3ZBHA

Geobacillus thermodenitrificans esxa crystal form i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
90
structure length
90
Chain Sequence
LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESXA
publication title Crystal Structure of the Homodimeric Esat-6-Family Proteins Esxa and Esxb from Geobacillus Thermodenitrificans
rcsb
molecule tags Unknown function
total genus 41
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3zbhA00
3GVMA 3HR0A 2KG7A 3O9OA 2KG7B 4ABMA 3Q4HA 3TXQA 3Q4HB 3OGIB 3GWKC 2AZ2A 3FAVA 3FAVB 3G80A 2DE0X 4GZRB 4I0XA 3TXSA 3ZBHA 4I0XB 2B9ZA 4LWSA 2AZ0A 4LWSB 3FD9A 1WA8A 2VRZA 2VS0A 1WA8B
chains in the Genus database with same CATH superfamily
3ASOC 3BPZA 4RAIA 4LF7B 5KHHA 4JI6O 2K9PA 1SQBH 3HKCB 1S5JA 4OPAA 4QE7A 3P3NA 5IE9A 1S77D 4GT1A 5EBLC 4ASUG 1EZVH 2A3QA 4GUNA 3BEHA 3L74H 4X20B 5DN6G 4FLTA 1OCRC 1GO3F 5H6QA 1IXBA 1SQFA 4QGPA 2GBOA 3STZC 2BSKB 3DC6A 3T1HO 4X20A 4NKGB 2IJHA 1NTMH 3LNNA 1JOYA 3JD4A 3SPGA 4KFMA 1EN5A 3BHPA 2XHBA 3SYQA 2BSKA 4AHCA 4LCUC 3OGCC 4LF4B 1NH2B 1Q5OA 4CH3A 1FXKB 2CK3G 1I7FA 3UT5B 3ZMUA 1GM7A 3CX5F 3K08A 4U3JB 4O4JB 1JA8A 5KMGB 1F7YA 2WA4A 3IGAC 3A0RA 1HNWO 4JI6B 1N33O 2WLKA 4U7OA 1H2GA 1JX9A 3K5MA 3RBZA 4X65O 4FLZA 4MVMA 1FXKA 5A9GA 2LGQA 3UT5A 2UXNA 1PNMA 2DOSA 2RDCA 4U3JA 4O4JA 5KMGA 1GMGA 1GAXA 2Q4PA 1SQGA 3FKSG 1T5EA 3EHBB 1YIJV 2OCCB 1SF9A 3RVYA 1YF2A 2ZE8A 2HJDA 4ZI7B 5IT9N 1AROP 3G4SV 3T1HB 4WF9V 3AK3A 2H8PC 5CA3A 5C93A 3OFNG 5IJ0B 4JI5O 4H37A 3OMAB 3ABUA 4PI2A 4GKJO 3CS5A 3LSQA 2Y69B 3M99B 3JD0A 1L0LH 2F43G 4WFBV 2X6AA 3QTCA 4DUZO 2FTKA 1M57B 4QPKA 4ZI7A 3DXRB 3H1LH 2QSAA 3ABLC 4FVMA 3GB7C 4X1KA 1K4CC 3ZN1A 3CRMA 5IJ0A 1L1FA 4LFBO 5LL6Y 2ZT9B 3K5OA 3CMEV 1MSWD 1S5LZ 4MW3A 4LF5B 2DWEC 1JQ0A 2QKSA 3BY6A 1SA0B 1HNWB 3LSUA 1N33B 2XASA 2QKAA 3DXRA 3F7VC 2JRIA 3TXSA 3CCJV 4J9ZB 4CZZA 2EIJB 3MD0A 1P7GA 2XUMA 1LNQA 4YIOA 3EXAA 4JI7O 3TJTA 2Z0AA 1N8RW 1W0JG 3PJSK 3W7XA 2M6YA 3FB5C 3K59A 4K8XA 3ZX6A 3KZIZ 1YHQV 1KBHA 4QNHB 1YITV 1J5EO 2YXHA 2AHZA 4JASA 5JVDB 1YJNV 3RYCB 5LGNA 3FYIB 2B1GA 3S3WA 1N4CA 4DV2O 4HZ3A 2WLNA 3NR7A 4GKJB 3OE7G 4YJ2B 3ZHUA 4OXSA 2UUBO 2F1MA 2K1EA 3OD4A 1ZLZA 3SYOA 2Q7EA 2AW9A 1Q6UA 3TCUA 2HFEC 4WFEA 3OM3B 5JVDA 4PA3A 3RYCA 4RUEA 4K8ZA 1SKVA 1AB3A 1NI8A 4DR2O 4JTDB 3SJQC 3SJAC 1IBMO 4YJ2A 2UXCO 1H2SB 2R9RB 4J9YB 5IJ9A 1B06A 4DR1B 3UCSC 1ZTEA 5DM6V 4FLYA 2DYRB 3JAKB 1ZWIC 3CXHF 1NT2B 3TETA 4Z1VA 1N34O 3QNEA 2EZPA 3AG3C 4UV8A 4PELA 3P3PA 4IYIA 2JS5A 5KHJA 1VQLV 5LHGA 4X64O 2YXLA 1EN6A 3H1KH 1BS3A 3CC7V 1O9GA 4ZBMA 5H6RA 3OEEG 1D5NA 2F66C 2CUGA 3KCYA 3JAKA 5IYZB 2EIMB 2Y0PA 4MS2A 4LF6O 1IBLO 4UB6Z 1RSOB 4MTOA 4CS4A 3G67A 4KXRA 5H2FZ 3T4DA 4DV2B 3ASOB 4ICGA 2HJFC 3I55V 3CCLV 2QWQB 5IYZA 1R3IC 4LF8O 4X89A 1QR8A 1GKFA 2DE0X 3T1YO 2Z5UA 1P4RA 4PDVA 4OGQB 2PUSA 1GTOA 1RSOA 3FD9A 1COWG 2YIBD 4D7SA 1OCRB 4R6ZA 1U97A 1FXVA 1ZUQA 1IBMB 4IGGA 2UXCB 4WFAV 1VP7A 3BA9A 3FYEB 1E79G 4JI8O 3UQ8A 3HKEB 3SJBC 3SPIA 3JASB 1WP8A 1EZJA 2YSUB 1E1QG 2Q0OC 1AILA 2LFRA 3OAAG 4JYYA 4TV8B 4FLWA 3UKMA 3ML0A 4YJ3B 5EC1C 4I5SA 4GYCB 2RJZA 4BIZA 2VQFO 4LF9O 2ATKC 4JI2O 3K58A 3HKEA 4MT8A 1VQ5V 4DV0O 1SRYA 4DR5O 1MABG 4J7KA 2GV9A 2Y0IA 4NXNO 4TV8A 5CMUA 5JH7A 1GN6A 1BMFG 3I5DA 1WLEA 3FB7C 4X62B 3RWRD 4YJ3A 3DC5A 1IBLB 2BCCH 3ZMTA 1KMIZ 5HFLA 2JEUA 4NTYA 4X66O 1QLNA 1G4YB 3CRAA 1X59A 2QWOB 4CH6A 3T1YB 4JI3B 1TGOA 2GUZB 1UPGA 1YXBA 4KHPO 2KG7B 2WAMA 1MZFA 3CHXA 4B3SO 3FB8C 1KB9F 3JATB 3K9SA 1H38A 1G1XB 4B3RO 3VQXA 2GUZA 3AEIA 3WU2Z 2WLJA 1R1BA 2NLJC 2G38A 3IFXA 2KG7A 4TUYB 4MTGA 1Y67A 1VQ4V 1FXHA 4G27B 2VQFB 1SZTA 3VQWA 3CWBH 4F6RB 1SQXH 3G71V 3JATA 1GM8A 3R66A 2EIKC 4DV0B 4O4IB 5J2UB 4UB8Z 2EIJC 2Q7HA 3ABLB 2ZE7A 1YSCA 3E89A 2ILMA 5CA0B 2UUCB 1PKXA 4LFAO 4TUYA 1AJQA 1BCCH 5IWAB 2BOBC 3ETGA 4L87A 1OZ0A 4F6RA 3CE2A 4IHJB 2JJ2G 5GTHZ 2FKXA 3CPWU 