2EJ7A

Solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
GSSGSSGMVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCG3 gene
publication title Solution structure of the DnaJ domain of the human protein HCG3, a hypothetical protein tmp_locus_21
rcsb
source organism Homo sapiens
molecule tags Structural genomics, unknown function
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ej7A01
2OCHA 2N04A 2CTWA 2CTQA 4J7ZA 1WJZA 2LO1A 1HDJA 3APQA 2EJ7A 2LGWA 4IT5A 2YUAA 4J80A 2QSAA 2QWQB 2CUGA 2DMXA 2N05A 3BVOA 2QWOB 2YS8A 2PF4E 2Y4TA 1N4CA 1BQ0A 3APOA 2KQXA 1FPOA 2CTPA 1XBLA 3UCSC 1IURA 1NZ6A 2DN9A 2Y4UA 2CTRA 2GUZB 1BQZA 2M6YA 1FAFA 2QWPB 1GH6A 3UO2A 3UO3A 4RWUA 2QWNB 3AG7A 2GUZA 2L6LA 2QWRB
chains in the Genus database with same CATH superfamily
1IBLB 3R65A 4NXNB 3RYHA 1H2SB 4UCOA 2PTMA 1HW7A 1M57B 2Z3YA 1I94B 1YHQV 2XNDG 4CH3A 2IU3A 2JJ1G 4I9QA 3X2QC 2EILC 4UCUA 4ASUG 3OR6C 4HYOA 2A79B 3B09A 2HG5C 1A32A 2QA4V 4PV1B 3RVZA 3A8TA 3ZRWA 4JF3A 1V55C 1BL8A 3ABLC 2PUSA 3DC5A 4GUNA 2Q9LA 1DF5A 4O2AB 4CS3A 4K8XA 2UXNA 4NKGB 2ZE8A 3R66A 3LSQA 4GKJO 2JGDB 4IIJA 3WG7C 1NR1A 2AW9A 3KG2A 5ITZB 1VQNV 2O57A 1LUVA 3JASA 3VQXA 1Q3EA 3DSQA 3OMNB 5CA1B 4JI4O 3ZMSA 1US6A 3WFVA 5KHJA 5IYDO 1UFIA 4RO2A 5JH7A 4PA7A 5LHGA 4HNAA 2IJKA 3FB6C 4DV1B 2Y4TA 1XDCA 2QKSA 3FB7C 5H2FZ 3K9SA 3F5WC 1MNGA 3AG4B 5D5PA 4FLUA 1MABG 2ZM6B 3L9DA 3OTOB 3BRCA 4O4IB 1NJIW 2QM8A 3SPCA 4DV0O 1GN3A 2NNUA 2ZINA 3E35A 3GWKC 1Q8IA 1IX9A 4DRXA 4JI2B 2ZD9A 1Q7YW 2DMXA 1RPRA 1RPOA 3CYOA 3CMAV 1GKFA 4TWKA 4JYAO 1MZEA 2GUZB 5FL7G 2C2AA 3C3TA 4UV8A 1ZTEA 2YI8A 1BGYH 1J5EO 2LP7A 3GVMA 4LNUA 4UFZA 3LDEA 3ZHSA 2NN4A 4QPJA 4I4TA 2GSMB 4YXWG 5LOVA 3EHBB 4DV3O 4X62O 4FZ0A 4MVOA 5GONB 4BWAA 2GHYA 4YY3O 1Q5OA 1SQVH 4FLWA 2WLLA 3ABKB 2Q68A 4J9ZB 1QHTA 4R50A 1KD1W 1PD3A 4DO2A 2HJFC 2Q0AA 1M5IA 4GKJB 2HEPA 1TVKB 1NR7A 5J2TB 3AEIA 4P30A 3SJBC 4UVAA 2EIJB 2Y4UA 1VQKV 2ZR3A 4MTGA 4TUYA 2OIGA 4IYHA 4YJ3B 4XDLA 4D6TH 4LF5O 3AG2B 3BHPA 3JATA 4JAVA 4QPKA 2EJ7A 4TQFA 5L3BA 1Q82W 3QTCA 3JSLA 5LBQA 3N2GA 3ZBHA 3B77A 4I0XB 4DR1B 1K3EA 4R6ZA 2IW5A 2ZR2A 2RMKB 1H2KA 4OXSA 2XHBA 3A0HZ 1FD9A 4DV0B 3N2KB 4PDMA 5CA0A 3SGIA 4JI1O 3E22A 3G67A 1AR4A 2RCVA 4MVZA 3JAMN 2W6JG 2OT5A 3ETEA 2ZCEA 2EINB 1NT2B 4YJ2A 4OX9B 2Q69A 1VQPV 1CPYA 1XOUA 4DK0A 4GKKO 3OT7A 1R3LC 4GX5A 5HFMA 5JVDB 1KMIZ 1XL4A 1J5EB 2P67A 3HKEA 1THZA 3FFQA 1KP3A 1N33O 1K4CC 1WP8A 3W7TA 4ZI7B 2Y69B 3O9OA 4DUZO 4JI6O 4DV3B 4DK1A 1NVPB 1IXMA 2ZXWB 2AZ2A 2W0XA 1NH2D 3SPJA 1PL4A 3RYHB 2K1EA 4PI2A 1K73W 1K92A 2YI9A 2CTWA 1JOYA 3K06A 2OTJV 4TV8A 3ASNB 3WB2A 3W7WA 4DR7B 4DV5O 4JI0B 1Y67A 3ML0A 1IURA 2BCCH 1V54B 4MTXA 3VQWA 2XAQA 2QEXV 2ATKC 3I56V 3ZRWB 2PZSA 4KP4A 5KHGA 3SYPA 2HP8A 3E8GA 5J2UA 2EIMB 1Q6IA 1D5NA 1WP7A 3OMIB 4IIJB 2X7RB 4NTYA 3K5MA 3JASB 2ADQB 1R6TA 2WA3A 2DYRB 3BABA 2WPDG 1NQTA 3SR2C 5JH7B 4HNAB 2IJJA 3CB2A 3E8BA 4B7EA 2DJVA 1FKAO 3RW0A 3CPWU 1YTFD 2VWJA 1NH2B 4O2BA 1SKVA 4H0LB 4I7ZB 1I5XA 5EYPA 1Q43A 2UXCO 5KHKA 3VOUA 2R72A 1N33B 4JI6B 4K8ZA 4DRXB 5H9CA 1ZX3A 2L6LA 4F6RA 3T4DA 1GM9A 4DUYO 2YIBA 4J7KA 3STLC 1OCRC 3K57A 1R3JC 4JZ2A 1QNMA 1QU7A 2Q73A 4NYKA 2YSUB 3ZHQA 4B3MO 3ZMTA 1Z5VA 2G38A 4BR6A 4AI8A 1AJQA 2JS3A 3H1HH 4LNUB 1XNRO 3H9VA 4DR5B 3OGIB 4WFHA 2XOKG 4U7NA 4I4TB 5IYBO 2ZNJA 4LBEC 5LOVB 1AI5A 1QLEB 4DV5B 4MSWC 4GX2A 1BSMA 1ZUQA 4KXRA 3CCUV 3APOA 1YI2V 2WLLB 4JTCB 4DW0A 2LFRA 2M6YA 1YJ9V 3K58A 5B1BB 2ILMA 3CCLV 1YTFB 4LF6B 1BMFG 4LF9O 3TXQA 4PI0A 3U0ZA 3T1YO 2GDSA 3B8MA 4PDLA 3SJAC 4TUYB 4YHHO 2DYSB 1GAXA 1KBHA 3JATB 3IC9A 4RAIA 2VQEO 3OGCC 4IL6Z 3N2GB 2DE0X 2ZKOA 2H3OA 2Z0AA 2QM4A 2V7QG 1SETA 2HHHB 1ZAUA 5CA0B 2DWDC 3ABMB 2Y0IA 3E22B 2CTRA 1N8RW 4PDRA 5KA5A 5BXZA 4NR1A 4PDVA 3CCMV 3JSNA 4X66B 4YJ2B 1VQOV 4LF7O 5EBWC 1XI1A 3VQVA 2H8PC 2X6CA 3DXRA 1XUQA 5KHIA 3ZMVA 5JCOC 1XNRB 3CRQA 3HKEB 1DTOA 2PI4A 2OYQA 4LC1A 3RVYA 1H2NA 3UQ8A 5B1AB 3SYOA 2ZE7A 5H5NA 3AG1B 