3ZBHA

Geobacillus thermodenitrificans esxa crystal form i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
90
structure length
90
Chain Sequence
LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Homodimeric Esat-6-Family Proteins Esxa and Esxb from Geobacillus Thermodenitrificans
rcsb
molecule tags Unknown function
molecule keywords ESXA
total genus 41
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3zbhA00
2AZ2A 2VS0A 3TXSA 3FD9A 3GWKC 4ABMA 4I0XB 3OGIB 2DE0X 3FAVA 3HR0A 3ZBHA 4GZRB 1WA8A 2B9ZA 3FAVB 3GVMA 2KG7A 2AZ0A 3O9OA 3Q4HA 2KG7B 4LWSA 2VRZA 1WA8B 3Q4HB 4LWSB 3G80A 3TXQA 4I0XA
chains in the Genus database with same CATH superfamily
4TUYA 4K0KO 3LSQA 4X1IB 1W2BU 1COWG 1WP7A 4J7KA 4GKKO 1K9MW 3A0BZ 2DQ3A 1KD1W 4UV9A 2L35A 5H2FZ 1W0KG 2AGAA 2QDOA 3ZHSA 5LHGA 1K92A 2Q67A 3L75H 1OZ0A 5IJ9B 5IY5C 1P7BA 4L87A 5DN6G 1M90W 2AXTZ 3SJAC 2VS0A 3RVYA 4WCEV 1H2GA 2E3CA 3BVOA 1MMMA 2IJHA 4O4IB 1RFYA 3CCLV 1K4CC 4P30A 3VOUA 4LWSA 1EN5A 4RQEA 3WB1A 4JTDB 5KAFZ 1QU7A 2XASA 4PELA 3H1HH 2BSKB 2YEVB 1IBMO 3HKBA 4D7SA 1NVPD 4DV0O 1AJQA 2VWKA 2E75B 2YI9A 1Q90D 1S72V 1AROP 3ETDA 2EJ7A 2PI4A 2QTOA 3RT3C 2QWRB 3FX7A 2EULA 3FB8C 2WWWA 4HYOA 2IU0A 5C93A 1RM1C 3JD2A 2DYRB 1EBOA 2P22C 2WLNA 3UCSC 3RYFA 4J7JA 1V55B 1N33O 2DJVA 3K5OA 1BMFG 1M9NA 4DW1A 4HBNA 2UU9O 1G6UA 2QKSA 4YHHB 5JVDB 3EXAA 1VQMV 1I0HA 1K5SA 4NYKA 2VQEO 4CH5A 1Q5OA 4DYLA 2A79B 5EBWC 3B4SA 1N32B 1FXKC 4JYAB 1PNMA 2RMKB 3ZMTA 3FYEB 4YY3B 2KKWA 5LXTA 1GN3A 3CB2A 1VQ7V 2KG7B 4X1KB 1YIJV 1FJGB 3IC7A 5FPOA 3FYIB 1VF7A 2CK3G 1H2MA 4DR6O 3CD6V 4K3AA 2ADPA 1XMQB 3ASNB 3SPIA 5FNVA 3P3NA 2WLKA 1Y74A 4GZRB 1PL4A 2PZSA 4W4KA 2EJRA 3CRQA 3A0HZ 3ABMB 2P4VA 2OT5A 3BHPA 4MTFA 1TVKB 2CDYA 3SYOA 4AQYO 5AG2A 4GCZA 3T1HB 4YHHO 1NJIW 1JJ2U 4LFCO 3ASOC 3MHSC 1K34A 4FM2A 1EM1A 1AJNA 1CEZA 3E22B 2KQXA 4JAUA 1HWYA 5CN0A 1FXHA 2N05A 5LMNB 1MNGA 3Q4HA 5IYDO 3A0RA 4YJ2A 2WLHA 4JI3B 1IDSA 4B7EA 4R8CA 1B3QA 5CBHA 4FLUA 1NH2D 4LF6O 4JI3O 1K8AW 3K79A 4Q20A 4IHJB 3HR0A 5EYPB 2N04A 1VEWA 2XTAA 2KG7A 2QGNA 1TUBB 1X59A 2Q7GA 2HG5C 3B2EE 5E1AC 1OCOB 2KSDA 1YJWV 1VP7A 2QKAA 2VWJA 4JYYA 3N2KB 3ML0A 2XOKG 3RGBA 4X89A 4U3FH 1OCCB 4ZIBA 4BR6A 3SJQC 3RYHB 1SQPH 2Q8VA 2YXYA 4GT1A 2PGGA 2HJDA 2Y4TA 2ZR2A 1UFIA 3J81N 1HNWO 3RYFB 2X6CA 1N0NA 3CRCA 5TISZ 4MSWC 1VIBA 3LDDA 1DGSA 3SPHA 3ETGA 2WLIB 1Q43A 5KX5B 2BOCC 4TV9A 3J7AU 1JCHA 4DV5O 2UUAB 3SPGA 3JCZA 4DK0A 2ZKOA 1JJOA 1AP6A 4TT3G 3L9DA 4I4TA 5JJJB 4DRXA 4FLYA 4PI2A 2WSSG 4QIWF 1XMOO 4NB5A 5KHHA 2A06H 3K03A 1XHZA 3DXRB 1S0VA 4LBEC 3CS5A 3OFNG 4B3SO 4QE9A 1S5HC 5LMUO 3CRRA 1KKCA 5B1OA 1Y6XA 4PD4F 4X1KA 4DO2A 5KMGB 2HFEC 3P30A 1AP5A 1YTFB 5L3CA 2PYJA 3JD4A 2UUCO 5BZBA 1KECA 4PDMA 2ZQMA 4O4HB 4LFCB 1HNZO 4U3JA 2AHZA 3R65A 1QR8A 3ABKB 4UVAA 4WFEA 5BR8O 4LR3A 4P9PA 1Q6IA 1P84F 2XAHA 4H0LB 4TQFA 4JTCB 4B3TB 1PP9H 3UO3A 1QLNA 1B6QA 3QNEA 3BEHA 1AR4A 4UVCA 4DR6B 1IZ3A 1GTOA 3K06A 1KP3A 4DUYO 2EIKC 2MK3A 4O4HA 3EHBB 4X64O 4I5SA 1DTOA 2FB5A 4F6RA 3ABLC 3JASA 2B9ZA 3CMAV 1FPOA 3HKEA 3L74H 3LNNA 2JK5C 5JH7A 2VRZA 4I55A 5B66Z 2ILMA 2ADQB 1Q6UA 2ZIOA 2A7WA 3E8FA 5JCOA 1H38A 1XQ8A 2OCCC 2JDIG 3STLC 4MTXA 1P7GA 1ZX3A 4ICGA 1TUBA 2X6BA 2GTSA 2V1DA 2OYQA 4EB6A 4X64B 2LW7A 2HEPA 3OW2U 4OGQB 1NTMH 1ZAUA 5LMUB 3QO5A 3OR6C 3O65A 3IFXA 1SS3A 5B5EZ 5IWAO 1Q86W 2DYRC 3W7WA 1YITV 2W0XA 2Y48A 2VQFB 3JATA 4BAYA 2BE3A 4X9QA 4RQFA 2Q7HA 3E22A 2YS8A 2JIZG 1VQ6V 3JAKA 2RJZA 3T4ZA 1PPJH 3SGIA 2ZIMA 1GN6A 1XEQA 1I94B 4OPHA 3ABUA 3VBBA 3UKMA 3ZBHA 2HVKC 1EN6A 5J2TB 4GKJB 4O2BA 4KFMA 3ASOB 1BQ0A 2JJ1G 3E8GA 4BIZA 1KQSU 1M56B 3VQXA 3S3XA 2E5LB 3TGUH 3ZMSA 2EX3A 3RWRD 3ZHVA 3OMNB 2GHYA 5FLXN 2R9IA 5EC1C 2V7QG 4GX5A 5JJEB 5KA6A 1GN4A 3DXRA 1B06A 3BA9A 3H1KH 4FLXA 2YXLA 1SF9A 4PA9A 3FB5C 2R70A 1JVMA 4MVZA 2CAZC 4RO2A 3U10A 5EC2C 2XAJA 1AR5A 1LR1A 4CZZA 3O9OA 