3ZBHA

Geobacillus thermodenitrificans esxa crystal form i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
90
structure length
90
Chain Sequence
LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESXA
publication title Crystal Structure of the Homodimeric Esat-6-Family Proteins Esxa and Esxb from Geobacillus Thermodenitrificans
rcsb
molecule tags Unknown function
total genus 41
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3zbhA00
3ZBHA 4ABMA 2VRZA 4I0XB 3Q4HB 4LWSB 3GVMA 3FD9A 1WA8B 3Q4HA 3FAVB 4I0XA 3G80A 4LWSA 1WA8A 3FAVA 4GZRB 3TXQA 3GWKC 2B9ZA 2AZ2A 2VS0A 3HR0A 2KG7B 3TXSA 3OGIB 2DE0X 2KG7A 3O9OA 2AZ0A
chains in the Genus database with same CATH superfamily
5KUKA 1ZLZA 5KHJA 3VQYA 4MW3A 2Q7EA 3K59A 2P90A 4K35A 4FLWA 4I9WA 4DR4O 2CTQA 3CS5A 5IYDO 1H2KA 2RCVA 2Y48A 2Q4PA 4I5SA 4YJ2B 5JCOC 4XDLA 1MABG 4JZGA 1K5SA 3KZIZ 4J9YB 4HBNA 1SRYA 3W7UA 3EFFK 2L35A 1K4DC 5KAFZ 3CD6V 2PGGA 4XDKA 4DR6B 4Z1VA 3BHPA 3CRMA 5KMGB 4NXMO 1P7BA 3JALB 5ITZA 1YZBA 4O4IA 4LF4O 3AG4C 5H6QA 4DV6B 2UUAB 4JPRA 3FFQA 1ORQC 3OEEG 4TWKA 1KYOF 4O4JA 4U3JA 4MSWC 5IDJA 2LGWA 2OTJV 3LDEA 3JAKA 4PA4A 3SYAA 5JVDB 4MT8A 3K0DA 4GUNA 3ZBHA 3CCRV 3CCVV 3ZMTA 1IBKO 2XUMA 1CEZA 1NH2B 1VF6A 4R6ZA 4DUYO 3B09A 1SF9A 2YIDA 1Q8IA 1U96A 3SYPA 3LSQA 4C7UA 4I9QA 3ZRWB 4LFCB 4G27B 2XNDG 1AI7A 3G6BA 1YI2V 4FVMA 4FLYA 5EYPB 1LR1A 4N21A 4P9OA 3RGBA 5KA5A 4X65O 4Z1MG 4B7KA 3RYCB 1V55C 4YJ2A 4K8XA 3WG7B 5DECA 3RW0A 5B1OA 5EC2C 3RYHB 1KECA 4FMTA 2EIKC 3B2EE 3CRRA 2WSSG 3JASA 1SC5B 4J7ZA 5LYJA 4ABMA 1OJHA 1O9GA 4JI0B 2ADQB 5KMGA 3ZEDA 3H1LH 2AGAA 2Q6AA 1XL6A 1R3LC 4J42A 4X20B 4I55B 4AI8A 5FPRA 3NXSA 3TETA 3O65A 4OX9O 3RYFB 1XNRB 1NR7A 1JX9A 3ABKB 4FLVA 3KKYA 2QJ1A 2ZT9B 1AJNA 4DV1B 1YSCA 1QLEB 1F4NA 2AHYA 4TV8A 2HVKC 2B1IA 2IW5A 5JVDA 3CMEV 2DYSB 3CC2V 1S3JA 3OFNG 1I94B 2CDYA 1E79G 2RDCA 1Q3EA 2P5OA 1FPOA 4DV6O 1KP3A 1SQXH 3BFRA 2UUAO 1SA0B 1Z5WA 2X7RB 1ZAUA 3OD4A 2CGOA 5BR8B 3SYQA 1QR8A 4DV7B 1WB8A 4RQFA 2P22C 4K8ZA 1SS3A 3D3IA 1KP2A 2IJJA 2UUCB 3SPGA 1I7FA 2FYUH 3UKMA 4OGQB 3JAWB 3CPWU 4H37A 4QE7A 3RYCA 1EN6A 2QWNB 2V1DA 3B40A 4LFCO 2EJRA 4DXWA 3RYHA 5EIBC 5C8YB 3FB6C 4DYLA 1W0KG 4WFAV 3G6EV 3VBBA 1GN6A 1YXBA 3CC4V 2VQEB 1ENVA 1JQ0A 4UCTA 4DV3O 3ZMZA 2ZQMA 4CBCA 4D6TH 4NB5A 1RFYA 5GONB 1BT8A 1IBLB 1H2SB 4X20A 2HJFC 5EBLC 4X8AA 4FIPC 3RYFA 3R66A 1AB3A 1AILA 2FMLA 1MZFA 2L6LA 5LHGA 2E76B 4JI0O 2OCHA 3RT3C 1OCOB 3ZN1A 1H2NA 1LUVA 2H94A 3SJQC 3ZHSA 4F4LA 3IAYA 1IDSA 3CEIA 4CZZA 4KXRA 1GMGA 1GAXA 3HKDA 1XNRO 2HHHB 4LF5B 2MW2B 4DV1O 1VIBA 2OCCC 1WPXA 4FZ1A 1XMOO 3N2GA 3DGEA 2GUZA 3CXHF 3H1HH 1QBZA 1I94O 3UM7A 2K1EA 1FXKC 3FAVB 4QPJA 5KAIZ 3GWKC 2ZDIA 2IM9A 3JAWA 5H2FZ 4AQYB 1JCHA 3SPCA 2ZR3A 3APQA 5IWAB 2XASA 4IYHA 5BR8O 4DV7O 5EK0A 5B1AC 1ZSPA 2XTAA 2WLNA 4ZI7B 5C8YA 4K0KB 4QJFB 2UUCO 4Q20A 4J41A 4JGSA 3RN4A 2ZE6A 2YXHA 2EILC 5DM6V 3IFXA 1B6QA 1XREA 3MDSA 4NTYA 2WLMA 5GONA 3J81N 4DV5B 1XNQB 4UV9A 1MZEA 4TOIA 5B3SB 3D3QA 1N4CA 3K58A 4XDJA 5JH7B 2RNBA 3SJBC 1PL0A 2VQEO 4LFAO 1JPXA 2Y69C 3ASOC 1G4YB 3GVMA 4NTWA 1IBLO 2A3QA 3CRCA 2F95B 1DK1A 3P30A 2YI9A 4FM2A 2NNUA 1Q82W 2BOBC 4FFKA 2CUGA 2QTOA 2RJZA 1FJGB 2Q0OC 5K1XA 3VQVA 3VQXA 3CCSV 1Q90D 1XHZA 3K5NA 2ZXWC 5IYCO 4ZIBA 5J2TB 1QQCA 3EHBB 4GX2A 1GN3A 4NXNO 4DR2B 1FFXB 4BIUA 1OV9A 2ATKC 4DR3B 2X6AA 2E75B 2VS0A 4A5UB 1SETA 3U11A 3FB8C 5GW7A 4PI2A 2HHHO 4LF5O 1F51A 4B3SB 4JYYA 4O4HA 1N33B 1URFA 2HP8A 4JI1B 2YXLA 4AQYO 2YC0A 1GM7A 5IWAO 1R73A 1X4TA 1YVWA 4O2AB 5L3DA 1KKDA 1AROP 3VQWA 4YJ3A 2O57A 4J9ZB 1SESA 1SKVA 4TV9A 4ASUG 5LP6C 3OMIB 4NTXA 5JH7A 5CBGA 4K0KO 3K5OA 5H9CA 4ZKIA 2NR5A 1BGYH 2DN9A 4R7CA 4GZRB 3LDDA 2YSUB 3P3NA 1Y74B 2YEVA 4DV5O 1LUWA 1XNQO 3X2QB 3QF7A 2KG7B 4GX5A 4I50B 4MTGA 5JWPA 2EIJB 4PDMA 4FLTA 2IJHA 1F4MA 2YIAA 4BWAA 2RQ6A 1O9HA 1VQLV 3JD2A 1PP9H 4PA6A 1Z5VA 3K04A 4FM1A 