4NYKA

Structure of a membrane protein
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
414
structure length
414
Chain Sequence
LKRVVWALCFMGSLALLALVCTNRIQYYFLYPHVTKLDEVAATRLTFPAVTFCNLNEFRFSRVTKNDLYHAGELLALLNNRYEIPDTQTADEKQLEILQDKANFRNFKPKPFNMLEFYDRAGHDIREMLLSCFFRGEQCSPEDFKVVFTRYGKCYTFNAGQDGKPRLITMKGGTGNGLEIMLDIQQDEYLPVWGETDETSFEAGIKVQIHSQDEPPLIDQLGFGVAPGFQTFVSCQEQRLIYLPPPWGDCKATTGDSEFYDTYSITACRIDCETRYLVENCNCRMVHMPGDAPYCTPEQYKECADPALDFLVEKDNEYCVCEMPCNVTRYGKELSMVKIPSKASAKYLAKKYNKSEQYIGENILVLDIFFEALNYETIEQKKAYEVAGLLGDIGGQMGLFIGASILTVLELFDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Acid-sensing ion channel 1
publication title Pore architecture and ion sites in acid-sensing ion channels and P2X receptors.
pubmed doi rcsb
source organism Gallus gallus
total genus 105
structure length 414
sequence length 414
ec nomenclature
pdb deposition date 2013-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00858 ASC Amiloride-sensitive sodium channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.770 Mainly Alpha Orthogonal Bundle Helix Hairpins YojJ-like 4nykA01
1.10.287.820 Mainly Alpha Orthogonal Bundle Helix Hairpins Acid-sensing ion channel domain 4nykA04
1.10.3590.10 Mainly Alpha Orthogonal Bundle acid-sensing ion channel 1 fold acid-sensing ion channel 1 domain 4nykA03
2.60.470.10 Mainly Beta Sandwich Acid-sensing ion channels like fold Acid-sensing ion channels like domains 4nykA02
4NYKA 4NTYA 4NTWA 2FB5A 2L35A 4FZ0A 4FZ1A 4NTXA 3S3WA 3IJ4A 1WP8A 1WP7A 2QTSA 3N27A 3S3XA
chains in the Genus database with same CATH superfamily
1AI6A 2E5LO 2CK3G 3VQYA 4YIOA 4LBEC 1FD9A 5CA1A 3LDDA 1U96A 4I0XA 2JGDB 3KCYA 1YI2V 4I50A 4MW8A 2BTQA 3K79A 3KKYA 2YICA 4RO2A 1ZL8A 2QSAA 1PM9A 5LMUO 1LNQA 4LC1A 5CN0A 1H8HG 4BW9A 1FXVA 5IJ9B 2IJJA 3K57A 2PTMA 3K04A 2P5OA 2ZE5A 3QNEA 2DN9A 5DEDA 5L3CA 1N8RW 1NVPD 1FS0G 2UXDB 5AG2A 1E1RG 1HW7A 2JGDA 3K08A 4DR6B 2ZR2A 1J5EB 3SGIA 3W7SA 2Q4PA 4J7KA 4JYYA 3ETQA 2IW5A 3RGBA 1M90W 3ZX6A 1YSCA 2Q6AA 4XDJA 1IBKB 2GTSA 2UXBB 4HAMA 4K35A 2X7RB 5CB4A 2HFEC 4LF4B 2DQ0A 3OTOO 3DGEA 4JI4O 1M9NA 1QLEB 3ZMSA 4JAVA 2RMKB 1GRJA 2QEXV 4UCUA 1EN6A 2VQEB 3EHBB 3GVMA 1Q81W 4TSFG 3SYOA 1ROPA 4U3FH 1R3IC 2ZCEA 3FYIB 3H9VA 1H38A 1HNWB 1K7DA 4G2KA 3IFXA 2IU3A 4IT5A 3G80A 1Q7YW 3THOA 1SQGA 2A3QA 2QTOA 1P84F 3RN4A 2X6AA 3A0HZ 5IT9N 1K4DC 3APOA 2Y0PA 1VIBA 1KC8W 5EBWC 4WCEV 2PYLA 2DJVA 2X0LA 5F2VO 4O4IA 3LNMB 2Q0OC 1WP8A 1K9MW 1MG1A 3QG5A 3CRMA 3T1CA 4LF8B 2UXCB 4AQYB 1IXMA 4O2AB 4PI0A 1KUQA 2CH7A 3D36C 3IAYA 5IJ0A 3K9SA 3AG2C 1YIJV 1JQ0A 3X2QB 2Y69C 3BA8A 3ASOB 5C93A 5KAIZ 3LSQA 3P3NA 2WLIA 1AB3A 3OUSA 4HBNA 2JRIA 3UM7A 2JGUA 3FD9A 3FB8C 2HVKC 4NXNO 3L70H 4FJCC 4DR3O 1RFYA 4YHHB 1VQMV 1K4CC 4LFAO 3N2GB 2QR4A 1IZ3A 3WB0A 3ABMC 5FPRA 2QM8A 5B3SC 2LFSA 3ABKB 3S3XA 4E4EA 2AXTZ 1W0KG 2QWOB 1V55C 3JCUZ 4JI6B 2WLKA 5KHKA 2HG5C 5LL6Y 3O65A 3BRCA 1I94B 1VARA 4XDLA 3OGIB 4RAIA 5LGNA 1XL6A 4KFMA 3ZHVA 2EIJC 4GX2A 5JJJB 4N21A 2YEVA 4JTAB 3N2GA 1Q6UA 1TA8A 1AR4A 2V1DA 5DECA 1MZFA 2P4VA 1PL0A 5LXTA 4GX1A 1KP2A 4Z2WA 2UUBB 4X64O 3FX7A 3RYHB 1R6TA 4JTDB 3AG7A 4X20B 1KB9F 2FTKA 4DW0A 2XAQA 5J2TB 1N33B 1ZUQA 3G71V 1AI5A 2HHHB 4PA6A 3J81N 4F6RB 4Z1MG 4JI3O 2DYSC 3CCQV 1HNXO 3VOUA 3AG3B 1Z5VA 1XHXA 3TCUA 2GSMB 4J9YB 4DV7B 1XOUA 1S5JA 2WLHA 5JQGB 3RYHA 1SETA 4QIWF 5KHIA 4IYHA 5KX5B 1D2DA 3UQ8A 1B04A 3WG7B 5CA0A 2FMLA 1XL4A 1Q43A 4Q6GA 3RFRA 5KHJA 1RM1B 1X4TA 4WBNB 3OMNB 4J41A 1YJ9V 2HJDA 3EVKA 4J7ZA 4JI1O 2BSKA 4RUEA 4F6RA 1FJGO 3CCSV 4O4LB 3AK1A 5BZBA 1OV9A 5L3GA 2XOKG 5LOVB 4J11A 4D7TA 4P30A 5JQGA 4GX0A 5IYDO 3SYQA 4X66B 2B9ZA 3CB2A 1HR0O 1JA8A 5KX5A 2N05A 2KQXA 4G27B 2OCCC 5LYJA 4LFCB 1OCOB 1NR1A 4PDRA 1T5EA 4H37A 2AW9A 5A2QN 2QDOA 2Z5UA 1V54C 4B3RO 5H6QA 1R3JC 3UT5B 4JI5O 4PA3A 3RBZA 2YUAA 4O4LA 1SQBH 1FAFA 1S0VA 2QE7G 4GYCB 3TETA 4JI8B 5LOVA 4PA4A 4ICGA 3KZIZ 