3ZBHA

Geobacillus thermodenitrificans esxa crystal form i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
90
structure length
90
Chain Sequence
b'LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESXA
publication title Crystal Structure of the Homodimeric Esat-6-Family Proteins Esxa and Esxb from Geobacillus Thermodenitrificans
rcsb
molecule tags Unknown function
total genus 41
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3zbhA00
3G80A 1WA8B 4I0XB 1WA8A 4I0XA 4GZRB 2AZ2A 2DE0X 3FAVB 3GWKC 3FAVA 3TXQA 3Q4HB 4ABMA 3Q4HA 2VS0A 4LWSB 4LWSA 2KG7B 3ZBHA 2KG7A 2AZ0A 2VRZA 3OGIB 3GVMA 3TXSA 3O9OA 2B9ZA 3FD9A 3HR0A
chains in the Genus database with same CATH superfamily
4DV0B 2YIBD 4MTXA 2PI5A 1Q82W 2ZXWB 4FM0A 1PNMA 4IT5A 2RMKB 1M90W 1H2GA 3X2QC 4PELA 2CTRA 4N23A 5JH7B 1M56B 2HFEC 1GM8A 3ETEA 1NQTA 4X65O 3JATA 3AK2A 2YIBA 2DWDC 4JI1O 2E3CA 1FFTB 2R9AA 4JI4O 4NXNO 4X65B 1OZ0A 4DR6O 1JOYA 4BIOA 4O2BB 3EFFK 3EXAA 3A0RA 3RGBA 3T1CA 3OE7G 1JA8A 3PN1A 4I50A 5KA5A 2HG5C 1R1BA 4WBNB 3WG7B 3ZMTA 4DR2B 1LUVA 2ZKOA 4I4TA 4NVPA 5HFLA 1MZFA 2BTOA 3APOA 5K1PA 1FFXB 5K1XA 3JASB 4L8JA 4JAAA 1DK1A 1LUWA 1FAFA 2VRZA 3JYCA 1MSWD 3RYCA 1K7DA 2LW1A 2YI8A 1UPGA 3QVNA 4KUMA 2A7WA 4JAUA 3W7UA 3CWBH 2V4DA 4FVMA 5L3CA 5KUMA 5B1BB 4JYBA 2QWNB 1HR0O 4O4LB 2Q5ZA 3SPJA 4UV8A 2WLLA 3LSUA 3H1LH 3RN4A 4UXNA 1YHQV 1HR0B 2DN9A 1ZWIC 3ZRVA 1AJNA 4LF5O 2A3QA 4I7ZB 4MVSA 5LGTA 3O65A 4LF5B 2Y69B 3H1JH 4J10A 1US6A 4FLZA 1FXKA 3P3NA 1OV9A 2JJ2G 2JS5A 1OCZC 2R9RB 1H2LA 2AHYA 4K0KO 1JMKC 2ZDIA 3J80N 3O9OA 2YI9A 3L73H 3FYEB 3SYQA 2B9ZA 2Y4UA 1ZTEA 3C3SA 3B2EE 2RJZA 3TCUA 3K9AA 4DO2A 2YUAA 2LGWA 1K97A 2A0LA 2PF4E 3AK3A 4GX0A 4W4LA 3B8NA 1EBOA 2ZIMA 4FFBB 5GTIZ 2CH7B 3IC9A 4ASUG 1URFA 4G28B 3FD9A 5EC1C 1WA8B 2ADPA 3ETQA 2ZXWC 3N2GA 3ABMB 2YC0A 3RW0A 5C8YB 4O4IA 2YSUB 3HKEB 3JARA 1M56C 3CJHB 4ZIBA 4WCEV 4TT3G 1Z5WA 1I94O 3K5NA 4XBFA 3HPLC 2VQEB 2A9HA 5L3DA 5LHHA 1I94B 1M5IA 2YS8A 4DV3O 4LBEC 1S72V 2PY5A 5LGNA 5KX5A 1AP6A 3D3QA 1JQ0A 4IHJB 2CDYA 1R6KA 2FB5A 4HYOA 4B3MO 3SR2C 3WG7C 1U97A 5LXTB 5IT9N 5J2TB 5H9CA 4EFBA 3N2KB 3W7TA 4FLVA 4UCRA 1N8RW 5CA1B 4E4EA 2ODMA 1KBHA 4CH3A 4KL1A 4YHHO 3SPIA 1E1QG 3BRCA 1HNWB 1KP3A 3VQYA 3E8FA 2W6IG 3M99B 2OYQA 2O57A 4X62B 3HKCB 5LA6A 4EEQA 1IBMO 1VQMV 3UT5B 1R3KC 4YHHB 4LFAO 2EIMC 3E2EA 3ZS8C 1S0VA 1R3IC 3RFRA 1ZL8B 1IBMB 4DR3O 4TV8B 2F66C 5B1BC 3Q4HA 1EZJA 2CK3G 1Y76A 4H37A 4O4HA 5IWAO 3N27A 3OT7A 2CTQA 4DR3B 1SESA 3JAKB 2ARHA 3I5DA 1L8DA 1IX9A 2BSKB 5IWAB 5B66Z 1XHXA 3CC4V 2HHHO 1K33A 5H5NA 3CYOA 4MVZA 3QNEA 5J2UB 4FJCC 2AZ2A 1Q5OA 2KKWA 1AR4A 2Y69C 1QVGU 5IE9A 1CEZA 1Z5VA 3ZIAG 3JAMN 2HHHB 4R6ZA 1XNQO 3SPGA 1G4YB 3OGCC 4RWUA 4JYYA 2QM8A 1QHTA 4ZHQB 3ABKB 4AILC 4DRXB 3CRQA 1JFFB 4I55A 1TAEA 2VWKA 1XNQB 1RSOB 5B1AC 2HVJC 4FIPC 3U10A 3E22B 4GCZA 3CHXA 2BE3A 1XQ8A 2IM9A 4R8CA 4JI8B 3SYOA 1QQCA 5EIBD 3QO7A 1JVMA 2WWWA 3E35A 1I08A 5EZYB 1GM9A 1VP7A 1D5NA 1IURA 2ZIOA 3ABMC 5DN6G 4CS2A 3QF7A 4X1KB 2DQ3A 1IDSA 1K4DC 5J9PC 3QTCA 1K73W 2UUAO 1TVKA 1YDXA 4LF9B 2EIKC 4GKJO 2QA4V 4CC5A 3A2FA 4KFMA 2WA3A 1IBLO 2XAHA 3OUSA 5GONA 4TUYA 4JI6O 2N74A 3LDCA 5EBLC 4GKJB 4JI7O 1SKVA 3S3WA 1HNXO 2GTAA 1IBLB 4UVCA 1H2NA 1VF7A 2LGQA 3ML0A 2ZR2A 4JI6B 3ZMZA 2QDOA 4JI7B 2ZE7A 4X89A 2UUBO 2YDEA 1DF4A 4I9QA 1FXHA 1PM9A 4O2AA 2WAMA 3JD3A 2UUBB 3M7MX 4OPHA 1I5XA 4YY3B 3RYHA 1S76D 4JI0O 3P32A 2JRIA 3CC2V 1KUQA 4IIJA 4LNUA 3E83A 2HKOA 4JI0B 1QR8A 4PA9A 1BQ0A 3HKDB 4KHPO 2QWRB 2V1DA 5CA0A 1YF2A 3AG1B 1OJHA 5LHIA 3UKMA 3DXRB 4KHPB 1PKXA 2ZQMA 4NKGB 4FPPA 4CS4A 1SC5B 1P84F 3E8BA 1R6NA 4DR7O 1WJZA 4BR6A 2JGDA 1XL4A 1M93A 1QLEB 1BSMA 4JZ2A 3G80A 1Y74B 3CRAA 2ATKC 3OM3B 3J81N 1SQPH 5IJ0A 1Q43A 3GWKC 2VQFO 4J11A 1KP2A 1WPXA 2QTOA 3GB7C 3K3WA 3LDDA 4GLXA 3AEIA 3ZHSA 3K06A 5L3GA 3APQA 2CE4A 3P3PA 1U96A 2VQFB 1AI6A 2JJ1G 3ABKC 1K3EA 