1G8MA

Crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 207
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g8mA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1g8mA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA02
1G8MA 1PL0A 2B1IA 1B93A 2XW6A 1C30A 1JDBB 4A1OA 1M9NA 1CS0A 4EHIA 2IU0A 2X8WA 2IU3A 1WO8A 1T36A 1A9XA 1ZCZA 2B1GA 1THZA 1IK4A 5H3LA 1S8AA 1VMDA 3ZZMA 1CE8A 1BXRA 1P4RA 1M6VA 1KEEA 1OZ0A 1EGHA 1C3OA 1S89A 2YVQA 1PKXA
chains in the Genus database with same CATH superfamily
1QG4A 4F5DA 1C1XA 2I2XB 1KOFA 1J09A 1XZPA 2CVHA 1SUPA 4HQ6A 5KUKA 2V5AA 3JATA 4JOSA 3DWFA 1FMTA 1NBMA 4HLDA 5T6BA 1J25A 4M98A 4QU9A 2GTAA 4M55A 1OI0A 1NZJA 4DDTA 2ZINA 4QNRA 4AZ0B 4KPYA 1D4FA 5CH3A 1M2KA 1KP9A 2GZHA 2IT1A 3FPCA 3OVMA 1KYZA 3BCRA 4KYVA 3ZDDA 5KYUB 4ZYUA 1Q6IA 4M9XA 5GZ3A 3ZX4A 2XUFA 2V7PA 2P0EA 1CV2A 4YAFA 1M2WA 1ZJWA 5DCUA 4U7DA 1WCV1 5IYZA 3D3IA 2GK6A 3MPOA 3SVLA 4PTYA 2C94A 3RHZA 3TEJA 2IYUA 3N6RA 3BF7A 2VKQA 2J45A 4QSMA 4E5SA 5DTRA 1E8DA 3T1OA 2NO6A 4YP0A 1XL6A 2EJRA 1IDN1 5ITZA 3SYOA 1W19A 1P2VA 3LT1A 4PCAA 3EJWA 2Q5JA 4F3YA 5IJ9B 1QWOA 2VAVA 2YXLA 3CLUC 3DGFC 4MIKA 3VI4B 4EJ6A 2D4AA 1YA6A 4MINA 5GINE 2XNHA 4LJ9A 2NVUB 4KHPB 4E4TA 1M72A 4LZNA 1T1JA 3FNIA 2VH1A 3QLTA 3PE4A 4YV0A 1KI3A 4HJXA 4IMRA 4RTMA 2ADOA 1EUDA 5M59B 2GUWA 1SB8A 4ZO6A 3M8AA 2RGXA 4B75A 3E82A 2FU5C 4O4HF 5K3FB 1UMDB 3A0HZ 3ZMUA 1C1YA 5LJLA 1OIXA 5GVSA 1PJSA 4O3MA 3FY4A 2J3IA 2FOIA 3A0BZ 1XFDA 3K5HA 3V3TA 1B14A 1FSFA 2X2EA 2AV6A 1S3SA 4OG2A 4D5EA 3N0WA 3BCUA 4A0RA 2FEOA 3O4RA 5F3RA 3CD6V 3TNJA 4TVOA 4V0MA 1JUDA 4KN5A 1ZX3A 5K8IA 1O9HA 5EJ2A 1QB8A 1ZQ1A 2QX8A 1R5TA 5E6UB 5C8YA 5IDXA 2QTMA 2CDAA 1ZABA 1ZCFA 1E1NA 4YIHA 3GLGE 4H9GA 3USZA 4R8MA 3DV2A 4EGSA 3SFVA 3UMBA 3I9FA 1T8RA 1HT2E 3UF0A 3GHYA 4G5OA 2QVCA 5E8RA 5L3EA 4YCAA 3BB3A 3EVZA 3AFMA 1ESMA 4B3DA 1KE2A 2JCXA 5TVKA 4ZFNA 3DE6X 5REQA 5JZMA 4J7JA 3ZLJA 5M7EA 1M2FA 1T6XA 1KZYC 1GN8A 3U60B 4Q16A 1EFVB 2H0RA 1FUUA 1IOZA 2BIFA 4QHSA 3FNFA 3QFFA 4GL2A 2OB2A 2JVIA 3BTOA 4AG3A 