1S5LZ

Architecture of the photosynthetic oxygen evolving center
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
b'MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 20
structure length 58
sequence length 58
chains with identical sequence z
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 1s5lZ00
5TISZ 4UB6Z 5KAIZ 5B66Z 5GTIZ 3JCUZ 3A0BZ 1S5LZ 3A0HZ 3KZIZ 5H2FZ 4UB8Z 2AXTZ 4IL6Z 5GTHZ 5KAFZ 5E79Z 4PJ0Z 3WU2Z 5B5EZ
chains in the Genus database with same CATH superfamily
3JCZA 3LSUA 2A7WA 4JI8B 4MW3A 1Z2GA 4JI8O 3ETEA 3L75H 1D5NA 5EC2C 4MS2A 3S3WA 2UUBB 4NTYA 1M56C 4AILC 2WLHA 4UCRA 1SRYA 2UUBO 4IYHA 1VQOV 3BCCH 2WSSG 1OCOB 2BTOA 2D2CB 2Q5ZA 1FKAO 2W0XA 4AQYO 1OCZC 5B66Z 5L3GA 1GH6A 4IIJB 4IIJA 1M1KW 2DYSC 1HR0B 1U97A 2IU3A 4I9QA 2RCVA 4R7CA 1BZKA 4CS2A 4GYCB 4FK5C 4FMTA 2F4VB 3FX7A 4CH5A 4O2AA 2F4VO 4MW8A 4JZGA 4MVOA 4MVZA 1EM1A 4UVBA 3QF7A 5LHHA 2LW7A 5B1NA 1I7FA 2Q0AA 4H0LB 1RM1C 2QTOA 5KX5A 1MOFA 3JAKB 3JAKA 1HNWB 2Q6AA 3F7VC 3JCUZ 1JFFB 1HNWO 3UKMA 2H94A 2BCCH 4LF9B 3L9DA 4TV8A 4TV8B 1U96A 3VOUA 2H8PC 5GTHZ 2XAQA 2KQXA 4LF9O 3RVZA 1ZAUA 4MVUA 2BTQB 2BTQA 4FJCC 5B1AC 3ZJZA 4BW9A 3LNNA 1J5EB 2DOSA 3IFXA 4TV9B 4TV9A 2Y48A 1KD1W 4NXMB 3K57A 3JD3A 1W0JG 3LUTB 3ZRVA 4HNAB 1RPRA 3H01A 4WFAV 3OM3B 1K33A 1AROP 3OT7A 4YIPA 3H1HH 4B3SB 5J2TA 4FFBB 4FFBA 1NKDA 1FXVA 4B3SO 2JGUA 3CXHF 1XMOO 2QKAA 2NLJC 3J7AU 1MABG 3LDEA 2Q7GA 3B09A 3MHSC 3D36C 1FXHA 1N33B 1ORQC 2L6LA 4JI4B 1BS3A 1XI1A 1MSWD 1N33O 4Z1VA 4JI4O 4JV5B 5B1BC 2ODMA 2BE3A 5BZBA 4B7EA 1H2GA 2R70A 4KL1A 1N32B 1XBLA 4X1YA 1N32O 2QJ1A 2E76B 3AK3A 1RSOB 3JSLA 4PI0A 3W7SA 1SA0B 1SA0A 3RN4A 4DYLA 4X89A 1B6QA 2QKCA 5EIBC 2N05A 2RQ6A 4D6TH 3SYQA 4MSWC 3A0BZ 1KYOF 3D3QA 5AG2A 4BR6A 3ASNC 1GAXA 2EILB 3E2EA 2DQ3A 1UPGA 3L71H 1G8MA 2UXCO 1YI2V 1OCRB 3FYEB 5H9CA 2WLNA 3WFVA 5HFMA 3RGBA 4WFHA 3A0HZ 3ETQA 5JQGB 5JQGA 2W6JG 2XAHA 2RMKB 1SZTA 5LL6Y 1US6A 1QVGU 4LF6O 1SQXH 4FZ0A 4OGQB 4IHJB 4IHJA 3UT5B 3UT5A 3RYIB 3RYIA 4CBCA 3BAAA 4E2LA 2LP7A 1YF2A 2IJJA 4H13B 2X6CA 2X0LA 3G80A 2RN9A 4LCUC 4MVRA 5DECA 1LR1A 4P2ZA 4NVPA 3ZBHA 3ZMZA 4JZ2A 5IYCO 4YXWG 4XDKA 2ZXWC 1G1XB 4JI5B 1NI8A 4PA9A 1I08A 2EIJB 2YXHA 4O4HA 3CX5F 4O4HB 2GSMB 3HKCB 3HKCA 3JD1A 4GZRB 5JVDB 3VQWA 5JVDA 1Q6HA 2Y0PA 1LNQA 3IC9A 1T5EA 1QCEA 3ASOB 3AK1A 2L35A 2VQEB 2YIDA 2QM4A 2VQEO 2Y4UA 3TETA 2QTSA 1HWYA 2EZPA 2C2AA 5H6RA 3OMNB 4B3RO 2P22C 5KHJA 3OE7G 4WFFA 2AXTZ 1VQMV 1W2BU 4O4JB 1YCIA 4K8ZA 4DK0A 1HNXB 3X2QC 1UJWB 3B77A 3B40A 5IY5C 3BHPA 2ZE5A 1HNXO 1CXZB 2LFSA 2NNUA 1O9GA 1QLEB 3ZRSA 2JGDB 1TVKA 4LFCO 3G6EV 2AZ0A 3AK2A 4X20A 3ZMVA 4DV5B 4OPHA 3K08A 1JVMA 4DRXB 1Q7YW 3ICXA 1KP2A 3W7XA 5EZYB 5EZYA 3UO3A 3N2KA 4N21A 2YSUB 2F93B 1BHBA 3D3IA 5KA6A 2GUZA 2LFRA 4QE7A 1ZUQA 3AG4B 3ZRWA 5JWPA 1F4NA 5LP6B 5LP6A 1DLBA 4X62B 1JPXA 4X62O 2DWDC 1V55C 4ZI7B 1F51A 1VQKV 1A32A 4KHPB 5H5NA 3JD4A 3OGIB 3STLC 2EZOA 1R1BA 3HR0A 2MK3A 3G71V 1KKDA 2B9ZA 3QO5A 4P30A 2DW4A 2KG7B 1XQ8A 2ZE7A 2JK5C 1M90W 5CA3A 1M93A 5LBQA 4LNUB 4LNUA 2CH7B 2CH7A 5IYZA 1KC8W 1I0HA 4DR2B 1GK9A 1P84F 1RP3B 4U7OA 1AB3A 3OGCC 4XDJA 1F7YA 2A06H 4DR2O 4XBFA 3FAVB 3FAVA 4DR1B 2UXXA 4DR1O 1GM7A 2HEPA 4BIUA 3TGUH 2X7RB 1MZEA 1FXKC 3T2MA 4YY3B 2EIKB 4UFZA 3LSSA 4BW5A 2ITCC 5LHGA 3CCQV 1Y67A 1Q43A 3AG2B 4JI2B 1WPXA 2ZDIC 3K58A 5LOVB 3FYIB 1R6TA 1SS3A 2GV9A 1W59A 2XAFA 3JAWB 1S0VA 1Q6IA 4CH3A 4DUYB 1AP6A 1AR5A 2E5LB 4DUYO 1FPOA 1K5SA 1GMGA 4G28B 1WN7A 3STZC 3CRAA 1I94O 1IVSA 5KUKA 3CPWU 2F43G 4MTXA 3IC7A 1RFYA 1SESA 5KHHA 4WFGA 1PKXA 2CK3G 1PPJH 1GTOA 5E1AC 4FLZA 1Q5OA 2OCHA 3WG7C 4R6ZA 4H37A 5BMVB 3ABLC 4GX0A 2ADQB 2IJKA 1GM8A 3ZX6A 1VF6A 2OIEA 5FPRA 4FM1A 1XHZA 3ABMC 1THZA 4NYKA 4N23A 5EK0A 1TUEB 1JX9A 4ZOLA 4JYYA 3A0RA 4JI1B 2WLMA 2ETNA 1K4DC 5EBMC 1BCCH 4PA7A 4QPJA 3K5MA 