1RFYA 1GN2A 2UU9O 4HBNA 4KXRA 4U7NA 2P5OA 5JCOC 2A79B 4XDLA 3CSXA 1YJWV 2HJDA 2UU9B 1G6UA 1YZBA 4IYIA 3NXSA 3CX5F 3RYFA 4K8XA 4GT1A 2ZM6O 3ASNB 3OEHG 2F4VO 1BT8A 4QIWF 1VQ9V 1TUBA 3ZHRA 2ZM6B 4YJ2A 2WPDG 1KMIZ 3H9VA 1XILA 1NTZH 1F4MA 5E1AC 2FKXA 3CRCA 3JALB 4PI2A 2UXXA 3D8CA 4TSFG 1DTOA 2XUMA 4GYCB 1SS3A 5JJNB 5KLVH 3OTOB 2N05A 5KAIZ 2QSAA 3TETA 2UUCO 4GX5A 2DE0X 3ZHQA 2MW2B 2GSMB 2IW5A 2UUCB 5KMGA 2UXBB 3B8MA 3CCVV 3ETGA 2ZINA 4JAVA 1FS0G 3LNNA 3C3TA 2Q8VA 1Q7YW 3FX7A 4CS3A 4EFEA 1Y6XA 5F2VO 2Q0AA 2XAQA 3ZHUA 1SRYA 3CCQV 5C93A 1MSDA 2UXDO 1N0JA 3VBBA 2W6JG 3DTUB 4J80A 5LYJA 1YIJV 3F5WC 2LJ2A 5KHGA 2UXDB 3FB5C 1FJGO 5JVDB 4MS2A 2E74B 1S77D 1PL4A 3T2MA 4FLWA 1BS3A 1W0KG 3VQXA 1FJGB 3AG1C 3MAQA 1BMFG 4H0LB 3JAWA 3L9DA 3OEEG 1ZAUA 4X66O 3RWRD 1Q6IA 3ZMVA 3VQWA 1QU7A 2LFSA 4WFEA 1QLEC 4DUZO 4X66B 1ZUQA 4FMTA 2RN9A 3OAAG 2ITCC 3ZHTA 4O2BA 4X1IB 2FYUH 5LOVA 4DUZB 3RBZA 1YXBA 1WB8A 3OR6C 3CCUV 1S3JA 4MT8A 4DR2O 5CB4A 5A9GA 4R50A 3K57A 1H2KA 3MHSC 3U11A 1GM7A 2ZE5A 1P4RA 2IU0A 1XMOB 2Z0AA 3JASA 2E76B 2Q67A 4D7TA 5IJ9A 3FFQA 2C2AA 3J7AU 1NT2B 2KG7A 4LP8A 5FLXN 3ASNC 1N34O 3CCLV 4F6EA 2QTSA 2IJIA 4OXSA 2HJFC 5FPOA 1VF6A 3OUFA 4JZGA 2HLDG 4FM1A 1N34B 1R73A 4JTAB 4D7SA 2Z5UA 4MVUA 2GUZA 2QM7A 3M8AA 4O4LA 1F23A 2X6AA 1Q8IA 2P6JA 3WB1A 4B3TO 2AGAA 2KSDA 1HDJA 4K8ZA 4YXWG 1EN4A 3JCZA 4X20B 4MTOA 1VQ5V 4B3TB 4QNHB 3OW2U 1BHAA 2HEPA 3CPWU 3MD0A 1NZ6A 4NB5A 5B3SB 1WN7A 4NTXA 4YJ3A 3H01A 2WLLB 4PJ0Z 4LH6A 3K5LA 2QWQB 4UCOA 5L3EA 4JV5O 3OD4A 5LMUB 4O4JA 4MVRA 1IVSA 4MTFA 2F43G 3STZC 4JV5B 1FXKB 1HWYA 3ZRWA 4RQEA 5KUKA 2CH7A 3E86A 2X6CA 1GN3A 1IBKO 1JPXA 1K5QA 1NTMH 3K5MA 2P06A 1XEQA 2QKAA 4BAYA 2CGNA 1WB7A 2A06H 2Y0PA 1IBKB 4LR3A 2BTQB 4A5UB 1FD9A 2IH1C 3JCUZ 1ENVA 2VQEO 3F5TA 4UCSA 4FLYA 2EILB 4TWKA 1CXZB 4HZ3A 2M7WA 1JR9A 5FPRA 2D2CB 1MOFA 3JARB 5BMVA 2AXTZ 3G71V 2L6LA 1F4NA 4IHJA 2XOKG 3DC6A 3ZRSA 1NU1H 4W4KA 2QR4A 4R7CA 5LXTA 4DUYO 3KCYA 1Q6UA 5LHGA 2N04A 4ZBMA 3CXCU 3SYPA 1G8MA 4DV1B 4DW0A 5FNVA 4DUYB 1NR1A 2HVKC 4F4LA 4EB6A 5CA1A 1HNWO 3DSQA 3WU2Z 4JI3B 4X62O 4HAMA 3AG3B 3L72H 3RVYA 2LW7A 3A0HZ 4I9WA 3RYIA 4ZOLA 1FPOA 3FB8C 3HKCA 1EM1A 2P67A 3TXSA 3CMAV 4J41A 4B3RO 4ZI7A 3PJSK 2ZD9A 4LCUC 4PHZA 2EINB 1XNRO 3MDSA 4DW1A 4TV8A 5KHIA 3P30A 1BGYH 4B3RB 3FB6C 4AI8A 2QWPB 4LWSA 1XNRB 3DC5A 5AG2A 3JAKA 1GH6A 2GHYA 2QJ1A 4JI2O 4CH5A 1ROPA 1NH2D 5KHHA 1WPBA 5IYZA 3OMAB 4JI2B 2YIAA 5IYBO 3T4DA 2WSSG 5LP6A 2P22C 3AK1A 3BPZA 1VARA 3Q4HB 4DXWA 2L35A 1Y76B 4O4HB 1PNKA 2WLMA 4OX9O 1EZVH 4OGQB 1QR9A 4DRXA 3BABA 1OCRB 4DK0A 5IDJA 1VMGA 2QEXV 2UXNA 4OX9B 1XOUA 4FK5C 3UO2A 3D36C 5JCOA 1AI4A 1FYJA 1M1KW 4CH4A 5DECA 3UM7A 4JI8O 1P7GA 3B09A 2BCCH 3W7SA 1MA1A 1BCCH 1FXKC 3BVOA 2Q6AA 4MW8A 1GAXA 5EYPA 2ZDIC 4I55B 1SA0A 3LNMB 3H1HH 1W2BU 4FLUA 1AROP 1DGSA 1KYOF 1V9PA 2VWJA 1D2DA 3S3XA 3CEIA 5JJEB 4LF9O 1GTOA 2EX3A 2F1MA 3H1KH 5KHJA 3GVMA 2Y48A 5JWPA 2EILC 1GKFA 2OCCB 3KG2A 4UB6Z 3JSLA 5CMUA 5IYDO 2RCVA 3HKBA 4DV7O 4K35A 1KB9F 2WLKA 3CXHF 1LR1A 3TJTA 4D6TH 4MW3A 1I0HA 4CC6A 1GRJA 3G6EV 3JD0A 4DV7B 4TV9A 4UV9A 5JQGA 3AG2B 1F7YA 2UXCO 2YICA 4LFBO 2IU3A 4YY3O 5GTHZ 4I0XA 4TUYB 5H6QA 1ZSPA 2DYRB 2UXCB 4RQFA 2FMLA 4BW5A 4LFBB 3AG3C 2PUSA 2QKCA 5CA3A 1OCOB 4I5SA 3LSQA 1FKAO 4X1YA 2YEVA 2PTMA 2PI4A 4JI5O 3KZIZ 4HNAA 2H94A 1BQZA 1UJWB 1HP8A 2EZOA 4NTYA 2Q9LA 4RAIA 4J7ZA 2LQTA 4JI5B 1H2MA 2EINC 3SYAA 3CC7V 4FLXA 4U3JA 1UFIA 3LSSA 1ZLZA 1B3QA 4J9YB 1XHZA 1XREA 2GV9A 3DXRA 2OCHA 5H2FZ 4EKWA 2E75B 1NBMG 1BE3H 2WA4A 3CP1A 3ABLB 1Y67A 4DR5O 1TGOA 1Y74A 2F93B 5DM6V 2ZCEA 4LF4O 3W7XA 5CA0B 4DR5B 3OTFA 1V55B 1H8HG 4LF6O 2WLJA 3K0DA 4UCTA 5E79Z 4LF4B 4PDLA 4IYHA 3A0BZ 3CB2A 1KU9A 4LF6B 1OCRC 3SYCA 3E8GA 4XDKA 5BXZA 5BR8O 5IJ0B 4G27B 1YJNV 1N36O 4DV4B 2PZSA 1Y66A 3FAVA 2IJKA 2H3OA 1W0JG 5BR8B 1VIBA 2AHZA 1N36B 1VEWA 2M6YA 3SGIA 4QE9A 2OWOA 4DV5O 