5CMUA

Artificial hiv fusion inhibitor ap1 fused to the c-terminus of gp41 nhr
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
73
structure length
73
Chain Sequence
SSGIVQQQNNLLRAIEAQQHLLQLTVWGIKQLQARILSGGRGGWMEWDREIEELIKKSEELIKKIEEQIKKQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Improved Pharmacological and Structural Properties of HIV Fusion Inhibitor AP3 over Enfuvirtide: Highlighting Advantages of Artificial Peptide Strategy.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Viral protein
molecule keywords Envelope glycoprotein,AP1
total genus 30
structure length 73
sequence length 73
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-07-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.210 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 5cmuA00
1F23A 1DLBA 1I5YA 2EZPA 3M99B 4JGSA 1K34A 1ENVA 4E2LA 3CYOA 1Y66A 4G2KA 5KA5A 3P30A 1QR8A 1Y4MA 1I5XA 1MG1A 3MHSC 2LP7A 1MOFA 2X7RB 4FK5C 1QCEA 3CP1A 4N23A 5KA6A 2P6JA 2M7WA 3MHHC 4N21A 3B8MA 1DF5A 5HFLA 5CN0A 3K9AA 3H01A 4FIPC 5CMUA 1SZTA 4FJCC 5H9CA 4JPRA 1JQ0A 2EZOA 4JF3A 3WFVA 1EBOA 2EBOA 5HFMA 3B8NA 1QBZA 1QR9A 2MK3A 2OT5A 1K33A 3GWOA 1JPXA 1DF4A 3B77A
chains in the Genus database with same CATH superfamily
3APQA 4R50A 3LSQA 3K57A 4DUYB 1YSCA 1GAXA 2CUGA 1CPYA 2GTSA 4JI1B 2FYUH 3CP1A 5KUMA 2HHHO 1B6QA 3OFNG 5CN0A 2DYRB 3CC7V 5H9CA 4JI4B 4DUZB 5LA6B 3JD4A 4X1KA 1I0HA 4J9ZB 5ITZB 2VQEB 4X20A 1K5SA 2P22C 1OCCC 4GCZA 4O4JA 5JVDB 1I7FA 1VQ6V 4LF7B 3QVNA 1OCOB 3SYPA 3RYHB 2VQFO 3FAVB 2X7RB 4CH6A 5DM6V 3ICXA 2P7TC 3MHHC 3CPWU 5KX5B 1GN6A 3ZRXA 3ZHUA 4MVMA 3PJSK 3L75H 2EJ7A 5BR8O 1FFTB 5JJEB 3UQ8A 4YIPA 3JD3A 5LYJB 2EIMC 4P2ZA 3ABTA 4HYOA 1U97A 1Z2GA 1R3IC 4B3RO 1URFA 2DOSA 4BIUA 1WPXA 1AI7A 1SA0A 4JI4O 5IE9A 3LDDA 4NXNO 1SQVH 1QLEB 4JI5B 2A06H 1I94O 3AG2B 4NXMO 4G27B 3JALA 2N05A 1YDXA 3FB6C 1FJGB 3E22B 3SJBC 1K33A 4GKJB 4RQEA 1QHTA 1P7BA 2ODMA 4JI3O 2Q0OC 3BABA 3HKEB 1GO3F 2FB5A 5KHGA 5LGTA 3QO7A 2QWQB 5B1AB 1H2GA 4JTAB 2QEXV 2XT9A 1E79G 3OT7A 4ZHQB 1XMQO 2Q6AA 1ROPA 3OW2U 1K34A 1XILA 3CJHB 5EIBC 4CH4A 4IYIA 5JCOC 3ABKC 1MA1A 2QKSA 3H01A 3J80N 1M56C 1IDSA 4LH6A 4JAAA 3SPCA 2VWJA 4X62B 2OT5A 3CSXA 2IH3C 1YI2V 2Z3YA 1FPOA 4DR4O 1VQ9V 3ZMVA 3SPIA 2RDCA 2H3OA 2P06A 2OIGA 3K9AA 3SPGA 3ZHVA 2DYSB 3QNEA 1FYJA 3STLC 5L3GA 4DV3B 3OMNB 4CC6A 2EULA 2F66C 4LWSB 3F5WC 3RFRA 5E1AC 3P30A 2HHHB 1H2SB 2RJZA 3BAAA 2FTKA 1XBLA 2W0FC 2L35A 1EM1A 4PDRA 4KHPB 3B4SA 3K79A 5B1BC 3CCJV 3WU2Z 3OUSA 4B7EA 1IX9A 2H94A 2GSMB 3WB1A 1F23A 2JS3A 2X6AA 3K59A 2Y0IA 2ILMA 1AVMA 4EEQA 1Q86W 5IYCO 5J2UB 1JX9A 2UXNA 1XNRO 3CRCA 1FFXA 5EZYB 4H33A 2KG7B 1M90W 4B3MO 4UVBA 5B1AC 3K5LA 4MVZA 2DN9A 2NR5A 2UU9B 2P4KA 5D5PA 4X65B 4YJ2A 4DV7O 2YI9A 4X66B 4J10A 4K3AA 4UXNA 4PA6A 2PY5A 1UFIA 3CCMV 2PI5A 2Q68A 3L74H 4MVOA 1JMKC 1BZKA 2IJKA 2W6IG 3WG7C 3AK1A 3L73H 4PDLA 2DJVA 3RVZA 2RCVA 2Z0AA 5J2TB 1AP5A 4DV1B 1XMQB 4LF6O 4DV5O 3DTUB 4JI2B 4UCOA 1YVWA 3W7TA 4IIJA 3JASA 4HAMA 1YTFD 4DV4O 3ASNC 3CRQA 2HFEC 4WCEV 3L71H 4PD4F 3QF7A 3QG5A 4XDJA 1SQXH 4OX9O 4B08A 1XQ8A 1B3QA 2CK3G 2PF4E 4C7UA 3ML0A 4JI2O 5IYDO 1RFYA 5JCOA 1YCIA 2LGWA 1J5EO 1IURA 3K08A 1ZX3A 2ZE7A 2W6JG 2IH1C 2ZM6O 4GZRB 4ZOLA 1XL4A 5IT9N 1I5XA 2JK5C 5BXZA 4YJ3B 1HNWO 3CCSV 3P3PA 1SC5B 4DK1A 4LBEC 4O4IA 4JI8O 1JA8A 1WJZA 3RYCA 3B8NA 1IXMA 3BRCA 2YUAA 1BQZA 5CBHA 4DRXA 3N2GB 3E8HA 2R72A 1AJQA 1BL8A 2JRIA 5CBFA 1FXHA 1PD3A 3L70H 1Q6UA 2XUMA 3CC2V 3OGCC 3AG7A 5BMVA 1OCRB 3N2GA 1YF2A 4O2AA 1S76D 2EX3A 4LNUA 3BFRA 1H2KA 2F23A 1JVMA 4O4IB 5FL7G 4DR2B 4WBNB 1VP7A 4B3TO 5DEDA 2ZDIC 4QE9A 2B5UA 4I5SA 3VQVA 1KYOF 5LMNO 4UCVA 1N32B 4FM2A 4TOIA 1N0NA 1WN7A 4RAIA 1QR9A 2QGNA 1VQ7V 4O4LA 1RM1C 1M1KW 5LGUA 4MSWC 1VQ4V 2FL4A 5L3DA 1Y74B 4DR6B 4DO2A 2WLLB 1XNQB 2ZE5A 4F6RB 1NVPB 2ARHA 1HNXO 5EC2C 1BHAA 2VQEO 3W7SA 5LP6A 2IW5A 3A0BZ 4F6EA 2PYJA 1PL4A 4HNAA 1HNWB 3MDSA 1XMOB 2CTQA 2KKWA 4YIOA 4WF9V 2UUBB 2WLMA 4X1IB 1HNXB 2X6BA 4WFAV 1XI1A 4KL1A 2OTJV 3U0ZA 4EFBA 1HR0B 2KG7A 3JAKB 1Y67A 4E2LA 3RW0A 1RP3B 3D3IA 3CXCU 1SQBH 4I9WA 2BOBC 1ZL8A 3T1HB 4LFBB 4DR5B 1KKCA 1JCHA 2PUSA 1NBMG 2B1IA 3RYIA 3IC9A 2QJ1A 1KC8W 4Q6GA 2BOCC 4PA9A 2Z5UA 3JYCA 4NXMB 4JYYA 2HLDG 4D7TA 3AG4B 2OCHA 2ZDIA 1PL0A 4N21A 1XUQA 3CEIA 4J41A 3JD2A 3CCEV 3WB2A 4LF4B 3D3QA 1GK9A 1YJWV 5B1BB 4MTGA 4CH3A 2YI8A 2WA3A 5B66Z 4GX0A 4QNHB 2RN9A 1R3KC 2JS5A 2EIJB 1PNKA 4LF9O 4JZ2A 4X62O 2UUCO 2BTQA 3KZIZ 1TGOA 2V1DA 4TUYA 4DV4B 4JYAB 1NQTA 4UB6Z 2MK3A 5C8YA 2UXBB 5HFLA 3CRRA 2JGDB 1DGSA 1OHHG 1G6UA 1VQLV 2ADPA 2IJIA 2IJHA 3SR2C 2WSSG 4DUYO 3SGIA 3C3SA 1J5EB 2YIAA 3M8AA 4PA3A 3WG7B 1XREA 2CE4A 4ZHQA 4NR1A 4R6ZA 4LH7A 1ZAUA 3CWBH 4KFMA 4PJ0Z 4DR7B 3B40A 4NYKA 4JI0B 4BWAA 3E8GA 4MW3A 2B9ZA 3MAQA 2WLNA 5KAFZ 4PDMA 3STZC 2F93B 1NT2B 2G38A 2EJRA 3JATA 1K8AW 4AI8A 1MSDA 5IJ9B 3E22A 4X9QA 2CGNA 3SYCA 1M9NA 4JI5O 3M99B 1XMOO 2CGOA 2K9PA 1OCZB 2BTOA 2N74A 4JTCB 3ZRWB 2RQ6A 1OZ0A 1S5LZ 2NNUA 4UCRA 1GM9A 4H44B 1VQ5V 3EVKA 1H8HG 1LR1A 1KUQA 2JGDA 2QE7G 1H8EG 1K92A 4PI2A 4DK0A 5KHJA 4CBCA 3BY6A 2Q9LA 4A5UB 3EXAA 1K4CC 4X89A 2HEPA 3CB2A 2PI4A 3F7YC 2QWPB 5LYJA 1XNRB 2QM4A 5JQGB 1Q7YW 3DC5A 3W7XA 1AB3A 4KUMA 4Z1MG 4PA7A 1NI8A 4IGGA 1WAZA 3ABMB 1AJNA 1VMGA 4X64B 2Y48A 5JVDA 4X20B 3HKCA 4X1KB 3JSLA 5EK0A 2XAQA 3H1HH 1GH6A 1Y66A 1NKDA 2JJ2G 3ASOB 5L3EA 2XTAA 2WA4A 3E83A 2XAFA 4B7KA 