2GTAA 3BFRA 2KB1A 2UXNA 1QQCA 3QTCA 3ZS8C 3OD4A 4K35A 3QO8A 4QIWF 5IWAB 3FKSG 5BR8B 1AJNA 1L0NH 1N36B 5IWAO 1EN5A 5LMUB 2WLKA 3E8HA 2RNBA 3T1CA 2KSDA 2EIMB 4UV8A 5CMUA 1CPYA 2Q73A 4JAAA 5DEDA 1NVPD 4DR3B 4PDVA 4UB6Z 5B3SB 4LF7O 4PA3A 4ZHQB 3O9OA 1XHXA 5K1XA 1URFA 2ILMA 3SGIA 3HPLC 4I4TA 4FM2A 2Q9LA 2N74A 3T4ZA 1OJHA 2Y69B 4FLVA 2OIGA 4X1IA 1G4YB 2WA3A 2HKOA 3K3WA 4HAMA 4YJ3B 2W6IG 4DUZB 1XUQA 1X59A 2DN9A 2P06A 2HP8A 3OMAB 1N0NA 3HKDB 2QDOA 4CS4A 3HB3B 5JH7A 1XOUA 4O4IB 4O4IA 4B7KA 5B5EZ 1WP7A 1BQZA 1BGYH 3K5OA 3VBBA 5CA0B 2V4DA 5CA0A 2OTLV 5L3DA 3CCRV 4PV1B 4JGSA 1XREA 4TWKA 3MD0A 4K0KB 4DV4B 4OX9B 3AG3C 1V54B 1M57B 1GRJA 3SDLA 4OX9O 2BSKB 2BSKA 2HJDA 3FD9A 2JVDA 1OHHG 4LP8A 5J2UB 5J2UA 2XOKG 5GTIZ 4LFBB 1MSDA 3T1HB 3T4DA 1HR0O 2EINC 4DK1A 4ICGA 4O2AB 4NXNB 3CCSV 5LMNB 1IBMB 4NXNO 5LMNO 5KAIZ 5KX5B 2LJ2A 2IM9A 1AI7A 4RAIA 2R9RB 4LR3A 3L70H 3GWOA 3HKBB 3HKBA 4PHZA 4DW0A 2WA4A 2XHBA 1VQ9V 4UCOA 2DYRB 4FLYA 1H2NA 1JA8A 4QJFB 3DSQA 2IH3C 1J5EO 1QU7A 3TCUA 3A8TA 4NXMO 2ZNJA 1S77D 5C8YB 5C8YA 5IYBO 3A2FA 2QA4V 1BHAA 3WB0A 3KKYA 1FS0G 3OR6C 5DN6G 2QM8A 5J2TB 3K5LA 1BT8A 1KECA 3JASA 4G27B 4XDLA 1P49A 2NR5A 4PDLA 1ZWIC 2Z0AA 3THOA 1H8HG 4GT1A 2ZT9B 4KUMA 5LHIA 3ZEDA 2LQTA 2FKXA 5KHGA 1WJZA 4Z1MG 4X8AA 1WAZA 4UB8Z 5LGTA 5LGUA 1IZ3A 3L72H 3PJSK 3TXSA 4GUNA 4JV5O 2BOCC 4FVMA 4JI0B 4X1YB 4C7UA 4JI0O 2GTSA 1MG1A 1TGOA 2FL4A 1NVPB 4OXSA 1D2DA 1H38A 1FFTB 3FB7C 2OWOA 2AHYA 1SERA 1YSCA 4B08A 1K97A 2A0LA 4LFAB 2AW9A 2XUMA 2OCCC 4LFAO 1XEQA 2LGWA 2PY5A 3CMEV 2B1GA 3E8BA 4UVAA 5KHIA 1NH2B 2CTRA 3F5WC 1NJIW 4YJ2B 4YJ2A 2XNDG 4P9PA 4MTGA 3B4SA 2P4KA 4A5UB 1VP7A 2A9HA 4PA6A 4TSFG 1HW7A 4MTFA 5LGNA 4PDRA 3CXCU 2VQFB 4X9QA 1MA1A 2VQFO 4EFBA 3C90A 4TOIA 1QR8A 3KG2A 1Q8IA 2PYLA 1J95A 1NR7A 4PI2A 4J10A 2CTWA 4MVMA 3E35A 4TQDA 1PV0A 1H2KA 5J9PC 1AJQA 2UXDB 1N8RW 2YI9A 2WLJA 3SYAA 4DO2A 3E86A 5F2VO 1QVFU 4OPAA 1KKCA 1GN2A 1YTFB 3CS5A 1SQBH 4X64B 1M56B 2ITDC 4X64O 2EJRA 3K9AA 1IXMA 2JEUA 1OCZB 4F6EA 2DE0X 4DR7B 1JOYA 2ARHA 4DR7O 3JAMN 1NR1A 1P7BA 2DYSB 4JI5O 3DC5A 4J9YB 2EINB 3KCXA 2E3CA 2H3OA 3KZIZ 1E79G 5JJEB 1CEZA 1LUWA 5IJ9B 1LUVA 5IJ9A 3CC7V 1JMKC 1ZX3A 3WB1A 1RM1B 1AR4A 3K04A 4NTWA 3LDCA 3K9SA 4DXWA 1VQNV 2HVJC 5ITZA 5ITZB 4UCVA 4U3JB 4U3JA 4X65B 4W4LA 1R3LC 1S3JA 5B1AB 4DV3B 5EC1C 4MT8A 1S76D 4QE9A 1GM9A 4JTCB 4FIPC 3ABKC 1E1QG 4JAVA 1B04A 3DXRA 3DXRB 4MVSA 4PELA 5JCOC 1Q86W 2OT5A 1XDCA 3IJ4A 5D5PA 4J80A 4WF9V 2DMXA 1K34A 4AHCA 1TVKB 4GKJB 3SPHA 1Y74B 1Y74A 4X20B 3ZHRA 1AI5A 1SQVH 1NQTA 4DV5O 3D36A 2IJHA 3N27A 3OMIB 3FB5C 3N2KB 1COWG 3BA8A 1FJGB 3RW0A 1K9MW 5B1BB 2GUZB 2ZCEA 4JI3B 3ZRWB 4JI7B 1OCCC 2JJ2G 2YI8A 1HNZB 3CCVV 3K5NA 4JYAB 2YUAA 2EBOA 3QO7A 4EB6B 4EB6A 2F1MA 2YEVB 2YEVA 3K59A 2CDYA 2JS3A 3ZMSA 4KHPO 2N04A 3G67A 2QWQB 3EHBB 3ETDA 3VQYA 5FNVB 5FNVA 1N4CA 1HP8A 4MTOA 2K9PA 4X66B 5FLXN 2UU9B 2XASA 1FD9A 1IBLB 4GCZA 4LF4B 4ZBMA 1IBLO 3BVOA 4LF4O 5IYZB 4CS3A 3P3PA 1L1FA 3ASNB 3FB6C 4DR6B 4AI8A 2IJIA 1ZL8B 1ZL8A 3BEHA 4DR6O 3SJCC 3JD0A 3JD2A 2ZE6A 5L3FA 1PNKA 5L3EA 3WU2Z 1FAFA 1OCOC 4YY3O 1KUQA 1GN6A 1FFXB 1FFXA 2XT9A 1YIJV 2CGOA 2UXBB 3EXAA 1GN3A 2D3OW 3K03A 1WB7A 5B1OA 3UO2A 2HVKC 2JDIG 1WA8B 1WA8A 4JI2O 3CRMA 4JPRA 5CBGA 1I5YA 2QR4A 5CBHA 1YITV 1SQQH 4KXRA 2HR3A 3CRQA 1ZLZA 3ETGA 4CH6A 5K1PA 1SQGA 3OW2U 1B06A 4BIOA 1GO3F 3OAAG 2E5LO 2ZNIA 3VQVA 1K4CC 3CRCA 3QVNA 3CHXA 3OFNG 3DTUB 3SJBC 5FL7G 2LO1A 1KQSU 3J80N 1AI6A 2ZIMA 3CCMV 3H9VA 2ZXWB 1WLEA 1N34B 1HDJA 3RYHB 3RYHA 5IE9A 4KP4A 3R65A 1L0LH 1N34O 1PNMA 5KA5A 1YDXA 1VQLV 4FZ1A 1AR1B 3OTFA 3CRRA 1DF4A 3SPGA 2YIAA 4UCUA 4WBNB 4WBNA 5BY1A 1PNLA 2OTJV 1S72V 5H2FZ 4ZOLB 4JI6B 3W7UA 1EN4A 4TUYB 4TUYA 4JI1O 2EX3A 4GKKB 3IAYA 1F4MA 5DM6V 2QM7A 4I55A 4I55B 1NTKH 4RQFA 3E83A 3TK1A 3RYFA 2YXYA 4LH7A 4WFBV 4I50B 