2JGDA 4O4LB 2Y0PA 3LNMB 3TXQA 1JVMA 1V9PA 3UCSC 1WP7A 2GTSA 3E2EA 1G6UA 2LP7A 1M90W 4WCEV 3CCQV 3E83A 2ZNIA 1FJGO 5CB4B 2QWPB 1M5IA 3E35A 5IYZA 1Q43A 1SQFA 5LHHA 4MVRA 4ZOLB 1Y66A 4K3AA 4DR2O 1OCCC 5L3FA 4YXWG 3JD1A 1WA8A 3JD3A 2VWKA 1AP5A 3AG3B 4DV0B 3CX5F 1FS0G 1VP7A 1SQVH 2AHZA 2LGQA 4B3SO 4WF9V 1Q6UA 4F6EA 1R3IC 2EIMC 3APOA 5HFLA 4LFBB 2ITCC 3OAAG 1ZL8A 2F43G 1V54B 4JI1O 3ABMC 4JTAB 4JTCB 4J7KA 1VQOV 3ZCCA 1Y74A 1FAFA 1MG1A 2CH7A 2PUSA 2KG7A 3SPHA 5B1BC 4NR1A 2X6CA 1BS3A 3SR2C 2N74A 4BAYA 1VQ8V 2PI5A 3ZJZA 2CGNA 1R6KA 2A7WA 4O4LA 3I5DA 2P6JA 4G28B 2E5LB 2WAMA 1S5HC 1MNGA 2PZSA 3BEHA 1QHTA 4HYOA 5JCOA 2H3OA 3A0HZ 3SDLA 4X62B 5CA3A 2YIBD 3RBZA 1H2LA 4PDRA 4ZOLA 3UQ8A 4PV1B 1IZ3A 1K4CC 4O4JB 1VQKV 4BIZA 2BTQA 1EM1A 1HNWO 2WA3A 2LW7A 1G8MA 2CTWA 3SPJA 1SZXA 3JAKB 1NJIW 5D5PA 3TK1A 3LSUA 1Y4MA 5L3BA 4PA7A 2P4VA 1IVSA 1BHAA 3DTUB 3UT5A 5KHKA 1JA8A 2CAZC 2R70A 2EINC 3FKSG 5IJ9B 4X65B 2UXDB 1VQPV 1KB9F 2WPDG 3ZIAG 4DV0O 3AG2C 2X0LA 3M7MX 3K06A 2ZINA 3OGIB 1XILA 2YICA 2OWOA 2PYJA 1N0NA 4B3MB 2OT5A 4DO2A 2DOSA 2WLHA 4HZ3A 1OCRB 4TQFA 1UFIA 4TUYA 4LWSB 4LFBO 2Z5UA 3FD9A 2LFRA 3PJSK 1J95A 3QTCA 4OPAA 3H1KH 1WAZA 4OX9B 3BY6A 4CS2A 3OR7C 4LNUB 3JASB 1NVPB 1PV0A 5LYJB 2JVDA 1OCZB 1NT2B 1WP8A 2NN4A 3WB1A 4NYKA 1KUQA 1PNMA 2R9RB 1VQ7V 2HFEC 4UXNA 2DQ0A 4JAAA 2B9ZA 3K5MA 2E5LO 4J10A 1QVGU 4PA3A 4NKGB 2IU0A 3E86A 5J2UB 1AJPA 2ETNA 4X88A 4GX0A 1M56C 4TV8B 1DTOA 2FKXA 1K92A 4I4TB 3CMAV 4X62O 2YS8A 2PY5A 2ZIOA 4PD4F 3QNEA 3H01A 4UCVA 4CH6A 3G67A 5IJ9A 2GDSA 1VQ5V 4J11A 3U10A 3CE2A 5IE9A 5FNVA 1MSWD 4JTDB 3QG5A 3SYOA 3W7TA 1WPBA 4JYCA 1SQGA 3SYCA 3ML0A 5IY5B 4RAIA 1W0JG 3HKEA 1RM1C 3M99B 4GKKB 4X1KB 2UXDO 4DV3B 4LR3A 3ZRVA 5KLVH 1S76D 4LWSA 4UCRA 3PN1A 4X64O 2XAQA 1KBHA 1NBMG 4OPHA 3TJTA 4WBNB 2ZE5A 1NQTA 4UVCA 1YDXA 1DLBA 2QDOA 2UXBO 4B3MO 3FX7A 4LNUA 4X66B 3RVZA 4BIOA 1M93A 4MVMA 3RWRD 4DW1A 3CJHA 2LW1A 2ARHA 4W4LA 5LMNB 2F93B 1K7DA 1I08A 3CSXA 2UXNA 1R3JC 2KKWA 3ZMSA 1ROPA 1P84F 4YY3O 5J2UA 3THOA 1YTFB 1XMOB 2V4DA 1N32B 1I5YA 3CB2A 4I4TA 2D3OW 4JYAB 1JR9A 4LF7B 2A06H 2YI8A 1TVKA 5JQGA 4LF9B 2Q0AA 3HKDB 4UVBA 2BE3A 1VF6C 4QIWF 3N2KB 3A8TA 1Z2GA 2HJDA 2VWJA 4KUMA 1H2MA 1K33A 1BQZA 4MW8A 1PPJH 3N2GB 3KG2A 2GUZB 3CWBH 2P67A 2BOCC 3W7WA 5EIBD 4TT3G 2ZR2A 4DW0A 4X1YB 1GH6A 2OIEA 4X1KA 4PI0A 3K0GA 2EBOA 3BAAA 1BCCH 2UXCO 3CCJV 4WBNA 5KX5B 2JJ2G 2GHYA 1YJWV 1FXKA 2QGNA 1WLEA 4NVPA 3FB7C 3JSNA 3L9DA 5LOVA 4GKKO 1L1FA 2V7QG 4MVOA 4LFAB 4B3TB 1N34B 1QLNA 2DMXA 2Q73A 5BXZA 3AG1B 4GX1A 3B77A 1IBMB 2QWRB 1NH2D 3O9OA 3IJ4A 1VARA 3WB2A 2UU9B 4X66O 1E1RG 2QWQB 1XEQA 4JI5B 2KSDA 2N05A 1R1BA 1GKFA 4NXNB 1D5AA 5AG2A 3RVYA 2CE4A 2Q5ZA 1L0NH 5LMNO 2HEPA 1X59A 5IJ0A 2ZKOA 3ETEA 3N2KA 1J5EB 3ABLB 1XI1A 1M57B 1N32O 4JYAO 2XAJA 4LF7O 3SJAC 3S3XA 4LF9O 4X1YA 2KB1A 2Q9LA 2E3CA 2P7TC 4LH7A 2IBZH 3BA9A 1H8HG 2Y4TA 2JJ1G 4FM0A 4JI3B 5KA6A 5KX5A 4X89A 3WG7C 5KUMA 2PI4A 3OUSA 3JAMN 4O4HB 4CS3A 3SPIA 4LC1A 4UCUA 5BMVA 1NU1H 4FZ0A 2ZD9A 4YIPA 4DK1A 1GM8A 2CTRA 2P06A 4EFBA 3ETGA 4YJ3B 1S0VA 1S72V 4P9PA 4TV9B 1QVFU 4XBFA 2F66C 4X1IB 5JJJB 5LGTA 1R3KC 4CH4A 2OYQA 1QCEA 3ABKC 1MMMA 4U7OA 4KHPB 4ZHQB 2YEVB 3D36A 4IL6Z 4B3TO 1N34O 4BW5A 3CRQA 1QLEC 2DYRB 3MHHC 1XMQB 4EEQA 3K3WA 2DYSC 1IBMO 4IT5A 1QU7A 3A0RA 2ZNJA 4LF6O 3F5TA 3OR6C 1H38A 3ZRSA 4J80A 2UU9O 1CP9A 4JI5O 3OEHG 2NLJC 1KKCA 2JGDB 3W7SA 1JFFB 3H1IH 3VOUA 1HNXB 1M1KW 3ASNB 2WLLA 2XAGA 1D2DA 1YEWA 3HKBA 4IHJB 5IYZB 4WFHA 4DV4B 1J5EO 4I7ZB 3B8NA 2HVJC 1FFTB 1HR0O 1L8DA 4DV2B 5LA6B 1WA8B 5TISZ 2F1MA 1DGSA 4UUJC 1IXBA 3HKCB 2Q7HA 1Q7YW 4JI3O 4KP4A 3AK1A 3F7VC 3CCEV 5D5QA 2ZE7A 3ETQA 2IJIA 4MTXA 4X1IA 1Q86W 3K5LA 2WLIA 1ZL8B 1HWYA 1SQBH 2IU3A 3ZS8C 4HAMA 4ZHQA 2CH7B 1VEWA 2GTAA 4BW9A 1OCOC 2FL4A 4WFFA 4DR1B 5KHGA 2AW9A 4UVAA 2UUBB 2VRZA 1N36O 3CRAA 5A2QN 4KHPO 4BR6A 3OMNB 1JFFA 3AG7A 1G1XB 