2AZ0A

Flock house virus b2-dsrna complex (p212121)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
total genus 23
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az0A00
2VS0A 1WA8B 3TXQA 3G80A 3O9OA 2DE0X 3ZBHA 2B9ZA 3Q4HB 3FD9A 3TXSA 3Q4HA 2VRZA 3HR0A 2KG7B 2AZ2A 2KG7A 4LWSB 4LWSA 3FAVA 3FAVB 4GZRB 2AZ0A 4ABMA 3GWKC 4I0XB 4I0XA 3OGIB 3GVMA 1WA8A
chains in the Genus database with same CATH superfamily
5CBGA 3TXSA 5LBQA 3UKMA 4OX9O 4LFBO 1L1FA 3K0DA 1Q3EA 2Y69B 3UM7A 1PL4A 4XDKA 2JJ2G 2CH7A 4ZOLA 4GX0A 4N21A 2RJZA 3OEEG 2LW1A 4B3SB 4X64O 2OCCB 2DYSB 3D36A 3HKCA 3JARA 2WSSG 4K3AA 1HNWO 5KAFZ 4TQDA 2JVDA 1Z5VA 4NKGB 1QVFU 4P9PA 1BSMA 1Y67A 1XMOO 4TV8B 3RT3C 1S0VA 3ZX6A 5EK0A 1VQOV 3ETDA 4LF8B 3GWKC 5GTHZ 4JI6B 1AP5A 2QKAA 3GWOA 3HB3B 3BAAA 2A79B 4DV7B 4X20B 1AI6A 2BSKA 3QNEA 1LNQA 1F23A 1KKCA 4TV8A 4DV5B 5HFLA 4U7OA 4FFBA 2R9IA 3OR7C 2L6LA 5LHIA 1AJQA 3E8HA 4IYIA 4NXNB 4FLXA 1NVPD 2Y0IA 4JI1O 3J7AU 1SQXH 2YIBA 2AZ2A 1P84F 4PA3A 1N0NA 4TUYB 2MK3A 4DW1A 2HHHB 3E83A 1FKAO 4PA6A 4QE9A 1N0JA 3OR6C 1YIJV 2EILC 2WLLA 1FS0G 4JTCB 4H33A 1QHTA 4I50B 3QO7A 1TGOA 4MVMA 3EXAA 2AXTZ 2WLIB 1R73A 2F93B 1Q8IA 2QM7A 2DW4A 3AG2C 1GM8A 4DO2A 3TGUH 2PY5A 4KFMA 2VQFB 4PI2A 4D7SA 1M56C 1BCCH 2ZQMA 3STZC 1V9PA 1YF2A 4BW9A 2VWKA 1GN2A 3WU2Z 1J95A 4I55B 1XDCA 2IU0A 4WBNA 4JI3O 3UT5B 3OTOB 5TISZ 2ETNA 1SQPH 5B3SB 1YJNV 2E74B 3DSQA 1J5EB 4LF4B 2JDIG 4FFBB 4TQFA 4DV7O 4CS2A 2UXXA 1HNZB 3BY6A 3N27A 4WFFA 1WB8A 1DLBA 1H2GA 1W0KG 2E5LO 3AG4B 1K4CC 1QCEA 2IBZH 3HR0A 2QWNB 4JAUA 4O2BA 2V7QG 4FMTA 1XQ8A 2ZIOA 3ABMB 4JAVA 3RYHA 2Y4TA 3VQVA 5LHHA 4PA9A 3D3IA 4RUEA 1ZX3A 2OTLV 1WP7A 4ZI7A 1WJZA 4UCVA 2Q69A 4H44B 1P49A 3CC2V 1NJIW 3BRCA 1BZKA 1GMGA 1MNGA 1N32B 1M90W 2FMLA 3CCVV 5H6QA 1MZEA 3JYCA 4RUFA 3K5MA 4L8JA 1AR1B 4GX5A 5CA1B 1FXVA 5EIBC 4XBFA 4B3SO 1NBMG 4P30A 1S76D 3FAVA 1J5EO 2HVKC 2JS5A 4HNAB 3CWBH 3FFQA 1D2DA 3MAQA 2OCCC 3QG5A 4J7KA 1QVGU 3FD9A 3JSLA 3RVZA 5D5QA 3FB6C 5IE9A 2WLHA 2ODMA 4CH4A 2XTAA 4PHZA 5EC2C 2HP8A 3OE7G 1YJWV 3HPLC 1IVSA 2R9RB 1BGYH 1LUWA 3BVOA 4DUYB 4PDLA 1SQBH 5EZYB 3IJ4A 4RQEA 1RSOB 4IL6Z 2RN9A 3K58A 1N34B 2Q73A 4X88A 5CA1A 4TWKA 2E76B 4TUYA 2GV9A 2P4VA 2YIAA 2JGDA 1SS3A 5CBHA 2JK5C 1Q6HA 5B1BB 3CC4V 2LP7A 2XNDG 2YEVA 1EFRG 1TAEA 4DV2B 1Q43A 2OCHA 4HBNA 4OXSA 1H38A 1TA8A 3APQA 3ETGA 1OJHA 3E35A 1YVWA 2EX3A 1EN4A 2IU3A 1K7DA 5KX5B 3VQWA 1OCZB 2X7RB 4O2AA 4DV5O 3E8BA 3KZIZ 1OCZC 2DYSC 1KP2A 4MVUA 4JI8B 3MHSC 1TUEB 2XASA 4X1YB 4NTXA 4FLZA 4OGQB 1Y6XA 1WN7A 2UUCO 3L71H 3WFVA 5JWPA 4JZGA 1HNWB 4WFBV 2ITDC 3SJAC 1N36B 1AB3A 2C2AA 1N33O 2OTJV 4LH7A 2X0LA 5JVDA 2XAQA 1COWG 3N2KB 1YHQV 1CXZB 3BHPA 3I55V 4B7KA 3CXHF 5CMUA 1Y66A 1RP3B 1OCCC 2PI5A 4IHJB 5C93A 2Z0AA 4WFAV 2UUBB 3ZEDA 1PM9A 5LGNA 1AJNA 4YY3O 1Z2GA 1NU1H 1EBOA 1Q7YW 2Y0PA 1PV0A 3CRCA 3HKEA 4TOIA 4U7NA 1IDSA 5IYZB 4FM0A 5KHKA 1VARA 1EN5A 4JI7B 2DQ0A 1MZFA 4X1KA 1KMIZ 2CDYA 3D3QA 3SYQA 3LDEA 3ZN1A 3LSUA 4DV0B 4DYLA 1JMKC 4LF6O 3T2MA 4H13B 2F66C 2DJVA 4QPJA 1QR8A 3FX7A 1QU7A 2EILB 4X66O 3L75H 2FL4A 4H0LB 3CCQV 3G80A 2ITCC 2EZPA 3JAKB 4LNUA 4X62O 4JI0O 1XREA 1H2LA 3OGCC 3FB7C 4DR7O 5L3DA 2KG7B 1ZTEA 5K1PA 3AEIA 1XNQB 1O9GA 1VQ5V 2BOCC 5LGUA 2ADPA 1TVKA 1F7YA 4R50A 1NVPB 3B4SA 3N2KA 2LFRA 4F6EA 2YC0A 1IBKO 2FB5A 5ITZB 5IWAO 2FTKA 1HR0O 2QM4A 3TK1A 4BIUA 2EIMB 2R70A 4B7EA 2Z5UA 3E89A 4GT1A 1Q81W 4UV9A 1OV9A 1FD9A 1IBMO 2CH7B 2WA3A 1SF9A 5IYZA 2VWJA 4YJ2A 2H94A 2IJIA 3ETEA 1WPBA 3A0RA 1FXHA 1YDXA 3SPJA 2G38A 3ZMTA 1DTOA 4G27B 2OIGA 4LF9O 5GW7A 3ZHUA 3ZMUA 1B04A 4FLTA 3CSXA 4IT5A 4CC5A 4JI3B 3K5NA 1I94O 1BL8A 4DRXA 3ZRXA 3B40A 5CA0A 2F95B 3L74H 1N36O 1IX9A 5EYPA 2PYJA 5JH7A 2HKOA 3IC7A 3Q4HA 4D6TH 1HNZO 1VQ8V 1M4UA 1GO3F 2D2CB 4F4LA 4LC1A 3CCSV 3MHHC 3K08A 2QWOB 3ICXA 2VQFO 1BQZA 3OD4A 4B3MO 4K8ZA 1XNRO 3EFFK 