1G8MA

Crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
590
Chain Sequence
b'RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 207
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g8mA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1g8mA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA02
2B1GA 2X8WA 1S8AA 1KEEA 1IK4A 1B93A 1A9XA 1OZ0A 1M9NA 1PL0A 1PKXA 4EHIA 1WO8A 3ZZMA 2IU3A 1VMDA 1JDBB 2XW6A 1C30A 1CS0A 2B1IA 2YVQA 1C3OA 1S89A 1THZA 1G8MA 1EGHA 1M6VA 1T36A 1P4RA 2IU0A 4A1OA 1ZCZA 1BXRA 1CE8A 5H3LA
chains in the Genus database with same CATH superfamily
1JSCA 4EI7A 4OGWA 4Z4FA 4R3WA 5FAXA 3LKDA 3CSSA 5DM0A 3PPYA 4R0NA 4ID3A 5FLXN 4D3YA 4IJQA 4W4KA 1S3IA 3O1HB 2YIMA 3ZS8A 4TUYB 3W34A 1Q43A 3IAM1 5DECA 4I19A 2HHLA 3ETJA 4FFPA 2V7QD 1VKRA 4PM4A 4HWOA 3O6VA 1VGQA 2H2HA 4ZIBA 3UJ6A 1FMLA 4GLXA 1Y76B 3GWOA 4TWBA 4PS1A 5T4HA 4ETNA 2XUZA 4KZKA 1IY2A 1VLQA 2J9XB 3M2PA 1OYVA 1QIFA 3PFIA 3VAYA 2P1DA 5AP9A 3IESA 3RSCA 3S5UA 4HLDA 2VSOA 2W2KA 4CM5A 4RK4A 5D5QA 1CIJA 2UYYA 4A2QA 4FT4A 2FOLA 1JJFA 1P0IA 1U0BB 4IO0A 2WMOB 1RYDA 3J81N 1QQ7A 4NAVA 3T3GA 1H05A 2C4VA 3H8JA 1LLFA 3R4VA 4MGYR 4MRRA 4CTNA 3E83A 5HS6A 2HIAA 4FUTA 2VHYA 3ZIAG 3ZN1A 3EGXA 3F96A 1YCFA 1A9QA 1W5BA 4CEHB 3KB1A 1IPEA 4BX8A 2WJIA 1I10A 4OI4A 1RBZA 1VIYA 2WY2D 4P0QB 2X4DA 4BWFB 1Q57A 5FAKA 5JXIA 3U4AA 4EEZA 1E20A 2OYCA 4FOSA 4YY3B 1M8PA 4M53A 1GP2A 1C2TA 5DP1A 4R6WA 5CGQB 3RB8A 4JQCA 3V3TA 2JGLA 1XQ8A 5JSHA 3HEMA 1QCEA 1GILA 3OSZA 4D7TA 1E2MA 4KV7A 2HRRA 4YI3A 4S1NA 3FIUA 2YRWA 1WCXA 1AO3A 2YWEA 1UBJS 3GDGA 5C1OA 4NBWA 5EHQA 4POAA 2QTFA 4ZHQA 3OZBA 3UO2A 1G5TA 5EMNA 5EAIA 2QD1A 4X7RA 1MJGA 1NJIW 1Q8IA 3I5MA 1I7SB 2FZGA 4FHZA 3NXKA 2E89A 4TTRA 4BBZA 3HJTA 3ZWCA 3I2GA 1AG9A 4DV4O 2OV1A 5AM1A 3BCUA 4N3AA 4AF8A 2BRUA 4OA5A 3P9XA 4KGZA 2GILA 2E4UA 3ASUA 4O1MA 3TW4A 1YOVA 1FC0A 3JTMA 2WSLA 3GCGA 3FTPA 2PL1A 1RAHA 4YDRA 4K3AA 2IJKA 1DMSA 1ZOPA 2VBCA 3MB8A 3L40A 4JLNA 2BGWA 1NZ6A 4EA6A 3GUCA 3G59A 3DE7X 2OYQA 3PQ2A 3FR8A 2IIQA 1X80A 1MP0A 3MWGA 3RTEA 4U7HA 1TLLA 1IN1A 4LJ6A 1G3QA 2XE8A 4FLXA 3CLRC 4BB5A 2NN3C 1GGEA 3GO4A 3T4XA 1Y4DE 2C1EA 1GL9B 4ZREA 1TZKA 1RM3A 3G9XA 2WLIA 5JZVA 1J7KA 1QF9A 2X15A 3O8NA 2YZ2A 4IWYA 4OU5A 4M0UA 4B73A 3KTAA 2DWDC 1JDNA 5JNLA 1VKNA 5KSPA 1R0XA 4G1MB 1H1TA 1OCEA 3LYHA 5C7OO 2EZ8A 2QJWA 3N6VA 4E1AA 1OYOA 4GPD1 5FKJA 5IKEA 4NVRA 3M34A 1T5IA 2P67A 3PEUA 5FUWA 1RSOB 3OIGA 3GK3A 3OLYA 3QQ5A 4Z2AA 4OQPA 4YDHB 3FCEA 3IBYA 3ACDA 2E87A 4X6LA 1PEDA 4OXRA 3FZQA 1LSUA 4OCZA 1JU9A 5BN1A 2C97A 3DGFC 3UUEA 4K6GA 5LZ7A 3VHXA 2PSDA 2FLKA 3UWMA 4HNQA 3L7IA 5ADVA 4HGZA 3IEPA 4U2EA 2V6IA 3SHOA 4R9SA 3ABMB 5KAFZ 3FMFA 3E5HA 4J2HA 4K0RA 2BM8A 2OFOA 5DNDA 3KXIA 1JAXA 3LLVA 2X5KO 3C3SA 2RJ3A 1NLMA 2BE7A 3ZPGA 3OW2U 1P1JA 2WR8A 4MW4A 3PTAA 1N34B 4EX6A 3RK4A 1X3LA 2A4KA 1QMGA 2PS1A 2HPZA 2QMHA 1C7FA 1I0HA 3UQZA 3MHSC 1K66A 3OZUA 2XQKA 4LUCA 1AILA 1V8FA 3MQFA 2V7EA 2B7CA 4R84A 1Q7RA 3S2ZA 2M6SA 2YMMA 2HW8A 3N2KA 3AVXA 3Q0TA 3NHZA 5BVGA 5IWCA 1UT6A 2HGSA 2WSSD 1PE0A 3DXRB 4ZCMA 1SUCA 4JYBA 1FYEA 1F2UB 4OHKA 3R3ZA 1W0CA 2NUBA 5IW8A 3FYCA 5T7BA 3WO0A 4FLZA 3N8HA 2NZYA 4BNVA 4MRVA 5MHTA 2XRYA 1JZTA 3GBSA 4AYXA 2GESA 4L73A 3R9KA 2ZCUA 3OJLA 1OGYA 4A2PA 1NGSA 2DHRA 4XIJA 2QDKA 4ME6A 4UBJA 1NNSA 1FJHA 1I3CA 5HQ3B 1DQSA 3SC3A 3CQ9A 4RGQA 1G1XB 2Z6UA 2X0IA 5DHTA 2FSGA 2YVQA 1Y9AA 4TQDA 1KI6B 1ULUA 5KNDH 4H6XA 5BY1A 2PJZA 2E3JA 1CB0A 4RESA 3CZPA 4TV8A 3QW2A 1E9VA 2ZG6A 1XI2A 3TLXA 2BFEB 2ZIWB 1C0KA 1ODSA 3SNHA 4MP6A 3R0JA 3D0RA 4M9SA 2B30A 1ZH2A 2ORWA 1HL7A 3CJHB 1YRYE 3FFQA 2SKCA 2R72A 4CL3A 4DSOA 1IEQA 1IN7A 1GXSA 2M32A 2CLDX 3H1GA 1W9HA 4EJ6A 1C80A 2GPBA 4OYHA 1JEJA 4MYCA 2PXAA 4G0VA 1H2NA 4KXRA 4WESA 2A9OA 2W11A 4OSOA 4CH6A 3ZWNA 1ZW6A 2YI8A 4BN4A 4Z9BA 4HVTA 3IQZA 2FAXA 3GJ3A 5HTOA 1C7EA 1QKJA 2FU5C 3JASB 3W1EA 2G5CA 4WKBA 1WCIB 1ZSYA 3PNSA 3R5TA 4LZLA 2R6ZA 3FAVA 2I6FA 2VPYA 5JAIA 4QQ8A 4D9JA 5ILGA 2GEBA 3AF3A 2EKLA 3JQPA 5CVTA 4P4LA 3SYCA 5EL0A 3VOAA 2C95A 5GVRA 1AKWA 1E79A 1Y8QB 3EZFA 3OJXA 3GHHA 3H17A 2OVBA 1A9XB 4ZJYA 3WG9A 5GONF 2OIEA 4BRWA 3RJZA 5CW1A 2DZDA 1UX1A 2VO1A 3EX7C 3PUYA 4D80A 3ASNC 3RN4A 1I24A 2XZDA 1GQ2A 2HUNA 3DZCA 2NQTA 2XF2A 2I7TA 1OFIA 3QKRB 1Y6JA 4J0HA 3VBCA 1DBWA 1SHTX 3OEED 4MIYA 1TEXA 4B6FA 2Y1XA 3IP9A 4H27A 4MRSA 1KEEB 3EEYA 4LCBA 3SC2A 4EG1A 5F5NA 1WB9A 4I55F 1HE1C 3HL0A 1ENVA 4S05A 2ADQB 1UBOS 5JCOA 5E2AA 3RSGA 2YW2A 1Z0DA 1WB6A 1IBKB 4R8CA 1U0RA 1GUDA 1E1QG 1EBOA 1ZTEA 1C7RA 3KU4A 4MTFA 3M6XA 3WLMA 2VK8A 1U28C 2BEKA 2RCYA 1RPJA 1S8AA 3CRQA 4P1ZA 1JVSA 3SXUA 3GOHA 4BIIA 4CL2A 1PR5A 1R9JA 2CFOA 3RVDA 2FZ4A 4JLBA 4LWSB 3VQXA 1EQAA 5HWSA 2W0FC 4QJIA 3IHTA 4KHPB 2VK4A 2ZWAA 2V5VA 2I33A 4X7MA 1KZYC 4JC8A 4EK9A 4MTCA 2AQ8A 4KPGA 2N1MA 3OTOO 3QO5A 3HUUA 5F7OA 4WHMA 1Z8HA 4DUYB 4LJ8A 3SC6A 2DH6A 2XRMA 4AUKA 4N5NA 5EKDA 1AF7A 5E4JA 1DTWB 1XAIA 1Z2AA 1YS6A 5E95A 2WFZA 5FBVB 4RPIA 1DC7A 1Q77A 3PA8A 2C2HA 4I1OA 3BREA 5KMGA 2YXEA 2FMIA 3PXAA 1EUYA 1R3LC 4B3MO 1EVKA 4WDRA 4XASA 2WD8A 1NJFA 2X3FA 1SB9A 1NBEA 4HV4A 