4NYKA

Structure of a membrane protein
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
414
structure length
414
Chain Sequence
LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 105
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4nykA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4nykA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4nykA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4nykA02
2FB5A 4FZ1A 4NTXA 4NTYA 2QTSA 4NTWA 4FZ0A 4NYKA 2L35A 3S3XA 3IJ4A 3N27A 1WP8A 3S3WA 1WP7A
chains in the Genus database with same CATH superfamily
3TGUH 1NTMH 5IJ9A 3RFRA 3EHBB 5J2UB 2LFRA 3ICXA 1IBLB 1YZBA 2JK5C 1VIBA 2CTRA 1XEQA 1N8RW 2HJFC 3E83A 3WG7B 3RBZA 2PUSA 2DWDC 1SA0A 3UT5A 4MVZA 1O9GA 4LF6B 1Q81W 2LW1A 4UCOA 4PI2A 5JCOC 2P06A 1NT2B 1W2BU 1N34O 2UU9O 1H2SB 3CC7V 3H1JH 2LW7A 2OCCC 1XBLA 2RN9A 3IAYA 3IC7A 3ASNC 4DR3O 3B8MA 3F5TA 3IFXA 3K79A 4F6RB 1VQLV 4X9QA 4NR1A 1V54C 3L70H 5GTHZ 3SPIA 3T1HO 2DMXA 2EIKB 3HKDB 2BSKB 3JD1A 5JVDA 1W59A 3JD3A 5JQGB 1R1BA 2OTLV 1H2NA 4LFBB 1RPRA 4OXSA 4NXMB 1KKCA 3CRQA 3K06A 2E5LO 2EZOA 3FB8C 1N36B 3AG1B 1AI6A 2XNDG 1WAZA 5LYJA 1MMMA 3JAKB 3ZRWA 4D7TA 1XHZA 4JI0O 1I5XA 1BGYH 1GH6A 5KAIZ 3J80N 2HVKC 4J80A 4LF4O 4FM2A 1L1FA 1M93A 2JEUA 3JAWA 4TQFA 4ZHQA 2V7QG 3P3NA 2KKWA 4LF9O 3JSLA 4RUFA 4DW1A 2ODMA 4MTFA 1M1KW 2WLNA 4FVMA 2EILC 3PN1A 1FYJA 1MNGA 4LNUB 1VQ4V 1G8MA 4IHJB 4JZGA 5B5EZ 2WWWA 4KFMA 1COWG 3CWBH 3EXAA 1JFFB 3GWOA 5EIBC 3JATA 4DV2O 4DR2B 2NLJC 2OIEA 4DR6O 4G28B 4B08A 1Q86W 1ZL8A 1K4CC 1K92A 3SPCA 4CS3A 4MVOA 1HNZB 2F43G 1QLNA 3ZHUA 1VP7A 2XAJA 2ARHA 3Q4HB 5GONA 2D2CB 2QR4A 1WLEA 1AVMA 4PA4A 1R3IC 3CCJV 3FAVA 4LF9B 4FZ0A 5LGUA 2ZE6A 4YIOA 2L6LA 5DM6V 5LP6A 3M8AA 4LFCO 2PI4A 1K5SA 5KAFZ 3ABTA 4PDLA 2ZCEA 4DV4B 1SQGA 1LR1A 4B3RO 2DYRC 2M6YA 4J9YB 4P9PA 2HLDG 1JPXA 1QR9A 2EULA 4DW0A 2JVDA 2V4DA 3UCSC 4DV2B 1F51A 3DXRB 5H2FZ 4MW8A 3CCLV 4DR6B 3JALA 2V1DA 5L3EA 3J7AU 4NXNB 4QE9A 2NNUA 1OCOB 3JCUZ 1S5HC 3KZIZ 2UXCB 1BE3H 2B5UA 1JJ2U 5FNVA 4W4LA 4TQDA 3D3IA 2Q0OC 3RYFB 1FPOA 2XUMA 3U0ZA 4GZRB 1AJQA 3JCZA 3HKBB 1M57B 1WB7A 2P90A 4MW3A 2ZXWC 3ASOC 3RYCA 1IXBA 4CH3A 1F4MA 4JI8B 1RSOB 2OTJV 4B3RB 4JZ2A 1MSDA 1Q90D 3ZRSA 2DW4A 4F6EA 5LGNA 4I4TA 2W6JG 4LF8B 1YF2A 3CCVV 1XMQB 4I7ZB 3LDDA 3SPJA 1VQ8V 1XNRO 5JJJB 4UV9A 3IJ4A 3ZHRA 3S3WA 4K0KB 2A0LA 3CP1A 1XNQO 1HR0O 2OIGA 1AP6A 3I56V 2JJ2G 2QWQB 1HNWO 3OMNB 1PNMA 1VQ7V 5IT9N 1FXKA 1NR7A 3J81N 1BMFG 2E74B 2B1IA 3K08A 4J41A 4X64O 4PA3A 4YY3O 4JGSA 1YHQV 2QDOA 1ZLZA 2CH7A 1N0JA 3K9AA 1I0HA 3FX7A 1GN4A 2YEVB 5LHHA 1SQBH 4PJ0Z 4MTXA 1AR5A 4DV1O 5B3SC 4O2BA 5LMNO 2NR5A 2WLLB 3DC6A 3K3WA 3SJAC 4AQYO 3A8TA 4EFEA 1NH2D 5DEDA 1HNWB 2P7TC 1VQ6V 2KQXA 1BZKA 4ICGA 4NTYA 3HKCA 5HFLA 4XDJA 3ZIAG 3K03A 1D5NA 3D3QA 1CP9A 5KUMA 4YHHO 1SC5B 1RP3B 2WLMA 4YY3B 4LH6A 4BR6A 1HDJA 4CS2A 5JH7B 3SYAA 4UCTA 5ITZA 1VF6C 4UXNA 1SZTA 2GV9A 3CXHF 4GX2A 5JCOA 2Q4PA 1V55C 3OEEG 2WLIB 3H1IH 2F23A 5EZYA 3TXQA 2VQEB 4DV3O 2YI9A 4FJCC 5C8YA 1K8AW 1NBMG 1KBHA 4BIZA 2EBOA 3OM3B 2R9IA 4JI5O 1FJGB 3U11A 3VOUA 4GLXA 3RYIA 3JD0A 4DRXB 1GN3A 2WLHA 4PHZA 2FL4A 1B6QA 3MD0A 3CS5A 4FFBB 5GTIZ 1QHTA 2JRIA 1FFXB 1H2MA 1PNLA 3OR7C 2CGOA 3E22B 4YHHB 3UKMA 3CJHA 3JASA 2BE3A 1Z2GA 3H01A 4UCVA 5H9CA 1H8HG 1L8DA 3BA9A 1M56B 2DQ0A 4B3MB 3B4SA 2GSMB 1BL8A 1FXHA 1WPXA 3OE7G 3JD4A 3PJSK 1RPOA 2X7RB 1I94B 3HB3B 1NU1H 3WFVA 4FLUA 4X89A 1A32A 2R72A 5IJ0B 2PF4E 2L35A 1GM8A 4U3JB 3JSNA 5TISZ 2Q9LA 3ZHSA 3APOA 2LO1A 5EC1C 1AJNA 4IHJA 5K1PA 2XAFA 1AB3A 4QE7A 1UJWB 4I9WA 3IC9A 1IZ3A 1HWYA 1IBMO 2HR3A 5L3GA 1M9NA 4E2LA 3KCXA 4UVCA 1PL4A 2K1EA 2ZNIA 3K0DA 2ZE7A 5B1OA 5JWPA 3VQVA 2ZKOA 3CC4V 5EYPA 4U7NA 2B9ZA 2GTSA 3H1KH 5LA6B 2PGGA 4K8ZA 1KYOF 4X1IB 3O65A 4JI7O 4B3TO 1PPJH 5J2TB 1SQQH 4JTCB 4P9OA 2GDSA 