1G8MA

Crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase, hydrolase
molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
pubmed doi rcsb
source organism Gallus gallus
total genus 207
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g8mA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1g8mA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA02
2IU0A 1IK4A 1JDBB 1KEEA 1PL0A 4EHIA 1THZA 1BXRA 2X8WA 4A1OA 1VMDA 2B1IA 1C30A 2XW6A 1B93A 1ZCZA 1EGHA 2YVQA 3ZZMA 2B1GA 1CE8A 1S89A 1CS0A 1C3OA 1A9XA 1OZ0A 1M6VA 1WO8A 2IU3A 1M9NA 1P4RA 5H3LA 1PKXA 1S8AA 1G8MA 1T36A
chains in the Genus database with same CATH superfamily
2XF2A 1UWVA 3ZRWA 5HDQA 4YS6A 2PEYA 1MNAA 3CQ9A 4MTXA 1NR1A 3BAFA 1RPTA 4MPRA 2IK8A 1Z2EA 1GZHB 2BDUA 4FFMA 5F9FA 3TLKA 1KQOA 3AIKA 1HDIA 1RWBA 2PGXA 3ADOA 4LX0A 5HS4A 2PUHA 2BFFA 2ZYAA 1OYOA 2J7PA 4TQAA 3VYTB 3GRZA 4MYDA 4TYWA 4YP1A 4PV1B 4GBMA 2Y77A 4Z3KA 3J7AC 3HUUA 2R1ZA 3M7IA 2AHZA 2I8AA 3PEFA 3OJEA 3FETA 3LUJA 5JLAA 4XYBA 4E31A 1CQZA 1FTYA 3CZRA 3QU9A 4LZAA 1TU0A 4AKIA 1PDVA 4YT2A 1PTJA 4EJSA 2QDKA 1BDBA 1GZ5A 4R9VA 4ERNA 2M7WA 2GN4A 2GTPA 1T8RA 2C77A 4G1CA 2H5IA 3MWDA 3N3AC 1EFKA 3MWLA 3DKPA 1GEGA 3LYHA 2HSZA 4HLDA 2A1UA 2QQ5A 4YCMA 4Z4QA 2NQTA 4OQFA 4X8AA 1NT4A 3AKEA 2PGNA 3CJQA 4FEYA 4DR7O 1FRQA 2IHYA 3VGPA 3O73A 5AYVA 1XP5A 1HNWB 5ADUS 1IY0A 2GBLA 4MXDA 4A0RA 1YIJV 1DKMA 1QP0A 4U3FH 1N6HA 3THYB 4ND8A 4BIMA 3LUCA 3KVVA 4OHCA 4UCWA 3JV7A 2OHGA 2VJLA 1DGSA 1JEJA 1OAAA 3KZXA 3E7FA 1D1TA 4J6EA 4XLZA 1ZH0A 2HEPA 2LBPA 2HRCA 3IVXA 3LVQE 1QMPA 3U10A 1H23A 5GTIZ 2R6JA 3ONVA 4F93B 2TS1A 2Z1NA 2C42A 4MQ6A 2HC9A 1J22A 4TXHA 1NFRA 5D6OA 5ALEA 5JEDA 1E9SA 3RYCA 4B2LA 1HRKA 4XFKA 3A26A 2W2LA 3VR3D 1S4MA 3W6NA 2ZJFA 3DAGA 5A9TA 2YDEA 1PEYA 2ICAA 2FPPA 4J0FA 1EDEA 2XSZA 1XJ0A 1HMYA 1D1SA 4U7JA 5TISZ 1G9XA 2M98A 2NSLA 5FLKA 1KWGA 4L78A 1FUIA 3PNKA 4NVRA 1VMDA 1DWPA 3CN9A 2IZOA 3L84A 4FZJA 4Z3OA 3HZZA 5K2MA 1BYIA 5SZJA 4RPJA 3UJ3X 3DYBA 4QOEA 4CTOA 2R8XA 3OZWA 1DRKA 2C96A 1Z22A 3DVRX 4NESA 4HD8A 4L9SA 4ZD4A 1DWUA 1LSJA 4EJ0A 4JAUA 4NMXB 2BCEA 1TEZA 4HX9A 3B1VA 3ITNA 3OCJA 1NT2B 3QVMA 1PR5A 2Q2OA 2C4TA 2VK2A 4XX1A 1HDOA 1NQWA 2QLTA 4U2FA 4KV9A 4NFYA 4GQAA 3H9QA 1Y1SA 3OBIA 4FB4A 5DP1A 1E1RG 4XKJA 3G0GA 2OZEA 1UDBA 5F35A 3CLRD 1P6QA 3M5WA 3AVPA 1G8KA 2Q3LA 5KA5A 2X7RB 3E05A 4OUDB 3GEMA 2AWOA 3PZRA 4E7OA 1VP3A 2QLBA 4EATA 2ATIA 1V47A 4MUNA 1PJ8A 1N1EA 4JKYA 4UDYX 1GPMA 4WLUA 3ZY6A 3VPDA 5KIAA 1LFAA 1AKYA 3PENA 4Y6SA 1MTOA 3G9UA 3GJ0A 1AKEA 2BGWA 3C98A 3HJHA 3N5CA 4DMRA 4OSPA 5DMHA 3CLHA 1IK4A 3BE6A 2B1RA 4YRGA 4ZQGA 3RJ9A 4E5PA 4HB2A 1C80A 2ZU6A 3DO6A 4PAOA 2R6FA 1M5UA 1E2QA 2IXAA 5DGXA 3L6UA 2C57A 2WOJA 4RCZA 4GXRA 1PUJA 4ZVSA 1EFHA 4C4SA 4A92A 5J3JA 4II2A 1I80A 1KDZA 2CJPA 3QKTA 3VHXB 3Q3GE 1L3IA 4PZLA 1A9XA 1I1NA 1E94E 3CLKA 2PS3A 2ZCUA 4WXHA 3ZCTA 2W2KB 4BEJA 3IGFA 3F2IA 4CEJA 1M2VB 3BXOA 2H29A 3C3DA 4OCNA 3O38A 4RBNA 2H1WA 5AOBA 1XRMA 3UEOA 4H1UA 3UJ7A 3CUYA 1W5SA 3JWJA 1N2CA 2X6TA 2FWAA 5DBFA 3A4VA 4FYIA 2CMGA 3W7WA 1SCQA 2OGSA 1CY6A 1IATA 1BWPA 3WZLA 1G2IA 4F85A 2CXTA 3C14C 1XMVA 4JGSA 4QUAA 4ASUA 3K5WA 3BWVA 1N7JA 2JZCA 3D6FA 2YN2A 2CL0X 3ETJA 3RU3A 1G291 1P2DA 4B82A 2JLRA 3N05A 3R0QA 2D8MA 3E2PA 1GYQA 2JJ2G 2HCFA 4NZ9A 2YV1A 4IFTA 1BAPA 1FPMA 5E1MA 4ZJUA 1R0KA 3AUFA 5BYKA 1TYBE 4V1CI 1N92A 4BVAA 1LLFA 2CLKB 3OZSA 5EMKA 4D46A 4DIMA 1YQQA 2C7PA 4OP2A 3V7WA 4ZT3A 3OSZA 1TO6A 1TZ2A 4R81A 2B61A 5FNZA 1WHTA 3UMSA 1QDEA 1W93A 3MBIA 1J5XA 1RBQA 3DEHA 3IEUA 2PA0A 5E95A 5BXZA 2A2ZA 3FNQA 3AM1A 1UIMA 2Y68A 2AGVA 3KPJA 1YIAA 2EINC 1FLVA 3IIJA 3DCIA 2NT4A 4NBRA 4G86A 4N76A 3JZAA 3MWEB 4CG0A 3O9VA 1DLJA 1M6VA 5ILGA 2VYVD 4KGDA 4JODA 2RE8A 4ALKA 3BY6A 2BR5A 4MVJM 4B7KA 1LLCA 4UQLA 3UJCA 5JCXA 3SDZA 2O3KA 1GLVA 1ZWIC 2I22A 5IT9A 3M0EA 1NG9A 4BHTA 2W93A 3E22A 5DN9A 3LHIA 5IN5A 3MB8A 1Z4IA 5LGTA 2W4MA 4DLUA 4BBJA 1NN0A 3CEPB 1M1ZA 4EVSA 2ZB2A 3QMPA 4HS9A 1KEEA 3WXBA 4G9BA 4QNNA 4IQ8A 2WAOA 3W7TA 1DRVA 4XB6B 3PHJA 4NYIQ 4AJOA 3GRFA 3AUJB 4RLSA 4MUXA 3ASNB 4K0KB 5CNJA 2FWRA 3HCNA 4HGPA 3MMPA 1Y9EA 3Q5DA 3TRHA 3RR2A 1WQ1R 2R6DA 3LCCA 3DVAB 4E2WA 4KHZA 4MKHA 5HDBB 4BV3A 3QPBA 2A86A 5KNBH 3LDFA 4K6OA 4N3NA 3T38A 1N0JA 5AI9A 5CFOA 3KX2A 4JI5B 5TF0A 5KUKA 3S6JA 2KM1A 4JC4A 2PQ0A 4PNPA 4JJIA 4XIYA 4FE4A 5T8KA 1YDMA 3NONA 3L07A 3ZZUA 1YR8A 3BE5A 2OPBA 4CM9D 2NYUA 4R5MA 4K3VA 4MVXA 5HF6A 4EITA 4WL0A 4FS3A 1EGMB 3FPKA 1GP2A 3NX4A 4TWBA 4YJ2B 3Q8KA 3QXSA 2UUOA 1B14A 1OT3A 1U0GA 2ZANA 4JI4B 1E61A 4PC1A 3FY4A 2A59A 3GCWA 2EBHX 3DG9A 1Z47A 2OESA 1CETA 3W5VA 1UUFA 2Y0CA 4HH4A 5DO9A 5ITZB 2OXCA 1G8FA 4JX9A 3LP6A 1UM9A 2H1RA 4CKWA 2OT3B 4D4LA 3AR5A 4EG8A 4YCAA 3R41A 2BFOA 4GE0A 3H1BA 1B6GA 2XOKD 3EDMA 5J58A 5FQNA 3WI7A 1Q3KA 4LSGA 1MQAA 4TN5A 3E1GA 2YVQA 2G36A 1G4UR 1GO3F 1B76A 1SKMA 1BMTA 4ZALA 3BMNB 4LGVA 1YS9A 2R1UA 3IA7A 5IT0A 3UQ8A 1N0VC 2F9FA 1KKDA 2HJWA 2FMFA 1G20B 3G88A 2WA1A 5NULA 4UXIA 5FLXN 3SYTA 3GELA 3NG1A 2UV8A 2I6SA 4NVPA 2Y1FA 3FZNA 3PFBA 3W5UA 1LEHA 4I4NA 1E1DA 1PGPA 3CLSD 3V6MA 3LVBA 3LTNC 1L6IA 