2Q5ZA 5BMVA 2E5LO 2HP8A 5CB4B 3SYPA 3K0DA 1RM1B 1FS0G 4GYCB 2W0FC 2YIAA 1HW7A 4X1YA 3APOA 2BTOA 2IJIA 3CYOA 4J42A 4LNUA 3AG1C 2QM4A 4LP8A 4DV0B 1O9GA 1TA8A 3H9VA 4C7UA 4IGGA 4GX2A 4IIJA 1AI5A 2EIKB 2ETNA 2IH3C 2Q6AA 3SJBC 2F43G 1YXBA 3JARB 3K59A 5JJNB 2LGQA 4FLTA 1PL0A 3CJHA 4NVPA 2BSKA 1VQLV 2UUBB 4NR1A 4LNUB 1PV0A 1XL4A 5LOVB 3CRAA 3SYAA 2CTPA 1YHQV 2YI8A 1NH2B 1BE3H 5A9GA 4UVBA 4GLXA 4EFBA 3W7XA 3UO2A 3DGEA 1MA1A 5LA6A 1N36O 1R3KC 2BCCH 3RBZA 1TUEB 4DXWA 3ETEA 4YXWG 5BR8B 2DOSA 2Z5UA 3JD1A 5EBLC 2GUZB 4JAVA 1BS3A 4J10A 4H33A 3M8AA 4JTAB 3CC7V 2YICA 3L70H 3M99B 2ITDC 4DR2B 2JVDA 4MVRA 4K35A 4TUYB 2B1IA 4D6TH 2ODMA 4IHJA 4BIOA 2CGNA 2P6JA 3RYIB 1M5IA 1R3JC 4JI8O 1V9PA 3N2GB 4G2KA 3JASB 3K08A 4JI5O 2WLMA 5J2UA 4LF5B 1FXKB 5LL6Y 1ENVA 1URFA 2XAFA 5J2TA 3VQVA 4PA6A 4QPKA 1K4DC 1BHAA 5BY1A 4CC5A 4K8XA 4JV5B 4DV5B 4DR3B 3PJSK 1HP8A 4JI6O 2F1MA 4PA7A 1Y66A 4MVUA 1GAXA 2FL4A 1SZTA 1SC5B 1HNXB 1P4RA 2AW9A 1XDCA 1IX9A 2ZNIA 1YCIA 5KHIA 1FFXB 2JGDA 1HNXO 2QKCA 2W6IG 1YSCA 4W4LA 3H1LH 4JI6B 5D5QA 3CCVV 2PTMA 5EK0A 4UFZA 2DYSC 2FKXA 4FJCC 3CCMV 3KG2A 1X4TA 2A0LA 3FB6C 2YSUB 5KA5A 1YI2V 4HNAB 2WA4A 5KX5A 4TSFG 2EIMB 5K1PA 4RWUA 5E79Z 1RP3B 4MTOA 3E89A 3WB2A 3OUFA 2EINC 3JD0A 4JI4B 5CA0A 5GW7A 2QE7G 1F4NA 4Z1MG 1FYJA 4BIUA 3AK1A 1BL8A 1TAEA 4DRXB 4B3TO 1IURA 4ZOLB 2PYLA 4I50B 4AILC 4D7TA 3TK1A 1SERA 4PHZA 4TV8A 3KZIZ 4E2LA 5IY5B 3B8MA 3OUSA 2ZNJA 3C90A 2HKOA 2LGWA 4TOIA 3OTOB 1KU9A 2OIEA 4QNHB 5B1AB 1MZEA 3TETA 2X6AA 2IJKA 1LUWA 4LF5O 2DN9A 4JI1O 4DUYB 1GRJA 3LUTB 5IJ0A 3CC4V 2QEXV 1NQTA 4CS3A 4KP4A 3ZHRA 2QTSA 2QR4A 4B3MO 4RUFA 1LNQA 1JQ0A 2JGUA 4CH3A 4ABMA 3H1IH 4FFBA 3RYHA 1L0LH 4U3JB 2PF4E 3W7UA 1XNQO 5L3FA 1WPBA 1GKFA 1SRYA 4YIPA 2ZDIA 3KCXA 3JSNA 3CHXA 3RYCA 5A2QN 1OCOC 3C3SA 1R73A 1YVWA 1NBMG 3FAVA 4DR3O 3G4SV 4O2AB 5H9CA 2A9HA 1NKDA 1WJZA 3DC5A 3IC9A 2LJ2A 3G71V 4WF9V 1FXVA 3VQWA 3RW0A 1NR1A 3CJHB 1MG1A 3M7MX 3I56V 1XI1A 1OCCC 3L71H 2ZT9B 4YJ2B 4I55B 4J9YB 2D2CB 1JFFA 3I55V 2FYUH 1Y67A 1UPGA 3OTFA 4FPPA 4YIOA 3QVNA 1BCCH 4U7NA 5L3BA 4KUMA 4X66B 2QM8A 3KCYA 1Y76A 1NR7A 1VQKV 1QCEA 2AZ0A 4WFFA 1N36B 5B1BC 3ABMC 4FLZA 1D2DA 3JALB 1NS1A 4GKKB 2DMXA 3D3QA 2ZDIC 4A5UB 4NKGB 4X62O 3ZS8C 2N74A 3FB7C 5KLVH 1Q82W 3RN4A 1Q8IA 2LQTA 4H44B 4I0XB 4CH6A 5CA0B 4NTWA 3ZCCA 3NR7A 1HNZB 4CS2A 1YF2A 1FFXA 2JGDB 2JS3A 2KB1A 4PDVA 5LHHA 1R1BA 5LP6A 4JAAA 2XNDG 2IU3A 4ZHQB 3E8BA 3MAQA 1H8HG 4UB6Z 4O4JB 2R9AA 3AEIA 3ICXA 3JSLA 2F93B 1E1QG 3ZHTA 3AG3C 3WU2Z 1ZLZA 3ZRVA 4JI1B 1QLEB 3QO7A 4OX9O 2F4VO 1VF6C 3AK2A 3W7TA 4OPAA 2AHYA 1DF4A 3HKCA 1KP2A 4CBCA 1FJGO 1QR9A 1GM9A 2EINB 2NR5A 3GWKC 3CE2A 1G4YB 4N23A 1I94O 3FAVB 5JQGB 4PV1B 1MZFA 3RYCB 5CBGA 3ZN0A 3MHHC 4EEQA 2QJ1A 4FLWA 1SESA 1U97A 4JGSA 1RPRA 2YIBD 5LYJA 3C3TA 1JX9A 1XL6A 3CC2V 4LF9B 4JI4O 5LGNA 4B3RB 1JR9A 4MVOA 2NN4A 2VQEB 1ZL8B 1W59A 5CMUA 3TCUA 1O9HA 1QLEC 4AI8A 1N33B 1IXMA 1MSWD 3D36A 1BSMA 4O4IA 1PNLA 5IYBO 1YZBA 3K0GA 4WFBV 4UCUA 3N2KA 2UXNA 3SYQA 4JI8B 1K33A 4I7ZB 3CX5F 1RPOA 2CGOA 3UT5A 1L0NH 1I5XA 4GKJO 4JI7O 2IH1C 2HJFC 4FIPC 4J80A 4Z2WA 1N0JA 1R6KA 1KB9F 4DV1O 2UUCB 5B3SC 1NU1H 4TQDA 3A8TA 1IBMB 1VQOV 4X1IA 5CBFA 1F7YA 1I08A 1GN2A 1RSOA 4JI7B 4LF4B 4MW3A 4ASUG 3CCEV 3T1YO 3IAYA 4L8JA 4IYHA 3ABTA 4JZGA 3BRCA 1JMKC 3RFRA 1Q7YW 5EBMC 1A32A 1ZUQA 3NXSA 5LBQA 4QPJA 1Z2GA 3MDSA 4JI2O 1YDXA 1SETA 4LC1A 1KUQA 4JF3A 3OD4A 2BOBC 3ABKC 1AVMA 3L73H 3DTUB 4UCVA 5KUKA 2YXHA 2EILB 2QWQB 3HKDB 4FZ1A 5DECA 1B04A 2JRIA 3CP1A 1QHTA 4HZ3A 5KAIZ 2XT9A 4DW0A 4AQYB 2LP7A 5CA1B 1PNKA 2Q68A 1LUVA 2WLLB 3G80A 3UT5B 4I9WA 2EBOA 4I0XA 5DM6V 1XUQA 1EFRG 4KHPO 4JV5O 2ATKC 4DV6B 1I5YA 1FAFA 2IM9A 3ZMUA 3F5WC 2VQFO 5KHKA 3ASNC 3X2QC 4OX9B 2K9PA 4F6RB 1GM7A 3D3IA 3ZHUA 2WPDG 1F23A 1J95A 4BWAA 2WAMA 1OJHA 4FVMA 4BW5A 1XNRB 4LFAB 2HVJC 3H01A 4PA3A 5EZYB 1Q6HA 2QWPB 3H1JH 2R9RB 4CS4A 