3K0DA

Crystal structure of cng mimicking nak mutant, nak-etpp, k+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
molecule tags Transport protein
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k0dA00
4MW3A 3LDEA 4J9YB 4G27B 2A9HA 4WFEA 2WLNA 1ZWIC 2EILC 3K06A 4PA3A 3K03A 3SJQC 5EBLC 4P2ZA 2NLJC 3F7YC 3SYQA 4JTCB 4RAIA 3ABKC 2WLJA 4R50A 2Q68A 1OCZC 2HVKC 1P7BA 3RVYA 4GX1A 5CBFA 4KFMA 3SPCA 4UUJC 3UM7A 1BL8A 1OCCC 2W0FC 1OCRC 4GX0A 1R3JC 3K0DA 3BEHA 5EC1C 1G4YB 2EIJC 4JTDB 4TWKA 4MS2A 1S5HC 2HFEC 1R3KC 2WLKA 2ZD9A 2WLLA 4XDLA 4MVSA 4R7CA 3UKMA 2AHZA 1M57C 1ORQC 3FB8C 4MW8A 3FB7C 1K4CC 4RO2A 4X89A 2BOCC 3TCUA 4MVMA 2EINC 2QKSA 4RUFA 2DWEC 4PA6A 3ZRSA 1J95A 2X6AA 3E89A 3LDCA 3K04A 3OGCC 3RBZA 5EBMC 3AG3C 4P9OA 4MVUA 4XDKA 2HJFC 4LCUC 5CBHA 1XL4A 1R3IC 2ZXWC 3ABMC 3SPGA 3T4DA 4H37A 2OCCC 2X6BA 4P9PA 4PDMA 4X8AA 2DYRC 2WLIB 4PA4A 2AHYA 1QLEC 3VOUA 4MTGA 3LNMB 4QE9A 4QE7A 5EC2C 2EIMC 4XDJA 1OCOC 3ASOC 5CBGA 3SYCA 3K08A 3ASNC 1KKDA 1M56C 4I9WA 2K1EA 2Q67A 3ZJZA 2IH1C 3SPJA 4PDLA 1R3LC 2Q6AA 3JYCA 3F5WC 4R8CA 3EFFK 5E1AC 3WG7C 4H33A 5J9PC 5B3SC 2X6CA 4BW5A 4WFFA 3LDDA 4X88A 3AG2C 3RW0A 5BZBA 2A0LA 4WFGA 3T4ZA 4GX2A 2WLMA 2DYSC 1V54C 3SPIA 3OUSA 1K4DC 4MVQA 5EK0A 2DWDC 4J9ZB 5B1AC 5KUKA 3HPLC 4P30A 2A79B 3KG2A 4QNHB 4HYOA 2ATKC 2IH3C 1JVMA 2WLHA 2BOBC 2KB1A 4MVRA 3FB5C 2HVJC 2R9RB 3E86A 3FB6C 4GX5A 3TETA 4RUEA 3SPHA 4MVZA 4DXWA 3F7VC 3E8GA 3AG4C 3IFXA 3AG1C 3STZC 3E8BA 4CBCA 4PA7A 3X2QC 4JTAB 3GB7C 2Y69C 2Q69A 3E8FA 4LBEC 4PA9A 3T2MA 2ITCC 1V55C 3K0GA 4MTFA 4WFHA 2JK5C 5IY5C 2P7TC 2HG5C 1XL6A 4MSWC 5KUMA 2ITDC 3RVZA 4EKWA 3OR6C 4MTOA 4F4LA 3T1CA 5EBWC 4LP8A 3E8HA 3OR7C 2EIKC 4G28B 4HZ3A 5B1BC 3SYOA 3ABLC 3E83A 3IGAC 3SYPA 2WLIA 2QTOA 3LUTB 3SYAA 4OXSA 4PDVA 4PDRA 4R6ZA 3STLC 1LNQA 3R65A 2WLLB 2YEVA 3PJSK 4ZBMA 4MVOA 3OUFA 2H8PC
chains in the Genus database with same CATH superfamily
3ZHSA 3L71H 2A9HA 3K79A 5C8YA 4O2BB 2JGUA 1KBHA 3CWBH 1J5EB 1BCCH 4U3JB 4RAIA 4DV3O 2EJRA 3WG7B 2PI4A 5JVDA 1M4UA 1RP3B 2DMXA 1YITV 4TUYB 2CTPA 1U96A 2Q8VA 1QCEA 2BSKB 3BVOA 1NH2D 3H1LH 1S76D 4PHZA 1R1BA 5EBMC 5IYZA 4XDKA 1QU7A 4XBFA 1MG1A 4F6RA 2X6BA 1HDJA 4GZRB 1NU1H 2WLIB 3CMAV 2M7WA 4QE9A 1BE3H 2V1DA 4QGPA 1JMKC 2RJZA 1VQMV 1KC8W 4ZHQA 5CA1B 3G4SV 3RYFA 3K5MA 4EFEA 3CJHB 1FJGB 2OCHA 3G6EV 1HR0O 1MOFA 1XDCA 1QQCA 4JV5B 5LP6C 3I5DA 4X1KA 5LYJA 3Q4HA 4LBEC 2GHYA 3DC5A 1XL6A 3FKSG 4MTOA 4DR7O 3CRRA 4TQFA 3P32A 3E8HA 5KAFZ 2MK3A 2ODMA 5JVDB 5BXZA 5IJ0A 1W2BU 3CSXA 3FX7A 4UCRA 4LNUA 2F1MA 1CEZA 1OCZB 3BRCA 3RN4A 3M8AA 4B7EA 2Z0AA 1SZTA 1NR1A 2WWWA 3ZMTA 3JD2A 1QR9A 4J42A 2H94A 3RYIA 4MT8A 1GO3F 5HFMA 3QO7A 4FLVA 3ABKC 1D5NA 1S3JA 2JDIG 1K5QA 4LF9O 3FFQA 2KG7B 1EZVH 3TK1A 3CMEV 1KB9F 2PZSA 1WN7A 4NXNO 4ZHQB 1S72V 3L75H 3FB7C 1QLEB 2VQFO 3RYFB 4DYLA 4LF6O 4FVMA 4JYCA 1DGSA 3K5LA 1CPYA 4DRXA 2X7RB 4O2AA 3P30A 4H13B 4LR3A 1WP7A 2W6JG 4I50B 2ADQB 1SQQH 2GV9A 1GRJA 1VF6C 4UFZA 2EZPA 1OCOC 2AXTZ 3ASOC 5EZYA 2XAFA 5LYJB 1A32A 5CMUA 3P3NA 1R3LC 2ARHA 2RNBA 2QR4A 1HP8A 2XASA 1PKXA 2R72A 3T4ZA 3UCSC 1THZA 1VQ9V 1JFFB 2Q4PA 1SQGA 1K4DC 2EILB 5IJ0B 1Y76A 1IBLB 1SQFA 1MSWD 1Y74B 2Y4TA 3ZBHA 3FYEB 4PDMA 2E76B 4DUZB 4B3SB 2EIKB 1YI2V 3E8GA 4LH7A 1AI4A 2XTAA 2Q7EA 4JTAB 2JIZG 3K0GA 4JYAB 1WP8A 2JK5C 5LMUB 4DR1O 1AI5A 3L74H 2PY5A 2ZT9B 4CH5A 1MSDA 1TGOA 2ILMA 3ABLC 5IJ9A 3ZN1A 2AZ2A 1XHZA 3SYAA 3CRCA 1B6QA 2YXLA 3ZX6A 3SJCC 1YJNV 1KECA 4WFEA 4J7ZA 4JGSA 1ZTEA 4I55B 1AILA 4P2ZA 3F7YC 5LP6A 5LHGA 3UT5A 1XREA 2P4VA 2WLJA 4O2AB 2YIDA 3DTUB 3CCSV 2PUSA 4L8JA 3BEHA 1S5HC 1VMGA 4LFBO 4RO2A 1PM9A 2EINC 3DXRB 1QVGU 1XNRO 2V7QG 4RUFA 4PA6A 1M93A 3QO5A 1OHHG 3OGCC 3W7UA 4FLXA 2OIEA 2AW9A 1VQLV 3ABMC 4P9PA 4X8AA 5H9CA 5LHIA 4TSFG 4K0KB 2LGQA 1JCHA 4O4LB 4WF9V 2DYSB 2IU3A 2DN9A 4NVPA 1KYOF 3LSUA 3RYCA 1PD3A 3OTOO 5KX5B 4OPHA 1RSOA 2Z3YA 2N05A 1COWG 5LGTA 3AG2C 1TAEA 4UV8A 3SR2C 1ROPA 2UXDB 1RM1B 4OX9B 3D36C 1H38A 5EYPA 3TETA 2OT5A 1AR1B 2HVJC 4DO2A 2HKOA 2YIBD 4KHPB 4PELA 5LOVA 3K9SA 4DV5B 3X2QC 4PV1B 4EB6B 4DUYO 1VQKV 3U0ZA 1VF6A 1YEWA 4JASA 2P90A 1AP5A 1VQPV 3RVZA 2UUAB 3UT5B 4E4EA 1E1QG 3HKBA 2ZR2A 1VF5B 5B66Z 3ZHVA 1DTOA 2ZM6B 4TV8B 2R9AA 2EBOA 2QTOA 5GONA 2JVDA 2Q0AA 3DSQA 3T1YO 1GN2A 1WPBA 1OCCB 4GYCB 1PP9H 1JOYA 4JI3B 1I5XA 3JSNA 1FD9A 1R3JC 1PL4A 2NNUA 1E1RG 3C90A 1XMQO 4JI0B 1R3KC 4X65B 3W7XA 5A2QN 2QA4V 2ZD9A 2FMLA 4XDLA 5BY1A 3RYCB 1JR9A 5JH7B 3E22A 4B3MB 1XOUA 2YUAA 1V9PA 1ZUQA 1Q8IA 2YDEA 2QEXV 1J95A 2X6AA 3E89A 3LDCA 4ICGA 3F5TA 2QKAA 1LUWA 5L3BA 4JZ2A 3SPGA 2E75B 4UVBA 2R9IA 4IHJA 1ZL8B 4FLWA 5L3DA 2OTLV 5E79Z 2E5LB 1PPJH 5C93A 3JATB 1SETA 1NBMG 1BZKA 3BAAA 3HKBB 1DK1A 4ABMA 5BR8O 1M5IA 3OUSA 1YTFD 1Z5WA 4FIPC 2UUCB 4K35A 5GONB 4DR4B 3MAQA 5DECA 2L6LA 1K33A 1SKVA 1VQ6V 2QWNB 4PA9A 4JI1O 1FFTB 1HNXB 2LO1A 3OR6C 1PNMA 2IJJA 2RN9A 3EXAA 1IXBA 1Q5OA 2EX3A 4CC5A 1K34A 1DLBA 5TISZ 2YC0A 1EBOA 3E22B 3SDLA 1NH2B 5EBLC 2UUBB 3CE2A 1H8HG 3M7MX 1H2NA 2Q68A 1OCZC 2AZ0A 4X66B 4DR3O 4UUJC 4IHJB 2XT9A 4LFAB 4MS2A 1J5EO 1F51A 4NR1A 4KXRA 1XEQA 3ZMVA 2VWJA 4DW0A 3QG5A 3DC6A 1Q81W 1HNWB 2QWQB 1M90W 4DV2O 3ZRSA 2E3CA 3RBZA 1TA8A 1BMFG 1QVFU 4LCUC 1I7FA 4GKKO 2P22C 2XOKG 1QLEC 3G80A 4YY3B 1VQ5V 4QE7A 3OTFA 4XDJA 5EC2C 1SC5B 4O4IA 5B1BB 5B1NA 5B1AB 2P6JA 1NQTA 3N2GA 1L0LH 3CPWU 4O2BA 3WFVA 5K1PA 1IBMO 4ASUG 4LF5O 1YF2A 1EN4A 2V4DA 4EFBA 5BZBA 4U3JA 4G2KA 4IYHA 2LFSA 2PI5A 4PI2A 1GAXA 4MVQA 4DV6B 2A79B 2ZNJA 2N74A 3FB5C 4RUEA 2QWRB 1SQVH 4TUYA 3IFXA 2OYQA 4CBCA 2BSKA 2DQ0A 5B1OA 3OFNG 3R66A 3BY6A 2QM8A 2UXCO 3BA8A 2EZOA 2HHHO 3L72H 2EIKC 1EN5A 1WAZA 4B3TO 1ZAUA 2YXYA 1AJPA 2WLIA 5FL7G 4DV7O 2JS3A 3PJSK 1B3QA 1VEWA 2F43G 3A8TA 2ZNIA 3FYIB 3NXSA 