1G8MA

Crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
total genus 207
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g8mA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1g8mA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA02
1C30A 1EGHA 1PKXA 1THZA 2X8WA 1T36A 1B93A 3ZZMA 1C3OA 1CE8A 2IU0A 1S8AA 1IK4A 1OZ0A 2IU3A 1VMDA 1WO8A 4A1OA 1P4RA 2YVQA 1CS0A 1A9XA 5H3LA 2B1IA 1JDBB 2B1GA 2XW6A 1BXRA 1KEEA 1ZCZA 1G8MA 1M6VA 4EHIA 1S89A 1M9NA 1PL0A
chains in the Genus database with same CATH superfamily
2XSZA 4CG2A 1MV5A 3QPDA 1PU2A 5F2NA 2IS1A 3B5IA 2ZK7A 3V8RA 3PT5A 5ALFA 3RTEA 1JI3A 2JA2A 3AERA 3T0FA 3SWWA 3MWLA 1ZIOA 2M32A 1V43A 3EVGA 2P06A 2FRVA 1D7AA 2JIMA 2KKSA 2OC4A 2OOKA 3OO1A 3RVLA 4F3RA 1Q14A 2ZRMA 4FGLA 3TYXA 4R8RA 1EHIA 3TNDA 1II0A 3VQYA 1C29B 3ISTA 3RYFB 2I4NA 3O1LA 4IJ5A 4WZAE 5F33A 3TLGB 3W7AA 4RIFA 1DGSA 1ONPA 3DKIA 5AJTA 1QUFA 1G8FA 3EGXA 4A8PA 3U11A 3QFSA 4LV5B 4JVMA 2DX7A 4G65A 4ZJPA 1T4GA 4UUOA 2HHCA 1E79A 5J4VA 1XEAA 5KKAA 3EXAA 1JR2A 2H6EA 3F97A 2O0KA 1G6KA 3LX4A 2WLNA 1MT3A 1FOEB 1RYMA 1US8B 2C03A 3M9XA 1KJJA 1G6UA 4YY3B 2GMWA 1U7PA 3K5NA 1P0QA 4GP7A 4Q16A 1X80B 1VP7A 1IFXA 2AA3A 3CH5A 3QKSA 3ZDQA 3N1UA 3FGPA 3B9QA 4WADA 4AZ3B 1I0ZA 3UEOA 1FFAA 1Z47A 4I7ZB 3BIXA 5IJAA 4F96A 1D8AA 3TQSA 1Q7BA 1U4SA 1W44A 4FFOA 4GI7A 4HF7A 1NI5A 2WU3A 4L3VA 1Y8RB 1GKUB 3OWXA 2IU6A 5CK4A 2UYCA 1W4BA 4RVCA 3CIOA 3AG3B 3OIVA 1OH6A 1BMDA 4J8PA 1IUOA 3U49A 1CDEA 4NV0A 2PDAA 4Z4IA 2BTQB 1RLIA 3OQ6A 4MQBA 3C4QA 1D03A 1YJNV 2VT3A 3VZBA 2AS0A 2XSZD 2W58A 1BNCA 1IZ8A 3JYLA 5BSWA 4BZZA 1IBMO 3HKBA 5A62A 5KNCD 2BCJQ 1BWQA 1JJFA 3R23A 1JR4A 4KE8A 4L0DA 4BNUA 4RTSA 721PA 3T7SA 4O1IA 4JQYA 3KVVA 3MIZA 2GESA 5EMHA 2H16A 2X3FA 3TXQA 1UBSB 5COQA 3PPVA 4LDZA 1TO2E 3OJ0A 4U2BA 1UJBA 1AQUA 2FDRA 2IPMA 3LWDA 4LWOA 3U3DA 3WFVA 4BQRA 4PYIA 2DT8A 1M1ZA 3F96A 3QK7A 4MEJA 1TIKA 1TA8A 2R4UA 5H6QA 3ORSA 4RNDB 1EXDA 4D82A 3LY8A 4EFDA 1SD2A 4QFTA 2JGJA 4QU0A 2O2EA 1USGA 1XRJA 1XZBA 4CZZA 4B4WA 1FZQA 2B92A 2R1TA 1C9DB 4GCZA 4N8DA 2ZYDA 3T1VA 1V47A 3I5UA 3O9MA 1HOXA 4OLBA 4OQZA 2O8CA 2RE8A 3ANYB 3JWHA 2QVYX 3GLIB 1EFTA 3IQXA 2NN4A 2QN8A 3OP1A 4IJ6A 1RDFA 1EI9A 2HQSA 2XWBF 3GGPA 4LX8A 2CVHA 1QR9A 5AVKA 1QHFA 4KXRA 4X9XA 3R5XA 3S29A 1APBA 3BK1A 1UWVA 3C5WP 3GMSA 4TQ9A 3LBHA 1U1IA 1C4XA 4QGHA 5G0TA 3I28A 3VYTB 1A2KC 4G0NA 4EJSC 4J10A 5HFLA 2PMFA 3IQEA 3N9IA 2NM0A 4DGQA 3RC8A 1K9SA 4DA8A 3ZWPA 4RLHA 4LBWA 4N41A 1X1EA 2Q4PA 2Z30A 4ZDIA 5THKA 2FZ5A 3B8HA 3MMZA 4EO4A 5AVSA 3KXIA 2CJFA 4W1PA 5AESA 3A1DA 3P9SA 4QSHA 3JAWB 1YBVA 2OK8A 3V7YA 2I0FA 4B81A 1L4GA 2ZIVB 4Z4QA 2E4WA 1HQYE 3MJFA 3E2PA 1DAFA 3ZI0A 3FNFA 1SB8A 5CVCA 5A3QA 2PFSA 3VOSA 4OMFG 4O4LB 3PDIB 4JU8A 4Q4HB 1SOVA 2BZSA 4V24A 1D2NA 3DEZA 4MKZA 3SX2A 2F8LA 2H31A 2G40A 4MV0A 5FL7A 2HMSA 3AF3A 2ZITA 4ETIA 3EGCA 5AK3A 2O8FA 4I5EA 4JMPA 2Y3IA 3CSXA 5B1BB 3WWYA 3JY6A 1RABA 4J7ZA 2IZ5A 2XMPA 1MSWD 3AETA 3PF8A 3PD7A 2W6QA 3CSSA 4BVHA 1O96B 5EXXA 3SQDA 3M4XA 3HP1A 4FPPA 1Z9BA 4H3KB 4WACA 3RUCA 3INGA 5HJ7A 5I4BA 2OTCA 3CUTA 1IZYA 2GN1A 1TTPB 2ZWOA 1VHLA 3FGNA 2EHDA 3VNAA 1LSSA 2QX6A 3IIEA 3OMIB 2Z2XA 5TQJA 3EEQA 4FQ7A 5I7SA 4YCJA 2JEOA 5K2MA 1KMHA 1PWHA 3A1UA 3WO0A 3Q8KA 4KJZA 3L93A 2Q9LA 3QX3A 2XLCA 2CFTA 4OWPB 2RCYA 5B64A 3GB9A 4B3SB 3AVXA 4PQEA 1NOKA 3RODA 1X94A 3I2HA 3SYOA 1Z25A 3ERCA 2RGWA 4M46A 1BXRA 4PW0A 5EINA 3NT2A 4HNHA 4L3OA 1B41A 2JGIA 3FZNA 6REQB 3TXXA 1KKCA 5JS8A 1ND5A 2YFQA 1N2EA 2W2QA 3HJFA 3MCAA 3SPHA 1Z62A 2AMVA 4WCFC 2AYZA 4ADSG 3THWB 2P9HA 1GUDA 3L6BA 3Q3HA 1TK3A 1TRKA 4BMSA 2ZXFA 1U8UA 1EWKA 3E7WA 3PLRA 2P0AA 1GG5A 2DULA 4TXJA 3U5ZB 3RJ5A 2JHGA 3B2NA 3GHYA 2WZDA 3BGOS 3I4FA 1IONA 1CT9A 1PHPA 2LXNA 2C7GA 5J3JA 2A9HA 2D59A 4V0OA 3FPBA 2A59A 2FK8A 1NJ8A 2MOKA 2NO1A 2AFIE 2CVQA 2XVAA 4F5DA 4LP8A 1Z6QA 4MTXA 2QUIA 2FWPA 3EEBA 1G5FA 2AMFA 4YO8A 3IKTA 5DHUA 4B3MO 1R5JA 1CS4C 1A5TA 2WWTA 4H3HB 1LRJA 4TMZA 4B9EA 4GBJA 5LBQA 1Q0QA 1U6KA 2PUEA 1UKYA 1PGNA 1RMYA 2A5LA 2XGGA 4MRVA 2AV6A 4Y1RA 1T3ZA 3BSFA 3OKPA 1RRKA 4Q7JB 4QXQA 1SWVA 1P6UA 2PLFA 2PXHA 2QD3A 1Z7EA 1V6SA 1GCIA 3QJYA 4BJHB 1AILA 1YV9A 3E7XA 5CLHA 3LZCA 4JT8A 5SZIA 3IXLA 5IT0A 4Z3OA 2J4CA 4F6RB 1JKJB 2WSIA 3I9LA 3RE1A 3T54A 4B0PA 4X66B 2PX6A 1PTKA 1YJ5A 2JHFA 1E77A 2LIPA 2XB8A 3EXIA 1E2EA 3M82A 3N05A 2R00A 3OZCA 3SR0A 3UANA 4YASA 2ZREA 2HLNA 5AOVA 1FF9A 1DEHA 4NNPA 3A4YA 3S1AA 3EYAA 3H5RA 3FDIA 1W1IA 4O8XB 3KBBA 5D8DA 3I23A 2X22A 1I9CA 2ZKIA 2C9DA 1L5KA 3V32A 1J0XO 3EAGA 3KUDA 1SC4A 3T9CA 3SEAA 1O97C 3CMCO 4O4LA 3KNZA 1E7RA 4PGFA 3AHJA 2BBOA 5IBCA 3F5TA 3PNYA 3ZLBA 4QPKA 2B1QA 5CNMA 2QV0A 1U2PA 1G8KA 2QNBA 4QNMA 1EFRA 1J2EA 1EXWA 1LC0A 3NRBA 4I2VA 4MKRA 4B6SA 3RD5A 4B3XA 4KAAA 1P0FA 3GEPA 1B3BA 4DLKA 1GDHA 2NSJA 1NN5A 2RB5A 1L3CA 4ND7A 1K0UA 3PQDA 4D96A 1FRFS 3QIAA 2GQ0A 4O2RA 1PGPA 3K9HA 5IK2A 3TZLA 5I8PA 3QBTA 4S35A 1BDMA 4LYAA 1NM5C 3E8HA 2GPNA 3R76A 3W9SA 5M5BA 5HHTA 1MPTA 1RWXA 4IPTA 4OYLA 5TMEA 3OZVA 4P86A 5JTUA 1CUVA 1W0JD 1P84F 4P30A 4JI3O 1HF3A 2VBCA 2XYHA 4R8MA 2ZT7A 3O0DA 5CB4A 