4I50A 5KUMA 3BRCA 4DV6B 2K1EA 4JTDB 4DV6O 2YIBA 3O65A 1IBKB 5LXTB 5LXTA 5BR8O 3X2QB 2JIZG 1N36O 5KAFZ 2P5OA 5IY5B 4J41A 4UVCA 4ZKIA 5LMUO 1XNQB 1H2SB 1K73W 5JCOA 2Q67A 3Q4HA 3OUFA 4ASUG 4DR3O 1KMIZ 2ZKOA 1CP9A 4U3FH 2AZ2A 1H8EG 4NKGB 4I4TB 4B3TB 1VQPV 1XILA 4NB5A 3DC6A 2JRIA 4I0XB 4I0XA 4B3TO 2GBOA 2P67A 4DR5B 2EULA 2Q0OC 4CH4A 3OR7C 1NH2D 4X1IB 4DV0B 4UXNA 2LGQA 4BWAA 1BQ0A 1ROPA 2DWEC 3W7WA 1M4UA 1WNSA 2CE4A 5CN0A 5FPOA 4BIZA 4QGPA 3IGAC 4RQEA 1AI4A 1XL4A 4ZIBA 4DUZO 4PJ0Z 5JH7B 1V55B 4DV1B 4H33A 3SYOA 2EILC 1Y4MA 3ZHTA 5EYPB 5EYPA 2UUCB 4JF3A 2CUGA 3L73H 4O4LB 4O4LA 1OCRC 3CCEV 2UUCO 4LF5B 1OV9A 2WPDG 3HKEB 3HKEA 4UCTA 4TT3G 4IL6Z 3FFQA 5JJNB 4K0KO 1XL6A 4DV4O 3RWRD 3U11A 2PI4A 1VEWA 3VQXA 2Y4TA 2Q7HA 1YTFD 4FM0A 2DQ0A 1P7GA 4D7TA 2VWKA 3CCJV 1QR9A 4J9ZB 4LFBO 2QWOB 1SC5B 3T1HO 2DJVA 1FXKB 1FXKA 1K5QA 2JS5A 4AQYB 1K92A 2E75B 5H6QA 4UCSA 3ABTA 3ZMTA 3JATB 3B8NA 3JATA 1AJPA 1ZTEA 3KCYA 4RWUA 3CJHB 3CJHA 3K0DA 1IBMO 2QWPB 2EIJC 3CSXA 2ZDIA 3AEIA 1R3KC 2PTMA 3H1KH 3NXSA 3ASOC 2FMLA 5JJJB 3CC2V 3T1YB 4YHHB 3T1YO 4GLXA 3GWKC 4G2KA 4FFKA 4YHHO 1KU9A 1UFIA 2CTPA 1W0KG 3OUSA 4R50A 1JFFA 1H2MA 3F7YC 4CC6A 3WG7B 5L3CA 4RO2A 2QGNA 2HHHB 4J7KA 2CGNA 4UUJC 3ABLB 2HHHO 4IT5A 1VARA 3H1LH 2ZM6B 5HFLA 2ZM6O 3ABMB 1FYJA 4WCEV 2PGGA 3JASB 4J7ZA 3E89A 3CB2A 1AILA 5CA1B 5CA1A 4HNAA 2PZSA 5A2QN 1QLEC 1Y76B 1Y76A 3M7MX 2F66C 1WB8A 1EZJA 1YXBA 1VIBA 2VS0A 4MVQA 1XMOB 2QWRB 4L8JA 1S5HC 4ABMA 3L74H 3N2GB 1K3EA 3K06A 3N2GA 3OEEG 1SQFA 1VF5B 4FLWA 1K8AW 1YVWA 1IXBA 3AG4C 4CC5A 1BE3H 2X6BA 4FLXA 5LP6C 1MNGA 2Z5UA 4NR1A 1KB9F 2PF4E 2JEXA 1RSOA 2W0FC 4UV9A 3QNEA 3P32A 3ZIAG 2V1DA 5EIBD 3ZHQA 1SQPH 1AVMA 4PA4A 1VQ7V 3ZMUA 2RDCA 3ABUA 1E1RG 1JCHA 1Q3EA 4HZ3A 3TJTA 3ML0A 4HYOA 3SYPA 1DTOA 2QWNB 4P9OA 2Q8VA 1Q81W 4TQFA 4LBEC 2YC0A 1AP5A 1PL4A 1BSMA 5CB4A 4HBNA 5CB4B 2VRZA 3PN1A 2M6YA 2UXCB 2PI5A 5GW7A 3E22B 3E22A 2RJZA 3K0GA 2UXDO 2XAGA 3QG5A 2EIKC 2EJ7A 3CEIA 1NBMG 1VQ8V 1P4RA 5KMGB 5KMGA 3G6BA 2ZE8A 3AG3B 4FLUA 1S5JA 1IURA 3AG2C 4LF6B 2VWJA 1WPBA 2GDSA 1EFRG 4NTXA 3MAQA 2B5UA 1KBHA 2JJ1G 2PYJA 2LW1A 4J11A 1R6KA 3BA9A 2ZR2A 4Q6GA 3B8MA 2ZQMA 3CP1A 1Q82W 1ZSPA 3U0ZA 5A9GA 2YXLA 3M99B 1G6UA 1DK1A 2UUAB 1YZBA 4D7SA 2UUAO 1TUBB 1TUBA 1H2LA 1M9NA 1N0JA 5EBLC 4GX5A 2WWWA 3RFRA 2V7QG 1DF5A 2PUSA 5KLVH 5LYJB 5LYJA 1VF6C 3OEHG 1R6NA 1EBOA 2P6JA 2OYQA 1JR9A 4X65O 1QNMA 4LH6A 3F5TA 1X4TA 3I56V 4DV3O 1L8DA 2NN4A 1GKFA 4B3RB 3CYOA 1B3QA 3ZCCA 2IH1C 4X1KB 4X1KA 4K8XA 2ADPA 4K3AA 1MZFA 1M5IA 3SYCA 3LSQA 5LA6B 5LA6A 2P90A 2YIBD 1MMMA 2CAZC 4O4JA 1YEWA 2FB5A 3SJAC 4QPKA 1PD3A 4E4EA 3JARB 3JARA 4I7ZB 4RUFA 3CMAV 4GKJO 2ATKC 2R72A 4FPPA 3EFFK 2Q7EA 2EIMC 3MDSA 5B3SC 2P4VA 4YIOA 2JGDA 4LFCB 1Q6UA 3AG1C 1NZ6A 2IU0A 1FJGO 1IDSA 2FYUH 4I9WA 4DV7B 4DV2B 4JI3O 1VQ6V 5BXZA 4DRXA 4JI7O 4DV7O 4JTAB 4DV2O 4LWSB 4LWSA 4QNHB 1R3JC 2Y69C 3RVYA 2R9AA 1HNZO 1OZ0A 2BOBC 1RPOA 4F4LA 1NS1A 4JYAO 4JAUA 1I5XA 1EZVH 4IGGA 4GX2A 5L3BA 4J42A 2OCCB 1F23A 2QEXV 1EN6A 2O57A 4J7JA 1QHTA 1YJWV 3BPZA 4LF8B 5IDJA 3GVMA 4Q20A 5TISZ 3S3XA 4ZI7A 4X66O 2AHZA 1VQ4V 1YJ9V 1NTZH 2UU9O 4LF8O 2KKWA 1JJ2U 3I55V 1WP8A 4EFEA 2HG5C 3B2EE 3ZHUA 4B3MB 3SPJA 2Q4PA 1DGSA 2B1IA 2KG7A 3LDDA 4B3MO 4W4KA 2GHYA 2G38A 5E79Z 1V54C 2WLIB 2IW5A 2WLIA 3UQ8A 1M57C 1PP9H 3CE2A 2M7WA 2ZINA 1GN4A 3CWBH 2E74B 3C3SA 5EBWC 1XMQB 1SETA 3RYCB 3RYCA 1XMQO 3H1JH 4WFEA 3SPIA 1ENVA 2UXBO 4FLTA 1PM9A 3FB8C 3RBZA 4Z2WA 2X6AA 3H1IH 3M8AA 3CD6V 2HFEC 4R8CA 3DGEA 1Q90D 4KFMA 4BAYA 3C3TA 4U7NA 3CCLV 1V9PA 3RT3C 2Z3YA 5LOVA 2P7TC 1R3IC 1Z5WA 1SF9A 1QBZA 3P3NA 3CC4V 3JAWA 1IX9A 3TXQA 2XAJA 4DW1A 1VF7A 1I94B 2QKSA 4H44B 4RUEA 4IYIA 1O9HA 1Y6XA 1SZXA 4DR4B 1KP3A 2DYRC 3JALB 3JALA 3W7TA 4DR4O 2HLDG 5D5QA 1Z5VA 4EEQA 1S5LZ 3AG7A 3SPCA 2F23A 2FTKA 1YHQV 3MHHC 