3CRQA 3A8TA 1TUBB 4ICGA 4YXWG 2ZE6A 3R65A 3QVNA 2H8PC 5KHIA 2VQEB 2LFSA 4UCUA 2F4VO 2DWEC 2P67A 4IGGA 5KMGB 1V54C 3K3WA 1YTFD 1AR4A 4O4HA 4DV1B 5CB4B 4FLUA 2KQXA 3APOA 2P4KA 3C3SA 3KCYA 4X1KB 1X59A 2ILMA 4JF3A 3ABTA 1UPGA 1PKXA 2EIJB 3H1HH 3K0GA 2LGWA 4GLXA 4TV9A 1KB9F 1THZA 4DV4B 5J2TB 1S5JA 1L0LH 5CA0B 3ABLB 3AG1B 4PA4A 5J2UB 4EB6A 4NR1A 4DV6B 5CN0A 2UXNA 2P5OA 5B1AC 2EZOA 4LFCB 2CE4A 4UV8A 2HJDA 3UO3A 4WFHA 1KBHA 4W4KA 4JPRA 4GKJO 4CS4A 1I7FA 1VQPV 2JJ1G 4UCTA 1GN3A 4JI6O 3VQXA 1OZ0A 3P30A 4Q6GA 4HYOA 3STLC 4DR2B 1E1QG 5IYCO 2B9ZA 4O4JB 1FAFA 2FKXA 5IY5C 2A7WA 4CC6A 1NS1A 4J7JA 2YI9A 5KHGA 2XOKG 2NR5A 2P06A 2XAJA 4JTDB 5FNVB 4UUJC 5LMNO 3JALA 2NLJC 5KA6A 3CCEV 1PL0A 3PJSK 4YJ3B 1M93A 1JJOA 2CTWA 4ZI7B 2YDEA 2PYLA 4B3RO 2F43G 3CRRA 1ZWIC 1YTFB 2EIKB 4KXRA 1JFFB 2EIMC 4KUMA 3PN1A 3AK2A 3SPCA 1NR1A 1AVMA 1EN6A 1WPXA 3DC6A 1IXMA 4JYYA 5BR8B 2Y69C 4E2LA 1URFA 1NTMH 3SR2C 1CEZA 1SZXA 4CZZA 2JEUA 3T1HO 3P3PA 5KUMA 4ASUG 5IJ0A 3K5OA 3BA9A 1N8RW 4I9QA 1HP8A 5KUKA 1GM7A 4UVCA 4FLVA 4X65B 2E3CA 4P9OA 4I0XA 4J9ZB 4O4HB 3T1HB 3ETQA 3U10A 1H2NA 2UUBO 1KUQA 1FJGO 1IXBA 1HNXB 4X66B 3OAAG 4X9QA 2QR4A 3JD3A 3LNMB 3FYIB 2HVJC 2Q0OC 3ZRWA 2UXCB 3FAVB 1V55C 5JVDB 2OYQA 5J9PC 4JI2O 2WLLB 1NT2B 1KKDA 3RYFA 3A0BZ 4QJFB 1Y74B 1V55B 4BAYA 1XUQA 4LF6B 5EBLC 2P6JA 1Q90D 2CTQA 1AJPA 4JI1B 1FFTB 4UVBA 3GB7C 3J81N 2GBOA 1M1KW 3DGEA 1H8HG 4JI8O 3ZS8C 1R3JC 2ZCEA 4IIJB 4FZ1A 3K9SA 1R6KA 1QLNA 2PF4E 4JYBA 1SRYA 4BIOA 1BHAA 1S3JA 4DR2O 3CC7V 4O4JA 3G6BA 4UVAA 1R3IC 4DR3O 4JASA 2DWDC 3K06A 2E5LB 3DXRA 4ZKIA 4DV3B 4DR5O 2OWOA 2QGNA 3ASOB 3JALB 5EBWC 2GUZB 3OGIB 4MVRA 4G2KA 4JGSA 2QM8A 2A3QA 3L9DA 3RYIB 4MVOA 2B5UA 1WB7A 5JQGB 1P7GA 4TT3G 1G6UA 3W7XA 3OMNB 3ZIAG 4FM2A 2MW2B 3AG3C 3TCUA 1RM1C 2W0FC 3ZRVA 3AG1C 4NTYA 3VBBA 3K79A 2WAMA 4DUYO 3E22B 4UXNA 1MABG 3SDLA 2ZXWC 2P7TC 4CH3A 1K9MW 1SC5B 4FK5C 1GM9A 4DR1B 4JV5B 1G4YB 5LHGA 4CS3A 4OX9B 2IW5A 5LOVB 2ZIMA 1VQLV 2HG5C 1L0NH 2BTOA 1Q6UA 2QE7G 3W7WA 1JCHA 5L3BA 1R3LC 5JCOC 3S3WA 1WA8B 4X1IA 2ZM6O 1SQGA 2BCCH 3RGBA 4LF7B 4DR4B 2DN9A 4B3MB 2IJJA 1YEWA 4AHCA 1VF6A 3K5LA 2Q6AA 4HNAA 1MSWD 1CP9A 4I0XB 1M5IA 2EIKC 5B3SC 1KU9A 2BOBC 5L3EA 3A2FA 4EEQA 3E8GA 2F4VB 5JQGA 4K0KB 1KECA 2UUAO 2UXBB 4EFEA 5FPOA 4B3RB 4RO2A 4U3JB 4UCSA 3ZRSA 2XT9A 3ZMZA 1VQ9V 2ZDIA 3O65A 3JAMN 4FFKA 1FXKA 1Q5OA 3ZBHA 2ZE5A 2CUGA 4QPKA 5C8YA 3HKCB 2JIZG 4LCUC 3RN4A 3IAYA 1IBMB 1IBLO 4ZHQA 4D7TA 5LMNB 2UXDB 4ABMA 4YJ3A 2QWQB 4X89A 2V1DA 4X1IB 3AG3B 5BXZA 3TXQA 3C90A 4B3TO 2YXYA 2EJRA 2B1IA 3QO8A 4FLYA 1MSDA 3OTFA 1W0JG 3H01A 1QQCA 1BMFG 2UUAB 2UXBO 5EIBD 1BQ0A 1H2KA 5KMGA 3B77A 2PTMA 3W7UA 1FFXA 1HR0B 5IWAB 3FKSG 3JD2A 4GZRB 2DYRC 2HFEC 3E8FA 3GVMA 4NYKA 5IJ0B 3JAKA 1O9HA 4LF7O 2W0XA 1YJ9V 1GRJA 3NXSA 4DR7B 3AG4C 4GX2A 2RQ6A 1PP9H 4J80A 1WP8A 4TSFG 1K3EA 3WG7B 3T4ZA 4KHPB 3HKDB 3I5DA 2EINB 4DXWA 4NVPA 2VQEO 3T1YO 4BIZA 5BMVA 2VRZA 1VQ4V 5DM6V 2Y48A 2YI8A 1AR5A 4WFGA 4MW3A 1QBZA 2QWPB 1W59A 3JD0A 4QGPA 5FNVA 4JI7O 1PPJH 3LSSA 3RYCA 2DOSA 4LH6A 2Q7HA 4JV5O 1QNMA 1N33B 5JH7B 4H37A 1K5SA 2UU9B 5DEDA 2NNUA 2ZXWB 1NH2D 1SKVA 5IYDO 1K97A 1NTZH 3J80N 4JAAA 4QIWF 5A9GA 3I56V 1WLEA 1DF4A 3SGIA 4LP8A 3OM3B 4O4LA 1NZ6A 3CMAV 2CK3G 4BR6A 2YEVB 1HW7A 4O2BB 4PA7A 2IM9A 4OPAA 1SERA 4LWSA 3B09A 4O2AB 4NXMO 3SYPA 1ZL8A 4DR3B 3AK1A 5B1NA 2LW7A 1JJ2U 4NTWA 4X64B 2LO1A 2OIEA 1JX9A 3ZHVA 3T4DA 4DK0A 3BPZA 2DYRB 1RFYA 3JASB 3LUTB 5B1BC 2Q68A 3B8NA 1R1BA 4RWUA 4N23A 1LUVA 1AI5A 1D5NA 4ZOLB 3B8MA 2ZDIC 4GKKB 2UXCO 1VIBA 5LA6A 1UFIA 1GKFA 2WLIA 1AP6A 3FB8C 3C3TA 1H2SB 1Q86W 4LF5O 1VF6C 3SPIA 2YUAA 1Y76A 4LFAO 1KYOF 2AGAA 4RAIA 2LGQA 1HNXO 4J41A 2HR3A 4F6RA 1D5AA 1KD1W 3OMAB 1XEQA 4JTAB 1AROP 3EVKA 4JI4B 1ZAUA 4J7ZA 5B66Z 4WCEV 4AQYO 2ARHA 4IYHA 3ZHTA 3ZMSA 1PNLA 2N74A 2BTQB 3JATB 2RMKB 1H2MA 3M7MX 4UB8Z 