2Y69B

Bovine heart cytochrome c oxidase re-refined with molecular oxygen
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
227
structure length
227
Chain Sequence
b'MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQEVETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDSYMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLNQTTLMSSRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME C OXIDASE SUBUNIT 1
publication title A Combined Quantum Chemical and Crystallographic Study on the Oxidized Binuclear Center of Cytochrome C Oxidase.
pubmed doi rcsb
molecule tags Electron transport
total genus 67
structure length 227
sequence length 227
chains with identical sequence O
ec nomenclature
pdb deposition date 2011-01-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00116 COX2 Cytochrome C oxidase subunit II, periplasmic domain
B PF02790 COX2_TM Cytochrome C oxidase subunit II, transmembrane domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.90 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 2y69B01
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2y69B02
1CC3A 5B1AB 1OF0A 3FQYA 5B1BB 2FQEA 4FA7B 5I6OA 1NZRA 2JXMA 4TXVB 1W8EA 2EIJB 2AZUA 2J55A 4E9WA 4DP7X 1MG3C 3ABGA 1MZYA 1JVOA 1CUOA 2PP8A 2YAMA 4JKNA 2UXVA 1L9RA 3ZIYA 2J57A 2XLLA 3FYEB 4P5RA 1A8ZA 1KCWA 4MFHA 3ABLB 1HFUA 2Q9OA 2GC4C 1AS6A 2R7EA 4HZ1A 3AY2A 1AQ8A 3ZBMA 3FU7A 1CYXA 2BHFA 5B7MA 3TBCA 4DP2X 4AI7A 2XVBA 3TASA 2XXFA 1NWPA 3V9EA 4YVUA 4HHWA 4YSAA 3KW8A 3PAUA 3ABMB 3QJRB 1BYOA 1OE1A 3QJUB 3UADA 2PPEA 3PPSA 4YSDA 2OCCB 2QDWA 3QPKA 2GBAA 2GIMA 3PLYA 1OCRB 3ABKB 1KDIA 3NP4A 1KYAA 2AFNA 4DP5X 2BWIA 3ERXA 1GS6X 1T5KA 1AS8A 1ASQA 3IBOA 4JHUA 4E9XA 4RH4A 4DP4X 2PP7A 4KOCA 1BXAA 2DYRB 3KW7A 4A2HA 1GYCA 2HZHA 2YQBA 4K9JA 2DYSB 4W1TA 4M3HA 3X1GA 1NDTA 1WA1X 6PAZA 1J5CA 2XUWA 2X87A 4QKTA 2DV6A 1TEGA 2IWKA 1AZUA 1AZCA 4WTQA 3IN2A 3N2JA 1TKWA 1J9RA 3OD3A 1V10A 2HX9A 5LDUA 1JVLA 4UANA 3WIAA 4DP8X 3AG3B 3CZUB 1V55B 2LLNA 4DP9X 3UABA 2QT6A 2NRDA 4BDVA 1GR7A 1AACA 7PCYA 4DP1X 1FA4A 2DY2A 4G71B 4Q8BA 5I6PA 3NJNA 2XX0A 2CBPA 3ZDWA 3S8FB 2P80D 4YSUA 1XMEB 2XWZA 2YAQA 2CCWA 4BWWA 2I85A 4YVNA 3WI9A 1MDAA 1BAWA 1DYZA 1NIDA 2BP0B 2WO2B 3UAEA 1AR1B 1A65A 1DZ0A 3WNIA 2FQFA 2BO0A 1N68A 2XV2A 1ZV2A 4AX3A 1ZIBA 4AKOA 4BWTA 3PXLA 3NJHA 2FWLB 3U25A 1AG0A 1NWOA 4E9SA 1KCBA 1YLBB 3EH5B 3L45A 3FU9A 1AAJA 5F7BA 1ET7A 4FAAB 3QJSB 2W88A 1ILUA 1GW0A 3DKHA 4PCYA 3DTUB 4ENZA 1A4AA 3H4HA 1WA0X 4BK5C 1RCYA 1PZBA 4BXVA 1NINA 1IBZA 1KBWA 1NIBA 1PLAA 1M9WA 2GI0A 5ANHA 1M56B 1TEFA 3NSCA 1JZJA 4HAKA 2EILB 2HX8A 2IDTA 2B08A 2ZXWB 1QLEB 3FQ2A 3NYKA 4DPCX 3GXUB 1RZQA 3MBWB 5FC9A 2PPAA 1GY2A 1BEXA 2YAPA 5B7EA 3SQRA 1BQ5A 2VM4A 2FJSA 2R7EB 5EHFA 3FU7B 4P5SA 3V9CA 2BZCA 4HALA 2YARA 1J9SA 4KO5A 3NJKA 2XXGA 4JHVA 4X4KA 4KNSA 1JZIA 4KO9A 4E9RA 1SHWA 2JKWA 3OMIB 3CG8A 2CAKA 2Q5BA 1A4CA 5B1JC 3MX0B 1JERA 3C75A 3FPXA 3CVCA 3FSAA 2P80A 3NJFA 4DP6X 1JXFA 3WKQA 1SNRA 6PCYA 3S3DB 3S3CB 1ADWA 1AANA 3AG4B 1QHQA 2DWTA 1L9SA 1X9RA 1OV8A 2YAHA 4E9TA 1NPJA 3CVDA 3UGEA 3T6XA 4E9QA 3EF4A 3UAAA 1UATA 1AZRA 3X2QB 1XB3A 1BYPA 4YSTA 4Q89A 2BP8A 3TBBA 4DPBX 5TK4A 2VSKB 1MG2C 5I5IA 3FSZA 5AZUA 1PNDA 1J9QA 1ASOA 5I5JA 3G5WA 5I26A 4E9YA 1A4BA 1FFTB 3NP3A 2IH9A 2UXTA 3NT0A 5IY5B 2FT8A 4HCGA 3X1EA 5D4JA 1RZPA 3H4FA 2ZOOA 4ZK8A 5I6NA 1XB8A 1NIAA 2AVFA 4E9VA 1J5DA 2ZWNA 2YAEA 2BWDA 1KDJA 3D12B 1AS7A 4A68A 2CUAA 3NJMA 4YL4A 4BDVB 3PCYA 1WS8A 1IUZA 1JZGA 4AKPA 1KV7A 4HCFA 3IEAA 2X88A 1HAUA 3QJQB 1ASPA 2MTAA 2OV0A 4UAHA 2RACA 1RKRA 2WSDA 2FTAA 3OM3B 1ID2A 5A7EA 3TA4D 1OCCB 3T9WA 4QLWA 2H47C 1BXVA 1L9TA 4GP4B 1ZDSA 1ZDQA 1XB6A 3PAZA 3UACA 2MRYA 3FSWA 2BZ7A 8PAZA 1TU2A 3FS9A 3PAVA 5I6LA 4AKQA 3X1BA 3GYRA 1GY1A 2OJ1A 2I7SA 2VN3A 2UXGA 3NJGA 2EIMB 4G7SB 4GY4A 4AZUA 5AFAA 2IDFA 2PCFA 2AANA 3T6VA 2FT6A 2HRHA 5PCYA 1KBVA 3FQ1A 1E67A 1JZEA 4NERA 3RYMA 1E65A 1PLBA 2YAOA 3FSVA 1AZNA 2XYBA 4YSQA 1OCOB 5D4IA 2VW6A 5PAZA 1CURA 2QPEB 1FWXA 3FU8A 3NJJA 4GP8B 1NIFA 1NICA 4A2GA 3OQRA 2J56A 2IDQA 1SDDA 1VLXA 2TSAA 1JXGA 2UX7A 2J5WA 2GC7C 2XV0A 1PY0A 1W6LA 4G72B 1M57B 2WO3B 3AG2B 1ET5A 9PCYA 4BXSV 3CDZA 3CVBA 4BWUA 4F2FA 1AZBA 3GDCA 1L9OA 2FQDA 3JTBA 4CSZA 1EZLA 2VSMB 1URIA 3JT2A 3AZUA 3NJLA 2QDVA 2YAFA 3TU6A 4UF7C 1OCZB 4N8UA 1NIEA 3N55A 1QNIA 2IWEA 5D4HA 4KO7A 5I6MA 3ASOB 3OMNB 1A3ZA 1BQKA 1SJMA 3EH3B 4A2EA 5I6KA 2FNWA 2HRGA 3WKPA 3DIVA 3X1NA 2GB2A 3NJIA 5B7FA 2IWFA 2EINB 1E5ZA 4DPAX 1GS7A 1L9QA 1PAZA 4M4RB 1SF3A 3T71A 1WS7A 2BP8B 4GP5B 1ETJA 2PLTA 4G70B 1BXUA 1AOZA 2E86A 2XV3A 1JXDA 3NSDA 2DWSA 1AG6A 2CJ3A 2PP9A 1NPNA 1PNCA 2JFCA 3X1FA 5I5MA 2VM3A 3NSYA 4YSRA 3OMAB 4A67A 1I53A 1ZPUA 1CYWA 2PPFA 4NAJA 5E9NA 3ZX1A 3FYIB 1E5YA 1N70A 5B3SB 2AZAA 1PZCA 1J9TA 2IDSA 1IC0A 4YSOA 1PMYA 1OE2A 2PPDA 1HAWA 3BQVA 2IDUA 4YSPA 1JOIA 1SFHA 2ZONA 3S8GB 3ASNB 2YXVA 2IH8A 4A2FA 4PAZA 3SBPA 2Y1AA 1SHXA 2BW4A 1MZZA 2FQGA 3QJTB 1X9UA 2A3TA 2BW5A 1B3IA 4YSSA 2IAAC 4L0PB 3EH4B 4A66A 7PAZA 1ZIAA 3WNJA 4HCIA 1PF3A 3AW5A 2VW4A 3EHBB 2B3IA 4GYBA 1L9PA 4HHGA 3WG7B 1GSKA 1V54B 3BVDB 1JZHA 5TK2A 4W9ZA 1IKOP 2TSBA 4KOBA 1KGYE 4N4YB 2GHZA 4A2DA 4F7KA 3QJVB 4KNTA 2GSMB 1WA2X 1SFDA 2W8CA 1AIZA 4KNUA 3HB3B 3IN0A 2VW7A 3FPYA 2N0MA 3NSFA 2H5UA 4EF3A 4YSCA 4DP0X 3T6ZA 2EIKB 1OE3A 1PZAA 2HLEB 3SBRA 2BP0A 2HX7A 2QPDB 2XU9A 4CSPA 4GXFA 4YSEA 1R1CA 3T6WA 2PPCA 3FT0A 4G7QB 3IE9A 1NTDA 2YXWA 4F2EA 1OOWA 4G7RB 5F7AA 3QQXA 2CALA 1JZFA 2I7OA 2XX1A 4NB7A 3HEIB 1SDDB 2UX6A 1ET8A 2HXAA 5AKRA 2H3XC 1ILSA 2UXFA 1PCSA 2VMJA 1W6WA 5I28A 3CDZB 1IBYA 3S3BB 1GS8A 3SBQA 5B1JA 3AG1B 3H56A 2PCYA 5B1KA 1EHKB 1PLCA 4WKXA 2Y69B 1E30A 4HIPA 1F56A 1BQRA 1SF5A 2FT7A 1WAEA 4KO6A 2YEVB
