1S5LZ

Architecture of the photosynthetic oxygen evolving center
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
total genus 20
structure length 58
sequence length 58
chains with identical sequence z
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 1s5lZ00
5KAIZ 5KAFZ 3A0HZ 4IL6Z 5TISZ 2AXTZ 5H2FZ 4UB8Z 3JCUZ 3WU2Z 1S5LZ 5GTHZ 5GTIZ 4PJ0Z 4UB6Z 5E79Z 3KZIZ 3A0BZ 5B66Z 5B5EZ
chains in the Genus database with same CATH superfamily
2QWOB 3J80N 4TV8B 4DR7B 1N0NA 2HLDG 3JAMN 2BOCC 1SQBH 4I4TB 4CH4A 1QVGU 2W0FC 3SYOA 2P22C 3H1LH 3CRQA 5KHHA 3I56V 2O57A 1N36B 5ITZA 4RUEA 5B66Z 3FD9A 4IHJB 5LGUA 2VQEO 1FFTB 1UJWB 4LFAB 1IBLB 4CH3A 2P7TC 2YXLA 3ICXA 2CDYA 2RCVA 4MTFA 2YC0A 5IE9A 3E2EA 5JCOA 5CA0B 4X65O 3FB5C 2D3OW 4TUYA 4H44B 1M57B 1KUQA 4LFCB 4B3RB 2YDEA 1ZX3A 1QQCA 3A2FA 1TAEA 3QTCA 2ZE7A 2XAJA 4D6TH 4EFBA 2OYQA 1Q7YW 4B3MO 2PI5A 1HNZB 4BW5A 3CE2A 1Q3EA 2IJJA 2X7RB 4CS4A 5BMVA 4LF4O 5LMUB 2JS3A 2UUAB 2HEPA 1BL8A 3CHXA 3K5NA 2A0LA 3HB3B 2JJ1G 4UCRA 3UCSC 2WLMA 3LUTB 3I55V 2EINC 1ZSPA 3E8GA 5EBLC 3B2EE 1GH6A 4PI0A 1VF7A 2F1MA 5CMUA 1MSWD 4KXRA 1YCIA 1I5YA 4LNUB 3ZHTA 2JS5A 1V55C 3KCXA 1SA0A 1ZAUA 3JSNA 4GLXA 1R3KC 4MTXA 1JX9A 1FJGB 1X4TA 4JI2O 2HVJC 1Q82W 2A7WA 1H2MA 4CS2A 4TV8A 3IC9A 4I4TA 1IX9A 5LHHA 1TUBB 1XMOO 2YS8A 2LFRA 3EXAA 1M1KW 4X65B 2LJ2A 4DR6O 4QNHB 3AK1A 3OFNG 3CSXA 3ZHRA 1BT8A 3QVNA 5LP6C 4IHJA 3L9DA 1N0JA 4X62O 4DR2O 4JI1O 2ZR2A 3D3QA 1XUQA 4IYHA 3ZMVA 1IBKO 5KA6A 4GX2A 1L0NH 4B3MB 3I5DA 2AXTZ 1B3QA 1BCCH 5BY1A 5CA0A 4YHHO 4LF4B 2QGNA 2A79B 2QEXV 1CPYA 4UB6Z 3QNEA 3BY6A 3T1HO 3HR0A 4JYAO 2W0XA 2QM4A 4I9WA 3G71V 2CAZC 1VQLV 4WFGA 2DYSC 4TOIA 3ZBHA 1VP7A 1KECA 4U3JB 2A3QA 1OCCC 4FPPA 4QPJA 2EINB 3MHSC 4WF9V 3T2MA 1I08A 3C90A 5FNVB 3ZCCA 3HKEA 2ZNIA 1QU7A 3RW0A 4DYLA 3OT7A 1N8RW 4CH5A 2DWDC 2H3OA 3DC5A 3W7UA 1F4MA 3ZMUA 1US6A 1XMOB 2VQFO 4LNUA 1ZTEA 1W59A 4DR6B 3DSQA 2AHYA 2YICA 1P7BA 4X62B 4JI1B 2CGOA 3KZIZ 3CRMA 3JD4A 1XBLA 2ZQMA 3CCQV 2BTOA 2F23A 4L8JA 1IBKB 5D5QA 1VQ6V 3T4DA 2HFEC 1TUBA 5LP6B 3CX5F 4DW0A 4TSFG 5FPOA 4B3SO 2YSUB 1QR8A 3TJTA 4I0XB 5LXTB 4ICGA 3ZHVA 4YHHB 1WB7A 2LO1A 5LBQA 4LWSB 4ABMA 2QDOA 4LH7A 4K35A 4DR5O 2PI4A 1NTMH 5FPRA 3D36C 1P49A 1WB8A 3SJCC 4FLYA 3DC6A 4FLTA 1FD9A 4JZGA 3JSLA 1GM8A 2UU9O 1FXVA 2WSSG 3T4ZA 5TISZ 1KU9A 4MVZA 4GKJO 1XHXA 2DYSB 4JI5O 3ETEA 1OCCB 2RN9A 5FLXN 1X59A 1G4YB 4IGGA 3SPJA 3OTOO 1Z2GA 4K8ZA 2PUSA 2IJKA 1N4CA 1E1RG 4QPKA 1PD3A 3W7WA 1Q90D 4U3JA 4PELA 1YF2A 5BR8O 5B1AC 2EILC 3Q4HB 4NXNO 5L3CA 4UCVA 2IW5A 4XDKA 5FNVA 4B7KA 4X20B 4LFBO 3VQWA 4MW3A 4B3TO 4DUZO 3T1YB 1NQTA 5C8YB 4DW1A 1E1QG 2LW1A 2ZD9A 2P6JA 2QR4A 5EC1C 3L71H 4JI7O 2OCCC 3AEIA 1K9MW 2GTAA 4DV1O 5B5EZ 1Q6HA 1AI7A 3CPWU 4X1KB 2Q73A 4DR4O 1FXHA 3JAKB 2A06H 3K3WA 3RBZA 4X1YB 1ZLZA 4JAVA 3SYQA 3A8TA 4KFMA 4QJFB 2WLIA 3MAQA 1ENVA 3UT5B 1HP8A 5LP6A 4HNAB 2Y69B 2UU9B 5LA6A 2XTAA 4I0XA 2E76B 3H01A 4JAAA 5LXTA 5LMNB 4JI5B 1AILA 2P06A 3SDLA 2HVKC 3CYOA 3BEHA 4O4HB 3ASOC 3GWKC 4DRXB 3SPIA 1SF9A 5B1NA 4MTGA 1P7GA 3THOA 2UXBB 4NXNB 2NLJC 5EBMC 3ZRVA 1O9HA 5KMGB 1FXKC 4NXMO 5CBGA 4B3TB 4DUZB 3VOUA 5B1AB 4DK1A 3LNMB 2GSMB 3P3PA 3SJAC 1L0LH 3FKSG 4DV1B 4E2LA 2WLLB 3H1IH 2CTPA 5CB4B 3ZRWB 1IVSA 3OUFA 3Q4HA 4ZKIA 1GN6A 3UO2A 4F6RB 4J10A 3A0HZ 3AG1C 2ZNJA 4X20A 2K9PA 3CXCU 4OPHA 1NBMG 1PP9H 2ITDC 1NJIW 1BE3H 4TV9B 1YEWA 5C8YA 4MVUA 3RFRA 3AG4B 2H94A 4ZIBA 3OE7G 3ABKC 4JTAB 1XNQO 1VARA 2RMKB 4GKKB 2Q8VA 2UUCB 1PPJH 1KMIZ 4X1KA 2F43G 1SERA 3WB0A 1DGSA 1Q6IA 3GVMA 1OV9A 4O2AB 3JAWB 3JAKA 4JI0O 2ZT9B 4NVPA 4X1YA 1B04A 3DXRB 2YXHA 1R6TA 2EIMC 3FB8C 1AR5A 3UT5A 4CS3A 3F7YC 1JMKC 2Q5ZA 1M90W 4HNAA 3ASOB 1RPOA 2RQ6A 3D36A 4FM0A 2Q7GA 2QKSA 1Y67A 5IJ0B 1K5QA 2GUZB 4DO2A 1NR7A 5EC2C 4NXMB 3U11A 1R1BA 4O4HA 5H2FZ 4DRXA 4OX9O 1K3EA 4RUFA 