3QF7A 2OIEA 2QWQB 4DR7B 1KU9A 4W4LA 2RQ6A 4LF5O 1GM7A 4LH6A 1VQ4V 4GKKB 4UV9A 2VQFO 2PI5A 1WAZA 1GN3A 3QO8A 4DXWA 3HKEA 1OJHA 1QQCA 4UCSA 1DTOA 3W7TA 3R66A 1YJNV 1NBMG 1SZTA 3ZJZA 3UT5A 4DR4O 4MVRA 3CHXA 4X62B 1H2LA 3JAKB 3P32A 4LF7B 4TWKA 2F1MA 2F43G 3ASOC 1Q8IA 3Q4HB 2ZIMA 4X65B 2QM7A 1IVSA 1M4UA 3HKCB 1V9PA 2ZQMA 4DV5O 3UCSC 1GMGA 4IIJB 4U7OA 3JALA 4WFAV 3HPLC 4DV6B 4GCZA 4WFFA 5K1PA 3A8TA 1K33A 1NT2B 3RYFB 2B5UA 4PELA 4CC5A 2OIGA 1N34O 1PNLA 3ABKC 3IGAC 2R9AA 2WLLB 3JAKA 1XQ8A 1D5AA 4QPJA 3MHHC 1Y74B 3MD0A 3Q4HA 2YI8A 1Q90D 4D7SA 2LGQA 1YCIA 5L3BA 2EIKB 1QVFU 3E35A 1F4NA 3K5LA 3CCLV 3RYFA 1P4RA 5LMNO 4I55A 2KG7B 1P49A 4HNAB 3T1HO 1TUEB 3N2KB 4GT1A 1GN6A 4DR2B 2FB5A 4DV1O 5E79Z 4G28B 1Y74A 1OCCB 4FLUA 1JR9A 1NH2B 3OE7G 1KQSU 1AROP 2YIBA 3FAVB 4EB6B 1GM8A 3DSQA 1SA0A 2RN9A 1I0HA 3ABLB 3TXSA 4J42A 2LJ2A 5KHHA 3RYCB 4FZ0A 1M1KW 3BCCH 3AG3C 4BW5A 1GN4A 4MS2A 4CZZA 2E5LB 5JH7B 4X89A 5IYCO 1VMGA 4GX5A 3FAVA 4PJ0Z 4PDVA 4RQEA 4EB6A 3WG7C 4FPPA 1HDJA 2RCVA 1RM1C 1IURA 5KMGB 4TT3G 3HB3B 1R6NA 3RYCA 1XHZA 5LMUB 3AG1B 3SJQC 1WPXA 4X9QA 4P9OA 3MDSA 5LHHA 3CJHA 1Y76B 4X1KA 5KUKA 1LUWA 1FXKB 5JH7A 4OX9O 2UU9O 3E22B 1PP9H 4I4TB 4LF9O 2EZPA 1BGYH 1XMQO 1AI7A 4PDMA 5J9PC 4D6TH 1OCOC 2MW2B 4LNUA 3AG4B 2PYJA 5KMGA 4Q20A 2LO1A 4JI0O 4ASUG 3JARA 1TVKB 3ZRSA 3U0ZA 2Q69A 3D36A 5B1BB 2LP7A 1G6UA 4O4HB 3D3IA 4B3SO 1LR1A 2P90A 2Y48A 3T1YO 2KB1A 2QKAA 5IWAO 4I4TA 2JK5C 3OTOB 2XAHA 1VF6A 3AK3A 5EBLC 3ML0A 1EN5A 4DRXB 1WN7A 2PZSA 4HZ3A 2BTOA 1S72V 3CS5A 5EC2C 3SPHA 4DV2O 1P7BA 1B6QA 4NKGB 2HEPA 4IYIA 4JTCB 2R72A 5IY5B 2A0LA 4O4HA 4K8ZA 2JS5A 3ZIAG 4H13B 5D5PA 5GTHZ 3ASNB 4X1YB 4MVZA 1WLEA 1AP6A 3UO3A 2QTSA 1KMIZ 2EINB 4AHCA 1CPYA 1H2KA 4OXSA 1W2BU 4CH4A 5LGTA 4R8CA 3ZMTA 2JJ2G 5BR8O 3G4SV 4RWUA 4DUZO 1BQZA 1ZWIC 4C7UA 2X6BA 2WPDG 1GAXA 2M6YA 3CP1A 3CD6V 2DWDC 1SQQH 1G4YB 1SQVH 3OMIB 1URFA 5IE9A 1W59A 4JZGA 1YZBA 3B77A 1S5HC 5IJ9A 2EIKC 1SESA 2AHZA 1L1FA 4O4JB 3QTCA 1O9HA 2PF4E 1Y6XA 4NXNB 1VQ7V 4DO2A 4DR3B 1F23A 2DWEC 1VF7A 2WLNA 1I5XA 3CEIA 4LFAB 1VQPV 3EFFK 2Q0AA 2OTLV 5LGUA 4JI2O 3ABLC 4JYBA 4TV9B 2Z3YA 2ZXWB 2JIZG 2W0FC 5JWPA 1S3JA 1N36O 4EFBA 5JCOC 1QHTA 1F4MA 4I9WA 3E8GA 1XEQA 4PI2A 4XDKA 3ZCCA 4NVPA 3D8CA 3LDEA 3OGCC 1HWYA 4QJFB 3S3WA 4B3MB 2F66C 4WF9V 2QWPB 5KHGA 3B8NA 3CSXA 1M56C 1JVMA 2VRZA 4JZ2A 1XDCA 2IM9A 1OCZB 1ORQC 1W0JG 3K59A 1XNQO 2CTQA 3N27A 1CXZB 4X64B 4TV9A 3NXSA 3OR7C 4FLYA 2XASA 1BCCH 1XNRO 4AILC 2PY5A 4AI8A 3CCRV 4CS4A 2E75B 1HNZO 2F93B 3CC4V 2ODMA 4PV1B 3SPJA 4FM0A 4JI3B 1Q3EA 5E1AC 1VQLV 2D3OW 2QKCA 2Q67A 3E8BA 1VF6C 2OT5A 5B66Z 2N74A 3AG4C 4KHPO 1AJNA 5CA3A 1L8DA 2YIDA 4O2AA 3VQXA 1AJPA 4I9QA 5B1NA 1Z2GA 4YY3O 2Q7HA 2LW1A 2UUAO 4JI1B 1FJGB 3EXAA 3FB6C 3MHSC 1M93A 4NTYA 2ARHA 4JV5O 2DMXA 4WFHA 1XBLA 2A79B 2ADPA 4JASA 1HR0B 3DXRB 1DLBA 4FIPC 3ZMVA 5GW7A 4K0KO 2R70A 2ADQB 3BA9A 5IY5C 3ZRWB 4FLTA 3BEHA 4JI7O 3FKSG 4LP8A 4B3RB 2ZNJA 1XREA 4JI5B 1Q6IA 1GO3F 3BPZA 2Y0IA 2G38A 4FLVA 1MOFA 3OTFA 4DR1O 1VQ5V 3JD4A 4B3TO 1IBLO 2WAMA 4Z1VA 1BHAA 3H1HH 4CH5A 5KA6A 1BHBA 3LSSA 4LF5B 2UXCO 3OR6C 2VQFB 4IL6Z 4I7ZB 3WFVA 1MSWD 2JEUA 1FXHA 2LW7A 1Q82W 4UB6Z 5CMUA 1VP7A 2JEXA 2CTRA 4X20A 4TV8B 4DR4B 2ZR3A 3R65A 5FPOA 1H2MA 5J2TA 2VWJA 1PNKA 3CRQA 2W6IG 1SERA 2EZOA 1ENVA 5EZYB 4QE9A 4I5SA 1ZAUA 4DV5B 1QLEC 5LBQA 4MTXA 4QE7A 1BT8A 4YXWG 4PA9A 1SRYA 1L0NH 4UVBA 5H6RA 1NKDA 1YJWV 2L6LA 2BCCH 1N34B 3L73H 3L71H 1HP8A 1VF5B 4GLXA 1YDXA 4DK0A 5BMVB 3W7XA 4FM1A 4WBNA 1K5SA 2ZXWC 4F6EA 2YXYA 2YC0A 5J2UB 3IJ4A 4U3JB 2XNDG 2NN4A 1VQ6V 5LA6B 2FKXA 2KSDA 4LCUC 1N32O 2GUZB 1Q86W 3QO7A 4JF3A 4BIUA 1S5LZ 4J7JA 4PD4F 1MABG 5LMNB 1H8EG 1QNMA 3T1HB 3K5NA 4FLXA 3K0DA 4R7CA 2Q7EA 4DV1B 5KUMA 2EJ7A 3ZBHA 5BMVA 3CRAA 2QJ1A 3D3QA 4DV4B 4HYOA 3ZRXA 3T4ZA 1QR9A 5J2UA 2W0XA 2GBOA 2A06H 3E86A 5LA6A 2BE3A 4DV0O 3X2QC 2GUZA 4MTGA 2LQTA 4F4LA 4B7KA 1N0NA 5IYZB 1OCRB 2B1IA 4MVQA 5GTIZ 2Y4TA 1BQ0A 2PUSA 