3K0DA

Crystal structure of cng mimicking nak mutant, nak-etpp, k+ complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
90
structure length
90
Chain Sequence
EFQVLFVLTILTLISGTIFYSTVEGLRPIDALYFSVVTLTTVGETPPPQTDFGKIFTILYIFIGIGLVFGFIHKLAVNVQLPSILSNLVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Potassium channel protein NaK
publication title Structural studies of ion permeation and Ca2+ blockage of a bacterial channel mimicking the cyclic nucleotide-gated channel pore.
pubmed doi rcsb
source organism Bacillus cereus
total genus 32
structure length 90
sequence length 90
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3k0dA00
3LUTB 3X2QC 2AHYA 3OGCC 5CBFA 5EBMC 2KB1A 3E8BA 4XDLA 4J9ZB 3SPHA 2HJFC 4R50A 4JTCB 4LBEC 4PDLA 2X6CA 3AG4C 3GB7C 4MW8A 2EINC 3SYQA 1M57C 4LP8A 3AG3C 3FB5C 1R3IC 3STZC 2WLNA 4R6ZA 1ORQC 2DWDC 3IGAC 4G27B 5J9PC 4XDKA 2X6BA 2HG5C 3FB6C 4HZ3A 3T1CA 1J95A 1BL8A 4I9WA 3ASNC 5B1BC 2HVKC 3HPLC 4MVZA 4PA9A 5KUMA 1P7BA 3SPGA 1OCZC 3SYOA 3T4ZA 4MVQA 4QE9A 1V55C 1JVMA 4MS2A 3E8GA 2QTOA 3F7VC 4WFFA 4BW5A 2DYSC 4X88A 1OCOC 4PA6A 4MVSA 4EKWA 4WFHA 1K4CC 2IH3C 4MSWC 2DWEC 4PDVA 3SYCA 3KG2A 3IFXA 5EBLC 2WLMA 2R9RB 4DXWA 4QNHB 1ZWIC 2EILC 3ASOC 2NLJC 3K0GA 2A79B 4G28B 3VOUA 5B3SC 4F4LA 3LDDA 3EFFK 4X8AA 4MTOA 4MVOA 5EC1C 2A0LA 1KKDA 2HFEC 4XDJA 2EIKC 2K1EA 1R3JC 2Q67A 1OCRC 2DYRC 3FB7C 3RW0A 3E8HA 4MVRA 1XL4A 1R3LC 2Q68A 5CBHA 4JTAB 5B1AC 3BEHA 2WLIA 4P30A 3LNMB 3K0DA 3OR7C 2BOBC 3OUSA 3ABLC 4RUEA 1LNQA 2OCCC 1S5HC 2ZXWC 4J9YB 5IY5C 2IH1C 2EIMC 3RVYA 3F5WC 3SPJA 4OXSA 4RO2A 4P2ZA 1XL6A 2X6AA 3E86A 3RBZA 3RVZA 3SPCA 2EIJC 3STLC 2P7TC 3SYPA 3WG7C 2HVJC 3SYAA 5BZBA 2WLLB 4PDRA 4P9PA 4R7CA 2ITCC 4KFMA 3E8FA 4PA3A 4RAIA 5E1AC 4TWKA 3SJQC 2WLJA 4H37A 2Q69A 4X89A 2Q6AA 3K03A 5EC2C 2WLLA 2WLIB 3R65A 4P9OA 1R3KC 3LDCA 4MTFA 4ZBMA 3LDEA 1K4DC 3UM7A 3JYCA 2WLKA 2ATKC 4GX0A 4UUJC 4CBCA 3TETA 1QLEC 3FB8C 4HYOA 2JK5C 4PDMA 4RUFA 5KUKA 4H33A 1OCCC 2AHZA 3K06A 3OR6C 4WFEA 3OUFA 5EK0A 3T2MA 3F7YC 3ABKC 3AG1C 4PA4A 1V54C 3ZRSA 2W0FC 4GX2A 2A9HA 3PJSK 4GX5A 2YEVA 3ABMC 4MTGA 4R8CA 3TCUA 4GX1A 4WFGA 3UKMA 4PA7A 2WLHA 3AG2C 2H8PC 4MVUA 3K04A 2ITDC 4MW3A 2ZD9A 3T4DA 1M56C 2BOCC 5EBWC 3E83A 4JTDB 4QE7A 2Y69C 3E89A 3SPIA 3ZJZA 5CBGA 4LCUC 2QKSA 4MVMA 1G4YB 3K08A
chains in the Genus database with same CATH superfamily
1RM1C 5EIBD 5KA5A 1N8RW 5EIBC 2QJ1A 2KB1A 1MSWD 1IBLB 1PL4A 2HJFC 4X62B 3JARA 4H44B 3BA8A 4EB6A 2QE7G 2XTAA 3W7UA 3FB5C 1R3IC 3QO8A 3ZRVA 3P32A 1FXKB 3FB6C 2HKOA 3T1CA 4I4TA 3RYFA 1PNMA 4UCUA 4WFFA 4CC5A 2HP8A 1N0JA 1QBZA 3AEIA 3WB1A 4K8ZA 4LF9O 3KG2A 2UUAB 1SQQH 1SRYA 3CRRA 1FYJA 5EYPA 2NLJC 3KCXA 1KD1W 4O2BA 3ZMZA 4HBNA 1AVMA 4DYLA 1BE3H 1AI7A 1WA8B 4TOIA 2A3QA 2ZXWC 2P06A 3B2EE 1XNRO 1XL6A 4K0KB 3E86A 2N05A 4NXNO 1F23A 5BZBA 2ZNJA 4PDRA 5KAIZ 3ABLB 2ITCC 4UV9A 1VQKV 1JJ2U 1WN7A 4IYHA 3WG7B 2Q0AA 1PKXA 4HNAA 4PDMA 5D5PA 4EFBA 5JVDA 4GKJB 2DJVA 4WFAV 3OD4A 4TQDA 4N23A 1Q5OA 3G4SV 1JCHA 1OCCB 5B1OA 2XOKG 2ITDC 4DV5B 3W7XA 1F4MA 4JTDB 1CXZB 1GMGA 1O9GA 1FXKA 3ZHQA 1NS1A 4W4LA 1VMGA 1XNQB 3H1LH 3RYCA 1WB8A 5L3FA 2RN9A 3JD1A 2Z3YA 1GO3F 1EN4A 3RWRD 4J10A 2WLNA 1VF6A 4H13B 3SPGA 1N34O 1JVMA 2QTOA 3F7VC 3GWKC 4FMTA 3CP1A 4Z2WA 5L3BA 3H1JH 1VQNV 2OIEA 5B1BB 2UXDB 1DLBA 3WB2A 3W7TA 4YIOA 1WA8A 1GRJA 2OTLV 2OIGA 2WLMA 4JI3O 2JVDA 4GLXA 1FXVA 3BRCA 1N32O 1D5AA 5CB4B 5B5EZ 4CS3A 2IJHA 1SQBH 5H5NA 4KXRA 4LF5B 1D5NA 2JGDB 2O57A 3FB7C 4MVRA 5B3SB 1N33O 3UT5B 4E4EA 3K0DA 1L0NH 4FLVA 3ZRXA 4I50B 3JD4A 3RVZA 4JI4O 3C3TA 1EZVH 1YXBA 2GDSA 4DR4B 1XMOO 4H37A 2Q69A 2PYJA 2XUMA 2Q4PA 5LHIA 2N74A 3I55V 3DC6A 3LDEA 4UVBA 1NT2B 1TUBB 1X4TA 2F93B 1FAFA 3K58A 4LF9B 3T2MA 2V7QG 4CC6A 1RFYA 1DF4A 2GUZB 4QJFB 4FLUA 1VF5B 1HR0O 3CCQV 3PN1A 1PNLA 4UCTA 1GM9A 4NR1A 4MW3A 1B06A 1I5XA 3KKYA 3CCMV 4LCUC 5DN6G 3K08A 5IYCO 1M1KW 5LP6C 1XNRB 3E35A 2IJKA 3M7MX 3DC5A 4NXNB 2PI4A 2YIBD 4PDLA 5F2VO 2EINC 3OTFA 1QHTA 2OT5A 3AG1B 2X6BA 5JQGB 3ASNC 1YIJV 4QE9A 1QCEA 1M9NA 3AG2B 2H94A 3JSLA 4UXNA 2JGDA 2FB5A 5ITZB 3D36C 2RCVA 3UT5A 5DECA 5LHHA 3ZCCA 2PF4E 4TV9B 4NVPA 2ILMA 2A79B 4UCVA 1NTMH 2IW5A 1K3EA 1Z2GA 1WP8A 4MVOA 2EZPA 1NH2D 4B3MO 4X1YB 2EILB 1N4CA 1ZUQA 3BEHA 1MSDA 3OR7C 1U96A 1TUBA 2EIMC 4D6TH 1I94O 4IHJB 4PV1B 4OXSA 1YCIA 4DUYO 2ARHA 2E3CA 1IBMO 3SJBC 2GUZA 4TWKA 3ZHRA 1IDSA 2AXTZ 1IBKO 4J7KA 2WLLA 2WLIB 1N34B 1XHZA 4N21A 4YJ3B 1PM9A 3D3QA 2BSKB 4LFBO 3BCCH 4CH6A 3K57A 2AZ0A 1BT8A 2XNDG 5FPRA 1VQ8V 1N32B 5CN0A 2R72A 4IT5A 4WF9V 1RP3B 1KP2A 1M93A 1R6TA 3ABMC 4B3TO 1K5SA 3H01A 4YJ2B 5IWAO 1BGYH 3FD9A 3IC7A 1Q6HA 1LUVA 1N33B 2ZE8A 3A0BZ 5JQGA 3CRMA 1AB3A 4DK1A 1L1FA 2WWWA 3C3SA 3X2QC 3OGCC 2IU3A 4TSFG 4FM0A 5CA0B 4DV0O 4FM1A 5ITZA 1XMOB 1YF2A 4TV8B 3ZMSA 2UXBO 4A5UB 3P3PA 4JYYA 4R6ZA 3S3WA 1HNWO 4TV9A 4AHCA 1N36O 3SDLA 3J80N 1Y67A 1K92A 2B5UA 4KHPB 1FKAO 3K59A 2YS8A 2P4KA 4X1YA 2WA3A 3RN4A 1YZBA 2YSUB 2WPDG 1OCZB 1EM1A 3H9VA 2L6LA 4BWAA 1PV0A 1EN5A 3W7SA 1UPGA 4LF4O 4IHJA 1GKFA 2DYSB 5FPOA 1SZXA 4G28B 3VQXA 2Q8VA 2P4VA 3JD2A 2HFEC 3AK3A 3B40A 1R73A 3EXAA 5JCOA 3N2GB 5KMGB 2WLIA 5K1XA 1DTOA 1YJ9V 1S72V 4YJ3A 4OX9O 4ZHQB 1SERA 2BSKA 5LL6Y 2EX3A 4P2ZA 1XUQA 2QM8A 4O2AB 3CCVV 1YSCA 1KBHA 1ZL8B 2P7TC 3O65A 3JD3A 5K1PA 2Q0OC 4KFMA 4JF3A 1VQ7V 5IJ9B 2QWQB 3CCJV 4D7SA 4YJ2A 2KSDA 2Y48A 3B8NA 1F51A 4JI7O 4CBCA 4UUJC 2KQXA 2D3OW 3OR6C 1EBOA 5EK0A 1QNMA 3K5OA 4O4JB 2VS0A 1JFFB 4GX2A 4CZZA 3MAQA 1ZTEA 1IVSA 2QA4V 5CA0A 4MTGA 1IX9A 2WLHA 1J5EO 4TV8A 5B1NA 2EJRA 3ZHSA 4TUYB 4EFEA 3JASB 4DUYB 1XI1A 2NR5A 4UB6Z 2CAZC 3O9OA 2ZCEA 4JTCB 4FFBB 3THOA 1AI4A 4HZ3A 2QGNA 3HPLC 4LFBB 4U3FH 4ZI7B 4BIOA 4NKGB 1K4CC 2QEXV 2IH3C 3F5TA 2DWEC 4J41A 1OZ0A 4B3TB 4ZHQA 2C2AA 4FLXA 5IYZB 1SETA 1Q8IA 