3ZHTA 1L0NH 3K03A 2VRZA 1KP2A 1GM7A 4HAMA 1YVWA 2DOSA 2XAQA 2YIAA 2NR5A 2UU9O 1P49A 1M9NA 4O4IB 3ZRXA 3OEHG 2WLLA 2QGNA 1AR5A 3FB8C 1N32O 4X89A 5J2TA 4D7SA 3KCXA 1SRYA 3NR7A 3K5NA 2WA4A 3ASNB 3B4SA 4DR6B 1AI6A 4DK0A 3H9VA 3M99B 5GW7A 1WB7A 1HNZB 2Q73A 1G8MA 3OEEG 4LF4O 4BW9A 3HR0A 4I5SA 3L70H 4NYKA 1HWYA 1W0JG 5LGUA 3JALB 4X1IA 4DR5B 1YZBA 4JI8O 3EHBB 4JI4B 1H2KA 4OPAA 3ZRVA 2DYSC 2ZIOA 4W4KA 2Y69B 2KSDA 3ZMUA 5KUKA 4AHCA 3CCVV 3ZN0A 2KG7A 4MVRA 2XAJA 4LWSA 2JS5A 1BQZA 4WFAV 3CCRV 3P3PA 4TT3G 5KA5A 3WU2Z 2YIBA 3KCYA 2QSAA 3HKDB 1RM1C 5KHKA 4LF7O 5IE9A 4MTFA 1W59A 2CTRA 4DUZO 2HG5C 1BQ0A 5KA6A 3QVNA 1N34B 1S5JA 4IL6Z 3BA9A 3OMIB 3CHXA 2WPDG 4UVAA 3IGAC 2F66C 4JYAO 4I50A 3MD0A 2QJ1A 4TV9A 2WLLB 4N23A 4R50A 3VQXA 4MVOA 1P84F 4GX0A 4MW3A 2ZE8A 4X62O 5J2TB 4I0XB 2UXBB 1NTZH 2OTJV 2BCCH 4BIUA 2FYUH 3ETQA 5IYBO 4JTCB 4JI5B 4L87A 3JAWA 3JCZA 4KFMA 1JFFA 1R6TA 1OCCC 1Y74A 1IBKB 2YICA 2RDCA 4X1IB 2DYRB 2FB5A 3TCUA 4DV0O 3APOA 1NR7A 1VARA 2HJFC 1Y67A 4LFCB 4LWSB 4JYBA 1K3EA 2QE7G 3FAVA 3SYCA 3A2FA 3CRQA 4LH6A 3ETGA 2Q6AA 3F5WC 3TXSA 3J7AU 1R6KA 4DK1A 3HKEA 4DR2B 1N36B 4I55A 2LQTA 1AI7A 1R73A 4ZI7B 4UCOA 3QO8A 1K9MW 1NT2B 1BSMA 3E86A 4TV9B 1IVSA 1N33O 4DV3B 3ZHQA 4X20B 2C2AA 5EIBC 3E8BA 3JASB 2P06A 5GTHZ 3GB7C 4CS4A 3O65A 1Q6UA 5L3CA 2HJDA 4ZKIA 3DXRA 2NN4A 2B9ZA 2QWOB 3RFRA 3QTCA 4KHPO 3JAWB 1IX9A 4FLUA 1WA8B 4R6ZA 3E2EA 4O4LA 4JI6O 5EK0A 4B08A 2OWOA 1F4NA 5H2FZ 2LFRA 2EIJB 5KX5A 3AG7A 1URFA 4JI7O 2D3OW 1G6UA 5CBFA 4PD4F 3LSSA 3MHSC 4UXNA 4UCVA 3FAVB 2XUMA 3N2KB 1KD1W 1TUEB 3GWOA 5IYDO 1N4CA 1OV9A 2OCCB 4Q6GA 1K4CC 1Q43A 2GBOA 4HNAA 4EB6A 3HKEB 4AQYB 3K59A 3JARA 2CGNA 5CB4A 4JI0O 3ZRWB 4D6TH 5GTIZ 2GDSA 2X0LA 2ZIMA 1SF9A 1CXZB 1NJIW 3J80N 5L3FA 4TV8A 1YTFB 1H2LA 1VQ4V 4DR7B 2EULA 4AILC 4J41A 1WPXA 2F95B 3G67A 3CC2V 2UXXA 4NTYA 4AI8A 2QTSA 2QWPB 5B1AC 3CP1A 1Y4MA 2VQEO 1XILA 4HYOA 2KB1A 4DV1O 2XAGA 5AG2A 4MVZA 1OZ0A 5D5PA 5F2VO 4UCTA 4LF9B 1MMMA 3B8NA 3I56V 1K73W 4FJCC 3O9OA 4Z1VA 2ZE6A 2K9PA 5JH7A 4NXNB 5KUMA 2ITDC 4WCEV 1JJ2U 2YSUB 1W0KG 3OR7C 2VQFB 3SYOA 4LF6B 5H6QA 5KHGA 2Y4UA 3SYPA 2XAHA 4PDRA 1S77D 2DE0X 4FM2A 1ZL8A 3QNEA 5LA6B 3SGIA 2WLNA 4HNAB 1ZWIC 3JATA 3JARB 5CB4B 1KP3A 3WB0A 5JCOA 1Q3EA 3A0HZ 4GX1A 5ITZA 3JCUZ 3SPCA 2CGOA 1XUQA 2CDYA 3UM7A 4C7UA 5L3GA 1GMGA 2F23A 3ML0A 3AG3B 3K5OA 2HFEC 1I94B 4NXMO 2A06H 3UKMA 3JD3A 4MW8A 1YJ9V 3EVKA 4FFKA 4U7OA 4FZ0A 5IWAO 4FLZA 1US6A 5KLVH 4J10A 4I9QA 1AR4A 3LNMB 4DR1B 3JD1A 4IT5A 3HKCA 1UPGA 2FTKA 3ASNC 3K08A 1Q6IA 4D7TA 3JSLA 4MTXA 2BE3A 1G1XB 3WG7C 5J2UB 3LDDA 1Z2GA 2CH7B 4WFBV 4YY3O 3U10A 2GUZB 3CS5A 1YXBA 1JVMA 2WLHA 2HR3A 4CH4A 1FXKB 1RPRA 1Y66A 3STZC 2G38A 3OE7G 2W6IG 5HFLA 4H0LB 1IZ3A 2Y69C 5DEDA 1FFXA 4N21A 2ITCC 3A0BZ 4F4LA 4LFBB 1MA1A 4LP8A 2CTWA 5LMNO 5ITZB 5LXTA 3BABA 1QNMA 1GM8A 4JF3A 1LR1A 2F4VO 2VS0A 1XNRB 1BHAA 1NS1A 3AEIA 4JAAA 3OMNB 4IIJB 1Q7YW 3H1HH 3H1JH 1XMOB 3CXCU 3SJQC 3LNNA 4X1YB 3OTOB 1P7BA 4B3RB 1GH6A 2W0FC 1IDSA 3IJ4A 2WSSG 3HKCB 1AROP 2WLKA 3ZIAG 3L9DA 4DV4O 4U7NA 3CEIA 1PV0A 2JEXA 3ABUA 1VQOV 3E35A 1R6NA 1UJWB 1SS3A 2FL4A 4YHHO 2P67A 3TGUH 2CUGA 4QIWF 5CA0A 3CYOA 1FXVA 4GKJO 2ZQMA 5CN0A 2LP7A 2PYJA 3PN1A 4DUYB 1XL4A 1R3IC 5B3SB 3OW2U 2DYRC 1Q90D 2AHYA 2LJ2A 4JI2B 3ZMZA 4DR6O 2YI8A 5JQGB 1SA0B 1TUBA 5LBQA 4R8CA 1FFXB 4H33A 3CRMA 5KMGA 4X88A 5DN6G 5LL6Y 1FXHA 3AG4B 1QHTA 3T1YB 4FPPA 5LXTB 4NKGB 1JPXA 2QDOA 2YS8A 4QNHB 1SZXA 1KU9A 3S3WA 3WB2A 1O9GA 5K1XA 1BS3A 1GN3A 1RFYA 4PA7A 3UQ8A 4CC6A 1L8DA 1NVPD 1XMQB 1JX9A 1FYJA 3OD4A 4MSWC 1SQXH 3N27A 3VBBA 2KKWA 5LHHA 5FNVB 2IW5A 1WJZA 1VF7A 2JGDB 3OM3B 2O57A 3L73H 2A7WA 3STLC 1LNQA 3ABTA 3BPZA 1XI1A 1FJGO 4UCSA 1FKAO 3JALA 1KKCA 5D5QA 1QR8A 2EILC 4RWUA 1E79G 1Z5VA 5CA0B 3B2EE 3SYQA 1BT8A 4DW1A 4JV5O 3AK2A 3RVYA 3JAMN 1WB8A 2HLDG 2CE4A 4GCZA 1BL8A 5H6RA 4IYIA 2WAMA 2EIJC 4TWKA 1GK9A 5BR8B 4MVSA 2Y0IA 2AHZA 4ZIBA 4RQEA 1T5EA 1TUBB 4I7ZB 4LF8B 4BR6A 3C3TA 5KMGB 3VQYA 2QKSA 3HKDA 4B7KA 4Z2WA 2DWEC 3B09A 1Q6HA 3CB2A 3GVMA 3IC9A 4FZ1A 5BMVA 5FLXN 4JI1B 4H37A 2IJKA 2OCCC 1XNQB 4PA4A 4HBNA 1N0NA 1SERA 4YJ3B 4H44B 1V54B 1GTOA 4EEQA 3OMAB 4O4HB 5LGNA 4CZZA 3W7TA 1VQNV 4LFCO 2VWKA 1EZJA 4KUMA 3SJBC 4BW5A 4I0XA 1PL0A 3AG1B 1GKFA 4QJFB 3ICXA 1V55B 3U11A 1DF5A 4GX5A 2R9RB 1N36O 4JYYA 4YJ2B 3JD4A 1HW7A 4DR3B 1CP9A 1SQBH 2Q69A 2GSMB 3K58A 3THOA 4YIOA 1YJWV 4DV2B 1B06A 3JD0A 3ZHRA 1UFIA 2RMKB 4U3FH 5KAIZ 2FKXA 4GKKB 3LDEA 1OCRB 1IBLO 1U97A 1OJHA 1M57B 3CX5F 5BMVB 3VQWA 4B3SO 3C3SA 4ZI7A 1IBMB 3B77A 4LF5B 3K0DA 4TOIA 5LMUO 2Z5UA 3RT3C 2ZXWB 4X20A 3JASA 2BOCC 3VQVA 4F6EA 4GUNA 2EIMB 1M56B 1GN4A 3K04A 2P5OA 3AG3C 1TVKB 1F23A 2JJ1G 3S3XA 2UXCB 1H2MA 1EM1A 1WA8A 4AQYO 2HHHB 3B8MA 2BTQA 4FM0A 4UVCA 5C8YB 4X64B 2IH1C 4B3TB 4PDLA 3ETDA 4X9QA 4DV7B 3G6BA 1NKDA 2LW7A 3RW0A 4IGGA 5JJJB 2DWDC 4J9ZB 1D2DA 3HPLC 2IH3C 3KKYA 3CCEV 2F93B 2IBZH 3F7VC 1KMIZ 3N2KA 1NI8A 2UU9B 5KHJA 3J81N 3T2MA 3G71V 2UXNA 2QKCA 4K0KO 3APQA 2ZINA 5IYZB 1H8EG 2B5UA 5DM6V 1XQ8A 3BHPA 1FXKC 3FD9A 3T1HB 1N32B 4F6RB 3ZRWA 2GTSA 1JQ0A 4W4LA 3CRAA 3GWKC 3K3WA 1K7DA 3R65A 5JCOC 2UXDO 4G27B 5KHHA 4LF4B 4OX9O 4CS3A 2HVKC 2DQ3A 4DV5O 4JI8B 4FFBA 4K3AA 5JWPA 1AJQA 4NTXA 4X1KB 2BTQB 3Q4HB 2UUAO 1PNLA 4R7CA 1KUQA 4FK5C 2LGWA 1GN6A 3ZMSA 2ZM6O 1Q86W 1SQPH 3I55V 1I5YA 4GLXA 2R70A 4J11A 4P9OA 4MVUA 1I94O 5IDJA 3WB1A 4LF7B 4LNUB 1MZEA 1P7GA 3KZIZ 5H5NA 2YXHA 4ZOLA 3CCUV 1MZFA 3W7SA 4FMTA 1KKDA 4I9WA 4K8XA 1N0JA 1B04A 1HR0B 5LA6A 1AB3A 4JI3O 3EFFK 5B3SC 3RYIB 2W0XA 2IJIA 4X65O 2DW4A 4X62B 1YHQV 2B1IA 2QM7A 5IY5B 4Z1MG 2ATKC 1K5SA 2GTAA 2IU0A 4A5UB 3FB6C 4B3MO 3SPHA 5JJNB 3AG4C 2HEPA 3ETEA 3TJTA 4Q20A 3HB3B 3D8CA 2JJ2G 1MABG 2ZKOA 4DRXB 4UB6Z 4HZ3A 