4P7BA 4J10A 1OKKD 5IVIA 2BR3A 1LQUA 4Q18A 3O3MB 1TM2A 1BFDA 1ODSA 1KI8A 4GYKA 3DC6A 4NE9A 2HQRA 1QIKA 1NW5A 4I2NA 1RBZA 2C8LA 4WAUA 1XEQA 1T29A 4QXQA 4JSRA 3TD6A 5ALFA 1YULA 3OJOA 1EK1A 1SQVH 3IV7A 4XDLA 2WK1A 4GXQA 3SZGA 1OCEA 4U7GA 3TDNA 3TW6A 5CA3A 4ETIA 2PMWB 4N03A 4H7JA 2XYRA 4DKXA 5FBKA 2VAVA 1P2TA 3CX4A 1WV1A 1DKPA 4FYJA 2V5UA 2C5EA 3O4JA 1Q3EA 1K86A 5BV0A 3VH4A 1RJDA 3RIHA 1AF4A 5DTMA 5JSUA 2VC2B 4WH0A 1N2ZA 3BMQB 1UKZA 4I4CA 1GA6A 4EPWA 3PNPA 1EX6A 3IB3A 5K6AC 4P36A 1NULA 3WYDA 2R8YA 3FSRA 1K2VN 1PT6A 4F84A 3D9QX 4N5NA 2DWPA 4IXDA 3ANSA 3OZXA 2JA1A 2Q0HA 3HDTA 2D62A 1I8TA 1M57B 1X7WB 2AK3A 2Y2VA 1JA0A 1ZXLA 4K81B 2FW8A 3E0XA 3WRXC 3E03A 2W6NA 5J2UF 2NYTA 2VJOA 4JJGA 1TK2A 1PG5A 3HEMA 3ABOB 3U2QA 1N9GB 2FPUA 4TKUA 2OXTA 2P8JA 8LDHA 5J2TA 2OMKA 2GK3A 1JIXA 2W70A 4IHKA 1J00A 1U9CA 1KYQA 4RORA 2HK6A 3H11B 1JV2B 2PFKA 1OAOC 3BWCA 2ATXA 5H8WA 1G1XB 1P6OA 3TZHA 4XDYA 5DOZA 1U8AA 3C5VA 5DLQC 1VYVA 1W44A 5B4VA 2CJXA 4CF7A 3TG2A 3KRTA 1T6ZA 3NC4A 5BURA 4OBEA 1T4GA 2JW5A 2PD6A 2G70A 2X6BA 3KXLA 4Q3LA 1B6TA 2XNCA 2QUHA 1O03A 2ZM6O 1RQNA 5ICGA 4X1YB 2NADA 3TLMA 4CL0A 3ZRSA 4JBGA 3TQSA 1W1WA 3FAKA 4Q9KA 1Q0RA 3LPAA 1N7HA 5EK0A 4PBRA 4UCUA 2REXB 1WA8A 1VA5A 4TUYA 3OEEA 3D7RA 2JJ1D 1UXIA 1UKYA 5K9ZA 5C52B 2FPLA 3LL7A 4EUFA 4CR6A 1NLMA 3U3OA 1Y67A 3L74H 1JFVA 5ECYA 1GTOA 5I7FA 5K6AA 1W85B 1RJEA 4TYQA 3UQYS 4RDIA 3MGKA 4UTVA 3I64A 4PXYA 5CGQB 4S04A 4G41A 1KK1A 4M9RA 5BWMA 4TVBA 4BFZA 2DFNA 4LTMA 3OMWA 4HWTA 4BJ5A 4LY0A 3B2QA 2C98A 4C0JA 4PYMA 9LDBA 3UTCA 1A2OA 1BCSA 3JASB 1V25A 2IYXA 1E62A 3WDMA 2QRZA 1G8SA 4NJEA 1OI0A 1GUZA 3ONNA 5J4YA 2MIIA 4ZREA 1T6BY 4OQXA 4KXXA 3EF1A 1E7RA 4F12A 3QG5A 2PZAA 2WTMA 4ILGC 4BZWA 1OQAA 5B36A 1DTSA 4EKIA 1V2GA 4LKRA 2AD1A 4KLAA 5JDIC 1DSSG 2VNHA 3DLCA 5IXJA 1DKOA 1XQWA 6AT1A 5CNIA 1Y9JA 2DERA 4Z4EA 4N6OA 1EM8B 4DWWA 2B3ZA 3AT1A 3QUSA 2Q5IA 1NMQA 2IBSA 1CV2A 1WXDA 2OAQ1 3QXGA 1FS5A 1KBZA 4NXNO 5EQJB 4EJ6A 1MAWA 1XQ1A 1J97A 4MVJH 3EZFA 4QPKA 3RC1A 3BHMA 4FZRA 1S76D 1I08A 4UCQA 1R2QA 1QCDA 4LUCA 4G28B 2MR5A 2N74A 5F51A 3L0BA 4LYJA 5D01A 1JKIA 3ML1A 1T0UA 1W5FA 4G1FA 1TM1E 3BK7A 4BV9A 3PICA 2VHYA 4N1AA 3IDOA 2Q1SA 5B4TA 1ZA1A 1NDQA 1ZINA 4CEIB 5DTJA 2ODPA 4Q1EA 3U3KA 1LR1A 3W9YA 5F1YA 4E08A 1EXWA 4GX2A 3E9MA 1Y76B 4PSAA 1U5AA 2WF6A 1V55B 3MQ2A 4M36A 4O2LA 2I03A 5ULLA 1BQ4A 3O75A 2C4KA 1PGJA 1NFFA 3VKVA 2C00A 2JIZG 4TV8A 3L0DA 1KPGA 4FYYA 2JLAA 5HFNA 4LJ5A 1TKRA 1Z6AA 3T5GA 4BFXA 4RTOA 3B8NA 1L9KA 5U9CA 3OHSX 3OOJA 3WIDA 5KCZA 1CRPA 3UXHA 4YP5A 3WWCA 3OCWA 1MW9X 2VDJA 1N1MA 4MO9A 2C2KA 3LG2A 2GN2A 4IFIA 1WBBA 2EG9A 2QLLA 2PZ8A 2FMXA 3QE3A 3TCUA 1L5MA 4H7FA 5JDIA 4DW1A 4DR7B 1QLHA 4B6JA 4TKVA 4TKZA 1GPLA 2A0UA 4WASA 2UYOA 2AKYA 3IDSA 4KNYA 5CB8A 2QP9X 3BCCH 5BQFA 3Q0TA 5DXJA 3KQLA 4DMCA 2IHZA 3WRVA 2REBA 1SZCA 2EWMA 4ZIBA 1WOYA 4ESOA 5ELMA 3RO7A 4BO1A 1F2DA 3BHJA 1GPYA 4V0OA 3TL6A 4C1BA 3DDUA 5JNRA 2IV2X 4CM4A 4K5QA 4YXFA 5K8VA 1AA9A 4DB4A 1X0VA 4AI8A 1VKJA 2EJVA 1K8QA 3CR8A 5JEEA 1PNKA 1KWKA 4YHBA 4KJXA 4CW7A 1MHPA 4PG7A 1W5AA 5BXQC 1ABBA 4YFYA 2GLUA 2VRWA 2QYOA 1JR3E 2HH9A 4YJ2F 1XBLA 1G1AA 4IZOA 2W43A 1O1YA 5AOCA 3UAVA 3INGA 3F6CA 4G0WA 3ETNA 1O94C 1K3FA 3GFVA 5EIOA 4QNRA 4Y6LA 5A7HA 5JXWA 4JEUA 2VYQA 5A3JA 1OJHA 4ZT5A 1RP1A 1YJNV 1FDRA 3P30A 2D3OW 5CBKA 1V54C 2ZP1A 5LGNA 4N48A 2NPOA 4D9FA 4PRZA 4QXOA 4XTRA 1V6CA 3RTAA 4UHFA 3QE0A 1GDTA 1EHIA 2VAXA 1H1DA 2XT6A 4L28A 4NZOA 1KYTA 2ILVA 3ICCA 1T3HA 3MYYA 3ZTWA 3C7KA 3WJ7A 1BEZA 2H4WA 2GZ2A 3OBBA 2IXGA 3ETHA 2GCOB 4FFNA 3RV3A 3HCPA 3ODGA 2H00A 3DVLA 1GGHA 3GOHA 1DJPA 3OO0A 4MTLA 1GQ2A 4KDFA 1ZESA 4C4AA 2BUAA 5CH3A 5K6RA 4NR1A 3DUFB 4TRJA 5M29A 1K9MW 3L7YA 5BT8A 1JG7A 4G36A 3CNEA 3T3IA 4HB0A 1ZNQO 1XA0A 1OF1A 3UJHA 1L7BA 1J8YF 3AI2A 1WAMA 3EVDA 3T5AA 3BXFA 4Y2RA 1T1GA 2OFWA 5LLDA 4X44A 4MLPA 1ODJA 5F76A 4FOLA 1C0IA 5EJ8A 2OWEA 3H4VA 3ASOB 1RLJA 2HCJB 5KAMA 1JVNA 3QHAA 4G0XA 1CC1S 5BNWA 2QKCA 1JAIA 3DHWC 4O4JB 4PAQA 3EF3A 3C3XA 3D81A 1WQ4A 1EVEA 5HHTA 3O9ZA 3THYA 2FJPA 1LWOA 1U1FA 3RYFB 5AI6A 4QPNA 3ACDA 4DDHA 2XVYA 2ZIZA 1XRRA 4D8VA 4I1PA 1GT91 2YIVX 5BUSA 3N07A 2DFDA 1V7QA 2C2BA 4ZK6A 4Y1GA 4MVSA 4UHCA 1IN7A 2FG5A 3TNJA 3UQZA 3NUQA 1NXPA 4QTXA 3OIUA 1EUQA 3G8DA 3MMXA 5JJ5A 2I7CA 2IUEA 4C7OB 4FZ3A 2UUAO 1O94A 1NJ8A 3AJRA 2JA2A 1O57A 1GTJ1 4BWGA 3R09A 2RGAA 1L1QA 2ZIGA 2VBIA 3B78A 2PZLA 4U7HA 4EIWA 4AC9A 4TL9A 4AN0A 3UB4A 4GWLA 3JYPA 3CH5A 1DBSA 5AK4A 5LQMA 5AP9A 2F1IA 4DDTA 4G5XA 5K1XA 4TMFA 3NM4A 1F51A 1JI3A 2WKWA 2H1HA 5CITA 3D1JA 1OHHA 2HCRA 3FPCA 3FHOA 3LD9A 4ZYXA 2YMMA 3ECCA 2JGNA 3DE4X 2C04A 1ID8A 1KYVA 3VR0A 2R751 4DVGA 5HK8A 4DSUA 1OPRA 3FZYA 4ZDKA 3GT7A 3GF4A 3NYWA 3DA8A 4KQHA 2WP8J 3VH1A 1SRQA 3PNYA 3UUFA 1N0NA 1ZOLA 1NT2A 1ZBDA 4EY4A 4OQEA 3W4JA 1SC1A 1W2GA 1G5PA 2GUGA 1FX0B 1Z8DA 2MSCB 4QJ3A 3NBYC 3TIFA 3SZ3A 5AVUA 3WWPA 2QWQB 1B41A 2MSEB 2FZ4A 2Q6AA 4PHCA 4MS3B 2ZT8A 2VQEO 3WGZA 4EO9A 2SNIE 4HLNA 5FBLB 2WIAA 4P9EA 1B06A 3RK4A 3QIVA 5FFFA 1DXQA 4ROSA 2JB9A 4YHHO 1EVLA 5JS6A 3OMAB 4UXNA 4R3UC 1B8OA 3OSUA 2ZYIA 2QNRA 5AJWA 5LQRA 