2AZ0A

Flock house virus b2-dsrna complex (p212121)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein/rna
total genus 23
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az0A00
2KG7B 3TXQA 3GWKC 3GVMA 4I0XB 4LWSA 1WA8A 4ABMA 3FAVB 2AZ0A 2DE0X 2VS0A 2B9ZA 2KG7A 3Q4HB 2AZ2A 3TXSA 2VRZA 3G80A 4I0XA 3O9OA 3OGIB 3FAVA 3HR0A 3FD9A 3ZBHA 4GZRB 4LWSB 1WA8B 3Q4HA
chains in the Genus database with same CATH superfamily
4XDLA 1ZL8A 5L3CA 2QKSA 4ZI7A 2XT9A 1KECA 2VQEO 1QLNA 1ROPA 3TXSA 4JAAA 1DK1A 1ZX3A 4MVOA 2EINB 1RSOB 3ETQA 3LSUA 2V1DA 3ZBHA 1GKFA 2QEXV 2R9AA 5KHGA 4PA7A 4IYHA 4LFBB 1YDXA 5EBLC 4NKGB 1KYOF 2JEUA 1XQ8A 1KP2A 1AI7A 1GN3A 3B40A 2Z0AA 5BR8O 1WAZA 3CYOA 4ZIBA 3MHHC 2FTKA 4OGQB 3OTOB 4LCUC 3DXRA 5CA0A 2EX3A 4R6ZA 3SDLA 4LWSB 1PL4A 4K0KB 1QCEA 1WN7A 1P4RA 3SYOA 1A32A 3D3QA 2BSKB 2WLKA 3JD3A 5FNVB 3K79A 3WB0A 2HLDG 1WPBA 1EN5A 1NH2B 4JI8O 1TAEA 4U7OA 3ZMTA 1PP9H 3U11A 3SPIA 3OEEG 4ZOLB 1FJGB 3W7UA 5KMGA 2UU9O 4G28B 1R6TA 5IJ9B 3SJCC 1P49A 2E74B 1N33O 2NN4A 4AQYO 3CXCU 2E76B 2RMKB 2QM8A 4WFFA 2UXCB 2IU3A 3CRMA 1YHQV 1XBLA 3T4DA 4HAMA 4JI4O 1NS1A 2QWPB 3VQWA 1AJNA 2HR3A 1Q7YW 3H1LH 4LF4B 2IBZH 5KLVH 3P32A 5A9GA 3OEHG 4LFAO 4EKWA 4X62B 4LH7A 4MVQA 1XREA 3E8BA 3STZC 1R1BA 2LJ2A 4UXNA 5GONA 3S3XA 2FB5A 4ZHQB 4LH6A 4UCTA 3BA9A 4O4HA 1FXKB 1M5IA 4ASUG 1RM1B 4PJ0Z 4N21A 1Q6IA 3D36A 3K03A 3ETGA 1GH6A 2Q68A 1AI4A 1BS3A 1WA8A 2DWDC 1TVKA 3C90A 3DGEA 3STLC 4DV4O 1KB9F 4LF5O 5B1OA 4GKJB 3P30A 2PY5A 3BEHA 3CS5A 1L0LH 2X7RB 4U7NA 1AI5A 1WPXA 2Q7EA 1Q8IA 2GHYA 4DK0A 1W2BU 1D2DA 1N34O 3F7VC 2YUAA 5KUMA 2ZE8A 4DV5B 3EVKA 1MNGA 5LMNB 3RVYA 3AG4C 3IJ4A 2AHZA 4KFMA 4X1YA 1AI6A 4YJ2B 1ZAUA 4X65B 1JFFA 2M6YA 2NR5A 1Q3EA 2QM7A 4JPRA 4PI2A 4DR4B 1GN2A 5L3FA 3KCXA 4XDKA 3GWOA 5LA6B 4WF9V 1B04A 2WLLA 1I94B 3OMAB 1Y4MA 2JJ2G 3JALB 4H0LB 3JAKB 3J80N 1SQVH 4LP8A 1N36O 1Y66A 2KKWA 3HKDB 4ICGA 1PNMA 1BHBA 3A0HZ 4LF8B 2YSUB 1OJHA 2GV9A 3FFQA 1O9GA 1X4TA 3B8MA 3RYHB 2LO1A 4O4IA 2D3OW 3QO7A 1QLEC 4JAVA 2VQFO 1SESA 3K58A 2ILMA 1MSDA 2CTRA 4GKKO 3FYIB 5J2TB 4X66O 3OTFA 5B1BC 5GTIZ 5CBFA 2IJKA 2ZDIA 3CRCA 1XI1A 4GZRB 5FLXN 4JI3O 1E79G 2XAHA 4FK5C 3H1JH 2NLJC 4BIOA 4DV2O 4HZ3A 1K4CC 3TCUA 2NNUA 2JGDA 4DO2A 5LHIA 2GUZA 2FYUH 3Q4HB 4FLZA 1AROP 2Q0AA 2ZM6O 1JJOA 1Q43A 3DC6A 4B08A 5LBQA 1G1XB 4J7KA 2DYRB 2ITCC 2AHYA 2ZNJA 5EBWC 1SERA 3L71H 1Q86W 1BQ0A 1VQ8V 4DR7B 3CC4V 2QWNB 2ITDC 5KA6A 3T1HO 1U96A 3CCLV 2A79B 4KUMA 2IJIA 2R70A 4Z1MG 3ZMVA 3G4SV 4TUYB 4RUFA 4I4TA 4X1KA 3RFRA 2ETNA 1XEQA 2EJ7A 2UUAB 3PN1A 1K7DA 3LNMB 3UCSC 1PNKA 4Q6GA 4B3RO 5K1PA 3RYCA 5B1NA 1VMGA 4MVSA 4JI7O 1R3LC 4HBNA 1PNLA 2K9PA 2DE0X 4JYAO 2IW5A 3A8TA 2WWWA 3NR7A 2KQXA 3K04A 4JTCB 3KKYA 1Y76A 4JI6O 2W6IG 3OR7C 4FM1A 4FJCC 4JI1O 1RPRA 4DV0B 4TT3G 3KG2A 2XAGA 4CBCA 3BFRA 2EIKC 4PA6A 1VQ7V 1S72V 2W6JG 5AG2A 3FAVB 1MOFA 2EIMC 3B8NA 4TV8B 1HDJA 1KMIZ 2Q7HA 1VQNV 1SS3A 1ENVA 2UXBB 2ZQMA 3UO2A 1SA0B 3CCVV 1VQLV 2OYQA 1H2MA 1XMOB 2UU9B 1OCCB 1GMGA 1AJPA 2Q69A 4NXMB 5BY1A 2GDSA 3K57A 4LFCB 1GM9A 2F93B 4H33A 1V55C 1I0HA 2VS0A 4K8XA 2UXNA 3TETA 2GSMB 3JAMN 1AP5A 4DR2B 1UPGA 1SETA 2AXTZ 2A7WA 4JGSA 2PGGA 4YIOA 4TQFA 4LF6B 2OCCB 2PI5A 5EYPB 1VF6A 2WLIA 2CTPA 3K5OA 3D36C 3AEIA 3DTUB 1IURA 3OUSA 3WFVA 4NB5A 4LNUB 2BOBC 3ZHVA 4R7CA 3RWRD 1XNRO 3OGCC 3FB6C 5LMUO 1F7YA 1DGSA 1CXZB 3UO3A 3CX5F 3LDCA 5D5PA 5B1AC 5IYDO 4DW1A 2ZT9B 2ZR2A 4KHPB 1OCZC 3L9DA 2QSAA 5EBMC 1BCCH 4U3FH 4WFEA 3ZN1A 5CA1B 4DV1B 5LOVB 1BZKA 2PZSA 3B09A 4I9WA 3FB8C 2CUGA 3JD1A 4I50A 3ZRXA 1NBMG 3A2FA 1ZSPA 2Q5ZA 4DR5O 1BGYH 2Q73A 3WU2Z 1M56C 3HR0A 4UFZA 3W7TA 2BTQB 5IYZB 2Q6AA 1IBMB 1R6KA 2Z5UA 1NVPB 4F6EA 1TUEB 4NVPA 1NTMH 3N2GA 3ZMUA 5IT9N 2YIAA 3ZN0A 1XL4A 3N2KB 4NTXA 4ZKIA 3FX7A 2P22C 2OTJV 4UVBA 1YJ9V 5JQGA 3MAQA 4JI2B 3GB7C 3E8FA 3LDEA 2KG7B 3AG3B 3SJBC 1VIBA 