1JQ0A 1NTMH 5BMVA 4JI6O 2WAMA 3LNMB 3BY6A 4EKWA 1TAEA 4X88A 2A79B 1NU1H 5GONB 5GONA 4GKKO 2AGAA 3U10A 1YJNV 4JYBA 2CTQA 3RYFB 3ZRXA 4F6RB 2QSAA 4F6RA 3J81N 3SR2C 4PD4F 3G4SV 2R9IA 4LC1A 2IBZH 1BL8A 3ABKB 4I5SA 2YICA 5IT9N 1IBKO 3ZHVA 3NR7A 2XTAA 1XNQO 3Q4HB 4L87A 1XNRB 2HJFC 1QLNA 1NT2B 3D8CA 3JYCA 1XNRO 5IYDO 3GB7C 2Q69A 1D5AA 2WLLB 2WLLA 2A3QA 3SJQC 2ZD9A 4LF7B 3APOA 3E8FA 3I5DA 4DR5O 3UM7A 4ZHQA 3AG1B 3ZN0A 4DV0O 1R73A 1PL0A 2ZIOA 2YS8A 2ZR3A 4PDMA 1OCCB 4CZZA 5CBFA 3JSNA 3APQA 3R66A 4O2BB 4O2BA 1BMFG 3UCSC 3EVKA 1K7DA 3ZN1A 1Y66A 2QE7G 3BABA 3OTOB 5KHKA 4DV1O 3OTOO 1TA8A 2YDEA 3ZHSA 1SKVA 3WB2A 4GX1A 2F95B 4YJ3A 3CCUV 1JJOA 4LF5O 1VQ5V 4JYCA 5IJ0B 5IJ0A 2Y0IA 3K79A 3E8GA 3HKDA 1VMGA 2MW2B 5C93A 3P30A 4JASA 2Q68A
chains in the Genus database with same CATH topology
5TISZ 4UB6Z 5KAIZ 5B66Z 5GTIZ 3JCUZ 3A0BZ 1S5LZ 3A0HZ 3KZIZ 5H2FZ 4UB8Z 2AXTZ 4IL6Z 5GTHZ 5KAFZ 5E79Z 4PJ0Z 3WU2Z 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5TIS Z;  4UB6 Z;  5KAI Z;  5B66 Z;  5GTI Z;  3JCU Z;  3A0B Z;  1S5L Z;  3A0H Z;  3KZI Z;  5H2F Z;  4UB8 Z;  2AXT Z;  4IL6 Z;  5GTH Z;  5KAF Z;  5E79 Z;  4PJ0 Z;  3WU2 Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 3JCZ A;  3LSU A;  2A7W A;  4JI8 B;  4MW3 A;  1Z2G A;  4JI8 O;  3ETE A;  3L75 H;  1D5N A;  5EC2 C;  4MS2 A;  3S3W A;  2UUB B;  4NTY A;  1M56 C;  4AIL C;  2WLH A;  4UCR A;  1SRY A;  2UUB O;  4IYH A;  1VQO V;  3BCC H;  2WSS G;  1OCO B;  2BTO A;  2D2C B;  2Q5Z A;  1FKA O;  2W0X A;  4AQY O;  1OCZ C;  5B66 Z;  5L3G A;  1GH6 A;  4IIJ B;  4IIJ A;  1M1K W;  2DYS C;  1HR0 B;  1U97 A;  2IU3 A;  4I9Q A;  2RCV A;  4R7C A;  1BZK A;  4CS2 A;  4GYC B;  4FK5 C;  4FMT A;  2F4V B;  3FX7 A;  4CH5 A;  4O2A A;  2F4V O;  4MW8 A;  4JZG A;  4MVO A;  4MVZ A;  1EM1 A;  4UVB A;  3QF7 A;  5LHH A;  2LW7 A;  5B1N A;  1I7F A;  2Q0A A;  4H0L B;  1RM1 C;  2QTO A;  5KX5 A;  1MOF A;  3JAK B;  3JAK A;  1HNW B;  2Q6A A;  3F7V C;  3JCU Z;  1JFF B;  1HNW O;  3UKM A;  2H94 A;  2BCC H;  4LF9 B;  3L9D A;  4TV8 A;  4TV8 B;  1U96 A;  3VOU A;  2H8P C;  5GTH Z;  2XAQ A;  2KQX A;  4LF9 O;  3RVZ A;  1ZAU A;  4MVU A;  2BTQ B;  2BTQ A;  4FJC C;  5B1A C;  3ZJZ A;  4BW9 A;  3LNN A;  1J5E B;  2DOS A;  3IFX A;  4TV9 B;  4TV9 A;  2Y48 A;  1KD1 W;  4NXM B;  3K57 A;  3JD3 A;  1W0J G;  3LUT B;  3ZRV A;  4HNA B;  1RPR A;  3H01 A;  4WFA V;  3OM3 B;  1K33 A;  1ARO P;  3OT7 A;  4YIP A;  3H1H H;  4B3S B;  5J2T A;  4FFB B;  4FFB A;  1NKD A;  1FXV A;  4B3S O;  2JGU A;  3CXH F;  1XMO O;  2QKA A;  2NLJ C;  3J7A U;  1MAB G;  3LDE A;  2Q7G A;  3B09 A;  3MHS C;  3D36 C;  1FXH A;  1N33 B;  1ORQ C;  2L6L A;  4JI4 B;  1BS3 A;  1XI1 A;  1MSW D;  1N33 O;  4Z1V A;  4JI4 O;  4JV5 B;  5B1B C;  2ODM A;  2BE3 A;  5BZB A;  4B7E A;  1H2G A;  2R70 A;  4KL1 A;  1N32 B;  1XBL A;  4X1Y A;  1N32 O;  2QJ1 A;  2E76 B;  3AK3 A;  1RSO B;  3JSL A;  4PI0 A;  3W7S A;  1SA0 B;  1SA0 A;  3RN4 A;  4DYL A;  4X89 A;  1B6Q A;  2QKC A;  5EIB C;  2N05 A;  2RQ6 A;  4D6T H;  3SYQ A;  4MSW C;  3A0B Z;  1KYO F;  3D3Q A;  5AG2 A;  4BR6 A;  3ASN C;  1GAX A;  2EIL B;  3E2E A;  2DQ3 A;  1UPG A;  3L71 H;  1G8M A;  2UXC O;  1YI2 V;  1OCR B;  3FYE B;  5H9C A;  2WLN A;  3WFV A;  5HFM A;  3RGB A;  4WFH A;  3A0H Z;  3ETQ A;  5JQG B;  5JQG A;  2W6J G;  2XAH A;  2RMK B;  1SZT A;  5LL6 Y;  1US6 A;  1QVG U;  4LF6 O;  1SQX H;  4FZ0 A;  4OGQ B;  4IHJ B;  4IHJ A;  3UT5 B;  3UT5 A;  3RYI B;  3RYI A;  4CBC A;  3BAA A;  4E2L A;  2LP7 A;  1YF2 A;  2IJJ A;  4H13 B;  2X6C A;  2X0L A;  3G80 A;  2RN9 A;  4LCU C;  4MVR A;  5DEC A;  1LR1 A;  4P2Z A;  4NVP A;  3ZBH A;  3ZMZ A;  4JZ2 A;  5IYC O;  4YXW G;  4XDK A;  2ZXW C;  1G1X B;  4JI5 B;  1NI8 A;  4PA9 A;  1I08 A;  2EIJ B;  2YXH A;  4O4H A;  3CX5 F;  4O4H B;  2GSM B;  