2AZ0A

Flock house virus b2-dsrna complex (p212121)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
total genus 23
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az0A00
3GVMA 1WA8A 2DE0X 3HR0A 3Q4HA 1WA8B 3FAVA 3Q4HB 3GWKC 2AZ2A 2B9ZA 2VS0A 3FAVB 4GZRB 3TXSA 3G80A 3OGIB 2KG7A 4LWSA 3TXQA 3O9OA 3ZBHA 2VRZA 2AZ0A 4I0XA 3FD9A 2KG7B 4ABMA 4LWSB 4I0XB
chains in the Genus database with same CATH superfamily
2PYJA 3ZRVA 1NVPD 3F5WC 3NR7A 4FVMA 2VWJA 4FM1A 2JK5C 3L9DA 5BMVB 2HJDA 3ZBHA 1XBLA 4LNUB 5JVDB 1DF5A 1L0NH 3OM3B 5BY1A 2UXCO 1MSWD 2H3OA 3H1HH 4JI4B 2HKOA 2R9AA 3ABLC 1Y6XA 5KHIA 1S0VA 2IBZH 1V54C 5J9PC 1ORQC 3N27A 3D3QA 4NXMB 3S3WA 3RW0A 2IJHA 1P84F 2EIJB 3K0GA 4J7KA 2DMXA 2JEXA 1IBKB 2FTKA 2QWPB 3OMNB 3DSQA 2ZCEA 4Z1VA 4JTAB 2JVDA 4LFBO 4WFBV 2JRIA 4DR6B 1O9HA 2LGWA 3Q4HB 2Y4TA 2KKWA 2XAFA 3IC7A 2Y69C 4B3TO 3A0BZ 2VQEB 1SQPH 2JJ1G 4DV7O 3ABTA 4KHPO 1RM1C 3KZIZ 4B3MB 1B06A 1DF4A 1GM9A 4DR2B 1FXHA 3ASNC 4O2BB 4CC6A 1VQPV 3N2KA 2H94A 3OR7C 5E1AC 5LGUA 2ZXWC 4RQEA 4DV5B 2PI5A 1M4UA 3K79A 1KU9A 3CRAA 5L3EA 4WFFA 1BCCH 3SYCA 4DR7O 1V55C 1HNXO 2EBOA 1QLNA 1HR0O 4FFKA 2PGGA 4P2ZA 4HNAB 5CA0A 4MVOA 1SQBH 1N0NA 4YJ2B 3O65A 5IYZB 4W4KA 3IJ4A 2E3CA 4GYCB 1YXBA 5KMGA 1HNWO 3ZJZA 5B3SB 1DLBA 1K34A 3K5NA 2EILB 2EJ7A 1S72V 2CAZC 2UXDB 1O9GA 3SR2C 3L75H 1KC8W 1MABG 4K35A 1F51A 3QNEA 2FB5A 4PI2A 3ZCCA 3BCCH 5KX5B 4TSFG 2CTRA 5KUMA 2GUZA 4MSWC 3OW2U 1Y74A 1H2GA 4P30A 2A3QA 2Q6AA 5EBWC 1XL4A 3WFVA 1ZL8A 1B3QA 1XUQA 4QPKA 1GMGA 3UT5A 1SESA 1OCRB 2UXXA 1BE3H 3U0ZA 1ZSPA 3I56V 1XL6A 1JFFB 2XAHA 2GBOA 2YUAA 4I5SA 3RYIB 1PNMA 3E22A 2VQFB 3CPWU 3CCSV 1TVKA 3OTOO 2OTJV 4GZRB 5FPRA 4J10A 2F93B 5JCOC 4WF9V 2ITCC 2XAJA 1WLEA 3JASA 3L71H 1P4RA 4X1IB 4UVBA 3LUTB 1RSOA 2P6JA 4TWKA 4DW0A 2QKCA 4TV9B 4I4TB 1SQVH 3FB5C 2W6IG 3B2EE 3SGIA 3TXSA 5D5PA 3K5MA 3RYHA 4DV6B 4FPPA 2OTLV 1IURA 1QHTA 4NXNB 2RQ6A 2LGQA 2EIKC 1YVWA 2RDCA 5C8YB 3N2GA 4JYCA 1QLEC 4LF7O 4ZBMA 4EB6B 2E75B 2VRZA 1I94O 1ZWIC 3QTCA 3ZHQA 1KB9F 2F4VO 5JQGB 1M93A 1KUQA 2MW2B 5LMNB 2LFSA 4MTFA 3F5TA 4NVPA 3C90A 4NB5A 3SPGA 1IXBA 1GM7A 4U3FH 2Y0IA 4RUEA 3B8MA 4OPHA 1K4DC 3CS5A 2BE3A 4ZHQB 4H37A 4G28B 3H9VA 3OMIB 3K5OA 4DO2A 2HLDG 4QJFB 4DR5O 3AG4B 2XASA 2YEVA 3ZRWB 4Z2WA 1GM8A 1NT2B 4RQFA 1VF7A 2X0LA 4BIOA 3K5LA 1YIJV 4U3JA 3AEIA 5A9GA 4U7NA 1AR1B 1CEZA 1Q6IA 1Q43A 3P3PA 1CPYA 4MW3A 4WFAV 2HP8A 1SQQH 1R6KA 2QDOA 1HNZO 4O4HA 4DV2B 3LNMB 1SRYA 1D5AA 1Z5VA 2QWNB 1Y67A 1XMOB 3IGAC 2QM7A 4FLWA 1YF2A 1GH6A 3TK1A 1VQNV 1S77D 1WAZA 1TGOA 2GTSA 5LHGA 2H8PC 1PV0A 1N0JA 5IYCO 4O4IA 1NQTA 3SPCA 5LP6C 5KA5A 2E5LB 2N05A 1HP8A 2G38A 1KECA 3J80N 3ZIAG 3ICXA 4B3RO 5HFMA 2OIEA 3WB1A 1PM9A 4H33A 2CGNA 4GKJO 3HKDA 1PKXA 1COWG 2DWDC 2WWWA 3CEIA 3JATA 3ZMTA 4FZ0A 2EIMB 4WBNB 5IJ0A 2NN4A 3T1HO 4JZGA 1P49A 1SQFA 3E89A 1YDXA 1KD1W 5JWPA 5KUKA 4LNUA 1JOYA 5L3DA 4H44B 3TXQA 1OCZB 2K9PA 4WFEA 1R3KC 4LFCO 5BXZA 5KHKA 4A5UB 1MZEA 3QF7A 1JPXA 4B08A 4QE9A 4B3SO 3A8TA 5KAFZ 4KFMA 3CCUV 1MA1A 1VF5B 1AR5A 1YITV 5HFLA 1J5EO 4AI8A 3D8CA 1YEWA 4CZZA 2GHYA 2WLJA 2FYUH 4EKWA 1NVPB 1Q82W 4GKKO 5J2UA 3CCJV 1NU1H 4JV5O 4ZOLA 1BQ0A 2P5OA 1PPJH 3O9OA 1M57B 1BQZA 4JI3O 5E79Z 2HHHO 4O2BA 2A7WA 1WB8A 2ZR3A 2DYSB 1HWYA 2AHYA 1H2KA 4LF5B 1GN2A 4IT5A 2UUCO 1OCCB 1N36B 2A79B 3TGUH 4AHCA 4QNHB 3T1HB 4X8AA 5IY5B 2IJKA 1BL8A 3T1YO 5B1BC 2EIJC 3L70H 1IBLO 3WG7B 1M9NA 2P4KA 1M1KW 3K3WA 1W0KG 1K33A 3RWRD 1KYOF 2JIZG 3CB2A 3CCEV 4DRXA 3JAKA 3OUFA 5A2QN 3CCMV 2CTQA 4YJ3A 1H2LA 3ZHTA 2ZQMA 2EZOA 3LSQA 3ZN1A 3OT7A 4NYKA 5LA6A 3FB8C 1KP3A 4X66O 3ZHUA 1Y66A 2ILMA 4PA7A 4OX9O 1VMGA 3P3NA 1FJGB 1JJ2U 5JJEB 3HPLC 1PL4A 2V1DA 3W7WA 3JCUZ 3RYCA 3AG3B 4P9PA 4KUMA 2D2CB 2YIBA 1L1FA 3UKMA 2BSKB 1Q6HA 4X1YA 2P7TC 4UV9A 2EINB 1I0HA 4IIJB 1IZ3A 4JI2B 4JI4O 1RFYA 4MVZA 3OFNG 4X20B 1AP6A 5IJ9A 