5EZYA 4EFEA 2XT9A 2IJHA 3UKMA 3HPLC 3WU2Z 2P4VA 2ZDIC 3ICXA 2XAGA 1NI8A 1GTOA 4WFFA 1Q6HA 3ETDA 5JQGA 4O4HA 2EBOA 4FM1A 3FAVA 4X65O 2Z5UA 4WFAV 1K5SA 1E79G 3E2EA 2OIEA 2X0LA 2WAMA 3CWBH 3THOA 2ZE5A 3E86A 5KUKA 1XMQB 4TV8B 5LXTA 1MA1A 4O4JA 3X2QB 2EILB 3L72H 4YHHB 4LF4O 1VEWA 1YF2A 2ADPA 4MVRA 4BW9A 1JJOA 3UT5A 4MVUA 1JVMA 4BW5A 4CH4A 4DV6O 2VQEB 3OFNG 4UB8Z 4GT1A 4B7KA 4FK5C 2ZQMA 1V55B 3ABLB 3OUFA 2Q4PA 4K35A 4AHCA 3T1HO 5J2UB 1AILA 4W4LA 4FLVA 1K97A 2WSSG 5LGUA 5CBHA 2QTOA 1PL0A 3WG7B 4CZZA 3ZMZA 1T5EA 1AP5A 2E5LO 2WLHA 2FKXA 3IJ4A 4J11A 2UXDO 3RYFA 2PGGA 4D7TA 4LF7B 3D36C 2PYJA 2ETNA 3MAQA 4UV9A 3W7SA 4O2BB 4WFEA 1R73A 4ZKIA 5CN0A 3AK1A 5EYPB 2YXLA 4I5SA 3ASOB 2XAHA 4UCTA 1GN4A 4ZOLA 1K8AW 2OWOA 2CAZC 1CXZB 4FLTA 1P7BA 1VQ4V 2UU9O 1N36B 1SESA 2Q7HA 2LJ2A 4Q20A 3RYIA 4F6RB 1Q86W 3IAYA 2A3QA 1R3KC 1G8MA 5KMGA 1ZSPA 3QNEA 3W7XA 1AVMA 4J80A 4DR3O 2HLDG 4X65B 1HNXO 2Q7EA 1HNWB 4EFBA 1BQ0A 1FPOA 3WB1A 3FB8C 3ZX6A 2EIKC 4PELA 4LFCO 4FZ1A 2QJ1A 4O4LA 1DGSA 1FYJA 4OPHA 4LF4B 5A2QN 1SC5B 1N32B 5GW7A 3IGAC 4KFMA 1N34O 1ZL8A 2NR5A 4UB6Z 3CCSV 4TSFG 2HVJC 3T1HB 1SA0A 2A06H 3P3NA 4EEQA 2IH3C 1K4DC 3A0RA 5B1OA 4LH7A 4H13B 1DLBA 1QLNA 1P7GA 4CH5A 4JV5O 4IGGA 1VF7A 3H1JH 1B3QA 1XQ8A 1JA8A 3ZEDA 2UXDB 3GB7C 2BTQA 1QR8A 4FMTA 4XBFA 3HKBA 2Q67A 5CA3A 1K5QA 1EN4A 1GK9A 3ETGA 4DV2O 5LHHA 5IDJA 1S5LZ 4IYIA 1JCHA 1PKXA 3HKDA 3KCXA 1NTMH 5E79Z 1IBMO 3E89A 4DR4B 4Z1VA 4MW8A 1G4YB 1RM1C 3C90A 4ICGA 1SQGA 3OW2U 2WLNA 3HKCA 4FLXA 3OD4A 4CH6A 4LF8O 2B1GA 3MHSC 2UUBO 4X88A 3DXRB 3P32A 1VQ9V 2VQFO 2P90A 4J10A 1BS3A 5B5EZ 4WFGA 1VIBA 4JI5O 1DK1A 2A9HA 5LA6A 3ZHTA 2FL4A 4LFCB 3CXCU 5L3CA 4BIOA 1PNMA 2VRZA 5EZYB 2ZT9B 4MVSA 4RWUA 1UPGA 1EN6A 1XMOO 1WPBA 3M99B 1GRJA 5JQGB 2ZDIA 4O4HB 4J7JA 2PI5A 3K0GA 3FAVB 4PA9A 5KX5A 2YS8A 2LFSA 2WLIA 3AG3C 4FFBA 5EBMC 1NS1A 3BA9A 3BPZA 4HBNA 3G80A 2QKAA 3PJSK 3J81N 4MVMA 5EIBC 1NVPD 4WFBV 4JI4B 5LXTB 4JV5B 4O4JB 1YJWV 3H01A 2QWNB 3VBBA 4NXMO 1KU9A 2OCHA 1BT8A 4P9PA 3UT5B 3ZHUA 1R1BA 1PNLA 1R6NA 2JIZG 4UVBA 3T4ZA 5B3SC 2QKCA 3RGBA 1FFXA 4K3AA 1E1RG 4BAYA 1U97A 4D7SA 3SYQA 1H2LA 4WBNA 5FPOA 2CGOA 1YCIA 1MZFA 1VMGA 1I7FA 4C7UA 1WB7A 1F51A 4ZIBA 3EXAA 4LFAO 5TISZ 4E4EA 5FLXN 3A2FA 4JYAB 1V9PA 4X1KA 1Y74A 3RYFB 1H2GA 4LF8B 1K7DA 3CRMA 1QBZA 5CBFA 3LDDA 3ZN1A 3D36A 4JI3O 4JI8O 1X59A 1M4UA 5KUMA 2VQFB 1NU1H 4YIPA 2F23A 2CH7A 1XNQO 4JI5B 4QGPA 2UUAO 2EJRA 4ZOLB 4X64O 4F4LA 4X62B 4DR2O 5BZBA 4YY3B 2QR4A 3RYIB 1GO3F 1S3JA 1FXVA 1OV9A 5F2VO 5KMGB 3JALA 4AQYO 1SZXA 1R3IC 2KSDA 1ORQC 3CXHF 1OCRB 3CC7V 1VQLV 2F4VO 1VF6C 3SDLA 4J7ZA 3RBZA 1R6KA 4MTFA 2EULA 1PP9H 1OCOB 1WPXA 3OR7C 4O4LB 4UCVA 1HNZO 1VQMV 4B3RO 2BTOA 1I08A 4LF5B 3IC7A 2F1MA 3ZHRA 1EZJA 1ZL8B 3QO5A 3S3XA 4FM0A 1NTZH 2LGWA 4GX0A 3CCQV 4IHJA 1SA0B 3AG2C 1SQQH 4CS2A 4JTAB 4Z2WA 4KL1A 2A7WA 4JI1B 2HJDA 1OCCC 3DGEA 1XEQA 2QM7A 1GMGA 1EFRG 1WLEA 1ZLZA 3TK1A 1BZKA 3EFFK 3K04A 2BTQB 1MMMA 2LO1A 1OCZC 3LSSA 5CB4A 5JJEB 3HKBB 2XUMA 4GKKB 2HKOA 2Q8VA 4KHPO 3K08A 3FX7A 3B8NA 2RDCA 3U10A 3D3QA 5CBGA 4ZBMA 3ZRXA 3KCYA 1XHXA 5LP6C 1KP2A 3HKDB 2UUAB 3L74H 4DUZB 5IJ9A 1AROP 1OJHA 4OPAA 5IT9N 4DR2B 3CCVV 5IY5C 1AB3A 3QG5A 1O9HA 5GTHZ 3CMEV 1WA8A 2JJ2G 4HAMA 3HKCB 4AQYB 3K59A 2OCCC 2F4VB 1IBKO 4NTXA 3K3WA 2DWEC 4TOIA 2HFEC 1AR5A 2V1DA 1DF4A 5BMVA 2P4KA 5LA6B 3T2MA 3SPIA 3CRRA 3EVKA 3QF7A 4JI7O 1D5AA 4RQFA 2FYUH 2LW1A 4UCSA 3ZRVA 2ITDC 3JD3A 4PJ0Z 3ASNC 1Z5WA 1YZBA 4JPRA 1N0NA 1PNKA 1V54C 3FKSG 5KX5B 4FJCC 4FFBB 2WLIB 4EB6A 1XILA 1SQFA 3CS5A 3JCZA 3RN4A 3BAAA 4R7CA 3ZMUA 2JRIA 4JTDB 4X20A 4UVCA 3K9AA 4U3FH 1VF5B 3CCEV 2UUCO 2D3OW 4DV7O 3LNMB 1TA8A 4BIZA 5AG2A 2UXBO 3JD2A 3ZRSA 4CS4A 1JR9A 1FFXB 1Q90D 1I5YA 5H6QA 1SERA 4J9YB 3L70H 4WBNB 2UXCB 1QVGU 4PHZA 1CEZA 2KQXA 3JD4A 2EX3A 1L8DA 1B06A 1NTKH 3FB5C 4UCRA 1KUQA 2AZ0A 4I50A 1GN6A 2E76B 3UO2A 4DUYB 4X1KB 5L3DA 1Y74B 1S72V 5A9GA 2BSKA 4JYCA 3ZHVA 2P22C 4B3MB 3G71V 1VQ8V 1K33A 