5CMUA

Artificial hiv fusion inhibitor ap1 fused to the c-terminus of gp41 nhr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Envelope glycoprotein,AP1
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cmuA00
5KA5A 1QCEA 2EBOA 4FK5C 2MK3A 1F23A 1DF5A 1ENVA 5CMUA 5KA6A 1QR8A 1I5XA 1Y66A 4FIPC 3WFVA 3CYOA 3B77A 3MHHC 1I5YA 3H01A 4N23A 4E2LA 1Y4MA 1SZTA 1QBZA 3B8MA 4FJCC 3K9AA 4G2KA 5H9CA 5CN0A 5HFLA 1DLBA 3P30A 5HFMA 1JQ0A 3GWOA 3M99B 2P6JA 1K33A 2OT5A 2X7RB 3B8NA 3MHSC 4JF3A 2M7WA 4N21A 1JPXA 1DF4A 1K34A 3CP1A 2EZOA 1QR9A 4JPRA 2LP7A 2EZPA 1MOFA 1MG1A 1EBOA 4JGSA
chains in the Genus database with same CATH superfamily
2PGGA 4BWAA 4JI1O 1IBKO 4GKJO 4JI5O 3JATB 5L3GA 4O2AA 4D7TA 1XHZA 5HFMA 2RQ6A 4MTGA 3ZIAG 5IYDO 4WFBV 4AHCA 1K34A 2ETNA 1P49A 1SQFA 3ZMUA 5ITZB 1AILA 1HDJA 1Q3EA 2DWEC 1Q43A 4QGPA 1IVSA 4ZHQA 2KG7B 1KKDA 3SPHA 1NR1A 1SZXA 1WP8A 2JEXA 1JX9A 3TCUA 3A0RA 4MVRA 4U3FH 1XMQO 4ABMA 4TQDA 3FB7C 2YXLA 1GM9A 2ARHA 2C2AA 2QM8A 2E5LB 2Q69A 3FX7A 5LXTB 2PY5A 5KHHA 4K8XA 3CCLV 1L8DA 3WG7B 3K79A 4NTXA 2HP8A 2IJJA 3SJCC 4UCVA 4L87A 4DR1O 3QVNA 4JI4B 1CP9A 2XASA 2IU3A 1M56C 4U7OA 3N27A 4FFBA 2EIKB 4BIZA 1PNMA 3T4DA 3GB7C 1FXKB 3D36A 1GM7A 3L72H 1BCCH 3B4SA 4JI0B 2GV9A 4BIUA 4UB6Z 3VQWA 2JVDA 3APQA 3QG5A 2ZE5A 3CXCU 3B09A 3OMAB 1PL4A 1Q7YW 1FJGO 2L6LA 3J7AU 5LGTA 4QIWF 2EIMC 2HLDG 5IJ9A 4R8CA 4IT5A 1TUBB 1NKDA 3WFVA 3MHHC 3B8MA 1US6A 2QWRB 1LUWA 1VQ8V 1DLBA 1E79G 2IBZH 2EINC 4ZBMA 1HP8A 2GDSA 4OPHA 3W7XA 1F4MA 3D36C 3ETEA 3FB8C 2Z0AA 2XT9A 3ZX6A 3RVYA 4UCUA 3ASOC 4LF9B 1PP9H 4O4JA 2HHHB 4WBNA 1SQVH 3OEEG 4UCRA 5B1AC 1M57C 1NJIW 4KXRA 1RP3B 2P67A 1MZEA 5C8YA 3UQ8A 3IGAC 4MW8A 3FB6C 4HNAB 2E5LO 4X1KA 1JA8A 1J5EB 2HEPA 1WP7A 2QM4A 3CXHF 3OTOB 1S5JA 4IIJA 3THOA 4JI4O 3SYOA 3DC6A 2ZR3A 1U97A 1QR9A 1I08A 1AJPA 1BMFG 1NZ6A 4D7SA 3BVOA 2QA4V 1B06A 2QSAA 1QHTA 3E35A 2LGWA 5KX5A 3FYEB 3SJBC 2EULA 3SYQA 1JJ2U 3N2KA 4I4TA 2JGDB 5DN6G 4GX1A 1LNQA 1TVKB 2GTSA 4GCZA 4EKWA 3HKCB 3ABMC 3ETQA 4D6TH 4LNUB 3AG2B 4JZGA 4B3SB 1AR4A 1JCHA 1B6QA 5D5QA 4DR5B 3A0HZ 3HB3B 5IY5B 4CC6A 4L8JA 3OM3B 4MW3A 4LF8B 5IYBO 2UXXA 4JI7B 1KYOF 4LF6B 2Z3YA 2UXBB 2Y69B 4JF3A 4R7CA 4B3TB 4FM2A 5DECA 4U7NA 4HYOA 3CX5F 4TV9B 2HVKC 1XMOB 4MVOA 3JAKA 4J11A 2QKAA 3ZMZA 3O9OA 3E8BA 3CE2A 4WFGA 1VQKV 2HHHO 2E75B 1KP3A 1G4YB 4J7KA 3WB0A 1YJWV 3K0DA 3RFRA 1ZTEA 2G38A 3OEHG 5LGUA 3TGUH 1Y76B 3ZRXA 5GONB 4J41A 3CCSV 2W6IG 1AI6A 1XL4A 1MZFA 4WF9V 2R72A 5B1BC 4DV7B 1RM1C 4CS2A 1K4DC 3HKDB 1R73A 1N0NA 2ZNJA 1OHHG 1ROPA 4CH6A 1HR0B 1R3IC 4UCTA 2OTLV 1ZLZA 2IH3C 5KA5A 2DOSA 2MK3A 4JYAB 1H8EG 2FYUH 1L1FA 3JASA 4B3MO 2OYQA 5EIBD 4FFKA 2JS3A 4DRXA 3E89A 3G71V 4B3SO 3ZMTA 3H9VA 2WPDG 1WB7A 4DR5O 4A5UB 2YSUB 2IH1C 1GH6A 1WLEA 4LWSA 1S3JA 4MTFA 3ZHRA 2A3QA 2B5UA 1SZTA 4JI7O 1UFIA 4LF6O 3JCZA 1VF7A 5JCOC 2UXBO 3E8GA 1R6NA 4P9OA 4NXMO 3VQXA 3K57A 1HW7A 1BE3H 3RVZA 2R70A 2F43G 4DR7B 5ITZA 3F7YC 3EXAA 4XDJA 4PELA 2ZDIC 3K5MA 4UCOA 4PV1B 1GO3F 3RGBA 2OIEA 4KP4A 2OCCB 3RT3C 1I7FA 3AEIA 2PI4A 2F4VB 5JQGB 4K35A 3ZHVA 4H44B 4B08A 2UXNA 2QWQB 5J2UA 4H0LB 4U3JA 5LMUB 3PN1A 5IWAO 3R65A 5J9PC 3OW2U 4DR6B 2YS8A 2DW4A 3OGIB 1P84F 5D5PA 1HR0O 4JASA 5LL6Y 4DV3B 2ADPA 4X20A 1AP6A 1NVPB 2WLIA 1R1BA 4JYAO 4DV2O 1IXMA 2NNUA 4IYIA 1NTZH 4FMTA 1ZX3A 1ZSPA 1AROP 3A2FA 4DV6O 3P3NA 3ICXA 2ZE7A 5KAIZ 4ICGA 4J7ZA 3BA9A 4DK1A 3G6EV 2Q5ZA 1HWYA 3ZHQA 1MABG 3WG7C 5EC2C 3NXSA 1M1KW 3DSQA 2DJVA 3RYHB 4DUZO 3K9SA 1TAEA 3U10A 4IGGA 5CA3A 2VQEB 1AJQA 4H13B 2EJ7A 2EIKC 3MHSC 1BQZA 4DR7O 3FAVA 3K5OA 3SGIA 2V1DA 3HKEB 4J9YB 2W6JG 3IC7A 4RUEA 2BE3A 5EBLC 4TV8B 5JJNB 1MMMA 4MVUA 4RO2A 1S72V 2F4VO 5BMVB 4JV5B 3W7WA 3RYFB 4B3RB 3SPIA 5FNVB 5FPOA 2EILC 3UCSC 4XDLA 5IJ0A 1NI8A 3F5TA 1K92A 3QO7A 1Q8IA 1S0VA 4JTAB 3DC5A 2Y0PA 4I55B 5AG2A 1M93A 2AHZA 3AK3A 3CJHB 4DV3O 3VQVA 1OCCB 3OE7G 1XMQB 1D5NA 1WA8A 2XAGA 3FD9A 4B7KA 3L74H 1B3QA 1FFXB 1QR8A 2RDCA 5JVDB 2F1MA 3LSQA 2YEVA 4PA7A 1YDXA 2P4VA 3L70H 3GWOA 2XUMA 3M7MX 1CPYA 3BAAA 4OX9B 4IYHA 4PDRA 2OTJV 3D3IA 1MOFA 5LA6B 3CC2V 1M90W 4K8ZA 1M5IA 3F5WC 1MSWD 1QVFU 1Q5OA 1YI2V 2VQEO 3WU2Z 4DK0A 4FLXA 1K3EA 1XQ8A 2X0LA 3A0BZ 3W7UA 4LFBO 3J81N 1A32A 2BSKA 3WB2A 2ODMA 2RN9A 4CH4A 3BPZA 3ABUA 5CA1B 2CTQA 4RWUA 1R6KA 2ZR2A 4JGSA 4JTCB 4IHJA 2XAFA 3AK1A 1D2DA 1HNXB 2CE4A 4KFMA 3ZMVA 4JV5O 3OMNB 4UVAA 5LMNB 3X2QC 4B3RO 4NKGB 4CS4A 3AG2C 1FYJA 3ETGA 2DYRB 4P2ZA 3ZBHA 5K1XA 3ABLB 3ABKB 5GONA 2UXCB 5B66Z 3JCUZ 3JAWB 3ZRSA 1KQSU 1THZA 5KAFZ 4TUYB 4HBNA 2Y69C 1F51A 1IURA 2QGNA 2UXDB 2MW2B 2QJ1A 1QNMA 3HKDA 4BIOA 3STLC 4DR3B 4YJ3A 4E4EA 4CBCA 3UO2A 5KUMA 2N05A 1NH2B 2P5OA 2PYLA 5CBGA 1I5XA 2WLLA 3G6BA 4J10A 4QE9A 1JFFA 3U0ZA 1COWG 2AW9A 2QKSA 4OX9O 1OCRB 1QVGU 2EJRA 1YEWA 4C7UA 3O65A 5LHIA 1VQLV 1FS0G 3OT7A 4X1YB 4GX5A 3DXRB 1JVMA 1AR1B 1XI1A 2AHYA 1IXBA 3QTCA 1QCEA 3BRCA 5EYPA 1F23A 2KSDA 1FFTB 2GTAA 4HAMA 5A9GA 1Y4MA 2FL4A 3C3TA 1KBHA 4Q6GA 4DR2B 2EIJB 4JAUA 4FM0A 3BFRA 1N4CA 1IDSA 4O2BB 1RFYA 1BL8A 3T1HO 1WB8A 1HNXO 1K5QA 4DO2A 5LMNO 1XUQA 1K9MW 5FL7G 5JH7B 3OFNG 1BGYH 4BR6A 4YIOA 4QPJA 1FKAO 1WN7A 3A8TA 5L3FA 2NLJC 2UXCO 1RSOA 2LO1A 3ABTA 1FXHA 3SPJA 5CMUA 3CCMV 4E2LA 1Z2GA 2UXDO 5IDJA 1YHQV 1L0LH 1MA1A 4DR3O 4DXWA 2RJZA 3CRCA 3CC7V 5J2TB 1AR5A 1FD9A 1IBMB 1PD3A 2Q0AA 1BZKA 3T2MA 4TSFG 4F4LA 