4EY8A 5BSKA 2XYQA 1WV1A 3O4HA 1SCAA 5CVJA 3U61B 2GBFA 3G8BA 4PANA 1U2PA 3LVQE 2OLJA 3L8ZA 3V1UA 3QVOA 1GPAA 3CCRV 2JIZA 2AHRA 1UKZA 4N7JA 4OFBA 1TIPA 4RHXA 3LPAA 4L2IB 2QN8A 2KBEA 4NCKA 1W4AA 3CRZA 1J2JA 3IT1A 3B4SA 4YJFA 4MW2A 3U7QB 3GT7A 1PT6A 2GEDA 5KVQA 4PONA 3R20A 1BGWA 2YWRA 3Q4HA 1GPJA 1RXCA 1J2YA 4LPKA 3EEFA 5DTMA 4WH0A 2XD9A 3LOUA 3MTJA 3WRXA 3TMKA 1CJMA 3NEPX 4X3CA 4JUDX 5C18A 3F2IA 3CVJA 3F90A 3WSTA 2HF9A 5IH7A 1IZ7A 3KUKA 5DLEA 4UEWA 5EIBD 3MCAA 2G9UA 2LIVA 1M4UA 2A5LA 1R27A 4FVTA 4NMHA 4OQFA 2YIBD 1F0YA 1KJJA 1N3IA 3IDQA 2R8XA 5KTSA 3MF4A 1SCDA 3QVNA 3VR4A 2ZUSA 5E4FA 2Y4NA 5CFPA 1Y76B 4N5NA 4AKHA 1U8YA 2R5FA 5FWNA 4U9HS 4IFIA 2VBGA 1FFDA 2KI5A 1R3DA 5DNCA 2ZIAA 2OQRA 2Z6UA 3VFDA 4R2IA 4KYIB 1VHJA 4DV7O 2KM1A 4YJGB 4H6VA 4RVNA 1MW9X 3AIMA 3W5CA 4B9AA 2PMBA 2ZTHA 3JV7A 2RJOA 5A1JA 3UNXA 3V2HA 4OGKA 4BV2A 2ZKLA 3BC1A 4FYPA 1PCXA 4UUJC 3E9ZA 3PV0A 2FW0A 4YFYA 2PGAA 4BPRA 5LZ5A 4AP6A 5C37A 3K8OE 4OKIA 4UAVA 1P0FA 4Y9TA 4MO2A 4JL6A 3PTZA 1A82A 4ABTA 4JBIA 1ECBA 3JQCA 1NRWA 4YROA 4YREA 1PE0A 1U8ZA 3L2OB 3O7WA 3U17A 1GNLA 4EBFA 3ETLA 3QKRA 1QGOA 1WCIA 3NMUF 5COBA 2VDWB 4LZJA 5K2OA 2ZYTX 4ARIA 4QVGA 5GTHZ 3CISA 2QW1A 5LOVA 4DLNA 1VE7A 4D43A 3FCEA 1KPHA 1NXXA 4KR0A 1Q84A 3EW9A 4Q21A 5EHQA 2PMEA 3KNZA 4M49A 4Z4CA 1I4WA 3O95A 4XD2A 3TRDA 5DASA 1NBWB 4B08A 3C3SA 5LLTA 2JIBA 3LQYA 1Z4PX 1NUAA 1JG4A 3WGMA 1VB5A 4R84A 4DUGD 1CQJB 1K5GA 3AG1B 2FZGA 4HTFA 5EIEA 1Q12A 3GVCA 2EQAA 1E1QD 2XMBA 2PBRA 5KU1A 3DA8A 3LT5A 1IPEA 5T4BA 3FB4A 4BIZA 1ZR4A 1KTVA 2PX5A 1OFGA 3KT3A 3MB5A 3VR4H 4TTVA 3UMJA 4CFZA 3ZHZA 3OFKA 3HUUA 3DPSA 4Y1RA 2MTBA 1IG0A 1P45A 1SKQA 4HEA1 1H2NA 2NGRA 1TFUA 2G6TA 4G0YA 1I01A 4RTNA 4L73A 3ZI7A 4FZ5A 2PX2A 1KJWA 3SQWA 5AG2A 1S2GA 2V5UA 1G8HA 1X3SA 3UW1A 3OM3B 3OJOA 2CXOA 4ZV9A 1L3CA 3LPDA 1XNQB 4G8DA 4OIFA 2PEYA 5HIKA 1GVHA 3FMGA 1VHDA 4B2LA 3SJCC 5L53A 2PKQP 5JYEA 2W6IG 2BZGA 1CTUA 1AUVA 1BA3A 2P6OA 2QIPA 3CYOA 5H3CA 3KVOA 1BXRB 5IUNC 4KV9A 3CEPB 5F21A 3NTXA 4PG6A 1SURA 4M0EA 4G4SP 2GVNA 2HBYA 3NJ4A 