3SPGA 2QDOA 3KKYA 3BEHA 1BS3A 2RDCA 3IGAC 1NTKH 1YXBA 4LF9B 4QE7A 3M8AA 4MTFA 3LDDA 5IJ9B 1JFFA 2NN4A 4JYAB 1HWYA 3DC5A 3CCLV 3ABKB 3CCRV 1F51A 4U3FH 1B6QA 3VQYA 1AILA 2XAGA 1B3QA 3E86A 1MOFA 2W6IG 4EB6B 2WLMA 4QNHB 3KG2A 5C8YB 1XHZA 1S72V 4C7UA 4CBCA 1XL6A 4WF9V 2R9AA 3DXRB 3WB0A 3F5TA 2KSDA 2JGUA 4GYCB 2QKSA 4F6RB 1ZUQA 3SJQC 2UU9O 3H1KH 3SJCC 3CB2A 4RQFA 4DV6O 1VEWA 5ITZA 5EZYA 3H1LH 1Y74A 1N4CA 1GN6A 3RBZA 1OCRC 3UT5A 4JI0B 1H8EG 1GAXA 3K9AA 2HJFC 3K59A 3UCSC 4GKJB 4E4EA 4DUZB 4DR6B 5J2TA 3UQ8A 3WB2A 3ZHSA 3T1CA 1F4MA 4NB5A 4EFBA 3JAWA 3SPHA 4FJCC 3P3NA 3O9OA 5LMUB 2Q7GA 4DV4O 1I5YA 2ZINA 4LNUB 1YSCA 1VQKV 2WLNA 5FPRA 1ZLZA 2XAHA 2IH3C 1DGSA 1R3KC 2HEPA 2JGDB 5BZBA 4DV1O 1KC8W 2YIDA 3SYOA 5LMUO 5BMVB 2ZR3A 1JA8A 1Y4MA 3D36C 4MT8A 3ZHRA 3N2GA 5H2FZ 1BHBA 4PDRA 4A5UB 5KHJA 4GUNA 2WLKA 2UXDO 2A9HA 1JR9A 4FM1A 5H5NA 1RPRA 1K33A 1XBLA 4X20A 4J10A 4LF8O 2GTAA 3JD1A 1RPOA 1I08A 3CEIA 1FFXB 5KA5A 4GX1A 1KP3A 1M57B 4PDMA 2QWRB 1X4TA 1AI4A 5E1AC 3JSNA 2N05A 4P2ZA 2X6CA 2JS3A 3CE2A 5IY5B 4K0KO 2M7WA 4DV2O 1I94B 3JATA 2PI4A 3F7VC 1NR7A 1NH2B 1K4DC 3CCUV 1JOYA 1VMGA 3ZRWB 3CP1A 1CPYA 1R6TA 3CHXA 1UJWB 1ZSPA 4IIJA 3BFRA 2D3OW 3L73H 1MG1A 1PD3A 1XHXA 1JPXA 1QLEB 1WA8A 1OCCB 4JI2B 2FYUH 3HKDA 4CH6A 1XI1A 3RFRA 3D8CA 3WB1A 4WBNB 4KP4A 1IURA 2ATKC 2ZR2A 3THOA 3CD6V 5A2QN 2QTOA 1GTOA 2YIBD 4I4TA 5LYJB 3B2EE 1XNQO 5B1AB 2GHYA 4JI4O 3R66A 2YXHA 3CYOA 2IJKA 1YZBA 3LNNA 2YS8A 3ZCCA 3ABUA 4MTGA 2AHYA 3TETA 2Q8VA 3OUSA 3F5WC 4LFBB 4LF5B 4GKKO 3ASNB 2Q4PA 1L8DA 2QA4V 3OW2U 4DR1O 2F1MA 1VQMV 1M56B 4YY3B 2YXLA 1TVKB 4MVSA 3ASOC 4MW8A 2Z3YA 5LP6A 3RYIA 3IFXA 3QTCA 1E79G 5E79Z 1A32A 2X6BA 1NI8A 3G6EV 3H1IH 3H9VA 1OCRB 4OPHA 2WA4A 4J11A 1YCIA 4WFEA 5IDJA 4K35A 1FXKC 4I4TB 5LYJA 3W7SA 4DV0O 5LL6Y 3JD4A 4R7CA 1EZJA 3RVYA 1Q82W 3HKBA 1XOUA 1LR1A 4JYCA 4DUZO 4DR6O 4LBEC 2K9PA 4YIOA 5K1XA 4Z1MG 2AW9A 2ZE8A 4J42A 1GK9A 3JCZA 2P90A 4I9WA 5GONA 1VQ7V 3SJBC 3ML0A 3FB5C 3OUFA 3CXCU 3ZHQA 1FPOA 2AHZA 5B5EZ 4O4IA 4YHHO 1BT8A 4YJ2B 4PJ0Z 4LF4O 2DMXA 2ZD9A 3CRMA 5EYPB 5H9CA 3ASNC 4I55A 1S77D 1T5EA 1Q6IA 4NXMB 5D5PA 3JARB 1XMQO 4JI5O 2BSKB 2H3OA 2WPDG 2ZE7A 4HAMA 2EJ7A 3E2EA 3OMIB 2DQ3A 3ABLC 4LWSB 2QEXV 3RYHB 2ZNJA 1K34A 3CJHB 4DRXB 4MS2A 4FIPC 4MVZA 2Q67A 4PDVA 3CS5A 1W2BU 3RYCB 1YI2V 2CGNA 2N04A 3CX5F 1FXKB 4LR3A 3ZMVA 1K8AW 1Z5WA 3K57A 4FLWA 1P7BA 3BA8A 2YICA 2IH1C 5GONB 1PNMA 3OEHG 2L35A 5LGTA 2KG7A 3RWRD 4TV9B 1ROPA 1XL4A 4PELA 1AI7A 1SETA 3HKBB 2RNBA 1N34O 3K03A 1F4NA 4AI8A 1VQNV 1SZTA 2ADQB 4HZ3A 4FPPA 4CH5A 1M57C 4XDLA 1OCOC 1Y76B 1ENVA 2GTSA 1SA0B 3CJHA 4X65O 1PNKA 5KHHA 2GUZA 2QTSA 3MDSA 3JAWB 4XDJA 1XILA 5KAIZ 1YITV 4EKWA 5HFMA 2JEXA 4FVMA 1DF5A 5AG2A 2XUMA 2EIJC 4JZ2A 3OFNG 2CGOA 4B3TB 4UCRA 1G1XB 1RSOA 2XHBA 4MSWC 1R6NA 4MVQA 1GN4A 4UCOA 4DK1A 1QLEC 5F2VO 3MD0A 1SQFA 4MTXA 2CTRA 5DECA 4AILC 1IBLB 3NR7A 3ZJZA 2ZNIA 1OHHG 2ZT9B 1JQ0A 3Q4HB 1N32O 5IJ9A 3L72H 2QSAA 5BR8O 1P4RA 4UB6Z 1MA1A 1EZVH 3WG7C 4X1YA 3BABA 5B1OA 2A0LA 5GTIZ 5EBMC 3A0HZ 3OT7A 4ZHQB 5KLVH 3BCCH 2P22C 2AZ0A 1HDJA 3LSQA 4O4IB 3VOUA 3K04A 2A06H 2ZM6B 1S5HC 1U97A 2E75B 4LFCO 3RW0A 2Q0AA 2BTQA 4B08A 1K92A 3KCXA 3N2GB 4DW0A 1VF7A 5KX5A 1B06A 2F23A 3ABKC 4X62B 2M6YA 4K8XA 3QF7A 3OTOO 2HLDG 5CB4A 5J2UA 1OCOB 3RYFB 4I50A 2KKWA 2Q9LA 2QJ1A 5FLXN 4Q20A 3CCJV 2X6AA 1VF5B 5JCOA 2QKCA 3QO5A 1EM1A 1SQVH 3X2QB 4J9YB 5LP6C 4KHPO 5CBFA 2GSMB 5L3CA 3W7TA 1I5XA 2BE3A 3SYAA 1IZ3A 5LP6B 4BW5A 1US6A 3U11A 2KB1A 2IJHA 1ORQC 1MMMA 2YSUB 4BWAA 1FYJA 2HHHO 4MTOA 2PUSA 2Q7EA 1SQQH 3JASA 3L70H 3CMEV 4X8AA 3M99B 3IC9A 4PV1B 5LXTA 1M9NA 1E1RG 1ZL8B 4DV3O 4DR5B 4UFZA 4NXNO 1U96A 1S5LZ 3LDCA 4PI0A 1RM1B 4R8CA 4JI5B 1XMQB 2K1EA 3DTUB 4ZIBA 4Z1VA 2CTPA 4ZBMA 4PD4F 5L3FA 3FYEB 2B1GA 1XNRB 3JCUZ 3S3XA 4R6ZA 3U0ZA 3CCMV 1KQSU 3G67A 5EC1C 2R72A 3G4SV 