4JQOA 3VPCA 2BKXA 4UARA 3OMLA 3D3QA 2LR0A 1TMKA 1YFKA 3C1OA 4JHXA 4C87A 2E2WA 3V42A 2ZRCA 2PMBA 1WXEA 4MQUA 2YN2A 1TEHA 5FBHA 2GBGA 1LW6E 3ET4A 2QE6A 5BYKA 2RH9B 5ARCA 1OWPA 2Q27A 2X2PA 2RDMA 1M8FA 3L7CA 2BOCC 4KFMA 3NV7A 4Q0MA 2PPVA 2CNBA 2H94A 3W3AH 3QM1A 1AI6A 3T7JA 4F2WA 1Z37A 2C94A 2B8TA 4N82A 4P35A 1N7HA 2OCGA 3CLVA 3EQZA 1WP4A 4K9MA 4WIFA 3W9UA 3VQTA 4H3HB 3QU2A 1PR0A 3WLFA 3TG2A 1TVCA 3CLKA 4BUJA 1G5RA 2PUGA 3Q6NA 4I4TF 2AZMA 1ZN9A 1AGYA 2Q8NA 3KKPA 2OO7A 1H2LA 1EGHA 4LWQA 5L4SA 3TZQA 4D6YA 4N48A 4LDQA 2BSXA 1BGWA 4NNJA 4E1BA 2ONCA 1N5LA 1GV0A 2WUFA 4F1WA 3R20A 3U4CA 2BLNA 2GKOA 4WJLA 4DG5A 1EXVA 5ALNA 2IKSA 4P92A 2VK1A 5AKGA 3WSVA 1TA8A 2H18A 4MT8A 3PKJA 1NNLA 1OCZB 3DMOA 2OHGA 2PV0A 4DZTA 7GPBA 4ZI7F 1Y7PA 5TF4A 4LXTA 3NVAA 2KSQA 5BT8A 4LXHA 1RBQA 4HFRA 5I45A 1E79G 2FW6A 1NF8A 2OHOA 2FDCA 1QDLB 1B1CA 2C3YA 5BN3A 4W82A 1A0OA 4HB0A 2BR4A 3AG2B 1U2TA 2MSNA 1R5BA 3G8BA 4OHFA 4C4SA 1IONA 5LD2C 3SVLA 2YC4C 3SP1A 4MS3A 4PZZA 4O8XA 3T7SA 2RE8A 4J8PA 1TCUA 3DL4A 1V26A 1DEOA 4FXOA 4COKA 5REQA 3HCOA 2ZUBA 3IAFA 1BFDA 1MX9A 2SECE 4H3KB 2DHQA 4HAYA 2I2WA 3BCHA 3I9FA 4D44A 4PA9A 1AP5A 4DTCA 4WZAA 2CLEB 2QAGC 3PRJA 1XMSA 4DYDA 1M93A 3BA8A 3QW4B 4JLJA 3CMMA 4JNKA 1SBTA 5YASA 2Q0AA 1MAHA 2ZIGA 2AB0A 1XZHA 4FHFA 4TM7A 2R85A 3C6QA 2Q3BA 3LHFA 2JAHA 3HU2A 1S2LA 5C5EA 1BT8A 1VE7A 1L7DA 3D7NA 4CF7A 1XG5A 1E9DA 3PEYA 1UANA 4AUNA 3DTYA 3LC2O 4FXPA 4A8JC 2AXNA 4AIRA 3PFGA 2YX1A 5B4TA 2FYUH 3A1DA 3QTLA 5JS1A 4G81A 1AQNA 1PJCA 2P4EA 1CDEA 1V16A 2VZ9A 1E4YA 2YUAA 3JD2A 1YJNV 2XDWA 4EJSB 2OLEA 4O1HA 2A9RA 4PV7A 4BFUA 4EY5A 5AW5A 2B92A 3VR2A 2D2IA 3E9CA 4RTKA 3SVZA 1J0AA 4UW9A 4ZAWA 2ADMA 1HSZA 4PA4A 1WHTA 4DA8A 4CBVA 3ETCA 3ROZA 1AGXA 1KQ3A 1YF3A 1NBMD 5C37A 4YX9A 1TDJA 2VHJA 2UYCA 3H9QA 3BJRA 4PXSA 3VX4A 5FBRB 2GRUA 1D2HA 2ZYVX 5CX1B 1E94E 3NM6B 4LF5B 4TS1A 2LDXA 2ZTHA 2ZM6O 1C7IA 1R6DA 2ZU6A 2JFZA 3B3QA 2VP9A 3P9ZA 4P31A 3RD5A 1XAJA 1RC0A 1MSDA 3UBTA 1EXDA 4LXGA 1PJRA 1OPRA 2C29D 3S99A 3PIIA 5EGNA 3T4PA 4PQYA 4N3GA 1TZMA 4BP8A 5J40A 1CY1A 4DLTA 1QRUA 3CRAA 4DEVA 5BNWA 3ECAA 2XKKA 5IMSA 1ORTA 4G2TA 4UCTA 3RR2A 1RZRA 5BSWA 1UAQA 3OZGA 4IRMA 3TR0A 1Y8ZA 1PR3A 4EF6A 3T5TA 4P7GA 1FP2A 4EKWA 1CZUA 4RCZA 1Y42X 4ZOEA 1GSHA 2A88A 2QWRB 2R11A 3X1WA 4IQFA 1S7CA 4R41A 1PWXA 4NCXA 1L5SA 4RS4A 2UXDO 5JJBA 1TU0A 1WD7A 5J2TF 5A3QA 2FFRA 2Q62A 3QWIA 4R3NA 1U9YA 3P9RA 5B1SA 3RGBA 4GT1A 1ZCBA 4BQSA 4PLGA 4ZOLA 4GBGA 3FLAA 1M1YE 2RGAA 3T38A 4GKJB 2RDCA 4MKFA 1XJ5A 2ATEA 3GAMA 3QK7A 5FUVA 3B1WA 1OW3B 3E2IA 2B61A 1Q1EA 1M2JA 1MRZA 5KCMA 4RZHA 5JISA 3GEIA 2WLJA 1JSRA 1WV0A 3QOXA 1AS0A 4CM4B 2OUKA 1LZLA 3WYNA 5JT1A 2O23A 4MWSA 5JSZA 4IHJA 5EFOA 4MX8A 2ID4A 2O3KA 3LYAA 1V1MB 4BZXA 4YJFA 3VDQA 1WB7A 4YRNA 2FOIA 3ZE7A 3VJLA 1OBOA 4ZGGA 1AZTA 1XZJA 2JJ2A 1MGOA 3VA7A 5FI5A 5DM4A 1MO6A 3EMBA 2WZDA 5JPCA 4Q93A 1JQ3A 2G71A 5JJEB 4E2YA 2ID9A 4KYTA 2GD0A 2GEJA 2WNHA 1OI2A 2IV7A 1JR3D 1TQ6A 4QOJA 1C8VB 3BK7A 2OHIA 3OAAD 2V7BA 3ANSA 3HXKA 2CDYA 3ZK8A 1D6JA 1EDZA 4XGNA 1DX6A 4M0DA 1WMAA 2ZQ5A 3L1KA 5CDTA 2FKNA 4YROA 3ADDA 2BH2A 1HTTA 1WNSA 2LPMA 4HATA 3DGEA 4CCSA 2CK3D 4F4JA 3OZ7A 2IYZA 3NWEA 3FSGA 1REQA 2GAOA 1WULS 2W4MA 2G9NA 4RK0A 4AUMA 2B7LA 3L04A 4AN4A 1T1IA 2UVDA 4IKEA 5IWAB 4D6XA 1K7SN 1I14A 3W04A 1FUIA 3HO6A 3T7EA 2ZSIA 1Y7IA 2FSSA 1K68A 4TLBA 4F6RA 3O4JA 1CJTC 3RYIA 1IVYA 2IPAB 3QKUA 4JA2A 4XX0B 3D4BA 3M7IA 1IB6A 3ND9A 5JS2A 1KIAA 4EVRA 2PN1A 3QPBA 3HZZA 1Y1KE 1WA8A 2PO7A 1XXHA 3N2NA 3T94A 2IHTA 3NHUA 1KVUA 1L7MA 1A5TA 3NDJA 1RAIA 4K2AA 1E7YA 1O4WA 2WMYA 3KV1A 4C1NA 3IBCA 1G2PA 2HV8A 5CDFE 4GOLD 4YAIA 1JHVA 3PENA 2BOBC 2GPYA 3VR4H 3JSXA 1CQIB 4AF7A 3AI2A 2Z1NA 3D6AA 4HMQA 1CLEA 1U3FA 1MX5A 4V39A 2BJHA 3LUTB 4IJUA 4XA8A 3W2GA 3DZKA 1POXA 1QBGA 5LNK1 1JFTA 1WKBA 2VVTA 1FUYB 3IPXA 3AXSA 3DMFA 2OKCA 1Z9BA 5SYNA 4R2WA 3ADPA 3JSNA 4LF8O 1PJLA 3AIKA 2DTDA 2W6NA 2OR3A 3E8BA 1J2EA 1AV7A 4MPJA 5IEJA 2QF7A 3PFNA 3N3AC 3NS7A 2IL1A 5J59A 1SWWA 2H17A 5EMKA 1WUIS 3KR9A 2PMEA 5B7PA 1CXZB 1HQYE 1IXSB 1HQKA 4CMBA 4GL2A 5HKAA 2ADPA 1FVFA 4L0CA 4DIMA 3LPAA 1Z39A 3MJ4A 1FTNA 4AP6A 3I28A 3N2GA 4B5LA 1TECE 4P58A 3E53A 3S6JA 4M54A 4UXJA 4N3NA 1N2CE 5EMLA 4IYHA 3FYDA 5CNIA 2JHCA 1N33B 2EARA 5GIOE 3TJMA 3UMCA 3UJNA 4H7PA 3R24A 1FSPA 1YB6A 4PFQA 4R40A 3JR7A 1OXBB 4WVLA 3I4LA 2OT5A 3G5LA 3RUDA 1NMZA 4OP2A 2IJJA 2HX1A 5A04A 1GPLA 4TWAA 1FS5A 2ZRPA 1Z6AA 3U49A 1QLHA 1EQ2A 1B8VA 4HOYA 2X3YA 4HYQA 3RC8A 3E4CA 1KFEB 3BWDD 4LF6B 1ZL0A 4H0CA 4ZT4A 1BS9A 2QMYA 1F9AA 1YT5A 4GUAA 3JQAD 3HEBA 3QE4A 3A4YA 1X1TA 4TLEA 3FRJA 3UVEA 4X8HA 1FLAA 2DYSB 3NH9A 2DUUA 4S1PA 1PR1A 1T9KA 5B36A 3E9QA 4MH0R 3K5PA 2Q2WA 1E4EB 4UB8Z 2BSAA 1YSDA 3UUFA 4YCMA 1WZ2A 4XQ0A 4YBRA 2CXNA 1AQUA 1FVOA 1L4LA 5I7RA 1N6OA 1W75A 2UXCB 2WOJA 4PSAA 4PSCA 3TVYA 2O2CA 4BDSA 3BWXA 4J7ZA 3LWBA 2MYTA 4A1OA 1U0FA 1EFRD 1N7JA 4GSKA 4Z4IA 3EBOA 3PUZA 3KSDO 1U98A 1RHQA 2DOSA 3TF5A 1ISGA 1OV6A 4YREA 1KH1A 5C8DA 1XZCA 3WFJA 1RYFA 4PIMA 4TLMB 3FA2A 4ZYUA 2NO9A 3HPQA 3A3YA 1NVBA 5I7UA 3R40A 4E5DA 2CE2X 2HN9A 3FGOA 4MSMA 2FB5A 