2HEPA

Solution nmr structure of the upf0291 protein ynzc from bacillus subtilis. northeast structural genomics target sr384.
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
42
structure length
42
Chain Sequence
MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords UPF0291 protein ynzC
publication title Solution NMR structure of the SOS response protein YnzC from Bacillus subtilis
pubmed doi rcsb
source organism Bacillus subtilis
total genus 14
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2006-06-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05979 DUF896 Bacterial protein of unknown function (DUF896)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.540 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix hairpin bin 2hepA00
2ZNIA 2RQ6A 3VQWA 1O9HA 3ZEDA 4CS4A 2R70A 5K1XA 2Q7HA 2ZCEA 3BHPA 4CH3A 2ZNJA 2YI9A 2PUSA 4CH6A 4TQFA 3VQVA 2ZIMA 4CH5A 2YIBD 2PGGA 3VQXA 2R72A 2ZINA 2HEPA 2E3CA 2ZIOA 3DSQA 4CH4A 4TQDA 4ZIBA 2JVDA 2Q7GA 4CS3A 2YIBA 2RJZA 1G6UA 1O9GA 5K1PA 2YI8A 3VQYA 4CS2A 2YIAA 4Q6GA 4BW9A 4BWAA 2QJ1A 3QTCA 2Q7EA
chains in the Genus database with same CATH superfamily
1SRYA 2KG7B 2WSSG 1NTMH 1IBLO 3F5WC 4FFBA 3FD9A 4ZHQB 4DR6B 2ZNJA 2FYUH 1N34B 1DF4A 1B3QA 3IGAC 4X62O 2QWOB 2HP8A 4UUJC 3ETGA 1NI8A 1YTFB 1MZEA 4X9QA 4DW1A 2YDEA 3C3SA 4IIJB 1YITV 1UJWB 2RQ6A 2K1EA 2LW1A 3QG5A 1IX9A 2EZOA 5B1NA 1XNRB 4LF9O 2QDOA 5KX5B 3KCXA 1YJWV 1H8HG 4C7UA 2NN4A 4B3MO 2VQFB 5LMUO 2JGDB 1DK1A 2IH1C 1FD9A 5LHGA 1QR8A 4NKGB 1NVPD 2Y4UA 4P30A 4KHPO 1YSCA 2YEVB 4PJ0Z 3G67A 3CCVV 4K0KB 5IE9A 1MSWD 3JCUZ 3AK2A 4DR7O 1GM7A 2LO1A 4JI0O 2QM8A 1EN6A 3RVZA 4DV2O 5K1PA 3WG7B 1IZ3A 5B1BB 4P2ZA 1AROP 1COWG 4DUYB 4OX9O 3CD6V 3EVKA 3CCRV 2XASA 1Y67A 1QU7A 1BS3A 3L71H 2LFSA 1H2LA 4FLTA 2FB5A 3ABKC 1Q5OA 2A0LA 3T4ZA 5BR8B 1V9PA 1XOUA 1K97A 4O4JA 1FFXB 2V7QG 4BW5A 1AR1B 2EINB 3SYAA 1NU1H 4NVPA 2Q6AA 3L9DA 1KKDA 5GONA 5EZYB 3Q4HB 3LNNA 2PZSA 5GTIZ 3UQ8A 1LR1A 2Q7GA 2P06A 3A0RA 4DV7O 1S72V 3M8AA 1AR5A 4CC6A 2P5OA 4B3RO 2CUGA 5KUMA 2QWNB 5J9PC 3SPIA 1RSOA 3LDEA 3ZJZA 3ZRWA 1M57B 1VEWA 1TUBB 2AW9A 2EILB 4JI4O 4AQYB 1IBKB 2M6YA 4UV8A 4UXNA 2GUZA 4X8AA 3ZHVA 1FYJA 4PELA 1R3KC 4LWSB 4GX1A 4JI1B 2IM9A 3BY6A 2HEPA 5EYPB 3J7AU 1VQOV 4NB5A 3U11A 4Q20A 4EB6B 4ICGA 4PA9A 4X1IB 1IURA 1OCOC 1HNZO 3ASOB 1M56C 3RT3C 4MVRA 1RP3B 4ZBMA 4FFKA 1FXHA 1YXBA 2Q73A 2HLDG 2ZNIA 2QKAA 4DR6O 2X6CA 5JWPA 2R70A 3JALA 5EIBD 3RYIB 4G27B 5J2UA 4MVOA 3TK1A 4MVSA 2YSUB 2DOSA 4GKKB 4I55B 2ZR2A 1K5QA 4FLVA 1JJOA 4PA3A 2F1MA 3B77A 4DV1B 2ZXWC 3MAQA 3DXRA 3G71V 2UXDO 3ABUA 1F4NA 5L3FA 3RYCB 2ZIMA 2YXYA 3ABMB 3T1HO 2Q9LA 4BAYA 5BXZA 4NTXA 4RO2A 4FK5C 4BWAA 4YHHO 1H8EG 2DN9A 2WLIA 3BA8A 1WAZA 2IU3A 3QTCA 2Q8VA 3HKDA 4FJCC 5KUKA 4JYYA 4X1YA 3N27A 4J11A 3SPCA 5LHHA 4X1KB 3UT5B 3IAYA 5GW7A 1TUEB 5J2TA 3JARB 5B1AB 2LQTA 1XBLA 4JASA 5IYZB 3JCZA 3SPHA 3JATA 3OUFA 1YCIA 2OIGA 3JAKB 3CRQA 5LOVA 3CSXA 2BE3A 1OCZB 2X6BA 1BE3H 1ZWIC 3DC6A 1OCRB 1YF2A 1VP7A 1Z2GA 2ITCC 4NR1A 4G2KA 4DV4O 5BR8O 2QTSA 2B1IA 4MVMA 2GTAA 2XAHA 1SQGA 2Y0IA 3ABLC 5DM6V 5IYDO 4JI6B 2A7WA 4FLXA 3IC7A 4ZI7A 4YY3O 1ZL8A 4KFMA 2VQEB 4GLXA 1FXKB 2YXHA 1M9NA 2W6IG 4FZ1A 5H6QA 1PV0A 3STZC 1E79G 2KKWA 2ADQB 3OMNB 1Y74A 1K4CC 1AP6A 1WB7A 4QJFB 4XDLA 1SQFA 3UCSC 4O2BB 4ABMA 1U96A 3FFQA 5B3SC 1S5LZ 2OYQA 4PA7A 2F23A 4JV5O 2NLJC 3IFXA 1IBLB 1VQKV 2ETNA 1LUVA 4CC5A 1PL4A 2DJVA 2A9HA 1KYOF 3O65A 4X88A 3LDDA 4FM1A 1IBKO 4B7EA 2JEXA 3THOA 2V4DA 2BCCH 3E2EA 2Z0AA 3BFRA 3JYCA 1B04A 1SQVH 4LBEC 1Q86W 4FLZA 2EX3A 4LF6B 3BABA 3P3PA 3LSUA 4JI1O 4UCUA 1KB9F 1XMOO 4UCVA 4LF9B 1XQ8A 5IJ9B 3F5TA 3RYHB 4MTOA 1GMGA 5B66Z 2HJDA 3BAAA 4W4KA 2WPDG 2EZPA 1TVKB 3K5LA 1Y4MA 4WFHA 1KP2A 2OT5A 5CA0A 2OWOA 1Z5VA 2F4VB 2DYSB 4AI8A 1AJQA 3AG4C 2KQXA 4KHPB 2P90A 1ZLZA 5CB4A 2BTQB 1NR1A 1VIBA 2UXCB 2A06H 2HKOA 2P67A 1AVMA 4HNAA 4DV2B 2OCHA 1KU9A 5H6RA 3N2GA 4X65B 5FNVA 1GN4A 2PYLA 1ZSPA 2ARHA 4GKKO 3C90A 3P3NA 3JAMN 5IY5C 1B6QA 5H5NA 4OPHA 1S3JA 5C93A 1MSDA 1AJPA 4B3TB 1H2KA 1US6A 2X6AA 4JI5O 2AZ2A 4TV9B 4F4LA 5JVDB 4YXWG 1Q3EA 3SPGA 4WBNB 3ABTA 1X59A 4O4LA 2PYJA 5JH7A 5LXTA 4DV7B 1HNWB 4RQEA 3AEIA 3BA9A 5DN6G 3HKEA 1YHQV 4JI2B 5H2FZ 1H38A 4B3RB 2WLNA 3LUTB 4OGQB 3LSSA 2QTOA 3DTUB 4H13B 5E1AC 2QWPB 3OUSA 1YJNV 4I0XA 3TGUH 3GB7C 1V55C 1SC5B 2HFEC 4CS2A 1NJIW 4MVQA 1JVMA 4JI4B 4O4JB 3K08A 1K5SA 3E89A 4I7ZB 3ZMTA 3ICXA 3ML0A 1G1XB 2YC0A 4B3SO 3ABKB 3W7WA 1R1BA 2JK5C 4BIOA 3SJBC 4IYIA 4GT1A 3RVYA 5JJJB 3K5MA 1L8DA 3D3QA 4JI6O 3STLC 5H9CA 1Y76A 4LNUA 3VQWA 1JJ2U 4H44B 2ATKC 4NTWA 4FPPA 4TUYB 3AG1B 4JI8O 2RN9A 2DE0X 3CE2A 5DECA 3VQXA 4YJ2B 1THZA 2IU0A 4TV8A 5LL6Y 2QWRB 4FMTA 3ZMUA 1WPXA 5KA6A 4TOIA 5EBMC 5KAFZ 2QEXV 5B5EZ 3WB0A 3VOUA 4X20B 3AG2C 1HW7A 1HDJA 2PF4E 3CCSV 1Y6XA 3CXCU 3WB2A 4UB8Z 3JAWA 3ZCCA 2B5UA 1H2NA 1RM1C 2YIBA 