1W0KG 3K3PA 5AVKA 4CT4B 2QPOA 2VS0A 5SV2A 4AVYA 5T3UA 1CEXA 5I9SA 4HJXA 4QDZA 1MC4A 2EF1A 1YE8A 3BBLA 2XMCA 5F3WB 4NH0A 3GDFA 1VE7A 1EDDA 1BHJA 1AV7A 1BC5A 5KINB 2NYAA 2VZ8A 1QIDA 4G4GA 5DH9A 2V3WA 1BW9B 2WUVA 4IQ0A 4OG2A 2VWPA 4K9SA 1AXEA 5C4GB 3A2LA 2Y48A 3CG0A 1XL6A 3I5DA 4QUHA 3W6ZA 4FDLA 5LQJA 3RVDA 2W2KA 3VO9A 4D5GA 4JLWA 4LJ7A 1T9HA 2ODNA 4O33A 5I9BA 1M2VA 1FU7A 4RV5A 2XQFA 5FA5A 3OA2A 2UKDA 3CZCA 5A0VA 5ED0A 3N0WA 5EGNA 2C7GA 4OHWA 5JZSA 5FPPA 1SZTA 3OR6C 1ACMA 3OZEA 2WSSA 1YOVA 5ALYA 3AOEC 2PRZA 5T4HA 2JGJA 2PLWA 2PW9A 4NBSA 1FDTA 4GZMA 4B6FA 5M2QA 2B37A 1EVZA 3ASNC 2PKXA 2FH5B 1WSDA 1E3JA 3RRNA 1WPRA 1WBDA 1NQTA 2OO5A 3W6PA 4I8IA 2IXBA 1Q1BA 4A6PA 1DO0A 1NBIA 3SX2A 4NG4A 1L7NA 2IEGA 1RHRA 4U5XA 3IDFA 1OLOA 1RKVA 2YWEA 3KS9A 4E1BA 3GPLA 1X1SA 3HS3A 4BO0A 1GXSB 2R6AA 2ZS7A 3U4QB 3CPJB 1BROA 1DT3A 5H5NA 4I43B 1S2DA 3EGWA 3OF3A 2VDWA 2GBCA 3ZE2B 5TPWB 1SCBA 1FNBA 3VAYA 3X2QC 4GP7A 2XTNA 3SC2B 2CJWB 2C2MA 2FZEA 4LCNA 1UK6A 4PDMA 4RY9A 4C2TA 3VR6D 1GZ4A 1POWA 1X1AA 2ZB7A 3MWEA 2NGRA 2ZXFA 1ULSA 1AGXA 3DXRB 1FFTB 2OHJA 1XNGA 3GNQA 1U04A 4QU8A 2Q3HA 2W6JA 3Q7PA 2KQXA 4EKDA 4WEOA 1AM4D 3DDCA 4EUHA 3RC2A 5DTQA 4RULA 4G1MB 2Y0BA 1OT5A 4UTXA 3NHFA 5HSGA 5JRDS 4LYYA 4XLTA 1KDTA 4CF6A 1GH6A 1X7YA 5JXGA 5AI5A 4TT3A 4QUDA 1PYDA 1NJGA 1ADJA 1K7DA 5IM5A 5CEFA 4XARA 4D44A 3VPCA 4H31A 1Y82A 1MQ0A 4JWKA 2PS0A 3VKUA 5C1PA 3MCVA 3S2FA 3K6KA 2WLNA 1E2GA 3D8RA 3WC4A 3C8DA 3CE9A 4R9RA 2Y69B 3UJ8A 4NF2A 2P4HX 2XWJI 3WMGA 5EKXA 3EG9B 4WNIA 3AFHA 1RIIA 1ZD1A 3A1FA 1XT6A 4PGHA 2BFPA 2BF7A 4YQFA 2BJWA 1FQWA 2O4CA 4KQ6A 4QDUA 1N5DA 3DVAA 2PKYX 4BFSA 1UQRA 3BPSA 4EFEA 2QTMA 3CRZA 1VP7A 1RM4A 2DQ3A 3T3EA 5H4HA 4B45A 2XXAB 3VYWA 4ZFNA 3F6SA 3PWTA 5C8ZA 3LCUA 4NBNA 1SNYA 1BVHA 1N25A 4PG5A 2PH7A 3EQ9A 2ZBRA 3BHNA 4J90A 1NVAA 1TTHA 2P6MA 5FL3A 4OMDA 3V2IA 3WTBA 4DUPA 3HA7A 4WK6A 2JAWA 3U4AA 4A2QA 1T24A 2R5WA 5KYNA 2AMYA 1O9GA 1KZ4A 4YJ2A 1EFRA 3EMKA 4Q7LA 1N8TA 3UMRA 4LOIA 4XR9A 3U7FB 3WAJA 5I8PA 3EGEA 2CLIB 5ER6A 2GB4A 1XDBA 2X0JA 2B1JA 3R8XA 2CKMA 5ITZA 3WMRA 5C80A 2BW0A 4PICA 1N2EA 4LTDA 1JPXA 4E5SA 4Z9AA 3CBGA 5JFOA 1P9WA 5CFLA 3L4KA 5GW7A 1DT5A 4QFCA 1VBFA 2NVUB 3COSA 1V7CA 1D9XA 2GFQA 5EIBC 4A36A 1Y5MA 2QEQA 2ZWMA 1QM5A 4RNDB 1A9OA 1ZC4A 4KL1A 5H9CA 3UYLA 3WK6A 4UPVA 2CNWA 1V3TA 4L5CA 3MDSA 3ZD8A 3PUWA 3ONEA 3BMNA 3HDHA 3UHJA 1L3BA 1XSEA 3LYLA 2W2TA 3QXCA 1OWPA 4B09A 5EJEA 1G20A 1TD9A 3U3DA 3FVRA 5JJCA 1XEAA 3PGLA 5KKNB 4OK3A 3FB4A 1EZ1A 3ND5A 4OP3A 1RJFA 1WN6A 3NZEA 3P9SA 2DFLA 1P7PA 1Q6IA 1DEAA 2AXNA 4L5IA 4FSXA 3QI7A 1M0WA 2PBLA 2D5LA 3WWZA 2PUGA 2A5YB 2AOWA 1UJ2A 5F3DA 2PSJA 2ZYWX 2X5XA 1QCZA 1VIAA 2C5GA 5KU1A 1EIZA 3EAQA 1LS1A 5CAEA 5DX1A 1K6MA 1IPHA 1YL5A 4O4JF 3QU7A 4ARBA 3KFXA 3BOSA 2J5QA 3OFVA 2H2AA 2I6QA 3VO1A 2ZM6B 2J3EA 2HFEC 1XLVA 1CJKC 4I8DA 2QAGC 3DZDA 3GMTA 3KQTA 5JSZB 2VEOA 1YO6A 3M4ZA 1I7NA 4UB6Z 5IANA 4AG3A 1RPAA 2WC1A 1DTOA 3C87A 4Q1BA 1F48A 4Q9HA 4JJ8A 5LBTA 1W8DA 5FXMA 3NATA 1JLLB 4PWZA 4X6UA 3L79A 3SMQA 3O7MA 3A36A 3IJPA 3GLGE 4PCLA 4DCUA 1PR2A 3PV0A 4JUIA 3THRA 2Z8XA 2Y0PA 4DEXA 4Y6QA 4ABTA 1MJHA 1RI5A 4GEKA 3BMQA 4KQEA 1J24A 3RIMA 2W2PA 1VQ9V 1QRDA 4AUEA 2GARA 4U7PB 3JQ7A 3VZQA 2X5JO 4CRWB 3CJRA 2BGIA 2VJKA 2Z9DA 1RXCA 2QW8A 1P77A 2WPNA 2ZYVX 1SUFA 3WDKA 3KSZO 5IWAB 3E8HA 1X7WA 1Q0SA 3E9YA 3M6AA 4QYTA 1UEJA 3APOA 2HDHA 4DIKA 1LLDA 2HBQA 3G2PA 5G40A 4V03A 1XVTA 2G08A 3QENA 5AQ1A 1XTPA 2HAEA 4LZJA 1EWRA 1NMZA 2PX5A 1N9GA 3KSBC 1T6XA 5AKHA 3E8GA 2HYIC 1ODCA 4ZVTA 3K6RA 3K2BA 3LBAA 1EE2A 4FWIB 3H11A 4X5OA 3D8TA 1SVWA 3HM9A 4P3PA 2F43G 1RYHA 1XZHA 1YQUA 4NDAA 3L71H 4LW8A 2CUTA 4NXNB 3R1IA 1BXZA 5FL7G 5FI0B 1DEXA 1Q6HA 3FWHA 4JQSA 2HSDA 1WS6A 4WOCA 1QQAA 1Y1KE 4RGVA 5KVSA 1XQ8A 3NWEA 4EHHA 1YJ9V 1C14A 4MHSA 5E2IA 2IH4A 5EBMC 2QAGA 5B58T 2HG5C 4IGAA 4QBHA 2EILB 2AE1A 4X1YA 1XOIA 4C20A 1IXMA 1SXJD 4XRGA 2OYRA 4MAFA 1XZCA 3L1UA 3RVRA 1COWG 5FBQB 1P2BA 4A2PA 1FNDA 4TZTA 2VQFO 2QSAA 2FW0A 4NBTA 1B2RA 1SKYE 3ANLA 1KQGA 2D2FA 3PGJA 1P0QA 4P4TA 4S1NA 1XMIA 1V55C 3RRBA 5KREA 3RD5A 3O4FA 4QDOA 1XZIA 1WKQA 4N40A 3ZLBA 3DOFA 1Z7WA 4CFZA 2OWDA 2ENWA 3WQHA 4BQIA 4MIEA 1JG2A 3MHSC 1QVGU 5K51A 4LRSB 4JU8A 2O2IA 2X9QA 4Q5IA 1MIHA 3JASA 2PU5A 1UX0A 1QKKA 2GHYA 4HH0A 2YV4A 3AHJA 4RXUA 1BMFG 1HE3A 1W49A 3GZJA 4BPBA 1Z0AA 1VJDA 3RAGA 5IBQA 2I1LA 1CZLA 1KP2A 5SYMA 1MQ9A 4MMXB 1CUWA 4FNOA 2MW2B 3JAWB 4LYFA 2GA8A 5AESA 3I2YX 3MJ4A 4D2IA 1PK8A 4HNTA 1ZPDA 2XAFA 3UMFA 3HI4A 4AJNA 3AEUB 3O93A 1ZL8B 1RJWA 3BXEA 3USES 3R44A 3PFWO 1DUVG 5REQB 3P9RA 5FA6A 1EM8A 1NQ5A 1N6IA 4AWXA 4GUAA 2CFSA 3EXEB 1VI6A 3OCVA 1O5OA 4XM1A 4IT5A 3NP9A 1ESCA 3OCUA 4RYLA 3WXMA 1HE5A 3M4JA 1PZMA 1CVIA 1PFWA 2DBVO 3V2HA 4QULA 2P91A 4GBED 5I9IA 4KC0A 1IVNA 1X80B 3TI9A 1V5IA 1QGED 1O87A 4WKGA 3HZRA 1ACLA 2WM3A 3SDLA 2BBSA 1A7KA 4QDJA 2HN9A 4ER7A 1X7GA 3FM9A 1G5TA 3BA6A 3X2SA 1NGSA 1KY2A 1NW6A 1MABB 3GLTA 1JP7A 3BGIA 1BT8A 5K8IA 1K1EA 2KLBA 2VHCA 3G5MA 2CLSA 4C2BA 2OTCA 4H3KB 4CEIA 1H2SB 1UPXA 4XB1A 5KEIA 2AQ8A 3DP7A 3PR2B 4CEHB 1TDJA 3EGXB 1Y76A 3AQ4A 3DMPA 3MWKA 