1I08A 5B1BC 4DV0B 4FFBB 1QLNA 2E5LO 3BCCH 3E83A 2IM9A 5EZYB 2E74B 2DJVA 3LUTB 4PDVA 4PJ0Z 2XNDG 4JPRA 1S5LZ 4J9YB 3CCLV 3H1KH 3B40A 4PA3A 2UUCO 5J2UA 2CH7A 1JJOA 4O4JA 4DR4O 1AP6A 1GM9A 1L1FA 1Y76B 4WBNA 2GUZA 2LW1A 1XMOO 1DF4A 5EC1C 4ZOLB 2BTOA 1VP7A 1FPOA 1FXKA 1HNXO 2RCVA 5FPRA 2PF4E 3DGEA 2CTQA 5B5EZ 3ZCCA 2IJHA 1YIJV 4B3RO 3RYHA 1F7YA 1N33B 4I4TA 1WNSA 2ZE5A 3OGIB 1YSCA 1IURA 4JAUA 5IJ9B 4GT1A 1EN6A 4BIZA 1YCIA 5CBGA 4UCUA 2UUBO 2B1GA 2Q67A 4IIJA 4BWAA 3ZJZA 3W7WA 3IC7A 2KQXA 5E1AC 4X66O 3CCMV 5LP6B 3CC4V 1NVPB 4JI6B 2A0LA 4JI2O 4LFAO 1V54C 2CAZC 3SPIA 4X1YA 4P30A 1K8AW 1HNWO 4MVMA 2BOBC 4JI7B 1NTMH 3K9AA 1H2SB 4CS2A 2P4KA 1P4RA 1M1KW 4RQFA 3AG1C 4KP4A 2ADPA 3E8FA 4LC1A 1V55C 4O4JB 1XHXA 4WBNB 3CCJV 1ZX3A 1BGYH 1ZSPA 3ABKB 3TXQA 4ZBMA 3OUFA 2H8PC 1VQ8V 1RSOB 5JQGA 3RYHB 1SA0A 4I4TB 3K06A 4DV6O 3OT7A 1D5AA 2NLJC 3AK3A 1Y6XA 4UB8Z 2Q9LA 5EYPB 2JEUA 5IT9N 3H1IH 1OCRC 2Y0PA 4JTDB 2ZR3A 3RGBA 5LOVB 1M57C 1ORQC 1MNGA 2VQEB 4JAVA 4DV1B 1QBZA 2ETNA 1OCOB 3ASOB 3CCQV 2OIGA 5KHIA 1AJNA 1FS0G 2ZXWC 2RQ6A 4J7JA 2ZDIC 4LF8O 1EFRG 5FNVA 2HP8A 4MTGA 2A3QA 2JGDA 2EIMC 2EJ7A 1O9HA 1M56C 1VQ7V 2K1EA 4UV9A 4QPKA 3SPJA 2PGGA 1XNQO 3K57A 4WFFA 4E2LA 1X4TA 4WFGA 3MDSA 3CD6V 1AVMA 2Q7GA 4JZGA 2D2CB 1YDXA 4DXWA 3CXHF 3A0RA 3ABLB 3D36A 1HNZO 5IYCO 4WFHA 5A9GA 4NXMB 3ZS8C 4EKWA 3T1CA 2Q0OC 5EBWC 1K97A 4NB5A 2ZCEA 4FM1A 4G28B 3JAKA 1H2GA 4DR5O 4PI0A 1IXMA 5IWAB 3SJAC 4JI4O 3MHHC 2YEVA 4YJ3A 4J7KA 1JA8A 2CK3G 4O4HA 2H3OA 1BHBA 3BFRA 3H01A 1S0VA 3UO3A 1FAFA 2EINB 4KL1A 2WA3A 1G4YB 3ZEDA 3CC7V 4FLTA 1RPOA 3ABMB 2JRIA 4YJ2A 1N34O 2M6YA 3D3QA 1F4MA 4CH6A 1WLEA 1NZ6A 4BIOA 5CBHA 3T4DA 1NTKH 3AG2B 2UXBO 1ENVA 1VIBA 2Q5ZA 5LMNB 5L3EA 4JI5O 2PTMA 2F4VB 3UO2A 4OGQB 4YIPA 3JYCA 5J9PC 1XBLA 2X6CA 2AGAA 3LSQA 1N8RW 1IBKO 1LUVA 4GX2A 2WLMA 3X2QB 1X59A 3D3IA 3JAKB 3RWRD 4X64O 4CH3A 3KG2A 2Y48A 1PNKA 2YI9A 2Q7HA 4NTWA 1I0HA 4J80A 4K8ZA 2YEVB 2MW2B 4YXWG 1Q82W 5JJEB 2N04A 2XHBA 3AK1A 5CA1A 2ZDIA 4BAYA 2L35A 2QM4A 5EIBD 5IY5C 4FLYA 2P7TC 4TQDA 1ZLZA 5FPOA 4DV4B 3CJHA 3IAYA 5CA3A 3QF7A 3OAAG 1TVKA 3ZHUA 4YHHB 1KQSU 2ZE7A 4GKJB 1K92A 1SESA 4OXSA 4QPJA 2PYLA 4DR2O 3N2GB 3VOUA 3T1HO
chains in the Genus database with same CATH topology
4G27B 1EBOA 2A9HA 3K79A 2WLNA 1ZWIC 1NH2B 5EBLC 1KP3A 1H8HG 4RAIA 2EJRA 2Q68A 1OCZC 2HVKC 3WG7B 2PI4A 4GX1A 2DQ3A 3SPCA 4UUJC 3UM7A 5L3GA 1GMGA 1YITV 1AJQA 3ML0A 3AG3B 4MS2A 1F51A 2HFEC 1QCEA 3ZMVA 1PNLA 4R7CA 3UKMA 3JD3A 4FK5C 4MW8A 1YJ9V 1Q81W 1NH2D 1M90W 4U7OA 3ZMSA 1S76D 1Q86W 3ZRSA 3I55V 1I5YA 3RBZA 5EBMC 4P9OA 1BMFG 4MVUA 4XDKA 1QVFU 5IDJA 4LCUC 4XBFA 1MG1A 2X6BA 2XOKG 2WLIB 1QLEC 3CMAV 2M7WA 3LNMB 4QE9A 1VQ5V 3JD1A 2V1DA 4QE7A 5EC2C 4XDJA 3CCUV 5B1BB 4FMTA 2FTKA 3ASNC 3K08A 5B1NA 4I9WA 3W7SA 1KKDA 5B1AB 2P6JA 1NQTA 1VQMV 1KC8W 3G4SV 4MTXA 3EFFK 3CPWU 3WG7C 3WFVA 5B3SC 3LDDA 4WFBV 4ASUG 5BZBA 4G2KA 2IJIA 2LFSA 2PI5A 2DW4A 1YHQV 3G6EV 2B1IA 2QM7A 1MOFA 4MVQA 5IY5B 2A79B 4Z1MG 2ATKC 1K5SA 1JVMA 2WLHA 2IU0A 3FB5C 3FB6C 2HR3A 1FXKB 4RUEA 3SPHA 1RPRA 1Y66A 3AG4C 3ETEA 3IFXA 3STZC 4CBCA 3OE7G 2W6IG 5HFLA 2DQ0A 5B1OA 3OFNG 4Q20A 2Y69C 3BY6A 3HB3B 2GHYA 2QM8A 4LBEC 4N21A 2ITCC 2JJ2G 1MABG 1XL6A 3FKSG 4MTOA 4F4LA 2EZOA 4LP8A 3P32A 3E8HA 2EIKC 2MK3A 4HZ3A 5B1BC 1QLNA 1GM8A 4JF3A 1W2BU 3E83A 1BHAA 3AEIA 1AJPA 2WLIA 5FL7G 3LUTB 4PDVA 3OMNB 1CEZA 2XNDG 1OCZB 4JPRA 3PJSK 1Q7YW 2F43G 4J9YB 1SZTA 3CCLV 1NR1A 2WWWA 3ZMTA 3CXCU 3JD2A 1QR9A 3FYIB 3NXSA 4PA3A 3K03A 3SJQC 2H94A 1KP2A 1GO3F 1GM7A 4HAMA 4MT8A 5HFMA 3QO7A 1GM9A 3ABKC 1L1FA 1S3JA 1P7BA 1K5QA 2JDIG 2XAQA 2W0FC 1DF4A 3TK1A 5EC1C 3CMEV 2WSSG 1M9NA 1AROP 2WLKA 3ZRXA 3OEHG 1FXKA 3ZIAG 2WLLA 4U7NA 2JEXA 1S72V 3ABUA 3DGEA 3FB8C 3FB7C 1QLEB 1VQOV 3E35A 1R6NA 4X89A 1UJWB 3ZCCA 2IJHA 1YIJV 1SRYA 2P67A 3ASNB 4JYCA 4QIWF 3CYOA 1FXVA 2ZQMA 5CN0A 2LP7A 1AI6A 1YSCA 1CPYA 3M99B 2X7RB 5GW7A 4JAUA 1XL4A 3P30A 1R3IC 5B3SB 3OW2U 2DYRC 1G8MA 2W6JG 3OEEG 2AHYA 4I5SA 4GT1A 4BIZA 2EZPA 3ASOC 1OCOC 1HWYA 5CBGA 1W0JG 3ZMZA 5LGUA 2XAFA 2B1GA 2Q67A 3ZJZA 5CMUA 3W7WA 1R3LC 5LBQA 3IC7A 4R8CA 5E1AC 3CCMV 4H33A 3EHBB 4X88A 5DN6G 3CC4V 1NVPB 1FXHA 3AG4B 2XASA 1PKXA 2A0LA 3T4ZA 3ZRVA 4FPPA 2DYSC 1THZA 1VQ9V 1V54C 2Y69B 3SPIA 1K4DC 2EILB 3ZMUA 1JPXA 5KUKA 1MSWD 4P30A 4QNHB 1K8AW 3FYEB 3ZN0A 3CCVV 4MVRA 2XAJA 4PDMA 4MVMA 2BOBC 3K9AA 4WFAV 3CCRV 1P4RA 1M1KW 2EIKB 4TT3G 3E8GA 5KA5A 4RQFA 1YI2V 3AG1C 1AI4A 4KP4A 4PA7A 4JTAB 1RM1C 3E8FA 4LC1A 2JIZG 1NVPD 1V55C 3K0GA 4MTFA 1JX9A 2JK5C 2HG5C 4MSWC 5KA6A 1AI5A 3VBBA 3CCJV 5LHHA 3OMIB 2IW5A 2WPDG 3ABLC 4UVAA 3IGAC 3ZN1A 3OM3B 3SYAA 3ABKB 3MD0A 3STLC 1LNQA 3ABTA 2WLLB 1B6QA 4N23A 4R50A 4ZBMA 4MVOA 3OUFA 2H8PC 4GX0A 4MW3A 1YJNV 1KECA 1VQ8V 4WFEA 1QR8A 2EILC 3K06A 1E79G 4JGSA 4BIUA 2OTJV 4P2ZA 2NLJC 3F7YC 5IYBO 3SYQA 5LHGA 4JTCB 4L87A 2WLJA 3JCZA 3RVYA 3DTUB 2HLDG 2JEUA 4KFMA 3CCSV 4GCZA 1BL8A 5H6RA 1OCCC 1OCRC 2WAMA 3BEHA 2EIJC 4JTDB 4TWKA 1GK9A 2ZR3A 1S5HC 4MVSA 2AHZA 4RQEA 1M57C 2DYRB 1ORQC 4JAVA 4RO2A 3TCUA 1QBZA 1OCOB 2EINC 2QKSA 3ASOB 3CCQV 1QVGU 2V7QG 4RUFA 2DWEC 4PA6A 3QO5A 1OHHG 3OGCC 1NR7A 3W7UA 1VQLV 2HJFC 1AJNA 1FS0G 2ZXWC 3ABMC 4H37A 2IJKA 2OCCC 2ZDIC 4P9PA 4X8AA 1EFRG 4TSFG 5H9CA 4PA4A 4JYBA 5LHIA 1K3EA 4MTGA 2QE7G 1JCHA 4WF9V 1SERA 2DYSB 2EIMC 1V54B 1GTOA 2IU3A 3SYCA 1M56C 3OMAB 1VQ7V 2K1EA 5LGNA 4CZZA 3W7TA 1PD3A 4UV9A 1VQNV 3ETGA 4QPKA 3SPJA 2Q6AA 3F5WC 1EZJA 4KUMA 2Z3YA 1R6KA 4WFFA 4BW5A 1COWG 4E2LA 5LGTA 3AG2C 1PL0A 3AG1B 4UV8A 4WFGA 1GKFA 1ROPA 1AI7A 1R73A 4QJFB 1RM1B 3CD6V 1V55B 3QO8A 1H38A 1K9MW 1DF5A 3TETA 2OT5A 1AR1B 2HVJC 2R9RB 3E86A 4GX5A 4DO2A 2HKOA 4DXWA 4PELA 3JD4A 2C2AA 3E8BA 3A0RA 3ABLB 3D36A 1CP9A 3X2QC 3GB7C 