3M7MX 1NVPD 2YIBA 1OCOC 5LHIA 2QWRB 3FB5C 4NB5A 2VRZA 4JF3A 3BPZA 1OCZC 3DSQA 3ABKB 4K35A 3N2KA 1MZEA 2N04A 1GN4A 4ASUG 3D8CA 4W4LA 3OEEG 1FXKA 1VF5B 1P84F 1B04A 3BCCH 3BHPA 1WA8A 4LFCO 1B06A 2O57A 4DR3B 1K4DC 3E35A 2H8PC 1BQ0A 1L1FA 3K06A 4PV1B 1M93A 5JWPA 5EBLC 2LGQA 3EFFK 4MT8A 2YSUB 3H1IH 4MVRA 3CMAV 2VS0A 1RPOA 4HNAB 3ZMUA 1VIBA 2M6YA 5IWAB 5KHHA 1Q6IA 1EZVH 4PDVA 4F6RA 1YITV 1E1QG 2WLLA 1HDJA 2LJ2A 2ZKOA 1UPGA 4HBNA 3QTCA 2HJFC 1I08A 1KQSU 4GYCB 4JI7B 4FIPC 3B09A 5JQGA 3VQXA 2DWDC 4JTDB 2P4VA 3UT5A 2AW9A 5CBGA 5LHHA 2YXHA 4FLWA 5IWAO 3U10A 4AQYO 2Q7GA 1TUEB 4X66O 2GUZA 1V55C 3W7UA 1QU7A 2YEVA 3ZRWA 1FD9A 4JAVA 1OV9A 4MS2A 1VQPV 1NJIW 4LNUB 1AR1B 3E8BA 4I7ZB 2EIKB 2BSKB 4D7SA 1SKVA 4DW1A 2IM9A 5JJJB 3AG3C 4LF7O 1US6A 2Q67A 1ZTEA 1K97A 1D5AA 1R3LC 3R66A 3OUFA 4WFFA 1N36O 1Z5WA 4DRXB 2HKOA 1FJGO 1TA8A 2X0LA 4DV5B 1KD1W 4NTXA 3RYCB 3K5OA 4TV8B 5B5EZ 1GM7A 4J7JA 3ZHRA 2YS8A 5BY1A 4H0LB 4JI8B 4AHCA 1R6NA 2HP8A 3A8TA 5CA0A 3KCXA 2EBOA 1IBKB 4B3SB 1F4NA 5EBWC 2JIZG 1ZSPA 1R6TA 4QIWF 2BTQB 3T1YB 5JH7B 1GKFA 2ATKC 3ZBHA 3TETA 1AR4A 2GBOA 2Y4UA 2K1EA 4IYHA 4CH5A 4J7KA 2Q7HA 2F43G 4G28B 4FM1A 3DC6A 4P9PA 5FLXN 4KHPO 2E74B 3JCUZ 2F4VO 1NTKH 4EB6A 1SF9A 2CTRA 4I4TA 5KLVH 1BGYH 1NR7A 2P67A 1MMMA 1MNGA 1IZ3A 4ZI7B 1FS0G 4DXWA 3H9VA 2P90A 4YXWG 2ZE6A 4JYBA 3I56V 1VQKV 3VQYA 1XHZA 5EYPB 3WB0A 4K0KB 2WLJA 5B3SB 2UU9O 5FPRA 1QQCA 2V7QG 1FFXB 4NVPA 1M56B 3ZHQA 3RBZA 3ZS8C 4FLYA 5EC1C 4BAYA 3T1YO 2OCCB 5CA3A 4IT5A 4JASA 4PELA 5EYPA 2E5LB 1SZXA 3ZMZA 3SYQA 3D36A 1DTOA 3UKMA 4TWKA 3BA9A 4F4LA 2UXDB 5IYZB 4BW5A 4GKKB 5EIBD 4LF5B 4DW0A 5L3CA 2YXLA 2GHYA 3J7AU 2UXCB 3ASOC 3K03A 1QLNA 3CRAA 3VOUA 1N32O 4B3RB 4NTYA 3TGUH 1R1BA 4I4TB 4R8CA 1SZTA 4LWSA 1LUWA 1Q43A 4NKGB 3VBBA 1S72V 3S3XA 1DLBA 2GDSA 1H2MA 1ENVA 2Y0PA 1KU9A 3EHBB 2ZNJA 1XL6A 1Y74A 1N36B 2DYRC 2QDOA 4K8XA 4FLTA 5B1NA 5JH7A 1W0JG 3LNMB 2JEXA 3TXSA 3H1JH 5A9GA 5EBMC 3SJAC 1L8DA 4DR4B 5B1OA 3OR6C 3B77A 4U3JB 3TK1A 1DK1A 4BIZA 2Y69B 1CEZA 3ZHSA 1QVFU 1IBLB 3CE2A 1Z5VA 4O4HB 2V4DA 4TT3G 4DR2O 4X1YB 2ZR3A 4TV8A 1H38A 3CJHA 4WBNA 1G4YB 1GMGA 4YHHO 2XOKG 1K7DA 4UV8A 3FYEB 4WFHA 4O2AB 2Q69A 5BR8B 2KQXA 4LFAB 3THOA 4FFKA 2Q0AA 1MG1A 4X88A 3HKEA 4DR1B 2WLIA 2XAHA 3K04A 2BSKA 2R9IA 1N0JA 1SQFA 3A0RA 4JI6O 2BE3A 3CX5F 3H1LH 3O65A 1AROP 2ZD9A 3OTOB 4O2BB 2YEVB 3JALB 2F95B 4WFEA 3E89A 4YJ3A 2IU3A 4JYCA 4N23A 2P6JA 4LC1A 2FKXA 1DF5A 1SA0B 1L0NH 4ZOLB 3AG1B 1BE3H 3HR0A 3TJTA 5H2FZ 1PNMA 5CB4A 1IBMO 3ZRSA 2Y69C 3UT5B 4I55A 1GN2A 5LXTA 2QKAA 1HNZO 1YXBA 3GWKC 4ZIBA 3LDEA 4UUJC 3G6EV 1PNLA 4B3MB 1A32A 1R73A 1VF6C 2XASA 1H2NA 1YHQV 1QCEA 1PP9H 4GKJO 3NR7A 4DV6B 5LOVB 3ETGA 4H13B 3IGAC 1MZFA 4JI0O 4O4JB 5ITZA 1XOUA 3RGBA 3T1CA 1YJ9V 3ETEA 2YC0A 3K9SA 3OMAB 5D5QA 4NXNB 1T5EA 2YIBD 2YXYA 3SJCC 4DV7B 1COWG 3N27A 4X65O 5LMNB 2ITCC 1P7GA 2EIJC 4YJ2B 1H2LA 1AI5A 5LGNA 4MTFA 2CDYA 1KB9F 2W0XA 3JAWB 2EINC 2HVJC 4XDKA 1R6KA 2NN4A 4J11A 5EZYA 2MW2B 3UO2A 2C2AA 1W2BU 3JD1A 2OTLV 1PPJH 1FAFA 3OR7C 5J2UA 1NH2D 3JSNA 1QLEC 3N2KB 2OYQA 2DYSC 2JEUA 3ZMSA 5H5NA 3GWOA 3S3WA 3TCUA 3BA8A 1SETA 1Q82W 1S0VA 1RSOB 3ABMC 4PHZA 3FB7C 4ABMA 1KBHA 1Q6HA 1JJOA 4LF8B 4GX5A 1PKXA 3AK3A 4FLUA 1TUBB 2IU0A 1ZLZA 3UCSC 1RPRA 3HKCB 1QBZA 1E1RG 1HWYA 1V54B 1VQMV 4DR1O 1S5JA 2AXTZ 4DV6O 4FFBB 1KP2A 1Q5OA 4OGQB 1S3JA 3ZX6A 2R9AA 3ZHTA 4WFBV 2EZPA 4IHJB 5IY5B 2WLHA 2ZIOA 2ITDC 1N4CA 4CC5A 4MTOA 3IJ4A 3SYAA 1XEQA 5C93A 1AI4A 1YIJV 2AZ0A 2LFRA 1F4MA 1IVSA 4W4KA 1BHBA 5CMUA 4D6TH 3AEIA 2UXCO 4B3TB 2A3QA 1OJHA 1TAEA 4I50A 2RNBA 3G71V 1DF4A 3CXHF 4JI6B 2QM7A 5IDJA 5IJ9A 3JATB 1VARA 2QWOB 3ZN0A 3ASNB 2XAGA 1PV0A 4CS3A 4LFCB 1JJ2U 3OAAG 2JJ1G 5KMGA 1XHXA 2BCCH 1MABG 5AG2A 3ETQA 1VF7A 1D2DA 4RQFA 1K3EA 2ZE8A 4B3SO 3HKDA 1TVKB 3OMIB 5KHIA 4QGPA 2A0LA 3G67A 1ORQC 2Q5ZA 1IBLO 3A0HZ 3SDLA 5A2QN 3RN4A 1EN5A 4R7CA 1EZJA 3QO5A 3ZJZA 5IY5C 5C8YB 1X59A 2E5LO 3OTOO 1N34O 3K5MA 2E76B 4OXSA 4TUYB 1JPXA 5KA5A 4DV0O 4JAUA 4UVAA 3LUTB 2WWWA 5TISZ 4J42A 2OWOA 1ZUQA 3DGEA 2ZXWC 2CAZC 5KX5A 2A7WA 4FFBA 1THZA 2PZSA 3UM7A 3RYHA 4OPAA 4YY3B 3BVOA 5LBQA 3SJQC 2HG5C 1PM9A 5LA6A 5FNVB 1TUBA 1I5YA 2EILB 4DV1O 1F51A 4G2KA 1QR8A 2XAJA 2IJJA 3CCRV 3CD6V 4LCUC 1EN6A 2RMKB 1NU1H 2ETNA 2UXBO 4MW8A 3B2EE 1G8MA 4Q20A 2CH7B 4LR3A 3RT3C 4J80A 3SPHA 4UCUA 3RYIB 2DWEC 2IBZH 1BMFG 1ZL8B 1BCCH 1Q8IA 1BS3A 4KXRA 3JAKA 1MSWD 4XDLA 1HNZB 1NR1A 3JAWA 3E2EA 3WFVA 2XNDG 2HJDA 4FLVA 1KMIZ 5H6QA 2YIDA 2E3CA 1KP3A 2VWKA 4L8JA 1BSMA 3APOA 4AQYB 3F5TA 4X1IA 4XBFA 1YJNV 3Q4HA 4BR6A 1FXVA 4LF5O 2EIKC 1O9GA 3UO3A 2DW4A 1N33B 5KUKA 1MOFA 4U7NA 2KSDA 4JI1O 3AG1C 2AGAA 3B8MA 1KKDA 1V9PA 4QE7A 1JQ0A 3DXRA 5KAIZ 5LP6B 4OPHA 1XDCA 1WNSA 3E8FA 4JI7O 3CCQV 5GONA 4J9YB 4YY3O 1Y6XA 3CYOA 5LHGA 3L9DA 4AILC 5LOVA 3CHXA 1NTMH 4I0XB 1VQOV 1FKAO 1WB7A 3KG2A 4Z2WA 2PYLA 3JCZA 1K5QA 3CCLV 4ZBMA 5LXTB 4O4LB 2B1GA 4I55B 1M4UA 2F1MA 4TV9A 5CB4B 4K0KO 1IXBA 1P49A 2JVDA 5BZBA 3X2QB 2QWNB 1K9MW 4UCSA 4NTWA 2EILC 1WLEA 3SYOA 3RVYA 3CS5A 4FK5C 2R9RB 3RYFA 1X4TA 4GKKO 4O2BA 4QPJA 3FX7A 2LFSA 3K58A 1Q3EA 2P5OA 3CC4V 3FYIB 1L0LH 4LF9B 1XNQO 4FLXA 5BMVB 3JARA 2JGUA 1D5NA 2GV9A 2WLIB 2EINB 5KA6A 3FFQA 2D3OW 3HKBB 1SESA 3JARB 1VQNV 2NLJC 3IC7A 4TQDA 1IBMB 4MVSA 4P30A 5H6RA 3O9OA 5GW7A 4UB8Z 3D36C 2L6LA 3T2MA 1IBKO 5E79Z 2ZNIA 1U96A 4X1YA 1N33O 1Y76A 3RYFB 3I55V 2UUBO 3GVMA 4O4HA 3LNNA 1UJWB 4FZ1A 1QVGU 