4ZAGA 3RYFA 2Z3HA 1XCMA 4D42A 4EP1A 4OGLA 1Z15A 2QHXA 4O08A 4OJMX 5KO2A 4QBGB 2B35A 4FNGA 2BEVB 3R76A 2G04A 3VNBA 3KAQA 4L4ZA 4BNNA 4L57A 3G0OA 2BAGA 2ERYA 1Q81W 2PEYA 3SSAA 1TTTA 3VJKA 3ZTWA 4EGSA 3WQQA 5JY6A 2ZI9A 4GKKB 3OZFA 3LYUA 3LUJA 3CNEA 1T9AA 2XXAB 1JG1A 1R15A 4L87A 1K8RA 5CLGA 2I6QA 1U8TA 1H4SA 4FE7A 1X86B 1AXEA 4GX5A 3WHPA 4A15A 2C2WA 3PQFA 3ZV3A 4UB6Z 1CD5A 2FOXA 1SCIA 1ZCFA 2RQ6A 3NEJA 4ZIRB 4AILC 2HLNA 1VYTA 3CXCU 4KVFA 1DKUA 3MPZA 4KG7A 4YMTA 5KB3A 3FKSG 4R2LA 4QWWA 2H4HA 2AKAB 5JBNA 5KQPA 4PYIA 1JLKA 3KTDA 1U3UA 5CIWA 2IXTA 4KQ1A 2DMRA 2WT8A 5KQMA 1O58A 2JK1A 4F3TA 5EXSA 1NQOA 1Q20A 4BIZA 3SYQA 1HWYA 2V5UA 2PBLA 1G63A 4CC5A 4RYLA 2BHSA 4WT7A 4EI9A 2R4UA 4NS4A 4OJYA 3COVA 1SHZA 3V6LA 1MA3A 1JFRA 1NLZA 3CZAA 3V4ZA 1GGNA 2PH3A 1Z4MA 2HSGA 1FNMA 2MU1A 3VUEA 2VS1A 2RHCA 3TJRA 4FMDF 4OF4A 1J2UA 3TNLA 3CWBH 4OJTA 2YY5A 4CKCB 1Q3TA 3QFRA 4OI0A 1O95C 2AD5A 2VNJA 3GLHA 3N05A 1D4FA 4MINA 1OWMA 3OH8A 2Z95A 4A5OA 3G2QA 4RVFA 1LEHA 1ESCA 1ZN8A 5CA1F 5AICA 1VG0B 3UMGA 5IJZA 4Y9TA 2DRIA 5AIBA 3IQHX 1PUIA 3ZY2A 4JGIA 1U7WA 3NM4A 4Q21A 2EX3A 2CY0A 4FMBB 3AYZB 1GKKA 3F6BX 2BGNA 2VEDA 1T5EA 1R27A 3WYFA 3OUTA 1ZGCA 1T8TA 3T9CA 3H11B 3NWJA 4RIEA 2Q0XA 5FBQB 1H1LA 3BD7A 1FUKA 1H5QA 3BXHA 4ZARA 4O4LA 4OLBA 2CTQA 2Q5IA 1KE2A 4BO9A 2UUCB 4JI8B 2P9ZA 3M3HA 3SQMA 2A4MA 5ALUA 3OM3B 3ZHZA 1R6NA 1EUQA 4H2DA 3E5RA 1X7YA 2GUZB 4O02B 4Y2HA 4UFPA 4YRBA 3PNLA 1D07A 4EENA 4NU8X 2YJGA 1VIAA 1Y3DE 3FBGA 3SMVA 5BSTA 2QUBA 2O57A 4BZQA 1G7RA 2YCLA 4RV9A 1U94A 2FFHA 1L5HB 5K0GA 1IM2A 4YIOA 3KXDA 4J0GA 2QP9X 4BLSA 3TUJC 2O3SA 2Q45A 4R2HA 3QVOA 3RZUA 4Q7KA 4BB0A 1H1DA 3BGDA 1X7WA 5K1XA 2ZNJA 1Q74A 2P0AA 2UZ0A 4PGGA 2ZB2A 3LRPA 3K2QA 3D2BA 4E4EA 2VI5A 3V7FA 1G8FA 1S1CA 2ONJA 1OY1A 2NZXA 2EJRA 4LGYA 5B66Z 3TIXB 4YJ3B 3RTGA 4X45A 4P5EA 1BA3A 3HBAA 3VVMA 4WFAV 4RD1A 2Y48A 1M56B 2XHBA 1LA2A 3VSCA 1A9YA 4NDNE 3JWIA 3OOWA 3HPLC 3IRUA 3NALA 3LHKA 1I33A 5I3ZA 3IQIX 1X7ZB 4LDNA 2ZYSA 3NAQA 3OMNB 1F6BA 1JU4A 5DM60 4C89A 1XLUA 2JJ1A 3DOHA 4IDFA 5B1DA 1SVNA 1XGKA 4WY2A 4FFKA 4L95C 3G7UA 4I8IA 3ZKAA 4B9EA 5MGNA 1OIXA 1E1CB 4XUCA 4URUR 3O4FA 1T0HB 3PUVA 4PNZA 3Q8WA 1QB8A 1I5OA 4F3YA 1Q16A 4BVHA 3G13A 1SCAA 4UFZA 3R6LA 3BCSA 4JOCA 1DEKA 2FZKA 2IYYA 3QU9A 1ST3A 1V95A 2O4UX 5JXJA 1CU1A 4Y2SA 4WKGA 3MCVA 1CEQA 1W0KA 1KH3A 4M89A 3QVGB 1IURA 2OCAA 4MR7B 3B09A 4Y9SA 1LW7A 5DEIA 5KLVH 3E61A 3FYIB 1FXWA 1J56A 4OCNB 3RRYA 3HP7A 5LZ2A 2B0JA 2ZSBA 5HIIA 2QW1A 1VIDA 3UH0A 4QUIA 2BGIA 2ADOA 1CYEA 1LLQA 2O2DA 1WPBA 3GEDA 2ZUUA 4LIPD 1Z2PX 2BCGY 4C4AA 3TZBA 4N8SA 1DCKA 1N0JA 1E2PA 3U3DA 5ITWA 4LYDA 4UVEA 3IULA 1G5IA 3SR2C 3WR5A 4PAGA 4BJ5A 4EELA 3H7IA 2D3TA 4DCVA 1Z6ZA 3QYFA 3BIXA 5FOUA 4C05A 4EG5A 2P5UA 1FBNA 4RH3A 4XYEA 4CMEC 1WB4A 1MEJA 3D54D 1COWA 4RHUA 5KTNA 1P62B 3DLCA 4LE0A 3X43A 1SXJC 1MOZA 4QNRA 2PSHA 4FYYA 2WLMA 4H7KA 2BFAA 4MSQA 4BC1A 4GBMA 3RAFC 3JWJA 1JJIA 4BTLA 1ILEA 4Z4CA 1J1UA 1M2OA 3EFFK 3O8RA 3SXPA 4MCJA 2H2AA 3D36A 1W4AA 1IL0A 3WLNA 1P6XA 5I5GA 2X0KA 2VNKA 1ZW1A 2PR2A 3ZDZB 1WJZA 2E3CA 4WTOA 1YD7A 5CB4F 2JIPA 3M6AA 3VNAA 3NM5A 5A9RA 1RRKA 3MPOA 2VAMA 2XCTB 2YVAA 2FUEA 4N8DA 4YJDA 4KIUA 2OAP1 2OZLB 3SYLA 5SY4A 5ICMA 4JODA 2EZTA 3OCZA 1NN1A 1HORA 5F23A 1GG9A 1COZA 3DKKA 1E1YA 1C9NA 2VPWA 1XP5A 4MEJA 5TMDA 1ZRHA 2G40A 5LL6P 4MGEA 4JC0A 1NZDA 1EFHA 1V8PA 2E0IA 4MOWA 3ZU4A 4HNAB 3HXTA 4IF4A 4TX1A 2B3ZA 1PW5A 1XKLA 1W36B 3HE3A 4UHFA 2GK4A 1SQSA 4KPUB 2NUTB 1P8AA 2R1VB 4PPGA 1WZIA 4GI1A 1I51A 1V55C 1EE2A 1PDWA 2L35A 2QU7A 3HLYA 3DMRA 1QFZA 1B6SA 2WPNA 3O47A 4JLPA 3CZ9A 4YV0A 1NN3A 2EQBA 4R71A 4RS3A 4WKOA 2CGEA 2RSLA 3AY3A 3H5RA 4ICGA 1I5XA 2ZUWA 3ZUPA 4IH4A 5DGIA 2V9PA 4AJ2A 1JJBA 4KN6A 3B60A 5CEJA 3VHRA 4LJAA 4LX0A 4ZV4A 1ZNZA 2VSXA 2AXEA 4WI1A 3ABSB 4Z5XA 2IUTA 5FWYA 4PLVA 1UJCA 1UM9B 4F6LA 4JNCA 3AFOA 5JJ5A 5EPOA 2EP5A 2WA2A 2Z6QA 5A2QA 3I0MA 2GAJA 2UKDA 2GZ2A 4LK2A 1CCWA 5LKRA 1GN8A 1I7FA 2JJ1G 4KUHA 2BGRA 1D09A 1EJ2A 3RIMA 3LQ4A 5KX5F 1F48A 1ABEA 1H2KA 2II6A 3W5AA 3ZHXA 2NX2A 1SN7A 3GLGE 1XI1A 1CQJA 3ONNA 5CVVA 3KUCA 3HB5X 2HWXA 1QNFA 3KOXA 4N5HX 3HN6A 5KOJA 1JR4A 4CH5A 1AVMA 4E7PA 2VTEA 4CMGA 2OQRA 3S2UA 1W0KG 3BRCA 1WZNA 5T4EA 2BYTA 3S8EA 4YPOA 4IHKA 1J90A 4P0PB 4B33A 1TU3A 5LMZA 3U9LA 1DLIA 4D9HA 4HH4A 4WFKA 2XYVA 1LZKA 1RWPA 2PXCA 3QBJA 2FG5A 2Z3VA 2C59A 2ZQYA 3R0IA 3FDZB 4RZQA 4ZVTA 4BRSA 3FGNA 1WB5A 2JGDA 5AJZA 1VG8A 3T1HB 1C9DB 1TIBA 4HL6A 3HRKA 3VKGA 1LB1B 3INYA 4P80A 3M6MD 2V58A 2QMZA 3E84A 1ADGA 2HU8A 4DW1A 4AG5A 3H42B 5J2UB 3G6WA 1GPMA 1D2DA 1GL3A 3JYLA 4BMZA 4RHEA 1EN5A 2R87A 2AEMA 1XNRO 2GO1A 4ED9A 1L5OA 3ZGLA 3LPDA 2ENUA 1W5EA 1QQCA 1ULSA 4TMKA 1B2RA 1Z6XA 2IP2A 2H8PC 2XODA 3I2FA 1Z34A 1EWRA 2QMOA 2QP4A 1RXUA 3T52A 2WVGA 1HMYA 1Z38A 1AHPA 4KKXB 3SDZA 3M7MX 3C24A 2RKOA 4UXIA 3B77A 4IV0A 2YHAA 1AS2A 3JRWA 1O9HA 5HSGA 3IXQA 1GT91 2OGUA 1F38A 4BLWA 4P9CA 3U4QA 1U5BB 3ICVA 4X63A 3QX9A 4OPHA 1T1SA 4EKEA 1A69A 1L1QA 3O8QB 4PZLA 2HM7A 5K8LA 2VJMB 2WHEA 4F4UA 1GPUA 4RZIA 1ECFA 3BCCH 4JJIA 5AKJA 1IQRA 2XH8A 5TEVA 5JYCA 3IH5A 5GTHZ 3E3NA 