2Y69B

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2y69B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y69B02
3NSDA 3OMNB 5A7EA 1QLEB 1L9TA 2DWTA 2QDVA 1E65A 2EILB 2CALA 1JZJA 4YSUA 1JERA 2IWFA 3T71A 1OV8A 1E5YA 4E9YA 4F2FA 4AKOA 1J5CA 4E9QA 4F7KA 1V10A 1A8ZA 2J55A 1NIEA 2W8CA 3EH3B 3IN2A 1V55B 1F56A 1SJMA 1WA2X 2BHFA 4DP1X 3T6ZA 1OCOB 1GS7A 1NICA 1VLXA 4TXVB 1OE3A 1WA0X 4DP8X 3EF4A 1L9PA 2IDUA 4W1TA 4HHWA 4M4RB 3QJSB 2AANA 3T9WA 2HX9A 2NRDA 2QPDB 1SF3A 2XXFA 1PY0A 3CVBA 1V54B 1KBVA 3NP4A 4KO6A 1IBYA 1JXFA 1AZBA 2AFNA 5I5JA 3TBBA 2YAOA 4BWUA 4HALA 3NJHA 2J57A 4M3HA 2HRGA 3T6VA 1TU2A 2PPAA 1WS7A 1URIA 2FQGA 2ZWNA 1NIAA 2EIKB 4HCFA 3IEAA 4Q89A 1JVOA 1PZBA 3ERXA 2PCYA 1DZ0A 2PP7A 4P5RA 1RZPA 4K9JA 2QPEB 5TK4A 1PZCA 1E5ZA 3L45A 1A3ZA 1JXDA 1IUZA 2XYBA 4GY4A 5I6PA 2DY2A 2YAQA 4FA7B 3GXUB 4FAAB 2FT7A 2IDQA 2GBAA 3NSFA 1RZQA 4KO9A 4YVUA 1AG6A 5I5IA 1MDAA 1AZRA 3NJGA 3UADA 2BO0A 4YSOA 3NP3A 2PPCA 5FC9A 3TBCA 1BQ5A 4F2EA 2IWEA 2XXGA 1CURA 3BVDB 3FSAA 4GP5B 3V9EA 1W8EA 2J56A 3PLYA 4KNUA 3WI9A 3FQYA 4A68A 3ASNB 1CYWA 1CYXA 3OQRA 4DP4X 2Q5BA 7PCYA 3SBQA 2PCFA 3UAEA 1NWOA 5F7AA 5IY5B 1HFUA 1NPJA 1OCRB 5B7MA 3GDCA 4DP7X 2DV6A 3QJQB 1IC0A 2ZONA 5B1BB 3EH4B 2Q9OA 4E9XA 1OCCB 2YEVB 3MX0B 6PCYA 2JFCA 3FYIB 1BXVA 2YAPA 1ZDSA 4DPAX 2HRHA 5B1AB 3DIVA 1BXAA 4YSEA 1BQRA 1RKRA 1MG2C 3ZIYA 2YAMA 3QPKA 5I6KA 1JZHA 2VSMB 1B3IA 2VN3A 3CVDA 3FPXA 2XV3A 1QHQA 1R1CA 1W6WA 1TKWA 1RCYA 1GYCA 2JXMA 3ABGA 4N8UA 1XB3A 2EIJB 2CJ3A 1L9QA 1MZZA 1A4BA 2I85A 1IBZA 2GC4C 3ABLB 3V9CA 3WNJA 1KDJA 2A3TA 3WKQA 2Y69B 4UANA 2FT8A 4X4KA 1WS8A 3NJKA 4DP2X 2VSKB 2PPFA 2FTAA 1MZYA 2W88A 1ASOA 5I26A 4YSCA 2BW5A 3NJJA 3FQ1A 4G72B 2PPEA 1GS6X 2GHZA 2PLTA 2R7EA 2I7SA 3OMIB 2GSMB 1IKOP 1KBWA 1PLBA 1AZNA 1BYOA 3DKHA 5AKRA 1E30A 4GYBA 2DYRB 1AIZA 2GB2A 2XUWA 1WA1X 2OV0A 2UX7A 2ZOOA 1JZIA 1ASQA 3PXLA 4MFHA 4G70B 2CUAA 3NT0A 2B3IA 2WSDA 3ABMB 3CG8A 1JZGA 4G71B 2XU9A 2RACA 5I6NA 1GSKA 4BDVB 3HEIB 4BDVA 2JKWA 3AY2A 4HAKA 5I5MA 2XV0A 4YSTA 1AOZA 2MTAA 1OE2A 3RYMA 1OE1A 1J9RA 2AZAA 1HAUA 3PAZA 2QT6A 2P80D 2UXTA 4KOCA 1A4CA 3UACA 2BW4A 4YSDA 4HHGA 2VW4A 5I6MA 3FSVA 3FSZA 4L0PB 4G7SB 4CSZA 5I28A 2IAAC 3FU9A 2ZXWB 3ABKB 4Q8BA 1NZRA 3PAUA 4YVNA 2BZ7A 4YSAA 1PF3A 2AVFA 1ET5A 2VW7A 4NB7A 3H4FA 3EH5B 2FWLB 2VMJA 4DP9X 2B08A 2FT6A 2LLNA 4A2EA 3FS9A 3CDZB 3CDZA 1PCSA 3S8FB 1PLCA 3CZUB 3WNIA 1MG3C 2XX1A 2DWSA 3FQ2A 3AG3B 3AZUA 2X88A 2YAHA 2EIMB 3G5WA 3TU6A 1AZCA 3QJRB 2GIMA 3S3BB 1TEGA 2EINB 1EHKB 2CAKA 4BK5C 3N55A 1J9TA 4GXFA 3QJVB 3H4HA 4A66A 3UAAA 3FPYA 4WKXA 5AZUA 1I53A 3OM3B 3CVCA 1ASPA 1FFTB 1JZEA 2FQEA 3WIAA 9PCYA 3AG4B 4BWWA 1A65A 4GP4B 2YAFA 1N68A 4NAJA 1J9QA 2YQBA 5I6OA 3QJUB 2IWKA 4JHVA 4DPBX 4YSSA 2CBPA 1ET8A 4E9WA 4A2GA 1M56B 1YLBB 1BAWA 1L9RA 4QKTA 1AR1B 3NJNA 1ET7A 1JVLA 3EHBB 1AG0A 4E9VA 4E9RA 4HIPA 1SHXA 1ZPUA 5PCYA 4A2FA 4AKPA 3ZDWA 5B7FA 1KCWA 1CC3A 1ILSA 2YXVA 2GI0A 4QLWA 1J5DA 1XB8A 4JKNA 4N4YB 2TSAA 2BZCA 3FU7B 2VM4A 3FU7A 2UXVA 1JZFA 3FSWA 2I7OA 4AKQA 1GR7A 1PLAA 5B1JC 4HCGA 2H5UA 1M9WA 3HB3B 3S3DB 4BXVA 4YSPA 1PNCA 3TASA 3TA4D 4DP0X 5E9NA 2H3XC 2TSBA 3X2QB 2BP8B 2BP8A 2FJSA 4GP8B 2YARA 2R7EB 3QJTB 3JT2A 4YSQA 1A4AA 1ADWA 3T6WA 1PMYA 2BP0B 2VM3A 1NINA 2BP0A 3NSCA 2GC7C 4YL4A 2XX0A 1GY2A 4A2DA 1ZIAA 3AG1B 4KOBA 4G7QB 3NJIA 1BXUA 5B3SB 1OF0A 3SBRA 1AS8A 5D4JA 3ASOB 3NJLA 3QQXA 5D4HA 4PAZA 2UXGA 5EHFA 1NIFA 2IDFA 3BQVA 4HZ1A 4DP6X 1PAZA 1J9SA 2IDTA 2FQFA 3UABA 3DTUB 1X9RA 3AG2B 2XWZA 1AZUA 1ZDQA 1OCZB 3FT0A 4AI7A 4WTQA 1GW0A 1NIDA 3C75A 2VW6A 3JTBA 1JOIA 5F7BA 3X1GA 1AS7A 2MRYA 2Y1AA 2HZHA 2PPDA 2HLEB 4ZK8A 1ZV2A 4W9ZA 1NDTA 1CUOA 2HXAA 2WO2B 3NJFA 3PAVA 3ZBMA 3KW8A 3GYRA 1ILUA 1SFHA 3MBWB 4BWTA 4E9TA 1AQ8A 3FU8A 1FWXA 1ID2A 4NERA 2IH8A 1SDDB 3WKPA 1SDDA 2QDWA 4ENZA 4AZUA 2PP9A 1KYAA 3S3CB 6PAZA 3NJMA 3SBPA 1M57B 1QNIA 4DPCX 5LDUA 3X1BA 2AZUA 5I6LA 2P80A 3PPSA 5AFAA 3IE9A 2XV2A 3PCYA 1L9SA 1X9UA 2PP8A 1BYPA 8PAZA 1N70A 4AX3A 1KCBA 1T5KA 5TK2A 1OOWA 4UAHA 1GS8A 4DP5X 1TEFA 1SNRA 2X87A 4RH4A 5ANHA 4EF3A 1XMEB 3AW5A 1SHWA 2UXFA 1E67A 1WAEA 2CCWA 2H47C 2DYSB 3NYKA 2HX7A 1FA4A 2WO3B 4UF7C 3ZX1A 2BWDA 2FQDA 1AS6A 3OD3A 3IN0A 2J5WA 3WG7B 4E9SA 1ETJA 1NIBA 1BQKA 1GY1A 3X1EA 1JXGA 1AAJA 2FNWA 1PZAA 5B7EA 3T6XA 4KO7A 4JHUA 3FYEB 1AANA 2IDSA 3D12B 1SFDA 2HX8A 4P5SA 7PAZA 2E86A 1W6LA 4KNSA 5B1KA 5D4IA 3N2JA 4CSPA 1NTDA 2OJ1A 3NSYA 2XLLA 3IBOA 4KO5A 1NPNA 2XVBA 2BWIA 1BEXA 1DYZA 5B1JA 4A67A 3H56A 4YSRA 1EZLA 4KNTA 1PNDA 3S8GB 4HCIA 1KV7A 3UGEA 5PAZA 4BXSV 1KGYE 1L9OA 1UATA 1ZIBA 3OMAB 4PCYA 3KW7A 1SF5A 2YXWA 4A2HA 2UX6A 3U25A 1XB6A 1NWPA 3X1FA 3X1NA 1AACA 3SQRA 2IH9A 2YAEA 4G7RB 1HAWA 1KDIA 2N0MA 2OCCB
chains in the Genus database with same CATH superfamily