2DWEC 4LF9O 3CCQV 4WBNA 1BT8A 2P06A 3AG3B 1VMGA 2CH7B 1SQXH 1BQZA 1VQ9V 1AB3A 3BPZA 1R3LC 2L6LA 1FXKA 2ZE8A 5IWAB 1US6A 1XBLA 4GUNA 3HB3B 2EZPA 4KXRA 4WFHA 5H5NA 4N21A 4O2AA 5F2VO 2UXBO 2B5UA 1Y4MA 4JI5B 5LP6C 3SDLA 1XMOB 3OE7G 2ZINA 3STZC 4ZHQA 2YDEA 4ZKIA 1QBZA 5LP6B 3CEIA 1AR1B 1U96A 3K9SA 5CA1A 3OT7A 4QE7A 2GTAA 5HFLA 2EIMC 2W6JG 2UUAO 4H13B 4DUZB 4DV4O 2Z0AA 3E8HA 4UB8Z 4FZ0A 3QG5A 4R50A 2P7TC 4DR7O 1M57B 4EKWA 1M1KW 3E83A 4X65B 3JAWB 1XILA 3CMEV 4DV1B 5IJ9A 2F23A 1YTFD 1THZA 1XMQO 1VQ4V 3U0ZA 2D3OW 3T1CA 5KHGA 1N4CA 3ZIAG 3CWBH 4PJ0Z 1SKVA 1PM9A 3A2FA 1VQ5V 5C8YB 1XOUA 3QTCA 4O4LA 2OWOA 4DV3B 4MS2A 3AG4C 3GWOA 2JEUA 1ZL8A 4HAMA 1W0JG 2FMLA 4MTGA 1N34B 1VQ8V 3ZHQA 4ZI7B 3S3WA 4B3RO 1XNQB 2ZR3A 3D36C 3N2GA 3E86A 4F6EA 1ZTEA 4FK5C 4CH4A 2XHBA 4DR5O 2UU9B 1OCZB 1M57C 3F5TA 1M56C 3AG2B 2DYSB 2NLJC 3E35A 1N34O 2Y69B 3OM3B 1IBLB 2DE0X 2UXDB 4O4LB 3RVZA 5DEDA 5H6RA 1BHBA 3LNMB 1NI8A 4JYBA 1S5LZ 3SJCC 1Q3EA 3K3WA 3IJ4A 3OMIB 4X62B 1HNWB 3OMAB 2XAGA 1KMIZ 1SA0A 1V54C 3K5MA 3APQA 2Y0IA 1H2KA 4I4TB 3FD9A 3BABA 1FFTB 1OV9A 4NXNB 5BXZA 3N27A 3VQYA 2F95B 2ZE5A 4TV9B 2OIGA 1M93A 1F4MA 4MVMA 4LF4O 2PI5A 2B1GA 4UV8A 1IBKB 1J5EB 2RN9A 4DUZO 3GB7C 3LSUA 4DV7O 4TWKA 1S5JA 2WLJA 3ZJZA 5GTIZ 2JJ2G 3F7VC 3G6BA 5LXTB 2ZM6B 2ZCEA 4JI0O 2P4KA 1KKDA 1D5NA 4PI0A 2QA4V 2WLIA 4JPRA 4IL6Z 1WN7A 3HKCB 3LSSA 2LW1A 4XDJA 3CPWU 3T1YB 4PDLA 3K58A 4QJFB 2UUBO 1WNSA 3ZMVA 3CCJV 4DV6O 5CA3A 5FPRA 2Q69A 1VF5B 5LMNO 3SR2C 3FFQA 1AI6A 3L72H 2XAQA 3ABLB 4LFBO 3RYIA 2XUMA 4O4JA 3T1HO 1ZWIC 5J9PC 1SQQH 4EFEA 5IT9N 3G6EV 5D5PA 1CPYA 5ITZA 1K5QA 3WFVA 1JFFB 2GDSA 2PY5A 1CXZB 5EZYA 1OCRC 5L3GA 4NTYA 1S77D 2IW5A 2HHHB 2YC0A 4CC6A 1QVGU 3AG7A 4ZBMA 2YEVA 3R66A 3ZRXA 5KUMA 4LFAO 1XREA 2UXCB 4MW8A 2ZM6O 4ZI7A 2G38A 3F7YC 2ZD9A 5ITZB 4PA4A 4LF7B 5EYPA 1S76D 5KHJA 4WFAV 2RQ6A 3BFRA 1QNMA 4LH7A 4JASA 5C8YA 3CCUV 1MOFA 3SPJA 3HKBB 1R3IC 3K9AA 1MSDA 2M7WA 2PUSA 3SYCA 4DV2B 1RSOB 1D5AA 2H94A 5KMGA 5FNVB 4XBFA 1Z5VA 3EFFK 2P67A 1SQGA 1TVKA 1EZJA 1L8DA 3OGCC 3J80N 1G8MA 1QVFU 4JYAO 3JAWA 4XDLA 2X7RB 1EZVH 2MW2B 5B1BB 2RNBA 1VARA 4GX1A 1JA8A 1VF6A 2QWNB 3ZRSA 1GH6A 2Q0AA 4MVSA 5LYJB 3TXSA 4DV3O 3CCSV 1AI4A 5K1XA 1PD3A 4J9ZB 2QWOB 3X2QB 1VQPV 1WLEA 1VQNV 1GK9A 5B3SB 1K7DA 2BTQA 5IYZA 1DF5A 4FMTA 4B3SB 1WB7A 3CRMA 2A3QA 3HPLC 3ZRWA 2ITCC 4IT5A 5CB4A 2OCCB 1DLBA 3K5NA 4NXMB 1ORQC 2C2AA 2LO1A 3AG1B 3THOA 2Q4PA 3IGAC 2UXBB 1K3EA 4X65O 3JARA 4X88A 3I5DA 2Q0OC 1L1FA 3OGIB 1Y76B 3OR7C 4I50A 1WP8A 4WFGA 5J2UB 4IIJB 2ZXWC 4I9QA 3CCRV 1DK1A 3U11A 2CE4A 3T2MA 4DR2O 1J5EO 2K1EA 4DV2O 2Y4UA 5LHIA 4O2BB 4BW9A 4DR1O 5H6QA 1PKXA 3ZN1A 1NTKH 1MABG 3G67A 3P3PA 3OEEG 4RUEA 4G28B 2GV9A 1ROPA 5EIBD 1NT2B 5FL7G 1H2SB 1M4UA 5B1NA 1Z5WA 5HFMA 3QF7A 3JAKB 4K8ZA 2JEXA 2NNUA 2EIJC 4B08A 2R72A 3KKYA 3DSQA 3OAAG 1JPXA 1E1RG 4FM1A 1I7FA 2CTQA 1UJWB 1SQBH 2OTLV 1P49A 1V55C 3JD3A 1AILA 1GMGA 1T5EA 2JS5A 1V54B 3B09A 3HKDA 1FKAO 4HNAA 1KYOF 2WA3A 2CTWA 4DR1B 3BAAA 1KBHA 1AI7A 2DWDC 2WLLA 4IYIA 3D8CA 2YIBA 4EB6B 4DR5B 2ZE6A 1IBKO 4J11A 1IVSA 2Y0PA 1TGOA 3BA8A 4E4EA 1OCZC 4UUJC 4FM0A 2GBOA 4X20B 1WA8A 2FTKA 4Z1VA 4LH6A 2M6YA 5JH7B 1YJNV 3WG7C 1IXBA 4F4LA 3JALA 1WA8B 4X20A 5IYCO 4MVQA 3P32A 1K73W 1SQFA 2EIJB 3FKSG 1G1XB 3W7SA 2V4DA 2LFRA 3OTOO 4PDRA 5LGUA 3ZRWB 4P9OA 3UM7A 1HR0B 4FLVA 4AHCA 4U7OA 2GUZA 2UXDO 1OHHG 2QSAA 3JATB 3UQ8A 2Y69C 4NTXA 4UCRA 2UXXA 1Q81W 4J41A 2OCHA 4DR4O 4X8AA 3JCUZ 1OCRB 4H37A 4UCSA 2GSMB 4JYCA 5JVDA 2H3OA 1SZXA 1GO3F 1NTZH 3CXHF 1SA0B 4YJ3A 4B3MB 4R6ZA 3AG4B 4JZ2A 1ZSPA 1HR0O 5L3EA 3LDCA 2DQ0A 2EZOA 4X1YB 3TJTA 4LWSB 2CH7A 4GX0A 4NXMO 2H8PC 5JWPA 5LA6B 3K5LA 5IDJA 4LF8B 5BMVB 3SPCA 2Q7EA 1AJPA 1SQVH 2E76B 3JAMN 1NVPB 3BCCH 3WB0A 4KHPB 4JI0B 2HR3A 3HKEB 2RDCA 4J7ZA 3QO8A 2Q73A 2EILC 4QGPA 4LFBB 2HLDG 4UCTA 4X66O 4UXNA 4DK1A 3Q4HB 2ZE7A 1F51A 2F66C 3LDEA 