4Z2WA 2Q5ZA 1XMOB 3UO2A 2LQTA 3SYCA 5LXTB 2UUCB 3H1JH 4GCZA 1GH6A 3AG2B 5DN6G 5JJEB 1QR9A 4YHHB 5L3GA 1DK1A 2JRIA 4KL1A 2EBOA 2WWWA 2W6JG 3F7YC 2LJ2A 5JJJB 2XAFA 2GDSA 4I7ZB 2EINC 2Y4UA 2ZKOA 4U3JA 1VP7A 3G71V 1JVMA 3P32A 2OT5A 3EHBB 1WNSA 2EULA 3ZN0A 1NQTA 5H6RA 3AG7A 4O4LB 4JYAO 4W4LA 1VQ6V 3CRAA 5JJNB 5IYBO 1V54B 2CAZC 5LOVA 2V4DA 3T1YB 5CA3A 1K73W 3AK3A 1K5QA 2O57A 3E22A 1SA0A 2WLJA 4L87A 3CPWU 5FL7G 4FZ0A 2VS0A 3ABMC 3HKEB 1FJGB 1IBKB 1TUBA 2DE0X 3X2QC 4AQYB 4G28B 5BY1A 4I5SA 5LA6B 4DR4O 1SESA 4IHJA 3TJTA 1G8MA 1BE3H 4YIPA 4LFAB 5IT9N 1I0HA 2PGGA 1NKDA 2PZSA 1WAZA 2RCVA
chains in the Genus database with same CATH topology
2VS0A 1WA8B 3TXQA 3G80A 3O9OA 2DE0X 3ZBHA 2B9ZA 3Q4HB 3FD9A 3TXSA 3Q4HA 2VRZA 3HR0A 2KG7B 2AZ2A 2KG7A 4LWSB 4LWSA 3FAVA 3FAVB 4GZRB 2AZ0A 4ABMA 3GWKC 4I0XB 4I0XA 3OGIB 3GVMA 1WA8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VS0 A;  1WA8 B;  3TXQ A;  3G80 A;  3O9O A;  2DE0 X;  3ZBH A;  2B9Z A;  3Q4H B;  3FD9 A;  3TXS A;  3Q4H A;  2VRZ A;  3HR0 A;  2KG7 B;  2AZ2 A;  2KG7 A;  4LWS B;  4LWS A;  3FAV A;  3FAV B;  4GZR B;  2AZ0 A;  4ABM A;  3GWK C;  4I0X B;  4I0X A;  3OGI B;  3GVM A;  1WA8 A; 
#chains in the Genus database with same CATH topology
 5CBG A;  3TXS A;  5LBQ A;  3UKM A;  4OX9 O;  4LFB O;  1L1F A;  3K0D A;  1Q3E A;  2Y69 B;  3UM7 A;  1PL4 A;  4XDK A;  2JJ2 G;  2CH7 A;  4ZOL A;  4GX0 A;  4N21 A;  2RJZ A;  3OEE G;  2LW1 A;  4B3S B;  4X64 O;  2OCC B;  2DYS B;  3D36 A;  3HKC A;  3JAR A;  2WSS G;  4K3A A;  1HNW O;  5KAF Z;  4TQD A;  2JVD A;  1Z5V A;  4NKG B;  1QVF U;  4P9P A;  1BSM A;  1Y67 A;  1XMO O;  4TV8 B;  3RT3 C;  1S0V A;  3ZX6 A;  5EK0 A;  1VQO V;  3ETD A;  4LF8 B;  3GWK C;  5GTH Z;  4JI6 B;  1AP5 A;  2QKA A;  3GWO A;  3HB3 B;  3BAA A;  2A79 B;  4DV7 B;  4X20 B;  1AI6 A;  2BSK A;  3QNE A;  1LNQ A;  1F23 A;  1KKC A;  4TV8 A;  4DV5 B;  5HFL A;  4U7O A;  4FFB A;  2R9I A;  3OR7 C;  2L6L A;  5LHI A;  1AJQ A;  3E8H A;  4IYI A;  4NXN B;  4FLX A;  1NVP D;  2Y0I A;  4JI1 O;  3J7A U;  1SQX H;  2YIB A;  2AZ2 A;  1P84 F;  4PA3 A;  1N0N A;  4TUY B;  2MK3 A;  4DW1 A;  2HHH B;  3E83 A;  1FKA O;  4PA6 A;  4QE9 A;  1N0J A;  3OR6 C;  1YIJ V;  2EIL C;  2WLL A;  1FS0 G;  4JTC B;  4H33 A;  1QHT A;  4I50 B;  3QO7 A;  1TGO A;  4MVM A;  3EXA A;  2AXT Z;  2WLI B;  1R73 A;  2F93 B;  1Q8I A;  2QM7 A;  2DW4 A;  3AG2 C;  1GM8 A;  4DO2 A;  3TGU H;  2PY5 A;  4KFM A;  2VQF B;  4PI2 A;  4D7S A;  1M56 C;  1BCC H;  2ZQM A;  3STZ C;  1V9P A;  1YF2 A;  4BW9 A;  2VWK A;  1GN2 A;  3WU2 Z;  1J95 A;  4I55 B;  1XDC A;  2IU0 A;  4WBN A;  4JI3 O;  3UT5 B;  3OTO B;  5TIS Z;  2ETN A;  1SQP H;  5B3S B;  1YJN V;  2E74 B;  3DSQ A;  1J5E B;  4LF4 B;  2JDI G;  4FFB B;  4TQF A;  4DV7 O;  4CS2 A;  2UXX A;  1HNZ B;  3BY6 A;  3N27 A;  4WFF A;  1WB8 A;  1DLB A;  1H2G A;  1W0K G;  2E5L O;  3AG4 B;  1K4C C;  1QCE A;  2IBZ H;  3HR0 A;  2QWN B;  4JAU A;  4O2B A;  2V7Q G;  4FMT A;  1XQ8 A;  2ZIO A;  3ABM B;  4JAV A;  3RYH A;  2Y4T A;  3VQV A;  5LHH A;  4PA9 A;  3D3I A;  4RUE A;  1ZX3 A;  2OTL V;  1WP7 A;  4ZI7 A;  1WJZ A;  4UCV A;  2Q69 A;  4H44 B;  1P49 A;  3CC2 V;  1NJI W;  3BRC A;  1BZK A;  1GMG A;  1MNG A;  1N32 B;  1M90 W;  2FML A;  3CCV V;  5H6Q A;  1MZE A;  3JYC A;  4RUF A;  3K5M A;  4L8J A;  1AR1 B;  4GX5 A;  5CA1 B;  1FXV A;  5EIB C;  4XBF A;  4B3S O;  1NBM G;  4P30 A;  1S76 D;  3FAV A;  1J5E O;  2HVK C;  2JS5 A;  4HNA B;  3CWB H;  3FFQ A;  1D2D A;  3MAQ A;  2OCC C;  3QG5 A;  4J7K A;  1QVG U;  3FD9 A;  3JSL A;  3RVZ A;  5D5Q A;  3FB6 C;  5IE9 A;  2WLH A;  2ODM A;  4CH4 A;  2XTA A;  4PHZ A;  5EC2 C;  2HP8 A;  3OE7 G;  1YJW V;  3HPL C;  1IVS A;  2R9R B;  1BGY H;  1LUW A;  3BVO A;  4DUY B;  4PDL A;  1SQB H;  5EZY B;  3IJ4 A;  4RQE A;  1RSO B;  4IL6 Z;  2RN9 A;  3K58 A;  1N34 