5H81A 5GTIZ 1BN7A 4RXTA 2ZSHA 3C98A 4LXQA 4QYWA 1RPNA 4MLCA 1ML3A 4MR9B 4PWZA 2J1LA 2JIRA 2X6BA 3H2ZA 5LP6A 3B2QA 4TYQA 3OOHA 4G1UC 4CV0A 1I5XA 1BXRB 4G5GA 2PRSA 2BFAA 5FOVA 4B3IA 2XBUA 4WZBA 2VJCA 1CZOA 2I4MA 1BHBA 2XQFA 3AOEC 3G2MA 4KV9A 4NHEA 3VQVA 4J1SA 3VKUA 4B2YA 5HUHA 2NP7A 1YO6A 3RT3C 2PGNA 5EEHA 2GDZA 2IVFA 3H3XA 3HDQA 2OUIA 1M5TA 5L9AA 4JZYA 2VK2A 2C5AA 1P7YA 2YOGA 4M1SA 4M0UA 4DW0A 4MV7A 2BDTA 4PHTA 4AF6A 1YCFA 4BRUA 2H07A 5A4DA 3GCDA 4RUKA 5G41A 4PFSA 3DC7A 2OORC 2OZVA 2VDRB 5DN6D 2P62A 4NTXA 1BCCH 1VQ7V 3F5FA 4P22A 1SZCA 5AW2A 3BD9A 1J09A 5K0TA 2QSJA 1U1EA 1CP2A 5ER9A 2UUCB 2Y1EA 3TJMA 4C78A 2WLLB 1Y6GA 3ORRA 1BGXT 1AQNA 1ABEA 1L7XA 1OB2A 1KRHA 3QUBA 1NSFA 2Y0CA 5BYAA 4PCAA 1L1FA 1SVUA 4RQTA 3NIFB 3OR7C 4Z53A 1G7SA 3UA3A 1EAYA 4BASA 4UCVA 2PUGA 1E1QA 1L7EA 1ORQC 2IWHA 3I2IA 5JC8A 3ID6C 1FUKA 3MLBA 1IBLB 3OCYA 2GO7A 4JY7A 4AKSA 4B73A 2EJTA 4D9GA 4JJFA 4X7BA 4EMUA 5EJ5A 4M21A 4KQ9A 1Q74A 3MWKA 3ASZA 1L5OA 2F7SA 2ZB8A 1PR0A 1B0PA 1WPBA 4HNTA 3DTNA 2XNSA 3ESBA 3FTCA 5FUYA 4R1OA 1BWSA 4QDOA 2I55A 1D2MA 2ZJAA 2B7LA 1ZNWA 2HCJB 3CX6A 4JYMA 5AW7A 4I4TA 4HUQA 3AEQA 4KIJA 1YDGA 2DHCA 2JL1A 3AF5A 2ONZA 1T2EA 1Y37A 4BMOB 4ZCMA 2P7IA 4CMKA 3IEMA 4QUDA 1E9SA 4C01A 1YGPA 4IIJA 5JJJB 5EHGA 1LTQA 4KVZA 4FZJA 1E3TA 1F5NA 2GZSA 2F2TA 4Q3DA 3TZCA 3ZW9A 1BS2A 3B1ZA 3EGOA 2PO5A 2V0NA 4W5JA 4P2GA 4EG4A 3K08A 1G4AE 1J25A 1QB7A 3X1YA 1EKXA 1JHMA 3KZKA 4X8AA 4B3RB 1XCMA 2QIOA 1P91A 1QCCA 4CLRB 4OCZA 1NIPA 5IM4F 4BPBA 3FUVA 5INTA 1QR6A 2G6BA 5FKJA 5A0FA 3H9UA 2W0MA 1KSGA 1WV1A 4QWWA 4G8DA 1XILA 5FPRA 1IOLA 2YIVX 2C94A 4M0DA 1YI0A 3CSUA 1AGYA 3HKCA 3FWHA 3I6QA 2HLDD 1K5QA 4AUMA 4WD3A 4Y2HA 3TSWA 4EA9A 2EKDA 1M1NB 1KMQA 2IW3A 2ODTX 2HDWA 2OBYA 1ZNZA 4RHFA 3WLKX 4WZBB 1C7JA 1PVOA 4DA4A 4P53A 3MMXA 5IC6A 1FEZA 1E0DA 1QYVA 2CHVA 4QE9A 3E7FA 4IV5A 4TZTA 4EYEA 3EX8A 4IR7A 4C4YA 3CX7A 1ACLA 4EKYA 1QAMA 3ZS8C 1YA4A 1NH2D 2XAHA 3HYNA 3K2EA 4J75A 5FOXA 2AEJA 2V1XA 4FJ1A 3TZQA 4IRXA 3OIGA 4AP6A 5AKLA 3RF6A 1PFKA 3WGOA 4D7SA 3G71V 4KLAA 4MSWC 2H59A 1IHXA 2PKQO 3CLSD 5L3RA 3WIDA 3BFVA 4Q3NA 2JIZA 2N74A 1XMQB 4BB5A 1G3IA 3FKSG 1KAOA 3S5JA 1DLBA 2A4MA 1XL1A 2C8VA 1ZVMA 2M6YA 1T2VA 2WZBA 3LUCA 2O5VA 3Q40A 3P9XA 5AI0A 1TGOA 3ABOB 5ELLA 3CVJA 1ADYA 4AYTA 5B55A 3ICQB 3PE6A 3DQQA 1QVWA 1OHHG 4I8XA 4YDHB 3CE6A 4BQOA 4DABA 2HXVA 4RKEA 4IUDS 5H6RA 1GYRA 1QP8A 1DKUA 3HRIA 3KZ1E 2EW8A 3DC6A 1X4TA 3TIGA 2IH2A 3AI2A 4GC5A 4JOBA 3I5MA 1WCIA 4K9NA 4KQFA 4XXHA 3VOTA 5JU6A 1Z5GA 3D81A 3ETNA 5ALNA 3QG5A 1K2VN 1KOJA 3RVKA 4B3RO 3AHCA 3DCIA 2QVZX 4HO1X 5BSMA 1ODFA 1XPJA 5THXA 3QLVA 3UQYS 1ULAA 5KOHA 1TAEA 3I9FA 2AHYA 4DF3A 4YIHA 3GP8A 2Z95A 2P5SA 3O8QA 3PENA 3OHMA 4HYEA 4Y2XA 3SIWA 3ZE8A 3ESRA 2WMOB 4DCSA 1U7ZA 1ZM9A 2G7ZA 2PFKA 5KAIZ 4R0NA 2SICE 5F51A 4ZCRA 2X9GA 3WSVA 4CLOA 3AESA 5M59B 1CHNA 4J7KA 2OO5C 4OQYA 3TVTA 1POWA 5B1AB 5LR6A 4CR7A 4H7IA 3WGNA 4X62O 2YASA 4HG2A 4P4SB 2PVSA 3PQ5A 1YDFA 5AJYA 4KIGA 5BRAA 2QEXV 4ARAA 5I5EA 2NYTA 3A6DA 5HQ3A 1ZLYA 2XTAA 3DMNA 3UK0A 5I6DA 3UPDA 4OBWA 1Q6UA 4BN4A 4F97A 4TYNA 1X8KA 1ZJYA 3ISVA 4K1LA 1C9KA 1Q91A 3OLZA 3A70A 3KJZA 1X1BA 4KPGA 2BD0A 2OM2A 4Y2QA 4BFWA 1YSCA 4UCQA 1HFEL 3LQYA 1XVUA 4UOZA 4EB6B 3KO8A 5JALA 1GAQA 1NZFA 2BM1A 2RAFA 4WCFB 2OG1A 1O57A 3V4VB 4C88A 3DP7A 2I4OA 4JBHA 1OWOA 1XMQO 2OQVA 4BBJA 1J1UA 5K3EA 3DVAB 1C3OB 4L72A 1WXQA 1WDTA 1ZD4A 3VJRA 4C5CA 1G6HA 1TECE 3N28A 3TBKA 1DX4A 1T9AA 1NA5A 2H1VA 2ZM6O 4AMGA 3NIBA 1QTIA 3MG9A 2P91A 1WXIA 3A9UA 3DDWA 5I9NA 1N2JA 2Q2VA 4YNBA 4ZIRA 3OCZA 1SPXA 2DOKA 2QT9A 4IYIA 2VSQA 3LX5A 4GLFA 3IPAA 2I7VA 1B8UA 1Y6ZA 4XDHA 4YECA 5IXSA 4PJ0Z 1OZGA 5IYZA 4FFBB 1GQYA 1T4MA 4J2HA 4HN2A 5DGXA 3T15A 1XLUA 1ZNYA 1Z5NA 5FYQA 5EK0A 5LOVB 4W6ZA 2VQDA 3IMGA 3ZWBA 2IS6A 5BQ5A 4KH1A 4MV8A 1KQ3A 3TG8A 1A9SA 3OQNA 3MSCA 4G86A 4XLTA 3SXUA 1GFWA 1RLOA 1SU7A 3HV2A 4LDNA 3GWOA 3FYUC 1JJOA 5HJ2A 1GGVA 4WA8A 4A73A 2CJWA 2C7RA 1K08A 1X86B 1K27A 4CL2A 2B3DA 1Y1PA 1NH2B 1NTRA 3G6WA 3QLTA 3G3EA 4HTAA 1M0EA 2W2LA 1G291 1D6SA 1JA1A 2F1JA 5ECWA 4MEAA 1RRMA 2EV9A 2VYND 3D2BA 4OIMA 1HDXA 2WFLB 3H3JA 1XQVA 2X0DA 5CCEA 3FVQA 1KMIZ 2MMGA 2WHQA 3LCJA 4OEHA 4R2HA 4XWAA 4BO9A 4P9DA 1D04A 2CDCA 5E2IA 2CSXA 3FWNA 5DECA 4OSPA 1U1CA 2JGFA 4LC9A 4C21A 2I7TA 2Y69B 4MGIR 1UPFA 4NDAA 4ZVOA 4R9SA 2G5PA 1VE5A 1WBJB 1E4VA 2RBEA 4GL4A 3HN6A 1UJCA 3KOOA 2IYVA 3LDHA 1ECGA 1FP2A 3TZHA 1KQFA 5AOCA 1LTKA 1OX6A 4JBWA 5IVDA 3UH1A 3PDWA 3ESQA 4ZREA 4TVSA 1AMUA 1VQ6V 2B2CA 1FQJA 1OCZC 3CPEA 3STTA 3T06B 4LF8O 1XCPA 3R1IA 1YVDA 1C8BA 2VPWA 2ZSAA 3E0XA 3KTDA 3PRJA 4MKGA 5CVVA 2M98A 1KB9F 3RHFA 1PJTA 3C97A 3SEZA 3TLCA 4MHTA 1E94E 1TGYA 2UZ3A 3K1ZA 3WGIA 4DK1A 2NU6A 4PA4A 3LTEA 2VT7A 2NV0A 3PFHA 4CLOB 1YJAA 2ZVDA 2C99A 5BSKA 2BOBC 2OTLV 4PS0A 1AC5A 4L3WA 4UZFA 2P5TB 1Y3CE 2FUG6 3PNLA 4J41A 1DDIA 4DIUA 4GKKB 1USUA 4P5PA 2C97A 4E4YA 1FXKC 4JLJA 2XAGA 3DGFC 3FCYA 5B57C 2DM6A 1S1MA 1XD8A 4XGNA 3SKYA 3THXA 2NQ8A 1NSYA 4ZT4A 4CFYA 2YUIA 5JMPA 3CR8A 4CDRA 2XTNA 3ZV6A 3TPZA 1BMTA 4WJKB 3UIEA 4R50A 3OEEG 1VQKV 2P9JA 3AVPA 