4O4IA 1MG1A 2LGWA 3AG4C 1QVFU 2IU0A 5J2UA 1FFXB 2EJ7A 2V7QG 4O2AB 1AP5A 2QDOA 3HKBB 3FX7A 2ZIOA 4LF7O 4FIPC 1QBZA 1JR9A 1YDXA 2CDYA 2QM7A 2YIDA 4IHJA 1M1KW 1XNRB 4G28B 2GSMB 4P9OA 3WG7C 5D5QA 4NB5A 5KA6A 1G8MA 1FFXA 2YDEA 4LNUB 1KP3A 3J81N 3H9VA 4B3RB 3ZRWB 1Y4MA 4O2AA 2CTWA 3X2QC 2E75B 1M90W 2E5LB 3HKBA 4FM2A 1JJOA 5JJEB 1I08A 3O9OA 5LXTB 5F2VO 3IC7A 4PA4A 2QWRB 4DW0A 2DYRC 2OIEA 4LNUA 3VOUA 3LNMB 3ZRWA 5KHKA 3A0BZ 1MMMA 5JCOC 3BRCA 5LXTA 4TQDA 4JZGA 1VQ9V 3E2EA 1DF4A 1JJ2U 2CTPA 2QA4V 5KAFZ 4D7TA 5GW7A 1K4DC 2X7RB 1N36O 5H9CA 2GTAA 4OX9B 3AG3B 4FK5C 5DECA 3OTFA 1YTFD 1OCOC 1O9HA 1RPRA 3VQYA 3UM7A 3VBBA 1PL4A 5HFMA 2ZR2A 1IURA 4FFKA 4MVQA 4I0XB 3J7AU 5EYPB 4K35A 2OWOA 1FAFA 1QVGU 5L3DA 3ABMC 1L0NH 3K57A 2BTQB 2FL4A 1K8AW 4DRXB 1MOFA 3N27A 4QE9A 4NTXA 1KU9A 3OMNB 3D3IA 1I94B 4UCUA 3E8HA 4I0XA 4CC5A 5EYPA 2YEVB 3E35A 2L35A 2E3CA 2ARHA 1SQQH 5DEDA 3T1CA 1KD1W 3H1HH 2BTQA 1NS1A 4DRXA 2Q0AA 2HP8A 3QO7A 1M4UA 3APQA 1K5QA 1YEWA 2F95B 3OUSA 2YEVA 2WWWA 2RCVA 4P9PA 2BTOA 1WPXA 1Q43A 5JJJB 4X1IB 1W2BU 3HB3B 1CEZA 1YCIA 1N36B 3U11A 1S0VA 1N32O 3A2FA 1DTOA 5B1BC 4LF5O 1L8DA 1PNLA 1R6KA 4J10A 1HWYA 3M7MX 2DYSC 5KUKA 2YICA 2P06A 3ASNB 3OMIB 3L75H 1NZ6A 4X1IA 4DW1A 1Q6IA 1YVWA 1ZX3A 1VQKV 4UVCA 1DK1A 1XUQA 1V55C 2ODMA 1SERA 4YIPA 1M5IA 5E79Z 3OR6C 3QO5A 4JI0O 1VEWA 2QTOA 4MTXA 3ZHTA 3H01A 2PYLA 2H3OA 3ZHRA 1K7DA 1SESA 1TVKB 2RN9A 5IDJA 3ZHSA 5J2TB 4ZKIA 3K03A 1LUVA 4X1KB 3SGIA 2P90A 3ZMZA 2JIZG 1QR9A 4X8AA 2HEPA 5L3BA 1PD3A 1XMOO 3JSLA 2IW5A 2QE7G 3K0GA 5J9PC 4WFGA 1TVKA 1PP9H 4AQYO 5TISZ 4QPJA 4J42A 5J2TA 4JYBA 3APOA 3CCQV 4U3FH 2OIGA 2GDSA 3AK2A 4LP8A 2Q67A 1N32B 3C3SA 3BA8A 3B77A 1H8EG 4DR1O 2E74B 1Q6HA 2O57A 4JAVA 1XL4A 3LDCA 2EIKB 2EINC 1RP3B 1CXZB 1OCZC 1VMGA 4O4HB 3W7WA 2PZSA 1TUBB 2KB1A 3ABKC 2DQ3A 4XDKA 5B1NA 3OGIB 4JI0B 3GWKC 2HVKC 2R70A 2IH1C 3K9AA 3A0HZ 1S76D 2XAJA 2OCHA 1BE3H 4CH5A 3AG4B 3K79A 2CGOA 3CRRA 3CMAV 1JPXA 4QIWF 2UU9B 1Q86W 3K04A 4O4HA 3BABA 3THOA 1TUBA 1KQSU 4DK0A 2OT5A 4JYAB 3QG5A 1XMOB 1EFRG 1Z5WA 2Q5ZA 1H2NA 5IJ9B 2Q6AA 2JGDB 4N21A 1HDJA 4AQYB 3WG7B 4UCRA 2LP7A 3CC2V 3OT7A 1UJWB 4R50A 3CCVV 1HNXO 4LFCB 3X2QB 2D3OW 5L3FA 1GN2A 1VF6C 2JGDA 1US6A 4DR3O 4FPPA 4PDRA 1Z2GA 5BMVA 2B9ZA 2HVJC 4UV9A 1VARA 2XOKG 2ZM6B 1R3LC 1OCCC 1WNSA 3ETDA 3KKYA 3UO2A 4PA6A 4PHZA 4BAYA 1H2LA 4J41A 4LH7A 1YI2V 1GH6A 1Q8IA 3LDDA 4FLVA 4X62O 1YJWV 2DN9A 4C7UA 4NXMO 3CCUV 1Y66A 2IBZH 2VRZA 3RN4A 5E1AC 2X6BA 4G2KA 1Q90D 5JCOA 5FPRA 4TWKA 4GX1A 2YIAA 1FYJA 4BIUA 3CJHB 1OCOB 4KUMA 2AZ2A 3BCCH 1K5SA 4K0KO 4PDMA 1M9NA 1S72V 4JI3O 5B1AC 1VQ7V 1GRJA 4PA7A 4Q20A 3TK1A 1QQCA 3ETEA 4IYHA 3ABMB 1HNXB 2Q8VA 3KCXA 3CJHA 2ZKOA 3WFVA 2ZIMA 4B7KA 4DR7O 1N0JA 1AR4A 2A79B 3IC9A 1JCHA 4DR3B 2ITCC 3DTUB 2NR5A 5EK0A 4H44B 5JH7B 3O65A 2P4VA 2X0LA 4I7ZB 5FNVB 3ASNC 2LQTA 4ZHQB 2A0LA 1NH2D 2B5UA 4MVRA 2R72A 5BR8B 2P22C 4FFBB 4LH6A 2YUAA 4NXMB 2DW4A 2UUCO 2KKWA 3OEHG 4UCTA 1XHXA 2GHYA 2PF4E 5IWAO 2P4KA 3ZMSA 5B1BB 1XL6A 1RFYA 5FNVA 3ZMVA 3CRQA 4I9QA 3JD1A 2HKOA 4ZHQA 2DYSB 5FL7G 4K0KB 4GX2A 4J80A 2NN4A 4FFBA 2OTJV 2YC0A 4JPRA 2EILC 2Y4TA 3CCRV 4CS2A 4RO2A 4PV1B 4JAUA 1YJ9V 1P84F 1V55B 5BXZA 2W0FC 5AG2A 1PL0A 5LP6C 1JFFB 3G6BA 2JGUA 2ZDIA 4NR1A 3JD2A 3JD3A 1XNRO 2DWDC 4DR7B 2UXBB 4FZ1A 5BY1A 2AXTZ 1EM1A 4D6TH 4HYOA 4E4EA 1HNZB 1CPYA 4J7JA 4PJ0Z 2VWKA 2QJ1A 3N2GB 1A32A 2EJRA 2E5LO 3HR0A 1AI7A 1JFFA 5LA6B 1PM9A 2XAHA 5L3GA 4Z1MG 4HNAB 1SQVH 1WAZA 1ORQC 1HR0B 2ZCEA 2ADPA 1K97A 2Q9LA 1V9PA 2W6IG 3CC4V 5KA5A 2XAGA 4X9QA 1QLEC 5C8YB 4U7NA 3N2GA 3J80N 3F5TA 2EX3A 5EIBD 5LA6A 2ITDC 1BQZA 3IAYA 2PGGA 4HNAA 3W7TA 3L9DA 1GN4A 3ZCCA 5D5PA 2YI9A 3K0DA 5B3SC 3K06A 3L72H 1DLBA 1WJZA 4BIOA 5JJNB 4YHHO 4LWSA 3QVNA 5C8YA 1AR1B 4J11A 3BAAA 5EC2C 1XMQB 4Q6GA 3AG7A 3PN1A 2EINB 4OX9O 1KKCA 3E22B 5LMUB 2EZOA 3T2MA 4J7ZA 2UXDB 1OCZB 3RFRA 2N04A 2EBOA 