2F95B 5TISZ 2DQ0A 4NXMO 5BR8B 1H8HG 4O2AA 1IBKO 1KMIZ 2Q0AA 3BPZA 5EK0A 5FNVB 4J42A 1IX9A 3E8GA 5B3SC 2EILC 1AP5A 3JD0A 2ADQB 4H0LB 1AJPA 5B5EZ 2ZE6A 2WPDG 4TOIA 2Q9LA 4DR6O 2ZNJA 3CC4V 1SA0B 1EZJA 4CBCA 4O4JA 4N23A 4DYLA 2VQEO 4HAMA 1R3LC 2KSDA 4ZI7B 5DM6V 3G80A 1IDSA 4B3MO 2CTWA 2IH1C 1WN7A 4DR2O 2NR5A 4I55B 4O4LB 1R3IC 1F4NA 5ITZA 1OCRC 2RN9A 4DV5O 3M7MX 2HFEC 2IM9A 3MDSA 1K97A 4JI5B 4GCZA 3GWKC 4QE7A 4MW8A 4ZIBA 2OCCB 2YIAA 3ASOB 2R70A 5DECA 3B77A 4JAUA 4UVCA 3THOA 4JYYA 4I0XA 3AG2B 4X62B 4CH4A 1XNQB 2W0FC 4PDRA 2JDIG 4D7SA 4FLUA 3FFQA 4X64O 1XI1A 2N74A 4JTDB 3SJAC 2QEXV 3RVYA 5JH7B 1YTFB 3ZHVA 2NLJC 2QKAA 3TJTA 3ZMVA 2UXDO 1CP9A 4UV8A 3ZRWA 4KXRA 4J11A 4IHJB 1LR1A 4PJ0Z 1UJWB 4H13B 2ADPA 1I08A 2UUAO 3TETA 4MTOA 3D3IA 2KQXA 4FFBA 2IJJA 5B1AB 3ZMZA 3OUSA 4LR3A 4TQDA 2DW4A 1Q90D 4LP8A 3B40A 4MVRA 3G4SV 1QVFU 3SYQA 2DJVA 3HKBA 2LO1A 4GX0A 1K5SA 2GDSA 1X59A 2O57A 2YICA 1SQGA 5LXTB 3SYAA 1K7DA 5LHHA 2QR4A 3K9SA 2VQFO 4G2KA 1E1QG 2A9HA 2DYRB 2ZIMA 2Y0PA 1DGSA 1Q86W 4TV8A 3T2MA 1I7FA 3CRQA 3FAVB 2YIDA 1FFXB 2ZD9A 3OGIB 1MNGA 4P9OA 5CBFA 5K1PA 4U7OA 4WFHA 2XAGA 2MK3A 1FXKB 4RUFA 3IC9A 2ZNIA 2HG5C 1LUWA 2JS3A 4DR4O 4X64B 4GT1A 3JAWA 1A32A 5JCOA 2Q68A 4DV6O 3B09A 3RYFB 4JI1B 1FPOA 3CJHB 2ZE8A 3H1LH 4YY3B 4NXNO 5LYJB 4EFBA 4RWUA 2BTQB 2CGOA 3WU2Z 3W7UA 5LOVB 4UCOA 1QCEA 2UUAB 3CMAV 1D2DA 1AJQA 1GAXA 2EJRA 4LWSA 2R9RB 2KG7B 1H8EG 4JI6B 3K0DA 1US6A 2ZM6B 1XHXA 2JGUA 5LMNO 3GVMA 2Z0AA 2N04A 4DUZB 5CB4B 1LUVA 2WLIA 1R6NA 4DUYB 4XBFA 5JJJB 3F7VC 2FMLA 1VF6A 2Q7GA 2UUBO 5GONA 3G71V 2IU0A 1NH2D 4XDJA 1ZUQA 2UU9B 4I50B 5H6QA 4UCSA 4FLXA 1XDCA 1B6QA 4RO2A 1AILA 4Z1MG 4UFZA 1YZBA 2F1MA 3K06A 5EZYB 2Z3YA 4IGGA 4CH3A 1SETA 2EIMC 3ETDA 1EFRG 1N4CA 2EULA 4MTGA 1M90W 3HKCA 3DTUB 3PJSK 4F6RB 4DR4B 1PD3A 2WLHA 2L6LA 4JYAB 2YI8A 3JARB 4K0KB 1OCZC 5H5NA 4JZ2A 4DV2O 2BOBC 4MVSA 5LGTA 4BAYA 4CC5A 2Y4UA 3APQA 5KHGA 2OT5A 3E83A 4PA3A 1VQ8V 1XMOO 1VQ6V 3W7TA 3VQYA 2YS8A 3CMEV 3DGEA 3F7YC 4JYBA 2JGDA 4N21A 5J2TB 3DXRA 4X9QA 2CE4A 1YJNV 5CA1A 1Y76A 4FK5C 3CC7V 1VF6C 1JVMA 3J7AU 3K59A 4F6EA 2QSAA 1FKAO 2E5LO 2YXHA 3AK3A 1VQ4V 1THZA 3FX7A 3ZMSA 4LBEC 1H2SB 3QO8A 2AW9A 5JJNB 3E8BA 1Q6UA 1D5NA 1YI2V 2UUBB 1VQLV 3OD4A 5LP6A 3L73H 4ASUG 1F4MA 1M57C 2Q73A 1YCIA 2XUMA 3JALA 2CH7A 2DYSC 3EVKA 5B1NA 3HR0A 4YXWG 5CBHA 1OCCC 1KBHA 3HKEA 4J9YB 3AG7A 2UXBB 1JR9A 1XOUA 3B4SA 5IY5C 3WB2A 2W0XA 4JGSA 4X20A 3WG7C 3KG2A 4AQYB 1UFIA 1EBOA 5IWAB 5EYPA 3K03A 1S76D 2DOSA 1JX9A 4LF8B 1OJHA 3QO7A 3BA9A 3SYOA 1U97A 5LHIA 1ZTEA 1WJZA 4FLYA 2WAMA 1WA8A 4TUYA 4WFGA 1RPOA 1KQSU 4E2LA 3AG1B 4LH6A 4DR3B 3AG3C 2RMKB 2YIBD 3B8NA 3W7XA 3CRMA 1QU7A 5EIBC 4X1KA 1GKFA 1VQMV 4LF5O 4R8CA 2EINC 1NR1A 2FL4A 2WLNA 1N36O 3ABKB 2AGAA 4EFEA 5CA0B 1SZXA 3IAYA 4QPJA 5BMVA 1OHHG 2ZR2A 4LC1A 5F2VO 4DXWA 1V9PA 3KCXA 2YI9A 4UCRA 5JVDA 3BY6A 5KMGB 1MZFA 2AZ0A 1GN6A 2WA4A 3CXHF 1ZLZA 4PDMA 3I5DA 5BZBA 4OGQB 1TA8A 2WLMA 4B7KA 4F4LA 1BMFG 3QG5A 1NJIW 1Q3EA 1ENVA 4I9WA 1N33B 3J81N 5FPOA 1KP2A 2PTMA 3DC6A 3CXCU 3H1KH 2BCCH 1FJGO 2L35A 1Y74B 2ZT9B 2V7QG 1AI4A 1Z2GA 1ZL8B 3UT5B 4UB8Z 3P32A 2QWOB 3FYEB 3Q4HA 2QE7G 2P90A 3CRCA 4ICGA 1VQKV 4UCUA 2E76B 3CC2V 3E22B 4JAVA 2CUGA 1FXVA 1TVKB 4JI2O 2OCCC 3ASOC 1NS1A 2X6BA 5LXTA 5LL6Y 1XNRB 3EFFK 2HEPA 1XHZA 4JPRA 3R65A 1HW7A 3AG2C 4JI7O 3OTFA 4UUJC 3JASB 5BR8O 3K58A 2F23A 4R6ZA 1FD9A 2ATKC 1IBMB 5AG2A 3ML0A 2IH3C 1RSOB 4PDVA 2AZ2A 4FM0A 1JJOA 2HVJC 2DQ3A 4L8JA 1S5JA 3BRCA 1TUEB 2QTOA 3CX5F 4GLXA 3SJBC 5LBQA 4DV4B 3ETQA 3FD9A 4HNAA 1QBZA 3RYHB 4YJ2A 4X65B 5IYZA 1BGYH 5H9CA 4PHZA 3R66A 1HDJA 1DK1A 1PP9H 2C2AA 1G8MA 1PL0A 1JCHA 1WNSA 4Q6GA 3N2GB 4JI0O 5GTHZ 2QGNA 1AI6A 4MVUA 1QVGU 3VBBA 2NNUA 5KHHA 3GB7C 4LF9B 5KX5A 1SC5B 2R9IA 3JD4A 4JI5O 2D3OW 3FKSG 1ROPA 1T5EA 5CN0A 2DYRC 1EN5A 4X62O 1XNQO 3APOA 4PV1B 2Q4PA 