3ZV4A 4ZQEA 4RPKA 5EWMA 4BFCA 2A6PA 5FNVF 4MKRA 3ZWKA 4MUMA 4LE2A 4MS3B 1UJ2A 3SDSA 5JJNB 2A9PA 2I4MA 3ZHRA 6GPBA 1B42A 3A6PC 4J43A 3H97A 3KJQA 3Q3HA 2VDJA 2EU8A 1QNMA 1FS6A 1L4FA 1OLOA 2X86A 4RHCA 1HT3A 1NVMB 2ZBVA 3CZCA 3ABOB 5EGNA 4FGKA 1T4CB 2WMDA 3OLZA 1R64A 2CMKA 1W9HA 4P3PA 4HYYA 4J16C 3ECCA 3H1IH 4BFTA 1XZAA 1O77A 3PGVA 2ATIA 4Q7LA 1AIPA 3PJSK 1H0SA 2Z2KA 2B4QA 1DRWA 1V54B 4J0IA 3KKMA 1UKVY 2CLEB 1UJBA 4G25A 1K7SN 2IYOA 4XGRA 2NWQA 5C46F 4PPGA 2B4KA 4TVBA 1I13A 1XN1A 3U10A 1UXIA 4S1NA 1V7ZA 1TO6A 2X9GA 4B7AA 1Y9AA 4UXNA 3I8OA 2WVJA 1P6XA 2IZ7A 2XSZD 4JVNA 1HEIA 2AZ4A 2F90A 2FFAA 2DWPA 2VT2A 4H6WA 3QF4B 4JBGA 4ETMA 2Z3HA 3ZN2A 3TJRA 3NUGA 1XK7A 2XYPA 4OX9O 4TWJA 3LUPA 5EJ8A 1I5OA 4B84A 4GXTA 2QTOA 3KZNA 4QE3A 2FSGA 3WAKA 4QC2A 1KC8W 1RXUA 5FOXA 4QYTA 2ACVA 4RPHA 1DQYA 1FVFA 3TN7A 4BGUA 2VJMB 3H0EA 3L02A 4LHXA 2OQ2A 3VOSA 5FFFA 4EFEA 4CIDA 3ASZA 4PV1B 3PR1A 1N5KA 5LGUA 4JYAB 1KO4A 4EPTA 4FN4A 1E1KA 1CG6A 4BVJA 4ZYTA 3L7AA 2C8VA 4UFPA 4KRYA 1HOXA 3GGOA 3ZDZB 3MAJA 5H5JA 1N8SA 4TS1A 3RT9A 4NPHA 1NVDA 1U4SA 5LQUA 3AI2A 3GFGA 3KELA 1OW3B 3DC6A 3JRXA 2Z56A 5ICGA 3TRIA 4G37A 3VPSA 4IZ6A 3INRA 5FQOA 1Y9ZA 3N0TA 3V32A 3CCUV 1GN2A 2HA0A 3ZK7A 2JI6A 2AF4C 5BSRA 1L5GB 5T6MA 2C2MA 3HP1A 3R0JA 1SQPH 2V7TA 3EC1A 2ZRIA 4G0NA 3WYFA 1XNRO 1Y4DE 1RYDA 2R1VA 2WMYA 2ZPUA 5FV7A 3UWPA 1E5TA 2ZJ5A 1ZZEA 5J2TA 1LSSA 3PS9A 4YI5A 4G2NA 1KKDA 4OJNA 3KJIA 5F2EA 1J21A 4KL8S 1XP8A 2UUOA 1XJWA 2IYNA 3ZCTA 3F1KA 1OT3A 4P4UA 3PC8C 5IHXA 4IDPA 1RI4A 1Z22A 2WHRA 5I7FA 1JLLB 1VLMA 4KV7A 1W4RA 3T7DA 3BD7A 4JASA 4LFCO 1YFJA 4IMPA 2F7SA 2WABA 4CKBA 1EGQA 4DEVA 1TPZA 1U97A 3VU1A 4GKKB 3GRRA 1I4EB 4BQFA 4H17A 4M60A 2HREA 1PZGA 4CMIA 3SWWA 4I7ZB 1L5MA 3L7MA 1ZSVA 4OL9A 5EP4A 2E1RA 3BFRA 2XZDA 5LFAA 3INTA 1G6UA 5JASA 3FSGA 5AVJA 1Z74A 2XGOA 1DRVA 1NUSA 4MLCA 3UGTA 3GEHA 3SZMA 1XZ8A 1VCMA 1MOSA 3KJFA 2HVJC 4UE3S 3GNSA 3K08A 1XCBA 4J0HA 5DM1A 1SZJG 1VIAA 3CRMA 1A96A 2QRHA 1U1GA 3BCHA 3SJCA 4IDEA 3LOPA 4K9MA 1R3LC 5G3ZA 3EODA 1JB1A 2FW9A 5ENZA 2I9PA 