3TJTA 1EZJA 3G80A 1A32A 3W7TA 4JYAB 1D5AA 3OMIB 3ETQA 2LP7A 4LF6O 1S0VA 3E22B 3H1KH 2ZD9A 3CRCA 3AG3C 3MHSC 4TQFA 3JD2A 2UXDB 4O4IA 3SYOA 4QNHB 3K79A 4KXRA 1SQQH 2Q0AA 5EK0A 1DF5A 4LF8B 3JD1A 4I9QA 3T1HB 1KKCA 2F4VO 1YI2V 2Y48A 1VQ4V 3LNMB 4YHHB 4A5UB 4EFEA 4LFBO 2YIDA 3FAVA 5CA1A 1MABG 5FL7G 3RN4A 4DR2O 1SA0B 2XNDG 2DWDC 4HYOA 1KD1W 1SQBH 2UXCO 2EJRA 5L3GA 1TA8A 4EEQA 4LF4B 4ZIBA 1GH6A 4AHCA 3K03A 2JVDA 1QLEC 4U3JA 2GDSA 3KCYA 5IYBO 3OR7C 1JOYA 1HP8A 4X65O 3JASA 4DRXB 5LGNA 4MTGA 4MVUA 1WA8A 2NR5A 1KP3A 2HJFC 3DXRB 1M90W 2QM4A 4ZOLB 2CTRA 3FB8C 2IW5A 3FB6C 3J80N 3UO3A 2XAGA 2R9AA 4I4TB 3CPWU 2N74A 3JD4A 4DV4B 4B3TO 5IT9N 2ZXWB 4LFAB 4GCZA 3ZN0A 4J7KA 3ZEDA 4CS4A 4FLYA 4L87A 1YTFD 2ZE8A 4X1YB 3B2EE 4ZKIA 2JIZG 2LGQA 4YY3B 3QO5A 1BQ0A 1NH2B 1PM9A 2R9IA 5IJ0A 3ZIAG 4O2AA 1NT2B 5AG2A 1ENVA 1H2MA 3OGCC 1J5EO 1G6UA 3T4DA 2YI8A 1CEZA 3X2QC 4HBNA 3E86A 1HNWO 1AI6A 3G4SV 4JI2O 5B1OA 1M93A 3S3WA 1Q43A 2LFRA 1QVGU 4UB6Z 3CHXA 3CC7V 3CRMA 4JV5B 1N33B 4DXWA 1X4TA 3DC5A 3S3XA 4MSWC 1AR4A 1GN3A 3CXHF 2CTQA 4MVZA 1WPBA 3K59A 1V54B 2D2CB 4JAVA 3MDSA 3T1CA 2QM7A 4O4HB 1IBMO 3OMAB 2CTPA 3AK1A 2UUBO 1ZL8B 2PGGA 3K5OA 4XDJA 1XMOB 2Y4TA 3ASNB 1K4DC 1O9GA 1FS0G 2KG7A 1M4UA 4AILC 1I7FA 5JQGB 2YUAA 4ZHQA 2Q67A 4F6EA 1OHHG 4DR5O 4PHZA 5F2VO 1K73W 4F6RB 4JGSA 2ZE5A 4U7NA 2WA3A 1AILA 1N0JA 3RYFA 4EFBA 1FPOA 2QA4V 2UXBB 2YICA 3FYEB 3TXQA 1VQ7V 5KX5A 1NH2D 1P7BA 4QPJA 4R7CA 3CYOA 3UKMA 1KQSU 2ZCEA 1TAEA 3L75H 2B9ZA 4QE7A 2H3OA 5CA3A 2JGDA 1F7YA 2VWJA 1U97A 4JYAO 3APQA 2YEVA 4K35A 3WG7C 3E8BA 3KKYA 4PDMA 2M7WA 5IWAO 2CH7B 4MTFA 4JI5B 1QLNA 3H1IH 1S76D 5LA6B 2RMKB 3OE7G 1YZBA 4I50B 2UUCB 2H8PC 4JF3A 4MW3A 1XDCA 3CJHB 3BRCA 1GN2A 4DYLA 4LF8O 1K7DA 2JRIA 5KHHA 5CB4B 1I08A 1QQCA 4BIZA 2GHYA 3W7UA 4WFFA 3AG4B 4CBCA 1OCCC 5LYJA 4DV5B 4PDVA 1N0NA 4L8JA 2EINC 2KSDA 1DGSA 2WLHA 4UFZA 4PDLA 5BY1A 3VQVA 5FNVB 1WB8A 4B7KA 3ZMVA 5JJEB 4LF4O 1JQ0A 3ZHUA 5A9GA 3E8HA 5ITZB 2R9RB 4MTXA 2ZR3A 1AI5A 5EIBC 5EZYA 1BHAA 2A3QA 4E2LA 1K8AW 3Q4HA 5LP6C 2IJHA 5EC2C 4WCEV 3BHPA 1SESA 2YI9A 3CCMV 5IY5B 3PJSK 4KP4A 3K04A 3IJ4A 1URFA 1PNLA 2EBOA 4DUZO 2ZT9B 1KC8W 1M57C 1Q82W 4B3SB 5LP6A 5IDJA 4LFAO 5L3EA 2JJ1G 1JCHA 1GRJA 2O57A 1LUWA 2X7RB 3CMEV 2OTJV 3BVOA 4JPRA 1TUBA 1BT8A 1I5YA 3J81N 2Z3YA 3ZRVA 4GKJB 2EIMB 1MA1A 2W0XA 3HKEB 3OD4A 3K3WA 5JCOC 1WJZA 4JI8B 3B8MA 3CRRA 5KMGB 4I0XB 4K8ZA 5A2QN 2JDIG 5L3BA 2W6JG 5JCOA 1QBZA 3ASOC 3HKCA 4QPKA 4X66O 3CC4V 1N33O 2ZE6A 1R73A 4RUEA 4EB6A 1NTZH 1V55B 2Q5ZA 3SJCC 2AXTZ 3E8FA 2P7TC 4WFAV 2DYRB 1L1FA 4MS2A 1Q6UA 5FPRA 3OEEG 3L72H 4LNUB 2DWEC 2P22C 2HVJC 4IHJB 5BMVB 1SF9A 4DV0O 1I94B 2P6JA 3ZRXA 3H1LH 4P9OA 4CS3A 1YJ9V 2BTOA 3OTFA 3C3TA 3ZMZA 1SQXH 4LF5O 3RYIA 2QKCA 1RPRA 2EIJB 1E1QG 3F7VC 4I55A 4LFBB 1Q81W 3A8TA 3LDCA 4FFBB 1N8RW 2RNBA 4DR2B 3K58A 1SQPH 2UXBO 1XHZA 3JD3A 3AG2B 4DV6B 1BMFG 3M7MX 4U7OA 2BSKA 5EBLC 1PD3A 2F93B 1W0JG 1Y66A 3RYCA 1G4YB 5K1XA 1SZTA 1GM8A 1DTOA 4TSFG 3HB3B 2WA4A 5BZBA 1W0KG 3NR7A 1VQNV 1PL0A 3JD0A 4PI0A 4LH6A 5B1AC 4JTAB 1M1KW 1IXMA 1YDXA 3KG2A 4NXMO 2CTWA 3FX7A 3FYIB 1O9HA 4NTYA 4X1KA 1OCZC 1XL6A 2UUCO 3JARA 4GX2A 1ROPA 2HHHO 2QWQB 3GVMA 4J10A 3JAKA 4IYHA 3UO2A 2ZIOA 4LFCB 2L6LA 3RFRA 1AB3A 4UVCA 1UFIA 3BPZA 4WF9V 3JSNA 1J5EB 4H37A 4DV5O 1VQ5V 3R65A 1EM1A 3G6EV 3HR0A 4X64B 1N36O 1JMKC 4IT5A 3L74H 4Z2WA 1GK9A 3I56V 5FLXN 3ZHTA 1YIJV 2F95B 4TQDA 3CS5A 1JFFA 1EZVH 2IJJA 4CZZA 1XI1A 4KL1A 4R50A 4LH7A 3OTOB 2IH3C 2E5LB 3I55V 1GM9A 5GTHZ 1E1RG 4PI2A 4CH3A 1K92A 2V1DA 2YIBD 3H01A 2ZKOA 1IBMB 5GONB 3ZHQA 1PP9H 5FPOA 2UUBB 3WU2Z 2N04A 4U3FH 2KB1A 4O2BA 4O2AB 3ZBHA 2QGNA 3GWKC 3CCQV 1Q6IA 3HPLC 5LGUA 2WLJA 1S5JA 5TISZ 4GKJO 1W59A 3CC2V 4DR5B 1DLBA 4KUMA 2EULA 2MK3A 1RSOB 3K5NA 1XEQA 3ZRWB 2JJ2G 1XNQB 4DR4B 2Y69C 3F7YC 1Q6HA 3N2KA 4W4LA 2Q7EA 1GKFA 5IJ9A 3RYHA 4LF7B 1BZKA 3W7XA 1RFYA 3D3IA 1TVKA 3BEHA 1NTKH 3QF7A 2GUZB 1GN6A 2Z5UA 1VQ8V 2WAMA 1XREA 3ZX6A 1JPXA 2XAFA 3K9AA 1KECA 1VF5B 1WP8A 5C8YA 1YVWA 2BTQA 3CB2A 4R6ZA 3WB1A 1XMQB 5IWAB 3ZHRA 1WP7A 3PN1A 2XT9A 1I94O 1N4CA 4CH5A 1KMIZ 2CDYA 5LGTA 1I5XA 1Q7YW 2OIEA 3CWBH 4CH4A 1NKDA 1XL4A 3RYFB 1T5EA 1OCOB 5IYCO 3K0GA 4DW0A 2YIAA 1M56B 1IXBA 3HKBA 2ZM6O 1HR0O 1D5NA 5DEDA 1BCCH 2ILMA 2UU9O 5KAIZ 4GYCB 1SZXA 1TGOA 4FZ0A 3NXSA 3JALB 4YJ3A 3QO7A 1JA8A 4J42A 4DV6O 5J2UB 2XUMA 2AHYA 2PI5A 5KHKA 4TWKA 2NNUA 4TV9A 1GAXA 4NXNO 1BL8A 5JVDA 2CAZC 3OR6C 3U0ZA 1ZUQA 4LP8A 5CBHA 4PDRA 2XAJA 4WBNA 2Q69A 4QIWF 1CXZB 3APOA 1P7GA 2CK3G 2FL4A 3OFNG 2EIKC 4DV3B 1ZX3A 2WLMA 4I9WA 4QGPA 4DUZB 1VQMV 1N32O 3LSQA 1NQTA 1WN7A 3CEIA 1ZTEA 3KZIZ 3K57A 3QVNA 4BIUA 2F66C 2WLIB 4UVBA 2UUAB 3EXAA 1QCEA 3HKDB 5LYJB 1XHXA 3P30A 1JR9A 1WNSA 2WLLA 3EFFK 4LFCO 5EC1C 2PI4A 4PA4A 4IL6Z 3RW0A 4B08A 1OCCB 5J2TB 4N23A 4RQFA 1KUQA 1S5HC 3RGBA 3BCCH 5D5PA 2OCCC 2ZDIC 3L73H 3JATB 4X64O 1VQPV 5LOVB 5KHGA 