chains in the Genus database with same CATH superfamily
2RQEA 1QI5A 3FQYA 4XDJA 4FMFA 1JNJA 4N1HB 3FF8A 4M00A 3C6LB 4GXVH 4S0TD 3VA2C 3SPCA 1L5GA 3U9UB 3WNMA 5EZLB 2WYZA 3ABGA 3UDWA 3DDFA 1ZEAL 1Q90A 2YKKA 4JO5A 4L9DA 3VD4A 2X1OA 1UA6L 3FTYA 1NVPD 2WKLA 3QEGL 1IBBA 4TVPH 1UXMA 3DC6A 2X4OB 2UXBB 5KMGA 5KJRL 1FIGL 5IB1B 3SYOA 1LNUA 1VFMA 3RGVB 2EDRA 2R7EA 5HTSA 2D0GA 2XCMC 2HPOA 4AE1A 3U0PA 4Y4KA 4DF9A 3PWVA 1HT6A 1PS3A 1VFAA 2WVUA 5FM5O 2P43B 4NXMB 3LEYH 1A02N 1GN3A 2XY1A 5IP4A 4JE4B 2GABA 1EN5A 4IHBA 5JIPA 5GGUA 3QUYD 4X64B 4K5LA 2KZWA 1FYJA 2BNQE 3DXAB 3KEHA 4L9LB 5IFAH 1U2CA 4JM2A 1CFTB 1HHKA 2F5BL 2FCBA 4JV5B 5AG9A 5AUMB 2AHZA 1XF5B 4U1KA 3ABKB 1D5MA 4N2MA 1R3KC 4W4LA 5FO7A 2L8AA 1FH5L 3U7YH 4XAWH 1Q9KB 1MCDA 5GHWH 3L3OC 4NENA 1U41A 4R7CA 2PR4H 4PJBB 1R17A 4Y9FA 3MAWA 2HT3D 2HT2D 2NY5L 2ZPKL 3UZEC 1NUDA 2R4RL 4RH4A 2COVD 3IJ8A 1XXDC 3ARFB 2PXYC 5I1JH 1GYCA 3O11B 4FMVA 4R2GB 4LKXB 4LFAO 1GGYA 1IKFL 2XKNB 3PGFH 4GQZA 1QBAA 3FQ4A 1WAAA 3GMQA 4EZLA 4GKOA 2GCYB 3T0EE 1KWKA 4UCFA 1LP9A 3CRCA 4YBHA 3V4VB 4ECNA 1D5BB 2HX9A 4DEWA 3P11L 4L4TB 1K7DA 2QR4A 4PS3A 1GAFH 2A6JA 2LLNA 3MLSH 3HN5A 3HA0A 4ZMQA 4ODTL 4TOYL 4UV4L 3IDIB 5IVXA 1QBBA 7PCYA 2WQRA 1XGUA 3P77B 4G42B 1MKFA 3LIUA 3UT5A 4ONHB 4JKPH 4L8JA 4OM0L 3ZHQA 5JORA 1IDSA 1RZ8A 4PLJD 3ALPA 5GXBB 3DX8A 4BWWA 1AGCB 3B7RL 2GUOA 3T4AC 3KXFB 3SDDD 3UTSA 2PYFA 3OAUH 2DMBA 2LR4A 3BUQA 5C86A 3T1HO 1A65A 2FEJA 4I9WE 3JYCA 4NCC2 1PPJH 5BOPA 1N0XL 4U6YB 2MSPA 5E79Z 4QIRA 4H25A 3FTXA 2YUXA 5TDOB 2FUQA 4JUSA 3WDHA 3GB7B 1M3JA 4G28B 4FQQA 5F8QC 1AG0A 1NWOA 3HC2A 3P30H 4KKNA 3TGUH 1IGCH 3IDJA 2BRRL 1IBLO 1YLBB 3B09A 4P0DA 3VI3E 1A3QA 1AI1L 1E79G 4MS8D 1BZ9B 3WHXA 4OSUH 5HD8D 1FCCA 1MCWM 1NM4A 4GG8A 3TBSA 4A7GF 4K3DH 4E42A 1V55C 1KLUA 4PI0A 1WA0X 2FO4B 1TQBB 4FYQA 4R0LA 3FK3A 4YHLL 1TYEB 2WQ8A 1IBZA 1KBWA 1QUNB 1U3JA 3W11C 3VFMA 3DTDA 4PTTB 5L7XL 2JXMB 2EH8H 2KPNA 2P5WE 1SN0A 5E8OA 4N25A 1MABG 12E8L 4GRWF 4NRXA 5HVHB 3LZRA 4HAKA 1E28A 4W68A 4ZI7A 1LO0L 4X6FB 5JYMA 2BVTA 4X83A 5ELIA 1AC6A 4IRSC 5ISZD 4A5UB 3K2UH 1F41A 3NVQA 5D8JL 3D25B 3FB5C 2IDCA 2EYTA 2R1XB 3ZHKA 1O6SA 1DQQA 3JAWA 1FVEB 4LNVA 2O93L 1SF9A 3KPPA 1SERA 4ZOLA 4JFTA 4NO0A 4NM4H 5IESL 2F53B 3DC0A 2WN2A 3GSQB 3DI2B 3L5IA 4LSSH 4Q52A 3CSFA 3NEOA 5HHNA 2Z35A 3GBEA 4P5SA 3P54A 1I9JH 2BZCA 5BO1H 3CFIC 2OP4L 3A0HZ 3QIBD 5HYJA 2R0KL 4MD0B 1JZIA 4F15B 3K8MA 1SHWA 1Z5LA 3LNEA 3E8FA 3TJTA 4TSBL 4ZXBC 3V5HB 3OMIB 1FL3B 1LWRA 4Q6IB 1JMXA 1PP9H 2W60B 4IOSD 1XV8A 4UFZA 5FW6A 1JERA 1RSOB 3SKOA 3SKMA 3VWJD 3UG3A 3CVCA 5HGDA 3BVNB 4O5LL 1DDHA 4CC6A 4HLZG 3SDCD 2JWYA 1A64A 2E59A 3FBKA 2XOTA 3QNXB 1HTYA 1P7KB 3HI6L 2MKWA 5BZWB 1M2VA 4LOFA 3RIAF 1NGQL 4S1DC 4PM1A 1KNOA 4AWJC 5IW6B 5HY9A 3T3PB 5L6YL 1YHQV 1JZ2A 4MXWL 5KSAB 3QUXC 3EF4A 2PYLA 2ZG1A 1DUZB 2O4EA 2OMXB 1MRCL 2B4CL 1Z6JT 3IVKB 1E9PA 1J0JA 3IM1A 2ZX8A 1KC8W 5B4MC 5LGHH 4N2FA 1WDAA 2BC4A 2W9DH 4OQTH 4QDGA 3KPRA 2HR3A 2OX5A 4HS3A 4LLVB 3OAWA 2G9HA 5D93C 1FH2A 5BVJB 5I74C 3U36B 1WIOA 1FL5A 4Z76B 1MELA 5I5JA 5JIKA 3LDDA 2GJPA 1A9BA 1FSKB 3V5KB 2H1PH 1KTRL 1FZKA 3FAVA 4F9PA 2VC2L 4FXGA 3CQQA 3SJVE 2ZM6O 1MXDA 4YHYB 3KPNA 5D4JA 4B5ZA 3SGEI 2IALB 4GRLB 1I4FA 3FB7B 3ZN6A 2I9TB 5KYNA 1Y0LA 2EIDA 3D12B 5FB8A 1XGPA 4JQIH 4A68A 5KBLA 3TCUA 3EJYC 4WI9A 3QCTH 5KYWA 1MVFA 35C8H 2NCMA 1F4XL 2DLFL 3T1YB 1JGVL 3G5YB 2X88A 4NQED 4LF5O 3TOPA 3WL9A 2C3GA 3WEXA 3MRIA 2MTAA 5LNDA 2ZX7A 3A67H 3RNQB 2BXZA 3E0GA 4JI6B 3MXWL 4PELA 5HHXH 2X6VA 3FQRB 4LLWA 3T9WA 1QVGU 4ZUSA 2BSKA 3MHSC 3MBXL 2HHHO 1UHVA 4PJFB 4YVUA 2M83A 1U95A 1K5SA 4DR5B 3EZ8A 1QBLH 5ABAA 2A5UA 2V2XB 1TT6A 4H0IA 3K7UA 1QYGL 2YOCA 3D06A 4N5ED 2FB4L 3WY1A 2ZSVB 1CGSH 4HUUB 1I1AC 4IKJA 2CTRA 5DJ2A 4JZJB 4KVNL 1UYWH 3L2LA 1ZS8B 2Y7LA 4PGDB 4L29B 2FL5A 3QUYA 1H8OA 4OD2B 1RLWA 3ZMUA 1RPKA 3NDYE 2FT6A 2DJMA 3D5OF 1ESOA 2AS5M 1M9SA 4CC5A 1C1EH 2JJSC 4ZFOL 4P46D 4HAFA 4WGVB 5PCYA 3CN1A 1I1FA 3LHAA 4NQDB 3F12B 4ONOA 4WUUE 2QQNL 5JHLA 4H1LA 1YMHA 3F7KA 1EEZB 4NCDA 1YUHA 1CURA 3ATAA 5BZXA 3BPNB 2XACC 4JZGA 4JRYE 3MBED 5BVPL 2DS4A 1X44A 3JBG7 1H3WM 2UY7B 4ODHH 1R3HA 4XXDA 2OXHB 5JLZB 1IFGA 1D6VL 4Y4HA 2F74A 5CBGA 1I3GH 5GQBA 2OT5A 3HNSL 2L0DA 3GI8L 4IMKA 5T1DL 2G3MA 2MQ3A 4EBQL 3IRCA 4JI5O 1VFUA 4JPWL 4WW2B 3JV5A 2R56H 3I2CL 4E5XA 2QDVA 4UB8Z 3DJSA 1I8KA 2Q8BL 3P1VA 2GFBA 1J1PL 3GF8A 3LHPH 2BOCA 4XPGL 3W1ZA 1K8IB 5I6MA 3OMNB 4L1SA 1N2RB 2ITDC 1TF4A 4Y2DD 1G1OA 4HQQH 5IJ9A 1SRYA 3RVZA 4HHAA 3NJIA 3QIUB 2I27N 1S3KH 4NBZB 4BE6A 2BNRD 5BMVA 4YZFF 4K5OA 3K3WA 3REVA 4U3FH 1HL9A 2IANB 1MFEH 3UKMA 1XF4B 4HF5H 3SDDA 5FHAL 4JDEB 