1S5LZ

Architecture of the photosynthetic oxygen evolving center
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
58
structure length
58
Chain Sequence
MTILFQLALAALVILSFVMVIGVPVAYASPQDWDRSKQLIFLGSGLWIALVLVVGVLN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 20
structure length 58
sequence length 58
chains with identical sequence z
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Z PF01737 Ycf9 YCF9
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.740 Mainly Alpha Orthogonal Bundle Helix Hairpins Photosystem II PsbZ, reaction centre 1s5lZ00
1S5LZ 2AXTZ 3KZIZ 5E79Z 5H2FZ 5TISZ 5B66Z 4UB6Z 5KAFZ 4PJ0Z 4UB8Z 3A0BZ 4IL6Z 5KAIZ 3A0HZ 3JCUZ 5GTIZ 3WU2Z 5B5EZ 5GTHZ
chains in the Genus database with same CATH superfamily
3K08A 3W7SA 3SYQA 4B3RO 2CTPA 5KMGA 1IBKB 2JVDA 1AJQA 1AJNA 1Z5WA 5IYCO 1N34B 1W59A 1JJOA 1R3LC 1EN4A 1EFRG 4E4EA 1RM1B 4J11A 2CTRA 3H1KH 1PPJH 1F4MA 3K5LA 3JD0A 3L73H 4W4KA 1EZVH 4UCOA 4PA6A 1WAZA 3JAKA 4GZRB 5EIBC 3OW2U 4B3TO 1VF6A 2ZE6A 3SJAC 2DWDC 3CB2A 3CJHB 2WLKA 4KHPB 2DQ3A 3K06A 3SJCC 2XT9A 2RNBA 4JI0O 1AB3A 2AZ0A 3MHSC 3GB7C 4UCVA 4JI3B 1OCRB 5JVDA 1SA0A 2KB1A 3OUFA 1VQNV 3K5NA 2OTLV 1KUQA 2DQ0A 3F7YC 4MTFA 2EIKB 3SYAA 4FLVA 2DW4A 4ZKIA 5JH7B 4DV3B 4LP8A 2Y69C 2A7WA 3N2GB 2ITCC 2ZKOA 1AI7A 3RYIB 2YSUB 3I5DA 3W7TA 1OCZB 4Z2WA 3M8AA 3HKCB 3E22B 2UXBB 2YUAA 3RYCB 4CC5A 5B1BB 3JSNA 5IJ9B 2GHYA 2ILMA 4JI7B 3K9SA 3JD2A 1F7YA 2LW7A 1A32A 3N2KA 3ZHTA 1XL6A 1NJIW 1BHAA 2YIBA 4F6RB 5J2TA 3P3PA 2JIZG 5J9PC 1JVMA 4JI6B 5BXZA 4H0LB 1KQSU 5JJEB 4X20A 3CWBH 4PI2A 3HKCA 3D3IA 1QNMA 2PI5A 4TT3G 1IBKO 2UXDO 5DEDA 4DXWA 2Q0OC 2R72A 3CS5A 2WA3A 2FMLA 4MVUA 1HNWB 1OCOB 2OTJV 1SETA 4X1YA 5LGNA 3X2QC 2UUBB 1JJ2U 3WU2Z 4K8ZA 2YIDA 4J7KA 3ABLC 3F5WC 3TCUA 4RQEA 1EN6A 1SRYA 1ZX3A 4PV1B 3SPCA 1H8EG 5E79Z 1VP7A 4O4HB 4CH6A 2BSKB 3ABLB 3HR0A 4DV0B 1K97A 1R73A 3K5OA 4H13B 5H9CA 3ABTA 2XTAA 2EULA 3O9OA 4JI6O 2V4DA 1S5JA 4DV5O 5FLXN 4NXMB 5EIBD 2OWOA 1SF9A 2CAZC 4QJFB 2LO1A 1KP2A 1BGYH 2UXDB 5KHJA 4LH6A 5KUKA 1Y6XA 1Q8IA 4O2AA 1X59A 1AI5A 5IT9N 4O2BB 5L3BA 3ZJZA 1BSMA 3JAWB 3B8NA 3K5MA 2Q9LA 4OPHA 1KYOF 4NKGB 2EIMC 4N21A 1FXVA 5K1XA 2BTOA 3CCSV 2WAMA 4JI4B 2B1IA 4DR3O 2M6YA 5BR8B 4UUJC 4XDKA 1RFYA 1ZL8A 4PHZA 2QKSA 2WSSG 3H1JH 4J7JA 3K59A 2GUZA 4LF4O 2QJ1A 2DE0X 1V55C 4DO2A 3W7XA 4TWKA 1AI6A 1N8RW 1D5AA 5LHHA 3ZS8C 1JMKC 1QR9A 3JD1A 1K8AW 4NB5A 1DTOA 2WLMA 1R1BA 2ZIMA 2ZQMA 1VF6C 3G67A 1M56B 3C90A 3ZRVA 3EVKA 4DK0A 2AZ2A 4B3SB 1GO3F 3OT7A 1Y66A 1VARA 1E1RG 2DWEC 3CCQV 4UVCA 3E83A 1EN5A 4J41A 3VQYA 2DN9A 3RYFB 4P9PA 2Z0AA 5LHIA 4KFMA 2JK5C 3HKDA 1VIBA 1JX9A 3IJ4A 4KHPO 1IZ3A 4YIOA 4HBNA 4LF8O 2F43G 3F7VC 4OXSA 1TVKB 2QDOA 2GBOA 1DK1A 3SDLA 3OEHG 1XL4A 3SYCA 2M7WA 1MSWD 5CA1B 4XDJA 2AHZA 1MZEA 2BOBC 4W4LA 5GTIZ 4JGSA 4KL1A 3CRCA 2LGQA 1BMFG 4NXNB 1URFA 1SQQH 1P84F 3CMAV 4BIZA 4J42A 5JVDB 4FJCC 4R6ZA 4KUMA 4LFBB 2W0XA 2ODMA 1XMOO 4JF3A 1GM9A 1DLBA 2GV9A 3RVZA 4DV1O 2GSMB 1PP9H 1Q90D 1ZUQA 4CS2A 3J81N 3THOA 1XOUA 1NT2B 3HKDB 4O4JA 2L6LA 5CA0A 5JCOA 4RAIA 4MW3A 5LBQA 1XI1A 3R66A 3DGEA 4ZI7B 4X64B 4B7EA 4LNUB 1RPRA 3WB0A 1EZJA 3EXAA 2VQFO 1M4UA 4ICGA 3OTFA 4P30A 2EZOA 4LBEC 3ETGA 4B3SO 3ZMZA 1OCCB 2R9RB 4I9QA 4BAYA 4X62O 2Q7GA 3TGUH 2D2CB 1PKXA 4B3RB 3FB7C 2F95B 1AJPA 3RWRD 4YHHB 2CH7B 4JAVA 3AK3A 4G28B 3JALA 2HLDG 1NI8A 3L74H 5GONB 4DR4O 5F2VO 4GCZA 2VRZA 3TXSA 1Y74B 4UCSA 2F1MA 1HNXO 2X6BA 5IY5C 1OZ0A 4QPKA 4FLXA 1M56C 4LF7B 3CRRA 1NVPD 5KLVH 1AR1B 1K73W 4K8XA 2DOSA 1NH2B 2EZPA 3OGIB 3H1HH 2EBOA 1U97A 4IHJA 4X64O 3ZMTA 4PD4F 5IE9A 2E5LB 3BEHA 1YI2V 3E8BA 4DR3B 3OE7G 3ZMSA 3CC7V 3TK1A 1E1QG 4MVOA 5LMNO 1FXKA 1GTOA 1Q81W 2BTQA 2YIBD 2VWKA 5KAIZ 4DV1B 2DYRB 3AEIA 5KA6A 3X2QB 1KB9F 2IJIA 2FB5A 3G6BA 1ENVA 4JPRA 1M5IA 1XQ8A 1IX9A 3I56V 2PYJA 2QTOA 1PL4A 3D36A 3E22A 2LQTA 