2Q4PA 4JAAA 4X66B 3AG1C 1ZAUA 4DR3O 4WFBV 1PPJH 3OEHG 2ZDIA 2Q68A 1NR7A 1H2GA 1SS3A 2RJZA 1F51A 1P84F 4Q6GA 3OTOO 2D3OW 1VQ6V 2E5LO 5LP6B 3CRAA 2JS3A 4TUYA 4X89A 3FKSG 4XBFA 4D6TH 4D7SA 4NYKA 4YJ2A 3SR2C 1FJGO 3QO8A 3RBZA 1QNMA 4ZI7B 3H1HH 1F23A 1F4MA 1R6NA 2ADPA 5EBWC 2JS5A 4DV0B 3ABLB 4JTDB 3B09A 3T2MA 5HFMA 1K34A 4X20A 3D36C 4TT3G 4JYBA 4I5SA 3E8GA 2FMLA 1Y74B 3M99B 2IJIA 3TETA 2Y0PA 1XILA 2ZE7A 2AGAA 4LF5B 4UCTA 2UXXA 3ZN1A 5HFLA 4UCRA 2XHBA 1Q90D 1I0HA 1S77D 3D36A 2E75B 1NZ6A 3HKCB 5KHJA 4IIJA 2QKSA 4DR1B 4R8CA 1XNQO 4DR4O 1IDSA 3SJQC 5B3SB 3E22A 4BR6A 4GX5A 4DK0A 5L3CA 3AG7A 4FVMA 4LF7O 2EJ7A 5LMNO 4N21A 2CGOA 4JI3O 4JTCB 2E3CA 3DSQA 4PD4F 2PTMA 1P49A 2VRZA 5LHIA 2K9PA 4MW8A 2QJ1A 1FXVA 2QSAA 2BOCC 3OW2U 5B1BC 1SA0A 1N34O 1XMQO 1MG1A 1P4RA 3SYCA 4NXMB 3CCJV 3ZMSA 5CA0B 4CH6A 2P4KA 4JZGA 4IGGA 4Z1VA 5LBQA 2CE4A 5CBFA 3SPJA 3ZRSA 2CGNA 4UCOA 2HHHB 4RWUA 3FB5C 1HNXB 2P4VA 2WWWA 5D5QA 5L3DA 4DRXA 3IC9A 1R3IC 3R66A 1XNRO 3FB7C 4PV1B 2A79B 1VF6C 2W0FC 2BSKB 4ZOLA 4HNAB 1MMMA 2DMXA 1QHTA 4J7JA 3N2GB 4I4TA 1N36B 3B40A 3K9SA 2GSMB 1LNQA 2VQFO 1VF6A 1VQ9V 3G6BA 3MD0A 1HWYA 1FFXA 3ZHSA 4JI7B 2JGUA 2UXNA 4WFEA 4UV9A 3CX5F 2PY5A 4K0KO 1ORQC 1EBOA 4Z1MG 1PNKA 3TXSA 3B8NA 2OTLV 4LC1A 4HAMA 3OM3B 4DV3O 3U10A 5CN0A 2Q0OC 1BGYH 2HG5C 2EILC 3SDLA 4DUYO 5CMUA 2AZ0A 3T1YB 4FM0A 3AK3A 4O4LB 2UUAO 3TCUA 4GX0A 1V54C 5JH7B 1SETA 2LJ2A 5LXTB 4LR3A 2PUSA 3QNEA 1XUQA 1EFRG 3EHBB 3A2FA 3OGIB 4GUNA 1R6KA 1R3LC 4JZ2A 3OT7A 4J41A 4J7ZA 2H94A 4FLWA 1OZ0A 3ASNC 1JFFB 4O4HA 4HZ3A 1BSMA 3H9VA 2ODMA 2DQ3A 1EN5A 3P32A 5JJNB 4JYCA 1AI4A 4LWSA 1G8MA 2DW4A 1CP9A 2VS0A 5EYPA 1L0NH 1AP5A 2N05A 2L35A 3UM7A 3K0DA 2C2AA 3SJAC 1SKVA 3GWOA 4X1IA 2XOKG 5JQGA 4H0LB 3ETEA 4BW9A 2XTAA 1GO3F 4F6RA 3W7SA 2RCVA 1Y76B 2WLKA 2GV9A 1R3JC 4DO2A 3WFVA 2IBZH 1K33A 2R72A 1MNGA 4AQYO 2X0LA 3L70H 4X62B 1MOFA 4FLUA 1AI7A 4DK1A 4TV8B 1VARA 2LGWA 4UCSA 3N2KB 2ZM6B 4J9ZB 3CCLV 1HR0B 4FM2A 4DR1O 4K3AA 2UU9B 1UPGA 2ZINA 1SERA 1FAFA 2Y69B 2ZQMA 3ABMC 3JAWB 1FKAO 4B3MB 1FFTB 3JSLA 3VQYA 1BQZA 2CH7A 5CBGA 5LMUB 1OJHA 5LA6A 1VMGA 2HVKC 4OXSA 4NXNB 4I50A 2BOBC 3SYPA 3ETDA 1B06A 3CJHA 5E79Z 1YEWA 5C8YB 4JAUA 3B4SA 4E4EA 1Z5WA 1RM1B 1JX9A 2AHZA 4P9PA 4DR7B 1KBHA 4O4IB 3A0BZ 4JI0B 1R6TA 3O9OA 1K9MW 4H33A 2JEUA 1N32B 2FKXA 3H1JH 2ITDC 3VBBA 3AG3B 3UT5A 3HKBB 2Q7HA 5KLVH 4OX9B 1BHBA 4XDKA 5KHIA 3CP1A 4RUFA 2HR3A 1OCRC 3RWRD 1Q8IA 1WLEA 4MT8A 5ITZA 1H2SB 1HNXO 3SYQA 3FAVB 5IYZA 5CA1B 4QE9A 4FIPC 2IJKA 4YIOA 2FTKA 4YJ3B 4DV1O 4WFGA 4EKWA 1W2BU 1NS1A 4K8XA 1NBMG 4U3JB 3OAAG 4J9YB 2MW2B 3JASB 4RAIA 1EN4A 1WA8B 2YXLA 2E76B 3CCEV 1J95A 1QLEB 2EIMC 1FXKC 4JI7O 2F43G 1QVFU 3DGEA 4DR3B 2XAQA 2B1GA 1M5IA 1RPOA 3ZS8C 3SGIA 1L0LH 1FXKA 3K06A 2GBOA 4UVAA 3MHHC 2EIKB 5KMGA 2GTSA 1FJGB 5KA5A 1K3EA 2WLLB 1D2DA 3T1YO 5IJ0B 3A0HZ 4D7TA 1VQLV 4GZRB 1VF7A 2DYRC 1CPYA 1MZFA 3D8CA 4ASUG 4G28B 4J80A 2LW7A 2VWKA 1NVPB 2DQ0A 3E83A 1IVSA 2QR4A 3X2QB 1AJNA 2OCCB 2RDCA 4IHJA 2E74B 1GTOA 5BMVA 1HNZB 2VQEO 4YIPA 1OV9A 1PNMA 4PA6A 2DYSC 2EIJC 3I5DA 4LCUC 2QE7G 3CCUV 2G38A 2YS8A 5LMNB 1PKXA 4JI3B 3CMAV 1QR9A 4OPAA 3E35A
chains in the Genus database with same CATH topology
4TUYA 3N2GA 4X65B 5LP6C 4FFBA 3BHPA 5FNVA 4D7SA 4ZHQB 2ZNJA 4YJ2A 4DR6B 2YI9A 3SR2C 2PYLA 1N34B 4ZI7B 2JS5A 4DV0B 4B3SB 5LP6A 4X20A 4IIJB 4B3TB 2RQ6A 3QG5A 4TV9B 1XNRB 4LF5B 4UCTA 1TUBA 5KX5B 2XHBA 4UCRA 5JVDB 4GKJB 3HKCB 3HKEB 5KHJA 4IIJA 5JCOC 4JI8B 1Q3EA 4WBNB 4DR1B 4O4LA 2VQFB 5KMGB 2PYJA 4K8ZA 5JH7A 5LXTA 3E22A 4DV7B 5JCOA 4DK0A 4FVMA 3HKCA 1HNWB 3BA9A 3HKEA 4JI2B 4B3RB 4K0KB 4EB6A 2E3CA 3DSQA 3SJCC 5K1PA 2PTMA 1P49A 4CS2A 2QJ1A 4JI4B 4DUYB 4O4JB 5FPRA 1SA0A 4LNUB 4NXMB 2P22C 4IHJB 5BMVB 5CA0B 3ICXA 4CH6A 1I94B 3SJBC 2HHHB 4UCOA 4FLTA 1HNXB 5JJJB 4CS3A 5D5QA 1Q5OA 3K5MA 1L8DA 5BR8B 1V9PA 2BTOA 4DRXA 3OTFA 4O4JA 1FFXB 4LNUA 3RYIA 3VQWA 4NVPA 4ZOLA 4HNAB 1QHTA 5GONA 5EZYB 4TUYB 4I55A 3N2GB 4LFBB 4I4TA 4FFBB 1N36B 3VQXA 4YJ2B 3LNNA 2PZSA 4DR2B 4TV8A 3K58A 3UQ8A 2Q7GA 1FFXA 1XHZA 4JI7B 2JGUA 4DV6B 4TOIA 3M7MX 3WB0A 4CC6A 4X20B 2F93B 2P5OA 1HW7A 3RYCA 2PY5A 5K1XA 1RSOA 3WB2A 3JAWA 1TUBB 3U10A 2YIBA 4AQYB 4PI0A 1IBKB 4LH6A 4JYAB 3T1YB 1D5AA 4FM0A 4O4LB 3ETQA 1O9HA 4X1KA 5JH7B 5LXTB 4LR3A 3E22B 2PUSA 3JARA 4TQFA 2UXDB 3A2FA 4O4IA 4JI1B 2IM9A 5EYPB 2HEPA 3JAKA 2ZIOA 4LFCB 2Q0AA 3U11A 4EB6B 3RFRA 4LF8B 4I9QA 3BPZA 4X1IB 4FLWA 3T1HB 3JSNA 1J5EB 1JFFB 4O4HA 4YHHB 4EFEA 5JJNB 4X64B 1JMKC 5CA1A 5EYPA 1SA0B 3SJAC 1SKVA 4X1IA 1TA8A 5JQGA 4EEQA 4LF4B 2F95B 4TQDA 4AHCA 4ZIBA 2JVDA 1JFFA 4U3JA 4BW9A 1XI1A 4F6RA 4KL1A 4LH7A 3OTOB 2ZNIA 3JASA 4DRXB 2E5LB 2R70A 4PI2A 3JALA 4CH3A 2GV9A 5EIBD 3RYIB 5J2UA 2QM4A 4ZOLB 2YIBD 1IBMB 2R72A 5GONB 4GKKB 4I55B 4X62B 5FPOA 2UUBB 2R9AA 4I4TB 4DV4B 4O2BA 4FLUA 4FLVA 4DK1A 4O2AB 1JJOA 4LFAB 4TV8B 2F1MA 4DV1B 3ZEDA 4CS4A 