1TUEB 5CT5A 2EJBA 5JRZA 2RGNA 4AJLA 1ADCA 3DF7A 4C6TA 5TSDA 3K70D 1XZIA 5DTMA 2BFNA 2ZDGA 3IC7A 5K3AA 4RJ2A 2QV0A 3PFBA 4V0OA 4OA8A 4S1WA 2Q1UA 1OU4A 1S5PA 2BELA 1PJ2A 3V7WA 2WQZA 3UMFA 3R9XB 1KY3A 5ES3A 2O4CA 1ML4A 1U9CA 4QD3A 4PLPA 4TL6A 4Q47A 1U5AA 2G5GX 2FLVA 1KYWA 4DYHA 1M34E 3QXHA 2O2ZA 5FOTA 2IQIA 3L07A 4P54A 3E7PA 1ENPA 1CZKA 3GZNB 1TEZA 2REXB 3LDFA 3P5BA 3AKCA 3ESBA 1M76A 2HKIA 3A1EA 4O29A 1TVEA 4BQRA 4FX5A 1NR7A 3BL6A 4LWPA 4D46A 3AOEA 2JGEA 3BEDA 5KYWA 3VPAA 4DMGA 4E2FA 3D4PA 4RK6A 5A9SA 2X0NA 5DYYA 2FMXA 1XKQA 4BYMA 1FYJA 1WXIA 4HTAA 1PTJC 1N78A 4P9PA 5MGBA 5ILQA 2OG1A 1UP4A 4MS7A 3C6MA 3OJFA 1C14A 5DRTA 5KVSA 2QQ0A 4OO3A 2FRXA 4ZJUA 2G8LA 4NFLA 4DN6A 3E22B 2YHIB 3O38A 4M1OA 1AK2A 1EM8B 3WXBA 2VQEB 2ZJ8A 5AD1A 1VSVA 1B0PA 3ER8A 1U8FO 2OUIA 1JDUA 3DV0B 5BR7A 2BFWA 1JVNA 2F90A 2F4VO 3RJ9A 1XZLA 4CV1A 3A32A 1QLNA 1T26A 4JKYA 4EG8A 2GPSA 5ELLA 5LBUA 1I5YA 1AXGA 1ESDA 3BXZA 4FIDA 3F3MA 2GYVA 2XEXA 4ZQGA 1E8MA 3K15A 3MWEB 4MJ3A 3ZI0A 2LJ2A 3PN1A 1QHFA 4BDTA 2N0SA 2G84A 2QLFA 3UK1A 3VZCA 1GZ7A 3L41A 5DH9A 2PRKA 1BCSA 3V7NA 2Q0SA 1SQ5A 4KZPA 3CVWA 3ROKA 3RSOA 3ZOZA 5LQRA 1EZ4A 3HBMA 5CW2A 7REQA 1TFRA 3E27A 4K1RA 5AESA 1SUPA 2C7GA 1D6NA 2OWOA 5M2QA 2C99A 3L70H 3CLHA 1W47A 2O95A 3V3KA 3AUFA 2MYNA 5JH7B 1RM4A 5DM70 5A3SA 4DRXB 4AURA 5DZSA 1ZJWA 1XD8A 2ITDC 3P9NA 1HKHA 4X89A 2POCA 1VLLA 5JSYA 2HHJA 3MRXA 2YKGA 3TR6A 5K6RA 3LNCA 3ZCSA 4DA7A 2HSEA 3O4HA 3PGVA 2FX3A 4CUKA 4CKZA 4Z0NA 5FV7A 1ISHA 3ZXSA 5CAEA 2FCAA 4G41A 3I0ZA 2B6HA 3AB7A 3GH3A 3AG1C 3TSCA 1WL8A 1I94B 5MN4A 1USIA 3BICA 4G0ZA 3WWPA 5TY0A 3BBLA 4OTZA 2JFWA 4LK3A 2CGNA 1BIFA 4C4OA 2INGX 4TL8A 4MSWC 2FSFA 4QUKA 2RHDA 3DL0A 4PSDA 3HDHA 4B34A 4WK6A 1T0UA 4R2JA 5CG1A 4Q1AA 4LGCA 3CF0A 1TQHA 1QIHA 4OXQA 4BMSA 2CUNA 3BOSA 4FLEA 4YRSA 1G98A 2ZRFA 2J9RA 3PUXA 9GPBA 4KL1A 1L8DA 2Y8EA 3IVRA 2PL3A 2ZXWC 3YASA 3H7AA 4DR6B 3GGPA 4BV9A 4JXKA 3LO5A 3L0SA 1EK5A 5GV7A 3GJQA 4J16C 3BUSA 4HNHA 4QM6A 5AKLA 1T2VA 2W2LD 4QQKA 3JARB 1QR6A 3U3ZA 2AN3A 2P9HA 4P4SB 5C1PA 2C5EA 4YHHB 1CNFA 3SZMA 1Q0LA 4F12A 4IJWA 2FK8A 3HJUA 4WFIA 3Q3GE 4AQYB 4G0PA 4Q39A 3HLTA 2DY0A 5A5GA 2VTBB 4F8JA 5HM6A 1AOXA 4HQRA 1VA4A 4FS3A 4YGYA 2QVXX 3TM4A 2VUSA 4HPJB 1PDOA 4Y0NA 1NULA 3ZE6A 1NJGA 2PTGA 4FFMA 5CDGA 4JL8A 3RSFA 2GZAA 4OOFA 2Z3YA 4BNIA 1SCBA 1SVSA 2JFYA 4CR6A 4JI2O 3ABQB 2EG5A 1BN6A 3VSEA 1F0NA 1UP6A 4AY4A 4R2MA 2Z3GA 2C3MA 3J7TA 2JI6A 4DHWA 4FK8A 4JHLA 3IDAA 1C8KA 1Z6TA 5ICCA 1R73A 3SIRA 4JENA 4XJXA 1PV0A 3E2MA 4JB8A 3ZCTA 5E8RA 2BBSA 1X74A 2C4WA 3GQBB 3CC7V 2H5JA 4YMVA 1NE7A 3ANMA 3MAGA 4BFTA 3LVRE 3CZMA 2O2IA 8OHMA 2XCQA 4ES6A 1NUPA 3DZDA 3NHJA 1XHEA 5GONA 2N05A 2GD6A 1U7TA 2P6NA 1FXKA 4DV6O 2C2MA 1YJXA 4J76A 1EIZA 1KZHA 1K2WA 1CNEA 3CF4A 3DBRB 3BZUA 1CUDA 3ABLC 1R0SA 4ZPJA 3ZGNA 1XU9A 4N5MA 1XMOB 2VHVA 3O0DA 3LP6A 2OFFA 4ZZ3A 2WABA 4ARZA 3T54A 2PKCA 1I4TD 5AKXA 5DWDA 3ORSA 3JRNA 3HB7A 5TPZD 4F9GA 3IKVA 4KE8A 4I55A 2V97A 3WL5A 1MABA 1SRQA 1NR1A 3VPHA 1YA8A 2VJLA 5L8VA 1JWBB 2R8XA 3SDBA 4QGSA 4O2AB 4FOLA 3DE1X 4FLTA 3BF7A 3MS4A 4PSUA 1OAOC 3GJ7A 1GDHA 1QPGA 2HCJB 5H70A 1I4LD 1UKCA 1ANKA 1UJ5A 2QJRA 3QKSA 3ABOB 5GY7A 3SF8A 2R7KA 2B37A 1EQUA 4BBJA 3I8OA 3PC8C 1XRRA 1Y5LA 4FDAA 4QTXA 3PNVA 3P97A 1VE5A 3K09C 4TMXA 1YDGA 3BJMA 1ZUD1 1K4KA 4O4HA 2J8ZA 4FP9A 4JLUA 1P1HA 1RAEA 1Y1PA 1VJ5A 5JCXA 1P3Y1 3CX4A 1IEWA 4BXOB 3D4LA 5EIXA 2D1SA 4TT3D 1QF6A 3KJFA 2PS9A 1SQVH 1A27A 3N8IA 4G5QA 5IBQA 3A05A 5HJ2A 3W5BA 3O03A 5DW0A 4F3CA 4RPLA 4RLQA 3RVNA 4F06A 3LY8A 1K9SA 1M4UA 2HLDA 5B2ZA 3WO1A 1H5UA 4DEXA 3GNTA 4RY9A 2A7WA 1UFRA 1EESA 3ZZ0A 4WEOA 1NQAO 4RH0A 1Y3AA 4C2UA 3A6JA 2OA0A 4EPXA 4C2BA 4PAMA 3OM9A 5DN9A 4XVHA 5MDHA 3PR1A 1RE0A 4ZAZA 4GOJA 5HMLA 3X1KA 5LN1A 2A35A 2VZEA 3QXXA 5IVKA 5HX7A 2P7TC 5JSKA 1PGPA 1DIRA 2J6HA 5HCNA 4IEIA 2ZT7A 3WWCA 5K0SA 2QBYB 1EFPA 4R8VA 4NMHA 3VDNB 2BHRA 2FWMX 1UAGA 1V54C 5H9CA 4YYEA 1ORVA 3NYIA 5AKHA 4QATA 1JEOA 4MVMA 2D6FA 3VQYA 2HA2A 4PJ0Z 4DABA 1E64A 1X8JA 3UJAA 1ZMXA 2C9CA 4I4TA 4L6AA 1S0UA 3G8YA 1YVWA 1XYVA 1EP2B 2OK8A 3TWOA 3S8MA 2FMKA 2ZDQA 3VMMA 1DO0A 3H05A 5KTSA 3K2EA 1DJPA 4DLKA 2C7PA 1DFGA 4RTQA 3IQGX 2M6RA 2YN4A 3MJTA 3FPAA 5F21A 5BSUA 2PYIA 1R6VA 3E03A 2AE2A 4EMUA 4RKEA 4MUKA 3WMWA 5LM3A 4FE4A 2GTHA 5THQA 4RDXA 3FKQA 1G8SA 4H7IA 2DWUA 3UK7A 3N75A 1TYEB 2MSWA 1F23A 3THOA 4JI4B 1WXHA 4Y2YA 2NV6A 2C61A 2ZVJA 1LBEA 4IIJA 2J0UB 5KBYA 3WLSA 5E6RB 2Q29A 2VP4A 2SCUB 1A9SA 4E12A 1Z4QA 2GCGA 3E9DA 2A9QA 2G4VA 5M29A 2E85A 2IUFA 3LUPA 4XD7D 4P3NA 3ME5A 2X19A 1T1RA 4ROSA 4LC5A 4C4PA 4OFBA 2XLCA 1DKNA 4RM3A 4REQB 2JANA 2OQVA 1FFEA 2E55A 4UVIA 1ZD3A 1U0HC 5K05A 1ONNA 3CF4G 3OFKA 4KFRA 4YFVA 3B51X 3U9TA 3K0GA 2J0VA 2JCYA 8LDHA 1VHLA 1E2LA 1P18A 4Z3OA 4PV1B 4WQMA 1KYIA 2ZTMA 3ABIA 4OB6A 4P34A 4W8OA 3UCEA 3F4KA 5CHEA 4W99A 4FCWA 3WGUA 3DTVA 4QPDA 1MABG 4I7EA 4Z1MA 2EATA 2Z83A 4ER7A 1SQ6A 3F98A 4GE0A 1UWVA 3JQ7A 3M2TA 2QD2A 4MB0A 3L0CA 1SK9A 4F2DA 3IMCA 4L8VA 2V9ZA 4FEAA 2D74A 1KP3A 3IR7A 2R79A 1WUYA 2VJYA 2HJDA 3WRXC 2WK1A 4KO3S 3A3KA 2BOVA 2ZD9A 2P9QA 1HNWB 