3ZN0A 1NVPD 1AB3A 2QM4A 1QNMA 4TQFA 4UVAA 1COWG 1WP8A 2K1EA 3UO3A 1THZA 4DV5B 1VQ8V 5FL7G 2Q68A 4JGSA 3RYFB 1R6TA 2P90A 3OTOO 1AI5A 3JALA 4MVQA 1BL8A 2OCCC 2X6BA 4LFCO 3HR0A 2R72A 1BZKA 2WLIB 5B1NA 2X7RB 1K92A 3CMEV 2FL4A 1S5HC 3SJBC 4LFCB 4YJ2B 3WFVA 3ZN1A 2UXBO 3G4SV 5EIBC 1VQNV 3F7YC 3LUTB 5L3BA 5GW7A 1NVPB 3VOUA 4GUNA 3JSNA 3K03A 3AG2C 1FXVA 4J7JA 2R9IA 1WAZA 3ASOB 1MABG 1EN5A 2Z3YA 3IFXA 2DYRC 4BW9A 1M57B 4F6RB 5ITZA 1AILA 3TGUH 4PI0A 3BHPA 4JF3A 4FFKA 4XDJA 1OCOC 1Q86W 4MVOA 5L3FA 1AR5A 2JK5C 3DGEA 2NLJC 1Z2GA 2NNUA 4LF7O 3BFRA 3OMNB 1YEWA 2IJJA 4LF7B 2RQ6A 2PYLA 2D3OW 3W7WA 5EK0A 5JH7A 4P9OA 5TISZ 4JASA 1HNZO 3ABLC 1AR1B 5LYJB 4ZKIA 2H8PC 1MMMA 1HNZB 3HB3B 1SQXH 5HFMA 4RUFA 2F23A 2JIZG 4X1IA 4UCVA 2XNDG 4GZRB 1KECA 2CGOA 2XHBA 1V55C 3ZMSA 3JAWB 4X88A 3CCMV 3ZRXA 3K5OA 5CBHA 1R3JC 4YIOA 3JATB 2BOBC 4IGGA 1XMOO 4WBNA 2XAFA 2P4KA 1Y4MA 3ZCCA 1QLNA 2Q4PA 1Q81W 5DEDA 4JI1B 5IY5B 1FFXA 2DWEC 3K79A 5LOVB 4JI4B 5KHKA 1QBZA 3U0ZA 4NXNB 4DR6B 4I50B 1CPYA 5CB4B 4QE7A 1JX9A 4QGPA 1LNQA 4I4TB 4Z1VA 4PA3A 5IJ9B 3KCXA 4CH6A 2KG7B 3SJQC 2AZ0A 4AHCA 2OTJV 4TOIA 2V7QG 3RYCB 1F51A 1L0LH 2DQ0A 3IC7A 2B5UA 2EIMB 5B1OA 3CCSV 3EVKA 4NXMO 4X20A 2WLHA 4C7UA 3T1YO 1PV0A 1ORQC 2JS3A 3K9SA 2W0XA 1KD1W 2LO1A 1D5AA 4DV2O 1VQPV 4NXMB 2GUZB 1KKDA 1PPJH 3T1YB 3FYIB 3IJ4A 1K9MW 4DV2B 5LMUO 1XMQO 4CZZA 3NR7A 3ASOC 5BZBA 1KC8W 2ZNJA 2GTSA 1W59A 1E79G 2JGUA 2GBOA 3F7VC 1N32O 3D36A 1XMQB 1M57C 1SF9A 2VS0A 5D5PA 1N32B 1R3LC 4YJ3B 3ZEDA 1N4CA 2RNBA 4FFBA 1K5SA 1B04A 4JTCB 2KB1A 1K34A 2DJVA 1EFRG 1XBLA 5LBQA 1WA8A 4J7KA 4K0KB 1GO3F 2DYSB 2XT9A 1PNLA 5B1AB 4O4JB 5C8YA 4X64O 2X0LA 3R65A 3CS5A 3TXQA 2ADQB 3HKEA 1KQSU 2BTQA 3LDEA 3CRMA 1PP9H 3AG7A 3CJHA 3ZRWB 2LFRA 4X64B 1HW7A 4RUEA 3OR7C 1BHBA 4P2ZA 3ETDA 4G2KA 1RM1B 4K3AA 1IZ3A 3ZJZA 1K4CC 2EJRA 2Q7HA 3N2GB 4YIPA 2QWOB 4FZ0A 4O4IB 3QO5A 5JJJB 1YI2V 5BY1A 1IXBA 2QKSA 2CTPA 2ZT9B 4CBCA 4DV1O 2EIKB 5KA6A 3WB0A 5J2TA 1DLBA 3CCEV 1H8EG 2R70A 3K0GA 3ZX6A 1SQBH 4JI3O 3SDLA 3N2KA 2CTWA 2K9PA 2EZPA 5IY5C 2G38A 4QPJA 2ETNA 3K04A 1N33O 4ABMA 2PYJA 5BMVB 3CD6V 2IBZH 1L0NH 5KX5B 2Y4TA 3OFNG 4H33A 4PA6A 4DV3B 1H38A 1N33B 4Z1MG 1Q6HA 2AW9A 4X8AA 3UT5A 3K58A 2ZR3A 1NTKH 1JJ2U 4B3MB 1I7FA 5FNVB 5EBMC 1ZL8A 1YITV 4UB8Z 2P4VA 3AG4B 1XL6A 4EB6B 4J9ZB 4BIZA 3I56V 1QVFU 2W0FC 3A8TA 3QO8A 1YTFD 3B4SA 3RYIB 4P30A 1K8AW 4ZOLB 2CUGA 2JVDA 5LA6B 2ILMA 2BSKA 1MZEA 4ZI7B 4BWAA 2FTKA 4KP4A 1VF6C 2JEXA 1EN6A 1Q3EA 1KKCA 5J2UA 2YXYA 4LFAB 2YXLA 2EULA 1AP5A 4LWSB 3L74H 5B3SC 2Q0OC 3BCCH 2CAZC 5D5QA 3FB7C 4ZHQA 2EIJB 4MVMA 2OIGA 4NR1A 1IXMA 1JFFA 4AQYO 5IYZB 3FKSG 1RSOA 3RVZA 5LP6B 1YTFB 2OIEA 2HP8A 4GKKO 4U7OA 1V54B 1OCCB 4AQYB 1GMGA 3I55V 1P7BA 3E22A 4MTGA 4DV6O 2P7TC 3OGIB 3SPCA 4FLTA 2QGNA 3B40A 1NH2B 4GKKB 1S5LZ 1VF5B 1ZX3A 3GWOA 1YVWA 2B1GA 4DV6B 5EZYA 3OMIB 1VQKV 3L71H 2DYSC 3RT3C 4L87A 3ABUA 4N21A 1DF5A 4X1KA 2JEUA 1WP7A 5EYPB 3K08A 4PA4A 4B7KA 1RM1C 1AVMA 3STLC 2YXHA 1SA0B 1NJIW 1Q90D 4DK1A 1PL0A 1E1RG 4WFGA 4PDVA 4Q20A 2EBOA 3L70H 4WFAV 4WFBV 3IAYA 4BIUA 2F95B 1I5YA 4LF8O 1NS1A 4UUJC 1TVKB 3R66A 1NR7A 1TA8A 2XAJA 1GK9A 5IYCO 2ZE6A 1G1XB 1P49A 1QCEA 2UUAB 4LF8B 4QJFB 5GONB 3HKBB 4Q6GA 3ZBHA 4B3SO 1GN6A 4TV9B 4E2LA 1RP3B 4DR4O 2JDIG 5JQGB 1HNXB 3B77A 3UCSC 4B3SB 1AJPA 2Y0IA 3QG5A 3HKDA 4DR4B 4I0XB 4O2AB 5CBFA 3AG4C 1X59A 2HR3A 1AJQA 1OHHG 4LC1A 3RYHB 1GN4A 5LGUA 3SPHA 3VQVA 5CN0A 4X1YB 2YEVB 1RPOA 5CBGA 4IIJB 4HNAB 1SZXA 4LNUB 4JPRA 2DW4A 3IGAC 1B06A 4DR1O 4JYAO 4U3JB 3EHBB 4IL6Z 4NTWA 1XI1A 3X2QB 4UCUA 1SERA 4JTDB 2LP7A 4DR1B 1H2SB 1T5EA 4JYAB 4LH7A 2ITDC 4RO2A 2OTLV 3SJCC 2GDSA 5A2QN 2EIJC 2Q69A 2MK3A 2NR5A 3E89A 1VQ7V 4U3FH 1SETA 5LMNO 4DV4O 2KQXA 2JGDB 3ZHVA 1S5JA 4WFHA 4DYLA 4DR7B 1WLEA 5LP6C 4FZ1A 1V54C 1OCCC 5LMNB 4PD4F 3BEHA 1VQ4V 3KKYA 4WF9V 3ZMUA 1O9GA 4QPKA 5EBWC 2WLNA 2E5LO 1O9HA 3C90A 