1VQNV 2JIZG 2Q8VA 2JGDA 3VQWA 3AG3C 4OPAA 4HNAA 4LF5O 5KX5A 5CA1A 3CB2A 4IYIA 1K9MW 1IBMB 3H9VA 4ZOLB 3LDEA 4Z1MG 2UUBB 2QM8A 3SYPA 5JJNB 4JYYA 1GK9A 4I0XA 3ZMSA 1VMGA 3BABA 3E89A 2A06H 3N2GB 3CCRV 5KHIA 3AK2A 3B09A 5BR8B 1WP7A 2R9AA 5B1AB 4CS4A 5B1AC 4X20B 5FPOA 4B3TB 3OR6C 2QSAA 4AI8A 1WA8A 3TJTA 1Y67A 3RYHB 1IBLO 4GKKB 1SS3A 3AG4C 2ZM6O 4TV9A 4BAYA 5CB4B 5IWAB 1HW7A 2DYSB 2F66C 3CCSV 4HZ3A 1VQMV 4DUZO 1K73W 1EN5A 1FFTB 3E8HA 4ZIBA 4HYOA 4B3SB 1B3QA 1Y74A 2K9PA 3K5NA 4TUYB 1R3KC 4I55B 4CC5A 4XDKA 5KA6A 1M90W 1M4UA 1K4DC 4FFKA 1F7YA 2OWOA 5BXZA 5IYDO 4GX5A 3EFFK 2OCHA 2WSSG 3C90A 4J7JA 1WJZA 2Q7EA 3SYCA 2GUZB 2ZNJA 3CE2A 2LP7A 2F4VO 1KKDA 3CRAA 2X6AA 2QE7G 4I50A 4GKJO 4LFBO 5IE9A 3CD6V 3ZX6A 5IYBO 2ZM6B 2Y4TA 3VBBA 1YJ9V 1JCHA 4NXMO 2ATKC 3LSQA 1GN6A 2YDEA 3LSSA 4ZI7B 4DUZB 4GUNA 3WG7C 1KQSU 1N36O 4MT8A 5CA0A 3ZN0A 4PA9A 2RNBA 4FZ1A 5BMVB 1TUBB 1XL4A 5LXTA 1E1QG 3HKEA 3ETQA 4CH4A 4PDRA 1AJPA 3CRCA 1NI8A 2LGWA 3GWKC 4RWUA 2BTOA 4FLVA 3OUFA 1YTFB 2F4VB 5H5NA 1VF6A 2DJVA 2Z5UA 1GO3F 2EIKC 5LOVB 4DR4B 1EN6A 4RO2A 4GKJB 1XILA 3OAAG 2UUAB 1N0NA 1DLBA 3ABKB 5IYZA 2BTQB 3FD9A 3JARB 3JAMN 4DR2O 4QNHB 4FK5C 3CMAV 1JJOA 1DGSA 4CBCA 3ZMVA 1BHAA 1DTOA 1AR4A 3I5DA 3A2FA 1HNZO 4R7CA 5EIBD 3AG1C 1SQFA 2A9HA 5CA3A 4YJ3B 1Y76A 3OMAB 4IT5A 1OCZB 1P7BA 5KHJA 4YJ2B 2EZPA 1OCZC 3QO5A 1S76D 2ADPA 1YIJV 1P4RA 4O2AB 1XL6A 2P4VA 1IVSA 3ZS8C 3O9OA 4OGQB 2EINB 2M7WA 1RM1B 4DV4O 1SKVA 5J9PC 1Q6IA 3RWRD 5IDJA 1WPBA 3OUSA 2QWPB 5IYCO 1YI2V 2IH3C 5E1AC 2QJ1A 2KG7A 4OX9B 4NTXA 2UUCO 2HP8A 1RFYA 3CC2V 2WAMA 3P32A 5CMUA 3LNMB 3ZMUA 4NXNO 2YI8A 1NKDA 1EM1A 2WLJA 4WFEA 5KLVH 3WB1A 3AG7A 1KD1W 1AILA 2QKAA 2OYQA 3E2EA 5KHKA 2UXCO 1IXMA 4EB6B 3K57A 3JD2A 4JASA 2W0FC 5B1BB 3VQYA 1AR1B 4MSWC 5EBWC 2YIAA 2YICA 4O4IB 4GT1A 3N27A 1I08A 1E79G 2RQ6A 4UFZA 3ETDA 1JA8A 2A3QA 4WFGA 1GM9A 1EFRG 1YVWA 3X2QB 4LBEC 4JI8O 1XUQA 1ZX3A 5L3CA 2ZE5A 4JI3O 1MG1A 5E79Z 1Q3EA 2YIDA 4LF8O 4FM0A 3FYIB 1XMQO 5CBGA 4FLYA 2UUCB 3AG2B 3SGIA 3QTCA 4TV8B 4K0KO 3AK1A 3AG2C 4U7OA 1IBKO 2DQ3A 2RJZA 3MDSA 2P4KA 3CSXA 4BIOA 3N2KA 5LA6A 4JAVA 3G6EV 4LR3A 1YEWA 3STLC 1L0LH 1OCOC 1DF4A 4A5UB 1YXBA 3L72H 3K58A 2JS5A 4G27B 4PD4F 2AGAA 4WBNB 1IDSA 1KP2A 2CK3G 4DR7B 1M57C 1MABG 2HG5C 4X65B 3ABLB 1H8EG 1M5IA 2UXDO 3K9SA 4JI6B 1EZJA 4JI3B 3CCMV 1OV9A 4JI2B 4KL1A 1MZEA 3JYCA 1I7FA 4RQEA 3STZC 4IIJB 2VWKA 4E4EA 1IBKB 3L74H 3ZMTA 4DR1B 1Y66A 2NN4A 4CC6A 4O4HB 1PNKA 4DYLA 4U3FH 3L9DA 4DO2A 2W0XA 1CXZB 2MW2B 4L87A 5KMGA 5FL7G 1QVGU 4JAUA 3ZRXA 1PL0A 4X1KA 1TVKB 1R3JC 3TXSA 2YIBA 1V9PA 4O4JB 1AP5A 2UXDB 5LL6Y 2VQEO 1YCIA 1CPYA 4KHPO 2AW9A 3QO7A 5A9GA 1XHXA 4X1YA 3RW0A 3L75H 3ZBHA 1FJGO 2IBZH 4GX1A 5LBQA 4BIUA 5IJ9B 3GVMA 4NTWA 4O4LA 1LNQA 4DR5B 2AHZA 2AZ2A 3CCQV 3W7SA 5L3BA 1N32B 1SF9A 4IGGA 4JI1O 3I55V 4DUYB 2Q0AA 1KUQA 1LUWA 1NQTA 1SA0B 2EJRA 3RT3C 4LP8A 3UT5B 2OT5A 3CEIA 5J2UA 3M99B 1QU7A 1TUEB 2X0LA 4R50A 4ZI7A 3UO3A 2FB5A 1VF5B 1HNXB 4B3MO 4ZKIA 2YXLA 3T4ZA 5D5PA 4CH5A 5F2VO 3G4SV 2PY5A 1I94O 4RQFA 4KHPB 2YXHA 2CAZC 5JVDB 2EIMB 2ZQMA 4FLWA 4WF9V 4WFAV 3OEHG 4F6RA 4P2ZA 2EIMC 3U10A 1TAEA 5EC2C 4FMTA 1NH2B 2Q67A 4WFFA 4JI1B 4WFHA 3HKDA 2BSKA 2XAHA 3SYOA 5JQGA 1J95A 3SPGA 1AI5A 4DV7B 5LYJB 3ZRWB 5DECA 3MAQA 5K1XA 3QVNA 1YJWV 3JAWB 4ZHQB 3UO2A 3FB6C 5IY5B 1M56C 3JAKA 1YJNV 1PKXA 4EKWA 2A79B 1Q82W 2R70A 1Q6UA 2DE0X 4DK1A 1Q43A 1ZTEA 2N05A 4J7KA 2YC0A 2ILMA 4EEQA 1XREA 3JATB 4JYBA 2WLKA 3OGIB 3DSQA 4LNUA 1SESA 2IH1C 4GCZA 1ZL8B 4JTAB 3OTOO 3L73H 4DK0A 1XQ8A 1JFFA 1G1XB 2QKCA 2QM4A 4X88A 2UXNA 5GONB 1S77D 2UUBO 1VQOV 2ZIMA 4UCSA 2P67A 4I9QA 4PELA 3FAVB 4DV5B 5EK0A 3CMEV 5LP6B 5CN0A 1Q8IA 2G38A 4BW9A 1CEZA 2AHYA 2XAQA 3Q4HA 4JPRA 3WB0A 2ZD9A 4D7SA 1G6UA 5BR8O 2FMLA 4Z1VA 1NJIW 3TETA 4PA7A 2E3CA 1FKAO 3BCCH 2QTOA 4UCUA 