5L3GA 3ABUA 1WB7A 1XMQO 1PNLA 3N27A 2Y0IA 3FB5C 1HNWB 1VQMV 2JGUA 4IHJA 5GTHZ 4EB6B 2DWEC 4JF3A 4UFZA 3T2MA 2JIZG 2ODMA 2BTOA 4G2KA 2IH1C 3F7YC 4MVQA 4P2ZA 3G4SV 2P4KA 3RFRA 1HNXO 4JI2B 5LA6A 4QPKA 2BTQB 2B5UA 4DK0A 2Z0AA 4CC6A 1IX9A 1S5LZ 3AG4B 3JD4A 4AHCA 1KMIZ 3HKCA 4DV4O 3UT5B 3W7XA 2F4VB 1BMFG 4DV2O 4H33A 1WJZA 4YIOA 4LP8A 5B3SC 4F6RB 1BQ0A 4MS2A 1GO3F 2QA4V 1RPRA 1T5EA 2YIBA 1K34A 2G38A 1LNQA 1NTMH 2PYLA 3ZX6A 3OGCC 1CPYA 5E79Z 4TUYB 2ITDC 4HNAA 1FYJA 1F7YA 4FJCC 1N8RW 2JEXA 4LH6A 3QO7A 3T4DA 1NTKH 3WU2Z 1AI6A 4JAUA 2RN9A 3AK2A 4MVUA 1Q6HA 2GV9A 4IIJB 1V55B 5H6RA 1Q81W 4CC5A 4DR1O 1KC8W 3L70H 2QSAA 2UUBO 4EB6A 4W4KA 4QNHB 1W59A 2EIKB 2QE7G 2C2AA 4PHZA 3ZHVA 1YF2A 4IGGA 4GCZA 3JATB 1YJNV 2WLKA 1FXVA 1EBOA 2BSKA 1GRJA 4FLZA 3IC9A 1K5QA 4O2BA 4UB8Z 3SJCC 3JARB 2X6BA 5CA1B 5L3CA 2M7WA 3L72H 2K9PA 4DR7B 4MVSA 1YHQV 3OMAB 4RQEA 4JI2O 1TUBB 3ZMVA 5BZBA 4PDLA 5FNVB 4X64B 4F6RA 3CC7V 1BHBA 2XOKG 1AR5A 5LXTA 3HKEB 2HG5C 2UXBB 2Q69A 3EXAA 2ZM6B 3E8GA 2F4VO 4L87A 4PDVA 3X2QC 4U7NA 1AR1B 3GB7C 3BVOA 1Y76A 2EIJC 4WFEA 5E1AC 4GT1A 4UCSA 5LL6Y 1BE3H 3KCXA 3K57A 1QNMA 5L3EA 3KCYA 4TSFG 5CMUA 4IIJA 4YY3B 1EFRG 2BCCH 3QVNA 1XQ8A 4EKWA 5B5EZ 1GN2A 1SQPH 4JYBA 4FLUA 3CJHB 4WFBV 1XBLA 1JMKC 4N23A 1GM9A 2XHBA 3JATA 4DR5B 2MK3A 3T1HO 1UPGA 4CH5A 1OZ0A 3WB0A 1HP8A 4JI6B 3AG3C 3OUFA 2HKOA 3JARA 1P4RA 5CA1A 1TVKB 3B8MA 3UO3A 2DQ3A 1R6NA 1XHXA 3Q4HA 2ADPA 5JQGB 2DJVA 2M6YA 3CCUV 1YITV 5EZYB 1ZTEA 2IH3C 4WFGA 1TUBA 1JJ2U 2UXCB 1K9MW 2Q8VA 3ZHUA 2EX3A 5CA0B 3T1CA 2LFSA 1Q6IA 1V54C 3DSQA 4DUZB 4IYIA 1VF5B 5J9PC 4DR7O 1DF4A 2OCCB 3ZHTA 1MA1A 2DWDC 1GTOA 4B7EA 1FXKB 3H1JH 1SQQH 5KHHA 2PF4E 5LOVB 2ZM6O 3CP1A 3L71H 1THZA 2B1GA 1EN4A 1S77D 2QKSA 2JEUA 1A32A 3E8BA 5B1AB 3ZMUA 1TUEB 3H9VA 3E8FA 2HR3A 3G71V 3UO2A 3CXCU 4CH3A 2OIGA 4JV5B 2EILB 4ICGA 1XOUA 4E4EA 1KQSU 2DW4A 3LDCA 1VQ4V 3JALA 4JI4B 5KHIA 5IJ0B 2W6JG 3A0BZ 2WWWA 1L0LH 1NZ6A 2Y69B 5EZYA 1B04A 3ASOB 3FYIB 4DR6O 1PKXA 4DR5O 5LBQA 5CBHA 1NKDA 5CBFA 4JI6O 5CA0A 4RO2A 5BY1A 1YJ9V 3OW2U 1KD1W 3A2FA 2R9AA 2EZOA 2YDEA 4R50A 1RP3B 3U0ZA 3NR7A 3D8CA 2YXYA 1AJQA 1AR4A 2UXXA 2N04A 2ZXWB 1Y6XA 1NVPD 1AI4A 1RSOB 2PTMA 2GSMB 1OCRC 1PL4A 3JSLA 3ZRWA 3GWOA 4RWUA 1Q5OA 2EULA 2VQFB 4X9QA 4PJ0Z 3QO8A 1N0JA 2JK5C 4EFEA 3I55V 5BMVB 1WN7A 5EYPA 4DUZO 2QM8A 1PD3A 3ZRXA 4FLXA 1XDCA 2RMKB 5B66Z 3DC6A 3DXRB 3OTOB 1OCZC 5IYBO 1PNKA 3S3WA 3HR0A 1K3EA 3K03A 1AI5A 3C90A 2A0LA 5CN0A 2ILMA 4R8CA 2AZ0A 3CHXA 4LF6B 1VMGA 4AILC 4UV8A 4GYCB 4LF8B 2W0XA 3CCMV 2LQTA 2Y4UA 3IC7A 4Z2WA 5LP6B 1US6A 3HPLC 4I55A 1M9NA 3K08A 4JV5O 3L73H 1R6TA 4FFBB 3CCLV 1M4UA 3ZHRA 2H8PC 4I0XB 1HR0B 3OT7A 4JI4O 3G80A 3CYOA 1VF7A 2Z3YA 2WLLB 3JCZA 2QKAA 5IY5C 1UJWB 2A79B 1RPOA 1SA0A 3HKBB 2E74B 4P30A 5H5NA 3K79A 1TAEA 1TA8A 2ZCEA 1RSOA 4JASA 2FTKA 1TGOA 3ICXA 3L75H 1K8AW 4YHHB 1FXHA 3B4SA 3T4ZA 4B3RB 5HFMA 2LO1A 4H0LB 2QR4A 1W2BU 4JI8B 3STZC 3HB3B 3DXRA 2JS3A 1OCCB 4D7SA 5EBWC 1YTFD 2JRIA 1H8EG 2VQFO 2W6IG 4L8JA 2A9HA 1XUQA 1E1QG 5LGNA 2WLIB 1HDJA 1N36B 2CK3G 4GKJB 2Q7GA 3F5WC 4U3FH 1B06A 1BSMA 3OTOO 3LUTB 4JI7B 2EIMB 3M8AA 2AZ2A 1VQ6V 1EN5A 5LP6A 2XAFA 4MVZA 5IT9N 1CXZB 3ABMB 4QGPA 4FFBA 4LF8O 1PM9A 1ZUQA 3JYCA 3ZN0A 5DEDA 2FB5A 4I0XA 3C3TA 5B1BB 1NR1A 1U97A 3BPZA 4H13B 1AP6A 3R65A 3JCUZ 2WLJA 1BL8A 5EC1C 4GLXA 3K9SA 1I0HA 2ZDIC 4TQDA 2XT9A 2EJ7A 1WNSA 2LJ2A 5F2VO 3FAVA 2GBOA 4UB6Z 1IXMA 3RYIB 4J7JA 4LBEC 3AG1C 1HNZB 2QTSA 1VQNV 4ZI7A 4YHHO 4RUFA 1EZJA 1FD9A 4B3RO 5FLXN 1HW7A 1YCIA 3T1YB 4FPPA 1VQ9V 4JI8O 2EINB 2QWOB 1COWG 2R9IA 3AK3A 1F23A 3D36C 4H44B 4Q6GA 3AG2B 1KU9A 3MHSC 4HNAB 5JJEB 4UCOA 2QKCA 3P32A 4GKJO 1AVMA 4JAVA 3ABLC 3E22B 5FPOA 1MSDA 4RUEA 2YUAA 4JI7O 1Y67A 1M57C 1MOFA 4D7TA 1GK9A 4MTOA 4QE9A 3STLC 2CTPA 2QM4A 1GN4A 3QO5A 3J80N 3TCUA 4DRXB 5JJNB 5J2TA 2QEXV 3ZHQA 4FK5C 1FFXA 4ZBMA 3LNNA 5LMUB 3MAQA 3EVKA 