4UB6Z 2IJJA 3ETQA 3NXSA 1PNMA 1AROP 3ZIAG 1V54B 5FPOA 3G80A 1WNSA 2A06H 5J2TB 5FL7G 4AQYO 2OIEA 4LH7A 3IC9A 3ZRWB 2IJHA 4R8CA 1Q7YW 3Q4HB 2VS0A 1QHTA 4UXNA 1BS3A 3ZX6A 5K1PA 3CEIA 2B5UA 3ZCCA 2ITDC 2QM4A 4WFFA 2UUCB 5C8YA 3E8GA 3SPGA 4EB6B 2QKCA 4BWAA 2E3CA 1G8MA 4WF9V 4GT1A 1HW7A 2IU0A 4FM1A 3CP1A 4JTDB 1LUVA 1LUWA 3ASOB 1SS3A 3ZMVA 5DN6G 4JI3O 2ZR3A 2ZCEA 1QCEA 1VF5B 5IJ9A 2G38A 5B1NA 4YXWG 4JTAB 4DRXB 3SYPA 2LFSA 3JAMN 3KCYA 4RWUA 1P7BA 3K79A 5H2FZ 2N74A 4GLXA 4DV2O 2OCCB 2XAHA 2JJ1G 2HHHO 1MZFA 4DUYO 3UO2A 3ZMUA 1BHBA 1AR4A 1PV0A 2OCCC 4L87A 3CYOA 1XHXA 2CK3G 3JAWA 1NQTA 3E8HA 3TJTA 1S0VA 3RYFA 1H2NA 1QU7A 4MSWC 1B3QA 4ZHQA 4MW8A 1VQ7V 5IYDO 5ITZB 2QR4A 4DV4O 4I0XB 1Y4MA 1VQ5V 1K33A 4FMTA 4LNUA 3WG7C 4PELA 1US6A 2B1GA 1Q82W 4KP4A 2Y0PA 2ZE8A 4LR3A 4LWSB 1BQZA 1COWG 2K1EA 1OJHA 3IAYA 1I94O 3HKBA 2P22C 2IJKA 5BR8O 1XMOB 4X89A 5L3GA 4NR1A 1YJNV 4DV6B 1V9PA 3ZHRA 4QNHB 5B1BC 1IXMA 2P5OA 1D5NA 4J7ZA 1UJWB 4JV5B 2A79B 4PDLA 4DUYB 1SA0B 5B1AC 5B1OA 3JALB 4WFEA 4B3MO 5LP6C 1GN3A 1I5YA 3ZRXA 1ZTEA 2P4VA 2WLIB 4C7UA 2FKXA 2QWPB 1T5EA 3LSUA 4JI4O 5LL6Y 2ZR2A 5IWAO 5DECA 2QKAA 3K57A 1WB7A 4PA4A 2P90A 3ABUA 2IH3C 5IJ0B 3KG2A 3OD4A 4OX9B 2FL4A 3JYCA 1RSOA 3B8MA 1DGSA 4LF5B 5EBWC 3TETA 3VQXA 1H2GA 4I5SA 2Q5ZA 4CZZA 4DR5B 5EK0A 4J9YB 5KMGB 2CH7A 1RP3B 3LDDA 4DR6O 3FKSG 3B4SA 2F93B 4D6TH 3T1HO 4O4IB 1IDSA 4O4LB 1YJWV 2OCHA 4K35A 3CC2V 1HR0O 4YIPA 1K4DC 4FLYA 2AXTZ 2EINC 2ZE5A 4FFKA 2JGDA 5IY5B 4LF4B 4JI0B 1P4RA 2YIAA 3K03A 1N33O 3LNMB 1BT8A 1GMGA 4CH3A 3T1YB 5LXTA 4BIOA 2W6JG 4I50B 4JZGA 4ZI7A 4FZ1A 3HB3B 4BW9A 1UPGA 2QA4V 2EIMB 3QF7A 3OUSA 5CA0B 3OGCC 3HKBB 4OX9O 4LFCB 3ABKB 3KKYA 5GONA 1OCZC 4NXMO 4FFBA 4LFCO 2H94A 3MDSA 4FLUA 4JYYA 2R9IA 4BIUA 1NR7A 1G1XB 1KP3A 4LF9O 4PJ0Z 3FAVA 3SJQC 4O2BA 5GTHZ 2Q7HA 2YXLA 4FZ0A 2Q0AA 4DR7O 2P7TC 2KSDA 2RQ6A 2LJ2A 4QE7A 1N0JA 1I5XA 1M57B 5E1AC 2GUZB 4MVSA 3STZC 1AI4A 1NVPB 1J95A 4FVMA 1N4CA 1FXKC 1N33B 4FK5C 3CRQA 2VWJA 2VQEO 4JTCB 2UUAO 4WBNB 3IC7A 4EFBA 4RO2A 4JZ2A 2NR5A 4X1KB 2UXCO 4GKJB 2ZE7A 3EFFK 4GKKB 4X88A 1WPXA 1G6UA 4QE9A 1QLNA 2JEUA 2LFRA 1R3KC 2EIJC 1Y76A 2ZIOA 4JI8B 2ZXWC 4DR4B 3JD3A 1R3IC 2RN9A 2CE4A 1AP5A 2OT5A 2P4KA 4IHJB 4UCUA 1PL0A 3P30A 1HWYA 2YXHA 4NVPA 1FKAO 2AW9A 5H6QA 3S3WA 1L0LH 4UV8A 5CB4A 1FFTB 2BTQB 3L75H 4ZOLA 5LYJB 3WG7B 4ZIBA 2A0LA 1XBLA 1Y74A 3BABA 4X66B 3QVNA 4I55A 4I4TA 1UFIA 3AG4C 2Y4UA 4X9QA 2YC0A 1ZLZA 1BQ0A 5LMNB 2FYUH 2QM8A 5EZYB 2W6IG 1S76D 1NH2D 2ZINA 1XNRO 4I55B 1OCOC 1YEWA 1TUEB 1YIJV 1KD1W 3OR7C 3TXQA 1N36B 2XOKG 5B3SC 1JR9A 1XNRB 4LF7O 3HKEB 2LGWA 4JI1O 1JQ0A 1JOYA 2QWOB 3FYEB 3T4DA 2PYLA 3ABMB 5EYPA 3OFNG 4PA3A 5EC1C 4YJ3A 2VQEB 1FXHA 1Q6UA 4FIPC 3BCCH 5KX5B 2ZM6O 1R6TA 3O65A 2A3QA 2P6JA 4HYOA 2HP8A 2JS3A 2Y0IA 4IIJB 3UT5A 4DRXA 3STLC 1TUBB 3RBZA 3HPLC 4FM0A 2GDSA 1QLEC 2Q69A 1J5EO 4FLTA 1B04A 3AG3B 2OYQA 5KX5A 4X1KA 4NTXA 5KA5A 3Q4HA 2XAJA 4F4LA 1XNQO 1WP8A 1HR0B 4DW0A 1K3EA 5L3EA 3RYCA 2R9AA 3NR7A 4R50A 5B1AB 2EINB 4FLZA 3SJBC 4X8AA 4IIJA 3UT5B 1RSOB 2JEXA 5D5PA 2RCVA 5CBHA 2KQXA 3CRAA 4O2AB 4YJ3B 1S77D 3T1YO 4U7NA 3ZN1A 1QQCA 4WCEV 3U10A 1THZA 3KCXA 1PD3A 3CCEV 1AILA 3CE2A 1S72V 2X6CA 2WLJA 1Y76B 3M99B 1O9HA 2WLHA 3SPHA 1ROPA 3QO5A 4TOIA 1Q43A 2KG7A 4GX2A 3CHXA 4FPPA 3JD4A 5KHIA 4GX5A 3U0ZA 2PY5A 4Z1MG 1JPXA 2WA4A 4MVQA 4U3JB 3HKEA 1NS1A 1HDJA 2BE3A 3T2MA 1CXZB 4AILC 1GN2A 1PNKA 2HEPA 3J80N 4K3AA 3AG1C 4QIWF 1HNZO 2CUGA 2JS5A 1Z2GA 1EM1A 4JASA 1OCRC 4KXRA 4MTXA 4ABMA 3P3NA 3UKMA 3WFVA 4EFEA 2VQFB 4GX0A 1IBMO 3WB2A 3CCMV 2EIKC 5L3DA 2QGNA 2CTWA 2GTAA 4B08A 1QVGU 3BHPA 4DK1A 2XAGA 3QG5A 4RUFA 5EBMC 2YXYA 1HNXB 4TV9A 3BVOA 1VQ4V 2EILC 2ZXWB 1OV9A 1GRJA 1IBLO 2ETNA 4HZ3A 4UV9A 2F66C 3L71H 3GWOA 3ASOC 1IBLB 4LFBO 1O9GA 3E89A 3RYHA 1I7FA 4HNAA 4DR6B 3GWKC 1Y67A 4DV0O 2UXXA 2CTQA 5IWAB 1K34A 4D7SA 