B;  2Q73 A;  4X88 A;  5CA1 A;  4TWK A;  2E76 B;  4TUY A;  2GV9 A;  2P4V A;  2YIA A;  2JGD A;  1SS3 A;  5CBH A;  2JK5 C;  1Q6H A;  5B1B B;  3CC4 V;  2LP7 A;  2XND G;  2YEV A;  1EFR G;  1TAE A;  4DV2 B;  1Q43 A;  2OCH A;  4HBN A;  4OXS A;  1H38 A;  1TA8 A;  3APQ A;  3ETG A;  1OJH A;  3E35 A;  1YVW A;  2EX3 A;  1EN4 A;  2IU3 A;  1K7D A;  5KX5 B;  3VQW A;  1OCZ B;  2X7R B;  4O2A A;  4DV5 O;  3E8B A;  3KZI Z;  1OCZ C;  2DYS C;  1KP2 A;  4MVU A;  4JI8 B;  3MHS C;  1TUE B;  2XAS A;  4X1Y B;  4NTX A;  4FLZ A;  4OGQ B;  1Y6X A;  1WN7 A;  2UUC O;  3L71 H;  3WFV A;  5JWP A;  4JZG A;  1HNW B;  4WFB V;  2ITD C;  3SJA C;  1N36 B;  1AB3 A;  2C2A A;  1N33 O;  2OTJ V;  4LH7 A;  2X0L A;  5JVD A;  2XAQ A;  1COW G;  3N2K B;  1YHQ V;  1CXZ B;  3BHP A;  3I55 V;  4B7K A;  3CXH F;  5CMU A;  1Y66 A;  1RP3 B;  1OCC C;  2PI5 A;  4IHJ B;  5C93 A;  2Z0A A;  4WFA V;  2UUB B;  3ZED A;  1PM9 A;  5LGN A;  1AJN A;  4YY3 O;  1Z2G A;  1NU1 H;  1EBO A;  1Q7Y W;  2Y0P A;  1PV0 A;  3CRC A;  3HKE A;  4TOI A;  4U7N A;  1IDS A;  5IYZ B;  4FM0 A;  5KHK A;  1VAR A;  1EN5 A;  4JI7 B;  2DQ0 A;  1MZF A;  4X1K A;  1KMI Z;  2CDY A;  3D3Q A;  3SYQ A;  3LDE A;  3ZN1 A;  3LSU A;  4DV0 B;  4DYL A;  1JMK C;  4LF6 O;  3T2M A;  4H13 B;  2F66 C;  2DJV A;  4QPJ A;  1QR8 A;  3FX7 A;  1QU7 A;  2EIL B;  4X66 O;  3L75 H;  2FL4 A;  4H0L B;  3CCQ V;  3G80 A;  2ITC C;  2EZP A;  3JAK B;  4LNU A;  4X62 O;  4JI0 O;  1XRE A;  1H2L A;  3OGC C;  3FB7 C;  4DR7 O;  5L3D A;  2KG7 B;  1ZTE A;  5K1P A;  3AEI A;  1XNQ B;  1O9G A;  1VQ5 V;  2BOC C;  5LGU A;  2ADP A;  1TVK A;  1F7Y A;  4R50 A;  1NVP B;  3B4S A;  3N2K A;  2LFR A;  4F6E A;  2YC0 A;  1IBK O;  2FB5 A;  5ITZ B;  5IWA O;  2FTK A;  1HR0 O;  2QM4 A;  3TK1 A;  4BIU A;  2EIM B;  2R70 A;  4B7E A;  2Z5U A;  3E89 A;  4GT1 A;  1Q81 W;  4UV9 A;  1OV9 A;  1FD9 A;  1IBM O;  2CH7 B;  2WA3 A;  1SF9 A;  5IYZ A;  2VWJ A;  4YJ2 A;  2H94 A;  2IJI A;  3ETE A;  1WPB A;  3A0R A;  1FXH A;  1YDX A;  3SPJ A;  2G38 A;  3ZMT A;  1DTO A;  4G27 B;  2OIG A;  4LF9 O;  5GW7 A;  3ZHU A;  3ZMU A;  1B04 A;  4FLT A;  3CSX A;  4IT5 A;  4CC5 A;  4JI3 B;  3K5N A;  1I94 O;  1BL8 A;  4DRX A;  3ZRX A;  3B40 A;  5CA0 A;  2F95 B;  3L74 H;  1N36 O;  1IX9 A;  5EYP A;  2PYJ A;  5JH7 A;  2HKO A;  3IC7 A;  3Q4H A;  4D6T H;  1HNZ O;  1VQ8 V;  1M4U A;  1GO3 F;  2D2C B;  4F4L A;  4LC1 A;  3CCS V;  3MHH C;  3K08 A;  2QWO B;  3ICX A;  2VQF O;  1BQZ A;  3OD4 A;  4B3M O;  4K8Z A;  1XNR O;  3EFF K;  3CRQ A;  3A8T A;  1TUB B;  4ICG A;  4YXW G;  2ZE6 A;  3R65 A;  3QVN A;  2H8P C;  5KHI A;  2VQE B;  2LFS A;  4UCU A;  2F4V O;  2DWE C;  2P67 A;  4IGG A;  5KMG B;  1V54 C;  3K3W A;  1YTF D;  1AR4 A;  4O4H A;  4DV1 B;  5CB4 B;  4FLU A;  2KQX A;  3APO A;  2P4K A;  3C3S A;  3KCY A;  4X1K B;  1X59 A;  2ILM A;  4JF3 A;  3ABT A;  1UPG A;  1PKX A;  2EIJ B;  3H1H H;  3K0G A;  2LGW A;  4GLX A;  4TV9 A;  1KB9 F;  1THZ A;  4DV4 B;  5J2T B;  1S5J A;  1L0L H;  5CA0 B;  3ABL B;  3AG1 B;  4PA4 A;  5J2U B;  4EB6 A;  4NR1 A;  4DV6 B;  5CN0 A;  2UXN A;  2P5O A;  5B1A C;  2EZO A;  4LFC B;  2CE4 A;  4UV8 A;  2HJD A;  3UO3 A;  4WFH A;  1KBH A;  4W4K A;  4JPR A;  4GKJ O;  4CS4 A;  1I7F A;  1VQP V;  2JJ1 G;  4UCT A;  1GN3 A;  4JI6 O;  3VQX A;  1OZ0 A;  3P30 A;  4Q6G A;  4HYO A;  3STL C;  4DR2 B;  1E1Q G;  5IYC O;  2B9Z A;  4O4J B;  1FAF A;  2FKX A;  5IY5 C;  2A7W A;  4CC6 A;  1NS1 A;  4J7J A;  2YI9 A;  5KHG A;  2XOK G;  2NR5 A;  2P06 A;  2XAJ A;  4JTD B;  5FNV B;  4UUJ C;  5LMN O;  3JAL A;  2NLJ C;  5KA6 A;  3CCE V;  1PL0 A;  3PJS K;  4YJ3 B;  1M93 A;  1JJO A;  2CTW A;  4ZI7 B;  2YDE A;  2PYL A;  4B3R O;  2F43 G;  3CRR A;  1ZWI C;  1YTF B;  2EIK B;  4KXR A;  1JFF B;  2EIM C;  4KUM A;  3PN1 A;  3AK2 A;  3SPC A;  1NR1 A;  1AVM A;  1EN6 A;  1WPX A;  3DC6 