4NYKA

Structure of a membrane protein
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
414
structure length
414
Chain Sequence
b'LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acid-sensing ion channel 1
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transport protein
total genus 105
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4nykA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4nykA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4nykA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4nykA02
3N27A 2L35A 4FZ0A 4FZ1A 4NTXA 4NTYA 4NTWA 3S3XA 2QTSA 1WP8A 1WP7A 4NYKA 3IJ4A 2FB5A 3S3WA
chains in the Genus database with same CATH superfamily
3JARB 3OMIB 2MK3A 4PA4A 1QHTA 1AI7A 5GW7A 2CDYA 4EEQA 2AHYA 3IAYA 5IE9A 1TAEA 4AQYO 3OE7G 3SPGA 4LF6B 2R9IA 2W0XA 4UCUA 1JCHA 1ZLZA 1AR4A 1NTZH 5FNVA 2IW5A 2GSMB 2VWKA 1R6KA 4FFBA 3ABUA 3WG7C 5EBMC 1MMMA 4I9WA 4DR1B 4K8ZA 4FK5C 4JYAO 1OHHG 5IYZA 3W7WA 4U3FH 1HNXO 2DQ0A 2BOCC 4TT3G 4L8JA 3UQ8A 4YXWG 4HNAA 3RWRD 4LFBO 2H3OA 1MSDA 3ZBHA 4P2ZA 4X89A 2P06A 1XNRO 1Y67A 4JZ2A 3QVNA 4J9YB 1JOYA 3OR7C 4K35A 5L3EA 5KHHA 1HR0B 4IYIA 3AG1B 4UCRA 1PNMA 1WA8A 2EIMB 1Z5WA 2PF4E 3E86A 2YXYA 4B3MB 2QWNB 4C7UA 4JI6O 4X20A 3JAKA 4CH3A 4JYYA 4TV8A 1UPGA 4FLXA 1NS1A 4IT5A 4F4LA 3OFNG 4XDLA 1K7DA 4PI2A 4GX5A 1EZVH 1VQ6V 2OCCB 1ZUQA 2LFSA 5KHKA 2UXBB 1YEWA 2JS3A 2HKOA 2LFRA 3ZMVA 1IVSA 4I50A 5JWPA 2RN9A 2NN4A 1XNQB 2F93B 4DR4B 5LA6B 4RUFA 3SYAA 1J5EO 3FB7C 4D6TH 3NR7A 2JRIA 3F5WC 3FYEB 3C3TA 4B3SO 4DV3B 2ADPA 2OYQA 2ZM6B 3GB7C 2WLLA 3CHXA 4PDMA 2WWWA 4DW0A 1I08A 2KKWA 1FXVA 1OCRC 2H8PC 2AZ0A 4KHPB 1BE3H 4LCUC 3U11A 1B04A 1GM9A 2XAGA 2YI9A 3TGUH 1SZXA 1XDCA 3KZIZ 5ITZA 5EBWC 4MT8A 5K1PA 3I56V 4D7TA 3H1LH 2JJ2G 3T1HO 3CRRA 2XTAA 5L3GA 3S3WA 1DGSA 1IBKO 1R3JC 3EFFK 1VIBA 2Q67A 1KUQA 1B3QA 3IFXA 5LGTA 2F66C 4DR5B 4X8AA 2VRZA 1HW7A 4W4LA 1PNLA 1EN4A 2ZCEA 2A06H 4NXMB 4JAAA 1Q90D 1JFFA 1LNQA 2Y0PA 4YY3B 3T4DA 5JVDB 4I0XB 4WF9V 1NVPB 2LW1A 4U7OA 3TCUA 1PPJH 3L72H 5CMUA 1V54C 1WP7A 3ABMC 3DC6A 3CCMV 3MD0A 2OT5A 1YTFD 2AGAA 1RM1B 1OZ0A 3LDEA 5H6RA 4UVBA 4MVSA 2UXCO 1M93A 4I4TB 3LDCA 4UVAA 4JI5O 2E75B 2ZXWB 3JD1A 2P6JA 2UU9O 2KSDA 4GUNA 1I5YA 5CBGA 1Q5OA 4N23A 3T1YB 1YHQV 1KU9A 1N36O 2UUBO 1M57B 3DGEA 4ZIBA 5IYDO 4WBNA 3KCXA 3OTOB 4EKWA 1XNQO 3CEIA 1YJ9V 2AXTZ 4R7CA 4MTGA 3STZC 2EIKC 2DJVA 2BSKA 4JTAB 5B3SB 5B1AC 4ASUG 2ZM6O 2CTQA 1FXKB 4FLWA 2ARHA 2KG7B 5KMGB 1SS3A 2B5UA 4DK1A 3CWBH 3OGCC 4X65B 1VQ4V 4EB6B 1M56B 1OCZB 1HP8A 2Q5ZA 3OMAB 4I5SA 2W6IG 5LMUO 3ABTA 3ETGA 2HJDA 1SC5B 4G2KA 1XEQA 2X6BA 5LOVA 1VEWA 4GKJB 5JH7A 3WU2Z 4GZRB 1G8MA 2CH7A 1IXMA 3SGIA 4B08A 1SQQH 1Z2GA 2R70A 1B06A 4LFCB 5JQGA 3ZIAG 3ZRVA 2IH3C 3FX7A 2ZNJA 1A32A 4FLUA 3CJHA 3ZS8C 2A79B 2EBOA 3ZMSA 1K9MW 1BMFG 4EFEA 3TXQA 2MW2B 5F2VO 5LMNB 2NR5A 1PM9A 4YY3O 3JD2A 3ETQA 1RFYA 1HNWO 3C90A 3KCYA 3OTFA 3A8TA 2QM4A 4LNUB 3RFRA 1R3LC 4G27B 2Q69A 4X62B 4O4HA 1NH2D 4TQFA 3BPZA 1FAFA 3K5LA 1BZKA 3FAVA 1QNMA 3P3NA 4O2AB 3B4SA 2Z3YA 2Q68A 4LR3A 4AHCA 3CXCU 4LH7A 1DLBA 2WLNA 3H9VA 1NQTA 3BA9A 5BZBA 1ENVA 5HFLA 4LF8B 3TXSA 4CC5A 5IJ0B 1MA1A 3JARA 3FFQA 2QM7A 1FJGO 3JALB 4PD4F 4B3TB 2LJ2A 3G6BA 2X6CA 3IC9A 3JD4A 3OTOO 2OCCC 3RYHB 2ETNA 1T5EA 3ZEDA 3ZX6A 1Q3EA 5JCOC 3MAQA 2JEUA 4OPAA 1PL4A 1MABG 1SERA 2P67A 5KUKA 1MZEA 2OIGA 4JTDB 4PDVA 3VQVA 4FVMA 4UVCA 3ZRSA 1IBMO 3RVZA 4JI0O 2D2CB 5KX5B 4X65O 1AJQA 1KECA 5EYPB 3EXAA 2P5OA 2ZR2A 1W0JG 2OIEA 4RAIA 3ZRWB 1E1RG 3M8AA 4NTWA 4MVZA 4UCVA 4KUMA 4DR7B 1KKCA 1XQ8A 2ODMA 5LGNA 1VQ9V 2FKXA 2UXDB 1GM8A 5DN6G 2E5LB 1P7GA 4R6ZA 4PA7A 4GKKB 4DV4B 2R9AA 1TVKB 1JVMA 2YS8A 3M7MX 4LFCO 2KQXA 1KP2A 3BAAA 3A0BZ 1H8EG 1NZ6A 1H2GA 3K9AA 2F1MA 1S3JA 5IY5C 3OW2U 4X9QA 1AJNA 1YSCA 1YJWV 4YIOA 5CN0A 1N34B 1VQ8V 1K8AW 1GMGA 1OCRB 