3ZBHA

Geobacillus thermodenitrificans esxa crystal form i
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
90
structure length
90
Chain Sequence
LTPEELRGVARQYNVESSNVTELIARLDQMSHTLQGIWEGASSEAFIQQYQELRPSFEKMAVLLNEVGQQLHNSATILEDTDQQIASQIR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Homodimeric Esat-6-Family Proteins Esxa and Esxb from Geobacillus Thermodenitrificans
rcsb
molecule tags Unknown function
molecule keywords ESXA
total genus 41
structure length 90
sequence length 90
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2012-11-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 3zbhA00
1WA8B 3GWKC 2VRZA 2AZ0A 2AZ2A 4LWSA 3TXSA 3FD9A 4I0XA 3OGIB 3G80A 2VS0A 2KG7B 2B9ZA 3FAVA 4GZRB 3HR0A 3TXQA 3GVMA 4ABMA 2KG7A 3FAVB 1WA8A 3O9OA 4I0XB 3Q4HA 3Q4HB 3ZBHA 4LWSB 2DE0X
chains in the Genus database with same CATH superfamily
1WA8B 4AQYO 5GW7A 5JH7A 3ABLB 2N74A 3ABUA 3ZHSA 1R6TA 2CUGA 2HKOA 1MOFA 1X4TA 5JCOA 3C3TA 5BMVA 2RQ6A 4LBEC 1XEQA 3F7VC 4KHPO 3B8NA 4GZRB 4EKWA 2B5UA 3E22B 5LXTA 4LF9O 3L72H 1JOYA 3A0RA 1K33A 1SZTA 4JI6B 3ML0A 5EZYB 2B1IA 2Q7GA 4O4JB 3OEEG 4EFEA 4HZ3A 4UVAA 1US6A 4UVCA 4HNAA 1IBKB 4PD4F 2KG7A 3AG7A 1BMFG 5EBWC 1V54B 4O4JA 1S5JA 2CGNA 1MZEA 3LDDA 3OMNB 4MTOA 2CAZC 3S3WA 2Q0OC 2JS5A 3ZMUA 2W6IG 2ITDC 3CRCA 4J41A 1HNWB 2ZE5A 4Q20A 2NN4A 1HDJA 3O9OA 4KUMA 2YS8A 1AROP 2FTKA 2QM7A 1MABG 3CXHF 2LW1A 1AJNA 3OTOO 2X0LA 3IJ4A 1YEWA 1QLEB 4GX2A 1P49A 2HEPA 1YJNV 3CHXA 1JCHA 5B1OA 2GV9A 4DV0O 3AG2C 3QO7A 3GB7C 1Z2GA 2Q4PA 2DE0X 4TV8A 3E86A 1HNXB 4NXNB 2ATKC 1S5LZ 4J7JA 3H01A 3L74H 3N2KA 2ZIOA 4JPRA 4DW1A 3HKDB 4LF8O 4G2KA 4X8AA 2DWEC 3GWOA 1JR9A 3I5DA 2AXTZ 4I5SA 4B3SB 2VQEB 3ZHVA 4JI1B 3BY6A 1XNRB 4QGPA 3A0BZ 2WLLB 1TGOA 5ITZA 3CCRV 2E5LB 3CC7V 1DGSA 1AR5A 2OWOA 2LO1A 2ZE6A 3N2GA 2PY5A 4NXMO 5IJ0A 1AR4A 4MW3A 1SERA 2NNUA 3K04A 3BCCH 2Q5ZA 4TUYB 2XT9A 2XTAA 1B06A 5IJ9A 3P3PA 1ZX3A 4B7KA 3U0ZA 3D8CA 2IJIA 3EXAA 2WLIA 1THZA 2Q0AA 1VARA 4I9QA 1Q6IA 1PNKA 2KB1A 2LP7A 1Q90D 3M99B 3F5WC 4LF6B 1OCRB 3P3NA 1RFYA 3JALA 4JI3B 4LWSA 3OEHG 3CMAV 2X7RB 4DR4O 4GX0A 3CCEV 1Q6HA 1GTOA 4XDLA 1IVSA 5CA3A 3SYCA 1GRJA 5F2VO 5LL6Y 2XAQA 4ZI7B 3OAAG 4H37A 4Z1MG 3T1YB 3E8BA 5H6RA 3R65A 2HG5C 4LF9B 3ABMB 4GKKB 1VF7A 4FM1A 3EVKA 5C8YA 4IHJB 5KHJA 1EN5A 4AI8A 3UO2A 2LJ2A 2QKSA 1VQ4V 5J2UA 4PDLA 3SPHA 1F4MA 4R6ZA 2Q9LA 4KP4A 1HR0B 3ZN0A 1QLNA 5GTIZ 2EZOA 3OTFA 4DV1O 1SQFA 1YIJV 4ICGA 2Q68A 3LNMB 1QHTA 1VQ7V 4UVBA 3G6BA 5GONB 1BGYH 3R66A 4H33A 4TQFA 3CE2A 1FD9A 5KLVH 2P22C 5IYZA 3TETA 1LNQA 5IE9A 4I7ZB 5EC1C 2WLKA 3ABTA 4JI0O 4O2BB 1VQ8V 3FAVB 4DYLA 4UXNA 1V9PA 4B3TO 1H38A 3RVZA 2IW5A 1BHAA 4IYIA 2A06H 2ZXWB 3VBBA 3DTUB 1Q86W 2OYQA 2VQFB 1XNQB 2Q6AA 4YIPA 1BT8A 5LBQA 1K3EA 2QWOB 2XAJA 1M57B 4UB8Z 3ETDA 1HR0O 1XL6A 4TUYA 4PELA 4B08A 1XHZA 5FL7G 4PA3A 1W59A 3OGIB 3UQ8A 1Q7YW 1IBLB 2Q7HA 1E1RG 5BY1A 1SQPH 2EIJB 1QR9A 4GX1A 2ZINA 1QLEC 3TXQA 4FFBA 4E4EA 5JWPA 1Q81W 3ZCCA 2NLJC 1OJHA 2BE3A 4DRXA 4OGQB 3P30A 3MAQA 3M8AA 3W7WA 2OIGA 3CX5F 2DYSB 2Y0IA 4CZZA 1AJQA 2X6BA 2M6YA 1D5AA 1DF4A 1YF2A 5KUMA 5CN0A 4JI0B 3CRAA 4CH3A 4B3TB 4ZKIA 5KMGB 1N36O 3JASB 4X1IB 5CBGA 4CH5A 1IBMO 2QR4A 4ZOLA 2DMXA 3E8HA 2F43G 4UCVA 4PA9A 2F1MA 2YI8A 3DXRA 1NJIW 4PJ0Z 4I55A 4Z2WA 5L3BA 2YIAA 4UUJC 4UFZA 2XAGA 3QF7A 2X6CA 4DV3O 1JVMA 3HR0A 4MT8A 5LYJB 3CXCU 1IZ3A 5FNVA 1L0LH 1AB3A 1BSMA 1NZ6A 4QE9A 3ZX6A 3CD6V 5FLXN 4W4KA 2UXDB 1PNMA 5IYDO 4ZIBA 5FPOA 5LA6A 4RAIA 1QNMA 2DYRB 4E2LA 1N34O 3CYOA 3L73H 5KX5B 4MVRA 1WA8A 5IT9N 2EJRA 1LR1A 3N2GB 5EZYA 4J7ZA 1NS1A 4QNHB 3J81N 1RSOB 3ZIAG 3OMAB 5TISZ 1DLBA 3VQVA 1K5QA 5BXZA 4ZHQB 2RJZA 4C7UA 4JYCA 2QKAA 4YJ3B 3EHBB 1BE3H 1MMMA 5L3GA 5ITZB 2IJKA 2VWKA 3TJTA 1UFIA 4YJ2B 5E1AC 3ABMC 3CRRA 2YIBD 1I7FA 2AHZA 1Y6XA 4TV9A 1TAEA 1Q8IA 5B3SC 1L1FA 4R8CA 3K57A 1IBMB 2GHYA 1K97A 4I4TB 2LGQA 3L70H 4DUYB 1XMOB 4U7OA 