1PV0A 3ETGA 4H33A 1H2SB 4CBCA 2WSSG 1YTFB 2HR3A 5JVDB 4DV3O 1H2NA 3H1LH 3HKBB 4CH6A 1FFXB 3C3TA 1SKVA 3ZHRA 2PGGA 2ITDC 4X1IB 5JJEB 1A32A 2DOSA 3CCMV 5EIBC 1WNSA 4UCTA 2UUCB 5IYZA 3CPWU 1OZ0A 5LHIA 3HKCA 1Y67A 3KG2A 4KP4A 2EJRA 2ZE7A 2F4VO 4IIJA 4YIPA 3I56V 4K3AA 2YIBD 1FFTB 1WB7A 5FLXN 3CE2A 4OX9B 1KECA 2UU9B 1QU7A 4LF9B 3JD2A 3HKBA 1FFXA 1JCHA 4LFBO 1ZSPA 1XMQB 2C2AA 1XILA 1L0LH 1R3LC 2WLLA 3JSNA 1EBOA 2IJHA 4LF6O 2CAZC 3L75H 1DGSA 1F51A 2UXXA 3IC9A 4MVMA 4DW1A 1QCEA 1XMOO 3AK2A 1IDSA 1K8AW 1NH2D 3W7WA 4B3SB 1WPBA 4E2LA 3T1YB 4X88A 3SPCA 2ETNA 5IWAB 4FLZA 2KG7A 3SDLA 4EFEA 2NR5A 4R50A 3JD3A 4HNAA 2OCHA 2K1EA 1SZXA 3N2KA 3CXHF 3JSLA 1AILA 1KYOF 1R6KA 4L87A 2O57A 5ITZB 4H0LB 3A2FA 5GONB 2ZINA 1VQ9V 4DV2B 4DR5O 3J80N 2ZT9B 4UVCA 5KAFZ 3F7YC 2P4KA 5L3EA 2L35A 2Q73A 2EX3A 3OAAG 5JJNB 4BR6A 3TK1A 3K5MA 5JCOA 1JJ2U 3WB1A 4UCRA 1GM9A 3H1IH 4JPRA 1UPGA 2A9HA 1AVMA 2ZD9A 3BVOA 3OEHG 5ITZA 5BR8B 4TUYB 5GONA 1NS1A 4NTWA 2H94A 3SPGA 3K03A 3ABTA 3AG2B 1YXBA 2YXLA 3OUFA 1WP7A 1SQXH 5H5NA 3O9OA 4GKJO 1S76D 5D5QA 2IBZH 3FB5C 2EIMB 1NQTA 1Y76A 1FXKA 2HLDG 4OPHA 3E22A 4FLWA 1X59A 4JI4B 1E1QG 2AGAA 2BOBC 1GH6A 2M7WA 3ABMB 2ITCC 2OTJV 1TUBB 3OM3B 5CA1B 4I0XB 1N0JA 2WWWA 2D2CB 1V55B 5EBMC 4FFKA 3CXCU 3LSUA 2A7WA 4X8AA 3TGUH 2LFRA 4WFGA 1ZL8B 1SQPH 1TVKA 1LUVA 2ZDIA 1KKDA 3CCVV 4JI2B 4DUYO 3B8MA 4TQFA 2YS8A 5TISZ 1AP5A 4JGSA 4UCVA 3P30A 1N36B 1TGOA 4W4KA 3SJBC 1IBMO 2EIJB 2H8PC 1OCRC 4RUFA 3K0GA 4PA7A 3CC2V 2DE0X 2KKWA 3M99B 2ILMA 1VQ8V 4MT8A 1OHHG 1TUBA 4DRXA 5CBHA 4EEQA 1BL8A 4JYCA 1EN4A 2NNUA 1Z5WA 1ZX3A 4J80A 4MVOA 1GKFA 1FPOA 1JPXA 1BE3H 1XNQB 1US6A 1IXBA 1NVPB 3HKDB 4X1YA 5CBFA 3U10A 3SJCC 2K9PA 4UUJC 1XNRB 4PDLA 5CB4B 1GK9A 2DYSB 5HFMA 3CMAV 1U97A 5EYPB 1HNZB 4JYAO 1KP3A 2YI9A 1I7FA 3M8AA 4NXMO 2AHYA 3CCUV 1AR5A 4KXRA 3UKMA 3K58A 1CEZA 2P67A 4KHPB 2XAJA 1OCCC 3HKDA 1QLNA 3RYIB 4UCOA 1EM1A 5BXZA 3G6EV 2XAGA 1QBZA 3BAAA 3ETDA 1Q6HA 4DYLA 5EYPA 2ZM6O 3JYCA 3APQA 3SR2C 3ICXA 4YY3B 3CCEV 2P7TC 2UUAB 2IH3C 3DC5A 4O4JA 2JJ1G 3OD4A 3T2MA 4KL1A 4R6ZA 3SYPA 3PJSK 4B08A 4JV5B 3CYOA 3H1JH 2XAFA 2YIAA 3QO5A 2IJKA 2OWOA 5A9GA 1XUQA 2OCCB 4O4IB 1EZJA 1CP9A 4K8XA 1AI4A 1V54B 2JDIG 1PD3A 3OT7A 3VQWA 3RYIA 2EILB 4K0KB 1FYJA 2RJZA 2CH7B 4JI7B 4LWSB 5IJ0B 2GHYA 2AZ2A 4BWAA 2P6JA 1JFFB 3CRCA 4WFBV 1WA8B 2WLIB 3ZN0A 1AR1B 3JAWB 4FVMA 3AG1C 4YJ2B 2YDEA 5C8YB 2JS3A 3W7UA 2UXDO 1VQKV 2P06A 3ZRVA 4ZKIA 4DR1B 3FFQA 5H9CA 2QWNB 3CRRA 4B3TB 2GV9A 1K97A 1IBLB 5EK0A 4FMTA 2WA3A 1FXKC 4PHZA 4DR6O 1J5EO 2GTAA 1HNXB 4TOIA 1M57B 2Q5ZA 4QGPA 5L3FA 1WB8A 2QWRB 4LWSA 2IJIA 3A0RA 1IBKO 2V4DA 3ZMUA 2UXBO 5LP6B 1JFFA 5IYBO 1RPOA 1Q5OA 1WA8A 1WJZA 3JAWA 5FL7G 2ZDIC 4YJ2A 5C8YA 5B1BC 4LF4O 5CBGA 1QVGU 3FYEB 3RWRD 2N04A 3E89A 2EIMC 4FZ1A 3AEIA 3ZHUA 2VQEO 4UXNA 2YEVB 3E2EA 3A0BZ 5EIBD 3CWBH 3LDCA 4UV8A 2GDSA 2CGNA 2F23A 5LXTB 2Y4UA 4IGGA 1GTOA 4LR3A 5EC1C 1HNWO 4CS2A 1O9GA 5LP6A 2YSUB 4JAAA 3GB7C 1R1BA 3IC7A 1VQNV 3K9AA 3OFNG 4QPKA 1NI8A 3ASNC 2E76B 4B3MO 4YJ3B 3RVYA 2EINC 4NYKA 3ABUA 2OYQA 2VWKA 4N23A 4B7EA 1N32B 1E79G 1ZLZA 3DXRA 1JMKC 4MTOA 2V7QG 2DYRB 1RP3B 1YF2A 4LF8O 3TXQA 3F7VC 4AQYO 2QGNA 3ZRWA 4UFZA 1MZEA 5H2FZ 3TJTA 3G67A 4OPAA 1B06A 5CA0B 1M5IA 3H1KH 4ZOLB 1PPJH 1BSMA 2B1GA 2H3OA 1MA1A 4MSWC 3LNNA 4YJ3A 2BSKB 1TAEA 3ZHTA 4DV0B 1BS3A 4MVSA 3KCXA 1H2GA 2CDYA 4ZBMA 4FM2A 2F95B 4YHHO 2XHBA 4P9PA 3FB7C 3JAMN 4FK5C 2CE4A 2EBOA 5LYJB 2QM4A 1Y66A 3PN1A 1RPRA 3J7AU 1I08A 4RQFA 4ZOLA 2VS0A 4FFBB 4A5UB 4DV3B 4JI6O 3OEEG 1B3QA 4TV8A 1SC5B 1NTZH 2CTWA 1KBHA 3ZMZA 1UFIA 1R73A 1IX9A 1SQFA 1I94O 2X6CA 3CMEV 4NB5A 5IDJA 3SPIA 5B1AB 4UVAA 5KA5A 5LHGA 1YHQV 2CTPA 3L72H 5EZYA 1R3KC 4CC6A 3JATB 2ZNIA 1BMFG 3BABA 3JD0A 4MVUA 2F4VB 1YEWA 2DQ3A 1PKXA 5DN6G 3SYCA 4FFBA 3GWOA 3HKEB 3K06A 2UUBO 3M7MX 2PI4A 2ZIOA 1SF9A 4LFBB 2EILC 1OCZC 3RVZA 1DF5A 2YXHA 2QKSA 2AZ0A 1QR8A 3RT3C 4LF6B 3DTUB 3OMAB 1N33O 3B2EE 2LGWA 1NTMH 4KUMA 