3T4ZA 4TQDA 2OT5A 1A32A 3G6BA 1MNGA 3THOA 3T1HO 3BA9A 1YSCA 1SZTA 2E5LB 1TUEB 4J42A 2QE7G 1B6QA 1M9NA 3T1HB 4Z2WA 1NKDA 3FAVB 2B1IA 2ZE8A 4PA7A 1YJ9V 1JCHA 4P9PA 1AI7A 2RDCA 1XDCA 1X4TA 3H1IH 4H13B 2DOSA 4GX1A 4PDMA 3D3IA 1YCIA 1VQOV 3UQ8A 3E8HA 2WLIA 1SQVH 5H6RA 1TUBB 3ICXA 2EJ7A 1M4UA 3JD1A 3CCJV 4FM2A 2F4VB 2Q7EA 1RPRA 1L1FA 3SJAC 3BA8A 3TK1A 1SQGA 3BAAA 4B08A 5LL6Y 3G67A 1SQQH 3CRRA 4MSWC 2BOCC 1XUQA 3JD4A 1J95A 4WFFA 4F6RA 2PGGA 2Q73A 5KAFZ 4PV1B 4PDRA 3WB2A 2XAGA 5KMGB 3L75H 4JYCA 4ICGA 1N0NA 1OCZB 1CP9A 1J5EO 2ZNIA 4OPAA 2XTAA 1MG1A 2YIDA 1PD3A 1SQFA 5JVDA 4X9QA 4GX2A 3CCRV 1WNSA 3MHHC 5B5EZ 2DMXA 1J5EB 3K59A 4UVBA 5ITZB 4NYKA 3ABTA 1NI8A 1VQ6V 1VQLV 2Q7GA 4H44B 2XASA 3JD2A 4UFZA 4DV0O 3CE2A 2IJHA 4B7EA 5EC2C 1JJOA 3BY6A 2IH3C 2NN4A
chains in the Genus database with same CATH topology
3G80A 1WA8B 4I0XB 1WA8A 4I0XA 4GZRB 2AZ2A 2DE0X 3FAVB 3GWKC 3FAVA 3TXQA 3Q4HB 4ABMA 3Q4HA 2VS0A 4LWSB 4LWSA 2KG7B 3ZBHA 2KG7A 2AZ0A 2VRZA 3OGIB 3GVMA 3TXSA 3O9OA 2B9ZA 3FD9A 3HR0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G80 A;  1WA8 B;  4I0X B;  1WA8 A;  4I0X A;  4GZR B;  2AZ2 A;  2DE0 X;  3FAV B;  3GWK C;  3FAV A;  3TXQ A;  3Q4H B;  4ABM A;  3Q4H A;  2VS0 A;  4LWS B;  4LWS A;  2KG7 B;  3ZBH A;  2KG7 A;  2AZ0 A;  2VRZ A;  3OGI B;  3GVM A;  3TXS A;  3O9O A;  2B9Z A;  3FD9 A;  3HR0 A; 
#chains in the Genus database with same CATH topology
 4DV0 B;  2YIB D;  4MTX A;  2PI5 A;  1Q82 W;  2ZXW B;  4FM0 A;  1PNM A;  4IT5 A;  2RMK B;  1M90 W;  1H2G A;  3X2Q C;  4PEL A;  2CTR A;  4N23 A;  5JH7 B;  1M56 B;  2HFE C;  1GM8 A;  3ETE A;  1NQT A;  4X65 O;  3JAT A;  3AK2 A;  2YIB A;  2DWD C;  4JI1 O;  2E3C A;  1FFT B;  2R9A A;  4JI4 O;  4NXN O;  4X65 B;  1OZ0 A;  4DR6 O;  1JOY A;  4BIO A;  4O2B B;  3EFF K;  3EXA A;  3A0R A;  3RGB A;  3T1C A;  3OE7 G;  1JA8 A;  3PN1 A;  4I50 A;  5KA5 A;  2HG5 C;  1R1B A;  4WBN B;  3WG7 B;  3ZMT A;  4DR2 B;  1LUV A;  2ZKO A;  4I4T A;  4NVP A;  5HFL A;  1MZF A;  2BTO A;  3APO A;  5K1P A;  1FFX B;  5K1X A;  3JAS B;  4L8J A;  4JAA A;  1DK1 A;  1LUW A;  1FAF A;  2VRZ A;  3JYC A;  1MSW D;  3RYC A;  1K7D A;  2LW1 A;  2YI8 A;  1UPG A;  3QVN A;  4KUM A;  2A7W A;  4JAU A;  3W7U A;  3CWB H;  2V4D A;  4FVM A;  5L3C A;  5KUM A;  5B1B B;  4JYB A;  2QWN B;  1HR0 O;  4O4L B;  2Q5Z A;  3SPJ A;  4UV8 A;  2WLL A;  3LSU A;  3H1L H;  3RN4 A;  4UXN A;  1YHQ V;  1HR0 B;  2DN9 A;  1ZWI C;  3ZRV A;  1AJN A;  4LF5 O;  2A3Q A;  4I7Z B;  4MVS A;  5LGT A;  3O65 A;  4LF5 B;  2Y69 B;  3H1J H;  4J10 A;  1US6 A;  4FLZ A;  1FXK A;  3P3N A;  1OV9 A;  2JJ2 G;  2JS5 A;  1OCZ C;  2R9R B;  1H2L A;  2AHY A;  4K0K O;  1JMK C;  2ZDI A;  3J80 N;  3O9O A;  2YI9 A;  3L73 H;  3FYE B;  3SYQ A;  2B9Z A;  2Y4U A;  1ZTE A;  3C3S A;  3B2E E;  2RJZ A;  3TCU A;  3K9A A;  4DO2 A;  2YUA A;  2LGW A;  1K97 A;  2A0L A;  2PF4 E;  3AK3 A;  4GX0 A;  4W4L A;  3B8N A;  1EBO A;  2ZIM A;  4FFB B;  5GTI Z;  2CH7 B;  3IC9 A;  4ASU G;  1URF A;  4G28 B;  3FD9 A;  5EC1 C;  1WA8 B;  2ADP A;  3ETQ A;  2ZXW C;  3N2G A;  3ABM B;  2YC0 A;  3RW0 A;  5C8Y B;  4O4I A;  2YSU B;  3HKE B;  3JAR A;  1M56 C;  3CJH B;  4ZIB A;  4WCE V;  4TT3 G;  1Z5W A;  1I94 O;  3K5N A;  4XBF A;  3HPL C;  2VQE B;  2A9H A;  5L3D A;  5LHH A;  1I94 B;  1M5I A;  2YS8 A;  4DV3 O;  4LBE C;  1S72 V;  2PY5 A;  5LGN A;  5KX5 A;  1AP6 A;  3D3Q A;  1JQ0 A;  4IHJ B;  2CDY A;  1R6K A;  2FB5 A;  4HYO A;  4B3M O;  3SR2 C;  3WG7 C;  1U97 A;  5LXT B;  5IT9 N;  5J2T B;  5H9C A;  4EFB A;  3N2K B;  3W7T A;  4FLV A;  4UCR A;  1N8R W;  5CA1 B;  4E4E A;  2ODM A;  1KBH A;  4CH3 A;  4KL1 A;  4YHH O;  3SPI A;  1E1Q G;  3BRC A;  1HNW B;  1KP3 A;  3VQY A;  3E8F A;  2W6I G;  3M99 B;  2OYQ A;  2O57 A;  4X62 B;  3HKC B;  5LA6 A;  4EEQ A;  1IBM O;  1VQM V;  3UT5 B;  1R3K C;  4YHH B;  4LFA O;  2EIM C;  