5IWAB 2YUAA 3K0GA 4O2AA 3K3WA 4X8AA 2F66C 4ZOLB 4X9QA 1XREA 3ABTA 2A7WA 5IJ9A 1G8MA 1WPXA 3LNMB 4DV0B 3BABA 2N04A 2IJIA 4PJ0Z 3B8MA 1H2SB 4Q6GA 4O4JA 2UXBB 2ZXWB 1JFFA 1HNWB 2ZIMA 4X89A 1N36B 2Q6AA 3A0HZ 1WNSA 3AK1A 4MTFA 1E1RG 5FLXN 2JS3A 1MZFA 1X59A 1S0VA 1DGSA 5KUKA 4I55B 3J81N 4JYBA 4DR1B 2EZOA 2WAMA 4TUYA 3JASA 4LF4B 1N0NA 4LC1A 4IL6Z 2E5LB 1UJWB 1H2GA 4PA7A 1LR1A 4TQFA 4FFBA 3ZHTA 1GAXA 3OEHG 2ZE5A 4OX9B 2DE0X 4LR3A 3ZHVA 4XDLA 1S77D 1QLNA 1AJPA 1K73W 4ZI7A 3S3XA 3HKBB 2E75B 3TK1A 3GWOA 5C93A 2EJ7A 4JI7B 5IYZA 2ZINA 1IZ3A 1ENVA 1SZTA 1P7BA 4ICGA 2CK3G 4ZOLA 1VQPV 1XILA 4JV5O 2YXHA 4EKWA 3K9SA 1HDJA 4DRXB 1YJNV 3SYCA 2JS5A 1WB7A 3RYIB 3IFXA 2Q7GA 5LBQA 1Q90D 4JZGA 3W7WA 4U3JB 1J5EB 1R1BA 4YY3O 4MTOA 4DR4O 1CP9A 1NR1A 1KKCA 2DYRC 1R3LC 5AG2A 1G6UA 2WA4A 4BIZA 4BR6A 3ZMVA 1LNQA 2E76B 4IIJB 2IH1C 2QKAA 3F5WC 4I55A 2QM7A 3ETGA 4F6RB 2PZSA 4RAIA 5E1AC 4QIWF 3UQ8A 2WLJA 1YDXA 2YC0A 5BR8O 5CA1B 5EC2C 4J42A 4JI8O 1K4DC 5GTIZ 1GN6A 3APOA 3N27A 5KHJA 2BTOA 3HB3B 1B3QA 5LOVB 4WFGA 2JDIG 3L74H 3D3IA 4QPKA 3HKBA 1GK9A 3SPIA 4H0LB 2PI5A 2QWOB 4AILC 4UCSA 4L87A 4J9ZB 4FVMA 1W0KG 4DRXA 5LP6B 4UCOA 2H3OA 3ZRWB 2E74B 3RYIA 2FKXA 3MHSC 5J9PC 1AJNA 3IGAC 3ETDA 4X1IB 4XDKA 5A9GA 1R6KA 1S76D 4U3JA 2EINB 3CXHF 3FX7A 3CMAV 1SESA 2FMLA 3CC2V 4MS2A 4MVSA 4WFHA 3ASNB 3BA9A 1Q82W 2GTAA 3C90A 2PY5A 3H1IH 4IIJA 1KYOF 4DXWA 3P3NA 4F4LA 1NTKH 1SQXH 4F6RA 1VEWA 1U97A 2F1MA 2K1EA 5KAFZ 5CA1A 5LGNA 2PGGA 4D7TA 1JJOA 3CB2A 3OEEG 2QM4A 1NH2B 4JZ2A 1RPOA 3SPJA 1XMQB 3VQVA 1VARA 3SYAA 2OCHA 4JYAO 1M4UA 2EIMB 2A06H 2R70A 1AROP 1K9MW 3QTCA 2IJJA 4DV4O 3CWBH 5LOVA 4I0XB 1FXHA 1B04A 3ETEA 4JV5B 1W2BU 1OJHA 3CYOA 2ZE7A 4WBNB 4RWUA 5BMVB 2PUSA 4F6EA 2CUGA 2NN4A 4PA4A 3SJCC 1BHBA 2ZIOA 5JJNB 1RPRA 4GX5A 3TXQA 3BY6A 2YI9A 4YY3B 3DGEA 3K04A 2LJ2A 1JA8A 5LP6A 3ZRWA 3ABMB 1A32A 1AP6A 1WAZA 4X1IA 2YIBA 1GM8A 4J7JA 4DK0A 1VF6C 4KHPO 3LNNA 1ZSPA 1SQGA 4X65O 1GM7A 4DR2O 2Q73A 3CRQA 3X2QB 5BR8B 1KP3A 4JI8B 2OTJV 5GW7A 3HKDB 3SJAC 3D36A 3T1HO 2L35A 4JI6O 1M5IA 1P4RA 4DR6O 5J2TB 3G71V 1JMKC 2UXCO 1M56B 4MSWC 4JI0O 4PDVA 1PL0A 2CGOA 3CRCA 2V4DA 3OT7A 2X0LA 2CTRA 3GVMA 3A8TA 3ASOC 4JASA 2YIDA 3BPZA 4B3SO 3FKSG 3EFFK 1SS3A 1JX9A 2EIKC 5CB4A 2Q67A 2XAJA 3RW0A 5CBHA 4I0XA 5B1AC 1H8EG 4G2KA 2OCCC 3OM3B 4YHHO 4WBNA 5BMVA 4I50A 4DUZB 2CH7B 3JSNA 4X64O 1Z5WA 3ETQA 4HYOA 4J7ZA 4DV1B 1P84F 3QG5A 4EEQA 3OUFA 2CTWA 2KKWA 4J80A 1V54C 4Z1VA 4ASUG 4GUNA 4CH4A 5CMUA 2PTMA 5LA6B 5IY5B 2H8PC 2Q7EA 3ZHUA 4DR7O 3E89A 3HKDA 4B3RO 3LUTB 4NTYA 3CS5A 2F23A 2QKCA 2P6JA 3CCRV 5J2TA 4JYAB 2Q9LA 3NXSA 4LFCO 1AI6A 4LP8A 5H9CA 4DV4B 4JAUA 3ABUA 2DWDC 2Y0PA 2AZ2A 1S5JA 4B7KA 4I9WA 4PA9A 5LGTA 3JCUZ 1Q6UA 4E2LA 1BHAA 3BVOA 5TISZ 3UO3A 2Y69B 4DO2A 5JJJB 2IU0A 4I7ZB 4JI1O 2LO1A 1QQCA 5CA3A 2XHBA 3I5DA 2Q68A 2CH7A 4JTAB 4FK5C 1SQFA 1GTOA 1DF5A 2VWKA 4X65B 4DR2B 2ADQB 4DR1O 4FLTA 2AW9A 1Y76B 3E8FA 1H2NA 1GH6A 2E5LO 3K03A 3T1HB 1KECA 3G67A 1K7DA 4JI6B 5LA6A 1QLEC 4DR6B 2UXCB 2XAQA 3TXSA 4JI0B 1H2KA 5LXTB 3AG1C 2UXXA 3PJSK 1I7FA 4B3SB 2MK3A 4OPAA 3AG2C 3G6BA 3KCYA 5C8YB 1XOUA 2NNUA 1ZX3A 3ZJZA 3CCSV 2QKSA 1Q3EA 5CBFA 5EBMC 3SR2C 4YHHB 2RNBA 2CTQA 3G6EV 3K9AA 4R50A 5EZYB 1YJWV 2X6CA 3GB7C 3L75H 1RSOB 4GCZA 3QF7A 1MG1A 3QNEA 1XEQA 5LYJB 4K35A 2D2CB 3CX5F 4X64B 1EZJA 2VQEO 1HP8A 2P67A 1NVPD 2W6JG 1OCOC 2BTQB 2HHHO 1NJIW 3OTOO 3MD0A 1RM1B 4BW9A 1Y76A 2QWPB 4DR7B 5EC1C 2GBOA 3RT3C 1H38A 3K5MA 1IXBA 4LFAO 4B3RB 3H1HH 1KU9A 1WP7A 3U0ZA 2DQ3A 3OUSA 2BOBC 2GV9A 1YHQV 3N2GA 2DYRB 3CPWU 1Y74B 5KMGA 1NQTA 4LFCB 1I5YA 4ZKIA 1XDCA 2R9IA 4GKKO 5LXTA 4P9PA 3CXCU 4UB8Z 1NZ6A 1ZL8A 5LMNO 2BCCH 1Z5VA 4GT1A 2RQ6A 3OMNB 2QR4A 5C8YA 3ZMTA 4H33A 1KQSU 2ZKOA 2UUCO 1OV9A 3L72H 2W0FC 3ZN1A 5LMUO 4W4KA 4JI1B 5E79Z 5KX5B 3APQA 2VQFO 3TCUA 4GX1A 4UV8A 2DOSA 2DW4A 5EZYA 2PYLA 1FFXB 4FZ1A 2ZT9B 3T4DA 4ZIBA 1RSOA 1ZLZA 3I56V 2OYQA 2B1GA 2GHYA 5LYJA 2FL4A 3JD0A 1GN3A 1L0LH 2MW2B 2AHYA 3E8BA 2YEVB 4L8JA 1US6A 2BTQA 2LW7A 4JI5O 2QWNB 1M57C 3AG3C 1H2MA 4JGSA 1MNGA 4NYKA 1BMFG 1VQ5V 4DW0A 3ZBHA 4DR5O 2LW1A 4XBFA 3RFRA 4MVZA 1FJGO 1V55C 1NR7A 2KG7B 1VIBA 5GONB 1PNKA 4JI2O 1IURA 1Q43A 4LNUB 5LHGA 1XMQO 4YXWG 4O2BB 3U11A 3KZIZ 4JYCA 1Q6IA 3FYIB 2F95B 5JJEB 4OPHA 5D5QA 1B6QA 1R3JC 1F4NA 4IYIA 2IM9A 4B08A 1SA0B 4QGPA 2UUBO 3EVKA 4DV2O 1HNXO 1FFTB 3RVYA 4K3AA 2EIJC 2B1IA 3CRAA 4PA3A 3B09A 1TUEB 5KX5A 3Q4HB 2VQEB 1R3KC 4ZBMA 2V1DA 3UM7A 1FFXA 2M7WA 3TETA 3FB8C 3DTUB 5IE9A 2JRIA 4WFEA 2HHHB 4O4HB 3OTOB 1AI5A 1AR4A 1JQ0A 1P7GA 3ZRSA 1KUQA 4LF7O 1QU7A 3HKEB 2YEVA 3OMAB 1KC8W 2YI8A 2Z5UA 4NXMO 1NBMG 1AR5A 2ETNA 4LFAB 3LSUA 4PHZA 1CPYA 4PI2A 3WFVA 2ZDIC 3E83A 4CS2A 3RYCB 5IT9N 2RJZA 2CDYA 3OGIB 3DXRB 5KA6A 1SF9A 4GKKB 3LSQA 2KG7A 2G38A 3JALB 5GONA 3AG4C 2LFSA 3CCLV 3ZX6A 5LMNB 2YXLA 4LWSB 4LNUA 3FAVB 2ADPA 1JPXA 1J95A 1D2DA 5KUMA 5HFLA 3ML0A 1YI2V 5IYDO 4O4LB 2UUCB 2P5OA 5LMUB 3WU2Z 1SA0A 1P49A 5EBLC 2VQFB 5FNVB 3OFNG 2UU9O 1AILA 3ZIAG 1E1QG 4GYCB 4XDJA 1OCRC 3ASOB 4DUZO 1TAEA 3Q4HA 3UCSC 3NR7A 1BCCH 4P30A 1WPBA 2GTSA 2EIKB 4DV1O 4X20B 4RO2A 4JI5B 3SPCA 5B1AB 4O4HA 2OCCB 4KUMA 3SJQC 2ZM6O 4DR5B 1W0JG 5L3GA 3HKEA 4RQEA 1R6NA 3H1KH 3TGUH 1FJGB 1VQ9V 1SQPH 5KHHA 5J2UB 2WLKA 4GX0A 1Q81W 4B7EA 2JK5C 3QO5A 2LGWA 1K97A 4NTXA 2ZE6A 1QR8A 2CTPA 5B66Z 3EHBB 4JI2B 5KLVH 4DV3O 1TVKB 3ABKC 1NTZH 3DXRA 2A9HA 1IXMA 1Q7YW 4BAYA 2RMKB 3TJTA 5DEDA 2HJDA 3UKMA 3JALA 4MVUA 1V54B 5IYBO 2Y0IA 2X7RB 4LWSA 3FAVA 4CH3A 5L3CA 1O9HA 2UUBB 2LP7A 1G1XB 4DV2B 3HR0A 1Y4MA 1HNXB 3VQWA 2W0XA 3CC7V 4O4LA 1E79G 1FXKC 4DV6O 3STZC 4C7UA 2HLDG 5FNVA 2HG5C 2FYUH 1SQVH 2HEPA 3SYOA 1GN2A 3T4ZA 2LQTA 4BW5A 2Y4TA 3E8GA 1FD9A 4LF8O 4LF7B 3WB0A 2XASA 4WFBV 4HAMA 1VF7A 4DV7O 4NXMB 4X20A 1ZWIC 2ZR2A 1NKDA 3AK2A 1CEZA 3OMIB 