3C90A 2HHHO 3JATA 1XMOB 1JX9A 2HKOA 2P22C 4U3JA 3F5WC 1K73W 4EKWA 3H01A 5BY1A 4DV7O 1XI1A 4MTFA 3JALB 1EFRG 5B5EZ 3DC6A 1AJQA 1THZA 1NTKH 1M57C 3E8HA 2CGOA 2W6JG 1KD1W 4L8JA 4UB8Z 1KKCA 1RSOB 3BY6A 4DR5B 5LP6C 2HP8A 2XTAA 3E83A 3JASB 2Q7GA 2WLMA 1YTFD 4NR1A 4U7NA 3SJAC 1D5NA 2HJFC 4X66O 4BIZA 4I55B 1JOYA 1BZKA 2WLJA 5B1OA 5FNVB 4GZRB 2R9IA 3WB2A 4LFCO 1DK1A 4CH3A 4P2ZA 1NJIW 2ZKOA 1RSOA 2FL4A 5JVDA 1K92A 3JASA 2UXNA 4ZI7B 4IHJB 1DF4A 3VQVA 4X1IA 3C3SA 5K1XA 4WFEA 3CX5F 2RDCA 1F7YA 1SA0B 5L3DA 4JI8O 4JI0B 1G1XB 1GN2A 1NR7A 1K34A 1MNGA 3K3WA 3L9DA 4GKJB 3WU2Z 4DR7O 2E3CA 3B40A 3ZS8C 2JVDA 3ZHSA 4GKKO 5FNVA 4TQDA 3B4SA 3ZEDA 3CCJV 1J95A 3G6BA 3ETEA 3GWKC 4DV4O 2DYRC 3I55V 1K5QA 2E74B 4ZI7A 4IHJA 1G8MA 3RW0A 4X62O 3HR0A 3I5DA 3QVNA 3U11A 4LF7O 1SS3A 1YVWA 1JJOA 2ZE8A 2XUMA 4MW3A 5HFLA 4X65O 4DUYB 4CS3A 3STLC 3STZC 1FKAO 1ZTEA 5KLVH 4H44B 2CUGA 5DM6V 4ABMA 3OW2U 3CJHB 1IBMB 4DV6O 1Y4MA 4X1KB 3T4DA 4ZHQB 4J10A 2ATKC 1MMMA 3L74H 1N4CA 2XT9A 1M56B 1VEWA 3NR7A 4O2BB 2FYUH 1COWG 3BFRA 4LNUB 1I5YA 4DUZB 1PNMA 1NZ6A 2R9RB 4BAYA 2MK3A 1YITV 2Q68A 2UUCO 3JARB 4DK1A 3MAQA 3E8FA 1K3EA 3CC7V 3JD1A 2QA4V 2RNBA 2Y69B 5B1AC 1UJWB 4LH7A 3VBBA 3B09A 2EULA 1P7GA 4ZHQA 3LUTB 1NU1H 4JYAB 4O2BA 3SYAA 3K5OA 1S77D 2Z0AA 4DR2O 3ZN1A 4JAUA 4TUYA 1EZVH 4NXMB 3ZHQA 2BOCC 4J9ZB 2Q9LA 3P3PA 4QNHB 5B3SB 2IH1C 1MSDA 2Q8VA 2DW4A 4I50B 4ZIBA 2BTQB 2HVJC 2WA4A 4XBFA 3F5TA 3BHPA 4GUNA 3UO2A 4NTXA 2ZM6B 4OGQB 1VQOV 3JCZA 1PL4A 2ZE6A 2NLJC 4BIOA 2IU0A
chains in the Genus database with same CATH topology
4NYKA 4NTYA 4NTWA 2FB5A 2L35A 4FZ0A 4FZ1A 4NTXA 3S3WA 3IJ4A 1WP8A 1WP7A 2QTSA 3N27A 3S3XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NYK A;  4NTY A;  4NTW A;  2FB5 A;  2L35 A;  4FZ0 A;  4FZ1 A;  4NTX A;  3S3W A;  3IJ4 A;  1WP8 A;  1WP7 A;  2QTS A;  3N27 A;  3S3X A; 
#chains in the Genus database with same CATH topology
 1AI6 A;  2E5L O;  2CK3 G;  3VQY A;  4YIO A;  4LBE C;  1FD9 A;  5CA1 A;  3LDD A;  1U96 A;  4I0X A;  2JGD B;  3KCY A;  1YI2 V;  4I50 A;  4MW8 A;  2BTQ A;  3K79 A;  3KKY A;  2YIC A;  4RO2 A;  1ZL8 A;  2QSA A;  1PM9 A;  5LMU O;  1LNQ A;  4LC1 A;  5CN0 A;  1H8H G;  4BW9 A;  1FXV A;  5IJ9 B;  2IJJ A;  3K57 A;  2PTM A;  3K04 A;  2P5O A;  2ZE5 A;  3QNE A;  2DN9 A;  5DED A;  5L3C A;  1N8R W;  1NVP D;  1FS0 G;  2UXD B;  5AG2 A;  1E1R G;  1HW7 A;  2JGD A;  3K08 A;  4DR6 B;  2ZR2 A;  1J5E B;  3SGI A;  3W7S A;  2Q4P A;  4J7K A;  4JYY A;  3ETQ A;  2IW5 A;  3RGB A;  1M90 W;  3ZX6 A;  1YSC A;  2Q6A A;  4XDJ A;  1IBK B;  2GTS A;  2UXB B;  4HAM A;  4K35 A;  2X7R B;  5CB4 A;  2HFE C;  4LF4 B;  2DQ0 A;  3OTO O;  3DGE A;  4JI4 O;  1M9N A;  1QLE B;  3ZMS A;  4JAV A;  2RMK B;  1GRJ A;  2QEX V;  4UCU A;  1EN6 A;  2VQE B;  3EHB B;  3GVM A;  1Q81 W;  4TSF G;  3SYO A;  1ROP A;  4U3F H;  1R3I C;  2ZCE A;  3FYI B;  3H9V A;  1H38 A;  1HNW B;  1K7D A;  4G2K A;  3IFX A;  2IU3 A;  4IT5 A;  3G80 A;  1Q7Y W;  3THO A;  1SQG A;  2A3Q A;  2QTO A;  1P84 F;  3RN4 A;  2X6A A;  3A0H Z;  5IT9 N;  1K4D C;  3APO A;  2Y0P A;  1VIB A;  1KC8 W;  5EBW C;  4WCE V;  2PYL A;  2DJV A;  2X0L A;  5F2V O;  4O4I A;  3LNM B;  2Q0O C;  1WP8 A;  1K9M W;  1MG1 A;  3QG5 A;  3CRM A;  3T1C A;  4LF8 B;  2UXC B;  4AQY B;  1IXM A;  4O2A B;  4PI0 A;  1KUQ A;  2CH7 A;  3D36 C;  3IAY A;  5IJ0 A;  3K9S A;  3AG2 C;  1YIJ V;  1JQ0 A;  3X2Q B;  2Y69 C;  3BA8 A;  3ASO B;  5C93 A;  5KAI Z;  3LSQ A;  3P3N A;  2WLI A;  1AB3 A;  3OUS A;  4HBN A;  2JRI A;  3UM7 A;  2JGU A;  3FD9 A;  3FB8 C;  2HVK C;  4NXN O;  3L70 H;  4FJC C;  4DR3 O;  1RFY A;  4YHH B;  1VQM V;  1K4C C;  4LFA O;  3N2G B;  2QR4 A;  1IZ3 A;  3WB0 A;  3ABM C;  5FPR A;  2QM8 A;  5B3S C;  2LFS A;  3ABK B;  3S3X A;  4E4E A;  2AXT Z;  1W0K G;  2QWO B;  1V55 C;  3JCU Z;  4JI6 B;  2WLK A;  5KHK A;  2HG5 C;  5LL6 Y;  3O65 A;  3BRC A;  1I94 B;  1VAR A;  4XDL A;  3OGI B;  4RAI A;  5LGN A;  1XL6 