A;  1IXM A;  4JYY A;  5BR8 B;  2Y69 C;  4E2L A;  1URF A;  1NTM H;  3SR2 C;  1CEZ A;  1SZX A;  4CZZ A;  2JEU A;  3T1H O;  3P3P A;  5KUM A;  4ASU G;  5IJ0 A;  3K5O A;  3BA9 A;  1N8R W;  4I9Q A;  1HP8 A;  5KUK A;  1GM7 A;  4UVC A;  4FLV A;  4X65 B;  2E3C A;  4P9O A;  4I0X A;  4J9Z B;  4O4H B;  3T1H B;  3ETQ A;  3U10 A;  1H2N A;  2UUB O;  1KUQ A;  1FJG O;  1IXB A;  1HNX B;  4X66 B;  3OAA G;  4X9Q A;  2QR4 A;  3JD3 A;  3LNM B;  3FYI B;  2HVJ C;  2Q0O C;  3ZRW A;  2UXC B;  3FAV B;  1V55 C;  5JVD B;  2OYQ A;  5J9P C;  4JI2 O;  2WLL B;  1NT2 B;  1KKD A;  3RYF A;  3A0B Z;  4QJF B;  1Y74 B;  1V55 B;  4BAY A;  1XUQ A;  4LF6 B;  5EBL C;  2P6J A;  1Q90 D;  2CTQ A;  1AJP A;  4JI1 B;  1FFT B;  4UVB A;  3GB7 C;  3J81 N;  2GBO A;  1M1K W;  3DGE A;  1H8H G;  4JI8 O;  3ZS8 C;  1R3J C;  2ZCE A;  4IIJ B;  4FZ1 A;  3K9S A;  1R6K A;  1QLN A;  2PF4 E;  4JYB A;  1SRY A;  4BIO A;  1BHA A;  1S3J A;  4DR2 O;  3CC7 V;  4O4J A;  3G6B A;  4UVA A;  1R3I C;  4DR3 O;  4JAS A;  2DWD C;  3K06 A;  2E5L B;  3DXR A;  4ZKI A;  4DV3 B;  4DR5 O;  2OWO A;  2QGN A;  3ASO B;  3JAL B;  5EBW C;  2GUZ B;  3OGI B;  4MVR A;  4G2K A;  4JGS A;  2QM8 A;  2A3Q A;  3L9D A;  3RYI B;  4MVO A;  2B5U A;  1WB7 A;  5JQG B;  1P7G A;  4TT3 G;  1G6U A;  3W7X A;  3OMN B;  3ZIA G;  4FM2 A;  2MW2 B;  3AG3 C;  3TCU A;  1RM1 C;  2W0F C;  3ZRV A;  3AG1 C;  4NTY A;  3VBB A;  3K79 A;  2WAM A;  4DUY O;  3E22 B;  4UXN A;  1MAB G;  3SDL A;  2ZXW C;  2P7T C;  4CH3 A;  1K9M W;  1SC5 B;  4FK5 C;  1GM9 A;  4DR1 B;  4JV5 B;  1G4Y B;  5LHG A;  4CS3 A;  4OX9 B;  2IW5 A;  5LOV B;  2ZIM A;  1VQL V;  2HG5 C;  1L0N H;  2BTO A;  1Q6U A;  2QE7 G;  3W7W A;  1JCH A;  5L3B A;  1R3L C;  5JCO C;  3S3W A;  1WA8 B;  4X1I A;  2ZM6 O;  1SQG A;  2BCC H;  3RGB A;  4LF7 B;  4DR4 B;  2DN9 A;  4B3M B;  2IJJ A;  1YEW A;  4AHC A;  1VF6 A;  3K5L A;  2Q6A A;  4HNA A;  1MSW D;  1CP9 A;  4I0X B;  1M5I A;  2EIK C;  5B3S C;  1KU9 A;  2BOB C;  5L3E A;  3A2F A;  4EEQ A;  3E8G A;  2F4V B;  5JQG A;  4K0K B;  1KEC A;  2UUA O;  2UXB B;  4EFE A;  5FPO A;  4B3R B;  4RO2 A;  4U3J B;  4UCS A;  3ZRS A;  2XT9 A;  3ZMZ A;  1VQ9 V;  2ZDI A;  3O65 A;  3JAM N;  4FFK A;  1FXK A;  1Q5O A;  3ZBH A;  2ZE5 A;  2CUG A;  4QPK A;  5C8Y A;  3HKC B;  2JIZ G;  4LCU C;  3RN4 A;  3IAY A;  1IBM B;  1IBL O;  4ZHQ A;  4D7T A;  5LMN B;  2UXD B;  4ABM A;  4YJ3 A;  2QWQ B;  4X89 A;  2V1D A;  4X1I B;  3AG3 B;  5BXZ A;  3TXQ A;  3C90 A;  4B3T O;  2YXY A;  2EJR A;  2B1I A;  3QO8 A;  4FLY A;  1MSD A;  3OTF A;  1W0J G;  3H01 A;  1QQC A;  1BMF G;  2UUA B;  2UXB O;  5EIB D;  1BQ0 A;  1H2K A;  5KMG A;  3B77 A;  2PTM A;  3W7U A;  1FFX A;  1HR0 B;  5IWA B;  3FKS G;  3JD2 A;  4GZR B;  2DYR C;  2HFE C;  3E8F A;  3GVM A;  4NYK A;  5IJ0 B;  3JAK A;  1O9H A;  4LF7 O;  2W0X A;  1YJ9 V;  1GRJ A;  3NXS A;  4DR7 B;  3AG4 C;  4GX2 A;  2RQ6 A;  1PP9 H;  4J80 A;  1WP8 A;  4TSF G;  1K3E A;  3WG7 B;  3T4Z A;  4KHP B;  3HKD B;  3I5D A;  2EIN B;  4DXW A;  4NVP A;  2VQE O;  3T1Y O;  4BIZ A;  5BMV A;  2VRZ A;  1VQ4 V;  5DM6 V;  2Y48 A;  2YI8 A;  1AR5 A;  4WFG A;  4MW3 A;  1QBZ A;  2QWP B;  1W59 A;  3JD0 A;  4QGP A;  5FNV A;  4JI7 O;  1PPJ H;  3LSS A;  3RYC A;  2DOS A;  4LH6 A;  2Q7H A;  4JV5 O;  1QNM A;  1N33 B;  5JH7 B;  4H37 A;  1K5S A;  2UU9 B;  5DED A;  2NNU A;  2ZXW B;  1NH2 D;  1SKV A;  5IYD O;  1K97 A;  1NTZ H;  3J80 N;  4JAA A;  4QIW F;  5A9G A;  3I56 V;  1WLE A;  1DF4 A;  3SGI A;  4LP8 A;  3OM3 B;  4O4L A;  1NZ6 A;  3CMA V;  2CK3 G;  4BR6 A;  2YEV B;  1HW7 A;  4O2B B;  4PA7 A;  2IM9 A;  4OPA A;  1SER A;  4LWS A;  3B09 A;  4O2A B;  4NXM O;  3SYP A;  1ZL8 A;  4DR3 B;  3AK1 A;  5B1N A;  2LW7 A;  1JJ2 U;  4NTW A;  4X64 B;  2LO1 A;  2OIE A;  1JX9 A;  3ZHV A;  3T4D A;  4DK0 A;  3BPZ A;  2DYR B;  1RFY A;  3JAS B;  3LUT B;  5B1B C;  2Q68 A;  3B8N A;  1R1B A;  4RWU A;  4N23 A;  1LUV A;  1AI5 A;  1D5N A;  4ZOL B;  3B8M A;  2ZDI C;  4GKK B;  2UXC O;  1VIB A;  5LA6 A;  1UFI A;  1GKF A;  2WLI A;  1AP6 A;  3FB8 C;  3C3T A;  1H2S B;  1Q86 W;  4LF5 O;  1VF6 C;  3SPI A;  2YUA A;  1Y76 A;  4LFA O;  1KYO F;  2AGA A;  4RAI A;  2LGQ A;  1HNX O;  4J41 A;  2HR3 A;  4F6R A;  1D5A A;  1KD1 W;  3OMA B;  1XEQ A;  4JTA B;  1ARO P;  3EVK A;  4JI4 B;  1ZAU A;  4J7Z A;  5B66 Z;  4WCE V;  4AQY O;  2ARH A;  4IYH A;  3ZHT A;  3ZMS A;  1PNL A;  2N74 A;  2BTQ B;  3JAT B;  2RMK B;  1H2M A;  3M7M X;  4UB8 Z;  3SPG A;  2QDO A;  3KKY A;  3BEH A;  1BS3 A;  2RDC A;  3IGA C;  1NTK H;  1YXB A;  4LF9 B;  4QE7 A;  3M8A A;  4MTF A;  3LDD A;  5IJ9 B;  1JFF A;  2NN4 A;  4JYA B;  1HWY A;  3DC5 A;  3CCL V;  3ABK B;  3CCR V;  1F51 A;  4U3F H;  1B6Q A;  3VQY A;  1AIL A;  2XAG A;  1B3Q A;  3E86 A;  1MOF A;  2W6I G;  4EB6 B;  2WLM A;  4QNH B;  3KG2 A;  5C8Y B;  1XHZ A;  1S72 V;  4C7U A;  4CBC A;  1XL6 A;  4WF9 V;  2R9A A;  3DXR B;  3WB0 A;  3F5T A;  2KSD A;  2JGU A;  4GYC B;  2QKS A;  4F6R B;  1ZUQ A;  3SJQ C;  2UU9 O;  3H1K H;  3SJC C;  3CB2 A;  4RQF A;  4DV6 O;  1VEW A;  5ITZ A;  5EZY A;  3H1L H;  1Y74 A;  1N4C A;  1GN6 A;  3RBZ A;  1OCR C;  3UT5 A;  4JI0 B;  1H8E G;  1GAX A;  3K9A A;  2HJF C;  3K59 A;  3UCS C;  4GKJ B;  4E4E A;  4DUZ B;  4DR6 B;  5J2T A;  3UQ8 A;  3WB2 A;  3ZHS A;  3T1C A;  1F4M A;  4NB5 A;  4EFB A;  3JAW A;  3SPH A;  4FJC C;  3P3N A;  3O9O A;  5LMU B;  2Q7G A;  4DV4 O;  1I5Y A;  2ZIN A;  4LNU B;  1YSC A;  1VQK V;  2WLN A;  5FPR A;  1ZLZ A;  2XAH A;  2IH3 C;  1DGS A;  1R3K C;  2HEP A;  2JGD B;  5BZB A;  4DV1 O;  1KC8 W;  2YID A;  3SYO A;  5LMU O;  5BMV B;  2ZR3 A;  1JA8 A;  1Y4M A;  3D36 C;  4MT8 A;  3ZHR A;  3N2G A;  5H2F Z;  1BHB A;  4PDR A;  4A5U B;  5KHJ A;  4GUN A;  2WLK A;  2UXD O;  2A9H A;  1JR9 A;  4FM1 A;  5H5N A;  1RPR A;  1K33 A;  1XBL A;  4X20 A;  4J10 A;  4LF8 O;  2GTA A;  3JD1 A;  1RPO A;  1I08 A;  3CEI A;  1FFX B;  5KA5 A;  4GX1 A;  1KP3 A;  1M57 B;  4PDM A;  2QWR B;  1X4T A;  1AI4 A;  5E1A C;  3JSN A;  2N05 A;  4P2Z A;  2X6C A;  2JS3 A;  3CE2 A;  5IY5 B;  4K0K O;  2M7W A;  4DV2 O;  1I94 B;  3JAT A;  2PI4 A;  3F7V C;  1NR7 A;  1NH2 B;  1K4D C;  3CCU V;  1JOY A;  1VMG A;  3ZRW B;  3CP1 A;  1CPY A;  1R6T A;  3CHX A;  1UJW B;  1ZSP A;  4IIJ A;  3BFR A;  2D3O W;  3L73 H;  1MG1 A;  1PD3 A;  1XHX A;  1JPX A;  1QLE B;  1WA8 A;  1OCC B;  4JI2 B;  2FYU H;  3HKD A;  4CH6 A;  1XI1 A;  3RFR A;  3D8C A;  3WB1 A;  4WBN B;  4KP4 A;  1IUR A;  2ATK C;  2ZR2 A;  3THO A;  3CD6 V;  5A2Q N;  2QTO A;  1GTO A;  2YIB D;  4I4T A;  5LYJ B;  3B2E E;  1XNQ O;  5B1A B;  2GHY A;  4JI4 O;  3R66 A;  2YXH A;  3CYO A;  2IJK A;  1YZB A;  3LNN A;  2YS8 A;  3ZCC A;  3ABU A;  4MTG A;  2AHY A;  3TET A;  2Q8V A;  3OUS A;  3F5W C;  4LFB B;  4LF5 B;  4GKK O;  3ASN B;  2Q4P A;  1L8D A;  2QA4 V;  3OW2 U;  4DR1 O;  2F1M A;  1VQM V;  1M56 B;  4YY3 B;  2YXL A;  1TVK B;  4MVS A;  3ASO C;  4MW8 A;  2Z3Y A;  5LP6 A;  3RYI A;  3IFX A;  3QTC A;  1E79 G;  5E79 Z;  1A32 A;  2X6B A;  1NI8 A;  3G6E V;  3H1I H;  3H9V A;  1OCR B;  4OPH A;  2WA4 A;  4J11 A;  1YCI A;  4WFE A;  5IDJ A;  4K35 A;  1FXK C;  4I4T B;  5LYJ A;  3W7S A;  4DV0 O;  5LL6 Y;  3JD4 A;  4R7C A;  1EZJ A;  3RVY A;  1Q82 W;  3HKB A;  1XOU A;  1LR1 A;  4JYC A;  4DUZ O;  4DR6 O;  4LBE C;  2K9P A;  4YIO A;  5K1X A;  4Z1M G;  2AW9 A;  2ZE8 A;  4J42 A;  1GK9 A;  3JCZ A;  2P90 A;  4I9W A;  5GON A;  1VQ7 V;  3SJB C;  3ML0 A;  3FB5 C;  3OUF A;  3CXC U;  3ZHQ A;  1FPO A;  2AHZ A;  5B5E Z;  4O4I A;  4YHH O;  1BT8 A;  4YJ2 B;  4PJ0 Z;  4LF4 O;  2DMX A;  2ZD9 A;  3CRM A;  5EYP B;  5H9C A;  3ASN C;  4I55 A;  1S77 D;  1T5E A;  1Q6I A;  4NXM B;  5D5P A;  3JAR B;  1XMQ O;  4JI5 O;  2BSK B;  2H3O