2EJ7A

Solution structure of the dnaj domain of the human protein hcg3, a hypothetical protein tmp_locus_21
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
82
structure length
82
Chain Sequence
b'GSSGSSGMVDYYEVLDVPRQASSEAIKKAYRKLALKWHPDKNPENKEEAERRFKQVAEAYEVLSDAKKRDIYDRYGSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HCG3 gene
molecule tags Structural genomics, unknown function
source organism Homo sapiens
publication title Solution structure of the DnaJ domain of the human protein HCG3, a hypothetical protein tmp_locus_21
rcsb
total genus 16
structure length 82
sequence length 82
ec nomenclature
pdb deposition date 2007-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ej7A01
2OCHA 2DN9A 1NZ6A 2Y4TA 4RWUA 1WJZA 2KQXA 3AG7A 2CTQA 2CUGA 2LO1A 4J80A 2QSAA 1N4CA 3APQA 2DMXA 1FAFA 1HDJA 2QWNB 1IURA 2QWRB 2LGWA 2N05A 2CTWA 2M6YA 3BVOA 2YUAA 2QWPB 4J7ZA 1BQ0A 2QWOB 2L6LA 2N04A 1XBLA 2Y4UA 3APOA 2EJ7A 1GH6A 1FPOA 2CTPA 2GUZA 2GUZB 2PF4E 2QWQB 4IT5A 3UCSC 2CTRA 1BQZA 3UO3A 2YS8A 3UO2A
chains in the Genus database with same CATH superfamily
5L3BA 3A0BZ 2Y69C 4MVRA 1H8EG 4DR1O 1AROP 2IH3C 3QO7A 3F7VC 1Y74A 4G2KA 2F93B 1HNWO 3ZRXA 5K1XA 1ZX3A 3FYIB 4FM1A 4ZOLA 2R9IA 4IL6Z 1IBMO 1YTFB 3LDDA 3OFNG 4FLZA 3B8NA 1R6TA 3AG7A 2P22C 2BTOA 4MT8A 5B3SB 2WLJA 4H13B 3ZN1A 2PYLA 2HG5C 3KCYA 3TCUA 4DR3O 3FD9A 1L0NH 2JS3A 4X20A 3K03A 1YDXA 3TJTA 3MAQA 1YHQV 3E22A 2R72A 4JI4B 2Z5UA 4I50B 4DYLA 4DRXB 4DR6O 2D3OW 1SQGA 4MVZA 4LF4B 3U11A 4D7SA 4J80A 3NXSA 1XOUA 1BE3H 3OUFA 3E86A 4O2AB 4LC1A 3IC7A 5J2TB 2QWPB 3OT7A 4JPRA 2JEUA 1N0JA 2ATKC 5A2QN 3QF7A 2ZR2A 2WSSG 1GM9A 3CD6V 5H6RA 4ZHQA 2RCVA 4DV1O 4YJ2B 2GDSA 2IJJA 1EN4A 4B3SB 1L0LH 4J11A 2PI5A 2Q5ZA 1P7GA 5LP6C 1BQ0A 5KHIA 4JYCA 2EULA 3TXSA 1CPYA 1N8RW 2XTAA 1BGYH 4H33A 1DF5A 3G67A 4TSFG 1CXZB 3H1HH 1G4YB 3OTOO 3T1HB 5KMGA 1JJOA 4JYAO 2LJ2A 2F43G 3JAWB 1JCHA 3C90A 2M6YA 3Q4HB 2HHHB 2WAMA 1Z5VA 2AHYA 2Q73A 5IWAB 4LFBO 3BPZA 1R6KA 1RSOB 2BSKA 3VQWA 1JA8A 2XAGA 5LGUA 3ICXA 5JH7A 4DR1B 3RVZA 4DV4B 3ZCCA 3LSQA 1YZBA 3CSXA 4O4HB 3ETDA 1TAEA 1BHAA 3ASNB 1J5EO 1JFFA 3RYHB 5LXTA 1KC8W 3RYCA 3FB8C 1XQ8A 2JVDA 1IXBA 4B3MB 4DW0A 4RUFA 4J7KA 2Q4PA 1KB9F 3CCQV 4LH6A 1KD1W 3AG4B 1MOFA 3E8FA 4LFCO 4DV4O 1Y67A 2Z0AA 4IHJA 4RQFA 4GX2A 2JIZG 1US6A 3L73H 2N05A 3CXCU 4NYKA 3H01A 1JMKC 3FB6C 1M56B 5BR8O 3J7AU 1SS3A 4MVMA 1XHZA 5CB4A 3LSUA 4WF9V 4XBFA 4LH7A 1R3JC 4ZKIA 1NU1H 4XDJA 3JATA 4X1IB 5IY5B 1SZTA 1VEWA 3H1KH 4PI0A 5LXTB 4WFEA 1NI8A 2DQ3A 2E5LB 3OM3B 4UCOA 3AEIA 5BMVB 3HPLC 4LF4O 1VIBA 3UO3A 5LYJB 5IYZA 4DUZO 3IGAC 1FFXB 4QPJA 3J80N 5GTHZ 2XAQA 2P67A 3FKSG 2ZE5A 5JJEB 1ZL8B 4IIJA 1QLNA 2CTWA 4O4LA 1NKDA 2ZINA 3B2EE 3GWKC 3DC5A 4J7ZA 2EJRA 3K9SA 4KHPB 2WLNA 4QJFB 5LHIA 1TA8A 5J9PC 1OHHG 1YI2V 3QO5A 4FLVA 3H1IH 2RN9A 1HNWB 5DEDA 1M93A 1SQBH 5EZYA 4BIOA 2VQEO 1PNKA 1A32A 2YXYA 5CBFA 2ZNJA 3SYOA 2QE7G 3KCXA 4UB8Z 1LR1A 1I5XA 3JALA 4RAIA 2K1EA 4QGPA 3RW0A 1RM1B 4MTXA 1N34O 1KP2A 4BR6A 1EBOA 4K3AA 3FFQA 3T1CA 1Q90D 4DV3B 4PI2A 3AG1C 4PA6A 1KQSU 2OTJV 4WFAV 3W7WA 4MW8A 4AQYO 3D36A 1DGSA 2IM9A 1OV9A 3B77A 4MTOA 4MVUA 1SQFA 2WLLB 1AR4A 1N32O 2NLJC 4UCRA 3R66A 4J10A 1VQ9V 3D3IA 2DYRB 4X8AA 4AHCA 1F4NA 4I55A 1GK9A 3T1HO 1FS0G 3FAVB 1W59A 4LFAO 1JOYA 4UCSA 3JD0A 3G6EV 1S5HC 3FYEB 1Q8IA 3OGIB 4LCUC 2UXBO 4MS2A 1Y76A 2YI9A 5IYZB 3JAWA 1ZAUA 3AG4C 3ABMC 1WNSA 4NTYA 4G27B 5GONB 1XNRB 3JSNA 2UXBB 2YIBA 5JQGB 2W6IG 1ZLZA 2WLKA 2ZM6B 4JI1O 3STZC 2V7QG 2E74B 4JTCB 4X1IA 2YSUB 2BOBC 3LUTB 3HKBB 5JJJB 3W7XA 2ZQMA 4NXMO 5EBMC 5LL6Y 5H2FZ 5CB4B 4D7TA 3ASOC 4ZHQB 2F23A 4EKWA 2UUCB 2PUSA 3JD1A 1YJNV 4KXRA 4O4JA 1E1RG 3E2EA 1FXVA 2WPDG 4OX9O 2Q8VA 3E8HA 2OIGA 3A2FA 3JATB 3MD0A 3K04A 2AGAA 3CMEV 2Q0OC 4GYCB 3ASOB 5LOVA 4FLYA 4FFKA 5LHHA 3RVYA 4LF9O 2Y0IA 1L1FA 2XNDG 1V9PA 1PNLA 2C2AA 3IJ4A 2HVJC 3OW2U 3N2KA 1NR1A 1FFTB 5LMNB 1XNQB 4QE9A 2AZ0A 4X1YB 5CA1A 2Y4UA 1M1KW 2AHZA 5AG2A 4YXWG 5C8YB 1FXKA 4OX9B 