1JFFA 3ZHRA 3CCRV 2LQTA 4K3AA 1AI7A 1FXKC 3RYIA 4DV3B 3KKYA 3VQWA 2ZDIC 4IYHA 4JI7B 5EBMC 2YEVB 3T1CA 2WLLB 4JTCB 1EM1A 3X2QB 1URFA 4YIPA 4J9ZB 4FLZA 3M8AA 3UCSC 3ZX6A 2CK3G 4X1IA 2PUSA 2ZE5A 2PI4A 3BA8A 4TV9A 3VOUA 4I4TA 2XHBA 4GX2A 4O4HB 1E1RG 2R72A 1JMKC 4LFAB 3CP1A 1GK9A 3UQ8A 2XT9A 2VWKA 3GWOA 2ETNA 2P67A 1QR9A 2K1EA 3K08A 4JI0B 4J80A 1R6TA 1H2NA 4LF4B 1MMMA 2BOCC 2WLKA 4NKGB 1EN6A 5C8YA 4O4IB 1FFTB 2ZKOA 3RN4A 4EB6A 4DW1A 4DV1O 4JASA 4PI0A 5CMUA 1VIBA 3JSLA 1M56B 1NH2B 5JQGA 3SJQC 3OEEG 3HKDB 1XQ8A 1R73A 3JD2A 3UO2A 2LW7A 3JATB 1TAEA 1GTOA 1K4CC 4Q20A 2XTAA 5IJ0B 1NZ6A 4DV0B 4ZHQA 1DTOA 2HJFC 3EHBB 1E79G 4JI1O 2HVKC 2PYLA 4YY3O 3D36C 3H1JH 2FKXA 4KL1A 4B7EA 5B1OA 5GTIZ 1IXMA 4DK0A 2KB1A 5B1BB 4QGPA 1XREA 3JD3A 5K1XA 2QWRB 2RNBA 3CCVV 3RBZA 3MHHC 4JI6O 2B1GA 2ZM6O 2P4VA 1WPXA 4DUZO 1N34B 1Q5OA 2QKSA 4DUYO 4CS2A 4BIUA 3CRRA 4BWAA 4CS3A 3NXSA 4MTXA 3ETGA 5J2UB 5L3CA 2Q0OC 1NKDA 5IDJA 2V4DA 4ZOLB 1N32B 1SF9A 2UU9O 3ABUA 4YHHB 4DR1B 1BHAA 4DV1B 3BVOA 3U10A 4LF6B 1SQXH 3BEHA 4NTXA 5LGNA 3QVNA 2GSMB 3JAMN 5FLXN 3AG4C 1M5IA 5L3GA 1YJWV 1G6UA 5EIBD 1GN4A 1BT8A 4JYAO 1NR7A 3E86A 4QIWF 3W7SA 4OXSA 4K0KO 4ZKIA 1W2BU 2CTPA 1XILA 4WBNA 2YXYA 4PD4F 2UXCB 5GW7A 4I7ZB 3C3TA 4TT3G 2XNDG 4GX1A 1W0JG 4DRXB 1FS0G 3JAKB 3ZN0A 4YJ3B 3L74H 2GV9A 3ABMB 2RJZA 4JF3A 5LA6B 4GUNA 2ITDC 2QJ1A 2P22C 1OCOB 4UCTA 1TUBB 4K8ZA 2Q5ZA 1EZVH 4NR1A 4X88A 3AK2A 3RYCB 2ZIOA 4LFBB 3AG1C 3MD0A 2PZSA 3P30A 1AR4A 1VQOV 2WSSG 1PNKA 2JEUA 1FAFA 1OZ0A 1SKVA 2PF4E 4GX5A 2A0LA 3HB3B 1NI8A 4X1YB 4B3TB 4ABMA 1GN3A 5L3BA 4DV7B 1KKDA 4CS4A 1QNMA 2OYQA 2E74B 2QWQB 4FMTA 5KHJA 4KHPB 2AXTZ 5D5QA 2Q7HA 1GO3F 4PA6A 3ABKC 1AI5A 3S3XA 2XAQA 5IJ9B 2UXBO 2F66C 4E4EA 2DWEC 2VS0A 4NTWA 4O2AB 1UPGA 4UCVA 1X4TA 3CWBH 1H2MA 4IL6Z 3ZRSA 4DR7B 4AQYO 1HNXB 3M99B 3BFRA 4FIPC 3CHXA 3ABLB 1HR0B 5IWAO 4J41A 2Q8VA 1V54B 1K9MW 1YSCA 4RAIA 1YTFD 2ZE7A 4LF8O 5EC1C 4R7CA 4XDKA 4BIZA 4O4JB 1XMQO 1BZKA 3SDLA 2B5UA 2LJ2A 2IJIA 2EX3A 5IE9A 3QO5A 1HNWB 1AROP 4BR6A 4CH6A 3SPHA 3UO3A 3LDEA 3H1IH 3OE7G 3IFXA 4DR3O 4X89A 3STLC 1P7GA 5ITZB 2YSUB 2BTOA 3LNNA 3JSNA 2Y69B 2Z5UA 1U96A 3JCZA 3VQVA 1N8RW 4YIOA 1RM1B 1W59A 3BABA 4PELA 1VQ9V 1SERA 4UVAA 1Q7YW 2X6CA 1NBMG 3ASNB 4G27B 3E8HA 4J7JA 4I0XB 1EN4A 3A2FA 2WA3A 2ZXWB 4AILC 2Q69A 1GRJA 2BSKA 3WB0A 3FYIB 1JQ0A 4JI8O 1V55B 5KLVH 4IIJA 3OTOB 3T4DA 3K04A 1K5QA 3CD6V 1RP3B 4UXNA 4K8XA 3EXAA 2X7RB 1I5XA 4JAAA 2WLLA 3UM7A 1MSDA 3RGBA 1N33O 2LW1A 4J7ZA 3DC5A 2YC0A 2YXLA 4FFBB 5FNVA 3G6BA 2XOKG 3KCYA 5EC2C 1XMQB 1PNLA 3OEHG 1SS3A 2QM4A 1L8DA 3HKBB 2PY5A 3LSUA 1VQ5V 1SA0A 5LMUO 4MVQA 3E8FA 4I9QA 3I55V 1NTMH 3ZMUA 3N2KB 4ZI7A 3K9AA 4MS2A 3TCUA 1NTKH 2JJ2G 4TV8B 1K8AW 1ZAUA 1KKCA 1ZX3A 2IU3A 4LF7B 4I55A 4O4LA 1XNRO 2AHZA 3MAQA 1BS3A 4MVMA 5C93A 1NTZH 1I94B 4KP4A 4D6TH 2F4VB 1IBMO 1S3JA 1VEWA 2B1IA 5IYBO 1MOFA 4L87A 1S5LZ 3LDCA 4DV4O 3BAAA 3JAWB 4BW9A 4JI8B 3X2QC 5KA6A 3BHPA 5IT9N 1S5HC 4X65O 2DN9A 1CXZB 3T4ZA 1OV9A 4DR5B 4CH5A 5JH7A 2Y48A 3H01A 1R3JC 1QR8A 2IW5A 1AVMA 2P06A 2Q7EA 3SJCC 2GUZB 3U11A 3OMAB 3RVZA 4IHJA 4PDLA 1LNQA 4LWSB 4LF9O 3JYCA 1RPRA 2EIKB 1HNZB 1F7YA 2ODMA 5LMUB 3A0RA 1QLEB 2WLIB 2OCHA 1QQCA 3CSXA 3SYPA 3STZC 4WCEV 1VARA 2F43G 5GONB 5B66Z 4TQFA 2A06H 3G67A 1M56C 4DV3O 2QA4V 5L3FA 4PA4A 1H38A 2DE0X 2Q67A 3CYOA 5FL7G 3E35A 3VQXA 1Z5WA 1WB7A 2OWOA 1P7BA 3FAVA 1FFXA 4IYIA 1G1XB 3AK1A 3HKCB 3OAAG 2RCVA 4HZ3A 4B3RB 1K73W 1FYJA 1FXKA 4LCUC 2EZPA 1Q8IA 5KAIZ 2ZDIA 3ETEA 4GKJB 1Y4MA 4R50A 1VP7A 2GTAA 4LFAO 3A0HZ 2QTSA 3OGCC 2ZINA 1K92A 1XEQA 5B1AC 5H6RA 3RYFA 3CJHA 1WP8A 1B04A 4FJCC 3ZHSA 2JGDB 1K3EA 3DXRB 3JD1A 1JA8A 2M6YA 5LYJA 4LF4O 5CA1B 1Y76B 2BTQA 1IVSA 4LFCB 5CBGA 5LOVA 2UXNA 2LFRA 3CCLV 4HBNA 1SZTA 3CE2A 3ZS8C 5EBLC 4B3SB 5DN6G 3MHSC 2CDYA 1YJ9V 4PA9A 2KG7A 1J5EB 3FB6C 3L72H 1TUBA 