5AVYA 1H1LB 2QL9A 3QVJA 1U7DA 2A3NA 2H57A 3TLEA 4KXWA 1OWLA 2VAWA 1J9EA 2QNIA 5CDHA 3SHQA 3N3BC 3IP3A 1MO2A 1XDZA 2WM9B 3MERA 5C18A 3ONDA 1QIFA 1GR1A 4IHQA 3HUFA 3VPXA 1H94A 3KC2A 3KHSA 2CTWA 3ZW7A 1THZA 4O2BB 1R6KA 2EJUA 1RHMA 3INYA 3TOXA 3WLRA 4W5WA 3EASA 3H5NA 3MCZA 1Y4DE 3OE7G 3C7TA 1YACA 4K1LA 2HHLA 1ZDMA 3QFSA 1XNQO 1JX9A 1JQAA 1L9XA 2JHAA 4AZWA 3H75A 1RR6A 2PYZA 5EAIA 1QPBA 3VYVA 3IPAA 1W2HA 1CDZA 4URWR 3OTQA 5M34A 5TY0A 1IXRC 4F1JA 1FNMA 2FPMA 1PW5A 5HIMA 1EJ6A 1XRQA 2FF5A 1GQOA 4OI2A 5A6VA 2QF7A 1L5WA 2X3YA 1S01A 2QXUA 4G0OA 3LF1A 2VF4X 4BNTA 5J2TF 2AC4A 4ONEA 4EMTA 1YASA 3UXMA 1Y3HA 3GZNB 4IIDA 3U4DA 1E5VA 3K72B 1D5NA 3CHXA 2F9MA 2H63A 2QD1A 3WKBA 2C4UA 3QOWA 4C29A 1QFYA 4JT4A 4KITC 5JZOA 2ENUA 1M90W 5H80A 1DAEA 4PIPA 3M9LA 3S2IA 3BERA 1UXGA 1NATA 3AUXA 1GUAA 2RN9A 2G71A 5JTTA 2B2XA 1P74A 1JJAA 1I3CA 4QOHA 2O8CB 1USVA 5BSFA 1XDCA 1JJ7A 2K7ZA 4DILA 4ZICA 1TAGA 1VKHA 2E55A 3CISA 3FTEA 3K5HA 3LHDA 2II6A 4GOND 4LJAA 4YLGA 3O6VA 3Q6MA 2W83A 3PD7A 1SHTX 3ICVA 1B1CA 1HV8A 1FP4B 1KKLA 4TUYF 2V6JA 5FWDA 3RLFA 4MP6A 1IH8A 4MIOA 4C4TA 2GD1O 3TR0A 1ULHA 3JQPA 1T0IA 3ZK7A 1ESMA 1G3RA 5HNKA 5EJMA 1H2MA 2OT5A 5K1PA 4GH5A 3CV3A 2I65A 1AZLA 4RLHA 3KOUA 1UFVA 4DQVA 3MGGA 1ZRMA 1GGFA 4DV0O 1NVWQ 3SQWA 1U0HC 3R2JA 1YSCA 2IHUA 4KXQA 3GZ4A 3Q6NA 1C4OA 4FUTA 3LQYA 1U97A 4MQLA 1LPOA 1RQGA 1CX9B 1GG2A 1IDSA 4RZ2A 4G0ZA 3DUFA 5EWLB 3HCOA 2FPKA 5A4KA 4F5WA 4X7BA 1KARA 2G88A 3AJ8A 2WD7A 1U99A 1JXQA 4GUNA 5FWNA 4TXLA 1NONA 1DOHA 2AHRA 2DHQA 2VQEB 5A04A 4V2IA 1K08A 3BA8A 1Z74A 1AROP 3KJHA 1K68A 1P80A 4O4JA 2JLXA 3I0NA 1Y63A 3C90A 3CEIA 1F6WA 1Q6YA 3IOEA 4G26A 2IGBA 2QTTA 2DHEA 1BO6A 4YHHB 3KKKA 1QG2A 2OYCA 3TR5A 2BZSA 3RYFA 1Q1NA 1UEXC 3CVOA 1E5DA 1BX1A 5DN6A 2WHXA 4XJSA 1SS3A 1KMIZ 2PWAA 4P4GA 1WXEA 3ZYCA 4B3DA 2ODQA 3EOZA 1BGVA 2LGQA 4R7TA 4KQ2A 2C3UA 5DCYA 4TVKA 1G42A 2F59A 1XUOA 5T8KC 1OYVA 4AP9A 2OK7A 4OKNA 4C7OA 3LDAA 3R5XA 2BDEA 4EELA 4H0FA 3HABA 1Z56C 1RU3A 3RG8A 3Q98A 2O9JA 4MUMA 2Y93A 1E3IA 3JU3A 2ZR0A 4EPYA 2XCTB 3X1DA 3AHIA 3RC8A 3JXEA 3K5PA 2GYWA 4TTJA 2FKNA 1ZVJA 4MLDA 3UJ9A 5KNDD 3PFKA 3B8FA 2VJAA 4NHEA 3TQHA 2X41A 3SM3A 1UP6A 4FIPC 1CBUA 1YB6A 2ACWA 2P6PA 5LVAA 1X1QA 1A76A 1F2UA 4RD0A 2BLLA 2R4UA 3CC7V 1Z8NA 5AH0A 1T13A 3GEIA 2P68A 1DJQA 3TIVA 1RAEA 2HF8A 2HRBA 4TLEA 4N39A 4W4TA 5KWSA 4HAVA 2AC2A 5HFAA 4S3MA 1R6AA 2W5UA 1XWIA 1UJNA 2CVOA 3WV4A 1IXYA 4JOSA 4ZD6A 3GK3A 3EFOB 3LX4A 4TV8F 2PUDA 4BNDB 4MUKA 2R84A 1PD3A 2DMRA 5FOVA 2YWRA 4TQGA 3JVEA 1DI0A 1P1CA 3QX9A 3M4XA 3GN2A 3TK1A 3ZHCA 1R4NB 3LE8A 4WQMA 1FX0A 2IH5A 2KJQA 5F7ZA 2GDSA 2G7ZA 4I8XA 3UCFA 2G6TA 3JALB 4LF9O 3WK5A 3VDRA 5ED4A 3JSXA 4IVQA 3IAYA 3BF8A 2ITCC 4MS3A 4UOEA 3OQNA 1H2NA 4KLZA 4YT5A 3KJNA 5T4EA 5TGTA 1YDHA 1Z18A 3UY4A 3E81A 3QOFA 1UX1A 3UXEA 2IODA 5E4JA 3DQQA 4NZMA 4AO6A 2ARKA 2JFWA 1MFZA 2W4QA 1M2WA 1UJBA 2J3IA 1GCOA 3UMYA 3C3AA 3RM3A 5IT9N 1SHKA 3KFLA 1IG3A 3RJZA 3F3SA 3PPVA 4H3HB 4K2AA 4G3MA 5KNLA 4IIBA 4M9XA 3PUXA 3W2IA 4BLWA 5CUQA 2OLEA 2W4LA 4CVNA 4LFBO 2ZSAA 3TH5A 2EGGA 4PFSA 5IX8A 4JI8O 4CS4A 1HEIA 2Q7XA 2O0LA 1AN0A 2BZ1A 1ZK4A 1RYFA 3NVDA 1AILA 1QRTA 3IBYA 1C2TA 3FNIA 1Q21A 1TA8A 4U9UA 1A7UA 5TMDA 5DGTA 4OHRA 4D0LB 4OLFA 5A02A 3QO7A 3A3YA 3CX8A 3A7DA 1BW9A 3PXXA 2X8BA 3L4EA 3MMNA 1JLSA 2CV0A 4J9ZB 1W0JG 3NT4A 4L8WB 1IZ7A 1F8XA 1I4DD 2HPVA 5F78A 3QNUA 2XKAA 1VJCA 3Q3IA 1KETA 4Z1MD 3EZNA 1KXJA 1JUDA 1OFTA 4KE6A 3S27A 4R2XA 4OATA 4AWAA 2WV9A 5H1YA 3A1VA 1NASA 3DSRA 2YZKA 4MV9A 5TVGA 2WIJA 1C9NA 1Z7EA 4OHOA 2HK9A 2QU8A 4RO0A 4J0QA 4CE6A 4R2JA 2C1EA 1D4ZA 1RHJA 3QELB 2Y69C 2PA3A 3HU3A 3WGHA 3BCSA 2G1AA 4WZAB 4S2UA 5KQGA 4XDZA 4C6SA 1NPYA 4D82A 1J39A 4HXFB 2C1XA 3CB2A 1T9GR 4FGUA 3PK0A 3NU1A 2QVCA 3PUYA 3AF6A 2DQKA 3GYGA 3RUHA 4Y9DA 2VHQA 2ZW9A 3QW2A 4S24A 3MJCA 1X87A 4UEJA 8OHMA 1VKRA 3AYZB 3FOAA 3OD4A 3PX3A 1Q92A 1KOLA 5EXDA 4ZHSA 3P32A 1H2YA 1RYZA 5DHAA 4RO2A 5AXCA 1MBZA 3U4QA 4UD6A 2XUDA 4CIXA 3UWSA 3IYLW 1JDBB 4GX0A 2B99A 5T41A 1EKXA 1LBQA 1GAEO 3T9FA 5TPWA 1E20A 3KXPA 2CJWA 5THKA 3PC8C 3SC2A 4YYEA 3O2NA 4F1KA 3VX8A 4X8LA 3LLVA 4RL6A 3UOGA 3FOEC 4UMEA 1DKNA 1WTCA 1U7HA 2VPWA 4MQUA 1PFQA 3OWXA 1USKA 3DZHA 1XYYA 2VTBB 4GOJA 1EHCA 3DXRA 1N9ZA 2J3LA 1G7SA 2ZI5A 1IXBA 2I4OA 4JVLA 2ZJ7A 4DV6O 4TQFA 2CDCA 3IODA 1T8TA 2D7DA 4MH0R 2EQ5A 1XTJA 4RJ2A 3UANA 5I7HA 1ZSPA 4J3JA 2ZBUA 4M8KA 4TMZA 3ZXUB 4DPLA 4U7NA 2JGKA 1NU1H 5JISA 4CNQA 1P7VA 3K70C 2QS9A 3QUQA 3GLIA 1HDGO 3CUWA 1TF7A 4XRRA 5G0SA 1OXMA 3MFYA 3OICA 3GUZA 4INOA 4MV3A 1KRXA 2PMFA 4EPTA 4HAYA 2F48A 4FXOA 2LDXA 3JCUZ 4UASA 1MZPA 1UC4B 3EG9A 4MW2A 5AICA 2I6GA 1BKSB 4MS7A 3D7MA 4JUCA 2FHPA 4MSMA 4V3CA 1BKYA 4JITA 1EZ4A 3FJOA 3EPHA 2QE7G 3KUUA 2XXAA 4CUJA 2IP4A 2IQIA 1F0KA 4L6CA 4MJXA 1ZLXA 3MPUA 2RI0A 1XL0A 4WTOA 3WICA 2M1ZA 2R85A 5HR5A 2P2YA 4JXJA 1XV5A 2IVZA 1RB7A 3H16A 1L4FA 3MBKA 3TDMA 1GKLA 5JCPA 5BQOA 1N3LA 5CMLA 2GESA 1C7EA 4UTPA 4RA9B 3PC8A 3TQTA 5AVOA 4XUGB 1Q5OA 5DLDA 3ZX4A 5DIFA 1K5SA 1MQSA 4NS1A 4EJFA 4R3NA 4KN6A 2VJCA 1ZEJA 1KU6A 2AKAB 3IS3A 5DNWA 4K05A 2X7XA 5IUKC 3ZWYA 1QWOA 