2X0LA 2P4VA 1N4CA 4CBCA 1PV0A 3CC2V 1AVMA 1YXBA 5CA1B 1L0LH 4JI4O 4JI7O 5J2TB 2RNBA 2XNDG 4AQYB 1VQKV 3ICXA 1VQ7V 4DV5O 4JAVA 1GO3F 1DF5A 1EBOA 5LA6A 2ITDC 3J81N 2Q0AA 3UO2A 1SQBH 2EILB 4BW5A 4JYAB 4YJ2B 4LF8O 3AG3B 5LXTB 1HNXB 3SJCC 3JAMN 1WJZA 2F4VO 2QKCA 4P30A 4X64O 3N27A 4W4KA 2FTKA 1THZA 4FZ0A 1BL8A 4LFBB 3LDDA 4NYKA 4MVRA 1AP6A 1XNRB 1KC8W 4J11A 3ZHTA 3KG2A 4LC1A 4F6EA 1YDXA 3MHHC 1V54B 4NKGB 4O4JB 1CP9A 3X2QC 1URFA 2V1DA 1EFRG 2XAQA 2YUAA 3BVOA 5AG2A 3ML0A 1WNSA 2PUSA 2VS0A 4BIZA 1ZL8B 5CBHA 2ZD9A 3RN4A 1FS0G 2NNUA 1ZSPA 2RMKB 1QLEC 1Y76B 4JV5O 2W0FC 4JI6B 4OXSA 5CB4B 4ZI7B 1ZAUA 2JK5C 1M56C 1AJPA 4IIJB 4RQFA 1E1QG 2ZIOA 2IM9A 4DV4O 4FM0A 2JGUA 5JVDA 4I0XA 2WLJA 3U10A 3L74H 2YIAA 3ABLC 4F6RB 3RYIB 2EIKB 4WFFA 1IURA 1VQPV 1O9GA 1H2KA 4EFBA 1KBHA 2GBOA 1R3IC 1E79G 1LR1A 1J5EB 4UXNA 3LSSA 1G1XB 5KUMA 3PJSK 1Q7YW 2GHYA 3JCZA 4B3SB 4I4TA 5A9GA 5EC1C 1S77D 4WFBV 5KHJA 4H37A 3STLC 3B77A 4IHJB 2Y0IA 4RQEA 1H38A 2DYRB 1OCCC 5GONB 4B3RB 4CS3A 4YJ3B 2LP7A 1GK9A 3W7UA 1FXHA 3CD6V 5LHHA 1Y4MA 4JZGA 4J41A 1N32O 1RSOB 1NI8A 4KXRA 3CMEV 1SKVA 2QR4A 3B40A 1KMIZ 5L3DA 4B7KA 4LF9O 3K59A 3AEIA 3T1HB 4NB5A 2YC0A 3APOA 1IBKB 2Y48A 2VQEO 4UB6Z 1FXKA 2CTPA 1NTMH 1Q81W 1G6UA 4PI0A 2KG7A 5EC2C 5KMGA 4TQDA 1IBLB 1FKAO 2XAHA 2DWDC 1J95A 3SYQA 4EB6A 2O57A 1IZ3A 4ZKIA 2CAZC 4GLXA 3ZHUA 4QIWF 1GN3A 1QR8A 3AK2A 2CGNA 3EVKA 5EIBD 5K1XA 3AK1A 3LNMB 3FKSG 2DN9A 1VQLV 3L75H 4FM2A 2L6LA 2HP8A 1YF2A 1P49A 4QE7A 1PKXA 2PTMA 2HVKC 2KB1A 2E3CA 3N2GB 3SJBC 2VQFO 4DXWA 1F7YA 1WB7A 2UXCB 3R65A 4P9OA 1HWYA 3K57A 2HG5C 4JI5B 2OCHA 3WFVA 1NR1A 4OGQB 2UU9B 3K03A 2HFEC 1W0KG 2RCVA 3E22B 1N36B 2UUBB 4IYHA 4ZOLB 4LP8A 4LNUA 2Z5UA 3CCVV 1F23A 1JX9A 3BRCA 3S3XA 3AK3A 2LGWA 4LBEC 3OAAG 5KLVH 3WB0A 4CS4A 2A7WA 3C3SA 3RT3C 1SESA 4O2AA 3QO8A 3UT5B 4QJFB 1H8HG 4ABMA 2QWQB 4JYCA 1VARA 4H13B 3HR0A 5IJ0A 2XT9A 3JALA 4B3RO 4KP4A 1XHZA 1QLNA 1YITV 1Y66A 2D3OW 5LMUB 1V55B 1GN4A 2B9ZA 3DXRB 3RYHA 4DV1O 1XL4A 2YSUB 3ZRXA 1K5SA 2BCCH 4JYBA 1RPOA 3W7XA 1US6A 2BTQB 1OV9A 2WLHA 2EILC 1H2MA 5IY5B 4RUEA 1IBLO 4MVUA 3AG3C 4UV9A 4FLVA 5KX5A 3BFRA 2IU3A 4KFMA 5EYPA 1MG1A 2Q4PA 4QE9A 5L3CA 2QKSA 3ZRWA 5BR8O 3CCLV 5JJEB 1VF5B 1FYJA 4DV7O 5KHIA 2WSSG 3P30A 4DR2O 1HNWB 1IDSA 5CA0B 4ICGA 4X1IB 1SA0B 2EJ7A 1TVKA 1Z5VA 2IJKA 3OUSA 5IJ9B 2GTAA 2Q8VA 3CCQV 1AI6A 4NTYA 1WB8A 4TUYB 3K0GA 3JASB 4CZZA 3VBBA 3B8MA 2E76B 5BMVB 1ROPA 2LO1A 2C2AA 2P90A 4KL1A 1FJGB 3GWKC 2JVDA 2QWOB 3CRQA 3OR6C 1AR1B 5EBLC 5CA1A 4LH6A 4J80A 2ZDIC 5E1AC 5J2TA 2ZE8A 3UCSC 2LW7A 3X2QB 1IXBA 2M6YA 1K73W 1F4NA 1AP5A 5BXZA 2WLMA 3J7AU 1QLEB 3AG7A 4YJ2A 2Q9LA 4K0KO 5LXTA 1W59A 4J7ZA 1IBMB 4U3JB 3H1IH 3K04A 3G6EV 1DTOA 1QU7A 4DR3O 3O9OA 4DRXB 1BQZA 4JI0B 2UXNA 1SETA 5IYBO 1K4CC 5LL6Y 2LQTA 2DYRC 4OPHA 1F4MA 3HKDB 4I9QA 2F95B 4K8XA 3ABLB 4UV8A 1K97A 2RQ6A 4O4JA 3HKEB 1ZWIC 1XMQO 2YI8A 5FL7G 4R50A 1ZL8A 1YCIA 3SYPA 1SZTA 1Y76A 3ZN0A 4J7JA 3FB5C 5CB4A 4ZI7A 2A0LA 2IU0A 1BT8A 1OCCB 4Z1MG 2VWJA 4IIJA 3PN1A 2DOSA 3A2FA 3VOUA 1YIJV 5D5PA 5LGUA 4JI4B 4JI7B 2HR3A 4F6RA 4GX1A 2LGQA 3RYIA 4GCZA 5LP6C 3ZMUA 1YTFB 4PJ0Z 4DV5B 1RP3B 1N33O 2IJJA 1ZX3A 4UB8Z 2PY5A 1ORQC 1CEZA 4I55B 4ZHQB 5GTIZ 2Q7GA 3Q4HB 4QPJA 5IDJA 3H1KH 3ETEA 4IHJA 3ZHSA 3JSLA 2EZOA 2F4VB 1MNGA 5GONA 4X64B 1JMKC 2UXXA 4YJ3A 3T4ZA 3K3WA 5B1BC 2Q73A 4JI3O 4YIPA 3K58A 4LF4O 3DTUB 1RSOA 1I94O 2ZR3A 1EN5A 3CRCA 4JI8O 1IX9A 4PDLA 4IL6Z 1XI1A 4FPPA 3RYCB 3CSXA 3SPCA 1SRYA 4CC6A 4DV2O 2ZNIA 1AB3A 1VF7A 4WCEV 1Q6HA 2EX3A 4JV5B 4X1KB 1YI2V 3DSQA 1MZFA 2Y69C 1O9HA 3H01A 1JJ2U 2ADQB 1MSWD 3HB3B 2YXLA 2L35A 1H2LA 1CPYA 3P32A 4CH6A 4FLYA 1V55C 2GV9A 3APQA 4QPKA 1I7FA 1Y6XA 1R73A 1DK1A 1B6QA 4MTOA 2YXHA 1UFIA 4TWKA 3BABA 4LFAO 4PDRA 1S5JA 3E2EA 2QJ1A 2Q6AA 3N2GA 1GAXA 3UM7A 2P7TC 2YIBA 4FMTA 2Y4TA 3JATB 1UJWB 