2AZ0A

Flock house virus b2-dsrna complex (p212121)
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
70
structure length
70
Chain Sequence
PSKLALIQELPDRIQTAVEAAMGMSYQDAPNNVRRDLDNLHACLNKAKLTVSRMVTSLLEKPSVVAYLEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Dual modes of RNA-silencing suppression by Flock House virus protein B2.
pubmed doi rcsb
source organism Flock house virus
molecule tags Viral protein/rna
molecule keywords 5'-R(*GP*CP*AP*(5BU)P*GP*GP*AP*CP*GP*CP*GP*(5BU)P*CP*CP*AP*(
total genus 23
structure length 70
sequence length 70
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-09-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11473 B2 RNA binding protein B2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2az0A00
3OGIB 3Q4HA 2KG7B 2VRZA 2B9ZA 3TXSA 3FD9A 2AZ2A 2VS0A 3G80A 2KG7A 3Q4HB 3ZBHA 1WA8A 1WA8B 4I0XB 3FAVA 4LWSA 4LWSB 3FAVB 2AZ0A 2DE0X 3GVMA 3TXQA 3O9OA 3GWKC 3HR0A 4GZRB 4ABMA 4I0XA
chains in the Genus database with same CATH superfamily
4TQFA 4Z1VA 4I7ZB 5CA0A 1YXBA 5B1AC 4JI2O 3E35A 1Y74A 1HR0B 3DXRB 5IY5C 4NTWA 2E74B 4YIPA 4R6ZA 1CXZB 4GLXA 3MHSC 4I0XA 4DO2A 2ZNIA 4PELA 1FKAO 2WWWA 2ZKOA 3CJHA 1A32A 4B7EA 4O4HA 3CYOA 1RM1C 2K9PA 2CDYA 1MZFA 3RYCB 1GM8A 2WLIB 3E8BA 3TK1A 3M8AA 1UFIA 5KUKA 1Y74B 1K92A 1QCEA 1RPOA 5K1XA 4O2BB 3K58A 4LF8O 2YXLA 3B8NA 2EINC 1IBLO 4WFGA 2W6JG 1D5AA 4R7CA 2DN9A 4TV9A 1XEQA 4JI7B 4U3FH 3CSXA 1P7GA 2X6CA 4ICGA 2PY5A 1XL6A 2JGDB 4W4KA 2Q68A 1S5HC 4RAIA 1HP8A 1M56C 4NXNO 4PD4F 2VRZA 2CH7A 3D3QA 4JI0O 2D2CB 4J7KA 1K97A 1V55B 2ZD9A 4IHJA 4CC6A 4YY3B 5AG2A 3LDCA 3OTOB 3K5OA 1VQ6V 1D5NA 5BR8B 3K9SA 3S3XA 1RM1B 3EFFK 4GUNA 3K57A 1FFXA 1SQGA 1Q6IA 2EIJB 3D8CA 1XHZA 3WU2Z 3CRQA 3R65A 2YI9A 2FTKA 3WG7C 3E86A 1YF2A 4LWSA 5CA1B 2W6IG 3K5LA 1SA0A 2RN9A 3CRRA 4JI6B 3ZMZA 4QGPA 4DR1O 4KUMA 2LP7A 2UUAO 4PA6A 3AK3A 2JEUA 2CTWA 4QPKA 1ZX3A 1BCCH 5JJEB 4HBNA 2ZQMA 2EBOA 4DR4O 4PV1B 3AG3C 2F43G 2LW1A 1M56B 3OUFA 2JK5C 1V9PA 2XASA 4JI0B 4U7NA 2WPDG 3SPGA 4JZGA 3UQ8A 4GYCB 2QE7G 3AEIA 5GONB 3ZHRA 4FZ1A 4KHPO 4RO2A 2VQFB 2F23A 2Q9LA 1UPGA 4JTCB 3HKDA 5L3EA 4RUFA 3HKDB 3SYCA 3K79A 1XNRB 3ZCCA 3VQYA 1Y67A 4JPRA 4ZOLA 2AXTZ 2AW9A 2KB1A 3P32A 3H1LH 5DECA 5GW7A 2UXNA 2GTSA 1XHXA 1K34A 5H9CA 3ABUA 3FB5C 1VQNV 3T1YO 2AHYA 2YEVA 3AG4C 1AVMA 1PKXA 1XBLA 2UU9B 4UCVA 4D7SA 4D7TA 2OIEA 1YI2V 3WB1A 3ZX6A 3G71V 4PI0A 3QNEA 2IJHA 4R50A 3CXCU 1FPOA 2BSKA 3T1CA 4WFBV 3ZRVA 1K3EA 1SQXH 3AG3B 2CTRA 4YXWG 1ZAUA 2EIMB 1P4RA 3T4DA 1I7FA 4PDRA 1KBHA 3ABKB 3CCQV 3AG4B 4DK0A 4DR4B 1T5EA 4IHJB 3JATB 4NR1A 1F4NA 1S3JA 4FM0A 2BE3A 3JATA 2BOBC 5B1AB 2QR4A 1YITV 1NTZH 5FNVA 4BIZA 1M57C 4FFBB 1Q8IA 2Y4UA 1LR1A 2CTQA 5LL6Y 4DV1B 2BSKB 1ENVA 4KXRA 5CMUA 4LF8B 2UXBO 1GM9A 1AR4A 1XI1A 5J2UB 4DV5B 2WA3A 1W0JG 2V1DA 3CCVV 2ZM6O 5LXTB 5LMUB 2JS5A 5IYZB 3I56V 4LR3A 2P22C 4R8CA 4N21A 2EILB 4YY3O 4WFEA 3B40A 3AG1C 2GTAA 2WAMA 4K0KB 2N04A 3SJBC 4CBCA 4BWAA 3APQA 2VWJA 1EZVH 2RQ6A 4J41A 1VQMV 3FAVA 4CH5A 4YHHO 3SPJA 1AJPA 1MA1A 3IAYA 2DWDC 2BCCH 4UVAA 2LO1A 3K59A 4UXNA 4EFBA 2HHHB 1EN4A 1N33O 1QLNA 4LF4B 1U96A 1M57B 3FB7C 1SZTA 2BTQB 4GKKO 1IBMB 2LQTA 1PNMA 3RYIA 1WB7A 2VQEB 3OEHG 3WG7B 4DW0A 2X6AA 4YHHB 5JQGA 5CA3A 1P49A 2IJKA 4PDLA 3LSQA 2EZPA 3BAAA 3UO3A 1J5EB 1CPYA 4UB6Z 4X9QA 2ZCEA 4YJ2A 1SA0B 4Z1MG 4AI8A 3ZHQA 4O4HB 1IVSA 3T2MA 3VBBA 4JI5O 2JJ2G 1KP2A 1XUQA 1EN5A 3JYCA 1R6TA 5LYJB 1B06A 4L8JA 2EIJC 4FM2A 1WN7A 1NQTA 5IDJA 3E89A 3SPIA 1K9MW 5GONA 2PI5A 3G67A 4P30A 2E76B 4LF6O 1CP9A 4OPAA 2Q7HA 4JAUA 4D6TH 1FXKA 1I5YA 3OM3B 3EXAA 1DTOA 1XNRO 1HDJA 3BPZA 3JSNA 3CC2V 4K35A 2DYSB 1EM1A 3FX7A 2EIKB 3ZRWB 1FXHA 1VEWA 2ZT9B 1YVWA 3K04A 4GX2A 4FLZA 5L3BA 1EBOA 2H3OA 1N0JA 4TV9B 2ZR2A 3RYFB 3OGCC 3SPCA 2BOCC 2GV9A 1F4MA 2ZE5A 1V55C 2V4DA 3OMNB 5DEDA 1J95A 4DUYO 2ETNA 1H2SB 1VQ5V 2UXDO 1COWG 4LFBO 2GDSA 3H1IH 4MSWC 4JYCA 4GCZA 