5CMUA

Artificial hiv fusion inhibitor ap1 fused to the c-terminus of gp41 nhr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
b'SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein,AP1
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cmuA00
1F23A 4N23A 3B8MA 1I5XA 1DLBA 3K9AA 1QR9A 2EZPA 1I5YA 2EZOA 1EBOA 2MK3A 3CYOA 2LP7A 3H01A 1DF4A 4FK5C 1Y4MA 1QBZA 2EBOA 4N21A 1QCEA 5HFLA 1K33A 2OT5A 1DF5A 1SZTA 1MG1A 4FJCC 4JPRA 1JQ0A 4G2KA 5CMUA 1ENVA 1MOFA 3B8NA 3WFVA 4E2LA 4JGSA 2X7RB 4FIPC 3MHSC 3GWOA 5CN0A 1K34A 3CP1A 1QR8A 2P6JA 3MHHC 3B77A 3P30A 3M99B 4JF3A 1Y66A 5H9CA 5KA6A 5KA5A 2M7WA 1JPXA 5HFMA
chains in the Genus database with same CATH superfamily
1AR4A 1V9PA 4I55B 2NR5A 2YI8A 1FXHA 1V54C 3D3IA 1PL4A 3OFNG 2ETNA 1MG1A 3P3NA 2FTKA 4BIOA 4LF7B 1AJPA 3N2GA 3T1HB 1R3KC 3UO2A 1JOYA 3JD4A 2ZE5A 1W0KG 1NT2B 1F4MA 5KUKA 1L0NH 4LFCO 4F6RB 1OCCB 4DUYB 4UVBA 3UM7A 3JAMN 4JTDB 1WAZA 4IL6Z 3ASNC 1LUWA 1IX9A 1GO3F 4JPRA 2B9ZA 3E22B 1IBLB 2DYSC 4MTOA 5BR8O 4G28B 3OGIB 2HP8A 1P7BA 2B1IA 3U10A 3GB7C 2PF4E 2OTLV 1N0NA 5EC1C 3G4SV 2XHBA 2AZ2A 4NTYA 3AK2A 3AG2C 1VF7A 3T1CA 2YS8A 4DV1O 4HBNA 5IJ0A 5EK0A 5IY5B 3JAKB 5B5EZ 2L35A 3AG3C 2RNBA 4I50B 2QE7G 1NH2D 1P49A 3R65A 2YEVA 1AJNA 4J42A 4FLUA 3SPGA 1BMFG 1WA8B 3T4DA 2CTWA 2WLIA 4DV7O 4CH3A 1PPJH 2UU9O 3JD2A 4JYBA 4UVAA 4DV4B 4O4HA 2OCCC 2VWJA 4DR3B 2ADQB 1G6UA 3SDLA 3N2KA 3CC7V 3ZN0A 5IDJA 4YHHB 3CMEV 1K3EA 1JJ2U 2N74A 3WG7C 4IIJA 1QR8A 3ETGA 4DV2B 1M56C 1EZJA 4WFGA 4WFHA 3MDSA 1Q3EA 4TUYB 5IYZB 2V1DA 5KHHA 1K8AW 3D36C 2CAZC 4B3TO 4PDLA 4YJ3A 3ZMVA 4JI8O 5FLXN 2LJ2A 5LOVA 3A0RA 2N04A 3ZCCA 1IURA 3G6BA 1J95A 3H1JH 5B1BC 3K57A 1VQ4V 4DR5O 1PP9H 1XNRB 4GUNA 1R6TA 2VQEO 5IWAB 1ZX3A 4X65O 1QBZA 3IGAC 2M6YA 2BSKB 1DF5A 1E79G 3AG3B 3CB2A 1BHAA 3HKEB 1I94O 4LFAO 4I55A 3LDDA 4O2BA 3SJBC 3QO8A 4X66O 4DV5O 3KCYA 2YICA 2YIAA 4DV3B 4LWSB 3OEEG 2ITCC 1Y76B 3BVOA 2AHZA 3BABA 4PDMA 1CEZA 5FPRA 4JZ2A 4F6RA 2ZD9A 1ZUQA 2Y48A 2ILMA 3QTCA 3E89A 4GT1A 2JEXA 1XHXA 1G1XB 3E22A 3QF7A 2DW4A 3FYIB 3RYCB 5CB4B 1JX9A 2X6AA 1R3JC 2JEUA 1Q86W 1RPRA 2BTQB 2GBOA 4RO2A 4OXSA 4FLZA 3BEHA 2XAGA 4PDRA 1V55C 1VF6C 2GTAA 4PI2A 1QLEC 4J11A 4KHPO 1FXKC 3CC4V 5JCOC 4GX2A 1BGYH 2EBOA 3CD6V 5C93A 2D2CB 1QVGU 3ABMC 3ZHQA 2QTSA 2BTOA 4CH5A 3BY6A 4FPPA 5LA6B 4GLXA 3JAKA 2QJ1A 1K4CC 1Y66A 1JPXA 3RFRA 3SGIA 2RDCA 3A0HZ 3CCEV 4I50A 5EBLC 4K0KB 2P7TC 2WA3A 3E8GA 1WA8A 2JGDB 3VQXA 3OW2U 4WFAV 3AG1B 5B1NA 2WWWA 1KD1W 2YSUB 3JARB 2XTAA 2ZIMA 1JJOA 2XAQA 1YXBA 1SQXH 3AG4C 2XNDG 3ZRWB 4KL1A 4HYOA 1NQTA 2Q68A 2ZXWC 2QSAA 4AQYO 4MTGA 3RBZA 1DF4A 4X8AA 4PA9A 1JFFB 1ROPA 2K9PA 4YJ2B 4JI0B 2KB1A 2V4DA 4JI1O 2W6JG 4TV9B 4TUYA 5IYZA 1GN6A 1FAFA 5K1XA 1IBMO 2UXBO 4NTWA 4B3TB 3ML0A 5HFMA 2QM4A 4OPHA 1G8MA 1V55B 4J9YB 2EINC 2WLJA 4TT3G 3S3WA 3C90A 4NVPA 3ZBHA 3ZHSA 3RVZA 1KU9A 4FLVA 3ABMB 5FPOA 5L3DA 2VQEB 2WLLB 2P6JA 3MHHC 1Q82W 2DE0X 4BAYA 2BSKA 3RVYA 3CMAV 4JZGA 1WB8A 2EZOA 1COWG 3ETQA 4N21A 5LGUA 3CCQV 1I94B 1IZ3A 1QLNA 1Q6IA 2EIJB 4LFAB 2GUZB 4QGPA 2X0LA 1S5LZ 2XT9A 1KC8W 4E2LA 3ZX6A 2CGNA 1YDXA 1CPYA 1OJHA 1YHQV 4AHCA 4LWSA 3L75H 1Y76A 5EBMC 1I5YA 2IU0A 2UUBB 4RUEA 3BFRA 2ZIOA 3FB5C 3CCSV 2UUCB 2D3OW 1S3JA 2Q7HA 4LF5O 5BMVA 3F7VC 5CA3A 4UV8A 4R6ZA 2VQFB 2Z0AA 4Z2WA 3OMAB 2Q73A 3K58A 4LF7O 2MK3A 2Y69B 3RYCA 5CB4A 5D5QA 1DK1A 4ZHQB 1D5AA 2BTQA 3T1YB 1BCCH 5LHGA 2GV9A 4DUYO 4YXWG 3JALB 2JJ1G 1XEQA 4P9OA 2LW7A 1W2BU 1IBLO 2R72A 3L74H 1M57B 2IJJA 4BIZA 4H0LB 2E74B 4J7ZA 3AEIA 1NVPB 3ETEA 3CXHF 4A5UB 4DR7B 4F4LA 5LA6A 2YXLA 5H6QA 2F43G 2WPDG 3K06A 3AK3A 3FFQA 4ICGA 5B1OA 4CS4A 4P2ZA 1THZA 4GX0A 2VRZA 5JJEB 4MVRA 2KKWA 3AG7A 4U7OA 3JARA 5HFLA 1EN4A 1GK9A 3JCZA 4EEQA 2QWNB 1FS0G 2JRIA 4IYHA 3ZHRA 2E3CA 1S0VA 2PGGA 2IH3C 3ZRWA 4HZ3A 2PY5A 2E5LO 1TAEA 4UXNA 1F7YA 4AQYB 3CS5A 2OWOA 4JI7B 1FKAO 4JAUA 2BOBC 1AI7A 1SKVA 5BXZA 4BWAA 4JYCA 1MSWD 1JFFA 4RAIA 3M7MX 4FFBB 3VOUA 4TV9A 2HG5C 1IBMB 3RT3C 5EBWC 1YTFB 4DV4O 3O9OA 4L8JA 4K8XA 1URFA 4I7ZB 5H2FZ 4LF6O 1WPBA 4UB8Z 5CBGA 4DR3O 1IBKB 1IXBA 1Z5WA 3ABLB 3P30A 3SR2C 1B3QA 3H1KH 1I5XA 4WCEV 2Y0IA 3W7TA 4K8ZA 3ASOB 3QNEA 3OT7A 4LC1A 4QPJA 4I5SA 2DYRB 5JJJB 3TXSA 2QTOA 4DW0A 3QVNA 2GHYA 4MT8A 2UUAB 1N8RW 1KP2A 4FZ0A 1SQBH 3CRQA 2IM9A 3TJTA 2HJDA 1AR1B 1Q6HA 1XNRO 5KLVH 1GH6A 2O57A 5IWAO 3B09A 2AGAA 2NLJC 1JCHA 4JI6B 1YEWA 2EIKC 4MS2A 1FFXA 5KMGB 3APOA 2X6BA 4IYIA 2JGUA 3HKCB 1K9MW 4PD4F 4ZI7B 1ZAUA 1H2MA 2ZCEA 3CE2A 1KKCA 1HWYA 1H38A 2P67A 3UO3A 3ZMTA 4DV3O 1FD9A 4ZIBA 1PL0A 1VQKV 2WLHA 1ZTEA 1RPOA 4JI3B 4KUMA 1QHTA 1F51A 1N4CA 1XOUA 4PHZA 1YI2V 2PZSA 2HJFC 4QIWF 3JALA 5B1AB 3K59A 4MVSA 2PUSA 3RYIB 4B3SB 3FB7C 2LGQA 1EN5A 1BZKA 1NH2B 4QPKA 1RM1C 4EFBA 1WNSA 1NU1H 4TQFA 5AG2A 4LF8B 1NTMH 2A9HA 4JI5O 2EZPA 2CUGA 3FX7A 3M8AA 1Y4MA 3L71H 3C3SA 3E86A 2ZDIC 4LCUC 3X2QB 4W4KA 1K4DC 4X64B 4WFEA 5DEDA 5CN0A 2Q0AA 2ZE7A 2PI5A 4WFBV 3W7WA 2AHYA 1B6QA 4Q6GA 4J9ZB 1G4YB 3OR7C 3L73H 1U97A 4CC5A 3OMIB 3K3WA 3TXQA 2E5LB 4JI4O 3CCUV 3JYCA 3DXRA 1V54B 4D7TA 1S5HC 4UCSA 4K0KO 2C2AA 1MZFA 2X6CA 4IHJB 2JVDA 2P06A 3RYFB 1MNGA 4FFBA 1Z5VA 1KQSU 2IBZH 2OIGA 2FMLA 2EULA 2Q6AA 3OE7G 1UPGA 3K5LA 4MVUA 1EN6A 3BAAA 4LF6B 3QO5A 4JI2B 2CTRA 2Q7GA 3B40A 1P84F 3JCUZ 4UCVA 1W0JG 3ASNB 4GKKB 2KQXA 2BCCH 4GYCB 1XL4A 1YIJV 2DYSB 2XAHA 3B77A 