5F8RC 4F24A 3FQUB 3L4XA 4TUJA 4Z77B 2DQUL 2NTSP 3VFWA 1E65A 1ZVYA 4WO4D 1K5NB 1MI5D 3UDWC 4KL1A 3ZTJH 4YBLB 4LHUD 1E28A 4U1IB 3MV7A 3QZMA 3RQ3A 4NKOB 4GQ9H 4OB5H 2FHBA 3EH3B 1NBZA 5JPNA 4DW0A 5I30L 4HZLB 1HQRA 2A83B 3O3AA 4YDLC 3AY4C 1SJMA 2ADGA 1FJ1B 1T22B 5T1DL 1VLXA 2HFEB 4ODSL 2CBQA 3MOQA 3C9NA 4HW6A 3WU1A 1GHFH 1DP0A 1A5FH 2E56A 1K7DA 4L3EE 4HIHB 3C60C 4R2GC 1YEHL 3T08A 2XT9A 1YY9D 2IAMD 3OF6D 4HFWB 1A7OL 4Z9KB 4FLWA 3MPCA 3MREB 4HK0B 2EDNA 2QPDB 4J8RA 3CC5B 3D51A 1V54B 4PG9A 1RIUL 3J2PA 2ZCKH 3GWJA 1F4YH 3N2GA 2ZR3A 3QIWA 3U30B 3O3BB 3C2AL 4XBPA 4NVPA 2CNZA 2MQGA 3MLZL 3FTVA 4RMTA 3CHXA 4MAUL 2BIMA 2D4DA 5TE4L 1TU2A 4LSSH 3QNEA 3GMNB 4PP2A 2EKSB 3QORD 3AWEA 1MN4A 1WS7A 2CDFB 4HBCH 5E56A 3FO9A 2IJJA 1GSMA 4H20L 2EC8A 2NY3B 3ZHUA 3IJHA 3IGFA 5BJTB 2F8XC 4KDVA 2IGTA 1ULVA 4PB9L 4XX1G 4LZKA 4A7GF 4OCLC 1F4AA 2FGWL 1WIPA 1PL0A 1VDGA 5LAXB 5IW3A 3ZN0A 2HFGH 4PVNA 4JI0O 5GGSA 1QOKA 3QXTA 5TDNB 3OB8A 2VLJB 4JO1H 5I17A 1XILA 3EHBD 4MNQD 3UERA 4ZIBA 1IQDB 1JNLH 3BT2H 1VCBC 3L6FA 2DWDB 3K6NA 4DXWA 1MDAA 4U1SB 3D9AL 2VO8A 1KJ2L 5DHVB 4OXSA 3T1YB 3DX4A 2GJPA 3CX2A 2Z93A 2VDQH 1AO7A 3L3OB 4JDVB 4HD9A 2OW7A 1AGDA 1YEEH 3R19A 5EORL 2BHUA 4KROB 3P54A 3CRMA 5CXPA 2F68X 5I8CA 1G7LB 3DJTA 3VXUB 5DRWB 5F9DC 4FLXA 1S7QB 1YG9A 3FQYA 4ZMTA 3SO3B 4GIAA 5D7LB 1XL4A 1JYVA 2RH0A 2F93B 4KKPA 4DFIA 4CDHA 1DVQA 3KPSA 4UI2A 4IIJB 1J8SA 1N26A 3KJ6H 1QBAA 4X5WB 4NI3A 4JY6A 3DETD 5TE7H 4DV0O 1JGDB 3CZEA 1TVKA 1NGXB 2YK1H 1VKXA 4CS4A 3I02B 2W92A 2YQ2A 2P44B 4BZ1A 5KA6A 2QJ1A 5GONB 4Q6YA 1FVEA 3FTXA 3OX8A 1U8OB 3K1KC 1OCCB 5EIVA 5IB5B 2VLRE 2JFCA 2IU0A 2WUCH 1KXVC 4EI5A 3DIVA 1S5HC 2NX5E 1SYVB 3FAWA 4EN3C 1N8OE 4WW1A 4ZT1A 2ITDC 3FH8A 1OARL 2R8SL 5KYNA 5DYOA 3LZOA 4K5LA 1PG7W 2J2ZB 4H37A 1FNGA 1FNEA 4PSRA 1SHMA 5KG9A 1I0HA 2QQNL 1E7VA 5CMAA 2R0WL 4FULA 3OE7G 2BPBA 4LMQI 1N34B 2K3TA 1FVDB 2FK9A 2VDOH 1JF5A 2YZ8A 4GSDH 5LBSH 3F5WC 3QAZB 3HUJF 3HVDA 4LGPB 2FD6H 4NRYB 3IMWA 4O2AA 3QZNA 3IGAA 2WWKT 2WLMA 1IX2A 3MRMA 4DKFL 3Q8BA 1MFBL 2FTAA 1MZYA 1PM9A 1G9MC 3P3TA 4JDZA 4MD5B 5KVMC 3GGWA 3V55A 1GS6X 2QVTA 3L75H 1UJTA 4QRBA 3CFMA 2ZP0T 3LRLA 2UXCB 3C8KA 4MTMA 3E0GA 5MI0C 3S5LB 3T8XB 4LQ1A 4JJ5B 3AACA 3ARGC 2EZOA 2UXBB 4GKZB 2GG1A 2FSDA 4BZ1H 1QSEB 1MCDA 4YDLB 3FB6C 5EO0B 5JH7A 2AJUH 1FBIH 3TH2T 2XNAA 2QLYA 2R56L 1HXMA 2LVEA 2WB1A 1F4HA 4DV6O 3EYSL 4LAQL 2EABA 2R1XA 5E2UL 1GSKA 2HG5C 2C4FT 2JKWA 4FDWA 4HIEA 4YE0A 3C60B 4R2GB 5J6HB 1OE1A 3BYYA 4M7KL 1HH9B 3KGRA 4M5ZH 5JR1H 4N21A 2JI3A 1UTDA 3PAZA 2QMJA 4WDIA 3R06A 1PX4A 3TPUB 3RZCB 2C9XA 4OR1A 2WMPA 1KQSU 1BAFL 5C2BH 5CZVH 5T3XH 4L0PB 3O6FA 4UT9A 2P5OA 2BP3A 3ZHFA 3BP7B 2OSLA 4MMZC 5F9JA 4DV4B 5IB1A 1NAKH 4QMEA 3IFNH 3DUSB 2BZ7A 3V0IA 3ROLB 5CZXC 1RXLA 1P7KB 3VXSB 2VCOA 3OLIA 4XNDA 3GZPA 3TO2B 3BMWA 2O5ZL 1KLGA 3L9BA 3U9UA 2XASA 2PR4H 3NTCL 1WQVT 1PCSA 3ZGIA 1E4JA 3I75B 1Y74B 4FNQA 5AVTB 5I0ZA 2FIKB 1H2SB 4JM2F 3HZKB 4MRCA 3QG6A 4PY8I 5AYTA 1M53A 1NBQA 1XF3B 3WFDH 3WLBA 4RWHA 4ZAKD 2NY2C 2BSSB 3MHZA 3TYFB 5C09D 2LGNA 2M26A 2GIMA 3BKJH 4G42A 1JFFA 1XD1A 1TEGA 4TQFA 1CQKA 4XVOA 2BDNH 3N55A 2ZKOA 3DNKA 4HIJB 4RRPA 2A74A 3H4HA 2G30A 3PNWB 4GKOA 2DIEA 5AZUA 4Z8FL 3VQVA 4IOIB 1EZVH 4XPBH 1YQVH 2NYZA 1FFTB 2EDEA 4JFXA 1QLEL 4OQTA 1R5IA 2BY1A 1A65A 4RDQG 5BV7H 5KVFE 3VM5A 3LKNA 5DEJA 3MZTA 2VRAA 4J4PC 3OPZH 5AG2A 4RBPH 4EEQA 5I75C 5E5UB 3UO8B 5KUKA 2ESVE 1MFDH 3LV3A 4JHZA 4J1UA 2UUBB 1OTUD 1LR1A 1S5JA 1A7PL 1KTLB 1YLBB 3OXSA 4HIIB 4YHIA 3CFDB 5LGHH 4U4BA 3MLRL 4QRRB 3L7EA 3TJEL 1WJZA 4M6MH 4GO9A 3W9DA 1UKSA 1Q0XL 5DSCB 3OZ9H 5GZOD 1S5HB 3KS0H 1ILSA 3K0WA 1D7FA 4XP4L 4EN3B 5DHXB 4NM4H 2ITDB 4DO4A 1MF2L 1QP1A 4RDBA 2EIBA 2Z8RA 3RRQA 3P3NA 1V3MA 3L4TA 2XAQA 5IY5C 2F7IA 3LXUX 4X83A 1OAXL 3FUJA 1SJXA 4N2EA 3V4VL 1MLBA 1A2YB 4TULL 4ZW7A 5H5NA 1WH0A 1IBKO 3ZHQA 2PO6C 2X4UA 3JWDC 3F5WB 3MRBA 1EAQA 4N6RB 3VVVA 4I3RL 4CKQA 5KSAC 1S5LZ 5EULV 3TPKA 1HL5A 3VWKA 3PFQA 5LP6C 3II2A 4KZEH 3EG9A 4M8RA 4I9WE 1HNYA 4F3FB 3AC0A 4XMXA 5HGBA 1MHPL 3EJZD 5MI0B 1A4AA 2YD2A 4PA3A 1PMYA 3IDIB 4JFDE 3T6WA 5C70A 4FFWD 1QQCA 43C9A 1IVTA 3BZFA 1MFVA 4LCWA 2GC7C 3BVXA 4KJYA 4DGUA 1X3DA 2ZSVB 1DVFB 2OWOA 1W59A 3CSFA 3FB6B 4G7QB 4DUWA 4LVEA 5LNGA 1HZLA 2EYTB 1JPTL 2NQDA 3CSYB 4MXQD 4Z3EA 1AR2A 1X7TA 3OHXC 2A99A 3K3QA 5IWAB 2DMBA 2HG5B 3WKMH 5DMYA 2AXTZ 3A23A 4XO9A 3MJ9H 3UABA 4FMFA 4G2KA 1T0PB 1P84K 1WZKA 1PQZA 3RWFA 2QDOA 4GBXC 5I8KH 4V2BA 3OLDA 2KS0A 5A16A 4MMXC 3UTTD 4UM9A 3RDJA 4P2RD 1AHWA 2DQFB 1UD3A 4KK8D 3BSZA 4IS6A 4UOW0 5K33A 3B37A 4I0PA 5CN2A 4D7SA 2NXYC 1OAJA 4BSWB 4MMZB 2QZ5A 1BJ1J 4UV4H 3T04D 3FQXB 4QWWD 2HR3A 1P1ZB 2HXAA 3GMQB 3CMEV 4DGIH 3D4CA 3ZBMA 25C8H 3SCMA 5IB2A 4MHHG 3Q2WA 3PS6A 5TPWL 1G6RA 3SKJH 2G75B 2NW3A 2CH7B 4QT5A 4S1RL 3UJJL 5I1IL 3GKWH 1IL1A 4XXWA 2ZTBA 1XDCA 3B4NA 1H2NA 4M1GL 1FCCA 5KHGA 4UOQA 3QEQA 3U4AA 3DO3A 4JGUA 1DUYB 1F3JB 3A3YB 3QQ3B 4F80A 2XA8H 3U82B 3LSSA 5C93A 2G9HA 3LOWA 2NY2B 4TSBH 1RI8A 3UFIA 2BOLA 1QFHA 4XOEA 4Y8DC 3EO9H 2YPLB 3QBTB 3DX3A 4OF3A 4BE5A 4QOKD 3GXNA 1KGJA 1R3HA 3GHEL 4GH7B 1X9UA 3QFJA 4NS0A 4HZ3A 2BSTB 4ZMQA 5JQ6H 1NCAL 3JUYA 3FKSG 1MH5B 4MJ6B 5TK2A 1XSJA 1VSCA 2V5SA 1KLFA 1R6KA 4HETA 4YXHH 4LWSA 3HI1B 4APQC 5MEPB 1GIGL 4JCLA 3CQPA 3OKMA 4IGBD 1E67A 3QJHB 1FRGL 3KXFD 1NCUA 4ZPVA 3N91A 3ARBD 4NC1E 5CWSB 5TH2A 4XZUA 3SJVA 