2DW4A 1L1FA 1SF9A 1PM9A 1YJNV 1W0KG 5LYJA 1AJPA 2CH7B 1RSOA 2NLJC 5C8YA 4JI7B 2B5UA 4H44B 3AG7A 2JS5A 1AJNA 3I55V 3JALB 2UXXA 4H33A 2EZOA 2BOCC 3SPGA 4FM2A 1LUWA 3E83A 4QIWF 1VF6A 3JARA 1VP7A 3ZN0A 3Q4HA 3VQYA 4XDJA 4TV9A 2N04A 4QE9A 1M90W 4LF9B 1FJGO 3E8FA 3I5DA 3T1YB 4CC6A 2YIBD 5IYCO 3JD1A 2Y48A 2EIKB 1IBLO 1FXHA 4HZ3A 3A0BZ 1COWG 5LL6Y 1W59A 3P30A 1FXKC 2DOSA 2FB5A 3K5LA 4A5UB 1JQ0A 4B08A 1FFTB 1AI6A 1IVSA 5DN6G 3CX5F 2JK5C 1M56C 2E75B 2P6JA 2Q0OC 1SQBH 4IHJB 3JAKA 4K0KO 4IT5A 1JPXA 1H38A 4FVMA 3SJCC 5DM6V 2Y0PA 3RT3C 2VWKA 5CB4B 3L71H 4DV4O 2ODMA 1G1XB 1D2DA 3JAWA 4NVPA 3BFRA 4G2KA 1AR1B 3HB3B 2CUGA 3ABUA 3LNNA 2Q6AA 3BY6A 1BHBA 5IJ9B 5LP6A 2E74B 3M8AA 3OUSA 3L75H 3D8CA 5DEDA 5LHIA 4PA6A 2F93B 5KLVH 2A0LA 1WA8B 1VQ6V 1RM1B 5H6RA 1YVWA 3BVOA 5FPRA 3OAAG 1MSDA 2CE4A 3ABTA 4E2LA 3H1LH 4PD4F 1SQPH 2E3CA 2WA4A 3K0DA 1Z2GA 4KUMA 5LMUO 2KG7A 2DQ3A 5BMVB 2F95B 4B3TO 3MHHC 3ZS8C 2QWPB 3J7AU 4R8CA 4BIUA 4Z1MG 2OTLV 5LMNO 3CP1A 4DYLA 5LGTA 3S3WA 2PYLA 1S76D 1RP3B 3U11A 1RFYA 4DV6B 2JVDA 2R9IA 4AILC 2H94A 3TJTA 1XREA 2CTPA 3PN1A 1WAZA 2XAJA 4CC5A 1WN7A 3LDCA 5K1XA 4K0KB 4L8JA 4EB6B 5IYZA 3AG3B 3SJQC 2CTQA 5EC1C 1K34A 3QO7A 4I9WA 2E5LB 4X20B 1B6QA 1GN2A 3SYAA 4B3SO 4YIOA 3CE2A 1YIJV 3ZCCA 3CEIA 2WWWA 1YSCA 2WLMA 2ZE6A 5JWPA 4L87A 4DV4B 2RN9A 1S77D 5B3SB 1ENVA 4LCUC 3RYCA 2ITCC 1O9GA 3OE7G 1JX9A 5EC2C 3L73H 3SYCA 2ZIOA 4QJFB 4I50B 2UU9B 1IDSA 4LWSA 4DR1O 2WLKA 2DQ0A 4XDKA 2CK3G 3ASOC 5JJNB 2GBOA 2BSKB 4N21A 1JJ2U 1VARA 4DR3B 2JDIG 3F5TA 4G27B 1BCCH 1HNXB 5JCOA 5LYJB 4WCEV 2PF4E 2AHZA 1RSOB 5LMUB 3N27A 4B3TB 5C8YB 4OX9O 1M9NA 3CRCA 4NB5A 2KKWA 5LMNB 1F7YA 1FAFA 2W6IG 1M57C 1M93A 3J80N 1N34B 2R70A 1L0NH 1Y76A 2LW7A 1JFFA 3UCSC 4UUJC 1BHAA 3G6BA 2P5OA 5L3FA 3JARB 1YEWA 3Q4HB 1XL6A 4TV9B 5D5QA 3BCCH 4ZHQA 4JZGA 1N0JA 4LFBO 4B3SB 1P84F 2QSAA 2QWQB 4MTOA 3QO8A 3ZIAG 2FTKA 1FXKA 2HVKC 5IE9A 3RFRA 4DV2B 3B2EE 4DR7O 1NKDA 3GWOA 4I55A 1CP9A 2GTAA 1HP8A 4JI0O 3SPHA 4GZRB 3JAKB 4GLXA 1FS0G 3AG4C 5HFLA 1YITV 1IBMB 2N74A 4NTWA 2V4DA 3FYEB 1H8HG 1OCCB 3AK3A 2UUBB 5L3EA 3D3IA 2QE7G 2P06A 1OCZB 5EBLC 5IWAO 4U7OA 1EBOA 1HWYA 3JAWB 1TUEB 1ZWIC 4P2ZA 1PV0A 3LSUA 4RUEA 5LP6B 1E1QG 3B4SA 3B40A 5GTIZ 2JGUA 4CBCA 2YDEA 4DR6O 5IY5B 1KYOF 1XMOB 2FMLA 4X8AA 1S0VA 5IJ0A 1F23A 1GM8A 1GM7A 3F7VC 3OEHG 2OCCB 3ABKC 1TUBA 4PA3A 2JEXA 2GV9A 2KG7B 2RQ6A 3CD6V 3CC4V 2BOBC 2Q5ZA 2IJIA 1QVFU 1Y4MA 4NXMB 1WB8A 4QE7A 1LR1A 1U96A 1GH6A 4LFBB 4DR5O 1URFA 2EIJC 2R9RB 4MW3A 1HDJA 3NR7A 2X6BA 4JYBA 3STZC 1F4MA 2XAFA 2ZNIA 1Q81W 1NZ6A 5IYZB 5KA6A 3DTUB 2GTSA 4LFAB 4LH6A 1S5HC 2MK3A 4MS2A 1SQXH 5KAIZ 3H1KH 5K1PA 1AI7A 4H37A 2QTSA 2HR3A 5L3GA 3K03A 4LF6O 3CRAA 2ZIMA 4JI3B 4JI8B 5FNVA 1G6UA 5IWAB 2EINC 3CCRV 3AK2A 1TGOA 3RYCB 4TQDA 1XNQB 1AI4A 1YXBA 4MT8A 5CMUA 4DW1A 2YICA 2AXTZ 4X64B 1SS3A 1QQCA 1QCEA 1LNQA 4P9OA 2QWRB 1WNSA 4LWSB 4LR3A 3G4SV 2YEVA 4DR6B 4LP8A 2Y69C 4X1IA 3K5NA 2HHHO 1BE3H 2YXYA 1EM1A 2ZXWC 3E8HA 3KZIZ 2AHYA 4J41A 3CJHA 4X1YA 5BR8O 2RJZA 1P4RA 1K9MW 3OMAB 3FYIB 4X66O 3T1CA 2YIAA 2AGAA 4JASA 4U3JA 4RQEA 1HNZB 4B3RB 3NXSA 2Q7GA 1OCOC 1YDXA 3QVNA 2RNBA 1Y76B 3HR0A 4UXNA 3F7YC 3P3PA 1JFFB 1Y66A 2EZPA 3TGUH 1KC8W 4DXWA 2YXHA 2F66C 2N05A 3C3SA 3JYCA 2R9AA 1N4CA 1XBLA 1W0JG 2EIMC 2KB1A 4O2AA 4ZHQB 1F4NA 1L0LH 2JGDA 3TCUA 5ITZA 2VS0A 3IFXA 1KKDA 5KHHA 1MG1A 3K5OA 4TT3G 4MVQA 2WLJA 4FLZA 2DYRC 4G28B 4KHPB 2P7TC 4FLYA 1UJWB 1FXKB 4GCZA 5B66Z 5CA1A 1XMQO 4W4KA 1H8EG 2LQTA 4JAAA 1OHHG 1EN5A 4I55B 1SRYA 4EKWA 1OZ0A 4JAUA 3UM7A 1M56B 5B1NA 3MD0A 2QDOA 4FIPC 1MSWD 3FD9A 4JGSA 1KB9F 1HR0O 3CCJV 4JYYA 1IZ3A 4O4IA 2ARHA 1JMKC 2D2CB 1IBKB 3ETQA 3O65A 1AP6A 1VQ5V 1S5JA 5BR8B 3JD0A 2W0FC 1KKCA 2GUZA 1KECA 5EK0A 3KKYA 1W2BU 1SZTA 3OTFA 3CSXA 1B04A 3APQA 5BY1A 3OM3B 1IXBA 4RUFA 2YIDA 1QLEC 5IJ0B 4X89A 3RWRD 3LUTB 3TETA 2BE3A 2IM9A 5GONA 1N36O 5E1AC 3BA8A 3UO3A 2MW2B 1H2MA 1TUBB 4GX1A 3TXSA 1ROPA 4ABMA 2PY5A 2B1IA 3OEEG 