3LDDA 4TT3G 3A0RA 3L71H 5BY1A 3E8HA 1BSMA 1WLEA 3K5LA 4FFKA 3E22B 2DN9A 1K33A 3ABLC 5J2UA 4FLZA 3P30A 4X1KB 3M8AA 3STLC 3WG7C 2FTKA 1XBLA 3CC4V 3BHPA 2WLLB 2YIAA 3VQYA 1TVKA 2RDCA 3L9DA 1BQZA 4Z1MG 3JCZA 1K8AW 3L70H 3R65A 1BZKA 2EULA 3SGIA 1OCCC 2AHZA 2ZNIA 3CSXA 4LF6O 1QLEB 2UU9B 3R66A 4DW1A 4ABMA 4R8CA 3RYHB 2P90A 2QSAA 5FL7G 2JJ1G 1PP9H 2F43G 4MVMA 1I08A 1VP7A 1URFA 5DM6V 2YXYA 2ZM6B 4JPRA 2WSSG 3RGBA 1ORQC 4G27B 4LH6A 1EFRG 3IAYA 3CCEV 5B1BC 2HVKC 4MVQA 2R9AA 3CHXA 5H6RA 3JAWB 4FPPA 4DV3B 2Z0AA 4PA6A 3MHHC 3E22A 1I0HA 2R9RB 2QTSA 2Q7HA 3ZMUA 3ZS8C 1NVPB 1OCOB 3VOUA 4X1KA 4KP4A 1K34A 5B3SC 2F4VO 3T1YO 3JATB 1MOFA 3G80A 4Q20A 1WJZA 3ICXA 1ROPA 4JI3B 3BAAA 4UCRA 1F7YA 1VQOV 1THZA 2Y4UA 4DV6B 1KMIZ 1HWYA 1W59A 1TA8A 2P22C 1QVFU 3RYHA 4P9OA 4IGGA 3LDCA 1XHXA 2ATKC 3CJHB 1Y6XA 2GSMB 4RUFA 4LF8B 1JR9A 3K06A 4LH7A 4UFZA 4JI4B 1V9PA 1H2LA 4WCEV 5IDJA 4DV7B 1YTFB 2BE3A 4FLYA 1FS0G 3UO2A 2YICA 4RQFA 2ZD9A 4I9QA 1M56C 5HFMA 1HNZO 1K5QA 4NB5A 2UXNA 1MA1A 4U7NA 3HKCB 3SPHA 1HR0B 3JAWA 4X66O 1PPJH 1HW7A 4LBEC 2JIZG 3OAAG 2AGAA 4QPJA 4J11A 3JAKB 2HR3A 3M99B 3L73H 1SKVA 1AJQA 4PD4F 1M57B 2CGNA 1VQ6V 1GN4A 1T5EA 3AG3B 1JOYA 3CEIA 4LF6B 2W6IG 3JATA 2XT9A 4NTWA 1PD3A 4AQYO 1V55B 4FLWA 2EILC 3K5NA 3OW2U 4FM2A 4DR3O 2VRZA 1KKDA 3JAMN 1XL4A 1XQ8A 1YEWA 4MTXA 4AI8A 3B77A 5EBWC 3VBBA 3CJHA 5IY5C 3CD6V 5IJ0B 3FYEB 5JCOC 3BFRA 1IBLO 3SYPA 2HVJC 4O4IB 4K8XA 3A2FA 1TGOA 5L3EA 4X62O 1ZAUA 4FZ0A 4JAAA 5L3DA 4B3MB 2EIJB 3CMEV 3FFQA 1FPOA 3DSQA 3N2KB 1LUWA 1I94B 5A2QN 1VQMV 1IBMB 1S3JA 3K79A 3HKCA 2UUAO 1BQ0A 4I5SA 1IBKB 1MZEA 2F4VB 3T1YB 2EBOA 4FJCC 4YIPA 5H6QA 2QWRB 4QE7A 2Y69C 5CBGA 3JAKA 3LSSA 5H2FZ 5JH7B 1YTFD 1G4YB 1AR1B 2ZR3A 1Q86W 1COWG 4FIPC 1MABG 1H8HG 4MW8A 4K0KO 1VQLV 3SYQA 2M6YA 2JJ2G 4UVCA 1Y66A 2IBZH 3AG7A 1BL8A 3AG4B 2K9PA 1EN6A 1L8DA 1OCZC 4JAVA 1M90W 1DK1A 2DYSC 3JARB 4X88A 4BIUA 3U10A 4EB6B 1UFIA 4GKJO 4CS4A 2JGUA 4CH5A 3CCUV 5BXZA 5IJ0A 4QNHB 4I4TB 2XAFA 3RYFB 4O4IA 2A0LA 2DMXA 4U7OA 3B4SA 1QVGU 1YITV 2Q5ZA 1HNZB 1BS3A 1QR9A 4DV5O 4OGQB 3D8CA 1MMMA 2LGQA 3OE7G 5JWPA 5KHKA 4RUEA 3ZEDA 1S5HC 4J9YB 5KHGA 4X66B 2DQ0A 2XAHA 1OCRB 3CE2A 2B9ZA 3N2KA 4KL1A 1SC5B 2XAGA 2JEXA 5EYPB 2X6AA 3RBZA 1XNQO 1YVWA 1AP5A 4R7CA 3J7AU 1Y74A 1OHHG 2JEUA 1NI8A 3IJ4A 2ODMA 3IC9A 3MDSA 3JYCA 2OWOA 1NU1H 3ZN0A 4PI0A 3E2EA 2LFRA 1S5LZ 4GZRB 3F7YC 4AQYB 2YDEA 5JH7A 2VWJA 4MT8A 2UXDO 3QO7A 2ZQMA 5LGUA 2ZDIA 2CE4A 4DR3B 4PELA 3ABKB 5KHIA 3QVNA 4HNAB 4UVAA 5GTHZ 1KB9F 2QDOA 5JVDB 2BOCC 4LF5O 1VQ4V
chains in the Genus database with same CATH topology
3LUTB 1RM1C 1MSWD 5KA5A 1N8RW 2P6JA 3CCRV 2KB1A 3CC7V 2HJFC 1E79G 1FXKC 4JTCB 3NXSA 2QE7G 1AI6A 3W7UA 4LP8A 5H9CA 3FB5C 1R3IC 3STZC 3QO8A 4JAUA 3ZRVA 3ABUA 2DWDC 2HLDG 1FXKB 1AI4A 3P32A 3FB6C 2HG5C 2HKOA 4HZ3A 3T1CA 4I9WA 3HPLC 4PA9A 5LGTA 3SYOA 3T4ZA 1PNMA 4WFFA 3E8GA 4BW5A 4E2LA 1BHAA 1K4CC 2QEXV 2IH3C 1QBZA 2DWEC 3AEIA 1OZ0A 2Y69B 3KG2A 2XASA 4DO2A 2IU0A 4WFBV 2C2AA 1SRYA 4HAMA 1SETA 1ZWIC 2NLJC 3K0GA 2ZR2A 1NKDA 1CEZA 3OMIB 3LDDA 3K3WA 4X8AA 1KD1W 5CA3A 4TT3G 3ABTA 3ZMZA 3A0RA 3E8HA 1WLEA 2Q68A 4JTAB 4FK5C 1G8MA 1GTOA 1WPXA 3LNMB 1AI7A 1K33A 3ABLC 2ZXWC 1DF5A 2IJIA 3P30A 1XL6A 3E86A 3B8MA 3STLC 3WG7C 2FTKA 1F23A 5BZBA 3CC4V 2WLLB 4PDRA 3ABLB 2ZXWB 2ITCC 3E8FA 4UV9A 1VQKV 4Z1MG 1JJ2U 3JCZA 1K8AW 4X89A 2Q6AA 3K03A 1KECA 3WG7B 1K7DA 3R65A 4MTFA 1E1RG 1PKXA 1S0VA 1QLEC 4PDMA 5KUKA 1OCCC 2AHZA 2XAQA 4JYBA 2EZOA 2WAMA 4WFAV 3AG1C 2UXXA 1QLEB 4N23A 3PJSK 4LC1A 3G4SV 1JCHA 1OCCB 5B1OA 1UJWB 1H2GA 4R8CA 4PA7A 2MK3A 3AG2C 2XOKG 2P90A 2ITDC 3W7XA 2NNUA 1F4MA 4JTDB 5FL7G 1GMGA 3ZJZA 3CCSV 1FXKA 2JJ1G 3OEHG 2QKSA 2F43G 4MVMA 5CBFA 5EBMC 4XDLA 1S77D 1QLNA 1AJPA 3G6EV 1K73W 5L3FA 3K9AA 5DM6V 4R50A 1YJWV 2X6CA 3GB7C 3JD1A 2Z3YA 1GO3F 4JPRA 4GCZA 2WSSG 3TK1A 5C93A 3GWOA 2WLNA 1MG1A 1ORQC 3QNEA 1EFRG 4G27B 1EZJA 3CCEV 5B1BC 2HVKC 1ENVA 1SZTA 3SPGA 1P7BA 4MVQA 2CK3G 1VQPV 5H6RA 1JVMA 2P67A 2QTOA 3F7VC 4FPPA 1NVPD 2W6JG 4FMTA 4EKWA 1OCOC 3CP1A 3MHHC 4PA6A 5L3BA 1VQNV 5B1BB 1DLBA 3W7TA 1YJNV 3SYCA 1NJIW 3IFXA 2OTLV 2WLMA 2R9RB 1FXVA 3ZMUA 5LBQA 1NVPB 1OCOB 3MD0A 3W7WA 1RM1B 3VOUA 2IJHA 4KP4A 1K34A 5B3SC 4MTOA 5EC1C 1H38A 1CP9A 1NR1A 2DYRC 3FB7C 4MVRA 1MOFA 1R3LC 5B3SB 2DQ3A 4BIZA 4Q20A 3K0DA 3OUSA 2BOBC 3ZMVA 1LNQA 1YHQV 1ROPA 2IH1C 3F5WC 3ZRXA 2DYRB 3CPWU 1VQOV 1NQTA 3JD4A 1THZA 3RVZA 1I5YA 4ZKIA 2QM7A 1HWYA 2R9IA 3ETGA 4P9PA 4RAIA 5E1AC 3CXCU 4QIWF 2WLJA 4H37A 2Q69A 5LHIA 5EC2C 1QVFU 4GT1A 4P9OA 3LDCA 3I55V 3LDEA 1K4DC 4UVBA 2ATKC 3OMNB 2GSMB 4RUFA 3ZMTA 4H33A 3K06A 1KQSU 3T2MA 2V7QG 3HB3B 1DF4A 4QJFB 4WCEV 2W0FC 5IDJA 3ZN1A 1YTFB 3CCQV 3TCUA 1PNLA 4GX1A 4UV8A 4WFGA 1FS0G 2JDIG 1GM9A 2DW4A 3D3IA 4QPKA 4MW3A 4RQFA 2ZD9A 3T4DA 1M56C 1I5XA 5HFMA 3I56V 3CCMV 1GK9A 2B1GA 2GHYA 3SPIA 4LCUC 5DN6G 2PI5A 3JD0A 1K5QA 3K08A 5IYCO 2AHYA 1M1KW 2UXNA 4U7NA 3E35A 3E8BA 2YEVB 2IJKA 4L87A 4J9ZB 3SPHA 2PI4A 4LBEC 2JIZG 4PDLA 3OAAG 2EINC 1W0KG 1M57C 3ZRWB 3AG3C 4JGSA 1BMFG 4QPJA 3MHSC 2OT5A 5J9PC 3AG1B 1VQ5V 1AJNA 3IGAC 3ETDA 2HR3A 2X6BA 4XDKA 3M99B 1R6KA 1S76D 1AJQA 4XBFA 2EINB 3ASNC 1M57B 4MVZA 1VQ6V 1YIJV 3AG3B 1JOYA 4QE9A 1QCEA 1V55C 1M9NA 3CMAV 1SESA 3AG2B 2H94A 4MS2A 3CC2V 1NR7A 2W6IG 4UXNA 4MVSA 4WFHA 3ASNB 1Q82W 1PNKA 1PD3A 1V55B 5LHGA 5LHHA 4YXWG 3ZCCA 4DXWA 2EILC 4JYCA 3FYIB 3OW2U 2A79B 2IW5A 4F4LA 1K3EA 1B6QA 4MVOA 1KKDA 2EZPA 2K1EA 1R3JC 1NH2D 1F4NA 2EILB 1XL4A 4MTXA 5LGNA 3BEHA 3B77A 3OR7C 5EBWC 3OEEG 3VBBA 5IY5C 1NH2B 2EIMC 3CD6V 1FFTB 3RVYA 1RPOA 3FYEB 4OXSA 3SPJA 3SYPA 2EIJC 2B1IA 2HVJC 3SYAA 5L3EA 4PA3A 2EIMB 4TWKA 1AROP 1K9MW 1TUEB 5L3DA 2IJJA 2EIJB 2WLLA 1FXHA 2WLIB 3CMEV 1R3KC 4ZBMA 4N21A 2V1DA 3UM7A 2M7WA 3ETEA 3TETA 3FB8C 3DTUB 1W2BU 3CYOA 