5FPRA 1EBOA 1G4YB 3VOUA 2XAQA 4F6RA 5KHIA 1R73A 4GUNA 3EFFK 5TISZ 5EZYA 1WP7A 2E5LO 1DTOA 2ZDIC 1G6UA 4CH4A 4GX1A 2WA4A 1S76D 1HNWB 4MW3A 2E75B 1K5QA 4TV9A 4J41A 2LFRA 3RVZA 1OZ0A 1WB8A 1OCCC 3C3SA 3WG7C 4X66B 4MTGA 5ITZA 2B1GA 4UCVA 4BIZA 4IHJB 1SZXA 1HNZB 5BZBA 1MZEA 2HJFC 1K9MW 4GT1A 4X1IB 5BMVA 4DV2B 2OCCC 2VRZA 3ETDA 2YEVB 1F23A 4NTYA 4KP4A 4H13B 4X20A 4LF7O 1DF4A 4MVUA 2XTAA 4QNHB 3E8HA 2LW7A 1BL8A 4RUEA 4DXWA 3DSQA 5LYJB 2HVJC 4LF9B 1QR8A 2UUCB 5LHHA 4FFBB 4PDMA 4GCZA 5JH7B 4YJ3A 4UB8Z 5B3SC 1JCHA 2HG5C 3HB3B 4YY3O 3CMAV 2RQ6A 4J9YB 2XUMA 4KL1A 3VQVA 4CS2A 1K5SA 4O2AA 4DK1A 2WLHA 3ABMC 4FFKA 1MSWD 5LGNA 4DW0A 1TUBA 3T1CA 5IJ0B 1M93A 3FD9A 4X88A 3LSQA 3AG4B 1FKAO 4HNAB 4JI6B 1M1KW 4I55A 3RBZA 2BCCH 3GWKC 3ZHTA 1NR1A 1XHZA 1KKCA 1B06A 2PTMA 4DV7B 4DRXB 1US6A 3K59A 4UCOA 1Z5VA 1JQ0A 5HFLA 2W0FC 1E1RG 1K3EA 3AG3C 1YI2V 1YCIA 4FZ1A 3CP1A 2IH1C 1WP8A 1OCRB 1YITV 3U0ZA 1VF6C 3ICXA 2UXDB 2CGNA 1L0NH 4U3JA 1GN6A 5JJJB 1H2SB 1JJ2U 4RQFA 3CCJV 1I7FA 3MDSA 5EIBD 3OUFA 4NXNB 3K9AA 2F4VB 1QLEB 1K97A 1URFA 1XL6A 3LUTB 3OM3B 5H5NA 2Y48A 5B1BB 5J2UA 2B5UA 4YHHO 1SQBH 1SQFA 3F5TA 2CH7B 2Z3YA 4R8CA 4DUZB 1R3KC 4PA3A 4WBNB 5CB4A 5JCOA 1QR9A 2D2CB 1Z5WA 4H44B 5EIBC 1M90W 4X9QA 4QE7A 1ZL8B 3MD0A 5LMUB 4ZI7B 1QNMA 4JZGA 2HHHO 4J10A 4CH5A 5KUKA 4DR1O 3ABTA 1G8MA 1PPJH 5IE9A 4PDVA 1KC8W 5LGUA 5J9PC 4J9ZB 4DV6O 4X89A 3E8GA 5LXTA 3JAWA 4QPKA 3G71V 1W0KG 2DW4A 2QWRB 3T4ZA 5A2QN 1VF7A 4MVMA 1ZWIC 2RN9A 4DR5B 2HFEC 3CJHA 3U10A 4JI5O 1I08A 4YIPA 4HYOA 4PD4F 3DXRB 2B1IA 1H2LA 4JV5B 5CA0B 3CMEV 4EFEA 5JVDA 2EJRA 1UJWB 4OPHA 2CTQA 1BHAA 5KAFZ 5IWAB 1Q81W 2L6LA 1S5LZ 4K3AA 3IFXA 3J81N 2JK5C 4UVAA 2XAJA 3TJTA 5KMGB 3QO5A 4O4LA 1FYJA 1QQCA 2AW9A 5IYCO 2EIKB 2WPDG 5C8YA 4PDLA 3ZHUA 4K8ZA 4AHCA 4B3TO 1AVMA 3I56V 3JARA 2JS5A 2EIMB 4DUYO 5KAIZ 4WFAV 1EFRG 1N32O 3ABLC 3SPHA 3ZHRA 4ABMA 2MK3A 3CB2A 3LSSA 1OCRC 4OX9O 5IY5C 3OMNB 1NH2D 2QE7G 5CA3A 1V55B 3K3WA 2AGAA 3M99B 4CS3A 1SC5B 5KHJA 1NTZH 5GONB 2WSSG 3AG1C 3LDDA 1NI8A 4KXRA 4O4HB 4QIWF 2IM9A 2X6AA 2CTWA 3IC7A 1HR0O 1ZUQA 1PM9A 2ZE5A 1WA8B 1XOUA 3T1YB 2RJZA 1TVKB 1MZFA 4LF7B 4JAUA 5LL6Y 1XMQB 1M4UA 5CBHA 3SYQA 5KX5A 4DV3B 5B1AB 1OCZB 4I0XA 4DR6B 4UCRA 1AB3A 1QVFU 4TWKA 1P84F 5BXZA 2JEXA 2OCHA 3QG5A 3ZRWA 4IL6Z 2EULA 2QDOA 4A5UB 2CK3G 4X1YB 1T5EA 1M56B 3NXSA 2UUBO 1JFFB 1SKVA 3BHPA 4FM2A 4BR6A 2AZ2A 2O57A 2VQEB 2WLLB 3RYIA 1YJWV 5DECA 3BPZA 3RN4A 5CN0A 2N74A 1XUQA 4NR1A 4FVMA 4JF3A 3WB1A 3HKBA 1N4CA 2IH3C 3OT7A 2PI4A 3OE7G 4GX5A 3H1HH 4IGGA 5LP6A 2ZR3A 1KUQA 3JATA 5BR8B 2UXXA 4O4IB 1EN6A 1VEWA 1EN4A 1PL0A 4XBFA 1VQOV 1KP3A 1BMFG 1QHTA 1S77D 1YJNV 2EILC 2DQ0A 4N23A 4RWUA 2Q67A 3EHBB 2IJJA 3RGBA 4JI8B 5JCOC 2V7QG 4NYKA 5L3BA 1IX9A 2OWOA 4MW8A 2RDCA 4FM0A 2X6CA 2JGDB 3WG7B 4F4LA 1JR9A 2GUZB 4BIUA 2ADPA 2DYSC 1N33B 4AQYB 3GVMA 4UB6Z 3JASA 2P4VA 1FFXA 3ETEA 3JSLA 3HKEA 3OTOO 3RYFA 2H3OA 4FLTA 3G6EV 3H1IH 4JI4B 4UCSA 2QJ1A 1J95A 4BW5A 2MW2B 4LC1A 1IBKO 4JYCA 2HJDA 4O4JA 1R3JC 1K34A 4LFAB 1SZTA 1YZBA 2A06H 1O9HA 1Q5OA 2F43G 4I4TB 4X1KB 5FPOA 3ZHSA 3E22A 3CPWU 4CH3A 3FB5C 3ZIAG 1SQGA 2X0LA 3H01A 3K5MA 3RYCB 2LP7A 3W7WA 1IZ3A 1V9PA 2UXCO 1DF5A 1MABG 1GK9A 4TQDA 5B3SB 1K33A 1BT8A 5L3EA 1Y76B 1NKDA 4W4KA 2QM4A 4LF4O 1B3QA 3L72H 2IJHA 3AK3A 1GN4A 4D7SA 4DV4B 3ABMB 4X62O 4LF5B 1Q90D 4CC6A 3IC9A 1YTFD 2ADQB 1P7BA 3SPCA 5KHHA 4DYLA 1VQ6V 1N34B 2YICA 2FMLA 3CEIA 2XHBA 3HKCA 4O2BA 2QKCA 5JJNB 3VBBA 3UT5A 1W0JG 4E4EA 2Y4TA 2CDYA 4FLUA 3APQA 2YIBD 1U97A 4B3TB 3SYPA 4MTOA 4P9PA 2IU0A 4GKJO 3W7XA 1L1FA 3G80A 1EZVH 2WLIB 2PYJA 3SR2C 3H1KH 2DJVA 3JD2A 2GBOA 1N36B 3D3IA 2RCVA 4UVCA 2P6JA 3RW0A 4EB6A 3ZJZA 4DV5O 3WB2A 2YS8A 5LMNO 1PD3A 4J7ZA 4IIJA 4B3MO 1IBLO 1V54C 1QBZA 3L70H 1NTKH 1JVMA 3K06A 1CPYA 3I5DA 2VQFB 3BAAA 3P3PA 1M57C 2EIJC 4DR4O 4GKKB 3JYCA 1SRYA 3M7MX 