5H2FZ 1I5YA 5CB4A 1G4YB 5LP6B 4FM2A 4XDLA 2YDEA 3JALB 2CH7B 4DV0O 4GKKB 2LP7A 4EEQA 3K57A 1AB3A 2W6JG 4JV5B 2OIGA 4U3JB 4D7TA 1Q81W 4I50A 4OPAA 3HKEB 3G6EV 3SPJA 4FLVA 2X6AA 3OR6C 4C7UA 5EZYA 4JI3B 2HHHB 1AJNA 3LSSA 1VQ7V 3E2EA 1MG1A 2UUCB 3LDDA 4F6RA 5IYDO 5EYPB 3FB7C 1WP7A 1L0LH 1F23A 1J95A 2B9ZA 4NTYA 3JARA 1WPBA 3RFRA 3D36A 4W4LA 5DEDA 3T1YB 3ABMC 1N34O 4BW5A 4MT8A 4FLTA 4HYOA 1IBLB 2HR3A 2ARHA 3SPIA 3ZRXA 1OCOC 3RT3C 1WA8B 4TUYB 2QM8A 4UB6Z 4LH7A 4FZ1A 5J2TA 1N32O 3C3SA 2M7WA 2JS5A 1R1BA 4YHHO 4DR1O 3PN1A 3ZEDA 4LF6O 5CA3A 3CCQV 1YHQV 1BHBA 4X66B 1BSMA 4DK1A 4X1KB 4OX9B
chains in the Genus database with same CATH topology
3GVMA 1WA8A 2DE0X 3HR0A 3Q4HA 1WA8B 3FAVA 3Q4HB 3GWKC 2AZ2A 2B9ZA 2VS0A 3FAVB 4GZRB 3TXSA 3G80A 3OGIB 2KG7A 4LWSA 3TXQA 3O9OA 3ZBHA 2VRZA 2AZ0A 4I0XA 3FD9A 2KG7B 4ABMA 4LWSB 4I0XB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVM A;  1WA8 A;  2DE0 X;  3HR0 A;  3Q4H A;  1WA8 B;  3FAV A;  3Q4H B;  3GWK C;  2AZ2 A;  2B9Z A;  2VS0 A;  3FAV B;  4GZR B;  3TXS A;  3G80 A;  3OGI B;  2KG7 A;  4LWS A;  3TXQ A;  3O9O A;  3ZBH A;  2VRZ A;  2AZ0 A;  4I0X A;  3FD9 A;  2KG7 B;  4ABM A;  4LWS B;  4I0X B; 
#chains in the Genus database with same CATH topology
 2PYJ A;  3ZRV A;  1NVP D;  3F5W C;  3NR7 A;  4FVM A;  2VWJ A;  4FM1 A;  2JK5 C;  3L9D A;  5BMV B;  2HJD A;  3ZBH A;  1XBL A;  4LNU B;  5JVD B;  1DF5 A;  1L0N H;  3OM3 B;  5BY1 A;  2UXC O;  1MSW D;  2H3O A;  3H1H H;  4JI4 B;  2HKO A;  2R9A A;  3ABL C;  1Y6X A;  5KHI A;  1S0V A;  2IBZ H;  1V54 C;  5J9P C;  1ORQ C;  3N27 A;  3D3Q A;  4NXM B;  3S3W A;  3RW0 A;  2IJH A;  1P84 F;  2EIJ B;  3K0G A;  4J7K A;  2DMX A;  2JEX A;  1IBK B;  2FTK A;  2QWP B;  3OMN B;  3DSQ A;  2ZCE A;  4Z1V A;  4JTA B;  2JVD A;  4LFB O;  4WFB V;  2JRI A;  4DR6 B;  1O9H A;  2LGW A;  3Q4H B;  2Y4T A;  2KKW A;  2XAF A;  3IC7 A;  2Y69 C;  4B3T O;  3A0B Z;  2VQE B;  1SQP H;  2JJ1 G;  4DV7 O;  3ABT A;  4KHP O;  1RM1 C;  3KZI Z;  4B3M B;  1B06 A;  1DF4 A;  1GM9 A;  4DR2 B;  1FXH A;  3ASN C;  4O2B B;  4CC6 A;  1VQP V;  3N2K A;  2H94 A;  3OR7 C;  5E1A C;  5LGU A;  2ZXW C;  4RQE A;  4DV5 B;  2PI5 A;  1M4U A;  3K79 A;  1KU9 A;  3CRA A;  5L3E A;  4WFF A;  1BCC H;  3SYC A;  4DR7 O;  1V55 C;  1HNX O;  2EBO A;  1QLN A;  1HR0 O;  4FFK A;  2PGG A;  4P2Z A;  4HNA B;  5CA0 A;  4MVO A;  1SQB H;  1N0N A;  4YJ2 B;  3O65 A;  5IYZ B;  4W4K A;  3IJ4 A;  2E3C A;  4GYC B;  1YXB A;  5KMG A;  1HNW O;  3ZJZ A;  5B3S B;  1DLB A;  1K34 A;  3K5N A;  2EIL B;  2EJ7 A;  1S72 V;  2CAZ C;  2UXD B;  1O9G A;  3SR2 C;  3L75 H;  1KC8 W;  1MAB G;  4K35 A;  1F51 A;  3QNE A;  2FB5 A;  4PI2 A;  3ZCC A;  3BCC H;  5KX5 B;  4TSF G;  2CTR A;  5KUM A;  2GUZ A;  4MSW C;  3OW2 U;  1Y74 A;  1H2G A;  4P30 A;  2A3Q A;  2Q6A A;  5EBW C;  1XL4 A;  3WFV A;  1ZL8 A;  1B3Q A;  1XUQ A;  4QPK A;  1GMG A;  3UT5 A;  1SES A;  1OCR B;  2UXX A;  1BE3 H;  3U0Z A;  1ZSP A;  3I56 V;  1XL6 A;  1JFF B;  2XAH A;  2GBO A;  2YUA A;  4I5S A;  3RYI B;  1PNM A;  3E22 A;  2VQF B;  3CPW U;  3CCS V;  1TVK A;  3OTO O;  2OTJ V;  4GZR B;  5FPR A;  4J10 A;  2F93 B;  5JCO C;  4WF9 V;  2ITC C;  2XAJ A;  1WLE A;  3JAS A;  3L71 H;  1P4R A;  4X1I B;  4UVB A;  3LUT B;  1RSO A;  2P6J A;  4TWK A;  4DW0 A;  2QKC A;  4TV9 B;  4I4T B;  1SQV H;  3FB5 C;  2W6I G;  3B2E E;  3SGI A;  3TXS A;  5D5P A;  3K5M A;  3RYH A;  4DV6 B;  4FPP A;  2OTL V;  1IUR A;  1QHT A;  4NXN B;  2RQ6 A;  2LGQ A;  2EIK C;  1YVW A;  2RDC A;  5C8Y B;  3N2G A;  4JYC A;  1QLE C;  4LF7 O;  4ZBM A;  4EB6 B;  2E75 B;  2VRZ A;  1I94 O;  1ZWI C;  3QTC A;  3ZHQ A;  1KB9 F;  2F4V O;  5JQG B;  1M93 A;  1KUQ A;  2MW2 B;  5LMN B;  2LFS A;  4MTF A;  3F5T A;  4NVP A;  3C90 A;  4NB5 A;  3SPG A;  1IXB A;  1GM7 A;  4U3F H;  2Y0I A;  4RUE A;  3B8M A;  4OPH A;  1K4D