4WFEA 1VQMV 1AI5A 1JQ0A 1S3JA 2XNDG 4PA4A 3ZRSA 1VQ8V 1BHBA 5CN0A 1RPRA 3K79A 4GX5A 4WF9V 2YEVA 1KP2A 3ABMC 3BY6A 1K5SA 3OMAB 3H01A 4I5SA 1KC8W 2Z5UA 3DGEA 3K04A 1NBMG 2EBOA 4FJCC 5H6QA 3ZRWA 3ABMB 1CPYA 3IC7A 3WFVA 2ZDIC 3E83A 4QE7A 2Y69C 5CBGA 3LSSA 1GM8A 1YTFD 1G4YB 1L1FA 1AR1B 2WWWA 3X2QC 3OGCC 2ZR3A 2IU3A 4TSFG 5KA6A 1Q86W 1COWG 3LSQA 4FIPC 1GM7A 1MABG 1H8HG 3AG4C 4MW8A 1VQLV 3SYQA 3X2QB 2LFSA 3CCLV 3ZMSA 2JJ2G 4UVCA 1KP3A 4R6ZA 1Y66A 2OTJV 5GW7A 1JPXA 1J95A 1BL8A 3AG4B 3D36A 5KUMA 5HFLA 1K92A 1OCZC 3ML0A 4JAVA 2B5UA 1YI2V 1M90W 5IYDO 1P4RA 3G71V 2DYSC 4X88A 4BIUA 1M56B 2YSUB 2WPDG 4MSWC 1OCZB 4PDVA 1PL0A 3W7SA 5EBLC 2X0LA 3CCUV 3OFNG 1GKFA 2DYSB 4QNHB 3ASOC 4JASA 2XAFA 4G28B 3FKSG 3ZIAG 3EFFK 1E1QG 3JD2A 2A0LA 1JX9A 2HFEC 4U7OA 2EIKC 4XDJA 1YITV 1QVGU 1QR9A 2Q67A 1OCRC 2XAJA 3ASOB 3RW0A 1R73A 5CBHA 5B1AC 2WLIA 1YJ9V 1DTOA 3OE7G 1H8EG 4P30A 4G2KA 4RUEA 1S72V 2OCCC 1S5HC 3OM3B 2EIKB 4J9YB 1SERA 2DQ0A 2XAHA 1OCRB 4RO2A 4P2ZA 2QM8A 2XAGA 2JEXA 3CCVV 2X6AA 3RBZA 3SPCA 1YSCA 5B1AB 2P7TC 2OCCB 3JD3A 4KUMA 4KFMA 4R7CA 4JF3A 3SJQC 1VQ7V 1W0JG 1OHHG 5L3GA 4RQEA 2JEUA 3CCJV 1R6NA 1VQ9V 3B8NA 2Y48A 1F51A 4CBCA 3JYCA 2WLKA 4GX0A 4UUJC 1Q81W 4HYOA 2JK5C 3ZN0A 3E2EA 3QO5A 2LFRA 1K97A 1QR8A 2D3OW 3EHBB 3OR6C 1EBOA 3OUFA 5EK0A 3F7YC 3ABKC 4MT8A 1V54C 4ASUG 4GX2A 2A9HA 1IXMA 4CZZA 4BAYA 1Q7YW 2QA4V 3QO7A 2ZQMA 5LGUA 4MTGA 2ZDIA 5CMUA 3UKMA 5IY5B 2WLHA 3ABKB 2H8PC 4MVUA 4PELA 1V54B 4UVAA 5IYBO 2X7RB 2BOCC 3E89A 1VQ4V 5B1NA 5L3CA 2EJRA 2LP7A 1Y4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LUT B;  3X2Q C;  2AHY A;  3OGC C;  5CBF A;  5EBM C;  2KB1 A;  3E8B A;  4XDL A;  4J9Z B;  3SPH A;  2HJF C;  4R50 A;  4JTC B;  4LBE C;  4PDL A;  2X6C A;  3AG4 C;  3GB7 C;  4MW8 A;  2EIN C;  3SYQ A;  1M57 C;  4LP8 A;  3AG3 C;  3FB5 C;  1R3I C;  3STZ C;  2WLN A;  4R6Z A;  1ORQ C;  2DWD C;  3IGA C;  4G27 B;  5J9P C;  4XDK A;  2X6B A;  2HG5 C;  3FB6 C;  4HZ3 A;  3T1C A;  1J95 A;  1BL8 A;  4I9W A;  3ASN C;  5B1B C;  2HVK C;  3HPL C;  4MVZ A;  4PA9 A;  5KUM A;  1P7B A;  3SPG A;  1OCZ C;  3SYO A;  3T4Z A;  4MVQ A;  4QE9 A;  1V55 C;  1JVM A;  4MS2 A;  3E8G A;  2QTO A;  3F7V C;  4WFF A;  4BW5 A;  2DYS C;  4X88 A;  1OCO C;  4PA6 A;  4MVS A;  4EKW A;  4WFH A;  1K4C C;  2IH3 C;  4MSW C;  2DWE C;  4PDV A;  3SYC A;  3KG2 A;  3IFX A;  5EBL C;  2WLM A;  2R9R B;  4DXW A;  4QNH B;  1ZWI C;  2EIL C;  3ASO C;  2NLJ C;  3K0G A;  2A79 B;  4G28 B;  3VOU A;  5B3S C;  4F4L A;  3LDD A;  3EFF K;  4X8A A;  4MTO A;  4MVO A;  5EC1 C;  2A0L A;  1KKD A;  2HFE C;  4XDJ A;  2EIK C;  2K1E A;  1R3J C;  2Q67 A;  1OCR C;  2DYR C;  3FB7 C;  3RW0 A;  3E8H A;  4MVR A;  1XL4 A;  1R3L C;  2Q68 A;  5CBH A;  4JTA B;  5B1A C;  3BEH A;  2WLI A;  4P30 A;  3LNM B;  3K0D A;  3OR7 C;  2BOB C;  3OUS A;  3ABL C;  4RUE A;  1LNQ A;  2OCC C;  1S5H C;  2ZXW C;  4J9Y B;  5IY5 C;  2IH1 C;  2EIM C;  3RVY A;  3F5W C;  3SPJ A;  4OXS A;  4RO2 A;  4P2Z A;  1XL6 A;  2X6A A;  3E86 A;  3RBZ A;  3RVZ A;  3SPC A;  2EIJ C;  3STL C;  2P7T C;  3SYP A;  3WG7 C;  2HVJ C;  3SYA A;  5BZB A;  2WLL B;  4PDR A;  4P9P A;  4R7C A;  2ITC C;  4KFM A;  3E8F A;  4PA3 A;  4RAI A;  5E1A C;  4TWK A;  3SJQ C;  2WLJ A;  4H37 A;  2Q69 A;  4X89 A;  2Q6A A;  3K03 A;  5EC2 C;  2WLL A;  2WLI B;  3R65 A;  4P9O A;  1R3K C;  3LDC A;  4MTF A;  4ZBM A;  3LDE A;  1K4D C;  3UM7 A;  3JYC A;  2WLK A;  2ATK C;  4GX0 A;  4UUJ C;  4CBC A;  3TET A;  1QLE C;  3FB8 C;  4HYO A;  2JK5 C;  4PDM A;  4RUF A;  5KUK A;  4H33 A;  1OCC C;  2AHZ A;  3K06 A;  3OR6 C;  4WFE A;  3OUF A;  5EK0 A;  3T2M A;  3F7Y C;  3ABK C;  3AG1 C;  4PA4 A;  1V54 C;  3ZRS A;  2W0F C;  4GX2 A;  2A9H A;  3PJS K;  4GX5 A;  2YEV A;  3ABM C;  4MTG A;  4R8C A;  3TCU A;  4GX1 A;  4WFG A;  3UKM A;  4PA7 A;  2WLH A;  3AG2 C;  2H8P C;  4MVU A;  3K04 A;  2ITD C;  4MW3 A;  2ZD9 A;  3T4D A;  1M56 C;  2BOC C;  5EBW C;  3E83 A;  4JTD B;  4QE7 A;  2Y69 C;  3E89 A;  3SPI A;  3ZJZ A;  5CBG A;  4LCU C;  2QKS A;  4MVM A;  1G4Y B;  3K08 A; 
#chains in the Genus database with same CATH topology
 1RM1 C;  5EIB D;  5KA5 A;  1N8R W;  5EIB C;  2QJ1 A;  2KB1 A;  1MSW D;  1IBL B;  1PL4 A;  2HJF C;  4X62 B;  3JAR A;  4H44 B;  3BA8 A;  4EB6 A;  2QE7 G;  2XTA A;  3W7U A;  3FB5 C;  1R3I C;  3QO8 A;  3ZRV A;  3P32 A;  1FXK B;  3FB6 C;  2HKO A;  3T1C A;  4I4T A;  3RYF A;  1PNM A;  4UCU A;  4WFF A;  4CC5 A;  2HP8 A;  1N0J A;  1QBZ A;  3AEI A;  3WB1 A;  4K8Z A;  4LF9 O;  3KG2 A;  2UUA B;  1SQQ H;  1SRY A;  3CRR A;  1FYJ A;  5EYP A;  2NLJ C;  3KCX A;  1KD1 W;  4O2B A;  3ZMZ A;  4HBN A;  1AVM A;  4DYL A;  1BE3 H;  1AI7 A;  1WA8 B;  4TOI A;  2A3Q A;  2ZXW C;  2P06 A;  3B2E E;  1XNR O;  1XL6 A;  4K0K B;  3E86 A;  2N05 A;  4NXN O;  1F23 A;  5BZB A;  2ZNJ A;  4PDR A;  5KAI Z;  3ABL B;  2ITC C;  4UV9 A;  1VQK V;  1JJ2 U;  1WN7 A;  4IYH A;  3WG7 B;  2Q0A A;  1PKX A;  4HNA A;  4PDM A;  5D5P A;  4EFB A;  5JVD A;  4GKJ B;  2DJV A;  4WFA V;  3OD4 A;  4TQD A;  4N23 A;  1Q5O A;  3G4S V;  1JCH A;  1OCC B;  5B1O A;  2XOK G;  2ITD C;  4DV5 B;  3W7X A;  1F4M A;  4JTD B;  1CXZ B;  1GMG A;  1O9G A;  1FXK A;  3ZHQ A;  1NS1 A;  4W4L A;  1VMG A;  1XNQ B;  3H1L H;  3RYC A;  1WB8 A;  5L3F A;  2RN9 A;  3JD1 A;  2Z3Y A;  1GO3 F;  1EN4 A;  3RWR D;  4J10 A;  2WLN A;  1VF6 A;  4H13 B;  3SPG A;  1N34 O;  1JVM A;  2QTO A;  3F7V C;  3GWK C;  4FMT A;  3CP1 A;  4Z2W A;  5L3B A;  3H1J H;  1VQN V;  2OIE A;  5B1B B;  2UXD B;  1DLB A;  3WB2 A;  3W7T A;  4YIO A;  1WA8 A;  1GRJ A;  2OTL V;  2OIG A;  2WLM A;  4JI3 O;  2JVD A;  4GLX A;  1FXV A;  3BRC A;  1N32 O;  1D5A A;  5CB4 B;  5B5E Z;  4CS3 A;  2IJH A;  1SQB H;  5H5N A;  4KXR A;  4LF5 B;  1D5N A;  2JGD B;  2O57 A;  3FB7 