3E2E A;  3ZS8 C;  1S0V A;  1R3I C;  3RFR A;  1ZL8 B;  1IBM B;  4DR3 O;  4TV8 B;  2F66 C;  5B1B C;  3Q4H A;  1EZJ A;  2CK3 G;  1Y76 A;  4H37 A;  4O4H A;  5IWA O;  3N27 A;  3OT7 A;  2CTQ A;  4DR3 B;  1SES A;  3JAK B;  2ARH A;  3I5D A;  1L8D A;  1IX9 A;  2BSK B;  5IWA B;  5B66 Z;  1XHX A;  3CC4 V;  2HHH O;  1K33 A;  5H5N A;  3CYO A;  4MVZ A;  3QNE A;  5J2U B;  4FJC C;  2AZ2 A;  1Q5O A;  2KKW A;  1AR4 A;  2Y69 C;  1QVG U;  5IE9 A;  1CEZ A;  1Z5V A;  3ZIA G;  3JAM N;  2HHH B;  4R6Z A;  1XNQ O;  3SPG A;  1G4Y B;  3OGC C;  4RWU A;  4JYY A;  2QM8 A;  1QHT A;  4ZHQ B;  3ABK B;  4AIL C;  4DRX B;  3CRQ A;  1JFF B;  4I55 A;  1TAE A;  2VWK A;  1XNQ B;  1RSO B;  5B1A C;  2HVJ C;  4FIP C;  3U10 A;  3E22 B;  4GCZ A;  3CHX A;  2BE3 A;  1XQ8 A;  2IM9 A;  4R8C A;  4JI8 B;  3SYO A;  1QQC A;  5EIB D;  3QO7 A;  1JVM A;  2WWW A;  3E35 A;  1I08 A;  5EZY B;  1GM9 A;  1VP7 A;  1D5N A;  1IUR A;  2ZIO A;  3ABM C;  5DN6 G;  4CS2 A;  3QF7 A;  4X1K B;  2DQ3 A;  1IDS A;  1K4D C;  5J9P C;  3QTC A;  1K73 W;  2UUA O;  1TVK A;  1YDX A;  4LF9 B;  2EIK C;  4GKJ O;  2QA4 V;  4CC5 A;  3A2F A;  4KFM A;  2WA3 A;  1IBL O;  2XAH A;  3OUS A;  5GON A;  4TUY A;  4JI6 O;  2N74 A;  3LDC A;  5EBL C;  4GKJ B;  4JI7 O;  1SKV A;  3S3W A;  1HNX O;  2GTA A;  1IBL B;  4UVC A;  1H2N A;  1VF7 A;  2LGQ A;  3ML0 A;  2ZR2 A;  4JI6 B;  3ZMZ A;  2QDO A;  4JI7 B;  2ZE7 A;  4X89 A;  2UUB O;  2YDE A;  1DF4 A;  4I9Q A;  1FXH A;  1PM9 A;  4O2A A;  2WAM A;  3JD3 A;  2UUB B;  3M7M X;  4OPH A;  1I5X A;  4YY3 B;  3RYH A;  1S76 D;  4JI0 O;  3P32 A;  2JRI A;  3CC2 V;  1KUQ A;  4IIJ A;  4LNU A;  3E83 A;  2HKO A;  4JI0 B;  1QR8 A;  4PA9 A;  1BQ0 A;  3HKD B;  4KHP O;  2QWR B;  2V1D A;  5CA0 A;  1YF2 A;  3AG1 B;  1OJH A;  5LHI A;  3UKM A;  3DXR B;  4KHP B;  1PKX A;  2ZQM A;  4NKG B;  4FPP A;  4CS4 A;  1SC5 B;  1P84 F;  3E8B A;  1R6N A;  4DR7 O;  1WJZ A;  4BR6 A;  2JGD A;  1XL4 A;  1M93 A;  1QLE B;  1BSM A;  4JZ2 A;  3G80 A;  1Y74 B;  3CRA A;  2ATK C;  3OM3 B;  3J81 N;  1SQP H;  5IJ0 A;  1Q43 A;  3GWK C;  2VQF O;  4J11 A;  1KP2 A;  1WPX A;  2QTO A;  3GB7 C;  3K3W A;  3LDD A;  4GLX A;  3AEI A;  3ZHS A;  3K06 A;  5L3G A;  3APQ A;  2CE4 A;  3P3P A;  1U96 A;  2VQF B;  1AI6 A;  2JJ1 G;  3ABK C;  1K3E A;  1RFY A;  1GN2 A;  2UU9 O;  4HBN A;  4KXR A;  4U7N A;  2P5O A;  5JCO C;  2A79 B;  4XDL A;  3CSX A;  1YJW V;  2HJD A;  2UU9 B;  1G6U A;  1YZB A;  4IYI A;  3NXS A;  3CX5 F;  3RYF A;  4K8X A;  4GT1 A;  2ZM6 O;  3ASN B;  3OEH G;  2F4V O;  1BT8 A;  4QIW F;  1VQ9 V;  1TUB A;  3ZHR A;  2ZM6 B;  4YJ2 A;  2WPD G;  1KMI Z;  3H9V A;  1XIL A;  1NTZ H;  1F4M A;  5E1A C;  2FKX A;  3CRC A;  3JAL B;  4PI2 A;  2UXX A;  3D8C A;  4TSF G;  1DTO A;  2XUM A;  4GYC B;  1SS3 A;  5JJN B;  5KLV H;  3OTO B;  2N05 A;  5KAI Z;  2QSA A;  3TET A;  2UUC O;  4GX5 A;  2DE0 X;  3ZHQ A;  2MW2 B;  2GSM B;  2IW5 A;  2UUC B;  5KMG A;  2UXB B;  3B8M A;  3CCV V;  3ETG A;  2ZIN A;  4JAV A;  1FS0 G;  3LNN A;  3C3T A;  2Q8V A;  1Q7Y W;  3FX7 A;  4CS3 A;  4EFE A;  1Y6X A;  5F2V O;  2Q0A A;  2XAQ A;  3ZHU A;  1SRY A;  3CCQ V;  5C93 A;  1MSD A;  2UXD O;  1N0J A;  3VBB A;  2W6J G;  3DTU B;  4J80 A;  5LYJ A;  1YIJ V;  3F5W C;  2LJ2 A;  5KHG A;  2UXD B;  3FB5 C;  1FJG O;  5JVD B;  4MS2 A;  2E74 B;  1S77 D;  1PL4 A;  3T2M A;  4FLW A;  1BS3 A;  1W0K G;  3VQX A;  1FJG B;  3AG1 C;  3MAQ A;  1BMF G;  4H0L B;  3JAW A;  3L9D A;  3OEE G;  1ZAU A;  4X66 O;  3RWR D;  1Q6I A;  3ZMV A;  3VQW A;  1QU7 A;  2LFS A;  4WFE A;  1QLE C;  4DUZ O;  4X66 B;  1ZUQ A;  4FMT A;  2RN9 A;  3OAA G;  2ITC C;  3ZHT A;  4O2B A;  4X1I B;  2FYU H;  5LOV A;  4DUZ B;  3RBZ A;  1YXB A;  1WB8 A;  3OR6 C;  3CCU V;  1S3J A;  4MT8 A;  4DR2 O;  5CB4 A;  5A9G A;  4R50 A;  3K57 A;  1H2K A;  3MHS C;  3U11 A;  1GM7 A;  2ZE5 A;  1P4R A;  2IU0 A;  1XMO B;  2Z0A A;  3JAS