5B1BC 2LGQA 1KQSU 2F43G 5KAFZ 2JEUA 4NXNO 1Q6UA 2UUCB 1XHZA 1M1KW 4DV7B 3H1IH 1HNWO 2IU0A 1TVKA 1I94O 5J2TA 5J9PC 2UXBB 3DC6A 5DECA 2X6AA 2DYSC 1VQ7V 2L35A 5C93A 1QR9A 1P49A 2YUAA 4YJ3A 3BEHA 1NBMG 1PPJH 1MOFA 1N32O 2B9ZA 4I0XA 2DN9A 3W7UA 3CHXA 1HR0B 1I0HA 3CC2V 3ABMC 4OGQB 4FFKA 3N2KA 3ZJZA 1Y6XA 5FNVB 4N23A 2IH1C 3G6EV 2CGNA 5EIBD 4DV1O 4WF9V 1TAEA 2CDYA 1BQZA 4PA4A 3WB0A 2YC0A 4FPPA 5LGNA 1X4TA 5JVDA 4Q6GA 2ZM6O 3OTOO 2XASA 2YEVB 1WJZA 2M7WA 3K79A 4X1IB 5B1AC 2K9PA 3AG1C 2QWOB 4ZI7A 1EZVH 5JJJB 4F6EA 4J42A 3M7MX 4JI2O 4DR4O 2XTAA 3CJHB 4X1YB 4GYCB 4X9QA 2QGNA 1FJGB 4U3JB 3JCUZ 4QNHB 2IBZH 3MDSA 1J95A
chains in the Genus database with same CATH topology
2OCHA 2N04A 2CTWA 2CTQA 4J7ZA 1WJZA 2LO1A 1HDJA 3APQA 2EJ7A 2LGWA 4IT5A 2YUAA 4J80A 2QSAA 2QWQB 2CUGA 2DMXA 2N05A 3BVOA 2QWOB 2YS8A 2PF4E 2Y4TA 1N4CA 1BQ0A 3APOA 2KQXA 1FPOA 2CTPA 1XBLA 3UCSC 1IURA 1NZ6A 2DN9A 2Y4UA 2CTRA 2GUZB 1BQZA 2M6YA 1FAFA 2QWPB 1GH6A 3UO2A 3UO3A 4RWUA 2QWNB 3AG7A 2GUZA 2L6LA 2QWRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  2N04 A;  2CTW A;  2CTQ A;  4J7Z A;  1WJZ A;  2LO1 A;  1HDJ A;  3APQ A;  2EJ7 A;  2LGW A;  4IT5 A;  2YUA A;  4J80 A;  2QSA A;  2QWQ B;  2CUG A;  2DMX A;  2N05 A;  3BVO A;  2QWO B;  2YS8 A;  2PF4 E;  2Y4T A;  1N4C A;  1BQ0 A;  3APO A;  2KQX A;  1FPO A;  2CTP A;  1XBL A;  3UCS C;  1IUR A;  1NZ6 A;  2DN9 A;  2Y4U A;  2CTR A;  2GUZ B;  1BQZ A;  2M6Y A;  1FAF A;  2QWP B;  1GH6 A;  3UO2 A;  3UO3 A;  4RWU A;  2QWN B;  3AG7 A;  2GUZ A;  2L6L A;  2QWR B; 
#chains in the Genus database with same CATH topology
 1IBL B;  3R65 A;  4NXN B;  3RYH A;  1H2S B;  4UCO A;  2PTM A;  1HW7 A;  1M57 B;  2Z3Y A;  1I94 B;  1YHQ V;  2XND G;  4CH3 A;  2IU3 A;  2JJ1 G;  4I9Q A;  3X2Q C;  2EIL C;  4UCU A;  4ASU G;  3OR6 C;  4HYO A;  2A79 B;  3B09 A;  2HG5 C;  1A32 A;  2QA4 V;  4PV1 B;  3RVZ A;  3A8T A;  3ZRW A;  4JF3 A;  1V55 C;  1BL8 A;  3ABL C;  2PUS A;  3DC5 A;  4GUN A;  2Q9L A;  1DF5 A;  4O2A B;  4CS3 A;  4K8X A;  2UXN A;  4NKG B;  2ZE8 A;  3R66 A;  3LSQ A;  4GKJ O;  2JGD B;  4IIJ A;  3WG7 C;  1NR1 A;  2AW9 A;  3KG2 A;  5ITZ B;  1VQN V;  2O57 A;  1LUV A;  3JAS A;  3VQX A;  1Q3E A;  3DSQ A;  3OMN B;  5CA1 B;  4JI4 O;  3ZMS A;  1US6 A;  3WFV A;  5KHJ A;  5IYD O;  1UFI A;  4RO2 A;  5JH7 A;  4PA7 A;  5LHG A;  4HNA A;  2IJK A;  3FB6 C;  4DV1 B;  2Y4T A;  1XDC A;  2QKS A;  3FB7 C;  5H2F Z;  3K9S A;  3F5W C;  1MNG A;  3AG4 B;  5D5P A;  4FLU A;  1MAB G;  2ZM6 B;  3L9D A;  3OTO B;  3BRC A;  4O4I B;  1NJI W;  2QM8 A;  3SPC A;  4DV0 O;  1GN3 A;  2NNU A;  2ZIN A;  3E35 A;  3GWK C;  1Q8I A;  1IX9 A;  4DRX A;  4JI2 B;  2ZD9 A;  1Q7Y W;  2DMX A;  1RPR A;  1RPO A;  3CYO A;  3CMA V;  1GKF A;  4TWK A;  4JYA O;  1MZE A;  2GUZ B;  5FL7 G;  2C2A A;  3C3T A;  4UV8 A;  1ZTE A;  2YI8 A;  1BGY H;  1J5E O;  2LP7 A;  3GVM A;  4LNU A;  4UFZ A;  3LDE A;  3ZHS A;  2NN4 A;  4QPJ A;  4I4T A;  2GSM B;  4YXW G;  5LOV A;  3EHB B;  4DV3 O;  4X62 O;  4FZ0 A;  4MVO A;  5GON B;  4BWA A;  2GHY A;  4YY3 O;  1Q5O A;  1SQV H;  4FLW A;  2WLL A;  3ABK B;  2Q68 A;  4J9Z B;  1QHT A;  4R50 A;  1KD1 W;  1PD3 A;  4DO2 A;  2HJF C;  2Q0A A;  1M5I A;  4GKJ B;  2HEP A;  1TVK B;  1NR7 A;  5J2T B;  3AEI A;  4P30 A;  3SJB C;  4UVA A;  2EIJ B;  2Y4U A;  1VQK V;  2ZR3 A;  4MTG A;  4TUY A;  2OIG A;  4IYH A;  4YJ3 B;  4XDL A;  4D6T H;  4LF5 O;  3AG2 B;  3BHP A;  3JAT A;  4JAV A;  4QPK A;  2EJ7 A;  4TQF A;  5L3B A;  1Q82 W;  3QTC A;  3JSL A;  5LBQ A;  3N2G A;  3ZBH A;  3B77 A;  4I0X B;  4DR1 B;  1K3E A;  4R6Z A;  2IW5 A;  2ZR2 A;  2RMK B;  1H2K A;  4OXS A;  2XHB A;  3A0H Z;  1FD9 A;  4DV0 B;  3N2K B;  4PDM A;  5CA0 A;  3SGI A;  4JI1 O;  3E22 A;  3G67 A;  1AR4 A;  2RCV A;  4MVZ A;  3JAM N;  2W6J G;  2OT5 A;  3ETE A;  2ZCE A;  2EIN B;  1NT2 B;  4YJ2 A;  4OX9 B;  2Q69 A;  1VQP V;  1CPY A;  1XOU A;  4DK0 A;  4GKK O;  3OT7 A;  1R3L C;  4GX5 A;  5HFM