4LV6A 1KHHA 5AK0A 3UT6A 3RRYA 4K8OA 3CVYA 4RKRA 3V7YA 5JPDA 4NJMB 4RWUA 4YRIA 3TRKA 5J1SB 2AH5A 4UQLA 1YB7A 1HE4A 1ZS9A 1R0RE 3D8UA 4BNNA 5LQJA 2DBRA 4AZ0A 3I73A 1SQBH 1H2AS 4QFTA 3LZDA 1HQYE 3ROPA 2D30A 3G0DA 4OK5A 3P94A 2CCKA 4I55F 1SUIA 4UW9A 1R3UA 4Q5IA 5KA5A 2PAAA 3IIJA 2MSNA 1H66A 1XDZA 3LY8A 2QQ0A 4BAZA 2QPTA 3OX2A 1OI2A 2WC1A 1VOTA 4ER5A 1EM6A 4NCBA 4DLSA 1KFCB 3DOUA 4DLPA 4O1IA 2VNIA 3LUJA 4FDVA 5KHJA 3EQ2A 1DK1A 2QJWA 2BCEA 4J16A 4Q3EA 4XM0A 4FW9A 3SYCA 2FEXA 2QMYA 5D8DA 3L8CA 2I7VA 4H7KA 3CZ9A 3VU9A 1ZY2A 2JHCA 4J76A 1G3QA 4PZEA 3RJ5A 2JRIA 1KL7A 1SVLA 2XYGA 2QXUA 3T3IA 4W8HA 5LDHA 1S7GA 5SYMA 4JJ4A 3HKEB 1UL1X 5JAOA 4D56A 4KGXA 3NM4A 1XU4A 1P1IA 2XWPA 2QTTA 1Z7WA 3GZJA 2VHJA 5GGXA 2GA9A 5G0TA 3K9FC 1D2AA 3RIMA 2HV8A 4B46A 4PHGA 3FKSG 5K8CA 1I6KA 3PNKA 3F6YA 1E2UA 4MP3A 4HQOA 4QRHA 2C4MA 2FYUH 2ZT8A 3WLJA 1PUIA 2WZDA 1A9RA 4L8JA 3AG1C 4GOLD 3ILXA 4ZOCA 4PG4A 4GX5A 3N2YA 1NFQA 2FSFA 5J3JA 4BMDA 2XR1A 1CF2O 4C7OA 3NT4A 2A5FA 2AD5A 4AUEA 3Q7QA 3K6KA 5AK4A 3LF1A 3V1NA 4WNAA 4EO4A 1MJHA 5LQCA 3S0JA 3UENA 3PHGA 2GM4A 4LA4A 5K8VA 3JQDA 4I9NA 1WNSA 1MN6A 4WEOA 1OV6A 4QBGB 1KR2A 3R7LA 3LC1O 1F8FA 5TJHA 2AOTA 4CMAA 3P2MA 3OTOB 2J5RA 1FX0A 3N39C 3W3ZB 1T1IA 3TKAA 2TS1A 3K5PA 3EF3A 4DCUA 1TQ4A 4AQYO 1ARZA 1EJ0A 2R0QC 3ABRB 3CNLA 5EJFA 3IKMB 1MVLA 5G53C 4KVFA 1E1YA 4WLOA 3N2IA 2BEVB 2I3AA 4G0UA 3L8EA 4I5GA 3WBKA 4X6XA 1PNKA 2KWIA 4ZYVA 4LBZA 4MVQA 4R2KA 2O1SA 3SICE 2BBSA 4HSEA 2LNDA 3CE2A 2E87A 1A5ZA 3QHQA 3I12A 4PU0A 4CF7A 2VPWA 5KU7A 1ISHA 4MS1B 1DKLA 4NU0A 2OFWA 3CLHA 2J3LA 3BXZA 3KXPA 2IWRA 4PF1A 2QX7A 4QEDA 3OOEA 2YMPA 4P5DA 2D7DA 3G5MA 2I71A 1VRWA 4BIMA 1URPA 1EFVA 1PSZA 4TTTS 3CQ9A 3NHPA 2ZR3A 3DL0A 2QLCA 3TBKA 4PG7A 2ZI7A 3PC8A 2W2KB 2AYZA 3NONA 1P5HA 2ODPA 1YJWV 3ENKA 4JTAB 1R15A 3GFQA 2PUFA 2CVFA 3QKSB 1BD3A 2WIBA 1GDTA 3BZWA 4TOIA 3FBGA 1Z28A 1MO4A 3AJDA 4TMTA 3K20A 2WIAA 4YY3O 4BNJA 1TM7E 5JSZA 1NMXA 1JT2A 1V2GA 4PLYA 1GPMA 4LQDA 2JZOA 4KIWA 4CZZA 1MT3A 1WUYA 4QE7A 3MJEA 1LGYA 1MB9A 4J7ZA 1OCCC 1ZMTA 