1YZBA 1FXKB 1N32O 4GCZA 1JJ2U 3IC7A 1Q6UA 1WPXA 1O9GA 3CXHF 1QVFU 4GT1A 5EYPB 3SPHA 3TXQA 1MABG 3FAVB 1YJNV 4JI6O 5KMGA 2WLNA 4AHCA 1FPOA 4PA3A 3JYCA 2Q0AA 1WLEA 4X66O 1F7YA 3K59A 1EN6A 3DGEA 1K7DA 2N05A 1XNQB 1SESA 3AG1B 1Y4MA 2KKWA 2WLLA 1LNQA 4GX5A 5CB4A 1MOFA 3ZRWA 4DV5O 4LF5O 3ETGA 3BA8A 1AI4A 4F6RA 3ABKB 4PD4F 3ZRXA 4H13B 1GN4A 1NR1A 1PM9A 5JQGB 4TV9A 4PA7A 1S5HC 3L73H 1IBMB 1I94O 4JYBA 3VQXA 3VQYA 2P67A 3SPCA 3F5WC 2EIMB 2JJ2G 4D7SA 4MW8A 1YJ9V 1M5IA 1GTOA 4UCTA 4O2AA 3JAWA 1YDXA 3P30A 1AVMA 4LFAO 5IJ9B 3F5TA 4OX9B 2QSAA 3DXRA 2E74B 1MMMA 4FVMA 4RO2A 1BZKA 4FFBB 1N32B 2QM7A 2HHHB 3OEHG 1U97A 1R6NA 4FJCC 1R3LC 5IJ0A 1GN3A 1BHAA 2GUZA 4NB5A 3E8BA 2VRZA 1RP3B 1FS0G 5EIBD 5D5PA 3LDCA 3CCJV 1WP8A 1FXKA 3JCUZ 2HKOA 2V1DA 3H9VA 5CA3A 4EFEA 4DV5B 4LF5B 3NR7A 5EYPA 4FLXA 3FAVA 2PYLA 2CUGA 2G38A 3ZS8C 2UUAO 1MA1A 3JASB 4UVCA 4YJ3B 2YIBA 4JPRA 1VQMV 3LNNA 1K73W 3BHPA 5JJEB 2IJHA 1I94B 4U7OA 1EZJA 1XREA 4F6EA 5C93A 3ASNC 4I50B 4PDVA 4O4IB 2VWKA 1H8HG 1Q81W 1FJGO 4LF6B 5JQGA 3RYFA 2PF4E 2DE0X 1TA8A 4I5SA 2CTRA 2L6LA 3K04A 4PV1B 3BA9A 3K79A 3KCYA 4HBNA 2QTSA 2F4VO 1NKDA 1NTZH 3PJSK 3R66A 3OD4A 1VF5B 1THZA 2IM9A 3E35A 1K8AW 3STZC 4F4LA 1VMGA 1KKCA 2KG7B 2Y48A 5J2UB 1TVKB 5IJ9A 3CC4V 1NVPB 4BIZA 1BSMA 1K34A 4U3FH 1FAFA 1CP9A 2XAFA 4FFBA 1B6QA 4DR3B 1WPBA 4O4JB 3AG3C 4MTOA 2PY5A 1NVPD 2FKXA 1VQ5V 1IURA 4FM2A 5L3EA 5LYJB 4XDJA 2Y4TA 3B77A 2M6YA 2RNBA 3D8CA 1S72V 4J11A 3JASA 3ASNB 4YJ3A 1HNXO 5KAFZ 1GRJA 1EFRG 4O4LB 2FTKA 4FLUA 1ZL8B 3S3WA 2F4VB 4JAUA 5J2TB 2Q6AA 4DV2O 5KHIA 4I50A 4O4IA 3B09A 2DWEC 2HJDA 4FZ1A 4JGSA 1JFFB 1SRYA 3A0RA 2OTJV 1PNKA 1H2SB 2XAHA 4J9YB 2Y0IA 1PNLA 1Z5VA 5JJJB 1WN7A 1Y66A 1NT2B 3SGIA 1ZUQA 4DV6B 1Y74B 4DV0B 4IYIA 3JD2A 4LBEC 4YIPA 4FMTA 3WU2Z 1UFIA 2BE3A 2UXNA 3G4SV 1AJQA 1HW7A 3RVZA 2IU0A 2KG7A 5J2UA 1TVKA 2ZDIC 4X8AA 1KD1W 3B8MA 1GMGA 3AG3B 4J7ZA 1R73A 4NTWA 2E5LB 3ZRSA 1YTFB 2CK3G 1ZWIC 1WJZA 1HR0O 4O4JA 2B5UA 1EZVH 2GDSA 1F23A 3D3IA 2B1GA 3CJHB 1HNXB 2QWQB 4L87A 4UXNA 2IBZH 3BFRA 2PTMA 3SPGA 3HKDB 3LSSA 1YTFD 4DV2B 5LYJA 1SQFA 3TGUH 4U7NA 5L3FA 5LGNA 1N33O 3JD0A 3CC7V 2QWNB 2YI8A 5DEDA 1RM1C 1YJWV 3FX7A 3T1YO 1V54C 4O4LA 2EULA 4G27B 2QKAA 5J2TA 1SS3A 4CBCA 1VF6C 3FB6C 4Q20A 2HP8A 4B08A 3APOA 5CBHA 2Y69C 1JFFA 1OCRC 3T1CA 2OT5A 3F7VC 3W7XA 3QF7A 5BZBA 1YIJV 1Y74A 2ZINA 4PI2A 1VQ8V 4HYOA 1AJNA 3CMEV 1HR0B 5LMNO 5JVDB 4JV5O 2ATKC 1JOYA 2ILMA 5GTIZ 5CA1B 2BSKB 2R9AA 1AI6A 4X9QA 1G6UA 1EN4A 4LF8O 2Q69A 1WAZA 2BOBC 3M8AA 5L3GA 2UXBO 3LDDA 5L3BA 1G8MA 1N33B 4YY3O 2X0LA 3K9AA 1K92A 4WFBV 3CJHA 4ZHQB 3E86A 1QLNA 1JA8A 3B4SA 4YIOA 2OIEA 3LSQA 1RM1B 5GONB 3HKDA 4JF3A 1P84F 4J9ZB 3BPZA 1V54B 3AG4C 4P9OA 1PNMA 2WLHA 1S76D 1SQGA 3OMNB 1K4CC 2YI9A 3ABTA 2CGNA 2EIJC 4BR6A 4CC5A 4PA9A 4FLWA 3CWBH 2KSDA 3ABMC 2XT9A 4GKKO 2UUCO 2GTSA 4RQFA 1OCRB 4QE7A 3BRCA 2MK3A 2UUBB 4ZI7B 1VQNV 4JV5B 4LWSA 2WA3A 1BMFG 3G80A 3CCRV 3K5LA 5IYZB 2OWOA 2WLJA 1PV0A 3ZJZA 5LHIA 2ZE5A 5JH7B 3O65A 1K33A 3G6BA 1XMQO 4LF8B 3IJ4A 1KB9F 1A32A 4FLVA 2ZDIA 1GM9A 1L1FA 3QG5A 1J5EO 4TQFA 3MDSA 5JVDA 2AGAA 1LUVA 2Y4UA 4I7ZB 4UVBA 4YY3B 1BGYH 5DM6V 4JTCB 5CA1A 5IWAB 2BSKA 4J42A 5KX5B 1DLBA 3RYHB 4O2BB 1GAXA 3ZHUA 1BQ0A 4BWAA 1VQ4V 1Y76B 3H1HH 1DF4A 4MVOA 4W4KA 2P5OA 2EZOA 3CCEV 3SR2C 2R9RB 4UB8Z 4ZHQA 3H1JH 3BAAA 3CS5A 1YXBA 2GV9A 5LL6Y 2AZ2A 4P30A 2ADQB 1JJOA 2EJ7A 2JK5C 5GONA 2ITCC 4I55B 2EIJB 3EHBB 3S3XA 3LSUA 3ZN1A 3ABMB 2OIGA 3IGAC 2JGDB 4PDRA 1VF6A 3APQA 3ZMSA 5K1XA 1QHTA 1XMQB 1IBMO 1GM7A 4DV3O 5DECA 4EKWA 1J5EB 1NI8A 1K5SA 4ZI7A 2D2CB 1G1XB 5EBWC 4N23A 5IYZA 4EB6B 1IZ3A 3HKCB 1XQ8A 2IU3A 4R50A 4W4LA 5JH7A 1MZEA 2B1IA 1KC8W 1MZFA 1OZ0A 1WA8B 2YUAA 3HKBB 2DOSA 1JR9A 3CCLV 2HHHO 4LF9O 5KAIZ 1SQVH 3ZIAG 2UXCB 3UKMA 1JCHA 1J95A 2V7QG 4LP8A 5KX5A 4R8CA 2LFSA 