1J5EO 2EJRA 3CCJV 3K5MA 2CH7B 1NR1A 1S5LZ 3W7WA 5IJ9A 1VQPV 1BMFG 5IJ9B 2UXXA 2GHYA 3UM7A 3OD4A 1OCZC 1GAXA 3HKBB 4FLVA 3E8HA 1O9GA 2HKOA 2HVKC 4MVMA 3ZRSA 2DWEC 3L71H 2Q5ZA 5CB4A 5KX5B 3RYIB 3NXSA 1YEWA 2UXBB 4MVQA 2A9HA 4DV1O 2WLIA 1UJWB 1OCCB 1OCOB 1R73A 4NB5A 1LUWA 5J2TA 2UUCB 3BRCA 1PNLA 3KZIZ 5IYCO 3HKBA 4UCOA 1XMOO 5H6RA 3ZEDA 4CC5A 1FXKC 1M4UA 4OGQB 1AILA 4JI1O 1LNQA 5C93A 4E4EA 1BQ0A 5C8YA 3CB2A 2MW2B 1GMGA 1VF5B 5D5PA 1VQKV 1AR5A 3FAVB 1Q90D 4HYOA 1VF7A 1D2DA 5EZYB 2FL4A 4CS2A 2Y69B 2QM7A 3TETA 3WB0A 1QHTA 5FLXN 4MT8A 3JAKB 1VP7A 2A0LA 4UV9A 5LXTA 1R3IC 3E22A 4EB6B 2EILC 4DV2O 2ZIOA 1R6KA 1XNQO 3AG1B 1R6NA 4ZI7A 2XAGA 4DR3B 4WBNB 2ZIMA 1M9NA 4X1KB 3CCRV 3FYEB 4YJ3B 4PDMA 4KL1A 2EINB 5IJ0A 3ZBHA 4FLXA 1RPRA 1P84F 3QO5A 1VARA 4XDJA 3K3WA 2Q8VA 3ZN1A 3TCUA 2AGAA 2IW5A 1QBZA 1PP9H 5B1NA 3C3TA 1AR1B 2Q67A 3BY6A 1QR9A 1AI6A 2JS3A 3KG2A 1KQSU 1BZKA 4MTOA 4MTXA 1BL8A 5LYJA 4JV5B 4DUZB 2OTLV 1AI7A 1F23A 1BE3H 4UCTA 4NVPA 1JCHA 3THOA 4CS4A 3T1HB 5EBLC 5BZBA 2CTPA 2YEVB 5LOVB 3N2KB 1XQ8A 4CH4A 3W7UA 3OTOO 1IBKB 5TISZ 5KHHA 3AK2A 1E1QG 3KCYA 4DRXB 3LNNA 4LF6B 1ZLZA 1JPXA 4J10A 2YSUB 1VQOV 2F4VB 5H5NA 4IL6Z 3N2GB 4I5SA 4UUJC 2DYSC 3KCXA 3CX5F 1ROPA 3ZMVA 2FMLA 1B04A 3K9AA 5LP6B 3G6BA 2O57A 1YTFB 1KMIZ 3AG2B 4H0LB 4K8XA 1E79G 2EX3A 2A79B 3IGAC 2QWPB 4JYYA 3SYPA 5H6QA 3ETEA 3EHBB 5EK0A 4JI4B 3CCMV 4O4IA 1DGSA 3QF7A 4NTXA 4JI3B 4UVCA 2H94A 4H13B 3G4SV 1W0KG 3JCZA 1GN6A 1G1XB 1PL0A 3SYOA 4GKKB 2WLMA 4UFZA 1KYOF 2LW7A 2ZXWC 3CRCA 4HZ3A 2A06H 4JAVA 2OCHA 1S72V 3CXHF 5B3SC 3T1YB 5LHIA 1FYJA 2Q7EA 1N32O 3JARB 1X59A 1RSOB 5L3GA 2GUZB 3RYHB 5JWPA 4HAMA 2FB5A 4WFHA 1SQQH 4MW8A 4TSFG 4EKWA 2Z5UA 4K3AA 1Q82W 4X65O 2HHHO 4JI1B 3ZS8C 1FXKB 2ZR3A 5KA5A 3DTUB 2AZ0A 1VQ7V 3NR7A 5IE9A 3P3PA 1FXVA 1AB3A 2WSSG 4JYAO 4X1YA 1HNWO 1NJIW 4LC1A 2EIMC 2VQEO 5JH7B 5C8YB 3VQVA 3FB8C 3IFXA 3BVOA 1S0VA 3ASNC 4ZBMA 3Q4HB 3A0RA 2WLLB 5GTIZ 3B4SA 1L1FA 3JD0A 4UVBA 5J9PC 3U10A 1NTMH 3STZC 2Q0AA 5EBWC 4B3MO 1H2LA 3E8FA 2IU0A 1JA8A 3CC7V 1SS3A 3CS5A 1Z2GA 2VS0A 3G80A 2F95B 1P7BA 3BA9A 4PA4A 3RYCA 4YIOA 1H2MA 3ASNB 4B3RB 1W59A 4DYLA 4DV6B 1S5JA 3LSSA 2QWOB 1LUVA 3H1HH 5BMVB 5KAIZ 3WB2A 4LF7B 4OX9B 2F66C 3ASOB 1B6QA 2H8PC 4JGSA 2HJDA 2XT9A 1QU7A 4DR3O 3LSUA 2VQFO 4MS2A 4JI8O 3HKEB 2QEXV 2NN4A 3QO8A 3OTFA 4JI7O 1Q43A 1DLBA 1XILA 1HWYA 2Q69A 1I08A 4OXSA 2X0LA 1DF4A 2A3QA 2ZE6A 1N4CA 2YDEA 1ZL8B 2DJVA 2JVDA 3TGUH 4LNUB 2R9RB 3DSQA 2X7RB 1FFXB 4C7UA 2CE4A 4O4IB 1THZA 3D36C 4JI2B 3MHHC 2Y48A 3M99B 2HR3A 2QWRB 2ADQB 2ITCC 2JDIG 4O2BA 1I94B 3E2EA 1IX9A 1AROP 4N23A 4I9QA 1U97A 3IC7A 2R72A 4OPHA 3ASOC 3F5TA 4A5UB 4I50B 5LHHA 2ZDIC 2BTQA 3AG2C 4TV8B 3GB7C 4X62O 1KP3A 4F4LA 3ZHSA 1NH2B 3VQXA 4QIWF 3APOA 4JI4O 4KFMA 2ZINA 1NZ6A 3SJAC 1FD9A 2XAQA 4XDLA 2QSAA 4JTAB 2L6LA 1VF6C 4LFAB 3FYIB 4YJ2B 3K0GA 4J7ZA 2DE0X 2UXDB 2QKAA 4HNAB 1US6A 4HNAA 1MZEA 2Q0OC 3OE7G 1TUEB 5CB4B 5EC1C 5KX5A 1H38A 1OV9A 5A2QN 3L75H 2XAHA 4O4LB 1WNSA 2GBOA 3VOUA 2E5LO 1JJOA 2OWOA 2WLLA 4IIJB 3IC9A 3UT5A 1NT2B 2DW4A 4ZHQB 4DV3O 2WLHA 4DR5B 4H44B 1K4CC 3VQWA 2P7TC 3O65A 1XNQB 1M1KW 3OEEG 2ZXWB 4GX0A 3CJHB 3B77A 5KHJA 3J80N 4NYKA 4LF9B 1GRJA 4X1YB 5B3SB 5KHIA 2FYUH 2KKWA 3JSLA 4DV5O 2RNBA 2CGNA 4UB8Z 2G38A 4O2AB 4MVUA 5JCOC 4JV5O 4PJ0Z 1URFA 4WBNA 1GH6A 4DR7B 2F4VO 4AQYO 2JEXA 4X88A 2ILMA 3J81N 5LGNA 5IYDO 2YC0A 1WA8A 2IM9A 4PHZA 3ZMUA 4DR6O 2RMKB 2F1MA 3PN1A 4G28B 2ZNJA 2ZDIA 3ML0A 1R3KC 4GZRB 3JAMN 4FLYA 1OJHA 4DR5O 3MDSA 1BSMA 3JD1A 1KUQA 3BABA 2ZE7A 4DV4B 3UO2A 4WFFA 4X20B 1VF6A 5A9GA 1IBKO 1Q81W 3JD3A 2EIKC 1AI4A 4X89A 4EEQA 1K4DC 5BMVA 2CGOA 2PGGA 2DMXA 3ABLC 4FFBA 4JI8B 1JMKC 2E3CA 4H37A 4FLWA 2Y69C 4TWKA 1GO3F 3C3SA 2KG7B 3STLC 3UCSC 5J2TB 3B09A 2W0FC 1QLEB 1K8AW 3A2FA 3RBZA 1HNZB 2PI4A 1PNKA 3QO7A 5CBHA 3RN4A 1GK9A 1SKVA 2QTSA 3CMEV 3L70H 1Q6HA 3T4ZA 1NS1A 2RDCA 3PJSK 4DUYB 5EYPB 4GT1A 1K5QA 4AILC 4F6EA 