A;  5JVD B;  1KMI Z;  1XL4 A;  1J5E B;  2P67 A;  3HKE A;  1THZ A;  3FFQ A;  1KP3 A;  1N33 O;  1K4C C;  1WP8 A;  3W7T A;  4ZI7 B;  2Y69 B;  3O9O A;  4DUZ O;  4JI6 O;  4DV3 B;  4DK1 A;  1NVP B;  1IXM A;  2ZXW B;  2AZ2 A;  2W0X A;  1NH2 D;  3SPJ A;  1PL4 A;  3RYH B;  2K1E A;  4PI2 A;  1K73 W;  1K92 A;  2YI9 A;  2CTW A;  1JOY A;  3K06 A;  2OTJ V;  4TV8 A;  3ASN B;  3WB2 A;  3W7W A;  4DR7 B;  4DV5 O;  4JI0 B;  1Y67 A;  3ML0 A;  1IUR A;  2BCC H;  1V54 B;  4MTX A;  3VQW A;  2XAQ A;  2QEX V;  2ATK C;  3I56 V;  3ZRW B;  2PZS A;  4KP4 A;  5KHG A;  3SYP A;  2HP8 A;  3E8G A;  5J2U A;  2EIM B;  1Q6I A;  1D5N A;  1WP7 A;  3OMI B;  4IIJ B;  2X7R B;  4NTY A;  3K5M A;  3JAS B;  2ADQ B;  1R6T A;  2WA3 A;  2DYR B;  3BAB A;  2WPD G;  1NQT A;  3SR2 C;  5JH7 B;  4HNA B;  2IJJ A;  3CB2 A;  3E8B A;  4B7E A;  2DJV A;  1FKA O;  3RW0 A;  3CPW U;  1YTF D;  2VWJ A;  1NH2 B;  4O2B A;  1SKV A;  4H0L B;  4I7Z B;  1I5X A;  5EYP A;  1Q43 A;  2UXC O;  5KHK A;  3VOU A;  2R72 A;  1N33 B;  4JI6 B;  4K8Z A;  4DRX B;  5H9C A;  1ZX3 A;  2L6L A;  4F6R A;  3T4D A;  1GM9 A;  4DUY O;  2YIB A;  4J7K A;  3STL C;  1OCR C;  3K57 A;  1R3J C;  4JZ2 A;  1QNM A;  1QU7 A;  2Q73 A;  4NYK A;  2YSU B;  3ZHQ A;  4B3M O;  3ZMT A;  1Z5V A;  2G38 A;  4BR6 A;  4AI8 A;  1AJQ A;  2JS3 A;  3H1H H;  4LNU B;  1XNR O;  3H9V A;  4DR5 B;  3OGI B;  4WFH A;  2XOK G;  4U7N A;  4I4T B;  5IYB O;  2ZNJ A;  4LBE C;  5LOV B;  1AI5 A;  1QLE B;  4DV5 B;  4MSW C;  4GX2 A;  1BSM A;  1ZUQ A;  4KXR A;  3CCU V;  3APO A;  1YI2 V;  2WLL B;  4JTC B;  4DW0 A;  2LFR A;  2M6Y A;  1YJ9 V;  3K58 A;  5B1B B;  2ILM A;  3CCL V;  1YTF B;  4LF6 B;  1BMF G;  4LF9 O;  3TXQ A;  4PI0 A;  3U0Z A;  3T1Y O;  2GDS A;  3B8M A;  4PDL A;  3SJA C;  4TUY B;  4YHH O;  2DYS B;  1GAX A;  1KBH A;  3JAT B;  3IC9 A;  4RAI A;  2VQE O;  3OGC C;  4IL6 Z;  3N2G B;  2DE0 X;  2ZKO A;  2H3O A;  2Z0A A;  2QM4 A;  2V7Q G;  1SET A;  2HHH B;  1ZAU A;  5CA0 B;  2DWD C;  3ABM B;  2Y0I A;  3E22 B;  2CTR A;  1N8R W;  4PDR A;  5KA5 A;  5BXZ A;  4NR1 A;  4PDV A;  3CCM V;  3JSN A;  4X66 B;  4YJ2 B;  1VQO V;  4LF7 O;  5EBW C;  1XI1 A;  3VQV A;  2H8P C;  2X6C A;  3DXR A;  1XUQ A;  5KHI A;  3ZMV A;  5JCO C;  1XNR B;  3CRQ A;  3HKE B;  1DTO A;  2PI4 A;  2OYQ A;  4LC1 A;  3RVY A;  1H2N A;  3UQ8 A;  5B1A B;  3SYO A;  2ZE7 A;  5H5N A;  3AG1 B;  5EZY A;  4EFE A;  2XT9 A;  2IJH A;  3UKM A;  3HPL C;  3WU2 Z;  2P4V A;  2ZDI C;  3ICX A;  2XAG A;  1NI8 A;  1GTO A;  4WFF A;  1Q6H A;  3ETD A;  5JQG A;  4O4H A;  2EBO A;  4FM1 A;  3FAV A;  4X65 O;  2Z5U A;  4WFA V;  1K5S A;  1E79 G;  3E2E A;  2OIE A;  2X0L A;  2WAM A;  3CWB H;  3THO A;  2ZE5 A;  3E86 A;  5KUK A;  1XMQ B;  4TV8 B;  5LXT A;  1MA1 A;  4O4J A;  3X2Q B;  2EIL B;  3L72 H;  4YHH B;  4LF4 O;  1VEW A;  1YF2 A;  2ADP A;  4MVR A;  4BW9 A;  1JJO A;  3UT5 A;  4MVU A;  1JVM A;  4BW5 A;  4CH4 A;  4DV6 O;  2VQE B;  3OFN G;  4UB8 Z;  4GT1 A;  4B7K A;  4FK5 C;  2ZQM A;  1V55 B;  3ABL B;  3OUF A;  2Q4P A;  4K35 A;  4AHC A;  3T1H O;  5J2U B;  1AIL A;  4W4L A;  4FLV A;  1K97 A;  2WSS G;  5LGU A;  5CBH A;  2QTO A;  1PL0 A;  3WG7 B;  4CZZ A;  3ZMZ A;  1T5E A;  1AP5 A;  2E5L O;  2WLH A;  2FKX A;  3IJ4 A;  4J11 A;  2UXD O;  3RYF A;  2PGG A;  4D7T A;  4LF7 B;  3D36 C;  2PYJ A;  2ETN A;  3MAQ A;  4UV9 A;  3W7S A;  4O2B B;  4WFE A;  1R73 A;  4ZKI A;  5CN0 A;  3AK1 A;  5EYP B;  2YXL A;  4I5S A;  3ASO B;  2XAH A;  4UCT A;  1GN4 A;  4ZOL A;  1K8A W;  2OWO A;  2CAZ C;  1CXZ B;  4FLT A;  1P7B A;  1VQ4 V;  2UU9 O;  1N36 B;  1SES A;  2Q7H A;  2LJ2 A;  4Q20 A;  3RYI A;  4F6R B;  1Q86 W;  3IAY A;  2A3Q A;  1R3K C;  1G8M A;  5KMG A;  1ZSP A;  3QNE A;  3W7X A;  1AVM A;  4J80 A;  4DR3 O;  2HLD G;  4X65 B;  1HNX O;  2Q7E A;  1HNW B;  4EFB A;  1BQ0 A;  1FPO A;  3WB1 A;  3FB8 C;  3ZX6 A;  2EIK C;  4PEL A;  4LFC O;  4FZ1 A;  2QJ1 A;  4O4L A;  1DGS A;  1FYJ A;  4OPH A;  4LF4 B;  5A2Q