2JRIA 3RYHA 4O2BA 4KHPO 1Y76A 2VS0A 5HFLA 1H8EG 2IH1C 4WCEV 2X6AA 1BS3A 4NKGB 3KG2A 2ZE6A 3N2GB 2WA4A 2OCHA 2YIBD 1YSCA 3VBBA 4RAIA 3R65A 3AG7A 1GO3F 4JYYA 4LCUC 4NR1A 1JVMA 2QWRB 4DV3B 1XOUA 2DQ0A 3B40A 5ITZB 4I55A 3RYCB 2Q7EA 4BAYA 3UO3A 4KL1A 3E83A 3N27A 4LF6O 2JGDA 4X89A 1GKFA 2W6JG 3CB2A 5IYCO 2QTOA 3JATB 1Z5WA 4X64B 3OMIB 1ROPA 4AI8A 2K1EA 1KYOF 4LF9B 2DMXA 3EVKA 3H1KH 1S5JA 3SYAA 2ZCEA 4N21A 1LUWA 2JEUA 1SQPH 4WFEA 4EB6A 3HKCA 4G28B 1JPXA 1FYJA 1XDCA 4KHPB 2V4DA 3PN1A 1VQOV 1WA8A 4DR3O 4BIUA 1H2KA 1Q86W 2GBOA 2UXXA 3HKBA 4JI4O 4FLZA 4JASA 2ETNA 1D5AA 2X6BA 1H38A 4JYCA 3CC2V 2R72A 3ZX6A 2XNDG 2FYUH 4X88A 3JD1A 1M56C 1PL0A 2Q7HA 4OPAA 2ZM6O 4IT5A 3OR6C 2PYJA 1XILA 4H0LB 3CCUV 1OCOC 3N2GA 2XAGA 3OGIB 1YHQV 2CH7B 5F2VO 1VIBA 3WFVA 2Y0PA 1IDSA 2XAQA 4DR1B 2PZSA 4P2ZA 3B8NA 4K8XA 1OHHG 1FFXB 3K57A 2JDIG 3RYCA 3RVYA 4DV4B 1IXMA 4R6ZA 1MG1A 4MVRA 4J7KA 4RQEA 2BCCH 1H2NA 4Z2WA 3JATA 2YIDA 1B06A 2ZXWC 1V9PA 2UXDB 3U0ZA 5DN6G 4X1IB 1VQPV 5KUKA 2Z5UA 3IFXA 4OGQB 4DV0O 4DV6O 4JI4B 3OTFA 5LOVB 2QM8A 2CE4A 2LQTA 1Q43A 2LGWA 3MD0A 1Q5OA 1NU1H 4UV8A 4WFAV 4Z1MG 4JI3O 4CH6A 4JI8O 1XI1A 3STLC 2ZM6B 4G2KA 4DK0A 2WWWA 3K08A 3OMAB 4AILC 1W0KG 2E5LO 2FMLA 3HKEB 1I7FA 4J80A 2YXYA 1M56B 3A0BZ 1D5NA 2ZKOA 2OTLV 3AK2A 3W7SA 1OCOB 1M9NA 5B1OA 4UCSA 1D2DA 3JALB 2EJRA 2KB1A 5KA5A 4JTDB 5GTHZ 1R3JC 4MVQA 1HNWO 2VQEB 5KHJA 3E8FA 2CH7A 5EZYB 1VQ9V 1YI2V 2A9HA 3CRCA 4K0KO 4FIPC 3J81N 4QGPA 3CEIA 1H2GA 4ZBMA 4H37A 1FFXA 2M7WA 3EFFK 3OEEG 1HWYA 2QWPB 4DXWA 2ZXWB 4IIJB 2FL4A 1QBZA 2NNUA 3K5MA 5B3SC 4OXSA 4JI3B 4R7CA 1AP5A 4JI8B 4BW9A 4PHZA 1MSDA 4LF7O 1VQ7V 4X1IA 3CCMV 1T5EA 1NTKH 3K0DA 2R70A 3G67A 3FYIB 5LOVA 1Y6XA 3WG7C 2E75B 2Q68A 2AHZA 1NS1A 3W7TA 2CTQA 1R6KA 4UUJC 1SZXA 3GWOA 4D7TA 4GX1A 1SKVA 1YITV 2IJIA 1P4RA 2F95B 2EZPA 2ODMA 3K06A 1QR9A 3LDEA 1HNWB 4YJ2B 1F51A 4JI2B 4ASUG 4FK5C 2ZR3A 2AW9A 1UPGA 1V55B 4K0KB 3ETQA 2EBOA 3L75H 3WB2A 4UCOA 3K5OA 2Q67A 1AR1B 4FZ0A 3JALA 2LW7A 2X6CA 1ZL8A 2ADPA 2ZIOA 3WB1A 3L72H 1W2BU 2N04A 3RYIB 4AQYO 3ZMZA 1N34O 2R9IA 3CP1A 5IDJA 1KQSU 3UQ8A 2NR5A 4DR2B 3M7MX 5EZYA 5KUMA 1U96A 1COWG 1S77D 2Q4PA 1WNSA 2WLIB 3ZHSA 3FYEB 2Z0AA 4UFZA 4Z1VA 4LF7B 5GW7A 3TXSA 4PA4A 5KHGA 4MVSA 5LA6B 1K4DC 3E8HA 4XBFA 5B3SB 3FB7C 1BQZA 1TUEB 2QKCA 2NN4A 2UUBO 4IIJA 1EN5A 2ARHA 1RPRA 2YEVB 3T1HB 1SQXH 4JYAB 3JCZA 2PGGA 4LC1A 2W6IG 3P3NA 3QO7A 4XDLA 1VEWA 3WG7B 4CZZA 1QNMA 5BXZA 4E4EA 3FFQA 1KP2A 2N74A 1ORQC 3SJBC 3K58A 5E1AC 3P32A 2B9ZA 1AR4A 3G6EV 4B7EA 1KBHA 3ZEDA 5A2QN 1CEZA 3L70H 5LGTA 4FM1A 3TETA 2E3CA 1FKAO 1YVWA 5B1BC 5IY5C 5AG2A 5IWAO 1VQKV 3CMAV 4P9PA 2VQFB 2EX3A 4ZOLB 3MHHC 1XL4A 4GX0A 4AQYB 3HPLC 4YJ2A 1H2LA 1N34B 2WPDG 4J7JA 3AG2C 2WLKA 1QLEC 1OJHA 2RJZA 5H5NA 1BHBA 4I9QA 2DW4A 4MSWC 4B3SB 2QJ1A 3BVOA 3BCCH 1RSOB 3CRAA 5FL7G 4WBNB 4JZ2A 5LHGA 3RYIA 4DUYO 3L74H 4DR5B 3OM3B 5K1PA 1URFA 1CXZB 4H33A 1S3JA 1NZ6A 1KP3A 1XL6A 1OCZC 3SJQC 4LR3A 5L3DA 3OGCC 2HR3A 4GKJB 4UVAA 3AK3A 4A5UB 1XNRO 3CRRA 3CCSV 3JARB 1W0JG 2YEVA 1M4UA 4CC6A 3OTOB 1DF5A 3RN4A 4PJ0Z 1EBOA 1Q8IA 5BR8B 4TQDA 3QO8A 2C2AA 3O9OA 5B1BB 5IY5B 5J9PC 2H8PC 1AROP 3N2KB 2DYRC 2F66C 3X2QC 2XOKG 3OW2U 4LFBB 2JGUA 1F4NA 5CN0A 2F93B 2UXCO 2EILB 4PDLA 2YIAA 5JJNB 2JEXA 3ZN0A 4QIWF 4JI7B 4J41A 2AZ0A 1SQQH 3RWRD 5E79Z 3AG2B 4ZOLA 2RDCA 1QLEB 3RT3C 4DR4B 1R3IC 4DUYB 2OCCB 5IYBO 2DQ3A 3NXSA 4IL6Z 2XUMA 4C7UA 4UV9A 3TK1A 4NTYA 2JVDA 2IH3C 2BTQB 4QE9A 3ML0A 3KKYA 3K0GA 2P90A 1IXBA 1AB3A 1SC5B 1RSOA 4WBNA 3OUSA 1JQ0A 1XNRB 4WFFA 1HDJA 1OCZB 4FFKA 3SYPA 1MNGA 1S0VA 4MVMA 5JCOC 1DK1A 1SETA 3K9SA 3VQVA 4X64O 3CCVV 1GK9A 4HZ3A 5H9CA 3C3TA 5CBFA 4KUMA 3DTUB 5EIBC 5A9GA 3E22B 3J7AU 1AJPA 3JARA 2XHBA 1LR1A 5KLVH 4WFHA 1KKDA 3IAYA 2DYRB 3ABLC 2EIKC 3X2QB 5JWPA 2HG5C 3U10A 1QCEA 2GHYA 3UM7A 1RFYA 