4DR7O 1PV0A 3ZIAG 4I55B 1SERA 5IYBO 1B3QA 3F7VC 2ZM6B 3ETGA 3M7MX 3JD2A 2CK3G 5EBMC 1H2NA 4GKJO 3JALA 2Q6AA 2YIBA 2KSDA 4LWSB 4X64O 1YHQV 4LP8A 1HNWB 2PZSA 2XNDG 4B3SO 5KLVH 4J11A 2UXCB 2UUBO 1JR9A 2ITDC 2JGUA 3W7SA 3CPWU 4G27B 3ABLB 4DV4O 2MK3A 5IJ0B 1NTKH 5LGTA 4J80A 2DQ3A 3A8TA 3OFNG 5CA1A 3KKYA 1GN4A 1W2BU 4JF3A 2EZOA 1G6UA 5BXZA 1NVPD 4ZI7B 3CP1A 4JI5B 4BW9A 1DK1A 4F6RB 2UU9O 3WFVA 3ZRWA 2ARHA 3CRMA 3U0ZA 4JZ2A 4QNHB 5K1PA 5KMGB 5KHGA 3HR0A 4WF9V 1I5XA 3JAKA 2R9AA 1NBMG 5KA6A 3RYFA 4LF9O 2UXCO 3SYAA 4LF7O 4OX9O 2YIAA 1WA8B 5LGUA 3ABMB 3OR7C 3TJTA 1G4YB 2QM8A 2YIDA 3RW0A 4KHPB 4X8AA 4B3RO 1Z5WA 4B08A 3OMAB 4J42A 1FJGO 4DV7B 3HKEA 1AP5A 3ZJZA 2B1IA 4LF5B 5JVDB 2OCCB 3CMAV 3C90A 1X4TA 4NTYA 3A0HZ 1QQCA 3H1JH 2LFSA 4FMTA 3ABMC 4J9YB 2WA4A 1L0LH 4PDVA 3H1KH 1WP7A 5B5EZ 2F93B 4TT3G 5ITZB 5EIBC 2QKSA 1IXMA 4DR2O 3JALB 5ITZA 4XBFA 1KECA 3JASA 1K33A 4CH6A 1NH2D 5LA6A 3UKMA 2VWKA 4I50A 1EFRG 1MOFA 1F51A 3SYQA 5JVDA 4LFCO 1WAZA 1FAFA 5CN0A 3EVKA 2JIZG 3ICXA 1H8EG 3OW2U 3CCUV 1Q3EA 3JARA 4LNUA 3H01A 1R3LC 2HEPA 1ZL8A 1IURA 4XDKA 1OCZB 2DQ0A 4RQFA 1MSWD 4U3JA 4MVSA 2KQXA 4K8ZA 4P2ZA 1SZXA 4Z2WA 2NLJC 1GKFA 5EC2C 4DV0O 1Z5VA 1YZBA 2B5UA 2OIGA 2XHBA 4NXMO 2L35A 3MAQA 2Y0IA 4O4JA 1IBLB 4CS3A 1GN3A 1ZWIC 5JJJB 4FPPA 1I94O 4TOIA 3RT3C 1SRYA 4FLTA 4JI3O 1OCOC 3F7YC 5JCOA 1GN2A 4DV3B 1K7DA 2YS8A 1Y66A 1RSOA 5KMGA 4G2KA 1PM9A 2YXHA 1FS0G 3L73H 5FPOA 3AK1A 4TUYA 4X66B 3SPHA 3LDEA 5B1OA 4QJFB 4UV8A 1VQ4V 1KKDA 2UUCO 3RGBA 2XUMA 3BCCH 4I55A 5LMUO 3MD0A 4RWUA 2BTOA 5DN6G 3D36A 3QVNA 3D3IA 1IBMO 3ABKC 2UUBB 5JQGB 3N2KA 4JYBA 3CEIA 3U11A 4L87A 5KUMA 3FFQA 3QG5A 4TQDA 4DXWA 1BS3A 4NKGB 2OYQA 4JI6O 3OT7A 4X65B 2QGNA 3TXSA 2Q7GA 4DUZO 3OAAG 1AP6A 3GWOA 5JJNB 2QKCA 4BR6A 1H8HG 4I0XB 4LF4O 3N2GA 1N32B 4PA3A 1SC5B 2NR5A 1TUBA 3L74H 5F2VO 1M93A 5IYZA 3SDLA 4DV2B 3I5DA 2XAJA 3JAWA 1V54C 3CE2A 1OZ0A 1XMOB 3SR2C 3W7XA 5GTHZ 1E1RG 3HB3B 1N0NA 2DYRC 2HLDG 1F7YA 5J2UA 4K0KO 3JD4A 4PA9A 2Q4PA 1YTFD 1PPJH 1BHBA 4JASA 4B3MB 2IBZH 3GWKC 1PL4A 1NR7A 3ETDA 1VQLV 3OGIB 3P30A 4DR1B 4X20A 4ZKIA 4FZ0A 3LUTB 1HW7A 2P6JA 3OMIB 5DM6V 2Z3YA 2JJ1G 1I0HA 1TUBB 2M7WA 1XMQB 2IH3C 4DV7O 1BQZA 4ASUG 2R9IA 4DK1A 4MTGA 1K73W 1JOYA 3RYHA 1NVPB 1Q5OA 2B1GA 2E75B 1IZ3A 2OCCC 3E83A 5B66Z 3B8MA 1N36O 4UCRA 1WJZA 1H2GA 1OCRC 4DV6O 2PYLA 4GX5A 1S76D 4QE9A 3ZHVA 3UT5B 1V54B 2HG5C 2R70A 4O4LA 3RVYA 3G6EV 2YUAA 2P4VA 1JQ0A 4PA7A 4DW1A 4I4TA 2D3OW 1XL4A 3FD9A 5FPRA 4LCUC 1KKCA 3JASB 5KHKA 4LH7A 3OR6C 2P90A 3ETQA 3ZRXA 4AQYB 2QA4V 1TAEA 4BIOA 1TVKB 1TVKA 4X64B 2HJFC 4J9ZB 3ZHTA 3DGEA 3SJQC 5JH7A 1IXBA 4ZHQA 4MTFA 1DF5A 1BGYH 4FK5C 4Q20A 1EZJA 3CCSV 2EJ7A 1EN6A 5CA0B 3L72H 1S77D 2OT5A 3FB6C 2WLJA 1QVFU 1BHAA 5B1BC 2V7QG 1Q86W 5FL7G 3E8GA 4ZOLB 1MNGA 1YDXA 5CBGA 2KG7A 4LBEC 3ABTA 4LFBB 2NNUA 2ODMA 4B3TO 1HNXO 2YIBD 2RJZA 3B2EE 1YIJV 4FLUA 1SQVH 2YI8A 1SF9A 3L9DA 3DXRA 2K1EA 2JRIA 1GTOA 1TGOA 4DR2B 3AG7A 4JTDB 1FFTB 1XDCA 4UCUA 1K5SA 2P5OA 5LMNO 1KD1W 3K06A 4Q6GA 3BEHA 2IJIA 4IYHA 2ZE8A 4QPJA 1ZTEA 2P67A 1IDSA 1R1BA 4P9PA 4B7KA 1AJQA 3X2QB 1Y76B 3DC5A 1N33B 1L0NH 1G8MA 1YJNV 1FJGB 1JJ2U 4H33A 5B1BB 2PF4E 3F5WC 3K08A 3T1HO 4MVZA 2WLKA 3TXQA 4NXNB 4BW5A 5H2FZ 4DRXA 1CEZA 2HFEC 1ORQC 4X1IB 1NU1H 4IGGA 4FFKA 3ZN0A 3HKCB 2XAFA 5LA6B 2PTMA 1WP8A 1NKDA 4DV0B 4FIPC 3IJ4A 4X66O 3N27A 3RFRA 1Q6UA 1RP3B 2CUGA 2N74A 3BA8A 3O9OA 4B3TB 1JFFA 2Z0AA 1VIBA 4ABMA 2X6BA 2XTAA 2DYRB 3DC6A 4IIJA 3FKSG 2QWQB 2QJ1A 5LMNB 3CRAA 4I9WA 1HNZO 2B9ZA 2YXYA 1QLEC 4FM1A 5BY1A 2Q73A 1KC8W 4WCEV 5LHGA 2C2AA 4AHCA 3BFRA 3SGIA 5EYPA 2Y0PA 3BHPA 4CZZA 3ZMTA 5L3FA 4JYAB 2PUSA 5KAFZ 3K5NA 2IH1C 1JX9A 4UCSA 3Q4HA 3RVZA 3K0DA 5D5QA 5IY5B 2GUZA 1N8RW 1HR0O 2RCVA 4EFEA 2QTOA 3LNMB 1SQFA 5E79Z 4TUYB 4X62B 4I4TB 4B3SB 4RUEA 2IU3A 3LDDA 3CWBH 1KU9A 1Q7YW 2W0XA 1OCRB 2ATKC 3CHXA 3JAWB 1KB9F 2PYJA 4GX1A 2HP8A 1VMGA 2P4KA 4X1KA 2EULA 5L3CA 