4ZIBA 4FLWA 1WPXA 1YIJV 4PELA 4B7EA 2DMXA 5B1AB 1EN5A 4PDRA 4X89A 4JI1B 3U0ZA 2LFSA 2ZM6O 4PD4F 5A9GA 3QNEA 2Q7GA 5LMUB 2A0LA 2XASA 2AZ2A 4FM0A 2BSKB 4JZ2A 3CCJV 3WG7C 1VQLV 2IH1C 1EM1A 3CPWU 1R3LC 2X6BA 2Y69B 4DR2B 3WB0A 2HP8A 2PTMA 5EBWC 1YCIA 1HP8A 4YJ2A 4NR1A 1GN3A 5CBHA 1NH2B 3ABKB 2KB1A 2E5LO 1WP8A 4OXSA 3ZMZA 3G71V 2GTSA 3M8AA 2KSDA 2PGGA 1AI5A 1X59A 1S3JA 4Z2WA 3H1LH 1QU7A 4O4JB 3CXHF 2Q7HA 1L8DA 2KKWA 1LNQA 4UXNA 4XDKA 1NTZH 1RFYA 1NZ6A 4J9ZB 3CEIA 3PJSK 3O65A 4W4LA 3E35A 2WWWA 3D3QA 1Q82W 5CMUA 3HKCA 4JI0B 5EIBD 5KHGA 4DR2O 5E79Z 4FVMA 5H9CA 1E79G 4FLXA 2QEXV 1IX9A 2BE3A 2VWJA 4CBCA 1LUVA 3S3WA 2YS8A 3BEHA 3ZRWB 1SKVA 1WAZA 1M57C 2FMLA 3HKDA 3DSQA 3SJCC 3ASNC 3E83A 1GN4A 2E75B 3X2QC 4R6ZA 1ROPA 3L70H 4UUJC 1XHXA 5LMUO 1Y6XA 1OCZB 5IT9N 4K8ZA 5DN6G 4IT5A 2F4VB 3HKEB 3RT3C 1JVMA 3D36C 2NR5A 1UFIA 4MVSA 3OEEG 4MVOA 1I08A 1S72V 1TGOA 1AP5A 4A5UB 2FL4A 1TUBA 2YI8A 4DW1A 4B3RO 1MSWD 2Q9LA 4DUYO 3AG1B 1Z2GA 4WFFA 1R73A 2YIBD 4O4LB 4H37A 2VQFO 2LQTA 2H8PC 1FPOA 4MSWC 3UCSC 3CCVV 2WLIB 4FZ1A 4D6TH 1Q5OA 2ZDIA 2CTQA 1N34B 4I4TB 5CN0A 2A3QA 2Z3YA 4OGQB 1Q81W 3A8TA 1MG1A 3CRAA 5E1AC 2CH7A 4HNAA 3JCUZ 1SQVH 4ZI7A 2OT5A 4TV8A 5B3SC 5CA1B 1NS1A 2OCHA 1Q6HA 1M5IA 3OMNB 4DV2O 3RGBA 1Q6UA 3U10A 3FAVA 5DM6V 2LGQA 1K97A 4G28B 1URFA 4BIZA 2UUCO 2EIJB 2VRZA 2BTQB 2UUBO 2ZIMA 1W0JG 4JZGA 1K92A 5GW7A 4KL1A 3VQYA 4NXMB 4YY3O 4HYOA 3P30A 4QIWF 1GO3F 4U7NA 1VQ7V 2QWNB 4DV5B 1HNZB 4N21A 1K33A 4I0XA 2OCCB 3JD3A 1P84F 5B66Z 1K4DC 4GCZA 3CJHA 2ZE7A 4CS3A 4FMTA 1JX9A 5J2UB 2EINC 5HFMA 4WFHA 1QHTA 3HKBA 1WPBA 1JQ0A 2B1GA 3SYPA 3UT5A 4GX1A 5CA3A 2EX3A 4F6EA 4E2LA 5EZYB 4DR4B 3B09A 4LR3A 1GH6A 5BMVA 1GN2A 1X4TA 4B3MO 4DV3O 1Y76B 4DR5O 3AK1A 4PDLA 3UT5B 1HR0B 4IIJB 5B1NA 2L35A 3SPJA 4PA9A 2JDIG 2JJ1G 4JTAB 3K79A 3W7SA 1CP9A 2FTKA 4UVCA 2EIJC 4PDVA 4DK1A 2HJFC 4UB6Z 4X65B 3QG5A 2HVKC 2ITCC 1KYOF 1YSCA 2NN4A 1BMFG 3F5TA 3NR7A 2CAZC 1JJ2U 4DV5O 3ETQA 4JI8O 2QM8A 4UCUA 1IDSA 2Y48A 1NQTA 1TVKB 2WLLA 2VQEB 4YY3B 2AXTZ 4MTGA 4GX5A 5J2UA 4X64O 4YIPA 1O9HA 1SQPH 1FFXA 2LO1A 1I7FA 3A0HZ 4LP8A 3LDCA 3H1JH 1NTKH 3SJAC 3P3NA 4WBNB 3ZJZA 3I5DA 2UXDB 4Z1VA 1ENVA 3KG2A 1PP9H 2CTPA 4I0XB 2GUZB 4DV1B 1PL0A 2PZSA 1H2NA 3B8MA 4X65O 2P90A 3WFVA 3T4ZA 3JD4A 1N4CA 4X1KB 3OD4A 1VQNV 3LNNA 4NXNO 2QM7A 2MK3A 2ODMA 4JI2O 1QLEB 3RFRA 1IVSA 5KMGB 3J81N 3K0DA 4UV9A 1Y4MA 1K73W 1PM9A 2M7WA 2YDEA 1S5JA 4X64B 1SZXA 4CC5A 1QVFU 3OMIB 3CC2V 3CCSV 3CB2A 3RYIB 5CBGA 2JGDA 4DR6B 1YXBA 4JGSA 4UCTA 2GTAA 5KAIZ 4B7KA 4DR4O 1HR0O 1U97A 2QKAA 1FJGB 1DTOA 2BOCC 1AR5A 3FB5C 1EZVH 1AVMA 3CS5A 3JASB 1H38A 4TQDA 2GBOA 5L3DA 5BZBA 2YUAA 2CDYA 3E22B 3G6BA 2GHYA 2XAHA 3E89A 1GRJA 3BAAA 4PA7A 1AR1B 1IURA 1R1BA 3LSSA 2YC0A 2JEXA 3CCLV 3BVOA 5JVDA 3K9AA 4KUMA 2HEPA 3CCEV 2DJVA 1FYJA 2KG7A 3T2MA 1YF2A 4DV6O 1XBLA 2LW1A 3CCMV 3BA8A 2HHHO 2DN9A 4GX0A 2QKSA 4QPKA 1SQXH 1H2LA 3T4DA 5D5QA 1S76D 4U3JB 4LFBB 3L9DA 2P4VA 4X88A 1GKFA 1Q7YW 1NVPD 1K3EA 1BSMA 2EILB 2XAFA 4JI2B 1S5LZ 2IJKA 3ETEA 5B1BC 4BWAA 1AJNA 4OPHA 1GM8A 3B40A 1AI6A 5EK0A 4DR7O 3RYCB 5LP6A 3OTOB 1EZJA 4EFBA 2EZOA 2EBOA 3ZEDA 1NT2B 5H5NA 4DXWA 5JWPA 4YHHB 3RYFA 5LGTA 4GZRB 3CWBH 4K35A 2UXDO 2QWOB 3BFRA 1MABG 2RNBA 4X20B 1RPRA 1YVWA 4PDMA 4GKKO 1D5AA 3AG3B 1RPOA 3VBBA 3RN4A 1Q6IA 4GKJO 2WLMA 2DQ0A 3Q4HA 1VQPV 4JI5B 3W7UA 3OTFA 1H8HG 1EFRG 3ZHQA 4FM2A 4LWSB 3JD2A 3K59A 4UVBA 4JI8B 5FLXN 1PV0A 3JASA 2QWQB 2IU0A 4LF8B 5ITZA 2N74A 4EFEA 1B6QA 1M4UA 5FL7G 1OZ0A 2G38A 3AK2A 3ZN0A 5C93A 1VQ8V 5C8YA 4O2BA 4DR3B 1VARA 3IC9A 5JVDB 3QVNA 3CRCA 5KLVH 4DV7O 1YEWA 4PHZA 2H94A 3WG7B 1MA1A 2YIDA 2ZXWB 4O2BB 4ZI7B 2F4VO 3HB3B 1P4RA 4JV5B 1QCEA 4JI4O 4JAAA 1WA8A 2XAJA 5KHHA 5H6QA 3I56V 2AW9A 2QKCA 1IBLO 4FLUA 4O4IB 3AG2C 4DV7B 1R3KC 2PYJA 1HWYA 5GTIZ 4K0KB 3K5LA 1QR9A 2F66C 2JS5A 5L3FA 5LOVB 5JJNB 3ML0A 5B5EZ 1XMOO 2W0XA 1XMQB 3SJBC 3JARB 2EZPA 3DTUB 4PA4A 5IYCO 1Y74B 3THOA 4B3TO 2Q67A 1N33B 5EYPB 1MNGA 1ZWIC 1YTFD 1I94O 2OWOA 1RP3B 1JR9A 3GB7C 3N27A 3JCZA 4FFBB 1OCZC 2B1IA 2RMKB 4IGGA 2W0FC 3TGUH 4LNUB 3SYAA 2R9AA 4NB5A 2PF4E 4CH5A 1HNZO 3OUSA 1I0HA 1OCCB 1SQQH 2DOSA 3BY6A 3QO8A 5FNVA 5L3GA 5TISZ 5KUKA 1Q3EA 2DYRC 1E1QG 4YHHO 1SF9A 2LP7A 3KZIZ 4CH4A 4LF5B 3K5MA 3T1YO 1H2SB 5KHKA 4F4LA 3R65A 4IYHA 3JAMN 4EEQA 1QQCA 4QE7A 1KECA 5KX5B 3STLC 1VQKV 4WFGA 1COWG 4X62O 4LFAB 4PV1B 1GMGA 2CUGA 2ADQB 4JI6B 4DO2A 2ZXWC 2DWDC 4U3JA 1W2BU 3OMAB 2XOKG 4I55B 5EC1C 1UPGA 4DV0O 5LMNO 1XNQO 3G4SV 1BL8A 3EHBB 1OCRB 5FPRA 3KKYA 3JAKB 2FYUH 2UXCB 2EIKB 4JASA 5HFLA 3ZMSA 4EB6A 4Q6GA 4LF9B 1MZFA 2CH7B 4TWKA 3ZHUA 2W6JG 1D2DA 5KAFZ 5LYJA 4YJ3A 3W7TA 4TUYB 4B3RB 4P9OA 1XMOB 5IJ0A 4CH3A 1SESA 1WN7A 1AI7A 3K0GA 2JGUA 3K57A 4K0KO 3CRRA 1FAFA 1YJWV 3D8CA 5CA0A 2B5UA 3BCCH 5F2VO 4LNUA 3UKMA 1QLEC 4RQEA 3F7YC 4I7ZB 2DWEC 2ILMA 3N2KB 4GKJB 1PNMA 2QM4A 1PKXA 3OEHG 2VWKA 3WB1A 3CC4V 1XL4A 3GWOA 2YEVA 1V54B 4F6RA 4NXNB 1KKCA 2P4KA 1NJIW 5IJ9A 4HBNA 1XNRO 3WU2Z 2X0LA 2CE4A 2EIMB 1VP7A 3AG2B 4JI7B 1PPJH 3AK3A 1B3QA 1M9NA 2RJZA 1NH2D 2GUZA 4CC6A 2QDOA 4X62B 3TETA 1NR7A 4JI5O 1HDJA 2ARHA 3L71H 4JTDB 4I9WA 2GV9A 4JYBA 5K1PA 4BIUA 4P2ZA 4Q20A 4CS2A 1OJHA 4LF7B 5IYDO 4U3FH 3IFXA 4K8XA 4TT3G 2Y4TA 1K8AW 4FFBA 2WLHA 2CGNA 3DXRB 3PN1A 1NBMG 4UFZA 2QJ1A 4FZ0A 5B1OA 1I94B 4X66O 1W0KG 3A0RA 1QNMA 2ZDIC 5LBQA 1N33O 2E76B 4LFCB 1B06A 1SC5B 4KP4A 2RQ6A 1VQMV 2E3CA 4I9QA 2QR4A 2UXNA 3P32A 3MHHC 2Q69A 3MDSA 5IDJA 4IYIA 1VF6C 3C3TA 3HR0A 5EYPA 2BTQA 3JSLA 4UV8A 2ZKOA 2OCCC 1XI1A 3UQ8A 1K5QA 2CGOA 3SYQA 1GAXA 2A9HA 5FNVB 1BS3A 1V54C 1VQ6V 1RSOA 1HNXB 2YIAA 2OTLV 4R7CA 4FIPC 5L3EA 3CHXA 4L8JA 3ZHSA 1DF4A 2P06A 4HNAB 3JAKA 4JI3O 4HAMA 3ZHVA 3OGCC 2QGNA 3L75H 5FPOA 2H3OA 1BQZA 1GM7A 1QBZA 1S77D 1QR8A 4DUZB 3BA9A 2WLIA 1GTOA 4U7OA 2K9PA 1KUQA 3BHPA 3HKCB 3SPIA 3DC6A 4B3SO 5IE9A 2FB5A 2RDCA 4UVAA 3WB2A 3QTCA 2IJIA 5B1BB 4TV9B 1IXMA 1ZSPA 4O4IA 3ABTA 2IU3A 2PY5A 1TUEB 1KP3A 4N23A 3B4SA 2Q6AA 2QWRB 1O9GA 1Q43A 3N2GA 2V4DA 3CYOA 1EN6A 5LP6B 4O2AA 4W4KA 4J41A 1FXKB 2L6LA 1D5NA 5D5PA 1VQ4V 2LFRA 3TK1A 1BT8A 3OR6C 5ITZB 2QSAA 1MSDA 1IBMB 1AB3A 3ZRVA 4MTFA 1MZEA 5GONA 4H44B 4I50A 4YJ3B 1UJWB 4NKGB 2JK5C 5L3CA 3HKEA 1VQ5V 4PJ0Z 5EIBC 4JI3B 3CRQA 2HKOA 4TV9A 4MVQA 4P30A 2ITDC 1HNXO 3L74H 3ZMVA 3L72H 2DW4A 1PL4A 1K7DA 3APQA 4CS4A 5IWAO 3CX5F 1F23A 1R6NA 2D2CB 3ZS8C 4WBNA 4MW3A 4NVPA 2GSMB 3X2QB 2ETNA 1ZUQA 2CTRA 2EINB 2YXLA 4X66B 2P6JA 3UO2A 4J42A 1DK1A 3VQVA 1FJGO 3BRCA 2QTOA 1JFFB 1NTMH 3RYHA 1KU9A 4P9PA 1XEQA 3CRMA 3ZRWA 1WP7A 2IJHA 4HZ3A 2UU9B 3ZHRA 5JH7B 2OIEA 2A7WA 2KQXA 2EILC 2WA3A 4ICGA 4NTWA 2UUBB 4FK5C 2Y0PA 4BW5A 1Z5WA 1VF7A 3OR7C 3CE2A 2NNUA 5BY1A 4JYAB 2R9RB 2DE0X 4BW9A 3H9VA 1Y66A 2IW5A 1XILA 4I5SA 1XDCA 3EXAA 1M90W 4NTXA 1CEZA 2ZIOA 1SA0B 3JARA 4ASUG 4RUEA 2ZNIA 2HJDA 4GUNA 4R8CA 2HLDG 1FKAO 1OCOC 1K4CC 3SPGA 1XREA 4CH6A 3JYCA 4E4EA 5JQGA 3N2GB 4QNHB 2IBZH 4GLXA 1F4MA 3EFFK 1P49A 1OCRC 1WA8B 3ABKC 1XL6A 4DUYB 2X6AA 1AILA 4DV2B 2PI4A 2QA4V 4JI7O 5KA6A 5J2TA 3GVMA 4LBEC 3EVKA 1J95A 1IBKO 5BXZA 1SERA 1BZKA 1KMIZ 3MHSC 4B08A 2KG7B 5KUMA 4EB6B 1VQOV 1QVGU 5JCOC 4X1YA 2Q7EA 3FX7A 4TQFA 3K58A 3LNMB 2LW7A 1KKDA 2XHBA 5KHJA 3F5WC 2R70A 1F7YA 4FPPA 4Z1MG 2F95B 4ABMA 4DRXA 3K5OA 3ZX6A 2N04A 2VQFB 1KBHA 1FD9A 1ORQC 1BCCH 1B04A 4GT1A 1F51A 1WJZA 3M99B 1M57B 1ZL8A 4UCVA 3BABA 1OCCC 1TVKA 1VF6A 3K06A 1IZ3A 1FXHA 4CZZA 3ZRSA 2DYSC 5JCOA 1H2KA 3DGEA 4DV0B 3P3PA 1VF5B 5DECA 1P7BA 4O4HA 4JF3A 5KA5A 1G8MA 4J9YB 4LF6B 2XUMA 4JI6O 4X9QA 2HR3A 3ZMTA 1JPXA 4JAUA 2P5OA 1M56C 3SYCA 3K08A 4J7JA 2UUAB 2UUAO 3RYIA 3M7MX 3LDEA 2XT9A 4LF7O 3SPHA 4LF5O 1RM1C 3ZMUA 1SRYA 4JAVA 4TUYA 1NVPB 4RWUA 5LA6B 1V55B 3S3XA 3ETGA 2QTSA 3CC7V 3DXRA 4TOIA 3SGIA 1S0VA 2ZE8A 2CK3G 1G1XB 1LUWA 2Q0AA 2F1MA 1WB8A 2EJ7A 2MW2B 3SR2C 2O57A 5B1AC 3I55V 1DLBA 4BAYA 3ABUA 4OPAA 4B3TB 2JRIA 1WB7A 2ADPA 5LA6A 5IJ0B 4DK0A 2V1DA 2BCCH 4WCEV 2X6CA 5LHGA 2LGWA 1I5YA 1IBLB 1N32B 4IHJB 2JJ2G 4RO2A 5CA0B 2OYQA 4JV5O 4JYYA 1FXKC 2Q68A 2EIMC 1N36B 