2WJJA 3WC4A 1TK3A 1GSOA 2PUEA 2FEWB 3LXMA 2VJPA 2W2QA 3T1YO 1D2MA 5J3JA 1JA1A 2Z1DA 1AUVA 2QT0A 2W2VA 3S7TA 4EATA 4JOSA 3ENWA 3KVYA 4BNYA 4R5HA 1F8GA 4DEYA 2D7DA 1K8QA 3TTTA 1J07A 4ZFRA 2DT8A 1J8DA 3UJ9A 3B8NA 2D8MA 4C21A 1QORA 3H8VA 3GP5A 1CVIA 1CR2A 2D13A 1JHYA 4RTRA 1SQ0A 2H59A 2ZZMA 2C7BA 4FWIB 2Y69C 4RY0A 2HLDG 4MIKA 1G16A 3Q4HB 1UMBA 3L5KA 2K2QB 3THXB 5FOSA 1TYBE 5I47A 4DT1B 3JVEA 4JJ6A 4QGAA 3DJFA 3QFSA 1Q7EA 2F43B 3MJCA 3PXUA 5I7WA 4V0NA 5LP6B 3LBIA 1BDMA 3GJ4A 3ACCA 5IDWA 2NZ8A 2LKCA 1ZJYA 1ZH0A 2MSKA 3V80A 4LYYA 1MB0A 1WN6A 5FTJA 5KU7A 1W1UA 3T9FA 2ZT6A 2XI4A 3IP8A 4KSCA 4BV3A 1JG4A 4N40A 2WU1A 1EH5A 3JQEA 1P0MA 1BJRE 3LZ6A 2GEVA 5IVHA 1N8SA 2DLNA 4YEDA 1XALA 2ETXA 4NTXA 1C5KA 3CEHA 3FNEA 1SVOA 4Q9KA 3T0IA 4CHTA 2CCJA 4MCHA 3EC2A 4MGIR 1XZAA 4HVCA 2CHGA 2A5JA 4INAA 1RWOA 4JP2A 3C1UA 1MQAA 1US6A 5EPEA 2G9VA 3GARA 3WK7A 3AT1A 1MMFB 2IOQA 3ISVA 1GAWA 1QHHA 2IY7A 1M5IA 3AG3C 1IBCA 5COQA 3GB7C 4RNCA 3T8YA 4XRRA 3E2EA 1N1DA 2WWVD 3EVGA 4M9XA 1WUHS 3DEHA 5E6UB 2D0IA 5H9WA 1LDEA 1NRJB 1T9GR 1WDLA 4DQ0A 3NBAA 4WE3A 3T3OA 4RLFA 3RU7A 4OPAA 4W9NC 1PL0A 4ZRMA 1Y67A 5DN6A 3TAHA 1Y4MA 4OUDA 4H31A 2QTVB 5U1PA 4Q1CA 3HBLA 1P7VA 4XPIA 1ENZA 1AUXA 3NU1A 3OPYI 3GXOA 5EJ8A 2A3QA 4N7MA 2WD7B 2B1QA 2DWCA 3EZLA 3FYTA 4UM9B 1PGNA 3HB4X 1L7OA 3UGKA 3SPHA 1UXKA 3MTQA 2QLMA 4EYOA 1XD2A 2CVZA 2PZGA 3VPXA 2A92A 4FEEA 5FUYA 3F1LA 1EHYA 4C5AA 4RKYA 2BZGA 1XBTA 3H3FA 1QO9A 3F9RA 1HF3A 1O4VA 1NVUQ 3IB3A 5DTRA 2XUFA 1VL6A 1VK9A 1WXGA 1W29A 1Z7EA 2RJZA 4LDZA 4IX9A 1HE5A 2WJ4A 3AV3A 2W6JD 3PIDA 2VPIA 3OEYA 5EHXA 5AUQA 5GZ3A 3QQPA 3DMPA 4NXNB 4Z1MG 3VISA 2JKZA 2BTQA 4LSGA 1DJLA 3M5PA 1YR3A 3SSMA 1ZM2A 8ADHA 5CXSA 1VHDA 4B4UA 3GZ4A 4YXWD 3R41A 2HRCA 4CM1A 2GZSA 2ZJOA 3WNBA 3ZJ5A 2WJ3A 4NC9A 3U4HA 4BO5A 1WBDA 1M2NA 1IDSA 2CCGA 2FE4A 3MIZA 3GGCA 5IYZF 4DPLA 3FVTA 3DFUA 2F3TA 3I56V 4DUPA 3IJ5A 3U2QA 3RYCA 5KUMA 1CIPA 3FHOA 4IV5A 3WGOA 4UMEA 5K3OA 4WVFA 3ZWQA 3UFXA 5KJ6A 2HMYB 3TOCA 3SLGA 7AT1A 2Z3ZA 2BZSA 4KFTA 1KY5A 2DXIA 4HRAA 3DE0X 4A8PA 2CHEA 2CL7X 4J9VA 3B20A 3AZOA 3FX7A 2ZQZA 3CX8A 3AEKA 5LLTA 1FLVA 3EPHA 1C9EA 4BR6A 1X13A 3R6TA 5JCZA 1OBHA 1SVKA 4Z86A 3ENVA 1CR4A 4XARA 3W7UA 3FNGA 3RANA 5C52B 2PEZA 3TB4A 4FC7A 2PJUA 3DV2A 3OUUA 2PWPA 3DF9A 2B99A 3U17A 4LRWA 3BAFA 4ZZIA 5IARA 4ZO7A 3R7FA 2AN5A 1YIOA 1NVDA 3TMAA 4QJ5A 1U8UA 1YZLA 2G1PA 4C4RA 5HCUA 1IVSA 5E7MA 1N6PA 4WECA 2X2FA 3UTCA 3RFFA 1BMFA 4G84A 1OC2A 4FDUA 1AZSC 1H2HA 2GERA 3BK1A 1CWUA 2XVYA 1P7YA 1XF9A 4YIKA 1OX4B 4YR9A 2Y4NA 3GFQA 5KNBA 5L53A 1P4JA 3WDKA 3PC6A 4GM4A 1LC0A 3LUDA 4INJA 2HA0A 2AKEA 3U37A 3PJSK 1AA9A 3KZCA 1G4YB 2BE3A 2JFFA 1E6UA 4GYJA 1UOEA 5DRYA 4AK9A 1A8SA 3RTDA 1JTVA 4D5GA 4QYIA 3AOGA 3CJTA 1H6AA 1CERA 3GUYA 3TRFA 4DSTA 1SEVA 3FR7A 4DBVO 2QVCA 1BKDR 4LHSA 3K9GA 2D0OB 2ZSAA 5DN6G 1MOSA 3L0PA 1RQ2A 3ZTTA 3R23A 3QWAA 4KIFA 5BUCA 1KJYA 2I9PA 2QD5A 2Q4OA 5MN5A 4LXUA 4X61A 2AFRA 3RRNA 3ICWA 3PXBA 3HHEA 4AZ0B 5HJ5A 3SJUA 4UUQA 2GBFA 4O2RA 3A7EA 8ABPA 5B1AB 1GGJA 1P39A 1M6HA 4F21A 1P1CA 4WNYA 2APJA 3HJGA 1DUIA 3WLQA 2X77A 3FUUA 421PA 3INTA 3ZWWA 2D5IA 1YB5A 3BB4A 4H3VA 3K9AA 1JAIA 1JHXA 2PPLA 3DE4X 4XQ9A 3JATB 3KOUA 1BGXT 3A3PA 1E2EA 2C42A 3MM4A 4G4GA 1GL6A 2WPDA 2Q99A 1C1DB 1GR1A 4LZNA 2AJDA 3CN9A 1Z5ZA 2Q1WA 4OJKA 2YY6A 1T8PA 5EE5B 2QV7A 3O9OA 3Q5GA 4PHGA 1EGVB 2C8LA 1BEEA 3DXYA 4XM1A 1ZR4A 1ZP6A 3CS5A 4WJZA 4H18A 5CYOA 1AV6A 3K5MA 3AR3A 3A6KA 1M2GA 1USKA 3EGIA 2JJ2G 4YT5A 5AVRA 1R0ZA 1N2XA 3N07A 2JA1A 1U9JA 1GPBA 1QBZA 4YCLA 1SXQA 3AM3A 2XYQA 1R1BA 4JQZA 4PANA 1XN4A 2J3JA 1EX6A 2J7PD 1T5DX 1RVDA 3N0WA 2LRHA 1RP7A 4B7UA 3N8GA 2V7TA 5JPIA 1LLDA 2WWIA 5I9MA 1AA6A 3PHIA 3JQ8B 1UBTS 4J0QA 1BCRA 3G2OA 1JQDA 3SSOA 4ICIA 1JJ2U 5DTQA 3GL9A 4D96A 5JWHA 1DX9A 1JJVA 1X0VA 3QTTA 4MIOA 4G0MA 2VF2A 2G5PA 1SBCA 2YNMA 2WF7A 4MHSA 4CFYA 1F5NA 2WW8A 3FZYA 4XLLA 3OT7A 1KO8A 3FGPA 1U96A 2WLIB 2NTNA 1F7VA 1MD9A 1PI3A 4DR7B 1FMTA 2OBCA 3G0GA 1FW8A 2CZCA 2PVPA 5IY5B 4DCMA 2C31A 4WNCA 3TIIA 3KTAB 1ZAYA 2F4NA 3EH2A 4AW9A 3WLEA 4YIHA 3CCJV 4TTIA 2VNAA 5D01A 1DAPA 4DDVA 3K08A 1LJUA 5ENVA 3O4RA 1OH6A 2ZE7A 4LF4B 1IDOA 1SOWA 2CMDA 1Q92A 1BMFG 1UWKA 1U2ZA 1Q0HA 2PTHA 1JKXA 4GSLA 3PL1A 3DMHA 4IZ6A 3C3YA 4KBYA 2QSYA 3HADA 2IJIA 2P78A 1C4XA 4HF7A 4U63A 4JX9A 3B40A 2WUWE 5KYGA 4FHDA 3L0BA 3N70A 2Y93A 2FF7A 4IDEA 3AQ4A 4NRDA 4DJDC 4M9CA 4R1UA 1GQYA 3EBLA 3VHXB 2EV9A 3U19A 4FB4A 4ZOQI 1O2DA 1SUWA 3OE7D 5DX0A 4KFSA 1HFEL 2VDRB 2EJCA 1U3CA 4ZDIA 5FTNA 5LZ5A 2O7RA 4A0RA 1R4MB 2QG6A 1WU7A 1PNOA 2IH3C 2IEZA 2VQ6A 1U6KA 4DMCA 2NYTA 1GQFA 2C3UA 4HDMA 1B3QA 1J42A 2TMDA 4H7FA 2O2XA 4IMJB 2RI1A 1CR6A 4GXRA 1M6VB 2RHTA 3DZHA 2PL9A 2IWRA 3CX3A 2ZZKA 3TUZC 2HB6A 4LRSB 3C3BA 2PT7A 4EG2A 5LCXA 4JBNA 4HQKA 1QC5A 4TN1A 2EAUA 4LS3A 2WVAA 4D57A 1BYUA 4QSHA 3NT4A 4M1EA 3OZTA 3HJHA 3D4OA 1WSDA 5KWSA 3OCJA 1SUSA 5I5EA 3MWYW 3VZBA 3DR5A 3LFTA 1QP4A 3CG4A 4BO3A 3L6OO 2EINB 3UGQA 2YJTD 3RF6A 4LYGA 3DCNA 4WNIA 4WFFA 4MI6A 4RQBA 1ATIA 2WPDG 3LW7A 3H1EA 5EP3A 3QXGA 3I76A 4W9RA 2BUBA 4Q9IA 3K5LA 4CN8A 1FNBA 5CA0F 2JGUA 