1TSHA 4LIQE 2FH8A 1I7UA 1EH9A 4MMYB 4WUKL 3CH1A 1BVZA 1UXSB 3GHBL 3K1KC 4KMLB 3OTOO 5IM7B 1HSAB 2WKOF 1NUGA 4WFGE 5IOKA 2IV9A 3BAEH 3JASA 1CTMA 3K4DA 3PGCA 3D2TA 3L3JB 1S9WA 3L1GA 5FUZH 2DBJA 2Z0UA 3GO1L 3EGSA 4LOEA 4AG4H 5DS2A 3QAQA 2BHYA 2FHBA 5L2JA 1QNZL 3CGTA 3HS0A 4IGBC 3LQMA 4Z18A 2HJLB 3CC4V 5CP3H 4PJDA 5H37G 4HOZA 4FJZA 4LLDB 2N4IA 5L2KD 1P6WA 3M45A 2VR9A 3PWNB 3S96A 4Z3JA 2GBOA 1Q5OA 4ZHQB 3RA7H 5IHZA 2SODB 1IL1A 3ROOA 4ABWA 3ZQ9A 4LF8B 1Z2GA 2Y7QA 4IHJB 4N20A 3OE7G 1JWSA 2DWDA 2KLTA 4NJ9H 4FQ1H 5ISZA 1P84F 4PWIA 1TZIA 3QE5A 2CBMA 4X7DC 2DQIH 2BERA 4P2OD 3UTPE 1E0OB 4NPYA 3TJEL 1I1YB 3HC0B 5H2BA 3U0TA 5FKPB 1H2SB 2G75B 3BKMH 3NSJA 3TIDB 4JI2B 2B59A 1NLBH 3HNVL 1A6VL 4QD2E 4W9FC 4W9HC 3RB7A 5F3BA 4DW2H 4BFIB 3DSNA 1MJUH 2ZUQB 1RVFL 3F83A 5IE9A 1NGYA 1N5YL 1RPOA 1A7OH 1P4IL 5F7EH 3QIBA 3QYNA 2YGNA 4DCQA 3H42H 3MLXL 1RK1A 1KJ2B 3CXHK 5D5MA 2Y36L 2D4DA 5BS0D 4UQEA 1HXMA 5D2NB 2OIGA 1NCWL 1CWVA 3GS0A 2GTQA 4FI6A 1EAOA 1JPST 1UM6H 1T3FA 3A6OA 5HHMD 3VWJA 3GSVA 5KW9H 3LDBC 2BVQA 1OHZA 3QCUL 1YYML 4Z7VB 3O6FA 5I0VA 4EI0A 1P84J 4BUHA 1MHEB 1YPZB 2H5UA 5CU9A 5KS9F 3FUMA 4YK4B 3EYOA 3IWUA 3HKEA 4DR4O 3N1QC 4MAYB 3JALB 2VRQA 3B56A 3ASNC 4YY3B 1H38A 1FGVL 4IHOA 3LN5A 4R7VA 5I1DB 3SO5A 4XO3A 4Z7NF 5IW3A 3T6WA 3MJ7A 4G7QB 5J1AA 2X4UA 2O61B 5KJ4A 3F6LA 2CH7A 4N90E 2CTQA 2CUMA 5SWSD 4Y5VC 4HNAB 1W0WB 3FAXA 4W4NA 3NZUA 2KUTA 1EHLL 4YGVB 5EOQH 2UXFA 3UTQA 4F33B 1JS4A 4NAMA 3RVXD 2XV6B 1EHXA 1DVFB 1ZVSA 2ZINA 3FMGH 3KL5A 4LSTH 3TA3C 5J8OA 3O81A 2XWEA 3PV6B 4JI4B 4XO4A 5DJAA 2HPTA 4B0MB 1GS8A 2CUIA 4BRJA 5F71A 3SBQA 1S8DA 1OARL 3F58H 2YA0A 2OIEA 3L70H 1PNMA 3D4YA 43C9A 1IILE 1PEZA 1ZTXH 2X40A 3L08A 5I8OL 5KG9A 2JB5H 1NTMH 5ADOH 4UVBA 3L4UA 5C7ZA 1DVZA 4AL8C 3SJBC 4FQ2L 4DGYL 1K92A 2V5SA 3HR6A 2WNGA 2GBVA 1RZIB 2NY1C 3OPZH 1D7BA 4PCKA 1T89A 5TDNA 1YEHH 2D3VA 2AZUA 3H7BA 4K3AA 2QGBA 4E2OA 2VS0A 1MZYA 2E27H 1MZEA 1OHQA 4Y9BA 3V0GA 3ZIYA 5KSBA 1ODAA 3EYVB 5JZ7C 4CS3A 3OKKA 3CN2A 1AIFA 1E1QG 3MV01 3PDOA 2PO6A 3U30C 1CQYA 4LCCB 3FB6C 3EO9H 4LFCO 1DVTA 2GC4C 4PB0H 1AS6A 1SZNA 1VQ9V 4JDZB 2H4EA 4N0CD 1T03H 2JIXA 3C2SA 4LEXH 4F7TA 4N0YL 2F58L 5EEYA 4ELMF 2HN7A 3VDAA 3NXSA 1AD9A 2AEPL 1OGSA 1WISA 1CFQB 1UZGA 2WA3A 1NAMA 1X4YA 1F4WH 2F2HA 3I02B 3KPLB 4WQOA 3ZE1E 4F9LC 5L3BA 1OGPA 1T83A 3Q5YA 3T0WA 1QLFB 1COWG 1IXMA 2JGUA 4X64O 1KEGH 1CI5A 4TRPL 4P46A 4XP5L 4UQIM 1FZOB 2Y5TB 1RERA 2CM5A 4Y2LA 4ZBMA 3RAJH 5LYJA 5E5MB 4MQTB 2J1KA 4E68A 2V7NB 4LVEA 3L7EA 3KJ6H 2AI0L 4FZ8H 4KRPB 5DLML 3H1LH 2EJ7A 3CXDL 2XFXB 4JHUA 5DDHB 1YI2V 5C0RH 4NTYA 1RU9H 5L88L 2JV6A 3QFJD 1NDTA 2WWWA 4GKSB 4NN7B 4FABH 1JPTH 3F62A 3CX5K 1C7TA 4O2FA 4Z7OF 3FRPG 4HV8B 4D9RD 5IB5A 3BIBX 3BXNB 1RIVL 1F4YH 1KPRB 2DQEL 4LEEA 3U4EB 4Z5RB 2HFEB 3O4LD 1J8HB 1LK2B 2P5PA 2VXUL 5DD3H 2VSDA 3D0VB 3IBEA 2DKUA 4LSUL 1AACA 4QOKD 3QZPA 4AV0A 4BDVA 3MOAL 1UC6A 1NMBH 3LCYA 4BFOA 2XX0A 2JLLA 5ITBH 1QATA 5CCKH 2LU5A 1CJYA 1U8OB 1UGKA 5E6IA 1F13A 1GOHA 3ULSA 5F44A 2BNRA 3EG9A 3ETTA 3PWLB 1FBIL 1IIKA 8FABB 3PJNA 3KG5A 2F18A 2BH0A 1SQVH 4ZPTB 1R24A 1AR1B 1DLHB 1AMXA 2UUDK 4S1SH 5ID0B 1XVSA 4YZFE 3TN0C 3AS3A 3LNNA 3U7WL 1LK3H 3AITA 1ZIBA 3X11A 2QHLA 4WWKA 5DQDH 3GLEA 1FNSL 2DQDH 4ZYKA 3GDBA 2FWLB 3INUL 5DMGC 2VXQA 2P90A 4UILH 3ZDYB 4LQFL 3DGCR 2C7UA 4W6WB 1KYDA 4M1GL 4ODBD 4U6TA 1DBBL 1ES0B 5LA6A 1XZ0A 1GM7A 4PJAB 1OTSC 4X4MA 1ZXKA 5H5NA 5AOJA 3WUWB 1ILUA 4M7ZC 4OT1L 4Y1AE 1JPGB 1KXVA 1A4AA 1UD8A 3JV4B 3SZ6A 2CXGA 3VVVA 4KK8D 3IMSA 4E0RA 4NKOA 1SQGA 1H9VA 4AYID 3IJSB 5LHGA 4NZRH 1MI5E 2ZXBA 4DN4H 4MW3A 1JZJA 3HAEG 1AHKA 2K6ZA 3LXUX 3X17A 1LE9B 2HX8A 1ZEAH 1FPTL 2YICA 3U6RB 1G9ML 4JFXA 3AK2A 1UA6H 3QEGH 3Q3GB 2WP3T 1I3VA 1C5BH 1E4JA 3ZGIA 1J10A 3JV6A 1BG1A 1FIGH 3EGXB 3NRPA 2H2SC 3HZVB 1UXWA 1MSDA 4P2RA 4L87A 1U8JB 3EFFB 4BFFA 2OSLB 5EF1A 5C08E 4OKDA 4YLBA 4YDNA 2VXSH 5DEFA 2NY0D 2XA3A 2YARA 4C4UA 5J13B 4GG6A 3F7LA 2ZCKL 2FRGP 5FNVA 3EFFK 1FAIL 2E6QA 3DGGB 3LSSA 1P1ZB 1TMCB 2OSWA 1F1GA 1VP7A 2QBWA 2P7TC 5F1IB 4JAVA 3WHE1 1Z3RA 3KR3H 5HGAA 2C4FT 4FXKC 4QNPE 2F5BH 3RFZA 3ENEA 1KGCE 2QGEA 3JATB 3ABTA 4M5YL 3UPAA 4AUJA 1ADWA 3DVIA 3RPKA 2Q7YB 1HOEA 2QGCA 2XZZA 2EXTA 2ZP0T 4MMXA 3VWKC 3UGEA 1IFHL 5J9PC 5JW5B 4HIHA 3IDNA 4DR2B 3X2QB 2NY5H 1PZ5B 2ZPKH 2R8SH 2R4RH 4PD4J 4R97C 1WPCA 2GK0B 1YUKB 3CZJA 4PRDA 1UQSA 3QZWG 1PEWA 1IKFH 3JZYA 4WEUD 4LPUA 5SWSA 3QAZB 1IVTA 4XMWA 4IGGA 5H35A 2GITA 4PDRA 5FPRA 1OAJA 4HJGB 3OVUB 3U2IA 2NY6C 5T5FL 3P11H 2MPAL 3M17A 3SQOH 3I55V 3HE7D 4EUPA 3GXDA 3UO8B 2XYCA 1JZ8A 3D3IA 1J8KA 4DV3B 2WMPB 4ODTH 4TOYH 2IGFL 1OP5K 5DUPL 3WTVA 3LEXB 2EJ1A 5LGYA 4AI8A 1G9NH 4PRPE 1IUZA 1V8HA 2QPSA 2BP5M 5FPIA 1JZGA 1NQTA 5CN0A 4KY1L 5C6TL 5HHOB 2G2PA 3Q6FA 5JPNA 2ATKB 3GTTA 4XB8A 2C9VA 5C0DB 3D85B 5MHSD 2N04A 4KMTH 3KLLA 3O2DA 3QEQE 4DR3B 1U92A 3O8XA 2EJRA 4PJIF 5A7EA 4PBVC 4MD5A 4XBEL 4JFFD 1TETL 5SX4I 3L71H 3SE8H 1YDPA 2WWMC 4BH8A 2F53D 3QBTB 4HWBH 5GS0L 2F93B 3BGMB 3ESNA 3PQYD 4NP9A 1CG9B 3APOA 4B60A 1EJOL 1VESA 2BRRH 3AABA 1P4UA 2CUGA 4DR5O 4ORGA 1OAQH 4XMUA 2DZEA 4UV7L 4AKQA 3TF7C 2XWTA 1M1XA 4HU8A 5DFVD 1G94A 1MHHA 1K6QL 4ZSOA 1MWAA 5LCVA 2N56A 3FCTA 1MY5A 3BP6A 