C;  3CS5 A;  2BE3 A;  4ZHQ B;  4H37 A;  4G28 B;  3H9V A;  3OMI B;  3K5O A;  4DO2 A;  2HLD G;  4QJF B;  4DR5 O;  3AG4 B;  2XAS A;  2YEV A;  3ZRW B;  4Z2W A;  1GM8 A;  1NT2 B;  4RQF A;  1VF7 A;  2X0L A;  4BIO A;  3K5L A;  1YIJ V;  4U3J A;  3AEI A;  5A9G A;  4U7N A;  1AR1 B;  1CEZ A;  1Q6I A;  1Q43 A;  3P3P A;  1CPY A;  4MW3 A;  4WFA V;  2HP8 A;  1SQQ H;  1R6K A;  2QDO A;  1HNZ O;  4O4H A;  4DV2 B;  3LNM B;  1SRY A;  1D5A A;  1Z5V A;  2QWN B;  1Y67 A;  1XMO B;  3IGA C;  2QM7 A;  4FLW A;  1YF2 A;  1GH6 A;  3TK1 A;  1VQN V;  1S77 D;  1WAZ A;  1TGO A;  2GTS A;  5LHG A;  2H8P C;  1PV0 A;  1N0J A;  5IYC O;  4O4I A;  1NQT A;  3SPC A;  5LP6 C;  5KA5 A;  2E5L B;  2N05 A;  1HP8 A;  2G38 A;  1KEC A;  3J80 N;  3ZIA G;  3ICX A;  4B3R O;  5HFM A;  2OIE A;  3WB1 A;  1PM9 A;  4H33 A;  2CGN A;  4GKJ O;  3HKD A;  1PKX A;  1COW G;  2DWD C;  2WWW A;  3CEI A;  3JAT A;  3ZMT A;  4FZ0 A;  2EIM B;  4WBN B;  5IJ0 A;  2NN4 A;  3T1H O;  4JZG A;  1P49 A;  1SQF A;  3E89 A;  1YDX A;  1KD1 W;  5JWP A;  5KUK A;  4LNU A;  1JOY A;  5L3D A;  4H44 B;  3TXQ A;  1OCZ B;  2K9P A;  4WFE A;  1R3K C;  4LFC O;  5BXZ A;  5KHK A;  4A5U B;  1MZE A;  3QF7 A;  1JPX A;  4B08 A;  4QE9 A;  4B3S O;  3A8T A;  5KAF Z;  4KFM A;  3CCU V;  1MA1 A;  1VF5 B;  1AR5 A;  1YIT V;  5HFL A;  1J5E O;  4AI8 A;  3D8C A;  1YEW A;  4CZZ A;  2GHY A;  2WLJ A;  2FYU H;  4EKW A;  1NVP B;  1Q82 W;  4GKK O;  5J2U A;  3CCJ V;  1NU1 H;  4JV5 O;  4ZOL A;  1BQ0 A;  2P5O A;  1PPJ H;  3O9O A;  1M57 B;  1BQZ A;  4JI3 O;  5E79 Z;  2HHH O;  4O2B A;  2A7W A;  1WB8 A;  2ZR3 A;  2DYS B;  1HWY A;  2AHY A;  1H2K A;  4LF5 B;  1GN2 A;  4IT5 A;  2UUC O;  1OCC B;  1N36 B;  2A79 B;  3TGU H;  4AHC A;  4QNH B;  3T1H B;  4X8A A;  5IY5 B;  2IJK A;  1BL8 A;  3T1Y O;  5B1B C;  2EIJ C;  3L70 H;  1IBL O;  3WG7 B;  1M9N A;  2P4K A;  1M1K W;  3K3W A;  1W0K G;  1K33 A;  3RWR D;  1KYO F;  2JIZ G;  3CB2 A;  3CCE V;  4DRX A;  3JAK A;  3OUF A;  5A2Q N;  3CCM V;  2CTQ A;  4YJ3 A;  1H2L A;  3ZHT A;  2ZQM A;  2EZO A;  3LSQ A;  3ZN1 A;  3OT7 A;  4NYK A;  5LA6 A;  3FB8 C;  1KP3 A;  4X66 O;  3ZHU A;  1Y66 A;  2ILM A;  4PA7 A;  4OX9 O;  1VMG A;  3P3N A;  1FJG B;  1JJ2 U;  5JJE B;  3HPL C;  1PL4 A;  2V1D A;  3W7W A;  3JCU Z;  3RYC A;  3AG3 B;  4P9P A;  4KUM A;  2D2C B;  2YIB A;  1L1F A;  3UKM A;  2BSK B;  1Q6H A;  4X1Y A;  2P7T C;  4UV9 A;  2EIN B;  1I0H A;  4IIJ B;  1IZ3 A;  4JI2 B;  4JI4 O;  1RFY A;  4MVZ A;  3OFN G;  4X20 B;  1AP6 A;  5IJ9 A;  2F95 B;  5TIS Z;  2DQ0 A;  4NXM O;  5BR8 B;  1H8H G;  4O2A A;  1IBK O;  1KMI Z;  2Q0A A;  3BPZ A;  5EK0 A;  5FNV B;  4J42 A;  1IX9 A;  3E8G A;  5B3S C;  2EIL C;  1AP5 A;  3JD0 A;  2ADQ B;  4H0L B;  1AJP A;  5B5E Z;  2ZE6 A;  2WPD G;  4TOI A;  2Q9L A;  4DR6 O;  2ZNJ A;  3CC4 V;  1SA0 B;  1EZJ A;  4CBC A;  4O4J A;  4N23 A;  4DYL A;  2VQE O;  4HAM A;  1R3L C;  2KSD A;  4ZI7 B;  5DM6 V;  3G80 A;  1IDS A;  4B3M O;  2CTW A;  2IH1 C;  1WN7 A;  4DR2 O;  2NR5 A;  4I55 B;  4O4L B;  1R3I C;  1F4N A;  5ITZ A;  1OCR C;  2RN9 A;  4DV5 O;  3M7M X;  2HFE C;  2IM9 A;  3MDS A;  1K97 A;  4JI5 B;  4GCZ A;  3GWK C;  4QE7 A;  4MW8 A;  4ZIB A;  2OCC B;  2YIA A;  3ASO B;  2R70 A;  5DEC A;  3B77 A;  4JAU A;  4UVC A;  3THO A;  4JYY A;  4I0X A;  3AG2 B;  4X62 B;  4CH4 A;  1XNQ B;  2W0F C;  4PDR A;  2JDI G;  4D7S A;  4FLU A;  3FFQ A;  4X64 O;  1XI1 A;  2N74 A;  4JTD B;  3SJA C;  2QEX V;  3RVY A;  5JH7 B;  1YTF B;  3ZHV A;  2NLJ C;  2QKA A;  3TJT A;  3ZMV A;  2UXD O;  1CP9 A;  4UV8 A;  3ZRW A;  4KXR A;  4J11 A;  4IHJ B;  1LR1 A;  4PJ0 Z;  1UJW B;  4H13 B;  2ADP A;  1I08 A;  2UUA O;  3TET A;  4MTO A;  3D3I A;  2KQX A;  4FFB A;  2IJJ A;  5B1A B;  3ZMZ A;  3OUS A;  4LR3 A;  4TQD A;  2DW4 A;  1Q90 D;  4LP8 A;  3B40 A;  4MVR A;  3G4S V;  1QVF U;  3SYQ A;  2DJV A;  