1OHHG 1PD3A 4LFCB 3H9VA 1ZSPA 4PI2A 1WPXA 1M90W 5IWAO 1SESA 2JGDA 1M5IA 1YCIA 5FNVB 1QR8A 2AZ2A 4BAYA 2Y4TA 3CCEV 5LP6C 2P06A 1Y6XA 3ZMSA 5IT9N 2LGWA 1XMQO 1WPBA 3QTCA 3A0BZ 4IT5A 2A7WA 1MABG 2LGQA 1ZUQA 2E5LB 4CH3A 1XOUA 1GM7A 2QWNB 4NXMB 5HFMA 4DR6B 1RFYA 2IJJA 3JCUZ 3OUSA 2DOSA 4W4LA 4MW3A 5LP6A 2OTJV 4E2LA 4JAAA 2AHZA 4P9OA 1VQ8V 3P3NA 1MMMA 1JVMA 1YJ9V 3S3WA 2QM4A 3W7TA 2QDOA 1SQBH 1HNXB 3SJCC 2M6YA 1N34O 3CD6V 4FVMA 2ADPA 4X1IA 4QE7A 4KP4A 1N36B 1L8DA 1MG1A 1WB8A 2CAZC 1YJWV 5BR8O 3GVMA 3CC4V 1AI5A 5LOVA 1TA8A 3K03A 2UUAB 5EIBD 5IWAB 4LFAO 1Y76A 1JFFB 5E1AC 4U7OA 2FKXA 4LF5O 4TV8A 3I55V 2LFRA 5L3DA 1N34B 2LJ2A 1SQPH 1VQ9V 2XOKG 4U3JB 4BIUA 4LH6A 1QNMA 4ZIBA 3CCLV 4FJCC 3HKCA 3R66A 4EB6A 4J7JA 3X2QC 1NI8A 4MVRA 5HFLA 2N05A 3ZHUA 2GSMB 3E22B 2HVJC 1WLEA 1O9HA 4O2AA 3HPLC 1H2KA 4O4JB 1XREA 4GKJB 1AJNA 4MVOA 5CBFA 3J7AU 4F6RA 1SETA 4YJ3A 5EZYA 1R3JC 2WLNA 1OCCC 5LBQA 1QVGU 4IYIA 1YSCA 4WFAV 1Y4MA 1MSDA 4RQEA 2YICA 1BT8A 3RWRD
chains in the Genus database with same CATH topology
3OGIB 3Q4HA 2KG7B 2VRZA 2B9ZA 3TXSA 3FD9A 2AZ2A 2VS0A 3G80A 2KG7A 3Q4HB 3ZBHA 1WA8A 1WA8B 4I0XB 3FAVA 4LWSA 4LWSB 3FAVB 2AZ0A 2DE0X 3GVMA 3TXQA 3O9OA 3GWKC 3HR0A 4GZRB 4ABMA 4I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGI B;  3Q4H A;  2KG7 B;  2VRZ A;  2B9Z A;  3TXS A;  3FD9 A;  2AZ2 A;  2VS0 A;  3G80 A;  2KG7 A;  3Q4H B;  3ZBH A;  1WA8 A;  1WA8 B;  4I0X B;  3FAV A;  4LWS A;  4LWS B;  3FAV B;  2AZ0 A;  2DE0 X;  3GVM A;  3TXQ A;  3O9O A;  3GWK C;  3HR0 A;  4GZR B;  4ABM A;  4I0X A; 
#chains in the Genus database with same CATH topology
 4TQF A;  4Z1V A;  4I7Z B;  5CA0 A;  1YXB A;  5B1A C;  4JI2 O;  3E35 A;  1Y74 A;  1HR0 B;  3DXR B;  5IY5 C;  4NTW A;  2E74 B;  4YIP A;  4R6Z A;  1CXZ B;  4GLX A;  3MHS C;  4I0X A;  4DO2 A;  2ZNI A;  4PEL A;  1FKA O;  2WWW A;  2ZKO A;  3CJH A;  1A32 A;  4B7E A;  4O4H A;  3CYO A;  1RM1 C;  2K9P A;  2CDY A;  1MZF A;  3RYC B;  1GM8 A;  2WLI B;  3E8B A;  3TK1 A;  3M8A A;  1UFI A;  5KUK A;  1Y74 B;  1K92 A;  1QCE A;  1RPO A;  5K1X A;  4O2B B;  3K58 A;  4LF8 O;  2YXL A;  3B8N A;  2EIN C;  1IBL O;  4WFG A;  2W6J G;  1D5A A;  4R7C A;  2DN9 A;  4TV9 A;  1XEQ A;  4JI7 B;  4U3F H;  3CSX A;  1P7G A;  2X6C A;  4ICG A;  2PY5 A;  1XL6 A;  2JGD B;  4W4K A;  2Q68 A;  1S5H C;  4RAI A;  1HP8 A;  1M56 C;  4NXN O;  4PD4 F;  2VRZ A;  2CH7 A;  3D3Q A;  4JI0 O;  2D2C B;  4J7K A;  1K97 A;  1V55 B;  2ZD9 A;  4IHJ A;  4CC6 A;  4YY3 B;  5AG2 A;  3LDC A;  3OTO B;  3K5O A;  1VQ6 V;  1D5N A;  5BR8 B;  3K9S A;  3S3X A;  1RM1 B;  3EFF K;  4GUN A;  3K57 A;  1FFX A;  1SQG A;  1Q6I A;  2EIJ B;  3D8C A;  1XHZ A;  3WU2 Z;  3CRQ A;  3R65 A;  2YI9 A;  2FTK A;  3WG7 C;  3E86 A;  1YF2 A;  4LWS A;  5CA1 B;  2W6I G;  3K5L A;  1SA0 A;  2RN9 A;  3CRR A;  4JI6 B;  3ZMZ A;  4QGP A;  4DR1 O;  4KUM A;  2LP7 A;  2UUA O;  4PA6 A;  3AK3 A;  2JEU A;  2CTW A;  4QPK A;  1ZX3 A;  1BCC H;  5JJE B;  4HBN A;  2ZQM A;  2EBO A;  4DR4 O;  4PV1 B;  3AG3 C;  2F43 G;  2LW1 A;  1M56 B;  3OUF A;  2JK5 C;  1V9P A;  2XAS A;  4JI0 B;  4U7N A;  2WPD G;  3SPG A;  4JZG A;  3UQ8 A;  4GYC B;  2QE7 G;  3AEI A;  5GON B;  3ZHR A;  4FZ1 A;  4KHP O;  4RO2 A;  2VQF B;  2F23 A;  2Q9L A;  1UPG A;  4JTC B;  3HKD A;  5L3E A;  4RUF A;  3HKD B;  3SYC A;  3K79 A;  1XNR B;  3ZCC A;  3VQY A;  1Y67 A;  4JPR A;  4ZOL A;  2AXT Z;  2AW9 A;  2KB1 A;  3P32 A;  3H1L H;  5DEC A;  5GW7 A;  2UXN A;  2GTS A;  1XHX A;  1K34 A;  5H9C A;  3ABU A;  3FB5 C;  1VQN V;  3T1Y O;  2AHY A;  2YEV A;  3AG4 C;  1AVM A;  1PKX A;  1XBL A;  2UU9 B;  4UCV A;  4D7S A;  4D7T A;  2OIE A;  1YI2 V;  3WB1 A;  3ZX6 A;  3G71 V;  4PI0 A;  3QNE A;  2IJH A;  4R50 A;  3CXC U;  1FPO A;  2BSK A;  3T1C A;  4WFB V;  3ZRV A;  1K3E A;  1SQX H;  3AG3 B;  2CTR A;  4YXW G;  1ZAU A;  2EIM B;  1P4R A;  3T4D A;  1I7F A;  4PDR A;  1KBH A;  3ABK B;  3CCQ V;  3AG4 B;  4DK0 A;  4DR4 B;  1T5E A;  4IHJ B;  3JAT B;  4NR1 A;  1F4N A;  1S3J A;  4FM0 A;  2BE3 A;  3JAT A;  2BOB C;  5B1A B;  2QR4 A;  1YIT V;  1NTZ H;  5FNV A;  4BIZ A;  1M57 C;  4FFB B;  1Q8I A;  2Y4U A;  1LR1 A;  2CTQ A;  5LL6 Y;  4DV1 B;  2BSK B;  1ENV A;  4KXR A;  5CMU A;  4LF8 B;  2UXB O;  1GM9 A;  1AR4 A;  1XI1 A;  5J2U B;  4DV5 B;  2WA3 A;  1W0J G;  2V1D A;  3CCV V;  2ZM6 O;  5LXT B;  5LMU B;  2JS5 A;  5IYZ B;  3I56 V;  4LR3 A;  2P22 C;  4R8C A;  4N21 A;  2EIL B;  4YY3 O;  4WFE A;  3B40 A;  3AG1 C;  2GTA A;  2WAM A;  4K0K B;  2N04 A;  3SJB C;  4CBC A;  4BWA A;  3APQ A;  2VWJ A;  1EZV H;  2RQ6 A;  4J41 A;  1VQM V;  3FAV A;  4CH5 A;  4YHH O;  3SPJ A;  1AJP A;  1MA1 A;  3IAY A;  2DWD C;  2BCC H;  4UVA A;  2LO1 A;  3K59 A;  4UXN A;  4EFB A;  2HHH B;  1EN4 A;  1N33 O;  1QLN A;  4LF4 B;  1U96 A;  1M57 B;  3FB7 C;  1SZT A;  2BTQ B;  4GKK O;  1IBM B;  2LQT A;  1PNM A;  3RYI A;  1WB7 A;  2VQE B;  3OEH G;  3WG7 B;  4DW0 A;  2X6A A;  4YHH B;  5JQG A;  5CA3 A;  1P49 A;  2IJK A;  4PDL A;  3LSQ A;  2EZP A;  3BAA A;  3UO3 A;  1J5E B;  1CPY A;  4UB6 Z;  4X9Q A;  2ZCE A;  4YJ2 A;  1SA0 B;  4Z1M G;  4AI8 A;  3ZHQ A;  4O4H B;  1IVS A;  3T2M A;  3VBB A;  4JI5 O;  2JJ2 G;  1KP2 A;  1XUQ A;  1EN5 A;  3JYC A;  1R6T A;  5LYJ B;  1B06 A;  4L8J A;  2EIJ C;  4FM2 A;  1WN7 A;  1NQT A;  5IDJ A;  3E89 A;  3SPI A;  1K9M W;  5GON A;  2PI5 A;  3G67 A;  4P30 A;  2E76 B;  4LF6 O;  1CP9 A;  4OPA A;  2Q7H A;  4JAU A;  4D6T H;  1FXK A;  1I5Y A;  3OM3 B;  3EXA A;  1DTO A;  1XNR O;  1HDJ A;  3BPZ A;  3JSN A;  3CC2 V;  4K35 A;  2DYS B;  1EM1 A;  3FX7 A;  2EIK B;  3ZRW B;  1FXH A;  1VEW A;  2ZT9 B;  1YVW A;  3K04 A;  4GX2 A;  4FLZ A;  5L3B A;  1EBO A;  2H3O A;  1N0J A;  4TV9 B;  2ZR2 A;  3RYF B;  3OGC C;  3SPC A;  2BOC C;  2GV9 A;  1F4M A;  2ZE5 A;  1V55 C;  2V4D A;  3OMN B;  5DED A;  1J95 A;  4DUY O;  2ETN A;  1H2S B;  1VQ5 V;  2UXD O;  1COW G;  4LFB O;  2GDS A;  3H1I H;  4MSW C;  4JYC A;  4GCZ A;  1J5E O;  2EJR A;  3CCJ V;  3K5M A;  2CH7 B;  1NR1 A;  1S5L Z;  3W7W A;  5IJ9 A;  1VQP V;  1BMF G;  5IJ9 B;  2UXX A;  2GHY A;  3UM7 A;  3OD4 A;  1OCZ C;  1GAX A;  3HKB B;  4FLV A;  3E8H A;  1O9G A;  2HKO A;  2HVK C;  4MVM A;  3ZRS A;  2DWE C;  3L71 H;  2Q5Z A;  5CB4 A;  5KX5 B;  3RYI B;  3NXS A;  1YEW A;  2UXB B;  4MVQ A;  2A9H A;  4DV1 O;  2WLI A;  1UJW B;  1OCC B;  1OCO B;  1R73 A;  4NB5 A;  1LUW A;  5J2T A;  2UUC B;  3BRC A;  1PNL A;  3KZI Z;  5IYC O;  3HKB A;  4UCO A;  1XMO O;  5H6R A;  3ZED A;  4CC5 A;  1FXK C;  1M4U A;  4OGQ B;  1AIL A;  4JI1 O;  1LNQ A;  5C93 A;  4E4E A;  1BQ0 A;  5C8Y A;  3CB2 A;  2MW2 B;  1GMG A;  1VF5 B;  5D5P A;  1VQK V;  1AR5 A;  3FAV B;  1Q90 D;  4HYO A;  1VF7 A;  1D2D A;  5EZY B;  2FL4 A;  4CS2 A;  2Y69 B;  2QM7 A;  3TET A;  3WB0 A;  1QHT A;  5FLX N;  4MT8 A;  3JAK B;  1VP7 A;  2A0L A;  4UV9 A;  5LXT A;  1R3I C;  3E22 A;  4EB6 B;  2EIL C;  4DV2 O;  2ZIO A;  1R6K A;  1XNQ O;  3AG1 B;  1R6N A;  4ZI7 A;  2XAG A;  4DR3 B;  4WBN B;  2ZIM A;  1M9N A;  4X1K B;  3CCR V;  3FYE B;  4YJ3 B;  4PDM A;  4KL1 A;  2EIN B;  5IJ0 A;  3ZBH A;  4FLX A;  1RPR A;  1P84 F;  3QO5 A;  1VAR A;  4XDJ A;  3K3W A;  2Q8V A;  3ZN1 A;  3TCU A;  2AGA A;  2IW5 A;  1QBZ A;  1PP9 H;  5B1N A;  3C3T A;  1AR1 B;  2Q67 A;  3BY6 A;  1QR9 A;  1AI6 A;  2JS3 A;  3KG2 A;  1KQS U;  1BZK A;  4MTO A;  4MTX A;  1BL8 A;  5LYJ A;  4JV5 B;  4DUZ B;  2OTL V;  1AI7 A;  1F23 A;  1BE3 H;  4UCT A;  4NVP A;  1JCH A;  3THO A;  4CS4 A;  3T1H B;  5EBL C;  5BZB A;  2CTP A;  2YEV B;  5LOV B;  3N2K B;  1XQ8 A;  4CH4 A;  3W7U A;  3OTO O;  1IBK B;  5TIS Z;  5KHH A;  3AK2 A;  1E1Q G;  3KCY A;  4DRX B;  3LNN A;  4LF6 B;  1ZLZ A;  1JPX A;  4J10 A;  2YSU B;  1VQO V;  2F4V B;  5H5N A;  4IL6 Z;  3N2G B;  4I5S A;  4UUJ C;  2DYS C;  3KCX A;  3CX5 F;  1ROP A;  3ZMV A;  2FML A;  1B04 A;  3K9A A;  5LP6 