4YHLH 5T1LD 1KCRL 2JCWA 3DRQB 1X3DA 3C6EA 4WFFE 2YZ1A 2CCVA 5L7XH 2XG5B 4MDJA 4HT1L 4MWFB 5KYXB 12E8H 1IBFA 1MHPL 1T5WB 1MFDL 4NERA 2VDPH 1JVKA 2CJSA 3HBPA 1EDYA 3LPWA 3MRBA 2BVOB 2I25N 4KVCL 2N0KA 3JT0A 4IU3A 4HJSA 3FONA 1GPOL 5D8JH 2PN5A 4ZMWA 5B3JE 5I2IB 2NSQA 1XBDA 4Y16C 1SLUA 3UIZA 4FQJL 1OT1A 4JN2B 4MB4A 1EN6A 5IESH 1NC2D 3TYFB 1UFIA 5C0IB 5I1CL 3GTNA 2UXCB 3L2NA 5EORL 4I89A 4IIJA 4OGAD 4N22A 5E4AA 4WU7B 5I5RA 1HH6A 2ZSWA 2OP4H 4YDZA 2E4FA 1AGBA 3HG3A 1AFVL 2LTQC 3BFWA 4LCUA 4ORZC 3DBSA 2X6AA 3WN6A 5HYEA 4TSBH 3RN4A 1EAJA 4GRLD 1FV1B 1UJ3A 2XVKA 2IFFL 4BQBA 3AZUA 2Y5EA 1U8CB 2YAFA 2QELA 2WYHA 4UF7C 2F54B 4N8UA 4PS8A 3V0VA 2J7LA 4QPEA 1NGWA 4LEOA 4NUJB 5KANG 3GRBA 1AYOA 1O6TA 1SJMA 2ZUVA 3HI6H 4HPYH 3OJ2C 1X7TA 5L6YH 3RUGE 2I69A 3FCGA 3GGWB 3DIVA 4MXWH 3U9UA 1HWYA 5EZLA 3H1IH 1ZK5A 2B4CH 1R3LB 4MNGE 3NFNB 3HG1D 3RWDB 4DPAX 4BQCA 2M26A 1GS7A 4YNYB 1OSZB 6TAAA 3ZIMA 4UOQA 2X4OA 4J3TA 4GP5B 3CDGB 3EH1A 1IAIL 5IB1A 3RGVA 4G1EA 3L8QA 4M6NH 4UOW0 3VXUB 1U8QB 3PIQB 4U31A 1VQ4V 3U1PA 4FQIL 2PW2B 2VC2H 5LGTA 4LPXA 1I9RH 3H3KA 1NPNA 1PNCA 1B04A 1Q7YW 4OI7A 2VM3A 2ZWKA 1NBYA 3QXWA 4P4KD 4YZWA 5LOVB 1CYWA 2IOIA 3DRTB 3QDHA 5CEZD 1ND0B 3CVIH 5GZND 1N70A 1T66C 3L4XA 2Q9LA 3DXAA 4X6CB 4LGSB 4L9LA 2ZIDA 1AXTL 1F4XH 3V8OA 4LMQI 3MCKB 1CFTA 5K9QI 1JGVH 4GQQA 1DQIA 3BUIA 5AUMA 1XF5A 5D5PA 2Y7NA 4JFPB 4ZTOL 1K4DB 2NW2B 1WC7B 2VLME 4LLMB 4NQDD 5FHBL 1TJHL 2Q7HA 3RL1B 1JZ3A 2KHAA 2V7HB 1Q9KA 2YXVA 4JVWA 2XT1B 1NAKL 3B9KC 3DV4B 5H4YA 2VZUA 4PJBA 2EC9T 3MBXH 4AJWA 4YN3A 3ARFA 4NWUH 5HHVL 2MPVA 4Z8FL 2C7FA 3O11A 2JLPA 3R7QA 3PL6D 2XKNA 1QYGH 3ZMTA 1CCZA 2IAAC 2HMID 2FB4H 1T2JA 3UP6A 5E23A 2GCYA 4J9ZB 4KVNH 2VW4A 4FVMA 3V4VA 2QE7G 1D5BA 1JZ5A 5KHIA 4TQFA 4CU7A 4F4LA 4L4TA 2QLVB 4JPIB 3MYJB 4F27A 1DHKA 2EDWA 3CZSA 3T2NH 3IDIA 4KNTA 5FM4A 2CSPA 3P77A 4D7PA 3US9A 2AW2A 3QVNA 4H13B 4ZOAA 4G42A 4KKCD 4KNUA 4LFBO 4B7KA 1WFOA 4MB5A 1I5XA 4ONHA 4UT6A 3DROB 5AB0A 2QQNH 4XBPB 2GBTA 4TNWF 5E1GA 4YSCA 1ZSPA 2EIKB 2CRIA 4FHJA 1AGCA 1G7PB 4D9QE 3R1GH 2NZIA 2OSYA 3KXFA 2H0FA 2Q7NA 5I6XB 5I9QC 2IAND 4XMVA 2YD0A 3BN9C 4ZFQA 5CD5C 3IGAA 3T09A 3CP1A 2FECL 5ICYB 4U6YA 4LB8A 5BVPH 2PTTB 4G6FD 1QRNE 1OGAD 2QWQB 2FYYB 3ARBC 3GB7A 4OZHF 4IOIB 4XP6L 1JWUB 3CZLA 3EBIA 3HUJE 2CA4A 3BH9B 3VFRB 3ARED 3T0BA 3UTTE 5AB1A 4HG4J 1B3JA 3OR7B 3T0XA 4NQVB 4OCMC 2W0FC 1HNXO 1RL1A 4ZW7A 3RVWD 2KZ1B 1B4JL 1BZ9A 1TUBB 4JPWH 1X5KA 2LJ2A 2VZ3A 1PIGA 3C87A 3I2CH 3Q0HA 2IG2L 3MRLB 4J10A 4YHIB 4OLUH 2EULA 1J1PH 4EIUA 4PVMA 4PLNC 4WKXA 4N2LA 2FO4A 4KHTL 3US0A 3B1TA 3QUML 3BPLB 1QUNA 4UTAA 4RVBA 2FQEA 4J7KA 3BVXA 5SX5H 2JXMA 3M8AA 4TXVB 2FIRT 3VMPA 2A83B 1NAML 4NC1C 3QQ3B 1T5EA 4OIBA 4X6FA 1CO1A 4E9WA 1E4HA 3D25A 5FKAB 2R1XA 2ATAA 4IIQC 2XBTA 2J57A 2EH7H 3HFFA 4JFFA 4WUKH 4RFOL 1FVEA 2JVUA 2IH1B 3GHBH 4BD4A 1S5HB 1SPDA 1HFUA 2KZKA 3QJZA 4PJIE 4TSCL 5BV7C 2F53A 3GSQA 3ILQC 4I77L 3J27A 1H2MA 4HZ1A 4FYRA 2C1PB 1X5AA 2CE4A 4DV0B 4AQEB 4AQ1C 3K0WA 4JGMA 1MZFA 4D0DB 2G38A 3V0DA 2LGWA 2E7CA 2QQLL 1A66A 1AI6A 1OVZA 4MD0A 2BVUA 3K6DA 4OFYD 3V5HA 3SN6N 5L8KB 5K9KB 1FL3A 4Q6IA 4FG2A 1VQMV 2XN9B 2W60A 1OB1B 2NZ1A 1RSOA 3QWOB 2WGXA 2WTPA 1HCFX 5FYJU 3AY4A 2CIIB 3BVNA 1Q82W 4IBSA 5JIDA 3E38A 4W6XB 2GY5A 3SDYL 2A1WL 3QNXA 4XWOD 4P9PA 3CB2A 5JQGB 1P7KA 1WZLA 1MCSA 3DDGA 3MR9B 5BZWA 3L17A 5FYLD 5IW6A 3IDYC 4MDRA 2X38A 4K5PA 2UUBB 2ZCLL 1QLEC 5KSAA 1J5EO 4B9ZA 2GUYA 1DUZA 2VB5A 1FI8C 2OMXA 3IVKA 1JFFB 2EP6A 2GSIB 1ASQA 3Q8AA 3SO3C 2IPUG 1OT2A 3NIFE 4LLVA 4QRPB 1BXAA 3HNVH 1SBBA 5BVJA 3U36A 5ESQB 4AIOA 2FEEL 3JAKB 4Z76A 2DMGA 3W0WB 1RVFH 2X1XR 1WAAE 3ATEA 1TEGA 1IVSA 3V5KA 5CUSL 5K59E 1A6ZB 3O9WC 2WUBL 3MLXH 1LP9E 1CFNA 1Y6XA 2XAFA 2B9ZA 3BD3A 1J5OL 2IALA 2Y36H 4GRLA 4BK4A 2I9TA 3V55A 5KTEL 5EFIB 4MVBC 1TLMA 3UPRB 1IBHA 1YYMH 1TTBA 2VXQL 5D7HA 4OZIA 2MIZA 4BK5A 5E2TL 4GBXC 3WU2Z 4CH3A 3G5YA 1RULH 2H8PC 1M71B 2BCMA 2DLGA 3P2TA 4PIBA 4QIWF 5IJDC 4RDQF 1OP3H 2YMXL 4ZNEA 3RNQA 2BOLA 3RBZA 3SGIA 4EVNB 4UCUA 1FGVH 4UNUA 5GS1C 3UTSE 4ODVL 3FQRA 1SLXA 2WO2B 4B3RB 5DUBB 4RMQA 1AI4A 4PJFA 2UXDO 3KHQA 3RTLA 1NKOA 1FYTB 4G8GE 2QVTA 2E76C 4MTMA 1EHLH 3D07A 2V2XA 3VNYA 5KZCB 1TITA 4JDVB 2ZSVA 2AK4E 4HUUA 3RI5F 1QVFU 4I3SL 1FXVA 1N32B 3I3DA 4JZJA 1O9WA 1OARH 3P4OB 1ZS8A 3OBAA 4HUXB 4PGDA 5E5RB 1IAMA 4L29A 1GKEA 3FSOA 4NZFA 1VFOA 5I8OH 4F2ME 5AVQB 2ZYIA 4OD2A 1IBGH 4FAAB 3RX5A 4UCTA 3DKHA 2KDGA 4UM9B 4XN1A 4DGYH 4I0XB 1A7BA 2EIEA 1X7QB 4QXUL 3NEXA 1F2XK 1SHSA 4KZEL 3DUSB 2FX9H 3U6XA 3WB1A 4NQDA 4YLCA 1DSFL 3F12A 5JW3L 2LT9A 4TLUA 4B9KC 4X9GA 5F6HI 4DAGL 1EFXB 1EEZA 4KRPD 3DHMA 3QI9C 4LFHD 4PLOB 4UCRA 5SWQB 4Q20A 3LKRB 1F0LA 1ACZA 2XI9A 1Q43A 4LU5L 5A2AA 2DWEC 4RQEA 1IC5L 3N42F 3ECWA 2VZ1A 2UY7A 2N01B 1HJCA 2OXHA 4N0YH 5JLZA 5FS5A 3QNEA 1J87A 3IDXL 1VSCA 3VRJB 5EWIL 1D2PA 3CE1A 4JFZL 1BA9A 1F7YA 1M1SA 2ILLA 4B50A 2DM7A 3GRWH 4UB0L 3Q01A 5HDOA 3D69B 4E9RA 4WW2A 3P3RA 3BUYB 3BDBA 2CAKA 2PMZA 4HIXL 4LF4B 4KK9D 4JCWA 3V2AR 1UGNA 4L0ZA 2NYZA 1K8IA 2XOKG 2G60H 4O9HL 4XP5H 1CS6A 3KGUA 4EIZC 1LDSA 4GAAA 1UOKA 3EJTA 4AEFA 1N2RA 3FUEA 3PF2A 1AR2A 5FYKE 3UFIA 3KL3A 3S9DB 1LWJA 5EU6B 1QQCA 2AI0H 2ZUWA 3QIUA 3BOVA 