3N2KA 4MS2A 2Z3YA 2P4VA 2LP7A 2L35A 5EK0A 1SZTA 3ABUA 2VWJA 1L8DA 2DN9A 2XASA 4DV7O 3SYCA 3ZHQA 5HFMA 4YXWG 2QA4V 4BIOA 1DTOA 5IT9N 1EM1A 1AI5A 1GN2A 4GYCB 4LH6A 2DJVA 4JI0B 2P4KA 2Q9LA 3GB7C 1K97A 1E79G 3TCUA 3OAAG 3RYFB 4DR7O 2CTWA 4GUNA 5KHKA 4TT3G 5H6QA 2BTQA 4DR1O 4HAMA 4TWKA 2KQXA 4PDMA 1NH2B 5IYDO 4NTXA 1N36O 3K03A 2FB5A 4TUYB 3OR7C 2JIZG 3ETDA 1XEQA 1WP7A 4GZRB 2QE7G 4DV4O 1XHZA 3RGBA 3QO5A 1IBLO 2LGQA 4MT8A 4RWUA 1AP6A 1M57C 2UXDO 4PA6A 1NH2D 4KP4A 1I5XA 5BMVB 4JI6B 3ABLB 2EIKB 3CD6V 4K3AA 5H6RA 3E22A 2ZE8A 1PL4A 1I0HA 4LFCO 4B3RO 3C3SA 4Q6GA 4X66B 2ZIMA 3M99B 2Q0OC 3ZMTA 4DV7B 1PKXA 2HJFC 3JD3A 4NYKA 1S5LZ 1TGOA 1HNZO 2WAMA 4UCUA 1SA0B 4EEQA 3E89A 5LMUO 1M93A 3BABA 2MW2B
chains in the Genus database with same CATH topology
5KAIZ 5KAFZ 3A0HZ 4IL6Z 5TISZ 2AXTZ 5H2FZ 4UB8Z 3JCUZ 3WU2Z 1S5LZ 5GTHZ 5GTIZ 4PJ0Z 4UB6Z 5E79Z 3KZIZ 3A0BZ 5B66Z 5B5EZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI Z;  5KAF Z;  3A0H Z;  4IL6 Z;  5TIS Z;  2AXT Z;  5H2F Z;  4UB8 Z;  3JCU Z;  3WU2 Z;  1S5L Z;  5GTH Z;  5GTI Z;  4PJ0 Z;  4UB6 Z;  5E79 Z;  3KZI Z;  3A0B Z;  5B66 Z;  5B5E Z; 
#chains in the Genus database with same CATH topology
 2QWO B;  3J80 N;  4TV8 B;  4DR7 B;  1N0N A;  2HLD G;  3JAM N;  2BOC C;  1SQB H;  4I4T B;  4CH4 A;  1QVG U;  2W0F C;  3SYO A;  2P22 C;  3H1L H;  3CRQ A;  5KHH A;  3I56 V;  2O57 A;  1N36 B;  5ITZ A;  4RUE A;  5B66 Z;  3FD9 A;  4IHJ B;  5LGU A;  2VQE O;  1FFT B;  1UJW B;  4LFA B;  1IBL B;  4CH3 A;  2P7T C;  2YXL A;  3ICX A;  2CDY A;  2RCV A;  4MTF A;  2YC0 A;  5IE9 A;  3E2E A;  5JCO A;  5CA0 B;  4X65 O;  3FB5 C;  2D3O W;  4TUY A;  4H44 B;  1M57 B;  1KUQ A;  4LFC B;  4B3R B;  2YDE A;  1ZX3 A;  1QQC A;  3A2F A;  1TAE A;  3QTC A;  2ZE7 A;  2XAJ A;  4D6T H;  4EFB A;  2OYQ A;  1Q7Y W;  4B3M O;  2PI5 A;  1HNZ B;  4BW5 A;  3CE2 A;  1Q3E A;  2IJJ A;  2X7R B;  4CS4 A;  5BMV A;  4LF4 O;  5LMU B;  2JS3 A;  2UUA B;  2HEP A;  1BL8 A;  3CHX A;  3K5N A;  2A0L A;  3HB3 B;  2JJ1 G;  4UCR A;  3UCS C;  2WLM A;  3LUT B;  3I55 V;  2EIN C;  1ZSP A;  3E8G A;  5EBL C;  3B2E E;  1GH6 A;  4PI0 A;  1VF7 A;  2F1M A;  5CMU A;  1MSW D;  4KXR A;  1YCI A;  1I5Y A;  4LNU B;  3ZHT A;  2JS5 A;  1V55 C;  3KCX A;  1SA0 A;  1ZAU A;  3JSN A;  4GLX A;  1R3K C;  4MTX A;  1JX9 A;  1FJG B;  1X4T A;  4JI2 O;  2HVJ C;  1Q82 W;  2A7W A;  1H2M A;  4CS2 A;  4TV8 A;  3IC9 A;  4I4T A;  1IX9 A;  5LHH A;  1TUB B;  1XMO O;  2YS8 A;  2LFR A;  3EXA A;  1M1K W;  4X65 B;  2LJ2 A;  4DR6 O;  4QNH B;  3AK1 A;  3OFN G;  3CSX A;  3ZHR A;  1BT8 A;  3QVN A;  5LP6 C;  4IHJ A;  3L9D A;  1N0J A;  4X62 O;  4DR2 O;  4JI1 O;  2ZR2 A;  3D3Q A;  1XUQ A;  4IYH A;  3ZMV A;  1IBK O;  5KA6 A;  4GX2 A;  1L0N H;  4B3M B;  3I5D A;  2AXT Z;  1B3Q A;  1BCC H;  5BY1 A;  5CA0 A;  4YHH O;  4LF4 B;  2QGN A;  2A79 B;  2QEX V;  1CPY A;  4UB6 Z;  3QNE A;  3BY6 A;  3T1H O;  3HR0 A;  4JYA O;  2W0X A;  2QM4 A;  4I9W A;  3G71 V;  2CAZ C;  1VQL V;  4WFG A;  2DYS C;  4TOI A;  3ZBH A;  1VP7 A;  1KEC A;  4U3J B;  2A3Q A;  1OCC C;  4FPP A;  4QPJ A;  2EIN B;  3MHS C;  4WF9 V;  3T2M A;  1I08 A;  3C90 A;  5FNV B;  3ZCC A;  3HKE A;  2ZNI A;  1QU7 A;  3RW0 A;  4DYL A;  3OT7 A;  1N8R W;  4CH5 A;  2DWD C;  2H3O A;  3DC5 A;  3W7U A;  1F4M A;  3ZMU A;  1US6 A;  1XMO B;  2VQF O;  4LNU A;  1ZTE A;  1W59 A;  4DR6 B;  3DSQ A;  2AHY A;  2YIC A;  1P7B A;  4X62 B;  4JI1 B;  2CGO A;  3KZI Z;  3CRM A;  3JD4 A;  1XBL A;  2ZQM A;  3CCQ V;  2BTO A;  2F23 A;  4L8J A;  1IBK B;  5D5Q A;  1VQ6 V;  3T4D A;  2HFE C;  1TUB A;  5LP6 B;  3CX5 F;  4DW0 A;  4TSF G;  5FPO A;  4B3S O;  2YSU B;  1QR8 A;  3TJT A;  4I0X B;  5LXT B;  4ICG A;  3ZHV A;  4YHH B;  1WB7 A;  2LO1 A;  5LBQ A;  4LWS B;  4ABM A;  2QDO A;  4LH7 A;  4K35 A;  4DR5 O;  