3L73H 1PP9H 3N2KB 3SPJA 5EK0A 3E22A 3F5TA 5EIBC 2HEPA 3ZCCA 3L70H 1M1KW 3RGBA 2Q7EA 4ZOLA 3FD9A 5JCOA 2JIZG 3OEHG 4R8CA 1NH2B 2YEVB 3E8BA 1N32B 1S5HC 4JI1O 1Q82W 4LF9B 1K4DC 4OX9O 2OTLV 3JSNA 3UT5A 3HKCB 5LHGA 2P4KA 3P3PA 5TISZ 4DW1A 2VQEB 3F7YC 4DV6O 1EN6A 2XUMA 2ZE7A 4XDKA 2B1GA 1S0VA 1KYOF 1QVGU 2FMLA 4K3AA 2ZINA 1XUQA 3DXRA 3TETA 5B5EZ 3ABKB 4X66O 1L8DA 5L3BA 2BTQA 3EHBB 5J2UB 1GN2A 1FD9A 4PA9A 3B8NA 1W2BU 1PL0A 3W7TA 3ZMTA 3T1CA 2WPDG 2EIJC 3RBZA 1K92A 4LF5O 4CS2A 2VQFB 1R1BA 5EZYB 3SJAC 4JF3A 3JCUZ 1JJOA 4P9PA 5DM6V 3H1JH 3L71H 1PNKA 1XOUA 2UUCO 5LBQA 3ASNB 3BCCH 1K33A 3D3IA 2V4DA 5CA0A 4X1IA 1SA0A 1Q6UA 5IJ9A 2XHBA 1JA8A 3G71V 1BGYH 4TUYA 5IWAO 2FB5A 1OCOC 3D36C 3JASA 3LUTB 3VQWA 4DR6B 3ZHRA 3E83A 1SQFA 3ZMZA 5BMVA 3HKBB 4O4IB 2JGDB 3AG2C 2HVJC 3QO5A 2V7QG 4A5UB 2QM8A 4TOIA 4BAYA 2GTSA 3B09A 4DV1B 1H2NA 1TUBB 4O2BB 1HNZO 1AR5A 2E74B 3E8GA 4H44B 1K5QA 3CCEV 2Z0AA 4U3JA 2UUAO 4DRXA 2OTJV 2QEXV 2RJZA 1COWG 1QCEA 4WFGA 5HFMA 4JAUA 3G80A 1F51A 1VQ5V 2DYSC 1NTKH 5BR8B 3LSUA 1Y74B 2K9PA 3CYOA 4GYCB 3HKDA 3CMAV 2AHZA 1SQPH 4DUZO 4DV7B 4LWSB 2OWOA 5KHGA 4Q6GA 4DR2B 5LP6B 3HKEA 2DWEC 4DUYO 2F23A 1KB9F 4DV0O 4U7NA 3IC7A 2QWPB 3OUFA 4MTXA 3D36A 4PA3A 1RPRA 3SR2C 2BOBC 5C8YB 4NXNB 2ILMA 3TK1A 4X1YB 1FPOA 4Z2WA 1NVPD 1FFXB 5JJNB 2QE7G 4JASA 3QF7A 4NTXA 1OJHA 3JD3A 1M90W 2XASA 2YICA 3ASOC 4D7SA 1GKFA 1AROP 2ZE6A 1MOFA 4I7ZB 5B1BB 4ZBMA 4GX2A 4JI2B 4PV1B 4UCOA 5H5NA 5H6QA 3IGAC 4G28B 4J9ZB 3RW0A 2X6AA 3OT7A 4H0LB 4DR6O 1HDJA 3SJQC 1NU1H 2CUGA 2A9HA 5J9PC 3MHSC 2RDCA 3CCRV 4HYOA 2GUZB 3CB2A 4WFHA 2M7WA 4WFAV 4K0KB 2IH1C 3CCJV 4I55A 4ZHQA 2WLKA 2Y69B 3Q4HA 4DR3B 1N0JA 5KA5A 1NBMG 1S72V 5B1NA 1QR9A 1ZTEA 1NKDA 2CGOA 4TV9B 1VQMV 1BS3A 2ZQMA 3LNNA 4FJCC 4LF6O 1I0HA 4NR1A 1XMQB 4HBNA 2ITCC 3CCSV 2QSAA 4UUJC 3RYCA 4E4EA 4UFZA 4B7EA 4WFEA 4DR1O 2BTOA 4X1KA 2QGNA 5L3FA 2B1IA 1AI4A 3I55V 1AI5A 3G67A 3JAWB 1WP8A 3ZJZA 2PYLA 5LYJB 4H33A 3RYFB 3SYOA 3E8HA 2GDSA 3ABKC 1GRJA 1P7BA 2WA3A 4MTFA 3L9DA 2W6JG 2YDEA 2EULA 4NVPA 4NXNO 1HR0O 1VP7A 4O4LB 2QTOA 3QO7A 2WLIB 1N33B 5B1OA 5E79Z 1VMGA 4BR6A 1BCCH 1XL6A 2Q0OC 3JATA 3ZHVA 2R9RB 4B3MO 4FZ1A 4RWUA 5FPRA 3N2KA 4JTCB 2CK3G 4JI2O 3ASNC 4GX0A 2PI4A 3U0ZA 2EINC 2H94A 3MDSA 5KA6A 1Q6IA 2R72A 1VF6C 1L1FA 1GTOA 4JI3B 2DW4A 2YEVA 4LF4B 1I94B 1Q8IA 3ZHQA 2UXBO 3ZN1A 3RVYA 2AW9A 1XMOB 3K9SA 3M99B 3G4SV 5FLXN 3K06A 2PGGA 4JI8B 5KAFZ 1WN7A 1M5IA 5FNVB 2EIJB 3HKCA 1Q86W 4FFBB 4PA6A 2PI5A 4DR4O 3QNEA 4DK0A 1R3KC 4MW8A 3E35A 4DV2B 4MVQA 1EM1A 3W7SA 1TGOA 1K3EA 5IYZB 4GT1A 4DV3O 4L87A 3IJ4A 2DQ3A 3UKMA 3F7VC 4HNAB 3K5OA 4KHPO 1QBZA 5J2UA 1OCOB 3A0HZ 1WPBA 2HJFC 2AZ2A 1AILA 1L0NH 2A3QA 1SF9A 4YHHB 4N21A 3AG4B 4LFAB 1BQ0A 1WA8B 3GWOA 3CC4V 1U96A 2ZE5A 4MW3A 5KAIZ 1X4TA 2ZT9B 3AG2B 5EZYA 1YZBA 2QA4V 3VQYA 1D2DA 1N0NA 4DR5O 2ZDIA 1QQCA 4X20B 1D5NA 3CP1A 3JAKB 1WAZA 4TV8B 2DMXA 1VF6A 4J7KA 3R66A 4JPRA 4XDJA 4E2LA 4NXMO 3OEEG 1KQSU 2PYJA 3BEHA 1FFTB 1NR7A 3FB6C 4UCTA 3K79A 2JDIG 3SYCA 3B2EE 5H9CA 4JI1B 3K5MA 1YVWA 2DE0X 4FIPC 3CC7V 2JS5A 1LUVA 4OX9B 3AG1C 1JR9A 1P84F 3WG7B 2JJ1G 2EIMC 4I50B 2CE4A 2HHHB 2FL4A 3HKBA 3FYIB 4O4IA 2JGDA 4DV6B 2DYSB 2WA4A 3CS5A 3O65A 2G38A 2BE3A 2QDOA 2WLLB 1JQ0A 3FB8C 1K34A 3BHPA 4BW9A 1VQOV 1TUBA 4O2BA 3T1YO 3CCUV 4X66B 5GTHZ 1XMOO 4BWAA 1M9NA 2P22C 1GM7A 4AILC 1VQNV 1TA8A 5ITZB 4FFKA 2N74A 3T2MA 3VQXA 2CTWA 5BY1A 3ASOB 3OM3B 1N8RW 4LF5B 4BIUA 2XAJA 5D5QA 1SQVH 1Y74A 3CRAA 4AI8A 5LHIA 1KD1W 5DEDA 2UUCB 4LF7B 4LWSA 5IT9N 1S5LZ 5LP6A 3WB1A 1M4UA 3NXSA 4PHZA 1JFFB 4YHHO 4FM1A 4GKJO 4DO2A 5IWAB 5C8YA 4MVMA 1X59A 1WPXA 1Q43A 2K1EA 4TSFG 4X1YA 3E8FA 1FFXA 1P4RA 3HPLC 3BA8A 4UCSA 3QG5A 2IBZH 4QGPA 2XOKG 3H1HH 2NLJC 3KKYA 1H2SB 2FYUH 4MS2A 2XAFA 3CPWU 3QTCA 5JJJB 2ZIMA 1V9PA 5H2FZ 3K08A 1SQGA 4IGGA 5FPOA 4CH5A 5LMNO 2ATKC 