3VR6D 1V54C 5K0TA 1GZ7A 1N9GB 3I58A 2GEKA 1BMFG 2FV8A 5HM6A 2XYVA 4G1BA 4J0DA 1VHWA 1EPUA 4MIOA 4G65A 4CGZA 2BI8A 1KJQA 4JUAA 121PA 2VDKB 1NU1H 1WQ3A 2I2AA 4WJZA 5ESXA 3CPJB 4G41A 3LCUA 1Y76A 3DLCA 2W0XA 1OPXA 1EEXB 3K09C 4IIJA 5KNBD 1JHOA 1YSBA 2Y99A 1V95A 5HQ3B 4M21A 1FSGA 1DAEA 4I3GA 4GMFA 1EDDA 2CNWD 1YUBA 3R65A 3STHA 4JT4A 2ZS7A 4UARA 1H2BA 3GWZA 4FJ1A 1T1RA 3PWZA 4PSAA 1ECPA 4G1VA 2PZEA 1I7DA 1Z0DA 2GF9A 3V4RA 3G5UA 2FHSA 5JSYA 4LWQA 3JYLA 4HLCA 3QYFA 1G21A 1YRBA 2XOKG 3GP5A 4FGWA 2P2ZA 1H6BA 5EFZA 1WDWB 2ZB8A 1CEEA 3SDLA 1V26A 1ONBA 3T9EA 2QHXA 1J8YF 3KXKA 2VI5A 3JQAA 4OJKA 2OXCA 1OCRB 4BECA 2JIOA 2H2WA 2XVYA 1N5IA 3TR0A 2QZZA 4CIWA 3FB6C 3CMAV 4HLUC 2XB4A 3NNDA 4KQXA 3GYBA 4UUAA 1EXDA 1IQRA 4Y2RA 4Y2XA 1U7HA 3QPVA 4NJEA 5L7YA 4DV2O 1PR5A 1RAFA 2DBZA 1LSOA 5IG2A 2DEUA 1VRCA 1NKTA 4Y7CA 5FA8A 4A91A 3AEKB 4RA9A 4YTEA 4YP6A 3V4SA 2YOGA 2HI0A 4BGEA 1JKJA 4NOMA 3DHWC 4UU0A 5B3JC 3W0LB 3A1NA 2BHNA 4BB6A 2QLMA 3NHBA 4XI9A 1QCCA 2C84A 1TYZA 4BUCA 5CPBA 3HU3A 1OI3A 1BDBA 3OJCA 2G84A 4EGFA 2VP5A 1DO0A 3MWEB 1RQXA 2GHIA 1PJTA 3DE7X 5KJFA 2IU0A 3CPSA 3EG9A 3ETJA 5JZSA 1WOMA 1NN0A 2V3CC 4TMWA 5HUHA 1NE7A 3HY3A 4FLVA 2Y67A 2FMFA 1AF4A 4MRRA 1RW4A 4ABYA 3U3XA 2X3UA 4H3SA 2C5AA 4MQ4A 1XZBA 1JOYA 2DPGA 4A73A 1JKXA 1QIDA 3VKUA 5B1NA 3LRPA 2Q4DA 4HUQB 2GVZC 3CG0A 1GYPA 2BF7A 4MJXA 5KIAA 1K2VN 5LBTA 4OKNA 1BRMA 3ZK8A 4E5DA 3OKFA 1NUTA 5DNVA 3CCLV 3QJYA 2C0CA 2L6LA 4UCUA 3E9CA 3BCSA 4M0UA 3RYFA 2CNOA 3C1UA 2CK3A 2DQYA 3TCXB 5F51A 2J07A 2WA1A 4LF7O 4DR7O 2JAQA 2PV7A 2PLAA 5SZKB 5K0FA 1QQ5A 13PKA 2VTVA 2H9AA 4DOMA 3E70C 5CT6A 2A9RA 2CZCA 3B1YA 3IQDB 1GUAA 5HCIA 4B3MB 4KQWA 4K46A 4JI5O 2VDQB 3M5PA 4UD2A 5ERYA 4CJXA 1SHKA 2BF4A 1NFRA 4TQGA 3HN6A 3K0CC 4HNVA 2NO1A 2O19A 3WGZA 1U6IA 2DBQA 4A23A 1ZLXA 5CVEA 1DIBA 3PG5A 1B73A 3D8SA 3DLIA 3CGGA 5CGQB 4IWNA 4RETA 1OXSC 4DNOA 3QG1A 4EYQA 3GFRA 4PNPA 2W71A 3EY9A 5CJPA 1DEKA 2V65A 1FCJA 1E4OA 2CE7A 1EP1B 1GRRA 1XXHE 3IELA 2V6MA 5IBCA 3NHZA 2ZM5A 4ALIA 3B2NA 4IV8A 1M75A 5CMLA 3THYB 4EPYA 