C;  4MVR A;  5B3S B;  1N33 O;  3UT5 B;  4E4E A;  3K0D A;  1L0N H;  4FLV A;  3ZRX A;  4I50 B;  3JD4 A;  3RVZ A;  4JI4 O;  3C3T A;  1EZV H;  1YXB A;  2GDS A;  4DR4 B;  1XMO O;  4H37 A;  2Q69 A;  2PYJ A;  2XUM A;  2Q4P A;  5LHI A;  2N74 A;  3I55 V;  3DC6 A;  3LDE A;  4UVB A;  1NT2 B;  1TUB B;  1X4T A;  2F93 B;  1FAF A;  3K58 A;  4LF9 B;  3T2M A;  2V7Q G;  4CC6 A;  1RFY A;  1DF4 A;  2GUZ B;  4QJF B;  4FLU A;  1VF5 B;  1HR0 O;  3CCQ V;  3PN1 A;  1PNL A;  4UCT A;  1GM9 A;  4NR1 A;  4MW3 A;  1B06 A;  1I5X A;  3KKY A;  3CCM V;  4LCU C;  5DN6 G;  3K08 A;  5IYC O;  1M1K W;  5LP6 C;  1XNR B;  3E35 A;  2IJK A;  3M7M X;  3DC5 A;  4NXN B;  2PI4 A;  2YIB D;  4PDL A;  5F2V O;  2EIN C;  3OTF A;  1QHT A;  2OT5 A;  3AG1 B;  2X6B A;  5JQG B;  3ASN C;  1YIJ V;  4QE9 A;  1QCE A;  1M9N A;  3AG2 B;  2H94 A;  3JSL A;  4UXN A;  2JGD A;  2FB5 A;  5ITZ B;  3D36 C;  2RCV A;  3UT5 A;  5DEC A;  5LHH A;  3ZCC A;  2PF4 E;  4TV9 B;  4NVP A;  2ILM A;  2A79 B;  4UCV A;  1NTM H;  2IW5 A;  1K3E A;  1Z2G A;  1WP8 A;  4MVO A;  2EZP A;  1NH2 D;  4B3M O;  4X1Y B;  2EIL B;  1N4C A;  1ZUQ A;  3BEH A;  1MSD A;  3OR7 C;  1U96 A;  1TUB A;  2EIM C;  4D6T H;  1I94 O;  4IHJ B;  4PV1 B;  4OXS A;  1YCI A;  4DUY O;  2ARH A;  2E3C A;  1IBM O;  3SJB C;  2GUZ A;  4TWK A;  3ZHR A;  1IDS A;  2AXT Z;  1IBK O;  4J7K A;  2WLL A;  2WLI B;  1N34 B;  1XHZ A;  4N21 A;  4YJ3 B;  1PM9 A;  3D3Q A;  2BSK B;  4LFB O;  3BCC H;  4CH6 A;  3K57 A;  2AZ0 A;  1BT8 A;  2XND G;  5FPR A;  1VQ8 V;  1N32 B;  5CN0 A;  2R72 A;  4IT5 A;  4WF9 V;  1RP3 B;  1KP2 A;  1M93 A;  1R6T A;  3ABM C;  4B3T O;  1K5S A;  3H01 A;  4YJ2 B;  5IWA O;  1BGY H;  3FD9 A;  3IC7 A;  1Q6H A;  1LUV A;  1N33 B;  2ZE8 A;  3A0B Z;  5JQG A;  3CRM A;  1AB3 A;  4DK1 A;  1L1F A;  2WWW A;  3C3S A;  3X2Q C;  3OGC C;  2IU3 A;  4TSF G;  4FM0 A;  5CA0 B;  4DV0 O;  4FM1 A;  5ITZ A;  1XMO B;  1YF2 A;  4TV8 B;  3ZMS A;  2UXB O;  4A5U B;  3P3P A;  4JYY A;  4R6Z A;  3S3W A;  1HNW O;  4TV9 A;  4AHC A;  1N36 O;  3SDL A;  3J80 N;  1Y67 A;  1K92 A;  2B5U A;  4KHP B;  1FKA O;  3K59 A;  2YS8 A;  2P4K A;  4X1Y A;  2WA3 A;  3RN4 A;  1YZB A;  2YSU B;  2WPD G;  1OCZ B;  1EM1 A;  3H9V A;  2L6L A;  4BWA A;  1PV0 A;  1EN5 A;  3W7S A;  1UPG A;  4LF4 O;  4IHJ A;  1GKF A;  2DYS B;  5FPO A;  1SZX A;  4G28 B;  3VQX A;  2Q8V A;  2P4V A;  3JD2 A;  2HFE C;  3AK3 A;  3B40 A;  1R73 A;  3EXA A;  5JCO A;  3N2G B;  5KMG B;  2WLI A;  5K1X A;  1DTO A;  1YJ9 V;  1S72 V;  4YJ3 A;  4OX9 O;  4ZHQ B;  1SER A;  2BSK A;  5LL6 Y;  2EX3 A;  4P2Z A;  1XUQ A;  2QM8 A;  4O2A B;  3CCV V;  1YSC A;  1KBH A;  1ZL8 B;  2P7T C;  3O65 A;  3JD3 A;  5K1P A;  2Q0O C;  4KFM A;  4JF3 A;  1VQ7 V;  5IJ9 B;  2QWQ B;  3CCJ V;  4D7S A;  4YJ2 A;  2KSD A;  2Y48 A;  3B8N A;  1F51 A;  4JI7 O;  4CBC A;  4UUJ C;  2KQX A;  2D3O W;  3OR6 C;  1EBO A;  5EK0 A;  1QNM A;  3K5O A;  4O4J B;  2VS0 A;  1JFF B;  4GX2 A;  4CZZ A;  3MAQ A;  1ZTE A;  1IVS A;  2QA4 V;  5CA0 A;  4MTG A;  1IX9 A;  2WLH A;  1J5E O;  4TV8 A;  5B1N A;  2EJR A;  3ZHS A;  4TUY B;  4EFE A;  3JAS B;  4DUY B;  1XI1 A;  2NR5 A;  4UB6 Z;  2CAZ C;  3O9O A;  2ZCE A;  4JTC B;  4FFB B;  3THO A;  1AI4 A;  4HZ3 A;  2QGN A;  3HPL C;  4LFB B;  4U3F H;  4ZI7 B;  4BIO A;  4NKG B;  1K4C C;  2QEX V;  2IH3 C;  3F5T A;  2DWE C;  4J41 A;  1OZ0 A;  4B3T B;  4ZHQ A;  2C2A A;  4FLX A;  5IYZ B;  1SET A;  1Q8I A;  5IWA B;  2YUA A;  3K0G A;  4O2A A;  3K3W A;  4X8A A;  2F66 C;  4ZOL B;  4X9Q A;  1XRE A;  3ABT A;  2A7W A;  5IJ9 A;  1G8M A;  1WPX A;  3LNM B;  4DV0 B;  3BAB A;  2N04 A;  2IJI A;  4PJ0 Z;  3B8M A;  1H2S B;  4Q6G A;  4O4J A;  2UXB B;  2ZXW B;  1JFF A;  1HNW B;  2ZIM A;  4X89 A;  1N36 B;  2Q6A A;  3A0H Z;  1WNS A;  3AK1 A;  4MTF A;  1E1R G;  5FLX N;  2JS3 A;  1MZF A;  1X59 A;  1S0V A;  1DGS A;  5KUK A;  4I55 B;  3J81 N;  4JYB A;  4DR1 B;  2EZO A;  2WAM A;  4TUY A;  3JAS A;  4LF4 B;  1N0N A;  4LC1 A;  4IL6 Z;  2E5L B;  1UJW B;  1H2G A;  4PA7 A;  1LR1 A;  4TQF A;  4FFB A;  3ZHT A;  1GAX A;  3OEH G;  2ZE5 A;  4OX9 B;  2DE0 X;  4LR3 A;  3ZHV A;  4XDL A;  1S77 D;  1QLN A;  1AJP A;  1K73 W;  4ZI7 A;  3S3X A;  3HKB B;  2E75 B;  3TK1 A;  3GWO A;  5C93 A;  2EJ7 A;  4JI7 B;  5IYZ A;  2ZIN A;  1IZ3 A;  1ENV A;  1SZT A;  1P7B A;  4ICG A;  2CK3 G;  4ZOL A;  1VQP V;  1XIL A;  4JV5 O;  2YXH A;  4EKW A;  3K9S A;  1HDJ A;  4DRX B;  1YJN V;  3SYC A;  2JS5 A;  1WB7 A;  3RYI B;  3IFX A;  2Q7G A;  5LBQ A;  1Q90 D;  4JZG A;  3W7W A;  4U3J B;  1J5E B;  1R1B A;  4YY3 O;  4MTO A;  4DR4 O;  1CP9 A;  1NR1 A;  1KKC A;  2DYR C;  1R3L C;  5AG2 A;  1G6U A;  2WA4 A;  4BIZ A;  4BR6 A;  3ZMV A;  1LNQ A;  2E76 B;  4IIJ B;  2IH1 C;  2QKA A;  3F5W C;  4I55 A;  2QM7 A;  3ETG A;  4F6R B;  2PZS A;  4RAI A;  5E1A C;  4QIW F;  3UQ8 A;  2WLJ A;  1YDX A;  2YC0 A;  5BR8 O;  5CA1 B;  5EC2 C;  4J42 A;  4JI8 O;  1K4D C;  5GTI Z;  1GN6 A;  3APO A;  3N27 A;  5KHJ A;  2BTO A;  3HB3 B;  1B3Q A;  5LOV B;  4WFG A;  2JDI G;  3L74 H;  3D3I A;  4QPK A;  3HKB A;  1GK9 A;  3SPI A;  4H0L B;  2PI5 A;  2QWO B;  4AIL C;  4UCS A;  4L87 A;  4J9Z B;  4FVM A;  1W0K G;  4DRX A;  5LP6 B;  4UCO A;  2H3O A;  3ZRW B;  2E74 B;  3RYI A;  2FKX A;  3MHS C;  5J9P C;  1AJN A;  3IGA C;  3ETD A;  4X1I B;  4XDK A;  5A9G A;  1R6K A;  1S76 D;  4U3J A;  2EIN B;  3CXH F;  3FX7 A;  3CMA V;  1SES A;  2FML A;  3CC2 V;  4MS2 A;  4MVS A;  4WFH A;  3ASN B;  3BA9 A;  1Q82 W;  2GTA A;  3C90 A;  2PY5 A;  3H1I H;  4IIJ A;  1KYO F;  4DXW A;  3P3N A;  4F4L A;  1NTK H;  1SQX H;  4F6R A;  1VEW A;  1U97 A;  2F1M A;  2K1E A;  5KAF Z;  5CA1 A;  5LGN A;  2PGG A;  4D7T A;  1JJO A;  3CB2 A;  3OEE G;  2QM4 A;  1NH2 B;  4JZ2 A;  1RPO A;  3SPJ A;  1XMQ B;  3VQV A;  1VAR A;  3SYA A;  