3ZMUA 5IE9A 4JI0O 1L0LH 1IXMA 3KZIZ 4CBCA 5IYDO 4PA7A 5DN6G 2ATKC 3L70H 1SQGA 3PJSK 5LP6C 1VIBA 2KG7B 3ZRXA 3ABTA 3CCJV 3AG2B 1IDSA 1BHBA 1NR1A 3I5DA 1H2GA 5GTIZ 1RFYA 2YIBA 1D2DA 4U7NA 1GMGA 2P22C 5CBHA 5IYCO 2DN9A 1N33B 2DQ0A 4R8CA 1GN4A 3JASB 3IC7A 3DSQA 5KMGA 3MD0A 1PNMA 2QWRB 4H37A 3K5MA 1T5EA 3HKCA 4ZI7A 3CP1A 4Q20A 5JVDB 2XAFA 1CP9A 1KB9F 2Q67A 1PKXA 2JIZG 4QNHB 1K97A 4RUFA 1LUVA 1TUBB 4O4IB 3SYAA 1MZEA 3G67A 2VS0A 1QU7A 2W6IG 2OCCB 2BOCC 3TETA 4YIOA 5CMUA 3UQ8A 2UUBO 4CC6A 4X88A 1Y74B 2UUCO 2ZE8A 1AI4A 1SQVH 1TUEB 2VQFO 1YVWA 1YZBA 4I9QA 3WG7B 1M56B 1GRJA 2YC0A 3RYIA 2CE4A 3VQYA 3CPWU 3RGBA 1XDCA 3FAVB 3K5OA 1BT8A 3B2EE 3VQVA 1XMQB 1S72V 1OCOC 2RJZA 5A9GA 5KX5B 3KCXA 2IH1C 4JI5B 1XHZA 3T1YO 4XDLA 1N34O 1J5EB 1FJGB 3B8MA 3U0ZA 2CK3G 1A32A 1VQ9V 1BL8A 1H2NA 5B1BB 2FB5A 3ETDA 4I4TB 1VQ6V 1SESA 2AW9A 1K33A 1SZTA 2B1GA 2Q5ZA 3HB3B 4JYAB 3SYOA 5LHHA 2DWDC 4DR7O 2ZR3A 3EFFK 3A8TA 2N05A 4JASA 2UXDB 2CDYA 4JI4B 1GAXA 2F23A 2Z5UA 4WFFA 3CCRV 2AXTZ 2LGWA 3TCUA 4UFZA 4NXNB 4IHJA 5L3FA 5LGNA 1CXZB 4JAVA 2RN9A 3RYFA 4B3MB 3MHSC 1HP8A 3E83A 3SYQA 5CA1B 4H13B 4LH6A 4FLTA 4X20B 1M5IA 1SS3A 3JATB 4JI7O 1Z2GA 4IGGA 1YJNV 5JWPA 4JYYA 1R1BA 4LBEC 5ITZB 4EFEA 1EFRG 3THOA 2WLNA 3HKDB 1PM9A 1H8EG 3HKBB 2LW1A 3T2MA 5L3BA 1Q7YW 5KAFZ 3JD0A 1KP3A 4MW3A 5GTHZ 1IBKO 2ZT9B 2UXXA 1QLEB 4B08A 2R9AA 1FXKB 1AB3A 3D8CA 3APQA 5FNVB 4I9WA 3B8NA 2XASA 1QNMA 2P4KA 3SPIA 2H3OA 4LF4B 1HDJA 2R70A 4JV5B 1M4UA 3ABKC 1SQQH 2F4VB 3MAQA 2ZQMA 2YDEA 1YJWV 3HKEA 5GONB 3CRRA 1FXVA 1OCRC 3BCCH 4Z1VA 2UUAO 5KHJA 3CRAA 3A2FA 3J80N 3LDCA 4P9PA 1TUBA 1AVMA 4XBFA 3AG4B 4JI6O 2EILC 2P5OA 2DQ3A 3CRCA 4DR4O 2ZXWB 1X4TA 4QJFB 2QKSA 4BW9A 1SETA 1HNXO 2IW5A 4K35A 3OTOO 3GWOA 1D5NA 4J7JA 1R3IC 3D36A 3H1HH 4DV6B 2EX3A 4J41A 3SPCA 1M9NA 4JI3O 4B7EA 3EHBB 5KX5A 1O9GA 2EINB 3STZC 1Q90D 4G2KA 2F66C 1N34B 2JJ2G 3QG5A 4UCOA 4LF9B 2PTMA 3FKSG 4GKJB 4UCTA 4I4TA 5H9CA 5KA6A 4B3SO 4C7UA 4GZRB 3ZMZA 3G71V 3PN1A 5EC2C 1ZLZA 1SZXA 4LF8O 3ABKB 2ZE6A 4X9QA 1R6KA 3SJCC 2ZM6O 2YXHA 1XI1A 1N32B 1RSOB 2ARHA 1OCZC 1QVFU 3TK1A 2JGDA 1X59A 4X64O 5LXTB 4H33A 2LP7A 2QM7A 3G80A 3N27A 1Q8IA 4FK5C 5CA0B 1LNQA 1VQ7V 5IT9N 2RQ6A 1PV0A 1AR5A 2ZNIA 5LMUB 5CA1A 5JJNB 4NR1A 4X20A 4KXRA 3ABUA 2JS5A 4XDJA 2F93B 3BHPA 3JATA 4R7CA 2V7QG 1IVSA 1M90W 5J2TB 5LBQA 1VMGA 1H2LA 1K7DA 4YJ2A 4GX5A 4PA3A 4FM2A 3HKDA 3K04A 4D7SA 3HKBA 3ZS8C 1PNLA 1AROP 1WN7A 3CHXA 3NXSA 4JI2O 2YEVB 3P3PA 1E1QG 1PD3A 1VF6A 4HAMA 3CSXA 1F23A 1FXKA 5JCOA 1K73W 1KYOF 3VBBA 4ABMA 4GKKO 2E75B 3CJHB 1DGSA 3SPJA 3CCVV 4RQFA 2HHHB 5EYPB 3DGEA 5A2QN 3CCMV 1SERA 2ZINA 4UB6Z 1VQLV 2ZNJA 4I0XB 3STLC 4DR2O 2WLLA 1BSMA 4DR6O 3ZN1A 3LUTB 5JQGB 1OCCC 1S5JA 1NZ6A 1AJQA 4X1KB 1VQ5V 1UJWB 2CTPA 1K5QA 1VQ8V 2YIDA 5K1PA 2WLMA 5GONA 3OM3B 3UCSC 2GUZA 2W0FC 2NNUA 4PV1B 3GVMA 2A3QA 1EM1A 3CEIA 2HKOA 3ZHTA 1N33O 1PNKA 5J9PC 5KUMA 4ZOLB 2M7WA 4DR4B 2FKXA 4OX9B 5L3EA 4DW1A 4KFMA 1XILA 2QR4A 3CYOA 1HNXB 4RQEA 3VQWA 1GM7A 1HNWB 4FFKA 3W7UA 3OTOB 1WP8A 3E8BA 2GDSA 3L72H 4PI0A 3H1IH 4LFBB 4DYLA 4LP8A 2XOKG 2P4VA 3TGUH 3IFXA 5IY5C 1XMOB 3OD4A 1W59A 2FYUH 2WLKA 4O2BB 4ZHQA 2QKCA 3K0DA 3HR0A 1VARA 1EZVH 5LGTA 2Q8VA 2OCHA 4LNUB 3GWKC 4MVOA 1GTOA 3LNMB 3ZHUA 2HR3A 4H44B 4IT5A 4DUZB 2QGNA 2B5UA 4DK0A 3OUSA 1Q43A 1XBLA 1NR7A 3NR7A 4W4LA 2YIBD 4PELA 1XMQO 2GSMB 1MA1A 3JD1A 4UVCA 2ZKOA 1ZWIC 4MTXA 1K5SA 4AILC 1M1KW 4NB5A 5B66Z 1I0HA 2K1EA 4R50A 1BS3A 2Q69A 2ZM6B 1J5EO 1FJGO 5IJ9B 3IAYA 5J2UB 2A0LA 1XNQB 2HLDG 3WB2A 4X1IB 1RSOA 4TSFG 2QDOA 5LMNB 4E4EA 1H2KA 2KSDA 2IU3A 3OEHG 1GM9A 4MSWC 5LXTA 1N0JA 4B3RO 4TV8B 5CA0A 2EIKB 4JYAO 5IYBO 4MVZA 5F2VO 2VWKA 4WF9V 2EJRA 4X89A 3IC9A 3FB6C 2CH7B 2UXDO 3K08A 5CBFA 1BQZA 3K79A 1N36B 2QKAA 1ENVA 4NXMB 2HVKC 3EXAA 3LSQA 3LSSA 2X7RB 2LO1A 1OZ0A 4DV0B 4UUJC 4NXNO 4JF3A 5D5PA 3WB1A 5J2TA 4O4LB 4DK1A 1L8DA 4ZKIA 3WU2Z 1VEWA 4B3MO 2HVJC 3B4SA 1WJZA 1R73A 2JS3A 1YF2A 4O2AB 3I55V 5LHIA 4TQDA 4MTFA 4YY3B 1MOFA 3RYHB 4X62B 1K34A 3LSUA 3CJHA 3EVKA 1JA8A 5EYPA 1RM1B 3CRMA 4NTXA 3BRCA 4O4JB 4DR2B 4I0XA 2YUAA 3CX5F 4DR6B 3LNNA 3CCLV 2LQTA 4D6TH 5JQGA 1SRYA 1SQFA 3BA8A 3J7AU 1QQCA 4X1KA 1GKFA 2R9IA 5JH7B 3RN4A 1NI8A 4DR1B 4LR3A 4U3JB 3S3XA 3E2EA 5BZBA 3OTFA 3H01A 4AI8A 4LF4O 1QCEA 4PA6A 3SYPA 4JV5O 4NYKA 1WB7A 2A06H 4ZOLA 2F4VO 3D3QA 1B06A 4DXWA 1OV9A 2H8PC 2G38A 1HNZB 2UXCB 1WLEA 5TISZ 2IJIA 2CTQA 1KMIZ 1HR0B 1GN3A 5GW7A 3JAWB 1US6A 3E8FA 1R6NA 1VQMV 2Y4TA 5EIBC 3ZRVA 1VF5B 2CGOA 4LNUA 3K9AA 3WB0A 4BW5A 3AG1C 4GCZA 1K92A 3ZIAG 3OUFA 3QO7A 1M93A 1JVMA 4CS3A 4DV6O 2ITDC 4HNAB 5BMVB 4LFCB 4EKWA 5LP6B 2QM8A 4DRXB 5LYJB 3K03A 4RWUA 3SJAC 5IJ9A 4NKGB 5J2UA 4LF9O 2MW2B 4GKJO 5B3SC 5BR8B 3LDEA 3KKYA 2XAJA 4X1IA 1ZL8B 1FPOA 1JQ0A 4TOIA 2RMKB 4B3RB 4TV8A 4X1YB 2IJHA 1P7GA 3H1LH 3AK1A 4JTAB 4N23A 2CH7A 5KHIA 1XL6A 1BE3H 5DM6V 2EJ7A 1N32O 4DV1B 3FB8C 4FJCC 1YITV 2H94A 1AP5A 2QEXV 3E8HA 1L1FA 3SJQC 5LL6Y 4O4LA 2LFRA 3FD9A 5KAIZ 2WSSG 3DTUB 1E1RG 2Q4PA 5LMUO 2R9RB 4O2AA 3OAAG 4PA4A 5KHGA 2EIJC 4G27B 4DV7B 3RYHA 5FL7G 4EB6B 3O65A 3OR6C 2W0XA 2UU9B 2OYQA 3CWBH 5E79Z 4J80A 4ZBMA 1OCOB 4ASUG 4O4JA 3UT5B 1U96A 3K0GA 4KP4A 4LH7A 2UXNA 5C8YB 1NS1A 2KG7A 4JAAA 4U3FH 1MABG 2Q0OC 2PI4A 2A7WA 5B3SB 1TVKB 5JH7A 2ZDIA 2DOSA 2F95B 4UCUA 4CZZA 2HHHO 4U3JA 3BA9A 5EIBD 1R3LC 3SPHA 1OHHG 3ZEDA 