5DLMH 5C7XL 5DQ9B 5EBGA 4PSRA 3P0YL 2QEXV 4PWFA 2GHYA 2IANA 1XF4A 3C6SB 4JDEA 2Z91B 5E1AC 2OBGA 5EC2C 1DBKH 1EFRG 4MMYA 3KPRE 4QXVA 1UXSA 4OLWL 3OJMB 5IM7A 1HSAA 2YC1B 2ICEC 2WXPA 3AREA 3HVDA 3K91A 4K9EL 4M7JL 4K7PL 1PNDA 4D3CL 1I8AA 4PJHB 5JWPA 1RIVH 4PV1B 1WP8A 1KEMH 1RHFA 4Y4FB 2DQEH 2ZICA 3I9GH 5JA8B 3L3JA 1QR8A 5AENA 3ETQA 3BKYL 1VQ7V 4KNQA 4TUJB 4EN3C 2FR4B 1OCZC 2YRBA 4LSUH 2BFGA 2HJLA 1RUQL 2E8YA 4LLDA 3MOAH 4I7ZC 2WZPD 3BMVA 1NI8A 3DX2A 2ZX6A 4ZHQA 2V17H 3E8BA 2XQYK 2YRLA 3QPXH 5D7LB 4AKPA 3KM2A 1Z7JA 4WI5A 3KPOB 2Q7AA 1QSZA 1ZCRA 5CLXA 3QJQB 1UB5B 4CC0A 5DYFA 1R3JC 4IHJA 2HFFB 1FBIH 3KLQA 4NQQA 3AVEA 1MWAL 3MXVH 5LCVL 4NQCB 1EGJA 2YPVA 4ZDHB 3GBNL 5ESVB 3GS4A 3VQVA 3NTCL 2ODMA 1OCCB 1I1YA 1IKNC 3HC0A 3TFKC 1BXVA 4XDKA 5FKPA 3S8WA 3FQUB 5KBPA 5TD4A 1OF2B 1MCKA 2YEQA 5IROC 2G75A 4XCEB 2D8KA 3TIDA 4W9CC 4BA8A 1I8LC 3INUH 5IB4B 2ZUSA 3C60C 3VAEA 4BFIA 5J12B 1LO3L 3ARPA 4LQFH 1FG2B 3FS9A 4M93C 5GZOA 5I6LA 1DBBH 1Y67A 4AUUA 2BVYA 3X1BA 1KB9J 1BJ1H 2XN2A 3ISRA 3QUZB 4F93B 1AXSB 1GY1A 1KJ2A 3D52A 3N43B 1BX2A 5EBWC 5EBLB 4ZMTA 1FJGB 3Q2CA 4RIRB 4OT1H 2EIZB 5CNHA 5CR8A 5D2NA 2DQ3A 5D96B 5GJSL 3OZ9L 1XREA 5GSVA 5KA6A 1IE5A 5D71L 3OKEB 2VDQH 2P8MB 4TVUA 4GINA 1U8IB 4Z7VA 1PKXA 2WQUA 3JWDH 1MHEA 5E03A 4K8RD 1YPZA 3F5TA 1E67A 3RYMA 4LARL 5FDYA 1AZNA 1G9MH 1UWGL 4MAYA 1NTZH 2GV9A 3JALA 1CQKA 2VW6A 1NU1H 1FWXA 2JQMA 3CHOA 3PP4H 4NFDA 3COOA 4AMKL 5I1DA 5E2UH 4YXLL 5C0CB 2O61A 4MXQD 3H7LA 4XNYH 5CSZB 4HNAA 1E8YA 1W0WA 3I50H 4J27A 1F90H 4M8QB 4YGVA 4HYOA 1PY0A 4QJ5B 2YI8A 1DVFA 3GLDA 3AG2B 2ZCKH 3D9AL 9PCYA 3BHPA 3PV6A 2I60H 4F2FA 1FAIH 3RL2B 5DVNA 2EKSB 3SDCC 1P7GA 4HD9A 5BR8O 1QVOB 2F7QA 3RDJA 5JIIA 3E22B 2DB8A 2ZXEB 3JVGA 1JDCA 4NYLB 1M2OA 1IC4H 4M5YH 3B7UX 4O4JB 4J4PC 5D4HA 4K15A 3CCSV 1RZIA 5HHOD 3F01A 3ZE0E 4WWPA 1N6QH 5TE7L 1M1KW 3TM6A 1CFMA 1EZVX 2BIMA 2KLSA 1DTUA 3CJHB 4QGPA 1S78D 1Z0NA 2DJSA 3D51A 4HJTA 5GS2D 4C83B 4G8AC 1L9QA 4XOEA 1FAKT 2BSED 3CCRV 3F7PC 3EYVA 4NCC1 5DSCB 1BW8A 3CUPB 3IFLL 4KKQA 4QRRD 2VMDA 1F1DA 1XNRO 4LCCA 4TPRH 1WEJL 3ZCCA 1EVTC 3H9ZA 3UQ8A 4DUVA 4JDZA 3WS6C 4YHML 2N7SA 2GI7A 3NSDA 3DVGB 4PJGF 1OV9A 5ALCH 1XCQB 2VDRB 2P5OA 5TDOA 3BGAA 3CFMA 1X5MA 2JF1A 4H88L 4UCSA 4WU5B 4BINA 4MVSA 1IAIM 5DUPH 5D72H 1CFQA 4MJHA 5GJTH 1PNKA 3I02A 4NKDB 2Q8VA 3KPLA 1TQCB 2IAMB 2CGRH 4XR8C 4Z7QB 2XPGB 1QLFA 1XGTB 3FUJA 4RGNB 4KH9A 1GHFL 1G7IB 4N68A 1FZOA 1CICD 2PCXA 4FQXD 1D7CA 2Y5TA 3G6DH 4XHQA 3EFDH 4TUOB 1M05B 2EIJC 4QMEA 2OKMA 3HRZB 5E5MA 4PP2B 3FUIA 4TTDD 5FECB 3CN0A 4TVSa 5ISZE 2GJJA 3DX0A 4OF6A 3CC7V 2FTKA 5D7IF 2XFXA 1TETH 5DDHA 1XT5A 1UVQB 1VQKV 1BZDA 3L73H 3ABLC 4PV9B 2O6CA 5J6SA 5IUCA 3BGFC 4UT6L 4C8XA 5T1KB 3GMRB 2DDQL 3FFOA 2JCCF 3C09C 3PABB 4H1LH 5HBBA 2DN9A 3KEDA 4N28A 3L1FA 4GKSA 5JHLH 1EJOH 1MOFA 3FO0L 1KJVB 1P7QB 4HV8A 4HCIA 4DWHA 1PF3A 4LF7O 3BXNA 4UV7H 4ODSL 3B9VA 1KPRA 1E27B 3BVDB 2L7JA 3U4EA 1K6QH 2B9AA 3K79A 2HFEA 1J8HA 1LK2A 4Z5RA 4KOBA 1F3RB 1KGYE 2Y9RT 3TWCH 1U30A 5FYKL 2OS7A 3MCYA 4R7XA 3D0VA 3ZT5A 4XMPH 1WCBB 1KCRH 4PRID 4ZTEA 3UAJD 2F54D 5IIEB 5E1HB 1SFDA 3QXTA 4HT1H 4M56A 4X6DF 1MHPH 2R9HC 1ZA6B 3K9SA 3ZXAC 1JGDB 1U91B 4KVCH 3TT3L 4EF3A 1I7FA 4FI7A 4UBDD 1OAKL 1ZE3H 4Q9QL 3PWLA 2F15A 1XCXA 3UO3A 3GSOB 8FABA 3HI5L 4UI2A 4BV1A 5JH7B 1A4KB 4N2CA 2K7QA 1N59B 4FQJH 3QVAA 4ZPTA 1DLHA 4RDQG 4UTAL 4UVCA 1P1VA 5ID0A 2F95B 2B9BA 3FULA 3PHSA 3IE9A 1Q8IA 1NTDA 2V3DA 2XETA 1USQA 2I7OA 2MK3A 3VXMB 2BY0A 3GKWL 5JO5B 4L8SB 2FLBT 2X9ZA 1AFVH 2OTWB 4N2GA 3QISA 4C54A 4JUTA 2VDLL 3G9VA 1ES0A 2RDCA 2MMXA 5TF0A 4EAEA 4PJAA 1VPOH 2IFFH 2CIKB 4Z7UB 2VAJA 3WUWA 4J3UA 4PJCB 1JPGA 5EUOF 2WZPA 3JV4A 5EIIG 2Z0AA 1X6LA 1OLZA 3IJSA 1QKZL 5GGVL 3QT2A 5B1BB 2FGZA 3FFQA 1N33O 1QD0A 4NQEE 3KYAA 3UYRL 1GYWA 1LE9A 2MTPA 1BYNA 3B40A 1MFMA 3U6RA 2IEPA 3O6KL 5DRXB 3ZO0A 5K9OB 2ZOLB 1BMGA 3Q3GA 4JKNA 2IW5A 4P9HH 3BP4B 3ETDA 1IAIH 3EGXA 3L9EA 3HZVA 1XIWC 4PJEE 1A1NA 4ZUWB 4FADA 2Q9OA 3BE1H 1AYRA 2R59A 1U8JA 3EFFA 4FLYA 3ZDZE 2OSLA 2UWEF 4FQIH 2XTJC 2GHWB 1B4LA 4LZKA 3VFOB 1YAZA 4LE8A 4YC2B 4Q4EA 2B1AL 4PCTA 4RZKA 2HYMA 4DP2X 2QSCH 3EW3B 2WQSA 4CMMB 3DGGA 3UMTA 1BQLL 1P1ZA 2BNQB 3V9EA 4OGYL 3I9AA 4AXWB 1JYNA 4W9EC 2F7RA 3IMTA 3KW8A 5HHQB 5F1IA 4JFHD 1AXTH 4TLKA 4X7FC 2X7RB 3A6BL 3BYTA 3UTZB 4ACPA 3JATA 3DARA 4ZTOH 1J0HA 5FHBH 2Q7YA 1TJHH 1HHJB 1R1BA 3AWEA 3NOIA 3ZK0A 4RSYA 4F8QA 5I1EH 4EE2A 5JW5A 3FQXB 3X12B 2Y7SA 2UUBO 1PZ5A 2BK8A 4KK6D 2GK0A 4Z8FH 1U3HC 1QO3B 3P4NB 4GW5B 4N24A 3KW7A 1PLGL 3ECBB 4AVJA 4JTCB 1RM1C 5ANME 3V95A 1G1XB 4QRQB 4Z9KB 3HKDA 4DKEH 2X87A 2OLDA 4HJGA 5L0QB 4DV1B 1HKFA 1QLNA 1TZ8A 3N2JA 3PJLA 3OUFA 4YFLI 3WE1A 3VQYA 1EAQA 3HR0A 2WMPA 2AEIT 2IC2A 2PETA 3ZT7A 3LEXA 4NNYB 1WWBX 5D1XC 1P7HL 4PEEA 2ED7A 4BIKA 4DR1B 2ZIOA 3SQBA 1MH5B 1XMQO 1LDPH 3BI9X 5HHOA 4UAOC 1TVKB 1JAEA 1KF9B 1YC8A 2ATKA 2FBRA 4D0CB 2PUQT 3TONA 3D85A 2WLYA 4FNLL 4U2ZA 5FWRA 2BNRE 4A55A 3TO2B 3BLBA 1JNHB 3RRQA 2BSEA 4JF3A 1BAWA 3IYLW 5D1ZI 4NOFA 1QHOA 4P5KB 4HEPG 4KKAD 2V9RA 4XP6H 4PRBB 3MVSA 2A9MH 2FE0A 1ZAGA 4OW6A 4QUOA 5F9JB 3BGMA 4ODWB 1CG9A 3VI3B 3GHEH 3GZQA 4FG6C 3QZMA 2LU4A 2E0PA 4LBEC 3ABUA 4B08A 1FNAA 4P59H 