3HKB A;  2LO1 A;  4GX0 A;  1K5S A;  2GDS A;  1X59 A;  2O57 A;  2YIC A;  1SQG A;  5LXT B;  3SYA A;  1K7D A;  5LHH A;  2QR4 A;  3K9S A;  2VQF O;  4G2K A;  1E1Q G;  2A9H A;  2DYR B;  2ZIM A;  2Y0P A;  1DGS A;  1Q86 W;  4TV8 A;  3T2M A;  1I7F A;  3CRQ A;  3FAV B;  2YID A;  1FFX B;  2ZD9 A;  3OGI B;  1MNG A;  4P9O A;  5CBF A;  5K1P A;  4U7O A;  4WFH A;  2XAG A;  2MK3 A;  1FXK B;  4RUF A;  3IC9 A;  2ZNI A;  2HG5 C;  1LUW A;  2JS3 A;  4DR4 O;  4X64 B;  4GT1 A;  3JAW A;  1A32 A;  5JCO A;  2Q68 A;  4DV6 O;  3B09 A;  3RYF B;  4JI1 B;  1FPO A;  3CJH B;  2ZE8 A;  3H1L H;  4YY3 B;  4NXN O;  5LYJ B;  4EFB A;  4RWU A;  2BTQ B;  2CGO A;  3WU2 Z;  3W7U A;  5LOV B;  4UCO A;  1QCE A;  2UUA B;  3CMA V;  1D2D A;  1AJQ A;  1GAX A;  2EJR A;  4LWS A;  2R9R B;  2KG7 B;  1H8E G;  4JI6 B;  3K0D A;  1US6 A;  2ZM6 B;  1XHX A;  2JGU A;  5LMN O;  3GVM A;  2Z0A A;  2N04 A;  4DUZ B;  5CB4 B;  1LUV A;  2WLI A;  1R6N A;  4DUY B;  4XBF A;  5JJJ B;  3F7V C;  2FML A;  1VF6 A;  2Q7G A;  2UUB O;  5GON A;  3G71 V;  2IU0 A;  1NH2 D;  4XDJ A;  1ZUQ A;  2UU9 B;  4I50 B;  5H6Q A;  4UCS A;  4FLX A;  1XDC A;  1B6Q A;  4RO2 A;  1AIL A;  4Z1M G;  4UFZ A;  1YZB A;  2F1M A;  3K06 A;  5EZY B;  2Z3Y A;  4IGG A;  4CH3 A;  1SET A;  2EIM C;  3ETD A;  1EFR G;  1N4C A;  2EUL A;  4MTG A;  1M90 W;  3HKC A;  3DTU B;  3PJS K;  4F6R B;  4DR4 B;  1PD3 A;  2WLH A;  2L6L A;  4JYA B;  2YI8 A;  3JAR B;  4K0K B;  1OCZ C;  5H5N A;  4JZ2 A;  4DV2 O;  2BOB C;  4MVS A;  5LGT A;  4BAY A;  4CC5 A;  2Y4U A;  3APQ A;  5KHG A;  2OT5 A;  3E83 A;  4PA3 A;  1VQ8 V;  1XMO O;  1VQ6 V;  3W7T A;  3VQY A;  2YS8 A;  3CME V;  3DGE A;  3F7Y C;  4JYB A;  2JGD A;  4N21 A;  5J2T B;  3DXR A;  4X9Q A;  2CE4 A;  1YJN V;  5CA1 A;  1Y76 A;  4FK5 C;  3CC7 V;  1VF6 C;  1JVM A;  3J7A U;  3K59 A;  4F6E A;  2QSA A;  1FKA O;  2E5L O;  2YXH A;  3AK3 A;  1VQ4 V;  1THZ A;  3FX7 A;  3ZMS A;  4LBE C;  1H2S B;  3QO8 A;  2AW9 A;  5JJN B;  3E8B A;  1Q6U A;  1D5N A;  1YI2 V;  2UUB B;  1VQL V;  3OD4 A;  5LP6 A;  3L73 H;  4ASU G;  1F4M A;  1M57 C;  2Q73 A;  1YCI A;  2XUM A;  3JAL A;  2CH7 A;  2DYS C;  3EVK A;  5B1N A;  3HR0 A;  4YXW G;  5CBH A;  1OCC C;  1KBH A;  3HKE A;  4J9Y B;  3AG7 A;  2UXB B;  1JR9 A;  1XOU A;  3B4S A;  5IY5 C;  3WB2 A;  2W0X A;  4JGS A;  4X20 A;  3WG7 C;  3KG2 A;  4AQY B;  1UFI A;  1EBO A;  5IWA B;  5EYP A;  3K03 A;  1S76 D;  2DOS A;  1JX9 A;  4LF8 B;  1OJH A;  3QO7 A;  3BA9 A;  3SYO A;  1U97 A;  5LHI A;  1ZTE A;  1WJZ A;  4FLY A;  2WAM A;  1WA8 A;  4TUY A;  4WFG A;  1RPO A;  1KQS U;  4E2L A;  3AG1 B;  4LH6 A;  4DR3 B;  3AG3 C;  2RMK B;  2YIB D;  3B8N A;  3W7X A;  3CRM A;  1QU7 A;  5EIB C;  4X1K A;  1GKF A;  1VQM V;  4LF5 O;  4R8C A;  2EIN C;  1NR1 A;  2FL4 A;  2WLN A;  1N36 O;  3ABK B;  2AGA A;  4EFE A;  5CA0 B;  1SZX A;  3IAY A;  4QPJ A;  5BMV A;  1OHH G;  2ZR2 A;  4LC1 A;  5F2V O;  4DXW A;  1V9P A;  3KCX A;  2YI9 A;  4UCR A;  5JVD A;  3BY6 A;  5KMG B;  1MZF A;  2AZ0 A;  1GN6 A;  2WA4 A;  3CXH F;  1ZLZ A;  4PDM A;  3I5D A;  5BZB A;  4OGQ B;  1TA8 A;  2WLM A;  4B7K A;  4F4L A;  1BMF G;  3QG5 A;  1NJI W;  1Q3E A;  1ENV A;  4I9W A;  1N33 B;  3J81 N;  5FPO A;  1KP2 A;  2PTM A;  3DC6 A;  3CXC U;  3H1K H;  2BCC H;  1FJG O;  2L35 A;  1Y74 B;  2ZT9 B;  2V7Q G;  1AI4 A;  1Z2G A;  1ZL8 B;  3UT5 B;  4UB8 Z;  3P32 A;  2QWO B;  3FYE B;  3Q4H A;  2QE7 G;  2P90 A;  3CRC A;  4ICG A;  1VQK V;  4UCU A;  2E76 B;  3CC2 V;  3E22 B;  4JAV A;  2CUG A;  1FXV A;  1TVK B;  4JI2 O;  2OCC C;  3ASO C;  1NS1 A;  2X6B A;  5LXT A;  5LL6 Y;  1XNR B;  3EFF K;  2HEP A;  1XHZ A;  4JPR A;  3R65 A;  1HW7 A;  3AG2 C;  4JI7 O;  3OTF A;  4UUJ C;  3JAS B;  5BR8 O;  3K58 A;  2F23 A;  4R6Z A;  1FD9 A;  2ATK C;  1IBM B;  5AG2 A;  3ML0 A;  2IH3 C;  1RSO B;  4PDV A;  2AZ2 A;  4FM0 A;  