1FAFA 4R50A 1RSOA 2LQTA 2YI9A 4I50B 3CCSV 1HP8A 3L74H 4JI3B 1TA8A 4ZBMA 1KD1W 3FKSG 2DMXA 1ORQC 2QKAA 3B77A 5JJEB 1S0VA 4IYIA 2F66C 3OR6C 4W4LA 1XNQO 2LGQA 2QTOA 2DQ3A 5DN6G 2ZM6B 2PYLA 1KQSU 3TXQA 3N2GB 4C7UA 4FLXA 3E83A 4LWSA 4PHZA 1X59A 4PA4A 5FL7G 1JOYA 3SYCA 5LGTA 3T1HB 5JQGB 2BSKA 4MVZA 2GTAA 5FNVA 4UV8A 1NT2B 3CWBH 5LP6C 4B3SO 3C3TA 5E1AC 1FPOA 1AR1B 1RPOA 4ZOLA 3PJSK 4F6RB 2P90A 5IJ9A 3D8CA 4B3RB 5EZYB 5H9CA 4JI7B 3R66A 1NVPD 4B7EA 5B5EZ 3ASNC 4JASA 3ABKC 1B6QA 4JYAB 1Q82W 1YXBA 1JPXA 2WA3A 1GTOA 4DR7O 4TV9B 3VQXA 1QU7A 2HVKC 4JI1B 1SQQH 3SPGA 1PKXA 2JS3A 1LUWA 5ITZB 2V4DA 4FPPA 1H2GA 2ZKOA 3AG2B 2A9HA 2UUAO 1KBHA 3ABLB 3K5NA 1FD9A 5GTHZ 4UUJC 2ZD9A 3ASOC 4OPAA 1M9NA 4ZHQA 4PELA 5KA5A 2Q9LA 2OTLV 5BMVB 1FXKA 1CEZA 5IY5B 2JIZG 4MS2A 5EC2C 2PUSA 1RP3B 2QWQB 3MHSC 4X20B 4J11A 5HFMA 2YIDA 3AG1B 1VQ5V 3E2EA 2JJ1G 4DV0O 4P30A 3ZCCA 2XAFA 2JRIA 2RNBA 2JGUA 1IBKB 1IVSA 4YJ3B 1GM8A 3DC5A 2YC0A 2UXBO 4CH6A 3JCZA 1XMOO 4JYYA 2Q4PA 5KHKA 3E86A 1XNRB 2M7WA 4NXMO 2ZIMA 4O2AB 1OCOC 4Q20A 3BVOA 3K5LA 4YJ2A 4WFGA 1E1QG 4LFCO 2JDIG 2H8PC 3LNNA 1YVWA 1TUBB 1J5EO 4RQEA 4FZ0A 5LA6A 4DR2O 4XDJA 5F2VO 4LF6O 4I55B 5H2FZ 3JALA 3JAKA 1FXVA 2F23A 3SYAA 2GTSA 1JX9A 3FB7C 3HKDA 3TK1A 2WLMA 4J80A 4D6TH 1GO3F 3L73H 2P67A 5H6RA 2P7TC 3RYHA 2F95B 1VARA 4JI0O 1SQPH 2YDEA 4KHPO 3IGAC 1IDSA 4U3JB 1THZA 1AP6A 4DV1O 5J2TA 1HW7A 4FLWA 2Q8VA 2VWJA 4K35A 1FFTB 5EK0A 5B66Z 1R3IC 1FS0G 1H2KA 2CGOA 1UFIA 3K9SA 3CRAA 3OGIB 2EILB 3G6BA 5J2UB 1XHXA 4JTAB 1IXBA 4WFHA 5L3GA 1IBMO 1CP9A 1I5YA 1TGOA 4MVRA 3Q4HA 2P5OA 2E5LB 4QPJA 2LW1A 3AG2C 3R65A 5CB4B 3E35A 2EINC 4P2ZA 1COWG 1JMKC 1BSMA 3CSXA 3QNEA 1GRJA 4RAIA 3CCEV 4B3MB 1IBLB 1KKDA 4GX0A 2DYSB 3BCCH 4X64O 5IDJA 4JI2O 5C93A 3TGUH 1AR4A 3G67A 4OXSA 3S3WA 1GM7A 3JCUZ 4TUYA 3CD6V 1NQTA 5GW7A 2Y0IA 3JAWB 5LXTB 3T2MA 2Y4UA 1PV0A 3CCRV 1VQKV 2B9ZA 1LUVA 2P4KA 3CE2A 3CJHB 3F7YC 5H6QA 4BAYA 4MTFA 4G2KA 5L3DA 2ZNIA 4L8JA 1XNQB 1NU1H 2N04A 2PF4E 1S5HC 2OIGA 2YIBA 1XILA 1HNWO 1K92A 2QGNA 5JVDB 1Z2GA 4FIPC 4LR3A 3IAYA 3BRCA 1VP7A 2QA4V 1MMMA 1SQXH 1N0JA 4BWAA 1MA1A 1NJIW 4CZZA 3AK1A 3CRQA 1D5NA 4FMTA 3ZMZA 3THOA 3FAVA 1HNZO 1LNQA 4TV8A 3ZX6A 1YF2A 4UV9A 4B3SB 3O65A 4O4LB 4FLVA 2CE4A 4DR3O 4YY3B 3J7AU 1SA0A 5C8YB 3UM7A 1N0NA 4TOIA 1FXHA 3JARB 2KB1A 2R9IA 3A0BZ 1AJQA 4FLYA 1F4MA 4EFBA 4RO2A 1YEWA 2ZE6A 3JSNA 2F1MA 2ARHA 4H37A 5IYBO 3JD0A 1VQMV 3W7SA 1FXKC 4LF9O 3SJQC 2DOSA 2ZCEA 4UCUA 3CHXA 1HNXO 2UUCO 1DLBA 5EYPA 1RM1C 3K0GA 3CRRA 1K8AW 1YTFB 1Y6XA 2ZXWB 2ZINA 4LNUA 4MT8A 4I9QA 4PDRA 3BABA 4PI0A 5DEDA 3QO8A 1N8RW 4G27B 2FKXA 2ZIOA 3ML0A 1F51A 2WLJA 5CA1A 3FYEB 5LOVA 1K4DC 2QTSA 2N05A 1P7GA 1V54B 4LFBO 1S3JA 2ATKC 5KX5B 4CC5A 1M57B 2EIJB 3M8AA 1F4NA 4DV7O 3CCQV 4GX2A 4I0XB 5K1XA 1I5XA 1AR5A 2YXLA 2BTQA 5IYZA 1Y67A 4YHHB 2A0LA 3ZRWB 2EBOA 2W0XA 3L75H 3ZEDA 4E2LA 2R9RB 4J7JA 4K0KO 5CMUA 3KCYA 2JVDA 3F5WC 2Y69B 4TSFG 3BA8A 2UXDO 4AILC 3N2KA 1W59A 1OV9A 2LGWA 2HKOA 2Q0OC 2DN9A 5E79Z 2R72A 2HHHB 1BQZA 1S5JA 2YXHA 4DR1B 3RYIB 4NXNO 3SJAC 1J5EB 2F4VO 2KG7A 1FJGO 2XOKG 1WLEA 3B4SA 3AG7A 1YSCA 4DV6B 3QTCA 4WFBV 1D5AA 4YXWG 1IXMA 2Q7GA 3HKBB 2ODMA 3CCMV 4WCEV 3I55V 4BW9A 3OW2U 5LP6B 4DUZO 1H8EG 3HPLC 3JATB 4JI5B 1SF9A 3E89A 4PV1B 3OMIB 3CC2V 2BOCC 1WNSA 3OFNG 1ZTEA 4J42A 5JWPA 1NR7A 2HP8A 2QWOB 3QF7A 4JI0B 2BE3A 3ASNB 5LHGA 3ABKB 1K73W 3KZIZ 4JTDB 3X2QB 1R6NA 2VWKA 4NTWA 4IHJA 1WB7A 1H38A 4QJFB 1NZ6A 2DYRC 1Y74A 1Q6UA 2WLNA 2KSDA 4IT5A 4X1IA 2H94A 3UKMA 1XDCA 4B7KA 3JASB 1OHHG 1FFXB 3HKEB 2YEVA 3RYFB 4JV5O 4AI8A 2ZXWC 4DUYB 4QGPA 1L8DA 4I5SA 2DWEC 4PA9A 3ASOB 5CBGA 1N32B 3SPJA 3AK2A 4LBEC 2ZE7A 3UQ8A 5IWAO 4O4JB 1MG1A 4I7ZB 5LYJA 5DM6V 4X64B 4OX9B 3ZRVA 2K1EA 5D5QA 1HWYA 2CAZC 2EZOA 4FFBA 3E22B 5JH7A 3CXHF 4JYBA 1EM1A 3SGIA 2L35A 4D7TA 3N27A 2YI8A 4X65O 1QVGU 3H9VA 3APOA 