2YIDA 1GN6A 3I5DA 1WLEA 1HNZB 3K5NA 3E89A 3SPIA 1G4YB 1NJIW 1QVFU 4WBNB 2JEXA 1BHBA 3CX5F 1R6NA 2GUZA 2Y4UA 4X62O 2HHHO 1SQXH 1XILA 3JD0A 4QNHB 3OGIB 1XHXA 2UUAB 3SDLA 3GVMA 2PZSA 2ZKOA 3BY6A 2BSKB 1JPXA 3CE2A 1NT2B 4XBFA 3LSQA 4PELA 1RM1C 1KKDA 1XREA 4TV9A 5CBFA 3K0DA 4B3TO 2IJIA 4DUZB 2ZXWC 4BIOA 3THOA 4FLZA 1BSMA 2EJRA 1PD3A 3D8CA 3CXHF 3UO3A 4MSWC 5CA3A 4DUYB 2CTRA 4FLTA 2QTSA 4DV0B 3SPHA 1TUEB 2QWRB 1M57C 3D3QA 5LOVB 3CRMA 2N04A 4J10A 5JH7B 4HAMA 5C93A 2X7RB 4Q20A 4HZ3A 2CH7B 3ABMB 1KP3A 1BHAA 1S76D 1CXZB 4X88A 2F43G 3DC5A 5JQGB 5B3SC 4LF7O 3JAWA 2EINB 3TJTA 1EZJA 1FXKC 5LYJA 3WB2A 3CJHB 3RYFA 1R6TA 2Q7HA 4CH4A 5A2QN 1D5AA 1GH6A 2YIBD 3OD4A 4DR7O 5IYCO 1OCZC 2UXDO 1DF4A 2E5LO 4GKKO 4RO2A 2HLDG 4O4LA 3J80N 2WLIA 1I5XA 4DYLA 1YJNV 3AG4C 3ETDA 3JYCA 5DECA 2IJHA 1XBLA 2EZPA 4O4HB 5B66Z 3FAVB 4JGSA 1U97A 5B1AB 2N05A 3A0RA 4J42A 1LUWA 4MVOA 3OMNB 2QKAA 1N34O 4Z1VA 2WAMA
chains in the Genus database with same CATH topology
3N27A 2L35A 4FZ0A 4FZ1A 4NTXA 4NTYA 4NTWA 3S3XA 2QTSA 1WP8A 1WP7A 4NYKA 3IJ4A 2FB5A 3S3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N27 A;  2L35 A;  4FZ0 A;  4FZ1 A;  4NTX A;  4NTY A;  4NTW A;  3S3X A;  2QTS A;  1WP8 A;  1WP7 A;  4NYK A;  3IJ4 A;  2FB5 A;  3S3W A; 
#chains in the Genus database with same CATH topology
 3JAR B;  3OMI B;  2MK3 A;  4PA4 A;  1QHT A;  1AI7 A;  5GW7 A;  2CDY A;  4EEQ A;  2AHY A;  3IAY A;  5IE9 A;  1TAE A;  4AQY O;  3OE7 G;  3SPG A;  4LF6 B;  2R9I A;  2W0X A;  4UCU A;  1JCH A;  1ZLZ A;  1AR4 A;  1NTZ H;  5FNV A;  2IW5 A;  2GSM B;  2VWK A;  1R6K A;  4FFB A;  3ABU A;  3WG7 C;  5EBM C;  1MMM A;  4I9W A;  4DR1 B;  4K8Z A;  4FK5 C;  4JYA O;  1OHH G;  5IYZ A;  3W7W A;  4U3F H;  1HNX O;  2DQ0 A;  2BOC C;  4TT3 G;  4L8J A;  3UQ8 A;  4YXW G;  4HNA A;  3RWR D;  4LFB O;  2H3O A;  1MSD A;  3ZBH A;  4P2Z A;  4X89 A;  2P06 A;  1XNR O;  1Y67 A;  4JZ2 A;  3QVN A;  4J9Y B;  1JOY A;  3OR7 C;  4K35 A;  5L3E A;  5KHH A;  1HR0 B;  4IYI A;  3AG1 B;  4UCR A;  1PNM A;  1WA8 A;  2EIM B;  1Z5W A;  2PF4 E;  3E86 A;  2YXY A;  4B3M B;  2QWN B;  4C7U A;  4JI6 O;  4X20 A;  3JAK A;  4CH3 A;  4JYY A;  4TV8 A;  1UPG A;  4FLX A;  1NS1 A;  4IT5 A;  4F4L A;  3OFN G;  4XDL A;  1K7D A;  4PI2 A;  4GX5 A;  1EZV H;  1VQ6 V;  2OCC B;  1ZUQ A;  2LFS A;  5KHK A;  2UXB B;  1YEW A;  2JS3 A;  2HKO A;  2LFR A;  3ZMV A;  1IVS A;  4I50 A;  5JWP A;  2RN9 A;  2NN4 A;  1XNQ B;  2F93 B;  4DR4 B;  5LA6 B;  4RUF A;  3SYA A;  1J5E O;  3FB7 C;  4D6T H;  3NR7 A;  2JRI A;  3F5W C;  3FYE B;  3C3T A;  4B3S O;  4DV3 B;  2ADP A;  2OYQ A;  2ZM6 B;  3GB7 C;  2WLL A;  3CHX A;  4PDM A;  2WWW A;  4DW0 A;  1I08 A;  2KKW A;  1FXV A;  1OCR C;  2H8P C;  2AZ0 A;  4KHP B;  1BE3 H;  4LCU C;  3U11 A;  1B04 A;  1GM9 A;  2XAG A;  2YI9 A;  3TGU H;  1SZX A;  1XDC A;  3KZI Z;  5ITZ A;  5EBW C;  4MT8 A;  5K1P A;  3I56 V;  4D7T A;  3H1L H;  2JJ2 G;  3T1H O;  3CRR A;  2XTA A;  5L3G A;  3S3W A;  1DGS A;  1IBK O;  1R3J C;  3EFF K;  1VIB A;  2Q67 A;  1KUQ A;  1B3Q A;  3IFX A;  5LGT A;  2F66 C;  4DR5 B;  4X8A A;  2VRZ A;  1HW7 A;  4W4L A;  1PNL A;  1EN4 A;  2ZCE A;  2A06 H;  4NXM B;  4JAA A;  1Q90 D;  1JFF A;  1LNQ A;  2Y0P A;  4YY3 B;  3T4D A;  5JVD B;  4I0X B;  4WF9 V;  1NVP B;  2LW1 A;  4U7O A;  3TCU A;  1PPJ H;  3L72 H;  5CMU A;  1V54 C;  1WP7 A;  3ABM C;  3DC6 A;  3CCM V;  3MD0 A;  2OT5 A;  1YTF D;  2AGA A;  1RM1 B;  1OZ0 A;  3LDE A;  5H6R A;  4UVB A;  4MVS A;  2UXC O;  1M93 A;  4I4T B;  3LDC A;  4UVA A;  4JI5 O;  2E75 B;  2ZXW B;  3JD1 A;  2P6J A;  2UU9 O;  2KSD A;  4GUN A;  1I5Y A;  5CBG A;  1Q5O A;  4N23 A;  3T1Y B;  1YHQ V;  1KU9 A;  1N36 O;  2UUB O;  1M57 B;  3DGE A;  4ZIB A;  5IYD O;  4WBN A;  3KCX A;  3OTO B;  4EKW A;  1XNQ O;  3CEI A;  1YJ9 V;  2AXT Z;  4R7C A;  4MTG