2Q69A 1VQKV 5IYCO 4WFHA 5L3CA 2GSMB 4JASA 4ZKIA 2P90A 1VQPV 3RVZA 4EKWA 1E1QG 3T1CA 5EBWC 1K97A 2ZR2A 4G28B 1DTOA 1H2GA 1YJWV 2EBOA 3JD0A 1IXMA 2QTOA 3MHHC 4R6ZA 3E2EA 2YEVA 5EK0A 2CK3G 3LDEA 1F4NA 1OCCB 1OCRB 2LFRA 2EIJB 1BHBA 1M57B 3H01A 1JOYA 2D3OW 1S0VA 5CBFA 1I5XA 2EINB 3LSSA 3MHSC 3B77A 4UXNA 1R3JC 3K0DA 2NNUA 1G4YB 3QNEA 3CC7V 1E1RG 1KD1W 1TUEB 1R3KC 2Z5UA 3GWOA 5IYDO 3W7XA 1RPOA 2ZD9A 2ZXWB 3ABMB 4XDLA 2QA4V 2OCCB 1K4CC 2BOCC 1F4MA 2EIMB 1M56B 2QEXV 1J95A 2X6AA 1WLEA 3E89A 3LDCA 3K04A 3ZRWB 3AG3C 2X0LA 5CBHA 5L3BA 1NJIW 3SPGA 1F23A 3T4DA 2JJ1G 3AG2B 5L3FA 1YTFB 4UVBA 2R9IA 1VQ4V 1ENVA 3B8MA 5L3EA 5L3DA 2OTLV 1WPXA 4UVCA 2IH1C 5C93A 4PDLA 3JYCA 3CC2V 1SETA 3ETDA 5J9PC 2X6CA 3LSQA 2UXXA 1NBMG 1NKDA 1N8RW 3RW0A 4GX2A 2WLMA 3X2QB 3D3IA 3OUSA 5B1AC 2DWDC 4J9ZB 1YTFD 3CP1A 3HPLC 1Y4MA 3KG2A 2Y48A 4FIPC 4HYOA 1PNKA 2IH3C 2XAGA 2KB1A 4MVZA 1OZ0A 3CCEV 2YEVB 3F7VC 4YXWG 1Q82W 1K33A 3B8NA 3I56V 1K73W 4FJCC 2ZDIA 4BAYA 1VQ6V 4PA9A 3T2MA 1FFTB 3G71V 2UXNA 5IY5C 2P7TC 5KUMA 2ITDC 1H8EG 4WCEV 3OR6C 1JJ2U 2B5UA 5DM6V 5CA3A 2YSUB 1FXKC 1PNMA 2IJJA 1W0KG 3OR7C 3ZRWA 3OAAG 1JQ0A 3SYOA 5H6QA 1KQSU 3SYPA 2XAHA 1K92A 1SESA 4OXSA 4PDRA 1K34A 3K3WA 1S77D 4QPJA 1K7DA 3R65A 3VOUA 1DLBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MW3 A;  3LDE A;  4J9Y B;  4G27 B;  2A9H A;  4WFE A;  2WLN A;  1ZWI C;  2EIL C;  3K06 A;  4PA3 A;  3K03 A;  3SJQ C;  5EBL C;  4P2Z A;  2NLJ C;  3F7Y C;  3SYQ A;  4JTC B;  4RAI A;  3ABK C;  2WLJ A;  4R50 A;  2Q68 A;  1OCZ C;  2HVK C;  1P7B A;  3RVY A;  4GX1 A;  5CBF A;  4KFM A;  3SPC A;  4UUJ C;  3UM7 A;  1BL8 A;  1OCC C;  2W0F C;  1OCR C;  4GX0 A;  1R3J C;  3K0D A;  3BEH A;  5EC1 C;  1G4Y B;  2EIJ C;  4JTD B;  4TWK A;  4MS2 A;  1S5H C;  2HFE C;  1R3K C;  2WLK A;  2ZD9 A;  2WLL A;  4XDL A;  4MVS A;  4R7C A;  3UKM A;  2AHZ A;  1M57 C;  1ORQ C;  3FB8 C;  4MW8 A;  3FB7 C;  1K4C C;  4RO2 A;  4X89 A;  2BOC C;  3TCU A;  4MVM A;  2EIN C;  2QKS A;  4RUF A;  2DWE C;  4PA6 A;  3ZRS A;  1J95 A;  2X6A A;  3E89 A;  3LDC A;  3K04 A;  3OGC C;  3RBZ A;  5EBM C;  3AG3 C;  4P9O A;  4MVU A;  4XDK A;  2HJF C;  4LCU C;  5CBH A;  1XL4 A;  1R3I C;  2ZXW C;  3ABM C;  3SPG A;  3T4D A;  4H37 A;  2OCC C;  2X6B A;  4P9P A;  4PDM A;  4X8A A;  2DYR C;  2WLI B;  4PA4 A;  2AHY A;  1QLE C;  3VOU A;  4MTG A;  3LNM B;  4QE9 A;  4QE7 A;  5EC2 C;  2EIM C;  4XDJ A;  1OCO C;  3ASO C;  5CBG A;  3SYC A;  3K08 A;  3ASN C;  1KKD A;  1M56 C;  4I9W A;  2K1E A;  2Q67 A;  3ZJZ A;  2IH1 C;  3SPJ A;  4PDL A;  1R3L C;  2Q6A A;  3JYC A;  3F5W C;  4R8C A;  3EFF K;  5E1A C;  3WG7 C;  4H33 A;  5J9P C;  5B3S C;  2X6C A;  4BW5 A;  4WFF A;  3LDD A;  4X88 A;  3AG2 C;  3RW0 A;  5BZB A;  2A0L A;  4WFG A;  3T4Z A;  4GX2 A;  2WLM A;  2DYS C;  1V54 C;  3SPI A;  3OUS A;  1K4D C;  4MVQ A;  5EK0 A;  2DWD C;  4J9Z B;  5B1A C;  5KUK A;  3HPL C;  4P30 A;  2A79 B;  3KG2 A;  4QNH B;  4HYO A;  2ATK C;  2IH3 C;  1JVM A;  2WLH A;  2BOB C;  2KB1 A;  4MVR A;  3FB5 C;  2HVJ C;  2R9R B;  3E86 A;  3FB6 C;  4GX5 A;  3TET A;  4RUE A;  3SPH A;  4MVZ A;  4DXW A;  3F7V C;  3E8G A;  3AG4 C;  3IFX A;  3AG1 C;  3STZ C;  3E8B A;  4CBC A;  4PA7 A;  3X2Q C;  4JTA B;  3GB7 C;  2Y69 C;  2Q69 A;  3E8F A;  4LBE C;  4PA9 A;  3T2M A;  2ITC C;  1V55 C;  3K0G A;  4MTF A;  4WFH A;  2JK5 C;  5IY5 C;  2P7T C;  2HG5 C;  1XL6 A;  4MSW C;  5KUM A;  2ITD C;  3RVZ A;  4EKW A;  3OR6 C;  4MTO A;  4F4L A;  3T1C A;  5EBW C;  4LP8 A;  3E8H A;  3OR7 C;  2EIK C;  4G28 B;  4HZ3 A;  5B1B C;  3SYO A;  3ABL C;  3E83 A;  3IGA C;  3SYP A;  2WLI A;  2QTO A;  3LUT B;  3SYA A;  4OXS A;  4PDV A;  4PDR A;  4R6Z A;  3STL C;  1LNQ A;  3R65 A;  2WLL B;  2YEV A;  3PJS K;  4ZBM A;  4MVO A;  3OUF A;  2H8P C; 
#chains in the Genus database with same CATH topology
 3ZHS A;  3L71 H;  2A9H A;  3K79 A;  5C8Y A;  4O2B B;  2JGU A;  1KBH A;  3CWB H;  1J5E B;  1BCC H;  4U3J B;  4RAI A;  4DV3 O;  2EJR A;  3WG7 B;  2PI4 A;  5JVD A;  1M4U A;  1RP3 B;  2DMX A;  1YIT V;  4TUY B;  2CTP A;  1U96 A;  2Q8V A;  1QCE A;  2BSK B;  3BVO A;  1NH2 D;  3H1L H;  1S76 D;  4PHZ A;  1R1B A;  5EBM C;  5IYZ A;  4XDK A;  1QU7 A;  4XBF A;  1MG1 A;  4F6R A;  2X6B A;  1HDJ A;  4GZR B;  1NU1 H;  2WLI B;  3CMA V;  2M7W A;  4QE9 A;  1BE3 H;  2V1D A;  4QGP A;  1JMK C;  2RJZ A;  1VQM V;  1KC8 W;  4ZHQ A;  5CA1 B;  3G4S V;  3RYF A;  3K5M A;  4EFE A;  3CJH B;  1FJG B;  2OCH A;  3G6E V;  1HR0 O;  1MOF A;  1XDC A;  1QQC A;  4JV5 B;  5LP6 C;  3I5D A;  4X1K A;  5LYJ A;  3Q4H A;  4LBE C;  2GHY A;  3DC5 A;  1XL6 A;  3FKS G;  4MTO A;  4DR7 O;  3CRR A;  4TQF A;  3P32 A;  3E8H A;  5KAF Z;  2MK3 A;  2ODM A;  5JVD B;  5BXZ A;  5IJ0 A;  1W2B U;  3CSX A;  3FX7 A;  4UCR A;  4LNU A;  2F1M A;  1CEZ A;  1OCZ B;  3BRC A;  3RN4 A;  3M8A A;  4B7E A;  2Z0A A;  1SZT A;  1NR1 A;  2WWW A;  3ZMT A;  3JD2 A;  1QR9 A;  4J42 A;  2H94 A;  3RYI A;  4MT8 A;  1GO3 F;  5HFM A;  3QO7 A;  4FLV A;  3ABK C;  1D5N A;  1S3J A;  2JDI G;  1K5Q A;  4LF9 O;  3FFQ A;  2KG7 B;  1EZV H;  3TK1 A;  3CME V;  1KB9 F;  2PZS A;  1WN7 A;  4NXN O;  4ZHQ B;  1S72 V;  3L75 H;  3FB7 C;  1QLE B;  2VQF O;  3RYF B;  4DYL A;  4LF6 O;  4FVM A;  4JYC A;  1DGS A;  3K5L A;  1CPY A;  4DRX A;  2X7R B;  4O2A A;  3P30 A;  4H13 B;  4LR3 A;  1WP7 A;  2W6J G;  4I50 B;  2ADQ B;  1SQQ H;  2GV9 A;  1GRJ A;  1VF6 C;  4UFZ A;  2EZP A;  1OCO C;  2AXT Z;  3ASO C;  5EZY A;  2XAF A;  5LYJ B;  1A32 A;  5CMU A;  3P3N A;  1R3L C;  2ARH A;  2RNB A;  2QR4 A;  1HP8 A;  2XAS A;  1PKX A;  2R72 A;  3T4Z A;  3UCS C;  1THZ A;  1VQ9 V;  1JFF B;  2Q4P A;  1SQG A;  1K4D C;  2EIL B;  5IJ0 B;  1Y76 A;  1IBL B;  1SQF A;  1MSW D;  1Y74 B;  