2OCH A;  4JYA O;  1M4U A;  2EIM B;  2A06 H;  2R70 A;  1ARO P;  1K9M W;  3QTC A;  2IJJ A;  4DV4 O;  3CWB H;  5LOV A;  4I0X B;  1FXH A;  1B04 A;  3ETE A;  4JV5 B;  1W2B U;  1OJH A;  3CYO A;  2ZE7 A;  4WBN B;  4RWU A;  5BMV B;  2PUS A;  4F6E A;  2CUG A;  2NN4 A;  4PA4 A;  3SJC C;  1BHB A;  2ZIO A;  5JJN B;  1RPR A;  4GX5 A;  3TXQ A;  3BY6 A;  2YI9 A;  4YY3 B;  3DGE A;  3K04 A;  2LJ2 A;  1JA8 A;  5LP6 A;  3ZRW A;  3ABM B;  1A32 A;  1AP6 A;  1WAZ A;  4X1I A;  2YIB A;  1GM8 A;  4J7J A;  4DK0 A;  1VF6 C;  4KHP O;  3LNN A;  1ZSP A;  1SQG A;  4X65 O;  1GM7 A;  4DR2 O;  2Q73 A;  3CRQ A;  3X2Q B;  5BR8 B;  1KP3 A;  4JI8 B;  2OTJ V;  5GW7 A;  3HKD B;  3SJA C;  3D36 A;  3T1H O;  2L35 A;  4JI6 O;  1M5I A;  1P4R A;  4DR6 O;  5J2T B;  3G71 V;  1JMK C;  2UXC O;  1M56 B;  4MSW C;  4JI0 O;  4PDV A;  1PL0 A;  2CGO A;  3CRC A;  2V4D A;  3OT7 A;  2X0L A;  2CTR A;  3GVM A;  3A8T A;  3ASO C;  4JAS A;  2YID A;  3BPZ A;  4B3S O;  3FKS G;  3EFF K;  1SS3 A;  1JX9 A;  2EIK C;  5CB4 A;  2Q67 A;  2XAJ A;  3RW0 A;  5CBH A;  4I0X A;  5B1A C;  1H8E G;  4G2K A;  2OCC C;  3OM3 B;  4YHH O;  4WBN A;  5BMV A;  4I50 A;  4DUZ B;  2CH7 B;  3JSN A;  4X64 O;  1Z5W A;  3ETQ A;  4HYO A;  4J7Z A;  4DV1 B;  1P84 F;  3QG5 A;  4EEQ A;  3OUF A;  2CTW A;  2KKW A;  4J80 A;  1V54 C;  4Z1V A;  4ASU G;  4GUN A;  4CH4 A;  5CMU A;  2PTM A;  5LA6 B;  5IY5 B;  2H8P C;  2Q7E A;  3ZHU A;  4DR7 O;  3E89 A;  3HKD A;  4B3R O;  3LUT B;  4NTY A;  3CS5 A;  2F23 A;  2QKC A;  2P6J A;  3CCR V;  5J2T A;  4JYA B;  2Q9L A;  3NXS A;  4LFC O;  1AI6 A;  4LP8 A;  5H9C A;  4DV4 B;  4JAU A;  3ABU A;  2DWD C;  2Y0P A;  2AZ2 A;  1S5J A;  4B7K A;  4I9W A;  4PA9 A;  5LGT A;  3JCU Z;  1Q6U A;  4E2L A;  1BHA A;  3BVO A;  5TIS Z;  3UO3 A;  2Y69 B;  4DO2 A;  5JJJ B;  2IU0 A;  4I7Z B;  4JI1 O;  2LO1 A;  1QQC A;  5CA3 A;  2XHB A;  3I5D A;  2Q68 A;  2CH7 A;  4JTA B;  4FK5 C;  1SQF A;  1GTO A;  1DF5 A;  2VWK A;  4X65 B;  4DR2 B;  2ADQ B;  4DR1 O;  4FLT A;  2AW9 A;  1Y76 B;  3E8F A;  1H2N A;  1GH6 A;  2E5L O;  3K03 A;  3T1H B;  1KEC A;  3G67 A;  1K7D A;  4JI6 B;  5LA6 A;  1QLE C;  4DR6 B;  2UXC B;  2XAQ A;  3TXS A;  4JI0 B;  1H2K A;  5LXT B;  3AG1 C;  2UXX A;  3PJS K;  1I7F A;  4B3S B;  2MK3 A;  4OPA A;  3AG2 C;  3G6B A;  3KCY A;  5C8Y B;  1XOU A;  2NNU A;  1ZX3 A;  3ZJZ A;  3CCS V;  2QKS A;  1Q3E A;  5CBF A;  5EBM C;  3SR2 C;  4YHH B;  2RNB A;  2CTQ A;  3G6E V;  3K9A A;  4R50 A;  5EZY B;  1YJW V;  2X6C A;  3GB7 C;  3L75 H;  1RSO B;  4GCZ A;  3QF7 A;  1MG1 A;  3QNE A;  1XEQ A;  5LYJ B;  4K35 A;  2D2C B;  3CX5 F;  4X64 B;  1EZJ A;  2VQE O;  1HP8 A;  2P67 A;  1NVP D;  2W6J G;  1OCO C;  2BTQ B;  2HHH O;  1NJI W;  3OTO O;  3MD0 A;  1RM1 B;  4BW9 A;  1Y76 A;  2QWP B;  4DR7 B;  5EC1 C;  2GBO A;  3RT3 C;  1H38 A;  3K5M A;  1IXB A;  4LFA O;  4B3R B;  3H1H H;  1KU9 A;  1WP7 A;  3U0Z A;  2DQ3 A;  3OUS A;  2BOB C;  2GV9 A;  1YHQ V;  3N2G A;  2DYR B;  3CPW U;  1Y74 B;  5KMG A;  1NQT A;  4LFC B;  1I5Y A;  4ZKI A;  1XDC A;  2R9I A;  4GKK O;  5LXT A;  4P9P A;  3CXC U;  4UB8 Z;  1NZ6 A;  1ZL8 A;  5LMN O;  2BCC H;  1Z5V A;  4GT1 A;  2RQ6 A;  3OMN B;  2QR4 A;  5C8Y A;  3ZMT A;  4H33 A;  1KQS U;  2ZKO A;  2UUC O;  1OV9 A;  3L72 H;  2W0F C;  3ZN1 A;  5LMU O;  4W4K A;  4JI1 B;  5E79 Z;  5KX5 B;  3APQ A;  2VQF O;  3TCU A;  4GX1 A;  4UV8 A;  2DOS A;  2DW4 A;  5EZY A;  2PYL A;  1FFX B;  4FZ1 A;  2ZT9 B;  3T4D A;  4ZIB A;  1RSO A;  1ZLZ A;  3I56 V;  2OYQ A;  2B1G A;  2GHY A;  5LYJ A;  2FL4 A;  3JD0 A;  1GN3 A;  1L0L H;  2MW2 B;  2AHY A;  3E8B A;  2YEV B;  4L8J A;  1US6 A;  2BTQ A;  2LW7 A;  4JI5 O;  2QWN B;  1M57 C;  3AG3 C;  1H2M A;  4JGS A;  1MNG A;  4NYK A;  1BMF G;  1VQ5 V;  4DW0 A;  3ZBH A;  4DR5 O;  2LW1 A;  4XBF A;  3RFR A;  4MVZ A;  1FJG O;  1V55 C;  1NR7 A;  2KG7 B;  1VIB A;  5GON B;  1PNK A;  4JI2 O;  1IUR A;  1Q43 A;  4LNU B;  5LHG A;  1XMQ O;  4YXW G;  4O2B B;  3U11 A;  3KZI Z;  4JYC A;  1Q6I A;  3FYI B;  2F95 B;  5JJE B;  4OPH A;  5D5Q A;  1B6Q A;  1R3J C;  1F4N A;  4IYI A;  2IM9 A;  4B08 A;  1SA0 B;  4QGP A;  2UUB O;  3EVK A;  4DV2 O;  1HNX O;  1FFT B;  3RVY A;  4K3A A;  2EIJ C;  2B1I A;  3CRA A;  4PA3 A;  3B09 A;  1TUE B;  5KX5 A;  3Q4H B;  2VQE B;  1R3K C;  4ZBM A;  2V1D A;  3UM7 A;  1FFX A;  2M7W A;  3TET A;  3FB8 C;  3DTU B;  5IE9 A;  2JRI A;  4WFE A;  2HHH B;  4O4H B;  3OTO B;  1AI5 A;  1AR4 A;  1JQ0 A;  1P7G A;  3ZRS A;  1KUQ A;  4LF7 O;  1QU7 A;  3HKE B;  2YEV A;  3OMA B;  1KC8 W;  2YI8 A;  2Z5U A;  4NXM O;  1NBM G;  1AR5 A;  2ETN A;  4LFA B;  3LSU A;  4PHZ A;  1CPY A;  4PI2 A;  3WFV A;  2ZDI C;  3E83 A;  4CS2 A;  3RYC B;  5IT9 N;  2RJZ A;  2CDY A;  3OGI B;  3DXR B;  5KA6 A;  1SF9 A;  4GKK B;  3LSQ A;  2KG7 A;  2G38 A;  3JAL B;  5GON A;  3AG4 C;  2LFS A;  3CCL V;  3ZX6 A;  5LMN B;  2YXL A;  4LWS B;  4LNU A;  3FAV B;  2ADP A;  1JPX A;  1J95 A;  1D2D A;  5KUM A;  5HFL A;  3ML0 A;  1YI2 V;  5IYD O;  4O4L B;  2UUC B;  2P5O A;  5LMU B;  3WU2 Z;  1SA0 A;  1P49 A;  5EBL C;  2VQF B;  5FNV B;  3OFN G;  2UU9 O;  1AIL A;  3ZIA G;  1E1Q G;  4GYC B;  4XDJ A;  1OCR C;  3ASO B;  4DUZ O;  1TAE A;  3Q4H A;  3UCS C;  3NR7 A;  1BCC H;  4P30 A;  1WPB A;  2GTS A;  2EIK B;  4DV1 O;  4X20 B;  4RO2 A;  4JI5 B;  3SPC A;  5B1A B;  4O4H A;  2OCC B;  4KUM A;  3SJQ C;  2ZM6 O;  4DR5 B;  1W0J G;  5L3G A;  3HKE A;  4RQE A;  1R6N A;  3H1K H;  3TGU H;  1FJG B;  1VQ9 V;  1SQP H;  5KHH A;  5J2U B;  2WLK A;  4GX0 A;  1Q81 W;  4B7E A;  2JK5 C;  3QO5 A;  2LGW A;  1K97 A;  4NTX A;  2ZE6 A;  1QR8 A;  2CTP A;  5B66 Z;  3EHB B;  4JI2 B;  5KLV H;  4DV3 O;  1TVK B;  3ABK C;  1NTZ H;  3DXR A;  2A9H A;  1IXM A;  1Q7Y W;  4BAY A;  2RMK B;  3TJT A;  5DED A;  2HJD A;  3UKM A;  