRB 3PWUA 1HP8A 3QRFM 3RKDC 2HG5C 2Q10A 2P5WE 4KK6D 3ZLQC 3O4LD 5DN6G 3CCMV 2EC9U 2OLDA 3C60D 4A1RA 1XH1A 1JZ7A 4K5PA 1TQCB 4V1DA 3NK3A 3CVHB 1N33O 2H0JA 3HCVB 3HKEA 2WCSA 3R18A 5CLWA 1SYVB 2NY5L 5F9JB 4ETQB 2HKOA 2XQYG 1YAZA 4ODWA 2Q8AL 4OUUA 4HFWA 1QSEA 2G75B 3MNZB 3NCJL 1O7DC 3F5WA 3PYCA 4UMGA 5J12C 5I1EH 5LAXA 2CBOA 1A7BA 1XTMA 4J1UB 1NU1H 2ZUYA 1Y0LA 2QV4A 1OCRB 4MAYB 4G5AA 1XF4B 4S10A 2UU9O 3M17B 3PHQA 1GGIH 1OIOA 3IDYC 4G7VH 4XCFL 4IOIA 2FQDA 3H85A 2XAHA 2OMYA 2XWTA 1NCCL 3WHE1 5LGJA 1OGAB 2ZUQB 1I1AB 2W0FA 4WY7L 1AJQA 4DKFH 1NVPD 2L3BA 2WCGA 2FBJH 3QUXD 5AW6B 2QDVA 5AB1A 2GSGB 4H33A 1R5IB 3EJZD 4LGSB 4M9OA 1OOAA 4PV1B 1HX0A 4JDVB 2IH9A 4KAQL 1S9XA 3WNKA 2VM3A 1L0QA 3U7WH 4JCWA 4JS7A 3H53A 3TYFB 1NCWL 3HI6H 3EGSA 1T22A 3GSXA 4N3TA 3C5SA 5GGVH 5I17B 2IFGA 2XIBA 1OTSD 3NCBB 1CICD 2OKMA 4Y5VB 4ZMVA 1JZHA 3NCEB 4ANKA 5FUZL 4BJLA 3SKUD 2FVNA 3PWUB 4JFXB 2X5PA 2UXBO 4KV5E 1QI4A 4NERA 5JIHA 1RP3B 1IZJA 2NZIA 4NRYB 2QQLH 4CS2A 4V1DB 3AQDA 2YS8A 2X89A 1T0MA 1TZGL 2VQ4A 6TAAA 4ODWB 3HMWH 4OUUB 3WE6A 2OM5A 2HT3C 3Q44A 3SOBH 5LAXB 2R2HA 3ZHTA 1AILA 1NI8A 1JHLL 5CFHA 1I7ZA 2WP3T 4J2QA 3ZSTA 3HG1B 4ZS6C 1GXEA 2OMWA 2WXQA 1ND0A 4ZW7A 3WY3A 4XBPB 2WD0A 3H42L 2PPEA 3QIBB 4AENA 4IOIB 3WNNA 2XWTB 4AJWA 1J87A 2V0AA 1UQSA 3K4ZA 1Z1WA 1EMTL 1I1YA 2HMIC 4BFBD 1RHHB 2AK1L 3D9AL 4NHCL 4KQ4H 3MRCA 1L9NA 2W9EL 4DUYB 3HS0C 4XMPH 4FLTA 3GYRA 2TSAA 4S0HA 1D3CA 1G7JA 5AL0A 3I84A 1OPGL 2GUOA 1UYWL 1EX0A 1YNKH 1PPIA 4X9FA 4ELKB 4OZ4A 4I87A 3HNVH 1UXWA 4ONFH 3BEVB 1ZLSL 2EZ0C 2WWOA 3RJDA 35C8L 1WP6A 3ZDYF 3QPXL 4JDEA 1NCDH 3V5HB 3V5DA 1JGLL 3EGSB 5AOJA 1T22B 3GSXB 1YEFH 4G8FA 3VGAB 