3HKC B;  3HKC A;  3JD1 A;  4GZR B;  5JVD B;  3VQW A;  5JVD A;  1Q6H A;  2Y0P A;  1LNQ A;  3IC9 A;  1T5E A;  1QCE A;  3ASO B;  3AK1 A;  2L35 A;  2VQE B;  2YID A;  2QM4 A;  2VQE O;  2Y4U A;  3TET A;  2QTS A;  1HWY A;  2EZP A;  2C2A A;  5H6R A;  3OMN B;  4B3R O;  2P22 C;  5KHJ A;  3OE7 G;  4WFF A;  2AXT Z;  1VQM V;  1W2B U;  4O4J B;  1YCI A;  4K8Z A;  4DK0 A;  1HNX B;  3X2Q C;  1UJW B;  3B77 A;  3B40 A;  5IY5 C;  3BHP A;  2ZE5 A;  1HNX O;  1CXZ B;  2LFS A;  2NNU A;  1O9G A;  1QLE B;  3ZRS A;  2JGD B;  1TVK A;  4LFC O;  3G6E V;  2AZ0 A;  3AK2 A;  4X20 A;  3ZMV A;  4DV5 B;  4OPH A;  3K08 A;  1JVM A;  4DRX B;  1Q7Y W;  3ICX A;  1KP2 A;  3W7X A;  5EZY B;  5EZY A;  3UO3 A;  3N2K A;  4N21 A;  2YSU B;  2F93 B;  1BHB A;  3D3I A;  5KA6 A;  2GUZ A;  2LFR A;  4QE7 A;  1ZUQ A;  3AG4 B;  3ZRW A;  5JWP A;  1F4N A;  5LP6 B;  5LP6 A;  1DLB A;  4X62 B;  1JPX A;  4X62 O;  2DWD C;  1V55 C;  4ZI7 B;  1F51 A;  1VQK V;  1A32 A;  4KHP B;  5H5N A;  3JD4 A;  3OGI B;  3STL C;  2EZO A;  1R1B A;  3HR0 A;  2MK3 A;  3G71 V;  1KKD A;  2B9Z A;  3QO5 A;  4P30 A;  2DW4 A;  2KG7 B;  1XQ8 A;  2ZE7 A;  2JK5 C;  1M90 W;  5CA3 A;  1M93 A;  5LBQ A;  4LNU B;  4LNU A;  2CH7 B;  2CH7 A;  5IYZ A;  1KC8 W;  1I0H A;  4DR2 B;  1GK9 A;  1P84 F;  1RP3 B;  4U7O A;  1AB3 A;  3OGC C;  4XDJ A;  1F7Y A;  2A06 H;  4DR2 O;  4XBF A;  3FAV B;  3FAV A;  4DR1 B;  2UXX A;  4DR1 O;  1GM7 A;  2HEP A;  4BIU A;  3TGU H;  2X7R B;  1MZE A;  1FXK C;  3T2M A;  4YY3 B;  2EIK B;  4UFZ A;  3LSS A;  4BW5 A;  2ITC C;  5LHG A;  3CCQ V;  1Y67 A;  1Q43 A;  3AG2 B;  4JI2 B;  1WPX A;  2ZDI C;  3K58 A;  5LOV B;  3FYI B;  1R6T A;  1SS3 A;  2GV9 A;  1W59 A;  2XAF A;  3JAW B;  1S0V A;  1Q6I A;  4CH3 A;  4DUY B;  1AP6 A;  1AR5 A;  2E5L B;  4DUY O;  1FPO A;  1K5S A;  1GMG A;  4G28 B;  1WN7 A;  3STZ C;  3CRA A;  1I94 O;  1IVS A;  5KUK A;  3CPW U;  2F43 G;  4MTX A;  3IC7 A;  1RFY A;  1SES A;  5KHH A;  4WFG A;  1PKX A;  2CK3 G;  1PPJ H;  1GTO A;  5E1A C;  4FLZ A;  1Q5O A;  2OCH A;  3WG7 C;  4R6Z A;  4H37 A;  5BMV B;  3ABL C;  4GX0 A;  2ADQ B;  2IJK A;  1GM8 A;  3ZX6 A;  1VF6 A;  2OIE A;  5FPR A;  4FM1 A;  1XHZ A;  3ABM C;  1THZ A;  4NYK A;  4N23 A;  5EK0 A;  1TUE B;  1JX9 A;  4ZOL A;  4JYY A;  3A0R A;  4JI1 B;  2WLM A;  2ETN A;  1K4D C;  5EBM C;  1BCC H;  4PA7 A;  4QPJ A;  3K5M A;  2GTA A;  3BFR A;  2KB1 A;  2UXN A;  1QQC A;  3QTC A;  3ZS8 C;  3OD4 A;  4K35 A;  3QO8 A;  4QIW F;  5IWA B;  3FKS G;  5BR8 B;  1AJN A;  1L0N H;  1N36 B;  5IWA O;  1EN5 A;  5LMU B;  2WLK A;  3E8H A;  2RNB A;  3T1C A;  2KSD A;  2EIM B;  4UV8 A;  5CMU A;  1CPY A;  2Q73 A;  4JAA A;  5DED A;  1NVP D;  4DR3 B;  4PDV A;  4UB6 Z;  5B3S B;  4LF7 O;  4PA3 A;  4ZHQ B;  3O9O A;  1XHX A;  5K1X A;  1URF A;  2ILM A;  3SGI A;  3HPL C;  4I4T A;  4FM2 A;  2Q9L A;  2N74 A;  3T4Z A;  1OJH A;  2Y69 B;  4FLV A;  2OIG A;  4X1I A;  1G4Y B;  2WA3 A;  2HKO A;  3K3W A;  4HAM A;  4YJ3 B;  2W6I G;  4DUZ B;  1XUQ A;  1X59 A;  2DN9 A;  2P06 A;  2HP8 A;  3OMA B;  1N0N A;  3HKD B;  2QDO A;  4CS4 A;  3HB3 B;  5JH7 A;  1XOU A;  4O4I B;  4O4I A;  4B7K A;  5B5E Z;  1WP7 A;  1BQZ A;  1BGY H;  3K5O A;  3VBB A;  5CA0 B;  2V4D A;  5CA0 A;  2OTL V;  5L3D A;  3CCR V;  4PV1 B;  4JGS A;  1XRE A;  4TWK A;  3MD0 A;  4K0K B;  4DV4 B;  4OX9 B;  3AG3 C;  1V54 B;  1M57 B;  1GRJ A;  3SDL A;  4OX9 O;  2BSK B;  2BSK A;  2HJD A;  3FD9 A;  2JVD A;  1OHH G;  4LP8 A;  5J2U B;  5J2U A;  2XOK G;  5GTI Z;  4LFB B;  1MSD A;  3T1H B;  3T4D A;  1HR0 O;  2EIN C;  4DK1 A;  4ICG A;  4O2A B;  4NXN B;  3CCS V;  5LMN B;  1IBM B;  4NXN O;  5LMN O;  5KAI Z;  5KX5 B;  2LJ2 A;  2IM9 A;  1AI7 A;  4RAI A;  2R9R B;  4LR3 A;  3L70 H;  3GWO A;  3HKB B;  3HKB A;  4PHZ A;  4DW0 A;  2WA4 A;  2XHB A;  1VQ9 V;  4UCO A;  2DYR B;  