B;  3G6B A;  2O57 A;  1YTF B;  1KMI Z;  3AG2 B;  4H0L B;  4K8X A;  1E79 G;  2EX3 A;  2A79 B;  3IGA C;  2QWP B;  4JYY A;  3SYP A;  5H6Q A;  3ETE A;  3EHB B;  5EK0 A;  4JI4 B;  3CCM V;  4O4I A;  1DGS A;  3QF7 A;  4NTX A;  4JI3 B;  4UVC A;  2H94 A;  4H13 B;  3G4S V;  1W0K G;  3JCZ A;  1GN6 A;  1G1X B;  1PL0 A;  3SYO A;  4GKK B;  2WLM A;  4UFZ A;  1KYO F;  2LW7 A;  2ZXW C;  3CRC A;  4HZ3 A;  2A06 H;  4JAV A;  2OCH A;  1S72 V;  3CXH F;  5B3S C;  3T1Y B;  5LHI A;  1FYJ A;  2Q7E A;  1N32 O;  3JAR B;  1X59 A;  1RSO B;  5L3G A;  2GUZ B;  3RYH B;  5JWP A;  4HAM A;  2FB5 A;  4WFH A;  1SQQ H;  4MW8 A;  4TSF G;  4EKW A;  2Z5U A;  4K3A A;  1Q82 W;  4X65 O;  2HHH O;  4JI1 B;  3ZS8 C;  1FXK B;  2ZR3 A;  5KA5 A;  3DTU B;  2AZ0 A;  1VQ7 V;  3NR7 A;  5IE9 A;  3P3P A;  1FXV A;  1AB3 A;  2WSS G;  4JYA O;  4X1Y A;  1HNW O;  1NJI W;  4LC1 A;  2EIM C;  2VQE O;  5JH7 B;  5C8Y B;  3VQV A;  3FB8 C;  3IFX A;  3BVO A;  1S0V A;  3ASN C;  4ZBM A;  3Q4H B;  3A0R A;  2WLL B;  5GTI Z;  3B4S A;  1L1F A;  3JD0 A;  4UVB A;  5J9P C;  3U10 A;  1NTM H;  3STZ C;  2Q0A A;  5EBW C;  4B3M O;  1H2L A;  3E8F A;  2IU0 A;  1JA8 A;  3CC7 V;  1SS3 A;  3CS5 A;  1Z2G A;  2VS0 A;  3G80 A;  2F95 B;  1P7B A;  3BA9 A;  4PA4 A;  3RYC A;  4YIO A;  1H2M A;  3ASN B;  4B3R B;  1W59 A;  4DYL A;  4DV6 B;  1S5J A;  3LSS A;  2QWO B;  1LUV A;  3H1H H;  5BMV B;  5KAI Z;  3WB2 A;  4LF7 B;  4OX9 B;  2F66 C;  3ASO B;  1B6Q A;  2H8P C;  4JGS A;  2HJD A;  2XT9 A;  1QU7 A;  4DR3 O;  3LSU A;  2VQF O;  4MS2 A;  4JI8 O;  3HKE B;  2QEX V;  2NN4 A;  3QO8 A;  3OTF A;  4JI7 O;  1Q43 A;  1DLB A;  1XIL A;  1HWY A;  2Q69 A;  1I08 A;  4OXS A;  2X0L A;  1DF4 A;  2A3Q A;  2ZE6 A;  1N4C A;  2YDE A;  1ZL8 B;  2DJV A;  2JVD A;  3TGU H;  4LNU B;  2R9R B;  3DSQ A;  2X7R B;  1FFX B;  4C7U A;  2CE4 A;  4O4I B;  1THZ A;  3D36 C;  4JI2 B;  3MHH C;  2Y48 A;  3M99 B;  2HR3 A;  2QWR B;  2ADQ B;  2ITC C;  2JDI G;  4O2B A;  1I94 B;  3E2E A;  1IX9 A;  1ARO P;  4N23 A;  4I9Q A;  1U97 A;  3IC7 A;  2R72 A;  4OPH A;  3ASO C;  3F5T A;  4A5U B;  4I50 B;  5LHH A;  2ZDI C;  2BTQ A;  3AG2 C;  4TV8 B;  3GB7 C;  4X62 O;  1KP3 A;  4F4L A;  3ZHS A;  1NH2 B;  3VQX A;  4QIW F;  3APO A;  4JI4 O;  4KFM A;  2ZIN A;  1NZ6 A;  3SJA C;  1FD9 A;  2XAQ A;  4XDL A;  2QSA A;  4JTA B;  2L6L A;  1VF6 C;  4LFA B;  3FYI B;  4YJ2 B;  3K0G A;  4J7Z A;  2DE0 X;  2UXD B;  2QKA A;  4HNA B;  1US6 A;  4HNA A;  1MZE A;  2Q0O C;  3OE7 G;  1TUE B;  5CB4 B;  5EC1 C;  5KX5 A;  1H38 A;  1OV9 A;  5A2Q N;  3L75 H;  2XAH A;  4O4L B;  1WNS A;  2GBO A;  3VOU A;  2E5L O;  1JJO A;  2OWO A;  2WLL A;  4IIJ B;  3IC9 A;  3UT5 A;  1NT2 B;  2DW4 A;  4ZHQ B;  4DV3 O;  2WLH A;  4DR5 B;  4H44 B;  1K4C C;  3VQW A;  2P7T C;  3O65 A;  1XNQ B;  1M1K W;  3OEE G;  2ZXW B;  4GX0 A;  3CJH B;  3B77 A;  5KHJ A;  3J80 N;  4NYK A;  4LF9 B;  1GRJ A;  4X1Y B;  5B3S B;  5KHI A;  2FYU H;  2KKW A;  3JSL A;  4DV5 O;  2RNB A;  2CGN A;  4UB8 Z;  2G38 A;  4O2A B;  4MVU A;  5JCO C;  4JV5 O;  4PJ0 Z;  1URF A;  4WBN A;  1GH6 A;  4DR7 B;  2F4V O;  4AQY O;  2JEX A;  4X88 A;  2ILM A;  3J81 N;  5LGN A;  5IYD O;  2YC0 A;  1WA8 A;  2IM9 A;  4PHZ A;  3ZMU A;  4DR6 O;  2RMK B;  2F1M A;  3PN1 A;  4G28 B;  2ZNJ A;  2ZDI A;  3ML0 A;  1R3K C;  4GZR B;  3JAM N;  4FLY A;  1OJH A;  4DR5 O;  3MDS A;  1BSM A;  3JD1 A;  1KUQ A;  3BAB A;  2ZE7 A;  4DV4 B;  3UO2 A;  4WFF A;  4X20 B;  1VF6 A;  5A9G A;  1IBK O;  1Q81 W;  3JD3 A;  2EIK C;  1AI4 A;  4X89 A;  4EEQ A;  1K4D C;  5BMV A;  2CGO A;  2PGG A;  2DMX A;  3ABL C;  4FFB A;  4JI8 B;  1JMK C;  2E3C A;  4H37 A;  4FLW A;  2Y69 C;  4TWK A;  1GO3 F;  3C3S A;  2KG7 B;  3STL C;  3UCS C;  5J2T B;  3B09 A;  2W0F C;  1QLE B;  1K8A W;  3A2F A;  3RBZ A;  1HNZ B;  2PI4 A;  1PNK A;  3QO7 A;  5CBH A;  3RN4 A;  1GK9 A;  1SKV A;  2QTS A;  3CME V;  3L70 H;  1Q6H A;  3T4Z A;  1NS1 A;  2RDC A;  