4JZ2A 3OM3B 2BSKB 2QM7A 3E89A 3TXSA 1NI8A 4O2BB 1IURA 1SERA 1P49A 4E2LA 1ZWIC 3ABTA 1QR9A 3IGAC 2R72A 3TGUH 3RYIA 5EBMC 3MD0A 2XAHA 3FYEB 1YIJV 2HLDG 5K1PA 3J7AU 1M56B 1B3QA 2ZIMA 4DR3O 1S5JA 3OTFA 3P3PA 1DF5A 4DR4B 5LXTB 2DE0X 5B1NA 2JS5A 4O2AA 2KQXA 4KL1A 3BABA 3JD0A 1JOYA 2DYRC 3LSSA 1Y76B 1HNZO 1N33O 1FKAO 1SZTA 1H2GA 2WA4A 2EZPA 1RM1B 1JJOA 3T1YO 3BCCH 4MTFA 3WFVA 3E22A 2W0FC 5A9GA 2F23A 2OTLV 4I50A 5C93A 3T1HB 2Q67A 3DC5A 5DN6G 3E8HA 2AXTZ 3ASNC 3SGIA 4NXMB 3AEIA 1D5NA 4KFMA 4LF4B 1K73W 1K97A 4DRXA 1XL4A 3C3SA 4PELA 5LGUA 5GTIZ 5FL7G 3L74H 4CS4A 5CB4A 5ITZB 2IJKA 3BA8A 4LCUC 4O4IB 4PA9A 1IBKB 3OE7G 1I5XA 3Q4HB 4DUYB 1NS1A 5LHIA 2ZE8A 4OXSA 2Q68A 1BZKA 4B08A 1OHHG 5LMUO 4U3JB 1NTZH 1ZX3A 1EZVH 3ETDA 3I56V 3K9AA 2JDIG 2D2CB 3BRCA 1P7GA
chains in the Genus database with same CATH topology
3ZBHA 4ABMA 2VRZA 4I0XB 3Q4HB 4LWSB 3GVMA 3FD9A 1WA8B 3Q4HA 3FAVB 4I0XA 3G80A 4LWSA 1WA8A 3FAVA 4GZRB 3TXQA 3GWKC 2B9ZA 2AZ2A 2VS0A 3HR0A 2KG7B 3TXSA 3OGIB 2DE0X 2KG7A 3O9OA 2AZ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZBH A;  4ABM A;  2VRZ A;  4I0X B;  3Q4H B;  4LWS B;  3GVM A;  3FD9 A;  1WA8 B;  3Q4H A;  3FAV B;  4I0X A;  3G80 A;  4LWS A;  1WA8 A;  3FAV A;  4GZR B;  3TXQ A;  3GWK C;  2B9Z A;  2AZ2 A;  2VS0 A;  3HR0 A;  2KG7 B;  3TXS A;  3OGI B;  2DE0 X;  2KG7 A;  3O9O A;  2AZ0 A; 
#chains in the Genus database with same CATH topology
 5KUK A;  1ZLZ A;  5KHJ A;  3VQY A;  4MW3 A;  2Q7E A;  3K59 A;  2P90 A;  4K35 A;  4FLW A;  4I9W A;  4DR4 O;  2CTQ A;  3CS5 A;  5IYD O;  1H2K A;  2RCV A;  2Y48 A;  2Q4P A;  4I5S A;  4YJ2 B;  5JCO C;  4XDL A;  1MAB G;  4JZG A;  1K5S A;  3KZI Z;  4J9Y B;  4HBN A;  1SRY A;  3W7U A;  3EFF K;  2L35 A;  1K4D C;  5KAF Z;  3CD6 V;  2PGG A;  4XDK A;  4DR6 B;  4Z1V A;  3BHP A;  3CRM A;  5KMG B;  4NXM O;  1P7B A;  3JAL B;  5ITZ A;  1YZB A;  4O4I A;  4LF4 O;  3AG4 C;  5H6Q A;  4DV6 B;  2UUA B;  4JPR A;  3FFQ A;  1ORQ C;  3OEE G;  4TWK A;  1KYO F;  4O4J A;  4U3J A;  4MSW C;  5IDJ A;  2LGW A;  2OTJ V;  3LDE A;  3JAK A;  4PA4 A;  3SYA A;  5JVD B;  4MT8 A;  3K0D A;  4GUN A;  3ZBH A;  3CCR V;  3CCV V;  3ZMT A;  1IBK O;  2XUM A;  1CEZ A;  1NH2 B;  1VF6 A;  4R6Z A;  4DUY O;  3B09 A;  1SF9 A;  2YID A;  1Q8I A;  1U96 A;  3SYP A;  3LSQ A;  4C7U A;  4I9Q A;  3ZRW B;  4LFC B;  4G27 B;  2XND G;  1AI7 A;  3G6B A;  1YI2 V;  4FVM A;  4FLY A;  5EYP B;  1LR1 A;  4N21 A;  4P9O A;  3RGB A;  5KA5 A;  4X65 O;  4Z1M G;  4B7K A;  3RYC B;  1V55 C;  4YJ2 A;  4K8X A;  3WG7 B;  5DEC A;  3RW0 A;  5B1O A;  5EC2 C;  3RYH B;  1KEC A;  4FMT A;  2EIK C;  3B2E E;  3CRR A;  2WSS G;  3JAS A;  1SC5 B;  4J7Z A;  5LYJ A;  4ABM A;  1OJH A;  1O9G A;  4JI0 B;  2ADQ B;  5KMG A;  3ZED A;  3H1L H;  2AGA A;  2Q6A A;  1XL6 A;  1R3L C;  4J42 A;  4X20 B;  4I55 B;  4AI8 A;  5FPR A;  3NXS A;  3TET A;  3O65 A;  4OX9 O;  3RYF B;  1XNR B;  1NR7 A;  1JX9 A;  3ABK B;  4FLV A;  3KKY A;  2QJ1 A;  2ZT9 B;  1AJN A;  4DV1 B;  1YSC A;  1QLE B;  1F4N A;  2AHY A;  4TV8 A;  2HVK C;  2B1I A;  2IW5 A;  5JVD A;  3CME V;  2DYS B;  3CC2 V;  1S3J A;  3OFN G;  1I94 B;  2CDY A;  1E79 G;  2RDC A;  1Q3E A;  2P5O A;  1FPO A;  4DV6 O;  1KP3 A;  1SQX H;  3BFR A;  2UUA O;  1SA0 B;  1Z5W A;  2X7R B;  1ZAU A;  3OD4 A;  2CGO A;  5BR8 B;  3SYQ A;  1QR8 A;  4DV7 B;  1WB8 A;  4RQF A;  2P22 C;  4K8Z A;  1SS3 A;  3D3I A;  1KP2 A;  2IJJ A;  2UUC B;  3SPG A;  1I7F A;  2FYU H;  3UKM A;  4OGQ B;  3JAW B;  3CPW U;  4H37 A;  4QE7 A;  3RYC A;  1EN6 A;  2QWN B;  2V1D A;  3B40 A;  4LFC O;  2EJR A;  4DXW A;  3RYH A;  5EIB C;  5C8Y B;  3FB6 C;  4DYL A;  1W0K G;  4WFA V;  3G6E V;  3VBB A;  1GN6 A;  1YXB A;  3CC4 V;  2VQE B;  1ENV A;  1JQ0 A;  4UCT A;  4DV3 O;  3ZMZ A;  2ZQM A;  4CBC A;  4D6T H;  4NB5 A;  1RFY A;  5GON B;  1BT8 A;  1IBL B;  1H2S B;  4X20 A;  2HJF C;  5EBL