2EIKC 1N36O 5KX5A 3CJHB 4C7UA 5IYBO 1TUBB 3TXQA 1IBKB 1VMGA 2YEVB 4F6RB 1XMQO 1AP6A 1R3IC 1YITV 2UXXA 2HFEC 1G6UA 3ABLC 1ZTEA 1PD3A 2X7RB 3ZHTA 3APOA 4YIOA 3VQXA 4X1KA 1OCOB 1YJ9V 1MMMA 3JALB 1THZA 5EBLC 2YICA 3AG3C 1GN6A 2ZD9A 4FJCC 4AILC 3SPCA 1XUQA 4ZBMA 3RBZA 3E8BA 1SA0A 3CP1A 3ABLB 3C3SA 4XDLA 3CCUV 4KHPO 4WFBV 3G80A 4GKKB 5IY5C 1U96A 2ZCEA 3K3WA 3IAYA 3O9OA 3ZBHA 4KFMA 1H2MA 2VS0A 2UXCO 4LF8O 5EC2C 1AJPA 1K5SA 2A79B 3CMAV 4JI0O 4DR7B 1HW7A 3OAAG 1BHBA 3ABMB 2ZE6A 2WA4A 3OE7G 4I4TA 3K5NA 4LWSA 1N0NA 3SJQC 3UM7A 3T1YB 3RWRD 2A06H 5LGNA 1T5EA 2YXHA 1K9MW 1WLEA 1AI4A 4TV8B 4H0LB 4AI8A 5BR8B 4DV6B 4L87A 5IJ9B 4ZOLB 3HKDB 2UU9O 1Q86W 4PA3A 1V55C 3VOUA 2ZT9B 4LF6O 2DYSB 2P7TC 3CCRV 2FKXA 3RYFB 1H2GA 3SDLA 4AQYB 2B9ZA 1SETA 4R50A 3ZIAG 2ZR3A 1K34A 3E8GA 4DR5B 3FB7C 4FLTA 1AJQA 1J5EB 2JGDB
chains in the Genus database with same CATH topology
2OCHA 2DN9A 1NZ6A 2Y4TA 4RWUA 1WJZA 2KQXA 3AG7A 2CTQA 2CUGA 2LO1A 4J80A 2QSAA 1N4CA 3APQA 2DMXA 1FAFA 1HDJA 2QWNB 1IURA 2QWRB 2LGWA 2N05A 2CTWA 2M6YA 3BVOA 2YUAA 2QWPB 4J7ZA 1BQ0A 2QWOB 2L6LA 2N04A 1XBLA 2Y4UA 3APOA 2EJ7A 1GH6A 1FPOA 2CTPA 2GUZA 2GUZB 2PF4E 2QWQB 4IT5A 3UCSC 2CTRA 1BQZA 3UO3A 2YS8A 3UO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  2DN9 A;  1NZ6 A;  2Y4T A;  4RWU A;  1WJZ A;  2KQX A;  3AG7 A;  2CTQ A;  2CUG A;  2LO1 A;  4J80 A;  2QSA A;  1N4C A;  3APQ A;  2DMX A;  1FAF A;  1HDJ A;  2QWN B;  1IUR A;  2QWR B;  2LGW A;  2N05 A;  2CTW A;  2M6Y A;  3BVO A;  2YUA A;  2QWP B;  4J7Z A;  1BQ0 A;  2QWO B;  2L6L A;  2N04 A;  1XBL A;  2Y4U A;  3APO A;  2EJ7 A;  1GH6 A;  1FPO A;  2CTP A;  2GUZ A;  2GUZ B;  2PF4 E;  2QWQ B;  4IT5 A;  3UCS C;  2CTR A;  1BQZ A;  3UO3 A;  2YS8 A;  3UO2 A; 
#chains in the Genus database with same CATH topology
 5L3B A;  3A0B Z;  2Y69 C;  4MVR A;  1H8E G;  4DR1 O;  1ARO P;  2IH3 C;  3QO7 A;  3F7V C;  1Y74 A;  4G2K A;  2F93 B;  1HNW O;  3ZRX A;  5K1X A;  1ZX3 A;  3FYI B;  4FM1 A;  4ZOL A;  2R9I A;  4IL6 Z;  1IBM O;  1YTF B;  3LDD A;  3OFN G;  4FLZ A;  3B8N A;  1R6T A;  3AG7 A;  2P22 C;  2BTO A;  4MT8 A;  5B3S B;  2WLJ A;  4H13 B;  3ZN1 A;  2PYL A;  2HG5 C;  3KCY A;  3TCU A;  4DR3 O;  3FD9 A;  1L0N H;  2JS3 A;  4X20 A;  3K03 A;  1YDX A;  3TJT A;  3MAQ A;  1YHQ V;  3E22 A;  2R72 A;  4JI4 B;  2Z5U A;  4I50 B;  4DYL A;  4DRX B;  4DR6 O;  2D3O W;  1SQG A;  4MVZ A;  4LF4 B;  3U11 A;  4D7S A;  4J80 A;  3NXS A;  1XOU A;  1BE3 H;  3OUF A;  3E86 A;  4O2A B;  4LC1 A;  3IC7 A;  5J2T B;  2QWP B;  3OT7 A;  4JPR A;  2JEU A;  1N0J A;  2ATK C;  5A2Q N;  3QF7 A;  2ZR2 A;  2WSS G;  1GM9 A;  3CD6 V;  5H6R A;  4ZHQ A;  2RCV A;  4DV1 O;  4YJ2 B;  2GDS A;  2IJJ A;  1EN4 A;  4B3S B;  1L0L H;  4J11 A;  2PI5 A;  2Q5Z A;  1P7G A;  5LP6 C;  1BQ0 A;  5KHI A;  4JYC A;  2EUL A;  3TXS A;  1CPY A;  1N8R W;  2XTA A;  1BGY H;  4H33 A;  1DF5 A;  3G67 A;  4TSF G;  1CXZ B;  3H1H H;  1G4Y B;  3OTO O;  3T1H B;  5KMG A;  1JJO A;  4JYA O;  2LJ2 A;  2F43 G;  3JAW B;  1JCH A;  3C90 A;  2M6Y A;  3Q4H B;  2HHH B;  2WAM A;  1Z5V A;  2AHY A;  2Q73 A;  5IWA B;  4LFB O;  3BPZ A;  1R6K A;  1RSO B;  2BSK A;  3VQW A;  1JA8 A;  2XAG A;  5LGU A;  3ICX A;  5JH7 A;  4DR1 B;  3RVZ A;  4DV4 B;  3ZCC A;  3LSQ A;  1YZB A;  3CSX A;  4O4H B;  3ETD A;  1TAE A;  1BHA A;  3ASN B;  1J5E O;  1JFF A;  3RYH B;  5LXT A;  1KC8 W;  3RYC A;  3FB8 C;  1XQ8 A;  2JVD A;  1IXB A;  4B3M B;  4DW0 A;  4RUF A;  4J7K A;  2Q4P A;  1KB9 F;  3CCQ V;  4LH6 A;  1KD1 W;  3AG4 B;  1MOF A;  3E8F A;  4LFC O;  4DV4 O;  1Y67 A;  2Z0A A;  4IHJ A;  4RQF A;  4GX2 A;  2JIZ G;  1US6 A;  3L73 H;  2N05 A;  3CXC U;  4NYK A;  3H01 A;  1JMK C;  3FB6 C;  1M56 B;  5BR8 O;  3J7A U;  1SS3 A;  4MVM A;  1XHZ A;  5CB4 A;  3LSU A;  4WF9 V;  4XBF A;  4LH7 A;  1R3J C;  4ZKI A;  1NU1 H;  4XDJ A;  3JAT A;  4X1I B;  5IY5 B;  1SZT A;  1VEW A;  3H1K H;  4PI0 A;  5LXT B;  4WFE A;  1NI8 A;  2DQ3 A;  2E5L B;  3OM3 B;  4UCO A;  3AEI A;  5BMV