1HR0B 1WJZA 4GYCB 4Z1VA 3P3NA 3OAAG 4MSWC 1I94O 3EXAA 5IJ0A 4GLXA 4L87A 3QVNA 3K08A 1AILA 3ZMSA 2A3QA 1OCOB 1H2NA 4HNAA 2AZ0A 2Y69C 2EZPA 3OD4A 4LF8O 2BTOA 3O9OA 1H8HG 1KU9A 4DRXA 4Z2WA 3A0RA 5EC1C 2Y0PA 3RT3C 1VQPV 2X6BA 2QR4A 2G38A 2FL4A 3BY6A 1VQ4V 3HKCB 1Y74B 3CC7V 2E3CA 4O2BB 3ZS8C 3UT5B 4DR3B 3ZRSA 2C2AA 2OIEA 1VQ9V 1ZLZA 1RFYA 2UUBB 1Q6HA 1JA8A 3ZHQA 2YXYA 4P9OA 3T1YO 1GAXA 3K0DA 1XMQO 2XNDG 2WAMA 4DV3O 3VQYA 2XASA 4CS4A 3B2EE 2P06A 4DR6O 1BE3H 2HEPA 1LR1A 1VF5B 4X8AA 1HNXB 4QE9A 1EZJA 4JZ2A 4EB6B 2OT5A 3JD4A 2CH7A 4IIJB 3CCUV 2LFSA 3X2QC 4EEQA 4WBNA 4MTXA 3ABUA 1YIJV
chains in the Genus database with same CATH topology
2KG7B 3TXQA 3GWKC 3GVMA 4I0XB 4LWSA 1WA8A 4ABMA 3FAVB 2AZ0A 2DE0X 2VS0A 2B9ZA 2KG7A 3Q4HB 2AZ2A 3TXSA 2VRZA 3G80A 4I0XA 3O9OA 3OGIB 3FAVA 3HR0A 3FD9A 3ZBHA 4GZRB 4LWSB 1WA8B 3Q4HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KG7 B;  3TXQ A;  3GWK C;  3GVM A;  4I0X B;  4LWS A;  1WA8 A;  4ABM A;  3FAV B;  2AZ0 A;  2DE0 X;  2VS0 A;  2B9Z A;  2KG7 A;  3Q4H B;  2AZ2 A;  3TXS A;  2VRZ A;  3G80 A;  4I0X A;  3O9O A;  3OGI B;  3FAV A;  3HR0 A;  3FD9 A;  3ZBH A;  4GZR B;  4LWS B;  1WA8 B;  3Q4H A; 
#chains in the Genus database with same CATH topology
 4XDL A;  1ZL8 A;  5L3C A;  2QKS A;  4ZI7 A;  2XT9 A;  1KEC A;  2VQE O;  1QLN A;  1ROP A;  3TXS A;  4JAA A;  1DK1 A;  1ZX3 A;  4MVO A;  2EIN B;  1RSO B;  3ETQ A;  3LSU A;  2V1D A;  3ZBH A;  1GKF A;  2QEX V;  2R9A A;  5KHG A;  4PA7 A;  4IYH A;  4LFB B;  1YDX A;  5EBL C;  4NKG B;  1KYO F;  2JEU A;  1XQ8 A;  1KP2 A;  1AI7 A;  1GN3 A;  3B40 A;  2Z0A A;  5BR8 O;  1WAZ A;  3CYO A;  4ZIB A;  3MHH C;  2FTK A;  4OGQ B;  3OTO B;  4LCU C;  3DXR A;  5CA0 A;  2EX3 A;  4R6Z A;  3SDL A;  4LWS B;  1PL4 A;  4K0K B;  1QCE A;  1WN7 A;  1P4R A;  3SYO A;  1A32 A;  3D3Q A;  2BSK B;  2WLK A;  3JD3 A;  5FNV B;  3K79 A;  3WB0 A;  2HLD G;  1WPB A;  1EN5 A;  1NH2 B;  4JI8 O;  1TAE A;  4U7O A;  3ZMT A;  1PP9 H;  3U11 A;  3SPI A;  3OEE G;  4ZOL B;  1FJG B;  3W7U A;  5KMG A;  2UU9 O;  4G28 B;  1R6T A;  5IJ9 B;  3SJC C;  1P49 A;  2E74 B;  1N33 O;  2NN4 A;  4AQY O;  3CXC U;  2E76 B;  2RMK B;  2QM8 A;  4WFF A;  2UXC B;  2IU3 A;  3CRM A;  1YHQ V;  1XBL A;  3T4D A;  4HAM A;  4JI4 O;  1NS1 A;  2QWP B;  3VQW A;  1AJN A;  2HR3 A;  1Q7Y W;  3H1L H;  4LF4 B;  2IBZ H;  5KLV H;  3P32 A;  5A9G A;  3OEH G;  4LFA O;  4EKW A;  4X62 B;  4LH7 A;  4MVQ A;  1XRE A;  3E8B A;  3STZ C;  1R1B A;  2LJ2 A;  4UXN A;  5GON A;  3S3X A;  2FB5 A;  4ZHQ B;  4LH6 A;  4UCT A;  3BA9 A;  4O4H A;  1FXK B;  1M5I A;  4ASU G;  1RM1 B;  4PJ0 Z;  4N21 A;  1Q6I A;  3D36 A;  3K03 A;  3ETG A;  1GH6 A;  2Q68 A;  1AI4 A;  1BS3 A;  1WA8 A;  2DWD C;  1TVK A;  3C90 A;  3DGE A;  3STL C;  4DV4 O;  1KB9 F;  4LF5 O;  5B1O A;  4GKJ B;  3P30 A;  2PY5 A;  3BEH A;  3CS5 A;  1L0L H;  2X7R B;  4U7N A;  1AI5 A;  1WPX A;  2Q7E A;  1Q8I A;  2GHY A;  4DK0 A;  1W2B U;  1D2D A;  1N34 O;  3F7V C;  2YUA A;  5KUM A;  2ZE8 A;  4DV5 B;  3EVK A;  1MNG A;  5LMN B;  3RVY A;  3AG4 C;  3IJ4 A;  2AHZ A;  4KFM A;  4X1Y A;  1AI6 A;  4YJ2 B;  1ZAU A;  4X65 B;  1JFF A;  2M6Y A;  2NR5 A;  1Q3E A;  2QM7 A;  4JPR A;  4PI2 A;  4DR4 B;  1GN2 A;  5L3F A;  3KCX A;  4XDK A;  3GWO A;  5LA6 B;  4WF9 V;  1B04 A;  2WLL A;  1I94 B;  3OMA B;  1Y4M A;  2JJ2 G;  3JAL B;  4H0L B;  3JAK B;  3J80 N;  1SQV H;  4LP8 A;  1N36 O;  1Y66 A;  2KKW A;  3HKD B;  4ICG A;  1PNM A;  1BHB A;  3A0H Z;  4LF8 B;  2YSU B;  1OJH A;  2GV9 A;  3FFQ A;  1O9G A;  1X4T A;  3B8M A;  3RYH B;  2LO1 A;  4O4I A;  2D3O W;  3QO7 A;  1QLE C;  4JAV A;  2VQF O;  1SES A;  3K58 A;  2ILM A;  1MSD A;  2CTR A;  4GKK O;  3FYI B;  5J2T B;  4X66 O;  3OTF A;  5B1B C;  5GTI Z;  5CBF A;  2IJK A;  2ZDI A;  3CRC A;  1XI1 A;  4GZR B;  5FLX N;  4JI3 O;  1E79 G;  