3WLIA 1BU5A 3EVEA 4WFEA 1MVNA 1TJ5A 4H7KA 1VJRA 1NYQA 1SKBA 4YCSA 1TT7A 2W6IA 4LSMA 2D2EA 2BOCC 2EZ9A 3K5IA 2W6PA 3H9BA 2NVUA 1U9ZA 2EJBA 3GFGA 2WNIA 1J5EB 4FCVA 2PTHA 1QTQA 3J80A 4DBLC 4B74A 3S8EA 4DXWA 5DW0A 6REQB 4QWWA 4I36A 5JC1A 4RVFA 3CLTD 4K8OA 3GVHA 4WFBV 5AJXA 5EPOA 1MRSA 2D0IA 1Y6RA 1A9SA 1SA0B 1T5LA 1Q74A 1FMLA 2DT8A 3HDGA 1NM5C 2IYTA 4ZTBA 3QUBA 3HWWA 1UCFA 1S3FA 2IXEA 1Y66A 2JAPA 4IILA 2GA9A 3H2SA 2JK0A 3LC7O 2ID8A 3T3OA 3O74A 5FYDA 2A5JA 3IPCA 4DW8A 2HPZA 1FLDA 2L19A 2EAUA 3PDWA 2CZQA 4R9SA 2I3AA 3DMNA 2G1KA 2JIRA 1CZHA 3O3CA 4UNIA 1IHOA 1GDDA 1MC1A 3RUEA 4WK0B 2B4QA 4ZXPA 3RAJA 4DMLA 2ZYUX 2JHGA 1V4NA 1HDYA 1R16A 2OKCA 1IY8A 2FZ5A 2Z08A 4OY3A 4HHEA 4ITUA 1IE3A 3QVSA 2O5CA 3AF0A 4JAAA 3TQQA 1BOFA 5GONB 4TWRA 3E5MA 3LW8A 3FSJX 2OQRA 5JSZA 2EILC 4GKBA 5GVSA 1FXVA 1NBEA 4EG3A 2A0FA 5KJ6A 3F6YA 3E4DA 3GU3A 3URMA 4JP3A 4WJZA 1JLLA 1S8FA 4S1VA 2BM9A 2XZTA 5L3CA 4I66A 3STZC 3KQQA 1FUUA 4EAQA 3GT0A 4E1VA 1FPOA 2D06A 4I1YA 2VQFB 3KKPA 5EIAA 1AVMA 4IEFB 3ABKB 4BMXA 5JS2A 2HK8A 3F98A 2EKQA 4IMIB 3AU9A 3FPHA 1H0RA 3U44B 3WLOA 5FUMA 1Q12A 2JCXA 4UHDA 1X8JA 3FF1A 2A78A 1YL7A 2GMWA 3FHJA 1A4UA 1UZLA 3GIWA 4N4AA 4UQOA 3FBWA 4NQZA 5AM4A 2BE9A 4R7ZA 2VDRB 4PJ0Z 1DV2A 4Y1FA 3L02A 4ER3A 3ESXA 2XA1A 2V5AA 2GN1A 1NM5A 3FB1A 1EZZA 4W5RA 1WB9A 2WDZA 1IN1A 2B94A 3SSNA 2I6TA 3EBLA 3KQOA 4IICA 5EXTA 1LSSA 4JYPA 4US2R 3N8GA 3DMFA 1JMKC 2IYRA 1ZNYA 4Z8XA 2NZYA 1EAYA 2FPOA 2ZYDA 2XRMA 3CXRA 1H69A 4FUQA 3U1TA 4WFGA 1FY2A 1XK6A 3W2FA 5JPCA 4HP8A 4M1YA 4NH4A 2X13A 4G6ZA 3T61A 2ONCA 3IQIX 4BXOB 1A4RA 1L1RA 3LX8A 1CSEE 5JBQA 4NPHA 5FKJA 1NFQA 4KYVA 3RYTC 4BKRA 1D1QA 4J7UA 4G9GA 4MA0A 2CLCX 4I9UA 1XJCA 1QO0A 1TMOA 4UREA 2IOFK 4JJEA 2ID7A 4LHSA 2A5LA 3TAHA 3AW8A 2A7XA 4RE6A 4Q12A 1H3EA 2FJUA 2V6IA 2CUZA 3U09A 2J9ZB 2ZIWB 4LWOA 4K6FA 4BW5A 1G9SA 1Y34E 4IYRA 4MGZR 3OZAA 3SR0A 3PL5A 1G6Q1 2HA4A 3R6TA 2QB5A 3MQ4A 3W8FA 1GTMA 1MB2A 4PA7A 4EGCB 3WBFA 2YY5A 4QUKA 1YEWA 1VRWA 2BLNA 2PT6A 1I94O 4F8EA 2QLCA 5JAIA 2A0XA 2JCBA 1T9ZA 3KLMX 2E4WA 1Y7IA 4YAWA 2JLWA 3W5IA 5EXPA 2NO6A 4YMHA 4ZCRA 1JA1A 1ECJA 4RKRA 4WCFB 4IDBA 4BUZA 4F6LA 3WU2Z 1PR3A 1PV0A 2ASEA 2MMGA 2R8OA 3TTWA 3UO8B 2D00A 2VF5X 3IOCA 4G27B 3NJ8A 1E8DA 3C41J 1KFJB 2QYTA 1GRQA 3CY6A 3IQEA 4XOUA 1JR2A 2Q69A 2Q5HA 1N8NA 4OIMA 1UBMS 3OQJA 3FFQA 2AZMA 1PLJA 3ENVA 3NNSA 5EJ9A 3FI9A 1XK7A 3JAWA 4QDKA 3SQLA 4LXYA 3PPYA 1H2HA 4R8SA 4R4JA 2NTNA 1KFCB 2HWWA 2QXYA 1QX3A 3AEUA 3L8CA 1E9RA 5LCXA 2APJA 1OIVA 2RH9B 5EPEA 4FNGA 5REQA 4YONB 4HDNB 2J6HA 2WY2D 3EXEA 4DCVA 2BYTA 3MWJA 1B16A 1NN1A 2JIBA 3UMVA 4NFHA 3GI1A 5KTYA 5JNVA 1NJSA 3UHOA 3WADA 5JD6A 3DOJA 2PAAA 2I0FA 1F7UA 1P7WA 2CLOB 1F14A 1X80A 5EIWA 2WD8A 3B82A 1BCRB 1JHZA 4ARSA 4XJVA 3BK2A 1THTA 1WLYA 2I4NA 4WX2B 1MABA 4KVGA 3JQGB 3LC2O 1QR8A 5K3CA 3JWPA 3U19A 3MUNA 1Z45A 2PV7A 4LRXA 1AKNA 3BFVA 1EXMA 1B0ZA 1I5EA 3PXUA 4CEHA 2ZPUA 3EGXA 4JLJA 1H1LA 4E22A 2ZXWB 3MTBA 1DADA 2PO5A 1KJYA 4YRTA 4O63O 4YLYA 3LVFO 1QOZA 3ID6C 1CFJA 3KOZA 1R9JA 1IN8A 2VCHA 3VQTA 4Y2QA 1SCIA 2GJKA 3KYCB 1Z8HA 4CQJA 3GIDA 2QLFA 2JBHA 1FJ2A 3ERCA 3NIGB 5AIBA 3SHFA 2Y05A 4O2BA 1FLNA 3GAAA 1ISHA 1KQ3A 4QOIA 2OBBA 3KFVA 2E48A 3PUHA 1AQUA 3L8DA 2EFJA 3DTTA 1GQQA 3W7VA 2B8TA 1GCUA 3K30A 2ZAYA 4MITA 2XE7A 4NU6A 1APBA 4N3GA 4NAHA 1X7HA 3MG9A 3D8HA 3KZCA 5B6PA 3V8QA 1PUIA 2HMWA 4K3AA 3P2MA 5DP2A 1TIYA 3CRAA 3VU1A 2YS6A 1O4VA 3QYFA 2VSQA 3AI1A 2ZROA 3SHWA 3KT6A 5GOTA 3DEYX 5JDCC 3GZNA 4TVOA 3VR5A 1UBOS 1IU9A 3H2YA 3HADA 4UHJA 2FR8C 4H1HA 1K3UB 2I87A 1EYZA 3HACA 2XAHA 3BJEA 3OVMA 1GN2A 1FSFA 2OO5C 1ZY2A 5JPDA 2AR0A 4JENA 4UHEA 2ZSHA 1ADYA 3PYLA 4OUDA 4M9CA 4OYHA 1X94A 1VCIA 1J9ZA 1WMSA 1JIQA 3FNEA 4YAIA 2D6FA 3GLFB 2O8CA 4CT0A 3VJRA 1FC0A 2Y6VA 2I7DA 5DYIA 3VR4H 4Y9SA 3PNOA 2RHRA 3KWLA 4AO7A 1KZGB 5ESXA 5DNCA 1WV0A 1HLFA 9MHTA 1ML3A 1IY2A 3HXQA 1GRCA 3SCZA 2IITA 2I7VA 2Q6LA 1FP4A 4FPXA 3VMMA 3RASA 4PLYA 3OX3A 1FTNA 1TTQB 4DR5O 2Y27A 5EJ7A 2O8FB 4NNPA 1QFJA 4OKSA 4BASA 4R7CA 1S02A 3VHXA 5AJZA 1VLQA 3BMXA 4PSCA 3E1UA 5BQPA 3P9IA 3VI4B 3ZGNA 3RYHB 1J07A 4XPIB 1SVSA 1WIWA 4QUBA 2HCBA 4FEGA 1RIFA 1DIOB 3BQNB 2JGIA 4OM8A 4FW8A 2C3YA 2HA2A 2VL7A 4GGPA 2N04A 1HQYE 3ISVA 1ZNXA 1B0AA 3OCQA 5EWLA 1P1IA 5CHEA 4QFMA 1B3QA 4Z9BA 1GPUA 1E99A 2XGOA 2CNKA 3EIQA 2H7YA 4BN5A 3ZRVA 3AG3B 1J5PA 4RZXA 2YWCA 4JLDA 3MILA 1Z5ZA 2IBZH 2XNHA 3PUIA 1GTSA 1VYTA 5JDCA 4Z2WA 2C5HA 1JFLA 2XNKA 4DTIA 2WZCA 4XA8A 1NMSA 1LSUA 3SYLA 5AJYA 2FR8A 1RHQA 4ROTA 5KYXB 1KI7A 4K6MA 4HBGA 2EEZA 1AMUA 4CUKA 4OSOA 1QGUB 2OFOA 4BZXA 4XUCA 2WYUA 2GEVA 4M0LA 4I9GA 4L73A 3R3VA 3KLPX 3PJFA 2AUMA 3DAPA 3PDJA 2HA3A 4ATNA 2X9VA 1IN4A 2JLZA 3V3TA 2W22A 4UVAA 1RKQA 1RAIA 2FFBA 2QVXX 4OHPA 4JI8B 3E7PA 4ZD5A 4ITRC 2GFHA 3TUIC 2CXSA 3U80A 4S1WA 1FFSA 4N3CA 4Q7EA 1UFOA 2P4UA 1FTSA 1YBMA 1JAXA 4QODA 3SU8A 1L1FA 1J2TA 2E6KA 4C7KA 3EIEA 3MINB 2OCHA 2BGTA 3OM0A 3N2EA 2E5LO 5TQ2B 1XX6A 4PA9A 2YZ7A 2GK4A 4L8YA 2OEPA 4AO8A 5JOQA 1HQKA 4KFCA 1CUDA 2QT0A 1QXSA 1J8QA 5EQDA 3QVUA 2AZDA 4PYNA 4WXMA 4N3BA 1W1IA 3CRRA 5AVQA 3PIIA 3Q5GA 5FO0A 1E1RD 