B;  3HPL C;  4LF4 O;  1VIB A;  3UO3 A;  5LYJ B;  5IYZ A;  4DUZ O;  3IGA C;  1FFX B;  4QPJ A;  3J80 N;  5GTH Z;  2XAQ A;  2P67 A;  3FKS G;  2ZE5 A;  5JJE B;  1ZL8 B;  4IIJ A;  1QLN A;  2CTW A;  4O4L A;  1NKD A;  2ZIN A;  3B2E E;  3GWK C;  3DC5 A;  4J7Z A;  2EJR A;  3K9S A;  4KHP B;  2WLN A;  4QJF B;  5LHI A;  1TA8 A;  5J9P C;  1OHH G;  1YI2 V;  3QO5 A;  4FLV A;  3H1I H;  2RN9 A;  1HNW B;  5DED A;  1M93 A;  1SQB H;  5EZY A;  4BIO A;  2VQE O;  1PNK A;  1A32 A;  2YXY A;  5CBF A;  2ZNJ A;  3SYO A;  2QE7 G;  3KCX A;  4UB8 Z;  1LR1 A;  1I5X A;  3JAL A;  4RAI A;  2K1E A;  4QGP A;  3RW0 A;  1RM1 B;  4MTX A;  1N34 O;  1KP2 A;  4BR6 A;  1EBO A;  4K3A A;  3FFQ A;  3T1C A;  1Q90 D;  4DV3 B;  4PI2 A;  3AG1 C;  4PA6 A;  1KQS U;  2OTJ V;  4WFA V;  3W7W A;  4MW8 A;  4AQY O;  3D36 A;  1DGS A;  2IM9 A;  1OV9 A;  3B77 A;  4MTO A;  4MVU A;  1SQF A;  2WLL B;  1AR4 A;  1N32 O;  2NLJ C;  4UCR A;  3R66 A;  4J10 A;  1VQ9 V;  3D3I A;  2DYR B;  4X8A A;  4AHC A;  1F4N A;  4I55 A;  1GK9 A;  3T1H O;  1FS0 G;  3FAV B;  1W59 A;  4LFA O;  1JOY A;  4UCS A;  3JD0 A;  3G6E V;  1S5H C;  3FYE B;  1Q8I A;  3OGI B;  4LCU C;  2UXB O;  4MS2 A;  1Y76 A;  2YI9 A;  5IYZ B;  3JAW A;  1ZAU A;  3AG4 C;  3ABM C;  1WNS A;  4NTY A;  4G27 B;  5GON B;  1XNR B;  3JSN A;  2UXB B;  2YIB A;  5JQG B;  2W6I G;  1ZLZ A;  2WLK A;  2ZM6 B;  4JI1 O;  3STZ C;  2V7Q G;  2E74 B;  4JTC B;  4X1I A;  2YSU B;  2BOB C;  3LUT B;  3HKB B;  5JJJ B;  3W7X A;  2ZQM A;  4NXM O;  5EBM C;  5LL6 Y;  5H2F Z;  5CB4 B;  4D7T A;  3ASO C;  4ZHQ B;  2F23 A;  4EKW A;  2UUC B;  2PUS A;  3JD1 A;  1YJN V;  4KXR A;  4O4J A;  1E1R G;  3E2E A;  1FXV A;  2WPD G;  4OX9 O;  2Q8V A;  3E8H A;  2OIG A;  3A2F A;  3JAT B;  3MD0 A;  3K04 A;  2AGA A;  3CME V;  2Q0O C;  4GYC B;  3ASO B;  5LOV A;  4FLY A;  4FFK A;  5LHH A;  3RVY A;  4LF9 O;  2Y0I A;  1L1F A;  2XND G;  1V9P A;  1PNL A;  2C2A A;  3IJ4 A;  2HVJ C;  3OW2 U;  3N2K A;  1NR1 A;  1FFT B;  5LMN B;  1XNQ B;  4QE9 A;  2AZ0 A;  4X1Y B;  5CA1 A;  2Y4U A;  1M1K W;  2AHZ A;  5AG2 A;  4YXW G;  5C8Y B;  1FXK A;  4OX9 B;  4ZIB A;  4FLW A;  1WPX A;  1YIJ V;  4PEL A;  4B7E A;  2DMX A;  5B1A B;  1EN5 A;  4PDR A;  4X89 A;  4JI1 B;  3U0Z A;  2LFS A;  2ZM6 O;  4PD4 F;  5A9G A;  3QNE A;  2Q7G A;  5LMU B;  2A0L A;  2XAS A;  2AZ2 A;  4FM0 A;  2BSK B;  4JZ2 A;  3CCJ V;  3WG7 C;  1VQL V;  2IH1 C;  1EM1 A;  3CPW U;  1R3L C;  2X6B A;  2Y69 B;  4DR2 B;  3WB0 A;  2HP8 A;  2PTM A;  5EBW C;  1YCI A;  1HP8 A;  4YJ2 A;  4NR1 A;  1GN3 A;  5CBH A;  1NH2 B;  3ABK B;  2KB1 A;  2E5L O;  1WP8 A;  4OXS A;  3ZMZ A;  3G71 V;  2GTS A;  3M8A A;  2KSD A;  2PGG A;  1AI5 A;  1X59 A;  1S3J A;  4Z2W A;  3H1L H;  1QU7 A;  4O4J B;  3CXH F;  2Q7H A;  1L8D A;  2KKW A;  1LNQ A;  4UXN A;  4XDK A;  1NTZ H;  1RFY A;  1NZ6 A;  4J9Z B;  3CEI A;  3PJS K;  3O65 A;  4W4L A;  3E35 A;  2WWW A;  3D3Q A;  1Q82 W;  5CMU A;  3HKC A;  4JI0 B;  5EIB D;  5KHG A;  4DR2 O;  5E79 Z;  4FVM A;  5H9C A;  1E79 G;  4FLX A;  2QEX V;  1IX9 A;  2BE3 A;  2VWJ A;  4CBC A;  1LUV A;  3S3W A;  2YS8 A;  3BEH A;  3ZRW B;  1SKV A;  1WAZ A;  1M57 C;  2FML A;  3HKD A;  3DSQ A;  3SJC C;  3ASN C;  3E83 A;  1GN4 A;  2E75 B;  3X2Q C;  4R6Z A;  1ROP A;  3L70 H;  4UUJ C;  1XHX A;  5LMU O;  1Y6X A;  1OCZ B;  5IT9 N;  4K8Z A;  5DN6 G;  4IT5 A;  2F4V B;  3HKE B;  3RT3 C;  1JVM A;  3D36 C;  2NR5 A;  1UFI A;  4MVS A;  3OEE G;  4MVO A;  1I08 A;  1S72 V;  1TGO A;  1AP5 A;  4A5U B;  2FL4 A;  1TUB A;  2YI8 A;  4DW1 A;  4B3R O;  1MSW D;  2Q9L A;  4DUY O;  3AG1 B;  1Z2G A;  4WFF A;  1R73 A;  2YIB D;  4O4L B;  4H37 A;  2VQF O;  2LQT A;  2H8P C;  1FPO A;  4MSW C;  3UCS C;  3CCV V;  2WLI B;  4FZ1 A;  4D6T H;  1Q5O A;  2ZDI A;  2CTQ A;  1N34 B;  4I4T B;  5CN0 A;  2A3Q A;  2Z3Y A;  4OGQ B;  1Q81 W;  3A8T A;  1MG1 A;  3CRA A;  5E1A C;  2CH7 A;  4HNA A;  3JCU Z;  1SQV H;  4ZI7 A;  2OT5 A;  4TV8 A;  5B3S C;  5CA1 B;  1NS1 A;  2OCH A;  1Q6H A;  1M5I A;  