4DR7B 1QQCA 1YEWA 3WG7B 1HDJA 5JQGA 1FD9A 3ZEDA 1K97A 5JCOC 4Q6GA 5L3DA 5B1AC 4LF6B 3MD0A 4DV4B 4NXNO 3OEHG 1YJ9V 3AK3A 2ARHA 4ZOLA 4LCUC 1KC8W 4UCOA 2IBZH 4WBNB 4MT8A 5IJ0B 3E2EA 2X0LA 1R6NA 1WAZA 4KL1A 3BY6A 4FFKA 2AZ2A 4RAIA 1Y74B 2HHHO 2Z3YA 4DV7B 1N8RW 5IE9A 2IJJA 2F4VB 3AG2C 3PN1A 4YJ3B 5GTHZ 2O57A 2LFSA 2CUGA 1GM8A 4FFBB 4B7KA 2YIDA 4K0KB 4DR4B 3DC6A 1S3JA 3B8NA 3ZMZA 1H8EG 5GONB 4YY3O 3JYCA 4G27B 1CP9A 1R6TA 3B77A 1H2NA 3T4DA 3K57A 1WPXA 4XDKA 4LF7O 4P2ZA 3ETQA 4OXSA 2RCVA 3B40A 2OTJV 5LOVA 2YUAA 5EIBC 4LF8O 2CTRA 1JOYA 5GONA 2UXCO 3TXQA 4JI2B 4TV8B 1XNRO 2Q9LA 3CSXA 1WB8A 2P5OA 1BGYH 2ZXWB 1IBLO 2DW4A 1H2LA 2E74B 3EVKA 3K04A 3CXCU 1N32O 3GVMA 2BTQB 5IYZB 1EN4A 1NZ6A 4R7CA 5LGTA 2P90A 2QM7A 1BZKA 3ZX6A 1E79G 1XHXA
chains in the Genus database with same CATH topology
2AZ2A 2VS0A 3TXSA 3FD9A 3GWKC 4ABMA 4I0XB 3OGIB 2DE0X 3FAVA 3HR0A 3ZBHA 4GZRB 1WA8A 2B9ZA 3FAVB 3GVMA 2KG7A 2AZ0A 3O9OA 3Q4HA 2KG7B 4LWSA 2VRZA 1WA8B 3Q4HB 4LWSB 3G80A 3TXQA 4I0XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AZ2 A;  2VS0 A;  3TXS A;  3FD9 A;  3GWK C;  4ABM A;  4I0X B;  3OGI B;  2DE0 X;  3FAV A;  3HR0 A;  3ZBH A;  4GZR B;  1WA8 A;  2B9Z A;  3FAV B;  3GVM A;  2KG7 A;  2AZ0 A;  3O9O A;  3Q4H A;  2KG7 B;  4LWS A;  2VRZ A;  1WA8 B;  3Q4H B;  4LWS B;  3G80 A;  3TXQ A;  4I0X A; 
#chains in the Genus database with same CATH topology
 4TUY A;  4K0K O;  3LSQ A;  4X1I B;  1W2B U;  1COW G;  1WP7 A;  4J7K A;  4GKK O;  1K9M W;  3A0B Z;  2DQ3 A;  1KD1 W;  4UV9 A;  2L35 A;  5H2F Z;  1W0K G;  2AGA A;  2QDO A;  3ZHS A;  5LHG A;  1K92 A;  2Q67 A;  3L75 H;  1OZ0 A;  5IJ9 B;  5IY5 C;  1P7B A;  4L87 A;  5DN6 G;  1M90 W;  2AXT Z;  3SJA C;  2VS0 A;  3RVY A;  4WCE V;  1H2G A;  2E3C A;  3BVO A;  1MMM A;  2IJH A;  4O4I B;  1RFY A;  3CCL V;  1K4C C;  4P30 A;  3VOU A;  4LWS A;  1EN5 A;  4RQE A;  3WB1 A;  4JTD B;  5KAF Z;  1QU7 A;  2XAS A;  4PEL A;  3H1H H;  2BSK B;  2YEV B;  1IBM O;  3HKB A;  4D7S A;  1NVP D;  4DV0 O;  1AJQ A;  2VWK A;  2E75 B;  2YI9 A;  1Q90 D;  1S72 V;  1ARO P;  3ETD A;  2EJ7 A;  2PI4 A;  2QTO A;  3RT3 C;  2QWR B;  3FX7 A;  2EUL A;  3FB8 C;  2WWW A;  4HYO A;  2IU0 A;  5C93 A;  1RM1 C;  3JD2 A;  2DYR B;  1EBO A;  2P22 C;  2WLN A;  3UCS C;  3RYF A;  4J7J A;  1V55 B;  1N33 O;  2DJV A;  3K5O A;  1BMF G;  1M9N A;  4DW1 A;  4HBN A;  2UU9 O;  1G6U A;  2QKS A;  4YHH B;  5JVD B;  3EXA A;  1VQM V;  1I0H A;  1K5S A;  4NYK A;  2VQE O;  4CH5 A;  1Q5O A;  4DYL A;  2A79 B;  5EBW C;  3B4S A;  1N32 B;  1FXK C;  4JYA B;  1PNM A;  2RMK B;  3ZMT A;  3FYE B;  4YY3 B;  2KKW A;  5LXT A;  1GN3 A;  3CB2 A;  1VQ7 V;  2KG7 B;  4X1K B;  1YIJ V;  1FJG B;  3IC7 A;  5FPO A;  3FYI B;  1VF7 A;  2CK3 G;  1H2M A;  4DR6 O;  3CD6 V;  4K3A A;  2ADP A;  1XMQ B;  3ASN B;  3SPI A;  5FNV A;  3P3N A;  2WLK A;  1Y74 A;  4GZR B;  1PL4 A;  2PZS A;  4W4K A;  2EJR A;  3CRQ A;  3A0H Z;  3ABM B;  2P4V A;  2OT5 A;  3BHP A;  4MTF A;  1TVK B;  2CDY A;  3SYO A;  4AQY O;  5AG2 A;  4GCZ A;  3T1H B;  4YHH O;  1NJI W;  1JJ2 U;  4LFC O;  3ASO C;  3MHS C;  1K34 A;  4FM2 A;  1EM1 A;  1AJN A;  1CEZ A;  3E22 B;  2KQX A;  4JAU A;  1HWY A;  5CN0 A;  1FXH A;  2N05 A;  5LMN B;  1MNG A;  3Q4H A;  5IYD O;  3A0R A;  4YJ2 A;  2WLH A;  4JI3 B;  1IDS A;  4B7E A;  4R8C A;  1B3Q A;  5CBH A;  4FLU A;  1NH2 D;  4LF6 O;  4JI3 O;  1K8A W;  3K79 A;  4Q20 A;  4IHJ B;  3HR0 A;  5EYP B;  2N04 A;  1VEW A;  2XTA A;  2KG7 A;  2QGN A;  1TUB B;  1X59 A;  2Q7G A;  2HG5 C;  3B2E E;  5E1A C;  1OCO B;  2KSD A;  1YJW V;  1VP7 A;  2QKA A;  2VWJ A;  4JYY A;  3N2K B;  3ML0 A;  2XOK G;  3RGB A;  4X89 A;  4U3F H;  1OCC B;  4ZIB A;  4BR6 A;  3SJQ C;  3RYH B;  1SQP H;  2Q8V A;  2YXY A;  4GT1 A;  2PGG A;  2HJD A;  2Y4T A;  2ZR2 A;  1UFI A;  3J81 N;  1HNW O;  3RYF B;  2X6C A;  1N0N A;  3CRC A;  5TIS