A;  2E76 B;  2Q67 A;  4D7T A;  5IJ9 A;  3FFQ A;  2C2A A;  3J7A U;  1NT2 B;  2KG7 A;  4LP8 A;  5FLX N;  3ASN C;  1N34 O;  3CCL V;  4F6E A;  2QTS A;  2IJI A;  4OXS A;  2HJF C;  5FPO A;  1VF6 A;  3OUF A;  4JZG A;  2HLD G;  4FM1 A;  1N34 B;  1R73 A;  4JTA B;  4D7S A;  2Z5U A;  4MVU A;  2GUZ A;  2QM7 A;  3M8A A;  4O4L A;  1F23 A;  2X6A A;  1Q8I A;  2P6J A;  3WB1 A;  4B3T O;  2AGA A;  2KSD A;  1HDJ A;  4K8Z A;  4YXW G;  1EN4 A;  3JCZ A;  4X20 B;  4MTO A;  1VQ5 V;  4B3T B;  4QNH B;  3OW2 U;  1BHA A;  2HEP A;  3CPW U;  3MD0 A;  1NZ6 A;  4NB5 A;  5B3S B;  1WN7 A;  4NTX A;  4YJ3 A;  3H01 A;  2WLL B;  4PJ0 Z;  4LH6 A;  3K5L A;  2QWQ B;  4UCO A;  5L3E A;  4JV5 O;  3OD4 A;  5LMU B;  4O4J A;  4MVR A;  1IVS A;  4MTF A;  2F43 G;  3STZ C;  4JV5 B;  1FXK B;  1HWY A;  3ZRW A;  4RQE A;  5KUK A;  2CH7 A;  3E86 A;  2X6C A;  1GN3 A;  1IBK O;  1JPX A;  1K5Q A;  1NTM H;  3K5M A;  2P06 A;  1XEQ A;  2QKA A;  4BAY A;  2CGN A;  1WB7 A;  2A06 H;  2Y0P A;  1IBK B;  4LR3 A;  2BTQ B;  4A5U B;  1FD9 A;  2IH1 C;  3JCU Z;  1ENV A;  2VQE O;  3F5T A;  4UCS A;  4FLY A;  2EIL B;  4TWK A;  1CXZ B;  4HZ3 A;  2M7W A;  1JR9 A;  5FPR A;  2D2C B;  1MOF A;  3JAR B;  5BMV A;  2AXT Z;  3G71 V;  2L6L A;  1F4N A;  4IHJ A;  2XOK G;  3DC6 A;  3ZRS A;  1NU1 H;  4W4K A;  2QR4 A;  4R7C A;  5LXT A;  4DUY O;  3KCY A;  1Q6U A;  5LHG A;  2N04 A;  4ZBM A;  3CXC U;  3SYP A;  1G8M A;  4DV1 B;  4DW0 A;  5FNV A;  4DUY B;  1NR1 A;  2HVK C;  4F4L A;  4EB6 A;  5CA1 A;  1HNW O;  3DSQ A;  3WU2 Z;  4JI3 B;  4X62 O;  4HAM A;  3AG3 B;  3L72 H;  3RVY A;  2LW7 A;  3A0H Z;  4I9W A;  3RYI A;  4ZOL A;  1FPO A;  3FB8 C;  3HKC A;  1EM1 A;  2P67 A;  3TXS A;  3CMA V;  4J41 A;  4B3R O;  4ZI7 A;  3PJS K;  2ZD9 A;  4LCU C;  4PHZ A;  2EIN B;  1XNR O;  3MDS A;  4DW1 A;  4TV8 A;  5KHI A;  3P30 A;  1BGY H;  4B3R B;  3FB6 C;  4AI8 A;  2QWP B;  4LWS A;  1XNR B;  3DC5 A;  5AG2 A;  3JAK A;  1GH6 A;  2GHY A;  2QJ1 A;  4JI2 O;  4CH5 A;  1ROP A;  1NH2 D;  5KHH A;  1WPB A;  5IYZ A;  3OMA B;  4JI2 B;  2YIA A;  5IYB O;  3T4D A;  2WSS G;  5LP6 A;  2P22 C;  3AK1 A;  3BPZ A;  1VAR A;  3Q4H B;  4DXW A;  2L35 A;  1Y76 B;  4O4H B;  1PNK A;  2WLM A;  4OX9 O;  1EZV H;  4OGQ B;  1QR9 A;  4DRX A;  3BAB A;  1OCR B;  4DK0 A;  5IDJ A;  1VMG A;  2QEX V;  2UXN A;  4OX9 B;  1XOU A;  4FK5 C;  3UO2 A;  3D36 C;  5JCO A;  1AI4 A;  1FYJ A;  1M1K W;  4CH4 A;  5DEC A;  3UM7 A;  4JI8 O;  1P7G A;  3B09 A;  2BCC H;  3W7S A;  1MA1 A;  1BCC H;  1FXK C;  3BVO A;  2Q6A A;  4MW8 A;  1GAX A;  5EYP A;  2ZDI C;  4I55 B;  1SA0 A;  3LNM B;  3H1H H;  1W2B U;  4FLU A;  1ARO P;  1DGS A;  1KYO F;  1V9P A;  2VWJ A;  1D2D A;  3S3X A;  3CEI A;  5JJE B;  4LF9 O;  1GTO A;  2EX3 A;  2F1M A;  3H1K H;  5KHJ A;  3GVM A;  2Y48 A;  5JWP A;  2EIL C;  1GKF A;  2OCC B;  3KG2 A;  4UB6 Z;  3JSL A;  5CMU A;  5IYD O;  2RCV A;  3HKB A;  4DV7 O;  4K35 A;  1KB9 F;  2WLK A;  3CXH F;  1LR1 A;  3TJT A;  4D6T H;  4MW3 A;  1I0H A;  4CC6 A;  1GRJ A;  3G6E V;  3JD0 A;  4DV7 B;  4TV9 A;  4UV9 A;  5JQG A;  3AG2 B;  1F7Y A;  2UXC O;  2YIC A;  4LFB O;  2IU3 A;  4YY3 O;  5GTH Z;  4I0X A;  4TUY B;  5H6Q A;  1ZSP A;  2DYR B;  2UXC B;  4RQF A;  2FML A;  4BW5 A;  4LFB B;  3AG3 C;  2PUS A;  2QKC A;  5CA3 A;  1OCO B;  4I5S A;  3LSQ A;  1FKA O;  4X1Y A;  2YEV A;  2PTM A;  2PI4 A;  4JI5 O;  3KZI Z;  4HNA A;  2H94 A;  1BQZ A;  1UJW B;  1HP8 A;  2EZO A;  4NTY A;  2Q9L A;  4RAI A;  4J7Z A;  2LQT A;  4JI5 B;  1H2M A;  2EIN C;  3SYA A;  3CC7 V;  4FLX A;  4U3J A;  1UFI A;  3LSS A;  1ZLZ A;  1B3Q A;  4J9Y B;  1XHZ A;  1XRE A;  2GV9 A;  3DXR A;  2OCH A;  5H2F Z;  4EKW A;  2E75 B;  1NBM G;  1BE3 H;  2WA4 A;  3CP1 A;  3ABL B;  1Y67 A;  4DR5 O;  1TGO A;  1Y74 A;  2F93 B;  5DM6 V;  2ZCE A;  4LF4 O;  3W7X A;  5CA0 B;  4DR5 B;  3OTF A;  1V55 B;  1H8H G;  4LF6 O;  2WLJ A;  3K0D