2Y4T A;  3ZBH A;  3FYE B;  4PDM A;  2E76 B;  4DUZ B;  4B3S B;  2EIK B;  1YI2 V;  3E8G A;  4LH7 A;  1AI4 A;  2XTA A;  2Q7E A;  4JTA B;  2JIZ G;  3K0G A;  4JYA B;  1WP8 A;  2JK5 C;  5LMU B;  4DR1 O;  1AI5 A;  3L74 H;  2PY5 A;  2ZT9 B;  4CH5 A;  1MSD A;  1TGO A;  2ILM A;  3ABL C;  5IJ9 A;  3ZN1 A;  2AZ2 A;  1XHZ A;  3SYA A;  3CRC A;  1B6Q A;  2YXL A;  3ZX6 A;  3SJC C;  1YJN V;  1KEC A;  4WFE A;  4J7Z A;  4JGS A;  1ZTE A;  4I55 B;  1AIL A;  4P2Z A;  3F7Y C;  5LP6 A;  5LHG A;  3UT5 A;  1XRE A;  2P4V A;  2WLJ A;  4O2A B;  2YID A;  3DTU B;  3CCS V;  2PUS A;  4L8J A;  3BEH A;  1S5H C;  1VMG A;  4LFB O;  4RO2 A;  1PM9 A;  2EIN C;  3DXR B;  1QVG U;  1XNR O;  2V7Q G;  4RUF A;  4PA6 A;  1M93 A;  3QO5 A;  1OHH G;  3OGC C;  3W7U A;  4FLX A;  2OIE A;  2AW9 A;  1VQL V;  3ABM C;  4P9P A;  4X8A A;  5H9C A;  5LHI A;  4TSF G;  4K0K B;  2LGQ A;  1JCH A;  4O4L B;  4WF9 V;  2DYS B;  2IU3 A;  2DN9 A;  4NVP A;  1KYO F;  3LSU A;  3RYC A;  1PD3 A;  3OTO O;  5KX5 B;  4OPH A;  1RSO A;  2Z3Y A;  2N05 A;  1COW G;  5LGT A;  3AG2 C;  1TAE A;  4UV8 A;  3SR2 C;  1ROP A;  2UXD B;  1RM1 B;  4OX9 B;  3D36 C;  1H38 A;  5EYP A;  3TET A;  2OT5 A;  1AR1 B;  2HVJ C;  4DO2 A;  2HKO A;  2YIB D;  4KHP B;  4PEL A;  5LOV A;  3K9S A;  4DV5 B;  3X2Q C;  4PV1 B;  4EB6 B;  4DUY O;  1VQK V;  3U0Z A;  1VF6 A;  1YEW A;  4JAS A;  2P90 A;  1AP5 A;  1VQP V;  3RVZ A;  2UUA B;  3UT5 B;  4E4E A;  1E1Q G;  3HKB A;  2ZR2 A;  1VF5 B;  5B66 Z;  3ZHV A;  1DTO A;  2ZM6 B;  4TV8 B;  2R9A A;  2EBO A;  2QTO A;  5GON A;  2JVD A;  2Q0A A;  3DSQ A;  3T1Y O;  1GN2 A;  1WPB A;  1OCC B;  4GYC B;  1PP9 H;  1JOY A;  4JI3 B;  1I5X A;  3JSN A;  1FD9 A;  1R3J C;  1PL4 A;  2NNU A;  1E1R G;  3C90 A;  1XMQ O;  4JI0 B;  1R3K C;  4X65 B;  3W7X A;  5A2Q N;  2QA4 V;  2ZD9 A;  2FML A;  4XDL A;  5BY1 A;  3RYC B;  1JR9 A;  5JH7 B;  3E22 A;  4B3M B;  1XOU A;  2YUA A;  1V9P A;  1ZUQ A;  1Q8I A;  2YDE A;  2QEX V;  1J95 A;  2X6A A;  3E89 A;  3LDC A;  4ICG A;  3F5T A;  2QKA A;  1LUW A;  5L3B A;  4JZ2 A;  3SPG A;  2E75 B;  4UVB A;  2R9I A;  4IHJ A;  1ZL8 B;  4FLW A;  5L3D A;  2OTL V;  5E79 Z;  2E5L B;  1PPJ H;  5C93 A;  3JAT B;  1SET A;  1NBM G;  1BZK A;  3BAA A;  3HKB B;  1DK1 A;  4ABM A;  5BR8 O;  1M5I A;  3OUS A;  1YTF D;  1Z5W A;  4FIP C;  2UUC B;  4K35 A;  5GON B;  4DR4 B;  3MAQ A;  5DEC A;  2L6L A;  1K33 A;  1SKV A;  1VQ6 V;  2QWN B;  4PA9 A;  4JI1 O;  1FFT B;  1HNX B;  2LO1 A;  3OR6 C;  1PNM A;  2IJJ A;  2RN9 A;  3EXA A;  1IXB A;  1Q5O A;  2EX3 A;  4CC5 A;  1K34 A;  1DLB A;  5TIS Z;  2YC0 A;  1EBO A;  3E22 B;  3SDL A;  1NH2 B;  5EBL C;  2UUB B;  3CE2 A;  1H8H G;  3M7M X;  1H2N A;  2Q68 A;  1OCZ C;  2AZ0 A;  4X66 B;  4DR3 O;  4UUJ C;  4IHJ B;  2XT9 A;  4LFA B;  4MS2 A;  1J5E O;  1F51 A;  4NR1 A;  4KXR A;  1XEQ A;  3ZMV A;  2VWJ A;  4DW0 A;  3QG5 A;  3DC6 A;  1Q81 W;  1HNW B;  2QWQ B;  1M90 W;  4DV2 O;  3ZRS A;  2E3C A;  3RBZ A;  1TA8 A;  1BMF G;  1QVF U;  4LCU C;  1I7F A;  4GKK O;  2P22 C;  2XOK G;  1QLE C;  3G80 A;  4YY3 B;  1VQ5 V;  4QE7 A;  3OTF A;  4XDJ A;  5EC2 C;  1SC5 B;  4O4I A;  5B1B B;  5B1N A;  5B1A B;  2P6J A;  1NQT A;  3N2G A;  1L0L H;  3CPW U;  4O2B A;  3WFV A;  5K1P A;  1IBM O;  4ASU G;  4LF5 O;  1YF2 A;  1EN4 A;  2V4D A;  4EFB A;  5BZB A;  4U3J A;  4G2K A;  4IYH A;  2LFS A;  2PI5 A;  4PI2 A;  1GAX A;  4MVQ A;  4DV6 B;  2A79 B;  2ZNJ A;  2N74 A;  3FB5 C;  4RUE A;  2QWR B;  1SQV H;  4TUY A;  3IFX A;  2OYQ A;  4CBC A;  2BSK A;  2DQ0 A;  5B1O A;  3OFN G;  3R66 A;  3BY6 A;  2QM8 A;  2UXC O;  3BA8 A;  2EZO A;  2HHH O;  3L72 H;  2EIK C;  1EN5 A;  1WAZ A;  4B3T O;  1ZAU A;  2YXY A;  1AJP A;  2WLI A;  5FL7 G;  4DV7 O;  2JS3 A;  3PJS K;  1B3Q A;  1VEW A;  2F43 G;  3A8T A;  2ZNI A;  3FYI B;  3NXS A;  3ZHT A;  1L0N H;  3K03 A;  2VRZ A;  1KP2 A;  1GM7 A;  4HAM A;  1YVW A;  2DOS A;  2XAQ A;  2YIA A;  2NR5 A;  2UU9 O;  1P49 A;  1M9N A;  4O4I B;  3ZRX A;  3OEH G;  2WLL A;  2QGN A;  1AR5 A;  3FB8 C;  1N32 O;  4X89 A;  5J2T A;  4D7S A;  3KCX A;  1SRY A;  3NR7 A;  3K5N A;  2WA4 A;  3ASN B;  3B4S A;  4DR6 B;  1AI6 A;  4DK0 A;  3H9V A;  3M99 B;  5GW7 A;  1WB7 A;  1HNZ B;  2Q73 A;  1G8M A;  3OEE G;  4LF4 O;  4BW9 A;  3HR0 A;  4I5S A;  3L70 H;  4NYK A;  1HWY A;  1W0J G;  5LGU A;  3JAL B;  4X1I A;  4DR5 B;  1YZB A;  4JI8 O;  3EHB B;  4JI4 B;  1H2K A;  4OPA A;  3ZRV A;  2DYS C;  2ZIO A;  4W4K A;  2Y69 B;  2KSD A;  3ZMU A;  5KUK A;  4AHC A;  3CCV V;  3ZN0 A;  2KG7 A;  4MVR A;  2XAJ A;  4LWS A;  2JS5 A;  1BQZ A;  4WFA V;  3CCR V;  3P3P A;  4TT3 G;  5KA5 A;  3WU2 Z;  2YIB A;  3KCY A;  2QSA A;  3HKD B;  1RM1 C;  5KHK A;  4LF7 O;  5IE9 A;  4MTF A;  1W59 A;  2CTR A;  4DUZ O;  2HG5 C;  1BQ0 A;  5KA6 A;  3QVN A;  1N34 B;  1S5J A;  4IL6 Z;  3BA9 A;  3OMI B;  3CHX A;  2WPD G;  4UVA A;  3IGA C;  2F66 C;  4JYA O;  4I50 A;  3MD0 A;  2QJ1 A;  4TV9 A;  2WLL B;  4N23 A;  4R50 A;  3VQX A;  4MVO A;  1P84 F;  4GX0 A;  4MW3 A;  2ZE8 A;  4X62 O;  5J2T B;  4I0X B;  2UXB B;  1NTZ H;  2OTJ V;  2BCC H;  4BIU A;  2FYU H;  3ETQ A;  5IYB O;  4JTC B;  4JI5 B;  4L87 A;  3JAW A;  3JCZ A;  4KFM A;  1JFF A;  1R6T A;  1OCC C;  1Y74 A;  1IBK B;  2YIC A;  2RDC A;  4X1I B;  2DYR B;  2FB5 A;  3TCU A;  4DV0 O;  3APO A;  1NR7 A;  1VAR A;  2HJF C;  1Y67 A;  4LFC B;  4LWS B;  4JYB A;  1K3E A;  2QE7 G;  3FAV A;  3SYC A;  3A2F A;  3CRQ A;  4LH6 A;  3ETG A;  2Q6A A;  3F5W C;  3TXS A;  3J7A U;  1R6K A;  4DK1 A;  3HKE A;  4DR2 B;  1N36 B;  4I55 A;  2LQT A;  1AI7 A;  1R73 A;  4ZI7 B;  4UCO A;  3QO8 A;  1K9M W;  1NT2 B;  1BSM A;  3E86 A;  4TV9 B;  1IVS A;  1N33 O;  4DV3 B;  3ZHQ A;  4X20 B;  2C2A A;  5EIB C;  3E8B A;  3JAS B;  