3OMN B;  4DV2 O;  3RGB A;  1Q6U A;  3U10 A;  3FAV A;  5DM6 V;  2LGQ A;  1K97 A;  4G28 B;  1URF A;  4BIZ A;  2UUC O;  2EIJ B;  2VRZ A;  2BTQ B;  2UUB O;  2ZIM A;  1W0J G;  4JZG A;  1K92 A;  5GW7 A;  4KL1 A;  3VQY A;  4NXM B;  4YY3 O;  4HYO A;  3P30 A;  4QIW F;  1GO3 F;  4U7N A;  1VQ7 V;  2QWN B;  4DV5 B;  1HNZ B;  4N21 A;  1K33 A;  4I0X A;  2OCC B;  3JD3 A;  1P84 F;  5B66 Z;  1K4D C;  4GCZ A;  3CJH A;  2ZE7 A;  4CS3 A;  4FMT A;  1JX9 A;  5J2U B;  2EIN C;  5HFM A;  4WFH A;  1QHT A;  3HKB A;  1WPB A;  1JQ0 A;  2B1G A;  3SYP A;  3UT5 A;  4GX1 A;  5CA3 A;  2EX3 A;  4F6E A;  4E2L A;  5EZY B;  4DR4 B;  3B09 A;  4LR3 A;  1GH6 A;  5BMV A;  1GN2 A;  1X4T A;  4B3M O;  4DV3 O;  1Y76 B;  4DR5 O;  3AK1 A;  4PDL A;  3UT5 B;  1HR0 B;  4IIJ B;  5B1N A;  2L35 A;  3SPJ A;  4PA9 A;  2JDI G;  2JJ1 G;  4JTA B;  3K79 A;  3W7S A;  1CP9 A;  2FTK A;  4UVC A;  2EIJ C;  4PDV A;  4DK1 A;  2HJF C;  4UB6 Z;  4X65 B;  3QG5 A;  2HVK C;  2ITC C;  1KYO F;  1YSC A;  2NN4 A;  1BMF G;  3F5T A;  3NR7 A;  2CAZ C;  1JJ2 U;  4DV5 O;  3ETQ A;  4JI8 O;  2QM8 A;  4UCU A;  1IDS A;  2Y48 A;  1NQT A;  1TVK B;  2WLL A;  2VQE B;  4YY3 B;  2AXT Z;  4MTG A;  4GX5 A;  5J2U A;  4X64 O;  4YIP A;  1O9H A;  1SQP H;  1FFX A;  2LO1 A;  1I7F A;  3A0H Z;  4LP8 A;  3LDC A;  3H1J H;  1NTK H;  3SJA C;  3P3N A;  4WBN B;  3ZJZ A;  3I5D A;  2UXD B;  4Z1V A;  1ENV A;  3KG2 A;  1PP9 H;  2CTP A;  4I0X B;  2GUZ B;  4DV1 B;  1PL0 A;  2PZS A;  1H2N A;  3B8M A;  4X65 O;  2P90 A;  3WFV A;  3T4Z A;  3JD4 A;  1N4C A;  4X1K B;  3OD4 A;  1VQN V;  3LNN A;  4NXN O;  2QM7 A;  2MK3 A;  2ODM A;  4JI2 O;  1QLE B;  3RFR A;  1IVS A;  5KMG B;  3J81 N;  3K0D A;  4UV9 A;  1Y4M A;  1K73 W;  1PM9 A;  2M7W A;  2YDE A;  1S5J A;  4X64 B;  1SZX A;  4CC5 A;  1QVF U;  3OMI B;  3CC2 V;  3CCS V;  3CB2 A;  3RYI B;  5CBG A;  2JGD A;  4DR6 B;  1YXB A;  4JGS A;  4UCT A;  2GTA A;  5KAI Z;  4B7K A;  4DR4 O;  1HR0 O;  1U97 A;  2QKA A;  1FJG B;  1DTO A;  2BOC C;  1AR5 A;  3FB5 C;  1EZV H;  1AVM A;  3CS5 A;  3JAS B;  1H38 A;  4TQD A;  2GBO A;  5L3D A;  5BZB A;  2YUA A;  2CDY A;  3E22 B;  3G6B A;  2GHY A;  2XAH A;  3E89 A;  1GRJ A;  3BAA A;  4PA7 A;  1AR1 B;  1IUR A;  1R1B A;  3LSS A;  2YC0 A;  2JEX A;  3CCL V;  3BVO A;  5JVD A;  3K9A A;  4KUM A;  2HEP A;  3CCE V;  2DJV A;  1FYJ A;  2KG7 A;  3T2M A;  1YF2 A;  4DV6 O;  1XBL A;  2LW1 A;  3CCM V;  3BA8 A;  2HHH O;  2DN9 A;  4GX0 A;  2QKS A;  4QPK A;  1SQX H;  1H2L A;  3T4D A;  5D5Q A;  1S76 D;  4U3J B;  4LFB B;  3L9D A;  2P4V A;  4X88 A;  1GKF A;  1Q7Y W;  1NVP D;  1K3E A;  1BSM A;  2EIL B;  2XAF A;  4JI2 B;  1S5L Z;  2IJK A;  3ETE A;  5B1B C;  4BWA A;  1AJN A;  4OPH A;  1GM8 A;  3B40 A;  1AI6 A;  5EK0 A;  4DR7 O;  3RYC B;  5LP6 A;  3OTO B;  1EZJ A;  4EFB A;  2EZO A;  2EBO A;  3ZED A;  1NT2 B;  5H5N A;  4DXW A;  5JWP A;  4YHH B;  3RYF A;  5LGT A;  4GZR B;  3CWB H;  4K35 A;  2UXD O;  2QWO B;  3BFR A;  1MAB G;  2RNB A;  4X20 B;  1RPR A;  1YVW A;  4PDM A;  4GKK O;  1D5A A;  3AG3 B;  1RPO A;  3VBB A;  3RN4 A;  1Q6I A;  4GKJ O;  2WLM A;  2DQ0 A;  3Q4H A;  1VQP V;  4JI5 B;  3W7U A;  3OTF A;  1H8H G;  1EFR G;  3ZHQ A;  4FM2 A;  4LWS B;  3JD2 A;  3K59 A;  4UVB A;  4JI8 B;  5FLX N;  1PV0 A;  3JAS A;  2QWQ B;  2IU0 A;  4LF8 B;  5ITZ A;  2N74 A;  4EFE A;  1B6Q A;  1M4U A;  5FL7 G;  1OZ0 A;  2G38 A;  3AK2 A;  3ZN0 A;  5C93 A;  1VQ8 V;  5C8Y A;  4O2B A;  4DR3 B;  1VAR A;  3IC9 A;  5JVD B;  3QVN A;  3CRC A;  5KLV H;  4DV7 O;  1YEW A;  4PHZ A;  2H94 A;  3WG7 B;  1MA1 A;  2YID A;  2ZXW B;  4O2B B;  4ZI7 B;  2F4V O;  3HB3 B;  1P4R A;  4JV5 B;  1QCE A;  4JI4 O;  4JAA A;  1WA8 A;  2XAJ A;  5KHH A;  5H6Q A;  3I56 V;  2AW9 A;  2QKC A;  1IBL O;  4FLU A;  4O4I B;  3AG2 C;  4DV7 B;  1R3K C;  2PYJ A;  1HWY A;  5GTI Z;  4K0K B;  3K5L A;  1QR9 A;  2F66 C;  2JS5 A;  5L3F A;  5LOV B;  5JJN B;  3ML0 A;  5B5E Z;  1XMO O;  2W0X A;  1XMQ B;  3SJB C;  3JAR B;  2EZP A;  3DTU B;  4PA4 A;  