N;  1SC5 B;  1N32 B;  5GW7 A;  3IGA C;  4KFM A;  1N34 O;  1ZL8 A;  2NR5 A;  4UB6 Z;  3CCS V;  4TSF G;  2HVJ C;  3T1H B;  1SA0 A;  2A06 H;  3P3N A;  4EEQ A;  2IH3 C;  1K4D C;  3A0R A;  5B1O A;  4LH7 A;  4H13 B;  1DLB A;  1QLN A;  1P7G A;  4CH5 A;  4JV5 O;  4IGG A;  1VF7 A;  3H1J H;  1B3Q A;  1XQ8 A;  1JA8 A;  3ZED A;  2UXD B;  3GB7 C;  2BTQ A;  1QR8 A;  4FMT A;  4XBF A;  3HKB A;  2Q67 A;  5CA3 A;  1K5Q A;  1EN4 A;  1GK9 A;  3ETG A;  4DV2 O;  5LHH A;  5IDJ A;  1S5L Z;  4IYI A;  1JCH A;  1PKX A;  3HKD A;  3KCX A;  1NTM H;  5E79 Z;  1IBM O;  3E89 A;  4DR4 B;  4Z1V A;  4MW8 A;  1G4Y B;  1RM1 C;  3C90 A;  4ICG A;  1SQG A;  3OW2 U;  2WLN A;  3HKC A;  4FLX A;  3OD4 A;  4CH6 A;  4LF8 O;  2B1G A;  3MHS C;  2UUB O;  4X88 A;  3DXR B;  3P32 A;  1VQ9 V;  2VQF O;  2P90 A;  4J10 A;  1BS3 A;  5B5E Z;  4WFG A;  1VIB A;  4JI5 O;  1DK1 A;  2A9H A;  5LA6 A;  3ZHT A;  2FL4 A;  4LFC B;  3CXC U;  5L3C A;  4BIO A;  1PNM A;  2VRZ A;  5EZY B;  2ZT9 B;  4MVS A;  4RWU A;  1UPG A;  1EN6 A;  1XMO O;  1WPB A;  3M99 B;  1GRJ A;  5JQG B;  2ZDI A;  4O4H B;  4J7J A;  2PI5 A;  3K0G A;  3FAV B;  4PA9 A;  5KX5 A;  2YS8 A;  2LFS A;  2WLI A;  3AG3 C;  4FFB A;  5EBM C;  1NS1 A;  3BA9 A;  3BPZ A;  4HBN A;  3G80 A;  2QKA A;  3PJS K;  3J81 N;  4MVM A;  5EIB C;  1NVP D;  4WFB V;  4JI4 B;  5LXT B;  4JV5 B;  4O4J B;  1YJW V;  3H01 A;  2QWN B;  3VBB A;  4NXM O;  1KU9 A;  2OCH A;  1BT8 A;  4P9P A;  3UT5 B;  3ZHU A;  1R1B A;  1PNL A;  1R6N A;  2JIZ G;  4UVB A;  3T4Z A;  5B3S C;  2QKC A;  3RGB A;  1FFX A;  4K3A A;  1E1R G;  4BAY A;  1U97 A;  4D7S A;  3SYQ A;  1H2L A;  4WBN A;  5FPO A;  2CGO A;  1YCI A;  1MZF A;  1VMG A;  1I7F A;  4C7U A;  1WB7 A;  1F51 A;  4ZIB A;  3EXA A;  4LFA O;  5TIS Z;  4E4E A;  5FLX N;  3A2F A;  4JYA B;  1V9P A;  4X1K A;  1Y74 A;  3RYF B;  1H2G A;  4LF8 B;  1K7D A;  3CRM A;  1QBZ A;  5CBF A;  3LDD A;  3ZN1 A;  3D36 A;  4JI3 O;  4JI8 O;  1X59 A;  1M4U A;  5KUM A;  2VQF B;  1NU1 H;  4YIP A;  2F23 A;  2CH7 A;  1XNQ O;  4JI5 B;  4QGP A;  2UUA O;  2EJR A;  4ZOL B;  4X64 O;  4F4L A;  4X62 B;  4DR2 O;  5BZB A;  4YY3 B;  2QR4 A;  3RYI B;  1GO3 F;  1S3J A;  1FXV A;  1OV9 A;  5F2V O;  5KMG B;  3JAL A;  4AQY O;  1SZX A;  1R3I C;  2KSD A;  1ORQ C;  3CXH F;  1OCR B;  3CC7 V;  1VQL V;  2F4V O;  1VF6 C;  3SDL A;  4J7Z A;  3RBZ A;  1R6K A;  4MTF A;  2EUL A;  1PP9 H;  1OCO B;  1WPX A;  3OR7 C;  4O4L B;  4UCV A;  1HNZ O;  1VQM V;  4B3R O;  2BTO A;  1I08 A;  4LF5 B;  3IC7 A;  2F1M A;  3ZHR A;  1EZJ A;  1ZL8 B;  3QO5 A;  3S3X A;  4FM0 A;  1NTZ H;  2LGW A;  4GX0 A;  3CCQ V;  4IHJ A;  1SA0 B;  3AG2 C;  1SQQ H;  4CS2 A;  4JTA B;  4Z2W A;  4KL1 A;  2A7W A;  4JI1 B;  2HJD A;  1OCC C;  3DGE A;  1XEQ A;  2QM7 A;  1GMG A;  1EFR G;  1WLE A;  1ZLZ A;  3TK1 A;  1BZK A;  3EFF K;  3K04 A;  2BTQ B;  1MMM A;  2LO1 A;  1OCZ C;  3LSS A;  5CB4 A;  5JJE B;  3HKB B;  2XUM A;  4GKK B;  2HKO A;  2Q8V A;  4KHP O;  3K08 A;  3FX7 A;  3B8N A;  2RDC A;  3U10 A;  3D3Q A;  5CBG A;  4ZBM A;  3ZRX A;  3KCY A;  1XHX A;  5LP6 C;  1KP2 A;  3HKD B;  2UUA B;  3L74 H;  4DUZ B;  5IJ9 A;  1ARO P;  1OJH A;  4OPA A;  5IT9 N;  4DR2 B;  3CCV V;  5IY5 C;  1AB3 A;  3QG5 A;  1O9H A;  5GTH Z;  3CME V;  1WA8 A;  2JJ2 G;  4HAM A;  3HKC B;  4AQY B;  3K59 A;  2OCC C;  2F4V B;  1IBK O;  4NTX A;  3K3W A;  2DWE C;  4TOI A;  2HFE C;  1AR5 A;  2V1D A;  1DF4 A;  5BMV A;  2P4K A;  5LA6 B;  3T2M A;  3SPI A;  3CRR A;  3EVK A;  3QF7 A;  4JI7 O;  1D5A A;  4RQF A;  2FYU H;  2LW1 A;  4UCS A;  3ZRV A;  2ITD C;  3JD3 A;  4PJ0 Z;  3ASN C;  1Z5W A;  1YZB A;  4JPR A;  1N0N A;  1PNK A;  1V54 C;  3FKS G;  5KX5 B;  4FJC C;  4FFB B;  2WLI B;  4EB6 A;  1XIL A;  1SQF A;  3CS5 A;  3JCZ A;  3RN4 A;  3BAA A;  4R7C A;  3ZMU A;  2JRI A;  4JTD B;  4X20 A;  4UVC A;  3K9A A;  4U3F H;  1VF5 B;  3CCE V;  2UUC O;  2D3O W;  4DV7 O;  3LNM B;  1TA8 A;  4BIZ A;  5AG2 A;  2UXB O;  3JD2 A;  3ZRS