C;  4X8A A;  4FIP C;  3RYF A;  3R66 A;  1AB3 A;  1AIL A;  2FML A;  1MZF A;  2L6L A;  5LHG A;  2E76 B;  4JI0 O;  2OCH A;  3RT3 C;  1OCO B;  3ZN1 A;  1H2N A;  1LUV A;  2H94 A;  3SJQ C;  3ZHS A;  4F4L A;  3IAY A;  1IDS A;  3CEI A;  4CZZ A;  4KXR A;  1GMG A;  1GAX A;  3HKD A;  1XNR O;  2HHH B;  4LF5 B;  2MW2 B;  4DV1 O;  1VIB A;  2OCC C;  1WPX A;  4FZ1 A;  1XMO O;  3N2G A;  3DGE A;  2GUZ A;  3CXH F;  3H1H H;  1QBZ A;  1I94 O;  3UM7 A;  2K1E A;  1FXK C;  3FAV B;  4QPJ A;  5KAI Z;  3GWK C;  2ZDI A;  2IM9 A;  3JAW A;  5H2F Z;  4AQY B;  1JCH A;  3SPC A;  2ZR3 A;  3APQ A;  5IWA B;  2XAS A;  4IYH A;  5BR8 O;  4DV7 O;  5EK0 A;  5B1A C;  1ZSP A;  2XTA A;  2WLN A;  4ZI7 B;  5C8Y A;  4K0K B;  4QJF B;  2UUC O;  4Q20 A;  4J41 A;  4JGS A;  3RN4 A;  2ZE6 A;  2YXH A;  2EIL C;  5DM6 V;  3IFX A;  1B6Q A;  1XRE A;  3MDS A;  4NTY A;  2WLM A;  5GON A;  3J81 N;  4DV5 B;  1XNQ B;  4UV9 A;  1MZE A;  4TOI A;  5B3S B;  3D3Q A;  1N4C A;  3K58 A;  4XDJ A;  5JH7 B;  2RNB A;  3SJB C;  1PL0 A;  2VQE O;  4LFA O;  1JPX A;  2Y69 C;  3ASO C;  1G4Y B;  3GVM A;  4NTW A;  1IBL O;  2A3Q A;  3CRC A;  2F95 B;  1DK1 A;  3P30 A;  2YI9 A;  4FM2 A;  2NNU A;  1Q82 W;  2BOB C;  4FFK A;  2CUG A;  2QTO A;  2RJZ A;  1FJG B;  2Q0O C;  5K1X A;  3VQV A;  3VQX A;  3CCS V;  1Q90 D;  1XHZ A;  3K5N A;  2ZXW C;  5IYC O;  4ZIB A;  5J2T B;  1QQC A;  3EHB B;  4GX2 A;  1GN3 A;  4NXN O;  4DR2 B;  1FFX B;  4BIU A;  1OV9 A;  2ATK C;  4DR3 B;  2X6A A;  2E75 B;  2VS0 A;  4A5U B;  1SET A;  3U11 A;  3FB8 C;  5GW7 A;  4PI2 A;  2HHH O;  4LF5 O;  1F51 A;  4B3S B;  4JYY A;  4O4H A;  1N33 B;  1URF A;  2HP8 A;  4JI1 B;  2YXL A;  4AQY O;  2YC0 A;  1GM7 A;  5IWA O;  1R73 A;  1X4T A;  1YVW A;  4O2A B;  5L3D A;  1KKD A;  1ARO P;  3VQW A;  4YJ3 A;  2O57 A;  4J9Z B;  1SES A;  1SKV A;  4TV9 A;  4ASU G;  5LP6 C;  3OMI B;  4NTX A;  5JH7 A;  5CBG A;  4K0K O;  3K5O A;  5H9C A;  4ZKI A;  2NR5 A;  1BGY H;  2DN9 A;  4R7C A;  4GZR B;  3LDD A;  2YSU B;  3P3N A;  1Y74 B;  2YEV A;  4DV5 O;  1LUW A;  1XNQ O;  3X2Q B;  3QF7 A;  2KG7 B;  4GX5 A;  4I50 B;  4MTG A;  5JWP A;  2EIJ B;  4PDM A;  4FLT A;  2IJH A;  1F4M A;  2YIA A;  4BWA A;  2RQ6 A;  1O9H A;  1VQL V;  3JD2 A;  1PP9 H;  4PA6 A;  1Z5V A;  3K04 A;  4FM1 A;  2JGD A;  4O4L B;  2Y0P A;  3LNM B;  3TXQ A;  1JVM A;  1V9P A;  3UCS C;  1WP7 A;  2GTS A;  3E2E A;  1G6U A;  2LP7 A;  1M90 W;  4WCE V;  3CCQ V;  3E83 A;  2ZNI A;  1FJG O;  5CB4 B;  2QWP B;  1M5I A;  3E35 A;  5IYZ A;  1Q43 A;  1SQF A;  5LHH A;  4MVR A;  4ZOL B;  1Y66 A;  4K3A A;  4DR2 O;  1OCC C;  5L3F A;  4YXW G;  3JD1 A;  1WA8 A;  3JD3 A;  2VWK A;  1AP5 A;  3AG3 B;  4DV0 B;  3CX5 F;  1FS0 G;  1VP7 A;  1SQV H;  2AHZ A;  2LGQ A;  4B3S O;  4WF9 V;  1Q6U A;  4F6E A;  1R3I C;  2EIM C;  3APO A;  5HFL A;  4LFB B;  2ITC C;  3OAA G;  1ZL8 A;  2F43 G;  1V54 B;  4JI1 O;  3ABM C;  4JTA B;  4JTC B;  4J7K A;  1VQO V;  3ZCC A;  1Y74 A;  1FAF A;  1MG1 A;  2CH7 A;  2PUS A;  2KG7 A;  3SPH A;  5B1B C;  4NR1 A;  2X6C A;  1BS3 A;  3SR2 C;  2N74 A;  4BAY A;  1VQ8 V;  2PI5 A;  3ZJZ A;  2CGN A;  1R6K A;  2A7W A;  4O4L A;  3I5D A;  2P6J A;  4G28 B;  2E5L B;  2WAM A;  1S5H C;  1MNG A;  2PZS A;  3BEH A;  1QHT A;  4HYO A;  5JCO A;  2H3O A;  3A0H Z;  3SDL A;  4X62 B;  5CA3 A;  2YIB D;  3RBZ A;  1H2L A;  4PDR A;  4ZOL A;  3UQ8 A;  4PV1 B;  1IZ3 A;  1K4C C;  4O4J B;  1VQK V;  4BIZ A;  2BTQ A;  1EM1 A;  1HNW O;  2WA3 A;  2LW7 A;  1G8M A;  2CTW A;  3SPJ A;  1SZX A;  3JAK B;  1NJI W;  5D5P A;  3TK1 A;  3LSU A;  1Y4M A;  5L3B A;  4PA7 A;  2P4V A;  1IVS A;  1BHA A;  3DTU B;  3UT5 A;  5KHK A;  1JA8 A;  2CAZ C;  2R70 A;  2EIN C;  3FKS G;  5IJ9 B;  4X65 B;  2UXD B;  1VQP V;  1KB9 F;  2WPD G;  3ZIA G;  4DV0 O;  3AG2 C;  2X0L A;  3M7M X;  3K06 A;  2ZIN A;  3OGI B;  1XIL A;  2YIC A;  2OWO A;  2PYJ A;  1N0N A;  4B3M