5IYC O;  1Y74 B;  3THO A;  4B3T O;  2Q67 A;  1N33 B;  5EYP B;  1MNG A;  1ZWI C;  1YTF D;  1I94 O;  2OWO A;  1RP3 B;  1JR9 A;  3GB7 C;  3N27 A;  3JCZ A;  4FFB B;  1OCZ C;  2B1I A;  2RMK B;  4IGG A;  2W0F C;  3TGU H;  4LNU B;  3SYA A;  2R9A A;  4NB5 A;  2PF4 E;  4CH5 A;  1HNZ O;  3OUS A;  1I0H A;  1OCC B;  1SQQ H;  2DOS A;  3BY6 A;  3QO8 A;  5FNV A;  5L3G A;  5TIS Z;  5KUK A;  1Q3E A;  2DYR C;  1E1Q G;  4YHH O;  1SF9 A;  2LP7 A;  3KZI Z;  4CH4 A;  4LF5 B;  3K5M A;  3T1Y O;  1H2S B;  5KHK A;  4F4L A;  3R65 A;  4IYH A;  3JAM N;  4EEQ A;  1QQC A;  4QE7 A;  1KEC A;  5KX5 B;  3STL C;  1VQK V;  4WFG A;  1COW G;  4X62 O;  4LFA B;  4PV1 B;  1GMG A;  2CUG A;  2ADQ B;  4JI6 B;  4DO2 A;  2ZXW C;  2DWD C;  4U3J A;  1W2B U;  3OMA B;  2XOK G;  4I55 B;  5EC1 C;  1UPG A;  4DV0 O;  5LMN O;  1XNQ O;  3G4S V;  1BL8 A;  3EHB B;  1OCR B;  5FPR A;  3KKY A;  3JAK B;  2FYU H;  2UXC B;  2EIK B;  4JAS A;  5HFL A;  3ZMS A;  4EB6 A;  4Q6G A;  4LF9 B;  1MZF A;  2CH7 B;  4TWK A;  3ZHU A;  2W6J G;  1D2D A;  5KAF Z;  5LYJ A;  4YJ3 A;  3W7T A;  4TUY B;  4B3R B;  4P9O A;  1XMO B;  5IJ0 A;  4CH3 A;  1SES A;  1WN7 A;  1AI7 A;  3K0G A;  2JGU A;  3K57 A;  4K0K O;  3CRR A;  1FAF A;  1YJW V;  3D8C A;  5CA0 A;  2B5U A;  3BCC H;  5F2V O;  4LNU A;  3UKM A;  1QLE C;  4RQE A;  3F7Y C;  4I7Z B;  2DWE C;  2ILM A;  3N2K B;  4GKJ B;  1PNM A;  2QM4 A;  1PKX A;  3OEH G;  2VWK A;  3WB1 A;  3CC4 V;  1XL4 A;  3GWO A;  2YEV A;  1V54 B;  4F6R A;  4NXN B;  1KKC A;  2P4K A;  1NJI W;  5IJ9 A;  4HBN A;  1XNR O;  3WU2 Z;  2X0L A;  2CE4 A;  2EIM B;  1VP7 A;  3AG2 B;  4JI7 B;  1PPJ H;  3AK3 A;  1B3Q A;  1M9N A;  2RJZ A;  1NH2 D;  2GUZ A;  4CC6 A;  2QDO A;  4X62 B;  3TET A;  1NR7 A;  4JI5 O;  1HDJ A;  2ARH A;  3L71 H;  4JTD B;  4I9W A;  2GV9 A;  4JYB A;  5K1P A;  4BIU A;  4P2Z A;  4Q20 A;  4CS2 A;  1OJH A;  4LF7 B;  5IYD O;  4U3F H;  3IFX A;  4K8X A;  4TT3 G;  2Y4T A;  1K8A W;  4FFB A;  2WLH A;  2CGN A;  3DXR B;  3PN1 A;  1NBM G;  4UFZ A;  2QJ1 A;  4FZ0 A;  5B1O A;  1I94 B;  4X66 O;  1W0K G;  3A0R A;  1QNM A;  2ZDI C;  5LBQ A;  1N33 O;  2E76 B;  4LFC B;  1B06 A;  1SC5 B;  4KP4 A;  2RQ6 A;  1VQM V;  2E3C A;  4I9Q A;  2QR4 A;  2UXN A;  3P32 A;  3MHH C;  2Q69 A;  3MDS A;  5IDJ A;  4IYI A;  1VF6 C;  3C3T A;  3HR0 A;  5EYP A;  2BTQ A;  3JSL A;  4UV8 A;  2ZKO A;  2OCC C;  1XI1 A;  3UQ8 A;  1K5Q A;  2CGO A;  3SYQ A;  1GAX A;  2A9H A;  5FNV B;  1BS3 A;  1V54 C;  1VQ6 V;  1RSO A;  1HNX B;  2YIA A;  2OTL V;  4R7C A;  4FIP C;  5L3E A;  3CHX A;  4L8J A;  3ZHS A;  1DF4 A;  2P06 A;  4HNA B;  3JAK A;  4JI3 O;  4HAM A;  3ZHV A;  3OGC C;  2QGN A;  3L75 H;  5FPO A;  2H3O A;  1BQZ A;  1GM7 A;  1QBZ A;  1S77 D;  1QR8 A;  4DUZ B;  3BA9 A;  2WLI A;  1GTO A;  4U7O A;  2K9P A;  1KUQ A;  3BHP A;  3HKC B;  3SPI A;  3DC6 A;  4B3S O;  5IE9 A;  2FB5 A;  2RDC A;  4UVA A;  3WB2 A;  3QTC A;  2IJI A;  5B1B B;  4TV9 B;  1IXM A;  1ZSP A;  4O4I A;  3ABT A;  2IU3 A;  2PY5 A;  1TUE B;  1KP3 A;  4N23 A;  3B4S A;  2Q6A A;  2QWR B;  1O9G A;  1Q43 A;  3N2G A;  2V4D A;  3CYO A;  1EN6 A;  5LP6 B;  4O2A A;  4W4K A;  4J41 A;  1FXK B;  2L6L A;  1D5N A;  5D5P A;  1VQ4 V;  2LFR A;  3TK1 A;  1BT8 A;  3OR6 C;  5ITZ B;  2QSA A;  1MSD A;  1IBM B;  1AB3 A;  3ZRV A;  4MTF A;  1MZE A;  5GON A;  4H44 B;  4I50 A;  4YJ3 B;  1UJW B;  4NKG B;  2JK5 C;  5L3C A;  3HKE A;  1VQ5 V;  4PJ0 Z;  5EIB C;  4JI3 B;  3CRQ A;  2HKO A;  4TV9 A;  4MVQ A;  4P30 A;  2ITD C;  1HNX O;  3L74 H;  3ZMV A;  3L72 H;  2DW4 A;  1PL4 A;  1K7D A;  3APQ A;  4CS4 A;  5IWA O;  3CX5 F;  1F23 A;  1R6N A;  2D2C B;  3ZS8 C;  4WBN A;  4MW3 A;  4NVP A;  2GSM B;  3X2Q B;  2ETN A;  1ZUQ A;  2CTR A;  2EIN B;  2YXL A;  4X66 B;  2P6J A;  3UO2 A;  4J42 A;  1DK1 A;  3VQV A;  1FJG O;  3BRC A;  2QTO A;  1JFF B;  1NTM H;  3RYH A;  1KU9 A;  4P9P A;  1XEQ A;  3CRM A;  3ZRW A;  1WP7 A;  2IJH A;  4HZ3 A;  2UU9 B;  3ZHR A;  5JH7 B;  2OIE A;  2A7W A;  2KQX A;  2EIL C;  2WA3 