3C5SB 3NAAL 1CK0H 1NCNA 4JFZL 3ZMNA 2JJVA 1FO0A 2V9RA 1Z0NA 3DPBB 2BE3A 5E8NB 3E89A 4HLZG 1DTUA 4ZMYA 2CO2A 2C9QA 1LO5B 1IGCL 2E9JA 3WUWG 1YHQV 1BE3H 4I7ZB 1I7FA 1P84F 3OQRA 4J8QA 3QUYC 4PVLA 3VH8A 4BZ2L 8FABA 5IOKA 1T0MB 4R26L 2J21A 4U1KA 5K1NA 4S0SD 1VLXA 4E4EA 4PJGF 1UD3A 2GCYB 1XV8A 3SO5A 1WPBA 3PWNA 4J28A 2X4SA 4DW0A 4G43A 4TKWA 4UNUA 3KWUA 2XPGA 3WE6B 3TBYA 4P9OA 2CHDA 5AAWC 2E6JA 4PJIE 3E8VA 5IVXE 1DVUA 3S3XA 4GQZA 12E8L 5IOPA 4YHPA 1F3DJ 3LRMA 1UENA 3MCLL 3K4AA 2O5XL 3PG2A 4LVOB 3GMLB 1KD1W 4HETA 1OM3L 1BZ8A 3T0VA 2B5IB 2HLAB 4FXKC 2UXCO 3IXAA 4FEIA 1XF3A 4JFQA 4U1HB 3JYBA 1QR1A 4K9JA 4Q0XH 4ZS6D 4X64O 5K93A 1QUPA 3P4MA 3SDAA 4XVSL 3D39D 2CO4A 3H4FA 1ZE3H 2FWLB 5DYOA 3RDTA 3T1HB 4XR8C 2BVOA 4HS6A 3CFJB 1UXWB 1PZUB 1J0HA 1N59A 4AT6B 2EEBA 4R7VA 4JDEB 3V95A 5L2KE 4PR5B 3V5DB 3STLA 2X4NA 4TSAH 3S0PA 5FV2A 3FTZA 1FO0B 4AGQA 3O45A 5I8EA 4DV6O 1TJMA 2GIYA 2E5LB 2EZ0D 3RB7A 5KJRH 5DRWA 3NBNA 3PQYE 3B7UX 2IDTA 2P45B 3G04A 4NT6B 1ENVA 1S0VA 4HGWA 3T0EA 5IW3A 3D18A 3EADA 3ARTA 4N22A 1IBYA 5BXFB 1CLYL 2V7NA 3W7WA 3C90A 4PA7A 1MW2A 4GW4B 4TV8B 1HESA 2Q3ZA 2X4SB 4G43B 3TWCL 5J9PC 4QTHB 1HQRB 1J1OL 5KBNC 1CD0A 1ID5I 3TOPA 4Q9CA 1F7YA 3TT3H 2BZDA 3E8HA 3QUYD 4OJFH 3GSVA 2BSBA 4MVQA 3OLIA 3REVA 1JZ4A 1N64H 3HVNA 2Y1VA 3P2BA 5L7XH 3UAJC 4B3TO 5ABZA 4NXKA 3IXAB 3QUMB 1ZHBB 3P3RA 5LMNB 2Y1YA 2CIIA 4PV9A 2R1WB 1ZSDA 3FUEA 1M2OA 2DQJH 2FMLA 4A7TA 4GT7A 3UYOD 4LARL 5DYOB 1R34A 1IRAY 3F7VC 1PNMA 1BEXA 2JV6A 3E8UH 4HS6B 4OZFA 5AB0A 4MA3A 2DYSB 2A3QA 1YTFB 1N59B 1ZHNB 1OTUD 4G8GE 2YQ3A 3H1HH 4FD0A 3LEVL 3H7BA 1JPTL 3RAJH 1AOHA 1TU2A 5CLXA 3STLB 5KANG 3OD4A 4ZQTA 4FHJA 