4FLY A;  1H2N A;  1JA8 A;  4QJF B;  3DSQ A;  2IH3 C;  1J5E O;  1QU7 A;  3TCU A;  3A8T A;  4NXM O;  2ZNJ A;  1S77 D;  5C8Y B;  5C8Y A;  5IYB O;  3A2F A;  2QA4 V;  1BHA A;  3WB0 A;  3KKY A;  1FS0 G;  3OR6 C;  5DN6 G;  2QM8 A;  5J2T B;  3K5L A;  1BT8 A;  1KEC A;  3JAS A;  4G27 B;  4XDL A;  1P49 A;  2NR5 A;  4PDL A;  1ZWI C;  2Z0A A;  3THO A;  1H8H G;  4GT1 A;  2ZT9 B;  4KUM A;  5LHI A;  3ZED A;  2LQT A;  2FKX A;  5KHG A;  1WJZ A;  4Z1M G;  4X8A A;  1WAZ A;  4UB8 Z;  5LGT A;  5LGU A;  1IZ3 A;  3L72 H;  3PJS K;  3TXS A;  4GUN A;  4JV5 O;  2BOC C;  4FVM A;  4JI0 B;  4X1Y B;  4C7U A;  4JI0 O;  2GTS A;  1MG1 A;  1TGO A;  2FL4 A;  1NVP B;  4OXS A;  1D2D A;  1H38 A;  1FFT B;  3FB7 C;  2OWO A;  2AHY A;  1SER A;  1YSC A;  4B08 A;  1K97 A;  2A0L A;  4LFA B;  2AW9 A;  2XUM A;  2OCC C;  4LFA O;  1XEQ A;  2LGW A;  2PY5 A;  3CME V;  2B1G A;  3E8B A;  4UVA A;  5KHI A;  1NH2 B;  2CTR A;  3F5W C;  1NJI W;  4YJ2 B;  4YJ2 A;  2XND G;  4P9P A;  4MTG A;  3B4S A;  2P4K A;  4A5U B;  1VP7 A;  2A9H A;  4PA6 A;  4TSF G;  1HW7 A;  4MTF A;  5LGN A;  4PDR A;  3CXC U;  2VQF B;  4X9Q A;  1MA1 A;  2VQF O;  4EFB A;  3C90 A;  4TOI A;  1QR8 A;  3KG2 A;  1Q8I A;  2PYL A;  1J95 A;  1NR7 A;  4PI2 A;  4J10 A;  2CTW A;  4MVM A;  3E35 A;  4TQD A;  1PV0 A;  1H2K A;  5J9P C;  1AJQ A;  2UXD B;  1N8R W;  2YI9 A;  2WLJ A;  3SYA A;  4DO2 A;  3E86 A;  5F2V O;  1QVF U;  4OPA A;  1KKC A;  1GN2 A;  1YTF B;  3CS5 A;  1SQB H;  4X64 B;  1M56 B;  2ITD C;  4X64 O;  2EJR A;  3K9A A;  1IXM A;  2JEU A;  1OCZ B;  4F6E A;  2DE0 X;  4DR7 B;  1JOY A;  2ARH A;  4DR7 O;  3JAM N;  1NR1 A;  1P7B A;  2DYS B;  4JI5 O;  3DC5 A;  4J9Y B;  2EIN B;  3KCX A;  2E3C A;  2H3O A;  3KZI Z;  1E79 G;  5JJE B;  1CEZ A;  1LUW A;  5IJ9 B;  1LUV A;  5IJ9 A;  3CC7 V;  1JMK C;  1ZX3 A;  3WB1 A;  1RM1 B;  1AR4 A;  3K04 A;  4NTW A;  3LDC A;  3K9S A;  4DXW A;  1VQN V;  2HVJ C;  5ITZ A;  5ITZ B;  4UCV A;  4U3J B;  4U3J A;  4X65 B;  4W4L A;  1R3L C;  1S3J A;  5B1A B;  4DV3 B;  5EC1 C;  4MT8 A;  1S76 D;  4QE9 A;  1GM9 A;  4JTC B;  4FIP C;  3ABK C;  1E1Q G;  4JAV A;  1B04 A;  3DXR A;  3DXR B;  4MVS A;  4PEL A;  5JCO C;  1Q86 W;  2OT5 A;  1XDC A;  3IJ4 A;  5D5P A;  4J80 A;  4WF9 V;  2DMX A;  1K34 A;  4AHC A;  1TVK B;  4GKJ B;  3SPH A;  1Y74 B;  1Y74 A;  4X20 B;  3ZHR A;  1AI5 A;  1SQV H;  1NQT A;  4DV5 O;  3D36 A;  2IJH A;  3N27 A;  3OMI B;  3FB5 C;  3N2K B;  1COW G;  3BA8 A;  1FJG B;  3RW0 A;  1K9M W;  5B1B B;  2GUZ B;  2ZCE A;  4JI3 B;  3ZRW B;  4JI7 B;  1OCC C;  2JJ2 G;  2YI8 A;  1HNZ B;  3CCV V;  3K5N A;  4JYA B;  2YUA A;  2EBO A;  3QO7 A;  4EB6 B;  4EB6 A;  2F1M A;  2YEV B;  2YEV A;  3K59 A;  2CDY A;  2JS3 A;  3ZMS A;  4KHP O;  2N04 A;  3G67 A;  2QWQ B;  3EHB B;  3ETD A;  3VQY A;  5FNV B;  5FNV A;  1N4C A;  1HP8 A;  4MTO A;  2K9P A;  4X66 B;  5FLX N;  2UU9 B;  2XAS A;  1FD9 A;  1IBL B;  4GCZ A;  4LF4 B;  4ZBM A;  1IBL O;  3BVO A;  4LF4 O;  5IYZ B;  4CS3 A;  3P3P A;  1L1F A;  3ASN B;  3FB6 C;  4DR6 B;  4AI8 A;  2IJI A;  1ZL8 B;  1ZL8 A;  3BEH A;  4DR6 O;  3SJC C;  3JD0 A;  3JD2 A;  2ZE6 A;  5L3F A;  1PNK A;  5L3E A;  3WU2 Z;  1FAF A;  1OCO C;  4YY3 O;  1KUQ A;  1GN6 A;  1FFX B;  1FFX A;  2XT9 A;  1YIJ V;  2CGO A;  2UXB B;  3EXA A;  1GN3 A;  2D3O W;  3K03 A;  1WB7 A;  5B1O A;  3UO2 A;  2HVK C;  2JDI G;  1WA8 B;  1WA8 A;  4JI2 O;  3CRM A;  4JPR A;  5CBG A;  1I5Y A;  2QR4 A;  5CBH A;  1YIT V;  1SQQ H;  4KXR A;  2HR3 A;  3CRQ A;  1ZLZ A;  3ETG A;  4CH6 A;  5K1P A;  1SQG A;  3OW2 U;  1B06 A;  4BIO A;  1GO3 F;  3OAA G;  2E5L O;  2ZNI A;  3VQV A;  1K4C C;  3CRC A;  3QVN A;  3CHX A;  3OFN G;  3DTU B;  3SJB C;  5FL7 G;  2LO1 A;  1KQS U;  3J80 N;  1AI6 A;  2ZIM A;  3CCM V;  3H9V A;  2ZXW B;  1WLE A;  1N34 B;  1HDJ A;  3RYH B;  3RYH