3DFZA 3EFOA 2XYVA 1K6JA 4BNDA 1P2GA 2AFHE 1HFEL 1YI8A 1SN7A 1TT5B 3G9TA 1BGXT 1TLTA 3HG7A 4FOPA 1R4NA 1NPDA 4B3IA 1GVNB 3OAAA 2GAJA 3HVKA 1E6UA 1LPPA 1R50A 4H0CA 3JALA 2O2YA 4M7WA 4M54A 5C7YA 2VRCD 3KCQA 1OBOA 4KG7A 3W7XA 3ZCPA 3AU8A 5KQRA 5D86A 3EW9A 2VTEA 4Y30A 1DX6A 5E6SB 1Z6XA 4HATA 3BYZA 5AT1A 4E09A 4IUBS 2ZULA 4LZZA 1JZTA 3L40A 4KJZA 1EDZA 3O9OA 1EFVB 5ER9A 1QRAA 2XUIA 4UM5A 1YDXA 4Y6GB 3HKBB 1Q83A 3WBKA 5K03A 4DY4A 1DBQA 1G21E 2X15A 4R5HA 3WMEA 1I7FA 4EAAA 3PBKA 1DCKA 3LF2A 2P2GA 1DO2A 3WKDA 2IIBA 3AUYA 2CLEB 4L0QA 1F5SA 2BHLA 1FX1A 3IT1A 5CW1A 3BA9A 3NRCA 1ARZA 1RWWA 4YPVA 2GJ4A 5LJLA 1Z3AA 4FWBA 4MCAA 1D0IA 2ORVA 1GTVA 1SBYA 3ABSB 5K3SA 4BB9A 1XRPA 4AMYA 4DV6B 2RNBA 1E1QG 3VC7A 1IL0A 1O6GA 5KNCA 3C3SA 2QKAA 2XV1A 2I4LA 4TSRA 2ZM5A 1BHSA 2XWSA 3D3WB 3HY6A 3SHVA 1H8HG 2NSYA 3COJA 5IJ9B 2J4FA 2OFPA 5I7EA 4DLYA 5I7AA 2A0YA 4LYGA 5GZ1A 3S4YA 3HR4A 2HVKC 3Q15C 3RU9A 2HEGA 2GN6A 1FZQA 4RSGA 4Q15A 3P26A 1P6UA 5EOVA 3NV9A 2OIGA 5E7JA 1YRAA 5HWSA 3ROQA 4WIAA 1Y33E 2VT3A 4H7HA 3RTCA 3FKSG 3HU2A 1QLWA 3MTJA 1M57C 2RAUA 4B76A 4DLPA 3QELA 1QIJA 4WZAA 4GF5A 3L92A 3ZWWA 3QTLA 4RMIA 4PNHA 3T15A 2QA5A 1UMKA 4MPPA 3QXXA 3N2YA 3VKWA 4LXXA 2DWUA 4ML3A 1TLLA 2O7PA 4IEEA 3CCVV 1F9EA 3G5TA 2O06A 2VLIA 3BFKA 4R16A 4M99A 3RFXA 4B7UA 3JX9A 1PT7A 5EMLA 2HA5A 4ZGBA 4YGXB 1UBJS 3QNMA 5AOAA 2QGNA 3OMNB 5AI0A 4LI3X 3GGDA 3E9QA 3I5XA 3OW2U 4GSLA 2IE8A 2DUUA 1G55A 2BFCB 1V16B 3WA6A 1CUFA 1K66A 4BJ1A 5GZ6A 3IE1A 3KT8A 1T26A 1U0TA 4K3UA 1K5PA 2LO1A 3LHFA 3HJUA 3CUUA 3W8EA 2CZGA 2VWGA 3WK8A 1USGA 2CVZA 1VL8A 3NTLA 2IUFA 2EYUA 2PUJA 4ZA2A 4OX9Y 1KB9F 3SK0A 2BCJQ 4FX5A 4QEDA 4QQNA 1QHTA 2VTBA 3ST7A 1MJGM 1XKLA 3K1YA 5KQSA 3QKIA 2XZPA 3NBAA 4IMJB 3CIFA 5IMBA 1IZ9A 1OASA 3ZBQA 2WOOA 1ENYA 3RBVA 1KTIA 3U7GA 5FF9A 4HOYA 4AS2A 3PDUA 1JXOA 4P53A 2QD5A 4TZKA 3WX0A 2F1KA 5COAA 1U28A 2PUFA 2ZB8A 4OAPA 3K9HA 2OUKA 1N2HA 3GN1A 2VTVA 1WABA 2ZIAA 3G2QA 1MLDA 5TT1A 4ZYWA 4DK0A 2BFBB 5FOUA 1BGYH 3CVJA 1ZMBA 2GT1A 2PT7A 1FXKB 2H94A 5BSEA 1XPUA 2WQ7A 2FEWB 3JQQA 1T6YA 3IVCA 3DPSA 4DBVO 2Y1GA 2IHKA 3W04A 4MEBA 4ID9A 3DGFC 4JJFA 1BE0A 3THXB 4EKWA 1KI4A 3TUJC 2DAPA 2ZTSA 1TXGA 1EUDB 4I1UA 1QOPB 5GV8A 2OOKA 1E79A 2F1HA 4PIMA 3QKSB 3U49A 4JNCA 3NLLA 3ZD9A 1VE5A 4P8RA 3K5MA 3O8BA 2R1TB 5B64A 3VJMA 3OFKA 1FW6A 1K8RA 3IQWA 1EHYA 2OV2A 5HIKA 4QNHB 3ND8A 2ECFA 5KQPA 2K2WA 4LA4A 4DWJA 4LF5O 3FVTA 4RA9A 1PX0A 4F1WA 1F12A 4PXAA 3KOOA 3AETB 3LNTA 1J20A 1YBHA 4AAYA 3TTXA 5AVWA 3KB1A 2HQBA 4NYJQ 4TWIA 3ZDRA 3PXAA 1C8KA 2X76A 1KO1A 2PXHA 3TLZA 5C8DA 3K9GA 4FYXA 3NDBB 1NDHA 2X5KO 2NU8B 2HHCA 3DSQA 1IFXA 1V6SA 4KQIA 5FWXB 4KBGA 2WTUA 1K34A 4RHTA 3ABKC 3CONA 1A2KC 4E2XA 3E61A 1I6MA 2JS3A 3CF4A 6REQA 1W85A 4DJDC 4N47A 1PT5A 6LDHA 1PVOA 1NBHA 3SJ7A 1XC7A 4CLRB 3DLAA 2V6FA 4RVUA 3JQDA 1SA0A 1X38A 3VVLA 5TQVA 1ZM9A 4H7DA 5F98A 3EH1A 2IYAA 5EIHA 5DMXA 4QQRA 1IBCA 3SDSA 4FJCC 3K2QA 5DEOA 1RWVA 1U2SA 1M1NB 2ZGVA 3D54D 3OEWA 5IARA 4PZAA 4EHAA 1YXBA 4GQIA 4RK0A 1IULA 1XTZA 3RDPA 3ESRA 3TQIA 5I4KA 1QDLB 3FW1A 1FP7A 3I32A 4F3CA 4DNFA 4OHVA 2OXIA 5F4ZA 3PJGA 2J85A 4OL9A 1HUQA 1IY1A 1T5DX 9ABPA 1KI1A 2H3HA 2L2QA 4MUYA 4QU0A 2BY4A 5E1DA 4JVNA 1RS0A 2OD2A 3TVTA 3GOQA 1XOUA 3TEJA 2XCLA 5K0TA 2FTKA 4V38A 4NTYA 2YYSA 4G0MA 3VZCA 2G9ZA 2FP3A 3K31A 3HBNA 4ID3A 1N2OA 1NWHA 2OK8A 4MR9B 4RAOA 3PYXA 5GONA 3A9SA 3JQCA 2OHXA 1S9HA 1WUHS 5CCDA 3MGAA 3S29A 2FAXA 3KZNA 3IXQA 2YOHA 4MDYA 4UC0A 3JD0A 2IXFA 2QAJA 2Y3IA 3KQMA 3LQQA 2QR4A 4M22A 1VPLA 1N3IA 1VSTA 1TGOA 1I94B 2FVYA 4YAFA 1SQXH 2F3QA 2HBZA 3H4TA 4PW0A 821PA 1MKYA 5KTOA 3OM8A 1WF3A 1LQTA 1NXWA 3IAS6 3U44A 4HLUC 1H9AA 5EZSA 5LHIA 1P7ZA 2DR0A 3A6FA 3E86A 4WCFC 4KFSA 2UZ0A 3UMMA 3T7KA 2D3WA 3A6ZA 4MYCA 5F23A 2GPTA 1OFIA 4X60A 4AKTA 4M89A 3QEOA 1QG4A 1N4AA 2XR1A 3D6NB 3KELA 4TXJA 1TLFA 2H5LA 3KTDA 1AGNA 4PCVA 2BMAA 3TJTA 4XAQA 4EY7A 1U0LA 4OHKA 4S12A 2C2OA 2QKSA 4Q1CA 5BR7A 3KP1A 1B23P 4B7XA 4UVGA 4MP3A 3PB3A 1XCJA 6YASA 4BXOA 4LPKA 2F2TA 3HY4A 2P62A 1S2NA 1RSOB 4JYYA 3MT9A 4MICA 3V8PA 4MRVA 1V5WA 1PR6A 2F8LA 3M7MX 3IXMA 2GRJA 2QBYB 3IGAC 4HH3C 4U63A 1UR5A 3V1MA 4XQEA 4IX1A 2PYJA 2CEKA 4S35A 1G3MA 3BZUA 4GPIB 3ASOC 1E9BA 3ADKA 2QWXA 1VB3A 3KV1A 1SOUA 2HRZA 3E3MA 3QTBA 1NKTA 2EL9A 2FEPA 2MSLA 2CEAA 3CX7A 3HCDA 3OJWA 4IH4A 5EJFA 5DXAA 5EHGA 2I7XA 3D0OA 3E7XA 2PANA 1WB8A 2IELA 4MGIR 5JO9A 2CD9A 1QP7A 4Q03A 1KEPA 1EP9A 2UUAB 2VJBA 2UYQA 5ALLA 1AP6A 3HXTA 1ECPA 2R66A 3I9MA 3ZCRA 1DK1A 2OCBA 3DXZA 2V8OA 1WB7A 5LQDA 4HLUA 2W6QA 2NZ2A 2B9EA 4EI2A 1AK9A 1WD5A 3TFOA 4YAJA 2VPTA 2E4XA 4OHYA 3WB2A 2ZXWC 1RT9A 3DMHA 3OURA 2R70A 4WCFA 1R6DA 3MTIA 4B7CA 2ZNIA 1YQTA 2V55B 3NAGA 1LTQA 1QF9A 4UU7A 4ILKA 3LDGA 1JQEA 2YX1A 3SP1A 4RHCA 1YZGA 2HL6A 5DX0A 3G2NA 3SS9X 5GWXA 3ZHQA 4IO0A 2QQ0A 2WVHA 3AEZA 1IURA 1L8LA 4PTYA 3Q12A 2GCOA 3AIMA 4V1CB 3DDZX 3N75A 2RJZA 2RKOA 1F8UA 2C92A 4LG1A 3I1FA 4HQKA 1P2SA 1M6NA 2QRKA 3GFRA 3OF5A 4XVHA 2CNOA 2J30A 4CGZA 4JLVA 2BISA 1U3DA 2C2HA 1AS0A 4IXMA 4HDNA 4MTCA 1ZJ6A 1ZP6A 4GM4A 2EJ7A 5JJIA 1B42A 1G17A 4XDGA 2IX3A 1GL6A 1IHUA 1WNTA 