4QJFB 3SDLA 4GKKO 4JYCA 1K7DA 3JALB 3OFNG 5IWAO 3OTOB 1S5JA 4DV0B 4CH6A 5H6QA 1QNMA 1JOYA 2LQTA 2X6CA 4H33A 2JS3A 3DXRA 2GBOA 5FNVB 1H2KA 1L0NH 4LF7B 4B3SO 2CGNA 4FM1A 2H8PC 4FLTA 5C93A 2VWJA 2XOKG 1XOUA 4J42A 1R6NA 2QWRB 1QCEA 1K33A 2YIBD 3CXCU 1Z5VA 2RDCA 3RYCB 4B7EA 3A0BZ 1ENVA 1SZXA 5B66Z 3ZMZA 4GYCB 2JGUA 4W4KA 3RYFA 4UCRA 1P7GA 1NTZH 2H3OA 4I4TB 3HKBA 2GTAA 2RMKB 1QLEB 1JQ0A 3SYQA 1PM9A 1RSOA 2EX3A 5LMUB 3B77A 2DYSC 4J10A 1SERA 2IJIA 4UVBA 1ZAUA 1OCCB 3GB7C 4JYAB 1MOFA 1FXKB 1URFA 4FLXA 3ML0A 1FXKC 1WP8A 3T1YO 1VQ5V 3OD4A 2CTQA 3CCEV 4UB6Z 4JI4B 3AK3A 2C2AA 1K97A 3FFQA 1WNSA 5CBFA 2Y69B 2QGNA 1FD9A 1D5AA 3FB5C 2F93B 1W0KG 4DR4O 1BSMA 1R6KA 2EIJB 4X66B 1JX9A 2UUAO 3ABMB 4O2BB 5CBHA 3F7YC 2BOCC 4LC1A 3G71V 4BW5A 2YEVA 4JV5B 3R66A 3OGCC 2RCVA 1OCRB 1F4NA 1XMOO 3G80A 3HKCB 2WPDG 2D3OW 1Q6HA 1J5EB 2WLLA 3T1YB 2UXXA 1NVPD 2MK3A 4AILC 1GM7A 5ITZB 4RUEA 4LCUC 4H0LB 3CRRA 2HHHO 3ZJZA 4JF3A 3T1CA 5EZYB 3B8NA 2FTKA 5C8YB 1F23A 3K5MA 2F95B 1FS0G 2OCCB 3NR7A 3SJQC 3ASNB 5JH7A 3G67A 3H1LH 4K3AA 3FB7C 1GN2A 2Y4UA 2FYUH 3ZHTA 3CYOA 5B1NA 2WLIA 1V54B 1SQXH 4OX9O 3ABKC 1MZFA 3RYIB 4YXWG 1AI7A 5JJEB 3AEIA 4EFBA 2UXBO 3W7XA 1XMOB 4PDMA 2HKOA 1SQVH 4H37A 3RGBA 2CTWA 3CJHB 3JASB 4DRXA 2Q7GA 2IU3A 1NVPB 1VARA 4FFBA 3EVKA 3HPLC 3VQXA 2XASA 2HHHB 1FFXA 2AXTZ 1TGOA 2O57A 1B06A 3E22A 2HFEC 2EINC 1SETA 1N34B 2UU9B 5GW7A 3BY6A 1RM1C 1Y6XA 1US6A 4TOIA 4LWSB 1PV0A 4DR3B 3DC5A 1U96A 2CUGA 4Z2WA 3K5OA 1H2LA 2EILB 3KKYA 4H44B 3W7TA 3T1HB 2UXBB 1S5LZ 3QF7A 2WA4A 4JTDB 4QGPA 4F4LA 5IJ0A 1B04A 4NYKA 1VQPV 2R9RB 1UFIA 4U3JA 4J9ZB 4PV1B 3F7VC 2VQFO 1KMIZ 5B1BC 2PZSA 2E5LB 1MSWD 1GKFA 1JMKC 2DWEC 1S0VA 3T2MA 1K3EA 3CCUV 2P6JA 2JDIG 4DR7O 4JI0B 4X65O 2QWNB 4LF4B 3X2QC 3T4DA 4JI6O 5EYPB 3W7UA 4ABMA 1UPGA 3E8FA 4IL6Z 4N21A 4JI2O 4JAAA 4XDLA 4FLZA 5FLXN 1YDXA 3K04A 3DGEA 4TT3G 4KP4A 3TK1A 1PD3A 3K5LA 4QPJA 2ZDIC 2XT9A 2DYRB 4DR1O 2JGDB 4HNAB 1GAXA 4X1IA 3KCYA 5KX5B 5CA1B 1VQ9V 5J2TA 1OHHG 2VQFB 2A7WA 4K35A 2QM7A 4DV6O 2DN9A 2ZINA 1S72V 1NS1A 3C3SA 4HAMA 4I0XB 4J7ZA 2PI5A 3E8BA 3G6BA 2ITCC 4ZOLA 1R6TA 1P49A 3ABLC 4TWKA 2P22C 3CX5F 3CPWU 5BY1A 1BQZA 4N23A 4UUJC 4QPKA 3ZEDA 2ZXWB 3ASOB 2ADQB 3ZRVA 2Y48A 4LFCB 2Z3YA 4UB8Z 3DTUB 3D8CA 3ETGA 1WA8B 2IJJA 4DR5O 2Q5ZA 2Q7HA 3N2GA 4TV9B 3MHHC 1N32O 2HJDA 3WB2A 4DUYO 4X20A 1H2GA 3BA8A 5D5QA 1QVFU 1XDCA 4DV6B 3RYHA 2YS8A 3WU2Z 1VF7A 2LJ2A 1Y74B 5CB4A 1VQKV 3H1HH 5AG2A 1VEWA 2Y0PA 1EBOA 3THOA 1R73A 1N4CA 1HNXO 2PYJA 1OZ0A 4X62O 1BHBA 3D36C 3BAAA 1BQ0A 3QNEA 4TUYA 1QQCA 4I55A 3A0RA 2FKXA 4X8AA 1AI4A 1TA8A 4NKGB 4I50B 3K0GA 1E1RG 5FPRA 2GUZA 3LNNA 2Q6AA 3IGAC 2F1MA 5L3DA 1BCCH 1G4YB 3ZHVA 5B3SB 4Q6GA 1XNRB 1X4TA 5CA0B 1T5EA 4MS2A 3QG5A 1FXVA 4DV7O 5LXTB 4MVSA 1XNQB 3HKEB 1HR0B 1R3LC 1NZ6A 2PYLA 2KB1A 3BFRA 1MA1A 1U97A 4X62B 5BMVA 1TUBA 4LH7A 3E35A 4X64B 1O9HA 5LHGA 1V55B 2GHYA 3SR2C 2KSDA 3CRMA 5IYZB 3FKSG 1QBZA 1SQPH 1X59A 1ZSPA 2VRZA 4MVQA 3UM7A 2ZR2A 5LOVA 3ZHQA 4MTOA 4H13B 1QR8A 4WFBV 2IW5A 4DV1B 1GTOA 2Y0IA 1NR1A 4ASUG 1GMGA 2XTAA 2IU0A 1YSCA 1DF5A 2BTQA 2ITDC 5LMNB 3JARA 1Y76B 4AQYB 4G2KA 1DK1A 2B1GA 3W7WA 3SJCC 1IURA 2ZT9B 3BEHA 1JVMA 3OW2U 1NTKH 3C3TA 4DV5O 1KU9A 2BOBC 5IY5C 4YJ3A 5EBLC 4L8JA 1ORQC 4KXRA 2HEPA 2JEXA 3BPZA 4YJ2A 5KHHA 1Q7YW 2QTSA 1N33O 1EN4A 3UQ8A 2HVJC 4OPHA 4O2AA 3OMIB 1Q5OA 2KG7B 3E8GA 1PP9H 3E86A 4QIWF 4ZBMA 5KUKA 4DV3B 4K8XA 2QWOB 4YIPA 5DN6G 2DOSA 1FAFA 3L71H 4R8CA 2VS0A 4JI5B 4LWSA 3P30A 4GX0A 1WB8A 4DV0O 3BHPA 2QEXV 4FIPC 4MVMA 5KA5A 4MVUA 3M7MX 4LF7O 4J11A 5EBMC 2WA3A 3CHXA 3QO8A 5H6RA 2P5OA 2W6IG 2YSUB 2Q73A 3KG2A 4DXWA 5LP6C 4EB6A 4BWAA 1N33B 3F5WC 1D2DA 4D6TH 4O4IA 2N04A 2YUAA 4IYHA 1P84F 2H94A 1ZUQA 1KB9F 1SRYA 2IM9A 3HR0A 4MTGA 2CTPA 3BVOA 1HP8A 3B40A 4FPPA 4I5SA 1JR9A 5LMUO 1KECA 3ETEA 3P3PA 