A;  5IE9 A;  4KP4 A;  3R65 A;  1L0L H;  1N34 O;  1PNM A;  5KA5 A;  1YDX A;  1VQL V;  4FZ1 A;  1AR1 B;  3OTF A;  3CRR A;  1DF4 A;  3SPG A;  2YIA A;  4UCU A;  4WBN B;  4WBN A;  5BY1 A;  1PNL A;  2OTJ V;  1S72 V;  5H2F Z;  4ZOL B;  4JI6 B;  3W7U A;  1EN4 A;  4TUY B;  4TUY A;  4JI1 O;  2EX3 A;  4GKK B;  3IAY A;  1F4M A;  5DM6 V;  2QM7 A;  4I55 A;  4I55 B;  1NTK H;  4RQF A;  3E83 A;  3TK1 A;  3RYF A;  2YXY A;  4LH7 A;  4WFB V;  4I50 B;  4I50 A;  5KUM A;  3BRC A;  4DV6 B;  2K1E A;  4JTD B;  4DV6 O;  2YIB A;  3O65 A;  1IBK B;  5LXT B;  5LXT A;  5BR8 O;  3X2Q B;  2JIZ G;  1N36 O;  5KAF Z;  2P5O A;  5IY5 B;  4J41 A;  4UVC A;  4ZKI A;  5LMU O;  1XNQ B;  1H2S B;  1K73 W;  5JCO A;  2Q67 A;  3Q4H A;  3OUF A;  4ASU G;  4DR3 O;  1KMI Z;  2ZKO A;  1CP9 A;  4U3F H;  2AZ2 A;  1H8E G;  4NKG B;  4I4T B;  4B3T B;  1VQP V;  1XIL A;  4NB5 A;  3DC6 A;  2JRI A;  4I0X B;  4I0X A;  4B3T O;  2GBO A;  2P67 A;  4DR5 B;  2EUL A;  2Q0O C;  4CH4 A;  3OR7 C;  1NH2 D;  4X1I B;  4DV0 B;  4UXN A;  2LGQ A;  4BWA A;  1BQ0 A;  1ROP A;  2DWE C;  3W7W A;  1M4U A;  1WNS A;  2CE4 A;  5CN0 A;  5FPO A;  4BIZ A;  4QGP A;  3IGA C;  4RQE A;  1AI4 A;  1XL4 A;  4ZIB A;  4DUZ O;  4PJ0 Z;  5JH7 B;  1V55 B;  4DV1 B;  4H33 A;  3SYO A;  2EIL C;  1Y4M A;  3ZHT A;  5EYP B;  5EYP A;  2UUC B;  4JF3 A;  2CUG A;  3L73 H;  4O4L B;  4O4L A;  1OCR C;  3CCE V;  2UUC O;  4LF5 B;  1OV9 A;  2WPD G;  3HKE B;  3HKE A;  4UCT A;  4TT3 G;  4IL6 Z;  3FFQ A;  5JJN B;  4K0K O;  1XL6 A;  4DV4 O;  3RWR D;  3U11 A;  2PI4 A;  1VEW A;  3VQX A;  2Y4T A;  2Q7H A;  1YTF D;  4FM0 A;  2DQ0 A;  1P7G A;  4D7T A;  2VWK A;  3CCJ V;  1QR9 A;  4J9Z B;  4LFB O;  2QWO B;  1SC5 B;  3T1H O;  2DJV A;  1FXK B;  1FXK A;  1K5Q A;  2JS5 A;  4AQY B;  1K92 A;  2E75 B;  5H6Q A;  4UCS A;  3ABT A;  3ZMT A;  3JAT B;  3B8N A;  3JAT A;  1AJP A;  1ZTE A;  3KCY A;  4RWU A;  3CJH B;  3CJH A;  3K0D A;  1IBM O;  2QWP B;  2EIJ C;  3CSX A;  2ZDI A;  3AEI A;  1R3K C;  2PTM A;  3H1K H;  3NXS A;  3ASO C;  2FML A;  5JJJ B;  3CC2 V;  3T1Y B;  4YHH B;  3T1Y O;  4GLX A;  3GWK C;  4G2K A;  4FFK A;  4YHH O;  1KU9 A;  1UFI A;  2CTP A;  1W0K G;  3OUS A;  4R50 A;  1JFF A;  1H2M A;  3F7Y C;  4CC6 A;  3WG7 B;  5L3C A;  4RO2 A;  2QGN A;  2HHH B;  4J7K A;  2CGN A;  4UUJ C;  3ABL B;  2HHH O;  4IT5 A;  1VAR A;  3H1L H;  2ZM6 B;  5HFL A;  2ZM6 O;  3ABM B;  1FYJ A;  4WCE V;  2PGG A;  3JAS B;  4J7Z A;  3E89 A;  3CB2 A;  1AIL A;  5CA1 B;  5CA1 A;  4HNA A;  2PZS A;  5A2Q N;  1QLE C;  1Y76 B;  1Y76 A;  3M7M X;  2F66 C;  1WB8 A;  1EZJ A;  1YXB A;  1VIB A;  2VS0 A;  4MVQ A;  1XMO B;  2QWR B;  4L8J A;  1S5H C;  4ABM A;  3L74 H;  3N2G B;  1K3E A;  3K06 A;  3N2G A;  3OEE G;  1SQF A;  1VF5 B;  4FLW A;  1K8A W;  1YVW A;  1IXB A;  3AG4 C;  4CC5 A;  1BE3 H;  2X6B A;  4FLX A;  5LP6 C;  1MNG A;  2Z5U A;  4NR1 A;  1KB9 F;  2PF4 E;  2JEX A;  1RSO A;  2W0F C;  4UV9 A;  3QNE A;  3P32 A;  3ZIA G;  2V1D A;  5EIB D;  3ZHQ A;  1SQP H;  1AVM A;  4PA4 A;  1VQ7 V;  3ZMU A;  2RDC A;  3ABU A;  1E1R G;  1JCH A;  1Q3E A;  4HZ3 A;  3TJT A;  3ML0 A;  4HYO A;  3SYP A;  1DTO A;  2QWN B;  4P9O A;  2Q8V A;  1Q81 W;  4TQF A;  4LBE C;  2YC0 A;  1AP5 A;  1PL4 A;  1BSM A;  5CB4 A;  4HBN A;  5CB4 B;  2VRZ A;  3PN1 A;  2M6Y A;  2UXC B;  2PI5 A;  5GW7 A;  3E22 B;  3E22 A;  2RJZ A;  3K0G A;  2UXD O;  2XAG A;  3QG5 A;  2EIK C;  2EJ7 A;  3CEI A;  1NBM G;  1VQ8 V;  1P4R A;  5KMG B;  5KMG A;  3G6B A;  2ZE8 A;  3AG3 B;  4FLU A;  1S5J A;  1IUR A;  3AG2 C;  4LF6 B;  2VWJ A;  1WPB A;  2GDS A;  1EFR G;  4NTX A;  3MAQ A;  2B5U A;  1KBH A;  2JJ1 G;  2PYJ A;  2LW1 A;  4J11 A;  1R6K A;  3BA9 A;  2ZR2 A;  4Q6G A;  3B8M A;  2ZQM A;  3CP1 A;  1Q82 W;  1ZSP A;  3U0Z A;  5A9G A;  2YXL A;  3M99 B;  1G6U A;  1DK1 A;  2UUA B;  