2XAH A;  4FK5 C;  3H1J H;  2NLJ C;  4BIO A;  4DV2 O;  4HZ3 A;  1K4C C;  3TCU A;  2NNU A;  2JGD A;  4DO2 A;  5LHI A;  2GUZ A;  2FYU H;  3Q4H B;  4FLZ A;  1ARO P;  2Q0A A;  2ZM6 O;  1JJO A;  1Q43 A;  3DC6 A;  4B08 A;  5LBQ A;  1G1X B;  4J7K A;  2DYR B;  2ITC C;  2AHY A;  2ZNJ A;  5EBW C;  1SER A;  3L71 H;  1Q86 W;  1BQ0 A;  1VQ8 V;  4DR7 B;  3CC4 V;  2QWN B;  2ITD C;  5KA6 A;  3T1H O;  1U96 A;  3CCL V;  2A79 B;  4KUM A;  2IJI A;  2R70 A;  4Z1M G;  3ZMV A;  3G4S V;  4TUY B;  4RUF A;  4I4T A;  4X1K A;  3RFR A;  2ETN A;  1XEQ A;  2EJ7 A;  2UUA B;  3PN1 A;  1K7D A;  3LNM B;  3UCS C;  1PNK A;  4Q6G A;  4B3R O;  5K1P A;  3RYC A;  5B1N A;  1VMG A;  4MVS A;  4JI7 O;  1R3L C;  4HBN A;  1PNL A;  2K9P A;  2DE0 X;  4JYA O;  2IW5 A;  3A8T A;  2WWW A;  3NR7 A;  2KQX A;  3K04 A;  4JTC B;  3KKY A;  1Y76 A;  4JI6 O;  2W6I G;  3OR7 C;  4FM1 A;  4FJC C;  4JI1 O;  1RPR A;  4DV0 B;  4TT3 G;  3KG2 A;  2XAG A;  4CBC A;  3BFR A;  2EIK C;  4PA6 A;  1VQ7 V;  1S72 V;  2W6J G;  5AG2 A;  3FAV B;  1MOF A;  2EIM C;  3B8N A;  4TV8 B;  1HDJ A;  1KMI Z;  2Q7H A;  1VQN V;  1SS3 A;  1ENV A;  2UXB B;  2ZQM A;  3UO2 A;  1SA0 B;  3CCV V;  1VQL V;  2OYQ A;  1H2M A;  1XMO B;  2UU9 B;  1OCC B;  1GMG A;  1AJP A;  2Q69 A;  4NXM B;  5BY1 A;  2GDS A;  3K57 A;  4LFC B;  1GM9 A;  2F93 B;  4H33 A;  1V55 C;  1I0H A;  2VS0 A;  4K8X A;  2UXN A;  3TET A;  2GSM B;  3JAM N;  1AP5 A;  4DR2 B;  1UPG A;  1SET A;  2AXT Z;  2A7W A;  4JGS A;  2PGG A;  4YIO A;  4TQF A;  4LF6 B;  2OCC B;  2PI5 A;  5EYP B;  1VF6 A;  2WLI A;  2CTP A;  3K5O A;  3D36 C;  3AEI A;  3DTU B;  1IUR A;  3OUS A;  3WFV A;  4NB5 A;  4LNU B;  2BOB C;  3ZHV A;  4R7C A;  3RWR D;  1XNR O;  3OGC C;  3FB6 C;  5LMU O;  1F7Y A;  1DGS A;  1CXZ B;  3UO3 A;  3CX5 F;  3LDC A;  5D5P A;  5B1A C;  5IYD O;  4DW1 A;  2ZT9 B;  2ZR2 A;  4KHP B;  1OCZ C;  3L9D A;  2QSA A;  5EBM C;  1BCC H;  4U3F H;  4WFE A;  3ZN1 A;  5CA1 B;  4DV1 B;  5LOV B;  1BZK A;  2PZS A;  3B09 A;  4I9W A;  3FB8 C;  2CUG A;  3JD1 A;  4I50 A;  3ZRX A;  1NBM G;  3A2F A;  1ZSP A;  2Q5Z A;  4DR5 O;  1BGY H;  2Q73 A;  3WU2 Z;  1M56 C;  3HR0 A;  4UFZ A;  3W7T A;  2BTQ B;  5IYZ B;  2Q6A A;  1IBM B;  1R6K A;  2Z5U A;  1NVP B;  4F6E A;  1TUE B;  4NVP A;  1NTM H;  3N2G A;  3ZMU A;  5IT9 N;  2YIA A;  3ZN0 A;  1XL4 A;  3N2K B;  4NTX A;  4ZKI A;  3FX7 A;  2P22 C;  2OTJ V;  4UVB A;  1YJ9 V;  5JQG A;  3MAQ A;  4JI2 B;  3GB7 C;  3E8F A;  3LDE A;  2KG7 B;  3AG3 B;  3SJB C;  1VIB A;  5FPR A;  1EBO A;  1G4Y B;  3VOU A;  2XAQ A;  4F6R A;  5KHI A;  1R73 A;  4GUN A;  3EFF K;  5TIS Z;  5EZY A;  1WP7 A;  2E5L O;  1DTO A;  2ZDI C;  1G6U A;  4CH4 A;  4GX1 A;  2WA4 A;  1S76 D;  1HNW B;  4MW3 A;  2E75 B;  1K5Q A;  4TV9 A;  4J41 A;  2LFR A;  3RVZ A;  1OZ0 A;  1WB8 A;  1OCC C;  3C3S A;  3WG7 C;  4X66 B;  4MTG A;  5ITZ A;  2B1G A;  4UCV A;  4BIZ A;  4IHJ B;  1SZX A;  1HNZ B;  5BZB A;  1MZE A;  2HJF C;  1K9M W;  4GT1 A;  4X1I B;  5BMV A;  4DV2 B;  2OCC C;  2VRZ A;  3ETD A;  2YEV B;  1F23 A;  4NTY A;  4KP4 A;  4H13 B;  4X20 A;  4LF7 O;  1DF4 A;  4MVU A;  2XTA A;  4QNH B;  3E8H A;  2LW7 A;  1BL8 A;  4RUE A;  4DXW A;  3DSQ A;  5LYJ B;  2HVJ C;  4LF9 B;  1QR8 A;  2UUC B;  5LHH A;  4FFB B;  4PDM A;  4GCZ A;  5JH7 B;  4YJ3 A;  4UB8 Z;  5B3S C;  1JCH A;  2HG5 C;  3HB3 B;  4YY3 O;  3CMA V;  2RQ6 A;  4J9Y B;  2XUM A;  4KL1 A;  3VQV A;  4CS2 A;  1K5S A;  4O2A A;  4DK1 A;  2WLH A;  3ABM C;  4FFK A;  1MSW D;  5LGN A;  4DW0 A;  1TUB A;  3T1C A;  5IJ0 B;  1M93 A;  3FD9 A;  4X88 A;  3LSQ A;  3AG4 B;  1FKA O;  4HNA B;  4JI6 B;  1M1K W;  4I55 A;  3RBZ A;  2BCC H;  3GWK C;  3ZHT A;  1NR1 A;  1XHZ A;  1KKC A;  1B06 A;  2PTM A;  4DV7 B;  4DRX B;  1US6 A;  3K59 A;  4UCO A;  1Z5V A;  1JQ0 A;  5HFL A;  2W0F C;  1E1R G;  1K3E A;  3AG3 C;  1YI2 V;  1YCI