4X9QA 5C93A 1HNWB 2OCCC 1H2GA 2QTSA 5H6QA 4CC5A 3LSUA 1KKCA 4ZI7B 4F6RB 4PDMA 4LP8A 4O4HB 4J42A 3OD4A 5JJEB 3CRMA 1G6UA 2F23A 3IFXA 5CBFA 2LQTA 2LP7A 1EZJA 2ILMA 4I0XA 2QWOB 4BAYA 1XHXA 4UVCA 1O9HA 4DR2O 3JALB 2DQ3A 2ITCC 4MTOA 4B3MB 4NB5A 1VQPV 4O4IA 5GW7A 1YVWA 1EN6A 3CWBH 2CDYA 3ZMSA 2CGNA 2XAQA 4NTYA 4RQFA 4Q20A 4NTWA 1SA0B 2Q8VA 3UT5A 3E8HA 4UV8A 1ZWIC 2JDIG 2XNDG 4TV8A 1BHAA 3CPWU 1Q81W 1OCOB 2VRZA 4YHHB 3CC4V 1MSDA 1Y74A 3UM7A 3ML0A 5EIBC 2GUZB 5FNVA 2P06A 4NXMB 2AGAA 1ZL8A 3N2GB 2CH7B 1P7BA 2YXHA 1Q6HA 4O4LA 3BCCH 3JD1A 3BA8A 4LH7A 3RBZA 1SQBH 2YIDA 3RYIB 1R3LC 2PUSA 1GRJA 3TXQA 4I55A 3I55V 2QDOA 5CB4B 1SKVA 1JQ0A 1SF9A 3PJSK 5LYJA 1IBMO 3CJHA 4WFHA 2QEXV 3OR6C 4FM1A 2BTQB 1HNWO 2FTKA 2M6YA 4GX2A 4I9WA 3OTFA 1SQXH 2LW1A 3CS5A 2LGQA 3H1JH 4UV9A 2UUBB 3C90A 1TGOA 3QO8A 1PM9A 4O2AB 3JSNA 5LGNA 2ZT9B 5IWAB 2QE7G 1NVPD 4JAAA 3AG7A 4X1IA 4YJ2A 2ZD9A 4WFFA 2ZINA 3P32A 3AG4B 3Q4HB 2IW5A 5JCOA 2HJFC 4MVMA 4I50A 4ZHQB 1YJNV 1EN5A 1M56B 1EFRG 3JARA 3KG2A 4G27B 4YY3B 4DV2B 2B9ZA 2Q0OC 3RWRD 5LOVA 3GVMA 2BCCH 3RYCA 2P90A 3E83A 1V9PA 1TUEB 4GZRB 2ZDIA 1XNQO 1OCCC 3T1CA 4DV6B 2YC0A 1N32B 1OZ0A 3W7SA 1VQ6V 2NN4A 4ZOLB 3LNMB 5JWPA 3L9DA 2R9RB 3AG1B 3M8AA 4KL1A 1H2LA 1V55B 2EIMB 1YF2A 4WFAV 1WAZA 3K06A 1WJZA 1GN6A 4DUZB 2Y48A 4YHHO 1VQ4V 1SESA 1SQGA 3JATA 5L3DA 2PYJA 3B8NA 4FFBB 3LNNA 4I9QA 3MD0A 3ZRWB 4CH5A 1EBOA 2L35A 4UUJC 1P7GA 4F6EA 3RN4A 1ENVA 1H2MA 2HVJC 1M4UA 2KG7A 1ZUQA 4Z1VA 5B1AB 2N74A 4J9ZB 2GHYA 1PKXA 4FZ0A 4LCUC 2WLNA 3RW0A 2K1EA 4GKKB 4PJ0Z 3FFQA 4R6ZA 4LFAO 5DM6V 2UUBO 1S5LZ 3EHBB 3JD4A 4NR1A 5LXTA 1N33B 4JAVA 2WAMA 1H2NA 1SS3A 1VQOV 1RPOA 2PTMA 1FAFA 3ABLC 3ASNB 3ABKC 3VQYA 3CCJV 4X64B 2WWWA 4O4JB 4WBNB 2Q9LA 4YY3O 3CCUV 1PNKA 1FXKA 5GTHZ 2QKCA 4J7JA 4NVPA 5E1AC 1NTKH 5C8YB 1N32O 3SYAA 3G4SV 1E1RG 2V7QG 1URFA 2D3OW 4X1KB 4PA3A 3TJTA 4O2BA 1GN4A 3GWKC 4PHZA 4AQYB 1SQPH 2OCHA 1YIJV 4FK5C 3F7VC 4PI0A 3T1YB 3K5NA 1TUBA 1Q6UA 2DWDC 4YXWG 4GX0A 1K5SA 4IIJB 4X66O 2A06H 1UPGA 4UVBA 1NQTA 4FVMA 4LFBB 1FXKC 4J80A 5KX5B 2EZPA 5EBMC 2YUAA 3N2KB 4I4TB 5FPRA 4MVSA 5K1PA 2EIJC 4LF4O 1GMGA 2W0XA 4X88A 3S3WA 1CXZB 4MS2A 2Q67A 4GKKO 3OUSA 1JR9A 5L3CA 1YZBA 3KZIZ 4XBFA 2OWOA 3T4ZA 4HNAA 5H2FZ 1N33O 2WLHA 1GKFA 3CYOA 1KECA 5BR8B 1NH2D 4ZKIA 1VF6A 4F6RA 1P4RA 1J95A 4K3AA 1S5HC 2ZE8A 3JAKB 5JJJB 4X65O 1GN3A 2XTAA 3MAQA 4PD4F 4X64O 3CRAA 1VF5B 2Y4UA 3LUTB 1AI7A 5B1NA 2Q6AA 2YIAA 3E2EA 4GT1A 2VQFB 1N34B 2YIBD 5EC1C 2JGDA 2H8PC 1TVKA 1OV9A 4CH3A 1CEZA 2N04A 2Y4TA 3HKCA 3SPGA 4MVQA 1Q82W 3ZEDA 4FLTA 4AQYO 3DTUB 3OUFA 3BEHA 3VOUA 2Y0IA 4LNUA 1SA0A 3LDEA 2F66C 2Q7EA 5BXZA 5BZBA 3T1YO 1VF6C 3AK2A 1N36B 1YTFB 4W4LA 1I94B 3FYIB 1R6TA 1NTMH 2AZ2A 2W0FC 3HKBB 5F2VO 4JI8B 1XDCA 2A79B 1BHBA 2VWKA 3ZS8C 2LW7A 2GUZA 2LFSA 1MG1A 3K3WA 4TV9A 1GN2A 2PF4E 5CA0B 5KA6A 3T1HB 1SRYA 1Y6XA 3KKYA 3RYIA 1XEQA 1G8MA 3K9AA 4JI2B 2WLKA 1VQMV 5CB4A 4MT8A 4RAIA 1G1XB 3H1LH 3ZCCA 5LHHA 4UXNA 2JJ2G 2EX3A 3L75H 3KCXA 4CS3A 5IY5C 1Y76A 2BTQA 5LP6B 1JJOA 1GAXA 2RMKB 1OCOC 3K59A 4LF5B 4FZ1A 5BR8O 2V4DA 1Y67A 3ZHSA 3ZJZA 2ZIOA 4IL6Z 2JGUA 2ZM6B 4DYLA 1IBLB 4JZ2A 2X7RB 2ZE6A 2CTWA 4EEQA 3JAMN 1H38A 3CP1A 4OPAA 2R9AA 3H1KH 3Q4HA 3OGCC 5IE9A 3CEIA 4YIPA 2NR5A 2IU0A 1L0NH 2VQFO 4FIPC 2Q68A 2WA4A 1I5YA 1N34O 2X6BA 3LDDA 5TISZ 3CHXA 4WCEV 5KHJA 3ZRVA 4DV4O 5EBWC 5J2UB 5H6RA 1NS1A 1JMKC 5KHGA 1I0HA 2YDEA 4ZOLA 4U3JB 1YCIA 4CZZA 2DYSB 1FPOA 1YITV 3OAAG 3SYCA 1N36O 1N8RW 3E22B 1VARA 1RPRA 1I94O 5KMGB 4JI8O 3AG4C 2ZCEA 2BTOA 3OMIB 3K0GA 3I56V 1BQ0A 4N21A 1JPXA 3K08A 4X20B 2AZ0A 2EZOA 5B3SB 2WLIB 4JPRA 1ORQC 3ZRWA 1QLEC 3IJ4A 5KHIA 1WNSA 1H8HG 2IJKA 4JI2O 4G2KA 2CGOA 1KUQA 4H37A 3G80A 2DMXA 2ZXWB 1VQ5V 2HG5C 4BW5A 5JQGA 3SYPA 3AG1C 1DF4A 1S77D 1GTOA 1V55C 3ZN1A 2QTOA 1XILA 2EILB 2F93B 3IAYA 1V54B 1KMIZ 4KHPB 4LF5O 4DV5B 3UKMA 1QBZA 2ZM6O 5HFLA 2GBOA 1IBLO 2JIZG 3S3XA 2Q7GA 1H2KA 3IC9A 2IJIA 2RCVA 2WLJA 2FMLA 1EN4A 3LSSA 1QLNA 1DTOA 2B1IA 3BY6A 2PZSA 5IT9N 3FAVB 1KD1W 3OR7C 1Q86W 4FLZA 4FLWA 4QNHB 3CMAV 2HFEC 1OCZB 1SQQH 2BOBC 1NR7A 1E1QG 5KUKA 4DV0B 3BHPA 4FLUA 1T5EA 1K4CC 3JD3A 1WPBA 2LFRA 2IM9A 4PA9A 4RUFA 4PA6A 3TXSA 4ZIBA 5IYZB 5IJ0B 4I7ZB 3SJQC 1W0JG 4EB6B 1XREA 5EZYB 3C3SA 4AI8A 3RYHA 1O9GA 4LF7B 2OIGA 4FJCC 3HR0A 3DGEA 4EFEA 2DN9A 3ASNC 1M9NA 1XNQB 1R3KC 3AG3B 1WA8B 2ITDC 2DQ0A 4H33A 4JI0O 2WA3A 4LFCB 3J80N 2CAZC 1OJHA 3HKEA 1QLEB 2YEVB 3H01A 3UO3A 2A7WA 1R3JC 1H2SB 1HNZB 2XOKG 5GTIZ 5BMVA 1IX9A 2Q4PA 3X2QB 4K0KB 2Z5UA 3RYFA 1AI4A 1Z5VA 1DK1A 4WFEA 2RNBA 4KHPO 3R66A 1AVMA 4DV5O 1SC5B 2WSSG 1PL0A 4RQEA 1AJNA 4UFZA 2HJDA 2BSKB 1AB3A 1IZ3A 2JEUA 3APOA 4X89A 4GYCB 2HR3A 3SJAC 1F4NA 3CB2A 4IHJB 3MDSA 3JD2A 4LF9O 4X62B 1PPJH 4TQFA 3CCRV 1XL6A 4LFAB 4DV0O 2K9PA 2QWNB 4FLVA 3JD0A 1FFXA 1K7DA 5JVDA 3D8CA 4GLXA 3E86A 3M99B 4OXSA 3CRQA 2QR4A 2ZNIA 1J5EO 3K58A 3TETA 4R50A 3EFFK 3G67A 1W2BU 1DF5A 4LF7O 1VQNV 1LUVA 5LA6A 4OGQB 2P7TC 1SETA 1U96A 5FLXN 4PDVA 3OTOO 5CN0A 1NU1H 3FKSG 4YJ3B 3CMEV 1NBMG 2ZKOA 3ZHUA 3K03A 3SR2C 1ZAUA 2BOCC 3U11A 3HKBA 2UUAB 5L3EA 1KP2A 1GM8A 4LFCO 3CRRA 4JTDB 4ASUG 3ETDA 3K04A 2JS5A 2WLLB 5CA1A 5H5NA 1JFFB 4W4KA 4JI6B 5CA0A 1B04A 1XNRB 2YI9A 2ATKC 5H9CA 4QJFB 3I5DA 5A2QN 4HZ3A 1HNZO 2QWPB 4K0KO 1QU7A 4X66B 4PDLA 2F95B 5B5EZ 2EINB 4MSWC 3WB1A 4JI3B 5EYPB 2HKOA 2ADQB 