A;  4KFM A;  3ZHV A;  2EIJ C;  4GX2 A;  5JJJ B;  4N21 A;  2YEV A;  4JTA B;  3N2G A;  1Q6U A;  1TA8 A;  1AR4 A;  2V1D A;  5DEC A;  1MZF A;  2P4V A;  1PL0 A;  5LXT A;  4GX1 A;  1KP2 A;  4Z2W A;  2UUB B;  4X64 O;  3FX7 A;  3RYH B;  1R6T A;  4JTD B;  3AG7 A;  4X20 B;  1KB9 F;  2FTK A;  4DW0 A;  2XAQ A;  5J2T B;  1N33 B;  1ZUQ A;  3G71 V;  1AI5 A;  2HHH B;  4PA6 A;  3J81 N;  4F6R B;  4Z1M G;  4JI3 O;  2DYS C;  3CCQ V;  1HNX O;  3VOU A;  3AG3 B;  1Z5V A;  1XHX A;  3TCU A;  2GSM B;  4J9Y B;  4DV7 B;  1XOU A;  1S5J A;  2WLH A;  5JQG B;  3RYH A;  1SET A;  4QIW F;  5KHI A;  4IYH A;  5KX5 B;  1D2D A;  3UQ8 A;  1B04 A;  3WG7 B;  5CA0 A;  2FML A;  1XL4 A;  1Q43 A;  4Q6G A;  3RFR A;  5KHJ A;  1RM1 B;  1X4T A;  4WBN B;  3OMN B;  4J41 A;  1YJ9 V;  2HJD A;  3EVK A;  4J7Z A;  4JI1 O;  2BSK A;  4RUE A;  4F6R A;  1FJG O;  3CCS V;  4O4L B;  3AK1 A;  5BZB A;  1OV9 A;  5L3G A;  2XOK G;  5LOV B;  4J11 A;  4D7T A;  4P30 A;  5JQG A;  4GX0 A;  5IYD O;  3SYQ A;  4X66 B;  2B9Z A;  3CB2 A;  1HR0 O;  1JA8 A;  5KX5 A;  2N05 A;  2KQX A;  4G27 B;  2OCC C;  5LYJ A;  4LFC B;  1OCO B;  1NR1 A;  4PDR A;  1T5E A;  4H37 A;  2AW9 A;  5A2Q N;  2QDO A;  2Z5U A;  1V54 C;  4B3R O;  5H6Q A;  1R3J C;  3UT5 B;  4JI5 O;  4PA3 A;  3RBZ A;  2YUA A;  4O4L A;  1SQB H;  1FAF A;  1S0V A;  2QE7 G;  4GYC B;  3TET A;  4JI8 B;  5LOV A;  4PA4 A;  4ICG A;  3KZI Z;  3QF7 A;  2OIE A;  2QWQ B;  4DR7 B;  1KU9 A;  4W4L A;  2RQ6 A;  4LF5 O;  1GM7 A;  4LH6 A;  1VQ4 V;  4GKK B;  4UV9 A;  2VQF O;  2PI5 A;  1WAZ A;  1GN3 A;  3QO8 A;  4DXW A;  3HKE A;  1OJH A;  1QQC A;  4UCS A;  1DTO A;  3W7T A;  3R66 A;  1YJN V;  1NBM G;  1SZT A;  3ZJZ A;  3UT5 A;  4DR4 O;  4MVR A;  3CHX A;  4X62 B;  1H2L A;  3JAK B;  3P32 A;  4LF7 B;  4TWK A;  2F1M A;  2F43 G;  3ASO C;  1Q8I A;  3Q4H B;  2ZIM A;  4X65 B;  2QM7 A;  1IVS A;  1M4U A;  3HKC B;  1V9P A;  2ZQM A;  4DV5 O;  3UCS C;  1GMG A;  4IIJ B;  4U7O A;  3JAL A;  4WFA V;  3HPL C;  4DV6 B;  4GCZ A;  4WFF A;  5K1P A;  3A8T A;  1K33 A;  1NT2 B;  3RYF B;  2B5U A;  4PEL A;  4CC5 A;  2OIG A;  1N34 O;  1PNL A;  3ABK C;  3IGA C;  2R9A A;  2WLL B;  3JAK A;  1XQ8 A;  1D5A A;  4QPJ A;  3MHH C;  1Y74 B;  3MD0 A;  3Q4H A;  2YI8 A;  1Q90 D;  4D7S A;  2LGQ A;  1YCI A;  5L3B A;  2EIK B;  1QVF U;  3E35 A;  1F4N A;  3K5L A;  3CCL V;  3RYF A;  1P4R A;  5LMN O;  4I55 A;  2KG7 B;  1P49 A;  4HNA B;  3T1H O;  1TUE B;  3N2K B;  4GT1 A;  1GN6 A;  4DR2 B;  2FB5 A;  4DV1 O;  5E79 Z;  4G28 B;  1Y74 A;  1OCC B;  4FLU A;  1JR9 A;  1NH2 B;  3OE7 G;  1KQS U;  1ARO P;  2YIB A;  3FAV B;  4EB6 B;  1GM8 A;  3DSQ A;  1SA0 A;  2RN9 A;  1I0H A;  3ABL B;  3TXS A;  4J42 A;  2LJ2 A;  5KHH A;  3RYC B;  4FZ0 A;  1M1K W;  3BCC H;  3AG3 C;  4BW5 A;  1GN4 A;  4MS2 A;  4CZZ A;  2E5L B;  5JH7 B;  4X89 A;  5IYC O;  1VMG A;  4GX5 A;  3FAV A;  4PJ0 Z;  4PDV A;  4RQE A;  4EB6 A;  3WG7 C;  4FPP A;  1HDJ A;  2RCV A;  1RM1 C;  1IUR A;  5KMG B;  4TT3 G;  3HB3 B;  1R6N A;  3RYC A;  1XHZ A;  5LMU B;  3AG1 B;  3SJQ C;  1WPX A;  4X9Q A;  4P9O A;  3MDS A;  5LHH A;  3CJH A;  1Y76 B;  4X1K A;  5KUK A;  1LUW A;  1FXK B;  5JH7 A;  4OX9 O;  2UU9 O;  3E22 B;  1PP9 H;  4I4T B;  4LF9 O;  2EZP A;  1BGY H;  1XMQ O;  1AI7 A;  4PDM A;  5J9P C;  4D6T H;  1OCO C;  2MW2 B;  4LNU A;  3AG4 B;  2PYJ A;  5KMG A;  4Q20 A;  2LO1 A;  4JI0 O;  4ASU G;  3JAR A;  1TVK B;  3ZRS A;  3U0Z A;  2Q69 A;  3D36 A;  5B1B B;  2LP7 A;  1G6U A;  4O4H B;  3D3I A;  4B3S O;  1LR1 A;  2P90 A;  2Y48 A;  3T1Y O;  2KB1 A;  2QKA A;  5IWA O;  4I4T A;  2JK5 C;  3OTO B;  2XAH A;  1VF6 A;  3AK3 A;  5EBL C;  3ML0 A;  1EN5 A;  4DRX B;  1WN7 A;  2PZS A;  4HZ3 A;  2BTO A;  1S72 V;  3CS5 A;  5EC2 C;  3SPH A;  4DV2 O;  1P7B A;  1B6Q A;  4NKG B;  2HEP A;  4IYI A;  4JTC B;  2R72 A;  5IY5 B;  2A0L A;  4O4H A;  4K8Z A;  2JS5 A;  3ZIA G;  4H13 B;  5D5P A;  5GTH Z;  3ASN B;  4X1Y B;  4MVZ A;  1WLE A;  1AP6 A;  