1Y6XA 2BE3A 2Y69C 4CH6A 1KKDA 3JASA 4JI8B 1NBMG 1AI6A 3ZHVA 5BY1A 4UCRA 1TGOA 1MSDA 1XQ8A 4DO2A 5JVDA 4PJ0Z 2AZ0A 2IJKA 3F5WC 4DR5B 3I56V 3BPZA 1NJIW 1M57C 1UFIA 5L3CA 4X65B 2A79B 3J81N 3K9SA 3ZMSA 4O4IA 3JD3A 1NTKH 1LR1A 3CXCU 2JK5C 1JR9A 3JAWA 2Q7EA 1NKDA 1S76D 1RP3B 4OX9O 1Y74A 2EIMC 4X66B 4DV5B 5EZYB 4PDVA 4FMTA 2QWPB 4JGSA 2FL4A 1HNWO 3Q4HB 2NN4A 3A0BZ 1MMMA 4UV9A 4WBNB 2ZR2A 5KA5A 2Y0PA 1GN2A 1SA0B 4LFBO 1XUQA 1FFXB 1WPXA 4JTCB 4J7KA 3W7SA 3FAVA 2PYLA 1XMOO 1HW7A 2F1MA 2DWEC 4HNAA 5LP6A 1DTOA 2OT5A 2Y4UA 1ZSPA 1Q81W 5LYJA 4DRXA 2Q9LA 3H9VA 3RWRD 1VQOV 4FIPC 2OTJV 3F5TA 4DUZO 3RW0A 3N2GB 2E76B 3E35A 3T1HO 3OGCC 4B7KA 1ZL8A 1XREA 4OGQB 4FM1A 4GX1A 4BIUA 4X1YA 2L6LA 3ABLC 3ICXA 2P90A 4KHPB 1OCRB 1KECA 1XNQO 3ASOC 2ODMA 5LMNO 2WAMA 2HFEC 3G6EV 3KG2A 1S77D 5H5NA 1F4NA 2DYRC 2EILB 4MVMA 1FFTB 3WFVA 2EIMB 3L9DA 4QE9A 1ORQC 3M99B 1N36O 4FLWA 1KUQA 3C3TA 4NXMO 2YXYA 1DLBA 3K5NA 4EB6A 4DV0O 1AP6A 1EBOA 1FYJA 5IJ0B 4FLYA 4CS2A 5ITZA 1KBHA 4MW8A 3R66A 3IJ4A 3FYEB 3UT5A 1SC5B 3HPLC 1VQPV 2OIEA 3DXRB 2YI9A 5C8YA 2ADPA 2JDIG 5KHKA 1I08A 2Z3YA 1NVPD 3SYCA 3ZJZA 2WLIB 4YY3O 4FLXA 1TVKA 1YSCA 1AILA 4X62O 1H2SB 1NTZH 2LFSA 5FNVA 4JI1B 4QE7A 2WA4A 3W7XA 4FVMA 2UXBB 5H6RA 1YCIA 3F7YC 4FZ1A 4O4HB 1BQ0A 5E1AC 3OMNB 1VP7A 2DJVA 2DMXA 3N2KB 1YJ9V 2QA4V 2QWOB 4YHHO 2PYJA 1QR9A 4IIJB 5B1AC 1SF9A 4DV2O 3DC6A 4FM0A 1OCZB 3JSLA 4DR1O 2GTSA 4YIPA 4L87A 2HEPA 3P32A 4K3AA 4YJ3B 4TWKA 1H8HG 1Q6UA 1Q5OA 4OPAA 3DC5A 4P30A 1TA8A 1SQPH 1O9HA 5LOVB 1I7FA 2QWQB 3UKMA 5L3GA 5EZYA 1B04A 3ZRSA 1YTFD 2XUMA 1VQNV 1Y67A 3CC2V 3Q4HA 3X2QC 1HNZO 2UXCO 4WBNA 1P4RA 1JMKC 1GM8A 4F6EA 4BR6A 4Z1MG 1SA0A 3U11A 4J10A 4MVQA 1AI5A 1WP7A 2RCVA 5DECA 1HR0O 4LF5B 4XDKA 4CH4A 3JSNA 3T4ZA
chains in the Genus database with same CATH topology
3E2EA 1M57B 2IJJA 4BIZA 5BZBA 3AEIA 1NVPB 1FXHA 3H01A 3ETEA 1V54C 3D3IA 1QCEA 4PA6A 3OFNG 1YJNV 4F4LA 3SYPA 1MG1A 2FTKA 4LBEC 5H6QA 2F43G 2WPDG 3K06A 1AJPA 1EFRG 1R3KC 2WLNA 5B1OA 1JOYA 3JD4A 4P2ZA 1W0KG 1H8EG 4DXWA 1THZA 4GX0A 1F4MA 3T2MA 2H8PC 5KUKA 5L3BA 1Q7YW 4MVRA 1OCCB 3JD0A 1KP3A 4MW3A 4UVBA 3UM7A 1WLEA 2UXXA 4JTDB 1QLEB 4U7OA 2IJIA 1FXKB 3ASNC 5HFLA 1GK9A 3JCZA 1GO3F 1FS0G 4JPRA 5GW7A 4I9WA 3B8NA 1S0VA 2DYSC 3ZRWA 2IH3C 4MTOA 3E8FA 4G28B 1R6NA 4HZ3A 2XASA 1VQMV 1P7BA 4UXNA 3ZRVA 2B1IA 3SPIA 3GB7C 4JAUA 2BOBC 1AI7A 3K9AA 4JYCA 4BW5A 1MSWD 2OTLV 3AG1C 4GCZA 5EC1C 4RAIA 3G4SV 1K92A 3ABKC 3ZIAG 3OUFA 3QO7A 2ZQMA 1JVMA 3VOUA 1YJWV 3AG2C 1FXVA 2HG5C 1OCRC 5EBWC 1YTFB 2ITDC 4EKWA 2QM8A 3T1CA 5CBGA 3K03A 3ABLB 3LDCA 3P30A 4P9PA 5EK0A 5IY5B 1I5XA 4XBFA 3AG4B 4WCEV 2EILC 3W7TA 5B3SC 3ASOB 3QNEA 2DQ3A 3LDEA 2ZXWB 3AG3C 4LC1A 2XAJA 4QJFB 2QKSA 4QPJA 4I5SA 2QE7G 1NH2D 3R65A 1SETA 2YEVA 1AJNA 1JQ0A 2DYRB 2IW5A 3SPGA 1BMFG 3T4DA 2WLIA 2IJHA 3GWOA 2QTOA 2GHYA 3JD2A 4JTAB 4N23A 4MT8A 1R3IC 3D36A 4JYBA 1XL6A 4UVAA 3SPCA 1KP2A 1N8RW 2OCCC 5DM6V 1M9NA 3EHBB 1AR1B 2EINB 3STZC 3FB8C 4FJCC 1YITV 2H94A 2QEXV 3E8HA 1L1FA 3CC7V 4G2KA 3SJQC 3ZN0A 5IDJA 2JJ2G 3CMEV 1K3EA 1JJ2U 2NLJC 1JCHA 2LFRA 3WG7C 2EIKC 1QR8A 3FKSG 4MS2A 3ETGA 1M56C 2X6BA 1EZJA 4WFGA 4WFHA 5H9CA 5KA6A 2WSSG 3DTUB 1E1RG 1K9MW 2R9RB 3OAAG 2V1DA 4PA4A 3ZMZA 3G71V 1K8AW 2EIJC 4G27B 4PDLA 5EC2C 5FL7G 3ZMVA 3OR6C 3ABKB 1HWYA 1H38A 1R6KA 2P67A 3ZMTA 4ZBMA 1OCOB 1PL0A 3A0RA 2WLHA 3ZCCA 4ASUG 1VQKV 1RPOA 1J95A 3K0GA 4KUMA 5B1BC 4KP4A 1VQ4V 1QVFU 1OCZC 2UXNA 3TK1A 1F51A 1YI2V 4H33A 2LP7A 2QM7A 4FK5C 2HJFC 1QBZA 3IGAC 1LNQA 1MABG 4QIWF 2PI4A 5B1AB 5B3SB 1VQ7V 1DF5A 2ZDIA 1E79G 4MVSA 3AG3B 1BHAA 4CZZA 3FB7C 1NH2B 4QPKA 1RM1C 1R3LC 3LDDA 3QO8A 3ABUA 3SPHA 1OHHG 4XDJA 4R7CA 2Y69C 2A9HA 1KKDA 2V7QG 2EZPA 1M90W 5LBQA 1NBMG 1Y4MA 3OEEG 1K7DA 2ITCC 1AI6A 4GX5A 4PA3A 3K04A 3E86A 2AHZA 2ZDIC 4LCUC 4PDMA 4DO2A 2IJKA 1CEZA 3F5WC 3X2QB 1PNLA 1AROP 3I56V 1K4DC 3NXSA 4WFEA 5CN0A 2YEVB 2ZD9A 2Y48A 1NJIW 1E1QG 1PD3A 1M57C 2PI5A 3E89A 5L3CA 4WFBV 3W7WA 2A79B 4HAMA 2AHYA 4GT1A 3ZMSA 1B6QA 1F23A 2JEXA 4J9ZB 1FXKA 1G4YB 1K73W 3JD3A 3VBBA 3OR7C 3CXCU 2JK5C 3SPJA 3CCVV 4RQFA 3OMIB 3DGEA 1NKDA 3K3WA 1S76D 3CCUV 3CCMV 1SERA 3JYCA 1VQLV 2DW4A 2EIMC 3FYIB 3STLC 1V54B 1JX9A 1S5HC 2WLLA 4PDVA 4FMTA 4JGSA 2C2AA 2X6AA 1R3JC 2JEUA 3ZN1A 1Q86W 2X6CA 1RPRA 3LUTB 4RO2A 4OXSA 1OCCC 3BEHA 4UV9A 1AJQA 2ZR2A 5KA5A 2XAGA 1VQ5V 4PDRA 1UJWB 1V55C 1KQSU 1K5QA 1VQ8V 1QLEC 1WPXA 4JTCB 3W7SA 2WLMA 1FXKC 3CC4V 2Q6AA 4GX2A 3OE7G 3OM3B 4MVUA 2DWEC 2EBOA 3CD6V 2W0FC 3QO5A 5C93A 1DTOA 2NNUA 2OT5A 1QVGU 3ABMC 1Q81W 1W0JG 2HKOA 3ASNB 1VQOV 3BY6A 4FIPC 1PNKA 4FPPA 2OTJV 1XL4A 5J9PC 1YIJV 2DYSB 2XAHA 1K4CC 3B77A 3ZMUA 1Y66A 3RW0A 5KUMA 2M7WA 1JPXA 3E35A 3OGCC 5L3EA 1IXMA 3CCEV 4KFMA 4CBCA 5EBLC 5IYDO 4PA7A 3CYOA 5DN6G 4RQEA 2ATKC 2P7TC 4GX1A 1GM7A 3E8GA 3OW2U 4BIUA 3W7UA 4WFAV 3E8BA 3PJSK 3AG1B 3ZRXA 5B1NA 2WWWA 3ABTA 3CCJV 1KD1W 2YSUB 3ABLC 3AG2B 4LP8A 2P90A 2XOKG 1BHBA 1OCRB 3IFXA 5IY5C 1NR1A 1H2GA 2XAQA 1KECA 3AG4C 2XNDG 3ZRWB 4U7NA 1GMGA 4HYOA 1NQTA 3ASOC 2WLKA 2Q68A 2ZXWC 3K0DA 5CBHA 4MTGA 2WAMA 2HFEC 3RBZA 5LGTA 5IYCO 1DF4A 3KG2A 3G6EV 1S77D 2DQ0A 4R8CA 1F4NA 2DYRC 4X8AA 2EILB 4MVOA 1GTOA 3IC7A 3LNMB 2HR3A 4PA9A 1ROPA 1PNMA 2B5UA 3MD0A 4MVMA 1FFTB 3WFVA 3OUSA 4H37A 2KB1A 2EIMB 1NR7A 2W6JG 4QE9A 3CP1A 1ORQC 4Q20A 2XAFA 3M99B 4PELA 2GSMB 3JD1A 4UVCA 