3MAQA 4FLYA 1S5JA 4UCSA 3N2KB 2ZM6B 1HR0B 4X1YB 3B2EE 4FM2A 4DR5B 3RYCB 2ZIMA 4YY3B 2UU9B 2ZINA 5IJ0A 4O2AA 3K5NA 1NT2B 3JAWB 4B3MB 1XNQB 1G6UA 2YI8A 3JSLA 3VQYA 4BWAA 4DR4B 5LMUB 3BA8A 3N2KA 3QTCA 4HBNA 5LA6A 2Q7EA 3HKDA 4X1YA 4NXNB 4I50A 1M93A 5IJ9A 1Q43A 3RYHA 3CHXA 4LF7B 4JV5B 1YEWA 5C8YB 4X1KB 3UT5B 1N33B 3IAYA 1TVKA 1X4TA 1Z5WA 3QF7A 5J2TA 3JARB 4DR7B 4O4IB 4JI0B 5IYZB 3JATA 1WPBA 3JAKB 5LOVA 3K59A 3CSXA 1N32B 5C8YA 3UT5A 3HKBB 2Q7HA 4OX9B 2BTQA 3CB2A 4O4HB 3WB1A 5KHIA 1XMQB 5IWAB 3PN1A 4CH5A 3RWRD 1KMIZ 1Q8IA 2PGGA 5ITZA 1H2SB 3K5OA 5IYZA 5CA1B 1XMOB 4CH4A 3RYFB 1T5EA 1O9GA 1SQGA 4YJ3B 1M4UA 2YIAA 4AILC 1I7FA 5JQGB 4ZHQA 4JI6B 3HKBA 4K8XA 4U3JB 4FLXA 4PHZA 4ZI7A 4F6RB 2VQEB 4GLXA 3JASB 4GYCB 1TGOA 2YXLA 3RYFA 3JALB 4EFBA 4YJ3A 5J2UB 2KKWA 4DR3B 5KHKA 4TV9A 2UXBB 1M5IA 3ZS8C 1SQFA 5KX5A 3SGIA 5JVDA 2CAZC 4O2BB 3FFQA 3U0ZA 2OYQA 2ZCEA 1TAEA 4WBNA 1IBLB 4CC5A 5KMGA 4FM1A 1FJGB 2VWJA 4DV3B 3THOA 2V4DA 4DUZB 5IJ0B 1B04A 1WN7A 4D7TA 3K57A 4FLZA 1VF7A 2EX3A 2F66C 4JI5B 2UUAB 5LA6B 4LF6B 3HKDB 5LYJB 3BABA 1XHXA 4UCUA 4LF9B 4I50B 4UCVA 2UUCB 1XQ8A 5IJ9B 1WNSA 3RYHB 3BRCA 3BAAA 2VWKA 5KHHA 5CB4B 4B08A 1TVKB 1QQCA 3K5LA 5J2TB 4IHJA 3RGBA 5D5PA 5CA0A 5BMVA 2OWOA 1HNZB 1Z5VA 2F4VB 3JATB 5LYJA 4DV5B 4L8JA 5LOVB 5KHGA 1DGSA 4UFZA 3VQVA 4KHPB 4X66B 5FNVB 5JJEB 5CB4A 1ZAUA 2BTQB 5LMNB 2UXCB 4JI3B 2RJZA 5ITZB 4Q6GA 4DV2B 4HNAA 5LP6B 1KU9A 5EIBC 5EZYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZNI A;  2RQ6 A;  3VQW A;  1O9H A;  3ZED A;  4CS4 A;  2R70 A;  5K1X A;  2Q7H A;  2ZCE A;  3BHP A;  4CH3 A;  2ZNJ A;  2YI9 A;  2PUS A;  4CH6 A;  4TQF A;  3VQV A;  2ZIM A;  4CH5 A;  2YIB D;  2PGG A;  3VQX A;  2R72 A;  2ZIN A;  2HEP A;  2E3C A;  2ZIO A;  3DSQ A;  4CH4 A;  4TQD A;  4ZIB A;  2JVD A;  2Q7G A;  4CS3 A;  2YIB A;  2RJZ A;  1G6U A;  1O9G A;  5K1P A;  2YI8 A;  3VQY A;  4CS2 A;  2YIA A;  4Q6G A;  4BW9 A;  4BWA A;  2QJ1 A;  3QTC A;  2Q7E A; 
#chains in the Genus database with same CATH topology
 1SRY A;  2KG7 B;  2WSS G;  1NTM H;  1IBL O;  3F5W C;  4FFB A;  3FD9 A;  4ZHQ B;  4DR6 B;  2ZNJ A;  2FYU H;  1N34 B;  1DF4 A;  1B3Q A;  3IGA C;  4X62 O;  2QWO B;  2HP8 A;  4UUJ C;  3ETG A;  1NI8 A;  1YTF B;  1MZE A;  4X9Q A;  4DW1 A;  2YDE A;  3C3S A;  4IIJ B;  1YIT V;  1UJW B;  2RQ6 A;  2K1E A;  2LW1 A;  3QG5 A;  1IX9 A;  2EZO A;  5B1N A;  1XNR B;  4LF9 O;  2QDO A;  5KX5 B;  3KCX A;  1YJW V;  1H8H G;  4C7U A;  2NN4 A;  4B3M O;  2VQF B;  5LMU O;  2JGD B;  1DK1 A;  2IH1 C;  1FD9 A;  5LHG A;  1QR8 A;  4NKG B;  1NVP D;  2Y4U A;  4P30 A;  4KHP O;  1YSC A;  2YEV B;  4PJ0 Z;  3G67 A;  3CCV V;  4K0K B;  5IE9 A;  1MSW D;  3JCU Z;  3AK2 A;  4DR7 O;  1GM7 A;  2LO1 A;  4JI0 O;  2QM8 A;  1EN6 A;  3RVZ A;  4DV2 O;  5K1P A;  3WG7 B;  1IZ3 A;  5B1B B;  4P2Z A;  1ARO P;  1COW G;  4DUY B;  4OX9 O;  3CD6 V;  3EVK A;  3CCR V;  2XAS A;  1Y67 A;  1QU7 A;  1BS3 A;  3L71 H;  2LFS A;  1H2L A;  4FLT A;  2FB5 A;  3ABK C;  1Q5O A;  2A0L A;  3T4Z A;  5BR8 B;  1V9P A;  1XOU A;  1K97 A;  4O4J A;  1FFX B;  2V7Q G;  4BW5 A;  1AR1 B;  2EIN B;  3SYA A;  1NU1 H;  4NVP A;  2Q6A A;  3L9D A;  1KKD A;  5GON A;  5EZY B;  3Q4H B;  3LNN A;  2PZS A;  5GTI Z;  3UQ8 A;  1LR1 A;  2Q7G A;  2P06 A;  3A0R A;  4DV7 O;  1S72 V;  3M8A A;  1AR5 A;  4CC6 A;  2P5O A;  4B3R O;  2CUG A;  5KUM A;  2QWN B;  5J9P C;  3SPI A;  1RSO A;  3LDE A;  3ZJZ A;  3ZRW A;  1M57 B;  1VEW A;  1TUB B;  2AW9 A;  2EIL B;  4JI4 O;  4AQY B;  1IBK B;  2M6Y A;  4UV8 A;  4UXN A;  2GUZ A;  4X8A A;  3ZHV A;  1FYJ A;  4PEL A;  1R3K C;  4LWS B;  4GX1 A;  4JI1 B;  2IM9 A;  3BY6 A;  2HEP A;  5EYP B;  3J7A U;  1VQO V;  4NB5 A;  3U11 A;  4Q20 A;  4EB6 B;  4ICG A;  4PA9 A;  4X1I B;  1IUR A;  1OCO C;  1HNZ O;  3ASO B;  1M56 C;  3RT3 C;  4MVR A;  1RP3 B;  4ZBM A;  4FFK A;  1FXH A;  1YXB A;  2Q73 A;  2HLD G;  2ZNI A;  2QKA A;  4DR6 O;  2X6C A;  5JWP A;  2R70 A;  3JAL A;  5EIB D;  3RYI B;  4G27 B;  5J2U A;  4MVO A;  3TK1 A;  4MVS A;  2YSU B;  2DOS A;  4GKK B;  4I55 B;  2ZR2 A;  1K5Q A;  4FLV A;  1JJO A;  4PA3 A;  2F1M A;  3B77 A;  4DV1 B;  2ZXW C;  3MAQ A;  3DXR A;  3G71 V;  2UXD O;  3ABU A;  1F4N A;  5L3F A;  3RYC B;  2ZIM A;  2YXY A;  3ABM B;  3T1H O;  2Q9L A;  4BAY A;  5BXZ A;  4NTX A;  4RO2 A;  4FK5 C;  4BWA A;  4YHH O;  1H8E G;  2DN9 A;  2WLI A;  3BA8 A;  1WAZ A;  2IU3 A;  3QTC A;  2Q8V A;  3HKD A;  4FJC C;  5KUK A;  4JYY A;  4X1Y A;  3N27 A;  4J11 A;  3SPC A;  5LHH A;  4X1K B;  3UT5 B;  3IAY A;  5GW7 A;  1TUE B;  5J2T A;  3JAR B;  5B1A B;  2LQT A;  1XBL A;  4JAS A;  5IYZ B;  3JCZ A;  3SPH A;  3JAT A;  3OUF A;  1YCI A;  2OIG A;  3JAK B;  3CRQ A;  5LOV A;  3CSX A;  2BE3 A;  1OCZ B;  2X6B A;  1BE3 H;  1ZWI C;  3DC6 A;  1OCR B;  1YF2 A;  1VP7 A;  1Z2G A;  2ITC C;  4NR1 A;  4G2K A;  4DV4 O;  5BR8 O;  2QTS A;  2B1I A;  4MVM