3LK6A 4JJKA 2YWFA 2PKQP 4RUEA 2C4HA 3U0VA 2PRIA 2E18A 3IILA 4C43A 2PVSA 4OQ4A 1SXGA 4NB5A 1TAHA 1BCRA 1JDTA 1G19A 1B15A 1SZXA 1Z4MA 1P19A 3ZLJA 1ZQ9A 3FFAA 2MJLA 2PUBA 3FIJA 1NNLA 3FAZA 3W05A 4GR4A 3ZGOA 4Q4HB 2QIOA 3USCS 1IYZA 4B40A 3TSYA 1K4MA 3JQGA 4G8BA 3LGAA 3ZWCA 4NK4A 1UJCA 3CF6R 2VZLA 4E1AA 1YUMA 4G4JA 1VRVA 4J0JA 5BN1A 3HI6A 5H9VA 4AF8A 1SBCA 2RCVA 2WYWA 1FYFA 1Y6XA 4FZ1A 1E7QA 3LKZA 4KODA 5FPQA 3ZUPA 5JLJA 4DR5B 2NQ8A 1D07A 4AF7A 5IUJC 1UPAA 3Q0EA 2DB3A 4FD3A 2D5CA 3VR3A 2WUEA 2X1MA 4Y98A 3VC3A 4L9WA 3OEYA 4I46A 3KYCA 1VIVA 4JP2A 3T7JA 5K0JA 5ILOA 3VDQA 4FM0A 2DFPA 2AB0A 4IIJB 1GNVA 2ZSUA 5TJHA 2ADOA 2F55A 5BR1A 4JI3O 4HQ6A 3IVGA 1CUSA 1LS6A 4Z9XA 4I7ZB 4Q3CA 4MVJG 4X61A 4PO1A 3SBEA 2P4VA 5L7TA 5C8VA 4B3TO 5HIJA 3DO8A 4O0MA 1YF2A 3U7EB 1NZDA 2Z0MA 4L8LA 2KKWA 4C5CA 1WCXA 4MVJE 3ZHRA 2HLNA 4MWDA 4IBOA 1JR3D 3OTWA 1SETA 4XWGA 4NBLA 4YUWA 2AJLI 4WW0A 3AG3C 4B9EA 4UUJC 3X3HA 3OLXA 4W8HA 3MJTA 2XT9A 3VSBA 2GOYA 2YJTD 2MR6A 5AMXA 5DRTA 2A0WA 4ZOAA 3EPJA 2XCSB 4AFNA 2O5VA 5IRCD 1N2GA 5HQJA 4JC0A 4I1OA 4H4EA 2BEKA 3SAJA 4KQWA 5EFZA 1PE0A 4WF9V 1F20A 2QT9A 1YZQA 2B5UA 2ORWA 4LYEA 2A8YA 5B3LA 1NVEA 3FVVA 2XYGA 1NRXA 4Q6WA 2BZ0A 4NCHA 1NI4B 3GLFA 4CL3A 1Z6PA 2K7FA 3BULA 3KKEA 1R74A 3NCTA 3CURA 4W9MC 1KSGA 4PM4A 2P75A 5LQCA 4HVAA 3AC0A 4DN6A 2B4KA 3ZPCA 3QBEA 1LQ2A 1W34A 1XI1A 1JLRA 1ZIYA 4XYLA 1OH5A 1XEXB 5GV7A 1N75A 3T41A 2P1RA 4OQLA 3M6WA 3JRXA 5GY7A 2E5LB 3EC1A 2ZSDA 3UFBA 1HA3A 4GGOA 2RGNC 4EOGA 4R01A 1RXEA 4ZVMA 1UWZA 2O8FA 5BV8A 3QH4A 1WCV1 3V42A 1MJNA 2HJ9A 4OFWA 1D4OA 2P2SA 3JSAA 3LV8A 4RHYA 5K0NA 4TTAA 1AI4A 4FLFA 1NBMG 3ZN0A 3CNLA 2RI1A 3DQZA 5CTAA 3I2KA 2FN7A 2ZJ6A 2VRZA 3SXPA 4OHMA 1QYCA 2XXBA 3RYHA 1YRYE 4I1VA 4YR9A 4DDKA 1NBME 4J0DA 4HDKB 3G0BA 3CA8A 2OECA 4BX2A 4R2WA 4EHFA 1C7ZA 3ZR4B 2EARA 1YZFA 1A96A 2WABA 3TB6A 2XNDG 1U8UA 3IJEB 5DM4A 3A14A 4BQSA 4IUYA 1HWYA 3F47A 1BHAA 3M1YA 4BB6A 3B8HA 3CJTA 3LLSA 1OXKB 2I33A 4XVQA 1EESA 1OC4A 2ATVA 2F64A 1O0BA 5GTHZ 4R8MA 2CF6A 2QDXA 1GN9A 1ID1A 2GRUA 5G02A 3FUTA 2R68A 2EL7A 2WWXA 3IP9A 2FR5A 3MOIA 2O54A 2ZRCA 2C2AA 2XCRB 1PNRA 5EGSA 1L7PA 2JAHA 3KJFA 1KOGA 2AYYA 5KYXA 3SYQA 3ZPXA 4MW4A 5B7NA 3I5YA 3HRIA 3VUFA 2Z5FA 1QGUA 1NW7A 4YP6A 4OFBA 4YCDA 2GQ0A 1VBKA 1WZUA 3KSAC 4HGOA 4DC0A 4F4DA 3D2BA 1U80A 4JEIA 5E7IA 1C30B 5CBPB 4A73A 4O8XB 2ZU0C 2GDJA 2AMLA 1L6RA 3LKVA 4Z7NB 1EGHA 1DG1G 3CU5A 1GXSA 4JL6A 2FW6A 4JB8A 5FBRB 3ROFA 4BNVA 4UBKA 4OB6A 1NVUQ 5EE0A 2G84A 2WLKA 3V33A 1JEEA 1Z39A 4EFLA 2WJAA 4IFEA 2P7IA 1NNUA 1N2XA 1RZRA 1I1HA 4I0WB 2DTDA 1QHXA 5AM0A 3OFND 2VH2A 1AI7A 3MINA 5TS2A 2H92A 1KVRA 4ZZIA 1R6BX 2NPIA 2RGNA 4UATA 1RFGE 2PQMA 5LQNA 1N5JA 5TQ2A 4EG5A 2YOGA 3OHMA 4ZOLB 2HB6A 1E3DA 4DLRA 1L8OA 4BAUA 1GPKA 3D6TB 3WB9A 4J0CA 1Y7TA 3ZKAA 1EA7A 3KDAA 2VYVA 3HU5A 4F5YA 3L8HA 2AHYA 4D9MA 2GD2A 2G38A 1DF5A 3TRIA 1LJLA 2LW1A 1WU8A 1LUWA 3IKVA 4F5DA 1Q11A 3TJRA 1EI9A 5KJFA 1TT5A 2QVLA 3L1JA 1JQ3A 3FB7C 3GRAA 3USZA 2Q3MA 1R0WA 4O2BF 2CNDA 1NSYA 2XCUA 3OPNA 1BS9A 4WDQA 2A58A 1BJKA 3WLLA 4FBGA 4MRRA 3WYFA 3QBJA 2C29D 2W4IA 3KD3A 4FMCB 1JAYA 4V0RA 4Y2YA 1W0KD 2B8NA 1ZAUA 1E5LA 4XLLA 1S5PA 3M4YA 1YR1A 4JI0O 5E6SA 3DDSA 4ZVPA 3KALA 4YCCA 4RKEA 3PRHA 1R15A 2J46A 1AC5A 1IMJA 1OW3B 2RAFA 2VI5A 3ECAA 4ZFTA 1P3Y1 3RV4A 2Y4NA 1WO8A 3Q3VA 1EFVA 4II7A 3K0AB 4KU4A 1SOMA 4PWYA 4PRYA 2H7VA 3HKBA 3DV9A 3K09A 4K9PA 3VOSA 3G8QA 3HB9A 3QPDA 3Q5EA 4H13B 5AK3A 2UUCO 2EZUA 2YRWA 5DSZA 4Z53A 3GPCA 1KAEA 4RWUA 1CUCA 1Z4OA 4I6GA 4W6ZA 1L5RA 2I80A 3HGQA 3T3GA 1MOSA 4CM9A 2Q2VA 3NTXA 4J9VA 3ANNA 3H2JA 3QFRA 3OOYA 1NN5A 9LDTA 2ZT5A 3WLSA 4B6RA 1K7SN 1QAOA 1QK5A 5FO1A 5LM3A 4XIIA 4G0VA 3KLOA 3MGCA 3ZY3A 5IHPA 2BE3A 3CPSA 4WPGA 2P6JA 2UUPA 3NVKI 3D3WA 1PQPA 4ND4A 2RHGB 3SPIA 3BCRA 5IJ9A 5L3VA 4KYUA 3PD0A 4KQJA 4NZPA 4KVFA 1V35A 1X1TA 4ZODA 2XOKA 2O2JA 4XYMA 5LU9A 2G09A 1DBWA 1J1UA 3H9JA 1DRJA 3D7SA 4UMDA 2RGWA 2SCUB 4JP8A 3GEHA 1JHDA 4I14A 3U62A 4X64O 3ZCVA 2R47A 3L46A 4D3YA 3PJEA 1UEIA 3WP1B 1KZ6A 1BWSA 3QWIA 3OKAA 1FS6A 1JJFA 4QREA 3F3YA 4A5UB 1YF3A 1PV4A 3TTVA 1YIDA 3TZQA 5KDOA 2Q6IA 5HIAA 3MS4A 3PP8A 1GG5A 5KBYA 2AJTA 2YWJA 3FGOA 3ORHA 4BMZA 2GF0A 1OKKA 3E3NA 4FT4A 1DUSA 1QZTA 4S1PA 4EJ2A 4LWQA 3FPLA 4F71A 4LF5B 2OCCB 3J80N 1C4XA 1W52X 3UK1A 3AHCA 3IJ4A 7MHTA 4OI1A 1TA4A 2QG9A 2GFIA 2BFCA 1U90A 1V16A 2ANCA 4KMRA 1Y6QA 1KQSU 1VQ5V 1JOYA 5L9AA 4QECA 3LCVB 5JROA 4EA9A 3BH6A 4GLXA 1K4CC 1UPFA 3I04M 3HBJA 4RF5A 4EG1A 2H2IA 3F3KA 1KHHA 2RDCA 3RVZA 3FFWA 1T9GS 3L8EA 1ODFA 1YTLA 1PFUA 2XMSA 2FMIA 1NMXA 4FHDA 3LGSA 3STVA 3CUSA 1GD1O 1SCAA 2XUMA 3SBGA 2ST1A 4GL4A 3QMMA 1D2GA 2BEVB 4JC8A 1O6BA 5AKJA 1E1MA 2WQ6A 3OCZA 4PXSA 4ESVA 4DQXA 1RE1A 2J59A 4DMUB 3A0BZ 1ZJZA 2JZOA 3BXHA 5JZVA 4I5EA 4DC1A 2B3JA 1FA9A 1GV1A 2Y0DA 3KL4A 5TSDA 5CFQA 5AVTA 3F5FA 1EUZA 1MN6A 4K03A 3UJ6A 1VBMA 2IS1A 1P7GA 4ZOBA 3MTQA 4GX1A 1TJNA 4JZYA 4ZC8A 1GZVA 2A9HA 3BAAA 4FJ0A 1YJXA 4PCAA 3GVPA 2BFBA 4BX3A 3EXAA 3BD7A 1VLZA 4LBEC 5GOZA 4A3SA 1FXKA 2ADFA 4RDHA 3TCNA 1Q2XA 2FZWA 3ROTA 5KYGA 3HN2A 3DF9A 1MX9A 4YXWG 2PT9A 3CD6V 