A;  4ICG A;  4NTW A;  2UUB B;  4FK5 C;  2Y0P A;  4BW5 A;  1Z5W A;  1VF7 A;  3OR7 C;  3CE2 A;  2NNU A;  5BY1 A;  4JYA B;  2R9R B;  2DE0 X;  4BW9 A;  3H9V A;  1Y66 A;  2IW5 A;  1XIL A;  4I5S A;  1XDC A;  3EXA A;  1M90 W;  4NTX A;  1CEZ A;  2ZIO A;  1SA0 B;  3JAR A;  4ASU G;  4RUE A;  2ZNI A;  2HJD A;  4GUN A;  4R8C A;  2HLD G;  1FKA O;  1OCO C;  1K4C C;  3SPG A;  1XRE A;  4CH6 A;  3JYC A;  4E4E A;  5JQG A;  3N2G B;  4QNH B;  2IBZ H;  4GLX A;  1F4M A;  3EFF K;  1P49 A;  1OCR C;  1WA8 B;  3ABK C;  1XL6 A;  4DUY B;  2X6A A;  1AIL A;  4DV2 B;  2PI4 A;  2QA4 V;  4JI7 O;  5KA6 A;  5J2T A;  3GVM A;  4LBE C;  3EVK A;  1J95 A;  1IBK O;  5BXZ A;  1SER A;  1BZK A;  1KMI Z;  3MHS C;  4B08 A;  2KG7 B;  5KUM A;  4EB6 B;  1VQO V;  1QVG U;  5JCO C;  4X1Y A;  2Q7E A;  3FX7 A;  4TQF A;  3K58 A;  3LNM B;  2LW7 A;  1KKD A;  2XHB A;  5KHJ A;  3F5W C;  2R70 A;  1F7Y A;  4FPP A;  4Z1M G;  2F95 B;  4ABM A;  4DRX A;  3K5O A;  3ZX6 A;  2N04 A;  2VQF B;  1KBH A;  1FD9 A;  1ORQ C;  1BCC H;  1B04 A;  4GT1 A;  1F51 A;  1WJZ A;  3M99 B;  1M57 B;  1ZL8 A;  4UCV A;  3BAB A;  1OCC C;  1TVK A;  1VF6 A;  3K06 A;  1IZ3 A;  1FXH A;  4CZZ A;  3ZRS A;  2DYS C;  5JCO A;  1H2K A;  3DGE A;  4DV0 B;  3P3P A;  1VF5 B;  5DEC A;  1P7B A;  4O4H A;  4JF3 A;  5KA5 A;  1G8M A;  4J9Y B;  4LF6 B;  2XUM A;  4JI6 O;  4X9Q A;  2HR3 A;  3ZMT A;  1JPX A;  4JAU A;  2P5O A;  1M56 C;  3SYC A;  3K08 A;  4J7J A;  2UUA B;  2UUA O;  3RYI A;  3M7M X;  3LDE A;  2XT9 A;  4LF7 O;  3SPH A;  4LF5 O;  1RM1 C;  3ZMU A;  1SRY A;  4JAV A;  4TUY A;  1NVP B;  4RWU A;  5LA6 B;  1V55 B;  3S3X A;  3ETG A;  2QTS A;  3CC7 V;  3DXR A;  4TOI A;  3SGI A;  1S0V A;  2ZE8 A;  2CK3 G;  1G1X B;  1LUW A;  2Q0A A;  2F1M A;  1WB8 A;  2EJ7 A;  2MW2 B;  3SR2 C;  2O57 A;  5B1A C;  3I55 V;  1DLB A;  4BAY A;  3ABU A;  4OPA A;  4B3T B;  2JRI A;  1WB7 A;  2ADP A;  5LA6 A;  5IJ0 B;  4DK0 A;  2V1D A;  2BCC H;  4WCE V;  2X6C A;  5LHG A;  2LGW A;  1I5Y A;  1IBL B;  1N32 B;  4IHJ B;  2JJ2 G;  4RO2 A;  5CA0 B;  2OYQ A;  4JV5 O;  4JYY A;  1FXK C;  2Q68 A;  2EIM C;  1N36 B;  2EIK C;  1N36 O;  5KX5 A;  3CJH B;  4C7U A;  5IYB O;  1TUB B;  3TXQ A;  1IBK B;  1VMG A;  2YEV B;  4F6R B;  1XMQ O;  1AP6 A;  1R3I C;  1YIT V;  2UXX A;  2HFE C;  1G6U A;  3ABL C;  1ZTE A;  1PD3 A;  2X7R B;  3ZHT A;  3APO A;  4YIO A;  3VQX A;  4X1K A;  1OCO B;  1YJ9 V;  1MMM A;  3JAL B;  1THZ A;  5EBL C;  2YIC A;  3AG3 C;  1GN6 A;  2ZD9 A;  4FJC C;  4AIL C;  3SPC A;  1XUQ A;  4ZBM A;  3RBZ A;  3E8B A;  1SA0 A;  3CP1 A;  3ABL B;  3C3S A;  4XDL A;  3CCU V;  4KHP O;  4WFB V;  3G80 A;  4GKK B;  5IY5 C;  1U96 A;  2ZCE A;  3K3W A;  3IAY A;  3O9O A;  3ZBH A;  4KFM A;  1H2M A;  2VS0 A;  2UXC O;  4LF8 O;  5EC2 C;  1AJP A;  1K5S A;  2A79 B;  3CMA V;  4JI0 O;  4DR7 B;  1HW7 A;  3OAA G;  1BHB A;  3ABM B;  2ZE6 A;  2WA4 A;  3OE7 G;  4I4T A;  3K5N A;  4LWS A;  1N0N A;  3SJQ C;  3UM7 A;  3T1Y B;  3RWR D;  2A06 H;  5LGN A;  1T5E A;  2YXH A;  1K9M W;  1WLE A;  1AI4 A;  4TV8 B;  4H0L B;  4AI8 A;  5BR8 B;  4DV6 B;  4L87 A;  5IJ9 B;  4ZOL B;  3HKD B;  2UU9 O;  1Q86 W;  4PA3 A;  1V55 C;  3VOU A;  2ZT9 B;  4LF6 O;  2DYS B;  2P7T C;  3CCR V;  2FKX A;  3RYF B;  1H2G A;  3SDL A;  4AQY B;  2B9Z A;  1SET A;  4R50 A;  3ZIA G;  2ZR3 A;  1K34 A;  3E8G A;  4DR5 B;  3FB7 C;  4FLT A;  1AJQ A;  1J5E B;  2JGD B; 
#chains in the Genus database with same CATH homology
 2OCH A;  2DN9 A;  1NZ6 A;  2Y4T A;  4RWU A;  1WJZ A;  2KQX A;  3AG7 A;  2CTQ A;  2CUG A;  2LO1 A;  4J80 A;  2QSA A;  1N4C A;  3APQ A;  2DMX A;  1FAF A;  1HDJ A;  2QWN B;  1IUR A;  2QWR B;  2LGW A;  2N05 A;  2CTW A;  2M6Y A;  3BVO A;  2YUA A;  2QWP B;  4J7Z A;  1BQ0 A;  2QWO B;  2L6L A;  2N04 A;  1XBL A;  2Y4U A;  3APO A;  2EJ7 A;  1GH6 A;  1FPO A;  2CTP A;  2GUZ A;  2GUZ B;  2PF4 E;  2QWQ B;  4IT5 A;  3UCS C;  2CTR A;  1BQZ A;  3UO3 A;  2YS8 A;  3UO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...