2V6MA 1I0IA 3ZU2A 3CCEV 2ZIXB 5A5VA 3KT0A 5CFQA 2XDQB 1Y7LA 2NP6A 1KQSU 1QGYA 1VXOA 1P7WA 3HI4A 3ZEFB 4I1UA 2WQ7A 1A5AB 3AWIA 3BMXA 5JBQA 1P45A 3VKFA 3ANTA 3EN0A 1NJ2A 2AX4A 3VO2A 2NT4A 2DR2A 2WAXA 2WV7A 4GO1A 4UCVA 1KVQA 1RYEA 3VTAA 3S2YA 4UBKA 3ZZTA 2YVKA 4H0LB 4EI2A 2FSVC 3PHJA 4PONA 2P0EA 1DHRA 4UFNA 4GUNA 2CLMB 1WABA 1T2UA 3F3SA 3AZQA 1G6HA 5DLPA 4X1OA 2XUJA 2V65A 3UN1A 3PWKA 2V7QA 3B8EA 2PT5A 1TCAA 1FX0A 2Q3LA 3EGVA 1IM5A 1U8XX 2J9GA 1NDHA 1AR5A 3NIWA 4AC9A 5B3KA 1UBMS 3OTHA 2HV9A 3G85A 1BE1A 2ZVPX 3DNFA 4CKXA 4IW3B 3G5AA 2IP1A 3ECCA 3ROPA 1KZ4A 3FLMA 2QP3A 1K73W 3NX4A 1FRFS 3GCWA 3OVMA 2WD9A 1L4NA 2O0JA 3OICA 3A36A 3CKMA 5FFMA 1L7QA 3UWOA 4UNQA 2Q5JA 3K4HA 1JEYB 2WYHA 4IVPA 1E96A 3W2TA 1S77D 1HEYA 5PNTA 1UMKA 4IMRA 5IN4A 2AHRA 3F47A 1SCNE 1EX1A 4M1MA 3TO5A 3BJEA 4MQMA 5DGDA 1Y1SA 1MDFA 1Y8CA 5FUXA 4BFSA 4PLZA 2C04A 2R8ZA 5CXUA 2QX7A 2IZ5A 2JCXA 3L8CA 1UEIA 4YGXB 1L9XA 2ZB7A 3E18A 2J6IA 2OHXA 1R9NA 4YCNA 5BSRA 1R5JA 3KLBA 5BW8A 2NSLA 4O0MA 2GFIA 5FF9A 1W4CA 1HGXA 1QFJA 2OBNA 5J5CA 1SXIA 2KS6A 5LPNA 3K0HA 2O3QA 1E6LA 1U0GA 3QMVA 5A2QN 4HSGA 2P62A 4P3PA 3A4TA 2G63A 2ZE5A 4IICA 2OM2A 1T4GA 3ZZNA 2X5OA 3Q88A 1DZIA 3OOEA 1Y4AE 3EG9A 3PICA 1AGNA 1J2JA 3CUSA 1N6RA 3UJDA 3V8MA 3KB2A 4OYRA 5HIMA 1B8PA 5A7GA 2VHQA 3B48A 1KERA 1RQPA 5ETJA 4OKSA 4Z9YA 1DWPA 2IITA 2QXTA 3HCAA 3E0XA 1NVTA 1CB7A 2DBQA 4C29A 4BEJA 5IJWA 3DR3A 4D81A 3H65A 2W93A 4YDSA 4DDWA 4PX5A 1EUCB 2GZMA 5JTUA 3EXIB 4UZEA 1X39A 3CU5A 1VPEA 1JSLA 2NQ8A 4DIDA 4QTYA 3WLLA 4MW5A 3QV2A 4Q01A 1TZCA 5E38A 2Q4TA 1NL3A 4JYMA 1IY1A 5DCLA 3DXXA 1K0UA 4V24A 1RQXA 2LV8A 5DM6V 3NHYA 5JUWA 1N0IA 2E1PA 3TQFA 1EAMA 1GADO 1DQYA 4R01A 1PRYA 1UPAA 2P06A 1CUXA 4EO4A 2VJBA 4R16A 4BBAA 3VUFA 3RPEA 5KX5A 4CT5A 4BRZA 3KOMA 4NQZA 3LPNA 2VIIA 1Y63A 2RK6A 4N23A 5IX8A 4YLYA 3IE0A 3AEZA 1RXVA 3ZRSA 5EXEA 3P0RA 5DXFA 1WMDA 3BDAA 1PNMA 1HOXA 1KJZA 2DAPA 1E5QA 3I2IA 4DG8A 2HDWA 3LY9A 3ZY3A 5ALGA 2F66C 5BQ3A 4ESOA 1YK1A 4I9UA 1TJPB 3NHSA 1T9CA 5KSZA 3U7QA 1GK9A 4ZDJA 1TJNA 3GFBA 4QYTA 1JALA 3I5XA 2V7QG 4EPWA 1O96A 2FPUA 1JZQA 3D6FA 4DKJA 1YI0A 3V8BA 1VQ4V 1A2KC 3W7TA 1RIIA 4D99A 1ULHA 3H97A 4H4EA 3MS2A 4GGMX 2IGTA 5JASA 4L6CA 4CLEA 4CMHA 1LS1A 3RS5A 4RHXA 3BFPA 2REBA 2IF0A 3U7FB 3IT3A 3QEKA 4JU8A 2HZ7A 2FPPB 5FWNA 5BSMA 3WZMA 3QSGA 1XQWA 3ZDBA 2JH3A 3WLKX 4DV0O 2DWOA 3ZQ4A 2WSSA 3HWWA 3UJCA 4BX0A 1CKEA 2QQEA 3CR7A 3RWOA 5ITZB 1DAGA 3MTJA 1L7AA 5IM4F 1LNZA 2JD2A 3HLKA 2G0AA 4DSAA 2VBIA 3L7YA 3X2SA 1R4AA 1MNAA 3OECA 4IG9A 2AFHE 3MJSA 1FTWA 1PZHA 4YB8A 3IOEA 3WMEA 1OVMA 3Q98A 2IYNA 1Q2XA 1YB4A 2OZEA 3ZE9A 1UEXC 4WUTA 4B3DA 2WKWA 3AUKA 4M8NE 5AW1A 2HNBA 1RYBA 1BHO1 3ZJ4A 4S2EA 2XGMA 3RSZA 3HRHA 1K4YA 4WZAB 4LCOA 4CG3A 3PX2A 4QULA 1N6NA 3NC4A 1XLVA 5JVDF 3FHCB 4G5XA 4IILA 3OZEA 4I6EA 4W7SA 5C7LO 3LBFA 4ZQCB 1NXPA 1TUBA 3J80A 2XOEA 1L5ZA 3UG7A 5J47A 1YTFD 2TMYA 3CCFA 5ADWA 3TW0A 3SKVA 1COWG 2IXEA 4E3WA 3ZI7A 5B1IA 2RGYA 1FS6A 2GUWA 1IXRC 1NQWA 4WZBB 1NBOA 4FYXA 1Z06A 3DVRX 3IAAA 1PWYE 1YVPA 2FR1A 1A8QA 4NF2A 5CH8A 2QJOA 4KQCA 3ZJTA 1HE4A 3ETNA 1V16B 3L7OA 1JQAA 2V45A 2X6TA 1E2NA 2DYRB 4FFVA 2W2OA 5I4CA 1IE3A 4G26A 2DHCA 4OMFG 1O95D 2YXYA 1C30B 2R1TB 3KQPA 4QX6A 1RWWA 2JGJA 5ERXA 2GN0A 4GMKA 4W5RA 5K51A 4ZYLA 1QQ5A 4K9NA 4JZGA 1GPNA 2RGGA 4XCQA 2A30A 1PS8A 4KXYA 4ESEA 3LUFA 4MQBA 1XTPA 3M5DA 3H9EO 3QFTA 3KM0A 5TX7A 4FYWA 3QWBA 3TW8A 5CH5A 2LO1A 2YL2A 3LA8A 1XXLA 3D8CA 5BQXA 4IDHA 1PX2A 4Z99A 3LT5A 1DOHA 1YJQA 1I4WA 1W85B 5TVKA 2ON6A 1XCBA 4JR1A 5FFFA 4FU0A 1TGVA 1GNPA 3PRHA 3DSQA 2PW9A 1U3WA 4FGSA 3OM1A 2FX2A 1XYYA 2CDNA 1AB6A 4MVJE 2C4MA 3WNDA 1JRLA 3VSAA 1BFKA 2CEAA 2CLHB 4IGEA 4Q9JA 3U7GA 1P1FA 3TRDA 2HTEA 1KFJB 1GH6A 3OEEA 4WK4B 3I37X 2UYGA 1ZK3A 2C4KA 3WB9A 1F8XA 3HBNA 1GSAA 4IGAA 3W5HA 3SZ3A 4K6CA 4RBNA 4DDTA 3OIUA 2J6BA 1KJNA 1QCDA 1ZGBA 1DLBA 3K8QA 3SXJA 1ZG3A 1ZIYA 5FA6A 4ZDKA 4AHCA 3L1VA 2FUG6 1RJ9A 4NYJQ 2BVNA 4PGAA 4UHBA 2QA4V 2HKOA 4NXMB 3GD5A 4RY8A 3TEFA 5AXAA 3I1YA 2P4QA 3R09A 2PE5A 1S76D 2HT6A 5KQSA 2XVZA 2V9CA 1XMVA 2X6BA 3MT0A 1GOTA 3Q11A 4PLWA 3IT1A 1J97A 1WP7A 4YRIA 4P9DA 1DQRA 4DDKA 4BJ3A 2AG5A 5HKBA 1X3SA 5B1BC 4WFQA 5IUNC 2IOFK 4AJ9A 3DA8A 4FLFA 4G9EA 2G06A 4W4TA 5AXBA 4G0UA 3JAKB 3PNYA 3KHUA 4WDQA 3EZNA 1ZNXA 4L5IA 2XQJA 3Q85A 3F7MA 4PCAA 2J3DA 3IR5A 2QPAA 4E03A 4BNTA 2GSDA 2EGHA 4MW0A 4AJEA 1A9RA 2HDHA 4LYFA 1SKQA 4IGKA 2Y0PA 1RKXA 2C7RA 1S9DA 1JLSA 2VBGA 1OCRC 3E2PA 5KQGA 2AN1A 1U2DC 1A97A 2RC6A 1WCWA 1D1PA 1AKTA 3AESB 4JYAB 3ZU3A 4UM8B 5JJIA 4F2HA 3W5DA 4KH1A 1OBVA 2EBWA 3HDTA 3U9SA 3KFXA 5HF6A 4B5KA 4F6RB 2H7VA 3RYIB 2GN1A 1P9OA 5EJ6A 2O9JA 4L07A 5FTMA 3GDWA 3UWKA 2O14A 3H2SA 2C0QA 1L7VC 1WA8B 3NV9A 1SXJD 3PJRA 4RK5A 3SICE 5LBQA 2QTTA 4HRYA 4QXAA 1KY2A 2VPQA 3F78A 3M4YA 2PGJA 4Z4GA 4MVJH 4NOJA 5H8WA 3TCUA 3ILYA 3C1AA 4EEQA 3L49A 4CIXA 5SY9A 3FZNA 1YBFA 1XHZA 4ETWA 1RFLA 3I61A 3VR6D 5FEMA 4C7OB 4MWDA 1PG0A 1PFQA 1XEXA 1P91A 3IJEB 1U81A 4KEAA 1IY0A 4IZOA 1JAZA 5EINA 2Y4UA 1NJ8A 3KE9A 4REMA 1OLOA 3LK7A 1V1RB 2BGJA 3UY4A 1HP8A 2O1SA 4TN5A 3Q72A 2QN2A 3IP3A 