2PI4 A;  1NTM H;  5FPR A;  3D36 C;  1P49 A;  1WB8 A;  3SJC C;  4FLY A;  3DC6 A;  4FLT A;  1FD9 A;  4JZG A;  3JSL A;  1GM8 A;  2UU9 O;  1FXV A;  2WSS G;  3T4Z A;  5TIS Z;  1KU9 A;  4MVZ A;  4GKJ O;  1XHX A;  2DYS B;  4JI5 O;  3ETE A;  1OCC B;  2RN9 A;  5FLX N;  1X59 A;  1G4Y B;  4IGG A;  3SPJ A;  3OTO O;  1Z2G A;  4K8Z A;  2PUS A;  2IJK A;  1N4C A;  1E1R G;  4QPK A;  1PD3 A;  3W7W A;  1Q90 D;  4U3J A;  4PEL A;  1YF2 A;  5BR8 O;  5B1A C;  2EIL C;  3Q4H B;  4NXN O;  5L3C A;  4UCV A;  2IW5 A;  4XDK A;  5FNV A;  4B7K A;  4X20 B;  4LFB O;  3VQW A;  4MW3 A;  4B3T O;  4DUZ O;  3T1Y B;  1NQT A;  5C8Y B;  4DW1 A;  1E1Q G;  2LW1 A;  2ZD9 A;  2P6J A;  2QR4 A;  5EC1 C;  3L71 H;  4JI7 O;  2OCC C;  3AEI A;  1K9M W;  2GTA A;  4DV1 O;  5B5E Z;  1Q6H A;  1AI7 A;  3CPW U;  4X1K B;  2Q73 A;  4DR4 O;  1FXH A;  3JAK B;  2A06 H;  3K3W A;  3RBZ A;  4X1Y B;  1ZLZ A;  4JAV A;  3SYQ A;  3A8T A;  4KFM A;  4QJF B;  2WLI A;  3MAQ A;  1ENV A;  3UT5 B;  1HP8 A;  5LP6 A;  4HNA B;  2Y69 B;  2UU9 B;  5LA6 A;  2XTA A;  4I0X A;  2E76 B;  3H01 A;  4JAA A;  5LXT A;  5LMN B;  4JI5 B;  1AIL A;  2P06 A;  3SDL A;  2HVK C;  3CYO A;  3BEH A;  4O4H B;  3ASO C;  3GWK C;  4DRX B;  3SPI A;  1SF9 A;  5B1N A;  4MTG A;  1P7G A;  3THO A;  2UXB B;  4NXN B;  2NLJ C;  5EBM C;  3ZRV A;  1O9H A;  5KMG B;  1FXK C;  4NXM O;  5CBG A;  4B3T B;  4DUZ B;  3VOU A;  5B1A B;  4DK1 A;  3LNM B;  2GSM B;  3P3P A;  3SJA C;  1L0L H;  3FKS G;  4DV1 B;  4E2L A;  2WLL B;  3H1I H;  2CTP A;  5CB4 B;  3ZRW B;  1IVS A;  3OUF A;  3Q4H A;  4ZKI A;  1GN6 A;  3UO2 A;  4F6R B;  4J10 A;  3A0H Z;  3AG1 C;  2ZNJ A;  4X20 A;  2K9P A;  3CXC U;  4OPH A;  1NBM G;  1PP9 H;  2ITD C;  1NJI W;  1BE3 H;  4TV9 B;  1YEW A;  5C8Y A;  4MVU A;  3RFR A;  3AG4 B;  2H94 A;  4ZIB A;  3OE7 G;  3ABK C;  4JTA B;  1XNQ O;  1VAR A;  2RMK B;  4GKK B;  2Q8V A;  2UUC B;  1PPJ H;  1KMI Z;  4X1K A;  2F43 G;  1SER A;  3WB0 A;  1DGS A;  1Q6I A;  3GVM A;  1OV9 A;  4O2A B;  3JAW B;  3JAK A;  4JI0 O;  2ZT9 B;  4NVP A;  4X1Y A;  1B04 A;  3DXR B;  2YXH A;  1R6T A;  2EIM C;  3FB8 C;  1AR5 A;  3UT5 A;  4CS3 A;  3F7Y C;  1JMK C;  2Q5Z A;  1M90 W;  4HNA A;  3ASO B;  1RPO A;  2RQ6 A;  3D36 A;  4FM0 A;  2Q7G A;  2QKS A;  1Y67 A;  5IJ0 B;  1K5Q A;  2GUZ B;  4DO2 A;  1NR7 A;  5EC2 C;  4NXM B;  3U11 A;  1R1B A;  4O4H A;  5H2F Z;  4DRX A;  4OX9 O;  1K3E A;  4RUF A;  1YZB A;  1FXK B;  1N32 O;  4GCZ A;  1JJ2 U;  3IC7 A;  1Q6U A;  1WPX A;  1O9G A;  3CXH F;  1QVF U;  4GT1 A;  5EYP B;  3SPH A;  3TXQ A;  1MAB G;  3FAV B;  1YJN V;  4JI6 O;  5KMG A;  2WLN A;  4AHC A;  1FPO A;  4PA3 A;  3JYC A;  2Q0A A;  1WLE A;  4X66 O;  1F7Y A;  3K59 A;  1EN6 A;  3DGE A;  1K7D A;  2N05 A;  1XNQ B;  1SES A;  3AG1 B;  1Y4M A;  2KKW A;  2WLL A;  1LNQ A;  4GX5 A;  5CB4 A;  1MOF A;  3ZRW A;  4DV5 O;  4LF5 O;  3ETG A;  3BA8 A;  1AI4 A;  4F6R A;  3ABK B;  4PD4 F;  3ZRX A;  4H13 B;  1GN4 A;  1NR1 A;  1PM9 A;  5JQG B;  4TV9 A;  4PA7 A;  1S5H C;  3L73 H;  1IBM B;  1I94 O;  4JYB A;  3VQX A;  3VQY A;  2P67 A;  3SPC A;  3F5W C;  2EIM B;  2JJ2 G;  4D7S A;  4MW8 A;  1YJ9 V;  1M5I A;  1GTO A;  4UCT A;  4O2A A;  3JAW A;  1YDX A;  3P30 A;  1AVM A;  4LFA O;  5IJ9 B;  3F5T A;  4OX9 B;  2QSA A;  3DXR A;  2E74 B;  1MMM A;  4FVM A;  4RO2 A;  1BZK A;  4FFB B;  1N32 B;  2QM7 A;  2HHH B;  3OEH G;  1U97 A;  1R6N A;  4FJC C;  1R3L C;  5IJ0 A;  1GN3 A;  1BHA A;  2GUZ A;  4NB5 A;  3E8B A;  2VRZ A;  1RP3 B;  1FS0 G;  5EIB D;  5D5P A;  3LDC A;  3CCJ V;  1WP8 A;  1FXK A;  3JCU Z;  2HKO A;  2V1D A;  3H9V A;  5CA3 A;  4EFE A;  4DV5 B;  4LF5 B;  3NR7 A;  5EYP A;  4FLX A;  3FAV A;  2PYL A;  2CUG A;  2G38 A;  3ZS8 C;  2UUA O;  1MA1 A;  3JAS B;  4UVC A;  4YJ3 B;  2YIB A;  4JPR A;  1VQM V;  3LNN A;  1K73 W;  3BHP A;  5JJE