4F6RB 1YI2V 4K0KO 2RNBA 1FAFA 1FXHA 1Y67A 4UCRA 2QWQB 1NKDA 2IU3A 3JATB 2E75B 3MHHC 2PGGA 4LR3A 3FFQA 2ODMA 4IIJB 5LHHA 5LP6A 5H5NA 1EZVH 4X62B 2E3CA 1V54C 4UCTA 2HVKC 4DK1A 4X65O 4PA4A 3JAKA 3KKYA 1KYOF 4JF3A 1U97A 1OCOB 2ZE7A 4FJCC 2Z0AA 3JCUZ 2EIMC 1FXKC 4RO2A 3JAKB 4NXMB 5EYPB 1EBOA 2ADPA 2DOSA 4YY3B 1YCIA 4EEQA 1R3IC 3RYIA 4RUEA 3HKBB 4FLVA 2HJDA 3VOUA 5EC2C 4I55B 3GVMA 2N04A 3APQA 3CCJV 1FJGO 2JK5C 4IHJA 4HBNA 3CSXA 3QVNA 4D6TH 1Q43A 5KA6A 1G1XB 3JD0A 1WAZA 4L87A 4PA6A 5IWAO 3JAMN 4DR2B 2QWPB 2PYJA 4ZI7A 1Y66A 1YHQV 2WLJA 5B1BB 1K92A 4CH4A 1KKDA 3BA9A 4P9OA 4GKJO 5KX5A 1K34A 2Q7EA 3MHSC 2P06A 3B8MA 4G27B 3PN1A 1UJWB 2E5LO 5CA1A 3OFNG 5B5EZ 5KUKA 3ASOB 4JZ2A 1N36B 2JJ1G 1B04A 4GCZA 1SESA 3ZJZA 4CS4A 4NB5A 3HKCB 1PNLA 1SC5B 4TT3G 2XAHA 3ABKC 4BR6A 1NBMG 1WB8A 2QTOA 4OXSA 1IXMA 2JEUA 1DTOA 4XDJA 4LFCO 2DJVA 4IL6Z 1R3KC 2XHBA 1GO3F 4YIOA 3ASNC 1HNWO 2D2CB 4BAYA 4LP8A 4FIPC 4U7NA 3FYEB 4O2AB 1N32O 4JI5B 1H8EG 1PPJH 1B6QA 2LFSA 2FMLA 2ITCC 4O4HB 3AG3B 2ZCEA 2YIDA 4IIJA 3RGBA 1QVGU 3HB3B 2OCHA 2PF4E 3K9SA 3SPGA 3THOA 3K79A 3W7XA 3ZHTA 4B3RO 3ZRXA 1OCRC 1H2NA 1KP2A 1MNGA 3STLC 3G4SV 2CK3G 4F4LA 1M93A 1F7YA 5BR8B 1N32B 1FFXB 2KSDA 2QDOA 3TCUA 1Y76A 4RWUA 4TV8B 4P2ZA 2LW7A 1VF6A 3RYFA 1RM1C 3DC5A 5LMUO 4D7TA 4GUNA 1GM8A 2YC0A 2W0FC 4J42A 4R7CA 2Y69C 4DRXB 2IBZH 4AHCA 4CH6A 3LSUA 2Y4TA 2OT5A 3K59A 2H94A 2DYRC 5CBFA 4IGGA 4LFCB 5BR8O 2CH7B 1CPYA 5EYPA 2QM8A 3ETQA 5JVDB 3B77A 1IBKO 2PZSA 1PL0A 2Y0PA 3IGAC 1AP6A 2RDCA 1IDSA 1LUVA 2Z5UA 2Q8VA 3FAVA 2EIKB 2JVDA 2HHHB 2EBOA 3D36A 1AI6A 2DQ3A 2JGDB 2L35A 3VQWA 2IM9A 2YDEA 2ZT9B 4XBFA 4UV8A 3E89A 2JRIA 2XAFA 4CBCA 4LF8B 2ZDIC 5CA0A 2K1EA 1QR8A 5GONA 1KBHA 1ZUQA 5A9GA 4X66B 5J2TA 1TUBB 4DV2O 5J2UB 3E8FA 3E35A 2UXNA 2UUCO 3IAYA 3AG3C 3K03A 4I0XB 5D5PA 3AG2B 1W0KG 2QWNB 1FJGB 4L8JA 5IY5C 4JI3O 2QJ1A 4I50B 2BTQA 2VQFO 1XNQO 3TXSA 5KMGA 1NTZH 2Q67A 1AILA 1KU9A 4A5UB 2CTQA 1AVMA 2JGUA 1URFA 4MSWC 1NT2B 5DM6V 4QPKA 2UUCB 4UV9A 3Q4HA 3QG5A 4MTFA 4JYYA 3CS5A 2E76B 1I94O 1YTFB 2EZPA 3JARA 4JYBA 1KD1W 4KHPB 5C8YB 5LHGA 4B3MO 2KG7B 3UO3A 4H13B 1Y76B 5LOVB 1JMKC 1XHXA 2JDIG 2HHHO 1BHBA 3ZHQA 3X2QC 1G4YB 2FL4A 1FKAO 1M1KW 3D36C 2ZNIA 3FKSG 2V4DA 3SYPA 1N8RW 1GMGA 3E22A 2ZIMA 4WF9V 2W0XA 3I56V 2WLHA 2QWRB 2GUZB 5L3CA 2YXHA 2QM4A 2LGWA 2UUBO 2YXLA 2ZD9A 4BW5A 1R3LC 2PUSA 3ZRVA 3QTCA 3AG4C 2XUMA 2YUAA 1RPRA 1TA8A 2P5OA 2F23A 4X20A 2UXCB 2A79B 1BCCH 3BAAA 1SQQH 1GN3A 1Q3EA 2ZR2A 5LXTB 3JD2A 3E8GA 1P84F 4O2AA 2ETNA 1O9HA 3UT5B 1VF5B 1M56B 2AZ2A 1ROPA 1W0JG 1N34B 2UXBO 1VQLV 3UT5A 5FNVB 1K73W 1YITV 3LDCA 1WB7A 1VQ9V 3K3WA 2UXXA 4WBNA 2EIMB 4K35A 1HP8A 3C3SA 4DV6B 4RQFA 3HKEA 4HYOA 4JI5O 4GYCB 4LFBB 2A9HA 4GKJB 3OGCC 1YZBA 1M4UA 3SYAA 4JTDB 2R9RB 4EB6B 4YJ3A 3K0GA 1UPGA 5LGTA 1WJZA 3TGUH 2FYUH 3AEIA 3T4ZA 2GTSA 4LNUA 5LP6B 3APOA 2BTQB 2N05A 4I50A 3CCMV 1I5YA 1NTKH 4DR4B 1JJOA 2XASA 5EIBD 3CEIA 3K0DA 5D5QA 4WFHA 1F4NA 2GSMB 2EINC 1M57C 2WSSG 3WB0A 3IC7A 5B66Z 1KB9F 4J7KA 4DR5O 1KMIZ 1OCCC 1JX9A 4DV3B 3WB2A 2WA3A 5LMNB 5CA1B 1S5HC 4UCSA 2JS3A 4PI0A 1KUQA 4QJFB 4FPPA 4U3FH 1F51A 1XILA 1MZFA 1EZJA 4O4LB 4X64O 1R6NA 5BMVB 4FFKA 4DR1B 3G6EV 4ASUG 4KFMA 1JA8A 1MSDA 1K5SA 1XL4A 4DR6O 3JAWB 2YSUB 3PJSK 4RQEA 4DR3O 2W6JG 3OW2U 4FLUA 4DV2B 2PI5A 1N33O 3BABA 1V55C 3F5TA 3SJBC 3QO8A 3RWRD 1QQCA 4D7SA 2IJJA 1E79G 2R70A 4BW9A 4DXWA 5CB4A 1VQNV 1S76D 4MVMA 4F6RA 1FPOA 1FXKB 1WLEA 4PHZA 2F4VO 5CMUA 3AK1A 2D3OW 4MS2A 1OCOC 4QPJA 2Q69A 4MVZA 4LFAB 3CPWU 1PKXA 3K58A 5LP6C 4KXRA 4GX5A 4WFGA 4CS3A 3F7YC 3J7AU 4YJ2A 1I94B 1AI7A 3UKMA 3JALB 3OTOB 3ASNB 1YJWV 4DV1B 3ICXA 1NVPD 1SA0B 4DV0B 2ZKOA 2Z3YA 3CC2V 1PP9H 3SDLA 1K8AW 4CC5A 5JJNB 4R50A 2IH3C 5LMUB 2R9AA 1YJ9V 4LFAO 3FB6C 1B3QA 1Y74A 2P6JA 3K5NA 1NTMH 2UUAO 3SR2C 4DR1O 4J80A 2GTAA 2AZ0A 3H1JH 2YICA 1BQ0A 3U10A 4X88A 4N21A 5LA6B 2GDSA 4J9YB 4DUZB 2R9IA 4O4LA 