2FB5A 3EVKA 5LP6A 1TA8A 4XDKA 4LF8O 2VS0A 3CCEV 2CK3G 3ASOB 3QO5A 4QE7A 3JAWA 4LF4B 4AILC 4I5SA 4Z2WA 4TUYA 4B3TO 1PNLA 3FB5C 1XMOO 2B1GA 1M57B 2LJ2A 3QNEA 5IJ9B 4EFBA 4X62O 1XOUA 2P22C 1X4TA 2JRIA 4JYCA 5KHKA 4KUMA 1MNGA 4P9PA 1VQ9V 1GK9A 2PI5A 2P6JA 2OT5A 1VEWA 3NR7A 2DYRC 2E76B 2UUCB 5CBHA 5LP6C 3P3PA 1KU9A 1UJWB 3CCQV 3CCVV 1RSOB 1K8AW 4X65B 3SDLA 4X1YA 3DXRA 5L3BA 4DV7O 2YIBA 1VIBA 1YSCA 3E22A 1SERA 4MVZA 3VBBA 2YI8A 3H1HH 5KMGA 1QQCA 1K33A 1BS3A 2UUAO 1YTFD 2XAHA 2A9HA 3ABMB 5LBQA 4X8AA 4B7EA 3E8FA 3SPCA 2P4KA 2Q7HA 4JI6O 3CD6V 2CUGA 1XBLA 1XNRO 4JYBA 4N23A 2ZIMA 3B2EE 2UU9B 1OCRC 3B40A 2A0LA 2E74B 5JH7A 5E79Z 2R9IA 4DR4B 2D2CB 3H1IH 2X6CA 1VP7A 2DYSC 4JI3O 4TOIA 4I0XB 1VMGA 3LDCA 2KKWA 4NXNB 2AXTZ 4DUYB 1Y66A 2O57A 1X59A 4O4IB 2KQXA 1D5AA 1Z5WA 4DV1B 4PA4A 3BABA 5EK0A 5B3SC 2M7WA 3UT5B 1BSMA 3HPLC 2FKXA 3K5LA 1EZVH 5J2TA 3L73H 1Q6IA 4TWKA 4UB8Z 4QPKA 1WPXA 2ZXWC 4JI1B 1IBKB 1N0JA 4GUNA 4GKJB 4JI5B 5DEDA 1Y74B 5BY1A 3JYCA 2H94A 4FPPA 4DW0A 5B1BB 1S76D 4ZI7A 2UUCO 1RM1B 4PI2A 1K97A 4O4HA 1ZL8B 1V54C 4G28B 1PV0A 5IYZA 4O4LB 4TT3G 1DGSA 5LMUO 1F7YA 2CTRA 4EB6A 4JYYA 4LR3A 3D3QA 5EZYA 3TK1A 4DR6O 2XHBA 5LHGA 1NT2B 2X6AA 3JALA 4FLYA 2WLMA 5LYJB 1W59A 2E3CA 5IYCO 2DE0X 2YICA 4DV4B 1OCZC 2XAJA 1BT8A 3L71H 1LR1A 2KB1A 2ZQMA 3KCYA 5B1OA 1JOYA 2JK5C 2UU9O 3B77A 3QF7A 2H3OA 4X1IB 4YJ2B 2IJHA 4LC1A 4NYKA 4BW9A 3P30A 3STZC 4DR4O 4LBEC 4DW1A 4DR1B 1AI5A 2CTPA 2YXYA 4Z1MG 4I50B 1Q90D 3JSLA 4NXNO 4DUYO 3JARB 3ZHTA 2EBOA 4MTXA 3N2GA 1YXBA 1AP5A 2CH7A 5LOVB 3JASB 2GSMB 3RYCB 4DV1O 1FXVA 1YJ9V 1KB9F 4DRXB 1W0KG 3ZN0A 3W7TA 1EM1A 3AG3C 1VQ7V 2QM7A 2JJ1G 4P30A 4LH6A 1K73W 1FJGB 5KLVH 1KC8W 2VWJA 2Q73A 4UCSA 4LWSB 3CSXA
chains in the Genus database with same CATH topology
1NR7A 3KG2A 1E1QG 5KUKA 4G27B 2P90A 5L3GA 5CA3A 3E83A 1TUEB 2ZDIA 5HFMA 1OCCC 1AJQA 1K4CC 3JD3A 4MTGA 3T1CA 2LFRA 3ZIAG 4PA9A 2EIKC 3MHSC 4PA6A 4RUFA 1OZ0A 5IYDO 4WFBV 3W7SA 1VQ6V 1K34A 3LNMB 3ZMUA 2R9RB 1W0JG 3SJQC 3AG1B 2V1DA 2DWEC 1V55B 2EIMB 4J9YB 2W6JG 3IC7A 4RUEA 5EBLC 4WFAV 3K06A 1KKDA 3SPHA 4MVUA 4RO2A 1NR1A 1S72V 4FJCC 2Y48A 2JEXA 3DGEA 1VQ4V 1JX9A 1SESA 3TCUA 3W7WA 5L3DA 3ASNC 1M9NA 3A0RA 4MVRA 3B8NA 3SPIA 1R3KC 3AG3B 3FB7C 2EILC 3MD0A 3ZRWB 1GM9A 4XDLA 2ITDC 2C2AA 2QM8A 2DQ0A 4H33A 1EBOA 2Q69A 4UUJC 1K92A 3QO7A 1S0VA 1ENVA 2HVJC 3CCLV 4JTAB 3WG7B 3K79A 1QLEB 2YEVB 3H01A 2IJJA 4L87A 1R3JC 2AHZA 2XOKG 5B1AB 3X2QB 2Z5UA 4J9ZB 2GHYA 1PKXA 4LCUC 1CP9A 2XASA 2WLNA 1AI4A 1OCCB 3OE7G 2K1EA 3RW0A 2IU3A 1M56C 4WFEA 4U7OA 4BIZA 2EIKB 1PNMA 3T4DA 3GB7C 1FXKB 2XAGA 4R6ZA 5DM6V 3D36A 1GM7A 2WSSG 1QR8A 3EHBB 3JD4A 4BIUA 1PL0A 4RQEA 1AJNA 4JAVA 2WAMA 3LSQA 2YEVA 4PA7A 3CXCU 3OMAB 3GWOA 2JEUA 4X89A 1VQOV 1Q7YW 1CPYA 1RPOA 2HR3A 1F4NA 3ABLC 3ASNB 5LGTA 3ABKC 2EIMC 4QIWF 4PDRA 2OTJV 3D3IA 2HLDG 1MOFA 3JD2A 3CCJV 4R8CA 2WWWA 3CC2V 3CCRV 1M90W 1XL6A 3CCUV 1PNKA 1FXKA 1NKDA 3F5WC 3WFVA 3MHHC 1MSWD 1QVFU 3JD0A 3B8MA 1YI2V 1K7DA 1VQ8V 5E1AC 1DLBA 1K3EA 1E79G 2X0LA 3W7UA 3E86A 2EINC 4ZBMA 3M99B 3SYAA 3G4SV 1E1RG 2V7QG 4OXSA 3W7XA 2D3OW 1F4MA 4PA3A 3ETEA 3FB8C 3ABUA 3RVYA 3TETA 1YIJV 4R50A 1R6KA 3EFFK 2ZR2A 4JGSA 4JTCB 2XAFA 3ASOC 4FK5C 3F7VC 1W2BU 1DF5A 1VQNV 2P7TC 1SETA 2DWDC 3OEEG 4KFMA 3ZMVA 4PDVA 2HFEC 4YXWG 4GX0A 1K5SA 3OMNB 4UVAA 5B1AC 5CN0A 3X2QC 4UVBA 1M57C 3FKSG 1NJIW 3AG2C 1NBMG 3CMEV 1NQTA 3K03A 2P67A 2BOCC 3IGAC 4MW8A 3ETGA 3FB6C 5L3EA 1FXKC 1KP2A 1GM8A 2DYRB 2EZPA 4JTDB 4P2ZA 4ASUG 5EBMC 3ETDA 3K04A 2WLLB 3ABLB 3ABKB 4MVSA 2EIJC 3ZRSA 1GMGA 1KQSU 1THZA 4X88A 2ATKC 5H9CA 4QJFB 2Y69C 4HZ3A 1F51A 3SYOA 3STLC 4MS2A 2ZR3A 4PDLA 2Q67A 4CBCA 3OUSA 2EINB 5L3CA 1QR9A 4MSWC 1AJPA 5KUMA 2HKOA 1BMFG 2QA4V 1NH2B 4XBFA 3T4ZA 3E35A 3FYEB 3SYQA 5CBGA 1JJ2U 4XDKA 1I5XA 2WLHA 1GKFA 2WLLA 3CYOA 3CCEV 4QE9A 2CK3G 3ASOB 3QO5A 4QE7A 1KECA 5DN6G 4GX1A 1LNQA 1NH2D 4ZKIA 1COWG 4GCZA 4I5SA 2QKSA 4EKWA 1P4RA 1PNLA 3ABMC 3FB5C 1OCRB 1QVGU 2EJRA 1J95A 2B1GA 1M57B 1S5HC 3QNEA 5LHIA 1VQLV 1FS0G 3AG2B 4GX5A 1JVMA 1AR1B 1JCHA 2AHYA 1B6QA 1QCEA 3HB3B 3LUTB 5IY5B 1F23A 1AI7A 1FFTB 5B1NA 2Q6AA 4HAMA 3E2EA 4GT1A 4JYCA 1Y4MA 4KUMA 4P9PA 3OM3B 4MW3A 1VQ9V 5IYBO 2EIJB 5EC1C 2UXXA 4JAUA 1GK9A 2Z3YA 2H8PC 2PI5A 2P6JA 1CEZA 2Y69B 2OT5A 4JF3A 3SPGA 4R7CA 4MVQA 1Q82W 2DYRC 5CBHA 1UJWB 3DTUB 3OUFA 4U7NA 3CCQV 4HYOA 3CCVV 2HVKC 1K8AW 4MVOA 3BEHA 3ZMZA 1BL8A 3VOUA 3E8BA 3LDEA 4WFGA 1VQKV 5L3BA 5BZBA 1K5QA 1YSCA 4DO2A 1SERA 1YTFB 1KP3A 4MVZA 3VBBA 1G4YB 1K9MW 5FL7G 3FYIB 3OFNG 1YJWV 3K0DA 4QPJA 1K33A 2W0FC 3OEHG 5LGUA 2A79B 1YTFD 1BHBA 2XAHA 2A9HA 3ABMB 5LBQA 3ZRXA 5L3FA 2NLJC 4X8AA 3E8FA 2LFSA 1MG1A 3SPCA 3K3WA 3CCSV 2W6IG 1AI6A 3ABTA 1FXHA 3SPJA 5CMUA 5KA6A 3CCMV 3CD6V 1XL4A 1SRYA 4JYBA 4WF9V 4N23A 4E2LA 5B1BC 1G8MA 3K9AA 1RM1C 1OCRC 5IDJA 1K4DC 1YHQV 2WLKA 2A0LA 1R73A 1VQMV 4MT8A 4DXWA 4RAIA 1OHHG 1ROPA 2R9IA 3ZCCA 5LHHA 2X6CA 4UXNA 3CC7V 2DYSC 2JJ2G 1PD3A 1R3IC 3T2MA 4TSFG 4F4LA 1EFRG 5IY5C 5C93A 3LDCA 2OTLV 2IH3C 2OCCC 5KA5A 1H2GA 2MK3A 5H6QA 1H8EG 1OCOC 1Y66A 1L1FA 3ZJZA 4PA4A 4PDMA 4LP8A 5EK0A 5B3SC 3E89A 2X7RB 2M7WA 3HPLC 3G71V 1H38A 3IFXA 5CBFA 3CP1A 3ZMTA 2WPDG 2LP7A 1EZJA 3OGCC 2YSUB 4BAYA 2IH1C 2IU0A 1WLEA 4TWKA 1S3JA 4UVCA 4MTFA 4QPKA 1WPXA 4FIPC 2Q68A 2B5UA 1I5YA 2ZXWC 2X6BA 3LDDA 1SZTA 2DQ3A 2ITCC 3JCZA 3JYCA 4MTOA 4WCEV 1VQPV 3E8GA 1R6NA 2H94A 4FPPA 5GW7A 5B1BB 3ZRVA 1S76D 1RM1B 1K97A 5EBWC 4P9OA 3ZMSA 2XAQA 5H6RA 1V54C 3RVZA 4RQFA 4Q20A 4G28B 4TT3G 2F43G 4CZZA 2DYSB 1YITV 3F7YC 4XDJA 4PELA 3OAAG 2ZDIC 3SYCA 1GO3F 1N8RW 3E8HA 4UV8A 1RPRA 1ZWIC 2JDIG 2XNDG 3TK1A 4KP4A 1BHAA 2OCCB 3CPWU 5LHGA 2X6AA 1Q81W 1OCOB 3AEIA 2PI4A 2WLMA 3CC4V 3AG4C 3OMIB 3K0GA 5IYCO 3I56V 3UM7A 4N21A 1JPXA 3ML0A 3K08A 1OCZC 2UXNA 2EZOA 5B3SB 2XAJA 2WLIB 4JPRA 1ORQC 3ZRWA 1P7BA 3JD1A 2KB1A 3RBZA 2ZQMA 1JOYA 5B1OA 1R3LC 2JK5C 3R65A 1H8HG 3B77A 2IJKA 5J9PC 4G2KA 3I55V 3OW2U 2IJHA 4LC1A 4H37A 3P30A 2DW4A 3STZC 1VQ5V 2ZXWB 1JQ0A 2HG5C 4LBEC 4BW5A 3PJSK 3SYPA 4JASA 1AI5A 1DF4A 3AG1C 4WFHA 4Z1MG 2QEXV 1S77D 1GTOA 1V55C 3ZN1A 2QTOA 3OR6C 2FTKA 4GX2A 2EILB 4I9WA 1V54B 1NVPB 2WLIA 2EBOA 4MTXA 1IXMA 2NNUA 4FMTA 4UV9A 2GSMB 3QO8A 3UKMA 1AROP 5LGNA 1QBZA 1FXVA 5HFLA 1YJ9V 2QE7G 2JIZG 1W0KG 3ZN0A 1NVPD 3W7TA 3AG3C 1VQ7V 2QM7A 2IJIA 2JJ1G 2WLJA 2ZD9A 4P30A 4WFFA 3LSSA 1QLNA 1DTOA 2B1IA 3BY6A 3P32A 1KD1W 3OR7C 3AG4B 1K73W 3G6EV 1Q86W 2IW5A 2HJFC 4MVMA 1KC8W 1HWYA 4QNHB 1MABG 3CMAV 3WG7C 5EC2C 3NXSA 1YJNV 1OCZB 1M56B 1M1KW 2BOBC 1QLEC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KA5 A;  1QCE A;  2EBO A;  4FK5 C;  2MK3 A;  1F23 A;  1DF5 A;  1ENV A;  5CMU A;  5KA6 A;  1QR8 A;  1I5X A;  1Y66 A;  4FIP C;  3WFV A;  3CYO A;  3B77 A;  3MHH C;  1I5Y A;  3H01 A;  4N23 A;  4E2L A;  1Y4M A;  1SZT A;  1QBZ A;  3B8M A;  4FJC C;  3K9A A;  4G2K A;  5H9C A;  5CN0 A;  5HFL A;  1DLB A;  3P30 A;  5HFM A;  1JQ0 A;  3GWO A;  3M99 B;  2P6J A;  1K33 A;  2OT5 A;  2X7R B;  3B8N A;  3MHS C;  4JF3 A;  2M7W A;  4N21 A;  1JPX A;  1DF4 A;  1K34 A;  3CP1 A;  2EZO A;  1QR9 A;  4JPR A;  2LP7 A;  2EZP A;  1MOF A;  1MG1 A;  1EBO A;  4JGS A; 
#chains in the Genus database with same CATH topology
 2PGG A;  4BWA A;  4JI1 O;  1IBK O;  4GKJ O;  4JI5 O;  3JAT B;  5L3G A;  4O2A A;  4D7T A;  1XHZ A;  5HFM A;  2RQ6 A;  4MTG A;  3ZIA G;  5IYD O;  4WFB V;  4AHC A;  1K34 A;  2ETN A;  1P49 A;  1SQF A;  3ZMU A;  5ITZ B;  1AIL A;  1HDJ A;  1Q3E A;  2DWE C;  1Q43 A;  4QGP A;  1IVS A;  4ZHQ A;  2KG7 B;  1KKD A;  3SPH A;  1NR1 A;  1SZX A;  1WP8 A;  2JEX A;  1JX9 A;  3TCU A;  3A0R A;  4MVR A;  4U3F H;  1XMQ O;  4ABM A;  4TQD A;  3FB7 C;  2YXL A;  1GM9 A;  2ARH A;  2C2A A;  2QM8 A;  2E5L B;  2Q69 A;  3FX7 A;  5LXT B;  2PY5 A;  5KHH A;  4K8X A;  3CCL V;  1L8D A;  3WG7 B;  3K79 A;  4NTX A;  2HP8 A;  2IJJ A;  3SJC C;  4UCV A;  4L87 A;  4DR1 O;  3QVN A;  4JI4 B;  1CP9 A;  2XAS A;  2IU3 A;  1M56 C;  4U7O A;  3N27 A;  4FFB A;  2EIK B;  4BIZ A;  1PNM A;  3T4D A;  3GB7 C;  1FXK B;  3D36 A;  1GM7 A;  3L72 H;  1BCC H;  3B4S A;  4JI0 B;  2GV9 A;  4BIU A;  4UB6 Z;  3VQW A;  2JVD A;  3APQ A;  3QG5 A;  2ZE5 A;  3CXC U;  3B09 A;  3OMA B;  1PL4 A;  1Q7Y W;  1FJG O;  2L6L A;  3J7A U;  5LGT A;  4QIW F;  2EIM C;  2HLD G;  5IJ9 A;  4R8C A;  4IT5 A;  1TUB B;  1NKD A;  3WFV A;  3MHH C;  3B8M A;  1US6 A;  2QWR B;  1LUW A;  1VQ8 V;  1DLB A;  1E79 G;  2IBZ H;  2EIN C;  4ZBM A;  1HP8 A;  2GDS A;  4OPH A;  3W7X A;  1F4M A;  3D36 C;  3ETE A;  3FB8 C;  2Z0A A;  2XT9 A;  3ZX6 A;  3RVY A;  4UCU A;  3ASO C;  4LF9 B;  1PP9 H;  4O4J A;  2HHH B;  4WBN A;  1SQV H;  3OEE G;  4UCR A;  5B1A C;  1M57 C;  1NJI W;  4KXR A;  1RP3 B;  2P67 A;  1MZE A;  5C8Y A;  3UQ8 A;  3IGA C;  4MW8 A;  3FB6 C;  4HNA B;  2E5L O;  4X1K A;  1JA8 A;  1J5E B;  2HEP A;  1WP7 A;  2QM4 A;  3CXH F;  3OTO B;  1S5J A;  4IIJ A;  3THO A;  4JI4 O;  3SYO A;  3DC6 A;  2ZR3 A;  1U97 A;  1QR9 A;  1I08 A;  1AJP A;  1BMF G;  1NZ6 A;  4D7S A;  3BVO A;  2QA4 V;  1B06 A;  2QSA A;  1QHT A;  3E35 A;  2LGW A;  5KX5 A;  3FYE B;  3SJB C;  2EUL A;  3SYQ A;  1JJ2 U;  3N2K A;  4I4T A;  2JGD B;  5DN6 G;  4GX1 A;  1LNQ A;  1TVK B;  2GTS A;  4GCZ A;  4EKW A;  3HKC B;  3ABM C;  3ETQ A;  4D6T H;  4LNU B;  3AG2 B;  4JZG A;  4B3S B;  1AR4 A;  1JCH A;  1B6Q A;  5D5Q A;  4DR5 B;  3A0H Z;  3HB3 B;  5IY5 B;  4CC6 A;  4L8J A;  3OM3 B;  4MW3 A;  4LF8 B;  5IYB O;  2UXX A;  4JI7 B;  1KYO F;  4LF6 B;  2Z3Y A;  2UXB B;  2Y69 B;  4JF3 A;  4R7C A;  4B3T B;  4FM2 A;  5DEC A;  4U7N A;  4HYO A;  3CX5 F;  4TV9 B;  2HVK C;  1XMO B;  4MVO A;  3JAK A;  4J11 A;  2QKA A;  3ZMZ A;  3O9O A;  3E8B A;  3CE2 A;  4WFG A;  1VQK V;  2HHH O;  2E75 B;  1KP3 A;  1G4Y B;  4J7K A;  3WB0 A;  1YJW V;  3K0D A;  3RFR A;  1ZTE A;  2G38 A;  3OEH G;  5LGU A;  3TGU H;  1Y76 B;  3ZRX A;  5GON B;  4J41 A;  3CCS V;  2W6I G;  1AI6 A;  1XL4 A;  1MZF A;  4WF9 V;  2R72 A;  5B1B C;  4DV7 B;  1RM1 C;  4CS2 A;  1K4D C;  3HKD B;  1R73 A;  1N0N A;  2ZNJ A;  1OHH G;  1ROP A;  4CH6 A;  1HR0 B;  1R3I C;  4UCT A;  2OTL V;  1ZLZ A;  2IH3 C;  5KA5 A;  2DOS A;  2MK3 A;  4JYA B;  1H8E G;  2FYU H;  1L1F A;  3JAS A;  4B3M O;  2OYQ A;  5EIB D;  4FFK A;  2JS3 A;  4DRX A;  3E89 A;  3G71 V;  4B3S O;  3ZMT A;  3H9V A;  2WPD G;  1WB7 A;  4DR5 O;  4A5U B;  2YSU B;  2IH1 C;  1GH6 A;  1WLE A;  4LWS A;  1S3J A;  4MTF A;  3ZHR A;  2A3Q A;  2B5U A;  1SZT A;  4JI7 O;  1UFI A;  4LF6 O;  3JCZ A;  1VF7 A;  5JCO C;  2UXB O;  3E8G A;  1R6N A;  4P9O A;  4NXM O;  3VQX A;  3K57 A;  1HW7 A;  1BE3 H;  3RVZ A;  2R70 A;  2F43 G;  4DR7 B;  5ITZ A;  3F7Y C;  3EXA A;  4XDJ A;  4PEL A;  2ZDI