3ZVLA 3B1XA 2FKXA 4TQFA 1Y1LA 3BRSA 3LO8A 4Z4HA 1J09A 2DFKB 3MGAA 4LMPA 3QLUC 3L4KA 3N2GB 5KOHA 4U7JA 2NR5A 3U61B 4ZD5A 4IDOA 4X1YB 1O6FA 1QDUA 4EKGA 4LZAA 1LPOA 3PHHA 3OEEG 1Q7YW 2FJ0A 5IHXA 3ZLTA 4KXWA 4MITA 3LQ1A 4IT5A 2O07A 4D6TH 4JI6O 1KBOA 2OY0A 2Z2XA 4UCWA 4A03A 2H3EA 2D7CA 4ZZ1A 1RMQA 2XZTA 1UDAA 1BOOA 4ZO4A 2P6JA 4MB2A 1YMQA 3RVBA 1EX7A 3IEKA 2VUIB 2NIPA 3WX0A 3V8VA 1GA4A 4LJKA 4JLSA 2Q6IA 1SCKA 2GNPA 3CVUA 3MJEA 1D2CA 4I50B 1E32A 3GJ5A 2PUHA 3MGKA 2VT3A 1SKMA 3FFAA 4GR4A 1YRLA 3I4CA 2E4VA 3V46A 2DB3A 4H7DA 1FDRA 1VJ1A 4OHRA 1YZBA 1L4BA 1ZKMA 2H3OA 1SIBE 1G8MA 3GT3A 3FH0A 1K7YA 5F76A 2ZBQA 3DTUB 3LLSA 3SHVA 3JQGB 3IEVA 2V6FA 5HE9A 4BCDA 3I62A 1K63A 2GXQA 2WZQA 2NG1A 5KNCA 5IDQA 3NTRA 1NQXA 2C2AA 1K5GA 2F93B 2SKEA 3IPCA 4B08A 3P0IA 2ZZNA 1H2RS 3GPLA 4BPBA 3OPYA 2LFSA 3G2MA 3QKWA 1A04A 3U0ZA 1I32A 3OFND 3CXUA 4DQDA 1X4TA 4CS4A 3JQ6A 4UAJA 4V1CB 3QPAA 2OV8A 3W2IA 2WFLA 2ZATA 4YMIA 3L93A 4UBOA 4D4LA 4JV5B 3BWMA 5FORA 1P5HA 2FPXA 3TI7A 1P5JA 1Z62A 1WTAA 1USWA 4OD0A 1W46A 5AW8A 1JFFA 2P9JA 2YS7A 2WM8A 2QTMA 1XJWA 1ZFNA 4JR0A 1SH7A 2FN8A 2OZPA 3M9WA 2AQKA 3G7SA 3AM5A 5KJ1A 1F4VA 2WE7A 1L4UA 3PDIB 1CS4C 4G8DA 1HKUA 3TCXB 3N76A 1KUQA 4PA3A 2FEOA 2J4DA 4HTFA 2A5LA 4C7KA 3V34A 4YRPA 3EPJA 3HVHA 2DW4A 3WKBA 2QL6A 4E46A 3COPA 2IU4A 1ESMA 5EC1C 3I6ZA 3W6ZA 2VDLB 3C8UA 2N74A 5CPFA 1ZWLA 1OXUA 4A23A 1RRPA 4XQEA 1OTXA 1HRDA 1N2JA 1NW3A 4QRIA 1MC1A 4CM3A 1BHSA 5DVZA 1Q2UA 3W4JA 4XWWA 3S40A 3WADA 3X1YA 2BFCA 4KO1S 3CA8A 3U3MA 3ERCA 2I4OA 3OM0A 2H1SA 4Q66C 3QZUA 2J5XA 1KMIY 3AVQA 1XRPA 4HC4A 1IJKA 4UV8A 3AO0B 2ZB4A 3TNFA 2X7JA 2DFDA 3UENA 5TMEA 3THYA 2BBOA 1DEXA 3BS4A 1SAYA 4G5GA 2PLNA 4CZ2A 4NPHA 3B52X 4CQMB 3H2HA 3O73A 1JG7A 4OWPA 3AL3A 2RAFA 2IHKA 1GG5A 5G0UA 4ND8A 5JG7A 1NLYA 1CUYA 1J00A 5GW7A 3SMQA 1TU4A 3LECA 3AEQA 3O2SB 2RKWA 3VOTA 1VF6A 2WM9B 2HMSA 3QVXA 4PDVA 1Z0KA 3WQHA 1YZTA 3RBVA 1NP3A 2R4TA 3GLHB 4WFGA 3LBYA 2AEFA 3OAAA 3H2BA 3V4FA 4QE3A 5DYIA 1YRAA 1WO8A 2C2ZA 3UA3A 3TZEA 1VSQA 3QTBA 3LDUA 4OV6B 5KTPA 1QFXA 4C4XA 4OAQA 4AKTA 4UNRA 2SNIE 2FSUA 2ZDIC 3GJTA 4Q1VA 2JLWA 2CK3A 2OHJA 5EHIA 4XVCA 4I4CA 4HAZA 3DC6A 1O7JA 1N5RA 1E7QA 1JDTA 1VZ3A 2XCOA 1FLNA 1AY0A 2B8JA 4O4LB 5AMXA 1MIOA 5I7AA 3K4QA 3PFWO 5KKCA 4FFLA 1Z5NA 2FHPA 4UEWA 4NP6A 2YIVX 2HLPA 1AN0A 4KR2A 2Q50A 1RTKA 4CETA 4C7XA 3R3UA 1T15A 3IE2A 4PLFA 4E32A 3MOSA 5D6NA 3OT5A 2C2YA 5F7XA 2Z5FA 4X66B 4NZNA 3MGBA 1E9BA 1ZD9A 5DF1A 4ZI7A 4AICA 5JDIA 1B3RA 1CY2A 1NW6A 4UD6A 1XDDA 1I36A 1V37A 1NUHA 1IN8A 3TTSA 2OCBA 1BJTA 3LTEA 5C2OA 1KI1A 4II2A 4M0FA 3P52A 2QGZA 4QQRA 3NWPA 1X7WB 5AWFC 1KVRA 5IAEA 4W5OA 4O2BF 2HWYA 4XBFA 3KO8A 2YC0A 4Q1EA 3AJDA 3L8DA 3WLRA 5B3JA 4JL5A 2BHNA 4ENRA 3AJRA 1CDDA 1Q1QA 4KWHA 4AZ3B 3D4IA 5EJAA 2GDJA 4L28A 4NJMB 1NXOA 3FMPB 4FOTA 2ZRKA 4ZC8A 1BXGA 3DVAB 3IDFA 5C1DA 2B8WA 3JXEA 1YQUA 1WEKA 4AS3A 3JRXA 1GZUA 3IUQA 3K9QO 1YHYA 2NGRA 3FHTA 1N75A 1RCFA 3ZGXA 4FDVA 1CY4A 3I09A 4S3MA 4AMGA 4DWWA 2O7PA 3E86A 4L8WB 3CLRD 4PA6A 1NI8A 2AE1A 1XILA 5KS2A 4OU4A 2E7ZA 1FP6A 1NTOA 2UZ1A 3F8WA 4N65A 1UAYA 3N74A 1IVNA 1XZGA 3FZEA 4MKHA 2MINB 1T8UA 2KWIA 1ZJ4A 3BHIA 3DC7A 4L9AA 4V0LA 5B4UA 5JHGB 4MVSA 1IM8A 2A5DA 1L1EA 4GPAA 3F7NA 3EC7A 1RQLA 3QH4A 2PT6A 1BFUA 4Y7DA 1XF1A 4R1PA 3C15C 4FSXA 1I3MA 3IEUA 4CBCA 4RUKA 4YS6A 5KQLA 3FOWA 4OGGA 2WUDA 4PAOA 3ETLA 1BTOA 2IDZA 1ZUHA 2P8JA 2WWRA 1QH8B 3JWPA 4Y1RB 3FF4A 4Q3NA 2Q3FA 3PDUA 1ZNWA 4X3PA 1KRHA 4RF5A 1OXMA 1E3SA 2JLCA 2J09A 2ZT9B 4PGHA 4AZWA 1GZ3A 1GUBA 1KPIA 1PR4A 1UX0A 2GXSA 2X9LA 3TH5A 5FPSA 4ZO8A 2HF7A 4RSRA 4IZIA 1FY2A 2ZPAA 4CEIA 1EFRA 1YI8A 4N54A 3DZBA 1HLFA 2ECOA 4D8TA 4C2TA 1JMKC 2EIMC 4KO4S 4XUGB 3D3WB 4RW0A 1UMDB 2CDAA 2GD2A 2BMJA 2YH2A 3EYWA 3C3MA 3RKSA 3SEAA 5TQ2A 2AOWA 4ZCTA 5J2TA 1ZMBA 2IZ0A 4JIMA 5D87A 4HT3B 1CEYA 1OX5A 4U3JA 4OHOA 1KZ1A 1KY4A 4PSKA 1RRCA 1DB3A 3RREA 3EOBI 3I9NA 4PC7A 3PPVA 2GARA 4HXFB 3BPZA 3QY9A 4MR8B 2AC4A 2GR9A 4LI0A 2X6RA 3VJMA 4MVCA 1IHUA 5FNVF 4UBLA 2RBKA 1YJ9V 4YO7A 5EWMB 4JVLA 3VKUA 2Q5ZA 4HQ6A 3H1JH 5A6SA 4EF5A 1LNSA 3MUFA 4IOKA 4I9FA 3NUZA 1H3FA 1V41E 2IGBA 4ETMA 1MG0A 1QGDA 2O5EA 2R00A 1X15A 1LPPA 1IUNA 1GPAA 6AT1A 3BMOA 2CVQA 4Z9XA 5BV8A 2Y1KA 3PIRA 4X64O 5CBPA 1GRRA 1VMGA 3NIFB 4OKIA 3T95A 4JSYA 1OV4A 5IYZA 3AP1A 1BHBA 3GLTA 3IODA 2O8EB 4ALLA 1QSGA 1L4FA 4CRWB 1UJ6A 5HFJA 4M37A 4UHJA 2P6MA 5JZBA 1PV2A 1UBSB 4AAYA 1XWIA 1RWXA 4HAUA 2B5UA 1N1GA 3EIEA 1YKFA 1XKXA 5FPHA 13PKA 1K7FB 4BFYA 5DGCA 1TF2A 3B2EA 1UZUA 4D5EA 4X62B 2WVHA 2QUIA 5FWYB 1DCTA 4MUJA 1KAGA 4IPTA 2FG7C 1VYVA 1BRMA 4U8GA 4B40A 2EZPA 4ARIA 1APBA 4XB1A 4MI3A 1D5NA 3AW8A 2LGQA 5EZ6B 2OCKA 1D2NA 2VQSA 2FRDA 2FWRA 5F78A 3IELA 1G21A 3U1BA 5L7TA 4KR7A 2ACVA 4F9TA 4PNHA 3LL7A 4BB9A 5A2GA 5F5XA 4ND7A 1LPMA 2BP7A 1J8MF 2J45A 3ER9A 1TM2A 4FM9A 3MINA 1I9GA 3UAVA 4AN0A 3HXOA 3V2UA 1L5KA 1ZVQA 3GHYA 1YKSA 1Z26A 5HNKA 3F9CA 4LH6A 1QIGA 4ENPA 2J9FA 1M2HA 1HFWA 4MUAA 2CB0A 4ZI5A 4K8OA 2X3UA 1SELA 1V4NA 1UXHA 1IPHA 2QYTA 4NK4A 3S2EA 1TZ2A 2QD4A 1YIAA 1KQFA 1OA1A 2HXGA 2IH5A 1P0PA 1O54A 3FVVA 4FCCA 2EF1A 