3H1HH 4U3JA 4ZOLB 4OPAA 4DV7O 4ZHQA 2OCCC 1Y4MA 1F23A 5CA0B 3M7MX 1NI8A 4EFBA 5IYZB 2UUBB 2UXDO 2LQTA 2EX3A 1Z5VA 2EIKC 3OT7A 3SJQC 3G67A 4OX9O 1M56C 2NR5A 1EN6A 3ZRWB 4KL1A 2QTSA 2VS0A 3O65A 1EFRG 4MVUA 1WPXA 5H9CA 1FS0G 1XMQO 2H3OA 3ZEDA 3NR7A 3OR6C 1GH6A 5B1BC 5LGUA 2MK3A 4FLZA 2RMKB 4FK5C 4X64B 3SJAC 3OE7G 4G28B 4FM0A 1RM1B 3OMIB 1VQMV 4JYAB 3CCQV 3WU2Z 5KHKA 1HWYA 3AG1B 4ABMA 5KHHA 3LSSA 2IU0A 1Q6UA 2QKCA 2OCCB 3AK2A 1OCZB 5EK0A 3D3IA 1GK9A 2F95B 1XMOO 2HFEC 1E1QG 1NR1A 4I9WA 1J95A 4JTAB 3B2EE 1NH2D 1GAXA 3CRMA 3G80A 2P4KA 3CWBH 3LDEA 3UM7A 4WFAV 1AJPA 1P7BA 1JJ2U 4JYAO 4O4HA 2OTLV 4DV7B 1SKVA 2B1GA 5BZBA 1TUEB 2OTJV 3ZN1A 4DW0A 2H8PC 1I5XA 4JASA 1M9NA 3RW0A 2LFRA 3STZC 1SA0A 1SQBH 4O4IB 4X1YB 5KHIA 1J5EB 4HNAB 1PD3A 1QCEA 3DSQA 3OD4A 1IURA 3L9DA 1I0HA 3OUFA 3CCLV 1R73A 2P67A 2RN9A 4X20B 2YIBA 4LC1A 4DR5B 4JI8O 3RYFB 1M5IA 1XQ8A 1EM1A 2R72A 1RPOA 1TVKB 1KP3A 5JVDA 1Y74B 1FFTB 3C90A 4GLXA 1AR1B 3W7SA 4LFBO 3OUSA 1H8HG 4DK0A 5IYCO 1DF5A 3ABKB 1V55B 4K0KB 1RP3B 3BRCA 1I08A 3KCYA 1XREA 4YHHO 2CH7A 3MD0A 4X9QA 1WP7A 2CTWA 5J9PC 4JI2O 2QSAA 2ZXWC 1GN6A 1Z5WA 4FZ0A 3WG7B 3HKDA 4NR1A 2DN9A 3SPIA 2EJ7A 4YXWG 1S3JA 1TUBA 2JJ2G 3JCZA 4W4LA 3CCVV 1ZL8B 3BEHA 1CEZA 1D2DA 5IDJA 3JD3A 1H2LA 4WFFA 3H1IH 5GTHZ 3JSLA 2UUAB 4PDVA 4LNUB 4X1KB 4NTYA 2JIZG 1K9MW 1ZWIC 1XNRO 1OCCB 3K5OA 2V7QG 1EN4A 4FFBB 4MVSA 3ETGA 4B3MB 3JD1A 2WLLA 1R1BA 1SETA 3EFFK 1WN7A 4X62O 5KHGA 4UB6Z 4JAUA 2WWWA 1K7DA 3VQXA 5JJJB 2JEXA 2BTOA 2GUZA 3QNEA 2BSKA 5J2TB 3W7TA 1FXVA 4PDMA 2Y4UA 3FB5C 4FVMA 1XMQB 2G38A 2HP8A 3L75H 5HFLA 4K8XA 4N23A 2YI9A 2WLIB 3RYCA 2ZR3A 4H0LB 3B09A 2CGOA 2IH1C 4I4TA 1GN4A 4Z1VA 5AG2A 5EBLC 5KA5A 1BQZA 3UCSC 1H2SB 1YVWA 4JGSA 4TV9B 3P32A 4DO2A 4BIUA 3JAWA 4DV5B 1JFFA 2QGNA 1WP8A 2QEXV 1J5EO 1GKFA 3N2KB 4WBNB 3JASA 5EBMC 3WFVA 2ZE8A 1MSWD 1ENVA 3CC4V 4ZBMA 4DV4O 4X65B 1HNXO 1U96A 3CCSV 5LYJA 1NU1H 1WNSA 2AGAA 2F66C 5DEDA 4MVQA 1BS3A 1TVKA 3CP1A 2C2AA 1YDXA 4DV6O 2FB5A 2E74B 3K06A 2UU9O 4O2BA 1FXKA 1ZAUA 1VQKV 1H2KA 2QA4V 1VQ6V 3A0HZ 4LF4O 1VF6C 1VIBA 4PI2A 3FB7C 1P4RA 3ABLC 5DECA 3ZRSA 1HW7A 4JI8B 2HVJC 3BVOA 4BWAA 3WB1A 3D3QA 3H1KH 5DN6G 2Y69B 4DR2O 4MTGA 4X1KA 4J11A 1SQGA 4NXNO 1BZKA 4FM2A 4TWKA 4NKGB 1XUQA 4LF7B 1HNZO 3K5MA 3A2FA 3X2QB 1FFXA 5L3FA 2PTMA 3RYCB 5B1AB 1JPXA 2WLMA 5KAFZ 4P9PA 1KC8W 4DUYO 2UXBB 2EULA 1R6KA 2XOKG 4GT1A 3E83A 2ZM6B 3A8TA 1D5NA 3T1HB 2BOCC 2P90A 4CC6A 4FLWA 1N0JA 2F93B 1VMGA 3J80N 1PL4A 4XDKA 2WPDG 1KECA 1XOUA 5HFMA 1LUWA 5H6QA 1YXBA 4JTCB 2B9ZA 1COWG 4AQYB 1YTFD 4OPHA 4CS2A 4YHHB 3T1HO 2BOBC 1JFFB 4IT5A 5KAIZ 3B40A 2PI4A 3LNNA 2VRZA 2KQXA 3OM3B 1CXZB 2PYLA 1SS3A 5B1AC 2YEVB 1XI1A 3BHPA 3AG1C 1SRYA 4FMTA 3LUTB 1A32A 4FZ1A 4BIZA 4LF5O 3KCXA 3KG2A 5H2FZ 1G6UA 2DWDC 2AW9A 1IXBA 2UXCO 3HKEB 3W7UA 1VQ5V 1YSCA 3ZMTA 3CMEV 1S0VA 3E2EA 3FD9A 4NTXA 1OZ0A 1OHHG 2HR3A 1PM9A 1K4DC 3ZHRA 1R3JC 3ZMVA 2CTRA 3K08A 2DQ0A 4WFBV 3HKCA 3WG7C 2L6LA 2P4VA 3RVYA 1GM7A 4FLXA 1GM9A 2JGDA 4K8ZA 2UU9B 5JQGB 3JARB 3L71H 2O57A 1KQSU 3H1LH 5L3DA 4NTWA 1FYJA 1MG1A 4LF4B 4QE7A 4F6EA 3RN4A 4JI2B 2OIEA 4DR3B 3DXRB 3NXSA 4MTXA 1T5EA 3I55V 2QE7G 4LH7A 1XBLA 1N33B 2ARHA 2AHYA 1QU7A 3T2MA 4B3SO 5FPRA 1W2BU 4JI1O 1OV9A 4X1IA 4JV5O 1M90W 5C93A 3AK3A 3ZBHA 4JI7O 3ETEA 4DR7O 4DUZO 1ZSPA 3K9AA 5LHIA 2EILC 2F4VB 3ZRWA 5A2QN 1SF9A 4GKKO 1XDCA 5EIBC 5IJ0B 3N27A 3B4SA 1WPBA 4UCOA 2A7WA 3HKBA 3OR7C 4TQDA 3CRQA 5LGNA 2EIJC 3SPCA 3FX7A 2WA4A 3SJCC 4DV5O 2CDYA 1ORQC 4JV5B 3GWKC 1ZTEA 3H9VA 3RBZA 1ZL8A 5B1NA 3ZS8C 2K9PA 1VQPV 3BPZA 4YY3O 3IFXA 1N4CA 3FB8C 2IJHA 1KKCA 2VQEO 1DK1A 2GBOA 2P7TC 1IX9A 4NVPA 5B3SB 4P30A 2MW2B 1BL8A 3Q4HB 3RT3C 1PV0A 4LWSB 4WFEA 4BIOA 1MA1A 2VWJA 1VP7A 4X1YA 3BA8A 2YEVA 3K5LA 2BCCH 3ASOC 2M7WA 3U11A 5IYBO 3FYIB 3DC6A 1GN2A 2ZM6O 1OCZC 1IBLO 3CB2A 4JI4O 1K4CC 4DR6B 2FKXA 4MW8A 4OX9B 1SQVH 3ZMSA 3TK1A 4DR7B 5JJEB 2X6AA 4O4IA 