1QLEB 1IURA 4IL6Z 3U11A 1ZSPA 3W7WA 1JCHA 3RFRA 5CA1A 1FD9A 4L8JA 2D3OW 3A0HZ 1MNGA 1GN4A 1XNQB 1RPOA 4WFBV 2WLLA 4AI8A 1YTFD 2Q73A 1I0HA 4CH4A 2F4VB 2CGOA 5KHHA 5HFMA 3RYIA 4DV5B 4EKWA 5FNVA 4BR6A 1XMQB 4X1YB 4O4JB 3GVMA 2YI9A 4GX1A 5H6RA 1OCCC 1D2DA 1GH6A 4B3MB 3VOUA 1MG1A 1EBOA 3ZHVA 3ETEA 5LP6A 3CCJV 5GW7A 4O4HA 2RJZA 1V54C 4ZHQB 4DR1B 3L9DA 2PUSA 4YJ2A 3AK2A 2AGAA 3H1IH 1GM7A 1DF5A 4O4LA 2Z3YA 5IYZA 5LA6A 2OIGA 4JI7O 3N2KB 4JYAO 4DR2B 3H01A 3LUTB 3BA9A 2QEXV 1QR8A 2JGDB 1YCIA 1G4YB 4LFAO 4X65O 2V1DA 2YICA 4B7KA 3BPZA 3BY6A 1VQPV 4BW5A 1M57C 4X20B 3CCVV 4JYBA 2PF4E 1GAXA 1IVSA 2YEVB 1MA1A 4CS3A 3B2EE 4GUNA 4F6RA 1XHZA 4G27B 4DR7B 3FFQA 5J2UB 3W7UA 1VQOV 5B66Z 1JA8A 2NLJC 2WLIA 3G6EV 4U7OA 1YDXA 3OEEG 3MD0A 2A9HA 4J9ZB 2K9PA 1F51A 3CSXA 1NR1A 4DUZB 4YJ2B 1M93A 3OMNB 2N04A 1CP9A 3ABMC 3RGBA 1M1KW 3OR6C 2C2AA 4PDVA 4Q20A 4TQFA 5IJ0A 4PI0A 3N2GA 1VQMV 4WBNA 2QWNB 1FFXB 1YVWA 3AG2B 3D36C 4JI2O 1W2BU 2P06A 4R7CA 2HJFC 1K92A 3CXCU 2ZDIA 4MTGA 2XAFA 2R70A 2MW2B 1KC8W 5IYZB 3A0RA 4JI1B 3JASA 1N0NA 3RT3C 4Q6GA 3S3XA 1YSCA 1BE3H 3ASNC 5JCOC 2PGGA 2WLLB 2GTSA 3ML0A 5HFLA 3H1LH 3JAKB 3AG4B 1SQBH 3FX7A 3ZHUA 2YS8A 3ZEDA 2MK3A 3CMEV 2ZD9A 2WLNA 1VQ9V 2HJDA 1AVMA 2B9ZA 3OAAG 4UCRA 1H38A 4MT8A 4LF9B 3DC5A 2XASA 3OTOO 2Q8VA 5JQGB 2ZM6B 5LMUO 5B3SB 2YDEA 3WB1A 1N34O 1MSDA 3K04A 1H2MA 5JJJB 2HFEC 3L70H 4MTOA 1DF4A 2DMXA 4RUEA 3EHBB 3P32A 3UO3A 3OTOB 2E74B 2UUAB 4UB8Z 1K4CC 4FFBB 4EEQA 1LR1A 4UVAA 1K9MW 1QBZA 2E75B 2HKOA 2BCCH 3CRMA 4JI5O 4JYAB 4AHCA 1FS0G 2HVKC 4TQDA 3ZRWA 1NU1H 2IW5A 3A0BZ 4OGQB 3LDCA 1KBHA 4ZBMA 4N23A 1MOFA 4UCTA 5KUMA 4IYHA 1PM9A 2O57A 2WWWA 4U3JA 4Z1VA 1MABG 4LFAB 2IM9A 3C3TA 4GKKO 5LXTB 3I55V 1SZXA 3A2FA 1L1FA 4NYKA 2PTMA 3BA8A 1YITV 2CGNA 5CA3A 2UUCO 3R65A 3LSQA 5C8YB 4LF6O 4YY3O 4TV8A 3D8CA 2PZSA 1YTFB 2EIJB 3IFXA 2P67A 1H2KA 1B6QA 1VQLV 3JARA 3C3SA 1SERA 4AQYB 3JCUZ 1SQXH 5L3FA 5BZBA 4ZOLB 1WLEA 5KAFZ 1HP8A 3ZBHA 3ZRSA 1BZKA 3AK1A 1VQ6V 1PNLA 2QM7A 4H33A 3SPJA 3K58A 2FTKA 4QPJA 4TV9B 4RQFA 3APOA 2ADQB 1NBMG 2JDIG 3LDEA 3MHHC 5EC2C 3JCZA 3MAQA 4U3FH 5EBLC 2EX3A 3G71V 1Q6HA 3PJSK 1KKDA 1ZL8B 4WFAV 1I94B 4TSFG 1H2SB 1FXKB 4CC6A 3K3WA 5JJNB 3E35A 4QGPA 4TUYB 4LF6B 1R6KA 1LNQA 1HNZB 1AR5A 5ITZA 3DXRA 1XEQA 4NTWA 2ZNJA 3RVYA 2EJ7A 5LOVB 1YHQV 3RYHB 4TUYA 1W0JG 3JATA 4I7ZB 5LGUA 2UUBO 1TGOA 1XILA 3KZIZ 3ETDA 1JFFA 4LCUC 4J10A 2KG7B 3T1HB 5LMUB 1Q5OA 2Y48A 5BMVB 4NTYA 2UU9O 2ATKC 2UXCB 4NXNO 3CCRV 4DV2B 1AP6A 2JJ2G 2X6AA 4OPAA 2DYSC 2AHYA 2XHBA 2UXBO 3AG7A 4CBCA 3UCSC 4TV8B 1CEZA 4XBFA 1SQFA 1VF7A 1SQPH 5LP6B 3F5TA 4MVRA 1VQ8V 2PI4A 4JI8O 3JARB 1WN7A 3N27A 3B77A 4ASUG 4FLWA 5C93A 1S5HC 3QO7A 4CH5A 1BCCH 4YY3B 1F4NA 1R6NA 2ZNIA 1CPYA 1P49A 4I50A 1WPBA 5JWPA 3B40A 1V55B 5LYJA 1NTMH 4DV7B 3FYIB 4X65B 4DV6O 1KKCA 1S3JA 4DV7O 1K5QA 4IT5A 5JH7A 1VQKV 2WPDG 3T4ZA 5EZYA 2ADPA 2E76B 4O4IA 4HNAB 3DXRB 3ASNB 2DYSB 2NNUA 2RMKB 1Q6IA 1Q3EA 5BMVA 1XDCA 5FNVB 4P9OA 4EB6A 2UXNA 5LHGA 2HVJC 3JSLA 4K0KO 3CX5F 1K5SA 1HNWO 3H9VA 5CN0A 3FB6C 3DC6A 4MVZA 3CD6V 3B09A 5TISZ 4LF5O 2HG5C 4CS4A 3K0GA 3BFRA 1YZBA 1R3JC 4K0KB 1E79G 1NTKH 4G2KA 4J80A 3DTUB 2ARHA 4D7TA 1K7DA 1NZ6A 4X62B 3LNNA 1IXBA 4JI2B 4E2LA 3SGIA 4I0XA 3VQVA 2ZDIC 4PDMA 1WP7A 3QTCA 1W0KG 4JYCA 4GYCB 3CCLV 1P7GA 2QSAA 2NN4A 4DYLA 1WB8A 2XAQA 3AG2C 1YXBA 5KHGA 2EILB 1SESA 2HR3A 3AG3C 2DYRC 3A8TA 3FAVB 2QE7G 4DR5O 2QTSA 3ZN0A 1GN6A 2UU9B 4UVBA 4JV5O 3UQ8A 2QWRB 3D3QA 1SC5B 4B3TB 2JRIA 1XUQA 2L35A 1XREA 1JFFB 5IDJA 1Q86W 2H3OA 1N32O 1F23A 1FPOA 1SZTA 5LGTA 2Z5UA 5LA6B 3RN4A 4DW1A 2RDCA 3ABKC 1J5EB 1SKVA 4DV4B 1NKDA 2F4VO 1U96A 2YEVA 4LC1A 2ZT9B 5L3CA 3SPIA 4GKJO 3QO8A 5IYBO 5A9GA 3VBBA 1WA8A 3E8FA 1VEWA 1GK9A 2CDYA 3PN1A 1I08A 1KMIZ 1SQGA 3K0DA 1IBMB 1OHHG 3LSSA 4MS2A 1X4TA 4WFGA 1VMGA 2W0FC 3E86A 4IGGA 2IU3A 3M7MX 4H44B 1FJGB 4DV3O 