3B1VA 3MJRA 3NKFA 1RPNA 3K9GA 4AN4A 3WQRA 1G64A 3C3DA 4AXBA 2RD2A 2CDRA 4F5EA 2A0XA 3S1AB 4B3RB 2ZBFA 2P9QA 1YQQA 2V8BA 2Q0AA 1A7UA 5L6MB 4AJHA 4B34A 1KRWA 4PLCA 4NBTA 4WNYA 1H9BA 4ND7A 1QCDA 3Q0EA 3WLKX 3OD5A 4GE3A 4A26A 4I8IA 4AJLA 4GP9A 5BW4A 3KKZA 1U2GC 1Q86W 1R8XA 1F12A 1T34A 3D8RA 7YASA 1FMLA 1SKYE 3K09A 2DFPA 3RC9A 3AG4B 5CA0A 1HF3A 3JZIA 2CV0A 3QXCA 5B1BB 5EMKA 3AWIA 3C7KA 2AQ8A 4K8RB 1AI4A 2XKAA 1XPRA 3RVYA 2ID7A 1BS1A 3TCNA 3K05A 2YZKA 2O2IA 4YBRA 1FMJA 1U28C 5TVGA 4Y6QA 3ZE8A 1S4MA 1N0IA 2ORVA 1BDHA 1HBJA 1YAJA 1OCEA 4UTNA 1XTIA 2VJMA 3RGBA 1R3KC 2DWUA 2II6A 4J2TA 3ILVA 4RTSA 5EHIA 1QBKC 3UXEA 3RM3A 2Y0PA 2Y0BA 1STOA 2Y1EA 4EA9A 3QVVA 1AV7A 4HUTA 5D5PA 4KO1S 3OZVA 2FEPA 1HZZC 3GLFA 2XEXA 4YJDA 1KTIA 4AMYA 1F60A 4M88A 1FMFA 1XIVA 1Z83A 5IVPA 1FXKB 5H6RA 2EL9A 3ANTA 4AKSA 4NYMR 1JR2A 3VZCA 3N86A 3T4PA 2H4WA 3S55A 2ZSJA 4UNSA 3OAAA 2LKCA 4IUCS 4YV1A 1XN4A 5F1KA 4K35A 1JI0A 2ODBA 4HLUA 3W8EA 1OZHA 1PBNA 3LM8A 1HDOA 3HCFA 4CLDA 4RIGA 3UK2A 1JSLA 3P71T 4EYGA 4YXWD 2J3EA 2QMZA 1NMEA 2F62A 4D1YA 1CUDA 3E86A 5B3JA 3I5DA 5K0JA 1J49A 2UXNA 1TEVA 5SY9A 2P9CA 3Q1KA 2A78A 4YJ2F 3OZXA 3I83A 5DOVA 5LXTB 3IQXA 3AUUA 1O57A 2ATVA 3CLKA 4NFHA 1JLLA 3VO9A 2CGEA 3ZCUA 1I3KA 1JPJA 4GMHA 3OOWA 1NULA 2G36A 2HADA 2ZJ0A 4NP6A 4W5HA 2RK4A 2B1JA 5L3DA 3C87A 3WDMA 3VBBA 1GRVA 4U5QA 1OROA 4DW1A 4WV3A 2ZVJA 3UK6A 2D3WA 4TYPA 4AWXA 1ETUA 4OJQA 2YXNA 2G5PA 3PHIA 3RB8A 3BRWD 5C1DA 1RBMA 2GO7A 2JEYA 2GCOA 1WUIS 4YI3A 2YEVB 2YJ6A 4GOMD 3NPMA 5FL3A 3LBIA 3KS9A 4Y0NA 1NQUA 4XFKA 4AWAA 3NJRA 1WAMA 3FSEA 4KR3A 4YJHA 3WLEA 2P5YA 1AP6A 1ZC3A 4MTFA 3LXRA 4WLUA 1OFTA 2XUDA 4W7HA 1J95A 1MV8A 2O8VA 1RDFA 3CCCA 4HMPA 2OZPA 4TTAA 4BMOB 4FOOA 3G68A 3AK1A 4DM4A 3BORA 2WFLB 4UJ5A 5GZ1A 2GJSA 3MPZA 3F7YC 3CHYA 1GKLA 1WZUA 5BSTA 3KOZA 5DHRA 1XRMA 4URFA 3DDZX 1MJGM 1O9BA 4YA6A 3GUUA 5KTOA 4P36A 5JI2E 2H8GA 4F8EA 2IJJA 3K0CA 3WE7A 1H85A 1P80A 1VCHA 4ZPJA 3AYXB 3VQXA 2PYZA 2VHCA 5BNZA 4N0MA 3AR9A 4I1VA 2GSDA 2IHBA 4BFVA 3LYLA 1GO3F 2QSZA 3QQPA 1EX6A 3LL7A 2BWJA 