2CTPA 4K3AA 3JYCA 5E79Z 4LF7O 2WLNA 3HPLC 4B3RB 1AI5A 1G8MA 2ZDIA 3LSQA 2HJFC 1H2MA 3S3XA 3SGIA 1NH2B 4TOIA 4UCUA 1RSOA 5K1XA 2WAMA 5LMNO 4DV4B 2A0LA 1S77D 1S72V 1VQOV 4X66O 3CJHB 3RYIB 2Y48A 4FLYA 4PV1B 3RYHB 4PA7A 5IWAB 2ILMA 1Q82W 5CB4B 2ZNJA 4J10A 1NVPB 1NR7A 3CJHA 4LF5B 1X59A 2EINB 4J9ZB 4H44B 2A3QA 2V1DA 2DYSC 1VEWA 4X89A 1O9GA 5K1PA 2Q73A 3SYOA 4B7EA 1N0NA 2HLDG 3MDSA 4WCEV 4FLTA 4MVOA 2BSKB 2RCVA 1SZXA 3G71V 3VQYA 3BFRA 3ZMZA 4JZGA 4AILC 3ZHUA 4JAAA 5JQGA 1ZLZA 3JSNA 2DW4A 4JI4B 1L0NH 5LOVA 3DGEA 1HNZB 1JQ0A 3SYQA 4IYHA 4NYKA 3RYHA 4JAVA 4PDRA 3RFRA 4I0XA 5IY5B 2ADQB 4LCUC 1QBZA 1AP5A 4RUFA 2EILB 3SPJA 1AI4A 4TSFG 4Q6GA 3T1YO 1NQTA 3JD4A 5JCOC 1L8DA 2CE4A 4U3JB 2ZQMA 3KZIZ 4EB6A 3JATA 4JI7B 4HAMA 1H2GA 5CBHA 1CP9A 3CCUV 1P7GA 5IJ9B 3IC9A 1Q5OA 2YXYA 2KKWA 5L3EA 2XNDG 1QVFU 1SQXH 5JH7B 4LF6O 3T1CA 3QO5A 4QIWF 3T4DA 3AG4B 4JI6O 4LH6A
chains in the Genus database with same CATH topology
1WA8B 3GWKC 2VRZA 2AZ0A 2AZ2A 4LWSA 3TXSA 3FD9A 4I0XA 3OGIB 3G80A 2VS0A 2KG7B 2B9ZA 3FAVA 4GZRB 3HR0A 3TXQA 3GVMA 4ABMA 2KG7A 3FAVB 1WA8A 3O9OA 4I0XB 3Q4HA 3Q4HB 3ZBHA 4LWSB 2DE0X
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WA8 B;  3GWK C;  2VRZ A;  2AZ0 A;  2AZ2 A;  4LWS A;  3TXS A;  3FD9 A;  4I0X A;  3OGI B;  3G80 A;  2VS0 A;  2KG7 B;  2B9Z A;  3FAV A;  4GZR B;  3HR0 A;  3TXQ A;  3GVM A;  4ABM A;  2KG7 A;  3FAV B;  1WA8 A;  3O9O A;  4I0X B;  3Q4H A;  3Q4H B;  3ZBH A;  4LWS B;  2DE0 X; 
#chains in the Genus database with same CATH topology
 1WA8 B;  4AQY O;  5GW7 A;  5JH7 A;  3ABL B;  2N74 A;  3ABU A;  3ZHS A;  1R6T A;  2CUG A;  2HKO A;  1MOF A;  1X4T A;  5JCO A;  3C3T A;  5BMV A;  2RQ6 A;  4LBE C;  1XEQ A;  3F7V C;  4KHP O;  3B8N A;  4GZR B;  4EKW A;  2B5U A;  3E22 B;  5LXT A;  4LF9 O;  3L72 H;  1JOY A;  3A0R A;  1K33 A;  1SZT A;  4JI6 B;  3ML0 A;  5EZY B;  2B1I A;  2Q7G A;  4O4J B;  3OEE G;  4EFE A;  4HZ3 A;  4UVA A;  1US6 A;  4UVC A;  4HNA A;  1IBK B;  4PD4 F;  2KG7 A;  3AG7 A;  1BMF G;  5EBW C;  1V54 B;  4O4J A;  1S5J A;  2CGN A;  1MZE A;  3LDD A;  3OMN B;  4MTO A;  2CAZ C;  3S3W A;  2Q0O C;  2JS5 A;  3ZMU A;  2W6I G;  2ITD C;  3CRC A;  4J41 A;  1HNW B;  2ZE5 A;  4Q20 A;  2NN4 A;  1HDJ A;  3O9O A;  4KUM A;  2YS8 A;  1ARO P;  2FTK A;  2QM7 A;  1MAB G;  3CXH F;  2LW1 A;  1AJN A;  3OTO O;  2X0L A;  3IJ4 A;  1YEW A;  1QLE B;  4GX2 A;  1P49 A;  2HEP A;  1YJN V;  3CHX A;  1JCH A;  5B1O A;  2GV9 A;  4DV0 O;  3AG2 C;  3QO7 A;  3GB7 C;  1Z2G A;  2Q4P A;  2DE0 X;  4TV8 A;  3E86 A;  1HNX B;  4NXN B;  2ATK C;  1S5L Z;  4J7J A;  3H01 A;  3L74 H;  3N2K A;  2ZIO A;  4JPR A;  4DW1 A;  3HKD B;  4LF8 O;  4G2K A;  4X8A A;  2DWE C;  3GWO A;  1JR9 A;  3I5D A;  2AXT Z;  4I5S A;  4B3S B;  2VQE B;  3ZHV A;  4JI1 B;  3BY6 A;  1XNR B;  4QGP A;  3A0B Z;  2WLL B;  1TGO A;  5ITZ A;  3CCR V;  2E5L B;  3CC7 V;  1DGS A;  1AR5 A;  2OWO A;  2LO1 A;  2ZE6 A;  3N2G A;  2PY5 A;  4NXM O;  5IJ0 A;  1AR4 A;  4MW3 A;  1SER A;  2NNU A;  3K04 A;  3BCC H;  2Q5Z A;  4TUY B;  2XT9 A;  2XTA A;  1B06 A;  5IJ9 A;  3P3P A;  1ZX3 A;  4B7K A;  3U0Z A;  3D8C A;  2IJI A;  3EXA A;  2WLI A;  1THZ A;  2Q0A A;  1VAR A;  4I9Q A;  1Q6I A;  1PNK A;  2KB1 A;  2LP7 A;  1Q90 D;  3M99 B;  3F5W C;  4LF6 B;  1OCR B;  3P3N A;  1RFY A;  3JAL A;  4JI3 B;  4LWS A;  3OEH G;  3CMA V;  2X7R B;  4DR4 O;  4GX0 A;  3CCE V;  1Q6H A;  1GTO A;  4XDL A;  1IVS A;  5CA3 A;  3SYC A;  1GRJ A;  5F2V O;  5LL6 Y;  2XAQ A;  4ZI7 B;  3OAA G;  4H37 A;  4Z1M G;  3T1Y B;  3E8B A;  5H6R A;  3R65 A;  2HG5 C;  4LF9 B;  3ABM B;  4GKK B;  1VF7 A;  4FM1 A;  3EVK A;  5C8Y A;  4IHJ B;  5KHJ A;  1EN5 A;  4AI8 A;  3UO2 A;  2LJ2 A;  2QKS A;  1VQ4 V;  5J2U A;  4PDL A;  3SPH A;  1F4M A;  4R6Z A;  2Q9L A;  4KP4 A;  1HR0 B;  3ZN0 A;  1QLN A;  5GTI Z;  2EZO A;  3OTF A;  4DV1 O;  1SQF A;  1YIJ V;  4ICG A;  2Q68 A;  