A;  3STZ C;  2EIK C;  2DJV A;  2BSK A;  4JTA B;  5B3S B;  5B1A C;  4ASU G;  2ZM6 O;  2CTQ A;  1FXK B;  4FLW A;  2ARH A;  2KG7 B;  5KMG B;  1SS3 A;  2B5U A;  4DK1 A;  3CWB H;  3OGC C;  4X65 B;  1VQ4 V;  4EB6 B;  1M56 B;  1OCZ B;  1HP8 A;  2Q5Z A;  3OMA B;  4I5S A;  2W6I G;  5LMU O;  3ABT A;  3ETG A;  2HJD A;  1SC5 B;  4G2K A;  1XEQ A;  2X6B A;  5LOV A;  1VEW A;  4GKJ B;  5JH7 A;  3WU2 Z;  4GZR B;  1G8M A;  2CH7 A;  1IXM A;  3SGI A;  4B08 A;  1SQQ H;  1Z2G A;  2R70 A;  1B06 A;  4LFC B;  5JQG A;  3ZIA G;  3ZRV A;  2IH3 C;  3FX7 A;  2ZNJ A;  1A32 A;  4FLU A;  3CJH A;  3ZS8 C;  2A79 B;  2EBO A;  3ZMS A;  1K9M W;  1BMF G;  4EFE A;  3TXQ A;  2MW2 B;  5F2V O;  5LMN B;  2NR5 A;  1PM9 A;  4YY3 O;  3JD2 A;  3ETQ A;  1RFY A;  1HNW O;  3C90 A;  3KCY A;  3OTF A;  3A8T A;  2QM4 A;  4LNU B;  3RFR A;  1R3L C;  4G27 B;  2Q69 A;  4X62 B;  4O4H A;  1NH2 D;  4TQF A;  3BPZ A;  1FAF A;  3K5L A;  1BZK A;  3FAV A;  1QNM A;  3P3N A;  4O2A B;  3B4S A;  2Z3Y A;  2Q68 A;  4LR3 A;  4AHC A;  3CXC U;  4LH7 A;  1DLB A;  2WLN A;  3H9V A;  1NQT A;  3BA9 A;  5BZB A;  1ENV A;  5HFL A;  4LF8 B;  3TXS A;  4CC5 A;  5IJ0 B;  1MA1 A;  3JAR A;  3FFQ A;  2QM7 A;  1FJG O;  3JAL B;  4PD4 F;  4B3T B;  2LJ2 A;  3G6B A;  2X6C A;  3IC9 A;  3JD4 A;  3OTO O;  2OCC C;  3RYH B;  2ETN A;  1T5E A;  3ZED A;  3ZX6 A;  1Q3E A;  5JCO C;  3MAQ A;  2JEU A;  4OPA A;  1PL4 A;  1MAB G;  1SER A;  2P67 A;  5KUK A;  1MZE A;  2OIG A;  4JTD B;  4PDV A;  3VQV A;  4FVM A;  4UVC A;  3ZRS A;  1IBM O;  3RVZ A;  4JI0 O;  2D2C B;  5KX5 B;  4X65 O;  1AJQ A;  1KEC A;  5EYP B;  3EXA A;  2P5O A;  2ZR2 A;  1W0J G;  2OIE A;  4RAI A;  3ZRW B;  1E1R G;  3M8A A;  4NTW A;  4MVZ A;  4UCV A;  4KUM A;  4DR7 B;  1KKC A;  1XQ8 A;  2ODM A;  5LGN A;  1VQ9 V;  2FKX A;  2UXD B;  1GM8 A;  5DN6 G;  2E5L B;  1P7G A;  4R6Z A;  4PA7 A;  4GKK B;  4DV4 B;  2R9A A;  1TVK B;  1JVM A;  2YS8 A;  3M7M X;  4LFC O;  2KQX A;  1KP2 A;  3BAA A;  3A0B Z;  1H8E G;  1NZ6 A;  1H2G A;  3K9A A;  2F1M A;  1S3J A;  5IY5 C;  3OW2 U;  4X9Q A;  1AJN A;  1YSC A;  1YJW V;  4YIO A;  5CN0 A;  1N34 B;  1VQ8 V;  1K8A W;  1GMG A;  1OCR B;  2X0L A;  2P4V A;  1N4C A;  4CBC A;  1PV0 A;  3CC2 V;  1AVM A;  1YXB A;  5CA1 B;  1L0L H;  4JI4 O;  4JI7 O;  5J2T B;  2RNB A;  2XND G;  4AQY B;  1VQK V;  3ICX A;  1VQ7 V;  4DV5 O;  4JAV A;  1GO3 F;  1DF5 A;  1EBO A;  5LA6 A;  2ITD C;  3J81 N;  2Q0A A;  3UO2 A;  1SQB H;  2EIL B;  4BW5 A;  4JYA B;  4YJ2 B;  4LF8 O;  3AG3 B;  5LXT B;  1HNX B;  3SJC C;  3JAM N;  1WJZ A;  2F4V O;  2QKC A;  4P30 A;  4X64 O;  3N27 A;  4W4K A;  2FTK A;  1THZ A;  4FZ0 A;  1BL8 A;  4LFB B;  3LDD A;  4NYK A;  4MVR A;  1AP6 A;  1XNR B;  1KC8 W;  4J11 A;  3ZHT A;  3KG2 A;  4LC1 A;  4F6E A;  1YDX A;  3MHH C;  1V54 B;  4NKG B;  4O4J B;  1CP9 A;  3X2Q C;  1URF A;  2V1D A;  1EFR G;  2XAQ A;  2YUA A;  3BVO A;  5AG2 A;  3ML0 A;  1WNS A;  2PUS A;  2VS0 A;  4BIZ A;  1ZL8 B;  5CBH A;  2ZD9 A;  3RN4 A;  1FS0 G;  2NNU A;  1ZSP A;  2RMK B;  1QLE C;  1Y76 B;  4JV5 O;  2W0F C;  4JI6 B;  4OXS A;  5CB4 B;  4ZI7 B;  1ZAU A;  2JK5 C;  1M56 C;  1AJP A;  4IIJ B;  4RQF A;  1E1Q G;  2ZIO A;  2IM9 A;  4DV4 O;  4FM0 A;  2JGU A;  5JVD A;  4I0X A;  2WLJ A;  3U10 A;  3L74 H;  2YIA A;  3ABL C;  4F6R B;  3RYI B;  2EIK B;  4WFF A;  1IUR A;  1VQP V;  1O9G A;  1H2K A;  4EFB A;  1KBH A;  2GBO A;  1R3I C;  1E79 G;  1LR1 A;  1J5E B;  4UXN A;  3LSS A;  1G1X B;  5KUM A;  3PJS K;  1Q7Y W;  2GHY A;  3JCZ A;  4B3S B;  4I4T A;  5A9G A;  5EC1 C;  1S77 D;  4WFB V;  5KHJ A;  4H37 A;  3STL C;  3B77 A;  4IHJ B;  2Y0I A;  4RQE A;  1H38 A;  2DYR B;  1OCC C;  5GON B;  4B3R B;  4CS3 A;  4YJ3 B;  2LP7 A;  1GK9 A;  3W7U A;  1FXH A;  3CD6 V;  5LHH A;  1Y4M A;  4JZG A;  4J41 A;  1N32 O;  1RSO B;  1NI8 A;  4KXR A;  3CME