C;  3K5M A;  4UCO A;  4PV1 B;  1GO3 F;  3RGB A;  2OIE A;  4KP4 A;  2OCC B;  3RT3 C;  1I7F A;  3AEI A;  2PI4 A;  2F4V B;  5JQG B;  4K35 A;  3ZHV A;  4H44 B;  4B08 A;  2UXN A;  2QWQ B;  5J2U A;  4H0L B;  4U3J A;  5LMU B;  3PN1 A;  5IWA O;  3R65 A;  5J9P C;  3OW2 U;  4DR6 B;  2YS8 A;  2DW4 A;  3OGI B;  1P84 F;  5D5P A;  1HR0 O;  4JAS A;  5LL6 Y;  4DV3 B;  2ADP A;  4X20 A;  1AP6 A;  1NVP B;  2WLI A;  1R1B A;  4JYA O;  4DV2 O;  1IXM A;  2NNU A;  4IYI A;  1NTZ H;  4FMT A;  1ZX3 A;  1ZSP A;  1ARO P;  3A2F A;  4DV6 O;  3P3N A;  3ICX A;  2ZE7 A;  5KAI Z;  4ICG A;  4J7Z A;  3BA9 A;  4DK1 A;  3G6E V;  2Q5Z A;  1HWY A;  3ZHQ A;  1MAB G;  3WG7 C;  5EC2 C;  3NXS A;  1M1K W;  3DSQ A;  2DJV A;  3RYH B;  4DUZ O;  3K9S A;  1TAE A;  3U10 A;  4IGG A;  5CA3 A;  2VQE B;  1AJQ A;  4H13 B;  2EJ7 A;  2EIK C;  3MHS C;  1BQZ A;  4DR7 O;  3FAV A;  3K5O A;  3SGI A;  2V1D A;  3HKE B;  4J9Y B;  2W6J G;  3IC7 A;  4RUE A;  2BE3 A;  5EBL C;  4TV8 B;  5JJN B;  1MMM A;  4MVU A;  4RO2 A;  1S72 V;  2F4V O;  5BMV B;  4JV5 B;  3W7W A;  3RYF B;  4B3R B;  3SPI A;  5FNV B;  5FPO A;  2EIL C;  3UCS C;  4XDL A;  5IJ0 A;  1NI8 A;  3F5T A;  1K92 A;  3QO7 A;  1Q8I A;  1S0V A;  4JTA B;  3DC5 A;  2Y0P A;  4I55 B;  5AG2 A;  1M93 A;  2AHZ A;  3AK3 A;  3CJH B;  4DV3 O;  3VQV A;  1OCC B;  3OE7 G;  1XMQ B;  1D5N A;  1WA8 A;  2XAG A;  3FD9 A;  4B7K A;  3L74 H;  1B3Q A;  1FFX B;  1QR8 A;  2RDC A;  5JVD B;  2F1M A;  3LSQ A;  2YEV A;  4PA7 A;  1YDX A;  2P4V A;  3L70 H;  3GWO A;  2XUM A;  3M7M X;  1CPY A;  3BAA A;  4OX9 B;  4IYH A;  4PDR A;  2OTJ V;  3D3I A;  1MOF A;  5LA6 B;  3CC2 V;  1M90 W;  4K8Z A;  1M5I A;  3F5W C;  1MSW D;  1QVF U;  1Q5O A;  1YI2 V;  2VQE O;  3WU2 Z;  4DK0 A;  4FLX A;  1K3E A;  1XQ8 A;  2X0L A;  3A0B Z;  3W7U A;  4LFB O;  3J81 N;  1A32 A;  2BSK A;  3WB2 A;  2ODM A;  2RN9 A;  4CH4 A;  3BPZ A;  3ABU A;  5CA1 B;  2CTQ A;  4RWU A;  1R6K A;  2ZR2 A;  4JGS A;  4JTC B;  4IHJ A;  2XAF A;  3AK1 A;  1D2D A;  1HNX B;  2CE4 A;  4KFM A;  3ZMV A;  4JV5 O;  3OMN B;  4UVA A;  5LMN B;  3X2Q C;  4B3R O;  4NKG B;  4CS4 A;  3AG2 C;  1FYJ A;  3ETG A;  2DYR B;  4P2Z A;  3ZBH A;  5K1X A;  3ABL B;  3ABK B;  5GON A;  2UXC B;  5B66 Z;  3JCU Z;  3JAW B;  3ZRS A;  1KQS U;  1THZ A;  5KAF Z;  4TUY B;  4HBN A;  2Y69 C;  1F51 A;  1IUR A;  2QGN A;  2UXD B;  2MW2 B;  2QJ1 A;  1QNM A;  3HKD A;  4BIO A;  3STL C;  4DR3 B;  4YJ3 A;  4E4E A;  4CBC A;  3UO2 A;  5KUM A;  2N05 A;  1NH2 B;  2P5O A;  2PYL A;  5CBG A;  1I5X A;  2WLL A;  3G6B A;  4J10 A;  4QE9 A;  1JFF A;  3U0Z A;  1COW G;  2AW9 A;  2QKS A;  4OX9 O;  1OCR B;  1QVG U;  2EJR A;  1YEW A;  4C7U A;  3O65 A;  5LHI A;  1VQL V;  1FS0 G;  3OT7 A;  4X1Y B;  4GX5 A;  3DXR B;  1JVM A;  1AR1 B;  1XI1 A;  2AHY A;  1IXB A;  3QTC A;  1QCE A;  3BRC A;  5EYP A;  1F23 A;  2KSD A;  1FFT B;  2GTA A;  4HAM A;  5A9G A;  1Y4M A;  2FL4 A;  3C3T A;  1KBH A;  4Q6G A;  4DR2 B;  2EIJ B;  4JAU A;  4FM0 A;  3BFR A;  1N4C A;  1IDS A;  4O2B B;  1RFY A;  1BL8 A;  3T1H O;  1WB8 A;  1HNX O;  1K5Q A;  4DO2 A;  5LMN O;  1XUQ A;  1K9M W;  5FL7 G;  5JH7 B;  3OFN G;  1BGY H;  4BR6 A;  4YIO A;  4QPJ A;  1FKA O;  1WN7 A;  3A8T A;  5L3F A;  2NLJ C;  2UXC O;  1RSO A;  2LO1 A;  3ABT A;  1FXH A;  3SPJ A;  5CMU A;  3CCM V;  4E2L A;  1Z2G A;  2UXD O;  5IDJ A;  1YHQ V;  1L0L H;  1MA1 A;  4DR3 O;  4DXW A;  2RJZ A;  3CRC A;  3CC7 V;  5J2T B;  1AR5 A;  1FD9 A;  1IBM B;  1PD3 A;  2Q0A A;  1BZK A;  3T2M A;  4TSF G;  4F4L A;  4X9Q A;  5C93 A;  1HNW B;  2OCC C;  1H2G A;  2QTS A;  5H6Q A;  4CC5 A;  3LSU A;  1KKC A;  4ZI7 B;  4F6R B;  4PDM A;  4LP8 A;  4O4H B;  4J42 A;  3OD4 A;  5JJE B;  3CRM A;  1G6U A;  2F23 A;  3IFX A;  5CBF A;  2LQT A;  2LP7 A;  1EZJ A;  2ILM A;  4I0X A;  2QWO B;  4BAY A;  1XHX A;  4UVC A;  1O9H A;  4DR2 O;  3JAL B;  2DQ3 A;  2ITC C;  4MTO A;  4B3M B;  4NB5 A;  1VQP V;  4O4I A;  5GW7 A;  1YVW A;  1EN6 A;  3CWB H;  2CDY A;  3ZMS A;  2CGN A;  2XAQ A;  4NTY A;  4RQF A;  4Q20 A;  4NTW A;  1SA0 B;  2Q8V A;  3UT5 A;  3E8H A;  4UV8 A;  1ZWI C;  2JDI G;  2XND G;  4TV8 A;  1BHA A;  3CPW U;  1Q81 W;  1OCO B;  2VRZ A;  4YHH B;  3CC4 V;  1MSD A;  1Y74 A;  3UM7 A;  3ML0 A;  5EIB C;  2GUZ B;  5FNV A;  2P06 A;  4NXM B;  2AGA A;  1ZL8 A;  3N2G B;  2CH7 B;  1P7B A;  2YXH A;  1Q6H A;  4O4L A;  3BCC H;  3JD1 A;  3BA8 A;  4LH7 A;  3RBZ A;  1SQB H;  2YID A;  3RYI B;  1R3L C;  2PUS A;  1GRJ A;  3TXQ A;  4I55 A;  3I55 V;  2QDO A;  5CB4 B;  1SKV A;  1JQ0 A;  1SF9 A;  3PJS K;  5LYJ A;  1IBM O;  3CJH A;  4WFH A;  2QEX V;  3OR6 C;  4FM1 A;  2BTQ B;  1HNW O;  2FTK A;  2M6Y A;  4GX2 A;  4I9W A;  3OTF A;  1SQX H;  2LW1 A;  3CS5 A;  2LGQ A;  3H1J H;  4UV9 A;  2UUB B;  3C90 A;  1TGO A;  3QO8 A;  1PM9 A;  4O2A B;  3JSN A;  5LGN A;  2ZT9 B;  5IWA B;  2QE7 G;  1NVP D;  4JAA A;  3AG7 A;  4X1I A;  4YJ2 A;  2ZD9 A;  4WFF A;  2ZIN A;  3P32 A;  3AG4 B;  3Q4H B;  2IW5 A;  5JCO A;  2HJF C;  4MVM A;  4I50 A;  4ZHQ B;  1YJN V;  1EN5 A;  1M56 B;  1EFR G;  3JAR A;  3KG2 A;  4G27 B;  4YY3 B;  4DV2 B;  2B9Z A;  2Q0O C;  3RWR D;  5LOV A;  3GVM A;  2BCC H;  3RYC A;  2P90 A;  3E83 A;  1V9P A;  1TUE B;  4GZR B;  2ZDI A;  1XNQ O;  1OCC C;  3T1C A;  4DV6 B;  2YC0 A;  1N32 B;  1OZ0 A;  3W7S A;  1VQ6 V;  2NN4 A;  4ZOL B;  3LNM