3N2KB 5L3FA 1IX9A 1K5QA 2CDYA 2E75B 4JYAO 2ZDIA 4TV8A 4UV8A 4CZZA 3RVZA 3SPHA 1K34A 3AG3B 4PA6A 4RAIA 1Z5WA 4JI4O 3BRCA 3SJBC 4PI0A 2QA4V 2XAGA 4NVPA 4C7UA 4PDVA 2LGQA 4TSFG 1LUVA 1BT8A 1OJHA 2X6BA 3APQA 2PTMA 2ZR3A 2YXYA 5LGTA 1BS3A 2E76B 3ABUA 2EJ7A 4AHCA 4KUMA 4XBFA 2CE4A 2Q69A 4WBNA 1W0JG 4X66O 2AZ0A 1QLEC 4Q20A 4LFAO 2BCCH 2IJKA 1ZWIC 3TCUA 4JV5O 3R65A 5A2QN 4NB5A 1THZA 4UVAA 4JI7B 3RVYA 5KHGA 4IIJA 1KP3A 1AROP 3AG4B 2Q68A 4R6ZA 1OCCC 3ZN1A 1J5EO 4B7KA 3NXSA 5KMGB 3K59A 3B2EE 1GRJA 1S3JA 2QKSA 4HBNA 4O4HA 4LF5B 3FYEB 3LSUA 3LDCA 3LUTB 3ZCCA 4X1KB 2CH7B 2ZE8A 3OT7A 4LF6O 1I5YA 1WN7A 4MVRA 3S3XA 2Y69C 3A0HZ 5HFMA 2ETNA 1YITV 1ROPA 2N74A 1KC8W 2LFSA 3MHSC 1Y4MA 1TVKA 1H38A 2JJ1G 4X1YB 5BZBA 3RN4A 4O4JA 4O4LB 2EIJC 2ZIOA 5LHIA 4P30A 1XI1A 4LFAB 3D36A 2IJHA 3ABMC 1YTFD 2XHBA 4WCEV 1EZVH 3OTFA 2Z0AA 1OCRC
chains in the Genus database with same CATH topology
2FB5A 4FZ1A 4NTXA 4NTYA 2QTSA 4NTWA 4FZ0A 4NYKA 2L35A 3S3XA 3IJ4A 3N27A 1WP8A 3S3WA 1WP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FB5 A;  4FZ1 A;  4NTX A;  4NTY A;  2QTS A;  4NTW A;  4FZ0 A;  4NYK A;  2L35 A;  3S3X A;  3IJ4 A;  3N27 A;  1WP8 A;  3S3W A;  1WP7 A; 
#chains in the Genus database with same CATH topology
 3TGU H;  1NTM H;  5IJ9 A;  3RFR A;  3EHB B;  5J2U B;  2LFR A;  3ICX A;  1IBL B;  1YZB A;  2JK5 C;  1VIB A;  2CTR A;  1XEQ A;  1N8R W;  2HJF C;  3E83 A;  3WG7 B;  3RBZ A;  2PUS A;  2DWD C;  1SA0 A;  3UT5 A;  4MVZ A;  1O9G A;  4LF6 B;  1Q81 W;  2LW1 A;  4UCO A;  4PI2 A;  5JCO C;  2P06 A;  1NT2 B;  1W2B U;  1N34 O;  2UU9 O;  1H2S B;  3CC7 V;  3H1J H;  2LW7 A;  2OCC C;  1XBL A;  2RN9 A;  3IAY A;  3IC7 A;  3ASN C;  4DR3 O;  3B8M A;  3F5T A;  3IFX A;  3K79 A;  4F6R B;  1VQL V;  4X9Q A;  4NR1 A;  1V54 C;  3L70 H;  5GTH Z;  3SPI A;  3T1H O;  2DMX A;  2EIK B;  3HKD B;  2BSK B;  3JD1 A;  5JVD A;  1W59 A;  3JD3 A;  5JQG B;  1R1B A;  2OTL V;  1H2N A;  4LFB B;  1RPR A;  4OXS A;  4NXM B;  1KKC A;  3CRQ A;  3K06 A;  2E5L O;  2EZO A;  3FB8 C;  1N36 B;  3AG1 B;  1AI6 A;  2XND G;  1WAZ A;  5LYJ A;  1MMM A;  3JAK B;  3ZRW A;  4D7T A;  1XHZ A;  4JI0 O;  1I5X A;  1BGY H;  1GH6 A;  5KAI Z;  3J80 N;  2HVK C;  4J80 A;  4LF4 O;  4FM2 A;  1L1F A;  1M93 A;  2JEU A;  3JAW A;  4TQF A;  4ZHQ A;  2V7Q G;  3P3N A;  2KKW A;  4LF9 O;  3JSL A;  4RUF A;  4DW1 A;  2ODM A;  4MTF A;  1M1K W;  2WLN A;  4FVM A;  2EIL C;  3PN1 A;  1FYJ A;  1MNG A;  4LNU B;  1VQ4 V;  1G8M A;  4IHJ B;  4JZG A;  5B5E Z;  2WWW A;  4KFM A;  1COW G;  3CWB H;  3EXA A;  1JFF B;  3GWO A;  5EIB C;  3JAT A;  4DV2 O;  4DR2 B;  2NLJ C;  2OIE A;  4DR6 O;  4G28 B;  4B08 A;  1Q86 W;  1ZL8 A;  1K4C C;  1K92 A;  3SPC A;  4CS3 A;  4MVO A;  1HNZ B;  2F43 G;  1QLN A;  3ZHU A;  1VP7 A;  2XAJ A;  2ARH A;  3Q4H B;  5GON A;  2D2C B;  2QR4 A;  1WLE A;  1AVM A;  4PA4 A;  1R3I C;  3CCJ V;  3FAV A;  4LF9 B;  4FZ0 A;  5LGU A;  2ZE6 A;  4YIO A;  2L6L A;  5DM6 V;  5LP6 A;  3M8A A;  4LFC O;  2PI4 A;  1K5S A;  5KAF Z;  3ABT A;  4PDL A;  2ZCE A;  4DV4 B;  1SQG A;  1LR1 A;  4B3R O;  2DYR C;  2M6Y A;  4J9Y B;  4P9P A;  2HLD G;  1JPX A;  1QR9 A;  2EUL A;  4DW0 A;  2JVD A;  2V4D A;  3UCS C;  4DV2 B;  1F51 A;  3DXR B;  5H2F Z;  4MW8 A;  3CCL V;  4DR6 B;  3JAL A;  2V1D A;  5L3E A;  3J7A U;  4NXN B;  4QE9 A;  2NNU A;  1OCO B;  3JCU Z;  1S5H C;  3KZI Z;  2UXC B;  1BE3 H;  2B5U A;  1JJ2 U;  5FNV A;  4W4L A;  4TQD A;  3D3I A;  2Q0O C;  3RYF B;  1FPO A;  2XUM A;  3U0Z A;  4GZR B;  1AJQ A;  3JCZ A;  3HKB B;  1M57 B;  1WB7 A;  2P90 A;  4MW3 A;  2ZXW C;  3ASO C;  3RYC A;  1IXB A;  4CH3 A;  1F4M A;  4JI8 B;  1RSO B;  2OTJ V;  4B3R B;  4JZ2 A;  1MSD A;  1Q90 D;  3ZRS A;  2DW4 A;  4F6E A;  5LGN A;  4I4T A;  2W6J G;  4LF8 B;  1YF2 A;  3CCV V;  1XMQ B;  4I7Z B;  3LDD A;  3SPJ A;  1VQ8 V;  1XNR O;  5JJJ B;  4UV9 A;  3IJ4 A;  3ZHR A;  3S3W A;  4K0K B;  2A0L A;  3CP1 A;  1XNQ O;  1HR0 O;  2OIG A;  1AP6 A;  3I56 V;  2JJ2 G;  2QWQ B;  1HNW O;  3OMN B;  1PNM A;  1VQ7 V;  5IT9 N;  1FXK A;  1NR7 A;  3J81 N;  1BMF G;  2E74 B;  2B1I A;  3K08 A;  4J41 A;  4X64 O;  4PA3 A;  4YY3 O;  4JGS A;  1YHQ V;  2QDO A;  1ZLZ A;  2CH7 A;  1N0J A;  3K9A A;  1I0H A;  3FX7 A;  1GN4 A;  2YEV B;  5LHH A;  1SQB H;  4PJ0 Z;  4MTX A;  1AR5 A;  4DV1 O;  5B3S C;  4O2B A;  5LMN O;  2NR5 A;  2WLL B;  3DC6 A;  3K3W A;  3SJA C;  4AQY O;  3A8T A;  4EFE A;  1NH2 D;  5DED A;  1HNW B;  2P7T C;  1VQ6 V;  2KQX A;  1BZK A;  4ICG A;  4NTY A;  3HKC A;  5HFL A;  4XDJ A;  3ZIA G;  3K03 A;  1D5N A;  3D3Q A;  1CP9 A;  5KUM A;  4YHH O;  1SC5 B;  1RP3 B;  2WLM A;  4YY3 B;  4LH6 A;  4BR6 A;  1HDJ A;  4CS2 A;  5JH7 B;  3SYA A;  4UCT A;  5ITZ A;  1VF6 C;  4UXN A;  1SZT A;  2GV9 A;  3CXH F;  4GX2 A;  5JCO A;  2Q4P A;  1V55 C;  3OEE G;  2WLI B;  3H1I H;  2F23 A;  5EZY A;  3TXQ A;  2VQE B;  4DV3 O;  2YI9 A;  4FJC C;  5C8Y A;  1K8A W;  1NBM G;  1KBH A;  4BIZ A;  2EBO A;  3OM3 B;  2R9I A;  4JI5 O;  1FJG B;  3U11 A;  3VOU A;  4GLX A;  3RYI A;  3JD0 A;  4DRX B;  1GN3 A;  2WLH A;  4PHZ A;  2FL4 A;  1B6Q A;  3MD0 A;  3CS5 A;  4FFB B;  5GTI Z;  1QHT A;  2JRI A;  1FFX B;  1H2M A;  1PNL A;  3OR7 C;  2CGO A;  3E22 B;  4YHH B;  3UKM A;  3CJH A;  3JAS A;  2BE3 A;  1Z2G A;  3H01 A;  4UCV A;  5H9C A;  1H8H G;  1L8D A;  3BA9 A;  1M56 B;  2DQ0 A;  4B3M B;  3B4S A;  2GSM B;  1BL8 A;  1FXH A;  1WPX A;  3OE7 G;  3JD4 A;  3PJS K;  1RPO A;  2X7R B;  1I94 B;  3HB3 B;  1NU1 H;  3WFV A;  4FLU A;  4X89 A;  1A32 A;  2R72 A;  5IJ0 B;  2PF4 E;  2L35 A;  1GM8 A;  4U3J B;  3JSN A;  5TIS Z;  2Q9L A;  3ZHS A;  3APO A;  2LO1 A;  5EC1 C;  1AJN A;  4IHJ A;  5K1P A;  2XAF A;  1AB3 A;  4QE7 A;  1UJW B;  4I9W A;  3IC9 A;  1IZ3 A;  1HWY A;  1IBM O;  2HR3 A;  5L3G A;  1M9N A;  4E2L A;  3KCX A;  4UVC A;  1PL4 A;  2K1E A;  2ZNI A;  3K0D A;  2ZE7 A;  5B1O A;  5JWP A;  3VQV A;  2ZKO A;  3CC4 V;  5EYP A;  4U7N A;  2B9Z A;  2GTS A;  3H1K H;  5LA6 B;  2PGG A;  4K8Z A;  1KYO F;  4X1I B;  3O65 A;  4JI7 O;  4B3T O;  1PPJ H;  5J2T B;  1SQQ H;  4JTC B;  4P9O A;  2GDS A;  1VQN V;  2JIZ G;  2Q8V A;  2JGD A;  3VQW A;  3AG3 C;  4OPA A;  4HNA A;  4LF5 O;  5KX5 A;  5CA1 A;  3CB2 A;  4IYI A;  1K9M W;  1IBM B;  3H9V A;  4ZOL B;  3LDE A;  4Z1M G;  2UUB B;  2QM8 A;  3SYP A;  5JJN B;  4JYY A;  1GK9 A;  4I0X A;  3ZMS A;  1VMG A;  3BAB A;  3E89 A;  2A06 H;  3N2G B;  3CCR V;  5KHI A;  3AK2 A;  3B09 A;  5BR8 B;  1WP7 A;  2R9A A;  5B1A B;  4CS4 A;  5B1A C;  4X20 B;  5FPO A;  4B3T B;  3OR6 C;  2QSA A;  4AI8 A;  1WA8 A;  3TJT A;  1Y67 A;  3RYH B;  1IBL O;  4GKK B;  1SS3 A;  3AG4 C;  2ZM6 O;  4TV9 A;  4BAY A;  5CB4 B;  5IWA B;  1HW7 A;  2DYS B;  2F66 C;  3CCS V;  4HZ3 A;  1VQM V;  4DUZ O;  1K73 W;  1EN5 A;  1FFT B;  3E8H A;  4ZIB A;  4HYO A;  4B3S B;  1B3Q A;  1Y74 A;  2K9P A;  3K5N A;  4TUY B;  1R3K C;  4I55 B;  4CC5 A;  4XDK A;  5KA6 A;  1M90 W;  1M4U A;  1K4D C;  4FFK A;  1F7Y A;  2OWO A;  5BXZ A;  5IYD O;  4GX5 A;  3EFF K;  2OCH A;  2WSS G;  3C90 A;  4J7J A;  1WJZ A;  2Q7E A;  3SYC A;  2GUZ B;  2ZNJ A;  3CE2 A;  2LP7 A;  2F4V O;  1KKD A;  3CRA A;  2X6A A;  2QE7 G;  4I50 A;  4GKJ O;  4LFB O;  5IE9 A;  3CD6 V;  3ZX6 A;  5IYB O;  2ZM6 B;  2Y4T A;  3VBB A;  1YJ9 V;  1JCH A;  4NXM O;  2ATK C;  3LSQ A;  1GN6 A;  2YDE A;  3LSS A;  4ZI7 B;  4DUZ B;  4GUN A;  3WG7 C;  1KQS U;  1N36 O;  4MT8 A;  5CA0 A;  3ZN0 A;  4PA9 A;  2RNB A;  4FZ1 A;  5BMV B;  1TUB B;  1XL4 A;  5LXT A;  1E1Q G;  3HKE A;  3ETQ A;  4CH4 A;  4PDR A;  1AJP A;  3CRC A;  1NI8 A;  2LGW A;  3GWK C;  4RWU A;  2BTO A;  4FLV A;  3OUF A;  1YTF B;  2F4V B;  5H5N A;  