3TXQA 3SDXB 4U2YA 1AE6H 5FUOL 3IETB 2GQHA 3O45B 3DK2A 5I8EB 3LB6C 4PJXF 4H37A 1HAUA 2J43A 5D5PA 2K9FB 2XICA 3CQFA 1SKVA 1PVHA 1HINH 4GW5B 2B1AH 4N5UA 1YDPA 1WBXA 2YMXL 1F56A 3IGKA 2HUHA 3MU3A 3QVAA 4LBEC 3APNA 3B7RL 3WFDH 5JPNA 3OR7C 1NEPA 5CO1A 2PCPA 1MFBH 1Y67A 3EYSL 3B1TA 5GS2D 5EU6D 1NGWA 2P5ED 5CN2A 2IJ0C 3D0LA 4H20H 2QTEA 3U10A 1UUSA 1G6RH 1WC7A 4DSYA 4O2CA 3HR6A 4X80L 4KJYA 3OR6C 4A37A 3WOVA 1SRYA 2ZCKL 3HE6D 1SERA 4C56E 5HYJB 4LSRH 2N3JA 3HRZB 2FCBA 4XPTL 1K8IA 3FQWA 3OMZA 1HHJB 1PY9A 1XCQA 4U6TA 2DLTA 4FZEL 5D93B 4E41B 3VFPB 4UUJA 3L4CA 1W72B 3KM2A 2WWNA 4F27A 1AY1L 1S72V 4M7JL 2MOGA 3VD5A 4A7SA 5GHWH 1JI2A 3O9WC 2VT0A 1A8JH 1KGJA 1IUZA 1CTMA 4Y16C 1BL8A 2X44D 4B9ZA 4KX8A 1KUMA 4PU2A 3MBEA 3P30H 1D6VL 3BLBA 5SX4H 4DR2B 1DQKA 1JJUA 1SOSA 3D2UD 3Q2NA 3OAYH 3WTUA 2KMWA 2YPKA 5E1AC 3EFDH 2ITCC 4XDLA 4L9LA 3QUZA 2YZ1A 3OMNB 3OLDA 3I55V 4N68A 2I25N 5GQBA 4XC3H 2X9WA 3A4FA 2VDRB 3QW9A 3PDGA 1YC8A 1FZJA 3MRQA 1SXAA 1VQPV 1RFYA 1XNQO 3EAKA 4JPIA 3QORC 4J8RA 4DR5B 3EFOA 5DC0A 3J7AU 1MCEA 4GX0A 3QRLA 1T1ZA 1FXHA 3ECBA 4XNQB 2BY2A 1HZKA 1YEDB 5CA1A 1GRJA 1CD8A 3IU4L 4ZOLA 4WI7A 4A2MA 3KDMB 1KLGA 3HC4L 4V33A 3X17A 2H94A 5T1KD 2IWGA 2J1XA 4H8WC 5FO2A 1BQSA 1ZLUH 5HI5D 4CC4A 2ETNA 2HFEA 4HLEA 3I2CL 2BRRL 3ABTA 4U3HA 3LQZB 1U8HA 4WIQA 3CVIH 2Z91A 3LB6D 2J6EH 2XCMC 5H37H 4KHPB 2MOVA 1WC7B 4Q4IA 2BOCC 3LEXA 4KDTA 3MCYA 4O2CB 1SN5A 4KJYB 4JDZA 4KUMA 3CN2A 1WIUA 4HGKC 2EO9A 4Z7VB 3ZT7A 4FPPA 2Q1EA 3B9DA 4I88A 2UY6B 1MJUL 3V5KB 4U1JB 1JVKA 2BHFA 4LF5B 1N5AA 2YPLD 4GT0A 4JFFD 4UUJB 3CXHK 3WEOA 3EF4A 3LIZL 1JGUH 4OFYD 5DD1H 4D7TA 4FNSA 4G71B 2YR3A 4U49A 4L3CB 4UQAA 