1Y6XA 3ABKB 3JALB 2DJVA 5L3CA 4CC6A 3SYAA 3ZN0A 1NR7A 5IYBO 1FFTB 4RUFA 3MHHC 4B7EA 2XT9A 2Q68A 3E22A 2JEXA 4I50B 4WBNB 4UCOA 4UUJC 1URFA 3WB2A 4WCEV 3JALA 3CCEV 4JI4O 1I94O 1XBLA 1KC8W 3U0ZA 4XDJA 4I50A 4WBNA 3AG1C 4B3MO 4DR6O 3ZEDA 4DYLA 3HPLC 2JJ1G 1EBOA 1F4NA 1VQ8V 3OR7C 1FPOA 2GTSA 1Z5VA 4I9WA 2FB5A 2F4VO 4XBFA 4GZRB 5LGUA 3ZBHA 1QU7A 3DGEA 4YHHB 3JCUZ 4H13B 1WB7A 3K3WA 4F4LA 3OTOB 2JVDA 3JARB 1JVMA 2V1DA 5KUMA 2ZD9A 1WN7A 1VQMV 2YI8A 3F5WC 1H8HG 1OCCB 2Q7GA 3B09A 1E1RG 4EB6B 4DV5B 5KX5B 1VF6A 4O2BB 2WSSG 4DR4B 4W4LA 1TA8A 2PTMA 4UFZA 3KG2A 2ADQB 4CBCA 5KLVH 5KAIZ 3JARA 1OHHG 5KHIA 1LUWA 2CTRA 4EKWA 1TUEB 4JAAA 1BGYH 4EB6A 5LGTA 5KX5A 1BZKA 1XNQO 5IYDO 4O2BA 3I56V 2F23A 4JI4B 2N05A 4UCVA 4DXWA 4MTFA 2H94A 4TT3G 3CCMV 2AZ0A 1D2DA 5ITZB 5B1AB 5LHHA 1XREA 1G6UA 1SC5B 3JAWB 4UVAA 4EFBA 1PPJH 1QCEA 4B3MB 1QNMA 4DR6B 2DQ0A 3AK1A 3HKCA 4YXWG 2CAZC 2W6JG 1VQPV 5FLXN 4F6EA 5BZBA 4DUYO 1Q7YW 2Y48A 3WB1A 2F4VB 5ITZA 2JS3A 3SJCC 4PDLA 4A5UB 3JAWA 4DV1B 2PYJA 2VS0A 2N74A 4PA9A 1MNGA 2YIBA 4GLXA 2NNUA 1SZXA 1JMKC 2IJKA 2UXXA 1NTZH 5IY5C 2ZDIC 2EULA 1ZAUA 2VQEO 4H0LB 3E8FA 4EEQA 4QJFB 1AI4A 4IL6Z 2KQXA 2BOCC 5LYJB 1K9MW 1NKDA 1BSMA 5K1XA 4UVBA 2PY5A 1VQNV 2UUAO 1M93A 1K33A 1XNQB 3SPJA 3BVOA 1GK9A 3E86A 5EBMC 3TGUH 1NVPB 1NU1H 2JDIG 4FZ0A 5L3EA 4I55B 2UU9O 3EFFK 5LYJA 1SQPH 2EILB 1D5AA 1ROPA 2AGAA 1RM1B 1V54C 4NTWA 4ZOLB 4JYAO 5LP6B 1J95A 2WLIB 3RYHB 2B1IA 4DUYB 5CA1B 1W59A 4RQEA 2HLDG 3RGBA 4I55A 3QF7A 4B3TO 1Y74B 3EVKA 3ZRVA 4LFCO 3ZRXA 2AHYA 3OUFA 2WA3A 2ZXWC 2Q73A 4ZOLA 2PI5A 5LP6A 1XEQA 2WLIA 1I5YA 3SR2C 3RYHA 3LSSA 5CA1A 2VQEB 5LOVB 4JTAB 3FFQA 4MVOA 3B8NA 2QKCA 1QLEB 1Y74A 4FM1A 2ZM6O 5B1OA 4K3AA 1CP9A 1PV0A 1XQ8A 1R3JC 1B6QA 1X4TA 2WLMA 2UUAB 1R3KC 5LOVA 5B3SB 2A7WA 3D36C 4BW5A 4O4LB 3GWOA 4LC1A 1XILA 2XTAA 4HAMA 5EBWC 1IVSA 4OPHA 5FPOA 4X65B 4MVSA 1S3JA 3L71H 2QM8A 2QWNB 1GN3A 3B40A 4LR3A 3RYFB 3AG2C 3FB6C 1SA0A 3Q4HB 3SPHA 4RQFA 4DV4O 4XDLA 3HKDB 4O4LA 3T4ZA 3B2EE 4TQFA 1KECA 3C3TA 1NQTA 1FJGO 3H1IH 5BMVB 4MW8A 5LBQA 4JV5O 4YY3O 5GTIZ 4B3TB 3A8TA 4JI5B 2IJIA 2D2CB 4HBNA 3K5NA 3RYFA 1THZA 3Q4HA 3G6EV 2QR4A 2WLLB 3HKDA 1S5HC 4WFHA 1EN4A 3JYCA 3ZIAG 3FAVB 4DUZB 3JCZA 4L8JA 3ZJZA 2XAQA 1DF5A 1M56C 3BFRA 4JGSA 3LDEA 4KL1A 3P30A 1ENVA 2MK3A 4LFBB 1HP8A 2CTQA 3S3XA 3M8AA 3AG1B 3CD6V 2ZNIA 2WLLA 3STLC 3MAQA 2LW1A 3E83A 3FAVA 4P30A 3UO3A 3G80A 3D8CA 3OW2U 2Z3YA 4IIJB 1P7BA 5KHGA 5BR8O 3WB0A 1MA1A 4DV7O 4ZIBA 2MW2B 2WLHA 3E8GA 3ABTA 4Z2WA 1FKAO 3C90A 3CSXA 2C2AA 1H2KA 4JI7B 4NYKA 2IH3C 1AI6A 1YTFB 1AJPA 4DV4B 5CBGA 4IIJA 1BT8A 1IDSA 4DV6O 1J5EB 3QO8A 1ZSPA 1FJGB 3RW0A 2CH7B 1F4MA 1Q3EA 1W0KG 4JV5B 3CCSV 4YY3B 2LFSA 4JZ2A 1N0NA 1TAEA 3TXQA 1NTKH 2UUBB 2UXBO 1I5XA 3F7YC 1NBMG 4FMTA 1HNZO 4PD4F 1KYOF 2CH7A 4H33A 4IT5A 1AJNA 1RPOA 2L6LA 4JI1O 3R65A 1AR5A 4DR2B 1BQ0A 4DO2A 1WPBA 2IJJA 2QM4A 3ZHQA 3W7UA 1HR0O 1SS3A 4E2LA 1PNKA 4FM0A 1F51A 4WFFA 4FJCC 1N34B 1FXKC 4DV7B 5H5NA 2QEXV 3RVZA 1LR1A 4DV3O 4X64B 2ETNA 2A9HA 2ZE6A 2A06H 3ICXA 4TOIA 1IBKO 2BE3A 2P7TC 5IY5B 1WB8A 4CH4A 2WPDG 2ZQMA 5CBFA 4BR6A 3JASA 4DV6B 4LF6B 1H2MA 1XMQO 3CP1A 3VQVA 2VWJA 1K92A 3U10A 5LMUO 1RM1C 3RYIB 2UXDO 1VF5B 2QWPB 1MSDA 2OCCC 1Y76B 2CGNA 1IZ3A 1NVPD 1WP7A 3B4SA 4LF8B 1VIBA 4GKKO 2XAFA 2RMKB 2HR3A 3L73H 2JK5C 4X1YB 2YXYA 4GX5A 1SETA 4JI1B 3LUTB 3RYIA 1R6TA 2HHHO 2Y69C 4EFEA 2LW7A 1V54B 1Y76A 3ZRSA 3L70H 1KP2A 4W4KA 1KKDA 1M57C 4JI8B 2OTLV 4RWUA 1QHTA 4P2ZA 4UXNA 1VQ6V 5GONB 2X6CA 4AI8A 5CBHA 2QTSA 3NXSA 3ZHVA 4LWSB 4AILC 3JSNA 3IJ4A 4X1YA 4JYCA 4NVPA 1ZL8B 3N2KB 1HW7A 2HG5C 4DK1A 5LHIA 2RQ6A 5EIBC 2ZNJA 4R7CA 4B08A 1Q82W 3DSQA 4GCZA 4DV3B 4CS3A 4LF9B 1U96A 2ZXWB 2ZR3A 4JI2B 2Y4UA 5A2QN 1IBKB 2OYQA 1AVMA 2PI4A 1Q81W 2CE4A 4X88A 1GM9A 4DR5B 5B5EZ 5CN0A 3CXCU 5GONA 4BWAA 1K34A 2V4DA 4NXNB 5LMNO 1AP6A 3RT3C 1IX9A 3OTOO 2P5OA 1ZL8A 