A;  4CS4 A;  1JR9 A;  1FFX B;  1Q90 D;  1I5Y A;  5H6Q A;  1SER A;  4J9Y B;  3L70 H;  4WBN B;  2UXC B;  1QVG U;  4PHZ A;  1CEZ A;  2KQX A;  3JD4 A;  2EX3 A;  1L8D A;  1B06 A;  1NTK H;  3FB5 C;  4UCR A;  1KUQ A;  2AZ0 A;  4I50 A;  1GN6 A;  2E76 B;  3UO2 A;  4DUY B;  4X1K B;  5L3D A;  1Y74 B;  1S72 V;  5A9G A;  2BSK A;  4JYC A;  3ZHV A;  2P22 C;  4B3M B;  3G71 V;  1VQ8 V;  1K33 A;  2DW4 A;  1L1F A;  1SF9 A;  1PM9 A;  1YJN V;  1W0K G;  5LYJ A;  1AJP A;  2CH7 B;  1RSO A;  2NLJ C;  5C8Y A;  4JI7 B;  2B5U A;  4H44 B;  3AG7 A;  2JS5 A;  1AJN A;  3I55 V;  3JAL B;  2UXX A;  4H33 A;  2EZO A;  2BOC C;  3SPG A;  4FM2 A;  1LUW A;  3E83 A;  4QIW F;  1VF6 A;  3JAR A;  1VP7 A;  3ZN0 A;  3Q4H A;  3VQY A;  4XDJ A;  4TV9 A;  2N04 A;  4QE9 A;  1M90 W;  4LF9 B;  1FJG O;  3E8F A;  3I5D A;  3T1Y B;  4CC6 A;  2YIB D;  5IYC O;  3JD1 A;  2Y48 A;  2EIK B;  1IBL O;  1FXH A;  4HZ3 A;  3A0B Z;  1COW G;  5LL6 Y;  1W59 A;  3P30 A;  1FXK C;  2DOS A;  2FB5 A;  3K5L A;  4A5U B;  1JQ0 A;  4B08 A;  1FFT B;  1AI6 A;  1IVS A;  5DN6 G;  3CX5 F;  2JK5 C;  1M56 C;  2E75 B;  2P6J A;  2Q0O C;  1SQB H;  4IHJ B;  3JAK A;  4K0K O;  4IT5 A;  1JPX A;  1H38 A;  4FVM A;  3SJC C;  5DM6 V;  2Y0P A;  3RT3 C;  2VWK A;  5CB4 B;  3L71 H;  4DV4 O;  2ODM A;  1G1X B;  1D2D A;  3JAW A;  4NVP A;  3BFR A;  4G2K A;  1AR1 B;  3HB3 B;  2CUG A;  3ABU A;  3LNN A;  2Q6A A;  3BY6 A;  1BHB A;  5IJ9 B;  5LP6 A;  2E74 B;  3M8A A;  3OUS A;  3L75 H;  3D8C A;  5DED A;  5LHI A;  4PA6 A;  2F93 B;  5KLV H;  2A0L A;  1WA8 B;  1VQ6 V;  1RM1 B;  5H6R A;  1YVW A;  3BVO A;  5FPR A;  3OAA G;  1MSD A;  2CE4 A;  3ABT A;  4E2L A;  3H1L H;  4PD4 F;  1SQP H;  2E3C A;  2WA4 A;  3K0D A;  1Z2G A;  4KUM A;  5LMU O;  2KG7 A;  2DQ3 A;  5BMV B;  2F95 B;  4B3T O;  3MHH C;  3ZS8 C;  2QWP B;  3J7A U;  4R8C A;  4BIU A;  4Z1M G;  2OTL V;  5LMN O;  3CP1 A;  4DYL A;  5LGT A;  3S3W A;  2PYL A;  1S76 D;  1RP3 B;  3U11 A;  1RFY A;  4DV6 B;  2JVD A;  2R9I A;  4AIL C;  2H94 A;  3TJT A;  1XRE A;  2CTP A;  3PN1 A;  1WAZ A;  2XAJ A;  4CC5 A;  1WN7 A;  3LDC A;  5K1X A;  4K0K B;  4L8J A;  4EB6 B;  5IYZ A;  3AG3 B;  3SJQ C;  2CTQ A;  5EC1 C;  1K34 A;  3QO7 A;  4I9W A;  2E5L B;  4X20 B;  1B6Q A;  1GN2 A;  3SYA A;  4B3S O;  4YIO A;  3CE2 A;  1YIJ V;  3ZCC A;  3CEI A;  2WWW A;  1YSC A;  2WLM A;  2ZE6 A;  5JWP A;  4L87 A;  4DV4 B;  2RN9 A;  1S77 D;  5B3S B;  1ENV A;  4LCU C;  3RYC A;  2ITC C;  1O9G A;  3OE7 G;  1JX9 A;  5EC2 C;  3L73 H;  3SYC A;  2ZIO A;  4QJF B;  4I50 B;  2UU9 B;  1IDS A;  4LWS A;  4DR1 O;  2WLK A;  2DQ0 A;  4XDK A;  2CK3 G;  3ASO C;  5JJN B;  2GBO A;  2BSK B;  4N21 A;  1JJ2 U;  1VAR A;  4DR3 B;  2JDI G;  3F5T A;  4G27 B;  1BCC H;  1HNX B;  5JCO A;  5LYJ B;  4WCE V;  2PF4 E;  2AHZ A;  1RSO B;  5LMU B;  3N27 A;  4B3T B;  5C8Y B;  4OX9 O;  1M9N A;  3CRC A;  4NB5 A;  2KKW A;  5LMN B;  1F7Y A;  1FAF A;  2W6I G;  1M57 C;  1M93 A;  3J80 N;  1N34 B;  2R70 A;  1L0N H;  1Y76 A;  2LW7 A;  1JFF A;  3UCS C;  4UUJ C;  1BHA A;  3G6B A;  2P5O A;  5L3F A;  3JAR B;  1YEW A;  3Q4H B;  1XL6 A;  4TV9 B;  5D5Q A;  3BCC H;  4ZHQ A;  4JZG A;  1N0J A;  4LFB O;  4B3S B;  1P84 F;  2QSA A;  2QWQ B;  4MTO A;  3QO8 A;  3ZIA G;  2FTK A;  1FXK A;  2HVK C;  5IE9 A;  3RFR A;  4DV2 B;  3B2E E;  4DR7 O;  1NKD A;  3GWO A;  4I55 A;  1CP9 A;  2GTA A;  1HP8 A;  4JI0 O;  3SPH A;  4GZR B;  3JAK B;  4GLX A;  1FS0 G;  3AG4 C;  5HFL A;  1YIT V;  1IBM B;  2N74 A;  4NTW A;  2V4D A;  3FYE B;  1H8H G;  1OCC B;  3AK3 A;  2UUB B;  5L3E A;  3D3I A;  2QE7 G;  2P06 A;  1OCZ B;  5EBL C;  5IWA O;  4U7O A;  1EBO A;  1HWY A;  3JAW B;  1TUE B;  1ZWI C;  4P2Z A;  1PV0 A;  3LSU A;  4RUE A;  5LP6 B;  1E1Q G;  3B4S A;  3B40 A;  5GTI Z;  2JGU A;  4CBC A;  2YDE A;  4DR6 O;  5IY5 B;  1KYO F;  1XMO B;  2FML A;  4X8A A;  1S0V A;  5IJ0 A;  1F23 A;  1GM8 A;  1GM7 A;  3F7V C;  3OEH G;  2OCC B;  3ABK C;  1TUB A;  4PA3 A;  2JEX