3PJS K;  4DUY B;  5EYP B;  4GT1 A;  1K5Q A;  4AIL C;  4F6E A;  4DR7 O;  1PV0 A;  3ZIA G;  4I55 B;  1SER A;  5IYB O;  1B3Q A;  3F7V C;  2ZM6 B;  3ETG A;  3M7M X;  3JD2 A;  2CK3 G;  5EBM C;  1H2N A;  4GKJ O;  3JAL A;  2Q6A A;  2YIB A;  2KSD A;  4LWS B;  4X64 O;  1YHQ V;  4LP8 A;  1HNW B;  2PZS A;  2XND G;  4B3S O;  5KLV H;  4J11 A;  2UXC B;  2UUB O;  1JR9 A;  2ITD C;  2JGU A;  3W7S A;  3CPW U;  4G27 B;  3ABL B;  4DV4 O;  2MK3 A;  5IJ0 B;  1NTK H;  5LGT A;  4J80 A;  2DQ3 A;  3A8T A;  3OFN G;  5CA1 A;  3KKY A;  1GN4 A;  1W2B U;  4JF3 A;  2EZO A;  1G6U A;  5BXZ A;  1NVP D;  4ZI7 B;  3CP1 A;  4JI5 B;  4BW9 A;  1DK1 A;  4F6R B;  2UU9 O;  3WFV A;  3ZRW A;  2ARH A;  3CRM A;  3U0Z A;  4JZ2 A;  4QNH B;  5K1P A;  5KMG B;  5KHG A;  3HR0 A;  4WF9 V;  1I5X A;  3JAK A;  2R9A A;  1NBM G;  5KA6 A;  3RYF A;  4LF9 O;  2UXC O;  3SYA A;  4LF7 O;  4OX9 O;  2YIA A;  1WA8 B;  5LGU A;  3ABM B;  3OR7 C;  3TJT A;  1G4Y B;  2QM8 A;  2YID A;  3RW0 A;  4KHP B;  4X8A A;  4B3R O;  1Z5W A;  4B08 A;  3OMA B;  4J42 A;  1FJG O;  4DV7 B;  3HKE A;  1AP5 A;  3ZJZ A;  2B1I A;  4LF5 B;  5JVD B;  2OCC B;  3CMA V;  3C90 A;  1X4T A;  4NTY A;  3A0H Z;  1QQC A;  3H1J H;  2LFS A;  4FMT A;  3ABM C;  4J9Y B;  2WA4 A;  1L0L H;  4PDV A;  3H1K H;  1WP7 A;  5B5E Z;  2F93 B;  4TT3 G;  5ITZ B;  5EIB C;  2QKS A;  1IXM A;  4DR2 O;  3JAL B;  5ITZ A;  4XBF A;  1KEC A;  3JAS A;  1K33 A;  4CH6 A;  1NH2 D;  5LA6 A;  3UKM A;  2VWK A;  4I50 A;  1EFR G;  1MOF A;  1F51 A;  3SYQ A;  5JVD A;  4LFC O;  1WAZ A;  1FAF A;  5CN0 A;  3EVK A;  2JIZ G;  3ICX A;  1H8E G;  3OW2 U;  3CCU V;  1Q3E A;  3JAR A;  4LNU A;  3H01 A;  1R3L C;  2HEP A;  1ZL8 A;  1IUR A;  4XDK A;  1OCZ B;  2DQ0 A;  4RQF A;  1MSW D;  4U3J A;  4MVS A;  2KQX A;  4K8Z A;  4P2Z A;  1SZX A;  4Z2W A;  2NLJ C;  1GKF A;  5EC2 C;  4DV0 O;  1Z5V A;  1YZB A;  2B5U A;  2OIG A;  2XHB A;  4NXM O;  2L35 A;  3MAQ A;  2Y0I A;  4O4J A;  1IBL B;  4CS3 A;  1GN3 A;  1ZWI C;  5JJJ B;  4FPP A;  1I94 O;  4TOI A;  3RT3 C;  1SRY A;  4FLT A;  4JI3 O;  1OCO C;  3F7Y C;  5JCO A;  1GN2 A;  4DV3 B;  1K7D A;  2YS8 A;  1Y66 A;  1RSO A;  5KMG A;  4G2K A;  1PM9 A;  2YXH A;  1FS0 G;  3L73 H;  5FPO A;  3AK1 A;  4TUY A;  4X66 B;  3SPH A;  3LDE A;  5B1O A;  4QJF B;  4UV8 A;  1VQ4 V;  1KKD A;  2UUC O;  3RGB A;  2XUM A;  3BCC H;  4I55 A;  5LMU O;  3MD0 A;  4RWU A;  2BTO A;  5DN6 G;  3D36 A;  3QVN A;  3D3I A;  1IBM O;  3ABK C;  2UUB B;  5JQG B;  3N2K A;  4JYB A;  3CEI A;  3U11 A;  4L87 A;  5KUM A;  3FFQ A;  3QG5 A;  4TQD A;  4DXW A;  1BS3 A;  4NKG B;  2OYQ A;  4JI6 O;  3OT7 A;  4X65 B;  2QGN A;  3TXS A;  2Q7G A;  4DUZ O;  3OAA G;  1AP6 A;  3GWO A;  5JJN B;  2QKC A;  4BR6 A;  1H8H G;  4I0X B;  4LF4 O;  3N2G A;  1N32 B;  4PA3 A;  1SC5 B;  2NR5 A;  1TUB A;  3L74 H;  5F2V O;  1M93 A;  5IYZ A;  3SDL A;  4DV2 B;  3I5D A;  2XAJ A;  3JAW A;  1V54 C;  3CE2 A;  1OZ0 A;  1XMO B;  3SR2 C;  3W7X A;  5GTH Z;  1E1R G;  3HB3 B;  1N0N A;  2DYR C;  2HLD G;  1F7Y A;  5J2U A;  4K0K O;  3JD4 A;  4PA9 A;  2Q4P A;  1YTF D;  1PPJ H;  1BHB A;  4JAS A;  4B3M B;  2IBZ H;  3GWK C;  1PL4 A;  1NR7 A;  3ETD A;  1VQL V;  3OGI B;  3P30 A;  4DR1 B;  4X20 A;  4ZKI A;  4FZ0 A;  3LUT B;  1HW7 A;  2P6J A;  3OMI B;  5DM6 V;  2Z3Y A;  2JJ1 G;  1I0H A;  1TUB B;  2M7W A;  1XMQ B;  2IH3 C;  4DV7 O;  1BQZ A;  4ASU G;  2R9I A;  4DK1 A;  4MTG A;  1K73 W;  1JOY A;  3RYH A;  1NVP B;  1Q5O A;  2B1G A;  2E75 B;  1IZ3 A;  2OCC C;  3E83 A;  5B66 Z;  3B8M A;  1N36 O;  4UCR A;  1WJZ A;  1H2G A;  1OCR C;  4DV6 O;  2PYL A;  4GX5 A;  1S76 D;  4QE9 A;  3ZHV A;  3UT5 B;  1V54 B;  2HG5 C;  2R70 A;  4O4L A;  3RVY A;  3G6E V;  2YUA A;  2P4V A;  1JQ0 A;  4PA7 A;  4DW1 A;  4I4T A;  2D3O W;  1XL4 A;  3FD9 A;  5FPR A;  4LCU C;  1KKC A;  3JAS B;  5KHK A;  4LH7 A;  3OR6 C;  2P90 A;  3ETQ A;  3ZRX A;  4AQY B;  2QA4 V;  1TAE A;  4BIO A;  