1VF6 A;  2DJV A;  2Z5U A;  1GO3 F;  2EIK C;  5LOV B;  4DR4 B;  1EN6 A;  4RO2 A;  4GKJ B;  1XIL A;  3OAA G;  2UUA B;  1N0N A;  1DLB A;  3ABK B;  5IYZ A;  2BTQ B;  3FD9 A;  3JAR B;  3JAM N;  4DR2 O;  4QNH B;  4FK5 C;  3CMA V;  1JJO A;  1DGS A;  4CBC A;  3ZMV A;  1BHA A;  1DTO A;  1AR4 A;  3I5D A;  3A2F A;  1HNZ O;  4R7C A;  5EIB D;  3AG1 C;  1SQF A;  2A9H A;  5CA3 A;  4YJ3 B;  1Y76 A;  3OMA B;  4IT5 A;  1OCZ B;  1P7B A;  5KHJ A;  4YJ2 B;  2EZP A;  1OCZ C;  3QO5 A;  1S76 D;  2ADP A;  1YIJ V;  1P4R A;  4O2A B;  1XL6 A;  2P4V A;  1IVS A;  3ZS8 C;  3O9O A;  4OGQ B;  2EIN B;  2M7W A;  1RM1 B;  4DV4 O;  1SKV A;  5J9P C;  1Q6I A;  3RWR D;  5IDJ A;  1WPB A;  3OUS A;  2QWP B;  5IYC O;  1YI2 V;  2IH3 C;  5E1A C;  2QJ1 A;  2KG7 A;  4OX9 B;  4NTX A;  2UUC O;  2HP8 A;  1RFY A;  3CC2 V;  2WAM A;  3P32 A;  5CMU A;  3LNM B;  3ZMU A;  4NXN O;  2YI8 A;  1NKD A;  1EM1 A;  2WLJ A;  4WFE A;  5KLV H;  3WB1 A;  3AG7 A;  1KD1 W;  1AIL A;  2QKA A;  2OYQ A;  3E2E A;  5KHK A;  2UXC O;  1IXM A;  4EB6 B;  3K57 A;  3JD2 A;  4JAS A;  2W0F C;  5B1B B;  3VQY A;  1AR1 B;  4MSW C;  5EBW C;  2YIA A;  2YIC A;  4O4I B;  4GT1 A;  3N27 A;  1I08 A;  1E79 G;  2RQ6 A;  4UFZ A;  3ETD A;  1JA8 A;  2A3Q A;  4WFG A;  1GM9 A;  1EFR G;  1YVW A;  3X2Q B;  4LBE C;  4JI8 O;  1XUQ A;  1ZX3 A;  5L3C A;  2ZE5 A;  4JI3 O;  1MG1 A;  5E79 Z;  1Q3E A;  2YID A;  4LF8 O;  4FM0 A;  3FYI B;  1XMQ O;  5CBG A;  4FLY A;  2UUC B;  3AG2 B;  3SGI A;  3QTC A;  4TV8 B;  4K0K O;  3AK1 A;  3AG2 C;  4U7O A;  1IBK O;  2DQ3 A;  2RJZ A;  3MDS A;  2P4K A;  3CSX A;  4BIO A;  3N2K A;  5LA6 A;  4JAV A;  3G6E V;  4LR3 A;  1YEW A;  3STL C;  1L0L H;  1OCO C;  1DF4 A;  4A5U B;  1YXB A;  3L72 H;  3K58 A;  2JS5 A;  4G27 B;  4PD4 F;  2AGA A;  4WBN B;  1IDS A;  1KP2 A;  2CK3 G;  4DR7 B;  1M57 C;  1MAB G;  2HG5 C;  4X65 B;  3ABL B;  1H8E G;  1M5I A;  2UXD O;  3K9S A;  4JI6 B;  1EZJ A;  4JI3 B;  3CCM V;  1OV9 A;  4JI2 B;  4KL1 A;  1MZE A;  3JYC A;  1I7F A;  4RQE A;  3STZ C;  4IIJ B;  2VWK A;  4E4E A;  1IBK B;  3L74 H;  3ZMT A;  4DR1 B;  1Y66 A;  2NN4 A;  4CC6 A;  4O4H B;  1PNK A;  4DYL A;  4U3F H;  3L9D A;  4DO2 A;  2W0X A;  1CXZ B;  2MW2 B;  4L87 A;  5KMG A;  5FL7 G;  1QVG U;  4JAU A;  3ZRX A;  1PL0 A;  4X1K A;  1TVK B;  1R3J C;  3TXS A;  2YIB A;  1V9P A;  4O4J B;  1AP5 A;  2UXD B;  5LL6 Y;  2VQE O;  1YCI A;  1CPY A;  4KHP O;  2AW9 A;  3QO7 A;  5A9G A;  1XHX A;  4X1Y A;  3RW0 A;  3L75 H;  3ZBH A;  1FJG O;  2IBZ H;  4GX1 A;  5LBQ A;  4BIU A;  5IJ9 B;  3GVM A;  4NTW A;  4O4L A;  1LNQ A;  4DR5 B;  2AHZ A;  2AZ2 A;  3CCQ V;  3W7S A;  5L3B A;  1N32 B;  1SF9 A;  4IGG A;  4JI1 O;  3I55 V;  4DUY B;  2Q0A A;  1KUQ A;  1LUW A;  1NQT A;  1SA0 B;  2EJR A;  3RT3 C;  4LP8 A;  3UT5 B;  2OT5 A;  3CEI A;  5J2U A;  3M99 B;  1QU7 A;  1TUE B;  2X0L A;  4R50 A;  4ZI7 A;  3UO3 A;  2FB5 A;  1VF5 B;  1HNX B;  4B3M O;  4ZKI A;  2YXL A;  3T4Z A;  5D5P A;  4CH5 A;  5F2V O;  3G4S V;  2PY5 A;  1I94 O;  4RQF A;  4KHP B;  2YXH A;  2CAZ C;  5JVD B;  2EIM B;  2ZQM A;  4FLW A;  4WF9 V;  4WFA V;  3OEH G;  4F6R A;  4P2Z A;  2EIM C;  3U10 A;  1TAE A;  5EC2 C;  4FMT A;  1NH2 B;  2Q67 A;  4WFF A;  4JI1 B;  4WFH A;  3HKD A;  2BSK A;  2XAH A;  3SYO A;  5JQG A;  1J95 A;  3SPG A;  1AI5 A;  4DV7 B;  5LYJ B;  3ZRW B;  5DEC A;  3MAQ A;  5K1X A;  3QVN A;  1YJW V;  3JAW B;  4ZHQ B;  3UO2 A;  3FB6 C;  5IY5 B;  1M56 C;  3JAK A;  1YJN V;  1PKX A;  4EKW A;  2A79 B;  1Q82 W;  2R70 A;  1Q6U A;  2DE0 X;  4DK1 A;  1Q43 A;  1ZTE A;  2N05 A;  4J7K A;  2YC0 A;  2ILM A;  4EEQ A;  1XRE A;  3JAT B;  4JYB A;  2WLK A;  3OGI B;  3DSQ A;  4LNU A;  1SES A;  2IH1 C;  4GCZ A;  1ZL8 B;  4JTA B;  3OTO O;  3L73 H;  4DK0 A;  1XQ8 A;  1JFF A;  1G1X B;  2QKC A;  2QM4 A;  4X88 A;  2UXN A;  5GON