A;  2GV9 A;  2KG7 B;  2RQ6 A;  3CD6 V;  3CC4 V;  2BOB C;  2Q5Z A;  2IJI A;  1QVF U;  1Y4M A;  4NXM B;  1WB8 A;  4QE7 A;  1LR1 A;  1U96 A;  1GH6 A;  4LFB B;  4DR5 O;  1URF A;  2EIJ C;  2R9R B;  4MW3 A;  1HDJ A;  3NR7 A;  2X6B A;  4JYB A;  3STZ C;  1F4M A;  2XAF A;  2ZNI A;  1Q81 W;  1NZ6 A;  5IYZ B;  5KA6 A;  3DTU B;  2GTS A;  4LFA B;  4LH6 A;  1S5H C;  2MK3 A;  4MS2 A;  1SQX H;  5KAI Z;  3H1K H;  5K1P A;  1AI7 A;  4H37 A;  2QTS A;  2HR3 A;  5L3G A;  3K03 A;  4LF6 O;  3CRA A;  2ZIM A;  4JI3 B;  4JI8 B;  5FNV A;  1G6U A;  5IWA B;  2EIN C;  3CCR V;  3AK2 A;  1TGO A;  3RYC B;  4TQD A;  1XNQ B;  1AI4 A;  1YXB A;  4MT8 A;  5CMU A;  4DW1 A;  2YIC A;  2AXT Z;  4X64 B;  1SS3 A;  1QQC A;  1QCE A;  1LNQ A;  4P9O A;  2QWR B;  1WNS A;  4LWS B;  4LR3 A;  3G4S V;  2YEV A;  4DR6 B;  4LP8 A;  2Y69 C;  4X1I A;  3K5N A;  2HHH O;  1BE3 H;  2YXY A;  1EM1 A;  2ZXW C;  3E8H A;  3KZI Z;  2AHY A;  4J41 A;  3CJH A;  4X1Y A;  5BR8 O;  2RJZ A;  1P4R A;  1K9M W;  3OMA B;  3FYI B;  4X66 O;  3T1C A;  2YIA A;  2AGA A;  4JAS A;  4U3J A;  4RQE A;  1HNZ B;  4B3R B;  3NXS A;  2Q7G A;  1OCO C;  1YDX A;  3QVN A;  2RNB A;  1Y76 B;  3HR0 A;  4UXN A;  3F7Y C;  3P3P A;  1JFF B;  1Y66 A;  2EZP A;  3TGU H;  1KC8 W;  4DXW A;  2YXH A;  2F66 C;  2N05 A;  3C3S A;  3JYC A;  2R9A A;  1N4C A;  1XBL A;  1W0J G;  2EIM C;  2KB1 A;  4O2A A;  4ZHQ B;  1F4N A;  1L0L H;  2JGD A;  3TCU A;  5ITZ A;  2VS0 A;  3IFX A;  1KKD A;  5KHH A;  1MG1 A;  3K5O A;  4TT3 G;  4MVQ A;  2WLJ A;  4FLZ A;  2DYR C;  4G28 B;  4KHP B;  2P7T C;  4FLY A;  1UJW B;  1FXK B;  4GCZ A;  5B66 Z;  5CA1 A;  1XMQ O;  4W4K A;  1H8E G;  2LQT A;  4JAA A;  1OHH G;  1EN5 A;  4I55 B;  1SRY A;  4EKW A;  1OZ0 A;  4JAU A;  3UM7 A;  1M56 B;  5B1N A;  3MD0 A;  2QDO A;  4FIP C;  1MSW D;  3FD9 A;  4JGS A;  1KB9 F;  1HR0 O;  3CCJ V;  4JYY A;  1IZ3 A;  4O4I A;  2ARH A;  1JMK C;  2D2C B;  1IBK B;  3ETQ A;  3O65 A;  1AP6 A;  1VQ5 V;  1S5J A;  5BR8 B;  3JD0 A;  2W0F C;  1KKC A;  2GUZ A;  1KEC A;  5EK0 A;  3KKY A;  1W2B U;  1SZT A;  3OTF A;  3CSX A;  1B04 A;  3APQ A;  5BY1 A;  3OM3 B;  1IXB A;  4RUF A;  2YID A;  1QLE C;  5IJ0 B;  4X89 A;  3RWR D;  3LUT B;  3TET A;  2BE3 A;  2IM9 A;  5GON A;  1N36 O;  5E1A C;  3BA8 A;  3UO3 A;  2MW2 B;  1H2M A;  1TUB B;  4GX1 A;  3TXS A;  1ROP A;  4ABM A;  2PY5 A;  2B1I A;  3OEE G;  5B1B C;  2LGQ A;  1KQS U;  2F43 G;  5KAF Z;  2JEU A;  4NXN O;  1Q6U A;  2UUC B;  1XHZ A;  1M1K W;  4DV7 B;  3H1I H;  1HNW O;  2IU0 A;  1TVK A;  1I94 O;  5J2T A;  5J9P C;  2UXB B;  3DC6 A;  5DEC A;  2X6A A;  2DYS C;  1VQ7 V;  2L35 A;  5C93 A;  1QR9 A;  1P49 A;  2YUA A;  4YJ3 A;  3BEH A;  1NBM G;  1PPJ H;  1MOF A;  1N32 O;  2B9Z A;  4I0X A;  2DN9 A;  3W7U A;  3CHX A;  1HR0 B;  1I0H A;  3CC2 V;  3ABM C;  4OGQ B;  4FFK A;  3N2K A;  3ZJZ A;  1Y6X A;  5FNV B;  4N23 A;  2IH1 C;  3G6E V;  2CGN A;  5EIB D;  4DV1 O;  4WF9 V;  1TAE A;  2CDY A;  1BQZ A;  4PA4 A;  3WB0 A;  2YC0 A;  4FPP A;  5LGN A;  1X4T A;  5JVD A;  4Q6G A;  2ZM6 O;  3OTO O;  2XAS A;  2YEV B;  1WJZ A;  2M7W A;  3K79 A;  4X1I B;  5B1A C;  2K9P A;  3AG1 C;  2QWO B;  4ZI7 A;  1EZV H;  5JJJ B;  4F6E A;  4J42 A;  3M7M X;  4JI2 O;  4DR4 O;  2XTA A;  3CJH B;  4X1Y B;  4GYC B;  4X9Q A;  2QGN A;  1FJG B;  4U3J B;  3JCU Z;  4QNH B;  2IBZ H;  3MDS A;  1J95 A; 
#chains in the Genus database with same CATH homology
 2OCH A;  2N04 A;  2CTW A;  2CTQ A;  4J7Z A;  1WJZ A;  2LO1 A;  1HDJ A;  3APQ A;  2EJ7 A;  2LGW A;  4IT5 A;  2YUA A;  4J80 A;  2QSA A;  2QWQ B;  2CUG A;  2DMX A;  2N05 A;  3BVO A;  2QWO B;  2YS8 A;  2PF4 E;  2Y4T A;  1N4C A;  1BQ0 A;  3APO A;  2KQX A;  1FPO A;  2CTP A;  1XBL A;  3UCS C;  1IUR A;  1NZ6 A;  2DN9 A;  2Y4U A;  2CTR A;  2GUZ B;  1BQZ A;  2M6Y A;  1FAF A;  2QWP B;  1GH6 A;  3UO2 A;  3UO3 A;  4RWU A;  2QWN B;  3AG7 A;  2GUZ A;  2L6L A;  2QWR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...