4PLZA 3JD4A 1CBUA 3UWSA 4QAQA 5JS7A 1Q5OA 2QTRA 4X66O 2KLBA 1XCGB 2Q3EA 3B6MA 2CZQA 2IUFA 2LBPA 4L8WB 1WEHA 2ZNRA 4L8YA 4LZPA 3A05A 3AP1A 3DE4X 5DTRA 5GGXA 1RQLA 1ZKMA 1QVFU 2ZBRA 3DH0A 2ARKA 2B9VA 3I1YA 3AR5A 4DQDA 1R6NA 4ME6A 4BWAA 1SCBA 4BX0A 5ADVA 3FM9A 4JI5O 3U61B 5B36A 1EFKA 3NHPA 2BR4A 3FWKA 5L4SA 3X43A 4FM0A 4G1CA 1DFHA 4ZIRB 4UEJA 2NZVG 4OU4A 3CF0A 1F2DA 3WWPA 3K5MA 2DSTA 2I2XB 4QUEA 1NZJA 3WTCA 1Y33E 3PC2A 1VL6A 2WIAA 1SHJA 3A0RB 4GNRA 2COEA 2NU9A 2OZLA 2PH5A 4PE5B 4XYMA 4UPDA 5LOVA 5ECGC 3IEIA 4DSOA 3I9KA 1KJQA 3RU7A 3GOQA 1JFVA 3RANA 4WDRA 5GY7A 1SY7A 2CEAA 1XF1A 4ZOAA 5ALLA 5EZ5A 2DHDA 4EQ6A 4EYGA 3ZEFB 2Y8EA 5BR8O 4IVQA 2YMLA 5IVIA 4FUTA 4UE2A 2C7PA 2IHNA 4N82A 3BSWA 2P5YA 3MBKA 4GQBA 1YK0A 1V5WA 3T3HA 4YQFA 2NR5A 4PC3A 1QOQB 2BI4A 3AR6A 4OM7A 4U9IS 2A58A 4J07A 4YGYA 3CNEA 5E79Z 3LNCA 5G0UA 3H1BA 4ZAXA 3HLTA 3DMYA 5FLKA 3EVDA 5FL3A 2R62A 4R81A 2VPPA 3C3TA 1GPNA 3NAQA 5LZ5A 4BV3A 2RGCA 2HQBA 1KAGA 4RUEA 3TI7A 4FHDA 1MTOA 1VBNA 3E81A 2ACVA 4B3DA 3I6MA 1O94D 4FNOA 1XTSA 4TM8A 4TXMA 4B47A 4UU7A 5JSUA 4GL2A 4BTVA 1RXWA 2CDRA 3SBDA 3KEQA 2VQFB 4XWWA 3HFSA 2Z2ZA 3QTTA 2A06H 1FXKB 1HNXB 3FMOB 3G49A 3IJ4A 3IV9A 4HX2A 2IX3A 2NADA 4EKWA 2RHGB 3MJVA 3OT5A 3NBYC 1F6BA 3CLKA 4YUWA 5GZ3A 1DQPA 3K0BA 5B4UA 2FFBA 2Q46A 3CZ9A 4ENQA 5IKPA 3HJUA 3GGOA 4WIFA 3OLCX 3C90A 1PJAA 1N7JA 2Z56A 4ZEWA 2A3RA 1DJNA 1PO7A 3DZFA 4ZHSA 5L3FA 4LJRA 1Y5NA 1EBFA 5JJKA 1RP1A 3IAS1 1ODTC 1RU3A 2WWGA 4UUNA 3SYLA 1UBJS 4M1WA 2O95A 2WJVA 2V3VA 4DV5O 2LR0A 1X70A 1N6PA 3NIDB 4P7GA 4PO9A 2HEGA 4WX2B 3T5PA 1UWZA 3B1YA 2MDTA 3IAUA 3U7IA 2BIFA 4Q7QA 2I34A 4F3WA 1KXZA 5KC9A 1MNAA 4EPRA 2AQ8A 2LW1A 1FU4A 4XWTA 5LDHA 2CJXA 2PCLA 2RH4A 3A1SA 3FAKA 3NP7A 1UIMA 1JDBC 1N9GB 4MV9A 3NHWA 4OHPA 4N0DA 2X58A 3RBXA 2EWMA 4A6DA 2P3LA 3GYBA 3AHGA 3BJMA 3HSSA 1QKKA 3NTUA 3HWSA 4FX2A 4B4VA 3NMUF 4TT3A 1OGJA 3OQJA 4WCEV 2GK4A 3DWGA 4JDUA 3WLIA 2BLNA 3ANMA 1E9VA 1L3IA 2PYDA 1P6QA 1I80A 1ZW1A 4HOYA 3EA0A 5DEOA 1I4DD 3EGIA 1XBTA 1LDEA 1F06A 2BE3A 2QRGA 4DMGA 2ERXA 3A11A 4IO1A 3ASVA 4LOJA 4BV9A 5E7QA 3WWDA 1GUZA 4QBKA 5AD1A 3DMOA 3G8DA 4PLPA 2QG6A 2OK7A 1Y8AA 2P27A 3CS3A 4Q7EA 4YP0A 2V8BA 3FOFC 2B8EA 3BH6A 3SJ7A 4U3JB 2JGNA 3LQQA 3MYYA 2ZBPA 3EY4A 4O5AA 4X92A 5H5JA 3HEAA 2VJDA 5T41A 3V1MA 1M73E 5LKRA 2Q68A 4TV9A 4UNIA 5FUVA 3NHYA 5FUQA 1I7SB 4N76A 3AF2A 3M6IA 4IVNA 5CUQA 3Q1KA 3VPXA 5KHHA 1P6OA 2QENA 4FCCA 4UMVA 3FSGA 3OR6C 2BJVA 4MVJF 1LGYA 1WB9A 1NUAA 4HWSA 4WN9B 1IB0A 1GTOA 1DKLA 4RD4A 4FK5C 1ZL2A 4TZKA 4BVLA 1PQPA 1U0FA 1ODCA 3DGEC 3HCCA 4RE6A 3T35A 5HVNA 1KI4A 4S0ZA 3EZXA 4WXRA 1X6VA 5MDHA 1CYDA 4EQ6B 3P9KA 5JY1A 3BMQA 4YYZA 1E2QA 4O1MA 4HAIA 4D9IA 1A8SA 4UCFA 4DR3B 3WX0A 2NXWA 4JXKA 4Y1FA 4PLYA 5JZVA 1XNRB 1VQ5V 1BOFA 1X2BA 4ND1A 2PGLA 4X44A 1KOLA 3A3OA 1L7MA 1YS6A 2AJTA 3ZTTA 3F6PA 1VLVA 1GNRA 1T24A 2DSNA 1UFVA 4DRXB 2PKXA 1WO8A 4H1WA 5H0IA 4LNUB 3WK8A 4M99A 1KFJB 3ZBQA 2ETNA 1O2DA 1PIWA 1VI2A 4AO7A 1W73A 2V96A 4ID9A 3SG0A 2ZPAA 3T3DA 2FPUA 2Q5OA 4V38A 3GLFA 1C14A 1AO0A 2VA9A 2OXCA 3FCOA 4BPRA 5JCJD 1D4FA 3SPJA 1NWHA 1AJQA 1XO1A 2ESRA 4Q7MB 4Z9XA 3L7MA 3ZXUB 1WB7A 5JQGF 4FEGA 1QHXA 4OHFA 1JXOA 2VWGA 2C31A 2J7KA 2ZRFA 1M2GA 5CMLA 5CFZA 4U2CA 2EZTA 2O2ZA 4B85A 4BAYA 1HEIA 2CNOA 1VLLA 3BEHA 1YRWA 2ZGVA 2UUOA 1A0OA 4M6WA 1GN8A 3PFBA 4DYVA 3CBGA 5AXBA 3R6DA 4B4OA 5CB8A 2OMKA 2GCEA 4WNAB 1FNSA 4YS6A 3MLAA 3NAGA 2AGVA 4YBRA 2VNKA 4URVR 4Q4AA 1EBOA 5IKEA 1RFYA 3BRSA 4K05A 1OCRB 4PA6A 4IKEA 1PTJC 3A3NA 4DUPA 3GO4A 3TXAA 3NHLA 1EVYA 1P4GA 3EA5A 5K0ZA 3NHAA 3E5RA 1OCCC 4FS3A 1IEWA 2PUHA 3CNNA 3IP3A 2P3OA 1RKVA 4J16A 4C4RA 4ZZ1A 3LXXA 4GXRA 2GCNA 2FMLA 4IQGA 3JAMA 2WJZB 2CW5A 3P2OA 1AZTA 1NF3A 2I71A 4L8GA 5GOTA 3CN9A 1IDSA 3QXCA 2FVYA 4ZN6A 1G21E 1DCKA 3FPLA 1YL6A 4ER3A 4OX9Y 4GKBA 4KRYA 1PUJA 1JLRA 1JQAA 4QGPA 4F8YA 3SPIA 3CUEF 3SBGA 4XDZA 1CY0A 1LI4A 1I5OA 2IH5A 1P3JA 2LIVA 5KYUA 4HAOA 2QY6A 3C8ZA 4CTJA 2X40A 4O8YA 3UWPA 4LWSA 2N47A 3TEFA 4DJDC 2C9ZA 3MD9A 4QAJA 4A10A 1WR8A 4DIDA 2C84A 2AMJA 2YEVA 1Z6XA 3M5PA 4N3GA 5DCYA 2B37A 1GQSA 2R6R1 4C7XA 3F4LA 3GNSA 4KLRA 3W2IA 4HH4A 3LKZA 2IXDA 2WBLC 5D5HA 5JCJA 5FA5A 4U3JA 1L4BA 1F2VA 1MORA 3O21A 5DDIP 4Q48A 4B83A 3KV1A 4COKA 2EDAA 2ET6A 2JAXA 5ECDA 5BYKA 3JALB 1ZG3A 1RACA 3PYXA 1AKUA 4KE6A 4UHHA 1PJRA 1T91A 1O1YA 4OXNA 3WGLA 5JH7F 3HU3A 4XYGA 4D57A 4AKGA 1MW9X 4D9FA 2I33A 1KVRA 2N9UA 3RFUA 4I55A 1UQUA 1E8MA 4KUGA 4LI3X 5JYDA 1A77A 3W05A 3UKJA 1J9GA 1BA3A 5CVTA 1T9CA 4UTPA 1Z74A 4NB5A 2Z57A 2AC4A 1T6XA 3GBVA 3BMQB 3NDPA 4Q34A 4ZWNA 2G0NA 4I9QA 5C1IA 4C4XA 1P60A 2LQTA 1XMSA 2P4UA 3KAQA 2WP0A 1KZHA 5E2BA 4C76A 4OXSA 2IJGX 3I5DA 1ISHA 3B60A 4HEA6 3PDJA 3JAKA 1ZD8A 3G85A 5DTMA 5EIHA 3NV7A 1XZEA 1QZXA 2D62A 2ON6A 2QUHA 4DRXA 3L07A 1VARA 3U3JA 2RGEA 3IUYA 5KU1A 1PL7A 1FZTA 1K3EA 2R4TA 3EX7C 3AR3A 2QY9A 4U7NA 3FBWA 4ISBA 3W90A 1JDSA 1JJ7A 5HF9A 5SY9A 4DRZA 5AFSA 4E70A 3DJYA 2C4MA 4HQFA 4H7FA 4HS4A 3NHRA 3VYVA 1H65A 4GF5A 3Q7TA 3Q0EA 4LSGA 4HC4A 1L5NA 3QU5A 3T5AA 4FBGA 4Q6BA 4KQEA 2M2IA 5GINE 4PC7A 2OCCB 3PQ8A 