1TVK B;  1TVK A;  4X64 B;  2HJF C;  4J9Z B;  3ZHT A;  3DGE A;  3SJQ C;  5JH7 A;  1IXB A;  4ZHQ A;  4MTF A;  1DF5 A;  1BGY H;  4FK5 C;  4Q20 A;  1EZJ A;  3CCS V;  2EJ7 A;  1EN6 A;  5CA0 B;  3L72 H;  1S77 D;  2OT5 A;  3FB6 C;  2WLJ A;  1QVF U;  1BHA A;  5B1B C;  2V7Q G;  1Q86 W;  5FL7 G;  3E8G A;  4ZOL B;  1MNG A;  1YDX A;  5CBG A;  2KG7 A;  4LBE C;  3ABT A;  4LFB B;  2NNU A;  2ODM A;  4B3T O;  1HNX O;  2YIB D;  2RJZ A;  3B2E E;  1YIJ V;  4FLU A;  1SQV H;  2YI8 A;  1SF9 A;  3L9D A;  3DXR A;  2K1E A;  2JRI A;  1GTO A;  1TGO A;  4DR2 B;  3AG7 A;  4JTD B;  1FFT B;  1XDC A;  4UCU A;  1K5S A;  2P5O A;  5LMN O;  1KD1 W;  3K06 A;  4Q6G A;  3BEH A;  2IJI A;  4IYH A;  2ZE8 A;  4QPJ A;  1ZTE A;  2P67 A;  1IDS A;  1R1B A;  4P9P A;  4B7K A;  1AJQ A;  3X2Q B;  1Y76 B;  3DC5 A;  1N33 B;  1L0N H;  1G8M A;  1YJN V;  1FJG B;  1JJ2 U;  4H33 A;  5B1B B;  2PF4 E;  3F5W C;  3K08 A;  3T1H O;  4MVZ A;  2WLK A;  3TXQ A;  4NXN B;  4BW5 A;  5H2F Z;  4DRX A;  1CEZ A;  2HFE C;  1ORQ C;  4X1I B;  1NU1 H;  4IGG A;  4FFK A;  3ZN0 A;  3HKC B;  2XAF A;  5LA6 B;  2PTM A;  1WP8 A;  1NKD A;  4DV0 B;  4FIP C;  3IJ4 A;  4X66 O;  3N27 A;  3RFR A;  1Q6U A;  1RP3 B;  2CUG A;  2N74 A;  3BA8 A;  3O9O A;  4B3T B;  1JFF A;  2Z0A A;  1VIB A;  4ABM A;  2X6B A;  2XTA A;  2DYR B;  3DC6 A;  4IIJ A;  3FKS G;  2QWQ B;  2QJ1 A;  5LMN B;  3CRA A;  4I9W A;  1HNZ O;  2B9Z A;  2YXY A;  1QLE C;  4FM1 A;  5BY1 A;  2Q73 A;  1KC8 W;  4WCE V;  5LHG A;  2C2A A;  4AHC A;  3BFR A;  3SGI A;  5EYP A;  2Y0P A;  3BHP A;  4CZZ A;  3ZMT A;  5L3F A;  4JYA B;  2PUS A;  5KAF Z;  3K5N A;  2IH1 C;  1JX9 A;  4UCS A;  3Q4H A;  3RVZ A;  3K0D A;  5D5Q A;  5IY5 B;  2GUZ A;  1N8R W;  1HR0 O;  2RCV A;  4EFE A;  2QTO A;  3LNM B;  1SQF A;  5E79 Z;  4TUY B;  4X62 B;  4I4T B;  4B3S B;  4RUE A;  2IU3 A;  3LDD A;  3CWB H;  1KU9 A;  1Q7Y W;  2W0X A;  1OCR B;  2ATK C;  3CHX A;  3JAW B;  1KB9 F;  2PYJ A;  4GX1 A;  2HP8 A;  1VMG A;  2P4K A;  4X1K A;  2EUL A;  5L3C A;  1OHH G;  1PD3 A;  4LFC B;  3H9V A;  1ZSP A;  4PI2 A;  1WPX A;  1M90 W;  5IWA O;  1SES A;  2JGD A;  1M5I A;  1YCI A;  5FNV B;  1QR8 A;  2AZ2 A;  4BAY A;  2Y4T A;  3CCE V;  5LP6 C;  2P06 A;  1Y6X A;  3ZMS A;  5IT9 N;  2LGW A;  1XMQ O;  1WPB A;  3QTC A;  3A0B Z;  4IT5 A;  2A7W A;  1MAB G;  2LGQ A;  1ZUQ A;  2E5L B;  4CH3 A;  1XOU A;  1GM7 A;  2QWN B;  4NXM B;  5HFM A;  4DR6 B;  1RFY A;  2IJJ A;  3JCU Z;  3OUS A;  2DOS A;  4W4L A;  4MW3 A;  5LP6 A;  2OTJ V;  4E2L A;  4JAA A;  2AHZ A;  4P9O A;  1VQ8 V;  3P3N A;  1MMM A;  1JVM A;  1YJ9 V;  3S3W A;  2QM4 A;  3W7T A;  2QDO A;  1SQB H;  1HNX B;  3SJC C;  2M6Y A;  1N34 O;  3CD6 V;  4FVM A;  2ADP A;  4X1I A;  4QE7 A;  4KP4 A;  1N36 B;  1L8D A;  1MG1 A;  1WB8 A;  2CAZ C;  1YJW V;  5BR8 O;  3GVM A;  3CC4 V;  1AI5 A;  5LOV A;  1TA8 A;  3K03 A;  2UUA B;  5EIB D;  5IWA B;  4LFA O;  1Y76 A;  1JFF B;  5E1A C;  4U7O A;  2FKX A;  4LF5 O;  4TV8 A;  3I55 V;  2LFR A;  5L3D A;  1N34 B;  2LJ2 A;  1SQP H;  1VQ9 V;  2XOK G;  4U3J B;  4BIU A;  4LH6 A;  1QNM A;  4ZIB A;  3CCL V;  4FJC C;  3HKC A;  3R66 A;  4EB6 A;  4J7J A;  3X2Q C;  1NI8 A;  4MVR A;  5HFL A;  2N05 A;  3ZHU A;  2GSM B;  3E22 B;  2HVJ C;  1WLE A;  1O9H A;  4O2A A;  3HPL C;  1H2K A;  4O4J B;  1XRE A;  4GKJ B;  1AJN A;  4MVO A;  5CBF A;  3J7A U;  4F6R A;  1SET A;  4YJ3 A;  5EZY A;  1R3J C;  2WLN A;  1OCC C;  5LBQ A;  1QVG U;  4IYI A;  1YSC A;  4WFA V;  1Y4M A;  1MSD A;  4RQE A;  2YIC A;  1BT8 A;  3RWR D; 
#chains in the Genus database with same CATH homology
 3OGI B;  3Q4H A;  2KG7 B;  2VRZ A;  2B9Z A;  3TXS A;  3FD9 A;  2AZ2 A;  2VS0 A;  3G80 A;  2KG7 A;  3Q4H B;  3ZBH A;  1WA8 A;  1WA8 B;  4I0X B;  3FAV A;  4LWS A;  4LWS B;  3FAV B;  2AZ0 A;  2DE0 X;  3GVM A;  3TXQ A;  3O9O A;  3GWK C;  3HR0 A;  4GZR B;  4ABM A;  4I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...