3FKSG 3JD0A 1WB8A 1YEWA 3OD4A 3OEHG 4U3JA 1HP8A 1SQQH 3E86A 3K0GA 1G1XB 4JYAO 1V54C 4MVUA 2QR4A 1QNMA 3T4DA 3ZEDA 4FVMA 3G6BA 1AJPA 3KCYA 1LUVA 4UCTA 4DR6O 4DR5O 3OM3B 4FM0A 1SERA 3L72H 2AZ2A 4DV2B 4LFAO 2LW1A 1N34B 1M57C 2ZT9B 3VQWA 3JASB 3CMEV 4IIJB 4QPKA 1S77D 2HVKC 5CA1B 4PA4A 1M5IA 2EIMB 2Q8VA 5J2TA 3QO8A 2WPDG 4DUZO 2QTSA 1JFFA 3K0DA 2QM8A 3BEHA 3HB3B 2UUAO 1EN4A 3Q4HB 1AR5A 5IJ0B 5IYZA 2YDEA 4J7ZA 3LSSA 4JPRA 1FXKC 5L3BA 2Q73A 3I5DA 1OCCB 1O9HA 2GTAA 2F4VB 5HFMA 2HR3A 4U7OA 4CS4A 4LP8A 4GX2A 4FJCC 4L87A 2DQ0A 3FD9A 4EKWA 3LSUA 4PI0A 3FB8C 1NH2B 4WFGA 4CS2A 2DMXA 1AP6A 3H1KH 5K1XA 4K8ZA 2KB1A 2CH7A 1Q81W 4DR7O 1ZWIC 2JDIG 3AK2A 5GTHZ 3RWRD 5IJ0A 4YHHB 5IYBO 1I94B 5GTIZ 4FLZA 3AG2C 3TXQA 4ZI7A 1F7YA 1N8RW 3C3TA 3CRMA 1JFFB 2UXXA 4MTXA 2FMLA 1Q90D 4EB6B 4JV5O 5FNVA 1P4RA 2XHBA 5CA1A 3KKYA 4Z1VA 3SPJA 2CTWA 4RUFA 1BT8A 3AG3B 2CTPA 1NTZH 4RUEA 1Y4MA 5L3FA 4U3FH 4UVCA 2VQFB 2OIEA 3OTFA 2ZXWB 5LP6C 2UUCB 2M7WA 5J9PC 4OX9B 3P32A 4LF4O 3ABLB 4TQFA 2E75B 1W0KG 1EFRG 2YICA 5JJNB 3CCVV 2QKCA 3P3NA 4DV0B 1VEWA 2AHYA 5CA0B 1AILA 1SS3A 1NS1A 1CP9A 3ZN1A 1SQGA 4UFZA 2UUAB 1AI6A 4FPPA 3A2FA 1RM1B 1Y76B 4H37A 3ZCCA 2LO1A 4ZKIA 4GLXA 3K3WA 3ZIAG 1TVKA 1W59A 3HKDB 4DV3O 5K1PA 5KHKA 4EFEA 4GX1A 1WPBA 5KMGB 4DYLA 3HKBA 3OGIB 4DV2O 5LL6Y 4X64O 4I9QA 5LMUB 1M57B 5LMUO 3MD0A 4LFBO 2LQTA 1J95A 1JOYA 2Q4PA 2PGGA 3HPLC 1K73W 1JR9A 1GN3A 4I50B 3F7VC 5F2VO 4HZ3A 4JGSA 1HR0O 1YTFB 3IFXA 4P9OA 1WP8A 3G4SV 2GUZB 2ADQB 4FMTA 1OCRC 2DQ3A 1LNQA 4MVQA 2ZCEA 2AHZA 3IAYA 2QSAA 4ICGA 4IHJA 3K5NA 2EZOA 4KP4A 1GM8A 4TV9B 2WLKA 1CXZB 1YZBA 2ZINA 4E4EA 2Y4TA 4JZGA 1VF6A 4QJFB 2LP7A 3CCUV 3W7WA 4I0XA 4FZ0A 3FAVA 1HW7A 4JI3B 5DECA 3AG4C 2PTMA 3C90A 3NXSA 5GONB 2A79B 1WP7A 4RO2A 1NZ6A 3JAMN 2Q7EA 1GRJA 3DXRB 4JV5B 1S5HC 4GUNA 1R3JC 4UV9A 2WAMA 5DN6G 3OE7G 3MHSC 2ZIMA 3X2QC 4GT1A 1GTOA 4RWUA 1RSOA 1KECA 2UXDO 2X6CA 1SRYA 3ZMTA 4BW9A 3ABUA 2ZQMA 1SQPH 1EBOA 4DR3O 4IL6Z 4X8AA 2ZM6B 2OCCC 3ZRVA 2ZR2A 3J81N 4TSFG 3G80A 4CZZA 3LDCA 2R70A 1WA8B 3T4ZA 3GB7C 3ETDA 2QTOA 3T1HO 2D2CB 1FXKB 3U11A 3ABLC 1VQ8V 2A9HA 3R65A 5FPOA 3PN1A 1V55B 5B3SC 4BIOA 4LF8O 2LW7A 2QA4V 2DE0X 4LF6B
chains in the Genus database with same CATH topology
1KP3A 2Z5UA 4R50A 3LSQA 4F4LA 4XBFA 3JYCA 4BW5A 1YJNV 1YSCA 2HLDG 5L3CA 1FXVA 2GHYA 2EIKC 3AG4B 2DW4A 2ZDIA 1PL0A 1MOFA 1CPYA 3ASOC 3K03A 3CP1A 4U7NA 5KUMA 5KUKA 3AG1C 3VOUA 1QLNA 4N21A 3B8MA 1B6QA 3OFNG 5CN0A 1KKDA 4R8CA 2DYRB 3CC7V 4QE7A 1SZTA 5H9CA 1JQ0A 3JD2A 3CCEV 3JD4A 3VBBA 3E8FA 4J9ZB 1GK9A 3CCQV 1K5SA 1YJWV 1OCCC 5B1BB 4J9YB 4GCZA 4MTGA 1S72V 1DLBA 1ENVA 3CYOA 5LHGA 1VQ6V 3EHBB 1OCOB 1XL6A 3SYPA 4GX0A 4QNHB 2DYRC 1R3KC 2X7RB 1VQOV 2EIJB 1PNKA 5DM6V 2P7TC 3MHHC 3KG2A 5B1NA 1W0JG 3CPWU 3ZRXA 3JCZA 3PJSK 4MVMA 1FFTB 1K5QA 3LNMB 2JEXA 3CCLV 3JD3A 4ZBMA 5EBMC 2B1GA 2EIMC 2V1DA 4P2ZA 3ABTA 4HYOA 1NQTA 2MK3A 5B1OA 1R3IC 3OR6C 3B77A 5HFLA 5BZBA 4BIUA 1WPXA 1AI7A 3TK1A 3X2QB 4BIZA 2Y69B 1K9MW 1CEZA 3SYOA 3LDDA 1OHHG 1WLEA 2EILC 1QVFU 3RVYA 4FK5C 1QLEB 2R9RB 4TT3G 1VQLV 2IJIA 3AG2B 2IJHA 2ZR3A 2WSSG 4G27B 1H38A 4PA3A 4QPJA 3WG7B 1G4YB 1GMGA 2LFSA 2XOKG 1K7DA 3FB6C 3CC4V 4UV8A 4R6ZA 1K33A 3FYEB 3FYIB 4WFHA 2Q69A 4KFMA 4RQEA 1P7BA 2WLIB 2EINB 1MG1A 3E8GA 4X88A 1GO3F 4MW3A 5KA6A 2WLNA 5LGTA 3QO7A 4PDMA 2D3OW 2WLIA 3STZC 5B1AB 1SESA 2XAHA 2EJRA 1VQNV 1H2GA 1K8AW 3K04A 2NLJC 3IC7A 2R9IA 4JTAB 2QEXV 3A0RA 1E79G 4MVSA 4P30A 2Q6AA 5H6RA 1M9NA 3SYCA 1ROPA 1AROP 3M99B 3OW2U 1K34A 5GW7A 2ZD9A 1OCZB 4JTCB 3T2MA 3ZRWB 2YEVB 1OZ0A 3ABKC 2NNUA 1GM9A 3I55V 4WFEA 3E89A 1VQ5V 2IU3A 4JYCA 1UJWB 4N23A 2P6JA 4LC1A 2QKSA 1H8HG 1QVGU 1DF5A 3FKSG 3JD0A 3H01A 2QE7G 1H8EG 1K92A 3AG1B 3OEHG 3E86A 1M56C 4CBCA 3BY6A 1PNMA 3K0GA 3SPCA 3ZRSA 1V54C 4MVUA 1K4CC 4X89A 2OT5A 2Y69C 2PI4A 3F7YC 3T4DA 2IH3C 1YI2V 2Z3YA 1Q7YW 3W7XA 1VQ9V 1AJPA 3LDEA 4KUMA 4UUJC 1PNLA 4Z1MG 3G6EV 1R73A 2XASA 1YHQV 4PA7A 1QCEA 3OM3B 3ZMVA 1SERA 3SPIA 3ABMB 3ETGA 1AJNA 1M57C 3K9AA 3IGAC 3SPGA 2DYSB 3QNEA 2Y48A 3STLC 5L3GA 3CMEV 4QPKA 1S77D 2HVKC 3OMNB 4PA4A 5EK0A 3T1CA 2EIMB 2XAQA 1YJ9V 3QO8A 2WPDG 1Y66A 3F5WC 3ETEA 3OMAB 1NKDA 2JJ2G 5E1AC 3P30A 3ASOB 5L3EA 2FTKA 3E83A 3K0DA 2XAFA 2QM8A 1NVPD 1COWG 3BEHA 3HB3B 1OCOC 5LHIA 2W0FC 3FB5C 2ITCC 4PDRA 3LSSA 4JPRA 2EIJC 1FXKC 4JF3A 5L3BA 3K79A 1OCCB 1AI5A 5B1BC 5LGNA 3CCJV 1OCZC 3OUSA 4MTFA 5HFMA 2H94A 2HR3A 4U7OA 2GSMB 3ABKB 4LP8A 4GX2A 4FJCC 4L87A 1F23A 2DQ0A 2EINC 2HVJC 2X6AA 4XDKA 1R6KA 4ASUG 4EKWA 2C2AA 1Q86W 3OEEG 5IYCO 1W2BU 3JD1A 1FXKA 2OTLV 1JX9A 2UXNA 3OR7C 1NH2D 3FB8C 1NH2B 4WFGA 4H33A 1K4DC 3E35A 2H8PC 1QLEC 1M90W 4UVBA 5B1AC 2KB1A 2DYSC 2JEUA 4MVZA 3ZMSA 1Q81W 1L1FA 3GWOA 1ZWIC 3K06A 3TCUA 1SETA 2JDIG 5IYBO 4UXNA 5EBLC 4PA6A 3EFFK 1Q82W 1S0VA 4MT8A 3ABMC 2YSUB 4MVRA 3AG2C 3CCMV 2PI5A 3CMAV 3FB7C 2Q68A 4MVOA 1N8RW 2IJKA 2W6IG 3WG7C 1RPOA 2UXXA 4MTXA 4GX5A 1PKXA 4PDLA 3RVZA 3ZMUA 2IU0A 1P4RA 1RPRA 3DTUB 1QBZA 3W7TA 3SPJA 1HWYA 1E1RG 4PDVA 4HAMA 4RUFA 1V54B 1VQMV 1YTFD 3AG3B 3ASNC 1YITV 1E1QG 2WLLA 4RUEA 2HFEC 1Y4MA 5L3FA 4WCEV 4UVCA 1KP2A 4XDJA 2ZXWB 2M7WA 5J9PC 2HJFC 1KQSU 3P32A 2CK3G 4FIPC 3ABLB 1S3JA 2DWDC 3ML0A 4JTDB 5IYDO 5CBGA 1W0KG 1EFRG 3K08A 5LHHA 4WFBV 2W6JG 2IH1C 3CCVV 2EZPA 2AHYA 5IY5B 2WLHA 1XL4A 2ITDC 1I5XA 4MTOA 2JK5C 1CP9A 3SYAA 3ZN1A 1AI4A 5C93A 1YIJV 1TUEB 3CCSV 1AI6A 4FPPA 1RM1B 4H37A 2LFRA 3ZCCA 1V55C 