B;  5JWP A;  3L9D A;  2R9R B;  3AG1 B;  3M8A A;  4KL1 A;  1H2L A;  1V55 B;  2EIM B;  1YF2 A;  4WFA V;  1WAZ A;  3K06 A;  1WJZ A;  1GN6 A;  4DUZ B;  2Y48 A;  4YHH O;  1VQ4 V;  1SES A;  1SQG A;  3JAT A;  5L3D A;  2PYJ A;  3B8N A;  4FFB B;  3LNN A;  4I9Q A;  3MD0 A;  3ZRW B;  4CH5 A;  1EBO A;  2L35 A;  4UUJ C;  1P7G A;  4F6E A;  3RN4 A;  1ENV A;  1H2M A;  2HVJ C;  1M4U A;  2KG7 A;  1ZUQ A;  4Z1V A;  5B1A B;  2N74 A;  4J9Z B;  2GHY A;  1PKX A;  4FZ0 A;  4LCU C;  2WLN A;  3RW0 A;  2K1E A;  4GKK B;  4PJ0 Z;  3FFQ A;  4R6Z A;  4LFA O;  5DM6 V;  2UUB O;  1S5L Z;  3EHB B;  3JD4 A;  4NR1 A;  5LXT A;  1N33 B;  4JAV A;  2WAM A;  1H2N A;  1SS3 A;  1VQO V;  1RPO A;  2PTM A;  1FAF A;  3ABL C;  3ASN B;  3ABK C;  3VQY A;  3CCJ V;  4X64 B;  2WWW A;  4O4J B;  4WBN B;  2Q9L A;  4YY3 O;  3CCU V;  1PNK A;  1FXK A;  5GTH Z;  2QKC A;  4J7J A;  4NVP A;  5E1A C;  1NTK H;  5C8Y B;  1N32 O;  3SYA A;  3G4S V;  1E1R G;  2V7Q G;  1URF A;  2D3O W;  4X1K B;  4PA3 A;  3TJT A;  4O2B A;  1GN4 A;  3GWK C;  4PHZ A;  4AQY B;  1SQP H;  2OCH A;  1YIJ V;  4FK5 C;  3F7V C;  4PI0 A;  3T1Y B;  3K5N A;  1TUB A;  1Q6U A;  2DWD C;  4YXW G;  4GX0 A;  1K5S A;  4IIJ B;  4X66 O;  2A06 H;  1UPG A;  4UVB A;  1NQT A;  4FVM A;  4LFB B;  1FXK C;  4J80 A;  5KX5 B;  2EZP A;  5EBM C;  2YUA A;  3N2K B;  4I4T B;  5FPR A;  4MVS A;  5K1P A;  2EIJ C;  4LF4 O;  1GMG A;  2W0X A;  4X88 A;  3S3W A;  1CXZ B;  4MS2 A;  2Q67 A;  4GKK O;  3OUS A;  1JR9 A;  5L3C A;  1YZB A;  3KZI Z;  4XBF A;  2OWO A;  3T4Z A;  4HNA A;  5H2F Z;  1N33 O;  2WLH A;  1GKF A;  3CYO A;  1KEC A;  5BR8 B;  1NH2 D;  4ZKI A;  1VF6 A;  4F6R A;  1P4R A;  1J95 A;  4K3A A;  1S5H C;  2ZE8 A;  3JAK B;  5JJJ B;  4X65 O;  1GN3 A;  2XTA A;  3MAQ A;  4PD4 F;  4X64 O;  3CRA A;  1VF5 B;  2Y4U A;  3LUT B;  1AI7 A;  5B1N A;  2Q6A A;  2YIA A;  3E2E A;  4GT1 A;  2VQF B;  1N34 B;  2YIB D;  5EC1 C;  2JGD A;  2H8P C;  1TVK A;  1OV9 A;  4CH3 A;  1CEZ A;  2N04 A;  2Y4T A;  3HKC A;  3SPG A;  4MVQ A;  1Q82 W;  3ZED A;  4FLT A;  4AQY O;  3DTU B;  3OUF A;  3BEH A;  3VOU A;  2Y0I A;  4LNU A;  1SA0 A;  3LDE A;  2F66 C;  2Q7E A;  5BXZ A;  5BZB A;  3T1Y O;  1VF6 C;  3AK2 A;  1N36 B;  1YTF B;  4W4L A;  1I94 B;  3FYI B;  1R6T A;  1NTM H;  2AZ2 A;  2W0F C;  3HKB B;  5F2V O;  4JI8 B;  1XDC A;  2A79 B;  1BHB A;  2VWK A;  3ZS8 C;  2LW7 A;  2GUZ A;  2LFS A;  1MG1 A;  3K3W A;  4TV9 A;  1GN2 A;  2PF4 E;  5CA0 B;  5KA6 A;  3T1H B;  1SRY A;  1Y6X A;  3KKY A;  3RYI A;  1XEQ A;  1G8M A;  3K9A A;  4JI2 B;  2WLK A;  1VQM V;  5CB4 A;  4MT8 A;  4RAI A;  1G1X B;  3H1L H;  3ZCC A;  5LHH A;  4UXN A;  2JJ2 G;  2EX3 A;  3L75 H;  3KCX A;  4CS3 A;  5IY5 C;  1Y76 A;  2BTQ A;  5LP6 B;  1JJO A;  1GAX A;  2RMK B;  1OCO C;  3K59 A;  4LF5 B;  4FZ1 A;  5BR8 O;  2V4D A;  1Y67 A;  3ZHS A;  3ZJZ A;  2ZIO A;  4IL6 Z;  2JGU A;  2ZM6 B;  4DYL A;  1IBL B;  4JZ2 A;  2X7R B;  2ZE6 A;  2CTW A;  4EEQ A;  3JAM N;  1H38 A;  3CP1 A;  4OPA A;  2R9A A;  3H1K H;  3Q4H A;  3OGC C;  5IE9 A;  3CEI A;  4YIP A;  2NR5 A;  2IU0 A;  1L0N H;  2VQF O;  4FIP C;  2Q68 A;  2WA4 A;  1I5Y A;  1N34 O;  2X6B A;  3LDD A;  5TIS Z;  3CHX A;  4WCE V;  5KHJ A;  3ZRV A;  4DV4 O;  5EBW C;  5J2U B;  5H6R A;  1NS1 A;  1JMK C;  5KHG A;  1I0H A;  2YDE A;  4ZOL A;  4U3J B;  1YCI A;  4CZZ A;  2DYS B;  1FPO A;  1YIT V;  3OAA G;  3SYC A;  1N36 O;  1N8R W;  3E22 B;  1VAR A;  1RPR A;  1I94 O;  5KMG B;  4JI8 O;  3AG4 C;  2ZCE A;  2BTO A;  3OMI B;  3K0G A;  3I56 V;  1BQ0 A;  4N21 A;  1JPX A;  3K08 A;  4X20 B;  2AZ0 A;  2EZO A;  5B3S B;  2WLI B;  4JPR A;  1ORQ C;  3ZRW A;  1QLE C;  3IJ4 A;  5KHI A;  1WNS A;  1H8H G;  2IJK A;  4JI2 O;  4G2K A;  2CGO A;  1KUQ A;  4H37 A;  3G80 A;  2DMX A;  2ZXW B;  1VQ5 V;  2HG5 C;  4BW5 A;  5JQG A;  3SYP A;  3AG1 C;  1DF4 A;  1S77 D;  1GTO A;  1V55 C;  3ZN1 A;  2QTO A;  1XIL A;  2EIL B;  2F93 B;  3IAY A;  1V54 B;  1KMI Z;  4KHP B;  4LF5 O;  4DV5 B;  3UKM A;  1QBZ A;  2ZM6 O;  5HFL A;  2GBO A;  1IBL O;  2JIZ G;  3S3X A;  2Q7G A;  1H2K A;  3IC9 A;  2IJI A;  2RCV A;  2WLJ A;  2FML A;  1EN4 A;  3LSS A;  1QLN A;  1DTO A;  2B1I A;  3BY6 A;  2PZS A;  5IT9 N;  3FAV B;  1KD1 W;  3OR7 C;  1Q86 W;  4FLZ A;  4FLW A;  4QNH B;  3CMA V;  2HFE C;  1OCZ B;  1SQQ H;  2BOB C;  1NR7 A;  1E1Q G;  5KUK A;  4DV0 B;  3BHP A;  4FLU A;  1T5E A;  1K4C C;  3JD3 A;  1WPB A;  2LFR A;  2IM9 A;  4PA9 A;  4RUF A;  4PA6 A;  3TXS A;  4ZIB A;  5IYZ B;  5IJ0 B;  4I7Z B;  3SJQ C;  1W0J G;  4EB6 B;  1XRE A;  5EZY B;  3C3S A;  4AI8 A;  3RYH A;  1O9G A;  4LF7 B;  2OIG A;  4FJC C;  3HR0 A;  3DGE A;  4EFE A;  2DN9 A;  3ASN C;  1M9N A;  1XNQ B;  1R3K C;  3AG3 B;  1WA8 B;  2ITD C;  2DQ0 A;  4H33 A;  4JI0 O;  2WA3 A;  4LFC B;  3J80 N;  2CAZ C;  1OJH A;  3HKE A;  1QLE B;  2YEV B;  3H01 A;  3UO3 A;  2A7W A;  1R3J C;  1H2S B;  1HNZ B;  2XOK G;  5GTI Z;  5BMV A;  1IX9 A;  2Q4P A;  3X2Q B;  4K0K B;  2Z5U A;  3RYF A;  1AI4 A;  1Z5V A;  1DK1 A;  4WFE A;  2RNB A;  4KHP O;  3R66 A;  1AVM A;  4DV5 O;  1SC5 B;  2WSS G;  1PL0 A;  4RQE A;  1AJN A;  4UFZ A;  2HJD A;  2BSK B;  1AB3 A;  1IZ3 A;  2JEU A;  3APO A;  4X89 A;  4GYC B;  2HR3 A;  3SJA C;  1F4N A;  3CB2 A;  4IHJ B;  3MDS A;  3JD2 A;  4LF9 O;  4X62 B;  1PPJ H;  4TQF A;  3CCR V;  1XL6 A;  4LFA B;  4DV0 O;  