1WBYB 4Y9GA 5EIBC 3L16A 4HD5A 2NR5A 2UVFA 4PJGE 1AAJA 2IG2H 1GIGL 1XSIA 2UU9B 1H6EA 2DWYA 1U8LB 1HYSD 3QDJB 2XN9D 1XXFC 4IBQA 4KHTH 3WYRA 3RDTC 5L2KE 4AVIA 1XGRB 3DRQA 2P5WB 5C07B 1R6KA 2FX7L 2WXFA 2XG5A 4NDMB 4MWFA 5LBQA 4KGLA 5KYXA 1KIQB 1NAMH 5AW4B 1T5WA 5G4NA 1K5WA 3D8MA 1NM9A 3K6IA 3PN1A 2BVOA 4HOMA 1R3KB 5FGRA 3VXOB 2DEYX 5I2IA 1KYOF 3ILEA 3VFGL 4RFOH 6CGTA 3L3OB 5C3LD 5AOKA 2J3SA 2TRHA 4DPCX 4JN2A 4TSCH 1HU8A 1VZHA 2PPAA 4I77H 4KZDH 5AZEL 5C0IA 4PJ8D 4BZ2L 4KXZI 3RU8H 3FU7B 4ANXA 5FX3A 1R19A 2C9UA 4CVXB 1B9ZA 2WLIA 1CL7I 4KO5A 3IB4A 4XPAL 2VLLB 2OCJA 3OX8B 4M1CC 5DJ6B 1FV1A 2ROYA 5BS0E 5AYTA 1KC5L 3S35L 1XBRA 1U8CA 5HHME 3ZDXF 1IARB 2WCSA 2KB1A 2F54A 3GBLA 1TUPA 2A1WH 2RMNA 3OG4B 4U1IB 4NUJA 1B6UA 3CDYA 3LSOB 4F24A 1J0KA 4ZZFA 2XC8A 4J2QA 1R0AL 3MRFB 1KYOJ 1RZKC 4NB5A 3GGWA 2ZCLH 3V7AE 3CBJB 3STLB 3DVFA 3MLTB 4X6DE 1R3LA 3VXPA 3NFNA 2ZNIA 2A9AA 3RWDA 3ZTEA 4LLQB 5KSUB 4YNYA 1OSZA 5BXZA 4DFHA 4UV9A 3T4AB 4WY7L 1NCDL 3UIYA 2RGSA 1HILB 3VSTA 1DSYA 3QG5A 3KCWA 5CAYB 3WEBA 5DT1H 3CDGA 1XSKA 3T08A 1SM3L 3CRQA 5SWSE 2PY5A 2EXWD 4AOFA 1O9HA 1KUMA 1FHGA 4MJIB 3VXUA 1U8QA 3PIQA 3DV6B 5EPMA 4OGXH 4NN5B 1EGJL 1WWAX 2PW2A 2YPVL 5LLIC 2VNCA 2Z0BA 4Y9CA 5M94B 5FM8A 4EOWL 5LOVA 2ZUYA 2CRYA 3DRTA 3H9SB 2BWQA 1TTFA 4P48A 5E2VH 4YDVB 1ND0A 2VITB 2WXOA 5CZXC 3CFNA 5JHAA 1HHGB 4X6CA 1N8RW 3VGFA 3FHAA 4GI6A 3MCKA 1WS8A 4UM9D 4NM8H 4KKRA 4RRPA 4O2BB 3I56V 3WIFB 1KJ2L 4JFPA 1TPXC 1K4DA 2NW2A 1WC7A 4LLMA 1HAUA 4YLQT 3RL1A 3V6BR 4MQSB 1OTUD 1JI1A 2DOCA 2V7HA 1IAOB 4GPVA 4HUMB 1SQ2N 4KUMA 4ODVH 3NBNA 4YHKH 4G80B 3H8NA 1I31A 4H33A 5JVDB 1E8WA 4IRSB 4BAYA 3TA4D 3RTQC 1LR1A 1L9TA 1BCCH 2PWEA 4A1RA 4GEJA 4PMEA 2VQEO 2CGYA 1WHOA 2DI8A 5KOMC 2DMXA 4U3JB 4W9GC 4I3SH 2ADQB 1ZJBA 1SQQH 5EC1C 3SDAC 5EU7C 4WTWA 2UWEE 3KH3A 3APFA 4FNTA 1S2EA 2J8UF 1U6AL 2OJ1A 2OM5A 3KD4A 4JPIA 3MYJA 1CU4L 2AW9A 4PJ6A 1BBDH 1EZVH 4B27A 4DKAA 3DJZA 4ZXBB 4ZSOE 2JKIS 3MRCB 1BFOB 4MVUA 1B88A 1MCBA 4QYAA 4QXUH 5BW7C 3MNZB 5DGRA 2Z92B 4XT1C 2JNZA 1UH3A 5E70A 1RUML 2NXYD 4NNPL 1ORQC 5JHMA 1LEKB 3HFMH 1DSFH 2HRPL 3DROA 4XBPA 2NDGA 2K1MA 2E7MA 4DAGH 5EU6D 3V7AG 3QIWC 1G7PA 4HJ0C 4MVZA 4B3SO 4FQLL 4LSVL 4ZKIA 4F20A 1IC5H 3DI3B 5ICYA 2AJYL 3OC8A 2PTTA 3FZUC 2FYYA 3LZOA 4HJIA 4NQUA 4IOIA 4OZ4B 3QFJE 1ZAUA 3BH9A 1KCVH 5D93B 1RZJC 3VFRA 5A1AA 5FIEA 5I74B 3IDXH 3OR7A 4D9RE 5LGUA 3NCBB 4NQVA 3FT4B 4JFZH 1D5ZB 4H8UA 3V8CA 5E9DD 2DQ0A 2MOVA 3QDMB 4ATWA 4JI0B 1TUBA 4CDGC 1KSRA 1PJ9A 4X80H 3O4LE 4ZG1A 4HUVB 5AOMA 4HIXH 4LCIH 4MJ6B 2K9FB 1IGML 3MRLA 3V4LA 1MEXL 1YEWA 1URIA 3JT2A 1NMCC 3M7FB 4XPFL 4YHIA 4CKVX 4QOKE 5IMMB 2YUZA 5LNGA 2V5YA 2H0EA 4XB7A 2VIRB 1QX1A 3QR2A 4NIKB 4OB5L 4XNBA 4EUPH 1PZ3A 5LVEA 1BMWA 4OVVA 1EEUA 2A83A 1SDYA 2O5YH 3QQ3A 4S1QH 1WFTA 4WENB 1BHAA 3X1NA 3ZYIA 3P0YH 4LPWA 4AIEA 1U3NA 3TT1H 3TEXA 4FCHA 1V9PA 2YQ2A 3DLQR 1S7UB 4NQCD 1G7QB 2R29A 5FKAA 1KLFB 4ZJ9A 3U9WA 4ZFFB 1Q72H 3UCRA 5ACLA 3JCZA 1KENH 4OLWH 2IH1A 1S5HA 4A39A 4GYCB 2N05A 3VSVA 4JI7B 2YA2A 3DECA 3QXVA 4M7JH 3RX8A 4D3CH 5FFOA 5LWYL 5K93A 3O2DH 2RQ6A 2YDEA 1P4LB 2E86A 2C1PA 4FF9A 5D1QD 4PV8B 4AQEA 2PP9A 4U7OA 2Z1PA 4HP5A 1JMKC 3ZRCC 1DCLA 1YNKH 4N6RB 1J7VR 1PV0A 3OMAB 1I1AB 3RIKA 1ZPUA 2K4WA 3QXDB 5E9NA 4JI3B 4IKLA 5K9KA 3VBBA 4KH2A 2EXSA 2XN9A 1RUQH 1OB1A 3WNNA 4HPOL 4V11A 4XCNB 2UZYB 3ZHNA 2AZAA 2RJZA 3QWOA 5F0LB 3PE9A 1MIEL 2CIIA 5I15H 3N04A 4M02A 3ETBF 1SMDA 1OZTG 5JJNB 4HUWB 2NOYA 5JQGA 3BO8B 4MW8A 3MR9A 5F1NB 3RHWF 3ZEDA 4GCZA 1UH2A 2UUAB 2LLGA 2Q73A 1JGUL 1MWAH 4YUEL 5AVWB 1A22B 5LCVH 4CA4A 4ZQKB 5T3ZL 3QORB 3FC8A 1JFFA 4M62H 3NTCH 2GSIA 4PJBE 3BP7B 2XRAL 5CJOH 4OKVB 4B9CA 5IMLB 1G6RL 4X9QA 4XHJD 4QRPA 4A7UA 3HI1B 4PJ8A 4G3YL 2J44A 1I7ZB 4K71C 5ESQA 5IG7B 2GDSA 3JAKA 1JV5B 2NR6D 3W0WA 3G7TA 1CT8B 1LO3H 1IEAB 4FNUA 1BBJB 1A6ZA 3KJ4C 2B3RA 2B3IA 4AEEA 1U2HA 3IJYB 3TVMD 2NTSP 3ETBJ 2PABA 2OYQA 3HPJB 3ABMC 4LSDA 3EJQA 2HKFL 5EFIA 2MHAB 2XPYA 2XNDG 1PZ2A 1LO4L 2YKLH 3IMRA 3JTSB 4ILDA 3UPRA 5GW7A 1PX3A 3EYQC 3L7FB 3PNRB 4BCYA 2X6UA 5AWNL 4A04A 3DX1A 3N6YA 4HXAL 3KDPB 2NY2C 2YGOA 4OX9O 3FUDA 1M71A 4OH2A 1U0QA 1SA0A 1R6NA 4LHUG 5I1HL 3H2WA 1UWGH 5J3HC 4DP0X 3Q6GL 1OE3A 1UD3A 4JW3A 4EVNA 2YWZA 4MA1B 2F8OA 4J42A 1AGFB 1E3XA 4EKXA 2MQGA 4BK8A 4MTFA 2OI9C 2BY2A 1PG7L 4YBQC 3O3AB 5MEPB 3BQUB 2FO1A 3MRPB 3TCXA 1SLVA 1TQVA 2NSMA 3FRPB 2DYSC 2MNUA 3PAYA 4KRLB 1FYTA 4X5QA 2XN1A 3B7YA 5F96L 3QQXA 1XQ4A 1N6VA 2WBKA 1U4FA 4XXWC 1TZGL 5AKRA 4JDVA 3D9AH 1EXUB 3JZ7A 3P4OA 4HUXA 4JG0L 3P40A 4WCYL 3S3BB 4DR6B 3U1SL 4CGUB 5B1JA 4PJ0Z 3W5MA 4WKZB 5E08L 1ZGLB 3R06B 4HBNA 2CDGB 5IREA 5B1KA 2QFRA 4KY2A 3O0LA 3OT7A 4UQ9A 4UM9A 4UCVA 2MCPH 1E30A 3FF7A 4I0XA 4RGND 2DRUA 1VA9A 1X7QA 5F7LB 3DUSA 1OF0A 5IBLD 5TE7H 4EFEA 3K6OA 2ICWJ 3ISYA 4WO0A 1IGTA 1RMFL 3IXTB 3IJ9A 3FTSA 4JNXA 2HLFC 1EFXA 2FEDC 1DVSA 4HMCA 4NHUB 1G5GA 2YAMA 5SWQA 1A21A 3LKRA 4JFFE 1GM8A 1OT4A 2VDOB 3E6FA 1V3LA 4G6ML 3QYCA 3ATFA 4C4BA 5T1KD 4LF9B 2F53E 4IDLA 4JHWL 3PQYE 4CN4A 4C59B 2BHFA 1KBBA 5LG6A 3VRJA 1M53A 1XH0A 3EAKA 4Q9RL 1M5IA 2OMYB 2H26B 4KPHL 3QO5A 4OZFG 4AQAB 1I7TB 3D69A 3TZVB 4Z7IA 5LHIA 4MTGA 4BZYA 3BUYA 5CO1A 1F6LL 3LQAL 2J43A 