2LO1A 3N2KA 4GX0A 3ZS8C 3JAMN 3CEIA 2IM9A 2M7WA 2IU3A 4FLUA 2W0XA 2P6JA 4ABMA 5K1PA 1BL8A 4DV5O 3P32A 4X66B 4I4TB 4JF3A 2YS8A 4PI0A 4DR4O 4JTCB 4FLXA 1YZBA 4UCSA 4GKKB 1FD9A 2ZE5A 3H1JH 2RNBA 3MHSC 5CA0A 4BW9A 1BHAA 1B3QA 1AI5A 1WA8B 3GVMA 3SYCA 5CB4B 4KHPB 2HHHB 3B8MA 4I4TA 4TSFG 3AG2B 1I0HA 1P49A 3SPCA 2XNDG 4B3SB 5JWPA 3ETQA 1FS0G 1OJHA 3D36A 3SYPA 1R73A 5EZYB 5JQGB 1XI1A 5B66Z 1WA8A 4LBEC 1XOUA 1K3EA 5CB4A 3CRCA 3E8BA 3D3QA 4R8CA 2QGNA 1VQOV 1IXMA 2FYUH 2DMXA 4TV9B 1BHBA 5EZYA 1VF7A 2F93B 2E76B 1K73W 5JQGA 1OV9A 2Q69A 2P67A 5LMNB 3K5LA 4DV1O 1M56B 1DGSA 1R6NA 2LJ2A 4LFAB 2FMLA 3W7SA 3CB2A 3CYOA 3MDSA 1UFIA 2KSDA 2R9AA 2R9IA 1NJIW 4TV9A 2EIMC 1NR1A 1XHZA 4KP4A 5IYCO 2ZINA 4LF4O 4MVZA 1KUQA 1XDCA 1MZEA 4MSWC 4N23A 3SDLA 1B04A 4MVUA 1F23A
chains in the Genus database with same CATH topology
3GVMA 3HR0A 2KG7A 3O9OA 2KG7B 4ABMA 3Q4HA 3TXQA 3Q4HB 3OGIB 3GWKC 2AZ2A 3FAVA 3FAVB 3G80A 2DE0X 4GZRB 4I0XA 3TXSA 3ZBHA 4I0XB 2B9ZA 4LWSA 2AZ0A 4LWSB 3FD9A 1WA8A 2VRZA 2VS0A 1WA8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GVM A;  3HR0 A;  2KG7 A;  3O9O A;  2KG7 B;  4ABM A;  3Q4H A;  3TXQ A;  3Q4H B;  3OGI B;  3GWK C;  2AZ2 A;  3FAV A;  3FAV B;  3G80 A;  2DE0 X;  4GZR B;  4I0X A;  3TXS A;  3ZBH A;  4I0X B;  2B9Z A;  4LWS A;  2AZ0 A;  4LWS B;  3FD9 A;  1WA8 A;  2VRZ A;  2VS0 A;  1WA8 B; 
#chains in the Genus database with same CATH topology
 3ASO C;  3BPZ A;  4RAI A;  4LF7 B;  5KHH A;  4JI6 O;  2K9P A;  1SQB H;  3HKC B;  1S5J A;  4OPA A;  4QE7 A;  3P3N A;  5IE9 A;  1S77 D;  4GT1 A;  5EBL C;  4ASU G;  1EZV H;  2A3Q A;  4GUN A;  3BEH A;  3L74 H;  4X20 B;  5DN6 G;  4FLT A;  1OCR C;  1GO3 F;  5H6Q A;  1IXB A;  1SQF A;  4QGP A;  2GBO A;  3STZ C;  2BSK B;  3DC6 A;  3T1H O;  4X20 A;  4NKG B;  2IJH A;  1NTM H;  3LNN A;  1JOY A;  3JD4 A;  3SPG A;  4KFM A;  1EN5 A;  3BHP A;  2XHB A;  3SYQ A;  2BSK A;  4AHC A;  4LCU C;  3OGC C;  4LF4 B;  1NH2 B;  1Q5O A;  4CH3 A;  1FXK B;  2CK3 G;  1I7F A;  3UT5 B;  3ZMU A;  1GM7 A;  3CX5 F;  3K08 A;  4U3J B;  4O4J B;  1JA8 A;  5KMG B;  1F7Y A;  2WA4 A;  3IGA C;  3A0R A;  1HNW O;  4JI6 B;  1N33 O;  2WLK A;  4U7O A;  1H2G A;  1JX9 A;  3K5M A;  3RBZ A;  4X65 O;  4FLZ A;  4MVM A;  1FXK A;  5A9G A;  2LGQ A;  3UT5 A;  2UXN A;  1PNM A;  2DOS A;  2RDC A;  4U3J A;  4O4J A;  5KMG A;  1GMG A;  1GAX A;  2Q4P A;  1SQG A;  3FKS G;  1T5E A;  3EHB B;  1YIJ V;  2OCC B;  1SF9 A;  3RVY A;  1YF2 A;  2ZE8 A;  2HJD A;  4ZI7 B;  5IT9 N;  1ARO P;  3G4S V;  3T1H B;  4WF9 V;  3AK3 A;  2H8P C;  5CA3 A;  5C93 A;  3OFN G;  5IJ0 B;  4JI5 O;  4H37 A;  3OMA B;  3ABU A;  4PI2 A;  4GKJ O;  3CS5 A;  3LSQ A;  2Y69 B;  3M99 B;  3JD0 A;  1L0L H;  2F43 G;  4WFB V;  2X6A A;  3QTC A;  4DUZ O;  2FTK A;  1M57 B;  4QPK A;  4ZI7 A;  3DXR B;  3H1L H;  2QSA A;  3ABL C;  4FVM A;  3GB7 C;  4X1K A;  1K4C C;  3ZN1 A;  3CRM A;  5IJ0 A;  1L1F A;  4LFB O;  5LL6 Y;  2ZT9 B;  3K5O A;  3CME V;  1MSW D;  1S5L Z;  4MW3 A;  4LF5 B;  2DWE C;  1JQ0 A;  2QKS A;  3BY6 A;  1SA0 B;  1HNW B;  3LSU A;  1N33 B;  2XAS A;  2QKA A;  3DXR A;  3F7V C;  2JRI A;  3TXS A;  3CCJ V;  4J9Z B;  4CZZ A;  2EIJ B;  3MD0 A;  1P7G A;  2XUM A;  1LNQ A;  4YIO A;  3EXA A;  4JI7 O;  3TJT A;  2Z0A A;  1N8R W;  1W0J G;  3PJS K;  3W7X A;  2M6Y A;  3FB5 C;  3K59 A;  4K8X A;  3ZX6 A;  3KZI Z;  1YHQ V;  1KBH A;  4QNH B;  1YIT V;  1J5E O;  2YXH A;  2AHZ A;  4JAS A;  5JVD B;  1YJN V;  3RYC B;  5LGN A;  3FYI B;  2B1G A;  3S3W A;  1N4C A;  4DV2 O;  4HZ3 A;  2WLN A;  3NR7 A;  4GKJ B;  3OE7 G;  4YJ2 B;  3ZHU A;  4OXS A;  2UUB O;  2F1M A;  2K1E A;  3OD4 A;  1ZLZ A;  3SYO A;  2Q7E A;  2AW9 A;  1Q6U A;  3TCU A;  2HFE C;  4WFE A;  3OM3 B;  5JVD A;  4PA3 A;  3RYC A;  4RUE A;  4K8Z A;  1SKV A;  1AB3 A;  1NI8 A;  4DR2 O;  4JTD B;  3SJQ C;  3SJA C;  1IBM O;  4YJ2 A;  2UXC O;  1H2S