3RGHA 4Z6AT 4GAGH 1EERB 4KXDA 5BQ7A 4HGMA 2QM8A 4LQFL 2MKLC 3MBEB 1GGCL 2ITFA 5HDWA 2AI0H 2XUMA 2ORBL 1XSKA 1MRFH 1OD7A 1ETZB 1E4XI 4XNXH 2XQBL 4BW5A 3VMPA 2UZYA 1HCVA 3DXRB 2GT9A 5K59E 4TNGA 1A1OB 3CZLA 4ZMLA 3Q8BA 4H0IA 1RUPL 3O9WD 4Y16D 4Q9BA 3VFSB 1FC1A 2HB0A 4JPIB 4J8RB 5BRZD 3MPCA 3PLYA 3P40A 1LQSR 3AQYA 3US1A 2LU7A 2ZM6O 2L04A 5DJ8A 2X4OA 1MRCL 1YQVL 3I50L 4AQAB 4JLRA 5JQIB 1XUQA 4GXVL 3NCWA 2WINA 4JI7O 4LOEA 4XCCH 4DVRL 2FLRT 4M3HA 1J9SA 1YEJH 4XPHH 1NUGA 2VDKL 2QKCA 1D7DA 5AL8A 5AW3B 3APQA 5KYUA 1QHTA 2WY3B 5JA8B 4QRRA 1D5NA 4UQIM 4CKQA 1LO0L 3CCEV 4F1ZA 5TK4A 4JYAB 3SD5A 1QW8A 1QFWI 4YY3B 2JIXA 3QXWA 3QVNA 1ZVSB 2X2YA 3R4RA 4DR4B 1WGVA 1A5FL 1UH4A 5HJ3B 5BZBA 3KYKH 4L4VD 2B7DT 3CCJV 1AXTH 5DJ0A 5L4FA 4JQIL 1N5AB 2APTA 1T4KB 4NQCD 5ITBL 2BZ7A 2PWEA 1Q94B 4GRMA 3FN0H 3FRPG 5E6IC 2XN9B 2BVTA 4JO3H 2QKIC 2E56A 5I8CA 3BSZH 1QLEB 5D7EA 1V54B 5EBMC 4CADB 4MNQB 3CPUA 3UAEA 5ICXA 3AY4C 4KI5E 1QZ1A 3F62A 1LEIB 1GN6A 5IB3B 5C0CB 2UZYB 2XY2A 1RZGB 2AK4B 1RPKA 3LSSA 4DV1B 4UF7C 3MR9B 4G6MH 1UKTA 5GIRA 2E7MA 1X4TA 1BQHA 1M2VA 2B3IA 1RK7A 1RVFH 2XSKA 1NUFA 2V3EA 4L48A 1KCVL 1OP3H 1NR7A 4JHWL 1EXHA 4KJPD 4BKLB 3L7EB 1PZBA 4ZNCD 2BNUA 1QLFA 5DJ8B 2X4OB 3A0OA 4ZPVB 4ZUSB 3UTSD 4TV9A 1F18A 1YEGH 4FDWA 4P5TA 3RLSA 4L8BA 3A6OA 3UBXG 1P84J 1QHOA 1SF9A 4HXAL 3T4DA 5AVYB 1IAKB 3EYFA 4UILL 5KYUB 5LOVA 3FCTA 5AG2A 3FQNB 3UGUA 3F64A 2EXYC 3N9GL 1KB5L 4TTGA 2E7BA 4RQQB 3TPUA 1OD9A 1ICTA 2QZ5A 3B2VL 5MI0C 1I3RA 3CBJB 1AFVH 1GS7A 1S6NA 1VQMV 5B1AB 2FATL 1JWUA 4M5ZL 3QZNA 3BAEL 2ITDA 3OAZK 4OZHA 1NTMH 5DJ0B 5L8KB 5MENE 2NY4B 3WNIA 4I0PC 3CXHF 4PLNC 4GRMB 4HUWA 5L2JB 5B39G 