3UO3 A;  2QTS A;  1KMI Z;  2EIN B;  4AHC A;  1CPY A;  1H2K A;  4OXS A;  1W2B U;  4CH4 A;  5LGT A;  4R8C A;  3ZMT A;  2JJ2 G;  5BR8 O;  3G4S V;  4RWU A;  4DUZ O;  1BQZ A;  1ZWI C;  4C7U A;  2X6B A;  2WPD G;  1GAX A;  2M6Y A;  3CP1 A;  3CD6 V;  2DWD C;  1SQQ H;  1G4Y B;  1SQV H;  3OMI B;  1URF A;  5IE9 A;  1W59 A;  4JZG A;  1YZB A;  3B77 A;  1S5H C;  5IJ9 A;  2EIK C;  1SES A;  2AHZ A;  1L1F A;  4O4J B;  3QTC A;  1O9H A;  2PF4 E;  1Y6X A;  4NXN B;  1VQ7 V;  4DO2 A;  4DR3 B;  1F23 A;  2DWE C;  1VF7 A;  2WLN A;  1I5X A;  3CEI A;  4LFA B;  1VQP V;  3EFF K;  2Q0A A;  2OTL V;  5LGU A;  4JI2 O;  3ABL C;  4JYB A;  4TV9 B;  2Z3Y A;  2ZXW B;  2JIZ G;  2W0F C;  5JWP A;  1S3J A;  1N36 O;  4EFB A;  5JCO C;  1QHT A;  1F4M A;  4I9W A;  3E8G A;  1XEQ A;  4PI2 A;  4XDK A;  3ZCC A;  4NVP A;  3D8C A;  3LDE A;  3OGC C;  1HWY A;  4QJF B;  3S3W A;  4B3M B;  2F66 C;  4WF9 V;  2QWP B;  5KHG A;  3B8N A;  3CSX A;  1M56 C;  1JVM A;  2VRZ A;  4JZ2 A;  1XDC A;  2IM9 A;  1OCZ B;  1ORQ C;  1W0J G;  3K59 A;  1XNQ O;  2CTQ A;  3N27 A;  1CXZ B;  4X64 B;  4TV9 A;  3NXS A;  3OR7 C;  4FLY A;  2XAS A;  1BCC H;  1XNR O;  4AIL C;  2PY5 A;  4AI8 A;  3CCR V;  4CS4 A;  2E75 B;  1HNZ O;  2F93 B;  3CC4 V;  2ODM A;  4PV1 B;  3SPJ A;  4FM0 A;  4JI3 B;  1Q3E A;  5E1A C;  1VQL V;  2D3O W;  2QKC A;  2Q67 A;  3E8B A;  1VF6 C;  2OT5 A;  5B66 Z;  2N74 A;  3AG4 C;  4KHP O;  1AJN A;  5CA3 A;  1L8D A;  2YID A;  4O2A A;  3VQX A;  1AJP A;  4I9Q A;  5B1N A;  1Z2G A;  4YY3 O;  2Q7H A;  2LW1 A;  2UUA O;  4JI1 B;  1FJG B;  3EXA A;  3FB6 C;  3MHS C;  1M93 A;  4NTY A;  2ARH A;  4JV5 O;  2DMX A;  4WFH A;  1XBL A;  2A79 B;  2ADP A;  4JAS A;  1HR0 B;  3DXR B;  1DLB A;  4FIP C;  3ZMV A;  5GW7 A;  4K0K O;  2R70 A;  2ADQ B;  3BA9 A;  5IY5 C;  3ZRW B;  4FLT A;  3BEH A;  4JI7 O;  3FKS G;  4LP8 A;  4B3R B;  2ZNJ A;  1XRE A;  4JI5 B;  1Q6I A;  1GO3 F;  3BPZ A;  2Y0I A;  2G38 A;  4FLV A;  1MOF A;  3OTF A;  4DR1 O;  1VQ5 V;  3JD4 A;  4B3T O;  1IBL O;  2WAM A;  4Z1V A;  1BHA A;  3H1H H;  4CH5 A;  5KA6 A;  1BHB A;  3LSS A;  4LF5 B;  2UXC O;  3OR6 C;  2VQF B;  4IL6 Z;  4I7Z B;  3WFV A;  1MSW D;  2JEU A;  1FXH A;  2LW7 A;  1Q82 W;  4UB6 Z;  5CMU A;  1VP7 A;  2JEX A;  2CTR A;  4X20 A;  4TV8 B;  4DR4 B;  2ZR3 A;  3R65 A;  5FPO A;  1H2M A;  5J2T A;  2VWJ A;  1PNK A;  3CRQ A;  2W6I G;  1SER A;  2EZO A;  1ENV A;  5EZY B;  4QE9 A;  4I5S A;  1ZAU A;  4DV5 B;  1QLE C;  5LBQ A;  4MTX A;  4QE7 A;  1BT8 A;  4YXW G;  4PA9 A;  1SRY A;  1L0N H;  4UVB A;  5H6R A;  1NKD A;  1YJW V;  2L6L A;  2BCC H;  1N34 B;  3L73 H;  3L71 H;  1HP8 A;  1VF5 B;  4GLX A;  1YDX A;  4DK0 A;  5BMV B;  3W7X A;  4FM1 A;  4WBN A;  1K5S A;  2ZXW C;  4F6E A;  2YXY A;  2YC0 A;  5J2U B;  3IJ4 A;  4U3J B;  2XND G;  2NN4 A;  1VQ6 V;  5LA6 B;  2FKX A;  2KSD A;  4LCU C;  1N32 O;  2GUZ B;  1Q86 W;  3QO7 A;  4JF3 A;  4BIU A;  1S5L Z;  4J7J A;  4PD4 F;  1MAB G;  5LMN B;  1H8E G;  1QNM A;  3T1H B;  3K5N A;  4FLX A;  3K0D A;  4R7C A;  2Q7E A;  4DV1 B;  5KUM A;  2EJ7 A;  3ZBH A;  5BMV A;  3CRA A;  2QJ1 A;  3D3Q A;  4DV4 B;  4HYO A;  3ZRX A;  3T4Z A;  1QR9 A;  5J2U A;  2W0X A;  2GBO A;  2A06 H;  3E86 A;  5LA6 A;  2BE3 A;  4DV0 O;  3X2Q C;  2GUZ A;  4MTG A;  2LQT A;  4F4L A;  4B7K A;  1N0N A;  5IYZ B;  1OCR B;  2B1I A;  4MVQ A;  5GTI Z;  2Y4T A;  1BQ0 A;  2PUS A;  1PV0 A;  3ETG A;  4H33 A;  1H2S B;  4CBC A;  2WSS G;  1YTF B;  2HR3 A;  5JVD B;  4DV3 O;  1H2N A;  3H1L H;  3HKB B;  4CH6 A;  1FFX B;  3C3T A;  1SKV A;  3ZHR A;  2PGG A;  2ITD C;  4X1I B;  5JJE B;  1A32 A;  2DOS A;  3CCM V;  5EIB C;  1WNS A;  4UCT A;  2UUC B;  5IYZ A;  3CPW U;  1OZ0 A;  5LHI A;  3HKC A;  1Y67 A;  3KG2 A;  4KP4 A;  2EJR A;  2ZE7 A;  2F4V O;  4IIJ A;  4YIP A;  3I56 V;  4K3A A;  2YIB D;  1FFT B;  1WB7 A;  5FLX N;  3CE2 A;  4OX9 B;  1KEC A;  2UU9 B;  1QU7 A;  4LF9 B;  3JD2 A;  3HKB A;  1FFX A;  1JCH A;  4LFB O;  