1YZB A;  4D7S A;  2UUA O;  1TUB B;  1TUB A;  1H2L A;  1M9N A;  1N0J A;  5EBL C;  4GX5 A;  2WWW A;  3RFR A;  2V7Q G;  1DF5 A;  2PUS A;  5KLV H;  5LYJ B;  5LYJ A;  1VF6 C;  3OEH G;  1R6N A;  1EBO A;  2P6J A;  2OYQ A;  1JR9 A;  4X65 O;  1QNM A;  4LH6 A;  3F5T A;  1X4T A;  3I56 V;  4DV3 O;  1L8D A;  2NN4 A;  1GKF A;  4B3R B;  3CYO A;  1B3Q A;  3ZCC A;  2IH1 C;  4X1K B;  4X1K A;  4K8X A;  2ADP A;  4K3A A;  1MZF A;  1M5I A;  3SYC A;  3LSQ A;  5LA6 B;  5LA6 A;  2P90 A;  2YIB D;  1MMM A;  2CAZ C;  4O4J A;  1YEW A;  2FB5 A;  3SJA C;  4QPK A;  1PD3 A;  4E4E A;  3JAR B;  3JAR A;  4I7Z B;  4RUF A;  3CMA V;  4GKJ O;  2ATK C;  2R72 A;  4FPP A;  3EFF K;  2Q7E A;  2EIM C;  3MDS A;  5B3S C;  2P4V A;  4YIO A;  2JGD A;  4LFC B;  1Q6U A;  3AG1 C;  1NZ6 A;  2IU0 A;  1FJG O;  1IDS A;  2FYU H;  4I9W A;  4DV7 B;  4DV2 B;  4JI3 O;  1VQ6 V;  5BXZ A;  4DRX A;  4JI7 O;  4DV7 O;  4JTA B;  4DV2 O;  4LWS B;  4LWS A;  4QNH B;  1R3J C;  2Y69 C;  3RVY A;  2R9A A;  1HNZ O;  1OZ0 A;  2BOB C;  1RPO A;  4F4L A;  1NS1 A;  4JYA O;  4JAU A;  1I5X A;  1EZV H;  4IGG A;  4GX2 A;  5L3B A;  4J42 A;  2OCC B;  1F23 A;  2QEX V;  1EN6 A;  2O57 A;  4J7J A;  1QHT A;  1YJW V;  3BPZ A;  4LF8 B;  5IDJ A;  3GVM A;  4Q20 A;  5TIS Z;  3S3X A;  4ZI7 A;  4X66 O;  2AHZ A;  1VQ4 V;  1YJ9 V;  1NTZ H;  2UU9 O;  4LF8 O;  2KKW A;  1JJ2 U;  3I55 V;  1WP8 A;  4EFE A;  2HG5 C;  3B2E E;  3ZHU A;  4B3M B;  3SPJ A;  2Q4P A;  1DGS A;  2B1I A;  2KG7 A;  3LDD A;  4B3M O;  4W4K A;  2GHY A;  2G38 A;  5E79 Z;  1V54 C;  2WLI B;  2IW5 A;  2WLI A;  3UQ8 A;  1M57 C;  1PP9 H;  3CE2 A;  2M7W A;  2ZIN A;  1GN4 A;  3CWB H;  2E74 B;  3C3S A;  5EBW C;  1XMQ B;  1SET A;  3RYC B;  3RYC A;  1XMQ O;  3H1J H;  4WFE A;  3SPI A;  1ENV A;  2UXB O;  4FLT A;  1PM9 A;  3FB8 C;  3RBZ A;  4Z2W A;  2X6A A;  3H1I H;  3M8A A;  3CD6 V;  2HFE C;  4R8C A;  3DGE A;  1Q90 D;  4KFM A;  4BAY A;  3C3T A;  4U7N A;  3CCL V;  1V9P A;  3RT3 C;  2Z3Y A;  5LOV A;  2P7T C;  1R3I C;  1Z5W A;  1SF9 A;  1QBZ A;  3P3N A;  3CC4 V;  3JAW A;  1IX9 A;  3TXQ A;  2XAJ A;  4DW1 A;  1VF7 A;  1I94 B;  2QKS A;  4H44 B;  4RUE A;  4IYI A;  1O9H A;  1Y6X A;  1SZX A;  4DR4 B;  1KP3 A;  2DYR C;  3JAL B;  3JAL A;  3W7T A;  4DR4 O;  2HLD G;  5D5Q A;  1Z5V A;  4EEQ A;  1S5L Z;  3AG7 A;  3SPC A;  2F23 A;  2FTK A;  1YHQ V;  3MHH C;  1JQ0 A;  1NTM H;  5BMV A;  4JI6 O;  2WAM A;  3LNM B;  3BY6 A;  4EKW A;  1TAE A;  4X88 A;  2A79 B;  1NU1 H;  5GON B;  5GON A;  4GKK O;  2AGA A;  3U10 A;  1YJN V;  4JYB A;  2CTQ A;  3RYF B;  3ZRX A;  4F6R B;  2QSA A;  4F6R A;  3J81 N;  3SR2 C;  4PD4 F;  3G4S V;  2R9I A;  4LC1 A;  2IBZ H;  1BL8 A;  3ABK B;  4I5S A;  2YIC A;  5IT9 N;  1IBK O;  3ZHV A;  3NR7 A;  2XTA A;  1XNQ O;  3Q4H B;  4L87 A;  1XNR B;  2HJF C;  1QLN A;  1NT2 B;  3D8C A;  3JYC A;  1XNR O;  5IYD O;  3GB7 C;  2Q69 A;  1D5A A;  2WLL B;  2WLL A;  2A3Q A;  3SJQ C;  2ZD9 A;  4LF7 B;  3APO A;  3E8F A;  3I5D A;  4DR5 O;  3UM7 A;  4ZHQ A;  3AG1 B;  3ZN0 A;  4DV0 O;  1R73 A;  1PL0 A;  2ZIO A;  2YS8 A;  2ZR3 A;  4PDM A;  1OCC B;  4CZZ A;  5CBF A;  3JSN A;  3APQ A;  3R66 A;  4O2B B;  4O2B A;  1BMF G;  3UCS C;  3EVK A;  1K7D A;  3ZN1 A;  1Y66 A;  2QE7 G;  3BAB A;  3OTO B;  5KHK A;  4DV1 O;  3OTO O;  1TA8 A;  2YDE A;  3ZHS A;  1SKV A;  3WB2 A;  4GX1 A;  2F95 B;  4YJ3 A;  3CCU V;  1JJO A;  4LF5 O;  1VQ5 V;  4JYC A;  5IJ0 B;  5IJ0 A;  2Y0I A;  3K79 A;  3E8G A;  3HKD A;  1VMG A;  2MW2 B;  5C93 A;  3P30 A;  4JAS A;  2Q68 A; 
#chains in the Genus database with same CATH homology
 5TIS Z;  4UB6 Z;  5KAI Z;  5B66 Z;  5GTI Z;  3JCU Z;  3A0B Z;  1S5L Z;  3A0H Z;  3KZI Z;  5H2F Z;  4UB8 Z;  2AXT Z;  4IL6 Z;  5GTH Z;  5KAF Z;  5E79 Z;  4PJ0 Z;  3WU2 Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...