B;  2IJH A;  1I94 B;  4U7O A;  1EZJ A;  1XRE A;  4F6E A;  5C93 A;  3ASN C;  4I50 B;  4PDV A;  4O4I B;  2VWK A;  1H8H G;  1Q81 W;  1FJG O;  4LF6 B;  5JQG A;  3RYF A;  2PF4 E;  2DE0 X;  1TA8 A;  4I5S A;  2CTR A;  2L6L A;  3K04 A;  4PV1 B;  3BA9 A;  3K79 A;  3KCY A;  4HBN A;  2QTS A;  2F4V O;  1NKD A;  1NTZ H;  3PJS K;  3R66 A;  3OD4 A;  1VF5 B;  1THZ A;  2IM9 A;  3E35 A;  1K8A W;  3STZ C;  4F4L A;  1VMG A;  1KKC A;  2KG7 B;  2Y48 A;  5J2U B;  1TVK B;  5IJ9 A;  3CC4 V;  1NVP B;  4BIZ A;  1BSM A;  1K34 A;  4U3F H;  1FAF A;  1CP9 A;  2XAF A;  4FFB A;  1B6Q A;  4DR3 B;  1WPB A;  4O4J B;  3AG3 C;  4MTO A;  2PY5 A;  1NVP D;  2FKX A;  1VQ5 V;  1IUR A;  4FM2 A;  5L3E A;  5LYJ B;  4XDJ A;  2Y4T A;  3B77 A;  2M6Y A;  2RNB A;  3D8C A;  1S72 V;  4J11 A;  3JAS A;  3ASN B;  4YJ3 A;  1HNX O;  5KAF Z;  1GRJ A;  1EFR G;  4O4L B;  2FTK A;  4FLU A;  1ZL8 B;  3S3W A;  2F4V B;  4JAU A;  5J2T B;  2Q6A A;  4DV2 O;  5KHI A;  4I50 A;  4O4I A;  3B09 A;  2DWE C;  2HJD A;  4FZ1 A;  4JGS A;  1JFF B;  1SRY A;  3A0R A;  2OTJ V;  1PNK A;  1H2S B;  2XAH A;  4J9Y B;  2Y0I A;  1PNL A;  1Z5V A;  5JJJ B;  1WN7 A;  1Y66 A;  1NT2 B;  3SGI A;  1ZUQ A;  4DV6 B;  1Y74 B;  4DV0 B;  4IYI A;  3JD2 A;  4LBE C;  4YIP A;  4FMT A;  3WU2 Z;  1UFI A;  2BE3 A;  2UXN A;  3G4S V;  1AJQ A;  1HW7 A;  3RVZ A;  2IU0 A;  2KG7 A;  5J2U A;  1TVK A;  2ZDI C;  4X8A A;  1KD1 W;  3B8M A;  1GMG A;  3AG3 B;  4J7Z A;  1R73 A;  4NTW A;  2E5L B;  3ZRS A;  1YTF B;  2CK3 G;  1ZWI C;  1WJZ A;  1HR0 O;  4O4J A;  2B5U A;  1EZV H;  2GDS A;  1F23 A;  3D3I A;  2B1G A;  3CJH B;  1HNX B;  2QWQ B;  4L87 A;  4UXN A;  2IBZ H;  3BFR A;  2PTM A;  3SPG A;  3HKD B;  3LSS A;  1YTF D;  4DV2 B;  5LYJ A;  1SQF A;  3TGU H;  4U7N A;  5L3F A;  5LGN A;  1N33 O;  3JD0 A;  3CC7 V;  2QWN B;  2YI8 A;  5DED A;  1RM1 C;  1YJW V;  3FX7 A;  3T1Y O;  1V54 C;  4O4L A;  2EUL A;  4G27 B;  2QKA A;  5J2T A;  1SS3 A;  4CBC A;  1VF6 C;  3FB6 C;  4Q20 A;  2HP8 A;  4B08 A;  3APO A;  5CBH A;  2Y69 C;  1JFF A;  1OCR C;  3T1C A;  2OT5 A;  3F7V C;  3W7X A;  3QF7 A;  5BZB A;  1YIJ V;  1Y74 A;  2ZIN A;  4PI2 A;  1VQ8 V;  4HYO A;  1AJN A;  3CME V;  1HR0 B;  5LMN O;  5JVD B;  4JV5 O;  2ATK C;  1JOY A;  2ILM A;  5GTI Z;  5CA1 B;  2BSK B;  2R9A A;  1AI6 A;  4X9Q A;  1G6U A;  1EN4 A;  4LF8 O;  2Q69 A;  1WAZ A;  2BOB C;  3M8A A;  5L3G A;  2UXB O;  3LDD A;  5L3B A;  1G8M A;  1N33 B;  4YY3 O;  2X0L A;  3K9A A;  1K92 A;  4WFB V;  3CJH A;  4ZHQ B;  3E86 A;  1QLN A;  1JA8 A;  3B4S A;  4YIO A;  2OIE A;  3LSQ A;  1RM1 B;  5GON B;  3HKD A;  4JF3 A;  1P84 F;  4J9Z B;  3BPZ A;  1V54 B;  3AG4 C;  4P9O A;  1PNM A;  2WLH A;  1S76 D;  1SQG A;  3OMN B;  1K4C C;  2YI9 A;  3ABT A;  2CGN A;  2EIJ C;  4BR6 A;  4CC5 A;  4PA9 A;  4FLW A;  3CWB H;  2KSD A;  3ABM C;  2XT9 A;  4GKK O;  2UUC O;  2GTS A;  4RQF A;  1OCR B;  4QE7 A;  3BRC A;  2MK3 A;  2UUB B;  4ZI7 B;  1VQN V;  4JV5 B;  4LWS A;  2WA3 A;  1BMF G;  3G80 A;  3CCR V;  3K5L A;  5IYZ B;  2OWO A;  2WLJ A;  1PV0 A;  3ZJZ A;  5LHI A;  2ZE5 A;  5JH7 B;  3O65 A;  1K33 A;  3G6B A;  1XMQ O;  4LF8 B;  3IJ4 A;  1KB9 F;  1A32 A;  4FLV A;  2ZDI A;  1GM9 A;  1L1F A;  3QG5 A;  1J5E O;  4TQF A;  3MDS A;  5JVD A;  2AGA A;  1LUV A;  2Y4U A;  4I7Z B;  4UVB A;  4YY3 B;  1BGY H;  5DM6 V;  4JTC B;  5CA1 A;  5IWA B;  2BSK A;  4J42 A;  5KX5 B;  1DLB A;  3RYH B;  4O2B B;  1GAX A;  3ZHU A;  1BQ0 A;  4BWA A;  1VQ4 V;  1Y76 B;  3H1H H;  1DF4 A;  4MVO A;  4W4K A;  2P5O A;  2EZO A;  3CCE V;  3SR2 C;  2R9R B;  4UB8 Z;  4ZHQ A;  3H1J H;  3BAA A;  3CS5 A;  1YXB A;  2GV9 A;  5LL6 Y;  2AZ2 A;  4P30 A;  2ADQ B;  1JJO A;  2EJ7 A;  2JK5 C;  5GON A;  2ITC C;  4I55 B;  2EIJ B;  3EHB B;  3S3X A;  3LSU A;  3ZN1 A;  3ABM B;  2OIG A;  3IGA C;  2JGD B;  4PDR A;  