3JAL A;  4MVU A;  1V54 B;  5IYB O;  2Y0I A;  2X7R B;  4LWS A;  3FAV A;  4CH3 A;  5L3C A;  1O9H A;  2UUB B;  2LP7 A;  1G1X B;  4DV2 B;  3HR0 A;  1Y4M A;  1HNX B;  3VQW A;  2W0X A;  3CC7 V;  4O4L A;  1E79 G;  1FXK C;  4DV6 O;  3STZ C;  4C7U A;  2HLD G;  5FNV A;  2HG5 C;  2FYU H;  1SQV H;  2HEP A;  3SYO A;  1GN2 A;  3T4Z A;  2LQT A;  4BW5 A;  2Y4T A;  3E8G A;  1FD9 A;  4LF8 O;  4LF7 B;  3WB0 A;  2XAS A;  4WFB V;  4HAM A;  1VF7 A;  4DV7 O;  4NXM B;  4X20 A;  1ZWI C;  2ZR2 A;  1NKD A;  3AK2 A;  1CEZ A;  3OMI B;  3LDD A;  4TT3 G;  3A0R A;  3L71 H;  5BY1 A;  3E8H A;  1BSM A;  1WLE A;  3K5L A;  4FFK A;  3E22 B;  2DN9 A;  1K33 A;  3ABL C;  5J2U A;  4FLZ A;  3P30 A;  4X1K B;  3M8A A;  3STL C;  3WG7 C;  2FTK A;  1XBL A;  3CC4 V;  3BHP A;  2WLL B;  2YIA A;  3VQY A;  1TVK A;  2RDC A;  3L9D A;  1BQZ A;  4Z1M G;  3JCZ A;  1K8A W;  3L70 H;  3R65 A;  1BZK A;  2EUL A;  3SGI A;  1OCC C;  2AHZ A;  2ZNI A;  3CSX A;  4LF6 O;  1QLE B;  2UU9 B;  3R66 A;  4DW1 A;  4ABM A;  4R8C A;  3RYH B;  2P90 A;  2QSA A;  5FL7 G;  2JJ1 G;  1PP9 H;  2F43 G;  4MVM A;  1I08 A;  1VP7 A;  1URF A;  5DM6 V;  2YXY A;  2ZM6 B;  4JPR A;  2WSS G;  3RGB A;  1ORQ C;  4G27 B;  4LH6 A;  1EFR G;  3IAY A;  3CCE V;  5B1B C;  2HVK C;  4MVQ A;  2R9A A;  3CHX A;  5H6R A;  3JAW B;  4FPP A;  4DV3 B;  2Z0A A;  4PA6 A;  3MHH C;  3E22 A;  1I0H A;  2R9R B;  2QTS A;  2Q7H A;  3ZMU A;  3ZS8 C;  1NVP B;  1OCO B;  3VOU A;  4X1K A;  4KP4 A;  1K34 A;  5B3S C;  2F4V O;  3T1Y O;  3JAT B;  1MOF A;  3G80 A;  4Q20 A;  1WJZ A;  3ICX A;  1ROP A;  4JI3 B;  3BAA A;  4UCR A;  1F7Y A;  1VQO V;  1THZ A;  2Y4U A;  4DV6 B;  1KMI Z;  1HWY A;  1W59 A;  1TA8 A;  2P22 C;  1QVF U;  3RYH A;  4P9O A;  4IGG A;  3LDC A;  1XHX A;  2ATK C;  3CJH B;  1Y6X A;  2GSM B;  4RUF A;  4LF8 B;  1JR9 A;  3K06 A;  4LH7 A;  4UFZ A;  4JI4 B;  1V9P A;  1H2L A;  4WCE V;  5IDJ A;  4DV7 B;  1YTF B;  2BE3 A;  4FLY A;  1FS0 G;  3UO2 A;  2YIC A;  4RQF A;  2ZD9 A;  4I9Q A;  1M56 C;  5HFM A;  1HNZ O;  1K5Q A;  4NB5 A;  2UXN A;  1MA1 A;  4U7N A;  3HKC B;  3SPH A;  1HR0 B;  3JAW A;  4X66 O;  1PPJ H;  1HW7 A;  4LBE C;  2JIZ G;  3OAA G;  2AGA A;  4QPJ A;  4J11 A;  3JAK B;  2HR3 A;  3M99 B;  3L73 H;  1SKV A;  1AJQ A;  4PD4 F;  1M57 B;  2CGN A;  1VQ6 V;  1GN4 A;  1T5E A;  3AG3 B;  1JOY A;  3CEI A;  4LF6 B;  2W6I G;  3JAT A;  2XT9 A;  4NTW A;  1PD3 A;  4AQY O;  1V55 B;  4FLW A;  2EIL C;  3K5N A;  3OW2 U;  4FM2 A;  4DR3 O;  2VRZ A;  1KKD A;  3JAM N;  1XL4 A;  1XQ8 A;  1YEW A;  4MTX A;  4AI8 A;  3B77 A;  5EBW C;  3VBB A;  3CJH A;  5IY5 C;  3CD6 V;  5IJ0 B;  3FYE B;  5JCO C;  3BFR A;  1IBL O;  3SYP A;  2HVJ C;  4O4I B;  4K8X A;  3A2F A;  1TGO A;  5L3E A;  4X62 O;  1ZAU A;  4FZ0 A;  4JAA A;  5L3D A;  4B3M B;  2EIJ B;  3CME V;  3FFQ A;  1FPO A;  3DSQ A;  3N2K B;  1LUW A;  1I94 B;  5A2Q N;  1VQM V;  1IBM B;  1S3J A;  3K79 A;  3HKC A;  2UUA O;  1BQ0 A;  4I5S A;  1IBK B;  1MZE A;  2F4V B;  3T1Y B;  2EBO A;  4FJC C;  4YIP A;  5H6Q A;  2QWR B;  4QE7 A;  2Y69 C;  5CBG A;  3JAK A;  3LSS A;  5H2F Z;  5JH7 B;  1YTF D;  1G4Y B;  1AR1 B;  2ZR3 A;  1Q86 W;  1COW G;  4FIP C;  1MAB G;  1H8H G;  4MW8 A;  4K0K O;  1VQL V;  3SYQ A;  2M6Y A;  2JJ2 G;  4UVC A;  1Y66 A;  2IBZ H;  3AG7 A;  1BL8 A;  3AG4 B;  2K9P A;  1EN6 A;  1L8D A;  1OCZ C;  4JAV A;  1M90 W;  1DK1 A;  2DYS C;  3JAR B;  4X88 A;  4BIU A;  3U10 A;  4EB6 B;  1UFI A;  4GKJ O;  4CS4 A;  2JGU A;  4CH5 A;  3CCU V;  5BXZ A;  5IJ0 A;  4QNH B;  4I4T B;  2XAF A;  3RYF B;  4O4I A;  2A0L A;  2DMX A;  4U7O A;  3B4S A;  1QVG U;  1YIT V;  2Q5Z A;  1HNZ B;  1BS3 A;  1QR9 A;  4DV5 O;  4OGQ B;  3D8C A;  1MMM A;  2LGQ A;  3OE7 G;  5JWP A;  5KHK A;  4RUE A;  3ZED A;  1S5H C;  4J9Y B;  5KHG A;  4X66 B;  2DQ0 A;  2XAH A;  1OCR B;  3CE2 A;  2B9Z A;  3N2K A;  4KL1 A;  1SC5 B;  2XAG A;  2JEX A;  5EYP B;  2X6A A;  3RBZ A;  1XNQ O;  1YVW A;  1AP5 A;  4R7C A;  3J7A U;  1Y74 A;  1OHH G;  2JEU A;  1NI8 A;  3IJ4 A;  2ODM A;  3IC9 A;  3MDS A;  3JYC A;  2OWO A;  1NU1 H;  3ZN0 A;  4PI0 A;  3E2E A;  2LFR A;  1S5L Z;  4GZR B;  3F7Y C;  4AQY B;  2YDE A;  5JH7 A;  2VWJ A;  4MT8 A;  2UXD O;  3QO7 A;  2ZQM A;  5LGU A;  2ZDI A;  2CE4 A;  4DR3 B;  4PEL A;  3ABK B;  5KHI A;  3QVN A;  4HNA B;  4UVA A;  5GTH Z;  1KB9 F;  2QDO A;  5JVD B;  2BOC C;  4LF5 O;  1VQ4 V; 
#chains in the Genus database with same CATH homology
 3LUT B;  1RM1 C;  1MSW D;  5KA5 A;  1N8R W;  2P6J A;  3CCR V;  2KB1 A;  3CC7 V;  2HJF C;  1E79 G;  1FXK C;  4JTC B;  3NXS A;  2QE7 G;  1AI6 A;  3W7U A;  4LP8 A;  5H9C A;  3FB5 C;  1R3I C;  3STZ C;  3QO8 A;  4JAU A;  3ZRV A;  3ABU A;  2DWD C;  2HLD G;  1FXK B;  1AI4 A;  3P32 A;  3FB6 C;  2HG5 C;  2HKO A;  4HZ3 A;  3T1C A;  4I9W A;  3HPL C;  4PA9 A;  5LGT A;  3SYO A;  3T4Z A;  1PNM A;  4WFF A;  3E8G A;  4BW5 A;  4E2L A;  1BHA A;  1K4C C;  2QEX V;  2IH3 C;  1QBZ A;  2DWE C;  3AEI A;  1OZ0 A;  2Y69 B;  3KG2 A;  2XAS A;  4DO2 A;  2IU0 A;  4WFB V;  2C2A A;  1SRY A;  4HAM A;  1SET A;  1ZWI C;  2NLJ C;  3K0G A;  2ZR2 A;  1NKD A;  1CEZ A;  3OMI B;  3LDD A;  3K3W A;  4X8A A;  1KD1 W;  5CA3 A;  4TT3 G;  3ABT A;  3ZMZ A;  3A0R A;  3E8H A;  1WLE A;  2Q68 A;  4JTA B;  4FK5 C;  1G8M A;  1GTO A;  1WPX A;  3LNM B;  1AI7 A;  1K33 A;  3ABL C;  2ZXW C;  1DF5 A;  2IJI A;  3P30 A;  1XL6 A;  3E86 A;  3B8M A;  3STL C;  3WG7 C;  2FTK A;  1F23 A;  5BZB A;  3CC4 V;  2WLL B;  4PDR A;  3ABL B;  2ZXW B;  2ITC C;  3E8F A;  4UV9 A;  1VQK V;  4Z1M G;  1JJ2 U;  3JCZ A;  1K8A W;  4X89 A;  2Q6A A;  3K03 A;  1KEC A;  3WG7 B;  1K7D A;  3R65 A;  4MTF A;  1E1R G;  1PKX A;  1S0V A;  1QLE C;  4PDM A;  5KUK A;  1OCC C;  2AHZ A;  2XAQ A;  4JYB A;  2EZO A;  2WAM A;  4WFA V;  3AG1 C;  2UXX A;  1QLE