4XMPH 5IG7B 4J9YB 5I75B 4JFFB 5I1HH 5JOPE 3ZX1A 1HL9A 4GKSA 3ZHNA 4XCNA 4X6EA 1QZNA 4Y5YB 4M6NL 2IVFC 1G6RH 5AUMA 5BQDA 5FGSA 2I9LA 3EVKA 5D1QD 4HULB 2J5WA 2LJ2A 1JMZA 4LBEC 5F97E 4UAOC 4Y4FD 3UYPB 3GMMA 3KCXA 1KEML 2H2PC 3LRMA 3L54A 3CXDL 3O6LL 4I1RA 4GRLC 3GK8H 4KJPD 1J0JA 4U31A 2UXDO 3OJMB 1A7NH 4UXNA 1S3RA 1DUZB 2FNWA 4V1DD 4L23A 3T6XA 1AANA 3VWJD 2K9UA 5F7FA 3CFBA 2CHNA 3GB7C 1AQHA 1WP7A 4PP1D 2J88H 3ARFC 3QRBA 3RUGE 3O9WD 5ACMA 1NTDA 1Z9SB 4N23A 4CSPA 1E1RG 4Q6KA 4U6HA 5LGYA 3GS4A 3HI6L 4A67A 4WU5B 1U41A 1VQLV 1EO8L 2PO6B 3CHPA 3E8HA 4YSRA 3UG3A 1SZTA 3GFUA 3LYRA 4NQCA 4BGDA 4LP4A 4FQQA 1JPGA 3GPEA 4KVNL 4UVBA 3HE6D 3UAJD 3UGEA 1R19A 4G7YL 4BXSV 4I48B 4NXKA 2CKBB 5LP6B 1HQ4B 1HWWA 2BC4B 2IADA 3FB7A 3K9SA 3PHAA 4PD4K 4X8JA 5E8PB 1W0JG 4PPTA 4ZW6A 1Q9OB 1NEZG 2H6OA 1E8XA 2VC2H 2W07A 5ISZE 2ZPKL 1PYWB 1U3YA 1F90H 3B2EE 2UVFA 2EXYD 3ULVE 3H1KH 1SF5A 2XKNA 2JIXA 2YGQA 4HPYH 4OFVA 3WXWL 3FCGA 4AI8A 1OCWL 3CFUA 4UOW1 3U25A 3MNDA 1HR0B 4JV5B 1YJDL 2I5YH 4DV3B 2DQ0A 2Z0AA 3FQRA 1NFDA 4PJFA 3OHXB 3KPMB 2OAAA 2EULA 1YEJH 3SJBC 3NSDA 1HHGA 5DJ0A 5L4FA 3BEVB 4YZFF 1BIIB 5BRZB 4GW1B 1ACCA 2WBJA 1D6VH 3ILDA 1DQLH 2RR3A 4YDJB 4Z7UB 3WGUB 4GBXB 5LA6B 2F4VB 4FXGC 1NC4D 3EZJB 1IJNA 5HJ3B 1NBYB 5GRUH 4CH4A 4MMXB 1JUFA 2CJUH 4X2UA 3V0EA 3K1DA 3ZL1A 5T3XE 4Q9RL 4HJEA 4BV1A 1XREA 1GS7A 3SQOH 2NXYB 3B8MA 4MB1A 4LPVA 4AIOA 2BTQB 1R1BA 2CRZA 3O2DL 1ADQH 1K6QL 4DETA 2VDRH 1J8HB 4FNLL 4G9FB 3P9WB 3DXAB 1P7QD 5I71C 1T0NB 4N0YL 5LL6Y 5EU5A 2XBDA 1Q4NX 4EBQH 5JIPA 1A6VH 5F7KC 2R0LH 2XXFA 1LE9B 5IJKA 5F7EL 1I3VA 4TV8B 3PQYD 1RUML 1RZGA 4YDKH 2X9ZA 3ILQD 4HT1L 4ODXA 3NZHL 3L71H 5I5JA 2DQEH 5FPOA 1UA7A 3VD4A 2EUVA 2J57A 4JKPH 4IIQC 1JRHL 3T6VA 1H3WM 1PX3A 1MFAH 4G1EB 5LHDA 2DBLH 3TCUA 1KBPA 3S3JA 3CIAA 2UY6B 4FFBB 1Q43A 4QAWA 4NNXA 3DBXB 3JD0A 2AW2A 2QM4A 3TLRA 1GO3F 1A3ZA 1JXDA 2BOBA 4YNYA 5I18L 5IREA 2J1KA 5J1SC 2GDSA 3FRPB 3EAKA 3VXNA 1P2CB 3DARA 4HXBL 5ANMB 4H0GA 2X3AA 3FQTB 4IHJB 3MXWH 3L3HA 2PW2B 2VB5A 4NO0B 2VITA 4FI8A 1K5WA 5A6LA 5KVGH 5BRQA 4PREA 5FYJE 4P2ZA 1SOSA 1WBXA 3FU6A 4N3UA 5I1EH 4DUYB 4GAJL 4TV9A 2EIMC 3EDEA 1ZJBA 4FQIH 3CE1A 2HJLA 3P2TA 4XNQB 5ALCL 3GSNB 4BFIB 3X3GH 5E2TH 1PKQE 3PABB 3UTSA 1BE3H 1DQKA 2OTWB 3G6JE 4LBEB 1KMIZ 1G9HA 4RA3A 4UAOB 3FSAA 4Y19E 4QRPE 4MVUA 2VN4A 5D1ZD 3VI4B 4GRLB 4DEPC 2TAAA 3S35X 1YEWA 4MSWA 3IFXA 5AW3B 2A9MH 4K0OA 3KPLA 2B1HH 5L4MA 4W4NA 4HS3B 2YSSB 5DT1H 4G5ZH 3B1TA 1FYHB 4TUYB 1U2YA 3HB3D 3EYOA 3SJQC 4ZUTA 3ARFB 1S9XB 2WVUA 2B15A 3D0AA 1OF2B 4DGYH 4HWUA 1LO0L 1U8NA 4X64O 2VJ8A 2V9QA 4D7TA 3OXRB 5HSFA 4WUUA 4B95C 3C08L 4KP4A 4U3FH 4YLQT 1NS1A 2YEVB 1KGCD 2X70B 1KU9A 1RP8A 1VHPA 2VQTA 2Z4TA 4O2FB 4GXVH 4NP4L 1T7YA 4YSEA 5GIRB 2Q6AA 1RKRA 3LMJH 1XT5A 1OLZA 1J0IA 2EC9U 2M7WA 1RU9H 3MRKA 4OTXL 2WO4A 3WFCL 5G4NA 2DQDL 5G5DA 1R1CA 1LEIB 3LD8C 3HC2A 3SE6A 1RCYA 3ABGA 3ZKSD 1UB6B 1U8MA 3PPEA 3DV6A 2DQGL 3QDJD 3RIFF 2D3VA 1I8MA 4RO2A 1KD1W 5A2JH 3FQNA 3VD0A 1A4BA 3JV6B 2OXGB 2YPVA 2EE9A 1T7VA 4ZOLB 3AQDA 5IJ0A 4L8SC 3BJ91 4HWEL 4O4IA 1CBVH 4MGXA 3THMH 5C0CB 5IB3A 5E08L 2GK2A 3U4EB 1CFBA 1CLZH 1K92A 5HYQB 2F53B 2ITEA 3BE1H 3MOAH 4FZ8L 4JANA 2CCVA 4QNPF 1INQB 4FXGB 4JTCB 1UB5A 3VGGA 4TVUA 4HOXA 2YKLH 5GISL 2XUWA 1FFNA 2OULB 5FGCB 3RX7A 3OWRA 1UT2A 1XFPA 2A9BA 2XVLA 3L5HA 3VQWA 4G70B 4FQXC 2SEBB 2UWEB 2QEXV 4F20A 4XMKH 4K0KO 2VZSA 3ARWA 5J6GB 1N8ZB 1QEXA 2VZ1A 3MR9A 4JAMB 3W39B 5H6RA 1RZJL 4YEFA 1JDDA 4GIPD 5LHIA 1KXTA 2P8LA 5I71B 4G8IA 4BFBD 2GUZB 4ZMPA 2F74A 2YA2A 1YRKA 2AZAA 4H5SB 4N8VA 2FEDD 2YEQA 2DIAA 5KMGB 3QXDB 4UQ3A 4MB3A 4WK4B 5ES4B 2E7CA 5KVDH 1J86A 1ND0B 1UWXK 1FG2A 5AKTA 4XNBA 4ENEC 4U6XA 1XUQA 2ZX5A 3ARXA 2YPVH 5J3HD 1IEAB 1VPOH 2X4PB 4IIQB 2ZQMA 1DE4B 3K03A 4POZC 2ZXWB 1JWMA 1K8DA 3EIFA 1BPLB 4PRNB 3T3ME 4LIQH 2ENSA 4WWKC 1WT5A 3QJZA 4KKBD 5HYJD 4A2MA 4LFAB 2AVFA 1NR7A 1ROCA 4X42A 1AH1A 5AEAA 1JV2B 4OIBA 1QRNE 4MKTA 3EOAB 3ATFA 1BD2B 3WIHH 1XHHA 2GBOA 3H9HB 5D5PA 3SODB 3GTTA 4UM8A 3V6FB 3I9GH 4U2ZA 1PLGL 3Q3GB 3DGEA 5C08A 3L8QA 1FORH 3VI3E 1Q90D 3DV4B 4W9JC 4YDIL 1JNHA 1FFOA 5E4AA 1I1AD 4OUUB 2WXFA 1R17A 1K4DA 1UA3A 4GSXA 4ZOCA 2C3XA 4YHKL 4Y5VA 4YHOH 4D9QD 1NH2D 4CU7A 5EIBD 4RAHA 2EIMB 3G5WA 1JX9A 3QQDB 2ADJB 2GY7B 4X6CE 2BNQD 3MRQA 4HFUH 2NR6D 4KY2A 3BDBA 4GG6B 4PLKC 4NLHA 4DEPB 3QDGE 2GBUA 2B2XH 1QFUH 3P4MB 2GTSA 1FZKB 1X5ZA 2YQ3A 3KVQA 2EH8L 3T8VA 1JI2A 1PZUB 4B5EA 4XPGL 2OMVA 5CP7A 4JB9L 1CR9L 4I87A 15C8H 3QJUB 4JHVA 4FQJH 2DLTA 4OFKA 1UXWA 3EO0B 4J6RL 4GAAA 1XTLA 2HPOA 3NIGF 1L9RA 2B4CH 4NWTL 1VQKV 5CA1B 2DWEC 5TDOB 1TTRA 3TA3C 2AV1A 4P2OA 1OJHA 1ML0A 1J5EO 5CR1A 2WCGA 4J41A 4E68A 3I50L 1JTPA 3TETA 2C3GA 4XC1H 5E9DD 3S35L 5CHNA 2RB8A 1T6VN 3H7LA 3D3IA 1MRFL 3CZLA 2RALA 1C5BH 5B7FA 4X1KB 1YPZA 3AREA 4ZFFB 5SWSA 1W72A 2XACC 4QHUA 4GFXA 5D7KE 3F12A 5D7IA 1OGTB 3VFMB 4D2NA 1TUPA 1ZTXL 1WFTA 3ZO0A 1BT8A 3LD8B 5JDSB 4YHHB 5E8NA 1VADB 1KCSL 2A4ZA 4U3JA 5BZXA 2DD8L 2XWJB 4QY8B 4UU9A 5EEXA 3LKOA 1ED3B 3P0VL 4R7XA 3GD1C 2ARJA 5DTFA 3S88L 2IPTH 5DLML 