1VF6 A;  3APQ A;  3ZMS A;  5K1X A;  1QHT A;  1XMQ B;  1IBM O;  1GM7 A;  4DV3 O;  5DEC A;  4EKW A;  1J5E B;  1NI8 A;  1K5S A;  4ZI7 A;  2D2C B;  1G1X B;  5EBW C;  4N23 A;  5IYZ A;  4EB6 B;  1IZ3 A;  3HKC B;  1XQ8 A;  2IU3 A;  4R50 A;  4W4L A;  5JH7 A;  1MZE A;  2B1I A;  1KC8 W;  1MZF A;  1OZ0 A;  1WA8 B;  2YUA A;  3HKB B;  2DOS A;  1JR9 A;  3CCL V;  2HHH O;  4LF9 O;  5KAI Z;  1SQV H;  3ZIA G;  2UXC B;  3UKM A;  1JCH A;  1J95 A;  2V7Q G;  4LP8 A;  5KX5 A;  4R8C A;  2LFS A;  2JRI A;  3RYH A;  4O2B A;  4KHP O;  1Y76 A;  2VS0 A;  5HFL A;  1H8E G;  2IH1 C;  4WCE V;  2X6A A;  1BS3 A;  4NKG B;  3KG2 A;  2ZE6 A;  3N2G B;  2WA4 A;  2OCH A;  2YIB D;  1YSC A;  3VBB A;  4RAI A;  3R65 A;  3AG7 A;  1GO3 F;  4JYY A;  4LCU C;  4NR1 A;  1JVM A;  2QWR B;  4DV3 B;  1XOU A;  2DQ0 A;  3B40 A;  5ITZ B;  4I55 A;  3RYC B;  2Q7E A;  4BAY A;  3UO3 A;  4KL1 A;  3E83 A;  3N27 A;  4LF6 O;  2JGD A;  4X89 A;  1GKF A;  2W6J G;  3CB2 A;  5IYC O;  2QTO A;  3JAT B;  1Z5W A;  4X64 B;  3OMI B;  1ROP A;  4AI8 A;  2K1E A;  1KYO F;  4LF9 B;  2DMX A;  3EVK A;  3H1K H;  1S5J A;  3SYA A;  2ZCE A;  4N21 A;  1LUW A;  2JEU A;  1SQP H;  4WFE A;  4EB6 A;  3HKC A;  4G28 B;  1JPX A;  1FYJ A;  1XDC A;  4KHP B;  2V4D A;  3PN1 A;  1VQO V;  1WA8 A;  4DR3 O;  4BIU A;  1H2K A;  1Q86 W;  2GBO A;  2UXX A;  3HKB A;  4JI4 O;  4FLZ A;  4JAS A;  2ETN A;  1D5A A;  2X6B A;  1H38 A;  4JYC A;  3CC2 V;  2R72 A;  3ZX6 A;  2XND G;  2FYU H;  4X88 A;  3JD1 A;  1M56 C;  1PL0 A;  2Q7H A;  4OPA A;  2ZM6 O;  4IT5 A;  3OR6 C;  2PYJ A;  1XIL A;  4H0L B;  3CCU V;  1OCO C;  3N2G A;  2XAG A;  3OGI B;  1YHQ V;  2CH7 B;  5F2V O;  1VIB A;  3WFV A;  2Y0P A;  1IDS A;  2XAQ A;  4DR1 B;  2PZS A;  4P2Z A;  3B8N A;  4K8X A;  1OHH G;  1FFX B;  3K57 A;  2JDI G;  3RYC A;  3RVY A;  4DV4 B;  1IXM A;  4R6Z A;  1MG1 A;  4MVR A;  4J7K A;  4RQE A;  2BCC H;  1H2N A;  4Z2W A;  3JAT A;  2YID A;  1B06 A;  2ZXW C;  1V9P A;  2UXD B;  3U0Z A;  5DN6 G;  4X1I B;  1VQP V;  5KUK A;  2Z5U A;  3IFX A;  4OGQ B;  4DV0 O;  4DV6 O;  4JI4 B;  3OTF A;  5LOV B;  2QM8 A;  2CE4 A;  2LQT A;  1Q43 A;  2LGW A;  3MD0 A;  1Q5O A;  1NU1 H;  4UV8 A;  4WFA V;  4Z1M G;  4JI3 O;  4CH6 A;  4JI8 O;  1XI1 A;  3STL C;  2ZM6 B;  4G2K A;  4DK0 A;  2WWW A;  3K08 A;  3OMA B;  4AIL C;  1W0K G;  2E5L O;  2FML A;  3HKE B;  1I7F A;  4J80 A;  2YXY A;  1M56 B;  3A0B Z;  1D5N A;  2ZKO A;  2OTL V;  3AK2 A;  3W7S A;  1OCO B;  1M9N A;  5B1O A;  4UCS A;  1D2D A;  3JAL B;  2EJR A;  2KB1 A;  5KA5 A;  4JTD B;  5GTH Z;  1R3J C;  4MVQ A;  1HNW O;  2VQE B;  5KHJ A;  3E8F A;  2CH7 A;  5EZY B;  1VQ9 V;  1YI2 V;  2A9H A;  3CRC A;  4K0K O;  4FIP C;  3J81 N;  4QGP A;  3CEI A;  1H2G A;  4ZBM A;  4H37 A;  1FFX A;  2M7W A;  3EFF K;  3OEE G;  1HWY A;  2QWP B;  4DXW A;  2ZXW B;  4IIJ B;  2FL4 A;  1QBZ A;  2NNU A;  3K5M A;  5B3S C;  4OXS A;  4JI3 B;  4R7C A;  1AP5 A;  4JI8 B;  4BW9 A;  4PHZ A;  1MSD A;  4LF7 O;  1VQ7 V;  4X1I A;  3CCM V;  1T5E A;  1NTK H;  3K0D A;  2R70 A;  3G67 A;  3FYI B;  5LOV A;  1Y6X A;  3WG7 C;  2E75 B;  2Q68 A;  2AHZ A;  1NS1 A;  3W7T A;  2CTQ A;  1R6K A;  4UUJ C;  1SZX A;  3GWO A;  4D7T A;  4GX1 A;  1SKV A;  1YIT V;  2IJI A;  1P4R A;  2F95 B;  2EZP A;  2ODM A;  3K06 A;  1QR9 A;  3LDE A;  1HNW B;  4YJ2 B;  1F51 A;  4JI2 B;  4ASU G;  4FK5 C;  2ZR3 A;  2AW9 A;  1UPG A;  1V55 B;  4K0K B;  3ETQ A;  2EBO A;  3L75 H;  3WB2 A;  4UCO A;  3K5O A;  2Q67 A;  1AR1 B;  4FZ0 A;  3JAL A;  2LW7 A;  2X6C A;  1ZL8 A;  2ADP A;  2ZIO A;  3WB1 A;  3L72 H;  1W2B U;  2N04 A;  3RYI B;  4AQY O;  3ZMZ A;  1N34 O;  2R9I A;  3CP1 A;  5IDJ A;  1KQS U;  3UQ8 A;  2NR5 A;  4DR2 B;  3M7M X;  5EZY A;  5KUM A;  1U96 A;  1COW G;  1S77 D;  2Q4P A;  1WNS A;  2WLI B;  3ZHS A;  3FYE B;  2Z0A A;  4UFZ A;  4Z1V