3OMAB 3OM3B 2IBZH 5LOVA 5CBGA 4PDRA 3FB8C 3DSQA 4XDLA 4IYIA 2HHHB 5CBFA 4I9WA 4X1IB 3CC4V 1TUBA 1KECA 2JGUA 3AG1B 1GM8A 1ZAUA 1N32B 1Z5VA 1FJGO 5A2QN 2EJRA 3J7AU 2KKWA 2X0LA 2E5LO 2F23A 1S5LZ 3E2EA 3ICXA 1FAFA 3G4SV 1SQVH 1YJ9V 3QNEA 2Q6AA 2YI8A 1M9NA 5H5NA 4X1IA 5DM6V 1NTZH 4LF8B 3RW0A 4H37A 3T1CA 3L72H 2N05A 1L0NH 3CXHF 4MVMA 1WJZA 5D5QA 1MMMA 3K9AA 1WA8B 3IGAC 4UFZA 4JAUA 3OMIB 5B5EZ 1TAEA 1QVFU 1FYJA 4X66O 3BAAA 4DUZO 3BRCA 5AG2A 3FD9A 1TA8A 2BSKA 4LWSA 3JASB 5EYPB 1YF2A 3SR2C 2BOCC 2Q67A 2DJVA 5BY1A 1ZWIC 3APQA 5FPRA 3VQWA 1RM1C 2LW1A 2H8PC 3CJHA 4HAMA 2IH1C 2XNDG 1BL8A 1ORQC 1FFXA 4A5UB 3CPWU 2LP7A 1TVKA 5CMUA 4P2ZA 3JATB 3ZHSA 1N36O 4DR2O 4PA7A 2Q7EA 3SYOA 4DR1O 1B06A 2XUMA 1KU9A 1GKFA 2X7RB 4WFHA 1L8DA 2Y4TA 4JAAA 4I4TB 4PA9A 3ZHQA 2Q4PA 4F6EA 4JI5B 5J2UA 5KHKA 1M90W 5CB4B 3UM7A 3CCUV 2Q68A 4FM2A 1H2LA 3FB5C 1XMQO 2Y69B 2QWQB 4YHHO 2V7QG 1H8HG 5JQGA
chains in the Genus database with same CATH topology
1S5LZ 2AXTZ 3KZIZ 5E79Z 5H2FZ 5TISZ 5B66Z 4UB6Z 5KAFZ 4PJ0Z 4UB8Z 3A0BZ 4IL6Z 5KAIZ 3A0HZ 3JCUZ 5GTIZ 3WU2Z 5B5EZ 5GTHZ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S5L Z;  2AXT Z;  3KZI Z;  5E79 Z;  5H2F Z;  5TIS Z;  5B66 Z;  4UB6 Z;  5KAF Z;  4PJ0 Z;  4UB8 Z;  3A0B Z;  4IL6 Z;  5KAI Z;  3A0H Z;  3JCU Z;  5GTI Z;  3WU2 Z;  5B5E Z;  5GTH Z; 
#chains in the Genus database with same CATH topology
 3K08 A;  3W7S A;  3SYQ A;  4B3R O;  2CTP A;  5KMG A;  1IBK B;  2JVD A;  1AJQ A;  1AJN A;  1Z5W A;  5IYC O;  1N34 B;  1W59 A;  1JJO A;  1R3L C;  1EN4 A;  1EFR G;  4E4E A;  1RM1 B;  4J11 A;  2CTR A;  3H1K H;  1PPJ H;  1F4M A;  3K5L A;  3JD0 A;  3L73 H;  4W4K A;  1EZV H;  4UCO A;  4PA6 A;  1WAZ A;  3JAK A;  4GZR B;  5EIB C;  3OW2 U;  4B3T O;  1VF6 A;  2ZE6 A;  3SJA C;  2DWD C;  3CB2 A;  3CJH B;  2WLK A;  4KHP B;  2DQ3 A;  3K06 A;  3SJC C;  2XT9 A;  2RNB A;  4JI0 O;  1AB3 A;  2AZ0 A;  3MHS C;  3GB7 C;  4UCV A;  4JI3 B;  1OCR B;  5JVD A;  1SA0 A;  2KB1 A;  3OUF A;  1VQN V;  3K5N A;  2OTL V;  1KUQ A;  2DQ0 A;  3F7Y C;  4MTF A;  2EIK B;  3SYA A;  4FLV A;  2DW4 A;  4ZKI A;  5JH7 B;  4DV3 B;  4LP8 A;  2Y69 C;  2A7W A;  3N2G B;  2ITC C;  2ZKO A;  1AI7 A;  3RYI B;  2YSU B;  3I5D A;  3W7T A;  1OCZ B;  4Z2W A;  3M8A A;  3HKC B;  3E22 B;  2UXB B;  2YUA A;  3RYC B;  4CC5 A;  5B1B B;  3JSN A;  5IJ9 B;  2GHY A;  2ILM A;  4JI7 B;  3K9S A;  3JD2 A;  1F7Y A;  2LW7 A;  1A32 A;  3N2K A;  3ZHT A;  1XL6 A;  1NJI W;  1BHA A;  2YIB A;  4F6R B;  5J2T A;  3P3P A;  2JIZ G;  5J9P C;  1JVM A;  4JI6 B;  5BXZ A;  4H0L B;  1KQS U;  5JJE B;  4X20 A;  3CWB H;  4PI2 A;  3HKC A;  3D3I A;  1QNM A;  2PI5 A;  4TT3 G;  1IBK O;  2UXD O;  5DED A;  4DXW A;  2Q0O C;  2R72 A;  3CS5 A;  2WA3 A;  2FML A;  4MVU A;  1HNW B;  1OCO B;  2OTJ V;  1SET A;  4X1Y A;  5LGN A;  3X2Q C;  2UUB B;  1JJ2 U;  3WU2 Z;  4K8Z A;  2YID A;  4J7K A;  3ABL C;  3F5W C;  3TCU A;  4RQE A;  1EN6 A;  1SRY A;  1ZX3 A;  4PV1 B;  3SPC A;  1H8E G;  5E79 Z;  1VP7 A;  4O4H B;  4CH6 A;  2BSK B;  3ABL B;  3HR0 A;  4DV0 B;  1K97 A;  1R73 A;  3K5O A;  4H13 B;  5H9C A;  3ABT A;  2XTA A;  2EUL A;  3O9O A;  4JI6 O;  2V4D A;  1S5J A;  4DV5 O;  5FLX N;  4NXM B;  5EIB D;  2OWO A;  1SF9 A;  2CAZ C;  4QJF B;  2LO1 A;  1KP2 A;  1BGY H;  2UXD B;  5KHJ A;  4LH6 A;  5KUK A;  1Y6X A;  1Q8I A;  4O2A A;  1X59 A;  1AI5 A;  5IT9 N;  4O2B B;  5L3B A;  3ZJZ A;  1BSM A;  3JAW B;  3B8N A;  3K5M A;  2Q9L A;  4OPH A;  1KYO F;  4NKG B;  2EIM C;  4N21 A;  1FXV A;  5K1X A;  2BTO A;  3CCS V;  2WAM A;  4JI4 B;  2B1I A;  4DR3 O;  2M6Y A;  5BR8 B;  4UUJ C;  4XDK A;  1RFY A;  1ZL8 A;  4PHZ A;  2QKS A;  2WSS G;  3H1J H;  4J7J A;  3K59 A;  2GUZ A;  4LF4 O;  2QJ1 A;  2DE0 X;  1V55 C;  4DO2 A;  3W7X A;  4TWK A;  1AI6 A;  1N8R W;  1D5A A;  5LHH A;  3ZS8 C;  1JMK C;  1QR9 A;  3JD1 