3LNM B;  1QHT A;  1VQ7 V;  4UVB A;  3G6B A;  5GON B;  1BGY H;  3R66 A;  4H33 A;  4TQF A;  3CE2 A;  1FD9 A;  5KLV H;  2P22 C;  5IYZ A;  3TET A;  1LNQ A;  5IE9 A;  4I7Z B;  5EC1 C;  2WLK A;  3ABT A;  4JI0 O;  4O2B B;  1VQ8 V;  3FAV B;  4DYL A;  4UXN A;  1V9P A;  4B3T O;  1H38 A;  3RVZ A;  2IW5 A;  1BHA A;  4IYI A;  2A06 H;  2ZXW B;  3VBB A;  3DTU B;  1Q86 W;  2OYQ A;  2VQF B;  1XNQ B;  2Q6A A;  4YIP A;  1BT8 A;  5LBQ A;  1K3E A;  2QWO B;  2XAJ A;  1M57 B;  4UB8 Z;  3ETD A;  1HR0 O;  1XL6 A;  4TUY A;  4PEL A;  4B08 A;  1XHZ A;  5FL7 G;  4PA3 A;  1W59 A;  3OGI B;  3UQ8 A;  1Q7Y W;  1IBL B;  2Q7H A;  1E1R G;  5BY1 A;  1SQP H;  2EIJ B;  1QR9 A;  4GX1 A;  2ZIN A;  1QLE C;  3TXQ A;  4FFB A;  4E4E A;  5JWP A;  1Q81 W;  3ZCC A;  2NLJ C;  1OJH A;  2BE3 A;  4DRX A;  4OGQ B;  3P30 A;  3MAQ A;  3M8A A;  3W7W A;  2OIG A;  3CX5 F;  2DYS B;  2Y0I A;  4CZZ A;  1AJQ A;  2X6B A;  2M6Y A;  1D5A A;  1DF4 A;  1YF2 A;  5KUM A;  5CN0 A;  4JI0 B;  3CRA A;  4CH3 A;  4B3T B;  4ZKI A;  5KMG B;  1N36 O;  3JAS B;  4X1I B;  5CBG A;  4CH5 A;  1IBM O;  2QR4 A;  4ZOL A;  2DMX A;  3E8H A;  2F43 G;  4UCV A;  4PA9 A;  2F1M A;  2YI8 A;  3DXR A;  1NJI W;  4PJ0 Z;  4I55 A;  4Z2W A;  5L3B A;  2YIA A;  4UUJ C;  4UFZ A;  2XAG A;  3QF7 A;  2X6C A;  4DV3 O;  1JVM A;  3HR0 A;  4MT8 A;  5LYJ B;  3CXC U;  1IZ3 A;  5FNV A;  1L0L H;  1AB3 A;  1BSM A;  1NZ6 A;  4QE9 A;  3ZX6 A;  3CD6 V;  5FLX N;  4W4K A;  2UXD B;  1PNM A;  5IYD O;  4ZIB A;  5FPO A;  5LA6 A;  4RAI A;  1QNM A;  2DYR B;  4E2L A;  1N34 O;  3CYO A;  3L73 H;  5KX5 B;  4MVR A;  1WA8 A;  5IT9 N;  2EJR A;  1LR1 A;  3N2G B;  5EZY A;  4J7Z A;  1NS1 A;  4QNH B;  3J81 N;  1RSO B;  3ZIA G;  3OMA B;  5TIS Z;  1DLB A;  3VQV A;  1K5Q A;  5BXZ A;  4ZHQ B;  2RJZ A;  4C7U A;  4JYC A;  2QKA A;  4YJ3 B;  3EHB B;  1BE3 H;  1MMM A;  5L3G A;  5ITZ B;  2IJK A;  2VWK A;  3TJT A;  1UFI A;  4YJ2 B;  5E1A C;  3ABM C;  3CRR A;  2YIB D;  1I7F A;  2AHZ A;  1Y6X A;  4TV9 A;  1TAE A;  1Q8I A;  5B3S C;  1L1F A;  4R8C A;  3K57 A;  1IBM B;  2GHY A;  1K97 A;  4I4T B;  2LGQ A;  3L70 H;  4DUY B;  1XMO B;  4U7O A;  4F6R B;  1YI2 V;  4K0K O;  2RNB A;  1FAF A;  1FXH A;  1Y67 A;  4UCR A;  2QWQ B;  1NKD A;  2IU3 A;  3JAT B;  2E75 B;  3MHH C;  2PGG A;  4LR3 A;  3FFQ A;  2ODM A;  4IIJ B;  5LHH A;  5LP6 A;  5H5N A;  1EZV H;  4X62 B;  2E3C A;  1V54 C;  4UCT A;  2HVK C;  4DK1 A;  4X65 O;  4PA4 A;  3JAK A;  3KKY A;  1KYO F;  4JF3 A;  1U97 A;  1OCO B;  2ZE7 A;  4FJC C;  2Z0A A;  3JCU Z;  2EIM C;  1FXK C;  4RO2 A;  3JAK B;  4NXM B;  5EYP B;  1EBO A;  2ADP A;  2DOS A;  4YY3 B;  1YCI A;  4EEQ A;  1R3I C;  3RYI A;  4RUE A;  3HKB B;  4FLV A;  2HJD A;  3VOU A;  5EC2 C;  4I55 B;  3GVM A;  2N04 A;  3APQ A;  3CCJ V;  1FJG O;  2JK5 C;  4IHJ A;  4HBN A;  3CSX A;  3QVN A;  4D6T H;  1Q43 A;  5KA6 A;  1G1X B;  3JD0 A;  1WAZ A;  4L87 A;  4PA6 A;  5IWA O;  3JAM N;  4DR2 B;  2QWP B;  2PYJ A;  4ZI7 A;  1Y66 A;  1YHQ V;  2WLJ A;  5B1B B;  1K92 A;  4CH4 A;  1KKD A;  3BA9 A;  4P9O A;  4GKJ O;  5KX5 A;  1K34 A;  2Q7E A;  3MHS C;  2P06 A;  3B8M A;  4G27 B;  3PN1 A;  1UJW B;  2E5L O;  5CA1 A;  3OFN G;  5B5E Z;  5KUK A;  3ASO B;  4JZ2 A;  1N36 B;  2JJ1 G;  1B04 A;  4GCZ A;  1SES A;  3ZJZ A;  4CS4 A;  4NB5 A;  3HKC B;  1PNL A;  1SC5 B;  4TT3 G;  2XAH A;  3ABK C;  4BR6 A;  1NBM G;  1WB8 A;  2QTO A;  4OXS A;  1IXM A;  2JEU A;  1DTO A;  4XDJ A;  4LFC O;  2DJV A;  4IL6 Z;  1R3K C;  2XHB A;  1GO3 F;  4YIO A;  3ASN C;  1HNW O;  2D2C B;  4BAY A;  4LP8 A;  4FIP C;  4U7N A;  3FYE B;  4O2A B;  1N32 O;  4JI5 B;  1H8E G;  1PPJ H;  1B6Q A;  2LFS A;  2FML A;  2ITC C;  4O4H B;  3AG3 B;  2ZCE A;  2YID A;  4IIJ A;  3RGB A;  1QVG U;  3HB3 B;  2OCH A;  2PF4 E;  3K9S A;  3SPG A;  3THO A;  3K79 A;  3W7X A;  3ZHT A;  4B3R O;  3ZRX A;  1OCR C;  1H2N A;  1KP2 A;  1MNG A;  3STL C;  3G4S V;  2CK3 