B;  2R9R B;  4J9Y B;  5IJ9 A;  1B06 A;  4DR1 B;  3UCS C;  1ZTE A;  5DM6 V;  4FLY A;  2DYR B;  3JAK B;  1ZWI C;  3CXH F;  1NT2 B;  3TET A;  4Z1V A;  1N34 O;  3QNE A;  2EZP A;  3AG3 C;  4UV8 A;  4PEL A;  3P3P A;  4IYI A;  2JS5 A;  5KHJ A;  1VQL V;  5LHG A;  4X64 O;  2YXL A;  1EN6 A;  3H1K H;  1BS3 A;  3CC7 V;  1O9G A;  4ZBM A;  5H6R A;  3OEE G;  1D5N A;  2F66 C;  2CUG A;  3KCY A;  3JAK A;  5IYZ B;  2EIM B;  2Y0P A;  4MS2 A;  4LF6 O;  1IBL O;  4UB6 Z;  1RSO B;  4MTO A;  4CS4 A;  3G67 A;  4KXR A;  5H2F Z;  3T4D A;  4DV2 B;  3ASO B;  4ICG A;  2HJF C;  3I55 V;  3CCL V;  2QWQ B;  5IYZ A;  1R3I C;  4LF8 O;  4X89 A;  1QR8 A;  1GKF A;  2DE0 X;  3T1Y O;  2Z5U A;  1P4R A;  4PDV A;  4OGQ B;  2PUS A;  1GTO A;  1RSO A;  3FD9 A;  1COW G;  2YIB D;  4D7S A;  1OCR B;  4R6Z A;  1U97 A;  1FXV A;  1ZUQ A;  1IBM B;  4IGG A;  2UXC B;  4WFA V;  1VP7 A;  3BA9 A;  3FYE B;  1E79 G;  4JI8 O;  3UQ8 A;  3HKE B;  3SJB C;  3SPI A;  3JAS B;  1WP8 A;  1EZJ A;  2YSU B;  1E1Q G;  2Q0O C;  1AIL A;  2LFR A;  3OAA G;  4JYY A;  4TV8 B;  4FLW A;  3UKM A;  3ML0 A;  4YJ3 B;  5EC1 C;  4I5S A;  4GYC B;  2RJZ A;  4BIZ A;  2VQF O;  4LF9 O;  2ATK C;  4JI2 O;  3K58 A;  3HKE A;  4MT8 A;  1VQ5 V;  4DV0 O;  1SRY A;  4DR5 O;  1MAB G;  4J7K A;  2GV9 A;  2Y0I A;  4NXN O;  4TV8 A;  5CMU A;  5JH7 A;  1GN6 A;  1BMF G;  3I5D A;  1WLE A;  3FB7 C;  4X62 B;  3RWR D;  4YJ3 A;  3DC5 A;  1IBL B;  2BCC H;  3ZMT A;  1KMI Z;  5HFL A;  2JEU A;  4NTY A;  4X66 O;  1QLN A;  1G4Y B;  3CRA A;  1X59 A;  2QWO B;  4CH6 A;  3T1Y B;  4JI3 B;  1TGO A;  2GUZ B;  1UPG A;  1YXB A;  4KHP O;  2KG7 B;  2WAM A;  1MZF A;  3CHX A;  4B3S O;  3FB8 C;  1KB9 F;  3JAT B;  3K9S A;  1H38 A;  1G1X B;  4B3R O;  3VQX A;  2GUZ A;  3AEI A;  3WU2 Z;  2WLJ A;  1R1B A;  2NLJ C;  2G38 A;  3IFX A;  2KG7 A;  4TUY B;  4MTG A;  1Y67 A;  1VQ4 V;  1FXH A;  4G27 B;  2VQF B;  1SZT A;  3VQW A;  3CWB H;  4F6R B;  1SQX H;  3G71 V;  3JAT A;  1GM8 A;  3R66 A;  2EIK C;  4DV0 B;  4O4I B;  5J2U B;  4UB8 Z;  2EIJ C;  2Q7H A;  3ABL B;  2ZE7 A;  1YSC A;  3E89 A;  2ILM A;  5CA0 B;  2UUC B;  1PKX A;  4LFA O;  4TUY A;  1AJQ A;  1BCC H;  5IWA B;  2BOB C;  3ETG A;  4L87 A;  1OZ0 A;  4F6R A;  3CE2 A;  4IHJ B;  2JJ2 G;  5GTH Z;  2FKX A;  3CPW U;  4O4I A;  1MG1 A;  2LGW A;  3AG4 C;  1QVF U;  2IU0 A;  5J2U A;  1FFX B;  2EJ7 A;  2V7Q G;  4O2A B;  1AP5 A;  2QDO A;  3HKB B;  3FX7 A;  2ZIO A;  4LF7 O;  4FIP C;  1QBZ A;  1JR9 A;  1YDX A;  2CDY A;  2QM7 A;  2YID A;  4IHJ A;  1M1K W;  1XNR B;  4G28 B;  2GSM B;  4P9O A;  3WG7 C;  5D5Q A;  4NB5 A;  5KA6 A;  1G8M A;  1FFX A;  2YDE A;  4LNU B;  1KP3 A;  3J81 N;  3H9V A;  4B3R B;  3ZRW B;  1Y4M A;  4O2A A;  2CTW A;  3X2Q C;  2E75 B;  1M90 W;  2E5L B;  3HKB A;  4FM2 A;  1JJO A;  5JJE B;  1I08 A;  3O9O A;  5LXT B;  5F2V O;  3IC7 A;  4PA4 A;  2QWR B;  4DW0 A;  2DYR C;  2OIE A;  4LNU A;  3VOU A;  3LNM B;  3ZRW A;  5KHK A;  3A0B Z;  1MMM A;  5JCO C;  3BRC A;  5LXT A;  4TQD A;  4JZG A;  1VQ9 V;  3E2E A;  1DF4 A;  1JJ2 U;  2CTP A;  2QA4 V;  5KAF Z;  4D7T A;  5GW7 A;  1K4D C;  2X7R B;  1N36 O;  5H9C A;  2GTA A;  4OX9 B;  3AG3 B;  4FK5 C;  5DEC A;  3OTF A;  1YTF D;  1OCO C;  1O9H A;  1RPR A;  3VQY A;  3UM7 A;  3VBB A;  1PL4 A;  5HFM A;  2ZR2 A;  1IUR A;  4FFK A;  4MVQ A;  4I0X B;  3J7A U;  5EYP B;  4K35 A;  2OWO A;  1FAF A;  1QVG U;  5L3D A;  3ABM C;  1L0N H;  3K57 A;  2BTQ B;  2FL4 A;  1K8A W;  4DRX B;  1MOF A;  3N27 A;  4QE9 A;  4NTX A;  1KU9 A;  3OMN B;  3D3I A;  1I94 B;  4UCU A;  3E8H A;  4I0X A;  4CC5 A;  5EYP A;  2YEV B;  3E35 A;  2L35 A;  2E3C A;  2ARH A;  1SQQ H;  5DED A;  3T1C A;  1KD1 W;  3H1H H;  2BTQ A;  1NS1 A;  4DRX A;  2Q0A A;  2HP8 A;  3QO7 A;  1M4U A;  3APQ A;  1K5Q A;  1YEW A;  2F95 B;  3OUS A;  2YEV A;  2WWW A;  2RCV A;  4P9P A;  2BTO A;  1WPX A;  1Q43 A;  5JJJ B;  4X1I