B;  2OT5 A;  4DO2 A;  2DOS A;  2WLH A;  4HZ3 A;  1OCR B;  4TQF A;  1UFI A;  4TUY A;  4LWS B;  4LFB O;  2Z5U A;  3FD9 A;  2LFR A;  3PJS K;  1J95 A;  3QTC A;  4OPA A;  3H1K H;  1WAZ A;  4OX9 B;  3BY6 A;  4CS2 A;  3OR7 C;  4LNU B;  3JAS B;  1NVP B;  1PV0 A;  5LYJ B;  2JVD A;  1OCZ B;  1NT2 B;  1WP8 A;  2NN4 A;  3WB1 A;  4NYK A;  1KUQ A;  1PNM A;  2R9R B;  1VQ7 V;  2HFE C;  4UXN A;  2DQ0 A;  4JAA A;  2B9Z A;  3K5M A;  2E5L O;  4J10 A;  1QVG U;  4PA3 A;  4NKG B;  2IU0 A;  3E86 A;  5J2U B;  1AJP A;  2ETN A;  4X88 A;  4GX0 A;  1M56 C;  4TV8 B;  1DTO A;  2FKX A;  1K92 A;  4I4T B;  3CMA V;  4X62 O;  2YS8 A;  2PY5 A;  2ZIO A;  4PD4 F;  3QNE A;  3H01 A;  4UCV A;  4CH6 A;  3G67 A;  5IJ9 A;  2GDS A;  1VQ5 V;  4J11 A;  3U10 A;  3CE2 A;  5IE9 A;  5FNV A;  1MSW D;  4JTD B;  3QG5 A;  3SYO A;  3W7T A;  1WPB A;  4JYC A;  1SQG A;  3SYC A;  3ML0 A;  5IY5 B;  4RAI A;  1W0J G;  3HKE A;  1RM1 C;  3M99 B;  4GKK B;  4X1K B;  2UXD O;  4DV3 B;  4LR3 A;  3ZRV A;  5KLV H;  1S76 D;  4LWS A;  4UCR A;  3PN1 A;  4X64 O;  2XAQ A;  1KBH A;  1NBM G;  4OPH A;  3TJT A;  4WBN B;  2ZE5 A;  1NQT A;  4UVC A;  1YDX A;  1DLB A;  2QDO A;  2UXB O;  4B3M O;  3FX7 A;  4LNU A;  4X66 B;  3RVZ A;  4BIO A;  1M93 A;  4MVM A;  3RWR D;  4DW1 A;  3CJH A;  2LW1 A;  2ARH A;  4W4L A;  5LMN B;  2F93 B;  1K7D A;  1I08 A;  3CSX A;  2UXN A;  1R3J C;  2KKW A;  3ZMS A;  1ROP A;  1P84 F;  4YY3 O;  5J2U A;  3THO A;  1YTF B;  1XMO B;  2V4D A;  1N32 B;  1I5Y A;  3CB2 A;  4I4T A;  2D3O W;  4JYA B;  1JR9 A;  4LF7 B;  2A06 H;  2YI8 A;  1TVK A;  5JQG A;  4LF9 B;  2Q0A A;  3HKD B;  4UVB A;  2BE3 A;  1VF6 C;  4QIW F;  3N2K B;  3A8T A;  1Z2G A;  2HJD A;  2VWJ A;  4KUM A;  1H2M A;  1K33 A;  1BQZ A;  4MW8 A;  1PPJ H;  3N2G B;  3KG2 A;  2GUZ B;  3CWB H;  2P67 A;  2BOC C;  3W7W A;  5EIB D;  4TT3 G;  2ZR2 A;  4DW0 A;  4X1Y B;  1GH6 A;  2OIE A;  4X1K A;  4PI0 A;  3K0G A;  2EBO A;  3BAA A;  1BCC H;  2UXC O;  3CCJ V;  4WBN A;  5KX5 B;  2JJ2 G;  2GHY A;  1YJW V;  1FXK A;  2QGN A;  1WLE A;  4NVP A;  3FB7 C;  3JSN A;  3L9D A;  5LOV A;  4GKK O;  1L1F A;  2V7Q G;  4MVO A;  4LFA B;  4B3T B;  1N34 B;  1QLN A;  2DMX A;  2Q73 A;  5BXZ A;  3AG1 B;  4GX1 A;  3B77 A;  1IBM B;  2QWR B;  1NH2 D;  3O9O A;  3IJ4 A;  1VAR A;  3WB2 A;  2UU9 B;  4X66 O;  1E1R G;  2QWQ B;  1XEQ A;  4JI5 B;  2KSD A;  2N05 A;  1R1B A;  1GKF A;  4NXN B;  1D5A A;  5AG2 A;  3RVY A;  2CE4 A;  2Q5Z A;  1L0N H;  5LMN O;  2HEP A;  1X59 A;  5IJ0 A;  2ZKO A;  3ETE A;  3N2K A;  1J5E B;  3ABL B;  1XI1 A;  1M57 B;  1N32 O;  4JYA O;  2XAJ A;  4LF7 O;  3SJA C;  3S3X A;  4LF9 O;  4X1Y A;  2KB1 A;  2Q9L A;  2E3C A;  2P7T C;  4LH7 A;  2IBZ H;  3BA9 A;  1H8H G;  2Y4T A;  2JJ1 G;  4FM0 A;  4JI3 B;  5KA6 A;  5KX5 A;  4X89 A;  3WG7 C;  5KUM A;  2PI4 A;  3OUS A;  3JAM N;  4O4H B;  4CS3 A;  3SPI A;  4LC1 A;  4UCU A;  5BMV A;  1NU1 H;  4FZ0 A;  2ZD9 A;  4YIP A;  4DK1 A;  1GM8 A;  2CTR A;  2P06 A;  4EFB A;  3ETG A;  4YJ3 B;  1S0V A;  1S72 V;  4P9P A;  4TV9 B;  1QVF U;  4XBF A;  2F66 C;  4X1I B;  5JJJ B;  5LGT A;  1R3K C;  4CH4 A;  2OYQ A;  1QCE A;  3ABK C;  1MMM A;  4U7O A;  4KHP B;  4ZHQ B;  2YEV B;  3D36 A;  4IL6 Z;  4B3T O;  1N34 O;  4BW5 A;  3CRQ A;  1QLE C;  2DYR B;  3MHH C;  1XMQ B;  4EEQ A;  3K3W A;  2DYS C;  1IBM O;  4IT5 A;  1QU7 A;  3A0R A;  2ZNJ A;  4LF6 O;  3F5T A;  3OR6 C;  1H38 A;  3ZRS A;  4J80 A;  2UU9 O;  1CP9 A;  4JI5 O;  3OEH G;  2NLJ C;  1KKC A;  2JGD B;  3W7S A;  1JFF B;  3H1I H;  3VOU A;  1HNX B;  1M1K W;  3ASN B;  2WLL A;  2XAG A;  1D2D A;  1YEW A;  3HKB A;  4IHJ B;  5IYZ B;  4WFH A;  4DV4 B;  1J5E O;  4I7Z B;  3B8N A;  2HVJ C;  1FFT B;  1HR0 O;  1L8D A;  4DV2 B;  5LA6 B;  1WA8 B;  5TIS Z;  2F1M A;  1DGS A;  4UUJ C;  1IXB A;  3HKC B;  2Q7H A;  1Q7Y W;  4JI3 O;  4KP4 A;  3AK1 A;  3F7V C;  3CCE V;  5D5Q A;  2ZE7 