1ZWIC 1CP9A 3ML0A 5HFMA 2Q67A 4MTXA 1DLBA 1K5SA 1G8MA 1PKXA 2JIZG 4QNHB 1K97A 1M1KW 1EBOA 1V55B 4RUFA 4J9YB 2EINC 3SYAA 2WLJA 2K1EA 4TT3G 4R50A 2Q69A 4MW8A 2W6IG 2OCCB 2BOCC 2A0LA 3RVZA 3TETA 3FYEB 5CMUA 2HLDG 3HPLC 3ABMB 1VQPV 4X88A 4TSFG 1AI4A 5L3DA 2IU3A 3OEHG 2WLLB 1GM9A 1TUEB 2P6JA 3MHHC 2JDIG 4MSWC 1Q82W 2Z3YA 1NVPD 3SYCA 3ZJZA 2WLIB 3WG7B 2EIKB 4BAYA 3RVYA 3CMAV 5IYBO 1M56B 4MVZA 2EZOA 1YSCA 4WF9V 2EJRA 1COWG 2LFSA 3CPWU 4N21A 4X89A 5LGUA 3FB6C 4QE7A 3W7XA 3CCQV 1QLNA 2EIJB 5H6RA 3K08A 3F7YC 5CBFA 1S72V 1OCOC 3K79A 2X0LA 1ENVA 1KC8W 2HVKC 4E2LA 3LSQA 3LSSA 2X7RB 3OMNB 5E1AC 2IH1C 1OZ0A 4UUJC 1YJ9V 4JF3A 1CPYA 2QA4V 1YHQV 4XDLA 5EBMC 4ZKIA 3B8MA 2HVJC 2CK3G 1QR9A 1R73A 1VQ9V 1BL8A 1I5YA 5B1AC 5B1BB 2IU0A 3ETDA 4RUEA 1OCZB 3FB5C 3CCSV 2D3OW 1S3JA 1SESA 1VQ6V 5CA3A 3F7VC 1K33A 3I55V 1SZTA 2B1GA 5LHIA 4UV8A 4R6ZA 4L87A 3HB3B 4MTFA 1MOFA 3P32A 3OMAB 4TWKA 1H8HG 3SYOA 1K34A 5LHHA 4P30A 2DWDC 2ZR3A 3EFFK 4JASA 1RM1B 3UKMA 2MK3A 2Y69B 5L3GA 3ZRSA 1YTFD 1VQNV 2Z5UA 4WFFA 3CCRV 3TCUA 3CCLV 3CC2V 3X2QC 5L3FA 5LGNA 1SRYA 5LHGA 1P4RA 1GM8A 4JAVA 4YXWG 1GKFA 3MHSC 4Z1MG 2R9IA 2JJ1G 4MVQA 1AI5A 3E83A 4P9OA 4XDKA 3SYQA 3T4ZA 1W2BU
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  4N23 A;  3B8M A;  1I5X A;  1DLB A;  3K9A A;  1QR9 A;  2EZP A;  1I5Y A;  2EZO A;  1EBO A;  2MK3 A;  3CYO A;  2LP7 A;  3H01 A;  1DF4 A;  4FK5 C;  1Y4M A;  1QBZ A;  2EBO A;  4N21 A;  1QCE A;  5HFL A;  1K33 A;  2OT5 A;  1DF5 A;  1SZT A;  1MG1 A;  4FJC C;  4JPR A;  1JQ0 A;  4G2K A;  5CMU A;  1ENV A;  1MOF A;  3B8N A;  3WFV A;  4E2L A;  4JGS A;  2X7R B;  4FIP C;  3MHS C;  3GWO A;  5CN0 A;  1K34 A;  3CP1 A;  1QR8 A;  2P6J A;  3MHH C;  3B77 A;  3P30 A;  3M99 B;  4JF3 A;  1Y66 A;  5H9C A;  5KA6 A;  5KA5 A;  2M7W A;  1JPX A;  5HFM A; 
#chains in the Genus database with same CATH topology
 1AR4 A;  1V9P A;  4I55 B;  2NR5 A;  2YI8 A;  1FXH A;  1V54 C;  3D3I A;  1PL4 A;  3OFN G;  2ETN A;  1MG1 A;  3P3N A;  2FTK A;  4BIO A;  4LF7 B;  1AJP A;  3N2G A;  3T1H B;  1R3K C;  3UO2 A;  1JOY A;  3JD4 A;  2ZE5 A;  1W0K G;  1NT2 B;  1F4M A;  5KUK A;  1L0N H;  4LFC O;  4F6R B;  1OCC B;  4DUY B;  4UVB A;  3UM7 A;  3JAM N;  4JTD B;  1WAZ A;  4IL6 Z;  3ASN C;  1LUW A;  1IX9 A;  1GO3 F;  4JPR A;  2B9Z A;  3E22 B;  1IBL B;  2DYS C;  4MTO A;  5BR8 O;  4G28 B;  3OGI B;  2HP8 A;  1P7B A;  2B1I A;  3U10 A;  3GB7 C;  2PF4 E;  2OTL V;  1N0N A;  5EC1 C;  3G4S V;  2XHB A;  2AZ2 A;  4NTY A;  3AK2 A;  3AG2 C;  1VF7 A;  3T1C A;  2YS8 A;  4DV1 O;  4HBN A;  5IJ0 A;  5EK0 A;  5IY5 B;  3JAK B;  5B5E Z;  2L35 A;  3AG3 C;  2RNB A;  4I50 B;  2QE7 G;  1NH2 D;  1P49 A;  3R65 A;  2YEV A;  1AJN A;  4J42 A;  4FLU A;  3SPG A;  1BMF G;  1WA8 B;  3T4D A;  2CTW A;  2WLI A;  4DV7 O;  4CH3 A;  1PPJ H;  2UU9 O;  3JD2 A;  4JYB A;  4UVA A;  4DV4 B;  4O4H A;  2OCC C;  2VWJ A;  4DR3 B;  2ADQ B;  1G6U A;  3SDL A;  3N2K A;  3CC7 V;  3ZN0 A;  5IDJ A;  4YHH B;  3CME V;  1K3E A;  1JJ2 U;  2N74 A;  3WG7 C;  4IIJ A;  1QR8 A;  3ETG A;  4DV2 B;  1M56 C;  1EZJ A;  4WFG A;  4WFH A;  3MDS A;  1Q3E A;  4TUY B;  5IYZ B;  2V1D A;  5KHH A;  1K8A W;  3D36 C;  2CAZ C;  4B3T O;  4PDL A;  4YJ3 A;  3ZMV A;  4JI8 O;  5FLX N;  2LJ2 A;  5LOV A;  3A0R A;  2N04 A;  3ZCC A;  1IUR A;  3G6B A;  1J95 A;  3H1J H;  5B1B C;  3K57 A;  1VQ4 V;  4DR5 O;  1PP9 H;  1XNR B;  4GUN A;  1R6T A;  2VQE O;  5IWA B;  1ZX3 A;  4X65 O;  1QBZ A;  3IGA C;  2M6Y A;  2BSK B;  1DF5 A;  1E79 G;  3AG3 B;  3CB2 A;  1BHA A;  3HKE B;  1I94 O;  4LFA O;  4I55 A;  3LDD A;  4O2B A;  3SJB C;  3QO8 A;  4X66 O;  4DV5 O;  3KCY A;  2YIC A;  2YIA A;  4DV3 B;  4LWS B;  3OEE G;  2ITC C;  1Y76 B;  3BVO A;  2AHZ A;  3BAB A;  4PDM A;  1CEZ A;  5FPR A;  4JZ2 A;  4F6R A;  2ZD9 A;  1ZUQ A;  2Y48 A;  2ILM A;  3QTC A;  3E89 A;  4GT1 A;  2JEX A;  1XHX A;  1G1X B;  3E22 A;  3QF7 A;  2DW4 A;  3FYI B;  3RYC B;  5CB4 B;  1JX9 A;  2X6A A;  1R3J C;  2JEU A;  1Q86 W;  1RPR A;  2BTQ B;  2GBO A;  4RO2 A;  4OXS A;  4FLZ A;  3BEH A;  2XAG A;  4PDR A;  1V55 C;  1VF6 C;  2GTA A;  4PI2 A;  1QLE C;  4J11 A;  4KHP O;  1FXK C;  3CC4 V;  5JCO C;  4GX2 A;  1BGY H;  2EBO A;  3CD6 V;  5C93 A;  2D2C B;  1QVG U;  3ABM C;  3ZHQ A;  2QTS A;  2BTO A;  4CH5 A;  3BY6 A;  4FPP A;  5LA6 B;  4GLX A;  3JAK A;  2QJ1 A;  1K4C C;  1Y66 A;  1JPX A;  3RFR A;  3SGI A;  2RDC A;  3A0H Z;  3CCE V;  4I50 A;  5EBL C;  4K0K B;  2P7T C;  2WA3 A;  3E8G A;  1WA8 A;  2JGD B;  3VQX A;  3OW2 U;  4WFA V;  3AG1 B;  5B1N A;  2WWW A;  1KD1 W;  2YSU B;  3JAR B;  2XTA A;  2ZIM A;  1JJO A;  2XAQ A;  1YXB A;  1SQX H;  3AG4 C;  2XND G;  3ZRW B;  4KL1 A;  4HYO A;  1NQT A;  2Q68 A;  2ZXW C;  2QSA A;  4AQY O;  4MTG A;  3RBZ A;  1DF4 A;  4X8A A;  4PA9 A;  1JFF B;  1ROP A;  2K9P A;  4YJ2 B;  4JI0 B;  2KB1 A;  2V4D A;  4JI1 O;  2W6J G;  4TV9 B;  4TUY A;  5IYZ A;  1GN6 A;  1FAF A;  5K1X A;  1IBM O;  2UXB O;  4NTW A;  4B3T B;  3ML0 A;  5HFM A;  2QM4 A;  4OPH A;  1G8M A;  1V55 B;  4J9Y B;  2EIN C;  2WLJ A;  4TT3 G;  3S3W A;  3C90 A;  4NVP A;  3ZBH A;  3ZHS A;  3RVZ A;  1KU9 A;  4FLV A;  3ABM B;  5FPO A;  5L3D A;  2VQE B;  2WLL B;  2P6J A;  3MHH C;  1Q82 W;  2DE0 X;  4BAY A;  2BSK A;  3RVY A;  3CMA V;  4JZG A;  1WB8 A;  2EZO A;  1COW G;  3ETQ A;  4N21 A;  5LGU A;  