B;  1W2B U;  3HB3 B;  1CEZ A;  1YCI A;  1N36 B;  3U11 A;  1S0V A;  1N32 O;  3A2F A;  1DTO A;  5B1B C;  4LF5 O;  1L8D A;  1PNL A;  1R6K A;  4J10 A;  1HWY A;  3M7M X;  2DYS C;  5KUK A;  2YIC A;  2P06 A;  3ASN B;  3OMI B;  3L75 H;  1NZ6 A;  4X1I A;  4DW1 A;  1Q6I A;  1YVW A;  1ZX3 A;  1VQK V;  4UVC A;  1DK1 A;  1XUQ A;  1V55 C;  2ODM A;  1SER A;  4YIP A;  1M5I A;  5E79 Z;  3OR6 C;  3QO5 A;  4JI0 O;  1VEW A;  2QTO A;  4MTX A;  3ZHT A;  3H01 A;  2PYL A;  2H3O A;  3ZHR A;  1K7D A;  1SES A;  1TVK B;  2RN9 A;  5IDJ A;  3ZHS A;  5J2T B;  4ZKI A;  3K03 A;  1LUV A;  4X1K B;  3SGI A;  2P90 A;  3ZMZ A;  2JIZ G;  1QR9 A;  4X8A A;  2HEP A;  5L3B A;  1PD3 A;  1XMO O;  3JSL A;  2IW5 A;  2QE7 G;  3K0G A;  5J9P C;  4WFG A;  1TVK A;  1PP9 H;  4AQY O;  5TIS Z;  4QPJ A;  4J42 A;  5J2T A;  4JYB A;  3APO A;  3CCQ V;  4U3F H;  2OIG A;  2GDS A;  3AK2 A;  4LP8 A;  2Q67 A;  1N32 B;  3C3S A;  3BA8 A;  3B77 A;  1H8E G;  4DR1 O;  2E74 B;  1Q6H A;  2O57 A;  4JAV A;  1XL4 A;  3LDC A;  2EIK B;  2EIN C;  1RP3 B;  1CXZ B;  1OCZ C;  1VMG A;  4O4H B;  3W7W A;  2PZS A;  1TUB B;  2KB1 A;  3ABK C;  2DQ3 A;  4XDK A;  5B1N A;  3OGI B;  4JI0 B;  3GWK C;  2HVK C;  2R70 A;  2IH1 C;  3K9A A;  3A0H Z;  1S76 D;  2XAJ A;  2OCH A;  1BE3 H;  4CH5 A;  3AG4 B;  3K79 A;  2CGO A;  3CRR A;  3CMA V;  1JPX A;  4QIW F;  2UU9 B;  1Q86 W;  3K04 A;  4O4H A;  3BAB A;  3THO A;  1TUB A;  1KQS U;  4DK0 A;  2OT5 A;  4JYA B;  3QG5 A;  1XMO B;  1EFR G;  1Z5W A;  2Q5Z A;  1H2N A;  5IJ9 B;  2Q6A A;  2JGD B;  4N21 A;  1HDJ A;  4AQY B;  3WG7 B;  4UCR A;  2LP7 A;  3CC2 V;  3OT7 A;  1UJW B;  4R50 A;  3CCV V;  1HNX O;  4LFC B;  3X2Q B;  2D3O W;  5L3F A;  1GN2 A;  1VF6 C;  2JGD A;  1US6 A;  4DR3 O;  4FPP A;  4PDR A;  1Z2G A;  5BMV A;  2B9Z A;  2HVJ C;  4UV9 A;  1VAR A;  2XOK G;  2ZM6 B;  1R3L C;  1OCC C;  1WNS A;  3ETD A;  3KKY A;  3UO2 A;  4PA6 A;  4PHZ A;  4BAY A;  1H2L A;  4J41 A;  4LH7 A;  1YI2 V;  1GH6 A;  1Q8I A;  3LDD A;  4FLV A;  4X62 O;  1YJW V;  2DN9 A;  4C7U A;  4NXM O;  3CCU V;  1Y66 A;  2IBZ H;  2VRZ A;  3RN4 A;  5E1A C;  2X6B A;  4G2K A;  1Q90 D;  5JCO A;  5FPR A;  4TWK A;  4GX1 A;  2YIA A;  1FYJ A;  4BIU A;  3CJH B;  1OCO B;  4KUM A;  2AZ2 A;  3BCC H;  1K5S A;  4K0K O;  4PDM A;  1M9N A;  1S72 V;  4JI3 O;  5B1A C;  1VQ7 V;  1GRJ A;  4PA7 A;  4Q20 A;  3TK1 A;  1QQC A;  3ETE A;  4IYH A;  3ABM B;  1HNX B;  2Q8V A;  3KCX A;  3CJH A;  2ZKO A;  3WFV A;  2ZIM A;  4B7K A;  4DR7 O;  1N0J A;  1AR4 A;  2A79 B;  3IC9 A;  1JCH A;  4DR3 B;  2ITC C;  3DTU B;  2NR5 A;  5EK0 A;  4H44 B;  5JH7 B;  3O65 A;  2P4V A;  2X0L A;  4I7Z B;  5FNV B;  3ASN C;  2LQT A;  4ZHQ B;  2A0L A;  1NH2 D;  2B5U A;  4MVR A;  2R72 A;  5BR8 B;  2P22 C;  4FFB B;  4LH6 A;  2YUA A;  4NXM B;  2DW4 A;  2UUC O;  2KKW A;  3OEH G;  4UCT A;  1XHX A;  2GHY A;  2PF4 E;  5IWA O;  2P4K A;  3ZMS A;  5B1B B;  1XL6 A;  1RFY A;  5FNV A;  3ZMV A;  3CRQ A;  4I9Q A;  3JD1 A;  2HKO A;  4ZHQ A;  2DYS B;  5FL7 G;  4K0K B;  4GX2 A;  4J80 A;  2NN4 A;  4FFB A;  2OTJ V;  2YC0 A;  4JPR A;  2EIL C;  2Y4T A;  3CCR V;  4CS2 A;  4RO2 A;  4PV1 B;  4JAU A;  1YJ9 V;  1P84 F;  1V55 B;  5BXZ A;  2W0F C;  5AG2 A;  1PL0 A;  5LP6 C;  1JFF B;  3G6B A;  2JGU A;  2ZDI A;  4NR1 A;  3JD2 A;  3JD3 A;  1XNR O;  2DWD C;  4DR7 B;  2UXB B;  4FZ1 A;  5BY1 A;  2AXT Z;  1EM1 A;  4D6T H;  4HYO A;  4E4E A;  1HNZ B;  1CPY A;  4J7J A;  4PJ0 Z;  2VWK A;  2QJ1 A;  3N2G B;  1A32 A;  2EJR A;  2E5L O;  3HR0 A;  1AI7 A;  1JFF A;  5LA6 B;  1PM9 A;  2XAH A;  5L3G A;  4Z1M G;  4HNA B;  1SQV H;  1WAZ A;  1ORQ C;  1HR0 B;  2ZCE A;  2ADP A;  1K97 A;  2Q9L A;  1V9P A;  2W6I G;  3CC4 V;  5KA5 A;  2XAG A;  4X9Q A;  1QLE C;  5C8Y B;  4U7N A;  3N2G A;  3J80 N;  3F5T A;  2EX3 A;  5EIB D;  5LA6 A;  2ITD C;  1BQZ A;  3IAY A;  2PGG A;  4HNA A;  3W7T A;  3L9D A;  1GN4 