2WTUA 2JCGA 1RWPA 1NP3A 3C3KA 2IZZA 4H7PA 1RSZA 3EYAA 3B5EA 1H2XA 5BR4A 1U9ZA 3LU1A 1ZRNA 1EN6A 3DFUA 4Q47A 3KCNA 3ADKA 3A1UA 4LRSB 1WBBA 1H22A 6ABPA 4UHKA 5LQMA 3BOSA 5FTKA 3BHJA 2I2DA 5TPWA 3IPCA 3BJRA 1R4AA 4PLHA 4BFUA 4OQEA 5JUWA 2EHJA 1BS3A 4PLTA 4UXJA 3SOZA 3NR7A 1IIRA 1BYUA 4IVNA 1Z0IA 3O9MA 1PR3A 5IVDA 3FUCA 1MHTA 5L3QB 3SQLA 5AKXA 1D9XA 3RARA 4GQAA 4YRKA 1VC2A 1QHGA 2WSYB 1FPOA 3ZGNA 1TF5A 3LW7A 1Y6RA 2Z2JA 4M87A 4NQZA 3TRHA 2IXDA 1P3DA 2BHSA 1FXHA 3ZJZA 4N6GA 3RFCA 1YZ3A 1XZJA 3VPCA 1RXYA 3MQ2A 3RG2A 2VYCA 1ZL2A 5FAXA 2QXTA 4QXAA 3H04A 4MPTA 2J6IA 4KX3A 1R16A 1YQWA 1GEEA 3L0PA 1F23A 2QKYA 1LNSA 2IH1C 1E6CA 4U9UA 1DADA 3QVGB 4EW2A 3OIGA 2AMLA 4XTRA 4EG0A 2WB2A 3TUIC 3VYRB 4AUKA 4KFSA 2XMZA 1ZJJA 4NBKA 3OM9A 3V7WA 2XTAA 2A0WA 2W6JD 3VUFA 1FFEA 2AOVA 4H33A 3A26A 2AOXA 2Z3IA 4ZAVA 3ZUPA 4ZVOA 3H11B 4J80A 4FS3A 4WFQA 4JP2A 4D9KA 4GT1A 5CDYA 2X0EA 2EJBA 3VNBA 3ENZA 3ZVRA 4RDXA 1KK1A 5BXZA 1ST3A 3A1WA 3K0SA 4Y30A 3HKBB 2B6NA 2Z09A 4H15A 4CKCB 3M9LA 2DR2A 4IHQA 1XOUA 3WRVA 2AFHE 3GGPA 2XNDA 3CH7A 3DBHA 4XWOA 2QUBA 3SEAA 2F55A 5B3LA 4U2FA 4MWCA 3LFUA 1ZBQA 4ZHQF 3RVDA 1SA0A 3AC0A 5B1YA 1FTSA 4QNNA 3QKSA 3DL2A 1X4TA 1SUBA 3T38A 2FWBA 1Y7PA 4FEEA 3R8FA 3R7WB 4E1VA 4JU8A 1GADO 3WNVA 4MARA 1U3TA 4JTDB 3WOVA 1Q6YA 1I5EA 5E1MA 2ZIWB 5BRAA 4LRXA 2QA5A 3MILA 4HZUB 1D04A 4P8RA 2CJPA 4DCPA 4G4GA 4RIEA 1DJMA 4FBGA 4TZ6A 5ER6A 3ZJ5A 3AK2A 4MW5A 1G9SA 4CUKA 2VTEA 1AE1A 3P9KA 4XQGA 2YXPX 1NHWA 4OJTA 2F9FA 2X5OA 4CR8A 5TPZD 2I4IA 5DSTA 2O7QA 2ZW9A 3N2NA 3N2ZB 5KSYA 4WXHA 1DP4A 4ZOAA 3VDXA 2YMQA 5LOVF 1R12A 3T2MA 4AN0A 1C41A 4V3CA 2PWYA 2RDMA 3AG4C 2G40A 4MZXA 4IVPA 4D4LA 3ZWOA 4DY6A 3FOBA 4W8GA 1FK8A 2XGGA 3QVUA 1E9BA 1Z5ZA 4OQXA 3DR5A 4EF4A 1DT5A 4X71A 4CKYA 3AUSA 1C9EA 3ZX6A 3GWKC 1E1RG 1YKFA 4LXGA 3CW9A 4AJKA 3C5VA 4ZYLA 5ADHA 3RU3A 2FLVA 3NANA 1U7OA 2BW0A 4FLYA 3TAHA 4DLTA 2E74B 2P79A 2OGUA 4A4DA 2CNDA 3QU5A 5K6AC 4YIKA 5KVCA 2Q41A 3REGA 3QBEA 1P39A 1E2GA 1OV9A 2HSWA 4HDCA 3M4YA 4O0LA 3HYSA 4AI8A 1R4ZA 3ZD7A 3D7KA 2XQFA 