3CCQ V;  1I94 B;  1IZ3 A;  1QLN A;  1Q6I A;  2EIJ B;  4LFA B;  2GUZ B;  4QGP A;  2X0L A;  1S5L Z;  2XT9 A;  1KC8 W;  4E2L A;  3ZX6 A;  2CGN A;  1YDX A;  1CPY A;  1OJH A;  1YHQ V;  4AHC A;  4LWS A;  3L75 H;  1Y76 A;  5EBM C;  1I5Y A;  2IU0 A;  2UUB B;  4RUE A;  3BFR A;  2ZIO A;  3FB5 C;  3CCS V;  2UUC B;  2D3O W;  1S3J A;  2Q7H A;  4LF5 O;  5BMV A;  3F7V C;  5CA3 A;  4UV8 A;  4R6Z A;  2VQF B;  2Z0A A;  4Z2W A;  3OMA B;  2Q73 A;  3K58 A;  4LF7 O;  2MK3 A;  2Y69 B;  3RYC A;  5CB4 A;  5D5Q A;  1DK1 A;  4ZHQ B;  1D5A A;  2BTQ A;  3T1Y B;  1BCC H;  5LHG A;  2GV9 A;  4DUY O;  4YXW G;  3JAL B;  2JJ1 G;  1XEQ A;  4P9O A;  2LW7 A;  1W2B U;  1IBL O;  2R72 A;  3L74 H;  1M57 B;  2IJJ A;  4BIZ A;  4H0L B;  2E74 B;  4J7Z A;  3AEI A;  1NVP B;  3ETE A;  3CXH F;  4A5U B;  4DR7 B;  4F4L A;  5LA6 A;  2YXL A;  5H6Q A;  2F43 G;  2WPD G;  3K06 A;  3AK3 A;  3FFQ A;  4ICG A;  5B1O A;  4CS4 A;  4P2Z A;  1THZ A;  4GX0 A;  2VRZ A;  5JJE B;  4MVR A;  2KKW A;  3AG7 A;  4U7O A;  3JAR A;  5HFL A;  1EN4 A;  1GK9 A;  3JCZ A;  4EEQ A;  2QWN B;  1FS0 G;  2JRI A;  4IYH A;  3ZHR A;  2E3C A;  1S0V A;  2PGG A;  2IH3 C;  3ZRW A;  4HZ3 A;  2PY5 A;  2E5L O;  1TAE A;  4UXN A;  1F7Y A;  4AQY B;  3CS5 A;  2OWO A;  4JI7 B;  1FKA O;  4JAU A;  2BOB C;  1AI7 A;  1SKV A;  5BXZ A;  4BWA A;  4JYC A;  1MSW D;  1JFF A;  4RAI A;  3M7M X;  4FFB B;  3VOU A;  4TV9 A;  2HG5 C;  1IBM B;  3RT3 C;  5EBW C;  1YTF B;  4DV4 O;  3O9O A;  4L8J A;  4K8X A;  1URF A;  4I7Z B;  5H2F Z;  4LF6 O;  1WPB A;  4UB8 Z;  5CBG A;  4DR3 O;  1IBK B;  1IXB A;  1Z5W A;  3ABL B;  3P30 A;  3SR2 C;  1B3Q A;  3H1K H;  1I5X A;  4WCE V;  2Y0I A;  3W7T A;  4K8Z A;  3ASO B;  3QNE A;  3OT7 A;  4LC1 A;  4QPJ A;  4I5S A;  2DYR B;  5JJJ B;  3TXS A;  2QTO A;  4DW0 A;  3QVN A;  2GHY A;  4MT8 A;  2UUA B;  1N8R W;  1KP2 A;  4FZ0 A;  1SQB H;  3CRQ A;  2IM9 A;  3TJT A;  2HJD A;  1AR1 B;  1Q6H A;  1XNR O;  5KLV H;  1GH6 A;  2O57 A;  5IWA O;  3B09 A;  2AGA A;  2NLJ C;  1JCH A;  4JI6 B;  1YEW A;  2EIK C;  4MS2 A;  1FFX A;  5KMG B;  3APO A;  2X6B A;  4IYI A;  2JGU A;  3HKC B;  1K9M W;  4PD4 F;  4ZI7 B;  1ZAU A;  1H2M A;  2ZCE A;  3CE2 A;  1KKC A;  1HWY A;  1H38 A;  2P67 A;  3UO3 A;  3ZMT A;  4DV3 O;  1FD9 A;  4ZIB A;  1PL0 A;  1VQK V;  2WLH A;  1ZTE A;  1RPO A;  4JI3 B;  4KUM A;  1QHT A;  1F51 A;  1N4C A;  1XOU A;  4PHZ A;  1YI2 V;  2PZS A;  2HJF C;  4QIW F;  3JAL A;  5B1A B;  3K59 A;  4MVS A;  2PUS A;  3RYI B;  4B3S B;  3FB7 C;  2LGQ A;  1EN5 A;  1BZK A;  1NH2 B;  4QPK A;  1RM1 C;  4EFB A;  1WNS A;  1NU1 H;  4TQF A;  5AG2 A;  4LF8 B;  1NTM H;  2A9H A;  4JI5 O;  2EZP A;  2CUG A;  3FX7 A;  3M8A A;  1Y4M A;  3L71 H;  3C3S A;  3E86 A;  2ZDI C;  4LCU C;  3X2Q B;  4W4K A;  1K4D C;  4X64 B;  4WFE A;  5DED A;  5CN0 A;  2Q0A A;  2ZE7 A;  2PI5 A;  4WFB V;  3W7W A;  2AHY A;  1B6Q A;  4Q6G A;  4J9Z B;  1G4Y B;  3OR7 C;  3L73 H;  1U97 A;  4CC5 A;  3OMI B;  3K3W A;  3TXQ A;  2E5L B;  4JI4 O;  3CCU V;  3JYC A;  3DXR A;  1V54 B;  4D7T A;  1S5H C;  4UCS A;  4K0K O;  2C2A A;  1MZF A;  2X6C A;  4IHJ B;  2JVD A;  2P06 A;  3RYF B;  1MNG A;  4FFB A;  1Z5V A;  1KQS U;  2IBZ H;  2OIG A;  2FML A;  2EUL A;  2Q6A A;  3OE7 G;  1UPG A;  3K5L A;  4MVU A;  1EN6 A;  3BAA A;  4LF6 B;  3QO5 A;  4JI2 B;  2CTR A;  2Q7G A;  3B40 A;  1P84 F;  3JCU Z;  4UCV A;  1W0J G;  3ASN B;  4GKK B;  2KQX A;  2BCC H;  4GYC B;  1XL4 A;  1YIJ V;  2DYS B;  2XAH A;  3B77 A;  3ZMU A;  5IE9 A;  4JI0 O;  1L0L H;  1IXM A;  3KZI Z;  4CBC A;  5IYD O;  4PA7 A;  5DN6 G;  2ATK C;  3L70 H;  1SQG A;  3PJS K;  5LP6 C;  1VIB A;  2KG7 B;  3ZRX A;  3ABT A;  3CCJ V;  3AG2 B;  1IDS A;  1BHB A;  1NR1 A;  3I5D A;  1H2G A;  5GTI Z;  1RFY A;  2YIB A;  1D2D A;  4U7N A;  1GMG A;  2P22 C;  5CBH A;  5IYC O;  2DN9 A;  1N33 B;  2DQ0 A;  4R8C A;  1GN4 A;  3JAS B;  3IC7 A;  3DSQ A;  5KMG A;  3MD0 A;  1PNM A;  2QWR B;  4H37 A;  3K5M A;  1T5E A;  3HKC A;  4ZI7 A;  3CP1 A;  4Q20 A;  5JVD B;  2XAF A;  1CP9 A;  1KB9 F;  2Q67 A;  1PKX A;  2JIZ G;  4QNH B;  1K97 A;  4RUF A;  1LUV A;  1TUB B;  4O4I B;  3SYA A;  1MZE A;  3G67 A;  2VS0 A;  1QU7 A;  2W6I G;  2OCC B;  2BOC C;  3TET A;  4YIO A;  5CMU A;  3UQ8 A;  2UUB O;  4CC6 A;  4X88 A;  1Y74 B;  2UUC O;  2ZE8 A;  1AI4 A;  1SQV H;  1TUE B;  2VQF O;  1YVW A;  1YZB A;  4I9Q A;  3WG7 B;  1M56 B;  1GRJ A;  2YC0 A;  3RYI A;  2CE4 A;  3VQY A;  3CPW U;  3RGB A;  1XDC A;  3FAV B;  3K5O A;  1BT8 A;  3B2E E;  3VQV A;  1XMQ B;  1S72 V;  1OCO C;  2RJZ A;  5A9G A;  5KX5 B;  3KCX A;  2IH1 C;  4JI5 B;  1XHZ A;  3T1Y O;  4XDL A;  1N34 O;  1J5E B;  1FJG B;  3B8M A;  3U0Z A;  2CK3 G;  1A32 A;  1VQ9 V;  1BL8 A;  1H2N A;  5B1B B;  2FB5 A;  3ETD A;  4I4T B;  1VQ6 V;  1SES A;  2AW9 A;  1K33 A;  1SZT A;  2B1G A;  2Q5Z A;  3HB3 B;  4JYA B;  3SYO A;  5LHH A;  2DWD C;  4DR7 O;  2ZR3 A;  3EFF K;  3A8T A;  2N05 A;  4JAS A;  2UXD B;  2CDY A;  4JI4 B;  1GAX A;  2F23 A;  2Z5U A;  4WFF A;  3CCR V;  2AXT Z;  2LGW A;  3TCU A;  4UFZ A;  4NXN B;  4IHJ A;  5L3F A;  5LGN A;  1CXZ B;  4JAV A;  2RN9 A;  3RYF A;  4B3M B;  3MHS C;  1HP8 A;  3E83 A;  3SYQ A;  5CA1 B;  4H13 B;  4LH6 A;  4FLT A;  4X20 B;  1M5I A;  1SS3 A;  3JAT B;  4JI7 O;  1Z2G A;  4IGG A;  1YJN V;  5JWP A;  4JYY A;  1R1B A;  4LBE C;  5ITZ B;  4EFE