1WJZA 3QUSA 3NHJA 2IYNA 2GYUA 1GWNA 3N2LA 3LVRE 3OCXA 4CIAA 4Y7DA 1SVLA 1VG0B 1XDZA 3ZZTA 2OKCA 3U60B 3FLBA 1Q5PA 2QZ9A 2VDQB 4BWVA 4B0OA 1ZY2A 1GADO 1H6DA 4AIRA 3OM3B 3L7DA 2YQ5A 4BP9A 1FP6A 1L8OA 2XE4A 1V26A 5DBOA 3MGBA 5T6MA 5D6OA 4RMJA 3ONDA 5I9LA 3R6GA 3ZRSA 3OUZA 3JR7A 2HJ9A 4YLGA 1E2JA 1RPTA 1ISMA 3KLOA 4UQPA 3RVPA 3WLTA 2R0QC 1GM5A 4IDHA 4J9UE 4Z1MA 3FDJA 5G3YA 3JQFA 4YFYA 2PZLA 1EP9A 3E23A 1GSAA 3U4DA 3UWDA 1RYHA 1ZDMA 2EKQA 2LKDA 3ZEAA 1Y0BA 5E3JA 5C31A 4C6HA 1M2OB 1ZOLA 1UBGA 3BK2A 1RS0A 1VQ1A 1I2AA 2GJKA 2BFPA 2LD4A 1UMCA 3S7TA 2YIBD 3FHLA 1JT9A 4MLPA 4R1SA 4RVUA 4R71A 3PNMA 5AVTA 2BGGA 4RZ2A 4TYPA 3DDUA 4IV0A 1Z5VA 2Z58A 4ZI5A 3NBXX 3DOEA 2O4CA 4NMHA 4F71A 4EJ2A 1TD1A 3S2YA 2GT1A 4BUCA 1NVPD 1E9RA 3AM3A 3ICWA 4V0SA 1XKLA 2IXTA 4BGEA 4BNYA 1LH0A 5ARDA 5J4HA 3SYMA 1QGUA 1UBUS 2AZ0A 1KAEA 2ONCA 3GBSA 3NHUA 3O2JA 5CGQB 5KYXB 1FPMA 4D1YA 4AZWA 4MVJA 4CH3A 3DL7A 2J85A 5CPFA 4RH3A 4JZGA 4HNAA 1GKIA 4NPAA 5DWVA 1WXXA 1DIBA 3KB2A 3D1JA 4EG6A 3ZCCA 3ZHQA 4DV1B 1GV0A 4Y2JA 2ZJ3A 3RSZA 2CFRA 2DWOA 4DC1A 2ODAA 1ZRMA 3UVEA 3HKEB 1Q0HA 1X42A 3C1OA 4F3CA 1QRSA 2XGJA 1T0UA 2XIJA 2P11A 1TYAE 4KR3A 4CMAA 3OJFA 3PRYA 5IUNC 3F7YC 3OE7A 3OZXA 1DOAA 3FSGD 1OLSA 3NXKA 4Z9AA 4TTVA 1BRMA 3HBJA 2HJSA 1MOFA 5FPPA 4F9GA 2BBSA 3RVDA 3EK2A 4MQLA 4F6EA 4DSZA 1RXVA 2DWUA 3E18A 3IS3A 4FTWA 2NTVA 4KL1A 1H3FA 2ORVA 3UUWA 2NAPA 3GIDA 3VGPA 3AFIA 4KXXA 3AG3C 2XCQA 2NO7A 2Y27A 3H1EA 4R1LA 5C8YA 2D3OW 3QKUA 1E6UA 4RVDA 4UAJA 4PYMA 4HDSB 2RNBA 4HATA 3GLKA 1TLLA 1P1KA 2YJ5A 1I6LA 3CXRA 1H8EG 1UJWB 3QOFA 1Q1NA 1MRNA 5LMNB 1NW4A 1NDQA 1T10A 2OCBA 3QEKA 1AB3A 3L5KA 4QULA 2A9PA 4H33A 5KOJA 2XYRA 4FGKA 4R54A 4PXYA 2F3PA 2Z5FA 3AZOA 1JTEA 4FWTA 4DAOA 4JV5O 1NXPA 4DM4A 1YJCA 3DTTA 4TSFA 5GW7A 2PYZA 4RHXA 4BO1A 3NHKA 1RYZA 3GVIA 3ZZMA 5JAIA 1WS6A 3IIKA 2HF8A 4U9HS 2VJKA 1H0KA 4EEXA 1P3Y1 1H2SB 2X76A 2VJAA 2EYQA 2ISSD 2Y0BA 3DMPA 4KBYA 1T1JA 2RJOA 3WJ7A 1T0PA 2EG9A 1F9EA 2I2WA 3HA3A 3LUHA 1OFGA 4K40A 3CZ4A 2EWWA 3RSHA 2AR7A 4F4LA 4JI8O 4PYQA 4WLNA 1KMMA 3WKCA 4FHGA 5M7EA 2XYGA 4RTQA 1JEEA 2XODA 2WD9A 2QKSA 1BT8A 3G9UA 2VXYA 3KELA 1UK8A 3N5CA 1XFAA 1PV2A 2WPDG 3D36C 1W0KA 1Y5IA 2QUBA 2ZS8A 3Q9SA 3A6GA 4F7DA 1I0HA 3EXFB 1H2XA 4GD3Q 2YXDA 3Q9UA 4OP3A 5IJ0B 4FLEA 3V6LA 3GNTA 1TVMA 2D8AA 3BL6A 3BC1A 5B1NA 2GRAA 3L8DA 3KT8A 5K3DA 4Z1VA 4C0LA 3CLTC 5CCDA 4CKEA 4TS3A 1PD3A 1UBEA 1XMVA 4XLLA 3NETA 1TYBE 4G5FA 5EJ9A 3WIBA 4LF4O 1E9AA 1NVMB 2B7CA 1CUWA 2DH6A 2X1MA 2Z2IA 3FUCA 3HSYA 4AJ9A 4E5MA 2MINA 2PD4A 1KVSA 5FO0A 3SHVA 4JX9A 4NWIA 4XASA 2P8SA 3IXQA 3PYMA 3TRJA 5K0CA 5FQOA 4CNBA 4YRCA 3H0KA 2Z6AA 2C5LA 1FTNA 4UJ3A 3L0YA 4X3CA 5K03A 3QE9Y 3CURA 3WI7A 3ZJVA 2J0UA 2XF8A 4TS9A 4LYFA 1FSPA 5BXQC 3A0HZ 1NIJA 3GPLA 1Z29A 1P2TA 2HMVA 3ELDA 1IBMB 1H38A 3O8BA 4JV5B 2Q6KA 1U28C 3CMEV 4D45A 3VU9A 1XROA 1CJKC 1LS6A 2RSLA 3PUJA 2QDOA 4J0QA 4Q1VA 3MHSC 3H99A 5ES4B 2AEMA 3NRJA 3WK5A 1XHEA 2FPGA 3SN6A 1IY1A 4KI7A 2CLMB 2PX4A 4LF9O 3FCAA 3UAZA 5BW6B 5PGMA 1H1LA 1FFHA 1L4MA 3EOBI 4DADA 2NTEA 1TM7E 4YJKA 4ZCQA 4YJ3A 1BQ3A 2HBQA 1PFYA 3VH4A 1BXGB 4UJ5A 7ABPA 3M4YA 3GD5A 1PJSA 1SOWA 1Z4KA 3DBLA 2FMUA 3KAPA 5KYXA 2GAAA 1G8AA 4UQOA 3KDSE 1T43A 1MC8A 4URWR 5AJWA 3FOEC 2PH1A 2QTBA 4YY3O 4US1R 2CYBA 5JD6A 1MP0A 2FVXA 3CVVA 1VHQA 1RJFA 1YJ8A 2BFEB 1I4TD 4V39A 1RE0A 1VQMV 1R5NA 4I1SA 4ZD4A 2D0OB 8MHTA 4ISCA 5JYBA 1XQXA 2PZSA 3KC2A 4NBNA 4E6PA 5A03A 1GO2A 5J58A 1CW2B 4QC2A 1QHTA 1NBMA 1ZU5A 3AIOA 3EZYA 1ISGA 4EKDA 1P5JA 2JCBA 5IW8A 2PSEA 2FW7A 3H6HA 2H92A 5EE1A 5BQPA 3OTQA 2J3LA 4AJ2A 2VDNB 5LD2C 2IYRA 2D06A 1Y5RA 3FFXA 4Q47A 4FZ1A 4J42A 1JDNA 2PWPA 3EXHC 3IE0A 2OHJA 1IQPA 4YJGB 3PC7A 1H4QA 2GZ2A 1E66A 2ZW9A 4NCAA 1EEXB 4HAYA 1YKGA 1M6HA 3BWXA 3R3VA 5I3CA 1OB5A 1A8QA 3B5EA 4FT2A 3T12A 4DMFA 2O54A 4TMYA 4H0LB 1WHTA 2HSWA 4QBIA 5DYIA 5BQXA 1LPAB 5CB6A 3ENQA 3DLTA 3LNMB 2J5RA 1AF7A 1GHTA 1HORA 2NYUA 2Q3LA 4Y0NA 5I7EA 2XY4A 2N0SA 4Q18A 2VHEA 3EXFA 3MT8A 1DQYA 1Z8DA 3WRWA 1UJNA 1UOEA 3L4BA 3ORQA 4NECA 3WDSA 3Q8MA 4MRRA 2JVDA 3MUFA 3MWDA 4R3WA 5E9AA 1GAEO 2Q3JA 4BIZA 2R25B 4IBOA 1E3WB 1IM8A 4RHUA 2EFJA 4IMRA 4TMFA 2HF7A 5CH5A 4OGLA 5F77A 4B3GA 2BKLA 3HJCA 3U7RA 3HG7A 3OO0A 2A0LA 4R5HA 3UTDA 2VQFO 4E4TA 4QU5A 4CCAA 4F9EA 3EB9A 2MINB 5JPIA 4LC5A 1QVVA 2V9CA 2JFVA 1M6WA 5FX2A 1NBME 3PT9A 3C6YA 3NJ8A 3SMQA 5TS3A 4KLNA 3S3WA 1RPAA 1VMIA 4XFJA 3QOYA 1T6NA 1QF6A 5K0SA 4KSCA 5AM0A 3SHWA 3PWTA 3QU9A 1YZNA 4R51A 5K0LA 4Q3BA 2IHJA 4MITA 2GRJA 3H5TA 4D42A 5IANA 1ZMTA 3KQQA 2ZB3A 3X1ZA 3RVBA 3JWEA 3O90A 4JZKA 1PEAA 1XE3A 2W98A 2M9MA 4LI0A 4DEVA 2DERA 1WDMA 4KQ2A 3ABKC 1AX9A 1NQUA 4HNQA 3KQKA 3MTBA 4FC6A 1LDGA 1QQBA 2ZBDA 1F23A 4MW9A 3GCZA 4I2NA 3OETA 3CB4A 2O2DA 2B4YA 4UCTA 1WHSA 3JD3A 1JIVA 2LDXA 3PV0A 3DHYA 1TCAA 4GYCB 3CLUC 5HM6A 4EFBA 1W93A 2WUGA 1Y4AE 2CK3A 3O31A 4TKUA 5DSZA 2K5UA 2VC2B 1RPOA 1E1NA 3OQPA 1RKXA 2NU7B 4LIPD 3VR5A 1WVIA 2Q4OA 2RHWA 4Q1CA 2P9TA 2BDEA 3AV3A 3IRVA 3P9IA 4CLEA 2NACA 1E1LA 4WNAA 2BUBA 4MVZA 1ESMA 4R05A 3PXCX 4OXRA 4IL6Z 3QO7A 4KOEC 9ABPA 1YS4A 5KHLB 3TNFA 