2P06 A;  5GTH Z;  3GB7 C;  4CS4 A;  3O65 A;  1Q6U A;  5L3C A;  2HJD A;  4ZKI A;  3DXR A;  2NN4 A;  2B9Z A;  2QWO B;  3RFR A;  3QTC A;  4KHP O;  3JAW B;  1IX9 A;  4FLU A;  1WA8 B;  4R6Z A;  3E2E A;  4O4L A;  4JI6 O;  5EK0 A;  4B08 A;  2OWO A;  1F4N A;  5H2F Z;  2LFR A;  2EIJ B;  5KX5 A;  3AG7 A;  1URF A;  4JI7 O;  2D3O W;  1G6U A;  5CBF A;  4PD4 F;  3LSS A;  3MHS C;  4UXN A;  4UCV A;  3FAV B;  2XUM A;  3N2K B;  1KD1 W;  1TUE B;  3GWO A;  5IYD O;  1N4C A;  1OV9 A;  2OCC B;  4Q6G A;  1K4C C;  1Q43 A;  2GBO A;  4HNA A;  4EB6 A;  3HKE B;  4AQY B;  3K59 A;  3JAR A;  2CGN A;  5CB4 A;  4JI0 O;  3ZRW B;  4D6T H;  5GTI Z;  2GDS A;  2X0L A;  2ZIM A;  1SF9 A;  1CXZ B;  1NJI W;  3J80 N;  5L3F A;  4TV8 A;  1YTF B;  1H2L A;  1VQ4 V;  4DR7 B;  2EUL A;  4AIL C;  4J41 A;  1WPX A;  2F95 B;  3G67 A;  3CC2 V;  2UXX A;  4NTY A;  4AI8 A;  2QTS A;  2QWP B;  5B1A C;  3CP1 A;  1Y4M A;  2VQE O;  1XIL A;  4HYO A;  2KB1 A;  4DV1 O;  2XAG A;  5AG2 A;  4MVZ A;  1OZ0 A;  5D5P A;  5F2V O;  4UCT A;  4LF9 B;  1MMM A;  3B8N A;  3I56 V;  1K73 W;  4FJC C;  3O9O A;  4Z1V A;  2ZE6 A;  2K9P A;  5JH7 A;  4NXN B;  5KUM A;  2ITD C;  4WCE V;  1JJ2 U;  2YSU B;  1W0K G;  3OR7 C;  2VQF B;  3SYO A;  4LF6 B;  5H6Q A;  5KHG A;  2Y4U A;  3SYP A;  2XAH A;  4PDR A;  1S77 D;  2DE0 X;  4FM2 A;  1ZL8 A;  3QNE A;  5LA6 B;  3SGI A;  2WLN A;  4HNA B;  1ZWI C;  3JAT A;  3JAR B;  5CB4 B;  1KP3 A;  3WB0 A;  5JCO A;  1Q3E A;  3A0H Z;  4GX1 A;  5ITZ A;  3JCU Z;  3SPC A;  2CGO A;  1XUQ A;  2CDY A;  3UM7 A;  4C7U A;  5L3G A;  1GMG A;  2F23 A;  3ML0 A;  3AG3 B;  3K5O A;  2HFE C;  1I94 B;  4NXM O;  2A06 H;  3UKM A;  3JD3 A;  4MW8 A;  1YJ9 V;  3EVK A;  4FFK A;  4U7O A;  4FZ0 A;  5IWA O;  4FLZ A;  1US6 A;  5KLV H;  4J10 A;  4I9Q A;  1AR4 A;  3LNM B;  4DR1 B;  3JD1 A;  4IT5 A;  3HKC A;  1UPG A;  2FTK A;  3ASN C;  3K08 A;  1Q6I A;  4D7T A;  3JSL A;  4MTX A;  2BE3 A;  1G1X B;  3WG7 C;  5J2U B;  3LDD A;  1Z2G A;  2CH7 B;  4WFB V;  4YY3 O;  3U10 A;  2GUZ B;  3CS5 A;  1YXB A;  1JVM A;  2WLH A;  2HR3 A;  4CH4 A;  1FXK B;  1RPR A;  1Y66 A;  3STZ C;  2G38 A;  3OE7 G;  2W6I G;  5HFL A;  4H0L B;  1IZ3 A;  2Y69 C;  5DED A;  1FFX A;  4N21 A;  2ITC C;  3A0B Z;  4F4L A;  4LFB B;  1MA1 A;  4LP8 A;  2CTW A;  5LMN O;  5ITZ B;  5LXT A;  3BAB A;  1QNM A;  1GM8 A;  4JF3 A;  1LR1 A;  2F4V O;  2VS0 A;  1XNR B;  1BHA A;  1NS1 A;  3AEI A;  4JAA A;  3OMN B;  4IIJ B;  1Q7Y W;  3H1H H;  3H1J H;  1XMO B;  3CXC U;  3SJQ C;  3LNN A;  4X1Y B;  3OTO B;  1P7B A;  4B3R B;  1GH6 A;  2W0F C;  1IDS A;  3IJ4 A;  2WSS G;  3HKC B;  1ARO P;  2WLK A;  3ZIA G;  3L9D A;  4DV4 O;  4U7N A;  3CEI A;  1PV0 A;  2JEX A;  3ABU A;  1VQO V;  3E35 A;  1R6N A;  1UJW B;  1SS3 A;  2FL4 A;  4YHH O;  2P67 A;  3TGU H;  2CUG A;  4QIW F;  5CA0 A;  3CYO A;  1FXV A;  4GKJ O;  2ZQM A;  5CN0 A;  2LP7 A;  2PYJ A;  3PN1 A;  4DUY B;  1XL4 A;  1R3I C;  5B3S B;  3OW2 U;  2DYR C;  1Q90 D;  2AHY A;  2LJ2 A;  4JI2 B;  3ZMZ A;  4DR6 O;  2YI8 A;  5JQG B;  1SA0 B;  1TUB A;  5LBQ A;  4R8C A;  1FFX B;  4H33 A;  3CRM A;  5KMG A;  4X88 A;  5DN6 G;  5LL6 Y;  1FXH A;  3AG4 B;  1QHT A;  3T1Y B;  4FPP A;  5LXT B;  4NKG B;  1JPX A;  2QDO A;  2YS8 A;  4QNH B;  1SZX A;  1KU9 A;  3S3W A;  3WB2 A;  1O9G A;  5K1X A;  1BS3 A;  1GN3 A;  1RFY A;  4PA7 A;  3UQ8 A;  4CC6 A;  1L8D A;  1NVP D;  1XMQ B;  1JX9 A;  1FYJ A;  3OD4 A;  4MSW C;  1SQX H;  3N27 A;  3VBB A;  2KKW A;  5LHH A;  5FNV B;  2IW5 A;  1WJZ A;  1VF7 A;  2JGD B;  3OM3 B;  2O57 A;  3L73 H;  2A7W A;  3STL C;  1LNQ A;  3ABT A;  3BPZ A;  1XI1 A;  1FJG O;  4UCS A;  1FKA O;  3JAL A;  1KKC A;  5D5Q A;  1QR8 A;  2EIL C;  4RWU A;  1E79 G;  1Z5V A;  5CA0 B;  3B2E E;  3SYQ A;  1BT8 A;  4DW1 A;  4JV5 O;  3AK2 A;  3RVY A;  3JAM N;  1WB8 A;  2HLD G;  2CE4 A;  4GCZ A;  1BL8 A;  5H6R A;  4IYI A;  2WAM A;  2EIJ C;  4TWK A;  1GK9 A;  5BR8 B;  4MVS A;  2Y0I A;  2AHZ A;  4ZIB A;  4RQE A;  1T5E A;  1TUB B;  4I7Z B;  4LF8 B;  4BR6 A;  3C3T A;  5KMG B;  3VQY A;  2QKS A;  3HKD A;  4B7K A;  4Z2W A;  2DWE C;  3B09 A;  1Q6H A;  3CB2 A;  3GVM A;  3IC9 A;  4FZ1 A;  5BMV A;  5FLX N;  4JI1 B;  4H37 A;  2IJK A;  2OCC C;  1XNQ B;  4PA4 A;  4HBN A;  1N0N A;  1SER A;  4YJ3 B;  4H44 B;  1V54 B;  1GTO A;  4EEQ A;  3OMA B;  4O4H B;  5LGN A;  4CZZ A;  3W7T A;  1VQN V;  4LFC O;  2VWK A;  1EZJ A;  4KUM A;  3SJB C;  4BW5 A;  4I0X A;  1PL0 A;  3AG1 B;  1GKF A;  4QJF B;  3ICX A;  1V55 B;  3U11 A;  1DF5 A;  4GX5 A;  2R9R B;  1N36 O;  4JYY A;  4YJ2 B;  3JD4 A;  1HW7 A;  4DR3 B;  1CP9 A;  1SQB H;  2Q69 A;  2GSM B;  3K58 A;  3THO A;  4YIO A;  1YJW V;  4DV2 B;  1B06 A;  3JD0 A;  3ZHR A;  1UFI A;  2RMK B;  4U3F H;  5KAI Z;  2FKX A;  4GKK B;  3LDE A;  1OCR B;  1IBL O;  1U97 A;  1OJH A;  1M57 B;  3CX5 F;  5BMV B;  3VQW A;  4B3S O;  3C3S A;  4ZI7 A;  1IBM B;  3B77 A;  4LF5 B;  3K0D A;  4TOI A;  5LMU O;  2Z5U A;  3RT3 C;  2ZXW B;  4X20 A;  3JAS A;  2BOC C;  3VQV A;  4F6E A;  4GUN A;  2EIM B;  1M56 B;  1GN4 A;  3K04 A;  2P5O A;  3AG3 C;  1TVK B;  1F23 A;  2JJ1 G;  3S3X A;  2UXC B;  1H2M A;  1EM1 A;  1WA8 A;  4AQY O;  2HHH B;  3B8M A;  2BTQ A;  4FM0 A;  4UVC A;  5C8Y B;  4X64 B;  2IH1 C;  4B3T B;  4PDL A;  3ETD A;  4X9Q A;  4DV7 B;  3G6B A;  1NKD A;  2LW7 A;  3RW0 A;  4IGG A;  5JJJ B;  2DWD C;  4J9Z B;  1D2D A;  3HPL C;  2IH3 C;  3KKY A;  3CCE V;  2F93 B;  2IBZ H;  3F7V C;  1KMI Z;  3N2K A;  1NI8 A;  2UU9 B;  5KHJ A;  3J81 N;  3T2M A;  3G71 V;  2UXN A;  2QKC A;  4K0K O;  3APQ A;  2ZIN A;  5IYZ B;  1H8E G;  2B5U A;  5DM6 V;  1XQ8 A;  3BHP A;  1FXK C;  3FD9 A;  3T1H B;  1N32 B;  4F6R B;  3ZRW A;  2GTS A;  1JQ0 A;  4W4L A;  3CRA A;  3GWK C;  3K3W