A;  4FZ1 A;  3CP1 A;  2IH1 C;  1WP8 A;  1OCR B;  1YIT V;  3U0Z A;  1VF6 C;  3ICX A;  2UXD B;  2CGN A;  1L0N H;  4U3J A;  1GN6 A;  5JJJ B;  1H2S B;  1JJ2 U;  4RQF A;  3CCJ V;  1I7F A;  3MDS A;  5EIB D;  3OUF A;  4NXN B;  3K9A A;  2F4V B;  1QLE B;  1K97 A;  1URF A;  1XL6 A;  3LUT B;  3OM3 B;  5H5N A;  2Y48 A;  5B1B B;  5J2U A;  2B5U A;  4YHH O;  1SQB H;  1SQF A;  3F5T A;  2CH7 B;  2Z3Y A;  4R8C A;  4DUZ B;  1R3K C;  4PA3 A;  4WBN B;  5CB4 A;  5JCO A;  1QR9 A;  2D2C B;  1Z5W A;  4H44 B;  5EIB C;  1M90 W;  4X9Q A;  4QE7 A;  1ZL8 B;  3MD0 A;  5LMU B;  4ZI7 B;  1QNM A;  4JZG A;  2HHH O;  4J10 A;  4CH5 A;  5KUK A;  4DR1 O;  3ABT A;  1G8M A;  1PPJ H;  5IE9 A;  4PDV A;  1KC8 W;  5LGU A;  5J9P C;  4J9Z B;  4DV6 O;  4X89 A;  3E8G A;  5LXT A;  3JAW A;  4QPK A;  3G71 V;  1W0K G;  2DW4 A;  2QWR B;  3T4Z A;  5A2Q N;  1VF7 A;  4MVM A;  1ZWI C;  2RN9 A;  4DR5 B;  2HFE C;  3CJH A;  3U10 A;  4JI5 O;  1I08 A;  4YIP A;  4HYO A;  4PD4 F;  3DXR B;  2B1I A;  1H2L A;  4JV5 B;  5CA0 B;  3CME V;  4EFE A;  5JVD A;  2EJR A;  1UJW B;  4OPH A;  2CTQ A;  1BHA A;  5KAF Z;  5IWA B;  1Q81 W;  2L6L A;  1S5L Z;  4K3A A;  3IFX A;  3J81 N;  2JK5 C;  4UVA A;  2XAJ A;  3TJT A;  5KMG B;  3QO5 A;  4O4L A;  1FYJ A;  1QQC A;  2AW9 A;  5IYC O;  2EIK B;  2WPD G;  5C8Y A;  4PDL A;  3ZHU A;  4K8Z A;  4AHC A;  4B3T O;  1AVM A;  3I56 V;  3JAR A;  2JS5 A;  2EIM B;  4DUY O;  5KAI Z;  4WFA V;  1EFR G;  1N32 O;  3ABL C;  3SPH A;  3ZHR A;  4ABM A;  2MK3 A;  3CB2 A;  3LSS A;  1OCR C;  4OX9 O;  5IY5 C;  3OMN B;  1NH2 D;  2QE7 G;  5CA3 A;  1V55 B;  3K3W A;  2AGA A;  3M99 B;  4CS3 A;  1SC5 B;  5KHJ A;  1NTZ H;  5GON B;  2WSS G;  3AG1 C;  3LDD A;  1NI8 A;  4KXR A;  4O4H B;  4QIW F;  2IM9 A;  2X6A A;  2CTW A;  3IC7 A;  1HR0 O;  1ZUQ A;  1PM9 A;  2ZE5 A;  1WA8 B;  1XOU A;  3T1Y B;  2RJZ A;  1TVK B;  1MZF A;  4LF7 B;  4JAU A;  5LL6 Y;  1XMQ B;  1M4U A;  5CBH A;  3SYQ A;  5KX5 A;  4DV3 B;  5B1A B;  1OCZ B;  4I0X A;  4DR6 B;  4UCR A;  1AB3 A;  1QVF U;  4TWK A;  1P84 F;  5BXZ A;  2JEX A;  2OCH A;  3QG5 A;  3ZRW A;  4IL6 Z;  2EUL A;  2QDO A;  4A5U B;  2CK3 G;  4X1Y B;  1T5E A;  1M56 B;  3NXS A;  2UUB O;  1JFF B;  1SKV A;  3BHP A;  4FM2 A;  4BR6 A;  2AZ2 A;  2O57 A;  2VQE B;  2WLL B;  3RYI A;  1YJW V;  5DEC A;  3BPZ A;  3RN4 A;  5CN0 A;  2N74 A;  1XUQ A;  4NR1 A;  4FVM A;  4JF3 A;  3WB1 A;  3HKB A;  1N4C A;  2IH3 C;  3OT7 A;  2PI4 A;  3OE7 G;  4GX5 A;  3H1H H;  4IGG A;  5LP6 A;  2ZR3 A;  1KUQ A;  3JAT A;  5BR8 B;  2UXX A;  4O4I B;  1EN6 A;  1VEW A;  1EN4 A;  1PL0 A;  4XBF A;  1VQO V;  1KP3 A;  1BMF G;  1QHT A;  1S77 D;  1YJN V;  2EIL C;  2DQ0 A;  4N23 A;  4RWU A;  2Q67 A;  3EHB B;  2IJJ A;  3RGB A;  4JI8 B;  5JCO C;  2V7Q G;  4NYK A;  5L3B A;  1IX9 A;  2OWO A;  4MW8 A;  2RDC A;  4FM0 A;  2X6C A;  2JGD B;  3WG7 B;  4F4L A;  1JR9 A;  2GUZ B;  4BIU A;  2ADP A;  2DYS C;  1N33 B;  4AQY B;  3GVM A;  4UB6 Z;  3JAS A;  2P4V A;  1FFX A;  3ETE A;  3JSL A;  3HKE A;  3OTO O;  3RYF A;  2H3O A;  4FLT A;  3G6E V;  3H1I H;  4JI4 B;  4UCS A;  2QJ1 A;  1J95 A;  4BW5 A;  2MW2 B;  4LC1 A;  1IBK O;  4JYC A;  2HJD A;  4O4J A;  1R3J C;  1K34 A;  4LFA B;  1SZT A;  1YZB A;  2A06 H;  1O9H A;  1Q5O A;  2F43 G;  4I4T B;  4X1K B;  5FPO A;  3ZHS A;  3E22 A;  3CPW U;  4CH3 A;  3FB5 C;  3ZIA G;  1SQG A;  2X0L A;  3H01 A;  3K5M A;  3RYC B;  2LP7 A;  3W7W A;  1IZ3 A;  1V9P A;  2UXC O;  1DF5 A;  1MAB G;  1GK9 A;  4TQD A;  5B3S B;  1K33 A;  1BT8 A;  5L3E A;  1Y76 B;  1NKD A;  4W4K A;  2QM4 A;  4LF4 O;  1B3Q A;  3L72 H;  2IJH A;  3AK3 A;  1GN4 A;  4D7S A;  4DV4 B;  3ABM B;  4X62 O;  4LF5 B;  1Q90 D;  4CC6 A;  3IC9 A;  1YTF D;  2ADQ B;  1P7B A;  3SPC A;  5KHH A;  4DYL A;  1VQ6 V;  1N34 B;  2YIC A;  2FML A;  3CEI A;  2XHB A;  3HKC A;  4O2B A;  2QKC A;  5JJN B;  