3FFOA 1E6JL 3LNDA 4OFYA 2VMFA 3NCJH 4L8SB 1I1FA 1VQ7V 4OSUH 2E5LB 2OJEB 1MRCH 3L5IA 2YMXL 2BP8B 5E70A 1YY8B 3LPOA 5AAWA 1D9KC 4N1EA 4JPKL 1H8LA 1WHOA 5E2VL 5L3GA 2NLJA 5ACZB 5LBVA 1CXZB 2Z64C 4L3EB 3F83A 1MCKA 4XOBA 4HKXA 5FM5O 1JGEB 1KN4L 5T5NF 2WIIB 5HY9B 1XX9C 4FABL 4NTWA 1GY2A 3DVNA 4AQEA 3G5XA 3T1FB 3BPLC 2DWXA 2NY0C 2IBBA 1PDKB 3HI5H 3KZ8A 4JYAB 2WK2A 5DRXB 2F58H 4KMTL 2R2HA 4OH2A 4YIQA 5KYWA 1GMIA 1W72H 4WTZA 4HNAA 4TYUA 1KV3A 2F19L 5SWQA 3BQVA 1V9PA 1NEUA 2W65A 4MA7H 3WNLA 1AD0B 2Y5TB 5DQDH 3IAGC 4XXCA 3DVIA 4P46C 1JN6B 3C12A 4IRZH 1PD0A 4AEIL 1ZDQA 1FYTA 3U6XA 3CRQA 4F9LA 2NY3D 4PGEB 3GSOB 5ITBH 5D7SL 1JOIA 1TQWA 1NFDE 3QUZA 2I60L 3MC0A 4PJFE 3WHXB 4QYOA 4HEME 4ZW3A 3IK2A 2VDPH 2WQSA 4ODHL 2YS8A 4XPHH 5FHAL 3KH4A 4XBEH 3TX4A 1IGFL 1TQTA 2VDKB 5I15H 3QWNA 3PAVA 4JI3O 2X0UA 1CL7H 4M4RA 4NAMA 3ZBHA 2VLJD 4RQQB 4M00A 1J5OH 1G6VK 4NQVB 4H8QA 4FLSA 4DKDC 5FV1L 1FWXA 1ID2A 4W9GC 2HRPL 4NQEA 3WKPA 3KWUA 1EN5A 1NBVL 4FGMA 2FE0A 3CBJB 2QM7A 4LLAA 4WUKL 4KROD 5TISZ 3RWRD 3PN1A 4Y88A 2FLBT 5FKPA 1CXLA 3E2HC 5IW1B 3VXUD 3SBPA 1B0WA 4DPCX 3S97C 3O3UN 1Z3GL 3MNZA 1R5WB 1GCFA 1PW3A 4UT6A 5D7LD 2YXHA 4I55A 3K5LA 2V7HA 2YD9A 5JO5B 1EO5A 1PY4A 4JO2L 4MBRA 2Y6SD 5JCOA 2IJIA 4HUWA 3BVNA 4OZFB 3L9YA 3BDYL 1MRDL 3TBTB 4AZ8A 4G43B 4MZRA 1I8IB 1OIOA 4JFOA 3F7VC 5GS0H 1HDMA 4I1NB 1RVFL 2CBTA 4IBTA 5C3TA 5J12B 3U6XS 2VLRB 2IGFH 1XNRB 5IOKA 5LMUO 2NX5B 2ENJA 3WOVA 4GAYA 3SD5A 2BIIA 1SJHB 1KY7A 3DX2A 2EDJA 3LNIA 3L3JB 1N10A 3EOTL 4TS6A 5EN3A 5A2AA 1SEQL 4J23A 3PY9A 3V5HA 2KH2B 4XDJA 4XB8A 2DWEB 1BHBA 4JG9A 1P7GA 4OFIA 3I85A 1TQVA 4XN1A 5LNEA 3HKBB 1U42A 4O02A 4QYAA 3STBA 5BCAA 2Y7LA 2D3LA 5LAPA 3IFOB 1NAMB 3IVKA 3VD2A 2QWOB 2GQHA 4AH2A 1PBYA 3A5VA 5BOJA 2VS0A 4ZD3H 3SHSA 3K08A 1MCLA 1BZEA 5ABZA 1Q38A 2OTUA 3NMEA 2JCCF 4OV6F 2PYFB 2V4LA 1GGCH 3WE6A 3WHE0 3ZXAC 5FS5A 5KBKA 2QSTA 3WS6A 1A21A 1NEPA 4O2EA 2OCHA 3NSYA 2YFOA 3MCLL 5KS9E 4XP1L 4P59L 4HG4K 4LF3B 3TEYA 1VEMA 4XE5B 1IKNC 3LRSA 4KX7A 1JGLH 4H0HB 1DEDA 3ISWA 3VOUA 1QSED 4NCC1 1D9KB 1L9OA 1OAZH 1YNLH 4ZG1A 5FX3A 3LEXA 3X13B 5DJDB 1ZS2A 1AGBB 3PHOA 4Y2NA 4IBVA 1JJ2U 4NQQA 4L4TA 3RBSA 1MWAB 1YPZF 3GWOA 5D6DC 3SYQA 3C60D 1RUKH 4R2GD 2DQHH 4XBGB 1T03L 4NKDB 4CH3A 5D7IF 2NY0B 1B4JH 4OI8A 4F1SA 3W81A 4L1DA 1NJ9A 2HTKC 1FCGA 5DC4B 1SKVA 1VFOA 4K8RD 3UZEC 3RZCD 4YAQB 4HOWA 2NR5A 3TIDB 5LXGH 1HX0A 1MSPA 5HGHA 5F1SA 1FGNL 2B7DT 1EEYB 4OKVB 4WCYH 3US1A 5H94B 2RA1A 2E74C 5ITZA 1T80A 5IP4A 4P46B 5KVDE 3K3WA 5F9OL 3CBRA 4EXPX 1FZMA 4PSPA 3KBEA 3FTGB 5H4YA 4JFYA 1DLFH 1F56A 1RJZB 1WA2X 3V7AG 5H9CA 4NO5B 2LQRA 3KPRE 4MB5A 4D9LL 1MFMA 4K8XA 5CJXC 1SUHA 3CFKB 4W1TA 2MCMA 1AY1L 2I32A 2QGNA 4WI6A 1A64A 1BVLB 2MOVA 4QTHA 4TQDA 3AABA 3GINA 5D71L 3O8XA 2OZ4A 1UG9A 4KBPA 5MENE 3MN8A 2IBZH 3HC3H 3OAUL 1JXFA 2G4GA 2PKDA 4RGND 1SS3A 3ARDA 4JN2B 3S98A 1VESA 5I1JH 2JI1A 5AYUH 2EXTA 3QDMB 4PWEA 1R6TA 3E2HB 1JR9A 2BINA 4ANXA 3IDXH 3HMXH 4ESKA 2EIKB 5HHQB 4NC1C 1XCQA 3IEAA 1DZ0A 4YHLL 4KZCA 5G4OA 2ESVB 2JQMA 4LEEA 1ZLSH 2ZUQB 2CR0A 4HWBL 4CILA 2Q8AH 1T89C 2CPUA 3HN3A 2VMEA 3Q13A 3SY6A 3VM7A 3DYPA 5D2NA 1OAKH 1JA8A 1AI1L 1T1YB 4MX7B 4KC3B 4QRRD 2EIDA 5IMOA 4LSUL 1JPSL 2WYIA 5IOPB 4XNAA 1FVCA 2EDDA 4FMVA 4OM1L 4OCSL 4FHKA 3AXHA 3SPJA 3BAEH 3MD0A 1OLLA 3NP3A 4QRSB 3QA3A 4EN3D 2NOYA 4C83A 4QKXB 4AXWA 4U1HB 5EN2B 4QXWA 2OZ4H 3QUKA 3MNMA 4APXB 1BHAA 2MMXA 5CA0A 5C08E 1DSWA 3BQUA 2NSQA 3O9OA 4LCUA 1IM9B 2X9XA 4XCFH 4YLBA 4N90E 4XBMA 4DUZB 1GM8A 1VA9A 5CEZH 3RDTA 3AG4C 2L7QA 1H0DB 2Q5BA 3HMWL 4GQRA 4ACTA 1CT8B 2V9UA 5H4ZA 4LFCB 4JGMA 4OD3L 1OAUH 4NUQA 3T5WA 2R70A 4HIXH 5A9GA 1NPJA 1OCRB 4ZS7L 3JT0A 3V0GA 4FZ1A 4WV1B 2ZJSL 1NGQL 3R0NA 1N3NB 4HUXA 1TITA 4Y8AA 2AEQH 1TXKA 1T04A 4MD0B 4D0BB 2G3XA 4JFDB 1IFHL 1P69B 4DRXB 3N9GL 4OT1L 4ICWA 4NT6B 4PMEA 4RMQA 3ULVC 2A6JB 1DDHA 3T1YO 1F8TL 2HLAA 3D06A 3HG4A 5FYKH 4YXLL 6PCYA 4L29A 1FA4A 1X5IA 1ZDSA 3V52H 2VLKE 4RFEB 1MG2C 4UDTA 1DVFD 1MJUL 4HXAL 4FLUA 4CC4A 4WSJA 5E5LA 1P5UC 4A7SA 4OZHB 4GS7C 4HA1A 5IV2B 4FIPC 4JFVA 1QHQA 4L8JA 1UM4H 3QO1A 3OWEA 4LOVA 1CGXA 5IVOA 1NOFA 2DQUH 2LOEA 2CDGA 3H55A 4DFHA 2ERJC 3ALWA 3FFCE 2CJ3A 4PS4L 5C0AD 5I1AA 2HJKB 4UQDA 4G6KH 1MZZA 3LIZA 2W81C 3G9AB 2F1MA 4OGAC 1KDJA 3EUUA 5BMVA 2CHWA 2PN5A 1RD6A 5I30H 5IQOA 2RIKA 4S1SL 4WFHA 1YHQV 4TUJB 3LNHA 4ODSH 4KI1A 2E74B 1S72V 2IOOA 1E28B 2WLYA 1UCTA 4NLAA 3DOHA 4LEOA 1YEHH 3DTXA 1AFVL 1NBZB 3C09C 5CZXD 1A7OH 1DJYA 2BH0A 3BN9C 4FL4C 3O3AB 1RIUH 2ADGB 3FULA 4MDRA 4MJIE 1OY3B 3ZRWA 5L3BA 3C2AH 1CLOL 3MLZH 4RBPK 4BDVB 3T4DA 4HAKA 4MAUH 5TE4H 2HLFC 3FK3A 3B8YA 4CGUB 1XHXA 5KLVH 4FG2A 4PRIE 1C8QA 1JZ4A 4NUPA 5K1NA 4JI2O 3D05A 3EBGA 2CLZA 4H20H 3KPPA 4PG9B 5IIEB 1YMME 32C2B 1N59B 3N2GB 2YPLD 5CCKL 3DOSA 3U2JA 4XBPB 2F2HA 3EJRA 2R51A 2XVKA 4PB9H 3X12A 1FYJA 2FGWH 3ZGHA 5BV7C 4OCWH 4F7PA 2UXCO 4EB6B 1XEUA 4OLXL 3PAUA 2Y2YA 4KFZC 4R8WL 5AVQB 4YSAA 2VW7A 4NCDA 1B6UA 3FH7A 4NB7A 4D3CL 4OI7A 4BGLA 2P5EA 4XNMA 4QPEA 1Q6IA 4J4PD 3D9AH 1FN4A 3O2WL 1KJ2H 3V0HA 2ILMA 2YOAA 2FT6A 4JFFD 