1TCRB 2G30A 4V33A 5B1CA 3AB0C 1M90W 1GHFH 2AJSL 5T3XL 1F3DH 4I18C 3V4VH 2LU3A 5DMYA 2HSIA 1EX0A 1GH6A 3HAEB 1F42A 4K55A 4P5MB 4QTIH 5AKTA 5HDQH 4F37K 4K0OA 3FQTB 2FO8A 3VU1A 1KP3A 4B6ZA 4OBRA 2HA1A 5EU6A 1KTKE 3T3PE 3UJTH 4DJMA 2ERJB 4R90H 4CKQA 3NP4A 4U4BA 5DQ9A 1QBMH 4JI8B 3C6SA 2VSCA 3CHRA 2Z91A 1PKQE 5LGNA 4Q9CA 4BKLB 4UT6H 3L75H 2Q69A 4RISL 2YC1A 4GMSL 2YQBA 5E4IA 1NCHA 4RSVA 4E4EA 4R83A 3FD9A 2DQHH 3CK0L 4PP1D 4F8TA 4PJHA 5I8EB 3P9WB 4Y4FA 4DV1O 1FFXB 1ICTA 4WWNA 1C16B 4B7EA 1JVLA 1CXFA 2JEXA 5FCUL 5EEVA 4ERSL 3IAGC 4TUJA 1G4RA 1G7JB 2FR4A 3C5ZC 3HE6C 4JFVA 2IH3B 1NT2B 1J48A 4LSRH 5E8DL 3VYOA 3MDSA 2IM9A 3TWYA 2D7OA 4PBXA 1PSKH 1OSEA 1ZK9A 4HSCX 1JNLL 3G6JA 5D7LA 4KTGA 1SOXA 2HP8A 2AC0A 1UCTA 3KPOA 2CBPA 4JB9H 1T7YA 1A9EB 1OW0A 4J23A 4BWAA 4GT1A 1OAKH 2NY1B 1UB5A 3KM1A 4JM2F 5HI3D 4Q9QH 2HFFA 4UT9A 4KHXL 3HG1E 4NQCA 4ACTA 4MZ2A 4ZDHA 5ESVA 3QZWB 4UNVA 3IMWA 4UTAH 4FLZA 2VRKA 4X5WB 3FQUA 4KVPA 5KVEL 4PJFE 3NSXA 4XCEA 3RWJB 1B90A 1R33A 1A8JH 5IB4A 1Z5WA 5D1QA 2K8MA 5HGHB 1DQKA 2YXMA 1FG2A 2EYSB 4E9SA 3ORJA 3LS5L 4C47A 3GNMH 3BFRA 3QUZA 1AXSA 3D3VB 5EBLA 5CEZE 4Y1AB 2HKAA 3LDCA 1KCUL 1UG9A 4RIRA 2EIZA 3KWXA 3ME0B 3RKDD 4FZ1A 2M8XA 1YEGL 4PJ9B 2J20A 3AG3C 3DNKA 3OKEA 2ED6A 1NDGB 2P8MA 3DX7B 1MI5B 1U8IA 3JWNE 1QKZH 1RCYA 1FO0B 2EEDA 4YDJB 4FFWC 2J5LC 3UYRH 1EO8L 2GI0A 2H0JA 3GK8L 3KYKH 4NQDE 5HVGB 1M56B 5HDBF 3O6KH 2RCSH 5HJGA 4X1KB 4OFDA 5FA4B 1C9SA 3ULVL 1DQMH 3B2VH 5IHLB 4N2HA 2WBJC 3WLWC 4Z7WF 4XXCA 4HSQA 5C0CA 2BFVH 2CKBB 4IJTA 4WW1B 5C08B 2RD0A 1HIML 2OSXA 5CSZA 3WV0A 1TTGA 1DO5A 4M8QA 4U1JB 1NOFA 2W9LA 3OPUA 1TNMA 1YCSA 5DM6V 1OK0A 1UUNA 3TC9A 5GGQL 3N44B 1V05A 4M9OA 3RL2A 2EKSA 3ARDB 2E9JA 3MV7B 4I4WB 3AUVA 4XWOC 1QVOA 3GTVA 3E22A 9CGTA 4NYLA 2VERN 3LEVL 3NJFA 4O4JA 3W5NA 3WKQA 1PTZA 4HIEB 1AKJB 5I1KH 3S3CB 4W70A 1HINL 3EKCA 5FYJL 4NN6C 1L6XA 1QHQA 2DWTA 2L7QA 4MCMA 1AQDB 1X9RA 3CVDA 5KS9B 3CJHA 1HZHL 1N67A 4C83A 4L3EB 2IANE 3CYOA 4BFBD 4ZD3H 4MNHB 4X62O 4LSPH 5DSCA 1MLBB 3CUPA 3V0IA 4FLQA 4Z7NB 1OGAE 5CGYC 5J5EA 3DC5A 1L6PA 3TN0B 5CN1A 1GZPB 1IE4A 1L8DA 3L3HB 3IKKA 5A2LH 3DVGA 1S3RA 4GFXA 5KHGA 4E9YA 1XCQA 4FZEL 4QXTB 2Q76B 3NT0A 2UXTA 4HSAC 1EBAA 2J4WL 5TTRA 4WU5A 1V7NH 3O9OA 2ZOOA 5FCSH 2AVFA 4NKDA 2XZQL 1J5DA 3MKKA 3QDJD 2IAMA 1ZLWH 2I5YL 4Z77B 2ZP9A 2GTWB 2XPGA 3AMKA 1XGTA 3E2HC 4AGNA 2N3JA 1GGTA 1NCJA 1G7IA 3IMUA 2ZAGA 5C07D 5CEZH 2G2RB 3ARQA 5IBUG 1LQSR 3LZQA 1M05A 4TUOA 4JM2C 4HCFA 1PD0A 3GT6A 3I75B 5BCAA 3HRZA 2V37A 4FNLH 2JQAA 3QEQB 4AK1A 4HFUH 4PP2A 5FECA 3ZW3A 4M6ML 2D03L 5AL0A 5C9JB 1O6VA 3D39D 3JWNH 1F2QA 2FTAA 1UEYA 1UVQA 5DZ9A 2XJKA 4PV9A 3P4MB 2QLYA 2Z64C 1ZY9A 4GP4B 1ZDSA 5DYOB 5T1KA 4LRNH 3GMRA 5DJ8B 4GOSA 3PABA 1XB6A 3QUKB 2D3OW 1FORL 4KQ3L 2YMTA 1HESA 1NFAA 2PXYD 4DUZB 1KJVA 2VR7A 1P7QA 1TJIH 3OKDB 4Q2ZB 2K6WA 3TJHC 2L4OA 3SYQA 2ZR3A 3BT2L 4LASL 1WFUA 1E27A 1SESA 3VGHA 2I7SA 3U6XS 4GLXA 2X5PA 3TYGL 2FX8L 2IDFA 1WCBA 2F7IA 5AEAA 3QG7L 1N3NB 2P7TB 3NCXA 5IIEA 3F2LA 4Z7VE 2FX7H 4ELDA 5H94B 1NUFA 1JF6A 5FYLE 1ZA6A 1YPZE 1JGDA 1U91A 3HCVB 1JZEA 1W16A 4YAQB 4KUCD 4ABQA 3KPSD 3QCVH 3OTFA 3BWZA 4M03A 1TVHB 4ZTPH 4DV7B 3GSOA 3V9FA 1HHIB 5JH7A 5PAZA 1N59A 4B0MM 4RWYL 5AZEH 4A2GA 3O6MH 1IM3B 2Q67A 4R97B 1QR4A 3W7WA 3NIGF 5FFLA 1D7FA 4LP4A 3VXMA 4MJID 2QTVA 3Q05A 5JO5A 4XOBA 1VQPV 4L8SA 2GC7C 2XV0A 5KVGE 4Z7OB 2OTWA 4KK9C 2R29L 4MRCA 1XMOB 2O57A 1DFBL 2B2XL 3BUPA 4HU2A 4K5MA 4BIZA 4QT5B 1AROP 3UZQB 4XZ4A 2CIKA 3H9SD 3OZLA 4CSZA 4Z7UA 2APXA 5KVDL 4JI0O 3B43A 4WVRA 2A77H 3EYUL 1QG3A 4PJCA 2D3NA 4F3FA 2DLHA 4YX2L 2AV7B 4RFEB 5CBEB 1H0DB 2A4CA 2YUVA 3EJZC 1M4UA 1IQWH 1R0AH 1F8TL 4KO7A 1JG9A 5TQ2H 1BV8A 2NY4C 4GAGL 2MW2B 1LUVA 3NIDF 4MRBA 2DW5A 4MNGB 5IHUL 3QGVA 3W11D 4GW4B 3Q13A 1T2QL 5F3HB 5DRXA 1X5LA 2K78A 1AQMA 5K9OA 2ZOLA 4N2EA 3SE4C 4LC1A 4RA0C 3EOTL 3IETA 2FGWL 1BM7A 3BP4A 3GIZL 2Y0IA 1N5AB 2R2HA 1NH6A 1SM3H 5DS8B 4JBSA 4ZUWA 2D4FA 3R18A 3ZZQA 3TTYA 4R50A 1EGJH 2YPVH 3BX7C 3VFOA 4WK0B 1N0JA 1U8NB 2ZOUA 1AY1L 1GC1L 4MDIB 2CHWA 1T22B 4CMMA 3IDMB 2F19L 5LMNB 4U1HB 4AXWA 2BNQA 3FBQA 4HZLB 3D4ZA 4U05A 2JB6B 4HH8A 3G6AB 5HHQA 4A6YB 4ZXBD 5B3SB 5BRZB 5JXEC 2J1XA 5J06A 2UZPA 5SX5K 1NMAL 1F6FB 3UTZA 3BZ4B 1OJHA 1TA8A 4A63A 1BMZA 4MS2A 1OE2A 5C09B 5B1OA 4XNMB 3UYOD 1HHJA 1PY9A 3GBML 4RWUA 1IAKB 4WAFA 4S1DD 2Y1ZA 3H1JH 3HBGA 3FQXA 4EXPX 3JCUZ 5FL7G 5F93C 4MKTA 3BSZA 1WN7A 2ZYHA 3GVMA 3LSQA 3QUXD 4OCWL 5FR3A 4O2AB 1QO3A 3P4NA 4GW5A 3GFUA 4Y16B 1JGLL 5B4MD 3SBPA 3ECBA 3MZGB 1RSYA 1BQSA 3RGBA 1QQDB 3I3EA 3JD0A 3IAQA 4RUEA 4QRQA 4MAZA 4P30A 4U6HB 5D6CB 1JF5A 1YITV 5DWUL 4Y88A 1MFUA 3DTXB 4U3SB 2GSGB 4DVBB 1U6AH 2ZCZA 4PWKA 4EZJA 4CILA 3F85A 3F7VB 3QDMD 3IMBA 2LTQB 1P9MA 2IXQB 2J8OA 4PD4K 1BG9A 3LIZA 1PNLA 4NNYA 2RN9A 2HAZA 4MCYB 2WYTA 5KVGH 3ZRWB 1G7MB 1RZFL 4X5PA 1MNUH 1QFUH 2AQRA 1MH5A 2GSMB 4NNPH 4Z0XA 3EJYD 2W8CA 2HRPH 3MA7B 3N2KB 4H8QA 3VXSD 3HB3B 3AUWB 2QZ5A 1TVKA 2W5PA 4PJDF 1U8HB 5CR1A 4AZ8B 3RX7A 4D0CA 5DHEA 5I30H 3WO3B 3U48A 1WQVT 3AGWA 4NX0A 4OJFL 3MLRH 3TO2A 4FQLH 1D3CA 4X1IA 1JNHA 3BC9A 4LSVH 1C5CH 4KDVA 4P5KA 4GKKB 3WKML 5I82A 2AJYH 4JYAB 5TF1L 4PRBA 3B2MA 3T2LA 1P49A 3UTTB 