A;  3ZCC A;  5D5P A;  2YI9 A;  3K0D A;  5B3S C;  3K06 A;  3L72 H;  1DLB A;  1WJZ A;  4BIO A;  5JJN B;  4YHH O;  4LWS A;  3QVN A;  5C8Y A;  1AR1 B;  4J11 A;  3BAA A;  5EC2 C;  1XMQ B;  4Q6G A;  3AG7 A;  3PN1 A;  2EIN B;  4OX9 O;  1KKC A;  3E22 B;  5LMU B;  2EZO A;  3T2M A;  4J7Z A;  2UXD B;  1OCZ B;  3RFR A;  2N04 A;  2EBO A;  1Y6X A;  3ABK B;  3JAL B;  2DJV A;  5L3C A;  4CC6 A;  3SYA A;  3ZN0 A;  1NR7 A;  5IYB O;  1FFT B;  4RUF A;  3MHH C;  4B7E A;  2XT9 A;  2Q68 A;  3E22 A;  2JEX A;  4I50 B;  4WBN B;  4UCO A;  4UUJ C;  1URF A;  3WB2 A;  4WCE V;  3JAL A;  3CCE V;  4JI4 O;  1I94 O;  1XBL A;  1KC8 W;  3U0Z A;  4XDJ A;  4I50 A;  4WBN A;  3AG1 C;  4B3M O;  4DR6 O;  3ZED A;  4DYL A;  3HPL C;  2JJ1 G;  1EBO A;  1F4N A;  1VQ8 V;  3OR7 C;  1FPO A;  2GTS A;  1Z5V A;  4I9W A;  2FB5 A;  2F4V O;  4XBF A;  4GZR B;  5LGU A;  3ZBH A;  1QU7 A;  3DGE A;  4YHH B;  3JCU Z;  4H13 B;  1WB7 A;  3K3W A;  4F4L A;  3OTO B;  2JVD A;  3JAR B;  1JVM A;  2V1D A;  5KUM A;  2ZD9 A;  1WN7 A;  1VQM V;  2YI8 A;  3F5W C;  1H8H G;  1OCC B;  2Q7G A;  3B09 A;  1E1R G;  4EB6 B;  4DV5 B;  5KX5 B;  1VF6 A;  4O2B B;  2WSS G;  4DR4 B;  4W4L A;  1TA8 A;  2PTM A;  4UFZ A;  3KG2 A;  2ADQ B;  4CBC A;  5KLV H;  5KAI Z;  3JAR A;  1OHH G;  5KHI A;  1LUW A;  2CTR A;  4EKW A;  1TUE B;  4JAA A;  1BGY H;  4EB6 A;  5LGT A;  5KX5 A;  1BZK A;  1XNQ O;  5IYD O;  4O2B A;  3I56 V;  2F23 A;  4JI4 B;  2N05 A;  4UCV A;  4DXW A;  4MTF A;  2H94 A;  4TT3 G;  3CCM V;  2AZ0 A;  1D2D A;  5ITZ B;  5B1A B;  5LHH A;  1XRE A;  1G6U A;  1SC5 B;  3JAW B;  4UVA A;  4EFB A;  1PPJ H;  1QCE A;  4B3M B;  1QNM A;  4DR6 B;  2DQ0 A;  3AK1 A;  3HKC A;  4YXW G;  2CAZ C;  2W6J G;  1VQP V;  5FLX N;  4F6E A;  5BZB A;  4DUY O;  1Q7Y W;  2Y48 A;  3WB1 A;  2F4V B;  5ITZ A;  2JS3 A;  3SJC C;  4PDL A;  4A5U B;  3JAW A;  4DV1 B;  2PYJ A;  2VS0 A;  2N74 A;  4PA9 A;  1MNG A;  2YIB A;  4GLX A;  2NNU A;  1SZX A;  1JMK C;  2IJK A;  2UXX A;  1NTZ H;  5IY5 C;  2ZDI C;  2EUL A;  1ZAU A;  2VQE O;  4H0L B;  3E8F A;  4EEQ A;  4QJF B;  1AI4 A;  4IL6 Z;  2KQX A;  2BOC C;  5LYJ B;  1K9M W;  1NKD A;  1BSM A;  5K1X A;  4UVB A;  2PY5 A;  1VQN V;  2UUA O;  1M93 A;  1K33 A;  1XNQ B;  3SPJ A;  3BVO A;  1GK9 A;  3E86 A;  5EBM C;  3TGU H;  1NVP B;  1NU1 H;  2JDI G;  4FZ0 A;  5L3E A;  4I55 B;  2UU9 O;  3EFF K;  5LYJ A;  1SQP H;  2EIL B;  1D5A A;  1ROP A;  2AGA A;  1RM1 B;  1V54 C;  4NTW A;  4ZOL B;  4JYA O;  5LP6 B;  1J95 A;  2WLI B;  3RYH B;  2B1I A;  4DUY B;  5CA1 B;  1W59 A;  4RQE A;  2HLD G;  3RGB A;  4I55 A;  3QF7 A;  4B3T O;  1Y74 B;  3EVK A;  3ZRV A;  4LFC O;  3ZRX A;  2AHY A;  3OUF A;  2WA3 A;  2ZXW C;  2Q73 A;  4ZOL A;  2PI5 A;  5LP6 A;  1XEQ A;  2WLI A;  1I5Y A;  3SR2 C;  3RYH A;  3LSS A;  5CA1 A;  2VQE B;  5LOV B;  4JTA B;  3FFQ A;  4MVO A;  3B8N A;  2QKC A;  1QLE B;  1Y74 A;  4FM1 A;  2ZM6 O;  5B1O A;  4K3A A;  1CP9 A;  1PV0 A;  1XQ8 A;  1R3J C;  1B6Q A;  1X4T A;  2WLM A;  2UUA B;  1R3K C;  5LOV A;  5B3S B;  2A7W A;  3D36 C;  4BW5 A;  4O4L B;  3GWO A;  4LC1 A;  1XIL A;  2XTA A;  4HAM A;  5EBW C;  1IVS A;  4OPH A;  5FPO A;  4X65 B;  4MVS A;  1S3J A;  3L71 H;  2QM8 A;  2QWN B;  1GN3 A;  3B40 A;  4LR3 A;  3RYF B;  3AG2 C;  3FB6 C;  1SA0 A;  3Q4H B;  3SPH A;  4RQF A;  4DV4 O;  4XDL A;  3HKD B;  4O4L A;  3T4Z A;  3B2E E;  4TQF A;  1KEC A;  3C3T A;  1NQT A;  1FJG O;  3H1I H;  5BMV B;  4MW8 A;  5LBQ A;  4JV5 O;  4YY3 O;  5GTI Z;  4B3T B;  3A8T A;  4JI5 B;  2IJI A;  2D2C B;  4HBN A;  3K5N A;  3RYF A;  1THZ A;  3Q4H A;  3G6E V;  2QR4 A;  2WLL B;  3HKD A;  1S5H C;  4WFH A;  1EN4 A;  3JYC A;  3ZIA G;  3FAV B;  4DUZ B;  3JCZ A;  4L8J A;  3ZJZ A;  2XAQ A;  1DF5 A;  1M56 C;  3BFR A;  4JGS A;  3LDE A;  4KL1 A;  3P30 A;  1ENV A;  2MK3 A;  4LFB B;  1HP8 A;  2CTQ A;  3S3X A;  3M8A A;  3AG1 B;  3CD6 V;  2ZNI