A;  1EFR G;  3THO A;  2WLN A;  3HKD B;  1PM9 A;  1H8E G;  3HKB B;  2LW1 A;  3T2M A;  5L3B A;  1Q7Y W;  5KAF Z;  3JD0 A;  1KP3 A;  4MW3 A;  5GTH Z;  1IBK O;  2ZT9 B;  2UXX A;  1QLE B;  4B08 A;  2R9A A;  1FXK B;  1AB3 A;  3D8C A;  3APQ A;  5FNV B;  4I9W A;  3B8N A;  2XAS A;  1QNM A;  2P4K A;  3SPI A;  2H3O A;  4LF4 B;  1HDJ A;  2R70 A;  4JV5 B;  1M4U A;  3ABK C;  1SQQ H;  2F4V B;  3MAQ A;  2ZQM A;  2YDE A;  1YJW V;  3HKE A;  5GON B;  3CRR A;  1FXV A;  1OCR C;  3BCC H;  4Z1V A;  2UUA O;  5KHJ A;  3CRA A;  3A2F A;  3J80 N;  3LDC A;  4P9P A;  1TUB A;  1AVM A;  4XBF A;  3AG4 B;  4JI6 O;  2EIL C;  2P5O A;  2DQ3 A;  3CRC A;  4DR4 O;  2ZXW B;  1X4T A;  4QJF B;  2QKS A;  4BW9 A;  1SET A;  1HNX O;  2IW5 A;  4K35 A;  3OTO O;  3GWO A;  1D5N A;  4J7J A;  1R3I C;  3D36 A;  3H1H H;  4DV6 B;  2EX3 A;  4J41 A;  3SPC A;  1M9N A;  4JI3 O;  4B7E A;  3EHB B;  5KX5 A;  1O9G A;  2EIN B;  3STZ C;  1Q90 D;  4G2K A;  2F66 C;  1N34 B;  2JJ2 G;  3QG5 A;  4UCO A;  4LF9 B;  2PTM A;  3FKS G;  4GKJ B;  4UCT A;  4I4T A;  5H9C A;  5KA6 A;  4B3S O;  4C7U A;  4GZR B;  3ZMZ A;  3G71 V;  3PN1 A;  5EC2 C;  1ZLZ A;  1SZX A;  4LF8 O;  3ABK B;  2ZE6 A;  4X9Q A;  1R6K A;  3SJC C;  2ZM6 O;  2YXH A;  1XI1 A;  1N32 B;  1RSO B;  2ARH A;  1OCZ C;  1QVF U;  3TK1 A;  2JGD A;  1X59 A;  4X64 O;  5LXT B;  4H33 A;  2LP7 A;  2QM7 A;  3G80 A;  3N27 A;  1Q8I A;  4FK5 C;  5CA0 B;  1LNQ A;  1VQ7 V;  5IT9 N;  2RQ6 A;  1PV0 A;  1AR5 A;  2ZNI A;  5LMU B;  5CA1 A;  5JJN B;  4NR1 A;  4X20 A;  4KXR A;  3ABU A;  2JS5 A;  4XDJ A;  2F93 B;  3BHP A;  3JAT A;  4R7C A;  2V7Q G;  1IVS A;  1M90 W;  5J2T B;  5LBQ A;  1VMG A;  1H2L A;  1K7D A;  4YJ2 A;  4GX5 A;  4PA3 A;  4FM2 A;  3HKD A;  3K04 A;  4D7S A;  3HKB A;  3ZS8 C;  1PNL A;  1ARO P;  1WN7 A;  3CHX A;  3NXS A;  4JI2 O;  2YEV B;  3P3P A;  1E1Q G;  1PD3 A;  1VF6 A;  4HAM A;  3CSX A;  1F23 A;  1FXK A;  5JCO A;  1K73 W;  1KYO F;  3VBB A;  4ABM A;  4GKK O;  2E75 B;  3CJH B;  1DGS A;  3SPJ A;  3CCV V;  4RQF A;  2HHH B;  5EYP B;  3DGE A;  5A2Q N;  3CCM V;  1SER A;  2ZIN A;  4UB6 Z;  1VQL V;  2ZNJ A;  4I0X B;  3STL C;  4DR2 O;  2WLL A;  1BSM A;  4DR6 O;  3ZN1 A;  3LUT B;  5JQG B;  1OCC C;  1S5J A;  1NZ6 A;  1AJQ A;  4X1K B;  1VQ5 V;  1UJW B;  2CTP A;  1K5Q A;  1VQ8 V;  2YID A;  5K1P A;  2WLM A;  5GON A;  3OM3 B;  3UCS C;  2GUZ A;  2W0F C;  2NNU A;  4PV1 B;  3GVM A;  2A3Q A;  1EM1 A;  3CEI A;  2HKO A;  3ZHT A;  1N33 O;  1PNK A;  5J9P C;  5KUM A;  4ZOL B;  2M7W A;  4DR4 B;  2FKX A;  4OX9 B;  5L3E A;  4DW1 A;  4KFM A;  1XIL A;  2QR4 A;  3CYO A;  1HNX B;  4RQE A;  3VQW A;  1GM7 A;  1HNW B;  4FFK A;  3W7U A;  3OTO B;  1WP8 A;  3E8B A;  2GDS A;  3L72 H;  4PI0 A;  3H1I H;  4LFB B;  4DYL A;  4LP8 A;  2XOK G;  2P4V A;  3TGU H;  3IFX A;  5IY5 C;  1XMO B;  3OD4 A;  1W59 A;  2FYU H;  2WLK A;  4O2B B;  4ZHQ A;  2QKC A;  3K0D A;  3HR0 A;  1VAR A;  1EZV H;  5LGT A;  2Q8V A;  2OCH A;  4LNU B;  3GWK C;  4MVO A;  1GTO A;  3LNM B;  3ZHU A;  2HR3 A;  4H44 B;  4IT5 A;  4DUZ B;  2QGN A;  2B5U A;  4DK0 A;  3OUS A;  1Q43 A;  1XBL A;  1NR7 A;  3NR7 A;  4W4L A;  2YIB D;  4PEL A;  1XMQ O;  2GSM B;  1MA1 A;  3JD1 A;  4UVC A;  2ZKO A;  1ZWI C;  4MTX A;  1K5S A;  4AIL C;  1M1K W;  4NB5 A;  5B66 Z;  1I0H A;  2K1E A;  4R50 A;  1BS3 A;  2Q69 A;  2ZM6 B;  1J5E O;  1FJG O;  5IJ9 B;  3IAY A;  5J2U B;  2A0L A;  1XNQ B;  2HLD G;  3WB2 A;  4X1I B;  1RSO A;  4TSF G;  2QDO A;  5LMN B;  4E4E A;  1H2K A;  2KSD A;  2IU3 A;  3OEH G;  1GM9 A;  4MSW C;  5LXT A;  1N0J A;  4B3R O;  4TV8 B;  5CA0 A;  2EIK B;  4JYA O;  5IYB O;  4MVZ A;  5F2V O;  2VWK A;  4WF9 V;  2EJR A;  4X89 A;  3IC9 A;  3FB6 C;  2CH7 B;  2UXD O;  3K08 A;  5CBF A;  1BQZ A;  3K79 A;  1N36 B;  2QKA A;  1ENV A;  4NXM B;  2HVK C;  3EXA A;  3LSQ A;  3LSS A;  2X7R B;  2LO1 A;  1OZ0 A;  4DV0 B;  4UUJ C;  4NXN O;  4JF3 A;  5D5P A;  3WB1 A;  5J2T A;  4O4L B;  4DK1 A;  1L8D A;  4ZKI A;  3WU2 Z;  1VEW A;  4B3M O;  2HVJ C;  3B4S A;  1WJZ A;  1R73 A;  2JS3 A;  1YF2 A;  4O2A B;  3I55 V;  5LHI A;  4TQD A;  4MTF A;  4YY3 B;  1MOF A;  3RYH B;  4X62 B;  1K34 A;  3LSU A;  3CJH A;  3EVK A;  1JA8 A;  5EYP A;  1RM1 B;  3CRM A;  4NTX A;  3BRC A;  4O4J B;  4DR2 B;  4I0X A;  2YUA A;  3CX5 F;  4DR6 B;  3LNN A;  3CCL V;  2LQT A;  4D6T H;  5JQG A;  1SRY A;  1SQF A;  3BA8 A;  3J7A U;  1QQC A;  4X1K A;  1GKF A;  2R9I A;  5JH7 B;  3RN4 A;  1NI8 A;  4DR1 B;  4LR3 A;  4U3J B;  3S3X A;  3E2E A;  5BZB A;  3OTF A;  3H01 A;  4AI8 A;  4LF4 O;  1QCE A;  4PA6 A;  3SYP A;  4JV5 O;  4NYK A;  1WB7 A;  2A06 H;  4ZOL A;  2F4V O;  3D3Q A;  1B06 A;  4DXW A;  1OV9 A;  2H8P C;  2G38 A;  1HNZ B;  2UXC B;  1WLE A;  5TIS Z;  2IJI A;  2CTQ A;  1KMI Z;  1HR0 B;  1GN3 A;  5GW7 A;  3JAW B;  1US6 A;  3E8F A;  1R6N A;  1VQM V;  2Y4T A;  5EIB C;  3ZRV A;  1VF5 B;  2CGO A;  4LNU A;  3K9A A;  3WB0 A;  4BW5 A;  3AG1 C;  4GCZ A;  1K92 A;  3ZIA G;  3OUF A;  3QO7 A;  1M93 A;  1JVM A;  4CS3 A;  4DV6 O;  2ITD C;  4HNA B;  5BMV B;  4LFC B;  4EKW A;  5LP6 B;  2QM8 A;  4DRX B;  5LYJ B;  3K03 A;  4RWU A;  3SJA C;  5IJ9 A;  4NKG B;  5J2U A;  4LF9 O;  2MW2 B;  4GKJ O;  5B3S C;  5BR8 B;  3LDE A;  3KKY A;  2XAJ A;  4X1I A;  1ZL8 B;  1FPO A;  1JQ0 A;  4TOI A;  2RMK B;  4B3R B;  4TV8 A;  4X1Y B;  2IJH A;  