2K9P A;  2QWN B;  4FLV A;  3JD0 A;  1FFX A;  1K7D A;  5JVD A;  3D8C A;  4GLX A;  3E86 A;  3M99 B;  4OXS A;  3CRQ A;  2QR4 A;  2ZNI A;  1J5E O;  3K58 A;  3TET A;  4R50 A;  3EFF K;  3G67 A;  1W2B U;  1DF5 A;  4LF7 O;  1VQN V;  1LUV A;  5LA6 A;  4OGQ B;  2P7T C;  1SET A;  1U96 A;  5FLX N;  4PDV A;  3OTO O;  5CN0 A;  1NU1 H;  3FKS G;  4YJ3 B;  3CME V;  1NBM G;  2ZKO A;  3ZHU A;  3K03 A;  3SR2 C;  1ZAU A;  2BOC C;  3U11 A;  3HKB A;  2UUA B;  5L3E A;  1KP2 A;  1GM8 A;  4LFC O;  3CRR A;  4JTD B;  4ASU G;  3ETD A;  3K04 A;  2JS5 A;  2WLL B;  5CA1 A;  5H5N A;  1JFF B;  4W4K A;  4JI6 B;  5CA0 A;  1B04 A;  1XNR B;  2YI9 A;  2ATK C;  5H9C A;  4QJF B;  3I5D A;  5A2Q N;  4HZ3 A;  1HNZ O;  2QWP B;  4K0K O;  1QU7 A;  4X66 B;  4PDL A;  2F95 B;  5B5E Z;  2EIN B;  4MSW C;  3WB1 A;  4JI3 B;  5EYP B;  2HKO A;  2ADQ B;  2FB5 A;  3EVK A;  5LP6 A;  1TA8 A;  4XDK A;  4LF8 O;  2VS0 A;  3CCE V;  2CK3 G;  3ASO B;  3QO5 A;  4QE7 A;  3JAW A;  4LF4 B;  4AIL C;  4I5S A;  4Z2W A;  4TUY A;  4B3T O;  1PNL A;  3FB5 C;  1XMO O;  2B1G A;  1M57 B;  2LJ2 A;  3QNE A;  5IJ9 B;  4EFB A;  4X62 O;  1XOU A;  2P22 C;  1X4T A;  2JRI A;  4JYC A;  5KHK A;  4KUM A;  1MNG A;  4P9P A;  1VQ9 V;  1GK9 A;  2PI5 A;  2P6J A;  2OT5 A;  1VEW A;  3NR7 A;  2DYR C;  2E76 B;  2UUC B;  5CBH A;  5LP6 C;  3P3P A;  1KU9 A;  1UJW B;  3CCQ V;  3CCV V;  1RSO B;  1K8A W;  4X65 B;  3SDL A;  4X1Y A;  3DXR A;  5L3B A;  4DV7 O;  2YIB A;  1VIB A;  1YSC A;  3E22 A;  1SER A;  4MVZ A;  3VBB A;  2YI8 A;  3H1H H;  5KMG A;  1QQC A;  1K33 A;  1BS3 A;  2UUA O;  1YTF D;  2XAH A;  2A9H A;  3ABM B;  5LBQ A;  4X8A A;  4B7E A;  3E8F A;  3SPC A;  2P4K A;  2Q7H A;  4JI6 O;  3CD6 V;  2CUG A;  1XBL A;  1XNR O;  4JYB A;  4N23 A;  2ZIM A;  3B2E E;  2UU9 B;  1OCR C;  3B40 A;  2A0L A;  2E74 B;  5JH7 A;  5E79 Z;  2R9I A;  4DR4 B;  2D2C B;  3H1I H;  2X6C A;  1VP7 A;  2DYS C;  4JI3 O;  4TOI A;  4I0X B;  1VMG A;  3LDC A;  2KKW A;  4NXN B;  2AXT Z;  4DUY B;  1Y66 A;  2O57 A;  1X59 A;  4O4I B;  2KQX A;  1D5A A;  1Z5W A;  4DV1 B;  4PA4 A;  3BAB A;  5EK0 A;  5B3S C;  2M7W A;  3UT5 B;  1BSM A;  3HPL C;  2FKX A;  3K5L A;  1EZV H;  5J2T A;  3L73 H;  1Q6I A;  4TWK A;  4UB8 Z;  4QPK A;  1WPX A;  2ZXW C;  4JI1 B;  1IBK B;  1N0J A;  4GUN A;  4GKJ B;  4JI5 B;  5DED A;  1Y74 B;  5BY1 A;  3JYC A;  2H94 A;  4FPP A;  4DW0 A;  5B1B B;  1S76 D;  4ZI7 A;  2UUC O;  1RM1 B;  4PI2 A;  1K97 A;  4O4H A;  1ZL8 B;  1V54 C;  4G28 B;  1PV0 A;  5IYZ A;  4O4L B;  4TT3 G;  1DGS A;  5LMU O;  1F7Y A;  2CTR A;  4EB6 A;  4JYY A;  4LR3 A;  3D3Q A;  5EZY A;  3TK1 A;  4DR6 O;  2XHB A;  5LHG A;  1NT2 B;  2X6A A;  3JAL A;  4FLY A;  2WLM A;  5LYJ B;  1W59 A;  2E3C A;  5IYC O;  2DE0 X;  2YIC A;  4DV4 B;  1OCZ C;  2XAJ A;  1BT8 A;  3L71 H;  1LR1 A;  2KB1 A;  2ZQM A;  3KCY A;  5B1O A;  1JOY A;  2JK5 C;  2UU9 O;  3B77 A;  3QF7 A;  2H3O A;  4X1I B;  4YJ2 B;  2IJH A;  4LC1 A;  4NYK A;  4BW9 A;  3P30 A;  3STZ C;  4DR4 O;  4LBE C;  4DW1 A;  4DR1 B;  1AI5 A;  2CTP A;  2YXY A;  4Z1M G;  4I50 B;  1Q90 D;  3JSL A;  4NXN O;  4DUY O;  3JAR B;  3ZHT A;  2EBO A;  4MTX A;  3N2G A;  1YXB A;  1AP5 A;  2CH7 A;  5LOV B;  3JAS B;  2GSM B;  3RYC B;  4DV1 O;  1FXV A;  1YJ9 V;  1KB9 F;  4DRX B;  1W0K G;  3ZN0 A;  3W7T A;  1EM1 A;  3AG3 C;  1VQ7 V;  2QM7 A;  2JJ1 G;  4P30 A;  4LH6 A;  1K73 W;  1FJG B;  5KLV H;  1KC8 W;  2VWJ A;  2Q73 A;  4UCS A;  4LWS B;  3CSX A; 
#chains in the Genus database with same CATH homology
 1NR7 A;  3KG2 A;  1E1Q G;  5KUK A;  4G27 B;  2P90 A;  5L3G A;  5CA3 A;  3E83 A;  1TUE B;  2ZDI A;  5HFM A;  1OCC C;  1AJQ A;  1K4C C;  3JD3 A;  4MTG A;  3T1C A;  2LFR A;  3ZIA G;  4PA9 A;  2EIK C;  3MHS C;  4PA6 A;  4RUF A;  1OZ0 A;  5IYD O;  4WFB V;  3W7S A;  1VQ6 V;  1K34 A;  3LNM B;  3ZMU A;  2R9R B;  1W0J G;  3SJQ C;  3AG1 B;  2V1D A;  2DWE C;  1V55 B;  2EIM B;  4J9Y B;  2W6J G;  3IC7 A;  4RUE A;  5EBL C;  4WFA V;  3K06 A;  1KKD A;  3SPH A;  4MVU A;  4RO2 A;  1NR1 A;  1S72 V;  4FJC C;  2Y48 A;  2JEX A;  3DGE A;  1VQ4 V;  1JX9 A;  1SES A;  3TCU A;  3W7W A;  5L3D A;  3ASN C;  1M9N A;  3A0R A;  4MVR A;  3B8N A;  3SPI A;  1R3K C;  3AG3 B;  3FB7 C;  2EIL C;  3MD0 A;  3ZRW B;  1GM9 A;  4XDL A;  2ITD C;  2C2A A;  2QM8 A;  2DQ0 A;  4H33 A;  1EBO A;  2Q69 A;  4UUJ C;  1K92 A;  3QO7 A;  1S0V A;  1ENV A;  2HVJ C;  3CCL V;  4JTA B;  3WG7 B;  3K79 A;  1QLE B;  2YEV B;  3H01 A;  2IJJ A;  4L87 A;  1R3J C;  2AHZ A;  2XOK G;  5B1A B;  3X2Q B;  2Z5U A;  4J9Z B;  2GHY A;  1PKX A;  4LCU C;  1CP9 A;  2XAS A;  2WLN A;  1AI4 A;  1OCC B;  3OE7 G;  2K1E A;  3RW0 A;  2IU3 A;  1M56 C;  4WFE A;  4U7O A;  4BIZ A;  2EIK B;  1PNM A;  3T4D A;  3GB7 C;  1FXK B;  2XAG A;  4R6Z A;  5DM6 V;  3D36 A;  1GM7 A;  2WSS G;  1QR8 A;  3EHB B;  3JD4 A;  4BIU A;  1PL0 A;  4RQE A;  1AJN A;  4JAV A;  2WAM A;  3LSQ A;  2YEV A;  4PA7 A;  3CXC U;  3OMA B;  3GWO A;  2JEU A;  4X89 A;  1VQO V;  1Q7Y W;  1CPY A;  1RPO A;  2HR3 A;  1F4N A;  3ABL C;  3ASN B;  5LGT A;  3ABK C;  2EIM C;  4QIW F;  4PDR A;  2OTJ V;  3D3I A;  2HLD G;  1MOF A;  3JD2 A;  3CCJ V;  4R8C A;  2WWW A;  3CC2 V;  3CCR V;  1M90 W;  1XL6 A;  3CCU V;  1PNK A;  1FXK A;  1NKD A;  3F5W C;  3WFV A;  3MHH C;  1MSW D;  1QVF U;  3JD0 A;  3B8M A;  1YI2 V;  1K7D A;  