1DUYA 2HRHA 4N20A 2P5WD 2UWEA 4Z7OB 3CRQA 1HKFA 5E8OA 3FB6C 2N56A 1RPRA 2W60B 3TO4A 3X14B 1D5IL 1KJ2B 2C3VA 4X4MA 1AROP 5IYZA 1CB4A 4FQCL 4K3HA 3S36H 2QHRL 5C07B 2V5SA 4X6BB 1LTXA 3IMUA 4ZOEA 3AXIA 3ESVF 5E6ID 5IQLA 5GRVK 5J5EA 1RJYA 1UZ8A 3A6CH 5F3BA 3SEPA 5HHQB 4OM0L 3V7MA 3SKNA 1UWYA 2ZQMA 2EDHA 3G4SV 2DLGA 3OHXA 3SQOH 4FADA 4JJ5A 5DMKA 3PS6A 4F7MA 5I1KH 4MDJB 5KVMC 2GTAA 2B14A 1M42A 4FLOA 5JHBA 1IC4L 2Z8VC 1JGDB 4NZTH 4BFRA 1HOCB 2VNCA 4QRAA 3P73A 5FIEA 1ZLVK 4F9LA 1V27A 1QVOA 5FYLL 3UPRB 4OGZA 5AW7B 1NGXA 4OB5L 3EYFB 1G1KA 3FCTB 3DJTA 3V10A 4H44C 2DYPB 1H5BC 1E79G 3HZKB 4PA9A 3NCYP 4IRSA 3PIQB 3TJHD 4ZDHA 2X6CA 4WU7B 3TVMB 4EUPG 1D5MA 3TPUB 3GGWA 1UATA 3ILDA 3Q9PA 4LFHG 3ZYIA 3OAUH 4XO5A 1FYJA 2VDPH 3W7SA 3L3JB 4MQXC 1HHKA 1IEHA 5B8CB 4OZHB 1XHHA 3NA9H 1VF5B 3GPSA 2CCLA 2EXYD 2CK2A 2DAVA 3VD1A 3FFCE 1HNZO 2YRBA 2E5EA 2BO0A 5IT2L 1CQYA 4CH6A 4U7MA 3JAWA 2D2OA 1SA0A 4FC3E 3CFDA 4EOWL 3JALA 2C3VB 1V7NH 1N0LA 1NEZB 1S5JA 2MFNA 1I9RH 3IBOA 4GRLC 5D7SH 5D9SA 4I0PD 3V6OA 3K3WA 5KMGA 4EDXA 1NOAA 3AS2A 3KEDA 3PWLA 4QHNB 4PJHE 1KXTA 2P47B 3NQIA 3LNMB 1UZ8B 3SKOA 3IC9A 1AVMA 3SDLA 1MW1A 1WCQA 3FFOA 2B9AA 4R2GB 4UQDA 4TVPL 4U1GB 5GS0C 4MWFA 4LSUL 4JMXA 4XNAA 4F7MB 3ULVE 4LDEB 2Y1AA 1NBYA 4X65O 4UCUA 1O6SB 2A5UA 2WKGA 3O9OA 4LCCA 4ZAKA 2ZE5A 3G5ZA 1QVOB 3SDCB 3U2JA 3VFGL 5CN0A 1NAKH 1UH3A 4DUWA 5ICYB 1FFNB 3GJFB 1SOQA 2DWTA 4XODA 5KYXA 5HDQL 4GAJL 4LCWA 3MLXH 3SJVE 4FA7B 4ZDHB 3CMEV 4JO4L 2E7DA 1D5MB 3LQAH 4HIJB 4R7DA 1ZANH 2ZYSA 2L0DA 1MOEA 3WJMA 1ROPA 4M1DL 5JJEB 3SE8L 5DC9B 3S36X 3RWIB 3SJCC 3DX4A 5I5IA 4B9KC 4GG6E 1BIIB 2EILB 2FLBT 4FFWC 3L3IA 4M48L 4MXWL 