G;  4F4L A;  1M93 A;  1F7Y A;  5BR8 B;  1N32 B;  1FFX B;  2KSD A;  2QDO A;  3TCU A;  1Y76 A;  4RWU A;  4TV8 B;  4P2Z A;  2LW7 A;  1VF6 A;  3RYF A;  1RM1 C;  3DC5 A;  5LMU O;  4D7T A;  4GUN A;  1GM8 A;  2YC0 A;  2W0F C;  4J42 A;  4R7C A;  2Y69 C;  4DRX B;  2IBZ H;  4AHC A;  4CH6 A;  3LSU A;  2Y4T A;  2OT5 A;  3K59 A;  2H94 A;  2DYR C;  5CBF A;  4IGG A;  4LFC B;  5BR8 O;  2CH7 B;  1CPY A;  5EYP A;  2QM8 A;  3ETQ A;  5JVD B;  3B77 A;  1IBK O;  2PZS A;  1PL0 A;  2Y0P A;  3IGA C;  1AP6 A;  2RDC A;  1IDS A;  1LUV A;  2Z5U A;  2Q8V A;  3FAV A;  2EIK B;  2JVD A;  2HHH B;  2EBO A;  3D36 A;  1AI6 A;  2DQ3 A;  2JGD B;  2L35 A;  3VQW A;  2IM9 A;  2YDE A;  2ZT9 B;  4XBF A;  4UV8 A;  3E89 A;  2JRI A;  2XAF A;  4CBC A;  4LF8 B;  2ZDI C;  5CA0 A;  2K1E A;  1QR8 A;  5GON A;  1KBH A;  1ZUQ A;  5A9G A;  4X66 B;  5J2T A;  1TUB B;  4DV2 O;  5J2U B;  3E8F A;  3E35 A;  2UXN A;  2UUC O;  3IAY A;  3AG3 C;  3K03 A;  4I0X B;  5D5P A;  3AG2 B;  1W0K G;  2QWN B;  1FJG B;  4L8J A;  5IY5 C;  4JI3 O;  2QJ1 A;  4I50 B;  2BTQ A;  2VQF O;  1XNQ O;  3TXS A;  5KMG A;  1NTZ H;  2Q67 A;  1AIL A;  1KU9 A;  4A5U B;  2CTQ A;  1AVM A;  2JGU A;  1URF A;  4MSW C;  1NT2 B;  5DM6 V;  4QPK A;  2UUC B;  4UV9 A;  3Q4H A;  3QG5 A;  4MTF A;  4JYY A;  3CS5 A;  2E76 B;  1I94 O;  1YTF B;  2EZP A;  3JAR A;  4JYB A;  1KD1 W;  4KHP B;  5C8Y B;  5LHG A;  4B3M O;  2KG7 B;  3UO3 A;  4H13 B;  1Y76 B;  5LOV B;  1JMK C;  1XHX A;  2JDI G;  2HHH O;  1BHB A;  3ZHQ A;  3X2Q C;  1G4Y B;  2FL4 A;  1FKA O;  1M1K W;  3D36 C;  2ZNI A;  3FKS G;  2V4D A;  3SYP A;  1N8R W;  1GMG A;  3E22 A;  2ZIM A;  4WF9 V;  2W0X A;  3I56 V;  2WLH A;  2QWR B;  2GUZ B;  5L3C A;  2YXH A;  2QM4 A;  2LGW A;  2UUB O;  2YXL A;  2ZD9 A;  4BW5 A;  1R3L C;  2PUS A;  3ZRV A;  3QTC A;  3AG4 C;  2XUM A;  2YUA A;  1RPR A;  1TA8 A;  2P5O A;  2F23 A;  4X20 A;  2UXC B;  2A79 B;  1BCC H;  3BAA A;  1SQQ H;  1GN3 A;  1Q3E A;  2ZR2 A;  5LXT B;  3JD2 A;  3E8G A;  1P84 F;  4O2A A;  2ETN A;  1O9H A;  3UT5 B;  1VF5 B;  1M56 B;  2AZ2 A;  1ROP A;  1W0J G;  1N34 B;  2UXB O;  1VQL V;  3UT5 A;  5FNV B;  1K73 W;  1YIT V;  3LDC A;  1WB7 A;  1VQ9 V;  3K3W A;  2UXX A;  4WBN A;  2EIM B;  4K35 A;  1HP8 A;  3C3S A;  4DV6 B;  4RQF A;  3HKE A;  4HYO A;  4JI5 O;  4GYC B;  4LFB B;  2A9H A;  4GKJ B;  3OGC C;  1YZB A;  1M4U A;  3SYA A;  4JTD B;  2R9R B;  4EB6 B;  4YJ3 A;  3K0G A;  1UPG A;  5LGT A;  1WJZ A;  3TGU H;  2FYU H;  3AEI A;  3T4Z A;  2GTS A;  4LNU A;  5LP6 B;  3APO A;  2BTQ B;  2N05 A;  4I50 A;  3CCM V;  1I5Y A;  1NTK H;  4DR4 B;  1JJO A;  2XAS A;  5EIB D;  3CEI A;  3K0D A;  5D5Q A;  4WFH A;  1F4N A;  2GSM B;  2EIN C;  1M57 C;  2WSS G;  3WB0 A;  3IC7 A;  5B66 Z;  1KB9 F;  4J7K A;  4DR5 O;  1KMI Z;  1OCC C;  1JX9 A;  4DV3 B;  3WB2 A;  2WA3 A;  5LMN B;  5CA1 B;  1S5H C;  4UCS A;  2JS3 A;  4PI0 A;  1KUQ A;  4QJF B;  4FPP A;  4U3F H;  1F51 A;  1XIL A;  1MZF A;  1EZJ A;  4O4L B;  4X64 O;  1R6N A;  5BMV B;  4FFK A;  4DR1 B;  3G6E V;  4ASU G;  4KFM A;  1JA8 A;  1MSD A;  1K5S A;  1XL4 A;  4DR6 O;  3JAW B;  2YSU B;  3PJS K;  4RQE A;  4DR3 O;  2W6J G;  3OW2 U;  4FLU A;  4DV2 B;  2PI5 A;  1N33 O;  3BAB A;  1V55 C;  3F5T A;  3SJB C;  3QO8 A;  3RWR D;  1QQC A;  4D7S A;  2IJJ A;  1E79 G;  2R70 A;  4BW9 A;  4DXW A;  5CB4 A;  1VQN V;  1S76 D;  4MVM A;  4F6R A;  1FPO A;  1FXK B;  1WLE A;  4PHZ A;  2F4V O;  5CMU A;  3AK1 A;  2D3O W;  4MS2 A;  1OCO C;  4QPJ A;  2Q69 A;  4MVZ A;  4LFA B;  3CPW U;  1PKX A;  3K58 A;  5LP6 C;  4KXR A;  4GX5 A;  4WFG A;  4CS3 A;  3F7Y C;  3J7A U;  4YJ2 A;  1I94 B;  1AI7 A;  3UKM A;  3JAL B;  3OTO B;  3ASN B;  1YJW V;  4DV1 B;  3ICX A;  1NVP D;  1SA0 B;  4DV0 B;  2ZKO A;  2Z3Y A;  3CC2 V;  1PP9 H;  3SDL A;  1K8A W;  4CC5 A;  5JJN B;  4R50 A;  2IH3 C;  5LMU B;  2R9A A;  1YJ9 V;  4LFA O;  3FB6 C;  1B3Q A;  1Y74 A;  2P6J A;  