A;  4UCT A;  5E79 Z;  4LF4 B;  4PDL A;  4IYH A;  3A0B Z;  3CB2 A;  1KU9 A;  4LF6 B;  1OCR C;  3SYC A;  3E8G A;  4XDK A;  5BXZ A;  5BR8 O;  5IJ0 B;  4G27 B;  1YJN V;  1N36 O;  4DV4 B;  2PZS A;  1Y66 A;  3FAV A;  2IJK A;  2H3O A;  1W0J G;  5BR8 B;  1VIB A;  2AHZ A;  1N36 B;  1VEW A;  2M6Y A;  3SGI A;  4QE9 A;  2OWO A;  4DV5 O;  3ZN0 A;  1NVP D;  1AB3 A;  2QM4 A;  1QNM A;  4TQF A;  4UVA A;  1COW G;  1WP8 A;  2K1E A;  3UO3 A;  1THZ A;  4DV5 B;  1VQ8 V;  5FL7 G;  2Q68 A;  4JGS A;  3RYF B;  1R6T A;  2P90 A;  3OTO O;  1AI5 A;  3JAL A;  4MVQ A;  1BL8 A;  2OCC C;  2X6B A;  4LFC O;  3HR0 A;  2R72 A;  1BZK A;  2WLI B;  5B1N A;  2X7R B;  1K92 A;  3CME V;  2FL4 A;  1S5H C;  3SJB C;  4LFC B;  4YJ2 B;  3WFV A;  3ZN1 A;  2UXB O;  3G4S V;  5EIB C;  1VQN V;  3F7Y C;  3LUT B;  5L3B A;  5GW7 A;  1NVP B;  3VOU A;  4GUN A;  3JSN A;  3K03 A;  3AG2 C;  1FXV A;  4J7J A;  2R9I A;  1WAZ A;  3ASO B;  1MAB G;  1EN5 A;  2Z3Y A;  3IFX A;  2DYR C;  4BW9 A;  1M57 B;  4F6R B;  5ITZ A;  1AIL A;  3TGU H;  4PI0 A;  3BHP A;  4JF3 A;  4FFK A;  4XDJ A;  1OCO C;  1Q86 W;  4MVO A;  5L3F A;  1AR5 A;  2JK5 C;  3DGE A;  2NLJ C;  1Z2G A;  2NNU A;  4LF7 O;  3BFR A;  3OMN B;  1YEW A;  2IJJ A;  4LF7 B;  2RQ6 A;  2PYL A;  2D3O W;  3W7W A;  5EK0 A;  5JH7 A;  4P9O A;  5TIS Z;  4JAS A;  1HNZ O;  3ABL C;  1AR1 B;  5LYJ B;  4ZKI A;  2H8P C;  1MMM A;  1HNZ B;  3HB3 B;  1SQX H;  5HFM A;  4RUF A;  2F23 A;  2JIZ G;  4X1I A;  4UCV A;  2XND G;  4GZR B;  1KEC A;  2CGO A;  2XHB A;  1V55 C;  3ZMS A;  3JAW B;  4X88 A;  3CCM V;  3ZRX A;  3K5O A;  5CBH A;  1R3J C;  4YIO A;  3JAT B;  2BOB C;  4IGG A;  1XMO O;  4WBN A;  2XAF A;  2P4K A;  1Y4M A;  3ZCC A;  1QLN A;  2Q4P A;  1Q81 W;  5DED A;  4JI1 B;  5IY5 B;  1FFX A;  2DWE C;  3K79 A;  5LOV B;  4JI4 B;  5KHK A;  1QBZ A;  3U0Z A;  4NXN B;  4DR6 B;  4I50 B;  1CPY A;  5CB4 B;  4QE7 A;  1JX9 A;  4QGP A;  1LNQ A;  4I4T B;  4Z1V A;  4PA3 A;  5IJ9 B;  3KCX A;  4CH6 A;  2KG7 B;  3SJQ C;  2AZ0 A;  4AHC A;  2OTJ V;  4TOI A;  2V7Q G;  3RYC B;  1F51 A;  1L0L H;  2DQ0 A;  3IC7 A;  2B5U A;  2EIM B;  5B1O A;  3CCS V;  3EVK A;  4NXM O;  4X20 A;  2WLH A;  4C7U A;  3T1Y O;  1PV0 A;  1ORQ C;  2JS3 A;  3K9S A;  2W0X A;  1KD1 W;  2LO1 A;  1D5A A;  4DV2 O;  1VQP V;  4NXM B;  2GUZ B;  1KKD A;  1PPJ H;  3T1Y B;  3FYI B;  3IJ4 A;  1K9M W;  4DV2 B;  5LMU O;  1XMQ O;  4CZZ A;  3NR7 A;  3ASO C;  5BZB A;  1KC8 W;  2ZNJ A;  2GTS A;  1W59 A;  1E79 G;  2JGU A;  2GBO A;  3F7V C;  1N32 O;  3D36 A;  1XMQ B;  1M57 C;  1SF9 A;  2VS0 A;  5D5P A;  1N32 B;  1R3L C;  4YJ3 B;  3ZED A;  1N4C A;  2RNB A;  4FFB A;  1K5S A;  1B04 A;  4JTC B;  2KB1 A;  1K34 A;  2DJV A;  1EFR G;  1XBL A;  5LBQ A;  1WA8 A;  4J7K A;  4K0K B;  1GO3 F;  2DYS B;  2XT9 A;  1PNL A;  5B1A B;  4O4J B;  5C8Y A;  4X64 O;  2X0L A;  3R65 A;  3CS5 A;  3TXQ A;  2ADQ B;  3HKE A;  1KQS U;  2BTQ A;  3LDE A;  3CRM A;  1PP9 H;  3AG7 A;  3CJH A;  3ZRW B;  2LFR A;  4X64 B;  1HW7 A;  4RUE A;  3OR7 C;  1BHB A;  4P2Z A;  3ETD A;  4G2K A;  1RM1 B;  4K3A A;  1IZ3 A;  3ZJZ A;  1K4C C;  2EJR A;  2Q7H A;  3N2G B;  4YIP A;  2QWO B;  4FZ0 A;  4O4I B;  3QO5 A;  5JJJ B;  1YI2 V;  5BY1 A;  1IXB A;  2QKS A;  2CTP A;  2ZT9 B;  4CBC A;  4DV1 O;  2EIK B;  5KA6 A;  3WB0 A;  5J2T A;  1DLB A;  3CCE V;  1H8E G;  2R70 A;  3K0G A;  3ZX6 A;  1SQB H;  4JI3 O;  3SDL A;  3N2K A;  2CTW A;  2K9P A;  2EZP A;  5IY5 C;  2G38 A;  4QPJ A;  2ETN A;  3K04 A;  1N33 O;  4ABM A;  2PYJ A;  5BMV B;  3CD6 V;  2IBZ H;  1L0N H;  5KX5 B;  2Y4T A;  3OFN G;  4H33 A;  4PA6 A;  4DV3 B;  1H38 A;  1N33 B;  4Z1M G;  1Q6H A;  2AW9 A;  4X8A A;  3UT5 A;  3K58 A;  2ZR3 A;  1NTK H;  1JJ2 U;  4B3M B;  1I7F A;  5FNV B;  5EBM C;  1ZL8 A;  1YIT V;  4UB8 Z;  2P4V A;  3AG4 B;  1XL6 A;  4EB6 B;  4J9Z B;  4BIZ A;  3I56 V;  1QVF U;  2W0F C;  3A8T A;  3QO8 