A;  2GTA A;  2XAH A;  1SQG A;  2Y0I A;  3ABL C;  5DM6 V;  5IYD O;  4JI6 B;  2A7W A;  4FLX A;  3IC7 A;  4ZI7 A;  4YY3 O;  1ZL8 A;  4KFM A;  2VQE B;  4GLX A;  1FXK B;  2YXH A;  1M9N A;  2W6I G;  4FZ1 A;  5H6Q A;  1PV0 A;  3STZ C;  1E79 G;  2KKW A;  2ADQ B;  3OMN B;  1Y74 A;  1K4C C;  1AP6 A;  1WB7 A;  4QJF B;  4XDL A;  1SQF A;  3UCS C;  4O2B B;  4ABM A;  1U96 A;  3FFQ A;  5B3S C;  1S5L Z;  2OYQ A;  4PA7 A;  2F23 A;  4JV5 O;  2NLJ C;  3IFX A;  1IBL B;  1VQK V;  2ETN A;  1LUV A;  4CC5 A;  1PL4 A;  2DJV A;  2A9H A;  1KYO F;  3O65 A;  4X88 A;  3LDD A;  4FM1 A;  1IBK O;  4B7E A;  2JEX A;  3THO A;  2V4D A;  2BCC H;  3E2E A;  2Z0A A;  3BFR A;  3JYC A;  1B04 A;  1SQV H;  4LBE C;  1Q86 W;  4FLZ A;  2EX3 A;  4LF6 B;  3BAB A;  3P3P A;  3LSU A;  4JI1 O;  4UCU A;  1KB9 F;  1XMO O;  4UCV A;  4LF9 B;  1XQ8 A;  5IJ9 B;  3F5T A;  3RYH B;  4MTO A;  1GMG A;  5B66 Z;  2HJD A;  3BAA A;  4W4K A;  2WPD G;  2EZP A;  1TVK B;  3K5L A;  1Y4M A;  4WFH A;  1KP2 A;  2OT5 A;  5CA0 A;  2OWO A;  1Z5V A;  2F4V B;  2DYS B;  4AI8 A;  1AJQ A;  3AG4 C;  2KQX A;  4KHP B;  2P90 A;  1ZLZ A;  5CB4 A;  2BTQ B;  1NR1 A;  1VIB A;  2UXC B;  2A06 H;  2HKO A;  2P67 A;  1AVM A;  4HNA A;  4DV2 B;  2OCH A;  1KU9 A;  5H6R A;  3N2G A;  4X65 B;  5FNV A;  1GN4 A;  2PYL A;  1ZSP A;  2ARH A;  4GKK O;  3C90 A;  3P3N A;  3JAM N;  5IY5 C;  1B6Q A;  5H5N A;  4OPH A;  1S3J A;  5C93 A;  1MSD A;  1AJP A;  4B3T B;  1H2K A;  1US6 A;  2X6A A;  4JI5 O;  2AZ2 A;  4TV9 B;  4F4L A;  5JVD B;  4YXW G;  1Q3E A;  3SPG A;  4WBN B;  3ABT A;  1X59 A;  4O4L A;  2PYJ A;  5JH7 A;  5LXT A;  4DV7 B;  1HNW B;  4RQE A;  3AEI A;  3BA9 A;  5DN6 G;  3HKE A;  1YHQ V;  4JI2 B;  5H2F Z;  1H38 A;  4B3R B;  2WLN A;  3LUT B;  4OGQ B;  3LSS A;  2QTO A;  3DTU B;  4H13 B;  5E1A C;  2QWP B;  3OUS A;  1YJN V;  4I0X A;  3TGU H;  3GB7 C;  1V55 C;  1SC5 B;  2HFE C;  4CS2 A;  1NJI W;  4MVQ A;  1JVM A;  4JI4 B;  4O4J B;  3K08 A;  1K5S A;  3E89 A;  4I7Z B;  3ZMT A;  3ICX A;  3ML0 A;  1G1X B;  2YC0 A;  4B3S O;  3ABK B;  3W7W A;  1R1B A;  2JK5 C;  4BIO A;  3SJB C;  4IYI A;  4GT1 A;  3RVY A;  5JJJ B;  3K5M A;  1L8D A;  3D3Q A;  4JI6 O;  3STL C;  5H9C A;  1Y76 A;  4LNU A;  3VQW A;  1JJ2 U;  4H44 B;  2ATK C;  4NTW A;  4FPP A;  4TUY B;  3AG1 B;  4JI8 O;  2RN9 A;  2DE0 X;  3CE2 A;  5DEC A;  3VQX A;  4YJ2 B;  1THZ A;  2IU0 A;  4TV8 A;  5LL6 Y;  2QWR B;  4FMT A;  3ZMU A;  1WPX A;  5KA6 A;  4TOI A;  5EBM C;  5KAF Z;  2QEX V;  5B5E Z;  3WB0 A;  3VOU A;  4X20 B;  3AG2 C;  1HW7 A;  1HDJ A;  2PF4 E;  3CCS V;  1Y6X A;  3CXC U;  3WB2 A;  4UB8 Z;  3JAW A;  3ZCC A;  2B5U A;  1H2N A;  1RM1 C;  2YIB A;  3TJT A;  1EZJ A;  3G80 A;  1A32 A;  3W7T A;  4JYA B;  1D5A A;  3OMI B;  3ETQ A;  2LP7 A;  4LF6 O;  1S0V A;  3E22 B;  3H1K H;  2ZD9 A;  3CRC A;  3AG3 C;  3MHS C;  4TQF A;  3JD2 A;  2UXD B;  4O4I A;  3SYO A;  4QNH B;  3K79 A;  4KXR A;  1SQQ H;  2Q0A A;  5EK0 A;  1DF5 A;  4LF8 B;  3JD1 A;  4I9Q A;  3T1H B;  1KKC A;  2F4V O;  1YI2 V;  2Y48 A;  1VQ4 V;  3LNM B;  4YHH B;  4A5U B;  4EFE A;  4LFB O;  2YID A;  3FAV A;  5CA1 A;  1MAB G;  5FL7 G;  3RN4 A;  4DR2 O;  1SA0 B;  2XND G;  2DWD C;  4HYO A;  1KD1 W;  1SQB H;  2UXC O;  2EJR A;  5L3G A;  1TA8 A;  4EEQ A;  4LF4 B;  4ZIB A;  1GH6 A;  4AHC A;  3K03 A;  2JVD A;  1QLE C;  4U3J A;  2GDS A;  3KCY A;  5IYB O;  3OR7 C;  1JOY A;  1HP8 A;  4X65 O;  3JAS A;  4DRX B;  5LGN A;  4MTG A;  4MVU A;  1WA8 A;  2NR5 A;  1KP3 A;  2HJF C;  3DXR B;  1M90 W;  2QM4 A;  4ZOL B;  2CTR A;  3FB8 C;  2IW5 A;  3FB6 C;  3J80 N;  3UO3 A;  2XAG A;  2R9A A;  4I4T B;  3CPW U;  2N74 A;  3JD4 A;  4DV4 B;  4B3T O;  5IT9 N;  2ZXW B;  4LFA B;  4GCZ A;  3ZN0 A;  4J7K A;  3ZED A;  4CS4 A;  4FLY A;  4L87 A;  1YTF D;  2ZE8 A;  4X1Y B;  3B2E E;  4ZKI A;  2JIZ G;  2LGQ A;  4YY3 B;  3QO5 A;  1BQ0 A;  1NH2 B;  1PM9 A;  2R9I A;  5IJ0 A;  3ZIA G;  4O2A A;  1NT2 B;  5AG2 A;  1ENV A;  1H2M A;  3OGC C;  1J5E O;  1G6U A;  3T4D A;  2YI8 A;  1CEZ A;  3X2Q C;  4HBN A;  3E86 A;  1HNW O;  1AI6 A;  3G4S V;  4JI2 O;  5B1O A;  1M93 A;  3S3W A;  1Q43 A;  2LFR A;  1QVG U;  4UB6 Z;  3CHX A;  3CC7 V;  3CRM A;  4JV5 B;  1N33 B;  4DXW A;  1X4T A;  3DC5 A;  3S3X A;  4MSW C;  1AR4 A;  1GN3 A;  3CXH F;  2CTQ A;  4MVZ A;  1WPB A;  3K59 A;  1V54 B;  2D2C B;  4JAV A;  3MDS A;  3T1C A;  2QM7 A;  4O4H B;  1IBM O;  3OMA B;  2CTP A;  3AK1 A;  2UUB O;  1ZL8 B;  2PGG A;  3K5O A;  4XDJ A;  1XMO B;  2Y4T A;  3ASN B;  1K4D C;  1O9G A;  1FS0 G;  2KG7 A;  1M4U A;  4AIL C;  1I7F A;  5JQG B;  2YUA A;  4ZHQ A;  2Q67 A;  4F6E A;  1OHH G;  4DR5 O;  4PHZ A;  5F2V O;  1K73 W;  4F6R B;  4JGS A;  2ZE5 A;  4U7N A;  2WA3 A;  1AIL A;  1N0J A;  3RYF A;  4EFB A;  1FPO A;  2QA4 V;  2UXB B;  2YIC A;  3FYE B;  3TXQ A;  1VQ7 V;  5KX5 A;  1NH2 D;  1P7B A;  4QPJ A;  4R7C A;  3CYO A;  3UKM