A;  1K8A W;  4NB5 A;  1DTO A;  2WLM A;  1R1B A;  2ZIM A;  2ZQM A;  1VF6 C;  3G67 A;  1M56 B;  3C90 A;  3ZRV A;  3EVK A;  4DK0 A;  2AZ2 A;  4B3S B;  1GO3 F;  3OT7 A;  1Y66 A;  1VAR A;  1E1R G;  2DWE C;  3CCQ V;  4UVC A;  3E83 A;  1EN5 A;  4J41 A;  3VQY A;  2DN9 A;  3RYF B;  4P9P A;  2Z0A A;  5LHI A;  4KFM A;  2JK5 C;  3HKD A;  1VIB A;  1JX9 A;  3IJ4 A;  4KHP O;  1IZ3 A;  4YIO A;  4HBN A;  4LF8 O;  2F43 G;  3F7V C;  4OXS A;  1TVK B;  2QDO A;  2GBO A;  1DK1 A;  3SDL A;  3OEH G;  1XL4 A;  3SYC A;  2M7W A;  1MSW D;  5CA1 B;  4XDJ A;  2AHZ A;  1MZE A;  2BOB C;  4W4L A;  5GTI Z;  4JGS A;  4KL1 A;  3CRC A;  2LGQ A;  1BMF G;  4NXN B;  1URF A;  1SQQ H;  1P84 F;  3CMA V;  4BIZ A;  4J42 A;  5JVD B;  4FJC C;  4R6Z A;  4KUM A;  4LFB B;  2W0X A;  2ODM A;  1XMO O;  4JF3 A;  1GM9 A;  1DLB A;  2GV9 A;  3RVZ A;  4DV1 O;  2GSM B;  1PP9 H;  1Q90 D;  1ZUQ A;  4CS2 A;  3J81 N;  3THO A;  1XOU A;  1NT2 B;  3HKD B;  4O4J A;  2L6L A;  5CA0 A;  5JCO A;  4RAI A;  4MW3 A;  5LBQ A;  1XI1 A;  3R66 A;  3DGE A;  4ZI7 B;  4X64 B;  4B7E A;  4LNU B;  1RPR A;  3WB0 A;  1EZJ A;  3EXA A;  2VQF O;  1M4U A;  4ICG A;  3OTF A;  4P30 A;  2EZO A;  4LBE C;  3ETG A;  4B3S O;  3ZMZ A;  1OCC B;  2R9R B;  4I9Q A;  4BAY A;  4X62 O;  2Q7G A;  3TGU H;  2D2C B;  1PKX A;  4B3R B;  3FB7 C;  2F95 B;  1AJP A;  3RWR D;  4YHH B;  2CH7 B;  4JAV A;  3AK3 A;  4G28 B;  3JAL A;  2HLD G;  1NI8 A;  3L74 H;  5GON B;  4DR4 O;  5F2V O;  4GCZ A;  2VRZ A;  3TXS A;  1Y74 B;  4UCS A;  2F1M A;  1HNX O;  2X6B A;  5IY5 C;  1OZ0 A;  4QPK A;  4FLX A;  1M56 C;  4LF7 B;  3CRR A;  1NVP D;  5KLV H;  1AR1 B;  1K73 W;  4K8X A;  2DOS A;  1NH2 B;  2EZP A;  3OGI B;  3H1H H;  2EBO A;  1U97 A;  4IHJ A;  4X64 O;  3ZMT A;  4PD4 F;  5IE9 A;  2E5L B;  3BEH A;  1YI2 V;  3E8B A;  4DR3 B;  3OE7 G;  3ZMS A;  3CC7 V;  3TK1 A;  1E1Q G;  4MVO A;  5LMN O;  1FXK A;  1GTO A;  1Q81 W;  2BTQ A;  2YIB D;  2VWK A;  5KAI Z;  4DV1 B;  2DYR B;  3AEI A;  5KA6 A;  3X2Q B;  1KB9 F;  2IJI A;  2FB5 A;  3G6B A;  1ENV A;  4JPR A;  1M5I A;  1XQ8 A;  1IX9 A;  3I56 V;  2PYJ A;  2QTO A;  1PL4 A;  3D36 A;  3E22 A;  2LQT A;  4UB6 Z;  2IJJ A;  3ETQ A;  3NXS A;  1PNM A;  1ARO P;  3ZIA G;  1V54 B;  5FPO A;  3G80 A;  1WNS A;  2A06 H;  5J2T B;  5FL7 G;  4AQY O;  2OIE A;  4LH7 A;  3IC9 A;  3ZRW B;  2IJH A;  4R8C A;  1Q7Y W;  3Q4H B;  2VS0 A;  1QHT A;  4UXN A;  1BS3 A;  3ZX6 A;  5K1P A;  3CEI A;  2B5U A;  3ZCC A;  2ITD C;  2QM4 A;  4WFF A;  2UUC B;  5C8Y A;  3E8G A;  3SPG A;  4EB6 B;  2QKC A;  4BWA A;  2E3C A;  1G8M A;  4WF9 V;  4GT1 A;  1HW7 A;  2IU0 A;  4FM1 A;  3CP1 A;  4JTD B;  1LUV A;  1LUW A;  3ASO B;  1SS3 A;  3ZMV A;  5DN6 G;  4JI3 O;  2ZR3 A;  2ZCE A;  1QCE A;  1VF5 B;  5IJ9 A;  2G38 A;  5B1N A;  4YXW G;  4JTA B;  4DRX B;  3SYP A;  2LFS A;  3JAM N;  3KCY A;  4RWU A;  1P7B A;  3K79 A;  5H2F Z;  2N74 A;  4GLX A;  4DV2 O;  2OCC B;  2XAH A;  2JJ1 G;  2HHH O;  1MZF A;  4DUY O;  3UO2 A;  3ZMU A;  1BHB A;  1AR4 A;  1PV0 A;  2OCC C;  4L87 A;  3CYO A;  1XHX A;  2CK3 G;  3JAW A;  1NQT A;  3E8H A;  3TJT A;  1S0V A;  3RYF A;  1H2N A;  1QU7 A;  4MSW C;  1B3Q A;  4ZHQ A;  4MW8 A;  1VQ7 V;  5IYD O;  5ITZ B;  2QR4 A;  4DV4 O;  4I0X B;  1Y4M A;  1VQ5 V;  1K33 A;  4FMT A;  4LNU A;  3WG7 C;  4PEL A;  1US6 A;  2B1G A;  1Q82 W;  4KP4 A;  2Y0P A;  2ZE8 A;  4LR3 A;  4LWS B;  1BQZ A;  1COW G;  2K1E A;  1OJH A;  3IAY A;  1I94 O;  3HKB A;  2P22 C;  2IJK A;  5BR8 O;  1XMO B;  4X89 A;  5L3G A;  4NR1 A;  1YJN V;  4DV6 B;  1V9P A;  3ZHR A;  4QNH B;  5B1B C;  1IXM A;  2P5O A;  1D5N A;  4J7Z A;  1UJW B;  4JV5 B;  2A79 B;  4PDL A;  4DUY B;  1SA0 B;  5B1A C;  5B1O A;  3JAL B;  4WFE A;  4B3M O;  5LP6 C;  1GN3 A;  1I5Y A;  3ZRX A;  1ZTE A;  2P4V A;  2WLI B;  4C7U A;  2FKX A;  2QWP B;  1T5E A;  3LSU A;  4JI4 O;  5LL6 Y;  