5IEBA 2V9PA 2YWJA 1Z5OA 2H08A 4RPCA 2WF6A 3BORA 1E4EB 1XZDA 5E1OA 2FXIA 2C92A 3QYFA 3WYEA 1FJXA 3PDCA 5CDFE 4Q1EA 5IXJA 3MBIA 1M75A 2OBNA 4X41A 3W7VA 1T4CA 1FDOA 1F7YA 2N42A 2P2CA 3FVWA 3HFJA 4WFQA 1P0MA 2P6MA 4ZBMA 4NYJQ 4EJMA 3VR0A 1ULSA 1TVKA 1RFGE 3EISA 4YIPA 5DTQA 3K70B 4X3OA 3V1NA 1F6WA 1NXXA 2QAGB 1W2HA 6LDHA 2AD1A 3ZLUA 4OB6A 3DYVA 1XR3A 3INTA 1I5RA 4YB8A 2I4IA 3QO5A 3ZV5A 3A7EA 2HCBA 4FFLA 5BWOA 3A10A 4DSAA 5KDOA 3O8RA 2EJWA 1D4OA 2O05A 1TQ8A 1H2MA 1LQUA 1YB4A 1X80A 3TX6A 1KFBB 5JMWA 3ICEA 3EZ9A 4U1RA 1JR9A 2VWPA 5L40A 1GGMA 1ACMA 1SUCA 3QXJA 4LMPA 2KB1A 1MIHA 1QGAA 2GZRA 4GLOA 4JQZA 1Q7CA 1W4LA 2MJLA 1FA9A 4BC0A 5FBVB 2WSSD 4HLUA 5JO9A 3OURA 3AOEA 1NW8A 3CE9A 1WLSA 4N5DA 3RG2A 5J63A 3P5SA 5DEIA 4YYEA 1S4MA 1PT8A 4ZKIA 4J91A 3EF0A 2OV4A 3DT8A 1AHNA 2HLDG 3SF0A 2DFPA 5LDDC 2WSMA 3Q3EA 3CC4V 1NOJA 1HEUA 5C8XA 1GTJ1 3DAHA 4LZWA 3E03A 3WL4A 2H1CA 2ROQA 3N3AC 5DBIA 3ZU6A 2QMHA 3CU5A 1VSVA 5DCUA 2ZRLA 2FOXA 2PE5A 1VB3A 1WOMA 4ID3A 1T1GA 2I7CA 2JK0A 3PLNA 1YB5A 5J5VA 3GUZA 4UFPA 5JJLA 4CEJA 3VTKA 5HKKD 1TAHA 3M5CA 2Q3MA 3S2IA 1W1WA 4TRMA 1CJCA 4D7AA 2VDMB 3ZD7A 2ZI5A 4EW1A 1D5AA 3EQ7A 4DG9A 1ZJ5A 3F0TA 1VIMA 3CB2A 3EVBA 4H7EA 1HYHA 3DE1X 3OEHA 1YI1A 1AJNA 5EC1C 1TZKA 2EP7A 4AG6A 3SICE 1NF8A 3E9RA 2G72A 3AF0A 1P5ZB 4RGQA 2P67A 5CAEB 2YCLA 2UXCO 3AG4B 3W6ZA 1HNWB 2KQUA 1R0ZA 2XNHA 3EN0A 4RKQA 1F4VA 1R8SA 5FCDA 2UUBO 1KU0A 1R9NA 4HD8A 2BFDB 3I2FA 4W4KA 1EGVB 3DF7A 4CS3A 3I83A 1PNTA 2HH9A 2OTJV 4HQKA 3W9YA 2QUZA 3HEBA 1JFFA 4MUXA 3MJEA 1GTG1 1QWOA 2VK4A 3MD0A 1FXHA 4B4KA 2D7DA 1UZAA 4TQGA 4D5EA 2PL1A 2X9QA 1ZI9A 3ZBHA 2OGWA 3D6JA 4C6RA 2LPMA 1N5JA 4O4IF 3DO6A 4YT2A 2ZM6B 3CLSC 1USVA 3DMDA 3M6LA 2B25A 1M0WA 1GCUA 4XDKA 2YN2A 3CEMA 3NONA 3TPFA 2RQ6A 1OGYA 3ADKA 4AJ4A 4D43A 1L5HB 1ONSA 1SBZA 1QIMA 1S8FA 3JSXA 3TMYA 3ZV7A 4D0RA 1OXUA 1YNSA 2KX7A 4EGSA 2QRKA 2YOFA 3OQHA 4TLCA 2AEEA 2I2DA 5JQGB 2EX1A 2C2HA 1A9RA 4ROSA 3P19A 2F66C 3M6XA 1SVWA 1N3BA 2Z2KA 3RS7A 4D8TA 5IZCC 4IGFA 3BD7A 2QRZA 3VC2A 2H8GA 4M2LA 1RWVA 1OI7A 2Q28A 3NYRA 4XCVA 1EP2B 4DC9A 2J32A 1ZL8B 2I3AA 4DT1B 3IQFA 2POQX 3NNSA 4DWVA 4MOWA 5ECYA 4O2LA 2JG3A 3E8MA 1XAGA 2FPPB 2JLYA 4J2TA 2PUBA 1KC1A 1X87A 3HA7A 3L01A 5BVHB 1NBEA 2F8MA 2DH5A 1AKVA 3FPCA 2GBPA 1X19A 3KQTA 3FUTA 1BTOA 4TQFA 1XHXA 1LBEA 1U0EA 2NUTB 2JDID 3QZUA 4L9AA 4HAZA 1Z07A 4R9RA 3I1IA 2AUMA 2ECPA 1HUQA 4JMLA 4HPWA 1U99A 4OXXA 1S6YA 2Q5QA 2W2XA 1F8YA 1GR1A 2DXIA 3AI1A 4IGEA 1M1YA 4X5OA 2ZT6A 1DELA 3UK7A 4BATA 4OKIA 4M0CA 3D0RA 2CHGA 3GIWA 3F6CA 4TQAA 1UBLS 1Y8QB 2CMHA 2WM8A 1CRLA 4O4JA 4OI4A 1QRRA 3KVRA 2H5JA 3KKNA 2EVWX 3F49S 5IAJA 3FTEA 1F38A 5IULC 2H3HA 3HYSA 1PG0A 1UXHA 2EXXA 4LYJA 4Z9FA 4MW8A 5B6JA 5LQJA 2O59A 1Y67A 4OWPA 2IQ5A 3NNDA 3HH8A 3QF4B 2Q0AA 1U8TA 3BHJA 3FYSA 2IHUA 2DWQA 3I3OA 2QT0A 3GJTA 4O63O 2HNKA 2OSVA 2V4DA 2J9RA 2W2LD 3MHPA 3QGMA 1STOA 3D8CA 4NZNA 4JI0O 4PNZA 1OLSB 3S7ZA 3AR7A 4KVAA 1H2EA 4RETA 4EELA 5DW0A 4D56A 2PUFA 2XUJA 3TL2A 4Q6WA 2AOXA 3GGGA 5TF0A 4BAUA 5M04A 1FFEA 1G7CA 4UNSA 4BFXA 2NZJA 1CR1A 1FDIA 4U7GA 2ZPUA 4L4XA 4OHMA 4YXFA 4HZIA 4L76A 3LIIA 1OH7A 3LK7A 3AL0C 1HNWO 1HKHA 4F7OA 4L0MA 1NU8A 4BB0A 2K2QB 1WMAA 5CBFA 4PG4A 1IULA 2HA7A 1J8VA 4LJ4A 4MQFB 1NHWA 3VZDA 3WWOA 2BFDA 1UZUA 1GZDA 2NTJA 3T34A 5CNKA 5CURA 3TBFA 1BCRA 1AROP 2AFHE 4QLAA 1RPZA 3AB8A 1CY4A 3L40A 3PHBE 2IW5A 3N0WA 2W11A 2FA9A 3ZWQA 1L1EA 4P9NA 1KDRA 1XF9A 1BQ4A 5B5SA 5IE9A 1P1HA 1SRQA 2CE2X 5DGDA 3L1UA 2XADA 5DNWA 2C2BA 1WZNA 1MHPA 3L7KA 1ZBDA 2CL5A 3QWAA 4KUEA 1J22A 2A35A 2OY0A 2FB9A 3T8YA 3PN1A 1OAOA 3ADPA 4L27A 2GJSA 4XLZA 2R751 1SHLA 1NVGA 5EXTA 3KXDA 1G6OA 3H2YA 3CXHF 2YMPA 1QYWA 3E2IA 2HEPA 4K8OA 2ID7A 5D2CA 4EH1A 3Q87B 1JAZA 2C88A 2HMAA 2PX0A 2WM2A 3C6KA 1G3QA 4EKGA 5TLSA 1WSAA 5G0SA 5ALTA 3S1AB 4LQ4A 4HTFA 4PTZA 5FTKA 2H00A 4RKWA 3STYA 1NLZA 3VC1A 1XZCA 1IATA 5CA1F 2WA3A 1BX1A 3I9V6 1CYEA 3SEQA 3O93A 4OP2A 2G1JA 1YE5A 2BP7A 3P9ZA 1U9JA 4BX3A 3UMCA 2HRCA 3U81A 3VSBA 2E1PA 3T4EA 4CF7A 4UB8Z 3OUFA 1ANKA 1QC5B 5K7SA 3EIXA 2OXEA 4EIWA 1D2HA 2QB5A 3Q15C 4DJTA 1RC8A 1PQYA 4U7PB 4JXEA 3QPBA 1OI4A 1BCSA 4MCIA 3F6RA 1K0FA 3QEBZ 5ALJA 4NDZA 4RK4A 3RVQA 1WW2A 1ZYUA 4V0RA 2I9KA 3SJBA 4B7EA 3BFXA 3VYRB 5LQUA 4LKOA 2CH7B 4HAXA 1UT5A 2WW8A 3S2GA 4MV6A 1FL9A 3EIEA 2HU5A 4RFSB 3C0KA 4DQLA 2O8EA 1QRUA 3O95A 1YJWV 2B83A 2ZKLA 1DC8A 4KFMA 2Z04A 2E5WA 5CB4B 1JEQA 1GTL1 1RIIA 2B1JA 2H1IA 3SY8A 4MUFA 4HWTA 1OTYA 2FPSA 2YI8A 1HG0A 2CUZA 2Y68A 5F78A 1HT3A 3PGKA 1C0KA 3C2QA 3VR5H 4DBLE 2HF2A 2XAAA 4UTRA 2CN1A 2V6JA 3O8DA 4HZ3A 2PJUA 4HR7A 4BKRA 1DBVO 4N0PA 4D0GA 3FWZA 2Z3JA 4L4RA 1QX4A 2Q7HA 1LX6A 4HB2A 3C6XA 5AVRA 3C3SA 4CE6A 4A8JB 1GRNA 2GCGA 5K4HA 3VR5D 1IM2A 3GH3A 5LJLA 2VN8A 5CFOA 1TI7A 4RPLA 4C43A 3CKYA 1MA1A 4LRQA 4QQRA 3F90A 1QFJA 1SXHA 4CG3A 1VPWA 4UD6A 4BNVA 3VYUB 5EFZA 4L8LA 3M7IA 4OI0A 2H2FA 3CCFA 4PQYA 2IDKA 4EF4A 1R74A 3TLJA 1CR2A 4CG0A 1XRNA 1XZHA 5EYPA 4KX3A 4YRDA 4X64O 2DLNA 4D9MA 2G1PA 5KWEA 3IOCA 2Q5IA 3L4BC 4ZZIA 4JP8A 3P4UA 1U8YA 4IFTA 4ZO9A 3NX4A 3W7WA 2PX3A 1Z13A 2WP8J 