A;  1KQS U;  2ZCE A;  1TAE A;  3L75 H;  2B9Z A;  4QE7 A;  2H3O A;  5CA3 A;  2JGD A;  1F7Y A;  2VWJ A;  1U97 A;  4JYA O;  3APQ A;  2YEV A;  4K35 A;  3WG7 C;  3E8B A;  3KKY A;  4PDM A;  2M7W A;  5IWA O;  2CH7 B;  4MTF A;  4JI5 B;  1QLN A;  3H1I H;  1S76 D;  5LA6 B;  2RMK B;  3OE7 G;  1YZB A;  4I50 B;  2UUC B;  2H8P C;  4JF3 A;  4MW3 A;  1XDC A;  3CJH B;  3BRC A;  1GN2 A;  4DYL A;  4LF8 O;  1K7D A;  2JRI A;  5KHH A;  5CB4 B;  1I08 A;  1QQC A;  4BIZ A;  2GHY A;  3W7U A;  4WFF A;  3AG4 B;  4CBC A;  1OCC C;  5LYJ A;  4DV5 B;  4PDV A;  1N0N A;  4L8J A;  2EIN C;  2KSD A;  1DGS A;  2WLH A;  4UFZ A;  4PDL A;  5BY1 A;  3VQV A;  5FNV B;  1WB8 A;  4B7K A;  3ZMV A;  5JJE B;  4LF4 O;  1JQ0 A;  3ZHU A;  5A9G A;  3E8H A;  5ITZ B;  2R9R B;  4MTX A;  2ZR3 A;  1AI5 A;  5EIB C;  5EZY A;  1BHA A;  2A3Q A;  4E2L A;  1K8A W;  3Q4H A;  5LP6 C;  2IJH A;  5EC2 C;  4WCE V;  3BHP A;  1SES A;  2YI9 A;  3CCM V;  5IY5 B;  3PJS K;  4KP4 A;  3K04 A;  3IJ4 A;  1URF A;  1PNL A;  2EBO A;  4DUZ O;  2ZT9 B;  1KC8 W;  1M57 C;  1Q82 W;  4B3S B;  5LP6 A;  5IDJ A;  4LFA O;  5L3E A;  2JJ1 G;  1JCH A;  1GRJ A;  2O57 A;  1LUW A;  2X7R B;  3CME V;  2OTJ V;  3BVO A;  4JPR A;  1TUB A;  1BT8 A;  1I5Y A;  3J81 N;  2Z3Y A;  3ZRV A;  4GKJ B;  2EIM B;  1MA1 A;  2W0X A;  3HKE B;  3OD4 A;  3K3W A;  5JCO C;  1WJZ A;  4JI8 B;  3B8M A;  3CRR A;  5KMG B;  4I0X B;  4K8Z A;  5A2Q N;  2JDI G;  5L3B A;  2W6J G;  5JCO A;  1QBZ A;  3ASO C;  3HKC A;  4QPK A;  4X66 O;  3CC4 V;  1N33 O;  2ZE6 A;  1R73 A;  4RUE A;  4EB6 A;  1NTZ H;  1V55 B;  2Q5Z A;  3SJC C;  2AXT Z;  3E8F A;  2P7T C;  4WFA V;  2DYR B;  1L1F A;  4MS2 A;  1Q6U A;  5FPR A;  3OEE G;  3L72 H;  4LNU B;  2DWE C;  2P22 C;  2HVJ C;  4IHJ B;  5BMV B;  1SF9 A;  4DV0 O;  1I94 B;  2P6J A;  3ZRX A;  3H1L H;  4P9O A;  4CS3 A;  1YJ9 V;  2BTO A;  3OTF A;  3C3T A;  3ZMZ A;  1SQX H;  4LF5 O;  3RYI A;  2QKC A;  1RPR A;  2EIJ B;  1E1Q G;  3F7V C;  4I55 A;  4LFB B;  1Q81 W;  3A8T A;  3LDC A;  4FFB B;  1N8R W;  2RNB A;  4DR2 B;  3K58 A;  1SQP H;  2UXB O;  1XHZ A;  3JD3 A;  3AG2 B;  4DV6 B;  1BMF G;  3M7M X;  4U7O A;  2BSK A;  5EBL C;  1PD3 A;  2F93 B;  1W0J G;  1Y66 A;  3RYC A;  1G4Y B;  5K1X A;  1SZT A;  1GM8 A;  1DTO A;  4TSF G;  3HB3 B;  2WA4 A;  5BZB A;  1W0K G;  3NR7 A;  1VQN V;  1PL0 A;  3JD0 A;  4PI0 A;  4LH6 A;  5B1A C;  4JTA B;  1M1K W;  1IXM A;  1YDX A;  3KG2 A;  4NXM O;  2CTW A;  3FX7 A;  3FYI B;  1O9H A;  4NTY A;  4X1K A;  1OCZ C;  1XL6 A;  2UUC O;  3JAR A;  4GX2 A;  1ROP A;  2HHH O;  2QWQ B;  3GVM A;  4J10 A;  3JAK A;  4IYH A;  3UO2 A;  2ZIO A;  4LFC B;  2L6L A;  3RFR A;  1AB3 A;  4UVC A;  1UFI A;  3BPZ A;  4WF9 V;  3JSN A;  1J5E B;  4H37 A;  4DV5 O;  1VQ5 V;  3R65 A;  1EM1 A;  3G6E V;  3HR0 A;  4X64 B;  1N36 O;  1JMK C;  4IT5 A;  3L74 H;  4Z2W A;  1GK9 A;  3I56 V;  5FLX N;  3ZHT A;  1YIJ V;  2F95 B;  4TQD A;  3CS5 A;  1JFF A;  1EZV H;  2IJJ A;  4CZZ A;  1XI1 A;  4KL1 A;  4R50 A;  4LH7 A;  3OTO B;  2IH3 C;  2E5L B;  3I55 V;  1GM9 A;  5GTH Z;  1E1R G;  4PI2 A;  4CH3 A;  1K92 A;  2V1D A;  2YIB D;  3H01 A;  2ZKO A;  1IBM B;  5GON B;  3ZHQ A;  1PP9 H;  5FPO A;  2UUB B;  3WU2 Z;  2N04 A;  4U3F H;  2KB1 A;  4O2B A;  4O2A B;  3ZBH A;  2QGN A;  3GWK C;  3CCQ V;  1Q6I A;  3HPL C;  5LGU A;  2WLJ A;  1S5J A;  5TIS Z;  4GKJ O;  1W59 A;  3CC2 V;  4DR5 B;  1DLB A;  4KUM A;  2EUL A;  2MK3 A;  1RSO B;  3K5N A;  1XEQ A;  3ZRW B;  2JJ2 G;  1XNQ B;  4DR4 B;  2Y69 C;  3F7Y C;  1Q6H A;  3N2K A;  4W4L A;  2Q7E A;  1GKF A;  5IJ9 A;  3RYH A;  4LF7 B;  1BZK A;  3W7X A;  1RFY A;  3D3I A;  1TVK A;  3BEH A;  1NTK H;  3QF7 A;  2GUZ B;  1GN6 A;  2Z5U A;  1VQ8 V;  2WAM A;  1XRE A;  3ZX6 A;  1JPX A;  2XAF A;  3K9A A;  1KEC A;  1VF5 B;  1WP8 A;  5C8Y A;  1YVW A;  2BTQ A;  3CB2 A;  4R6Z A;  3WB1 A;  1XMQ B;  5IWA B;  3ZHR A;  1WP7 A;  3PN1 A;  2XT9 A;  1I94 O;  1N4C A;  4CH5 A;  1KMI Z;  2CDY A;  5LGT A;  1I5X A;  1Q7Y W;  2OIE A;  3CWB H;  4CH4 A;  1NKD A;  1XL4 A;  3RYF B;  1T5E A;  1OCO B;  5IYC O;  3K0G A;  4DW0 A;  2YIA A;  1M56 B;  1IXB A;  3HKB A;  2ZM6 O;  1HR0 O;  1D5N A;  5DED A;  1BCC H;  2ILM A;  2UU9 O;  5KAI Z;  4GYC B;  1SZX A;  1TGO A;  4FZ0 A;  3NXS A;  3JAL B;  4YJ3 A;  3QO7 A;  1JA8 A;  4J42 A;  4DV6 O;  5J2U B;  2XUM A;  2AHY A;  2PI5 A;  5KHK A;  4TWK A;  2NNU A;  4TV9 A;  1GAX A;  4NXN O;  1BL8 A;  5JVD A;  2CAZ C;  3OR6 C;  3U0Z A;  1ZUQ A;  4LP8 A;  5CBH A;  4PDR A;  2XAJ A;  4WBN A;  2Q69 A;  4QIW F;  1CXZ B;  3APO A;  1P7G A;  2CK3 G;  2FL4 A;  3OFN G;  2EIK C;  4DV3 B;  1ZX3 A;  2WLM A;  4I9W A;  4QGP A;  4DUZ B;  1VQM V;  1N32 O;  3LSQ A;  1NQT A;  1WN7 A;  3CEI A;  1ZTE A;  3KZI Z;  3K57 A;  3QVN A;  4BIU A;  2F66 C;  2WLI B;  4UVB A;  2UUA B;  3EXA A;  1QCE A;  3HKD B;  5LYJ B;  1XHX A;  3P30 A;  1JR9 A;  1WNS A;  2WLL