1P7G A;  3H1L H;  3AK1 A;  4JTA B;  4N23 A;  2CH7 A;  5KHI A;  1XL6 A;  1BE3 H;  5DM6 V;  2EJ7 A;  1N32 O;  4DV1 B;  3FB8 C;  4FJC C;  1YIT V;  2H94 A;  1AP5 A;  2QEX V;  3E8H A;  1L1F A;  3SJQ C;  5LL6 Y;  4O4L A;  2LFR A;  3FD9 A;  5KAI Z;  2WSS G;  3DTU B;  1E1R G;  2Q4P A;  5LMU O;  2R9R B;  4O2A A;  3OAA G;  4PA4 A;  5KHG A;  2EIJ C;  4G27 B;  4DV7 B;  3RYH A;  5FL7 G;  4EB6 B;  3O65 A;  3OR6 C;  2W0X A;  2UU9 B;  2OYQ A;  3CWB H;  5E79 Z;  4J80 A;  4ZBM A;  1OCO B;  4ASU G;  4O4J A;  3UT5 B;  1U96 A;  3K0G A;  4KP4 A;  4LH7 A;  2UXN A;  5C8Y B;  1NS1 A;  2KG7 A;  4JAA A;  4U3F H;  1MAB G;  2Q0O C;  2PI4 A;  2A7W A;  5B3S B;  1TVK B;  5JH7 A;  2ZDI A;  2DOS A;  2F95 B;  4UCU A;  4CZZ A;  2HHH O;  4U3J A;  3BA9 A;  5EIB D;  1R3L C;  3SPH A;  1OHH G;  3ZED A;  1Y6X A;  2BE3 A;  2Y69 C;  4CH6 A;  1KKD A;  3JAS A;  4JI8 B;  1NBM G;  1AI6 A;  3ZHV A;  5BY1 A;  4UCR A;  1TGO A;  1MSD A;  1XQ8 A;  4DO2 A;  5JVD A;  4PJ0 Z;  2AZ0 A;  2IJK A;  3F5W C;  4DR5 B;  3I56 V;  3BPZ A;  1NJI W;  1M57 C;  1UFI A;  5L3C A;  4X65 B;  2A79 B;  3J81 N;  3K9S A;  3ZMS A;  4O4I A;  3JD3 A;  1NTK H;  1LR1 A;  3CXC U;  2JK5 C;  1JR9 A;  3JAW A;  2Q7E A;  1NKD A;  1S76 D;  1RP3 B;  4OX9 O;  1Y74 A;  2EIM C;  4X66 B;  4DV5 B;  5EZY B;  4PDV A;  4FMT A;  2QWP B;  4JGS A;  2FL4 A;  1HNW O;  3Q4H B;  2NN4 A;  3A0B Z;  1MMM A;  4UV9 A;  4WBN B;  2ZR2 A;  5KA5 A;  2Y0P A;  1GN2 A;  1SA0 B;  4LFB O;  1XUQ A;  1FFX B;  1WPX A;  4JTC B;  4J7K A;  3W7S A;  3FAV A;  2PYL A;  1XMO O;  1HW7 A;  2F1M A;  2DWE C;  4HNA A;  5LP6 A;  1DTO A;  2OT5 A;  2Y4U A;  1ZSP A;  1Q81 W;  5LYJ A;  4DRX A;  2Q9L A;  3H9V A;  3RWR D;  1VQO V;  4FIP C;  2OTJ V;  3F5T A;  4DUZ O;  3RW0 A;  3N2G B;  2E76 B;  3E35 A;  3T1H O;  3OGC C;  4B7K A;  1ZL8 A;  1XRE A;  4OGQ B;  4FM1 A;  4GX1 A;  4BIU A;  4X1Y A;  2L6L A;  3ABL C;  3ICX A;  2P90 A;  4KHP B;  1OCR B;  1KEC A;  1XNQ O;  3ASO C;  2ODM A;  5LMN O;  2WAM A;  2HFE C;  3G6E V;  3KG2 A;  1S77 D;  5H5N A;  1F4N A;  2DYR C;  2EIL B;  4MVM A;  1FFT B;  3WFV A;  2EIM B;  3L9D A;  4QE9 A;  1ORQ C;  3M99 B;  1N36 O;  4FLW A;  1KUQ A;  3C3T A;  4NXM O;  2YXY A;  1DLB A;  3K5N A;  4EB6 A;  4DV0 O;  1AP6 A;  1EBO A;  1FYJ A;  5IJ0 B;  4FLY A;  4CS2 A;  5ITZ A;  1KBH A;  4MW8 A;  3R66 A;  3IJ4 A;  3FYE B;  3UT5 A;  1SC5 B;  3HPL C;  1VQP V;  2OIE A;  3DXR B;  2YI9 A;  5C8Y A;  2ADP A;  2JDI G;  5KHK A;  1I08 A;  2Z3Y A;  1NVP D;  3SYC A;  3ZJZ A;  2WLI B;  4YY3 O;  4FLX A;  1TVK A;  1YSC A;  1AIL A;  4X62 O;  1H2S B;  1NTZ H;  2LFS A;  5FNV A;  4JI1 B;  4QE7 A;  2WA4 A;  3W7X A;  4FVM A;  2UXB B;  5H6R A;  1YCI A;  3F7Y C;  4FZ1 A;  4O4H B;  1BQ0 A;  5E1A C;  3OMN B;  1VP7 A;  2DJV A;  2DMX A;  3N2K B;  1YJ9 V;  2QA4 V;  2QWO B;  4YHH O;  2PYJ A;  1QR9 A;  4IIJ B;  5B1A C;  1SF9 A;  4DV2 O;  3DC6 A;  4FM0 A;  1OCZ B;  3JSL A;  4DR1 O;  2GTS A;  4YIP A;  4L87 A;  2HEP A;  3P32 A;  4K3A A;  4YJ3 B;  4TWK A;  1H8H G;  1Q6U A;  1Q5O A;  4OPA A;  3DC5 A;  4P30 A;  1TA8 A;  1SQP H;  1O9H A;  5LOV B;  1I7F A;  2QWQ B;  3UKM A;  5L3G A;  5EZY A;  1B04 A;  3ZRS A;  1YTF D;  2XUM A;  1VQN V;  1Y67 A;  3CC2 V;  3Q4H A;  3X2Q C;  1HNZ O;  2UXC O;  4WBN A;  1P4R A;  1JMK C;  1GM8 A;  4F6E A;  4BR6 A;  4Z1M G;  1SA0 A;  3U11 A;  4J10 A;  4MVQ A;  1AI5 A;  1WP7 A;  2RCV A;  5DEC A;  1HR0 O;  4LF5 B;  4XDK A;  4CH4 A;  3JSN A;  3T4Z A; 
#chains in the Genus database with same CATH homology
 3E2E A;  1M57 B;  2IJJ A;  4BIZ A;  5BZB A;  3AEI A;  1NVP B;  1FXH A;  3H01 A;  3ETE A;  1V54 C;  3D3I A;  1QCE A;  4PA6 A;  3OFN G;  1YJN V;  4F4L A;  3SYP A;  1MG1 A;  2FTK A;  4LBE C;  5H6Q A;  2F43 G;  2WPD G;  3K06 A;  1AJP A;  1EFR G;  1R3K C;  2WLN A;  5B1O A;  1JOY A;  3JD4 A;  4P2Z A;  1W0K G;  1H8E G;  4DXW A;  1THZ A;  4GX0 A;  1F4M A;  3T2M A;  2H8P C;  5KUK A;  5L3B A;  1Q7Y W;  4MVR A;  1OCC B;  3JD0 A;  1KP3 A;  4MW3 A;  4UVB A;  3UM7 A;  1WLE A;  2UXX A;  4JTD B;  1QLE B;  4U7O A;  2IJI A;  1FXK B;  3ASN C;  5HFL A;  1GK9 A;  3JCZ A;  1GO3 F;  1FS0 G;  4JPR A;  5GW7 A;  4I9W A;  3B8N A;  1S0V A;  2DYS C;  3ZRW A;  2IH3 C;  4MTO A;  3E8F A;  4G28 B;  1R6N A;  4HZ3 A;  2XAS A;  1VQM V;  1P7B A;  4UXN A;  3ZRV A;  2B1I A;  3SPI A;  3GB7 C;  4JAU A;  2BOB C;  1AI7 A;  3K9A A;  4JYC A;  4BW5 A;  1MSW D;  2OTL V;  3AG1 C;  4GCZ A;  5EC1 C;  4RAI A;  3G4S V;  1K92 A;  3ABK C;  3ZIA G;  3OUF A;  3QO7 A;  2ZQM A;  1JVM A;  3VOU A;  1YJW V;  3AG2 C;  1FXV A;  2HG5 C;  1OCR C;  5EBW C;  1YTF B;  2ITD C;  4EKW A;  2QM8 A;  3T1C A;  5CBG A;  3K03 A;  3ABL B;  3LDC A;  3P30 A;  4P9P A;  5EK0 A;  5IY5 B;  1I5X A;  4XBF A;  3AG4 B;  4WCE V;  2EIL C;  3W7T A;  5B3S C;  3ASO B;  3QNE A;  2DQ3 A;  3LDE A;  2ZXW B;  3AG3 C;  4LC1 A;  2XAJ A;  4QJF B;  2QKS A;  4QPJ A;  4I5S A;  2QE7 G;  1NH2 D;  3R65 A;  1SET A;  2YEV A;  1AJN A;  1JQ0 A;  2DYR B;  2IW5 A;  3SPG A;  1BMF G;  3T4D A;  2WLI A;  2IJH A;  3GWO A;  2QTO A;  2GHY A;  3JD2 A;  4JTA B;  4N23 A;  4MT8 A;  1R3I C;  3D36 A;  4JYB A;  1XL6 A;  4UVA A;  3SPC A;  1KP2 A;  1N8R W;  2OCC C;  5DM6 V;  1M9N A;  3EHB B;  1AR1 B;  2EIN B;  3STZ C;  3FB8 C;  4FJC C;  1YIT V;  2H94 A;  2QEX V;  3E8H A;  1L1F A;  3CC7 V;  4G2K