Z;  4MSW C;  1VIB A;  3LDD A;  1DGS A;  3SPH A;  3ETG A;  2WLI B;  1Q43 A;  5KX5 B;  2BOC C;  4TV9 A;  3J7A U;  1JCH A;  4DV5 O;  2UUA B;  3SPG A;  3JCZ A;  4DK0 A;  2ZKO A;  1JJO A;  1AP6 A;  4TT3 G;  3L9D A;  4I4T A;  5JJJ B;  4DRX A;  4FLY A;  4PI2 A;  2WSS G;  4QIW F;  1XMO O;  4NB5 A;  5KHH A;  2A06 H;  3K03 A;  1XHZ A;  3DXR B;  1S0V A;  4LBE C;  3CS5 A;  3OFN G;  4B3S O;  4QE9 A;  1S5H C;  5LMU O;  3CRR A;  1KKC A;  5B1O A;  1Y6X A;  4PD4 F;  4X1K A;  4DO2 A;  5KMG B;  2HFE C;  3P30 A;  1AP5 A;  1YTF B;  5L3C A;  2PYJ A;  3JD4 A;  2UUC O;  5BZB A;  1KEC A;  4PDM A;  2ZQM A;  4O4H B;  4LFC B;  1HNZ O;  4U3J A;  2AHZ A;  3R65 A;  1QR8 A;  3ABK B;  4UVA A;  4WFE A;  5BR8 O;  4LR3 A;  4P9P A;  1Q6I A;  1P84 F;  2XAH A;  4H0L B;  4TQF A;  4JTC B;  4B3T B;  1PP9 H;  3UO3 A;  1QLN A;  1B6Q A;  3QNE A;  3BEH A;  1AR4 A;  4UVC A;  4DR6 B;  1IZ3 A;  1GTO A;  3K06 A;  1KP3 A;  4DUY O;  2EIK C;  2MK3 A;  4O4H A;  3EHB B;  4X64 O;  4I5S A;  1DTO A;  2FB5 A;  4F6R A;  3ABL C;  3JAS A;  2B9Z A;  3CMA V;  1FPO A;  3HKE A;  3L74 H;  3LNN A;  2JK5 C;  5JH7 A;  2VRZ A;  4I55 A;  5B66 Z;  2ILM A;  2ADQ B;  1Q6U A;  2ZIO A;  2A7W A;  3E8F A;  5JCO A;  1H38 A;  1XQ8 A;  2OCC C;  2JDI G;  3STL C;  4MTX A;  1P7G A;  1ZX3 A;  4ICG A;  1TUB A;  2X6B A;  2GTS A;  2V1D A;  2OYQ A;  4EB6 A;  4X64 B;  2LW7 A;  2HEP A;  3OW2 U;  4OGQ B;  1NTM H;  1ZAU A;  5LMU B;  3QO5 A;  3OR6 C;  3O65 A;  3IFX A;  1SS3 A;  5B5E Z;  5IWA O;  1Q86 W;  2DYR C;  3W7W A;  1YIT V;  2W0X A;  2Y48 A;  2VQF B;  3JAT A;  4BAY A;  2BE3 A;  4X9Q A;  4RQF A;  2Q7H A;  3E22 A;  2YS8 A;  2JIZ G;  1VQ6 V;  3JAK A;  2RJZ A;  3T4Z A;  1PPJ H;  3SGI A;  2ZIM A;  1GN6 A;  1XEQ A;  1I94 B;  4OPH A;  3ABU A;  3VBB A;  3UKM A;  3ZBH A;  2HVK C;  1EN6 A;  5J2T B;  4GKJ B;  4O2B A;  4KFM A;  3ASO B;  1BQ0 A;  2JJ1 G;  3E8G A;  4BIZ A;  1KQS U;  1M56 B;  3VQX A;  3S3X A;  2E5L B;  3TGU H;  3ZMS A;  2EX3 A;  3RWR D;  3ZHV A;  3OMN B;  2GHY A;  5FLX N;  2R9I A;  5EC1 C;  2V7Q G;  4GX5 A;  5JJE B;  5KA6 A;  1GN4 A;  3DXR A;  1B06 A;  3BA9 A;  3H1K H;  4FLX A;  2YXL A;  1SF9 A;  4PA9 A;  3FB5 C;  2R70 A;  1JVM A;  4MVZ A;  2CAZ C;  4RO2 A;  3U10 A;  5EC2 C;  2XAJ A;  1AR5 A;  1LR1 A;  4CZZ A;  3O9O A;  2Q5Z A;  5BMV A;  2E5L O;  2HP8 A;  5CB4 B;  3SYP A;  3K0D A;  1RM1 B;  1FS0 G;  4GYC B;  2W0F C;  2YIA A;  1HW7 A;  4X1Y A;  3APO A;  2BTO A;  2IJI A;  3CYO A;  4J42 A;  4LNU A;  3AG1 C;  2QM4 A;  4LP8 A;  4DV0 B;  1O9G A;  1TA8 A;  3H9V A;  4C7U A;  4IGG A;  4GX2 A;  4IIJ A;  1AI5 A;  2EIK B;  2ETN A;  2IH3 C;  2Q6A A;  3SJB C;  2F43 G;  1YXB A;  3JAR B;  3K59 A;  5JJN B;  2LGQ A;  4FLT A;  1PL0 A;  3CJH A;  4NVP A;  2BSK A;  1VQL V;  2UUB B;  4NR1 A;  4LNU B;  1PV0 A;  1XL4 A;  5LOV B;  3CRA A;  3SYA A;  2CTP A;  1YHQ V;  2YI8 A;  1NH2 B;  1BE3 H;  5A9G A;  4UVB A;  4GLX A;  4EFB A;  3W7X A;  3UO2 A;  3DGE A;  1MA1 A;  5LA6 A;  1N36 O;  1R3K C;  2BCC H;  3RBZ A;  1TUE B;  4DXW A;  3ETE A;  4YXW G;  5BR8 B;  2DOS A;  2Z5U A;  3JD1 A;  5EBL C;  2GUZ B;  4JAV A;  1BS3 A;  4J10 A;  4H33 A;  3M8A A;  4JTA B;  3CC7 V;  2YIC A;  3L70 H;  3M99 B;  2ITD C;  4DR2 B;  2JVD A;  4MVR A;  4K35 A;  4TUY B;  2B1I A;  4D6T H;  2ODM A;  4IHJ A;  4BIO A;  2CGN A;  2P6J A;  3RYI B;  1M5I A;  1R3J C;  4JI8 O;  1V9P A;  3N2G B;  4G2K A;  3JAS B;  3K08 A;  4JI5 O;  2WLM A;  5J2U A;  4LF5 B;  1FXK B;  5LL6 Y;  1ENV A;  1URF A;  2XAF A;  5J2T A;  3VQV A;  4PA6 A;  4QPK A;  1K4D C;  1BHA A;  5BY1 A;  4CC5 A;  4K8X A;  4JV5 B;  4DV5 B;  4DR3 B;  3PJS K;  1HP8 A;  4JI6 O;  2F1M A;  4PA7 A;  1Y66 A;  4MVU A;  1GAX A;  2FL4 A;  1SZT A;  1SC5 B;  1HNX B;  1P4R A;  2AW9 A;  1XDC A;  1IX9 A;  2ZNI A;  1YCI A;  5KHI A;  1FFX B;  2JGD A;  1HNX O;  2QKC A;  2W6I G;  1YSC A;  4W4L A;  3H1L