A;  2WLL A;  3STL C;  3MAQ A;  2LW1 A;  3E83 A;  3FAV A;  4P30 A;  3UO3 A;  3G80 A;  3D8C A;  3OW2 U;  2Z3Y A;  4IIJ B;  1P7B A;  5KHG A;  5BR8 O;  3WB0 A;  1MA1 A;  4DV7 O;  4ZIB A;  2MW2 B;  2WLH A;  3E8G A;  3ABT A;  4Z2W A;  1FKA O;  3C90 A;  3CSX A;  2C2A A;  1H2K A;  4JI7 B;  4NYK A;  2IH3 C;  1AI6 A;  1YTF B;  1AJP A;  4DV4 B;  5CBG A;  4IIJ A;  1BT8 A;  1IDS A;  4DV6 O;  1J5E B;  3QO8 A;  1ZSP A;  1FJG B;  3RW0 A;  2CH7 B;  1F4M A;  1Q3E A;  1W0K G;  4JV5 B;  3CCS V;  4YY3 B;  2LFS A;  4JZ2 A;  1N0N A;  1TAE A;  3TXQ A;  1NTK H;  2UUB B;  2UXB O;  1I5X A;  3F7Y C;  1NBM G;  4FMT A;  1HNZ O;  4PD4 F;  1KYO F;  2CH7 A;  4H33 A;  4IT5 A;  1AJN A;  1RPO A;  2L6L A;  4JI1 O;  3R65 A;  1AR5 A;  4DR2 B;  1BQ0 A;  4DO2 A;  1WPB A;  2IJJ A;  2QM4 A;  3ZHQ A;  3W7U A;  1HR0 O;  1SS3 A;  4E2L A;  1PNK A;  4FM0 A;  1F51 A;  4WFF A;  4FJC C;  1N34 B;  1FXK C;  4DV7 B;  5H5N A;  2QEX V;  3RVZ A;  1LR1 A;  4DV3 O;  4X64 B;  2ETN A;  2A9H A;  2ZE6 A;  2A06 H;  3ICX A;  4TOI A;  1IBK O;  2BE3 A;  2P7T C;  5IY5 B;  1WB8 A;  4CH4 A;  2WPD G;  2ZQM A;  5CBF A;  4BR6 A;  3JAS A;  4DV6 B;  4LF6 B;  1H2M A;  1XMQ O;  3CP1 A;  3VQV A;  2VWJ A;  1K92 A;  3U10 A;  5LMU O;  1RM1 C;  3RYI B;  2UXD O;  1VF5 B;  2QWP B;  1MSD A;  2OCC C;  1Y76 B;  2CGN A;  1IZ3 A;  1NVP D;  1WP7 A;  3B4S A;  4LF8 B;  1VIB A;  4GKK O;  2XAF A;  2RMK B;  2HR3 A;  3L73 H;  2JK5 C;  4X1Y B;  2YXY A;  4GX5 A;  1SET A;  4JI1 B;  3LUT B;  3RYI A;  1R6T A;  2HHH O;  2Y69 C;  4EFE A;  2LW7 A;  1V54 B;  1Y76 A;  3ZRS A;  3L70 H;  1KP2 A;  4W4K A;  1KKD A;  1M57 C;  4JI8 B;  2OTL V;  4RWU A;  1QHT A;  4P2Z A;  4UXN A;  1VQ6 V;  5GON B;  2X6C A;  4AI8 A;  5CBH A;  2QTS A;  3NXS A;  3ZHV A;  4LWS B;  4AIL C;  3JSN A;  3IJ4 A;  4X1Y A;  4JYC A;  4NVP A;  1ZL8 B;  3N2K B;  1HW7 A;  2HG5 C;  4DK1 A;  5LHI A;  2RQ6 A;  5EIB C;  2ZNJ A;  4R7C A;  4B08 A;  1Q82 W;  3DSQ A;  4GCZ A;  4DV3 B;  4CS3 A;  4LF9 B;  1U96 A;  2ZXW B;  2ZR3 A;  4JI2 B;  2Y4U A;  5A2Q N;  1IBK B;  2OYQ A;  1AVM A;  2PI4 A;  1Q81 W;  2CE4 A;  4X88 A;  1GM9 A;  4DR5 B;  5B5E Z;  5CN0 A;  3CXC U;  5GON A;  4BWA A;  1K34 A;  2V4D A;  4NXN B;  5LMN O;  1AP6 A;  3RT3 C;  1IX9 A;  3OTO O;  2P5O A;  1ZL8 A;  2LO1 A;  3N2K A;  4GX0 A;  3ZS8 C;  3JAM N;  3CEI A;  2IM9 A;  2M7W A;  2IU3 A;  4FLU A;  2W0X A;  2P6J A;  4ABM A;  5K1P A;  1BL8 A;  4DV5 O;  3P32 A;  4X66 B;  4I4T B;  4JF3 A;  2YS8 A;  4PI0 A;  4DR4 O;  4JTC B;  4FLX A;  1YZB A;  4UCS A;  4GKK B;  1FD9 A;  2ZE5 A;  3H1J H;  2RNB A;  3MHS C;  5CA0 A;  4BW9 A;  1BHA A;  1B3Q A;  1AI5 A;  1WA8 B;  3GVM A;  3SYC A;  5CB4 B;  4KHP B;  2HHH B;  3B8M A;  4I4T A;  4TSF G;  3AG2 B;  1I0H A;  1P49 A;  3SPC A;  2XND G;  4B3S B;  5JWP A;  3ETQ A;  1FS0 G;  1OJH A;  3D36 A;  3SYP A;  1R73 A;  5EZY B;  5JQG B;  1XI1 A;  5B66 Z;  1WA8 A;  4LBE C;  1XOU A;  1K3E A;  5CB4 A;  3CRC A;  3E8B A;  3D3Q A;  4R8C A;  2QGN A;  1VQO V;  1IXM A;  2FYU H;  2DMX A;  4TV9 B;  1BHB A;  5EZY A;  1VF7 A;  2F93 B;  2E76 B;  1K73 W;  5JQG A;  1OV9 A;  2Q69 A;  2P67 A;  5LMN B;  3K5L A;  4DV1 O;  1M56 B;  1DGS A;  1R6N A;  2LJ2 A;  4LFA B;  2FML A;  3W7S A;  3CB2 A;  3CYO A;  3MDS A;  1UFI A;  2KSD A;  2R9A A;  2R9I A;  1NJI W;  4TV9 A;  2EIM C;  1NR1 A;  1XHZ A;  4KP4 A;  5IYC O;  2ZIN A;  4LF4 O;  4MVZ A;  1KUQ A;  1XDC A;  1MZE A;  4MSW C;  4N23 A;  3SDL A;  1B04 A;  4MVU A;  1F23 A; 
#chains in the Genus database with same CATH homology
 3GVM A;  3HR0 A;  2KG7 A;  3O9O A;  2KG7 B;  4ABM A;  3Q4H A;  3TXQ A;  3Q4H B;  3OGI B;  3GWK C;  2AZ2 A;  3FAV A;  3FAV B;  3G80 A;  2DE0 X;  4GZR B;  4I0X A;  3TXS A;  3ZBH A;  4I0X B;  2B9Z A;  4LWS A;  2AZ0 A;  4LWS B;  3FD9 A;  1WA8 A;  2VRZ A;  2VS0 A;  1WA8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...