3ZW9A 1VPWA 2Z4RA 2IW5A 3COYA 2V9PA 4LGYA 1XLWA 3DL7A 5TE9A 1EUDA 4H1WA 3HZOA 4DJTA 2XODA 4OQYA 3RHTA 1V1MB 4UVBA 4CWAA 4KMOA 3Q0IA 4GYCB 2R1TA 1Z6TA 3A58B 3WL8A 4QXRA 1D6SA 1R5BA 1PNTA 1VFNA 1IM8A 2WA2A 3OMIB 1LRJA 4U4AA 1YQGA 1J2UA 2JVJA 4FLEA 1MT0A 3I6MA 1KQFA 4O25A 1GN8A 2Y1WA 2IP2A 4HYTA 4HLQB 2CXXA 1MX3A 3EC7A 1RRVA 3ZVLA 3GGOA 5B1EA 4ES6A 521PA 1T2UA 1S1CA 4AB1A 3B1KA 1R37A 3RS8A 1Y3AA 2JFZA 3WB0A 3ESAA 2F3RA 2X8AA 3OEHG 1UXHA 2GEUA 4RH1A 2C7BA 1SXJB 1J49A 4NPAA 2A67A 3WYEA 4MARA 4YT8A 2NU8A 2VKTA 3BDAA 3OY7A 1PGNA 5B66Z 4L4XA 2I62A 2JJ1A 3SFTA 2AXQA 5FTLA 4IS3A 1QHNA 3EX8A 4A1FA 2H2HA 5JSYA 1QQTA 1K8XB 2DTEA 4G1BA 5G1PA 1JHXA 3QX8A 4MQMA 3VQWA 3L4SO 3PC3A 2NX2A 1AUXA 3NAZA 3WK4A 4CLRA 1L5ZA 2ZIMA 4EP1A 3Q6IA 4ZGGA 1O3YA 1U02A 1G6HA 4RJKA 2ARHA 1FU8A 5FUYA 3RHSA 1NVMB 1Z4KA 1XMSA 1Z2PX 1M1NA 1XEWX 3KLNA 1TTPB 2FN8A 2PS9A 3DV2A 1XNQB 3M2PA 4E5VA 4P98A 5DHSA 5K3DA 2P5SA 3WHIA 5F7JA 4LF6O 2Z8ZA 2ZCJA 3DHVA 1H4QA 1P2VA 2XNJA 5JSHA 1FJHA 5LGUA 1Y37A 1Y7PA 1FSSA 5EIXA 4EI8A 4AY2A 1X9HA 4B8ZA 2K9PA 4FIZA 4PC6A 3K2EA 1SD2A 621PA 1WSBA 1VSQA 5EZQA 1W36D 1ZL8A 1VI2A 1ZMOA 3IPXA 4JGGA 3GJYA 4QICA 1Q6ZA 4AXXA 3IE2A 2YW2A 4J2HA 4MR9A 2V8BA 3B3AA 3GUVA 5BW6B 3I6ZA 1M3SA 5PGMA 2Q3DA 5L4SA 4OH7A 3SLRA 5FV7A 8ABPA 3ZGZA 4KSBA 2VAMA 1VPTA 2WT9A 2WKSA 2QQFA 1KPIA 2C1ZA 2VHZA 4AZ3B 2JLYA 4JPRA 3QJ5A 4ZVQA 4ZVRA 4FCCA 5B7GA 3ED5A 5EG5A 1V71A 3DL2A 4ZI5A 1QQ5A 2SKEA 3LZ6A 1DAHA 2F4NA 1IIBA 2DKFA 3L8GA 1Z0DA 1RYYA 3WYGA 4B2IA 4FGWA 3CZ9A 1VA4A 1JFSA 1Z6ZA 1T2VA 2ZXUA 3EPLA 3LYUA 2WYIA 1JE0A 3AYXB 3NBFA 2YQ4A 1FMFA 3UATA 3MFQA 4ZOLF 3AHDA 1G8GA 2JNWA 5CH5A 4DJ5X 3UV7A 2ZB4A 3HCEA 2GJ8A 3AY6A 4YRQA 4ZQFA 3PX2A 3RIYA 1NU8A 3RKUA 4GRDA 3LCMA 3V4PB 3W3ZB 2QP4A 2A9FA 2OBNA 4P33A 3A2MA 1YZUA 1KJZA 4DV0B 4JKIA 1MZFA 4L4UA 5FL7D 5EZ5A 1YRLA 4E03A 2B4AA 1S8NA 5GIPE 4D80A 1X86B 3JQEA 5D3ZA 5JRJA 1XBTA 4XGNA 1F60A 2PIAA 4FM1A 5EKUA 1QHIA 1ZK0A 3GLKA 4DZRA 3VPFA 5DHRA 4LPSA 3DAFA 4MWOA 1RSOA 3W3AA 3A4LA 4TYYA 1XDDA 2QWOB 3AJAA 1QU2A 4L2IB 4G0QA 2QBYA 2GTHA 2OAGA 3KQYA 4F2PA 3IC7A 5AW6A 4CKCB 1QK4A 3Q7IA 1COWD 1FYEA 2UZ4A 3ANXA 3BWYA 2EF0A 1RLTA 2BKXA 3DEFA 1IWBB 3R7WB 2Z4SA 1E96A 2PUTA 4MUAA 4LR3A 2W98A 4EBFA 4HPXB 1ZM7A 1WB4A 3UHPA 4CGYA 4CMBA 1UMCB 1GK9A 1V95A 1FS4A 4BNHA 2Y1CA 1H9CA 1PS8A 1FQOA 1KEVA 3RVBA 1D04A 2R5NA 5KNBD 5KHLB 5GVRA 5L3FA 3P9NA 2HGSA 3TQOA 5J4VA 3BEHA 5HZHA 2KYRA 2CHUA 2D4AA 4UTZA 5JXIA 3UH0A 5ALZA 2IKQA 4NCBA 4R40A 1ZVKA 1KJWA 5B57C 1NRJB 3I9V6 4FFSA 2R0QC 5AHXA 1BMFD 4FGZA 4ABMA 2W0FC 3HUTA 1U9YA 2WWFA 1C0KA 1YRBA 2YRFA 4CM5A 1FYWA 1P1HA 2MOKA 1TGYA 1P4RA 1ISIA 4GXNA 1SY7A 4E11A 4ZU1X 3DHYA 2VZ0A 5DLEA 3RRMA 1A7AA 4JI3B 1IWPB 4YV2A 4YP7A 1OCRB 1BFUA 2QMEA 4BNKA 2OG1A 3OO1A 2AMJA 4PLCA 1UBTS 1R6VA 3WS7A 4B3TB 1XL1A 1VIBA 3JQFA 1I33A 1YWGO 4Y7DA 5L95A 4BX0A 1ZD4A 1DFGA 4JJ7A 3OQVA 3G8YA 3NBQA 1JB9A 2Z2IA 2QKYA 3SJCC 4CMGA 4E4RA 1JXMA 1E4VA 2OSBA 3D3NA 3LWZA 4KL8S 4LF9B 1E58A 4YJGB 1E7YA 1TMGE 2QRGA 1URFA 4JZKA 3UHAA 2JHCA 3INNA 2HWYA 2ZETA 4Q16A 3CVXA 3TE6A 4MPJA 4OI0A 4QJIA 3I6YA 3P9QA 4DIEA 2CE2X 4JTDB 5KYWB 3ILHA 2X4GA 2VWHA 3OZBA 3IAFA 1P3JA 3FB8C 3G17A 2HMUA 3H19A 4IYHA 4NR0A 1CVLA 1BX3A 4NTZA 5UKDA 4C0XA 2PX0A 4H3VA 3QTCA 4GO1A 1Z2AA 2IYPA 4WECA 1VKZA 3AP1A 3MXTA 2ZZNA 2ZE5A 1HRDA 3DMYA 4Q4HA 2B4RO 1AQJA 1ULUA 3WFJA 5GONF 3DWIA 1W8IA 2ODEA 1MPTA 1M76A 3GDOA 3D8CA 3D8BA 4JR2A 4LFBB 4WK4B 3CEHA 2DQ4A 1T3GA 1PX2A 1ELOA 1MO3A 4JT9A 2VP5A 3GDHA 3A3NA 4CIWA 3QJYA 3EWAA 3OE7D 1LPAB 3RSZA 1AX9A 4HVLA 3I9JA 1FSPA 2H4YA 2WJIA 3X1ZA 4S1TA 4R05A 1T9DA 1VCNA 5DULA 3VO2A 1E3SA 3I8SA 3GJ4A 3MJEA 3DZCA 4HDAA 1A77A 4JIGA 1M8PA 4N01A 4KH1A 221PA 1YB2A 4KPGA 2C82A 3FSEA 4GE3A 3QI2A 4IIJA 2DMXA 1YVEI 2PK3A 4Q9LA 3KXDA 1P7YA 3Q3JB 4DIDA 4U00A 2QK4A 3BRWD 5K0ZA 3SJCA 5E7MA 1FXWA 4MUIA 3EQ7A 2RHDA 2ZI9A 1OZ0A 2G9NA 1P0MA 1ZH6A 1WDKA 2G1UA 1CU1A 2Z6AA 2OV3A 4M38A 1RBMA 1SC4A 1SZPA 3IMKA 2WJJA 3ONFA 1L8XA 1MV5A 4V39A 2CT8A 3G7UA 4PNEA 2GVDC 1KYXA 3AG4B 1ANKA 4JDUA 3U1VA 2AC7A 1L5GB 1DFHA 2H1LA 4RGQA 3MUFA 3EVZA 3LOQA 2X4LA 4RADA 4AQDA 1NI4A 4OA8A 1T15A 4XBFA 3WYBA 1LLUA 4KPUB 4X1IB 4CTNA 5C9ZA 1VHJA 4QT0A 3DFUA 3DHNA 3OIGA 1ZOSA 4F21A 1MR3F 1Y6GA 3A1CA 3DLTA 1ODIA 1JDBC 4UVHA 2Y76A 3NOOA 1VHDA 3AHFA 4UUQA 4PS1A 3UWOA 3EEYA 3K9FC 1XEXA 2EFEB 4MULA 2B7BA 2XMRA 4JOCA 3WLAA 1I2ZA 5SY6A 4QGSA 1FUEA 1DNPA 2GF2A 5B2ZA 3CNBA 1G7CA 1HLGA 1UXKA 2NLOA 2EFCB 1QMGA 5CPBA 1VHLA 3Q7TA 2J5BA 5IJAA 3TGPA 3BSSA 3MJSA 3CRQA 3C4VA 5DCAJ 3Q3EA 2KS6A 1EE1A 1I5OA 4ZQBA 5JH7B 3HFRA 3AVTA 3ZG6A 5ARBA 1EUCB 1U2QA 4JXEA 1R9NA 2Q07A 1QC5B 4DCNA 4K1XA 2R62A 1MTZA 1PN3A 1TU3A 4HDKA 4J42A 3H84A 3P71T 3ZHYA 5AOVA 1GFIA 1RADA 3V3KA 1Z28A 2YCLA 1F4NA 2EXXA 5JQGB 3OMLA 5BY2A 4CFSA 1WZ2A 2MYUA 2ZUVA 5C2OA 2FWBA 4P93A 1EVKA 1U28C 3MTGA 4AYXA 3O31A 4L4SA 2JJ2D 3I58A 5KZMB 3ZVMA 4L3OA 5HKBA 2Q5EA 2FSFA 2B1GA 1LV8A 2P4SA 3K4PA 4YV0A 3B4SA 4JI0B 3M1LA 3U1BA 1IK6A 1PYOA 2R97A 4YFVA 3KEFA 1QR6A 2EW8A 1ZNWA 1KAHA 4LP8A 2X19A 1DBVO 1JG3A 2AOTB 4EHDA 1IHXA 4UDOA 1ZMRA 1QGOA