3W7UA 1F4MA 2YEVA 3ZRWA 4ZKIA 1BHBA 3K3WA 5CMUA 3ZIAG 4JAVA 3AEIA 4LBEC 4MS2A 1VQPV 1NJIW 3B8NA 1IXMA 1AR1B 3E8BA 4GX1A 2EIKB 1DF4A 3G71V 5IDJA 2QM7A 5CBHA 3E8HA 3ZN0A 1AJQA 1BL8A 3AG3C 2XAGA 3ASNB 5CBFA 2Q67A 1JJ2U 1M57B 3OAAG 1FXHA 1PD3A 1K97A 1R3LC 2JJ1G 3MD0A 3OUFA 3CC2V 4WFFA 3OGCC 1J95A 1OCRB 1JOYA 1MABG 2HKOA 3HPLC 1K73W 1S76D 2X0LA 1KD1W 3F7VC 4RQFA 1K3EA 1JVMA 4HZ3A 4JGSA 1YTFB 5FL7G 3IFXA 3OMIB 4P9OA 2ZDIC 4QE9A 1GM7A 2B5UA 4I5SA 3G4SV 4FMTA 1OCRC 2DQ3A 1LNQA 1R6NA 2A0LA 4MVQA 1ORQC 2AHZA 4R7CA 2EZOA 1EZJA 3QO5A 4RAIA 3ZJZA 5IY5C 2EBOA 4KP4A 1F4NA 1QR9A 1GM8A 2WLKA 4OXSA 5EBWC 2JIZG 1JPXA 5KA5A 1VQ7V 4JAUA 4QIWF 4UVAA 3LUTB 2WWWA 1RM1C 3DGEA 2ZXWC 4QJFB 1M1KW 5LGUA 1GKFA 2ATKC 2LP7A 3W7WA 3CCUV 4MSWC 1THZA 1VQ4V 5L3DA 3TETA 3UM7A 4DO2A 2WLLB 3AG4C 2K1EA 1NVPB 3NXSA 2F43G 5LBQA 3SJQC 5EC2C 4G28B 2A79B 4P9PA 2HG5C 1BHAA 4RO2A 3W7SA 1I5YA 2EILB 2IW5A 1F51A 1S5HC 4G2KA 1NR7A 1QR8A 2XAJA 1R3JC 2P67A 4UV9A 2WAMA 5DN6G 2IJJA 3MHSC 3OE7G 3CCRV 3X2QC 4GT1A 1GTOA 3CD6V 1FS0G 4LCUC 4WF9V 1KECA 4DXWA 2WLMA 2X6CA 1SRYA 3ZMTA 3ABUA 2P90A 4YXWG 2ZQMA 4MW8A 2X6BA 4JYBA 1G8MA 4Q20A 1EBOA 3I56V 4WFAV 4X8AA 1VQKV 2OTJV 2OCCC 3ZRVA 2ZR2A 3SPHA 4TSFG 4CZZA 2WLJA 2DWEC 3RW0A 4E2LA 5B3SB 3D3IA 3LDCA 3CXCU 2V7QG 4I9WA 1BMFG 3T4ZA 2BOBC 3GB7C 3ETDA 2QTOA 1M56B 1FXKB 3RBZA 3ABLC 5EC1C 1VQ8V 4BAYA 2OCCB 1JCHA 2A9HA 3R65A 1NBMG 2B1IA 1MSWD 5CA3A 4XDLA 4JASA 1NR1A 4PELA 3WFVA 3E2EA 1KC8W 1V55B 5B3SC 2BOCC 2XNDG 3ZMZA 4PA9A 3SYQA 3D36A 5H6QA 2QA4V 1DTOA 3UKMA 4TWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F23 A;  1DLB A;  1I5Y A;  2EZP A;  3M99 B;  4JGS A;  1K34 A;  1ENV A;  4E2L A;  3CYO A;  1Y66 A;  4G2K A;  5KA5 A;  3P30 A;  1QR8 A;  1Y4M A;  1I5X A;  1MG1 A;  3MHS C;  2LP7 A;  1MOF A;  2X7R B;  4FK5 C;  1QCE A;  3CP1 A;  4N23 A;  5KA6 A;  2P6J A;  2M7W A;  3MHH C;  4N21 A;  3B8M A;  1DF5 A;  5HFL A;  5CN0 A;  3K9A A;  3H01 A;  4FIP C;  5CMU A;  1SZT A;  4FJC C;  5H9C A;  4JPR A;  1JQ0 A;  2EZO A;  4JF3 A;  3WFV A;  1EBO A;  2EBO A;  5HFM A;  3B8N A;  1QBZ A;  1QR9 A;  2MK3 A;  2OT5 A;  1K33 A;  3GWO A;  1JPX A;  1DF4 A;  3B77 A; 
#chains in the Genus database with same CATH topology
 3APQ A;  4R50 A;  3LSQ A;  3K57 A;  4DUY B;  1YSC A;  1GAX A;  2CUG A;  1CPY A;  2GTS A;  4JI1 B;  2FYU H;  3CP1 A;  5KUM A;  2HHH O;  1B6Q A;  3OFN G;  5CN0 A;  2DYR B;  3CC7 V;  5H9C A;  4JI4 B;  4DUZ B;  5LA6 B;  3JD4 A;  4X1K A;  1I0H A;  4J9Z B;  5ITZ B;  2VQE B;  4X20 A;  1K5S A;  2P22 C;  1OCC C;  4GCZ A;  4O4J A;  5JVD B;  1I7F A;  1VQ6 V;  4LF7 B;  3QVN A;  1OCO B;  3SYP A;  3RYH B;  2VQF O;  3FAV B;  2X7R B;  4CH6 A;  5DM6 V;  3ICX A;  2P7T C;  3MHH C;  3CPW U;  5KX5 B;  1GN6 A;  3ZRX A;  3ZHU A;  4MVM A;  3PJS K;  3L75 H;  2EJ7 A;  5BR8 O;  1FFT B;  5JJE B;  3UQ8 A;  4YIP A;  3JD3 A;  5LYJ B;  2EIM C;  4P2Z A;  3ABT A;  4HYO A;  1U97 A;  1Z2G A;  1R3I C;  4B3R O;  1URF A;  2DOS A;  4BIU A;  1WPX A;  1AI7 A;  1SA0 A;  4JI4 O;  5IE9 A;  3LDD A;  4NXN O;  1SQV H;  1QLE B;  4JI5 B;  2A06 H;  1I94 O;  3AG2 B;  4NXM O;  4G27 B;  3JAL A;  2N05 A;  1YDX A;  3FB6 C;  1FJG B;  3E22 B;  3SJB C;  1K33 A;  4GKJ B;  4RQE A;  1QHT A;  1P7B A;  2ODM A;  4JI3 O;  2Q0O C;  3BAB A;  3HKE B;  1GO3 F;  2FB5 A;  5KHG A;  5LGT A;  3QO7 A;  2QWQ B;  5B1A B;  1H2G A;  4JTA B;  2QEX V;  2XT9 A;  1E79 G;  3OT7 A;  4ZHQ B;  1XMQ O;  2Q6A A;  1ROP A;  3OW2 U;  1K34 A;  1XIL A;  3CJH B;  5EIB C;  4CH4 A;  4IYI A;  5JCO C;  3ABK C;  1MA1 A;  2QKS A;  3H01 A;  3J80 N;  1M56 C;  1IDS A;  4LH6 A;  4JAA A;  3SPC A;  2VWJ A;  4X62 B;  2OT5 A;  3CSX A;  2IH3 C;  1YI2 V;  2Z3Y A;  1FPO A;  4DR4 O;  1VQ9 V;  3ZMV A;  3SPI A;  2RDC A;  2H3O A;  2P06 A;  2OIG A;  3K9A A;  3SPG A;  3ZHV A;  2DYS B;  3QNE A;  1FYJ A;  3STL C;  5L3G A;  4DV3 B;  3OMN B;  4CC6 A;  2EUL A;  2F66 C;  4LWS B;  3F5W C;  3RFR A;  5E1A C;  3P30 A;  2HHH B;  1H2S B;  2RJZ A;  3BAA A;  2FTK A;  1XBL A;  2W0F C;  2L35 A;  1EM1 A;  4PDR A;  4KHP B;  3B4S A;  3K79 A;  5B1B C;  3CCJ V;  3WU2 Z;  3OUS A;  4B7E A;  1IX9 A;  2H94 A;  2GSM B;  3WB1 A;  1F23 A;  2JS3 A;  2X6A A;  3K59 A;  2Y0I A;  2ILM A;  1AVM A;  4EEQ A;  1Q86 W;  5IYC O;  5J2U B;  1JX9 A;  2UXN A;  1XNR O;  3CRC A;  1FFX A;  5EZY B;  4H33 A;  2KG7 B;  1M90 W;  4B3M O;  4UVB A;  5B1A C;  3K5L A;  4MVZ A;  2DN9 A;  2NR5 A;  2UU9 B;  2P4K A;  5D5P A;  4X65 B;  4YJ2 A;  4DV7 O;  2YI9 A;  4X66 B;  4J10 A;  4K3A A;  4UXN A;  4PA6 A;  2PY5 A;  1UFI A;  3CCM V;  2PI5 A;  2Q68 A;  3L74 H;  4MVO A;  1JMK C;  1BZK A;  2IJK A;  2W6I G;  3WG7 C;  3AK1 A;  3L73 H;  4PDL A;  2DJV A;  3RVZ A;  2RCV A;  2Z0A A;  5J2T B;  1AP5 A;  4DV1 B;  1XMQ B;  4LF6 O;  4DV5 O;  3DTU B;  4JI2 B;  4UCO A;  1YVW A;  3W7T A;  4IIJ A;  3JAS A;  4HAM A;  1YTF D;  4DV4 O;  3ASN C;  3CRQ A;  2HFE C;  4WCE V;  3L71 H;  4PD4 F;  3QF7 A;  3QG5 A;  4XDJ A;  1SQX H;  4OX9 O;  4B08 A;  1XQ8 A;  1B3Q A;  2CK3 G;  2PF4 E;  4C7U A;  3ML0 A;  4JI2 O;  5IYD O;  1RFY A;  5JCO A;  1YCI A;  2LGW A;  1J5E O;  1IUR A;  3K08 A;  1ZX3 A;  2ZE7 A;  2W6J G;  2IH1 C;  2ZM6 O;  4GZR B;  4ZOL A;  1XL4 A;  5IT9 N;  1I5X A;  2JK5 C;  5BXZ A;  4YJ3 B;  1HNW O;  3CCS V;  3P3P A;  1SC5 B;  4DK1 A;  4LBE C;  4O4I A;  4JI8 O;  1JA8 A;  1WJZ A;  3RYC A;  3B8N A;  1IXM A;  3BRC