5D71L 4WO0A 2E3CA 1Q6IA 2LGNA 3WXVL 5HGHA 2W0KA 3KG2A 1URLA 1OGSA 3JAWB 3VFVB 1SA0B 2V7HB 2IGFL 3QJXA 2JCCE 4PSRA 4YJZL 3JALB 1TEGA 2C9PA 1P69B 1PG7H 3VSTA 2C4XA 4EDXB 1JK8B 2YUWA 3PWLB 3PGDA 2PWGA 5E08L 3MLUH 1OV9A 4HCRA 3RVXD 3EOAB 4UQ9A 4FFZH 4OKVB 4X20A 2PKDA 1E4HA 3D4YA 3JWNG 3VMNA 1D9KC 1T66C 5ANHA 4KC3B 5I2IB 2VQ1B 3ZDYB 3CBRA 2FIRT 5D1QE 3TIEB 1YMMB 3KPMB 4G8IA 4XXWA 5DGRA 5DVOA 3BDYH 2CKBA 4RRPM 1WZMA 4J80A 3CWGA 1RIVL 3PGFL 4ZAKB 2HJDA 2MEJB 3BWSA 4LCUC 1E5UI 1NAML 4NYKA 3WN5C 1HHHB 4MZ3A 3J80N 5GS0D 3ESMA 2F4VO 5FM4A 1BLIA 5DK0A 2P5OA 5BR8O 3LMJH 3A6BL 5C6WH 1EEUA 4HH9A 4IJ3B 4BRVA 1OK8A 2OQJA 3UTTE 4GLRH 4ODSL 3RNKA 4DTGL 4E9TA 5EF2A 2C9XA 4G7YH 4PJGB 5ITZA 3T8XA 3WD5L 5EZJB 3TFKC 1R0AH 2RGSA 3JD1A 1WISA 4KMTL 5FLUA 2DTSA 3WJMB 2HZHA 4HBCH 3VXSA 5C86A 1DBJH 4GFTB 2QADB 4LLDA 5SWZE 4AVKA 3HR5B 4LVNC 2IQ9H 4O4LA 1HQ4A 3IJHA 3ZE1F 2WLZA 4F8NA 5I1GL 4CN1A 2IBGA 3UTOA 3LSOA 3QQ4A 4U0RC 2ZONA 3WG7B 4G7RB 1RL1A 3JWDH 4MA7L 4NWTH 5HGHB 3NJHA 1WFOA 4IGBB 3LVTA 3OX8A 5IFAL 3AG7A 3ZDZB 4ZFQA 2GI0A 4W4LA 1PZ2A 2J1ZA 3TYGL 4GMTL 1T5KA 2GTWB 2MTPA 1VEMA 4JY4B 5HHNA 4FFWD 1UWEH 2H41A 4DR7O 4Y9CA 1UURA 4BFNA 1NINA 4GEIA 2V8LA 4MVSA 5DDHA 2FNBA 4O02A 3WCYA 3THOA 5DS2A 1NPJA 3OKOB 5LYJB 2AJUL 1KLFB 3NXSA 5EHFA 3RTQD 3QEQE 1E27A 2CQVA 3L3KA 4HDIB 4DO5A 2WSKA 1S9YA 3K0GA 1ZWIA 1EVTC 1SJVA 1OAXH 3V0AC 5JIPA 4B9JA 1BSMA 4K35A 4JQXA 4DOHE 3MLPA 4WKZA 2CKBB 4N2CA 4YFLF 5A2CA 5J11C 1MIEH 3IFNL 3UZVA 3U4AA 4JL2A 4BV1A 5HVWA 5JQ6L 2BRQA 3OAAG 1BFOA 1SJEA 1EJ8A 4RFOH 5D5MF 3V6OC 1NANI 2AZUA 2H4EA 1H3WM 1IM9A 1Q0YH 1JTTA 2JB5L 3K5LA 4OY9A 4QCIA 5DK0B 2JJWA 2FZ3B 5KOMC