A;  4LF7 B;  5GW7 A;  3TXS A;  4PA4 A;  5KHG A;  4MVS A;  5LA6 B;  1K4D C;  3E8H A;  4XBF A;  5B3S B;  3FB7 C;  1BQZ A;  1TUE B;  2QKC A;  2NN4 A;  2UUB O;  4IIJ A;  1EN5 A;  2ARH A;  1RPR A;  2YEV B;  3T1H B;  1SQX H;  4JYA B;  3JCZ A;  2PGG A;  4LC1 A;  2W6I G;  3P3N A;  3QO7 A;  4XDL A;  1VEW A;  3WG7 B;  4CZZ A;  1QNM A;  5BXZ A;  4E4E A;  3FFQ A;  1KP2 A;  2N74 A;  1ORQ C;  3SJB C;  3K58 A;  5E1A C;  3P32 A;  2B9Z A;  1AR4 A;  3G6E V;  4B7E A;  1KBH A;  3ZED A;  5A2Q N;  1CEZ A;  3L70 H;  5LGT A;  4FM1 A;  3TET A;  2E3C A;  1FKA O;  1YVW A;  5B1B C;  5IY5 C;  5AG2 A;  5IWA O;  1VQK V;  3CMA V;  4P9P A;  2VQF B;  2EX3 A;  4ZOL B;  3MHH C;  1XL4 A;  4GX0 A;  4AQY B;  3HPL C;  4YJ2 A;  1H2L A;  1N34 B;  2WPD G;  4J7J A;  3AG2 C;  2WLK A;  1QLE C;  1OJH A;  2RJZ A;  5H5N A;  1BHB A;  4I9Q A;  2DW4 A;  4MSW C;  4B3S B;  2QJ1 A;  3BVO A;  3BCC H;  1RSO B;  3CRA A;  5FL7 G;  4WBN B;  4JZ2 A;  5LHG A;  3RYI A;  4DUY O;  3L74 H;  4DR5 B;  3OM3 B;  5K1P A;  1URF A;  1CXZ B;  4H33 A;  1S3J A;  1NZ6 A;  1KP3 A;  1XL6 A;  1OCZ C;  3SJQ C;  4LR3 A;  5L3D A;  3OGC C;  2HR3 A;  4GKJ B;  4UVA A;  3AK3 A;  4A5U B;  1XNR O;  3CRR A;  3CCS V;  3JAR B;  1W0J G;  2YEV A;  1M4U A;  4CC6 A;  3OTO B;  1DF5 A;  3RN4 A;  4PJ0 Z;  1EBO A;  1Q8I A;  5BR8 B;  4TQD A;  3QO8 A;  2C2A A;  3O9O A;  5B1B B;  5IY5 B;  5J9P C;  2H8P C;  1ARO P;  3N2K B;  2DYR C;  2F66 C;  3X2Q C;  2XOK G;  3OW2 U;  4LFB B;  2JGU A;  1F4N A;  5CN0 A;  2F93 B;  2UXC O;  2EIL B;  4PDL A;  2YIA A;  5JJN B;  2JEX A;  3ZN0 A;  4QIW F;  4JI7 B;  4J41 A;  2AZ0 A;  1SQQ H;  3RWR D;  5E79 Z;  3AG2 B;  4ZOL A;  2RDC A;  1QLE B;  3RT3 C;  4DR4 B;  1R3I C;  4DUY B;  2OCC B;  5IYB O;  2DQ3 A;  3NXS A;  4IL6 Z;  2XUM A;  4C7U A;  4UV9 A;  3TK1 A;  4NTY A;  2JVD A;  2IH3 C;  2BTQ B;  4QE9 A;  3ML0 A;  3KKY A;  3K0G A;  2P90 A;  1IXB A;  1AB3 A;  1SC5 B;  1RSO A;  4WBN A;  3OUS A;  1JQ0 A;  1XNR B;  4WFF A;  1HDJ A;  1OCZ B;  4FFK A;  3SYP A;  1MNG A;  1S0V A;  4MVM A;  5JCO C;  1DK1 A;  1SET A;  3K9S A;  3VQV A;  4X64 O;  3CCV V;  1GK9 A;  4HZ3 A;  5H9C A;  3C3T A;  5CBF A;  4KUM A;  3DTU B;  5EIB C;  5A9G A;  3E22 B;  3J7A U;  1AJP A;  3JAR A;  2XHB A;  1LR1 A;  5KLV H;  4WFH A;  1KKD A;  3IAY A;  2DYR B;  3ABL C;  2EIK C;  3X2Q B;  5JWP A;  2HG5 C;  3U10 A;  1QCE A;  2GHY A;  3UM7 A;  1RFY A;  3N2K A;  4MS2 A;  2Z3Y A;  2P4V A;  2LP7 A;  2L35 A;  5EK0 A;  1SZT A;  3ABU A;  2VWJ A;  1L8D A;  2DN9 A;  2XAS A;  4DV7 O;  3SYC A;  3ZHQ A;  5HFM A;  4YXW G;  2QA4 V;  4BIO A;  1DTO A;  5IT9 N;  1EM1 A;  1AI5 A;  1GN2 A;  4GYC B;  4LH6 A;  2DJV A;  4JI0 B;  2P4K A;  2Q9L A;  3GB7 C;  1K97 A;  1E79 G;  3TCU A;  3OAA G;  3RYF B;  4DR7 O;  2CTW A;  4GUN A;  5KHK A;  4TT3 G;  5H6Q A;  2BTQ A;  4DR1 O;  4HAM A;  4TWK A;  2KQX A;  4PDM A;  1NH2 B;  5IYD O;  4NTX A;  1N36 O;  3K03 A;  2FB5 A;  4TUY B;  3OR7 C;  2JIZ G;  3ETD A;  1XEQ A;  1WP7 A;  4GZR B;  2QE7 G;  4DV4 O;  1XHZ A;  3RGB A;  3QO5 A;  1IBL O;  2LGQ A;  4MT8 A;  4RWU A;  1AP6 A;  1M57 C;  2UXD O;  4PA6 A;  1NH2 D;  4KP4 A;  1I5X A;  5BMV B;  4JI6 B;  3ABL B;  2EIK B;  3CD6 V;  4K3A A;  5H6R A;  3E22 A;  2ZE8 A;  1PL4 A;  1I0H A;  4LFC O;  4B3R O;  3C3S A;  4Q6G A;  4X66 B;  2ZIM A;  3M99 B;  2Q0O C;  3ZMT A;  4DV7 B;  1PKX A;  2HJF C;  3JD3 A;  4NYK A;  1S5L Z;  1TGO A;  1HNZ O;  2WAM A;  4UCU A;  1SA0 B;  4EEQ A;  3E89 A;  5LMU O;  1M93 A;  3BAB A;  2MW2 B; 
#chains in the Genus database with same CATH homology
 5KAI Z;  5KAF Z;  3A0H Z;  4IL6 Z;  5TIS Z;  2AXT Z;  5H2F Z;  4UB8 Z;  3JCU Z;  3WU2 Z;  1S5L Z;  5GTH Z;  5GTI Z;  4PJ0 Z;  4UB6 Z;  5E79 Z;  3KZI Z;  3A0B Z;  5B66 Z;  5B5E Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...