3COZA 4L08A 5MN6A 2KB0A 3H1PA 2JFFA 4X93A 5EJMA 2BM8A 1LJUA 4MSQA 3QE2A 3NVKI 2GEUA 2FQ1A 5DNCA 4W5NA 5EXPA 4DS3A 1K8YB 1N4DA 4MDYA 3M5WA 1A8UA 1WEKA 4Q66C 6Q21A 3BAAA 3IC5A 4ABYA 5IPFA 1I7DA 3NEAA 5CA0B 4OO3A 3EH1A 1VE1A 5KHKA 1WMDA 3WWEA 5JSHA 1M5RA 2ZYHA 4NE2A 8ADHA 3S0JA 2BHRA 1AM4D 4HBZA 1UEJA 1MO4A 1Q7TA 4G1FA 5EWMA 4CIXA 4IDEA 3RRFA 1OLOA 4LVCA 4MVWA 4GRAA 4LFBO 1Z28A 2KE5A 5CLFA 1UC4B 2WYOA 3ZOZA 1O94C 2D1YA 2ZJ1A 4UM9B 5ICGA 4D8YA 2QPOA 3KR9A 4Q9NA 3KJIA 2E82A 2YHIA 5AKGA 1VP3A 3SZMA 2GWRA 4YRIA 2J0SA 1N0IA 3L8HA 1QE5A 3DBRA 3B85A 3ISJA 5GVRA 2IIPA 4NFYA 1BFUA 4K9PA 3TVDA 5KWVA 4M83A 1PM9A 1EVZA 221PA 2GPAA 3B7PA 3FRIA 3M6VA 1HDCA 2G77B 4PINA 3VBEA 3OBBA 4B33A 2Q9UA 3RNLA 1NVUQ 4UAUA 1SIWA 3OQOA 3K0FB 3VU1A 2QM4A 1FMCA 2PAAA 2HQ1A 3DONA 2JEXA 1BJTA 2QQEA 4XA8A 2HV9A 1RM1C 4JI8B 1Y7PA 3TLKA 3QVTA 1AKQA 2IJHA 3I01A 3HWX1 1VGQA 1JS1X 3DHVA 4UVDA 3UG6A 3L6OO 3MAGA 4AMZA 3BPSA 4V0QA 2A1TR 1QIGA 4G5HA 5IAAA 1NN3A 5CIWA 3ZQJA 3JARA 4Q20A 5KX5A 1CZUA 1X15A 2EHJA 2PZKA 3LDGA 1XXHE 4BFYA 5IYDO 1KTVA 3G2LA 3O3MB 4NOKA 4MHOA 2QI9C 3AI7A 4XB6B 4BKQA 2R1VB 1A5AB 3BE5A 3LGAA 4UREA 2HXSA 1JBKA 3JQ8B 5FRDA 3GC6A 1UADA 2I6QA 2J9YB 3EIFA 3D6HA 4IINA 2R4QA 1ZAUA 2FRDA 1TT5B 4HQ0A 3ZWXA 3UUGA 4C0AC 5SICE 1FX0B 2WKRA 2GASA 3O4JA 3BY6A 1Z4NA 2W0SA 2WYVA 4M7PA 2Q3HA 2RK4A 3NP9A 4WI1A 5C4MA 4S1VA 4PR3A 4B6OA 3O38A 1LKZA 3EBOA 3CF4G 4LSWA 3C4JA 1CZNA 3KTFA 4ZI7A 1N36O 1TD9A 4E11A 3ABRB 4AU1A 1ODLA 2CXSA 3QKRB 4KPFC 5LQCA 3N58A 4LG1A 1DX9A 4RFLA 3M70A 2NP6A 4RDCA 3T61A 5H9WA 1A9TA 3PQ6A 2NU7A 3R3SA 4YROA 5EKUA 4YRAA 4IG4A 1JQKA 2R11A 4TWAA 1AA9A 1PZHA 2ZRPA 1FMJA 3DOCA 4JJZA 4QFBA 3K5WA 3HJTA 5GVSA 1QIHA 5EMJA 2UZ0A 1XDWA 3IC7A 1D2RA 3JZFA 4M7RA 3TDKA 3ILHA 1RQ2A 2BSAA 3L8FA 3LUBA 2WD8A 4FWBA 1FNCA 2FPKA 3ZEIA 2GUZB 1BA2A 4RL6A 1ENYA 5BN4A 1RJEA 2Z8YM 1Z6PA 4AILC 4I8DA 3BWYA 4LHWA 4M9SA 1ZIXA 1VIBA 2H2IA 2J41A 2MR6A 2YZGA 3BKXA 3IQGX 4KUMA 3PZRA 4FFVA 1XX6A 1YWGO 2OYRA 3G88A 3VQXA 3F7TA 3FB1A 1JDZA 3R24A 5C8YF 4N03A 3SR4A 3AK3A 1Y1SA 4HDRB 1GAJA 2OP1A 1Q20A 4XI9A 2O2XA 3PICA 4WBNF 1RRCA 4QBGB 1RXSA 1UDXA 2IFTA 2PS0A 3WBJA 1IOVA 4D9EA 1JDPA 5T4HA 4QX6A 4FDUA 3DXXA 1ZMOA 3HUTA 3GCXA 5DHAA 5ELXA 3O8NA 2X6TA 4EPYA 4YIKA 1O08A 1WETA 1DVRA 1WBDA 1CV2A 1ORRA 2HYDA 4Z9BA 4DXHA 4FS8A 3K9AA 3RKSA 4ZOLF 1L5GB 4ESOA 5B53A 4YUVA 1BSVA 1ORVA 4EBFA 4UM9D 2ZAMA 4B7KA 4DV3B 1FTWA 1E6CA 3STZC 2WSYB 1Y5MA 3N7AA 4GC9A 4JNCA 4MPPA 4PRYA 1KI8A 2YZ2A 5BNFA 4DUGA 1HT2E 5E7MA 3RRXA 2WLHA 4ENVA 2V59A 1EINA 4TL8A 1A82A 2C3MA 4RAQA 4JUAA 1GNVA 3JTEA 3IELA 4KBFA 4B3TB 2QTHA 3G79A 2H4ZA 2CLCX 1QRAA 2JW5A 3EVCA 2UUBB 4X1KB 1VYVA 2FR5A 1A04A 1X9HA 3IVAA 1EG7A 1TU0A 2H4FA 2X3UA 1CUDA 2QPAA 4B6EA 2FSGA 4GQAA 1JSCA 4Z7QB 5L6MB 5AWFC 5JJ5A 3I0MA 3WQQA 1FDVA 1E9CA 1K7CA 3UJDA 2R9RB 3DMTA 3VKFA 1GPWB 2B94A 3DV0B 4EQZA 1DQSA 3C5HA 1M2WA 1L5WA 2EATA 4YAEA 2C5EA 2IP4A 1VTKA 2ZSEA 4LSZA 3EUFA 4OMDA 5FLEX 3M34A 3TKLA 1XRQA 4TWJA 3C3MA 4E2XA 4JB0A 3ELUA 4BKOA 4RF4A 1W6RA 4CQMD 4F2WA 1IMJA 3K0CA 2J3JA 5B30A 2GZDA 3T5DA 3X1JA 2PRIA 3KB1A 3DSRA 3W8DA 3KQUA 5ALVA 1QJ4A 2GTHA 1N1EA 2B99A 4QSMA 4B74A 4RZXA 5HRCA 5K9ZA 1NXQA 4MIEA 3RK4A 3TGLA 2IYWA 4RDIA 1Q3HA 3EEOA 3UBTA 3W7BA 1NUUA 3Q4HB 1BFKA 3BXZA 1N5KA 2IYPA 2XDQA 1V8OA 1HTTA 4ENUA 4HGYA 1LU9A 4JD5A 4F3NA 2Y6UA 3E70C 2YSUB 3O4FA 5TJ9A 3AUYA 3WA7A 2B1RA 4YTEA 4IQFA 1UT6A 3K03A 3SD7A 4JVOA 4NSNA 2Q4TA 2VAXA 1WL8A 3A1EA 3QUTA 1C7QA 1XPUA 3E7DA 3GLRA 3PXXA 4WRRA 4BQFA 2BGWA 1N34O 3FSRA 1TYDE 1UDWA 5JJNB 2P1RA 1N1DA 5DISB 4KO1S 4EY5A 1Q90D 2G9QA 2V6IA 3L4KA 4BP3A 3GVMA 3OLQA 3T52A 1V45E 4MJ3A 1Z0FA 3LGSA 4AX8A 4RKRA 3N3BC 2D5NA 1Q7YW 4TUYB 2Q9BA 3RT1A 3GRPA 4PLHA 2IC5A 4HRYA 2HHJA 1SH7A 4MRMB 3CH7A 3C6QA 3O9VA 4PA9A 4DC0A 1GU0A 4YAUA 1V41E 4WJLA 2AKYA 1XP8A 2DR3A 4O29A 5IMBA 4BU1A 1CDOA 1TM3E 1H0HA 1M8FA 3TECE 2PQ0A 4XYBA 4P31A 3FHTA 1JBQA 1NBHA 2NLJC 3V3TA 4W5OA 2ZRCA 5DX8A 4ALNA 2DQSA 4OI2A 1IWOA 2DHEA 5H3LA 5KINB 2BY4A 6YASA 3H4MA 4L9WA 4TYMA 3ZBPA 4R1PA 5JD5A 1TO1E 2ZDGA 1JEOA 3P0JA 4FD2A 1GMGA 2EW2A 2OFOA 1F12A 2NQTA 4ED9A 2OBMA 1ILWA 2O5EA 4EA8A 3K6RA 1JSZA 1KS9A 2WABA 1FS0G 4O2BA 2Z1NA 1EE2A 3T7EA 4BNLA 4PZ9A 5JOQA 3SDLA 5JBIA 4O4JB 1D1SA 4F4FA 1KF0A 3UWMA 1PI3A 2AOWA 3O7WA 4AP5A 1ZL0A 5DOVA 1F60A 2KYRA 2IGTA 3D7RA 3TUIC 3LQFA 2A5YB 5AIAA 1VMGA 2D74A 2O3UA 2G5GX 3JQPA 1QZZA 5FWXB 1OCOC 4X95A 2P79A 3D8UA 3PNOA 3FCCA 3DV0A 4B3SO 3WK6A 4XIGS 1XELA 4BE4A 2AXNA 2VP4A 4B7XA 1J0CA 4LJSA 4ZVMA 2FTKE 1K7FB 2GD6A 4K6KA 2F1MA 1VJGA 5CLJA 5D3KA 1U5BA 3U3ZA 2D4AA 2SHKA 1KDZA 1RNLA 3BXPA 2JLBA 3F6BX 2QYHA 4PPQA 4PBSA 1GTMA 1L5RA 1KZ1A 2WNHA 4ZT7A 1AB5A 1DJOA 1EDZA 2PVCA 4V0MA 2JLXA 1Z5ZA 5D01A 2O8DA 1LZLA 5G0WA 3ZHUA 3M81A 4U2DA 3ZWCA 2V4MA 1V8PA 3P0IA 4UCSA 4KKXB 4Q39A 4PSVA 2XEXA 3ZUPA 2HWKA 1ZS9A 4P32A 2VAPA 5J2TA 4FEAA 3ZCTA 3U44B 3WNQA 4L8JA 4FYWA 1KC3A 1R5BA 2R6HA 2LCIA 3ZR4B 4BMYA 2Q1TA 4IJVA 3SZRA 2IITA 3KD3A 4AULA 1BQEA 1SVNA 3RC7A 2BKXA 1BSMA 3T38A 2DYRC 1E0AA 2NO5A 5HZKA 1FXSA 2OQRA 3GGSA 1N92A 3ASUA 4DBZA 