1ZSP A;  1XMQ B;  2C2A A;  1XIL A;  1L0L H;  1R3L C;  2WLL A;  3JSN A;  1EBO A;  2IJH A;  4LF6 O;  2CAZ C;  3L75 H;  1DGS A;  1F51 A;  2UXX A;  3IC9 A;  4MVM A;  4DW1 A;  1QCE A;  1XMO O;  3AK2 A;  1IDS A;  1K8A W;  1NH2 D;  3W7W A;  4B3S B;  1WPB A;  4E2L A;  3T1Y B;  4X88 A;  3SPC A;  2ETN A;  5IWA B;  4FLZ A;  2KG7 A;  3SDL A;  4EFE A;  2NR5 A;  4R50 A;  3JD3 A;  4HNA A;  2OCH A;  2K1E A;  1SZX A;  3N2K A;  3CXH F;  3JSL A;  1AIL A;  1KYO F;  1R6K A;  4L87 A;  2O57 A;  5ITZ B;  4H0L B;  3A2F A;  5GON B;  2ZIN A;  1VQ9 V;  4DV2 B;  4DR5 O;  3J80 N;  2ZT9 B;  4UVC A;  5KAF Z;  3F7Y C;  2P4K A;  5L3E A;  2L35 A;  2Q73 A;  2EX3 A;  3OAA G;  5JJN B;  4BR6 A;  3TK1 A;  3K5M A;  5JCO A;  1JJ2 U;  3WB1 A;  4UCR A;  1GM9 A;  3H1I H;  4JPR A;  1UPG A;  2A9H A;  1AVM A;  2ZD9 A;  3BVO A;  3OEH G;  5ITZ A;  5BR8 B;  4TUY B;  5GON A;  1NS1 A;  4NTW A;  2H94 A;  3SPG A;  3K03 A;  3ABT A;  3AG2 B;  1YXB A;  2YXL A;  3OUF A;  1WP7 A;  1SQX H;  5H5N A;  3O9O A;  4GKJ O;  1S76 D;  5D5Q A;  2IBZ H;  3FB5 C;  2EIM B;  1NQT A;  1Y76 A;  1FXK A;  2HLD G;  4OPH A;  3E22 A;  4FLW A;  1X59 A;  4JI4 B;  1E1Q G;  2AGA A;  2BOB C;  1GH6 A;  2M7W A;  3ABM B;  2ITC C;  2OTJ V;  1TUB B;  3OM3 B;  5CA1 B;  4I0X B;  1N0J A;  2WWW A;  2D2C B;  1V55 B;  5EBM C;  4FFK A;  3CXC U;  3LSU A;  2A7W A;  4X8A A;  3TGU H;  2LFR A;  4WFG A;  1ZL8 B;  1SQP H;  1TVK A;  1LUV A;  2ZDI A;  1KKD A;  3CCV V;  4JI2 B;  4DUY O;  3B8M A;  4TQF A;  2YS8 A;  5TIS Z;  1AP5 A;  4JGS A;  4UCV A;  3P30 A;  1N36 B;  1TGO A;  4W4K A;  3SJB C;  1IBM O;  2EIJ B;  2H8P C;  1OCR C;  4RUF A;  3K0G A;  4PA7 A;  3CC2 V;  2DE0 X;  2KKW A;  3M99 B;  2ILM A;  1VQ8 V;  4MT8 A;  1OHH G;  1TUB A;  4DRX A;  5CBH A;  4EEQ A;  1BL8 A;  4JYC A;  1EN4 A;  2NNU A;  1Z5W A;  1ZX3 A;  4J80 A;  4MVO A;  1GKF A;  1FPO A;  1JPX A;  1BE3 H;  1XNQ B;  1US6 A;  1IXB A;  1NVP B;  3HKD B;  4X1Y A;  5CBF A;  3U10 A;  3SJC C;  2K9P A;  4UUJ C;  1XNR B;  4PDL A;  5CB4 B;  1GK9 A;  2DYS B;  5HFM A;  3CMA V;  1U97 A;  5EYP B;  1HNZ B;  4JYA O;  1KP3 A;  2YI9 A;  1I7F A;  3M8A A;  4NXM O;  2AHY A;  3CCU V;  1AR5 A;  4KXR A;  3UKM A;  3K58 A;  1CEZ A;  2P67 A;  4KHP B;  2XAJ A;  1OCC C;  3HKD A;  1QLN A;  3RYI B;  4UCO A;  1EM1 A;  5BXZ A;  3G6E V;  2XAG A;  1QBZ A;  3BAA A;  3ETD A;  1Q6H A;  4DYL A;  5EYP A;  2ZM6 O;  3JYC A;  3APQ A;  3SR2 C;  3ICX A;  4YY3 B;  3CCE V;  2P7T C;  2UUA B;  2IH3 C;  3DC5 A;  4O4J A;  2JJ1 G;  3OD4 A;  3T2M A;  4KL1 A;  4R6Z A;  3SYP A;  3PJS K;  4B08 A;  4JV5 B;  3CYO A;  3H1J H;  2XAF A;  2YIA A;  3QO5 A;  2IJK A;  2OWO A;  5A9G A;  1XUQ A;  2OCC B;  4O4I B;  1EZJ A;  1CP9 A;  4K8X A;  1AI4 A;  1V54 B;  2JDI G;  1PD3 A;  3OT7 A;  3VQW A;  3RYI A;  2EIL B;  4K0K B;  1FYJ A;  2RJZ A;  2CH7 B;  4JI7 B;  4LWS B;  5IJ0 B;  2GHY A;  2AZ2 A;  4BWA A;  2P6J A;  1JFF B;  3CRC A;  4WFB V;  1WA8 B;  2WLI B;  3ZN0 A;  1AR1 B;  3JAW B;  4FVM A;  3AG1 C;  4YJ2 B;  2YDE A;  5C8Y B;  2JS3 A;  3W7U A;  2UXD O;  1VQK V;  2P06 A;  3ZRV A;  4ZKI A;  4DR1 B;  3FFQ A;  5H9C A;  2QWN B;  3CRR A;  4B3T B;  2GV9 A;  1K97 A;  1IBL B;  5EK0 A;  4FMT A;  2WA3 A;  1FXK C;  4PHZ A;  4DR6 O;  1J5E O;  2GTA A;  1HNX B;  4TOI A;  1M57 B;  2Q5Z A;  4QGP A;  5L3F A;  1WB8 A;  2QWR B;  4LWS A;  2IJI A;  3A0R A;  1IBK O;  2V4D A;  3ZMU A;  2UXB O;  5LP6 B;  1JFF A;  5IYB O;  1RPO A;  1Q5O A;  1WA8 A;  1WJZ A;  3JAW A;  5FL7 G;  2ZDI C;  4YJ2 A;  5C8Y A;  5B1B C;  4LF4 O;  5CBG A;  1QVG U;  3FYE B;  3RWR D;  2N04 A;  3E89 A;  2EIM C;  4FZ1 A;  3AEI A;  3ZHU A;  2VQE O;  4UXN A;  2YEV B;  3E2E A;  3A0B Z;  5EIB D;  3CWB H;  3LDC A;  4UV8 A;  2GDS A;  2CGN A;  2F23 A;  5LXT B;  2Y4U A;  4IGG A;  1GTO A;  4LR3 A;  5EC1 C;  1HNW O;  4CS2 A;  1O9G A;  5LP6 A;  2YSU B;  4JAA A;  3GB7 C;  1R1B A;  3IC7 A;  1VQN V;  3K9A A;  3OFN G;  4QPK A;  1NI8 A;  3ASN