2VE6B 5F9JA 3JD4A 4ZAKB 5FWQA 4F7PB 4HH9B 4ODWA 3VI3A 1ZOXA 2AQ2A 3S5LG 4RMWA 1BD2B 5F9OH 2HXAA 4RGOL 2V33A 3PWUB 5MERB 1KBKA 1MFAH 4TLTA 3X3FL 1WBYA 1W6WA 2Q7GA 4F57L 1DBAL 2GEQA 5SX4H 5DTFB 1I1AD 2YS8A 5F2VO 4H37A 4PJAE 4GJTB 3RY6C 1U8LA 1O7DC 3H56A 1HE7A 3QDJA 5DR5H 5IQLA 2AEQL 4FRWA 1EERB 4LCWB 1P2CB 1V27A 4EEQA 4N0UB 2EDXA 2WM0A 1BF5A 2Q2LA 3DHPA 3V0WL 1XGRA 4OB5H 4PRAB 4QF1B 3RYCB 2JS3A 1WTGT 4KO6A 4O4IB 5I8KL 5C07A 3KWUA 4ES9A 1KIQA 2A9HA 5KTEH 1NZRA 1D5RA 4U7SA 2AXJA 1R3KA 1WD9A 2ALAA 4WGKA 3VXOA 4LVHC 2DJVA 2E4TA 5GS0C 3L3OA 5J7CC 5KMGB 4PJIB 4D7TA 1S9KC 1NR1A 1VF5C 4L1LA 3LKNB 3UZEA 2QMJA 5AOLA 5J2UB 1E6JL 1TZOA 1INQB 4PDLA 2VWEE 2VM9A 3FU7A 2WY3B 5D70H 3QH3B 3W39B 5IWAB 4YIQB 3UCQA 4CVXA 4GO9A 5JR1L 1INEL 4XMKL 3GI9L 4HUCA 2VLLA 3OX8A 1R6TA 2ROXA 2VO5A 1COBA 4JDTH 5DJ6A 2XSKA 3TASA 5EF2A 2IBBA 2XQBL 4U3CA 4HPOH 4X5LA 4S1RL 4HHWA 3N27A 3EJSA 3LKSB 4FQXC 4X7CC 1MPAH 3PAUA 4YXKL 4IMKC 1UD6A 4RQQB 3SYPA 1SJVA 4X9FA 2J6EA 3DOHA 1X6NA 4AEHL 3EXLA 2HG5B 1IGFH 2VLKD 3W3BA 4DT2A 4G7VL 4U1IA 3CSPA 2CGOA 3CC5B 3LSOA 4AJYV 1MSWD 1LEIB 2MOQA 3MRFA 2BOCC 4YUEH 3L48A 1JGUH 4K3GA 3STLA 2EILC 3KPSA 4UXNA 2XXMB 3TGXA 1BJMA 1U8MB 5DHMC 5KSUA 3OV6A 4LLQA 1I8UA 1I85A 2XRAH 1DTOA 1I3RB 4NPJA 4GSRA 1CP9A 3T4AA 1GN2A 2CO7B 1HILA 3CPWU 3NCJL 1BLNB 4G3YH 5HDWA 4B53A 1N4XL 2F4VO 4CVWA 2YS4A 4XZUB 4MJIA 3ARBB 3V6OE 3WTUA 1MW1A 2CPCA 3DV6A 4UT9L 3NIGE 5CJBA 4URTB 4L5FL 4RMSA 1AHWB 1CDJA 4I2XB 1SVZA 3WAJA 4MSWB 2W0FB 3H9SA 1KXTA 4CU8A 3WIAA 2HKFH 2HJDA 2D9CA 1YZZA 5KBKA 1LO4H 4B3MB 1HHGA 2WVSA 3RZCC 4MTOA 1GOFA 3ZYJA 4NRZB 5AWNH 2OK0L 1CR9L 4IGBD 4HXAH 3ZN0A 4YDLC 3EJJX 1PAMA 3FOMB 3APNA 4IOFC 5HHOE 2C3VA 3WIFA 4P5TC 1BT8A 2AKRB 5ABZA 4XMZA 3CPLB 3Q6GH 4UOZA 4CDHA 3N85L 3UTSB 1IAOA 4UV8A 5GIRB 3MV9D 1FNHA 3HMXA 4GFTB 4PSPA 3CCVV 1PG7H 4G80A 3CN4A 5JVDA 2V2WB 1FE8L 3IF1B 4JYCA 4IRSA 3ZUNC 4G8GB 5G4MA 4QRRE 4KKBD 4TQPA 4MAUL 1U21A 2BO0A 3TO4C 1RP9A 2AK4B 1KECA 1TZGH 1NCOA 2QPFA 4A7TA 4YBLC 5BV7B 2YLKA 4U3JA 4DXWA 1T0OA 4KUZH 4ZUTB 4G9FD 5JXAL 1HEZB 2DQFB 4FFVC 5D7JD 5KBMA 3ILDA 5D6DC 1KCBA 5I73C 5CJ8A 4WCYH 3TLRA 4AQ1B 4BH7B 3U1SH 1UENA 4JR9H 5H37A 4F2MB 1KFGA 4GKZB 4XX5A 2O26U 4MB1A 5F7BA 1ET7A 5E08H 3LAFA 4U1LB 2JS5A 1B0RB 1F3JB 2A6KA 2JGDB 4ZXBA 5CA0B 4KV5F 4NO5B 2W88A 3MRCA 1BFOA 4L3FA 1DN2A 3MNZA 1Q81W 6FABL 3ZTJG 3M1CA 2Z92A 1LEKA 2C5DC 2ZP8A 1VARA 1RMFH 3O6FC 5H9CA 4FNPA 5AZ2L 4PS4L 1NCAL 2EYTB 3K74B 3O65A 4W4OC 5F72S 1DQQB 1HYRC 2GK2A 1QLEB 2ILMA 3OLGA 4G6MH 3WENA 3FL7A 3HR5B 4IJ3C 1EBPA 3GXUB 5E2WL 3U46B 3ZKMD 2F1MA 2WUCL 3E80A 4JHWH 3TEWA 1A6WL 4TQDA 2YAPA 4OZ4A 2APSA 3SQRA 1BQ5A 2VM4A 1UZ6E 2FJSA 5E6RB 2VDQB 3TX4A 5GRUH 5EIQA 1EXGA 3FT4A 3V9CA 1D5ZA 4NUMA 4KPHH 1IM9B 2DQUH 4JM0A 1PD3A 3NJKA 2DIEA 3QDMA 4NZUL 4W81A 3O9WB 4NKQB 4XE5B 3TA3D 4HUVA 4KO9A 4MJ6A 1Y74B 5D4QA 3E8VA 1CLOL 1A4CA 3DSFL 3EOAB 4JFED 2AJSH 4PRIE 4HOXA 5IMMA 2F54E 3ULUL 4O4YL 4JK0D 3FPXA 4OZIE 2VDRL 2VIRA 4WFED 4ENEC 2WV3A 4PJ7E 3MCLL 2DQCH 1KTDA 3VFNA 4GBXB 4QRTB 2VDNB 5AW1B 2H8PB 3CSTA 4OCXH 3SDXF 1S7UA 1T89C 1HH9B 3T0VA 1G7QA 2VR3A 4R4ND 1HWWA 4ZFFA 1KLFA 3A5VA 5FDWB 4Y1SA 4APQC 2PGGA 1U8PB 5GS1B 3M1OA 2UY6B 3MV8B 2A74B 2UZIH 4GMSH 4F7MB 5JZ7D 3IKCB 2H6PB 4S2SB 5GS2H 2A7WA 4OZHB 1CVSC 1P4LA 1SXZA 4OJEH 2PO6C 4PV8A 2QJDA 2C1OB 1CD9B 2IU0A 3LEYL 4N6RA 4RRPM 1I1AA 3JAMN 3D3VD 4C58B 4XPBL 5E8DH 5JW4M 1YEIL 2ZWNA 3CD4A 4LWSB 2YAEA 3HHSB 3N41B 4HKZB 4A7GA 2UZYA 4H0LC 4X6CE 5IFAL 3BHBB 3NUKA 4ICXA 4G5ZL 2APWA 2C34A 2X41A 3BO8A 2BTOA 3QTCA 5F1NA 2JJSA 2OR9H 3LH8A 4X50A 1MOEA 1WFNA 3U7YL 2VH5H 3BWUF 3ZY7A 4XAWL 4KHXH 5GHWL 5J56B 2O5XL 1U4EA 1NVPB 3QORA 4ZQKA 2PR4L 4KRMB 1EZVY 1FHNA 3OM3B 1PFCA 1BAGA 3BP7A 4OKVA 5EV7A 5IMLA 4QLWA 5I1JL 5KVEH 1K4CB 1WJ3A 3GINA 1KY7A 5GGTA 4KJQD 3L13A 1I7ZA 5IG7A 4H2AA 1JV5A 1BL8A 3PAZA 1TENA 5I75B 1CT8A 2A73B 5A2BA 1GMIA 1IEAA 3B4NA 2W92A 1JYVA 1HYSC 1E9QB 4F7EB 1BBJA 3CFTA 3LS5H 4DUZO 5EDSA 4F8PA 2ZZUT 1S5LZ 2QKCA 4MVOA 3FUFA 1GAFL 3BZEB 5K1NA 2QWRB 2AGAA 3HPJA 1XAKA 3P73B 4LGPB 3WGUB 3MV7D 1CZ8H 2CDFB 4JFHE 4W9IC 3V6FB 2MHAA 3N9GH 5IEHB 3JTSA 2KG7B 2R51A 3L7FA 1ORSB 3C3TA 5KVFL 3CAFA 1EHNA 2MFNA 3GK8H 3DHJA 4ZS7H 2WNWA 2YAOA 1PZSA 5J57B 5J6HB 5J0BA 2HVKC 3OAUL 5DUML 3Q06A 4FNSA 1AGFA 4L3ED 5E6IC 3MNMA 5MEPA 4KHPO 3BQUA 3MRPA 3AM8A 5E1AB 3FRPA 1JD9A 1DF4A 3KYOB 2M7WA 2EDQA 2LQTA 3TN0D 2KKQA 1IGCL 2DI9A 4X66B 3AU1B 1W59A 4YOKA 1TAEA 1DBJL 4JMXA 4ZZKA 4LVNC 5GGQH 4WWKC 5D7SH 1EXUA 1T5XB 3ZTDC 5KYYB 2WO3B 2E75B 1IBKO 1MCCA 1Q0XH 2XWCA 3K06A 4OSUL 4EKJA 1KYUA 1L9OA 4WKZA 4K94C 2BDNH 4C56D 1ZGLA 3R06A 2CDGA 2ZD0A 1VGKB 5JW4N 2X1PA 2IGTA 3LEVH 1OTSD 2XBDA 1OCZB 3QNYB 3ZE0B 4DK3A 4PGJA 2CHXA 4I7ZB 2OJEB 1QU7A 1HINH 1KXVC 3E7JA 1TGOA 3CNKA 3O3DB 4GO8A 2CA3A 3SDDB 1ITCA 1ZKAA 1OAUL 3IXTA 4I1NB 1UPGA 3K2UL 5EOCJ 1CXIA 1FPOA 1QMUA 2H1LM 2XA8H 5DD1L 2WTRB 1R3JB 4NHUA 4NAQA 3T8MA 1OEZW 3CIAA 5KHKA 3QDGD 1VEPA 1SQMA 4JO1L 4NM4L 1RLBA 4J80A 4FGMA 4LSSL 1MRFH 4JFYB 4FLUA 3P9LB 2H32H 3UTOA 1XAUA 1I9JL 3G04B 2ED8A 1HNYA 1U33A 2E7BA 3G71V 2EDFA 3BSZL 3C60B 2J4WH 4P57B 1N8ZB 4TNVF 2VJXA 1M7IB 2OMYA 1U36A 3APMA 4M93B 2H26A 5BRQA </