2ZR2 A;  5IWA O;  5DEC A;  2QKA A;  3K57 A;  1WB7 A;  4PA4 A;  2P90 A;  3ABU A;  2IH3 C;  5IJ0 B;  3KG2 A;  3OD4 A;  4OX9 B;  2FL4 A;  3JYC A;  1RSO A;  3B8M A;  1DGS A;  4LF5 B;  5EBW C;  3TET A;  3VQX A;  1H2G A;  4I5S A;  2Q5Z A;  4CZZ A;  4DR5 B;  5EK0 A;  4J9Y B;  5KMG B;  2CH7 A;  1RP3 B;  3LDD A;  4DR6 O;  3FKS G;  3B4S A;  2F93 B;  4D6T H;  3T1H O;  4O4I B;  1IDS A;  4O4L B;  1YJW V;  2OCH A;  4K35 A;  3CC2 V;  1HR0 O;  4YIP A;  1K4D C;  4FLY A;  2AXT Z;  2EIN C;  2ZE5 A;  4FFK A;  2JGD A;  5IY5 B;  4LF4 B;  4JI0 B;  1P4R A;  2YIA A;  3K03 A;  1N33 O;  3LNM B;  1BT8 A;  1GMG A;  4CH3 A;  3T1Y B;  5LXT A;  4BIO A;  2W6J G;  4I50 B;  4JZG A;  4ZI7 A;  4FZ1 A;  3HB3 B;  4BW9 A;  1UPG A;  2QA4 V;  2EIM B;  3QF7 A;  3OUS A;  5CA0 B;  3OGC C;  3HKB B;  4OX9 O;  4LFC B;  3ABK B;  3KKY A;  5GON A;  1OCZ C;  4NXM O;  4FFB A;  4LFC O;  2H94 A;  3MDS A;  4FLU A;  4JYY A;  2R9I A;  4BIU A;  1NR7 A;  1G1X B;  1KP3 A;  4LF9 O;  4PJ0 Z;  3FAV A;  3SJQ C;  4O2B A;  5GTH Z;  2Q7H A;  2YXL A;  4FZ0 A;  2Q0A A;  4DR7 O;  2P7T C;  2KSD A;  2RQ6 A;  2LJ2 A;  4QE7 A;  1N0J A;  1I5X A;  1M57 B;  5E1A C;  2GUZ B;  4MVS A;  3STZ C;  1AI4 A;  1NVP B;  1J95 A;  4FVM A;  1N4C A;  1FXK C;  1N33 B;  4FK5 C;  3CRQ A;  2VWJ A;  2VQE O;  4JTC B;  2UUA O;  4WBN B;  3IC7 A;  4EFB A;  4RO2 A;  4JZ2 A;  2NR5 A;  4X1K B;  2UXC O;  4GKJ B;  2ZE7 A;  3EFF K;  4GKK B;  4X88 A;  1WPX A;  1G6U A;  4QE9 A;  1QLN A;  2JEU A;  2LFR A;  1R3K C;  2EIJ C;  1Y76 A;  2ZIO A;  4JI8 B;  2ZXW C;  4DR4 B;  3JD3 A;  1R3I C;  2RN9 A;  2CE4 A;  1AP5 A;  2OT5 A;  2P4K A;  4IHJ B;  4UCU A;  1PL0 A;  3P30 A;  1HWY A;  2YXH A;  4NVP A;  1FKA O;  2AW9 A;  5H6Q A;  3S3W A;  1L0L H;  4UV8 A;  5CB4 A;  1FFT B;  2BTQ B;  3L75 H;  4ZOL A;  5LYJ B;  3WG7 B;  4ZIB A;  2A0L A;  1XBL A;  1Y74 A;  3BAB A;  4X66 B;  3QVN A;  4I55 A;  4I4T A;  1UFI A;  3AG4 C;  2Y4U A;  4X9Q A;  2YC0 A;  1ZLZ A;  1BQ0 A;  5LMN B;  2FYU H;  2QM8 A;  5EZY B;  2W6I G;  1S76 D;  1NH2 D;  2ZIN A;  1XNR O;  4I55 B;  1OCO C;  1YEW A;  1TUE B;  1YIJ V;  1KD1 W;  3OR7 C;  3TXQ A;  1N36 B;  2XOK G;  5B3S C;  1JR9 A;  1XNR B;  4LF7 O;  3HKE B;  2LGW A;  4JI1 O;  1JQ0 A;  1JOY A;  2QWO B;  3FYE B;  3T4D A;  2PYL A;  3ABM B;  5EYP A;  3OFN G;  4PA3 A;  5EC1 C;  4YJ3 A;  2VQE B;  1FXH A;  1Q6U A;  4FIP C;  3BCC H;  5KX5 B;  2ZM6 O;  1R6T A;  3O65 A;  2A3Q A;  2P6J A;  4HYO A;  2HP8 A;  2JS3 A;  2Y0I A;  4IIJ B;  3UT5 A;  4DRX A;  3STL C;  1TUB B;  3RBZ A;  3HPL C;  4FM0 A;  2GDS A;  1QLE C;  2Q69 A;  1J5E O;  4FLT A;  1B04 A;  3AG3 B;  2OYQ A;  5KX5 A;  4X1K A;  4NTX A;  5KA5 A;  3Q4H A;  2XAJ A;  4F4L A;  1XNQ O;  1WP8 A;  1HR0 B;  4DW0 A;  1K3E A;  5L3E A;  3RYC A;  2R9A A;  3NR7 A;  4R50 A;  5B1A B;  2EIN B;  4FLZ A;  3SJB C;  4X8A A;  4IIJ A;  3UT5 B;  1RSO B;  2JEX A;  5D5P A;  2RCV A;  5CBH A;  2KQX A;  3CRA A;  4O2A B;  4YJ3 B;  1S77 D;  3T1Y O;  4U7N A;  3ZN1 A;  1QQC A;  4WCE V;  3U10 A;  1THZ A;  3KCX A;  1PD3 A;  3CCE V;  1AIL A;  3CE2 A;  1S72 V;  2X6C A;  2WLJ A;  1Y76 B;  3M99 B;  1O9H A;  2WLH A;  3SPH A;  1ROP A;  3QO5 A;  4TOI A;  1Q43 A;  2KG7 A;  4GX2 A;  3CHX A;  4FPP A;  3JD4 A;  5KHI A;  4GX5 A;  3U0Z A;  2PY5 A;  4Z1M G;  1JPX A;  2WA4 A;  4MVQ A;  4U3J B;  3HKE A;  1NS1 A;  1HDJ A;  2BE3 A;  3T2M A;  1CXZ B;  4AIL C;  1GN2 A;  1PNK A;  2HEP A;  3J80 N;  4K3A A;  3AG1 C;  4QIW F;  1HNZ O;  2CUG A;  2JS5 A;  1Z2G A;  1EM1 A;  4JAS A;  1OCR C;  4KXR A;  4MTX A;  4ABM A;  3P3N A;  3UKM A;  3WFV A;  4EFE A;  2VQF B;  4GX0 A;  1IBM O;  3WB2 A;  3CCM V;  2EIK C;  5L3D A;  2QGN A;  2CTW A;  2GTA A;  4B08 A;  1QVG U;  3BHP A;  4DK1 A;  2XAG A;  3QG5 A;  4RUF A;  5EBM C;  2YXY A;  1HNX B;  4TV9 A;  3BVO A;  1VQ4 V;  2EIL C;  2ZXW B;  1OV9 A;  1GRJ A;  