V;  1SKV A;  2QR4 A;  3B40 A;  1KMI Z;  5L3D A;  4B7K A;  4LF9 O;  3K59 A;  3AEI A;  3T1H B;  4NB5 A;  2YC0 A;  3APO A;  1IBK B;  2Y48 A;  2VQE O;  4UB6 Z;  1FXK A;  2CTP A;  1NTM H;  1Q81 W;  1G6U A;  4PI0 A;  2KG7 A;  5EC2 C;  5KMG A;  4TQD A;  1IBL B;  1FKA O;  2XAH A;  2DWD C;  1J95 A;  3SYQ A;  4EB6 A;  2O57 A;  1IZ3 A;  4ZKI A;  2CAZ C;  4GLX A;  3ZHU A;  4QIW F;  1GN3 A;  1QR8 A;  3AK2 A;  2CGN A;  3EVK A;  5EIB D;  5K1X A;  3AK1 A;  3LNM B;  3FKS G;  2DN9 A;  1VQL V;  3L75 H;  4FM2 A;  2L6L A;  2HP8 A;  1YF2 A;  1P49 A;  4QE7 A;  1PKX A;  2PTM A;  2HVK C;  2KB1 A;  2E3C A;  3N2G B;  3SJB C;  2VQF O;  4DXW A;  1F7Y A;  1WB7 A;  2UXC B;  3R65 A;  4P9O A;  1HWY A;  3K57 A;  2HG5 C;  4JI5 B;  2OCH A;  3WFV A;  1NR1 A;  4OGQ B;  2UU9 B;  3K03 A;  2HFE C;  1W0K G;  2RCV A;  3E22 B;  1N36 B;  2UUB B;  4IYH A;  4ZOL B;  4LP8 A;  4LNU A;  2Z5U A;  3CCV V;  1F23 A;  1JX9 A;  3BRC A;  3S3X A;  3AK3 A;  2LGW A;  4LBE C;  3OAA G;  5KLV H;  3WB0 A;  4CS4 A;  2A7W A;  3C3S A;  3RT3 C;  1SES A;  4O2A A;  3QO8 A;  3UT5 B;  4QJF B;  1H8H G;  4ABM A;  2QWQ B;  4JYC A;  1VAR A;  4H13 B;  3HR0 A;  5IJ0 A;  2XT9 A;  3JAL A;  4B3R O;  4KP4 A;  1XHZ A;  1QLN A;  1YIT V;  1Y66 A;  2D3O W;  5LMU B;  1V55 B;  1GN4 A;  2B9Z A;  3DXR B;  3RYH A;  4DV1 O;  1XL4 A;  2YSU B;  3ZRX A;  1K5S A;  2BCC H;  4JYB A;  1RPO A;  3W7X A;  1US6 A;  2BTQ B;  1OV9 A;  2WLH A;  2EIL C;  1H2M A;  5IY5 B;  4RUE A;  1IBL O;  4MVU A;  3AG3 C;  4UV9 A;  4FLV A;  5KX5 A;  3BFR A;  2IU3 A;  4KFM A;  5EYP A;  1MG1 A;  2Q4P A;  4QE9 A;  5L3C A;  2QKS A;  3ZRW A;  5BR8 O;  3CCL V;  5JJE B;  1VF5 B;  1FYJ A;  4DV7 O;  5KHI A;  2WSS G;  3P30 A;  4DR2 O;  1HNW B;  1IDS A;  5CA0 B;  4ICG A;  4X1I B;  1SA0 B;  2EJ7 A;  1TVK A;  1Z5V A;  2IJK A;  3OUS A;  5IJ9 B;  2GTA A;  2Q8V A;  3CCQ V;  1AI6 A;  4NTY A;  1WB8 A;  4TUY B;  3K0G A;  3JAS B;  4CZZ A;  3VBB A;  3B8M A;  2E76 B;  5BMV B;  1ROP A;  2LO1 A;  2C2A A;  2P90 A;  4KL1 A;  1FJG B;  3GWK C;  2JVD A;  2QWO B;  3CRQ A;  3OR6 C;  1AR1 B;  5EBL C;  5CA1 A;  4LH6 A;  4J80 A;  2ZDI C;  5E1A C;  5J2T A;  2ZE8 A;  3UCS C;  2LW7 A;  3X2Q B;  1IXB A;  2M6Y A;  1K73 W;  1F4N A;  1AP5 A;  5BXZ A;  2WLM A;  3J7A U;  1QLE B;  3AG7 A;  4YJ2 A;  2Q9L A;  4K0K O;  5LXT A;  1W59 A;  4J7Z A;  1IBM B;  4U3J B;  3H1I H;  3K04 A;  3G6E V;  1DTO A;  1QU7 A;  4DR3 O;  3O9O A;  4DRX B;  1BQZ A;  4JI0 B;  2UXN A;  1SET A;  5IYB O;  1K4C C;  5LL6 Y;  2LQT A;  2DYR C;  4OPH A;  1F4M A;  3HKD B;  4I9Q A;  2F95 B;  4K8X A;  3ABL B;  4UV8 A;  1K97 A;  2RQ6 A;  4O4J A;  3HKE B;  1ZWI C;  1XMQ O;  2YI8 A;  5FL7 G;  4R50 A;  1ZL8 A;  1YCI A;  3SYP A;  1SZT A;  1Y76 A;  3ZN0 A;  4J7J A;  3FB5 C;  5CB4 A;  4ZI7 A;  2A0L A;  2IU0 A;  1BT8 A;  1OCC B;  4Z1M G;  2VWJ A;  4IIJ A;  3PN1 A;  2DOS A;  3A2F A;  3VOU A;  1YIJ V;  5D5P A;  5LGU A;  4JI4 B;  4JI7 B;  2HR3 A;  4F6R A;  4GX1 A;  2LGQ A;  3RYI A;  4GCZ A;  5LP6 C;  3ZMU A;  1YTF B;  4PJ0 Z;  4DV5 B;  1RP3 B;  1N33 O;  2IJJ A;  1ZX3 A;  4UB8 Z;  2PY5 A;  1ORQ C;  1CEZ A;  4I55 B;  4ZHQ B;  5GTI Z;  2Q7G A;  3Q4H B;  4QPJ A;  5IDJ A;  3H1K H;  3ETE A;  4IHJ A;  3ZHS A;  3JSL A;  2EZO A;  2F4V B;  1MNG A;  5GON A;  4X64 B;  1JMK C;  2UXX A;  4YJ3 A;  3T4Z A;  3K3W A;  5B1B C;  2Q73 A;  4JI3 O;  4YIP A;  3K58 A;  4LF4 O;  3DTU B;  1RSO A;  1I94 O;  2ZR3 A;  1EN5 A;  3CRC A;  4JI8 O;  1IX9 A;  4PDL A;  4IL6 Z;  1XI1 A;  4FPP A;  3RYC B;  3CSX A;  3SPC A;  1SRY A;  4CC6 A;  4DV2 O;  2ZNI A;  1AB3 A;  1VF7 A;  4WCE V;  1Q6H A;  2EX3 A;  4JV5 B;  4X1K B;  1YI2 V;  3DSQ A;  1MZF A;  2Y69 C;  1O9H A;  3H01 A;  1JJ2 U;  2ADQ B;  1MSW D;  3HB3 B;  2YXL A;  2L35 A;  1H2L A;  1CPY A;  3P32 A;  4CH6 A;  4FLY A;  1V55 C;  2GV9 A;  3APQ A;  4QPK A;  1I7F A;  1Y6X A;  1R73 A;  1DK1 A;  1B6Q A;  4MTO A;  2YXH A;  1UFI A;  4TWK A;  3BAB A;  4LFA O;  4PDR A;  1S5J A;  3E2E A;  2QJ1 A;  2Q6A A;  3N2G A;  1GAX A;  3UM7 A;  2P7T C;  2YIB A;  4FMT A;  2Y4T A;  3JAT B;  1UJW B;  3L73 H;  1PP9 H;  3N2K B;  3SPJ A;  5EK0 A;  3E22 A;  3F5T A;  5EIB C;  2HEP A;  3ZCC A;  3L70 H;  1M1K W;  3RGB A;  2Q7E A;  4ZOL A;  3FD9 A;  5JCO A;  2JIZ G;  3OEH G;  4R8C A;  1NH2 B;  2YEV B;  3E8B A;  1N32 B;  1S5H C;  4JI1 O;  1Q82 W;  4LF9 B;  1K4D C;  4OX9 O;  2OTL V;  3JSN A;  3UT5 A;  3HKC B;  5LHG A;  2P4K A;  3P3P A;  5TIS Z;  4DW1 A;  2VQE B;  3F7Y C;  4DV6 O;  1EN6 A;  2XUM A;  2ZE7 A;  4XDK A;  2B1G A;  1S0V A;  1KYO F;  1QVG U;  2FML A;  4K3A A;  2ZIN A;  1XUQ A;  3DXR A;  3TET A;  5B5E Z;  3ABK B;  4X66 O;  1L8D A;  5L3B A;  2BTQ A;  3EHB B;  5J2U B;  1GN2 A;  1FD9 A;  4PA9 A;  3B8N A;  1W2B U;  1PL0 A;  3W7T A;  3ZMT A;  3T1C A;  2WPD G;  2EIJ C;  3RBZ A;  1K92 A;  4LF5 O;  4CS2 A;  2VQF B;  1R1B A;  5EZY B;  3SJA C;  4JF3 A;  3JCU Z;  1JJO A;  4P9P A;  5DM6 V;  3H1J H;  3L71 H;  1PNK A;  1XOU A;  2UUC O;  5LBQ A;  3ASN B;  3BCC H;  1K33 A;  3D3I A;  2V4D A;  5CA0 A;  4X1I A;  1SA0 A;  1Q6U A;  5IJ9 A;  2XHB A;  1JA8 A;  3G71 V;  1BGY H;  4TUY A;  5IWA O;  2FB5 A;  1OCO C;  3D36 C;  3JAS A;  3LUT B;  3VQW A;  4DR6 B;  3ZHR A;  3E83 A;  1SQF A;  3ZMZ A;  5BMV A;  3HKB B;  4O4I B;  2JGD B;  3AG2 C;  2HVJ C;  3QO5 A;  2V7Q G;  4A5U B;  2QM8 A;  4TOI A;  4BAY A;  2GTS A;  3B09 A;  4DV1 B;  1H2N A;  1TUB B;  4O2B B;  1HNZ O;  1AR5 A;  2E74 B;  3E8G A;  4H44 B;  1K5Q A;  3CCE V;  2Z0A A;  4U3J A;  2UUA O;  4DRX A;  2OTJ V;  2QEX V;  2RJZ A;  1COW G;  1QCE A;  4WFG A;  5HFM A;  4JAU A;  3G80 A;  1F51 A;  1VQ5 V;  2DYS C;  1NTK H;  5BR8 B;  3LSU A;  1Y74 B;  2K9P A;  3CYO A;  4GYC B;  3HKD A;  3CMA V;  2AHZ A;  1SQP H;  4DUZ O;  4DV7 B;  4LWS B;  2OWO A;  5KHG A;  4Q6G A;  4DR2 B;  5LP6 B;  3HKE A;  2DWE C;  4DUY O;  2F23 A;  1KB9 F;  4DV0 O;  4U7N A;  3IC7 A;  2QWP B;  3OUF A;  4MTX A;  3D36 A;  4PA3 A;  1RPR A;  3SR2 C;  2BOB C;  5C8Y B;  4NXN B;  2ILM A;  3TK1 A;  4X1Y B;  1FPO A;  4Z2W A;  1NVP D;  1FFX B;  5JJN B;  2QE7 G;  4JAS A;  3QF7 A;  4NTX A;  1OJH A;  3JD3 A;  1M90 W;  2XAS A;  2YIC A;  3ASO C;  4D7S A;  1GKF A;  1ARO P;  2ZE6 A;  1MOF A;  4I7Z B;  5B1B B;  4ZBM A;  4GX2 A;  4JI2 B;  4PV1 B;  4UCO A;  5H5N A;  5H6Q A;  3IGA C;  4G28 B;  4J9Z B;  3RW0 A;  2X6A A;  3OT7 A;  4H0L B;  4DR6 O;  1HDJ A;  3SJQ C;  1NU1 H;  2CUG A;  2A9H A;  5J9P C;  3MHS C;  2RDC A;  3CCR V;  4HYO A;  2GUZ B;  3CB2 A;  4WFH A;  2M7W A;  4WFA V;  4K0K B;  2IH1 C;  3CCJ V;  4I55 A;  4ZHQ A;  2WLK A;  2Y69 B;  3Q4H A;  4DR3 B;  1N0J A;  5KA5 A;  1NBM G;  1S72 V;  5B1N A;  1QR9 A;  1ZTE A;  1NKD A;  2CGO A;  4TV9 B;  1VQM V;  1BS3 A;  2ZQM A;  3LNN A;  4FJC C;  4LF6 O;  1I0H A;  4NR1 A;  1XMQ B;  4HBN A;  2ITC C;  3CCS V;  2QSA A;  4UUJ C;  3RYC A;  4E4E A;  4UFZ A;  4B7E A;  4WFE A;  4DR1 O;  2BTO A;  4X1K A;  2QGN A;  5L3F A;  2B1I A;  1AI4 A;  3I55 V;  1AI5 A;  3G67 A;  3JAW B;  1WP8 A;  3ZJZ A;  2PYL A;  5LYJ B;  4H33 A;  3RYF B;  3SYO A;  3E8H A;  2GDS A;  3ABK C;  1GRJ A;  1P7B A;  2WA3 A;  4MTF A;  3L9D A;  2W6J G;  2YDE A;  2EUL A;  4NVP A;  4NXN O;  1HR0 O;  1VP7 A;  4O4L B;  2QTO A;  3QO7 A;  2WLI B;  1N33 B;  5B1O A;  5E79 Z;  1VMG A;  4BR6 A;  1BCC H;  1XL6 A;  2Q0O C;  3JAT A;  3ZHV A;  2R9R B;  4B3M O;  4FZ1 A;  4RWU A;  5FPR A;  3N2K A;  4JTC B;  2CK3 G;  4JI2 O;  3ASN C;  4GX0 A;  2PI4 A;  3U0Z A;  2EIN C;  2H94 A;  3MDS A;  5KA6 A;  1Q6I A;  2R72 A;  1VF6 C;  1L1F A;  1GTO A;  4JI3 B;  2DW4 A;  2YEV A;  4LF4 B;  1I94 B;  1Q8I A;  3ZHQ A;  2UXB O;  3ZN1 A;  3RVY A;  2AW9 A;  1XMO B;  3K9S A;  3M99 