1UKCA 5DHSA 5L7WA 3A1NA 1IK4A 2IUYA 3TG2A 1VPLA 4RQEA 1HMPA 3TI9A 4BGUA 2K6GA 4BP8A 2PT5A 3TFOA 4UCUA 3X2QB 3QX8A 4J3JA 4YJFA 3VX3A 2YNMD 3MTDA 5JNLA 2QR4A 1ECFA 2QE7G 1RAGA 2CUNA 3JQ9C 3OA2A 3CZQA 2FX3A 2IX9A 2SNIE 4ZOBA 2P4EA 3EQ2A 3OH8A 5EHNA 1W94A 2ATVA 2AF3C 3LY7A 3IFXA 2ZYRA 3IQHX 4AIIA 2WIGA 5GIOE 2GHYA 2ZR7A 3ZVKA 1V54B 3CUWA 2JGKA 3HCRA 4GOJA 2WU1A 4R2KA 1EUCB 3R44A 4GYKA 4TLDA 2XKAA 3RPEA 3IUSA 4BLWA 2XZTA 2BR5A 2H9IA 2ZSUA 3VU3A 4AB1A 2P7HA 1WP8A 3DM5A 3LYUA 3NTOA 4R8KA 3Q2IA 1CCWA 1KNQA 1PK9A 1YZBA 2C4TA 2RH8A 4K9SA 3B3GA 4E1VA 4B7ZA 5K6AC 4YHHO 1G7RA 2YVLA 3DFIA 2Y67A 5EUQB 2ZS7A 3L7YA 3KBOA 4G4SO 2WF9A 4LBVA 1VRVA 2PZ8A 5I7FA 1A1VA 3VDRA 1H5QA 1NBMG 3NH9A 3GCWA 4CMHA 4O4JF 2OBBA 2RGBA 1FTGA 1R4AA 2PS3A 1JXMA 4X8LA 5LDGA 5PNTA 5CLIA 5B1EA 2XZOA 1L5QA 2J9GA 5T5QA 3DAOA 4HEHA 2RIPA 5HRAA 3OIYA 5EHQA 3GLHB 4AZVA 1ZJ4A 2DCUA 4C2BA 4ROTA 2DR0A 2JVKA 4CHTA 1KZ9A 5DBHX 1MJGA 5BPFA 2GLXA 1CF9A 3OX2A 1VPVA 2Z3VA 4JL6A 4R2WA 1N0NA 2I6SA 2DUUA 3ABIA 3GN1A 2BOVA 2VHUA 4BO0A 3K05A 1X3SA 1Y6JA 4UATA 2JFXA 1G8GA 3DL4A 3E15A 4M60A 2TMGA 4N5MA 2DECA 4NJMA 2C96A 1JLSA 1M5UA 2RGDA 2R48A 2W2VA 2QTVB 4B5LA 1JVSA 2GNAA 4K86A 2MHCA 3AEUA 4A8JA 5LIRA 3AWIA 5TMBA 4LD4A 3GDFA 4DV3O 2CBGA 2QXTA 1K8ZB 1DE0A 3CF2A 3SPGA 1QNLA 3ICVA 4QOFA 3PX2A 3BF7A 4DV2B 1U5BB 5EVCA 1YQQA 2VWKA 3E9YA 4MP3A 4DPKA 3D4OA 2BSQA 5IEJA 4TTRA 2HLPA 5G0VA 5DN9A 3U0VA 5EYPB 4RHEA 3TCKA 1XLVA 2A5DA 4YRGA 1IMOA 1ZP6A 1ZUWA 4C04A 4LZOA 2WR8A 1L5FA 2VSFA 4URXR 1PNMA 1NVDA 1KIMA 4G1BA 4ZYWA 1XIVA 1PF7E 4O4HB 4JJAA 3IEXA 4FFRA 5JDCA 2HI0A 2HU7A 1RYYA 2IZ6A 4WN9A 3IAFA 4DUZB 3ML1A 4G84A 4IL5A 3IC9A 3MTQA 5AVYA 2QN9A 2X5JO 1OXTA 5EHZA 1WV0A 2OD9A 1G3MA 1Z06A 1N7GA 3T5CA 1KO4A 2HPZA 3FZQA 1BMFA 1RXCA 3MUEA 1X3LA 4OXYA 3WZMA 4C3OB 4RA6A 4CL8A 2RGRA 3ONFA 3U7EB 5LHHA 3LKBA 4DDWA 2AIRA 1ZTEA 2W9XA 1QPBA 4PSAA 1JXAA 1HL3A 1YB6A 3IO5A 4J1TC 1TMKA 3QQ5A 1J1IA 3DA8A 3C4VA 3A58B 1QHHB 2RHMA 2PWBA 3HE3A 5J2UB 3PTZA 4HFJA 5DFAA 1QWSA 1TJ4A 4DCPA 4R8CA 5CA1A 1QO0D 1E6WA 1P29A 4ML3A 4F45A 1WW8A 3BRWA 4IHKA 2EIJB 2YHIB 2V6BA 2NT4A 4PU0A 4B6GA 5TEWA 1UK6A 3TTVA 4LOAA 2FPLA 4IFEA 1YVEI 5AICA 5HGXA 5JXGA 1VF7A 1ZIPA 1CVLA 1YOVA 2Z98A 2P75A 2ZB2A 3CUKA 3AK2A 3G67A 1ZGZA 4M86A 4XM0A 1HX7A 1D3AA 4IFBA 3IVGA 5E4YA 2ONKA 2NXEA 4B44A 2H3EA 4BQQA 3CMMA 3QX9A 4F9TA 2MSKA 3CCJV 5JFOA 5ENVA 1IAQA 3CPHA 2EIKC 1AUOA 2QE7D 3H1KH 5LMNO 1AKYA 3BMNB 1H2AS 3H5OA 2CXUA 2EFYA 3GDGA 2HGZA 3I04A 2CLSA 4J3NA 1T2NA 3FOWA 1OWPA 4L28A 2EFGA 4EX7A 1YC5A 2M6SA 4P5EA 1KPHA 4K9DA 4WFJA 1WN7A 1X0XA 3EG9A 1W49A 3OEHG 2XE7A 4MA0A 2R1UA 4OQ4A 4W1SA 4OPAA 4Y2UA 3UT0A 5BW5A 2OSBA 3LSUA 5C35A 1R6DA 1DTOA 1H8EA 3IDQA 1UT8A 2BTEA 3II6X 4DJJA 1L7PA 4I55F 5EHXA 1HLPA 3FYCA 5K45A 4GKKO 3KIPA 3UJ7A 2O2GA 4F38A 2O2SA 4JLVA 1M2NA 3U37A 3GY0A 1F2TB 2GJ4A 3CEJA 4OPMA 4ARIA 5I9SA 3T1HB 1IQUA 2PRKA 2YIBA 1W2BU 2QPLA 3CUUA 3S4YA 3FZYA 4OFZA 4NJEA 1UODA 1QG6A 1Y48E 3TTYA 3QRWA 2BEUB 4GZ3A 4MQEB 4DUZO 2R85A 3BM5A 3LAWA 3QV2A 2YEVB 1DJQA 1VM6A 3QH4A 3EFOB 1Z4IA 1IXSB 1OFIA 1YRHA 4L5IA 5B1BC 4HDNB 4KTTE 3VPSA 3ZV3A 4DSTA 3K06A 2HA4A 3SFZA 5FORA 1J90A 1JAIA 3SJUA 4NTWA 2YV3A 6NULA 4RHCA 3ROEA 4RK6A 3S70A 1RHJA 3VO2A 4IY1A 1EK6A 4YMUA 1JH9A 1GDTA 1QPZA 2FQYA 1ZHHA 1I2BA 2GM4A 1SXQA 4QODA 3B48A 2JH8A 4NU0A 1OYOA 2CK3D 2D54A 1O8CA 2QLJA 5DXJA 3QFHA 3T1NA 3U3RA 2PMCA 1Q81W 3FPHA 3QBDA 1B7GO 4GUDA 2JFNA 4WXYB 3ZBUA 1C0EA 1P74A 2W6NA 3CF4A 4TT3G 1PAUA 3J7AU 2WYWA 3V6MA 3ZIAG 2A92A 4KXMA 4PSKA 6CHYA 2A5GA 3BHIA 1Y9EA 3GEHA 3EE6A 1S2DA 3UAXA 5EUBA 3OGIB 5JBNA 5FNZA 4CKWA 1T8UA 2I80A 3HDVA 2HRZA 3ABTA 2P8RA 3ZIDA 5HIAA 4V02A 2I1WA 4JXZA 1AF2A 4OCNA 5LA6F 4Y2YA 2DKOA 2RKBA 5B3SC 2GFQA 2WJIA 3VYWA 1HC7A 2XEDA 3N6RA 4WXMA 5IARA 5HSGA 4LZNA 1UPBA 3DP9A 4GKJB 4WT7A 1TUIA 4FGUA 1KI7A 1XWFA 1LUVA 4FBMA 4HDAA 4QBTA 4X64B 5B1SA 3GLVA 5LQKA 5B1HA 1XTKA 2HA6A 3BRCA 1QDEA 1PR5A 4RWEA 1ZOIA 2L18A 2BSKA 4C0QC 4P0QB 1BQ0A 1UBHS 4G25A 2GK7A 5JAPA 4XM1A 4GLXA 1W5SA 2H0AA 4HX9A 1GRJA 2AC2A 3HGTA 1ZM2A 3KVYA 3H5VA 3L77A 4L9RA 3DPIA 3LV8A 5EC8A 3VMMA 2WOOA 3G5UA 2V7GA 1DC3A 1EM6A 3ZTYA 3R0ZA 4CXMA 5FOQA 5C32A 4OD0A 4QT0A 1XZGA 1XAJA 2XPCA 1VHWA 2V0GA 3MJRA 3WGZA 1UZMA 2GBLC 1X77A 3GPCA 3RIYA 3HR0A 2TMYA 5C80A 1VYTA 1PV0A 4RLSA 2Q9AA 1A9ZA 3CV3A 3GUYA 4J7AA 2IJJA 4HAVA 2HRQA 2O5CA 3B78A 3BJEA 5CFNA 2HKIA 4JLMA 1DU4A 2GS9A 2PPLA 3IULA 4GOXA 2CHQA 5F2KA 2PKWA 3UYKA 2PA3A 5JYCA 2OBXA 1DBPA 4CN9A 1X59A 2ZXUA 4UHKA 3KP1A 2XYPA 4AS1A 3KE9A 4LJ9A 2HDOA 4ETNA 3OCWA 3BH1A 3PPWA 3N2YA 3GJ3A 2H54A 2W4IA 2QXUA 2ZJ8A 4OLJA 1H3EA 1SS3A 1UBKS 2ECFA 4XVHA 4FR5A 1BXKA 3IP7A 3IKMB 1ZVVA 1QLEB 1TZCA 4BHTA 3NVMB 2R44A 1PQWA 4E21A 3K4HA 4JJ4A 1LPBB 2ZFUA 4JIMA 1B73A 2XQKA 3KU4A 1XD2B 3EPHA 1Z3AA 5ALEA 2GN6A 2WZQA 4C0HA 2RGNA 1XZPA 3UAYA 4MKHA 4GZMA 2AZMA 2QD5A 2WD7A 3NIWA 4I1IA 3TOXA 4BBPA 2B8NA 5K0FA 4YDQA 1FJGB 4FOSA 1XVVA 4W5HA 2F3UA 3DL2A 4DLVA 1O0CA 2OT5A 2WLIA 5KX5F 1YMUA 3DR3A 3B8FA 3ILXA 4HNGA 5F7OA 5CMUA 4WFHA 3RC3A 4HGNA 4OJKA 2ZQYA 4PLTA 2XIQA 