3ZJAA 3R1GL 1MELA 2FJHA 4X7TA 2CLVA 3KJ4B 1W15A 4K3EL 5GGSB 1VAHA 3WNIA 5EORH 4ERSH 1XF1A 2ATPB 2XX1A 2VUYA 4LK4A 4TNGA 2X0LA 3L72H 1AYOA 4TLTA 5F1NB 3DECA 3AGVA 3T4YB 3TO4C 3RVYA 4MMYA 2Z93B 4H8WC 1AZCA 3W3BA 3IMBA 3O6KL 3V79C 1YO4A 2WWWA 1AGDB 2XZCH 4JJHA 1AC0A 1U8CA 1KYOF 3RUGB 3AM8C 5IF0A 5I8CB 1J9TA 1VGEH 4N6QA 4WGKA 3SKMB 2LE9A 2VDOB 4Q6IA 4DV4O 1BQLL 2HFTA 1NGZB 5T1KA 3MFFA 3JTSB 2JGUA 3AG4B 3RX8A 1FF5A 1C5DB 2PO6D 3KPSB 3G6AA 5E95B 1S6NA 3FX7A 1WC7A 2GJ6E 4GCZA 1OSZA 4JY6B 2EIZA 2C9QA 1A4JA 3HN8A 5F70A 3PDOA 1J95A 1OARH 3X11A 5I82A 2BNUB 5IYBO 5ISZB 4H1LA 4RSVA 2AABL 1ZT4A 2HVJA 3KAAA 3K8LA 3OMZA 4E9VA 1FVEB 1GYUA 5KSUB 2QQNH 3VDBA 1VACA 2A7BA 2R0WH 5EPMB 1XQ8A 1CGSH 1A8JH 5LJYH 3PRZA 1QFWL 4WHTA 1Y0LA 4ABQA 3BX7C 4M1CC 4XAKE 3BUYB 5FGRA 5H35A 1XAKA 5DYOB 4GS7B 5E5MB 1FNGB 1ACYL 1FNEB 3O45B 3D69A 4QRFA 3MACL 4MVQA 2X12A 1KP3A 2FJFB 2XWDA 3EBAA 3SE4C 1MFBH 4DKFH 5M94B 4PJDE 3QUXA 5CMAB 2CGZA 5CIPH 5F7DB 1QHOA 4LPWA 1T21A 4UILH 3N42B 2H5UA 4JAVA 3C5JA 4EAEA 1G87A 3Q6FA 1FFXB 1R3JA 4GBXD 4HUKB 2VR3A 4KX8A 2CO7A 4MD4A 2UUBO 4O2AB 5DZVA 3IGAB 4GNKB 3LUTB 3MRMB 3UKMA 1BYNA 3OKEB 3OTOB 3AK3A 3TL5A 1G6UA 2EVJA 4JUSA 4PJ6A 1LK3L 3GGWB 1M4KA 1KFGA 2KQMA 5JIIA 2R56H 4F1ZA 5E2UH 2NXYD 4LAQH 3EYSH 4YSQA 3GJEB 1CDIA 5T1LA 3BVOA 4LF8B 4PV9B 3VDCA 1J8HD 4G9FD 3C09B 5GGSY 1I1CA 3DXAD 4FL4B 4M7KH 4LLYB 5JH7B 3NJIA 2ZUXA 3ABLC 1KKCA 5B3SB 1Q8MA 4PJ7E 5FM8A 2XWTB 2V4DA 3CFCL 1Q8IA 2R1XB 3NJLA 1BAFH 4PWHA 4PAZA 4HIEB 2KDYA 1EXHA 2PWEA 1J9SA 1NM9A 2ITCC 5KYUB 4L4TE 3VFTA 3INOA 1IC5L 3SE3C 4QPKA 5EBLC 3AMLA 3P3UA 3R06B 3MHHC 2ARHA 1TJHL 3JWOL 3PAYA 1AHWC 5BV7B 3DPBB 2O5ZH 3FT3B 5EZIL 5BUPA 3K04A 3JYCA 3NTCH 2F5BL 1KBBA 3MRDB 3TWCL 2WXKA 4W9ZA 5F9JB 2BVTA 3JWNG 1NUDA 2DQJL 3LPFA 2E7DA 3D09A 1OKEA 4NO0D 1A6ZA 3GEFA 2M8XA 5E0FA 5C6TH 1Y76B 4MDIB 3GMOA 2J8UE 4QGTA 1I7RB 5L8KB 3ZIAG 1PKQB 3NAAL 4JRYA 4JKLA 5IWAO 3DX7B 4J3OF 1IT9H 1RLWA 2QDWA 2ROYA 2Z31A 4XXWC 4QRPB 3B9VA 2P46B 2K7PA 3NJMA 4Z8FH 3WLBB 1S7RA 1N6VA 2A1WL 1M6UA 3UZQB 4O2CB 5AVVB 1QLEH 2XTJE 5KVEL 4MCYB 4G42B 4JI1B 1OD9A 8FABA 2E46A 2BE3A 1UH4A 3IGUA 4N0CD 2P4AB 4ZSOE 2CGYA 3VFUB 3C2SA 1GKOA 3D25B 1A7PH 3BH9B 5CEZE 2QVMA 5E6ZA 3TJEH 1EDYA 1PY9A 5ICYB 3MRJA 4LOEA 4R26L 4TTGA 1VGKB 1NDMB 2Y5EA 1KTJA 3LKNB 3WBDA 4YJZL 1V3KA 4DZBA 3BD5A 4YUEL 1GZHC 1Q0XH 3VXPB 1H5BC 1EQWA 4BFOA 4XP4H 4J1UB 4B60A 2AJ3A 3ESUF 1MF2H 3HJEA 1U91A 2FNBA 2IFGA 2IWGA 1MCBA 3L7EB 3A6OA 3M6DA 1ETJA 1FNLA 1OAXH 5FYKE 5D2NE 4XGZA 1PNLA 1CP9A 2V2XB 4TULH 5CBHA 1IU1A 1I3RA 5M7QA 4JPWL 4I5BB 3D12B 3SR2C 3VSQA 1PS3A 2R23A 4PJ9A 1DN2A 1P9MC 4I3RH 4CVXB 4MTFA 1I7UA 5B1KA 3H9VA 2P28B 5DJYA 5B8CA 3U1PA 2YD0A 1HVXA 5C0CD 1MLBB 4PW4A 3ZE1E 4XODA 1EZVY 1UA6L 1A6PA 2Z7WA 5HHXL 5HGAB 4AJWA 2F53D 3OVUB 2LU7A 3CVIL 1FNHA 2IV9A 1EDQA 5I76A 4HCIA 5B3JF 4EQ3A 1QSFA 3UJTL 2OCFD 2WTPA 3VWKB 2JKNA 1TZGL 5EK0A 4I3GA 4LDCA 3SPVB 3FB7C 1JPTH 5JLZB 1HINL 2GUOB 5JOFA 1RHHA 2K0RA 4KZDH 3NABL 3JCZA 2NNFA 7CGTA 3LEYL 1PAMA 4IMKC 5GRVK 1JPEA 1SQFA 4G27B 4G6AD 2F95B 4XI5C 3H1LH 4KJYB 2VLLB 4YDVA 4R4BA 4AC4A 3WY1A 4R50A 1J0ZA 3GBML 3ZDZE 5IKCA 1WBYA 3KD4A 5AVSB 3EYFA 2NQ3A 3N0AA 3K6DA 5FO8A 2JK5A 4PWGA 4Q58C 3CFJA 4JO3L 3KPNB 1KJMB 3S4SA 1IFRA 2IIJA 3MLTA 2DWYA 5KANI 2OR9L 2ITCB 1JERA 2H1PL 5MEQA 3KBHE 3RWFB 5DUML 3O2VH 5EBLB 4X62B 3KWWB 4E41A 1QRNB 1QTPA 2W8CA 4WNQB 4XCYA 4UB0H 4UM9B 5TPWH 4ELKA 3D36A 1AHWB 3QRGL 3TCXA 1RK0B 4L2LA 1VFAA 2OR8A 1UUNA 4IS6B 3QQNA 1BD2D 3UJJH 5K9OA 1A1NB 3VI3B 3ZHSA 1KMGA 3EXJA 2B39A 5AL0A 1MJ7L 4WHYG 4M1GH 4ABVA 1A7BA 2BLFA 1DVSA 2QLVB 4L18A 5EOTA 2FAUA 1HR0O 1D7CA 1G6RB 2JV6A 1U2CA 2ZXDA 2HFFB 5GRJL 4W9LC 5E1QA 4X6CB 4QT5B 2WZPA 1OCZC 5C92A 1O9ZA 4EDWL 1AZBA 5EBMC 5I1LB 1IL1B 3GHEH 4PBWD 3QDGB 4F27A 1NCAH 3UXFA 1R9FA 1RK1A 2A6IB 3ZT6A 2E59A 2XXMB 2F4VO 2GI7A 3W9EB 4PJ8C 1GIGH 4HLZG 4ZTPL 1NH6A 4RFOL 3VFOA 1JWUA 3E89A 3UBXA 5HI3C 4KK9C 1IGTB 1R3HB 2H7WA 4LP8A 5HTSA 3HPJA 1N36O 3L45A 1TQBC 3R0MA 1FXKC 1SQPH 2PWGA 1ONQA 1COBA 1OT2A 1QR4A 2Z6FA 4HKBA 1AQKL 2GFBA 4M6NH 5DLLA 5BS0E 3U0WL 4LWSB 3QYNA 1E9OA 3P9MA 1KCUL 3OKMB 4AK2A 1OW0A 1E8ZA 1KEMH 5H2FZ 4YVUA 3CXDH 5TH2B 3SJVB 1SQXH 2Z3FA 2VXSH 2QM8A 4ABUA 2VXTH 5BNXD 1GZPB 2YUWA 4X98B 2VC2B 2VH5L 3CH1A 5INCA 5C07D 4ONGH 1C7SA 1KELL 5AUMB 3LRKA 5AL8A 1VF6C 4WI4A 5DURB 2ZOLA 3CCRV 3LKQA 4TOIA 3AQXA 3MJGX 3S36L 5J1TC 3CB2A 2IXQB 3Q05A 4KTDH 3JAWA 4OZIA 3GMMB 4GP5B 4UTBL 2GJZA 2A6KA 3RVXC 4W9DC 3IU4L 4WI0B 1EFXB 3HI6H 3NFPB 1G0DA 5D1XA 3GI9L 3CPLB 1E50A 2R29L 1ZGLA 3N06B 4HWZA 5C6PB 4GSRA 3QWRD 4N0UE 1CTOA 2NDGA 3CFBB 4WJ5B 1NVPB 4KVNH 3C8DA 4GLRH 1NUFA 4G7YH 1F0LA 4DP7X 3RP1A 1X4XA 3TBVB 2YPKA 3HOGA 3QR0A 3I6GB 4BIOA 3FAVA 2ZOTA 1MFNA 1F11A 3REVA 4GUPA 1ODAA 3KLDA 4XP6L 3ZHKA 2RN9A 4JO5A 3DC5A 4UQCA 2Y7QA 1UWGH 4L3ED 2ZPKH 3UO1L 2ARWA 4NQCB 4DWHA 4DUYO 2A4EA 1JPGB 4FQQB 4BWAA 5DCCA 2DMXA 3WJLC 5DQJB 3WXWH 1DO5A 1YIJV 1SJEA 4G28B 1EJ6A 1AZVA 1OCWH 2VXQL 2VRZA 4NHCL 3ZIYA 1YJDH 1JZ2A 2ZNIA 3FB7B 3IS1X 2VDRB 5CBFA 4N5EC 1AIFA 