A;  3SJQ C;  3ZN0 A;  5IDJ A;  2JJ2 G;  3CME V;  1K3E A;  1JJ2 U;  2NLJ C;  1JCH A;  2LFR A;  3WG7 C;  2EIK C;  1QR8 A;  3FKS G;  4MS2 A;  3ETG A;  1M56 C;  2X6B A;  1EZJ A;  4WFG A;  4WFH A;  5H9C A;  5KA6 A;  2WSS G;  3DTU B;  1E1R G;  1K9M W;  2R9R B;  3OAA G;  2V1D A;  4PA4 A;  3ZMZ A;  3G71 V;  1K8A W;  2EIJ C;  4G27 B;  4PDL A;  5EC2 C;  5FL7 G;  3ZMV A;  3OR6 C;  3ABK B;  1HWY A;  1H38 A;  1R6K A;  2P67 A;  3ZMT A;  4ZBM A;  1OCO B;  1PL0 A;  3A0R A;  2WLH A;  3ZCC A;  4ASU G;  1VQK V;  1RPO A;  1J95 A;  3K0G A;  4KUM A;  5B1B C;  4KP4 A;  1VQ4 V;  1QVF U;  1OCZ C;  2UXN A;  3TK1 A;  1F51 A;  1YI2 V;  4H33 A;  2LP7 A;  2QM7 A;  4FK5 C;  2HJF C;  1QBZ A;  3IGA C;  1LNQ A;  1MAB G;  4QIW F;  2PI4 A;  5B1A B;  5B3S B;  1VQ7 V;  1DF5 A;  2ZDI A;  1E79 G;  4MVS A;  3AG3 B;  1BHA A;  4CZZ A;  3FB7 C;  1NH2 B;  4QPK A;  1RM1 C;  1R3L C;  3LDD A;  3QO8 A;  3ABU A;  3SPH A;  1OHH G;  4XDJ A;  4R7C A;  2Y69 C;  2A9H A;  1KKD A;  2V7Q G;  2EZP A;  1M90 W;  5LBQ A;  1NBM G;  1Y4M A;  3OEE G;  1K7D A;  2ITC C;  1AI6 A;  4GX5 A;  4PA3 A;  3K04 A;  3E86 A;  2AHZ A;  2ZDI C;  4LCU C;  4PDM A;  4DO2 A;  2IJK A;  1CEZ A;  3F5W C;  3X2Q B;  1PNL A;  1ARO P;  3I56 V;  1K4D C;  3NXS A;  4WFE A;  5CN0 A;  2YEV B;  2ZD9 A;  2Y48 A;  1NJI W;  1E1Q G;  1PD3 A;  1M57 C;  2PI5 A;  3E89 A;  5L3C A;  4WFB V;  3W7W A;  2A79 B;  4HAM A;  2AHY A;  4GT1 A;  3ZMS A;  1B6Q A;  1F23 A;  2JEX A;  4J9Z B;  1FXK A;  1G4Y B;  1K73 W;  3JD3 A;  3VBB A;  3OR7 C;  3CXC U;  2JK5 C;  3SPJ A;  3CCV V;  4RQF A;  3OMI B;  3DGE A;  1NKD A;  3K3W A;  1S76 D;  3CCU V;  3CCM V;  1SER A;  3JYC A;  1VQL V;  2DW4 A;  2EIM C;  3FYI B;  3STL C;  1V54 B;  1JX9 A;  1S5H C;  2WLL A;  4PDV A;  4FMT A;  4JGS A;  2C2A A;  2X6A A;  1R3J C;  2JEU A;  3ZN1 A;  1Q86 W;  2X6C A;  1RPR A;  3LUT B;  4RO2 A;  4OXS A;  1OCC C;  3BEH A;  4UV9 A;  1AJQ A;  2ZR2 A;  5KA5 A;  2XAG A;  1VQ5 V;  4PDR A;  1UJW B;  1V55 C;  1KQS U;  1K5Q A;  1VQ8 V;  1QLE C;  1WPX A;  4JTC B;  3W7S A;  2WLM A;  1FXK C;  3CC4 V;  2Q6A A;  4GX2 A;  3OE7 G;  3OM3 B;  4MVU A;  2DWE C;  2EBO A;  3CD6 V;  2W0F C;  3QO5 A;  5C93 A;  1DTO A;  2NNU A;  2OT5 A;  1QVG U;  3ABM C;  1Q81 W;  1W0J G;  2HKO A;  3ASN B;  1VQO V;  3BY6 A;  4FIP C;  1PNK A;  4FPP A;  2OTJ V;  1XL4 A;  5J9P C;  1YIJ V;  2DYS B;  2XAH A;  1K4C C;  3B77 A;  3ZMU A;  1Y66 A;  3RW0 A;  5KUM A;  2M7W A;  1JPX A;  3E35 A;  3OGC C;  5L3E A;  1IXM A;  3CCE V;  4KFM A;  4CBC A;  5EBL C;  5IYD O;  4PA7 A;  3CYO A;  5DN6 G;  4RQE A;  2ATK C;  2P7T C;  4GX1 A;  1GM7 A;  3E8G A;  3OW2 U;  4BIU A;  3W7U A;  4WFA V;  3E8B A;  3PJS K;  3AG1 B;  3ZRX A;  5B1N A;  2WWW A;  3ABT A;  3CCJ V;  1KD1 W;  2YSU B;  3ABL C;  3AG2 B;  4LP8 A;  2P90 A;  2XOK G;  1BHB A;  1OCR B;  3IFX A;  5IY5 C;  1NR1 A;  1H2G A;  2XAQ A;  1KEC A;  3AG4 C;  2XND G;  3ZRW B;  4U7N A;  1GMG A;  4HYO A;  1NQT A;  3ASO C;  2WLK A;  2Q68 A;  2ZXW C;  3K0D A;  5CBH A;  4MTG A;  2WAM A;  2HFE C;  3RBZ A;  5LGT A;  5IYC O;  1DF4 A;  3KG2 A;  3G6E V;  1S77 D;  2DQ0 A;  4R8C A;  1F4N A;  2DYR C;  4X8A A;  2EIL B;  4MVO A;  1GTO A;  3IC7 A;  3LNM B;  2HR3 A;  4PA9 A;  1ROP A;  1PNM A;  2B5U A;  3MD0 A;  4MVM A;  1FFT B;  3WFV A;  3OUS A;  4H37 A;  2KB1 A;  2EIM B;  1NR7 A;  2W6J G;  4QE9 A;  3CP1 A;  1ORQ C;  4Q20 A;  2XAF A;  3M99 B;  4PEL A;  2GSM B;  3JD1 A;  4UVC A;  1ZWI C;  1CP9 A;  3ML0 A;  5HFM A;  2Q67 A;  4MTX A;  1DLB A;  1K5S A;  1G8M A;  1PKX A;  2JIZ G;  4QNH B;  1K97 A;  1M1K W;  1EBO A;  1V55 B;  4RUF A;  4J9Y B;  2EIN C;  3SYA A;  2WLJ A;  2K1E A;  4TT3 G;  4R50 A;  2Q69 A;  4MW8 A;  2W6I G;  2OCC B;  2BOC C;  2A0L A;  3RVZ A;  3TET A;  3FYE B;  5CMU A;  2HLD G;  3HPL C;  3ABM B;  1VQP V;  4X88 A;  4TSF G;  1AI4 A;  5L3D A;  2IU3 A;  3OEH G;  2WLL B;  1GM9 A;  1TUE B;  2P6J A;  3MHH C;  2JDI G;  4MSW C;  1Q82 W;  2Z3Y A;  1NVP D;  3SYC A;  3ZJZ A;  2WLI B;  3WG7 B;  2EIK B;  4BAY A;  3RVY A;  3CMA V;  5IYB O;  1M56 B;  4MVZ A;  2EZO A;  1YSC A;  4WF9 V;  2EJR A;  1COW G;  2LFS A;  3CPW U;  4N21 A;  4X89 A;  5LGU A;  3FB6 C;  4QE7 A;  3W7X A;  3CCQ V;  1QLN A;  2EIJ B;  5H6R A;  3K08 A;  3F7Y C;  5CBF A;  1S72 V;  1OCO C;  3K79 A;  2X0L A;  1ENV A;  1KC8 W;  2HVK C;  4E2L A;  3LSQ A;  3LSS A;  2X7R B;  3OMN B;  5E1A C;  2IH1 C;  1OZ0 A;  4UUJ C;  1YJ9 V;  4JF3 A;  1CPY A;  2QA4 V;  1YHQ V;  4XDL A;  5EBM C;  4ZKI A;  3B8M A;  2HVJ C;  2CK3 G;  1QR9 A;  1R73 A;  1VQ9 V;  1BL8 A;  1I5Y A;  5B1A C;  5B1B B;  2IU0 A;  3ETD A;  4RUE A;  1OCZ B;  3FB5 C;  3CCS V;  2D3O W;  1S3J A;  1SES A;  1VQ6 V;  5CA3 A;  3F7V C;  1K33 A;  3I55 V;  1SZT A;  2B1G A;  5LHI A;  4UV8 A;  4R6Z A;  4L87 A;  3HB3 B;  4MTF A;  1MOF A;  3P32 A;  3OMA B;  4TWK A;  1H8H G;  3SYO A;  1K34 A;  5LHH A;  4P30 A;  2DWD C;  2ZR3 A;  3EFF K;  4JAS A;  1RM1 B;  3UKM A;  2MK3 A;  2Y69 B;  5L3G A;  3ZRS A;  1YTF D;  1VQN V;  2Z5U A;  4WFF A;  3CCR V;  3TCU A;  3CCL V;  3CC2 V;  3X2Q C;  5L3F A;  5LGN A;  1SRY A;  5LHG A;  1P4R A;  1GM8 A;  4JAV A;  4YXW G;  1GKF A;  3MHS C;  4Z1M G;  2R9I A;  2JJ1 G;  4MVQ A;  1AI5 A;  3E83 A;  4P9O A;  4XDK A;  3SYQ A;  3T4Z A;  1W2B U; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...