1IBL O;  2ETN A;  4HZ3 A;  4UV9 A;  2F66 C;  3L71 H;  3GWO A;  3ASO C;  1IBL B;  4LFB O;  1O9G A;  3E89 A;  3RYH A;  1I7F A;  4HNA A;  4DR6 B;  3GWK C;  1Y67 A;  4DV0 O;  2UXX A;  2CTQ A;  5IWA B;  1K34 A;  4D7S A;  1QLE B;  1IUR A;  4IL6 Z;  3U11 A;  1ZSP A;  3W7W A;  1JCH A;  3RFR A;  5CA1 A;  1FD9 A;  4L8J A;  2D3O W;  3A0H Z;  1MNG A;  1GN4 A;  1XNQ B;  1RPO A;  4WFB V;  2WLL A;  4AI8 A;  1YTF D;  2Q73 A;  1I0H A;  4CH4 A;  2F4V B;  2CGO A;  5KHH A;  5HFM A;  3RYI A;  4DV5 B;  4EKW A;  5FNV A;  4BR6 A;  1XMQ B;  4X1Y B;  4O4J B;  3GVM A;  2YI9 A;  4GX1 A;  5H6R A;  1OCC C;  1D2D A;  1GH6 A;  4B3M B;  3VOU A;  1MG1 A;  1EBO A;  3ZHV A;  3ETE A;  5LP6 A;  3CCJ V;  5GW7 A;  4O4H A;  2RJZ A;  1V54 C;  4ZHQ B;  4DR1 B;  3L9D A;  2PUS A;  4YJ2 A;  3AK2 A;  2AGA A;  3H1I H;  1GM7 A;  1DF5 A;  4O4L A;  2Z3Y A;  5IYZ A;  5LA6 A;  2OIG A;  4JI7 O;  3N2K B;  4JYA O;  4DR2 B;  3H01 A;  3LUT B;  3BA9 A;  2QEX V;  1QR8 A;  2JGD B;  1YCI A;  1G4Y B;  4LFA O;  4X65 O;  2V1D A;  2YIC A;  4B7K A;  3BPZ A;  3BY6 A;  1VQP V;  4BW5 A;  1M57 C;  4X20 B;  3CCV V;  4JYB A;  2PF4 E;  1GAX A;  1IVS A;  2YEV B;  1MA1 A;  4CS3 A;  3B2E E;  4GUN A;  4F6R A;  1XHZ A;  4G27 B;  4DR7 B;  3FFQ A;  5J2U B;  3W7U A;  1VQO V;  5B66 Z;  1JA8 A;  2NLJ C;  2WLI A;  3G6E V;  4U7O A;  1YDX A;  3OEE G;  3MD0 A;  2A9H A;  4J9Z B;  2K9P A;  1F51 A;  3CSX A;  1NR1 A;  4DUZ B;  4YJ2 B;  1M93 A;  3OMN B;  2N04 A;  1CP9 A;  3ABM C;  3RGB A;  1M1K W;  3OR6 C;  2C2A A;  4PDV A;  4Q20 A;  4TQF A;  5IJ0 A;  4PI0 A;  3N2G A;  1VQM V;  4WBN A;  2QWN B;  1FFX B;  1YVW A;  3AG2 B;  3D36 C;  4JI2 O;  1W2B U;  2P06 A;  4R7C A;  2HJF C;  1K92 A;  3CXC U;  2ZDI A;  4MTG A;  2XAF A;  2R70 A;  2MW2 B;  1KC8 W;  5IYZ B;  3A0R A;  4JI1 B;  3JAS A;  1N0N A;  3RT3 C;  4Q6G A;  3S3X A;  1YSC A;  1BE3 H;  3ASN C;  5JCO C;  2PGG A;  2WLL B;  2GTS A;  3ML0 A;  5HFL A;  3H1L H;  3JAK B;  3AG4 B;  1SQB H;  3FX7 A;  3ZHU A;  2YS8 A;  3ZED A;  2MK3 A;  3CME V;  2ZD9 A;  2WLN A;  1VQ9 V;  2HJD A;  1AVM A;  2B9Z A;  3OAA G;  4UCR A;  1H38 A;  4MT8 A;  4LF9 B;  3DC5 A;  2XAS A;  3OTO O;  2Q8V A;  5JQG B;  2ZM6 B;  5LMU O;  5B3S B;  2YDE A;  3WB1 A;  1N34 O;  1MSD A;  3K04 A;  1H2M A;  5JJJ B;  2HFE C;  3L70 H;  4MTO A;  1DF4 A;  2DMX A;  4RUE A;  3EHB B;  3P32 A;  3UO3 A;  3OTO B;  2E74 B;  2UUA B;  4UB8 Z;  1K4C C;  4FFB B;  4EEQ A;  1LR1 A;  4UVA A;  1K9M W;  1QBZ A;  2E75 B;  2HKO A;  2BCC H;  3CRM A;  4JI5 O;  4JYA B;  4AHC A;  1FS0 G;  2HVK C;  4TQD A;  3ZRW A;  1NU1 H;  2IW5 A;  3A0B Z;  4OGQ B;  3LDC A;  1KBH A;  4ZBM A;  4N23 A;  1MOF A;  4UCT A;  5KUM A;  4IYH A;  1PM9 A;  2O57 A;  2WWW A;  4U3J A;  4Z1V A;  1MAB G;  4LFA B;  2IM9 A;  3C3T A;  4GKK O;  5LXT B;  3I55 V;  1SZX A;  3A2F A;  1L1F A;  4NYK A;  2PTM A;  3BA8 A;  1YIT V;  2CGN A;  5CA3 A;  2UUC O;  3R65 A;  3LSQ A;  5C8Y B;  4LF6 O;  4YY3 O;  4TV8 A;  3D8C A;  2PZS A;  1YTF B;  2EIJ B;  3IFX A;  2P67 A;  1H2K A;  1B6Q A;  1VQL V;  3JAR A;  3C3S A;  1SER A;  4AQY B;  3JCU Z;  1SQX H;  5L3F A;  5BZB A;  4ZOL B;  1WLE A;  5KAF Z;  1HP8 A;  3ZBH A;  3ZRS A;  1BZK A;  3AK1 A;  1VQ6 V;  1PNL A;  2QM7 A;  4H33 A;  3SPJ A;  3K58 A;  2FTK A;  4QPJ A;  4TV9 B;  4RQF A;  3APO A;  2ADQ B;  1NBM G;  2JDI G;  3LDE A;  3MHH C;  5EC2 C;  3JCZ A;  3MAQ A;  4U3F H;  5EBL C;  2EX3 A;  3G71 V;  1Q6H A;  3PJS K;  1KKD A;  1ZL8 B;  4WFA V;  1I94 B;  4TSF G;  1H2S B;  1FXK B;  4CC6 A;  3K3W A;  5JJN B;  3E35 A;  4QGP A;  4TUY B;  4LF6 B;  1R6K A;  1LNQ A;  1HNZ B;  1AR5 A;  5ITZ A;  3DXR A;  1XEQ A;  4NTW A;  2ZNJ A;  3RVY A;  2EJ7 A;  5LOV B;  1YHQ V;  3RYH B;  4TUY A;  1W0J G;  3JAT A;  4I7Z B;  5LGU A;  2UUB O;  1TGO A;  1XIL A;  3KZI Z;  3ETD A;  1JFF A;  4LCU C;  4J10 A;  2KG7 B;  3T1H