1VQ8 V;  5E1A C;  1DLB A;  1K3E A;  1E79 G;  2X0L A;  3W7U A;  3E86 A;  2EIN C;  4ZBM A;  3M99 B;  3SYA A;  3G4S V;  1E1R G;  2V7Q G;  4OXS A;  3W7X A;  2D3O W;  1F4M A;  4PA3 A;  3ETE A;  3FB8 C;  3ABU A;  3RVY A;  3TET A;  1YIJ V;  4R50 A;  1R6K A;  3EFF K;  2ZR2 A;  4JGS A;  4JTC B;  2XAF A;  3ASO C;  4FK5 C;  3F7V C;  1W2B U;  1DF5 A;  1VQN V;  2P7T C;  1SET A;  2DWD C;  3OEE G;  4KFM A;  3ZMV A;  4PDV A;  2HFE C;  4YXW G;  4GX0 A;  1K5S A;  3OMN B;  4UVA A;  5B1A C;  5CN0 A;  3X2Q C;  4UVB A;  1M57 C;  3FKS G;  1NJI W;  3AG2 C;  1NBM G;  3CME V;  1NQT A;  3K03 A;  2P67 A;  2BOC C;  3IGA C;  4MW8 A;  3ETG A;  3FB6 C;  5L3E A;  1FXK C;  1KP2 A;  1GM8 A;  2DYR B;  2EZP A;  4JTD B;  4P2Z A;  4ASU G;  5EBM C;  3ETD A;  3K04 A;  2WLL B;  3ABL B;  3ABK B;  4MVS A;  2EIJ C;  3ZRS A;  1GMG A;  1KQS U;  1THZ A;  4X88 A;  2ATK C;  5H9C A;  4QJF B;  2Y69 C;  4HZ3 A;  1F51 A;  3SYO A;  3STL C;  4MS2 A;  2ZR3 A;  4PDL A;  2Q67 A;  4CBC A;  3OUS A;  2EIN B;  5L3C A;  1QR9 A;  4MSW C;  1AJP A;  5KUM A;  2HKO A;  1BMF G;  2QA4 V;  1NH2 B;  4XBF A;  3T4Z A;  3E35 A;  3FYE B;  3SYQ A;  5CBG A;  1JJ2 U;  4XDK A;  1I5X A;  2WLH A;  1GKF A;  2WLL A;  3CYO A;  3CCE V;  4QE9 A;  2CK3 G;  3ASO B;  3QO5 A;  4QE7 A;  1KEC A;  5DN6 G;  4GX1 A;  1LNQ A;  1NH2 D;  4ZKI A;  1COW G;  4GCZ A;  4I5S A;  2QKS A;  4EKW A;  1P4R A;  1PNL A;  3ABM C;  3FB5 C;  1OCR B;  1QVG U;  2EJR A;  1J95 A;  2B1G A;  1M57 B;  1S5H C;  3QNE A;  5LHI A;  1VQL V;  1FS0 G;  3AG2 B;  4GX5 A;  1JVM A;  1AR1 B;  1JCH A;  2AHY A;  1B6Q A;  1QCE A;  3HB3 B;  3LUT B;  5IY5 B;  1F23 A;  1AI7 A;  1FFT B;  5B1N A;  2Q6A A;  4HAM A;  3E2E A;  4GT1 A;  4JYC A;  1Y4M A;  4KUM A;  4P9P A;  3OM3 B;  4MW3 A;  1VQ9 V;  5IYB O;  2EIJ B;  5EC1 C;  2UXX A;  4JAU A;  1GK9 A;  2Z3Y A;  2H8P C;  2PI5 A;  2P6J A;  1CEZ A;  2Y69 B;  2OT5 A;  4JF3 A;  3SPG A;  4R7C A;  4MVQ A;  1Q82 W;  2DYR C;  5CBH A;  1UJW B;  3DTU B;  3OUF A;  4U7N A;  3CCQ V;  4HYO A;  3CCV V;  2HVK C;  1K8A W;  4MVO A;  3BEH A;  3ZMZ A;  1BL8 A;  3VOU A;  3E8B A;  3LDE A;  4WFG A;  1VQK V;  5L3B A;  5BZB A;  1K5Q A;  1YSC A;  4DO2 A;  1SER A;  1YTF B;  1KP3 A;  4MVZ A;  3VBB A;  1G4Y B;  1K9M W;  5FL7 G;  3FYI B;  3OFN G;  1YJW V;  3K0D A;  4QPJ A;  1K33 A;  2W0F C;  3OEH G;  5LGU A;  2A79 B;  1YTF D;  1BHB A;  2XAH A;  2A9H A;  3ABM B;  5LBQ A;  3ZRX A;  5L3F A;  2NLJ C;  4X8A A;  3E8F A;  2LFS A;  1MG1 A;  3SPC A;  3K3W A;  3CCS V;  2W6I G;  1AI6 A;  3ABT A;  1FXH A;  3SPJ A;  5CMU A;  5KA6 A;  3CCM V;  3CD6 V;  1XL4 A;  1SRY A;  4JYB A;  4WF9 V;  4N23 A;  4E2L A;  5B1B C;  1G8M A;  3K9A A;  1RM1 C;  1OCR C;  5IDJ A;  1K4D C;  1YHQ V;  2WLK A;  2A0L A;  1R73 A;  1VQM V;  4MT8 A;  4DXW A;  4RAI A;  1OHH G;  1ROP A;  2R9I A;  3ZCC A;  5LHH A;  2X6C A;  4UXN A;  3CC7 V;  2DYS C;  2JJ2 G;  1PD3 A;  1R3I C;  3T2M A;  4TSF G;  4F4L A;  1EFR G;  5IY5 C;  5C93 A;  3LDC A;  2OTL V;  2IH3 C;  2OCC C;  5KA5 A;  1H2G A;  2MK3 A;  5H6Q A;  1H8E G;  1OCO C;  1Y66 A;  1L1F A;  3ZJZ A;  4PA4 A;  4PDM A;  4LP8 A;  5EK0 A;  5B3S C;  3E89 A;  2X7R B;  2M7W A;  3HPL C;  3G71 V;  1H38 A;  3IFX A;  5CBF A;  3CP1 A;  3ZMT A;  2WPD G;  2LP7 A;  1EZJ A;  3OGC C;  2YSU B;  4BAY A;  2IH1 C;  2IU0 A;  1WLE A;  4TWK A;  1S3J A;  4UVC A;  4MTF A;  4QPK A;  1WPX A;  4FIP C;  2Q68 A;  2B5U A;  1I5Y A;  2ZXW C;  2X6B A;  3LDD A;  1SZT A;  2DQ3 A;  2ITC C;  3JCZ A;  3JYC A;  4MTO A;  4WCE V;  1VQP V;  3E8G A;  1R6N A;  2H94 A;  4FPP A;  5GW7 A;  5B1B B;  3ZRV A;  1S76 D;  1RM1 B;  1K97 A;  5EBW C;  4P9O A;  3ZMS A;  2XAQ A;  5H6R A;  1V54 C;  3RVZ A;  4RQF A;  4Q20 A;  4G28 B;  4TT3 G;  2F43 G;  4CZZ A;  2DYS B;  1YIT V;  3F7Y C;  4XDJ A;  4PEL A;  3OAA G;  2ZDI C;  3SYC A;  1GO3 F;  1N8R W;  3E8H A;  4UV8 A;  1RPR A;  1ZWI C;  2JDI G;  2XND G;  3TK1 A;  4KP4 A;  1BHA A;  2OCC B;  3CPW U;  5LHG A;  2X6A A;  1Q81 W;  1OCO B;  3AEI A;  2PI4 A;  2WLM A;  3CC4 V;  3AG4 C;  3OMI B;  3K0G A;  5IYC O;  3I56 V;  3UM7 A;  4N21 A;  1JPX A;  3ML0 A;  3K08 A;  1OCZ C;  2UXN A;  2EZO A;  5B3S B;  2XAJ A;  2WLI B;  4JPR A;  1ORQ C;  3ZRW A;  1P7B A;  3JD1 A;  2KB1 A;  3RBZ A;  2ZQM A;  1JOY A;  5B1O A;  1R3L C;  2JK5 C;  3R65 A;  1H8H G;  3B77 A;  2IJK A;  5J9P C;  4G2K A;  3I55 V;  3OW2 U;  2IJH A;  4LC1 A;  4H37 A;  3P30 A;  2DW4 A;  3STZ C;  1VQ5 V;  2ZXW B;  1JQ0 A;  2HG5 C;  4LBE C;  4BW5 A;  3PJS K;  3SYP A;  4JAS A;  1AI5 A;  1DF4 A;  3AG1 C;  4WFH A;  4Z1M G;  2QEX V;  1S77 D;  1GTO A;  1V55 C;  3ZN1 A;  2QTO A;  3OR6 C;  2FTK A;  4GX2 A;  2EIL B;  4I9W A;  1V54 B;  1NVP B;  2WLI A;  2EBO A;  4MTX A;  1IXM A;  2NNU A;  4FMT A;  4UV9 A;  2GSM B;  3QO8 A;  3UKM A;  1ARO P;  5LGN A;  1QBZ A;  1FXV A;  5HFL A;  1YJ9 V;  2QE7 G;  2JIZ G;  1W0K G;  3ZN0 A;  1NVP D;  3W7T A;  3AG3 C;  1VQ7 V;  2QM7 A;  2IJI A;  2JJ1 G;  2WLJ A;  2ZD9 A;  4P30 A;  4WFF A;  3LSS A;  1QLN A;  1DTO A;  2B1I A;  3BY6 A;  3P32 A;  1KD1 W;  3OR7 C;  3AG4 B;  1K73 W;  3G6E V;  1Q86 W;  2IW5 A;  2HJF C;  4MVM A;  1KC8 W;  1HWY A;  4QNH B;  1MAB G;  3CMA V;  3WG7 C;  5EC2 C;  3NXS A;  1YJN V;  1OCZ B;  1M56 B;  1M1K W;  2BOB C;  1QLE C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...