A;  2YUA A;  1BQZ A;  5CBH A;  4DRX A;  3N2G B;  3E8H A;  2R72 A;  1AJQ A;  1BL8 A;  2JRI A;  5CBF A;  1FXH A;  1PD3 A;  3L70 H;  1Q6U A;  2XUM A;  3CC2 V;  3OGC C;  3AG7 A;  5BMV A;  1OCR B;  3N2G A;  1YF2 A;  4O2A A;  1S76 D;  2EX3 A;  4LNU A;  3BFR A;  1H2K A;  2F23 A;  1JVM A;  4O4I B;  5FL7 G;  4DR2 B;  4WBN B;  1VP7 A;  4B3T O;  5DED A;  2ZDI C;  4QE9 A;  2B5U A;  4I5S A;  3VQV A;  1KYO F;  5LMN O;  4UCV A;  1N32 B;  4FM2 A;  4TOI A;  1N0N A;  1WN7 A;  4RAI A;  1QR9 A;  2QGN A;  1VQ7 V;  4O4L A;  1RM1 C;  1M1K W;  5LGU A;  4MSW C;  1VQ4 V;  2FL4 A;  5L3D A;  1Y74 B;  4DR6 B;  4DO2 A;  2WLL B;  1XNQ B;  2ZE5 A;  4F6R B;  1NVP B;  2ARH A;  1HNX O;  5EC2 C;  1BHA A;  2VQE O;  3W7S A;  5LP6 A;  2IW5 A;  3A0B Z;  4F6E A;  2PYJ A;  1PL4 A;  4HNA A;  1HNW B;  3MDS A;  1XMO B;  2CTQ A;  2KKW A;  4YIO A;  4WF9 V;  2UUB B;  2WLM A;  4X1I B;  1HNX B;  2X6B A;  4WFA V;  1XI1 A;  4KL1 A;  2OTJ V;  3U0Z A;  4EFB A;  1HR0 B;  2KG7 A;  3JAK B;  1Y67 A;  4E2L A;  3RW0 A;  1RP3 B;  3D3I A;  3CXC U;  1SQB H;  4I9W A;  2BOB C;  1ZL8 A;  3T1H B;  4LFB B;  4DR5 B;  1KKC A;  1JCH A;  2PUS A;  1NBM G;  2B1I A;  3RYI A;  3IC9 A;  2QJ1 A;  1KC8 W;  4Q6G A;  2BOC C;  4PA9 A;  2Z5U A;  3JYC A;  4NXM B;  4JYY A;  2HLD G;  4D7T A;  3AG4 B;  2OCH A;  2ZDI A;  1PL0 A;  4N21 A;  1XUQ A;  3CEI A;  4J41 A;  3JD2 A;  3CCE V;  3WB2 A;  4LF4 B;  3D3Q A;  1GK9 A;  1YJW V;  5B1B B;  4MTG A;  4CH3 A;  2YI8 A;  2WA3 A;  5B66 Z;  4GX0 A;  4QNH B;  2RN9 A;  1R3K C;  2JS5 A;  2EIJ B;  1PNK A;  4LF9 O;  4JZ2 A;  4X62 O;  2UUC O;  2BTQ A;  3KZI Z;  1TGO A;  2V1D A;  4TUY A;  4DV4 B;  4JYA B;  1NQT A;  4UB6 Z;  2MK3 A;  5C8Y A;  2UXB B;  5HFL A;  3CRR A;  2JGD B;  1DGS A;  1OHH G;  1G6U A;  1VQL V;  2ADP A;  2IJI A;  2IJH A;  3SR2 C;  2WSS G;  4DUY O;  3SGI A;  3C3S A;  1J5E B;  2YIA A;  3M8A A;  4PA3 A;  3WG7 B;  1XRE A;  2CE4 A;  4ZHQ A;  4NR1 A;  4R6Z A;  4LH7 A;  1ZAU A;  3CWB H;  4KFM A;  4PJ0 Z;  4DR7 B;  3B40 A;  4NYK A;  4JI0 B;  4BWA A;  3E8G A;  4MW3 A;  2B9Z A;  3MAQ A;  2WLN A;  5KAF Z;  4PDM A;  3STZ C;  2F93 B;  1NT2 B;  2G38 A;  2EJR A;  3JAT A;  1K8A W;  4AI8 A;  1MSD A;  5IJ9 B;  3E22 A;  4X9Q A;  2CGN A;  3SYC A;  1M9N A;  4JI5 O;  3M99 B;  1XMO O;  2CGO A;  2K9P A;  1OCZ B;  2BTO A;  2N74 A;  4JTC B;  3ZRW B;  2RQ6 A;  1OZ0 A;  1S5L Z;  2NNU A;  4UCR A;  1GM9 A;  4H44 B;  1VQ5 V;  3EVK A;  1H8H G;  1LR1 A;  1KUQ A;  2JGD A;  2QE7 G;  1H8E G;  1K92 A;  4PI2 A;  4DK0 A;  5KHJ A;  4CBC A;  3BY6 A;  2Q9L A;  4A5U B;  3EXA A;  1K4C C;  4X89 A;  2HEP A;  3CB2 A;  2PI4 A;  3F7Y C;  2QWP B;  5LYJ A;  1XNR B;  2QM4 A;  5JQG B;  1Q7Y W;  3DC5 A;  3W7X A;  1AB3 A;  4KUM A;  4Z1M G;  4PA7 A;  1NI8 A;  4IGG A;  1WAZ A;  3ABM B;  1AJN A;  1VMG A;  4X64 B;  2Y48 A;  5JVD A;  4X20 B;  3HKC A;  4X1K B;  3JSL A;  5EK0 A;  2XAQ A;  3H1H H;  1GH6 A;  1Y66 A;  1NKD A;  2JJ2 G;  3ASO B;  5L3E A;  2XTA A;  2WA4 A;  3E83 A;  2XAF A;  4B7K A;  3M7M X;  1NVP D;  2YIB A;  1OCO C;  5LHI A;  2QWR B;  3FB5 C;  4NB5 A;  2VRZ A;  4JF3 A;  3BPZ A;  1OCZ C;  3DSQ A;  3ABK B;  4K35 A;  3N2K A;  1MZE A;  2N04 A;  1GN4 A;  4ASU G;  3D8C A;  4W4L A;  3OEE G;  1FXK A;  1VF5 B;  1P84 F;  1B04 A;  3BCC H;  3BHP A;  1WA8 A;  4LFC O;  1B06 A;  2O57 A;  4DR3 B;  1K4D C;  3E35 A;  2H8P C;  1BQ0 A;  1L1F A;  3K06 A;  4PV1 B;  1M93 A;  5JWP A;  5EBL C;  2LGQ A;  3EFF K;  4MT8 A;  2YSU B;  3H1I H;  4MVR A;  3CMA V;  2VS0 A;  1RPO A;  4HNA B;  3ZMU A;  1VIB A;  2M6Y A;  5IWA B;  5KHH A;  1Q6I A;  1EZV H;  4PDV A;  4F6R A;  1YIT V;  1E1Q G;  2WLL A;  1HDJ A;  2LJ2 A;  2ZKO A;  1UPG A;  4HBN A;  3QTC A;  2HJF C;  1I08 A;  1KQS U;  4GYC B;  4JI7 B;  4FIP C;  3B09 A;  5JQG A;  3VQX A;  2DWD C;  4JTD B;  2P4V A;  3UT5 A;  2AW9 A;  5CBG A;  5LHH A;  2YXH A;  4FLW A;  5IWA O;  3U10 A;  4AQY O;  2Q7G A;  1TUE B;  4X66 O;  2GUZ A;  1V55 C;  3W7U A;  1QU7 A;  2YEV A;  3ZRW A;  1FD9 A;  4JAV A;  1OV9 A;  4MS2 A;  1VQP V;  1NJI W;  4LNU B;  1AR1 B;  3E8B A;  4I7Z B;  2EIK B;  2BSK B;  4D7S A;  1SKV A;  4DW1 A;  2IM9 A;  5JJJ B;  3AG3 C;  4LF7 O;  1US6 A;  2Q67 A;  1ZTE A;  1K97 A;  1D5A A;  1R3L C;  3R66 A;  3OUF A;  4WFF A;  1N36 O;  1Z5W A;  4DRX B;  2HKO A;  1FJG O;  1TA8 A;  2X0L A;  4DV5 B;  1KD1 W;  4NTX A;  3RYC B;  3K5O A;  4TV8 B;  5B5E Z;  1GM7 A;  4J7J A;  3ZHR A;  2YS8 A;  5BY1 A;  4H0L B;  4JI8 B;  4AHC A;  1R6N A;  2HP8 A;  3A8T A;  5CA0 A;  3KCX A;  2EBO A;  1IBK B;  4B3S B;  1F4N A;  5EBW C;  2JIZ G;  1ZSP A;  1R6T A;  4QIW F;  2BTQ B;  3T1Y B;  5JH7 B;  1GKF A;  2ATK C;  3ZBH A;  3TET A;  1AR4 A;  2GBO A;  2Y4U A;  2K1E A;  4IYH A;  4CH5 A;  4J7K A;  2Q7H A;  2F43 G;  4G28 B;  4FM1 A;  3DC6 A;  4P9P A;  5FLX N;  4KHP O;  2E74 B;  3JCU Z;  2F4V O;  1NTK H;  4EB6 A;  1SF9 A;  2CTR A;  4I4T A;  5KLV H;  1BGY H;  1NR7 A;  2P67 A;  1MMM A;  1MNG A;  1IZ3 A;  4ZI7 B;  1FS0 G;  4DXW A;  3H9V A;  2P90 A;  4YXW G;  2ZE6 A;  4JYB A;  3I56 V;  1VQK V;  3VQY A;  1XHZ A;  5EYP B;  3WB0 A;  4K0K B;  2WLJ A;  5B3S B;  2UU9 O;  5FPR A;  1QQC A;  2V7Q G;  1FFX B;  4NVP A;  1M56 B;  3ZHQ A;  3RBZ A;  3ZS8 C;  4FLY A;  5EC1 C;  4BAY A;  3T1Y O;  2OCC B;  5CA3 A;  4IT5 A;  4JAS A;  4PEL A;  5EYP A;  2E5L B;  1SZX A;  3ZMZ A;  3SYQ A;  3D36 A;  1DTO A;  3UKM A;  4TWK A;  3BA9 