A;  2WPD G;  2ZE7 A;  4HAM A;  2EJ7 A;  3E2E A;  3OMI B;  2DQ3 A;  3ABL C;  4LWS B;  2QEX V;  3RYH B;  2ZNJ A;  1K34 A;  3CJH B;  4DRX B;  4MS2 A;  4FIP C;  4MVZ A;  2Q67 A;  4PDV A;  3CS5 A;  1W2B U;  3RYC B;  1YI2 V;  2CGN A;  2N04 A;  3CX5 F;  1FXK B;  4LR3 A;  3ZMV A;  1K8A W;  1Z5W A;  3K57 A;  4FLW A;  1P7B A;  3BA8 A;  2YIC A;  2IH1 C;  5GON B;  1PNM A;  3OEH G;  2L35 A;  5LGT A;  2KG7 A;  3RWR D;  4TV9 B;  1ROP A;  1XL4 A;  4PEL A;  1AI7 A;  1SET A;  3HKB B;  2RNB A;  1N34 O;  3K03 A;  1F4N A;  4AI8 A;  1VQN V;  1SZT A;  2ADQ B;  4HZ3 A;  4FPP A;  4CH5 A;  1M57 C;  4XDL A;  1OCO C;  1Y76 B;  1ENV A;  2GTS A;  1SA0 B;  3CJH A;  4X65 O;  1PNK A;  5KHH A;  2GUZ A;  2QTS A;  3MDS A;  3JAW B;  4XDJ A;  1XIL A;  5KAI Z;  1YIT V;  4EKW A;  5HFM A;  2JEX A;  4FVM A;  1DF5 A;  5AG2 A;  2XUM A;  2EIJ C;  4JZ2 A;  3OFN G;  2CGO A;  4B3T B;  4UCR A;  1G1X B;  1RSO A;  2XHB A;  4MSW C;  1R6N A;  4MVQ A;  1GN4 A;  4UCO A;  4DK1 A;  1QLE C;  5F2V O;  3MD0 A;  1SQF A;  4MTX A;  2CTR A;  5DEC A;  4AIL C;  1IBL B;  3NR7 A;  3ZJZ A;  2ZNI A;  1OHH G;  2ZT9 B;  1JQ0 A;  3Q4H B;  1N32 O;  5IJ9 A;  3L72 H;  2QSA A;  5BR8 O;  1P4R A;  4UB6 Z;  1MA1 A;  1EZV H;  3WG7 C;  4X1Y A;  3BAB A;  5B1O A;  2A0L A;  5GTI Z;  5EBM C;  3A0H Z;  3OT7 A;  4ZHQ B;  5KLV H;  3BCC H;  2P22 C;  2AZ0 A;  1HDJ A;  3LSQ A;  4O4I B;  3VOU A;  3K04 A;  2A06 H;  2ZM6 B;  1S5H C;  1U97 A;  2E75 B;  4LFC O;  3RW0 A;  2Q0A A;  2BTQ A;  4B08 A;  1K92 A;  3KCX A;  3N2G B;  4DW0 A;  1VF7 A;  5KX5 A;  1B06 A;  2F23 A;  3ABK C;  4X62 B;  2M6Y A;  4K8X A;  3QF7 A;  3OTO O;  2HLD G;  5CB4 A;  5J2U A;  1OCO B;  3RYF B;  4I50 A;  2KKW A;  2Q9L A;  2QJ1 A;  5FLX N;  4Q20 A;  3CCJ V;  2X6A A;  1VF5 B;  5JCO A;  2QKC A;  3QO5 A;  1EM1 A;  1SQV H;  3X2Q B;  4J9Y B;  5LP6 C;  4KHP O;  5CBF A;  2GSM B;  5L3C A;  3W7T A;  1I5X A;  2BE3 A;  3SYA A;  1IZ3 A;  5LP6 B;  4BW5 A;  1US6 A;  3U11 A;  2KB1 A;  2IJH A;  1ORQ C;  1MMM A;  2YSU B;  4BWA A;  1FYJ A;  2HHH O;  4MTO A;  2PUS A;  2Q7E A;  1SQQ H;  3JAS A;  3L70 H;  3CME V;  4X8A A;  3M99 B;  3IC9 A;  4PV1 B;  5LXT A;  1M9N A;  1E1R G;  1ZL8 B;  4DV3 O;  4DR5 B;  4UFZ A;  4NXN O;  1U96 A;  1S5L Z;  3LDC A;  4PI0 A;  1RM1 B;  4R8C A;  4JI5 B;  1XMQ B;  2K1E A;  3DTU B;  4ZIB A;  4Z1V A;  2CTP A;  4ZBM A;  4PD4 F;  5L3F A;  3FYE B;  2B1G A;  1XNR B;  3JCU Z;  3S3X A;  4R6Z A;  3U0Z A;  3CCM V;  1KQS U;  3G67 A;  5EC1 C;  2R72 A;  3G4S V;  4Z2W A;  2Q5Z A;  1XMO B;  3UO2 A;  2LQT A;  3SYC A;  5LXT B;  2UUC B;  3H1J H;  4GCZ A;  1GH6 A;  3AG2 B;  5DN6 G;  5JJE B;  1QR9 A;  4YHH B;  5L3G A;  1DK1 A;  2JRI A;  4KL1 A;  2EBO A;  2WWW A;  2W6J G;  3F7Y C;  2LJ2 A;  5JJJ B;  2XAF A;  2GDS A;  4I7Z B;  2EIN C;  2Y4U A;  2ZKO A;  4U3J A;  1VP7 A;  3G71 V;  1JVM A;  3P32 A;  2OT5 A;  3EHB B;  1WNS A;  2EUL A;  3ZN0 A;  1NQT A;  5H6R A;  3AG7 A;  4O4L B;  4JYA O;  4W4L A;  1VQ6 V;  3CRA A;  5JJN B;  5IYB O;  1V54 B;  2CAZ C;  5LOV A;  2V4D A;  3T1Y B;  5CA3 A;  1K73 W;  3AK3 A;  1K5Q A;  2O57 A;  3E22 A;  1SA0 A;  2WLJ A;  4L87 A;  3CPW U;  5FL7 G;  4FZ0 A;  2VS0 A;  3ABM C;  3HKE B;  1FJG B;  1IBK B;  1TUB A;  2DE0 X;  3X2Q C;  4AQY B;  4G28 B;  5BY1 A;  4I5S A;  5LA6 B;  4DR4 O;  1SES A;  4IHJ A;  3TJT A;  1G8M A;  1BE3 H;  4YIP A;  4LFA B;  5IT9 N;  1I0H A;  2PGG A;  1NKD A;  2PZS A;  1WAZ A;  2RCV A; 
#chains in the Genus database with same CATH homology
 2VS0 A;  1WA8 B;  3TXQ A;  3G80 A;  3O9O A;  2DE0 X;  3ZBH A;  2B9Z A;  3Q4H B;  3FD9 A;  3TXS A;  3Q4H A;  2VRZ A;  3HR0 A;  2KG7 B;  2AZ2 A;  2KG7 A;  4LWS B;  4LWS A;  3FAV A;  3FAV B;  4GZR B;  2AZ0 A;  4ABM A;  3GWK C;  4I0X B;  4I0X A;  3OGI B;  3GVM A;  1WA8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...