A;  3ETQ A;  2IJI A;  4MTX A;  4X1I A;  1Q86 W;  3K5L A;  2WLI A;  1ZL8 B;  1HWY A;  1SQB H;  2IU3 A;  3ZS8 C;  4HAM A;  4ZHQ A;  2CH7 B;  1VEW A;  2GTA A;  4BW9 A;  1OCO C;  2FL4 A;  4WFF A;  4DR1 B;  5KHG A;  2AW9 A;  4UVA A;  2UUB B;  2VRZ A;  1N36 O;  3CRA A;  5A2Q N;  4KHP O;  4BR6 A;  3OMN B;  1JFF A;  3AG7 A;  1G1X B;  5L3G A;  3ABU A;  1WB7 A;  1XMQ O;  1PNL A;  3N27 A;  2Y0I A;  3FB5 C;  1HNW B;  1VQM V;  2JGU A;  4IHJ A;  5GTH Z;  4EB6 B;  2DWE C;  4JF3 A;  4UFZ A;  3T2M A;  2JIZ G;  2ODM A;  2BTO A;  4G2K A;  2IH1 C;  3F7Y C;  4MVQ A;  4P2Z A;  3G4S V;  2P4K A;  3RFR A;  1HNX O;  4JI2 B;  5LA6 A;  4QPK A;  2BTQ B;  2B5U A;  4DK0 A;  2Z0A A;  4CC6 A;  1IX9 A;  1S5L Z;  3AG4 B;  3JD4 A;  4AHC A;  1KMI Z;  3HKC A;  4DV4 O;  3UT5 B;  3W7X A;  2F4V B;  1BMF G;  4DV2 O;  4H33 A;  1WJZ A;  4YIO A;  4LP8 A;  5B3S C;  4F6R B;  1BQ0 A;  4MS2 A;  1GO3 F;  2QA4 V;  1RPR A;  1T5E A;  2YIB A;  1K34 A;  2G38 A;  1LNQ A;  1NTM H;  2PYL A;  3ZX6 A;  3OGC C;  1CPY A;  5E79 Z;  4TUY B;  2ITD C;  4HNA A;  1FYJ A;  1F7Y A;  4FJC C;  1N8R W;  2JEX A;  4LH6 A;  3QO7 A;  3T4D A;  1NTK H;  3WU2 Z;  1AI6 A;  4JAU A;  2RN9 A;  3AK2 A;  4MVU A;  1Q6H A;  2GV9 A;  4IIJ B;  1V55 B;  5H6R A;  1Q81 W;  4CC5 A;  4DR1 O;  1KC8 W;  3L70 H;  2QSA A;  2UUB O;  4EB6 A;  4W4K A;  4QNH B;  1W59 A;  2EIK B;  2QE7 G;  2C2A A;  4PHZ A;  3ZHV A;  1YF2 A;  4IGG A;  4GCZ A;  3JAT B;  1YJN V;  2WLK A;  1FXV A;  1EBO A;  2BSK A;  1GRJ A;  4FLZ A;  3IC9 A;  1K5Q A;  4O2B A;  4UB8 Z;  3SJC C;  3JAR B;  2X6B A;  5CA1 B;  5L3C A;  2M7W A;  3L72 H;  2K9P A;  4DR7 B;  4MVS A;  1YHQ V;  3OMA B;  4RQE A;  4JI2 O;  1TUB B;  3ZMV A;  5BZB A;  4PDL A;  5FNV B;  4X64 B;  4F6R A;  3CC7 V;  1BHB A;  2XOK G;  1AR5 A;  5LXT A;  3HKE B;  2HG5 C;  2UXB B;  2Q69 A;  3EXA A;  2ZM6 B;  3E8G A;  2F4V O;  4L87 A;  4PDV A;  3X2Q C;  4U7N A;  1AR1 B;  3GB7 C;  3BVO A;  1Y76 A;  2EIJ C;  4WFE A;  5E1A C;  4GT1 A;  4UCS A;  5LL6 Y;  1BE3 H;  3KCX A;  3K57 A;  1QNM A;  5L3E A;  3KCY A;  4TSF G;  5CMU A;  4IIJ A;  4YY3 B;  1EFR G;  2BCC H;  3QVN A;  1XQ8 A;  4EKW A;  5B5E Z;  1GN2 A;  1SQP H;  4JYB A;  4FLU A;  3CJH B;  4WFB V;  1XBL A;  1JMK C;  4N23 A;  1GM9 A;  2XHB A;  3JAT A;  4DR5 B;  2MK3 A;  3T1H O;  1UPG A;  4CH5 A;  1OZ0 A;  3WB0 A;  1HP8 A;  4JI6 B;  3AG3 C;  3OUF A;  2HKO A;  3JAR A;  1P4R A;  5CA1 A;  1TVK B;  3B8M A;  3UO3 A;  2DQ3 A;  1R6N A;  1XHX A;  3Q4H A;  2ADP A;  5JQG B;  2DJV A;  2M6Y A;  3CCU V;  1YIT V;  5EZY B;  1ZTE A;  2IH3 C;  4WFG A;  1TUB A;  1JJ2 U;  2UXC B;  1K9M W;  2Q8V A;  3ZHU A;  2EX3 A;  5CA0 B;  3T1C A;  2LFS A;  1Q6I A;  1V54 C;  3DSQ A;  4DUZ B;  4IYI A;  1VF5 B;  5J9P C;  4DR7 O;  1DF4 A;  2OCC B;  3ZHT A;  1MA1 A;  2DWD C;  1GTO A;  4B7E A;  1FXK B;  3H1J H;  1SQQ H;  5KHH A;  2PF4 E;  5LOV B;  2ZM6 O;  3CP1 A;  3L71 H;  1THZ A;  2B1G A;  1EN4 A;  1S77 D;  2QKS A;  2JEU A;  1A32 A;  3E8B A;  5B1A B;  3ZMU A;  1TUE B;  3H9V A;  3E8F A;  2HR3 A;  3G71 V;  3UO2 A;  3CXC U;  4CH3 A;  2OIG A;  4JV5 B;  2EIL B;  4ICG A;  1XOU A;  4E4E A;  1KQS U;  2DW4 A;  3LDC A;  1VQ4 V;  3JAL A;  4JI4 B;  5KHI A;  5IJ0 B;  2W6J G;  3A0B Z;  2WWW A;  1L0L H;  1NZ6 A;  2Y69 B;  5EZY A;  1B04 A;  3ASO B;  3FYI B;  4DR6 O;  1PKX A;  4DR5 O;  5LBQ A;  5CBH A;  1NKD A;  5CBF A;  4JI6 O;  5CA0 A;  4RO2 A;  5BY1 A;  1YJ9 V;  3OW2 U;  1KD1 W;  3A2F A;  2R9A A;  2EZO A;  2YDE A;  4R50 A;  1RP3 B;  3U0Z A;  3NR7 A;  3D8C A;  2YXY A;  1AJQ A;  1AR4 A;  2UXX A;  2N04 A;  2ZXW B;  1Y6X A;  1NVP D;  1AI4 A;  1RSO B;  2PTM A;  2GSM B;  1OCR C;  1PL4 A;  3JSL A;  3ZRW A;  3GWO A;  4RWU A;  1Q5O A;  2EUL A;  2VQF B;  4X9Q A;  4PJ0 Z;  3QO8 A;  1N0J A;  2JK5 C;  4EFE A;  3I55 V;  5BMV B;  1WN7 A;  5EYP A;  4DUZ O;  2QM8 A;  1PD3 A;  3ZRX A;  4FLX A;  1XDC A;  2RMK B;  5B66 Z;  3DC6 A;  3DXR B;  3OTO B;  1OCZ C;  5IYB O;  1PNK A;  3S3W A;  3HR0 A;  1K3E A;  3K03 A;  1AI5 A;  3C90 A;  2A0L A;  5CN0 A;  2ILM A;  4R8C A;  2AZ0 A;  3CHX A;  4LF6 B;  1VMG A;  4AIL C;  4UV8 A;  4GYC B;  4LF8 B;  2W0X A;  3CCM V;  2LQT A;  2Y4U A;  3IC7 A;  4Z2W A;  5LP6 B;  1US6 A;  3HPL C;  4I55 A;  1M9N A;  3K08 A;  4JV5 O;  3L73 H;  1R6T A;  4FFB B;  3CCL V;  1M4U A;  3ZHR A;  2H8P C;  4I0X B;  1HR0 B;  3OT7 A;  4JI4 O;  3G80 A;  3CYO A;  1VF7 A;  2Z3Y A;  2WLL B;  3JCZ A;  2QKA A;  5IY5 C;  1UJW B;  2A79 B;  1RPO A;  1SA0 A;  3HKB B;  2E74 B;  4P30 A;  5H5N A;  3K79 A;  1TAE A;  1TA8 A;  2ZCE A;  1RSO A;  4JAS A;  2FTK A;  1TGO A;  3ICX A;  3L75 H;  1K8A W;  4YHH B;  1FXH A;  3B4S A;  3T4Z A;  4B3R B;  5HFM A;  2LO1 A;  4H0L B;  2QR4 A;  1W2B U;  4JI8 B;  3STZ C;  3HB3 B;  3DXR A;  2JS3 A;  1OCC B;  4D7S A;  5EBW C;  1YTF D;  2JRI A;  1H8E G;  2VQF O;  2W6I G;  4L8J A;  2A9H A;  1XUQ A;  1E1Q G;  5LGN A;  2WLI B;  1HDJ A;  1N36 B;  2CK3 G;  4GKJ B;  2Q7G A;  3F5W C;  4U3F H;  1B06 A;  1BSM A;  3OTO O;  3LUT B;  4JI7 B;  2EIM B;  3M8A A;  2AZ2 A;  1VQ6 V;  1EN5 A;  5LP6 A;  2XAF A;  4MVZ A;  5IT9 N;  1CXZ B;  3ABM B;  4QGP A;  4FFB A;  4LF8 O;  1PM9 A;  1ZUQ A;  3JYC A;  3ZN0 A;  5DED A;  2FB5 A;  4I0X A;  3C3T A;  5B1B B;  1NR1 A;  1U97 A;  3BPZ A;  4H13 B;  1AP6 A;  3R65 A;  3JCU Z;  2WLJ A;  1BL8 A;  5EC1 C;  4GLX A;  3K9S A;  1I0H A;  2ZDI C;  4TQD A;  2XT9 A;  2EJ7 A;  1WNS A;  2LJ2 A;  5F2V O;  3FAV A;  2GBO A;  4UB6 Z;  1IXM A;  3RYI B;  4J7J A;  4LBE C;  3AG1 C;  1HNZ B;  2QTS A;  1VQN V;  4ZI7 A;  4YHH O;  4RUF A;  1EZJ A;  1FD9 A;  4B3R O;  5FLX N;  1HW7 A;  1YCI A;  3T1Y B;  4FPP A;  1VQ9 V;  4JI8 O;  2EIN B;  2QWO B;  1COW G;  2R9I A;  3AK3 A;  1F23 A;  3D36 C;  4H44 B;  4Q6G A;  3AG2 B;  1KU9 A;  3MHS C;  4HNA B;  5JJE B;  4UCO A;  2QKC A;  3P32 A;  4GKJ O;  1AVM A;  4JAV A;  3ABL C;  3E22 B;  5FPO A;  1MSD A;  4RUE A;  2YUA A;  4JI7 O;  1Y67 A;  1M57 C;  1MOF A;  4D7T A;  1GK9 A;  4MTO A;  4QE9 A;  3STL C;  2CTP A;  2QM4 A;  1GN4 A;  3QO5 A;  3J80 N;  3TCU A;  4DRX B;  5JJN B;  5J2T A;  2QEX V;  3ZHQ A;  4FK5 C;  1FFX A;  4ZBM A;  3LNN A;  5LMU B;  3MAQ A;  3EVK A;  4JZ2 A;  3OM3 B;  2BSK B;  2QM7 A;  3E89 A;  3TXS A;  1NI8 A;  4O2B B;  1IUR A;  1SER A;  1P49 A;  4E2L A;  1ZWI C;  3ABT A;  1QR9 A;  3IGA C;  2R72 A;  3TGU H;  3RYI A;  5EBM C;  3MD0 A;  2XAH A;  3FYE B;  1YIJ V;  2HLD G;  5K1P A;  3J7A U;  1M56 B;  1B3Q A;  2ZIM A;  4DR3 O;  1S5J A;  3OTF A;  3P3P A;  1DF5 A;  4DR4 B;  5LXT B;  2DE0 X;  5B1N A;  2JS5 A;  4O2A A;  2KQX A;  4KL1 A;  3BAB A;  3JD0 A;  1JOY A;  2DYR C;  3LSS A;  1Y76 B;  1HNZ O;  1N33 O;  1FKA O;  1SZT A;  1H2G A;  2WA4 A;  2EZP A;  1RM1 B;  1JJO A;  3T1Y O;  3BCC H;  4MTF A;  3WFV A;  3E22 A;  2W0F C;  5A9G A;  2F23 A;  2OTL V;  4I50 A;  5C93 A;  3T1H B;  2Q67 A;  3DC5 A;  5DN6 G;  3E8H A;  2AXT Z;  3ASN C;  3SGI A;  4NXM B;  3AEI A;  1D5N A;  4KFM A;  4LF4 B;  1K73 W;  1K97 A;  4DRX A;  1XL4 A;  3C3S A;  4PEL A;  5LGU A;  5GTI Z;  5FL7 G;  3L74 H;  4CS4 A;  5CB4 A;  5ITZ B;  2IJK A;  3BA8 A;  4LCU C;  4O4I B;  4PA9 A;  1IBK B;  3OE7 G;  1I5X A;  3Q4H B;  4DUY B;  1NS1 A;  5LHI A;  2ZE8 A;  4OXS A;  2Q68 A;  1BZK A;  4B08 A;  1OHH G;  5LMU O;  4U3J B;  1NTZ H;  1ZX3 A;  1EZV H;  3ETD A;  3I56 V;  3K9A A;  2JDI G;  2D2C B;  3BRC A;  1P7G A; 
#chains in the Genus database with same CATH homology
 3ZBH A;  4ABM A;  2VRZ A;  4I0X B;  3Q4H B;  4LWS B;  3GVM A;  3FD9 A;  1WA8 B;  3Q4H A;  3FAV B;  4I0X A;  3G80 A;  4LWS A;  1WA8 A;  3FAV A;  4GZR B;  3TXQ A;  3GWK C;  2B9Z A;  2AZ2 A;  2VS0 A;  3HR0 A;  2KG7 B;  3TXS A;  3OGI B;  2DE0 X;  2KG7 A;  3O9O A;  2AZ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...