A;  1YTF D;  3B4S A;  3RYI B;  4P30 A;  1K8A W;  4ZOL B;  2CUG A;  2JVD A;  5LA6 B;  2ILM A;  2BSK A;  1MZE A;  4ZI7 B;  4BWA A;  2FTK A;  4KP4 A;  1VF6 C;  2JEX A;  1EN6 A;  1Q3E A;  1KKC A;  5J2U A;  2YXY A;  4LFA B;  2YXL A;  2EUL A;  1AP5 A;  4LWS B;  3L74 H;  5B3S C;  2Q0O C;  3BCC H;  2CAZ C;  5D5Q A;  3FB7 C;  4ZHQ A;  2EIJ B;  4MVM A;  2OIG A;  4NR1 A;  1IXM A;  1JFF A;  4AQY O;  5IYZ B;  3FKS G;  1RSO A;  3RVZ A;  5LP6 B;  1YTF B;  2OIE A;  2HP8 A;  4GKK O;  4U7O A;  1V54 B;  1OCC B;  4AQY B;  1GMG A;  3I55 V;  1P7B A;  3E22 A;  4MTG A;  4DV6 O;  2P7T C;  3OGI B;  3SPC A;  4FLT A;  2QGN A;  3B40 A;  1NH2 B;  4GKK B;  1S5L Z;  1VF5 B;  1ZX3 A;  3GWO A;  1YVW A;  2B1G A;  4DV6 B;  5EZY A;  3OMI B;  1VQK V;  3L71 H;  2DYS C;  3RT3 C;  4L87 A;  3ABU A;  4N21 A;  1DF5 A;  4X1K A;  2JEU A;  1WP7 A;  5EYP B;  3K08 A;  4PA4 A;  4B7K A;  1RM1 C;  1AVM A;  3STL C;  2YXH A;  1SA0 B;  1NJI W;  1Q90 D;  4DK1 A;  1PL0 A;  1E1R G;  4WFG A;  4PDV A;  4Q20 A;  2EBO A;  3L70 H;  4WFA V;  4WFB V;  3IAY A;  4BIU A;  2F95 B;  1I5Y A;  4LF8 O;  1NS1 A;  4UUJ C;  1TVK B;  3R66 A;  1NR7 A;  1TA8 A;  2XAJ A;  1GK9 A;  5IYC O;  2ZE6 A;  1G1X B;  1P49 A;  1QCE A;  2UUA B;  4LF8 B;  4QJF B;  5GON B;  3HKB B;  4Q6G A;  3ZBH A;  4B3S O;  1GN6 A;  4TV9 B;  4E2L A;  1RP3 B;  4DR4 O;  2JDI G;  5JQG B;  1HNX B;  3B77 A;  3UCS C;  4B3S B;  1AJP A;  2Y0I A;  3QG5 A;  3HKD A;  4DR4 B;  4I0X B;  4O2A B;  5CBF A;  3AG4 C;  1X59 A;  2HR3 A;  1AJQ A;  1OHH G;  4LC1 A;  3RYH B;  1GN4 A;  5LGU A;  3SPH A;  3VQV A;  5CN0 A;  4X1Y B;  2YEV B;  1RPO A;  5CBG A;  4IIJ B;  4HNA B;  1SZX A;  4LNU B;  4JPR A;  2DW4 A;  3IGA C;  1B06 A;  4DR1 O;  4JYA O;  4U3J B;  3EHB B;  4IL6 Z;  4NTW A;  1XI1 A;  3X2Q B;  4UCU A;  1SER A;  4JTD B;  2LP7 A;  4DR1 B;  1H2S B;  1T5E A;  4JYA B;  4LH7 A;  2ITD C;  4RO2 A;  2OTL V;  3SJC C;  2GDS A;  5A2Q N;  2EIJ C;  2Q69 A;  2MK3 A;  2NR5 A;  3E89 A;  1VQ7 V;  4U3F H;  1SET A;  5LMN O;  4DV4 O;  2KQX A;  2JGD B;  3ZHV A;  1S5J A;  4WFH A;  4DYL A;  4DR7 B;  1WLE A;  5LP6 C;  4FZ1 A;  1V54 C;  1OCC C;  5LMN B;  4PD4 F;  3BEH A;  1VQ4 V;  3KKY A;  4WF9 V;  3ZMU A;  1O9G A;  4QPK A;  5EBW C;  2WLN A;  2E5L O;  1O9H A;  3C90 A;  3T4Z A;  4TQD A;  2OT5 A;  1A32 A;  3G6B A;  1MNG A;  3THO A;  3T1H O;  3BA9 A;  1YSC A;  1SZT A;  2E5L B;  1TUE B;  4J42 A;  2QE7 G;  1B6Q A;  1M9N A;  3T1H B;  4Z2W A;  1NKD A;  3FAV B;  2B1I A;  2ZE8 A;  4PA7 A;  1YJ9 V;  1JCH A;  4P9P A;  1AI7 A;  2RDC A;  1XDC A;  1X4T A;  3H1I H;  4H13 B;  2DOS A;  4GX1 A;  4PDM A;  3D3I A;  1YCI A;  1VQO V;  3UQ8 A;  3E8H A;  2WLI A;  1SQV H;  5H6R A;  1TUB B;  3ICX A;  2EJ7 A;  1M4U A;  3JD1 A;  3CCJ V;  4FM2 A;  2F4V B;  2Q7E A;  1RPR A;  1L1F A;  3SJA C;  3BA8 A;  3TK1 A;  1SQG A;  3BAA A;  4B08 A;  5LL6 Y;  3G67 A;  1SQQ H;  3CRR A;  4MSW C;  2BOC C;  1XUQ A;  3JD4 A;  1J95 A;  4WFF A;  4F6R A;  2PGG A;  2Q73 A;  5KAF Z;  4PV1 B;  4PDR A;  3WB2 A;  2XAG A;  5KMG B;  3L75 H;  4JYC A;  4ICG A;  1N0N A;  1OCZ B;  1CP9 A;  1J5E O;  2ZNI A;  4OPA A;  2XTA A;  1MG1 A;  2YID A;  1PD3 A;  1SQF A;  5JVD A;  4X9Q A;  4GX2 A;  3CCR V;  1WNS A;  3MHH C;  5B5E Z;  2DMX A;  1J5E B;  3K59 A;  4UVB A;  5ITZ B;  4NYK A;  3ABT A;  1NI8 A;  1VQ6 V;  1VQL V;  2Q7G A;  4H44 B;  2XAS A;  3JD2 A;  4UFZ A;  4DV0 O;  3CE2 A;  2IJH A;  4B7E A;  5EC2 C;  1JJO A;  3BY6 A;  2IH3 C;  2NN4 A; 
#chains in the Genus database with same CATH homology
 3G80 A;  1WA8 B;  4I0X B;  1WA8 A;  4I0X A;  4GZR B;  2AZ2 A;  2DE0 X;  3FAV B;  3GWK C;  3FAV A;  3TXQ A;  3Q4H B;  4ABM A;  3Q4H A;  2VS0 A;  4LWS B;  4LWS A;  2KG7 B;  3ZBH A;  2KG7 A;  2AZ0 A;  2VRZ A;  3OGI B;  3GVM A;  3TXS A;  3O9O A;  2B9Z A;  3FD9 A;  3HR0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...