3KPUA 4U7NA 3WWEA 2XYPA 1NF9A 1R12A 4O4IB 4H3SA 4MSDA 3NBMA 4EAAA 3D64A 4WN9A 3DBIA 2O5CA 4RVCA 2XAHA 1YZ3A 1BH6A 2C2OA 2Q8QA 1VL0A 3I9V6 1GYPA 3H5IA 4J4TA 4PIVA 3C4JA 4R2XA 2EIJB 1J5PA 1EK2A 1KI4A 4P7JA 5B7NA 1ZC4A 3OI7A 1EK1A 3AM4A 5AVVA 1A4UA 2GF2A 1ETUA 4FDLA 4BQIA 3HCPA 3MB5A 1N92A 2AZXA 4S24A 4CCYA 1KPGA 3ESCA 3D7SA 2GS9A 1I8TA 1D4AA 1UMCB 3D7RA 1EFRG 2A84A 3UT5B 4ZU1X 3ZPXA 1VPDA 1YQGA 2UUBB 3CUKA 4AXXA 3FKJA 2OGWA 2H06A 1BNCA 4AWAA 4KE9A 3HVRA 4D4JA 1ADYA 3H9CA 3EGOA 2MMCA 2B5OA 4NCNA 5ALWA 1I1OA 1HNXO 5HE8A 3LMKA 3FYUC 2NNWB 2FB9A 4E09A 4XLZA 3CH6A 3JQDA 4AP9A 2PLRA 4BZWA 1GLNA 1F0KA 4CQLA 4P0TA 5B4VA 2IUUA 4DR4B 4A73A 3D43A 4W6ZA 3DXFA 3IOCA 3ML0A 1ODLA 3DMNA 4D3ZA 5C53B 4GYWA 5DNUA 4UTNA 4DR1O 2B1GA 3PNMA 2KE5A 3DDNA 4TSFD 4C6TB 1EDEA 1RWNA 3KVVA 4QYSA 3D8BA 3OQVA 4J2OA 4OHMA 3MMNA 3EH1A 1YNOA 1Q14A 1YZNA 1OVGA 2W2KB 1QU3A 4Y67A 4QVGA 4PG7A 1OX6A 4WPGA 3H84A 1II8A 4QGPA 1U2GC 4EA8A 2WWYA 1NW9B 3DE6X 2ODBA 3RARA 4IHQA 4AJPA 3EGXB 1ZGZA 4WXEA 1E6CA 4J0JA 2NU9A 2HYDA 4B8YA 3SJAA 1AI7A 2XOXA 4J07A 4EX7A 3AFMA 5JMTA 5DLEA 4CT4B 2BD0A 4BVKA 2YHBA 3IRVA 4LQ4A 3KCQA 3MJHA 3TXAA 1YOBA 2FUNB 3QFFA 4JD5A 3FWPA 3BA6A 3K8YA 4E0QA 3AF6A 4O4JF 4RWUA 3GJ8A 4KQKA 1VXRA 1DIHA 1VP3A 5EIHA 2O54A 3E7FA 2EBFX 1VKJA 3TLGA 3A1SA 3IQFA 1EINA 1NT4A 3VNRA 4HBZA 4QEDA 3GVHA 1A9OA 1Z0UA 3BEOA 1R0YA 4ZHQB 2IH4A 4F04A 1ZS9A 1HH4A 3CB2A 3FTEA 1SQXH 1KC8W 2H2WA 4X20A 5JXGA 1E8NA 1OWOA 3PQ4A 4MV8A 1F2VA 1M66A 3IR6A 4TQAA 2PX8A 4AN1A 2PLWA 2G88A 4EVSA 1L9KA 1YOVB 3S0JA 2NV0A 3KYBA 1J6UA 5K3CA 4HAWA 4ZOAA 3SZLA 1LUAA 4X60A 3LX6A 4RLSA 4IVRA 4G0WA 4CDRA 4NEGA 4C6SA 4TMVA 3HUFA 4MVYA 2QKAA 3EK2A 4WSOA 3EEOA 4QRDA 1I3OA 1X8XA 1X80B 3X2EA 5GM2A 4U6SA 1BCSB 2F2TA 2HD4A 2NX8A 3T99A 3W7XA 3U11A 2OYRA 1NJ5A 2JI8A 3O65A 4B3BA 4GUDA 5ULLA 1QGUA 2BT4A 1H4TA 2M1ZA 3ZX4A 1YE5A 3C4QA 3R8XA 3L18A 4IEEA 4BNXA 2D62A 4O5AA 1CF4A 4XD2A 4L9WA 2HRQA 4EUEA 2V98A 1HR0O 1RWVA 2CXRA 4BU0A 4LW8A 3X2QC 3QUBA 1K9MW 2P6RA 1R4NA 4U7DA 5AW0A 5TGZA 4QUBA 2UUAO 1NNI1 1LDYA 4FINA 3ZDDA 1OC4A 1OCCC 3B82A 1QR2A 3TEMA 1CR0A 1D03A 3LVBA 3CUUA 4WKCA 5CA1A 1PKEA 3W7SA 5GTIZ 5INTA 3G9ZA 1FXUA 1DLJA 1Z82A 1G20A 4BQQA 1LNQA 4MVRA 4ABTA 2WWFA 5EOVA 1Z75A 1I01A 5CU7A 3ROMA 3E23A 4WCEV 2F9FA 3TW6A 1FPQA 2N1BA 3QY0A 4MQEA 4ZV7A 3T34A 2QMEA 5KCZA 4KDCA 5EEHA 1IQPA 2IH2A 4NV3A 4CTKA 1OCOC 1XEWY 1DIAA 4YR7A 1V4BA 3ZMZA 1G4HA 2B21A 2VXBA 2XZPA 2PWYA 1PUXA 2IVZA 4JB0A 2ODMA 2Z57A 4PSVA 1X1RA 4ZI2A 4BX3A 4B43A 3AB3A 3PI6A 2J3LA 3LX4A 2J67A 1ZL8A 4NECA 3K5OA 3C85A 5LA6F 4A16A 5CA0A 2GVNA 2FUKA 1LSJA 1M8JA 5JAMA 4BIUA 1ZN2A 2GJ8A 4L0DA 1Z8NA 3ZE0B 1BL8A 3TE7A 2GA8A 2NXWA 4RTNA 2BMDA 3KVOA 3QPUA 4MV0A 3N2KB 1DDIA 4Q6GA 2O19A 2Q9UA 3K6SA 3MUNA 621PA 5BVGB 4YT2A 3EA0A 5GAOA 4UV9A 2OCDA 4EQZA 2P9GA 2XWBF 3H86A 1QZTA 1J5XA 4NBSA 1V2HE 2R6FA 2ORED 5CNKA 1GCGA 4CVNA 3EB9A 2XUOA 1KMCA 2P7IA 2ZR8A 1L5MA 2YIBD 2Z4TA 2CDBA 2IM9A 4DMMA 4CIAA 2D00A 2ZAGA 1G8HA 3ESZA 1SERA 4GMDA 3AVVA 1CRZA 4HEJA 5CNMA 4J7XA 5LU8A 3FCUB 4OM7A 3FOCA 4JXEA 1B3BA 5KJFA 2ZJYA 5L3EA 1CQXA 1O0CA 3H4TA 3KAJA 1RR6A 9LDBA 5TGDA 2VSFA 3BF8A 4X1IA 4E51A 2JK0A 1QOPB 4R9VA 1QG6A 2XAJA 4AP5A 3R8CA 2NZJA 1TYDE 1AKMA 5ALFA 1ZVMA 2PF4E 1TL7C 5KSYA 2HMTA 4MPRA 1J9EA 1VB3A 2FMHA 3ZY6A 2GPJA 1RKQA 1FSFA 5BW5A 4NPAA 4TV8B 4QARA 3KPWA 4EHDA 3SLRA 2EL9A 2N75A 4H13B 5BV7A 5KOYA 2PMDA 3VX3A 2PZSA 3RTAA 4MVXA 3HM9A 1UKBA 5CG2A 3O4GA 5I01A 3OFJA 1GXSB 4G63A 3UFBA 1I6KA 3R65A 3EIUA 1Q3KA 5IE9A 4UHDA 4ESVA 4G27B 2QK4A 4MJXA 3MG9A 1UADA 5JBIA 3WG7C 4WESB 4ZYVA 1NAHA 5B1EA 2GN2A 4E94A 3KAPA 3A9TA 1Q1BA 4NIMA 2BC9A 2QN6A 3BMNA 4N76A 2LIVA 4IV8A 4OGFA 2B4QA 1R5TA 4U5QA 4BTVA 1MTOA 5SY6A 1NI4A 1NVPB 3TI9A 2C96A 4W5TA 3KHSA 4GVXA 1P2FA 2O8FA 3FAVB 4QEKA 2RMKA 4MUBA 1CUJA 3QKSB 3E5MA 6Q21A 2VAWA 2L0XA 3DHYA 2ZRLA 2VHZA 3S27A 3SM9A 2F48A 4HLNA 3WWZA 3UEOA 2I7VA 1L7PA 1OH8A 3DM5A 3ROGA 2ANCA 4F4LA 4YACA 1ZGAA 4N03A 3AK2A 2XUDA 3AX6A 2RHRA 1CUBA 5CLLA 4E2WA 2Y1DA 3Q9UA 2V3CC 4NYMR 2G6VA 4ITVA 5CM9C 2PS0A 4LF7B 4JI5O 2FY8A 1V5GA 4H4DA 5CB4A 4BE9A 3PXDA 3MVEA 4BLPA 1OROA 1RHMA 2FWIA 5KJEA 1JA9A 1DG3A 1A4XA 1MCZA 2WG0A 4ZXFA 3AERA 5D7NA 3IC5A 4DMUB 2EVWX 1JPUA 3BFKA 3SC2B 1X7DA 1LBTA 3JCZA 5BR1A 2WTAA 4R4JA 4UBIA 3B9RA 1U11A 3RWBA 3L43A 2QLTA 3WRYC 2R96A 2DHDA 4PDMA 4L2IA 3GT7A 3REOA 5IF3A 2CH7A 4RADA 2W90A 4IFBA 5DYWA 5KNLA 1JJOA 2QRPA 3D2LA 3NOXA 3STXA 3SXUB 1PFWA 2G25A 2PQMA 3QUQA 2Q7GA 3B6ZA 1E6EA 5BSKA 5JV5A 4BFLA 1QK4A 1O0BA 3QLVA 3KT6A 1RQRA 3OPQA 2WLKA 4DIOA 5A06A 3IFXA 2VCHA 3UCXA 3VYSB 1NBWB 4PVCA 1R74A 3JW8A 2H65A 4G1UC 3TG8A 2B4YA 4BIOA 2R5FA 5TARA 4II7A 4EW2A 1TKRA 3KQVA 4DM7A 4HZ3A 4R6ZA 3OHSX 4M9RA 5CCEA 3A1NA 1UDBA 2MDTA 2KMLA 1P2TA 1PJQA 1J0EA 4F38A 2W48A 2IHJA 5DNWA 4XGIA 3QUAA 4RE5A 3RU2A 4BP3A 1Z5WA 5KMGB 2VPXA 4BLUA 1G5HA 1SKBA 2PKQO 1G2OA 1V35A 2GBIA 1U6JA 3OKCA 4DNXA 5BNFA 3EPPA 3I52A 1KZGB 2IU0A 5JD3A 3J80N 4GOMD 4YAGA 4LE1A 4QPJC 4RM2A 5TEWA 4KITB 3UW3A 2HOQA 3IEXA 1FMJA 4CTMA 1VQ2A 4IIJB 1H2FA 4M7OA 4Y2VA 2ZIFA 3X1JA 5BNIA