B;  5LMU B;  1Q5O A;  2Y48 A;  5BMV B;  4NTY A;  2UU9 O;  2ATK C;  2UXC B;  4NXN O;  3CCR V;  4DV2 B;  1AP6 A;  2JJ2 G;  2X6A A;  4OPA A;  2DYS C;  2AHY A;  2XHB A;  2UXB O;  3AG7 A;  4CBC A;  3UCS C;  4TV8 B;  1CEZ A;  4XBF A;  1SQF A;  1VF7 A;  1SQP H;  5LP6 B;  3F5T A;  4MVR A;  1VQ8 V;  2PI4 A;  4JI8 O;  3JAR B;  1WN7 A;  3N27 A;  3B77 A;  4ASU G;  4FLW A;  5C93 A;  1S5H C;  3QO7 A;  4CH5 A;  1BCC H;  4YY3 B;  1F4N A;  1R6N A;  2ZNI A;  1CPY A;  1P49 A;  4I50 A;  1WPB A;  5JWP A;  3B40 A;  1V55 B;  5LYJ A;  1NTM H;  4DV7 B;  3FYI B;  4X65 B;  4DV6 O;  1KKC A;  1S3J A;  4DV7 O;  1K5Q A;  4IT5 A;  5JH7 A;  1VQK V;  2WPD G;  3T4Z A;  5EZY A;  2ADP A;  2E76 B;  4O4I A;  4HNA B;  3DXR B;  3ASN B;  2DYS B;  2NNU A;  2RMK B;  1Q6I A;  1Q3E A;  5BMV A;  1XDC A;  5FNV B;  4P9O A;  4EB6 A;  2UXN A;  5LHG A;  2HVJ C;  3JSL A;  4K0K O;  3CX5 F;  1K5S A;  1HNW O;  3H9V A;  5CN0 A;  3FB6 C;  3DC6 A;  4MVZ A;  3CD6 V;  3B09 A;  5TIS Z;  4LF5 O;  2HG5 C;  4CS4 A;  3K0G A;  3BFR A;  1YZB A;  1R3J C;  4K0K B;  1E79 G;  1NTK H;  4G2K A;  4J80 A;  3DTU B;  2ARH A;  4D7T A;  1K7D A;  1NZ6 A;  4X62 B;  3LNN A;  1IXB A;  4JI2 B;  4E2L A;  3SGI A;  4I0X A;  3VQV A;  2ZDI C;  4PDM A;  1WP7 A;  3QTC A;  1W0K G;  4JYC A;  4GYC B;  3CCL V;  1P7G A;  2QSA A;  2NN4 A;  4DYL A;  1WB8 A;  2XAQ A;  3AG2 C;  1YXB A;  5KHG A;  2EIL B;  1SES A;  2HR3 A;  3AG3 C;  2DYR C;  3A8T A;  3FAV B;  2QE7 G;  4DR5 O;  2QTS A;  3ZN0 A;  1GN6 A;  2UU9 B;  4UVB A;  4JV5 O;  3UQ8 A;  2QWR B;  3D3Q A;  1SC5 B;  4B3T B;  2JRI A;  1XUQ A;  2L35 A;  1XRE A;  1JFF B;  5IDJ A;  1Q86 W;  2H3O A;  1N32 O;  1F23 A;  1FPO A;  1SZT A;  5LGT A;  2Z5U A;  5LA6 B;  3RN4 A;  4DW1 A;  2RDC A;  3ABK C;  1J5E B;  1SKV A;  4DV4 B;  1NKD A;  2F4V O;  1U96 A;  2YEV A;  4LC1 A;  2ZT9 B;  5L3C A;  3SPI A;  4GKJ O;  3QO8 A;  5IYB O;  5A9G A;  3VBB A;  1WA8 A;  3E8F A;  1VEW A;  1GK9 A;  2CDY A;  3PN1 A;  1I08 A;  1KMI Z;  1SQG A;  3K0D A;  1IBM B;  1OHH G;  3LSS A;  4MS2 A;  1X4T A;  4WFG A;  1VMG A;  2W0F C;  3E86 A;  4IGG A;  2IU3 A;  3M7M X;  4H44 B;  1FJG B;  4DV3 O;  3OMA B;  3OM3 B;  2IBZ H;  5LOV A;  5CBG A;  4PDR A;  3FB8 C;  3DSQ A;  4XDL A;  4IYI A;  2HHH B;  5CBF A;  4I9W A;  4X1I B;  3CC4 V;  1TUB A;  1KEC A;  2JGU A;  3AG1 B;  1GM8 A;  1ZAU A;  1N32 B;  1Z5V A;  1FJG O;  5A2Q N;  2EJR A;  3J7A U;  2KKW A;  2X0L A;  2E5L O;  2F23 A;  1S5L Z;  3E2E A;  3ICX A;  1FAF A;  3G4S V;  1SQV H;  1YJ9 V;  3QNE A;  2Q6A A;  2YI8 A;  1M9N A;  5H5N A;  4X1I A;  5DM6 V;  1NTZ H;  4LF8 B;  3RW0 A;  4H37 A;  3T1C A;  3L72 H;  2N05 A;  1L0N H;  3CXH F;  4MVM A;  1WJZ A;  5D5Q A;  1MMM A;  3K9A A;  1WA8 B;  3IGA C;  4UFZ A;  4JAU A;  3OMI B;  5B5E Z;  1TAE A;  1QVF U;  1FYJ A;  4X66 O;  3BAA A;  4DUZ O;  3BRC A;  5AG2 A;  3FD9 A;  1TA8 A;  2BSK A;  4LWS A;  3JAS B;  5EYP B;  1YF2 A;  3SR2 C;  2BOC C;  2Q67 A;  2DJV A;  5BY1 A;  1ZWI C;  3APQ A;  5FPR A;  3VQW A;  1RM1 C;  2LW1 A;  2H8P C;  3CJH A;  4HAM A;  2IH1 C;  2XND G;  1BL8 A;  1ORQ C;  1FFX A;  4A5U B;  3CPW U;  2LP7 A;  1TVK A;  5CMU A;  4P2Z A;  3JAT B;  3ZHS A;  1N36 O;  4DR2 O;  4PA7 A;  2Q7E A;  3SYO A;  4DR1 O;  1B06 A;  2XUM A;  1KU9 A;  1GKF A;  2X7R B;  4WFH A;  1L8D A;  2Y4T A;  4JAA A;  4I4T B;  4PA9 A;  3ZHQ A;  2Q4P A;  4F6E A;  4JI5 B;  5J2U A;  5KHK A;  1M90 W;  5CB4 B;  3UM7 A;  3CCU V;  2Q68 A;  4FM2 A;  1H2L A;  3FB5 C;  1XMQ O;  2Y69 B;  2QWQ B;  4YHH O;  2V7Q G;  1H8H G;  5JQG A; 
#chains in the Genus database with same CATH homology
 1S5L Z;  2AXT Z;  3KZI Z;  5E79 Z;  5H2F Z;  5TIS Z;  5B66 Z;  4UB6 Z;  5KAF Z;  4PJ0 Z;  4UB8 Z;  3A0B Z;  4IL6 Z;  5KAI Z;  3A0H Z;  3JCU Z;  5GTI Z;  3WU2 Z;  5B5E Z;  5GTH Z; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...