A;  4F4L A;  2UXD B;  5IYZ B;  4BW5 A;  4GKK B;  5EIB D;  4LF5 B;  4DW0 A;  5L3C A;  2YXL A;  2GHY A;  3J7A U;  2UXC B;  3ASO C;  3K03 A;  1QLN A;  3CRA A;  3VOU A;  1N32 O;  4B3R B;  4NTY A;  3TGU H;  1R1B A;  4I4T B;  4R8C A;  1SZT A;  4LWS A;  1LUW A;  1Q43 A;  4NKG B;  3VBB A;  1S72 V;  3S3X A;  1DLB A;  2GDS A;  1H2M A;  1ENV A;  2Y0P A;  1KU9 A;  3EHB B;  2ZNJ A;  1XL6 A;  1Y74 A;  1N36 B;  2DYR C;  2QDO A;  4K8X A;  4FLT A;  5B1N A;  5JH7 A;  1W0J G;  3LNM B;  2JEX A;  3TXS A;  3H1J H;  5A9G A;  5EBM C;  3SJA C;  1L8D A;  4DR4 B;  5B1O A;  3OR6 C;  3B77 A;  4U3J B;  3TK1 A;  1DK1 A;  4BIZ A;  2Y69 B;  1CEZ A;  3ZHS A;  1QVF U;  1IBL B;  3CE2 A;  1Z5V A;  4O4H B;  2V4D A;  4TT3 G;  4DR2 O;  4X1Y B;  2ZR3 A;  4TV8 A;  1H38 A;  3CJH A;  4WBN A;  1G4Y B;  1GMG A;  4YHH O;  2XOK G;  1K7D A;  4UV8 A;  3FYE B;  4WFH A;  4O2A B;  2Q69 A;  5BR8 B;  2KQX A;  4LFA B;  3THO A;  4FFK A;  2Q0A A;  1MG1 A;  4X88 A;  3HKE A;  4DR1 B;  2WLI A;  2XAH A;  3K04 A;  2BSK A;  2R9I A;  1N0J A;  1SQF A;  3A0R A;  4JI6 O;  2BE3 A;  3CX5 F;  3H1L H;  3O65 A;  1ARO P;  2ZD9 A;  3OTO B;  4O2B B;  2YEV B;  3JAL B;  2F95 B;  4WFE A;  3E89 A;  4YJ3 A;  2IU3 A;  4JYC A;  4N23 A;  2P6J A;  4LC1 A;  2FKX A;  1DF5 A;  1SA0 B;  1L0N H;  4ZOL B;  3AG1 B;  1BE3 H;  3HR0 A;  3TJT A;  5H2F Z;  1PNM A;  5CB4 A;  1IBM O;  3ZRS A;  2Y69 C;  3UT5 B;  4I55 A;  1GN2 A;  5LXT A;  2QKA A;  1HNZ O;  1YXB A;  3GWK C;  4ZIB A;  3LDE A;  4UUJ C;  3G6E V;  1PNL A;  4B3M B;  1A32 A;  1R73 A;  1VF6 C;  2XAS A;  1H2N A;  1YHQ V;  1QCE A;  1PP9 H;  4GKJ O;  3NR7 A;  4DV6 B;  5LOV B;  3ETG A;  4H13 B;  3IGA C;  1MZF A;  4JI0 O;  4O4J B;  5ITZ A;  1XOU A;  3RGB A;  3T1C A;  1YJ9 V;  3ETE A;  2YC0 A;  3K9S A;  3OMA B;  5D5Q A;  4NXN B;  1T5E A;  2YIB D;  2YXY A;  3SJC C;  4DV7 B;  1COW G;  3N27 A;  4X65 O;  5LMN B;  2ITC C;  1P7G A;  2EIJ C;  4YJ2 B;  1H2L A;  1AI5 A;  5LGN A;  4MTF A;  2CDY A;  1KB9 F;  2W0X A;  3JAW B;  2EIN C;  2HVJ C;  4XDK A;  1R6K A;  2NN4 A;  4J11 A;  5EZY A;  2MW2 B;  3UO2 A;  2C2A A;  1W2B U;  3JD1 A;  2OTL V;  1PPJ H;  1FAF A;  3OR7 C;  5J2U A;  1NH2 D;  3JSN A;  1QLE C;  3N2K B;  2OYQ A;  2DYS C;  2JEU A;  3ZMS A;  5H5N A;  3GWO A;  3S3W A;  3TCU A;  3BA8 A;  1SET A;  1Q82 W;  1S0V A;  1RSO B;  3ABM C;  4PHZ A;  3FB7 C;  4ABM A;  1KBH A;  1Q6H A;  1JJO A;  4LF8 B;  4GX5 A;  1PKX A;  3AK3 A;  4FLU A;  1TUB B;  2IU0 A;  1ZLZ A;  3UCS C;  1RPR A;  3HKC B;  1QBZ A;  1E1R G;  1HWY A;  1V54 B;  1VQM V;  4DR1 O;  1S5J A;  2AXT Z;  4DV6 O;  4FFB B;  1KP2 A;  1Q5O A;  4OGQ B;  1S3J A;  3ZX6 A;  2R9A A;  3ZHT A;  4WFB V;  2EZP A;  4IHJ B;  5IY5 B;  2WLH A;  2ZIO A;  2ITD C;  1N4C A;  4CC5 A;  4MTO A;  3IJ4 A;  3SYA A;  1XEQ A;  5C93 A;  1AI4 A;  1YIJ V;  2AZ0 A;  2LFR A;  1F4M A;  1IVS A;  4W4K A;  1BHB A;  5CMU A;  4D6T H;  3AEI A;  2UXC O;  4B3T B;  2A3Q A;  1OJH A;  1TAE A;  4I50 A;  2RNB A;  3G71 V;  1DF4 A;  3CXH F;  4JI6 B;  2QM7 A;  5IDJ A;  5IJ9 A;  3JAT B;  1VAR A;  2QWO B;  3ZN0 A;  3ASN B;  2XAG A;  1PV0 A;  4CS3 A;  4LFC B;  1JJ2 U;  3OAA G;  2JJ1 G;  5KMG A;  1XHX A;  2BCC H;  1MAB G;  5AG2 A;  3ETQ A;  1VF7 A;  1D2D A;  4RQF A;  1K3E A;  2ZE8 A;  4B3S O;  3HKD A;  1TVK B;  3OMI B;  5KHI A;  4QGP A;  2A0L A;  3G67 A;  1ORQ C;  2Q5Z A;  1IBL O;  3A0H Z;  3SDL A;  5A2Q N;  3RN4 A;  1EN5 A;  4R7C A;  1EZJ A;  3QO5 A;  3ZJZ A;  5IY5 C;  5C8Y B;  1X59 A;  2E5L O;  3OTO O;  1N34 O;  3K5M A;  2E76 B;  4OXS A;  4TUY B;  1JPX A;  5KA5 A;  4DV0 O;  4JAU A;  4UVA A;  3LUT B;  2WWW A;  5TIS Z;  4J42 A;  2OWO A;  1ZUQ A;  3DGE A;  2ZXW C;  2CAZ C;  5KX5 A;  2A7W A;  4FFB A;  1THZ A;  2PZS A;  3UM7 A;  3RYH A;  4OPA A;  4YY3 B;  3BVO A;  5LBQ A;  3SJQ C;  2HG5 C;  1PM9 A;  5LA6 A;  5FNV B;  1TUB A;  1I5Y A;  2EIL B;  4DV1 O;  1F51 A;  4G2K A;  1QR8 A;  2XAJ A;  2IJJ A;  3CCR V;  3CD6 V;  4LCU C;  1EN6 A;  2RMK B;  1NU1 H;  2ETN A;  2UXB O;  4MW8 A;  3B2E E;  1G8M A;  4Q20 A;  2CH7 B;  4LR3 A;  3RT3 C;  4J80 A;  3SPH A;  4UCU A;  3RYI B;  2DWE C;  2IBZ H;  1BMF G;  1ZL8 B;  1BCC H;  1Q8I A;  1BS3 A;  4KXR A;  3JAK A;  1MSW D;  4XDL A;  1HNZ B;  1NR1 A;  3JAW A;  3E2E A;  3WFV A;  2XND G;  2HJD A;  4FLV A;  1KMI Z;  5H6Q A;  2YID A;  2E3C A;  1KP3 A;  2VWK A;  4L8J A;  1BSM A;  3APO A;  4AQY B;  3F5T A;  4X1I A;  4XBF A;  1YJN V;  3Q4H A;  4BR6 A;  1FXV A;  4LF5 O;  2EIK C;  1O9G A;  3UO3 A;  2DW4 A;  1N33 B;  5KUK A;  1MOF A;  4U7N A;  2KSD A;  4JI1 O;  3AG1 C;  2AGA A;  3B8M A;  1KKD A;  1V9P A;  4QE7 A;  1JQ0 A;  3DXR A;  5KAI Z;  5LP6 B;  4OPH A;  1XDC A;  1WNS A;  3E8F A;  4JI7 O;  3CCQ V;  5GON A;  4J9Y B;  4YY3 O;  1Y6X A;  3CYO A;  5LHG A;  3L9D A;  4AIL C;  5LOV A;  3CHX A;  1NTM H;  4I0X B;  1VQO V;  1FKA O;  1WB7 A;  3KG2 A;  4Z2W A;  2PYL A;  3JCZ A;  1K5Q A;  3CCL V;  4ZBM A;  5LXT B;  4O4L B;  2B1G A;  4I55 B;  1M4U A;  2F1M A;  4TV9 A;  5CB4 B;  4K0K O;  1IXB A;  1P49 A;  2JVD A;  5BZB A;  3X2Q B;  2QWN B;  1K9M W;  4UCS A;  4NTW A;  2EIL C;  1WLE A;  3SYO A;  3RVY A;  3CS5 A;  4FK5 C;  2R9R B;  3RYF A;  1X4T A;  4GKK O;  4O2B A;  4QPJ A;  3FX7 A;  2LFS A;  3K58 A;  1Q3E A;  2P5O A;  3CC4 V;  3FYI B;  1L0L H;  4LF9 B;  1XNQ O;  4FLX A;  5BMV B;  3JAR A;  2JGU A;  1D5N A;  2GV9 A;  2WLI B;  2EIN B;  5KA6 A;  3FFQ A;  2D3O W;  3HKB B;  1SES A;  3JAR B;  1VQN V;  2NLJ C;  3IC7 A;  4TQD A;  1IBM B;  4MVS A;  4P30 A;  5H6R A;  3O9O A;  5GW7 A;  4UB8 Z;  3D36 C;  2L6L A;  3T2M A;  1IBK O;  5E79 Z;  2ZNI A;  1U96 A;  4X1Y A;  1N33 O;  1Y76 A;  3RYF B;  3I55 V;  2UUB O;  3GVM A;  4O4H A;  3LNN A;  1UJW B;  4FZ1 A;  1QVG U;  3FKS G;  3JD0 A;  1WB8 A;  1YEW A;  3OD4 A;  3OEH G;  4U3J A;  1HP8 A;  1SQQ H;  3E86 A;  3K0G A;  1G1X B;  4JYA O;  1V54 C;  4MVU A;  2QR4 A;  1QNM A;  3T4D A;  3ZED A;  4FVM A;  3G6B A;  1AJP A;  3KCY A;  1LUV A;  4UCT A;  4DR6 O;  4DR5 O;  3OM3 B;  4FM0 A;  1SER A;  3L72 H;  2AZ2 A;  4DV2 B;  4LFA O;  2LW1 A;  1N34 B;  1M57 C;  2ZT9 B;  3VQW A;  3JAS B;  3CME V;  4IIJ B;  4QPK A;  1S77 D;  2HVK C;  5CA1 B;  4PA4 A;  1M5I A;  2EIM B;  2Q8V A;  5J2T A;  3QO8 A;  2WPD G;  4DUZ O;  2QTS A;  1JFF A;  3K0D A;  2QM8 A;  3BEH A;  3HB3 B;  2UUA O;  1EN4 A;  3Q4H B;  1AR5 A;  5IJ0 B;  5IYZ A;  2YDE A;  4J7Z A;  3LSS A;  4JPR A;  1FXK C;  5L3B A;  2Q73 A;  3I5D A;  1OCC B;  1O9H A;  2GTA A;  2F4V B;  5HFM A;  2HR3 A;  4U7O A;  4CS4 A;  4LP8 A;  4GX2 A;  4FJC C;  4L87 A;  2DQ0 A;  3FD9 A;  4EKW A;  3LSU A;  4PI0 A;  3FB8 C;  1NH2 B;  4WFG A;  4CS2 A;  2DMX A;  1AP6 A;  3H1K H;  5K1X A;  4K8Z A;  2KB1 A;  2CH7 A;  1Q81 W;  4DR7 O;  1ZWI C;  2JDI G;  3AK2 A;  5GTH Z;  3RWR D;  5IJ0 A;  4YHH B;  5IYB O;  1I94 B;  5GTI Z;  4FLZ A;  3AG2 C;  3TXQ A;  4ZI7 A;  1F7Y A;  1N8R W;  3C3T A;  3CRM A;  1JFF B;  2UXX A;  4MTX A;  2FML A;  1Q90 D;  4EB6 B;  4JV5 O;  5FNV A;  1P4R A;  2XHB A;  5CA1 A;  3KKY A;  4Z1V A;  3SPJ A;  2CTW A;  4RUF A;  1BT8 A;  3AG3 B;  2CTP A;  1NTZ H;  4RUE A;  1Y4M A;  5L3F A;  4U3F H;  4UVC A;  2VQF B;  2OIE A;  3OTF A;  2ZXW B;  5LP6 C;  2UUC B;  2M7W A;  5J9P C;  4OX9 B;  3P32 A;  4LF4 O;  3ABL B;  4TQF A;  2E75 B;  1W0K G;  1EFR G;  2YIC A;  5JJN B;  3CCV V;  2QKC A;  3P3N A;  4DV0 B;  1VEW A;  2AHY A;  5CA0 B;  1AIL A;  1SS3 A;  1NS1 A;  1CP9 A;  3ZN1 A;  1SQG A;  4UFZ A;  2UUA B;  1AI6 A;  4FPP A;  3A2F A;  1RM1 B;  1Y76 B;  4H37 A;  3ZCC A;  2LO1 A;  4ZKI A;  4GLX A;  3K3W A;  3ZIA G;  1TVK A;  1W59 A;  3HKD B;  4DV3 O;  5K1P A;  5KHK A;  4EFE A;  4GX1 A;  1WPB A;  5KMG B;  4DYL A;  3HKB A;  3OGI B;  4DV2 O;  5LL6 Y;  4X64 O;  4I9Q A;  5LMU B;  1M57 B;  5LMU O;  3MD0 A;  4LFB O;  2LQT A;  1J95 A;  1JOY A;  2Q4P A;  2PGG A;  3HPL C;  1K73 W;  1JR9 A;  1GN3 A;  4I50 B;  3F7V C;  5F2V O;  4HZ3 A;  4JGS A;  1HR0 O;  1YTF B;  3IFX A;  4P9O A;  1WP8 A;  3G4S V;  2GUZ B;  2ADQ B;  4FMT A;  1OCR C;  2DQ3 A;  1LNQ A;  4MVQ A;  2ZCE A;  2AHZ A;  3IAY A;  2QSA A;  4ICG A;  4IHJ A;  3K5N A;  2EZO A;  4KP4 A;  1GM8 A;  4TV9 B;  2WLK A;  1CXZ B;  1YZB A;  2ZIN A;  4E4E A;  2Y4T A;  4JZG A;  1VF6 A;  4QJF B;  2LP7 A;  3CCU V;  3W7W A;  4I0X A;  4FZ0 A;  3FAV A;  1HW7 A;  4JI3 B;  5DEC A;  3AG4 C;  2PTM A;  3C90 A;  3NXS A;  5GON B;  2A79 B;  1WP7 A;  4RO2 A;  1NZ6 A;  3JAM N;  2Q7E A;  1GRJ A;  3DXR B;  4JV5 B;  1S5H C;  4GUN A;  1R3J C;  4UV9 A;  2WAM A;  5DN6 G;  3OE7 G;  3MHS C;  2ZIM A;  3X2Q C;  4GT1 A;  1GTO A;  4RWU A;  1RSO A;  1KEC A;  2UXD O;  2X6C A;  1SRY A;  3ZMT A;  4BW9 A;  3ABU A;  2ZQM A;  1SQP H;  1EBO A;  4DR3 O;  4IL6 Z;  4X8A A;  2ZM6 B;  2OCC C;  3ZRV A;  2ZR2 A;  3J81 N;  4TSF G;  3G80 A;  4CZZ A;  3LDC A;  2R70 A;  1WA8 B;  3T4Z A;  3GB7 C;  3ETD A;  2QTO A;  3T1H O;  2D2C B;  1FXK B;  3U11 A;  3ABL C;  1VQ8 V;  2A9H A;  3R65 A;  5FPO A;  3PN1 A;  1V55 B;  5B3S C;  4BIO A;  4LF8 O;  2LW7 A;  2QA4 V;  2DE0 X;  4LF6 B; 
#chains in the Genus database with same CATH homology
 1KP3 A;  2Z5U A;  4R50 A;  3LSQ A;  4F4L A;  4XBF A;  3JYC A;  4BW5 A;  1YJN V;  1YSC A;  2HLD G;  5L3C A;  1FXV A;  2GHY A;  2EIK C;  3AG4 B;  2DW4 A;  2ZDI A;  1PL0 A;  1MOF A;  1CPY A;  3ASO C;  3K03 A;  3CP1 A;  4U7N A;  5KUM A;  5KUK A;  3AG1 C;  3VOU A;  1QLN A;  4N21 A;  3B8M A;  1B6Q A;  3OFN G;  5CN0 A;  1KKD A;  4R8C A;  2DYR B;  3CC7 V;  4QE7 A;  1SZT A;  5H9C A;  1JQ0 A;  3JD2 A;  3CCE V;  3JD4 A;  3VBB A;  3E8F A;  4J9Z B;  1GK9 A;  3CCQ V;  1K5S A;  1YJW V;  1OCC C;  5B1B B;  4J9Y B;  4GCZ A;  4MTG A;  1S72 V;  1DLB A;  1ENV A;  3CYO A;  5LHG A;  1VQ6 V;  3EHB B;  1OCO B;  1XL6 A;  3SYP A;  4GX0 A;  4QNH B;  2DYR C;  1R3K C;  2X7R B;  1VQO V;  2EIJ B;  1PNK A;  5DM6 V;  2P7T C;  3MHH C;  3KG2 A;  5B1N A;  1W0J G;  3CPW U;  3ZRX A;  3JCZ A;  3PJS K;  4MVM A;  1FFT B;  1K5Q A;  3LNM B;  2JEX A;  3CCL V;  3JD3 A;  4ZBM A;  5EBM C;  2B1G A;  2EIM C;  2V1D A;  4P2Z A;  3ABT A;  4HYO A;  1NQT A;  2MK3 A;  5B1O A;  1R3I C;  3OR6 C;  3B77 A;  5HFL A;  5BZB A;  4BIU A;  1WPX A;  1AI7 A;  3TK1 A;  3X2Q B;  4BIZ A;  2Y69 B;  1K9M W;  1CEZ A;  3SYO A;  3LDD A;  1OHH G;  1WLE A;  2EIL C;  1QVF U;  3RVY A;  4FK5 C;  1QLE B;  2R9R B;  4TT3 G;  1VQL V;  2IJI A;  3AG2 B;  2IJH A;  2ZR3 A;  2WSS G;  4G27 B;  1H38 A;  4PA3 A;  4QPJ A;  3WG7 B;  1G4Y B;  1GMG A;  2LFS A;  2XOK G;  1K7D A;  3FB6 C;  3CC4 V;  4UV8 A;  4R6Z A;  1K33 A;  3FYE B;  3FYI B;  4WFH A;  2Q69 A;  4KFM A;  4RQE A;  1P7B A;  2WLI B;  2EIN B;  1MG1 A;  3E8G A;  4X88 A;  1GO3 F;  4MW3 A;  5KA6 A;  2WLN A;  5LGT A;  3QO7 A;  4PDM A;  2D3O W;  2WLI A;  3STZ C;  5B1A B;  1SES A;  2XAH A;  2EJR A;  1VQN V;  1H2G A;  1K8A W;  3K04 A;  2NLJ C;  3IC7 A;  2R9I A;  4JTA B;  2QEX V;  3A0R A;  1E79 G;  4MVS A;  4P30 A;  2Q6A A;  5H6R A;  1M9N A;  3SYC A;  1ROP A;  1ARO P;  3M99 B;  3OW2 U;  1K34 A;  5GW7 A;  2ZD9 A;  1OCZ B;  4JTC B;  3T2M A;  3ZRW B;  2YEV B;  1OZ0 A;  3ABK C;  2NNU A;  1GM9 A;  3I55 V;  4WFE A;  3E89 A;  1VQ5 V;  2IU3 A;  4JYC A;  1UJW B;  4N23 A;  2P6J A;  4LC1 A;  2QKS A;  1H8H G;  1QVG U;  1DF5 A;  3FKS G;  3JD0 A;  3H01 A;  2QE7 G;  1H8E G;  1K92 A;  3AG1 B;  3OEH G;  3E86 A;  1M56 C;  4CBC A;  3BY6 A;  1PNM A;  3K0G A;  3SPC A;  3ZRS A;  1V54 C;  4MVU A;  1K4C C;  4X89 A;  2OT5 A;  2Y69 C;  2PI4 A;  3F7Y C;  3T4D A;  2IH3 C;  1YI2 V;  2Z3Y A;  1Q7Y W;  3W7X A;  1VQ9 V;  1AJP A;  3LDE A;  4KUM A;  4UUJ C;  1PNL A;  4Z1M G;  3G6E V;  1R73 A;  2XAS A;  1YHQ V;  4PA7 A;  1QCE A;  3OM3 B;  3ZMV A;  1SER A;  3SPI A;  3ABM B;  3ETG A;  1AJN A;  1M57 C;  3K9A A;  3IGA C;  3SPG A;  2DYS B;  3QNE A;  2Y48 A;  3STL C;  5L3G A;  3CME V;  4QPK A;  1S77 D;  2HVK C;  3OMN B;  4PA4 A;  5EK0 A;  3T1C A;  2EIM B;  2XAQ A;  1YJ9 V;  3QO8 A;  2WPD G;  1Y66 A;  3F5W C;  3ETE A;  3OMA B;  1NKD A;  2JJ2 G;  5E1A C;  3P30 A;  3ASO B;  5L3E A;  2FTK A;  3E83 A;  3K0D A;  2XAF A;  2QM8 A;  1NVP D;  1COW G;  3BEH A;  3HB3 B;  1OCO C;  5LHI A;  2W0F C;  3FB5 C;  2ITC C;  4PDR A;  3LSS A;  4JPR A;  2EIJ C;  1FXK C;  4JF3 A;  5L3B A;  3K79 A;  1OCC B;  1AI5 A;  5B1B C;  5LGN A;  3CCJ V;  1OCZ C;  3OUS A;  4MTF A;  5HFM A;  2H94 A;  2HR3 A;  4U7O A;  2GSM B;  3ABK B;  4LP8 A;  4GX2 A;  4FJC C;  4L87 A;  1F23 A;  2DQ0 A;  2EIN C;  2HVJ C;  2X6A A;  4XDK A;  1R6K A;  4ASU G;  4EKW A;  2C2A A;  1Q86 W;  3OEE G;  5IYC O;  1W2B U;  3JD1 A;  1FXK A;  2OTL V;  1JX9 A;  2UXN A;  3OR7 C;  1NH2 D;  3FB8 C;  1NH2 B;  4WFG A;  4H33 A;  1K4D C;  3E35 A;  2H8P C;  1QLE C;  1M90 W;  4UVB A;  5B1A C;  2KB1 A;  2DYS C;  2JEU A;  4MVZ A;  3ZMS A;  1Q81 W;  1L1F A;  3GWO A;  1ZWI C;  3K06 A;  3TCU A;  1SET A;  2JDI G;  5IYB O;  4UXN A;  5EBL C;  4PA6 A;  3EFF K;  1Q82 W;  1S0V A;  4MT8 A;  3ABM C;  2YSU B;  4MVR A;  3AG2 C;  3CCM V;  2PI5 A;  3CMA V;  3FB7 C;  2Q68 A;  4MVO A;  1N8R W;  2IJK A;  2W6I G;  3WG7 C;  1RPO A;  2UXX A;  4MTX A;  4GX5 A;  1PKX A;  4PDL A;  3RVZ A;  3ZMU A;  2IU0 A;  1P4R A;  1RPR A;  3DTU B;  1QBZ A;  3W7T A;  3SPJ A;  1HWY A;  1E1R G;  4PDV A;  4HAM A;  4RUF A;  1V54 B;  1VQM V;  1YTF D;  3AG3 B;  3ASN C;  1YIT V;  1E1Q G;  2WLL A;  4RUE A;  2HFE C;  1Y4M A;  5L3F A;  4WCE V;  4UVC A;  1KP2 A;  4XDJ A;  2ZXW B;  2M7W A;  5J9P C;  2HJF C;  1KQS U;  3P32 A;  2CK3 G;  4FIP C;  3ABL B;  1S3J A;  2DWD C;  3ML0 A;  4JTD B;  5IYD O;  5CBG A;  1W0K G;  1EFR G;  3K08 A;  5LHH A;  4WFB V;  2W6J G;  2IH1 C;  3CCV V;  2EZP A;  2AHY A;  5IY5 B;  2WLH A;  1XL4 A;  2ITD C;  1I5X A;  4MTO A;  2JK5 C;  1CP9 A;  3SYA A;  3ZN1 A;  1AI4 A;  5C93 A;  1YIJ V;  1TUE B;  3CCS V;  1AI6 A;  4FPP A;  1RM1 B;  4H37 A;  2LFR A;  3ZCC A;  1V55 C;  3W7U A;  1F4M A;  2YEV A;  3ZRW A;  4ZKI A;  1BHB A;  3K3W A;  5CMU A;  3ZIA G;  4JAV A;  3AEI A;  4LBE C;  4MS2 A;  1VQP V;  1NJI W;  3B8N A;  1IXM A;  1AR1 B;  3E8B A;  4GX1 A;  2EIK B;  1DF4 A;  3G71 V;  5IDJ A;  2QM7 A;  5CBH A;  3E8H A;  3ZN0 A;  1AJQ A;  1BL8 A;  3AG3 C;  2XAG A;  3ASN B;  5CBF A;  2Q67 A;  1JJ2 U;  1M57 B;  3OAA G;  1FXH A;  1PD3 A;  1K97 A;  1R3L C;  2JJ1 G;  3MD0 A;  3OUF A;  3CC2 V;  4WFF A;  3OGC C;  1J95 A;  1OCR B;  1JOY A;  1MAB G;  2HKO A;  3HPL C;  1K73 W;  1S76 D;  2X0L A;  1KD1 W;  3F7V C;  4RQF A;  1K3E A;  1JVM A;  4HZ3 A;  4JGS A;  1YTF B;  5FL7 G;  3IFX A;  3OMI B;  4P9O A;  2ZDI C;  4QE9 A;  1GM7 A;  2B5U A;  4I5S A;  3G4S V;  4FMT A;  1OCR C;  2DQ3 A;  1LNQ A;  1R6N A;  2A0L A;  4MVQ A;  1ORQ C;  2AHZ A;  4R7C A;  2EZO A;  1EZJ A;  3QO5 A;  4RAI A;  3ZJZ A;  5IY5 C;  2EBO A;  4KP4 A;  1F4N A;  1QR9 A;  1GM8 A;  2WLK A;  4OXS A;  5EBW C;  2JIZ G;  1JPX A;  5KA5 A;  1VQ7 V;  4JAU A;  4QIW F;  4UVA A;  3LUT B;  2WWW A;  1RM1 C;  3DGE A;  2ZXW C;  4QJF B;  1M1K W;  5LGU A;  1GKF A;  2ATK C;  2LP7 A;  3W7W A;  3CCU V;  4MSW C;  1THZ A;  1VQ4 V;  5L3D A;  3TET A;  3UM7 A;  4DO2 A;  2WLL B;  3AG4 C;  2K1E A;  1NVP B;  3NXS A;  2F43 G;  5LBQ A;  3SJQ C;  5EC2 C;  4G28 B;  2A79 B;  4P9P A;  2HG5 C;  1BHA A;  4RO2 A;  3W7S A;  1I5Y A;  2EIL B;  2IW5 A;  1F51 A;  1S5H C;  4G2K A;  1NR7 A;  1QR8 A;  2XAJ A;  1R3J C;  2P67 A;  4UV9 A;  2WAM A;  5DN6 G;  2IJJ A;  3MHS C;  3OE7 G;  3CCR V;  3X2Q C;  4GT1 A;  1GTO A;  3CD6 V;  1FS0 G;  4LCU C;  4WF9 V;  1KEC A;  4DXW A;  2WLM A;  2X6C A;  1SRY A;  3ZMT A;  3ABU A;  2P90 A;  4YXW G;  2ZQM A;  4MW8 A;  2X6B A;  4JYB A;  1G8M A;  4Q20 A;  1EBO A;  3I56 V;  4WFA V;  4X8A A;  1VQK V;  2OTJ V;  2OCC C;  3ZRV A;  2ZR2 A;  3SPH A;  4TSF G;  4CZZ A;  2WLJ A;  2DWE C;  3RW0 A;  4E2L A;  5B3S B;  3D3I A;  3LDC A;  3CXC U;  2V7Q G;  4I9W A;  1BMF G;  3T4Z A;  2BOB C;  3GB7 C;  3ETD A;  2QTO A;  1M56 B;  1FXK B;  3RBZ A;  3ABL C;  5EC1 C;  1VQ8 V;  4BAY A;  2OCC B;  1JCH A;  2A9H A;  3R65 A;  1NBM G;  2B1I A;  1MSW D;  5CA3 A;  4XDL A;  4JAS A;  1NR1 A;  4PEL A;  3WFV A;  3E2E A;  1KC8 W;  1V55 B;  5B3S C;  2BOC C;  2XND G;  3ZMZ A;  4PA9 A;  3SYQ A;  3D36 A;  5H6Q A;  2QA4 V;  1DTO A;  3UKM A;  4TWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...