1KPVA 5IYDO 2DI8A 3GM8A 4M61A 2J73A 4DV2B 3FF7A 2A0LD 3AU1B 5JXAL 3ULVF 3RLSA 2ILLA 2ICWJ 1LO5B 4AM0Q 2W07B 4H26A 3PXJA 1CZ8L 5IZ7A 1INEL 1ZT1B 3MJ7A 4JREC 1QQDB 2PNDA 2JIXB 1IIKA 1X7QA 5K9KA 2H8PA 4H33A 1T2QL 4LLWB 3FQRB 2J12B 5KBNC 1NFDB 3D18B 3B1UA 3HRZC 4PJFB 4FLZA 1JF1A 3G04A 1JI1A 4RNRA 4KXRA 1ANUA 4TNFA 4P23C 4LKXB 3F58L 3K80A 4ENED 4Q9RH 2ADQB 5DJ0B 5FLXN 1B9ZA 1MNGA 3SDCA 2CO6A 4JPVL 3K2MC 4MA8L 2WBJB 4GUQA 4DK0A 1IKOP 4BH8A 4N86A 4DGWC 4POZD 3O2DH 1K6QH 2XZQL 4Y7MA 5IT2L 2QPFA 1IGJA 3AQYA 4FNLH 5DK0B 1JUFB 4N0YH 5E0QA 4OLVL 3AG1C 1CFTA 1OEZW 3E22B 1BVNT 1WGOA 2RNBA 4WENB 5F7EH 4C7UA 1KB5L 4PVMA 1DFBL 1RUMH 3QI9C 5JHDE 1O0VA 5FA3B 3NZHH 3I74A 3WU2Z 1IGIL 3EDFA 1XGQA 1FNFA 3ZCCA 3T3PF 3FXIC 1FL5B 1WFNA 3HE7C 1JRHH 1B90A 2JLLA 2OCJA 1DQTA 3OL2A 5EU5B 1J1XL 2JJTC 3ZTNL 3B3IB 3VW3H 3SDXA 5C71A 2ZOUA 1M7DA 5CINL 2MW2B 1I8UA 1LJMA 1RZGB 3L3DA 4JFEA 5EBMB 4ODXB 4DR7B 1XH0A 5I18H 3MA7A 3UCQA 3M7OA 1OCOC 3CCLV 1IAKA 5IQ7L 3FU9A 1FPOA 3M8OL 1IILE 4PJ8B 3GVMA 4TLSA 5DM6V 3KLKA 4PBVC 1BBDL 3TFKC 2ZCLL 3H4FA 2B4CC 4G9DA 4YNYB 1A3RL 5EF0A 1AR5A 1MW3A 2NX5D 1NTKH 4BR6A 4GAJH 4JPIB 1KNOA 4BHUA 1QHTA 3APFA 3M46A 3S3SA 3HKZA 4UQIM 3BI9X 4XVUD 1HZHL 2Z91A 4PDLA 4PIBA 3B43A 4Y9EA 4O5LH 5CLTA 3UPCA 3AXLA 4NBXB 4QTFA 4UQBA 3L3HB 4R84A 3ZMRA 3EGXB 3IFPB 2ZXGA 3BWAB 3SDAC 5TQ2L 1YC7A 4LAJH 4RWYH 3RYHB 3BEWA 3VH8G 2O72A 3CLEL 3OTTA 1TAEA 5HYSA 4RWUA 3G6JF 3IJSB 4AIEA 4CVZA 1A4KB 2G9KA 2ZNWA 3T1HB 4H8UA 1DCLA 1D2PA 4L2YA 4NPYA 2OYPA 3MRGA 4KVCL 5C0BE 2EINB 2VQFO 1DQDH 5DWUH 3DUUA 2Y07L 3JUZA 2BVOB 2XWBB 3QJVB 3SE8L 3FQ4A 5KS9B 3BZEA 1TZHA 2WYTA 4NZTL 2GIYA 3GXDA 4LFAO 1LO0H 4NNYA 3VXQA 4NZJA 4RZCB 2DYSC 2G38A 4QHNA 1JHKL 2ALAA 2P43B 2P45B 3UEQA 2CBPA 1CK0H 3UG4A 5EC1C 4NP4H 1I7TA 3EYOB 4DO6A 4ZUTB 4ZYKA 4OF8A 3R65A 5I1GL 4DW1A 4FI7A 4OTXH 1L5GA 3RYIA 1D9KD 3WFCH 4XCEA 1ZHKB 4P2OC 4I77H 2DL9A 4WUUB 3DJRA 5K9QG 2V3DA 1JV5B 2Q3XA 2NNUA 4B9ZA 2DQGH 4HIPA 4ZFZB 5IB4A 2FBRA 4U6TA 3CJHB 3A0OA 2PYLA 3TNNB 1KYOJ 4C47A 4HJ0C 3AREC 4K7PY 4A6YL 4DN4H 2V7NA 4CC5A 3GSWA 4NI6A 2NY0D 1U8IA 3BRGC 1U4EA 4HWEH 2FO8A 5G5DB 4OZIF 4TRPL 5E08H 1SERA 4OZ4B 3FSWA 3JALA 1EGJA 1IBHA 4ZQKA 1PLAA 2BJML 3FQNB 4FZ8H 3JCUZ 3KCPB 1U8KB 1EANA 4X5QA 5D5MA 2X4OB 3MUZ1 4R5XA 1QA9A 3ZRFC 4MJ4A 4QJ5B 5IJ0B 4NTXA 1TTGA 3QEGL 1E3ZA 1XIWC 2AXGA 5IB3B 3KPRB 2E0PA 1KOAA 3SZKC 2QMKA 5FCSH 3WEAA 4X4YB 5FB8A 1AJPA 2FH8A 5DJCB 3HKDA 5LQBL 3ABTA 5IVXE 3OKYA 4MNQE 2Y7NA 5EH1A 1XMQB 3E6HB 3AG1B 3M86A 4M48L 3GS0A 5MENB 5DZJA 3P4NA 1QSFE 2AJZA 2YD4A 3QI9B 4XT1C 4B3EA 3WUWB 3KGUA 5CLXA 2UUAB 3OJVC 2XTSA 2OCCC 2IALB 1LQSR 1QPPA 3O4LA 5H37G 3HE7B 3NA9L 1XF5B 3QDMD 4AT6B 4OI9A 1URFA 4F15B 2Q8BL 2OW6A 4FJ6A 4XXCC 4QAMB 1JWSB 4EI0A 4GAGL 1E0OB 3RT3C 4UQ3B 3KGTA 4DT2A 2BCCH 1EGJH 2E5LO 1BZ9A 4G80A 2WQUA 4Y16A 3WN5B 4FI6A 1G9NH 1PD1A 3C75A 5LGUA 5DZNA 2ESVD 2G3NA 5DJAA 5T33H 3T3MF 2WWOA 4ODUB 2IEPA 1PLGH 5E8DL 4NZ8A 4ZMYA 1JZ7A 3CN4A 3DGGB 2L04A 5AW9B 4O4JB 4N87A 4AL8L 2OKMA 3N1PC 5C0EA 4YDIH 3WXVL 4OY9A 1VQMV 4I0XA 2A9HA 5ESQA 2CTQA 4BWTA 1SXNA 4AQAB 1WP8A 4QXTB 2WNXA 4AK1A 2XVGA 4UM8B 3C6LA 3GNML 2E7LA 1PD3A 5HDBE 1BZ7A 4CSSA 5C08B 2W9DL 3DSQA 2FJGB 3S3CB 1WFMA 4PJGA 3FUFA 4Q14A 2Y72A 3QHZL 1CFSB 4KXBA 2EH8H 1IM9D 1E2VA 2OSXA 3SDXF 1JCKA 2AZUA 4JB9H 3DMMC 3PPSA 4Z3FA 4L3CB 2EDKA 1CR9H 4C55A 2CUGA 3PCYA 4YWGL 3RY5A 3FC8A 2YC1A 3OGIB 4JASA 4J6RH 3WL9B 5C1MB 4WF7A 3W11C 3RGBA 2RFXA 1TEFA 4NWTH 4I9WD 5F3FA 3PV6B 3DROB 4IBLT 3TJHC 3KWTA 5CP7B 1WG3A 1IBBA 3MRRA 2DYSB 1GCYA 2WXHA 3I50H 2C4FU 2BX5A 3QVAA 3S35H 1K33A 2VLKB 1OP3H 1MRFH 5EC1B 1K5QA 1UXWB 2R2BA 2ZKYA 3EXLA 2CJSA 1UEMA 2IANA 4FA6A 4P2OB 3IN0A 1UJ3A 1ZTXH 5KSBF 3HAEH 1CD1B 2G5BB 4B97A 3GMRA 1KCSH 3L2LA 2HG0A 3BIAX 4AILC 4K73A 5CHNB 4JFTA 2VXVL 5KTEH 4I13B 3P0VH 3AREB 5K93A 1RULH 1CIUA 3S88H 1W72B 5DLMH 5AD0B 2QQKH 2VWEE 3PWNB 4QHUB 2HX8A 4NUMA 3P30A 3MQIA 1JCHA 2H32H 3QPQD 2YMXH 2L6LA 1RFDL 3WS6C 2P3YA 4U3JB 4YJ2B 4JPKH 3CDCA 5E2VH 5T8IA 4UU9B 1NPNA 1XNRO 2XVBA 3LKOB 2APXA 1I85A 4EIUA 3MBEA 2V5MA 3IE4A 3G5ZA 4NFDA 1ZANL 4UCOA 2J6EL 5BQ7B 2PY5A 3MX0A 3IRCA 2VDKL 3MV7D 4LRIA 4Z23A 2VDPB 4NP9A 4FABH 2V1DA 1XIWB 3OJDA 4ELME 2IM9A 2YD8A 1HKLL 2ADIB 5D2LA 4MJIB 3EADA 2VL5B 1RUPL 4KMTH 2K6ZA 3UH8A 1K2DA 1NM4A 3QHFL 4PCYA 1MCPL 1UFUA 2N74A 3LSOB 1DDTA 4KRMB 2F19H 4PRIB 3A6CL 2XNDG 4Z3IA 4ODVL 1P53A 5JTWA 1TVBB 1D2DA 4A2HA 1YMMB 1SDAB 3GZKA 2ZE6A 3NDYE 5FKAA 1UQSA 4EI6B 2ZCEA 1GN6A 4N20A 4S11A 5DD0L 2ETWA 3IBEA 4UQ2A 2QTOA 3ZMZA 1DJZA 2R2HB 3C5ZC 4YIQB 2OCCB 3QIWD 1XGRA 2I60H 4HNAB 3FU3A 5T5NG 4BSJA 3RBGA 4J3VA 1Z1WA 4Z1PA 4ODHH 1E6OL 1JZJA 3QPXL 4UUJC 3N41F 5FHAH 3VX1A 5E6YA 4O4LA 1IGFH 2BVPB 4F2FA 1R0AL 3IDYC 1MVYA 3P73B 5GW7A 4F7KA 2DYRC 1FFRA 3OKLA 3IF1B 5AW1B 3NPZB 3OAYH 2R69A 3CFNA 3DIFA 1OK8A 3OUFA 1EV2E 1FV1B 2C3VB 3MV9E 4RQFA 5CJQL 1IMHC 2HRPH 1SQVH 1KYOK 5D5QA 4NENB 1NBVH 4R96A 1PZDA 3K71A 2CGRL 2EIEA 2ZUUA 4M4RB 4WUKH 3K5MA 5DJXA 5SX5H 5E8EA 5EZYA 1KENL 2XTJC 5E6IC 5JYLA 1BGXL 3STLC 1F3RB 1NAML 