3VBB A;  3UT5 A;  1W0J G;  4E4E A;  2Y4T A;  2CDY A;  4FLU A;  3APQ A;  2YIB D;  1U97 A;  4B3T B;  3SYP A;  4MTO A;  4P9P A;  2IU0 A;  4GKJ O;  3W7X A;  1L1F A;  3G80 A;  1EZV H;  2WLI B;  2PYJ A;  3SR2 C;  3H1K H;  2DJV A;  3JD2 A;  2GBO A;  1N36 B;  3D3I A;  2RCV A;  4UVC A;  2P6J A;  3RW0 A;  4EB6 A;  3ZJZ A;  4DV5 O;  3WB2 A;  2YS8 A;  5LMN O;  1PD3 A;  4J7Z A;  4IIJ A;  4B3M O;  1IBL O;  1V54 C;  1QBZ A;  3L70 H;  1NTK H;  1JVM A;  3K06 A;  1CPY A;  3I5D A;  2VQF B;  3BAA A;  3P3P A;  1M57 C;  2EIJ C;  4DR4 O;  4GKK B;  3JYC A;  1SRY A;  3M7M X;  1FAF A;  4R50 A;  1RSO A;  2LQT A;  2YI9 A;  4I50 B;  3CCS V;  1HP8 A;  3L74 H;  4JI3 B;  1TA8 A;  4ZBM A;  1KD1 W;  3FKS G;  2DMX A;  1ORQ C;  2QKA A;  3B77 A;  5JJE B;  1S0V A;  4IYI A;  2F66 C;  3OR6 C;  4W4L A;  1XNQ O;  2LGQ A;  2QTO A;  2DQ3 A;  5DN6 G;  2ZM6 B;  2PYL A;  1KQS U;  3TXQ A;  3N2G B;  4C7U A;  4FLX A;  3E83 A;  4LWS A;  4PHZ A;  1X59 A;  4PA4 A;  5FL7 G;  1JOY A;  3SYC A;  5LGT A;  3T1H B;  5JQG B;  2BSK A;  4MVZ A;  2GTA A;  5FNV A;  4UV8 A;  1NT2 B;  3CWB H;  5LP6 C;  4B3S O;  3C3T A;  5E1A C;  1FPO A;  1AR1 B;  1RPO A;  4ZOL A;  3PJS K;  4F6R B;  2P90 A;  5IJ9 A;  3D8C A;  4B3R B;  5EZY B;  5H9C A;  4JI7 B;  3R66 A;  1NVP D;  4B7E A;  5B5E Z;  3ASN C;  4JAS A;  3ABK C;  1B6Q A;  4JYA B;  1Q82 W;  1YXB A;  1JPX A;  2WA3 A;  1GTO A;  4DR7 O;  4TV9 B;  3VQX A;  1QU7 A;  2HVK C;  4JI1 B;  1SQQ H;  3SPG A;  1PKX A;  2JS3 A;  1LUW A;  5ITZ B;  2V4D A;  4FPP A;  1H2G A;  2ZKO A;  3AG2 B;  2A9H A;  2UUA O;  1KBH A;  3ABL B;  3K5N A;  1FD9 A;  5GTH Z;  4UUJ C;  2ZD9 A;  3ASO C;  4OPA A;  1M9N A;  4ZHQ A;  4PEL A;  5KA5 A;  2Q9L A;  2OTL V;  5BMV B;  1FXK A;  1CEZ A;  5IY5 B;  2JIZ G;  4MS2 A;  5EC2 C;  2PUS A;  1RP3 B;  2QWQ B;  3MHS C;  4X20 B;  4J11 A;  5HFM A;  2YID A;  3AG1 B;  1VQ5 V;  3E2E A;  2JJ1 G;  4DV0 O;  4P30 A;  3ZCC A;  2XAF A;  2JRI A;  2RNB A;  2JGU A;  1IBK B;  1IVS A;  4YJ3 B;  1GM8 A;  3DC5 A;  2YC0 A;  2UXB O;  4CH6 A;  3JCZ A;  1XMO O;  4JYY A;  2Q4P A;  5KHK A;  3E86 A;  1XNR B;  2M7W A;  4NXM O;  2ZIM A;  4O2A B;  1OCO C;  4Q20 A;  3BVO A;  3K5L A;  4YJ2 A;  4WFG A;  1E1Q G;  4LFC O;  2JDI G;  2H8P C;  3LNN A;  1YVW A;  1TUB B;  1J5E O;  4RQE A;  4FZ0 A;  5LA6 A;  4DR2 O;  4XDJ A;  5F2V O;  4LF6 O;  4I55 B;  5H2F Z;  3JAL A;  3JAK A;  1FXV A;  2F23 A;  3SYA A;  2GTS A;  1JX9 A;  3FB7 C;  3HKD A;  3TK1 A;  2WLM A;  4J80 A;  4D6T H;  1GO3 F;  3L73 H;  2P67 A;  5H6R A;  2P7T C;  3RYH A;  2F95 B;  1VAR A;  4JI0 O;  1SQP H;  2YDE A;  4KHP O;  3IGA C;  1IDS A;  4U3J B;  1THZ A;  1AP6 A;  4DV1 O;  5J2T A;  1HW7 A;  4FLW A;  2Q8V A;  2VWJ A;  4K35 A;  1FFT B;  5EK0 A;  5B66 Z;  1R3I C;  1FS0 G;  1H2K A;  2CGO A;  1UFI A;  3K9S A;  3CRA A;  3OGI B;  2EIL B;  3G6B A;  5J2U B;  1XHX A;  4JTA B;  1IXB A;  4WFH A;  5L3G A;  1IBM O;  1CP9 A;  1I5Y A;  1TGO A;  4MVR A;  3Q4H A;  2P5O A;  2E5L B;  4QPJ A;  2LW1 A;  3AG2 C;  3R65 A;  5CB4 B;  3E35 A;  2EIN C;  4P2Z A;  1COW G;  1JMK C;  1BSM A;  3CSX A;  3QNE A;  1GRJ A;  4RAI A;  3CCE V;  4B3M B;  1IBL B;  1KKD A;  4GX0 A;  2DYS B;  3BCC H;  4X64 O;  5IDJ A;  4JI2 O;  5C93 A;  3TGU H;  1AR4 A;  3G67 A;  4OXS A;  3S3W A;  1GM7 A;  3JCU Z;  4TUY A;  3CD6 V;  1NQT A;  5GW7 A;  2Y0I A;  3JAW B;  5LXT B;  3T2M A;  2Y4U A;  1PV0 A;  3CCR V;  1VQK V;  2B9Z A;  1LUV A;  2P4K A;  3CE2 A;  3CJH B;  3F7Y C;  5H6Q A;  4BAY A;  4MTF A;  4G2K A;  5L3D A;  2ZNI A;  4L8J A;  1XNQ B;  1NU1 H;  2N04 A;  2PF4 E;  1S5H C;  2OIG A;  2YIB A;  1XIL A;  1HNW O;  1K92 A;  2QGN A;  5JVD B;  1Z2G A;  4FIP C;  4LR3 A;  3IAY A;  3BRC A;  1VP7 A;  2QA4 V;  1MMM A;  1SQX H;  1N0J A;  4BWA A;  1MA1 A;  1NJI W;  4CZZ A;  3AK1 A;  3CRQ A;  1D5N A;  4FMT A;  3ZMZ A;  3THO