C;  2E76 B;  4B3M O;  4YJ3 B;  3RVY A;  2EIN C;  4NYK A;  3ABU A;  2OYQ A;  2VWK A;  4N23 A;  4B7E A;  1N32 B;  1E79 G;  1ZLZ A;  3DXR A;  1JMK C;  4MTO A;  2V7Q G;  2DYR B;  1RP3 B;  1YF2 A;  4LF8 O;  3TXQ A;  3F7V C;  4AQY O;  2QGN A;  3ZRW A;  4UFZ A;  1MZE A;  5H2F Z;  3TJT A;  3G67 A;  4OPA A;  1B06 A;  5CA0 B;  1M5I A;  3H1K H;  4ZOL B;  1PPJ H;  1BSM A;  2B1G A;  2H3O A;  1MA1 A;  4MSW C;  3LNN A;  4YJ3 A;  2BSK B;  1TAE A;  3ZHT A;  4DV0 B;  1BS3 A;  4MVS A;  3KCX A;  1H2G A;  2CDY A;  4ZBM A;  4FM2 A;  2F95 B;  4YHH O;  2XHB A;  4P9P A;  3FB7 C;  3JAM N;  4FK5 C;  2CE4 A;  2EBO A;  5LYJ B;  2QM4 A;  1Y66 A;  3PN1 A;  1RPR A;  3J7A U;  1I08 A;  4RQF A;  4ZOL A;  2VS0 A;  4FFB B;  4A5U B;  4DV3 B;  4JI6 O;  3OEE G;  1B3Q A;  4TV8 A;  1SC5 B;  1NTZ H;  2CTW A;  1KBH A;  3ZMZ A;  1UFI A;  1R73 A;  1IX9 A;  1SQF A;  1I94 O;  2X6C A;  3CME V;  4NB5 A;  5IDJ A;  3SPI A;  5B1A B;  4UVA A;  5KA5 A;  5LHG A;  1YHQ V;  2CTP A;  3L72 H;  5EZY A;  1R3K C;  4CC6 A;  3JAT B;  2ZNI A;  1BMF G;  3BAB A;  3JD0 A;  4MVU A;  2F4V B;  1YEW A;  2DQ3 A;  1PKX A;  5DN6 G;  3SYC A;  4FFB A;  3GWO A;  3HKE B;  3K06 A;  2UUB O;  3M7M X;  2PI4 A;  2ZIO A;  1SF9 A;  4LFB B;  2EIL C;  1OCZ C;  3RVZ A;  1DF5 A;  2YXH A;  2QKS A;  2AZ0 A;  1QR8 A;  3RT3 C;  4LF6 B;  3DTU B;  3OMA B;  1N33 O;  3B2E E;  2LGW A;  1NTM H;  4KUM A;  3C90 A;  2HHH O;  3JAT A;  1XMO B;  1JX9 A;  2HKO A;  2P22 C;  4U3J A;  3F5W C;  1K73 W;  4EKW A;  3H01 A;  5BY1 A;  4DV7 O;  1XI1 A;  4MTF A;  3JAL B;  1EFR G;  5B5E Z;  3DC6 A;  1AJQ A;  1THZ A;  1NTK H;  1M57 C;  3E8H A;  2CGO A;  2W6J G;  1KD1 W;  4L8J A;  4UB8 Z;  1KKC A;  1RSO B;  3BY6 A;  4DR5 B;  5LP6 C;  2HP8 A;  2XTA A;  3E83 A;  3JAS B;  2Q7G A;  2WLM A;  1YTF D;  4NR1 A;  4U7N A;  3SJA C;  1D5N A;  2HJF C;  4X66 O;  4BIZ A;  4I55 B;  1JOY A;  1BZK A;  2WLJ A;  5B1O A;  5FNV B;  4GZR B;  2R9I A;  3WB2 A;  4LFC O;  1DK1 A;  4CH3 A;  4P2Z A;  1NJI W;  2ZKO A;  1RSO A;  2FL4 A;  5JVD A;  1K92 A;  3JAS A;  2UXN A;  4ZI7 B;  4IHJ B;  1DF4 A;  3VQV A;  4X1I A;  3C3S A;  5K1X A;  4WFE A;  3CX5 F;  2RDC A;  1F7Y A;  1SA0 B;  5L3D A;  4JI8 O;  4JI0 B;  1G1X B;  1GN2 A;  1NR7 A;  1K34 A;  1MNG A;  3K3W A;  3L9D A;  4GKJ B;  3WU2 Z;  4DR7 O;  2E3C A;  3B40 A;  3ZS8 C;  2JVD A;  3ZHS A;  4GKK O;  5FNV A;  4TQD A;  3B4S A;  3ZED A;  3CCJ V;  1J95 A;  3G6B A;  3ETE A;  3GWK C;  4DV4 O;  2DYR C;  3I55 V;  1K5Q A;  2E74 B;  4ZI7 A;  4IHJ A;  1G8M A;  3RW0 A;  4X62 O;  3HR0 A;  3I5D A;  3QVN A;  3U11 A;  4LF7 O;  1SS3 A;  1YVW A;  1JJO A;  2ZE8 A;  2XUM A;  4MW3 A;  5HFL A;  4X65 O;  4DUY B;  4CS3 A;  3STL C;  3STZ C;  1FKA O;  1ZTE A;  5KLV H;  4H44 B;  2CUG A;  5DM6 V;  4ABM A;  3OW2 U;  3CJH B;  1IBM B;  4DV6 O;  1Y4M A;  4X1K B;  3T4D A;  4ZHQ B;  4J10 A;  2ATK C;  1MMM A;  3L74 H;  1N4C A;  2XT9 A;  1M56 B;  1VEW A;  3NR7 A;  4O2B B;  2FYU H;  1COW G;  3BFR A;  4LNU B;  1I5Y A;  4DUZ B;  1PNM A;  1NZ6 A;  2R9R B;  4BAY A;  2MK3 A;  1YIT V;  2Q68 A;  2UUC O;  3JAR B;  4DK1 A;  3MAQ A;  3E8F A;  1K3E A;  3CC7 V;  3JD1 A;  2QA4 V;  2RNB A;  2Y69 B;  5B1A C;  1UJW B;  4LH7 A;  3VBB A;  3B09 A;  2EUL A;  1P7G A;  4ZHQ A;  3LUT B;  1NU1 H;  4JYA B;  4O2B A;  3SYA A;  3K5O A;  1S77 D;  2Z0A A;  4DR2 O;  3ZN1 A;  4JAU A;  4TUY A;  1EZV H;  4NXM B;  3ZHQ A;  2BOC C;  4J9Z B;  2Q9L A;  3P3P A;  4QNH B;  5B3S B;  2IH1 C;  1MSD A;  2Q8V A;  2DW4 A;  4I50 B;  4ZIB A;  2BTQ B;  2HVJ C;  2WA4 A;  4XBF A;  3F5T A;  3BHP A;  4GUN A;  3UO2 A;  4NTX A;  2ZM6 B;  4OGQ B;  1VQO V;  3JCZ A;  1PL4 A;  2ZE6 A;  2NLJ C;  4BIO A;  2IU0 A; 
#chains in the Genus database with same CATH homology
 4NYK A;  4NTY A;  4NTW A;  2FB5 A;  2L35 A;  4FZ0 A;  4FZ1 A;  4NTX A;  3S3W A;  3IJ4 A;  1WP8 A;  1WP7 A;  2QTS A;  3N27 A;  3S3X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...