H;  4JI6 B;  5D5Q A;  3CCV V;  2PTM A;  5EK0 A;  4UFZ A;  2DYS C;  2FKX A;  4FJC C;  3CCM V;  3KG2 A;  1X4T A;  2A0L A;  3FB6 C;  2YSU B;  5KA5 A;  1YI2 V;  4HNA B;  2WA4 A;  5KX5 A;  4TSF G;  2EIM B;  5K1P A;  4RWU A;  5E79 Z;  1RP3 B;  4MTO A;  3E89 A;  3WB2 A;  3OUF A;  2EIN C;  3JD0 A;  4JI4 B;  5CA0 A;  5GW7 A;  2QE7 G;  1F4N A;  4Z1M G;  1FYJ A;  4BIU A;  3AK1 A;  1BL8 A;  1TAE A;  4DRX B;  4B3T O;  1IUR A;  4ZOL B;  2PYL A;  4I50 B;  4AIL C;  4D7T A;  3TK1 A;  1SER A;  4PHZ A;  4TV8 A;  3KZI Z;  4E2L A;  5IY5 B;  3B8M A;  3OUS A;  2ZNJ A;  3C90 A;  2HKO A;  2LGW A;  4TOI A;  3OTO B;  1KU9 A;  2OIE A;  4QNH B;  5B1A B;  1MZE A;  3TET A;  2X6A A;  2IJK A;  1LUW A;  4LF5 O;  2DN9 A;  4JI1 O;  4DUY B;  1GRJ A;  3LUT B;  5IJ0 A;  3CC4 V;  2QEX V;  1NQT A;  4CS3 A;  4KP4 A;  3ZHR A;  2QTS A;  2QR4 A;  4B3M O;  4RUF A;  1LNQ A;  1JQ0 A;  2JGU A;  4CH3 A;  4ABM A;  3H1I H;  4FFB A;  3RYH A;  1L0L H;  4U3J B;  2PF4 E;  3W7U A;  1XNQ O;  5L3F A;  1WPB A;  1GKF A;  1SRY A;  4YIP A;  2ZDI A;  3KCX A;  3JSN A;  3CHX A;  3RYC A;  5A2Q N;  1OCO C;  3C3S A;  1R73 A;  1YVW A;  1NBM G;  3FAV A;  4DR3 O;  3G4S V;  4O2A B;  5H9C A;  2A9H A;  1NKD A;  1WJZ A;  3DC5 A;  3IC9 A;  2LJ2 A;  3G71 V;  4WF9 V;  1FXV A;  3VQW A;  3RW0 A;  1NR1 A;  3CJH B;  1MG1 A;  3M7M X;  3I56 V;  1XI1 A;  1OCC C;  3L71 H;  2ZT9 B;  4YJ2 B;  4I55 B;  4J9Y B;  2D2C B;  1JFF A;  3I55 V;  2FYU H;  1Y67 A;  1UPG A;  3OTF A;  4FPP A;  4YIO A;  3QVN A;  1BCC H;  4U7N A;  5L3B A;  4KUM A;  4X66 B;  2QM8 A;  3KCY A;  1Y76 A;  1NR7 A;  1VQK V;  1QCE A;  2AZ0 A;  4WFF A;  1N36 B;  5B1B C;  3ABM C;  4FLZ A;  1D2D A;  3JAL B;  1NS1 A;  4GKK B;  2DMX A;  3D3Q A;  2ZDI C;  4A5U B;  4NKG B;  4X62 O;  3ZS8 C;  2N74 A;  3FB7 C;  5KLV H;  1Q82 W;  3RN4 A;  1Q8I A;  2LQT A;  4H44 B;  4I0X B;  4CH6 A;  5CA0 B;  4NTW A;  3ZCC A;  3NR7 A;  1HNZ B;  4CS2 A;  1YF2 A;  1FFX A;  2JGD B;  2JS3 A;  2KB1 A;  4PDV A;  5LHH A;  1R1B A;  5LP6 A;  4JAA A;  2XND G;  2IU3 A;  4ZHQ B;  3E8B A;  3MAQ A;  1H8H G;  4UB6 Z;  4O4J B;  2R9A A;  3AEI A;  3ICX A;  3JSL A;  2F93 B;  1E1Q G;  3ZHT A;  3AG3 C;  3WU2 Z;  1ZLZ A;  3ZRV A;  4JI1 B;  1QLE B;  3QO7 A;  4OX9 O;  2F4V O;  1VF6 C;  3AK2 A;  3W7T A;  4OPA A;  2AHY A;  1DF4 A;  3HKC A;  1KP2 A;  4CBC A;  1FJG O;  1QR9 A;  1GM9 A;  2EIN B;  2NR5 A;  3GWK C;  3CE2 A;  1G4Y B;  4N23 A;  1I94 O;  3FAV B;  5JQG B;  4PV1 B;  1MZF A;  3RYC B;  5CBG A;  3ZN0 A;  3MHH C;  4EEQ A;  2QJ1 A;  4FLW A;  1SES A;  1U97 A;  4JGS A;  1RPR A;  2YIB D;  5LYJ A;  3C3T A;  1JX9 A;  1XL6 A;  3CC2 V;  4LF9 B;  4JI4 O;  5LGN A;  4B3R B;  1JR9 A;  4MVO A;  2NN4 A;  2VQE B;  1ZL8 B;  1W59 A;  5CMU A;  3TCU A;  1O9H A;  1QLE C;  4AI8 A;  1N33 B;  1IXM A;  1MSW D;  3D36 A;  1BSM A;  4O4I A;  1PNL A;  5IYB O;  1YZB A;  3K0G A;  4WFB V;  4UCU A;  3N2K A;  2UXN A;  3SYQ A;  4JI8 B;  1K33 A;  4I7Z B;  3CX5 F;  1RPO A;  2CGO A;  3UT5 A;  1L0N H;  1I5X A;  4GKJ O;  4JI7 O;  2IH1 C;  2HJF C;  4FIP C;  4J80 A;  4Z2W A;  1N0J A;  1R6K A;  1KB9 F;  4DV1 O;  2UUC B;  5B3S C;  1NU1 H;  4TQD A;  3A8T A;  1IBM B;  1VQO V;  4X1I A;  5CBF A;  1F7Y A;  1I08 A;  1GN2 A;  1RSO A;  4JI7 B;  4LF4 B;  4MW3 A;  4ASU G;  3CCE V;  3T1Y O;  3IAY A;  4L8J A;  4IYH A;  3ABT A;  4JZG A;  3BRC A;  1JMK C;  3RFR A;  1Q7Y W;  5EBM C;  1A32 A;  1ZUQ A;  3NXS A;  5LBQ A;  4QPJ A;  1Z2G A;  3MDS A;  4JI2 O;  1YDX A;  1SET A;  4LC1 A;  1KUQ A;  4JF3 A;  3OD4 A;  2BOB C;  3ABK C;  1AVM A;  3L73 H;  3DTU B;  4UCV A;  5KUK A;  2YXH A;  2EIL B;  2QWQ B;  3HKD B;  4FZ1 A;  5DEC A;  1B04 A;  2JRI A;  3CP1 A;  1QHT A;  4HZ3 A;  5KAI Z;  2XT9 A;  4DW0 A;  4AQY B;  2LP7 A;  5CA1 B;  1PNK A;  2Q68 A;  1LUV A;  2WLL B;  3G80 A;  3UT5 B;  4I9W A;  2EBO A;  4I0X A;  5DM6 V;  1XUQ A;  