A;  3FAV A;  1HNZ O;  1LNQ A;  4TV8 A;  3ZX6 A;  1YF2 A;  4UV9 A;  4B3S B;  3O65 A;  4O4L B;  4FLV A;  2CE4 A;  4DR3 O;  4YY3 B;  3J7A U;  1SA0 A;  5C8Y B;  3UM7 A;  1N0N A;  4TOI A;  1FXH A;  3JAR B;  2KB1 A;  2R9I A;  3A0B Z;  1AJQ A;  4FLY A;  1F4M A;  4EFB A;  4RO2 A;  1YEW A;  2ZE6 A;  3JSN A;  2F1M A;  2ARH A;  4H37 A;  5IYB O;  3JD0 A;  1VQM V;  3W7S A;  1FXK C;  4LF9 O;  3SJQ C;  2DOS A;  2ZCE A;  4UCU A;  3CHX A;  1HNX O;  2UUC O;  1DLB A;  5EYP A;  1RM1 C;  3K0G A;  3CRR A;  1K8A W;  1YTF B;  1Y6X A;  2ZXW B;  2ZIN A;  4LNU A;  4MT8 A;  4I9Q A;  4PDR A;  3BAB A;  4PI0 A;  5DED A;  3QO8 A;  1N8R W;  4G27 B;  2FKX A;  2ZIO A;  3ML0 A;  1F51 A;  2WLJ A;  5CA1 A;  3FYE B;  5LOV A;  1K4D C;  2QTS A;  2N05 A;  1P7G A;  1V54 B;  4LFB O;  1S3J A;  2ATK C;  5KX5 B;  4CC5 A;  1M57 B;  2EIJ B;  3M8A A;  1F4N A;  4DV7 O;  3CCQ V;  4GX2 A;  4I0X B;  5K1X A;  1I5X A;  1AR5 A;  2YXL A;  2BTQ A;  5IYZ A;  1Y67 A;  4YHH B;  2A0L A;  3ZRW B;  2EBO A;  2W0X A;  3L75 H;  3ZED A;  4E2L A;  2R9R B;  4J7J A;  4K0K O;  5CMU A;  3KCY A;  2JVD A;  3F5W C;  2Y69 B;  4TSF G;  3BA8 A;  2UXD O;  4AIL C;  3N2K A;  1W59 A;  1OV9 A;  2LGW A;  2HKO A;  2Q0O C;  2DN9 A;  5E79 Z;  2R72 A;  2HHH B;  1BQZ A;  1S5J A;  2YXH A;  4DR1 B;  3RYI B;  4NXN O;  3SJA C;  1J5E B;  2F4V O;  2KG7 A;  1FJG O;  2XOK G;  1WLE A;  3B4S A;  3AG7 A;  1YSC A;  4DV6 B;  3QTC A;  4WFB V;  1D5A A;  4YXW G;  1IXM A;  2Q7G A;  3HKB B;  2ODM A;  3CCM V;  4WCE V;  3I55 V;  4BW9 A;  3OW2 U;  5LP6 B;  4DUZ O;  1H8E G;  3HPL C;  3JAT B;  4JI5 B;  1SF9 A;  3E89 A;  4PV1 B;  3OMI B;  3CC2 V;  2BOC C;  1WNS A;  3OFN G;  1ZTE A;  4J42 A;  5JWP A;  1NR7 A;  2HP8 A;  2QWO B;  3QF7 A;  4JI0 B;  2BE3 A;  3ASN B;  5LHG A;  3ABK B;  1K73 W;  3KZI Z;  4JTD B;  3X2Q B;  1R6N A;  2VWK A;  4NTW A;  4IHJ A;  1WB7 A;  1H38 A;  4QJF B;  1NZ6 A;  2DYR C;  1Y74 A;  1Q6U A;  2WLN A;  2KSD A;  4IT5 A;  4X1I A;  2H94 A;  3UKM A;  1XDC A;  4B7K A;  3JAS B;  1OHH G;  1FFX B;  3HKE B;  2YEV A;  3RYF B;  4JV5 O;  4AI8 A;  2ZXW C;  4DUY B;  4QGP A;  1L8D A;  4I5S A;  2DWE C;  4PA9 A;  3ASO B;  5CBG A;  1N32 B;  3SPJ A;  3AK2 A;  4LBE C;  2ZE7 A;  3UQ8 A;  5IWA O;  4O4J B;  1MG1 A;  4I7Z B;  5LYJ A;  5DM6 V;  4X64 B;  4OX9 B;  3ZRV A;  2K1E A;  5D5Q A;  1HWY A;  2CAZ C;  2EZO A;  4FFB A;  3E22 B;  5JH7 A;  3CXH F;  4JYB A;  1EM1 A;  3SGI A;  2L35 A;  4D7T A;  3N27 A;  2YI8 A;  4X65 O;  1QVG U;  3H9V A;  3APO A;  1HR0 B;  1WJZ A;  4GYC B;  4Z1V A;  3P3N A;  3OAA G;  4MSW C;  1I94 O;  3EXA A;  5IJ0 A;  4GLX A;  4L87 A;  3QVN A;  3K08 A;  1AIL A;  3ZMS A;  2A3Q A;  1OCO B;  1H2N A;  4HNA A;  2AZ0 A;  2Y69 C;  2EZP A;  3OD4 A;  4LF8 O;  2BTO A;  3O9O A;  1H8H G;  1KU9 A;  4DRX A;  4Z2W A;  3A0R A;  5EC1 C;  2Y0P A;  3RT3 C;  1VQP V;  2X6B A;  2QR4 A;  2G38 A;  2FL4 A;  3BY6 A;  1VQ4 V;  3HKC B;  1Y74 B;  3CC7 V;  2E3C A;  4O2B B;  3ZS8 C;  3UT5 B;  4DR3 B;  3ZRS A;  2C2A A;  2OIE A;  1VQ9 V;  1ZLZ A;  1RFY A;  2UUB B;  1Q6H A;  1JA8 A;  3ZHQ A;  2YXY A;  4P9O A;  3T1Y O;  1GAX A;  3K0D A;  1XMQ O;  2XND G;  2WAM A;  4DV3 O;  3VQY A;  2XAS A;  4CS4 A;  3B2E E;  2P06 A;  4DR6 O;  1BE3 H;  2HEP A;  1LR1 A;  1VF5 B;  4X8A A;  1HNX B;  4QE9 A;  1EZJ A;  4JZ2 A;  4EB6 B;  2OT5 A;  3JD4 A;  2CH7 A;  4IIJ B;  3CCU V;  2LFS A;  3X2Q C;  4EEQ A;  4WBN A;  4MTX A;  3ABU A;  1YIJ V; 
#chains in the Genus database with same CATH homology
 2KG7 B;  3TXQ A;  3GWK C;  3GVM A;  4I0X B;  4LWS A;  1WA8 A;  4ABM A;  3FAV B;  2AZ0 A;  2DE0 X;  2VS0 A;  2B9Z A;  2KG7 A;  3Q4H B;  2AZ2 A;  3TXS A;  2VRZ A;  3G80 A;  4I0X A;  3O9O A;  3OGI B;  3FAV A;  3HR0 A;  3FD9 A;  3ZBH A;  4GZR B;  4LWS B;  1WA8 B;  3Q4H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...