A;  1K7D A;  3R65 A;  5JCO C;  2UXD O;  4G27 B;  5KHH A;  4LF4 B;  4OX9 O;  4CS3 A;  2HVK C;  2DQ3 A;  4DV5 O;  4JI8 B;  4FFB A;  4K3A A;  5JWP A;  1AJQ A;  4NTX A;  4X1K B;  2BTQ B;  3Q4H B;  2UUA O;  1PNL A;  4R7C A;  1KUQ A;  4FK5 C;  2LGW A;  1GN6 A;  3ZMS A;  2ZM6 O;  1Q86 W;  1SQP H;  3I55 V;  1I5Y A;  4GLX A;  2R70 A;  4J11 A;  4P9O A;  4MVU A;  1I94 O;  5IDJ A;  3WB1 A;  4LF7 B;  4LNU B;  1MZE A;  1P7G A;  3KZI Z;  5H5N A;  2YXH A;  4ZOL A;  3CCU V;  1MZF A;  3W7S A;  4FMT A;  1KKD A;  4I9W A;  4K8X A;  1N0J A;  1B04 A;  1HR0 B;  5LA6 A;  1AB3 A;  4JI3 O;  3EFF K;  5B3S C;  3RYI B;  2W0X A;  2IJI A;  4X65 O;  2DW4 A;  4X62 B;  1YHQ V;  2B1I A;  2QM7 A;  5IY5 B;  4Z1M G;  2ATK C;  1K5S A;  2GTA A;  2IU0 A;  4A5U B;  3FB6 C;  4B3M O;  3SPH A;  5JJN B;  3AG4 C;  2HEP A;  3ETE A;  3TJT A;  4Q20 A;  3HB3 B;  3D8C A;  2JJ2 G;  1MAB G;  2ZKO A;  4DRX B;  4UB6 Z;  4HZ3 A;  1I08 A;  5B1B C;  4DV0 B;  4FFB B;  1QLN A;  2E5L O;  3BCC H;  3E83 A;  2IM9 A;  5EZY B;  2E74 B;  2DJV A;  3LUT B;  4PDV A;  4PJ0 Z;  2XND G;  4JPR A;  1S5L Z;  4J9Y B;  3CCL V;  3H1K H;  3B40 A;  4PA3 A;  2UUC O;  5J2U A;  2CH7 A;  1JJO A;  4O4J A;  4DR4 O;  1AP6 A;  1GM9 A;  1L1F A;  1Y76 B;  4WBN A;  2GUZ A;  2LW1 A;  1XMO O;  1DF4 A;  5EC1 C;  4ZOL B;  2BTO A;  1VP7 A;  1FPO A;  1FXK A;  1HNX O;  2RCV A;  5FPR A;  2PF4 E;  3DGE A;  2CTQ A;  5B5E Z;  3ZCC A;  2IJH A;  1YIJ V;  4B3R O;  3RYH A;  1F7Y A;  1N33 B;  4I4T A;  1WNS A;  2ZE5 A;  3OGI B;  1YSC A;  1IUR A;  4JAU A;  5IJ9 B;  4GT1 A;  1EN6 A;  4BIZ A;  1YCI A;  5CBG A;  4UCU A;  2UUB O;  2B1G A;  2Q67 A;  4IIJ A;  4BWA A;  3ZJZ A;  3W7W A;  3IC7 A;  2KQX A;  5E1A C;  4X66 O;  3CCM V;  5LP6 B;  3CC4 V;  1NVP B;  4JI6 B;  2A0L A;  4JI2 O;  4LFA O;  1V54 C;  2CAZ C;  3SPI A;  4X1Y A;  4P30 A;  1K8A W;  1HNW O;  4MVM A;  2BOB C;  4JI7 B;  1NTM H;  3K9A A;  1H2S B;  4CS2 A;  2P4K A;  1P4R A;  1M1K W;  4RQF A;  3AG1 C;  4KP4 A;  2ADP A;  3E8F A;  4LC1 A;  1V55 C;  4O4J B;  1XHX A;  4WBN B;  3CCJ V;  1ZX3 A;  1BGY H;  1ZSP A;  3ABK B;  3TXQ A;  4ZBM A;  3OUF A;  2H8P C;  1VQ8 V;  1RSO B;  5JQG A;  3RYH B;  1SA0 A;  4I4T B;  3K06 A;  4DV6 O;  3OT7 A;  1D5A A;  2NLJ C;  3AK3 A;  1Y6X A;  4UB8 Z;  2Q9L A;  5EYP B;  2JEU A;  5IT9 N;  3H1I H;  1OCR C;  2Y0P A;  4JTD B;  2ZR3 A;  3RGB A;  5LOV B;  1M57 C;  1ORQ C;  1MNG A;  2VQE B;  4JAV A;  4DV1 B;  1QBZ A;  2ETN A;  1OCO B;  3ASO B;  3CCQ V;  2OIG A;  5KHI A;  1AJN A;  1FS0 G;  2ZXW C;  2RQ6 A;  4J7J A;  2ZDI C;  4LF8 O;  1EFR G;  5FNV A;  2HP8 A;  4MTG A;  2A3Q A;  2JGD A;  2EIM C;  2EJ7 A;  1O9H A;  1M56 C;  1VQ7 V;  2K1E A;  4UV9 A;  4QPK A;  3SPJ A;  2PGG A;  1XNQ O;  3K57 A;  4WFF A;  4E2L A;  1X4T A;  4WFG A;  3MDS A;  3CD6 V;  1AVM A;  2Q7G A;  4JZG A;  2D2C B;  1YDX A;  4DXW A;  3CXH F;  3A0R A;  3ABL B;  3D36 A;  1HNZ O;  5IYC O;  4WFH A;  5A9G A;  4NXM B;  3ZS8 C;  4EKW A;  3T1C A;  2Q0O C;  5EBW C;  1K97 A;  4NB5 A;  2ZCE A;  4FM1 A;  4G28 B;  3JAK A;  1H2G A;  4DR5 O;  4PI0 A;  1IXM A;  5IWA B;  3SJA C;  4JI4 O;  3MHH C;  2YEV A;  4YJ3 A;  4J7K A;  1JA8 A;  2CK3 G;  4O4H A;  2H3O A;  1BHB A;  3BFR A;  3H01 A;  1S0V A;  3UO3 A;  1FAF A;  2EIN B;  4KL1 A;  2WA3 A;  1G4Y B;  3ZED A;  3CC7 V;  4FLT A;  1RPO A;  3ABM B;  2JRI A;  4YJ2 A;  1N34 O;  2M6Y A;  3D3Q A;  1F4M A;  4CH6 A;  1WLE A;  1NZ6 A;  4BIO A;  5CBH A;  3T4D A;  1NTK H;  3AG2 B;  2UXB O;  1ENV A;  1VIB A;  2Q5Z A;  5LMN B;  5L3E A;  4JI5 O;  2PTM A;  2F4V B;  3UO2 A;  4OGQ B;  4YIP A;  3JYC A;  5J9P C;  1XBL A;  2X6C A;  2AGA A;  3LSQ A;  1N8R W;  1IBK O;  1LUV A;  4GX2 A;  2WLM A;  3X2Q B;  1X59 A;  3D3I A;  3JAK B;  3RWR D;  4X64 O;  4CH3 A;  3KG2 A;  2Y48 A;  1PNK A;  2YI9 A;  2Q7H A;  4NTW A;  1I0H A;  4J80 A;  4K8Z A;  2YEV B;  2MW2 B;  4YXW G;  1Q82 W;  5JJE B;  2N04 A;  2XHB A;  3AK1 A;  5CA1 A;  2ZDI A;  4BAY A;  2L35 A;  2QM4 A;  5EIB D;  5IY5 C;  4FLY A;  2P7T C;  4TQD A;  1ZLZ A;  5FPO A;  4DV4 B;  3CJH A;  3IAY A;  5CA3 A;  3QF7 A;  3OAA G;  1TVK A;  3ZHU A;  4YHH B;  1KQS U;  2ZE7 A;  4GKJ B;  1K92 A;  1SES A;  4OXS A;  4QPJ A;  2PYL A;  4DR2 O;  3N2G B;  3VOU A;  3T1H O; 
#chains in the Genus database with same CATH homology
 4G27 B;  1EBO A;  2A9H A;  3K79 A;  2WLN A;  1ZWI C;  1NH2 B;  5EBL C;  1KP3 A;  1H8H G;  4RAI A;  2EJR A;  2Q68 A;  1OCZ C;  2HVK C;  3WG7 B;  2PI4 A;  4GX1 A;  2DQ3 A;  3SPC A;  4UUJ C;  3UM7 A;  5L3G A;  1GMG A;  1YIT V;  1AJQ A;  3ML0 A;  3AG3 B;  4MS2 A;  1F51 A;  2HFE C;  1QCE A;  3ZMV A;  1PNL A;  4R7C A;  3UKM A;  3JD3 A;  4FK5 C;  4MW8 A;  1YJ9 V;  1Q81 W;  1NH2 D;  1M90 W;  4U7O A;  3ZMS A;  1S76 D;  1Q86 W;  3ZRS A;  3I55 V;  1I5Y A;  3RBZ A;  5EBM C;  4P9O A;  1BMF G;  4MVU A;  4XDK A;  1QVF U;  5IDJ A;  4LCU C;  4XBF A;  1MG1 A;  2X6B A;  2XOK G;  2WLI B;  1QLE C;  3CMA V;  2M7W A;  3LNM B;  4QE9 A;  1VQ5 V;  3JD1 A;  2V1D A;  4QE7 A;  5EC2 C;  4XDJ A;  3CCU V;  5B1B B;  4FMT A;  2FTK A;  3ASN C;  3K08 A;  5B1N A;  4I9W A;  3W7S A;  1KKD A;  5B1A B;  2P6J A;  1NQT A;  1VQM V;  1KC8 W;  3G4S V;  4MTX A;  3EFF K;  3CPW U;  3WG7 C;  3WFV A;  5B3S C;  3LDD A;  4WFB V;  4ASU G;  5BZB A;  4G2K A;  2IJI A;  2LFS A;  2PI5 A;  2DW4 A;  1YHQ V;  3G6E V;  2B1I A;  2QM7 A;  1MOF A;  4MVQ A;  5IY5 B;  2A79 B;  4Z1M G;  2ATK C;  1K5S A;  1JVM A;  2WLH A;  2IU0 A;  3FB5 C;  3FB6 C;  2HR3 A;  1FXK B;  4RUE A;  3SPH A;  1RPR A;  1Y66 A;  3AG4 C;  3ETE A;  3IFX A;  3STZ C;  4CBC A;  3OE7 G;  2W6I G;  5HFL A;  2DQ0 A;  5B1O A;  3OFN G;  4Q20 A;  2Y69 C;  3BY6 A;  3HB3 B;  2GHY A;  2QM8 A;  4LBE C;  4N21 A;  2ITC