1EFR G;  4KHP O;  4JV5 O;  2ATK C;  4DV6 B;  1I5Y A;  1FAF A;  2IM9 A;  3ZMU A;  3F5W C;  2VQF O;  5KHK A;  3ASN C;  3X2Q C;  4OX9 B;  2K9P A;  4F6R B;  1GM7 A;  3D3I A;  3ZHU A;  2WPD G;  1F23 A;  1J95 A;  4BWA A;  2WAM A;  1OJH A;  4FVM A;  4BW5 A;  1XNR B;  4LFA B;  2HVJ C;  3H01 A;  4PA3 A;  5EZY B;  1Q6H A;  2QWP B;  3H1J H;  2R9R B;  4CS4 A;  2DWE C;  4LF9 O;  3CCQ V;  4WBN A;  1BT8 A;  2P06 A;  3AG3 B;  1VMG A;  2CH7 B;  1SQX H;  1BQZ A;  1VQ9 V;  1AB3 A;  3BPZ A;  1R3L C;  2L6L A;  1FXK A;  2ZE8 A;  5IWA B;  1US6 A;  1XBL A;  4GUN A;  3HB3 B;  2EZP A;  4KXR A;  4WFH A;  5H5N A;  4N21 A;  4O2A A;  5F2V O;  2UXB O;  2B5U A;  1Y4M A;  4JI5 B;  5LP6 C;  3SDL A;  1XMO B;  3OE7 G;  2ZIN A;  3STZ C;  4ZHQ A;  2YDE A;  4ZKI A;  1QBZ A;  5LP6 B;  3CEI A;  1AR1 B;  1U96 A;  3K9S A;  5CA1 A;  3OT7 A;  4QE7 A;  2GTA A;  5HFL A;  2EIM C;  2W6J G;  2UUA O;  4H13 B;  4DUZ B;  4DV4 O;  2Z0A A;  3E8H A;  4UB8 Z;  4FZ0 A;  3QG5 A;  4R50 A;  2P7T C;  4DR7 O;  1M57 B;  4EKW A;  1M1K W;  3E83 A;  4X65 B;  3JAW B;  1XIL A;  3CME V;  4DV1 B;  5IJ9 A;  2F23 A;  1YTF D;  1THZ A;  1XMQ O;  1VQ4 V;  3U0Z A;  2D3O W;  3T1C A;  5KHG A;  1N4C A;  3ZIA G;  3CWB H;  4PJ0 Z;  1SKV A;  1PM9 A;  3A2F A;  1VQ5 V;  5C8Y B;  1XOU A;  3QTC A;  4O4L A;  2OWO A;  4DV3 B;  4MS2 A;  3AG4 C;  3GWO A;  2JEU A;  1ZL8 A;  4HAM A;  1W0J G;  2FML A;  4MTG A;  1N34 B;  1VQ8 V;  3ZHQ A;  4ZI7 B;  3S3W A;  4B3R O;  1XNQ B;  2ZR3 A;  3D36 C;  3N2G A;  3E86 A;  4F6E A;  1ZTE A;  4FK5 C;  4CH4 A;  2XHB A;  4DR5 O;  2UU9 B;  1OCZ B;  1M57 C;  3F5T A;  1M56 C;  3AG2 B;  2DYS B;  2NLJ C;  3E35 A;  1N34 O;  2Y69 B;  3OM3 B;  1IBL B;  2DE0 X;  2UXD B;  4O4L B;  3RVZ A;  5DED A;  5H6R A;  1BHB A;  3LNM B;  1NI8 A;  4JYB A;  1S5L Z;  3SJC C;  1Q3E A;  3K3W A;  3IJ4 A;  3OMI B;  4X62 B;  1HNW B;  3OMA B;  2XAG A;  1KMI Z;  1SA0 A;  1V54 C;  3K5M A;  3APQ A;  2Y0I A;  1H2K A;  4I4T B;  3FD9 A;  3BAB A;  1FFT B;  1OV9 A;  4NXN B;  5BXZ A;  3N27 A;  3VQY A;  2F95 B;  2ZE5 A;  4TV9 B;  2OIG A;  1M93 A;  1F4M A;  4MVM A;  4LF4 O;  2PI5 A;  2B1G A;  4UV8 A;  1IBK B;  1J5E B;  2RN9 A;  4DUZ O;  3GB7 C;  3LSU A;  4DV7 O;  4TWK A;  1S5J A;  2WLJ A;  3ZJZ A;  5GTI Z;  2JJ2 G;  3F7V C;  3G6B A;  5LXT B;  2ZM6 B;  2ZCE A;  4JI0 O;  2P4K A;  1KKD A;  1D5N A;  4PI0 A;  2QA4 V;  2WLI A;  4JPR A;  4IL6 Z;  1WN7 A;  3HKC B;  3LSS A;  2LW1 A;  4XDJ A;  3CPW U;  3T1Y B;  4PDL A;  3K58 A;  4QJF B;  2UUB O;  1WNS A;  3ZMV A;  3CCJ V;  4DV6 O;  5CA3 A;  5FPR A;  2Q69 A;  1VF5 B;  5LMN O;  3SR2 C;  3FFQ A;  1AI6 A;  3L72 H;  2XAQ A;  3ABL B;  4LFB O;  3RYI A;  2XUM A;  4O4J A;  3T1H O;  1ZWI C;  5J9P C;  1SQQ H;  4EFE A;  5IT9 N;  3G6E V;  5D5P A;  1CPY A;  5ITZ A;  1K5Q A;  3WFV A;  1JFF B;  2GDS A;  2PY5 A;  1CXZ B;  5EZY A;  1OCR C;  5L3G A;  4NTY A;  1S77 D;  2IW5 A;  2HHH B;  2YC0 A;  4CC6 A;  1QVG U;  3AG7 A;  4ZBM A;  2YEV A;  3R66 A;  3ZRX A;  5KUM A;  4LFA O;  1XRE A;  2UXC B;  4MW8 A;  2ZM6 O;  4ZI7 A;  2G38 A;  3F7Y C;  2ZD9 A;  5ITZ B;  4PA4 A;  4LF7 B;  5EYP A;  1S76 D;  5KHJ A;  4WFA V;  2RQ6 A;  3BFR A;  1QNM A;  4LH7 A;  4JAS A;  5C8Y A;  3CCU V;  1MOF A;  3SPJ A;  3HKB B;  1R3I C;  3K9A A;  1MSD A;  2M7W A;  2PUS A;  3SYC A;  4DV2 B;  1RSO B;  1D5A A;  2H94 A;  5KMG A;  5FNV B;  4XBF A;  1Z5V A;  3EFF K;  2P67 A;  1SQG A;  1TVK A;  1EZJ A;  1L8D A;  3OGC C;  3J80 N;  1G8M A;  1QVF U;  4JYA O;  3JAW A;  4XDL A;  2X7R B;  1EZV H;  2MW2 B;  5B1B B;  2RNB A;  1VAR A;  4GX1 A;  1JA8 A;  1VF6 A;  2QWN B;  3ZRS A;  1GH6 A;  2Q0A A;  4MVS A;  5LYJ B;  3TXS A;  4DV3 O;  3CCS V;  1AI4 A;  5K1X A;  1PD3 A;  4J9Z B;  2QWO B;  3X2Q B;  1VQP V;  1WLE A;  1VQN V;  1GK9 A;  5B3S B;  1K7D A;  2BTQ A;  5IYZ A;  1DF5 A;  4FMT A;  4B3S B;  1WB7 A;  3CRM A;  2A3Q A;  