B;  1S77 D;  2UUB O;  1VQO V;  2ZIM A;  4UCS A;  2P67 A;  4I9Q A;  4PEL A;  3FAV B;  4DV5 B;  5EK0 A;  3CME V;  5LP6 B;  5CN0 A;  1Q8I A;  2G38 A;  4BW9 A;  1CEZ A;  2AHY A;  2XAQ A;  3Q4H A;  4JPR A;  3WB0 A;  2ZD9 A;  4D7S A;  1G6U A;  5BR8 O;  2FML A;  4Z1V A;  1NJI W;  3TET A;  4PA7 A;  2E3C A;  1FKA O;  3BCC H;  2QTO A;  4UCU A;  4QJF B;  3SDL A;  4GKK O;  4JYC A;  1K7D A;  3JAL B;  3OFN G;  5IWA O;  3OTO B;  1S5J A;  4DV0 B;  4CH6 A;  5H6Q A;  1QNM A;  1JOY A;  2LQT A;  2X6C A;  4H33 A;  2JS3 A;  3DXR A;  2GBO A;  5FNV B;  1H2K A;  1L0N H;  4LF7 B;  4B3S O;  2CGN A;  4FM1 A;  2H8P C;  4FLT A;  5C93 A;  2VWJ A;  2XOK G;  1XOU A;  4J42 A;  1R6N A;  2QWR B;  1QCE A;  1K33 A;  2YIB D;  3CXC U;  1Z5V A;  2RDC A;  3RYC B;  4B7E A;  3A0B Z;  1ENV A;  1SZX A;  5B66 Z;  3ZMZ A;  4GYC B;  2JGU A;  4W4K A;  3RYF A;  4UCR A;  1P7G A;  1NTZ H;  2H3O A;  4I4T B;  3HKB A;  2GTA A;  2RMK B;  1QLE B;  1JQ0 A;  3SYQ A;  1PM9 A;  1RSO A;  2EX3 A;  5LMU B;  3B77 A;  2DYS C;  4J10 A;  1SER A;  2IJI A;  4UVB A;  1ZAU A;  1OCC B;  3GB7 C;  4JYA B;  1MOF A;  1FXK B;  1URF A;  4FLX A;  3ML0 A;  1FXK C;  1WP8 A;  3T1Y O;  1VQ5 V;  3OD4 A;  2CTQ A;  3CCE V;  4UB6 Z;  4JI4 B;  3AK3 A;  2C2A A;  1K97 A;  3FFQ A;  1WNS A;  5CBF A;  2Y69 B;  2QGN A;  1FD9 A;  1D5A A;  3FB5 C;  2F93 B;  1W0K G;  4DR4 O;  1BSM A;  1R6K A;  2EIJ B;  4X66 B;  1JX9 A;  2UUA O;  3ABM B;  4O2B B;  5CBH A;  3F7Y C;  2BOC C;  4LC1 A;  3G71 V;  4BW5 A;  2YEV A;  4JV5 B;  3R66 A;  3OGC C;  2RCV A;  1OCR B;  1F4N A;  1XMO O;  3G80 A;  3HKC B;  2WPD G;  2D3O W;  1Q6H A;  1J5E B;  2WLL A;  3T1Y B;  2UXX A;  1NVP D;  2MK3 A;  4AIL C;  1GM7 A;  5ITZ B;  4RUE A;  4LCU C;  4H0L B;  3CRR A;  2HHH O;  3ZJZ A;  4JF3 A;  3T1C A;  5EZY B;  3B8N A;  2FTK A;  5C8Y B;  1F23 A;  3K5M A;  2F95 B;  1FS0 G;  2OCC B;  3NR7 A;  3SJQ C;  3ASN B;  5JH7 A;  3G67 A;  3H1L H;  4K3A A;  3FB7 C;  1GN2 A;  2Y4U A;  2FYU H;  3ZHT A;  3CYO A;  5B1N A;  2WLI A;  1V54 B;  1SQX H;  4OX9 O;  3ABK C;  1MZF A;  3RYI B;  4YXW G;  1AI7 A;  5JJE B;  3AEI A;  4EFB A;  2UXB O;  3W7X A;  1XMO B;  4PDM A;  2HKO A;  1SQV H;  4H37 A;  3RGB A;  2CTW A;  3CJH B;  3JAS B;  4DRX A;  2Q7G A;  2IU3 A;  1NVP B;  1VAR A;  4FFB A;  3EVK A;  3HPL C;  3VQX A;  2XAS A;  2HHH B;  1FFX A;  2AXT Z;  1TGO A;  2O57 A;  1B06 A;  3E22 A;  2HFE C;  2EIN C;  1SET A;  1N34 B;  2UU9 B;  5GW7 A;  3BY6 A;  1RM1 C;  1Y6X A;  1US6 A;  4TOI A;  4LWS B;  1PV0 A;  4DR3 B;  3DC5 A;  1U96 A;  2CUG A;  4Z2W A;  3K5O A;  1H2L A;  2EIL B;  3KKY A;  4H44 B;  3W7T A;  3T1H B;  2UXB B;  1S5L Z;  3QF7 A;  2WA4 A;  4JTD B;  4QGP A;  4F4L A;  5IJ0 A;  1B04 A;  4NYK A;  1VQP V;  2R9R B;  1UFI A;  4U3J A;  4J9Z B;  4PV1 B;  3F7V C;  2VQF O;  1KMI Z;  5B1B C;  2PZS A;  2E5L B;  1MSW D;  1GKF A;  1JMK C;  2DWE C;  1S0V A;  3T2M A;  1K3E A;  3CCU V;  2P6J A;  2JDI G;  4DR7 O;  4JI0 B;  4X65 O;  2QWN B;  4LF4 B;  3X2Q C;  3T4D A;  4JI6 O;  5EYP B;  3W7U A;  4ABM A;  1UPG A;  3E8F A;  4IL6 Z;  4N21 A;  4JI2 O;  4JAA A;  4XDL A;  4FLZ A;  5FLX N;  1YDX A;  3K04 A;  3DGE A;  4TT3 G;  4KP4 A;  3TK1 A;  1PD3 A;  3K5L A;  4QPJ A;  2ZDI C;  2XT9 A;  2DYR B;  4DR1 O;  2JGD B;  4HNA B;  1GAX A;  4X1I A;  3KCY A;  5KX5 B;  5CA1 B;  1VQ9 V;  5J2T A;  1OHH G;  2VQF B;  2A7W A;  4K35 A;  2QM7 A;  4DV6 O;  2DN9 A;  2ZIN A;  1S72 V;  1NS1 A;  3C3S A;  4HAM A;  4I0X B;  4J7Z A;  2PI5 A;  3E8B A;  3G6B A;  2ITC C;  4ZOL A;  1R6T A;  1P49 A;  3ABL C;  4TWK A;  2P22 C;  3CX5 F;  3CPW U;  5BY1 A;  1BQZ A;  4N23 A;  4UUJ C;  4QPK A;  3ZED A;  2ZXW B;  3ASO B;  2ADQ B;  3ZRV A;  2Y48 A;  4LFC B;  2Z3Y A;  4UB8 Z;  3DTU B;  3D8C A;  3ETG A;  1WA8 B;  2IJJ A;  4DR5 O;  2Q5Z A;  2Q7H A;  3N2G A;  