C;  2JJ2 G;  1MAB G;  1XL6 A;  3FKS G;  4MTO A;  4F4L A;  2EZO A;  4LP8 A;  3P32 A;  3E8H A;  2EIK C;  2MK3 A;  4HZ3 A;  5B1B C;  1QLN A;  1GM8 A;  4JF3 A;  1W2B U;  3E83 A;  1BHA A;  3AEI A;  1AJP A;  2WLI A;  5FL7 G;  3LUT B;  4PDV A;  3OMN B;  1CEZ A;  2XND G;  1OCZ B;  4JPR A;  3PJS K;  1Q7Y W;  2F43 G;  4J9Y B;  1SZT A;  3CCL V;  1NR1 A;  2WWW A;  3ZMT A;  3CXC U;  3JD2 A;  1QR9 A;  3FYI B;  3NXS A;  4PA3 A;  3K03 A;  3SJQ C;  2H94 A;  1KP2 A;  1GO3 F;  1GM7 A;  4HAM A;  4MT8 A;  5HFM A;  3QO7 A;  1GM9 A;  3ABK C;  1L1F A;  1S3J A;  1P7B A;  1K5Q A;  2JDI G;  2XAQ A;  2W0F C;  1DF4 A;  3TK1 A;  5EC1 C;  3CME V;  2WSS G;  1M9N A;  1ARO P;  2WLK A;  3ZRX A;  3OEH G;  1FXK A;  3ZIA G;  2WLL A;  4U7N A;  2JEX A;  1S72 V;  3ABU A;  3DGE A;  3FB8 C;  3FB7 C;  1QLE B;  1VQO V;  3E35 A;  1R6N A;  4X89 A;  1UJW B;  3ZCC A;  2IJH A;  1YIJ V;  1SRY A;  2P67 A;  3ASN B;  4JYC A;  4QIW F;  3CYO A;  1FXV A;  2ZQM A;  5CN0 A;  2LP7 A;  1AI6 A;  1YSC A;  1CPY A;  3M99 B;  2X7R B;  5GW7 A;  4JAU A;  1XL4 A;  3P30 A;  1R3I C;  5B3S B;  3OW2 U;  2DYR C;  1G8M A;  2W6J G;  3OEE G;  2AHY A;  4I5S A;  4GT1 A;  4BIZ A;  2EZP A;  3ASO C;  1OCO C;  1HWY A;  5CBG A;  1W0J G;  3ZMZ A;  5LGU A;  2XAF A;  2B1G A;  2Q67 A;  3ZJZ A;  5CMU A;  3W7W A;  1R3L C;  5LBQ A;  3IC7 A;  4R8C A;  5E1A C;  3CCM V;  4H33 A;  3EHB B;  4X88 A;  5DN6 G;  3CC4 V;  1NVP B;  1FXH A;  3AG4 B;  2XAS A;  1PKX A;  2A0L A;  3T4Z A;  3ZRV A;  4FPP A;  2DYS C;  1THZ A;  1VQ9 V;  1V54 C;  2Y69 B;  3SPI A;  1K4D C;  2EIL B;  3ZMU A;  1JPX A;  5KUK A;  1MSW D;  4P30 A;  4QNH B;  1K8A W;  3FYE B;  3ZN0 A;  3CCV V;  4MVR A;  2XAJ A;  4PDM A;  4MVM A;  2BOB C;  3K9A A;  4WFA V;  3CCR V;  1P4R A;  1M1K W;  2EIK B;  4TT3 G;  3E8G A;  5KA5 A;  4RQF A;  1YI2 V;  3AG1 C;  1AI4 A;  4KP4 A;  4PA7 A;  4JTA B;  1RM1 C;  3E8F A;  4LC1 A;  2JIZ G;  1NVP D;  1V55 C;  3K0G A;  4MTF A;  1JX9 A;  2JK5 C;  2HG5 C;  4MSW C;  5KA6 A;  1AI5 A;  3VBB A;  3CCJ V;  5LHH A;  3OMI B;  2IW5 A;  2WPD G;  3ABL C;  4UVA A;  3IGA C;  3ZN1 A;  3OM3 B;  3SYA A;  3ABK B;  3MD0 A;  3STL C;  1LNQ A;  3ABT A;  2WLL B;  1B6Q A;  4N23 A;  4R50 A;  4ZBM A;  4MVO A;  3OUF A;  2H8P C;  4GX0 A;  4MW3 A;  1YJN V;  1KEC A;  1VQ8 V;  4WFE A;  1QR8 A;  2EIL C;  3K06 A;  1E79 G;  4JGS A;  4BIU A;  2OTJ V;  4P2Z A;  2NLJ C;  3F7Y C;  5IYB O;  3SYQ A;  5LHG A;  4JTC B;  4L87 A;  2WLJ A;  3JCZ A;  3RVY A;  3DTU B;  2HLD G;  2JEU A;  4KFM A;  3CCS V;  4GCZ A;  1BL8 A;  5H6R A;  1OCC C;  1OCR C;  2WAM A;  3BEH A;  2EIJ C;  4JTD B;  4TWK A;  1GK9 A;  2ZR3 A;  1S5H C;  4MVS A;  2AHZ A;  4RQE A;  1M57 C;  2DYR B;  1ORQ C;  4JAV A;  4RO2 A;  3TCU A;  1QBZ A;  1OCO B;  2EIN C;  2QKS A;  3ASO B;  3CCQ V;  1QVG U;  2V7Q G;  4RUF A;  2DWE C;  4PA6 A;  3QO5 A;  1OHH G;  3OGC C;  1NR7 A;  3W7U A;  1VQL V;  2HJF C;  1AJN A;  1FS0 G;  2ZXW C;  3ABM C;  4H37 A;  2IJK A;  2OCC C;  2ZDI C;  4P9P A;  4X8A A;  1EFR G;  4TSF G;  5H9C A;  4PA4 A;  4JYB A;  5LHI A;  1K3E A;  4MTG A;  2QE7 G;  1JCH A;  4WF9 V;  1SER A;  2DYS B;  2EIM C;  1V54 B;  1GTO A;  2IU3 A;  3SYC A;  1M56 C;  3OMA B;  1VQ7 V;  2K1E A;  5LGN A;  4CZZ A;  3W7T A;  1PD3 A;  4UV9 A;  1VQN V;  3ETG A;  4QPK A;  3SPJ A;  2Q6A A;  3F5W C;  1EZJ A;  4KUM A;  2Z3Y A;  1R6K A;  4WFF A;  4BW5 A;  1COW G;  4E2L A;  5LGT A;  3AG2 C;  1PL0 A;  3AG1 B;  4UV8 A;  4WFG A;  1GKF A;  1ROP A;  1AI7 A;  1R73 A;  4QJF B;  1RM1 B;  3CD6 V;  1V55 B;  3QO8 A;  1H38 A;  1K9M W;  1DF5 A;  3TET A;  2OT5 A;  1AR1 B;  2HVJ C;  2R9R B;  3E86 A;  4GX5 A;  4DO2 A;  2HKO A;  4DXW A;  4PEL A;  3JD4 A;  2C2A A;  3E8B A;  3A0R A;  3ABL B;  3D36 A;  1CP9 A;  3X2Q C;  3GB7 C;  2Q69 A;  1VQK V;  5IYC O;  4WFH A;  5L3C A;  2GSM B;  4JAS A;  4ZKI A;  2P90 A;  1VQP V;  3RVZ A;  4EKW A;  1E1Q G;  3T1C A;  5EBW C;  1K97 A;  2ZR2 A;  4G28 B;  1DTO A;  1H2G A;  1YJW V;  2EBO A;  3JD0 A;  1IXM A;  2QTO A;  3MHH C;  4R6Z A;  3E2E A;  2YEV A;  5EK0 A;  2CK3 G;  3LDE A;  1F4N A;  1OCC B;  1OCR B;  2LFR A;  2EIJ B;  1BHB A;  1M57 B;  3H01 A;  1JOY A;  2D3O W;  1S0V A;  5CBF A;  1I5X A;  2EIN B;  3LSS A;  3MHS C;  3B77 A;  4UXN A;  1R3J C;  3K0D A;  2NNU A;  1G4Y B;  3QNE A;  3CC7 V;  1E1R G;  1KD1 W;  1TUE B;  1R3K C;  2Z5U A;  3GWO A;  5IYD O;  3W7X A;  1RPO A;  2ZD9 A;  2ZXW B;  3ABM B;  4XDL A;  2QA4 V;  2OCC B;  1K4C C;  2BOC C;  1F4M A;  2EIM B;  1M56 B;  2QEX V;  1J95 A;  2X6A A;  1WLE A;  3E89 A;  3LDC A;  3K04 A;  3ZRW B;  3AG3 C;  2X0L A;  5CBH A;  5L3B A;  1NJI W;  3SPG A;  1F23 A;  3T4D A;  2JJ1 G;  3AG2 B;  5L3F A;  1YTF B;  4UVB A;  2R9I A;  1VQ4 V;  1ENV A;  3B8M A;  5L3E A;  5L3D A;  2OTL V;  1WPX A;  4UVC A;  2IH1 C;  5C93 A;  4PDL A;  3JYC A;  3CC2 V;  1SET A;  3ETD A;  5J9P C;  2X6C A;  3LSQ A;  2UXX A;  1NBM G;  1NKD A;  1N8R W;  3RW0 A;  4GX2 A;  2WLM A;  3X2Q B;  3D3I A;  3OUS A;  5B1A C;  2DWD C;  4J9Z B;  1YTF D;  3CP1 A;  3HPL C;  1Y4M A;  3KG2 A;  2Y48 A;  4FIP C;  4HYO A;  1PNK A;  2IH3 C;  2XAG A;  2KB1 A;  4MVZ A;  1OZ0 A;  3CCE V;  2YEV B;  3F7V C;  4YXW G;  1Q82 W;  1K33 A;  3B8N A;  3I56 V;  1K73 W;  4FJC C;  2ZDI A;  4BAY A;  1VQ6 V;  4PA9 A;  3T2M A;  1FFT B;  3G71 V;  2UXN A;  5IY5 C;  2P7T C;  5KUM A;  2ITD C;  1H8E G;  4WCE V;  3OR6 C;  1JJ2 U;  2B5U A;  5DM6 V;  5CA3 A;  2YSU B;  1FXK C;  1PNM A;  2IJJ A;  1W0K G;  3OR7 C;  3ZRW A;  3OAA G;  1JQ0 A;  3SYO A;  5H6Q A;  1KQS U;  3SYP A;  2XAH A;  1K92 A;  1SES A;  4OXS A;  4PDR A;  1K34 A;  3K3W A;  1S77 D;  4QPJ A;  1K7D A;  3R65 A;  3VOU A;  1DLB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...