A;  3EFF K;  4LFC O;  5EC1 C;  2PI4 A;  4PA4 A;  4IL6 Z;  3RW0 A;  4B08 A;  1OCC B;  5J2T B;  4N23 A;  4RQF A;  1KUQ A;  1S5H C;  3RGB A;  3BCC H;  5D5P A;  2OCC C;  2ZDI C;  3L73 H;  3JAT B;  4X64 O;  1VQP V;  5LOV B;  5KHG A;  2Q4P A;  4JAA A;  4X66 B;  3AG1 C;  1ZAU A;  4DR3 O;  4WFB V;  1PPJ H;  3OEH G;  2ZDI A;  2Q68 A;  1NR7 A;  1H2G A;  1SS3 A;  2RJZ A;  1F51 A;  1P84 F;  4Q6G A;  3OTO O;  2D3O W;  1VQ6 V;  2E5L O;  5LP6 B;  3CRA A;  2JS3 A;  4TUY A;  4X89 A;  3FKS G;  4XBF A;  4D6T H;  4D7S A;  4NYK A;  4YJ2 A;  3SR2 C;  1FJG O;  3QO8 A;  3RBZ A;  1QNM A;  4ZI7 B;  3H1H H;  1F23 A;  1F4M A;  1R6N A;  2ADP A;  5EBW C;  2JS5 A;  4DV0 B;  3ABL B;  4JTD B;  3B09 A;  3T2M A;  5HFM A;  1K34 A;  4X20 A;  3D36 C;  4TT3 G;  4JYB A;  4I5S A;  3E8G A;  2FML A;  1Y74 B;  3M99 B;  2IJI A;  3TET A;  2Y0P A;  1XIL A;  2ZE7 A;  2AGA A;  4LF5 B;  4UCT A;  2UXX A;  3ZN1 A;  5HFL A;  4UCR A;  2XHB A;  1Q90 D;  1I0H A;  1S77 D;  3D36 A;  2E75 B;  1NZ6 A;  3HKC B;  5KHJ A;  4IIJ A;  2QKS A;  4DR1 B;  4R8C A;  1XNQ O;  4DR4 O;  1IDS A;  3SJQ C;  5B3S B;  3E22 A;  4BR6 A;  4GX5 A;  4DK0 A;  5L3C A;  3AG7 A;  4FVM A;  4LF7 O;  2EJ7 A;  5LMN O;  4N21 A;  2CGO A;  4JI3 O;  4JTC B;  2E3C A;  3DSQ A;  4PD4 F;  2PTM A;  1P49 A;  2VRZ A;  5LHI A;  2K9P A;  4MW8 A;  2QJ1 A;  1FXV A;  2QSA A;  2BOC C;  3OW2 U;  5B1B C;  1SA0 A;  1N34 O;  1XMQ O;  1MG1 A;  1P4R A;  3SYC A;  4NXM B;  3CCJ V;  3ZMS A;  5CA0 B;  4CH6 A;  2P4K A;  4JZG A;  4IGG A;  4Z1V A;  5LBQ A;  2CE4 A;  5CBF A;  3SPJ A;  3ZRS A;  2CGN A;  4UCO A;  2HHH B;  4RWU A;  3FB5 C;  1HNX B;  2P4V A;  2WWW A;  5D5Q A;  5L3D A;  4DRX A;  3IC9 A;  1R3I C;  3R66 A;  1XNR O;  3FB7 C;  4PV1 B;  2A79 B;  1VF6 C;  2W0F C;  2BSK B;  4ZOL A;  4HNA B;  1MMM A;  2DMX A;  1QHT A;  4J7J A;  3N2G B;  4I4T A;  1N36 B;  3B40 A;  3K9S A;  2GSM B;  1LNQ A;  2VQF O;  1VF6 A;  1VQ9 V;  3G6B A;  3MD0 A;  1HWY A;  1FFX A;  3ZHS A;  4JI7 B;  2JGU A;  2UXN A;  4WFE A;  4UV9 A;  3CX5 F;  2PY5 A;  4K0K O;  1ORQ C;  1EBO A;  4Z1M G;  1PNK A;  3TXS A;  3B8N A;  2OTL V;  4LC1 A;  4HAM A;  3OM3 B;  4DV3 O;  3U10 A;  5CN0 A;  2Q0O C;  1BGY H;  2HG5 C;  2EIL C;  3SDL A;  4DUY O;  5CMU A;  2AZ0 A;  3T1Y B;  4FM0 A;  3AK3 A;  4O4L B;  2UUA O;  3TCU A;  4GX0 A;  1V54 C;  5JH7 B;  1SET A;  2LJ2 A;  5LXT B;  4LR3 A;  2PUS A;  3QNE A;  1XUQ A;  1EFR G;  3EHB B;  3A2F A;  3OGI B;  4GUN A;  1R6K A;  1R3L C;  4JZ2 A;  3OT7 A;  4J41 A;  4J7Z A;  2H94 A;  4FLW A;  1OZ0 A;  3ASN C;  1JFF B;  4O4H A;  4HZ3 A;  1BSM A;  3H9V A;  2ODM A;  2DQ3 A;  1EN5 A;  3P32 A;  5JJN B;  4JYC A;  1AI4 A;  4LWS A;  1G8M A;  2DW4 A;  1CP9 A;  2VS0 A;  5EYP A;  1L0N H;  1AP5 A;  2N05 A;  2L35 A;  3UM7 A;  3K0D A;  2C2A A;  3SJA C;  1SKV A;  3GWO A;  4X1I A;  2XOK G;  5JQG A;  4H0L B;  3ETE A;  4BW9 A;  2XTA A;  1GO3 F;  4F6R A;  3W7S A;  2RCV A;  1Y76 B;  2WLK A;  2GV9 A;  1R3J C;  4DO2 A;  3WFV A;  2IBZ H;  1K33 A;  2R72 A;  1MNG A;  4AQY O;  2X0L A;  3L70 H;  4X62 B;  1MOF A;  4FLU A;  1AI7 A;  4DK1 A;  4TV8 B;  1VAR A;  2LGW A;  4UCS A;  3N2K B;  2ZM6 B;  4J9Z B;  3CCL V;  1HR0 B;  4FM2 A;  4DR1 O;  4K3A A;  2UU9 B;  1UPG A;  2ZIN A;  1SER A;  1FAF A;  2Y69 B;  2ZQM A;  3ABM C;  3JAW B;  1FKA O;  4B3M B;  1FFT B;  3JSL A;  3VQY A;  1BQZ A;  2CH7 A;  5CBG A;  5LMU B;  1OJH A;  5LA6 A;  1VMG A;  2HVK C;  4OXS A;  4NXN B;  4I50 A;  2BOB C;  3SYP A;  3ETD A;  1B06 A;  3CJH A;  5E79 Z;  1YEW A;  5C8Y B;  4JAU A;  3B4S A;  4E4E A;  1Z5W A;  1RM1 B;  1JX9 A;  2AHZ A;  4P9P A;  4DR7 B;  1KBH A;  4O4I B;  3A0B Z;  4JI0 B;  1R6T A;  3O9O A;  1K9M W;  4H33 A;  2JEU A;  1N32 B;  2FKX A;  3H1J H;  2ITD C;  3VBB A;  3AG3 B;  3UT5 A;  3HKB B;  2Q7H A;  5KLV H;  4OX9 B;  1BHB A;  4XDK A;  5KHI A;  3CP1 A;  4RUF A;  2HR3 A;  1OCR C;  3RWR D;  1Q8I A;  1WLE A;  4MT8 A;  5ITZ A;  1H2S B;  1HNX O;  3SYQ A;  3FAV B;  5IYZ A;  5CA1 B;  4QE9 A;  4FIP C;  2IJK A;  4YIO A;  2FTK A;  4YJ3 B;  4DV1 O;  4WFG A;  4EKW A;  1W2B U;  1NS1 A;  4K8X A;  1NBM G;  4U3J B;  3OAA G;  4J9Y B;  2MW2 B;  3JAS B;  4RAI A;  1EN4 A;  1WA8 B;  2YXL A;  2E76 B;  3CCE V;  1J95 A;  1QLE B;  2EIM C;  1FXK C;  4JI7 O;  2F43 G;  1QVF U;  3DGE A;  4DR3 B;  2XAQ A;  2B1G A;  1M5I A;  1RPO A;  3ZS8 C;  3SGI A;  1L0L H;  1FXK A;  3K06 A;  2GBO A;  4UVA A;  3MHH C;  2EIK B;  5KMG A;  2GTS A;  1FJG B;  5KA5 A;  1K3E A;  2WLL B;  1D2D A;  3T1Y O;  5IJ0 B;  3A0H Z;  4D7T A;  1VQL V;  4GZR B;  1VF7 A;  2DYR C;  1CPY A;  1MZF A;  3D8C A;  4ASU G;  4G28 B;  4J80 A;  2LW7 A;  2VWK A;  1NVP B;  2DQ0 A;  3E83 A;  1IVS A;  2QR4 A;  3X2Q B;  1AJN A;  2OCC B;  2RDC A;  4IHJ A;  2E74 B;  1GTO A;  5BMV A;  1HNZ B;  2VQE O;  4YIP A;  1OV9 A;  1PNM A;  4PA6 A;  2DYS C;  2EIJ C;  3I5D A;  4LCU C;  2QE7 G;  3CCU V;  2G38 A;  2YS8 A;  5LMN B;  1PKX A;  4JI3 B;  3CMA V;  1QR9 A;  4OPA A;  3E35 A; 