4TV9 B;  3MHH C;  1N32 O;  2HJD A;  3WB2 A;  4DUY O;  4X20 A;  1H2G A;  3BA8 A;  5D5Q A;  1QVF U;  1XDC A;  4DV6 B;  3RYH A;  2YS8 A;  3WU2 Z;  1VF7 A;  2LJ2 A;  1Y74 B;  5CB4 A;  1VQK V;  3H1H H;  5AG2 A;  1VEW A;  2Y0P A;  1EBO A;  3THO A;  1R73 A;  1N4C A;  1HNX O;  2PYJ A;  1OZ0 A;  4X62 O;  1BHB A;  3D36 C;  3BAA A;  1BQ0 A;  3QNE A;  4TUY A;  1QQC A;  4I55 A;  3A0R A;  2FKX A;  4X8A A;  1AI4 A;  1TA8 A;  4NKG B;  4I50 B;  3K0G A;  1E1R G;  5FPR A;  2GUZ A;  3LNN A;  2Q6A A;  3IGA C;  2F1M A;  5L3D A;  1BCC H;  1G4Y B;  3ZHV A;  5B3S B;  4Q6G A;  1XNR B;  1X4T A;  5CA0 B;  1T5E A;  4MS2 A;  3QG5 A;  1FXV A;  4DV7 O;  5LXT B;  4MVS A;  1XNQ B;  3HKE B;  1HR0 B;  1R3L C;  1NZ6 A;  2PYL A;  2KB1 A;  3BFR A;  1MA1 A;  1U97 A;  4X62 B;  5BMV A;  1TUB A;  4LH7 A;  3E35 A;  4X64 B;  1O9H A;  5LHG A;  1V55 B;  2GHY A;  3SR2 C;  2KSD A;  3CRM A;  5IYZ B;  3FKS G;  1QBZ A;  1SQP H;  1X59 A;  1ZSP A;  2VRZ A;  4MVQ A;  3UM7 A;  2ZR2 A;  5LOV A;  3ZHQ A;  4MTO A;  4H13 B;  1QR8 A;  4WFB V;  2IW5 A;  4DV1 B;  1GTO A;  2Y0I A;  1NR1 A;  4ASU G;  1GMG A;  2XTA A;  2IU0 A;  1YSC A;  1DF5 A;  2BTQ A;  2ITD C;  5LMN B;  3JAR A;  1Y76 B;  4AQY B;  4G2K A;  1DK1 A;  2B1G A;  3W7W A;  3SJC C;  1IUR A;  2ZT9 B;  3BEH A;  1JVM A;  3OW2 U;  1NTK H;  3C3T A;  4DV5 O;  1KU9 A;  2BOB C;  5IY5 C;  4YJ3 A;  5EBL C;  4L8J A;  1ORQ C;  4KXR A;  2HEP A;  2JEX A;  3BPZ A;  4YJ2 A;  5KHH A;  1Q7Y W;  2QTS A;  1N33 O;  1EN4 A;  3UQ8 A;  2HVJ C;  4OPH A;  4O2A A;  3OMI B;  1Q5O A;  2KG7 B;  3E8G A;  1PP9 H;  3E86 A;  4QIW F;  4ZBM A;  5KUK A;  4DV3 B;  4K8X A;  2QWO B;  4YIP A;  5DN6 G;  2DOS A;  1FAF A;  3L71 H;  4R8C A;  2VS0 A;  4JI5 B;  4LWS A;  3P30 A;  4GX0 A;  1WB8 A;  4DV0 O;  3BHP A;  2QEX V;  4FIP C;  4MVM A;  5KA5 A;  4MVU A;  3M7M X;  4LF7 O;  4J11 A;  5EBM C;  2WA3 A;  3CHX A;  3QO8 A;  5H6R A;  2P5O A;  2W6I G;  2YSU B;  2Q73 A;  3KG2 A;  4DXW A;  5LP6 C;  4EB6 A;  4BWA A;  1N33 B;  3F5W C;  1D2D A;  4D6T H;  4O4I A;  2N04 A;  2YUA A;  4IYH A;  1P84 F;  2H94 A;  1ZUQ A;  1KB9 F;  1SRY A;  2IM9 A;  3HR0 A;  4MTG A;  2CTP A;  3BVO A;  1HP8 A;  3B40 A;  4FPP A;  4I5S A;  1JR9 A;  5LMU O;  1KEC A;  3ETE A;  3P3P A;  3N2K B;  5L3F A;  1IX9 A;  1K5Q A;  2CDY A;  2E75 B;  4JYA O;  2ZDI A;  4TV8 A;  4UV8 A;  4CZZ A;  3RVZ A;  3SPH A;  1K34 A;  3AG3 B;  4PA6 A;  4RAI A;  1Z5W A;  4JI4 O;  3BRC A;  3SJB C;  4PI0 A;  2QA4 V;  2XAG A;  4NVP A;  4C7U A;  4PDV A;  2LGQ A;  4TSF G;  1LUV A;  1BT8 A;  1OJH A;  2X6B A;  3APQ A;  2PTM A;  2ZR3 A;  2YXY A;  5LGT A;  1BS3 A;  2E76 B;  3ABU A;  2EJ7 A;  4AHC A;  4KUM A;  4XBF A;  2CE4 A;  2Q69 A;  4WBN A;  1W0J G;  4X66 O;  2AZ0 A;  1QLE C;  4Q20 A;  4LFA O;  2BCC H;  2IJK A;  1ZWI C;  3TCU A;  4JV5 O;  3R65 A;  5A2Q N;  4NB5 A;  1THZ A;  4UVA A;  4JI7 B;  3RVY A;  5KHG A;  4IIJ A;  1KP3 A;  1ARO P;  3AG4 B;  2Q68 A;  4R6Z A;  1OCC C;  3ZN1 A;  1J5E O;  4B7K A;  3NXS A;  5KMG B;  3K59 A;  3B2E E;  1GRJ A;  1S3J A;  2QKS A;  4HBN A;  4O4H A;  4LF5 B;  3FYE B;  3LSU A;  3LDC A;  3LUT B;  3ZCC A;  4X1K B;  2CH7 B;  2ZE8 A;  3OT7 A;  4LF6 O;  1I5Y A;  1WN7 A;  4MVR A;  3S3X A;  2Y69 C;  3A0H Z;  5HFM A;  2ETN A;  1YIT V;  1ROP A;  2N74 A;  1KC8 W;  2LFS A;  3MHS C;  1Y4M A;  1TVK A;  1H38 A;  2JJ1 G;  4X1Y B;  5BZB A;  3RN4 A;  4O4J A;  4O4L B;  2EIJ C;  2ZIO A;  5LHI A;  4P30 A;  1XI1 A;  4LFA B;  3D36 A;  2IJH A;  3ABM C;  1YTF D;  2XHB A;  4WCE V;  1EZV H;  3OTF A;  2Z0A A;  1OCR C; 
#chains in the Genus database with same CATH homology
 2FB5 A;  4FZ1 A;  4NTX A;  4NTY A;  2QTS A;  4NTW A;  4FZ0 A;  4NYK A;  2L35 A;  3S3X A;  3IJ4 A;  3N27 A;  1WP8 A;  3S3W A;  1WP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...