1Z3GH 1RPOA 1OPOA 2D8KA 3TV3L 3UTZA 1OB0A 2Z1PA 5ETUA 4OCMC 1YYMH 1IBYA 3ARDC 4I0KA 5KBPA 1BOYA 4JO2H 3V8CA 4TTDC 3ARVA 3NJHA 1JQ0A 2X0VA 1MRDH 3SDLA 3BDYH 3KE0A 1ZA3A 4M3HA 4U1KA 3OKNB 4YXKL 4ZXBA 4LF7B 4M1DL 5FKPB 1KC8W 3MU3A 2DM7A 1Y6KR 5ID0B 2H6PB 2VNCA 3DMMB 2ETNA 3RYCA 2PCYA 3OZLA 2F1BA 5EU3A 2GJ6B 2V7HB 4NGHL 2YBGA 1NDGA 1SN2A 4AOFA 3BVNB 3NIDF 3KPSD 2XPGA 4FTVE 5FO7A 3TEXA 3SYCA 2UZYA 5DEFA 2FB5A 2CHDA 1U30A 3EOTH 5EZJB 1SEQH 2QTVA 3BAIA 3BRFA 2VAJA 4N8VG 4JFOB 5FF6B 1JL8A 3N1FC 3WFHA 3GTVA 4PJCA 4J7JA 1IC7L 4KK6C 4O58H 1KTRL 3RPIB 3SBWA 3IGLA 3FQWA 5ISZD 5DHYB 1T1XB 3NSFA 4Z3GA 4KO9A 3MJ6A 1AG6A 2HB0A 2HJDA 2MK3A 3UIZA 4GAYB 4JDEB 5SWZA 3D4YA 1HOCA 4XC3L 3RVVD 3TBCA 3V5HB 5I5RA 4GW5B 4I9XA 1K4CA 1BQ5A 2YRBA 1WUZA 4IHOA 3IJ7A 2O93L 4PJDB 1ZRUA 4PJGF 5CEYA 2J56A 2Y9RT 3IVKB 3WI9A 4P4RA 5E2JA 5C6WH 1Y6NR 3MCLH 1AKJA 3NACL 4PTUA 4AH2B 3SPHA 5JA8B 4XP1H 5IHHA 4IIZA 4Y0GA 1M5IA 3PHSA 3ZDYF 1M2VA 4UFZA 2OTUB 3W7WA 4XAWL 3WE6B 5T3XD 4NRXA 3DXRB 1EHAA 4PM1A 4CADB 3SJCC 4O51A 2WQXA 1RZKH 2KZKA 4BFNA 4JBSA 5JW5B 5JHBA 3C5XA 43CAA 1HSAB 1J12A 3H9SA 1JSYA 1HZKA 3G5YB 1AZZC 4QJ3B 5J9PC 4M9PA 4Y9GA 4BUHA 2ZF9A 2P5WA 1CGYA 4JYYA 5IJ9A 1QTSA 4Z0BH 4XNZB 1Z0MA 5AKVA 1M90W 3VXTA 1T03H 1WSST 2CLRA 2IPUK 2ALWA 3WDJA 4Z7OE 1WE5A 4PJ7B 5J1AB 2E3VA 2V37A 1SVCP 2HEPA 3JZ7A 3MXVL 4IKNA 4CC4C 3MYJB 1IRAY 4W4OA 4PRHA 1TTFA 4AIZB 3P77A 4D6TH 4DUZO 4L4TB 2AQ2A 3QIUA 1FGNH 3B6SB 4NXSA 4JQXC 4LFCO 3IXTB 1IBZA 3E80A 5F9OH 3B8SA 3IMUA 2KSDA 4HWBA 1F18A 3C5ZB 1NJ9B 3JTTA 1AJQA 1BFTA 5I16A 1RUAL 2AQSA 2W88A 4L8DA 2CIKA 3KLQA 2DN7A 1A9BA 2BW5A 3MCG1 1W2BU 2MQ0A 1FLRL 1TVHB 2PF6A 4Q7DA 3KYMA 4ZODA 3RI5F 4UUJB 4D9LH 2AC0A 2GSMB 5ITZB 5KAQF 1PLBA 3IDYB 4P30A 1IBGL 1AY1H 2DYRB 1AIZA 1FZMB 2J8UB 3LN4A 3CCJV 2OV0A 4GYBA 4HV8B 5D5ME 3NCEB 4KH2A 5D2LF 2A2QT 4L5FL 4JFYB 5D71H 4AV4A 4IJ3C 1JHTB 2XXCB 3OAUH 3TEUA 3A0HZ 3VXRA 4H2CA 1EHLL 3DJSA 4ZKIA 2DJSA 3AY2A 5D7JA 2XV0A 1UH2A 1BLNA 2VSDA 1F45A 4LESA 4Z76A 2WN3A 2XTJB 5E6IB 3STLB 1HAUA 2E8ZA 3O8XB 1ZSDA 2J20A 1L7TH 1PL3A 3GXTA 2CIIA 2DICA 2P80D 5I1KL 3T4AA 2BERA 3ARDB 2VGLM 4ZSOB 2Q5ZA 3TURA 4KOCA 3IPEA 3HBPA 3MNVB 4LLUB 3JD1A 3ZZSA 4E9LA 2EYRA 4HWBH 5ESVB 1QLRA 4R90L 3O4LE 4PGCB 3B9KC 2X4QB 1W8NA 4IMLA 1RLBA 2WZAA 2XV6B 4WTXA 3U7WL 1AI1H 2W1NA 1BP3B 3DVFA 4LSUH 4OB5L 5LLIC 1CXEA 2A5UA 1GA2A 1S9VB 2CRYA 1MHCA 3DHMA 4KKAC 4WTZG 5EO1B 1KYDA 2JJWA 2OIEA 4OCSH 3ELAT 3N43B 5HHOA 1F86A 5J56B 4B08A 3CDZB 1U3ZA 4MVMA 3VNZA 5C9JB 2LU4A 1ETZA 3POCA 5D2NB 1GN4A 1AR1D 4FQLH 1IEHA 4F58L 4MDJA 3BCFA 4YQXL 5IMOB 4X88A 1MG3C 3ARUA 2DWSA 3FUHA 3MJ8B 4YPGA 4R97C 1SXCA 2I9TA 2L4OA 1GJWA 4UINL 3BW9A 4PV1B 2Y36L 3HMWH 4P5TA 3H2WA 2FECL 3SYOA 1QASA 2IBZY 3DX6A 1DR9A 1ZTXE 4QRAA 4OGZA 5BZWA 3S3BB 4OD3H 2X09A 1ORQC 3TXQA 1E9PA 5JIDA 3ZE1B 2ZJSH 1NGQH 3WFBL 2OMUB 4LCUB 1Z0NA 2M2DA 1NMAH 2C9PA 3QJXA 1IFHH 3RX9A 5CB4A 4OJFL 3WIAA 3N9GH 4NBZB 2ADYA 1ZVSB 5IROA 5BVJB 4GT1A 2KYIA 2JELH 1F8TH 2NUPB 5TFSL 1Z6JT 1M2OA 4JFQB 3N44F 3HKEA 3CXFA 3IWVA 1MJUH 4GG8B 4HXAH 3HZVA 2CHXA 4PJCF 3VWKD 1T04B 4ONHA 1EZVX 4PGZA 1TTUA 1SMAA 4YFLF 4Z2WA 2NNAB 2VIRB 3AUVA 4PJ5E 1JNLL 1YMHA 3G71V 4V33A 1LEKB 5J9PB 3ULUF 3NG5A 3B2VH 4PS4H 1LEGB 2BSKA 5DD1L 3CCHA 3ZDZB 4HVBA 2YXVA 1FFQA 4AMXA 3PQYE 1XB8A 3PP3H 2LTQC 1QHPA 2ED9A 1R73A 4L4VA 2OK0L 1MCRA 1ZA6A 4Z7AA 3T0EA 4X1IB 3D33A 2F23A 1MCWW 2UXVA 2QR4A 4S1SH 1N32B 2EO7A 3CD6V 5K9JH 2CDGB 4W9IC 2WXOA 2C9AA 2ENQA 4OD1L 1GR7A 4GQPH 2D7TL 4J39A 1COWG 2BSEA 2MH4A 5EU7E 3RGVA 5JMRA 1PPJH 5C0FA 4G2AA 3V4PA 2J43A 3D3VA 3DO7B 3S3DB 3BJLA 3B5TA 3KJ6L 5BMVB 3T77A 5HVWA 1PNCA 1AFVH 4X5XA 5FM5M 3TASA 1GTOA 4UM9D 2NY4B 4I5SA 4W9HC 2YK1L 4GIOA 4DW2L 2R9HD 2YARA 1EX0A 2AF2A 1EK3A 4I0PD 2N01B 4X9IA 4IRSC 2C9VA 1CLOH 2AQTA 3RYFB 1NGYB 2BP0A 1KJ2B 4YGVA 5B22A 3TESA 3NSCA 5C0DA 4L8CA 3DTXB 1TTAA 1B0RA 2WLNA 5HHNA 3QULA 4L9LC 1XNQB 2IQ9L 4IJ3B 1WICA 5CN3A 3BFOA 2UXNA 4MASA 4J10A 1CL7I 1AS8A 5CCKH 1ITCA 3CC1A 4MB4A 3V0AC 3QDGD 1QLEC 4CMHC 3QO7A 3B2MA 4KI5E 4E4EA 4OLXH 4ZMLA 4GSDL 5E8OA 2CLZB 4NJ9L 1X7SA 4R8WH 3APNA 4YY3B 4WTQA 3QF7A 1J0YA 3OTOO 2JQAA 3DOSB 4D3CH 1JYWA 3HS0C 3W38A 3IDNA 4YEEA 3LS5H 3O2WH 2VQEB 3X12B 5KYYA 4PV8A 3DWTA 5BS0B 3R1GH 3GF8A 4KDTC 3WAJA 3RWCB 1ZV2A 1D6EA 4K3EH 4LF8O 1NDTA 4LLMB 5C3LD 5CUSL 1MCOL 4B96A 5TTRA 3GQFA 2Q7HA 4F8NA 5IWLA 3OAZH 1KGCE 4HCRL 4XNMB 3VACA 3EJUA 4B9KC 1HHIA 2C34A 5ADOL 3SJVD 1AQ8A 3AG7A 2AJUL 3H8NA 4JI8O 5D7KD 2FJHB 4ANVA 3O6KH 2CLVB 2BOCC 2A9CA 4P4KC 4CNIB 3Q8AA 3TC9A 2N59A 3OG6B 1JTTA 5EYPB 4NN7B 3C3SA 5DURD 3S96A 4LXFA 3I6LE 4R97B 1H3PH 4GRWH 1BQLH 4HMDA 4OGQC 4P3WA 1YVWA 4XX1E 5AW2B 4I88A 4PJXA 5FO9A 5JR1L 4FZ0A 3J7HA 4N0UB 1EFXD 4X9HA 1N33B 3L5XL 1FC2D 4UOJA 3WSQL 2RMNA 4JZJC 5CIPB 5CZVL 4PGBA 1ORQB 4JQVC 3FAXA 2FEEL 4AQ1A 3RTQA 2O6PA 5T1KB 4L0ZA 4BQ6A 4EF3A 1IQWL 2WAHA 1B2WL 2DQ6A 2YGPA 2L3BA 2UZIH 5HVFB 3PWJB 2OBGA 3G6AB 4NQCD 4JYBA 1OSZB 1C1EL 5GS1A 1QR1B 1A4JB 1NCWH 3PDOB 3X11B 5IQLA 1S9YB 5C6TL 1D5RA 2DRUA 1ACYH 3GDBA 2HVJB 3MACH 