1J4AA 3OFND 4K2HA 1JFRA 4HL6A 3HVRA 4HDNA 3QQPA 3BILA 2ZJ5A 3KTAB 3U7GA 2AJBA 1QGUB 2QZJA 3DEYX 3IT3A 4PANA 3SU8A 1G59A 2YJNA 4EAAA 2EBOA 1HBJA 4L22A 4KXFB 1W29A 1XMPA 2EJRA 1XYGA 5C1OA 5JNWA 3E9QA 1Y7IA 5AM3A 2XOEA 3RFTA 3SS7X 3JWPA 2OT3B 1JAYA 1RM0A 3DUFA 3G7SA 5E6UA 2PJRA 5TRTA 4IGAA 1SBHA 1Z37A 4R01A 1M67A 3LL4A 4INOA 4UHFA 1PL8A 4MYCA 2CLLB 3V8PA 3GI1A 1XHFA 5JPCA 4DE5A 5IRCD 2P40A 2LZ0A 2XVXA 1W47A 2JGEA 1ZGCA 4CKBB 1LSOA 4AHCA 5AVQA 2H2GA 3NT4A 4E6EA 3Q9NA 5CD1A 3ED1A 4YC7A 4UHBA 3GVPA 4I6JA 4FOLA 1NULA 3AF1A 3BGSA 3PNPA 4WLFA 2G80A 4RNCA 4X7MA 5EGNA 3RTDA 3T7TA 1DG3A 1P0IA 4FVMA 3IDSA 3V5NA 3V7NA 4OGGA 4NRDA 2G6VA 4IVPA 4QNNA 3QXGA 2A79B 3VAZA 1ZEJA 3H11B 2H1OA 5C8YB 1MMFB 3RM3A 2G4LA 4ZAWA 2GN0A 2Q2NA 4ZXFA 3ABMB 3UUEA 3QE3A 4LF6B 1W46A 2HCFA 3OI7A 3Q7RA 4FSXA 1VLJA 4KFUA 1KBZA 1T2DA 1U7HA 3APOA 1LY1A 1U7XA 3QJ5A 4J1QA 4WFIA 5G2OA 2A3QA 1QIFA 2XA9A 4PM4A 1K8XB 4OHVA 4XSGA 5FBKA 3ST7A 3Q3GE 1C1DA 3A27A 1V71A 2QM3A 3JQGB 1NC1A 2N1MA 4C2AA 4DKJA 1NJ1A 1O89A 2P9QA 3OPMA 1THMA 5EZQA 4K1RA 3JATB 2B78A 2YW2A 3A37A 3HCAA 1UC8A 2MSDB 1WPQA 1Z15A 3VR3D 1MIOA 3ZDZB 5E7JA 3GELA 5T7BA 2QWQB 3H9EO 1NMQA 3TTWA 1H23A 5JZMA 2PYJA 4J94A 3WGGA 1JIXA 1PJCA 1ZWLA 3W7SA 3P1JA 5BV1A 3N2KB 4S05A 2CVOA 3GEBA 3K1AA 3LC1O 1PD0A 3PA8A 5ALRA 1CTQA 3UENA 3QEAZ 2B0CA 3QFCA 5L95A 1A7KA 1PEKE 4JHXA 3WGUA 4CG1A 1FQOA 1GDDA 1OASA 4XQGA 3T7RA 1LBTA 2O0JA 3SIPA 1YEWA 3WLJA 3N5KA 3TTSA 1CJTC 2E49A 3ZNPA 4CLXA 1J0DA 3LWBA 3HQ4O 1UBNA 3VR1A 4HI0E 1N0JA 3ULKA 4XRGA 2O5RA 2FEOA 5HBRA 1KY4A 4G26A 3DTVA 5CVJA 1JH8A 1TA4A 3H2BA 1P2DA 4PHHA 2C2MA 2C3YA 5BSFA 2PX5A 2YOHA 3KOWA 3F2IA 3CGWA 1LQTA 1EFUA 2GM5A 4YAGA 5CDUA 5FNVA 4ZTZB 4HMPA 2EQBA 4XPZA 3EXHA 2C8LA 1F0KA 1I3OA 4AROA 1OTHA 3UCFA 1IJFA 4BNDA 4G89A 4KW7A 4OUKX 4TQUS 2VYCA 5IDYA 1KJWA 1X7ZA 1P0CA 2DZDA 2V6FA 3CZRA 2RONA 5ITZA 4GU5A 1A4XA 4QDXA 2UDPA 5TQ2B 5IY5B 4GOKA 3KKKA 3GWZA 1M4UA 1D4AA 3WOHA 1YHYA 2NYRA 2JCYA 5JR3A 3WU2Z 1CS0A 2C2KA 2YZ7A 3BKWA 3GMDA 2VQ3A 4Y67A 5K2OA 1ZM7A 1UPXA 5B3LA 5GOZA 1FVXA 5AJXA 5H16A 1VZ2A 4B3FX 1F51E 2B4TO 3MT0A 2ID4A 1KEEA 3ELWA 1HLFA 2VPXA 2PNJA 3H86A 1NGSA 3CW8X 3VKGA 1C4OA 2RI1A 4ZHQB 5CN0A 1E1DA 2V58A 3C3EA 3OESA 1IC6A 3PEVA 2CUGA 2YYYA 5ITSA 3CX5F 2XCRB 3C3DA 3ZCVA 3W1VA 1HQCA 1PSZA 1DG9A 2AG0A 2VHJA 3QJGA 4MUYA 3WDMA 3AI3A 5TPWB 4CM5A 2CMDA 1YA6A 1IJBA 2CF6A 4C29A 1CR4A 5KDDA 2XDYA 4IGKA 5JADA 1IN5A 1JG7A 1SCJA 3H1LH 1RAIA 4GDMA 1GXSA 1DIHA 1GN9A 2AOUB 2XGMA 1EH5A 1GY8A 2ZUWA 1OWLA 2KG7A 3PL1A 3MWJA 5JCPA 2QF7A 3K0SA 3OT4A 5DXFA 2B3JA 1KDPA 3B82A 1Z88A 2NSDA 5B6IA 3DOOA 4QFDA 4XFDA 2GK6A 1PJLA 2YV4A 3G23A 4Y2GA 4A23A 2ZDQA 1M83A 4CH6A 1YRLA 1ZWKA 2P3SA 1SXJA 4Q1BA 3F3KA 5D3QA 8ATCA 4L75A 3WYBA 4O2BF 2BFEA 2QAJA 1Y3IA 3HBMA 5KQMA 2NX2A 2GVDC 4PICA 5EBWC 1YFZA 3KLBA 1VIYA 3COVA 5L3BA 1TGVA 3ETGA 5E1MA 4FK8A 3ZN0A 1ISSA 2HMTA 3KKYA 5HFMA 3PUVA 4IDCA 3PXGA 3NWOA 1M56B 3LSSA 3FA2A 1EFVB 4URUR 5IT9A 2ZQZA 1PKEA 3EW7A 3FB8C 1GG9A 3R3HA 1CNEA 4Y3UA 3CVWA 1KK1A 3R4CA 4E2LA 1CF2O 4ND6A 4WOBA 3BG5A 3SZUA 2HQOA 2D13A 4G3MA 3JQ9A 4KFTA 4P34A 5G40A 1BMFG 1T9GS 4Y8VA 4FYJA 4WINA 2CUTA 1BGWA 3ZVLA 3E27A 1Y4DE 2D1TA 2XUHA 5JJIA 3AXSA 2DP4E 4L74A 2VATA 4M0KA 4DWJA 4CTMA 1E1QD 3NUQA 3T4XA 1SCAA 3B7WA 3CPWU 3ELYA 3IT0A 1Z63A 2FPIB 2OHGA 4NPHA 1ESNA 5ITWA 2P1ZA 1T5SA 1WABA 3WLMA 4AN0A 1YCDA 1JYEA 5KHOC 1KRWA 1NUTA 5C7LO 1AR4A 5FUWA 3FHOA 4YJ2B 4DR5B 3ROKA 3PFIA 4B40A 1EIZA 2OZEA 3R5KA 3K73O 4LMAA 5JDIC 2AN5A 3AESB 4E5YA 1D5CA 4YWHA 3HB5X 4ASUA 1YZKA 2FSSA 1NLYA 2I6FA 1X7WA 3N0TA 2X42A 1AHIA 1V9SA 2H52A 3KKEA 3SHOA 1X1QA 1AUPA 2AOTB 3ILSA 2DLCX 1NTMH 4L95C 3NI2A 1XOIA 2QORA 1LNZA 5FNVB 4DR6O 2H1RA 4JIGA 3ZH2A 4AP9A 1L7BA 1V9CA 4IICA 5ICEA 5K8JB 1TUGA 2OWOA 3D6NB 3EODA 4XX0B 3RV3A 5JAOA 4PPNA 3CS5A 1VJ0A 1R18A 4I4IA 3SBXA 2IBSA 1EB8A 4TN5A 4IIUA 5I5GA 1N2BA 2ZB4A 1SKUA 2BELA 2LV8A 1XREA 5CM9C 4B7UA 3JV7A 1IJEA 1C8VB 1LSJA 1MJNA 4K9KA 3SX0A 3KR2A 5ABPA 3NWBA 4N01A 1ABFA 1VMAA 1NR7A 5HP4A 2G76A 1DC7A 2BKEA 5B7QA 2UXDB 3CUVA 2H29A 3QKIA 2EJVA 2VP2A 5SV2A 3H83A 4LBZA 3OOSA 1R10A 3Q0TA 1Z7GA 3HJAA 4BU0A 3FMFA 4IDOA 4PX2A 4IVRA 1AO3A 3GRRA 3DAFA 2ATXA 4N3AA 2CBXA 2RHHA 5DHRA 3DO8A 3RLFA 2RPZA 4H1UA 1AKRA 4JL5A 4OQEA 1H0SA 1HDZA 1VSTA 1GZ7A 2OD7A 4QOEA 1RJWA 3RGGA 1SMKA 5GJBA 3CE2A 2CXPA 5TGZA 1RHUA 4N6OA 5JIBA 2QWRB 3O91A 5ALIA 1WXWA 2H8KA 3HMQA 5JNSA 5HJ5A 3AEKB 4IZ6A 4GQIA 4L07A 1HDYA 3SQWA 1PV1A 2IF0A 1GXSB 2AOUA 2HWWA 3ER6A 1NHGA 3TSAA 4EHDA 4N9QA 5A5DA 3SOPA 4DA6A 1E7YA 1GGHA 3DD1A 1EGAA 1G63A 5D7NA 3OFSA 3P5BA 4NEHB 5LB4A 2JGRA 1W19A 2IU0A 1IBKB 1SU6A 1AQ6A 2C2GA 4L6CA 4NR0A 1DOZA 2P8JA 2VI5A 2IUUA 1S2NA 3J80A 3G0GA 3S3TA 4CI9A 1K33A 2DQ0A 3WTBA 1I94B 1QOPB 2Q62A 2QN2A 4PPGA 4NXMB 1KE2A 3F46A 3I2JA 2ZJ6A 5A7GA 2Z4SA 4LFBB 3NDRA 5ERGB 3F5WC 3KYDA 5TF4A 4Q9HA 4ZAFA 1JHXA 4JYBA 4XB1A 3B8EA 1OLUA 1MVNA 1OX7A 1QU3A 3OOWA 2PD6A 3V8NA 5C7IO 4PYLA 4UVBA 4PX5A 3AFNA 3HL4A 4TWIA 3QPVA 3B8MA 2DBRA 4Y2PA 3HVHA 5EKDA 4HH3C 5FI1B 5IBQA 2F43B 4C14A 3O2SB 5CCBA 4G3XA 1ZR2A