1JJO A;  2HVJ C;  2DQ3 A;  4L8J A;  1S5J A;  3BRC A;  1TUE B;  2QTO A;  3CX5 F;  4GLX A;  3SJB C;  5LBQ A;  4DV4 B;  3ETQ A;  3FD9 A;  4HNA A;  1QBZ A;  3RYH B;  4YJ2 A;  4X65 B;  5IYZ A;  1BGY H;  5H9C A;  4PHZ A;  3R66 A;  1HDJ A;  1DK1 A;  1PP9 H;  2C2A A;  1G8M A;  1PL0 A;  1JCH A;  1WNS A;  4Q6G A;  3N2G B;  4JI0 O;  5GTH Z;  2QGN A;  1AI6 A;  4MVU A;  1QVG U;  3VBB A;  2NNU A;  5KHH A;  3GB7 C;  4LF9 B;  5KX5 A;  1SC5 B;  2R9I A;  3JD4 A;  4JI5 O;  2D3O W;  3FKS G;  1ROP A;  1T5E A;  5CN0 A;  2DYR C;  1EN5 A;  4X62 O;  1XNQ O;  3APO A;  4PV1 B;  2Q4P A;  1JFF A;  3ZHR A;  3CCR V;  2LQT A;  4K3A A;  1AI7 A;  1FXK C;  3RYI A;  4DV3 B;  3KKY A;  3VQW A;  2ZDI C;  4IYH A;  4JI7 B;  5EBM C;  2YEV B;  3T1C A;  2WLL B;  4JTC B;  1EM1 A;  3X2Q B;  1URF A;  4YIP A;  4J9Z B;  4FLZ A;  3M8A A;  3UCS C;  3ZX6 A;  2CK3 G;  4X1I A;  2PUS A;  2ZE5 A;  2PI4 A;  3BA8 A;  4TV9 A;  3VOU A;  4I4T A;  2XHB A;  4GX2 A;  4O4H B;  1E1R G;  2R72 A;  1JMK C;  4LFA B;  3CP1 A;  1GK9 A;  3UQ8 A;  2XT9 A;  2VWK A;  3GWO A;  2ETN A;  2P67 A;  1QR9 A;  2K1E A;  3K08 A;  4JI0 B;  4J80 A;  1R6T A;  1H2N A;  4LF4 B;  1MMM A;  2BOC C;  2WLK A;  4NKG B;  1EN6 A;  5C8Y A;  4O4I B;  1FFT B;  2ZKO A;  3RN4 A;  4EB6 A;  4DW1 A;  4DV1 O;  4JAS A;  4PI0 A;  5CMU A;  1VIB A;  3JSL A;  1M56 B;  1NH2 B;  5JQG A;  3SJQ C;  3OEE G;  3HKD B;  1XQ8 A;  1R73 A;  3JD2 A;  3UO2 A;  2LW7 A;  3JAT B;  1TAE A;  1GTO A;  1K4C C;  4Q20 A;  2XTA A;  5IJ0 B;  1NZ6 A;  4DV0 B;  4ZHQ A;  1DTO A;  2HJF C;  3EHB B;  1E79 G;  4JI1 O;  2HVK C;  2PYL A;  4YY3 O;  3D36 C;  3H1J H;  2FKX A;  4KL1 A;  4B7E A;  5B1O A;  5GTI Z;  1IXM A;  4DK0 A;  2KB1 A;  5B1B B;  4QGP A;  1XRE A;  3JD3 A;  5K1X A;  2QWR B;  2RNB A;  3CCV V;  3RBZ A;  3MHH C;  4JI6 O;  2B1G A;  2ZM6 O;  2P4V A;  1WPX A;  4DUZ O;  1N34 B;  1Q5O A;  2QKS A;  4DUY O;  4CS2 A;  4BIU A;  3CRR A;  4BWA A;  4CS3 A;  3NXS A;  4MTX A;  3ETG A;  5J2U B;  5L3C A;  2Q0O C;  1NKD A;  5IDJ A;  2V4D A;  4ZOL B;  1N32 B;  1SF9 A;  2UU9 O;  3ABU A;  4YHH B;  4DR1 B;  1BHA A;  4DV1 B;  3BVO A;  3U10 A;  4LF6 B;  1SQX H;  3BEH A;  4NTX A;  5LGN A;  3QVN A;  2GSM B;  3JAM N;  5FLX N;  3AG4 C;  1M5I A;  5L3G A;  1YJW V;  1G6U A;  5EIB D;  1GN4 A;  1BT8 A;  4JYA O;  1NR7 A;  3E86 A;  4QIW F;  3W7S A;  4OXS A;  4K0K O;  4ZKI A;  1W2B U;  2CTP A;  1XIL A;  4WBN A;  2YXY A;  4PD4 F;  2UXC B;  5GW7 A;  4I7Z B;  3C3T A;  4TT3 G;  2XND G;  4GX1 A;  1W0J G;  4DRX B;  1FS0 G;  3JAK B;  3ZN0 A;  4YJ3 B;  3L74 H;  2GV9 A;  3ABM B;  2RJZ A;  4JF3 A;  5LA6 B;  4GUN A;  2ITD C;  2QJ1 A;  2P22 C;  1OCO B;  4UCT A;  1TUB B;  4K8Z A;  2Q5Z A;  1EZV H;  4NR1 A;  4X88 A;  3AK2 A;  3RYC B;  2ZIO A;  4LFB B;  3AG1 C;  3MD0 A;  2PZS A;  3P30 A;  1AR4 A;  1VQO V;  2WSS G;  1PNK A;  2JEU A;  1FAF A;  1OZ0 A;  1SKV A;  2PF4 E;  4GX5 A;  2A0L A;  3HB3 B;  1NI8 A;  4X1Y B;  4B3T B;  4ABM A;  1GN3 A;  5L3B A;  4DV7 B;  1KKD A;  4CS4 A;  1QNM A;  2OYQ A;  2E74 B;  2QWQ B;  4FMT A;  5KHJ A;  4KHP B;  2AXT Z;  5D5Q A;  2Q7H A;  1GO3 F;  4PA6 A;  3ABK C;  1AI5 A;  3S3X A;  2XAQ A;  5IJ9 B;  2UXB O;  2F66 C;  4E4E A;  2DWE C;  2VS0 A;  4NTW A;  4O2A B;  1UPG A;  4UCV A;  1X4T A;  3CWB H;  1H2M A;  4IL6 Z;  3ZRS A;  4DR7 B;  4AQY O;  1HNX B;  3M99 B;  3BFR A;  4FIP C;  3CHX A;  3ABL B;  1HR0 B;  5IWA O;  4J41 A;  2Q8V A;  1V54 B;  1K9M W;  1YSC A;  4RAI A;  1YTF D;  2ZE7 A;  4LF8 O;  5EC1 C;  4R7C A;  4XDK A;  4BIZ A;  4O4J B;  1XMQ O;  1BZK A;  3SDL A;  2B5U A;  2LJ2 A;  2IJI A;  2EX3 A;  5IE9 A;  3QO5 A;  1HNW B;  1ARO P;  4BR6 A;  4CH6 A;  3SPH A;  3UO3 A;  3LDE A;  3H1I H;  3OE7 G;  3IFX A;  4DR3 O;  4X89 A;  3STL C;  1P7G A;  5ITZ B;  2YSU B;  2BTO A;  3LNN A;  3JSN A;  2Y69 B;  2Z5U A;  1U96 A;  3JCZ A;  3VQV A;  1N8R W;  4YIO A;  1RM1 B;  1W59 A;  3BAB A;  4PEL A;  1VQ9 V;  1SER A;  4UVA A;  1Q7Y W;  2X6C A;  1NBM G;  3ASN B;  4G27 B;  3E8H A;  4J7J A;  4I0X B;  1EN4 A;  3A2F A;  2WA3 A;  2ZXW B;  4AIL C;  2Q69 A;  1GRJ A;  2BSK A;  3WB0 A;  3FYI B;  1JQ0 A;  4JI8 O;  1V55 B;  5KLV H;  4IIJ A;  3OTO B;  3T4D A;  3K04 A;  1K5Q A;  3CD6 V;  1RP3 B;  4UXN A;  4K8X A;  3EXA A;  2X7R B;  1I5X A;  4JAA A;  2WLL A;  3UM7 A;  1MSD A;  3RGB A;  1N33 O;  2LW1 A;  4J7Z A;  3DC5 A;  2YC0 A;  2YXL A;  4FFB B;  5FNV A;  3G6B A;  2XOK G;  3KCY A;  5EC2 C;  1XMQ B;  1PNL A;  3OEH G;  1SS3 A;  2QM4 A;  1L8D A;  3HKB B;  2PY5 A;  3LSU A;  1VQ5 V;  1SA0 A;  5LMU O;  4MVQ A;  3E8F A;  4I9Q A;  3I55 V;  1NTM H;  3ZMU A;  3N2K B;  4ZI7 A;  3K9A A;  4MS2 A;  3TCU A;  1NTK H;  2JJ2 G;  4TV8 B;  1K8A W;  1ZAU A;  1KKC A;  1ZX3 A;  2IU3 A;  4LF7 B;  4I55 A;  4O4L A;  1XNR O;  2AHZ A;  3MAQ A;  1BS3 A;  4MVM A;  5C93 A;  1NTZ H;  1I94 B;  4KP4 A;  4D6T H;  2F4V B;  1IBM O;  1S3J A;  1VEW A;  2B1I A;  5IYB O;  1MOF A;  4L87 A;  1S5L Z;  3LDC A;  4DV4 O;  3BAA A;  3JAW B;  4BW9 A;  4JI8 B;  3X2Q C;  5KA6 A;  3BHP A;  5IT9 N;  1S5H C;  4X65 O;  2DN9 A;  1CXZ B;  3T4Z A;  1OV9 A;  4DR5 B;  4CH5 A;  5JH7 A;  2Y48 A;  3H01 A;  1R3J C;  1QR8 A;  2IW5 A;  1AVM A;  2P06 A;  2Q7E A;  3SJC C;  2GUZ B;  3U11 A;  3OMA B;  3RVZ A;  4IHJ A;  4PDL A;  1LNQ A;  4LWS B;  4LF9 O;  3JYC A;  1RPR A;  2EIK B;  1HNZ B;  1F7Y A;  2ODM A;  5LMU B;  3A0R A;  1QLE B;  2WLI B;  2OCH A;  1QQC A;  3CSX A;  3SYP A;  3STZ C;  4WCE V;  1VAR A;  2F43 G;  5GON B;  5B66 Z;  4TQF A;  2A06 H;  3G67 A;  1M56 C;  4DV3 O;  2QA4 V;  5L3F A;  4PA4 A;  1H38 A;  2DE0 X;  2Q67 A;  3CYO A;  5FL7 G;  3E35 A;  3VQX A;  1Z5W A;  1WB7 A;  2OWO A;  1P7B A;  3FAV A;  1FFX A;  4IYI A;  1G1X B;  3AK1 A;  3HKC B;  3OAA G;  2RCV A;  4HZ3 A;  4B3R B;  1K73 W;  1FYJ A;  1FXK A;  4LCU C;  2EZP A;  1Q8I A;  5KAI Z;  2ZDI A;  3ETE A;  4GKJ B;  1Y4M A;  4R50 A;  1VP7 A;  2GTA A;  4LFA O;  3A0H Z;  2QTS A;  3OGC C;  2ZIN A;  1K92 A;  1XEQ A;  5B1A C;  5H6R A;  3RYF A;  3CJH A;  1WP8 A;  1B04 A;  4FJC C;  3ZHS A;  2JGD B;  1K3E A;  3DXR B;  3JD1 A;  1JA8 A;  2M6Y A;  5LYJ A;  4LF4 O;  5CA1 B;  1Y76 B;  2BTQ A;  1IVS A;  4LFC B;  5CBG A;  5LOV A;  2UXN A;  2LFR A;  3CCL V;  4HBN A;  1SZT A;  3CE2 A;  3ZS8 C;  5EBL C;  4B3S B;  5DN6 G;  3MHS C;  2CDY A;  1YJ9 V;  4PA9 A;  2KG7 A;  1J5E B;  3FB6 C;  3L72 H;  1TUB A;  5H2F Z;  1I5Y A;  5CB4 A;  1G4Y B;  5LP6 B;  4FM2 A;  4XDL A;  2YDE A;  3JAL B;  2CH7 B;  4DV0 O;  4GKK B;  2LP7 A;  4EEQ A;  3K57 A;  1AB3 A;  2W6J G;  4JV5 B;  2OIG A;  4U3J B;  4D7T A;  1Q81 W;  4I50 A;  4OPA A;  3HKE B;  3G6E V;  3SPJ A;  4FLV A;  2X6A A;  3OR6 C;  4C7U A;  5EZY A;  4JI3 B;  2HHH B;  1AJN A;  3LSS A;  1VQ7 V;  3E2E A;  1MG1 A;  2UUC B;  3LDD A;  4F6R A;  5IYD O;  5EYP B;  3FB7 C;  1WP7 A;  1L0L H;  1F23 A;  1J95 A;  2B9Z A;  4NTY A;  3JAR A;  1WPB A;  3RFR A;  3D36 A;  4W4L A;  5DED A;  3T1Y B;  3ABM C;  1N34 O;  4BW5 A;  4MT8 A;  4FLT A;  4HYO A;  1IBL B;  2HR3 A;  2ARH A;  3SPI A;  3ZRX A;  1OCO C;  3RT3 C;  1WA8 B;  4TUY B;  2QM8 A;  4UB6 Z;  4LH7 A;  4FZ1 A;  5J2T A;  1N32 O;  3C3S A;  2M7W A;  2JS5 A;  1R1B A;  4YHH O;  4DR1 O;  3PN1 A;  3ZED A;  4LF6 O;  5CA3 A;  3CCQ V;  1YHQ V;  1BHB A;  4X66 B;  1BSM A;  4DK1 A;  4X1K B;  4OX9 B; 
#chains in the Genus database with same CATH homology
 3GVM A;  1WA8 A;  2DE0 X;  3HR0 A;  3Q4H A;  1WA8 B;  3FAV A;  3Q4H B;  3GWK C;  2AZ2 A;  2B9Z A;  2VS0 A;  3FAV B;  4GZR B;  3TXS A;  3G80 A;  3OGI B;  2KG7 A;  4LWS A;  3TXQ A;  3O9O A;  3ZBH A;  2VRZ A;  2AZ0 A;  4I0X A;  3FD9 A;  2KG7 B;  4ABM A;  4LWS B;  4I0X B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...