B;  3G4S V;  5FLX N;  3K06 A;  2PGG A;  4JI8 B;  5KAF Z;  1WN7 A;  1M5I A;  5FNV B;  2EIJ B;  3HKC A;  1Q86 W;  4FFB B;  4PA6 A;  2PI5 A;  4DR4 O;  3QNE A;  4DK0 A;  1R3K C;  4MW8 A;  3E35 A;  4DV2 B;  4MVQ A;  1EM1 A;  3W7S A;  1TGO A;  1K3E A;  5IYZ B;  4GT1 A;  4DV3 O;  4L87 A;  3IJ4 A;  2DQ3 A;  3UKM A;  3F7V C;  4HNA B;  3K5O A;  4KHP O;  1QBZ A;  5J2U A;  1OCO B;  3A0H Z;  1WPB A;  2HJF C;  2AZ2 A;  1AIL A;  1L0N H;  2A3Q A;  1SF9 A;  4YHH B;  4N21 A;  3AG4 B;  4LFA B;  1BQ0 A;  1WA8 B;  3GWO A;  3CC4 V;  1U96 A;  2ZE5 A;  4MW3 A;  5KAI Z;  1X4T A;  2ZT9 B;  3AG2 B;  5EZY A;  1YZB A;  2QA4 V;  3VQY A;  1D2D A;  1N0N A;  4DR5 O;  2ZDI A;  1QQC A;  4X20 B;  1D5N A;  3CP1 A;  3JAK B;  1WAZ A;  4TV8 B;  2DMX A;  1VF6 A;  4J7K A;  3R66 A;  4JPR A;  4XDJ A;  4E2L A;  4NXM O;  3OEE G;  1KQS U;  2PYJ A;  3BEH A;  1FFT B;  1NR7 A;  3FB6 C;  4UCT A;  3K79 A;  2JDI G;  3SYC A;  3B2E E;  5H9C A;  4JI1 B;  3K5M A;  1YVW A;  2DE0 X;  4FIP C;  3CC7 V;  2JS5 A;  1LUV A;  4OX9 B;  3AG1 C;  1JR9 A;  1P84 F;  3WG7 B;  2JJ1 G;  2EIM C;  4I50 B;  2CE4 A;  2HHH B;  2FL4 A;  3HKB A;  3FYI B;  4O4I A;  2JGD A;  4DV6 B;  2DYS B;  2WA4 A;  3CS5 A;  3O65 A;  2G38 A;  2BE3 A;  2QDO A;  2WLL B;  1JQ0 A;  3FB8 C;  1K34 A;  3BHP A;  4BW9 A;  1VQO V;  1TUB A;  4O2B A;  3T1Y O;  3CCU V;  4X66 B;  5GTH Z;  1XMO O;  4BWA A;  1M9N A;  2P22 C;  1GM7 A;  4AIL C;  1VQN V;  1TA8 A;  5ITZ B;  4FFK A;  2N74 A;  3T2M A;  3VQX A;  2CTW A;  5BY1 A;  3ASO B;  3OM3 B;  1N8R W;  4LF5 B;  4BIU A;  2XAJ A;  5D5Q A;  1SQV H;  1Y74 A;  3CRA A;  4AI8 A;  5LHI A;  1KD1 W;  5DED A;  2UUC B;  4LF7 B;  4LWS A;  5IT9 N;  1S5L Z;  5LP6 A;  3WB1 A;  1M4U A;  3NXS A;  4PHZ A;  1JFF B;  4YHH O;  4FM1 A;  4GKJ O;  4DO2 A;  5IWA B;  5C8Y A;  4MVM A;  1X59 A;  1WPX A;  1Q43 A;  2K1E A;  4TSF G;  4X1Y A;  3E8F A;  1FFX A;  1P4R A;  3HPL C;  3BA8 A;  4UCS A;  3QG5 A;  2IBZ H;  4QGP A;  2XOK G;  3H1H H;  2NLJ C;  3KKY A;  1H2S B;  2FYU H;  4MS2 A;  2XAF A;  3CPW U;  3QTC A;  5JJJ B;  2ZIM A;  1V9P A;  5H2F Z;  3K08 A;  1SQG A;  4IGG A;  5FPO A;  4CH5 A;  5LMN O;  2ATK C;  2YID A;  1GN6 A;  3I5D A;  1WLE A;  1HNZ B;  3K5N A;  3E89 A;  3SPI A;  1G4Y B;  1NJI W;  1QVF U;  4WBN B;  2JEX A;  1BHB A;  3CX5 F;  1R6N A;  2GUZ A;  2Y4U A;  4X62 O;  2HHH O;  1SQX H;  1XIL A;  3JD0 A;  4QNH B;  3OGI B;  1XHX A;  2UUA B;  3SDL A;  3GVM A;  2PZS A;  2ZKO A;  3BY6 A;  2BSK B;  1JPX A;  3CE2 A;  1NT2 B;  4XBF A;  3LSQ A;  4PEL A;  1RM1 C;  1KKD A;  1XRE A;  4TV9 A;  5CBF A;  3K0D A;  4B3T O;  2IJI A;  4DUZ B;  2ZXW C;  4BIO A;  3THO A;  4FLZ A;  1BSM A;  2EJR A;  1PD3 A;  3D8C A;  3CXH F;  3UO3 A;  4MSW C;  5CA3 A;  4DUY B;  2CTR A;  4FLT A;  2QTS A;  4DV0 B;  3SPH A;  1TUE B;  2QWR B;  1M57 C;  3D3Q A;  5LOV B;  3CRM A;  2N04 A;  4J10 A;  5JH7 B;  4HAM A;  5C93 A;  2X7R B;  4Q20 A;  4HZ3 A;  2CH7 B;  3ABM B;  1KP3 A;  1BHA A;  1S76 D;  1CXZ B;  4X88 A;  2F43 G;  3DC5 A;  5JQG B;  5B3S C;  4LF7 O;  3JAW A;  2EIN B;  3TJT A;  1EZJ A;  1FXK C;  5LYJ A;  3WB2 A;  3CJH B;  3RYF A;  1R6T A;  2Q7H A;  4CH4 A;  5A2Q N;  1D5A A;  1GH6 A;  2YIB D;  3OD4 A;  4DR7 O;  5IYC O;  1OCZ C;  2UXD O;  1DF4 A;  2E5L O;  4GKK O;  4RO2 A;  2HLD G;  4O4L A;  3J80 N;  2WLI A;  1I5X A;  4DYL A;  1YJN V;  3AG4 C;  3ETD A;  3JYC A;  5DEC A;  2IJH A;  1XBL A;  2EZP A;  4O4H B;  5B66 Z;  3FAV B;  4JGS A;  1U97 A;  5B1A B;  2N05 A;  3A0R A;  4J42 A;  1LUW A;  4MVO A;  3OMN B;  2QKA A;  1N34 O;  4Z1V A;  2WAM A; 
#chains in the Genus database with same CATH homology
 3N27 A;  2L35 A;  4FZ0 A;  4FZ1 A;  4NTX A;  4NTY A;  4NTW A;  3S3X A;  2QTS A;  1WP8 A;  1WP7 A;  4NYK A;  3IJ4 A;  2FB5 A;  3S3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...