#chains in the Genus database with same CATH homology
 4TUY A;  3N2G A;  4X65 B;  5LP6 C;  4FFB A;  3BHP A;  5FNV A;  4D7S A;  4ZHQ B;  2ZNJ A;  4YJ2 A;  4DR6 B;  2YI9 A;  3SR2 C;  2PYL A;  1N34 B;  4ZI7 B;  2JS5 A;  4DV0 B;  4B3S B;  5LP6 A;  4X20 A;  4IIJ B;  4B3T B;  2RQ6 A;  3QG5 A;  4TV9 B;  1XNR B;  4LF5 B;  4UCT A;  1TUB A;  5KX5 B;  2XHB A;  4UCR A;  5JVD B;  4GKJ B;  3HKC B;  3HKE B;  5KHJ A;  4IIJ A;  5JCO C;  4JI8 B;  1Q3E A;  4WBN B;  4DR1 B;  4O4L A;  2VQF B;  5KMG B;  2PYJ A;  4K8Z A;  5JH7 A;  5LXT A;  3E22 A;  4DV7 B;  5JCO A;  4DK0 A;  4FVM A;  3HKC A;  1HNW B;  3BA9 A;  3HKE A;  4JI2 B;  4B3R B;  4K0K B;  4EB6 A;  2E3C A;  3DSQ A;  3SJC C;  5K1P A;  2PTM A;  1P49 A;  4CS2 A;  2QJ1 A;  4JI4 B;  4DUY B;  4O4J B;  5FPR A;  1SA0 A;  4LNU B;  4NXM B;  2P22 C;  4IHJ B;  5BMV B;  5CA0 B;  3ICX A;  4CH6 A;  1I94 B;  3SJB C;  2HHH B;  4UCO A;  4FLT A;  1HNX B;  5JJJ B;  4CS3 A;  5D5Q A;  1Q5O A;  3K5M A;  1L8D A;  5BR8 B;  1V9P A;  2BTO A;  4DRX A;  3OTF A;  4O4J A;  1FFX B;  4LNU A;  3RYI A;  3VQW A;  4NVP A;  4ZOL A;  4HNA B;  1QHT A;  5GON A;  5EZY B;  4TUY B;  4I55 A;  3N2G B;  4LFB B;  4I4T A;  4FFB B;  1N36 B;  3VQX A;  4YJ2 B;  3LNN A;  2PZS A;  4DR2 B;  4TV8 A;  3K58 A;  3UQ8 A;  2Q7G A;  1FFX A;  1XHZ A;  4JI7 B;  2JGU A;  4DV6 B;  4TOI A;  3M7M X;  3WB0 A;  4CC6 A;  4X20 B;  2F93 B;  2P5O A;  1HW7 A;  3RYC A;  2PY5 A;  5K1X A;  1RSO A;  3WB2 A;  3JAW A;  1TUB B;  3U10 A;  2YIB A;  4AQY B;  4PI0 A;  1IBK B;  4LH6 A;  4JYA B;  3T1Y B;  1D5A A;  4FM0 A;  4O4L B;  3ETQ A;  1O9H A;  4X1K A;  5JH7 B;  5LXT B;  4LR3 A;  3E22 B;  2PUS A;  3JAR A;  4TQF A;  2UXD B;  3A2F A;  4O4I A;  4JI1 B;  2IM9 A;  5EYP B;  2HEP A;  3JAK A;  2ZIO A;  4LFC B;  2Q0A A;  3U11 A;  4EB6 B;  3RFR A;  4LF8 B;  4I9Q A;  3BPZ A;  4X1I B;  4FLW A;  3T1H B;  3JSN A;  1J5E B;  1JFF B;  4O4H A;  4YHH B;  4EFE A;  5JJN B;  4X64 B;  1JMK C;  5CA1 A;  5EYP A;  1SA0 B;  3SJA C;  1SKV A;  4X1I A;  1TA8 A;  5JQG A;  4EEQ A;  4LF4 B;  2F95 B;  4TQD A;  4AHC A;  4ZIB A;  2JVD A;  1JFF A;  4U3J A;  4BW9 A;  1XI1 A;  4F6R A;  4KL1 A;  4LH7 A;  3OTO B;  2ZNI A;  3JAS A;  4DRX B;  2E5L B;  2R70 A;  4PI2 A;  3JAL A;  4CH3 A;  2GV9 A;  5EIB D;  3RYI B;  5J2U A;  2QM4 A;  4ZOL B;  2YIB D;  1IBM B;  2R72 A;  5GON B;  4GKK B;  4I55 B;  4X62 B;  5FPO A;  2UUB B;  2R9A A;  4I4T B;  4DV4 B;  4O2B A;  4FLU A;  4FLV A;  4DK1 A;  4O2A B;  1JJO A;  4LFA B;  4TV8 B;  2F1M A;  4DV1 B;  3ZED A;  4CS4 A;  3MAQ A;  4FLY A;  1S5J A;  4UCS A;  3N2K B;  2ZM6 B;  1HR0 B;  4X1Y B;  3B2E E;  4FM2 A;  4DR5 B;  3RYC B;  2ZIM A;  4YY3 B;  2UU9 B;  2ZIN A;  5IJ0 A;  4O2A A;  3K5N A;  1NT2 B;  3JAW B;  4B3M B;  1XNQ B;  1G6U A;  2YI8 A;  3JSL A;  3VQY A;  4BWA A;  4DR4 B;  5LMU B;  3BA8 A;  3N2K A;  3QTC A;  4HBN A;  5LA6 A;  2Q7E A;  3HKD A;  4X1Y A;  4NXN B;  4I50 A;  1M93 A;  5IJ9 A;  1Q43 A;  3RYH A;  3CHX A;  4LF7 B;  4JV5 B;  1YEW A;  5C8Y B;  4X1K B;  3UT5 B;  1N33 B;  3IAY A;  1TVK A;  1X4T A;  1Z5W A;  3QF7 A;  5J2T A;  3JAR B;  4DR7 B;  4O4I B;  4JI0 B;  5IYZ B;  3JAT A;  1WPB A;  3JAK B;  5LOV A;  3K59 A;  3CSX A;  1N32 B;  5C8Y A;  3UT5 A;  3HKB B;  2Q7H A;  4OX9 B;  2BTQ A;  3CB2 A;  4O4H B;  3WB1 A;  5KHI A;  1XMQ B;  5IWA B;  3PN1 A;  4CH5 A;  3RWR D;  1KMI Z;  1Q8I A;  2PGG A;  5ITZ A;  1H2S B;  3K5O A;  5IYZ A;  5CA1 B;  1XMO B;  4CH4 A;  3RYF B;  1T5E A;  1O9G A;  1SQG A;  4YJ3 B;  1M4U A;  2YIA A;  4AIL C;  1I7F A;  5JQG B;  4ZHQ A;  4JI6 B;  3HKB A;  4K8X A;  4U3J B;  4FLX A;  4PHZ A;  4ZI7 A;  4F6R B;  2VQE B;  4GLX A;  3JAS B;  4GYC B;  1TGO A;  2YXL A;  3RYF A;  3JAL B;  4EFB A;  4YJ3 A;  5J2U B;  2KKW A;  4DR3 B;  5KHK A;  4TV9 A;  2UXB B;  1M5I A;  3ZS8 C;  1SQF A;  5KX5 A;  3SGI A;  5JVD A;  2CAZ C;  4O2B B;  3FFQ A;  3U0Z A;  2OYQ A;  2ZCE A;  1TAE A;  4WBN A;  1IBL B;  4CC5 A;  5KMG A;  4FM1 A;  1FJG B;  2VWJ A;  4DV3 B;  3THO A;  2V4D A;  4DUZ B;  5IJ0 B;  1B04 A;  1WN7 A;  4D7T A;  3K57 A;  4FLZ A;  1VF7 A;  2EX3 A;  2F66 C;  4JI5 B;  2UUA B;  5LA6 B;  4LF6 B;  3HKD B;  5LYJ B;  3BAB A;  1XHX A;  4UCU A;  4LF9 B;  4I50 B;  4UCV A;  2UUC B;  1XQ8 A;  5IJ9 B;  1WNS A;  3RYH B;  3BRC A;  3BAA A;  2VWK A;  5KHH A;  5CB4 B;  4B08 A;  1TVK B;  1QQC A;  3K5L A;  5J2T B;  4IHJ A;  3RGB A;  5D5P A;  5CA0 A;  5BMV A;  2OWO A;  1HNZ B;  1Z5V A;  2F4V B;  3JAT B;  5LYJ A;  4DV5 B;  4L8J A;  5LOV B;  5KHG A;  1DGS A;  4UFZ A;  3VQV A;  4KHP B;  4X66 B;  5FNV B;  5JJE B;  5CB4 A;  1ZAU A;  2BTQ B;  5LMN B;  2UXC B;  4JI3 B;  2RJZ A;  5ITZ B;  4Q6G A;  4DV2 B;  4HNA A;  5LP6 B;  1KU9 A;  5EIB C;  5EZY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...