3QORC 1CDCA 2DQTL 3OLGA 4P9HL 1QWNA 4N9GB 2RBLA 3RWHA 3ALPA 4XI5D 8CGTA 2Y5QA 2JIXD 4Y1TA 4TSAH 4JI1O 3HNTL 4AW7A 1LO4L 1Y0LB 1TUEB 2HA1A 2LTQB 2PR9A 4WFEE 4EKWA 2E86A 1NKRA 3KDMB 4PJ9C 3DURA 1ZKAA 4RAUA 2WD0A 2A77H 2WXJA 3REWB 4AYEC 1GGUA 2AI0H 3GTNA 4ZHQA 4LLDB 3QUXB 1LK3H 1D5MA 1RZ8A 5E03A 4RCAA 4G7VL 4B9YA 3VGAC 1T21B 3CN2A 2WBJD 4P07A 4UT9L 1CDHA 1CPUA 3Q8CA 2J72A 1KWKA 3Q6FB 4U1NA 2E9JA 4MD4B 5HHVH 2TRYA 1E27A 4KH9A 1DBBL 5JHDB 3GSQA 4JKMA 3GC3A 3CFEA 1QO3A 2L7EA 2OI9B 1CVSC 5DF0A 5IQNA 5I2IB 4G11A 1JF6A 3DDGA 3MRFA 4IRSB 1WPCA 5T1LB 3OJ2C 2HVBA 3H9SE 4DQAA 4B3MB 1VF5C 4S10A 4EZJA 3F7YC 3U0ZA 3L1EA 4L9LB 1TSHA 4D9QE 1IC5H 4K4KA 4NQSA 3CCVV 1KGUA 4FLQA 2YICA 1ZHLA 4RX4A 3AXIA 2N1TE 3JWOH 3DETC 4U7KA 1MZEA 2Y69C 2CM5A 5EUKA 1HEZA 1QLEB 2BCKA 4CMHB 5EZIH 4O4HA 3OC5A 1CD9B 3TWCH 4YSUA 1UJWB 4R4ND 3VFTB 1XBLA 3DHUA 4UV9A 5FDWA 1PKOA 2DQJH 4PJ8D 4FEIA 1AJ7L 4WGVB 4X4MA 1A8ZA 3ZDXF 1P7HL 3WB0A 4OQTL 2OXHB 3HS0B 4KK9D 5HI3D 2DEYX 4N8CH 4WNJA 3PGDA 5EIIB 3AS0A 4A39A 3NAAH 4I9QA 4ZUSA 3HHSA 4MQTB 2IDUA 3QYCA 3AU0A 2F7OA 2IPUG 4HHWA 4PUBL 4R7VA 4QHMB 5LN4A 5E9DE 3SDDA 3SN6N 1A6ZB 3GIZL 3HHMA 2A1WH 4IBWA 2L7JA 4DPRA 1MOFA 2J25A 1QVFU 4C56A 1PY0A 3U46A 3BMVA 3LHPH 3OR7A 4P06A 4X99A 4HUVA 3A4EA 5KVEH 2BOCB 4B3VA 4P4KB 1TETH 2JTYA 5I73C 3EOBA 2OL3L 3UTSD 1Q9WA 1P49A 4P57B 4TL5A 5FIEA 4BQ9A 4N2DA 4BIZA 4P04A 2D0GA 1ZHNA 1S7RB 4TUUA 4QD2E 5DMGD 1LE5A 2MHAB 3D0LA 4IK6A 3RVXD 4WW2A 4HCFA 4J2QA 4JUTA 4R26H 4J3OG 4BIKA 2QPEB 5FOJA 4JZJB 4YUEH 8FABB 5DJ6B 3B77A 2C3HA 2F08A 1IUZA 2XYBA 1LO3L 5E1AC 1R24B 5EWIL 1J88A 3LHAA 7FABL 3U2SA 1KBHA 4F93B 3EJPA 3IU3A 3O6ML 2AXFB 3MRJB 3Q1EA 1M7UA 4DSYA 4WUUD 1YJDC 3VQ2C 5T1MA 1PEZA 1XCXA 5I5IA 3IDMB 2PTVA 2B16A 5AOIA 3SKJL 5JNYA 2VWEC 3HPLC 3FSOA 2J4WH 4ADGA 4YSOA 3UO2A 2PPCA 1N0XL 2CTPA 2AJ3B 3GSXA 4GEIA 2NT0A 3C90A 2IWEA 4N5ED 3LRHA 2X1WL 1M05A 2R1WA 3O11A 3BP5B 4XGZB 4PJXF 3H54A 3KG2A 4DV5O 4J7ZA 3ZU8A 3ASNB 1JK8B 2PCXA 1UA6H 3OQRA 5GGVH 2FYYA 2G3ZA 2HUEA 3KH3A 5HHXH 4K7PX 1Q0EA 3CVIH 4DR1B 1MHHB 2MNWA 5B39B 1TO4A 2R23B 4PJ9B 4O9HL 4PR5B 1NWOA 3UJTH 4J2XA 1MLCA 3OKDA 5CP3A 5LCVL 3W2DL 5DJYB 2DV6A 4S1QL 4XXDA 2HAZA 1TZGH 4P05A 4I2XA 1HINH 3BSZL 5IVXB 5ALBL 3BY6A 5HI4D 3VGAB 4MNQB 3NABH 5JZ7C 3LEYH 5M95B 1Q9LB 4Z7QE 4H44C 5I76B 2FL4A 5EC2C 4JQIA 2EJ1A 4XMPL 1SQBH 1QSFB 2K6YA 2VWJA 2NT1A 3QUML 4OCNC 3CMAV 3QPKA 2WA3A 2Z35A 2VSCA 4LGSB 5I6KA 3FPXA 2QFRA 3QI9D 4YGAB 5L3FA 2HLDG 3UP6A 1TKWB 5J89A 2VN6A 4JO3H 3ZE0F 1VF5B 3CZJA 2ZKHL 3RNQB 3VXUE 2WB7A 3HE7D 2X6AA 2EDLA 2OR9H 3F7YB 1QLFA 4R4BB 5DDHB 3UTQA 4WKZA 1NFAA 3EFOA 5F6HJ 5FYLL 5L2JA 4MJJA 5DUMH 4E36A 3BEHA 4H1LG 4HH9A 4WVRA 1MJ8L 5IKCB 3WNJA 1WBYB 1JBJA 3EYFB 1EERB 4GKLA 1J5IA 2ENPA 3WKQA 2Y69B 1QUNB 3QRGH 4U6YA 1IGML 4Q9QL 5CF3A 1S7UB 1ASOA 2YRPA 1CF1A 3LTVA 3S4SB 3MLTB 2GHWB 3BSGA 3SDCC 3T0EE 3ZVVA 4WFGE 3RFRA 5EUOA 4FKEA 1I08A 3IJEA 3K2UL 5CP3H 1W0VB 5MEQB 3VBBA 1EPFA 1AZNA 1HESA 1MJ7H 5AKRA 3EGSA 3QFDB 5F2VO 4E41B 2VZTA 5GZOC 2Y24A 4BFGA 3IJYB 3CDGB 4ATWA 3BGFC 2FATL 3A67L 1ASQA 3TFKD 2ATKC 4B9GA 3PXLA 2NXZC 1VFAB 1NMCC 2Y2WA 2CUAA 4WLCA 5HDBB 3EBHA 4N0RA 1IDSA 5K9OB 2ICEC 4EDWH 4WIQA 3VFGL 2PETA 3K8KA 4GOSA 3JSNA 2W80C 4X7CC 1GM7A 5IBTL 3QZBA 4HWNA 3FB5A 4XNYL 5DJ2A 5C08D 1L1FA 1AOZA 3CCSV 4N90D 3OV6A 3SYPA 1ECYA 1H6FA 1PCXA 1MJJB 1HCZA 1KGIA 5LXTB 4ZTPH 5EOCL 2MSPA 4RFOH 5E7BA 2X9WA 4FLRA 1BA9A 1UD4A 3BZ4A 2YOCA 4ZOAA 3UPAA 3CX5F 3U0PB 5I73B 1EEUA 2ZR2A 5F3HA 2HJFC 3U0TB 5I6MA 3FSZA 4WO4A 1YNTB 2W0PA 2JNZA 1BL8A 3OKOB 4QO1A 1EN6A 2C1OA 4WWNA 2JS5A 5F9AC 3BO8A 1D6VL 2O61A 3U0WH 2JRIA 2P6JA 4FFWC 1S7XB 3M99B 3NCYP 5GGUA 3VFOB 1YCIA 3JATA 1KCUH 3ZZQA 2D7NA 1PF3A 3UBXB 2CCLA 3HPJB 1QFWM 4LGRB 1BDYA 5D55A 5EEYA 4TPRL 2VLKD 1ONQB 5ICXA 4DVBA 5E1AB 1IAMA 2VH5H 2EXSA 1I75A 4HKBB 1TPXC 1V7ML 4IKKA 1LL1A 1QW9A 3S8FB 3CCQV 1BG9A 1KELH 1R3IL 2OMXB 3P9MB 2IBGA 4JE0A 4S0HA 3S36H 1V7NL 4P2OD 4A1RA 4IBZA 2IAMA 1ZT7B 2EO1A 1C5CL 1GAFL 2X38A 4AYFA 3MGOA 2R0LL 3IU4H 3HPLB 1OM9A 4BZ2A 1K5SA 4YIPA 1QCEA 4DR7O 2YAHA 2YUXA 3GI9H 4LSDA 4Y2OB 2R29H 2P7TC 2DLIA 3ARED 4HJ0D 5KBMA 4JS7A 1KJ3L 1Q72L 1IC1A 4YXWG 2WAMA 3D5OF 1CMOA 3ULSA 4KXZH 4OCRH 4JKPL 3ZR6A 3JAWB 4QXUL 3EDKA 5CBEB 4C4KO 2GJZB 5AYQA 1GMGA 4WW2F 2VDNH 1BOGA 4WBNA 3GWKC 1AE6L 3NRPA 3C6SB 5D1XB 4XP6H 3VSVA 4F7CA 3AJ7A 3O81A 3UO1H 4ELMB 5BO0D 4OFYD 1KWGA 5GRVL 4RQEA 3E8UH 1S7VA 1B4LA 3B9EA 4F5CE 1XWVA 2ODHA 1I5YA 2VXQH 4PJEA 1XIWD 3P1VA 1RZJC 2WN2A 4H8VA 2YPKB 1YZZA 1AB3A 2B59A 5DVLA 2XOKG 3REVB 2YC0A 5JXAH 3PV7A 3RJDA 5KVGL 3J80N 1TQSA 4RSYA 1YYCA 2YUZA 1CZ8H 5IBUG 4H44B 1INEH 1MAML 4E9RA 3VU1A 5EF1A 5EC2B 3AAZA 5C9KA 4X6DA 4K7PL 3T1HO 3L3GA 1T2QH 5C0ND 5JORB 3VRIA 1YMMD 1J5DA 1AGCA 4WNSA 1SVBA 1AIFB 1TFHA 4B9JA 4M61B 4RGNE 5BZDA 3D52A 2FR4A 2Y25A 2ZAIA 2BMKB 5L4JA 3FU7A 5GHWL 1RZ7H 3F58H 4JFUA 3WCYA 4IYIA 1JZFA 4MQXD 2IOIA 3ZKMC 1QVOA 4JPVH 4MA8H 4HX1A 1EAPA 1F97A 1NT2B 1X7QB 2VJXA 4IGBC 5B1JC 1DJWA 1TCMA 1CFQB 2R15A 4JY4A 1SQGA 3MRIB 1BQHA 2ZT9C 5IT2H 5DT1