3K5N A;  1NTM H;  2UUA O;  3SR2 C;  4DR1 O;  4J80 A;  2GTA A;  2AZ0 A;  3H1J H;  2YIC A;  1BQ0 A;  3U10 A;  4X88 A;  4N21 A;  5LA6 B;  2GDS A;  4J9Y B;  4DUZ B;  2R9I A;  4O4L A;  3H1H H;  4U3J A;  4ZOL B;  4OPA A;  4DV7 O;  4ZHQ A;  2OCC C;  1Y4M A;  1F23 A;  5CA0 B;  3M7M X;  1NI8 A;  4EFB A;  5IYZ B;  2UUB B;  2UXD O;  2LQT A;  2EX3 A;  1Z5V A;  2EIK C;  3OT7 A;  3SJQ C;  3G67 A;  4OX9 O;  1M56 C;  2NR5 A;  1EN6 A;  3ZRW B;  4KL1 A;  2QTS A;  2VS0 A;  3O65 A;  1EFR G;  4MVU A;  1WPX A;  5H9C A;  1FS0 G;  1XMQ O;  2H3O A;  3ZED A;  3NR7 A;  3OR6 C;  1GH6 A;  5B1B C;  5LGU A;  2MK3 A;  4FLZ A;  2RMK B;  4FK5 C;  4X64 B;  3SJA C;  3OE7 G;  4G28 B;  4FM0 A;  1RM1 B;  3OMI B;  1VQM V;  4JYA B;  3CCQ V;  3WU2 Z;  5KHK A;  1HWY A;  3AG1 B;  4ABM A;  5KHH A;  3LSS A;  2IU0 A;  1Q6U A;  2QKC A;  2OCC B;  3AK2 A;  1OCZ B;  5EK0 A;  3D3I A;  1GK9 A;  2F95 B;  1XMO O;  2HFE C;  1E1Q G;  1NR1 A;  4I9W A;  1J95 A;  4JTA B;  3B2E E;  1NH2 D;  1GAX A;  3CRM A;  3G80 A;  2P4K A;  3CWB H;  3LDE A;  3UM7 A;  4WFA V;  1AJP A;  1P7B A;  1JJ2 U;  4JYA O;  4O4H A;  2OTL V;  4DV7 B;  1SKV A;  2B1G A;  5BZB A;  1TUE B;  2OTJ V;  3ZN1 A;  4DW0 A;  2H8P C;  1I5X A;  4JAS A;  1M9N A;  3RW0 A;  2LFR A;  3STZ C;  1SA0 A;  1SQB H;  4O4I B;  4X1Y B;  5KHI A;  1J5E B;  4HNA B;  1PD3 A;  1QCE A;  3DSQ A;  3OD4 A;  1IUR A;  3L9D A;  1I0H A;  3OUF A;  3CCL V;  1R73 A;  2P67 A;  2RN9 A;  4X20 B;  2YIB A;  4LC1 A;  4DR5 B;  4JI8 O;  3RYF B;  1M5I A;  1XQ8 A;  1EM1 A;  2R72 A;  1RPO A;  1TVK B;  1KP3 A;  5JVD A;  1Y74 B;  1FFT B;  3C90 A;  4GLX A;  1AR1 B;  3W7S A;  4LFB O;  3OUS A;  1H8H G;  4DK0 A;  5IYC O;  1DF5 A;  3ABK B;  1V55 B;  4K0K B;  1RP3 B;  3BRC A;  1I08 A;  3KCY A;  1XRE A;  4YHH O;  2CH7 A;  3MD0 A;  4X9Q A;  1WP7 A;  2CTW A;  5J9P C;  4JI2 O;  2QSA A;  2ZXW C;  1GN6 A;  1Z5W A;  4FZ0 A;  3WG7 B;  3HKD A;  4NR1 A;  2DN9 A;  3SPI A;  2EJ7 A;  4YXW G;  1S3J A;  1TUB A;  2JJ2 G;  3JCZ A;  4W4L A;  3CCV V;  1ZL8 B;  3BEH A;  1CEZ A;  1D2D A;  5IDJ A;  3JD3 A;  1H2L A;  4WFF A;  3H1I H;  5GTH Z;  3JSL A;  2UUA B;  4PDV A;  4LNU B;  4X1K B;  4NTY A;  2JIZ G;  1K9M W;  1ZWI C;  1XNR O;  1OCC B;  3K5O A;  2V7Q G;  1EN4 A;  4FFB B;  4MVS A;  3ETG A;  4B3M B;  3JD1 A;  2WLL A;  1R1B A;  1SET A;  3EFF K;  1WN7 A;  4X62 O;  5KHG A;  4UB6 Z;  4JAU A;  2WWW A;  1K7D A;  3VQX A;  5JJJ B;  2JEX A;  2BTO A;  2GUZ A;  3QNE A;  2BSK A;  5J2T B;  3W7T A;  1FXV A;  4PDM A;  2Y4U A;  3FB5 C;  4FVM A;  1XMQ B;  2G38 A;  2HP8 A;  3L75 H;  5HFL A;  4K8X A;  4N23 A;  2YI9 A;  2WLI B;  3RYC A;  2ZR3 A;  4H0L B;  3B09 A;  2CGO A;  2IH1 C;  4I4T A;  1GN4 A;  4Z1V A;  5AG2 A;  5EBL C;  5KA5 A;  1BQZ A;  3UCS C;  1H2S B;  1YVW A;  4JGS A;  4TV9 B;  3P32 A;  4DO2 A;  4BIU A;  3JAW A;  4DV5 B;  1JFF A;  2QGN A;  1WP8 A;  2QEX V;  1J5E O;  1GKF A;  3N2K B;  4WBN B;  3JAS A;  5EBM C;  3WFV A;  2ZE8 A;  1MSW D;  1ENV A;  3CC4 V;  4ZBM A;  4DV4 O;  4X65 B;  1HNX O;  1U96 A;  3CCS V;  5LYJ A;  1NU1 H;  1WNS A;  2AGA A;  2F66 C;  5DED A;  4MVQ A;  1BS3 A;  1TVK A;  3CP1 A;  2C2A A;  1YDX A;  4DV6 O;  2FB5 A;  2E74 B;  3K06 A;  2UU9 O;  4O2B A;  1FXK A;  1ZAU A;  1VQK V;  1H2K A;  2QA4 V;  1VQ6 V;  3A0H Z;  4LF4 O;  1VF6 C;  1VIB A;  4PI2 A;  3FB7 C;  1P4R A;  3ABL C;  5DEC A;  3ZRS A;  1HW7 A;  4JI8 B;  2HVJ C;  3BVO A;  4BWA A;  3WB1 A;  3D3Q A;  3H1K H;  5DN6 G;  2Y69 B;  4DR2 O;  4MTG A;  4X1K A;  4J11 A;  1SQG A;  4NXN O;  1BZK A;  4FM2 A;  4TWK A;  4NKG B;  1XUQ A;  4LF7 B;  1HNZ O;  3K5M A;  3A2F A;  3X2Q B;  1FFX A;  5L3F A;  2PTM A;  3RYC B;  5B1A B;  1JPX A;  2WLM A;  5KAF Z;  4P9P A;  1KC8 W;  4DUY O;  2UXB B;  2EUL A;  1R6K A;  2XOK G;  4GT1 A;  3E83 A;  2ZM6 B;  3A8T A;  1D5N A;  3T1H B;  2BOC C;  2P90 A;  4CC6 A;  4FLW A;  1N0J A;  2F93 B;  1VMG A;  3J80 