B;  4N23 A;  3PJS K;  4LC1 A;  3G4S V;  1JCH A;  1OCC B;  5B1O A;  1UJW B;  1H2G A;  4R8C A;  4PA7 A;  2MK3 A;  3AG2 C;  2XOK G;  2P90 A;  2ITD C;  3W7X A;  2NNU A;  1F4M A;  4JTD B;  5FL7 G;  1GMG A;  3ZJZ A;  3CCS V;  1FXK A;  2JJ1 G;  3OEH G;  2QKS A;  2F43 G;  4MVM A;  5CBF A;  5EBM C;  4XDL A;  1S77 D;  1QLN A;  1AJP A;  3G6E V;  1K73 W;  5L3F A;  3K9A A;  5DM6 V;  4R50 A;  1YJW V;  2X6C A;  3GB7 C;  3JD1 A;  2Z3Y A;  1GO3 F;  4JPR A;  4GCZ A;  2WSS G;  3TK1 A;  5C93 A;  3GWO A;  2WLN A;  1MG1 A;  1ORQ C;  3QNE A;  1EFR G;  4G27 B;  1EZJ A;  3CCE V;  5B1B C;  2HVK C;  1ENV A;  1SZT A;  3SPG A;  1P7B A;  4MVQ A;  2CK3 G;  1VQP V;  5H6R A;  1JVM A;  2P67 A;  2QTO A;  3F7V C;  4FPP A;  1NVP D;  2W6J G;  4FMT A;  4EKW A;  1OCO C;  3CP1 A;  3MHH C;  4PA6 A;  5L3B A;  1VQN V;  5B1B B;  1DLB A;  3W7T A;  1YJN V;  3SYC A;  1NJI W;  3IFX A;  2OTL V;  2WLM A;  2R9R B;  1FXV A;  3ZMU A;  5LBQ A;  1NVP B;  1OCO B;  3MD0 A;  3W7W A;  1RM1 B;  3VOU A;  2IJH A;  4KP4 A;  1K34 A;  5B3S C;  4MTO A;  5EC1 C;  1H38 A;  1CP9 A;  1NR1 A;  2DYR C;  3FB7 C;  4MVR A;  1MOF A;  1R3L C;  5B3S B;  2DQ3 A;  4BIZ A;  4Q20 A;  3K0D A;  3OUS A;  2BOB C;  3ZMV A;  1LNQ A;  1YHQ V;  1ROP A;  2IH1 C;  3F5W C;  3ZRX A;  2DYR B;  3CPW U;  1VQO V;  1NQT A;  3JD4 A;  1THZ A;  3RVZ A;  1I5Y A;  4ZKI A;  2QM7 A;  1HWY A;  2R9I A;  3ETG A;  4P9P A;  4RAI A;  5E1A C;  3CXC U;  4QIW F;  2WLJ A;  4H37 A;  2Q69 A;  5LHI A;  5EC2 C;  1QVF U;  4GT1 A;  4P9O A;  3LDC A;  3I55 V;  3LDE A;  1K4D C;  4UVB A;  2ATK C;  3OMN B;  2GSM B;  4RUF A;  3ZMT A;  4H33 A;  3K06 A;  1KQS U;  3T2M A;  2V7Q G;  3HB3 B;  1DF4 A;  4QJF B;  4WCE V;  2W0F C;  5IDJ A;  3ZN1 A;  1YTF B;  3CCQ V;  3TCU A;  1PNL A;  4GX1 A;  4UV8 A;  4WFG A;  1FS0 G;  2JDI G;  1GM9 A;  2DW4 A;  3D3I A;  4QPK A;  4MW3 A;  4RQF A;  2ZD9 A;  3T4D A;  1M56 C;  1I5X A;  5HFM A;  3I56 V;  3CCM V;  1GK9 A;  2B1G A;  2GHY A;  3SPI A;  4LCU C;  5DN6 G;  2PI5 A;  3JD0 A;  1K5Q A;  3K08 A;  5IYC O;  2AHY A;  1M1K W;  2UXN A;  4U7N A;  3E35 A;  3E8B A;  2YEV B;  2IJK A;  4L87 A;  4J9Z B;  3SPH A;  2PI4 A;  4LBE C;  2JIZ G;  4PDL A;  3OAA G;  2EIN C;  1W0K G;  1M57 C;  3ZRW B;  3AG3 C;  4JGS A;  1BMF G;  4QPJ A;  3MHS C;  2OT5 A;  5J9P C;  3AG1 B;  1VQ5 V;  1AJN A;  3IGA C;  3ETD A;  2HR3 A;  2X6B A;  4XDK A;  3M99 B;  1R6K A;  1S76 D;  1AJQ A;  4XBF A;  2EIN B;  3ASN C;  1M57 B;  4MVZ A;  1VQ6 V;  1YIJ V;  3AG3 B;  1JOY A;  4QE9 A;  1QCE A;  1V55 C;  1M9N A;  3CMA V;  1SES A;  3AG2 B;  2H94 A;  4MS2 A;  3CC2 V;  1NR7 A;  2W6I G;  4UXN A;  4MVS A;  4WFH A;  3ASN B;  1Q82 W;  1PNK A;  1PD3 A;  1V55 B;  5LHG A;  5LHH A;  4YXW G;  3ZCC A;  4DXW A;  2EIL C;  4JYC A;  3FYI B;  3OW2 U;  2A79 B;  2IW5 A;  4F4L A;  1K3E A;  1B6Q A;  4MVO A;  1KKD A;  2EZP A;  2K1E A;  1R3J C;  1NH2 D;  1F4N A;  2EIL B;  1XL4 A;  4MTX A;  5LGN A;  3BEH A;  3B77 A;  3OR7 C;  5EBW C;  3OEE G;  3VBB A;  5IY5 C;  1NH2 B;  2EIM C;  3CD6 V;  1FFT B;  3RVY A;  1RPO A;  3FYE B;  4OXS A;  3SPJ A;  3SYP A;  2EIJ C;  2B1I A;  2HVJ C;  3SYA A;  5L3E A;  4PA3 A;  2EIM B;  4TWK A;  1ARO P;  1K9M W;  1TUE B;  5L3D A;  2IJJ A;  2EIJ B;  2WLL A;  1FXH A;  2WLI B;  3CME V;  1R3K C;  4ZBM A;  4N21 A;  2V1D A;  3UM7 A;  2M7W A;  3ETE A;  3TET A;  3FB8 C;  3DTU B;  1W2B U;  3CYO A;  4WFE A;  1VQM V;  1AI5 A;  1JQ0 A;  1S3J A;  2XND G;  4PA4 A;  3ZRS A;  1VQ8 V;  1BHB A;  5CN0 A;  1RPR A;  3K79 A;  4GX5 A;  4WF9 V;  2YEV A;  1KP2 A;  3ABM C;  3BY6 A;  1K5S A;  3OMA B;  3H01 A;  4I5S A;  1KC8 W;  2Z5U A;  3DGE A;  3K04 A;  1NBM G;  2EBO A;  4FJC C;  5H6Q A;  3ZRW A;  3ABM B;  1CPY A;  3IC7 A;  3WFV A;  2ZDI C;  3E83 A;  4QE7 A;  2Y69 C;  5CBG A;  3LSS A;  1GM8 A;  1YTF D;  1G4Y B;  1L1F A;  1AR1 B;  2WWW A;  3X2Q C;  3OGC C;  2ZR3 A;  2IU3 A;  4TSF G;  5KA6 A;  1Q86 W;  1COW G;  3LSQ A;  4FIP C;  1GM7 A;  1MAB G;  1H8H G;  3AG4 C;  4MW8 A;  1VQL V;  3SYQ A;  3X2Q B;  2LFS A;  3CCL V;  3ZMS A;  2JJ2 G;  4UVC A;  1KP3 A;  4R6Z A;  1Y66 A;  2OTJ V;  5GW7 A;  1JPX A;  1J95 A;  1BL8 A;  3AG4 B;  3D36 A;  5KUM A;  5HFL A;  1K92 A;  1OCZ C;  3ML0 A;  4JAV A;  2B5U A;  1YI2 V;  1M90 W;  5IYD O;  1P4R A;  3G71 V;  2DYS C;  4X88 A;  4BIU A;  1M56 B;  2YSU B;  2WPD G;  4MSW C;  1OCZ B;  4PDV A;  1PL0 A;  3W7S A;  5EBL C;  2X0L A;  3CCU V;  3OFN G;  1GKF A;  2DYS B;  4QNH B;  3ASO C;  4JAS A;  2XAF A;  4G28 B;  3FKS G;  3ZIA G;  3EFF K;  1E1Q G;  3JD2 A;  2A0L A;  1JX9 A;  2HFE C;  4U7O A;  2EIK C;  4XDJ A;  1YIT V;  1QVG U;  1QR9 A;  2Q67 A;  1OCR C;  2XAJ A;  3ASO B;  3RW0 A;  1R73 A;  5CBH A;  5B1A C;  2WLI A;  1YJ9 V;  1DTO A;  3OE7 G;  1H8E G;  4P30 A;  4G2K A;  4RUE A;  1S72 V;  2OCC C;  1S5H C;  3OM3 B;  2EIK B;  4J9Y B;  1SER A;  2DQ0 A;  2XAH A;  1OCR B;  4RO2 A;  4P2Z A;  2QM8 A;  2XAG A;  2JEX A;  3CCV V;  2X6A A;  3RBZ A;  3SPC A;  1YSC A;  5B1A B;  2P7T C;  2OCC B;  3JD3 A;  4KUM A;  4KFM A;  4R7C A;  4JF3 A;  3SJQ C;  1VQ7 V;  1W0J G;  1OHH G;  5L3G A;  4RQE A;  2JEU A;  3CCJ V;  1R6N A;  1VQ9 V;  3B8N A;  2Y48 A;  1F51 A;  4CBC A;  3JYC A;  2WLK A;  4GX0 A;  4UUJ C;  1Q81 W;  4HYO A;  2JK5 C;  3ZN0 A;  3E2E A;  3QO5 A;  2LFR A;  1K97 A;  1QR8 A;  2D3O W;  3EHB B;  3OR6 C;  1EBO A;  3OUF A;  5EK0 A;  3F7Y C;  3ABK C;  4MT8 A;  1V54 C;  4ASU G;  4GX2 A;  2A9H A;  1IXM A;  4CZZ A;  4BAY A;  1Q7Y W;  2QA4 V;  3QO7 A;  2ZQM A;  5LGU A;  4MTG A;  2ZDI A;  5CMU A;  3UKM A;  5IY5 B;  2WLH A;  3ABK B;  2H8P C;  4MVU A;  4PEL A;  1V54 B;  4UVA A;  5IYB O;  2X7R B;  2BOC C;  3E89 A;  1VQ4 V;  5B1N A;  5L3C A;  2EJR A;  2LP7 A;  1Y4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...