3HPL C;  3ZRW A;  2ITC C;  4IT5 A;  5CB4 A;  2OCC B;  1DLB A;  3K5N A;  4NXM B;  1ORQ C;  2C2A A;  2LO1 A;  3AG1 B;  3THO A;  2Q4P A;  3IGA C;  2UXB B;  1K3E A;  4X65 O;  3JAR A;  4X88 A;  3I5D A;  2Q0O C;  1L1F A;  3OGI B;  1Y76 B;  3OR7 C;  4I50 A;  1WP8 A;  4WFG A;  5J2U B;  4IIJ B;  2ZXW C;  4I9Q A;  3CCR V;  1DK1 A;  3U11 A;  2CE4 A;  3T2M A;  4DR2 O;  1J5E O;  2K1E A;  4DV2 O;  2Y4U A;  5LHI A;  4O2B B;  4BW9 A;  4DR1 O;  5H6Q A;  1PKX A;  3ZN1 A;  1NTK H;  1MAB G;  3G67 A;  3P3P A;  3OEE G;  4RUE A;  4G28 B;  2GV9 A;  1ROP A;  5EIB D;  1NT2 B;  5FL7 G;  1H2S B;  1M4U A;  5B1N A;  1Z5W A;  5HFM A;  3QF7 A;  3JAK B;  4K8Z A;  2JEX A;  2NNU A;  2EIJ C;  4B08 A;  2R72 A;  3KKY A;  3DSQ A;  3OAA G;  1JPX A;  1E1R G;  4FM1 A;  1I7F A;  2CTQ A;  1UJW B;  1SQB H;  2OTL V;  1P49 A;  1V55 C;  3JD3 A;  1AIL A;  1GMG A;  1T5E A;  2JS5 A;  1V54 B;  3B09 A;  3HKD A;  1FKA O;  4HNA A;  1KYO F;  2WA3 A;  2CTW A;  4DR1 B;  3BAA A;  1KBH A;  1AI7 A;  2DWD C;  2WLL A;  4IYI A;  3D8C A;  2YIB A;  4EB6 B;  4DR5 B;  2ZE6 A;  1IBK O;  4J11 A;  1IVS A;  2Y0P A;  1TGO A;  3BA8 A;  4E4E A;  1OCZ C;  4UUJ C;  4FM0 A;  2GBO A;  4X20 B;  1WA8 A;  2FTK A;  4Z1V A;  4LH6 A;  2M6Y A;  5JH7 B;  1YJN V;  3WG7 C;  1IXB A;  4F4L A;  3JAL A;  1WA8 B;  4X20 A;  5IYC O;  4MVQ A;  3P32 A;  1K73 W;  1SQF A;  2EIJ B;  3FKS G;  1G1X B;  3W7S A;  2V4D A;  2LFR A;  3OTO O;  4PDR A;  5LGU A;  3ZRW B;  4P9O A;  3UM7 A;  1HR0 B;  4FLV A;  4AHC A;  4U7O A;  2GUZ A;  2UXD O;  1OHH G;  2QSA A;  3JAT B;  3UQ8 A;  2Y69 C;  4NTX A;  4UCR A;  2UXX A;  1Q81 W;  4J41 A;  2OCH A;  4DR4 O;  4X8A A;  3JCU Z;  1OCR B;  4H37 A;  4UCS A;  2GSM B;  4JYC A;  5JVD A;  2H3O A;  1SZX A;  1GO3 F;  1NTZ H;  3CXH F;  1SA0 B;  4YJ3 A;  4B3M B;  4R6Z A;  3AG4 B;  4JZ2 A;  1ZSP A;  1HR0 O;  5L3E A;  3LDC A;  2DQ0 A;  2EZO A;  4X1Y B;  3TJT A;  4LWS B;  2CH7 A;  4GX0 A;  4NXM O;  2H8P C;  5JWP A;  5LA6 B;  3K5L A;  5IDJ A;  4LF8 B;  5BMV B;  3SPC A;  2Q7E A;  1AJP A;  1SQV H;  2E76 B;  3JAM N;  1NVP B;  3BCC H;  3WB0 A;  4KHP B;  4JI0 B;  2HR3 A;  3HKE B;  2RDC A;  4J7Z A;  3QO8 A;  2Q73 A;  2EIL C;  4QGP A;  4LFB B;  2HLD G;  4UCT A;  4X66 O;  4UXN A;  4DK1 A;  3Q4H B;  2ZE7 A;  1F51 A;  2F66 C;  3LDE A;  4DR7 B;  1QQC A;  1YEW A;  3WG7 B;  1HDJ A;  5JQG A;  1FD9 A;  3ZED A;  1K97 A;  5JCO C;  4Q6G A;  5L3D A;  5B1A C;  4LF6 B;  3MD0 A;  4DV4 B;  4NXN O;  3OEH G;  1YJ9 V;  3AK3 A;  2ARH A;  4ZOL A;  4LCU C;  1KC8 W;  4UCO A;  2IBZ H;  4WBN B;  4MT8 A;  5IJ0 B;  3E2E A;  2X0L A;  1R6N A;  1WAZ A;  4KL1 A;  3BY6 A;  4FFK A;  2AZ2 A;  4RAI A;  1Y74 B;  2HHH O;  2Z3Y A;  4DV7 B;  1N8R W;  5IE9 A;  2IJJ A;  2F4V B;  3AG2 C;  3PN1 A;  4YJ3 B;  5GTH Z;  2O57 A;  2LFS A;  2CUG A;  1GM8 A;  4FFB B;  4B7K A;  2YID A;  4K0K B;  4DR4 B;  3DC6 A;  1S3J A;  3B8N A;  3ZMZ A;  1H8E G;  5GON B;  4YY3 O;  3JYC A;  4G27 B;  1CP9 A;  1R6T A;  3B77 A;  1H2N A;  3T4D A;  3K57 A;  1WPX A;  4XDK A;  4LF7 O;  4P2Z A;  3ETQ A;  4OXS A;  2RCV A;  3B40 A;  2OTJ V;  5LOV A;  2YUA A;  5EIB C;  4LF8 O;  2CTR A;  1JOY A;  5GON A;  2UXC O;  3TXQ A;  4JI2 B;  4TV8 B;  1XNR O;  2Q9L A;  3CSX A;  1WB8 A;  2P5O A;  1BGY H;  2ZXW B;  1IBL O;  2DW4 A;  1H2L A;  2E74 B;  3EVK A;  3K04 A;  3CXC U;  1N32 O;  3GVM A;  2BTQ B;  5IYZ B;  1EN4 A;  1NZ6 A;  4R7C A;  5LGT A;  2P90 A;  2QM7 A;  1BZK A;  3ZX6 A;  1E79 G;  1XHX A; 
#chains in the Genus database with same CATH homology
 2AZ2 A;  2VS0 A;  3TXS A;  3FD9 A;  3GWK C;  4ABM A;  4I0X B;  3OGI B;  2DE0 X;  3FAV A;  3HR0 A;  3ZBH A;  4GZR B;  1WA8 A;  2B9Z A;  3FAV B;  3GVM A;  2KG7 A;  2AZ0 A;  3O9O A;  3Q4H A;  2KG7 B;  4LWS A;  2VRZ A;  1WA8 B;  3Q4H B;  4LWS B;  3G80 A;  3TXQ A;  4I0X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...