N;  1PL4 A;  4XDK A;  2WPD G;  1KEC A;  1XOU A;  5HFM A;  1LUW A;  5H6Q A;  1YXB A;  4JTC B;  2B9Z A;  1COW G;  4AQY B;  1YTF D;  4OPH A;  4CS2 A;  4YHH B;  3T1H O;  2BOB C;  1JFF B;  4IT5 A;  5KAI Z;  3B40 A;  2PI4 A;  3LNN A;  2VRZ A;  2KQX A;  3OM3 B;  1CXZ B;  2PYL A;  1SS3 A;  5B1A C;  2YEV B;  1XI1 A;  3BHP A;  3AG1 C;  1SRY A;  4FMT A;  3LUT B;  1A32 A;  4FZ1 A;  4BIZ A;  4LF5 O;  3KCX A;  3KG2 A;  5H2F Z;  1G6U A;  2DWD C;  2AW9 A;  1IXB A;  2UXC O;  3HKE B;  3W7U A;  1VQ5 V;  1YSC A;  3ZMT A;  3CME V;  1S0V A;  3E2E A;  3FD9 A;  4NTX A;  1OZ0 A;  1OHH G;  2HR3 A;  1PM9 A;  1K4D C;  3ZHR A;  1R3J C;  3ZMV A;  2CTR A;  3K08 A;  2DQ0 A;  4WFB V;  3HKC A;  3WG7 C;  2L6L A;  2P4V A;  3RVY A;  1GM7 A;  4FLX A;  1GM9 A;  2JGD A;  4K8Z A;  2UU9 B;  5JQG B;  3JAR B;  3L71 H;  2O57 A;  1KQS U;  3H1L H;  5L3D A;  4NTW A;  1FYJ A;  1MG1 A;  4LF4 B;  4QE7 A;  4F6E A;  3RN4 A;  4JI2 B;  2OIE A;  4DR3 B;  3DXR B;  3NXS A;  4MTX A;  1T5E A;  3I55 V;  2QE7 G;  4LH7 A;  1XBL A;  1N33 B;  2ARH A;  2AHY A;  1QU7 A;  3T2M A;  4B3S O;  5FPR A;  1W2B U;  4JI1 O;  1OV9 A;  4X1I A;  4JV5 O;  1M90 W;  5C93 A;  3AK3 A;  3ZBH A;  4JI7 O;  3ETE A;  4DR7 O;  4DUZ O;  1ZSP A;  3K9A A;  5LHI A;  2EIL C;  2F4V B;  3ZRW A;  5A2Q N;  1SF9 A;  4GKK O;  1XDC A;  5EIB C;  5IJ0 B;  3N27 A;  3B4S A;  1WPB A;  4UCO A;  2A7W A;  3HKB A;  3OR7 C;  4TQD A;  3CRQ A;  5LGN A;  2EIJ C;  3SPC A;  3FX7 A;  2WA4 A;  3SJC C;  4DV5 O;  2CDY A;  1ORQ C;  4JV5 B;  3GWK C;  1ZTE A;  3H9V A;  3RBZ A;  1ZL8 A;  5B1N A;  3ZS8 C;  2K9P A;  1VQP V;  3BPZ A;  4YY3 O;  3IFX A;  1N4C A;  3FB8 C;  2IJH A;  1KKC A;  2VQE O;  1DK1 A;  2GBO A;  2P7T C;  1IX9 A;  4NVP A;  5B3S B;  4P30 A;  2MW2 B;  1BL8 A;  3Q4H B;  3RT3 C;  1PV0 A;  4LWS B;  4WFE A;  4BIO A;  1MA1 A;  2VWJ A;  1VP7 A;  4X1Y A;  3BA8 A;  2YEV A;  3K5L A;  2BCC H;  3ASO C;  2M7W A;  3U11 A;  5IYB O;  3FYI B;  3DC6 A;  1GN2 A;  2ZM6 O;  1OCZ C;  1IBL O;  3CB2 A;  4JI4 O;  1K4C C;  4DR6 B;  2FKX A;  4MW8 A;  4OX9 B;  1SQV H;  3ZMS A;  3TK1 A;  4DR7 B;  5JJE B;  2X6A A;  4O4I A;  2CTP A;  4K3A A;  3JYC A;  5E79 Z;  4LF7 O;  2WLN A;  3HPL C;  4B3R B;  1AI5 A;  1G8M A;  2ZDI A;  3LSQ A;  2HJF C;  1H2M A;  3S3X A;  3SGI A;  1NH2 B;  4TOI A;  4UCU A;  1RSO A;  5K1X A;  2WAM A;  5LMN O;  4DV4 B;  2A0L A;  1S77 D;  1S72 V;  1VQO V;  4X66 O;  3CJH B;  3RYI B;  2Y48 A;  4FLY A;  4PV1 B;  3RYH B;  4PA7 A;  5IWA B;  2ILM A;  1Q82 W;  5CB4 B;  2ZNJ A;  4J10 A;  1NVP B;  1NR7 A;  3CJH A;  4LF5 B;  1X59 A;  2EIN B;  4J9Z B;  4H44 B;  2A3Q A;  2V1D A;  2DYS C;  1VEW A;  4X89 A;  1O9G A;  5K1P A;  2Q73 A;  3SYO A;  4B7E A;  1N0N A;  2HLD G;  3MDS A;  4WCE V;  4FLT A;  4MVO A;  2BSK B;  2RCV A;  1SZX A;  3G71 V;  3VQY A;  3BFR A;  3ZMZ A;  4JZG A;  4AIL C;  3ZHU A;  4JAA A;  5JQG A;  1ZLZ A;  3JSN A;  2DW4 A;  4JI4 B;  1L0N H;  5LOV A;  3DGE A;  1HNZ B;  1JQ0 A;  3SYQ A;  4IYH A;  4NYK A;  3RYH A;  4JAV A;  4PDR A;  3RFR A;  4I0X A;  5IY5 B;  2ADQ B;  4LCU C;  1QBZ A;  1AP5 A;  4RUF A;  2EIL B;  3SPJ A;  1AI4 A;  4TSF G;  4Q6G A;  3T1Y O;  1NQT A;  3JD4 A;  5JCO C;  1L8D A;  2CE4 A;  4U3J B;  2ZQM A;  3KZI Z;  4EB6 A;  3JAT A;  4JI7 B;  4HAM A;  1H2G A;  5CBH A;  1CP9 A;  3CCU V;  1P7G A;  5IJ9 B;  3IC9 A;  1Q5O A;  2YXY A;  2KKW A;  5L3E A;  2XND G;  1QVF U;  1SQX H;  5JH7 B;  4LF6 O;  3T1C A;  3QO5 A;  4QIW F;  3T4D A;  3AG4 B;  4JI6 O;  4LH6 A; 
#chains in the Genus database with same CATH homology
 1WA8 B;  3GWK C;  2VRZ A;  2AZ0 A;  2AZ2 A;  4LWS A;  3TXS A;  3FD9 A;  4I0X A;  3OGI B;  3G80 A;  2VS0 A;  2KG7 B;  2B9Z A;  3FAV A;  4GZR B;  3HR0 A;  3TXQ A;  3GVM A;  4ABM A;  2KG7 A;  3FAV B;  1WA8 A;  3O9O A;  4I0X B;  3Q4H A;  3Q4H B;  3ZBH A;  4LWS B;  2DE0 X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...