3JYQA 3LLCA 4XJTA 2HU2A 3GJ6A 4HNGA 5AI5A 1U2EA 2WKSA 5KQMA 4LC9A 4XLZA 1F20A 2VTKA 2IXTA 4XDJA 3W6OA 1XD2B 1P72A 4U7TB 1TU3A 1GTJ1 3HA5A 3UKDA 3JVVA 1QQCA 1JVNA 3U1VA 2X2OA 3L74H 1U9JA 5DIFA 1RKQA 5CTAA 5BV0A 3FTCA 3ZOZA 2D2XA 4P4LA 1AGXA 5JH7F 2E37A 3OUTA 1KA9H 2GBCA 5KYYB 3NPAA 1A3CA 3LX8A 5CW2A 5IF3A 4I1PA 4KIJA 4CI0B 1RVDA 4ALMA 1JLMA 4D4JA 2B8WA 3IQZA 5EP3A 1X8KA 1ZD2P 4FLFA 2HX1A 2AN4A 5B6JA 4XFJA 4YT2A 1N6RA 3DC7A 1G17A 3MWEA 2VYND 1SAYA 1PFKA 3KCYA 1LQUA 4B2IA 4NAVA 1NQTA 4ZFTA 1F8XA 5BN5B 3HSKA 1UPCA 1Y5NA 5L3CA 1ZESA 3TM5A 2GNOA 4WFBV 2ARHA 3RV3A 1K66A 1X1BA 4AF6A 4HCJA 1U80A 4DR5B 1H2RS 4LXHA 4YFVA 1RTTA 3IV6A 4MV5A 1ANKA 4CM8A 4KHZA 1C0PA 3ZLBA 1BH2A 4FMCF 3ND5A 3KTAB 3EA5A 2XADA 1BJTA 2Q62A 4LC1A 1R5XA 4ZVUA 4UOEA 5A71A 2VSOA 4JPRA 1V25A 5B7QA 3AUJB 4PZPA 2WM9B 1RJFA 4KN6A 4WY2A 3I5XA 3ZJVA 1QB7A 5EJEA 4XASA 4BZPA 4A16A 1RM0A 1YJCA 2J3MA 4I4TF 2BEWB 1FP4B 4IVRA 1ONNA 3HR8A 2VK2A 1MOQA 3W7XA 3LNTA 5KDOA 1G19A 1SHLA 2QYSA 2X4IA 3QFTA 5ALJA 4MTGA 1G59A 1BOOA 1AZTA 3DMNA 3HHPA 2UUCB 1ESDA 4FJ0A 4KBYA 4HDAA 3HBAA 2B5WA 4ZVMA 1RYYA 1JEEA 1IEVA 4H0NA 2AT1A 2B1QA 2WV9A 5AW0A 5SYNA 4RGQA 1YZFA 1U98A 1F2TA 1KQOA 4JGIA 5ABPA 1AHHA 4MUGA 3CEHA 2ERXA 3FX7A 3JQFC 2PNJA 4UMEA 3SC2A 4GKJO 1NVVQ 3FVQA 4X66B 3SAJA 2HWKA 3CO0S 4I50B 2JS5A 1Y5MA 3H75A 1KHTA 4Q3KA 5AVWA 1RQ2A 2Z3VA 3DCIA 4HGQA 1RBZA 1EX1A 4OUDB 1QNLA 4N12A 2B35A 3Q8XB 4V0RA 1CPYA 3JWIA 2Z08A 1A2KC 2DP4E 1HX7A 5DLQC 3WMWA 2R70A 3GAFA 2ZJYA 4CLXA 5ESWA 1DOAA 3DVSX 4IYHA 1O03A 2XHEA 1ESNA 3T1HB 3KD2A 1DXOA 4X61A 4NFYA 4HYEA 2Y4UA 4C22A 4TMKA 2RCYA 1SZCA 3A6DA 1QHHA 5JNSA 5CLJA 4DXAA 1J56A 4TTPA 4JYCA 1H3EA 1C1DA 2K2WA 2RAUA 4R6WA 3HPLC 4NVPA 3MT0A 3IS3A 3S8EA 4O25A 2QGFA 2D62A 4KXLA 4D4MA 1C0LA 3T9AA 2H7YA 4L8FA 2WSBA 2RBGA 2AVDA 3FPLA 3TMYA 4R0VA 4TT8A 1QVWA 3PQ4A 2IEZA 4BLTA 3TOVA 1MC4A 1DSSG 1QG2A 3RUPA 2EZ9A 2GQ0A 1AUOA 3AHIA 5ALVA 1DTWB 3LV8A 4H44B 4PZ9A 4BTEA 1NT4A 3ANSA 5I8PA 1TF7A 3B52X 5KNDA 1KJIA 1WVIA 5AHRA 4AXXA 2CNKA 1DWOA 1GR1A 3ROEA 4DT1B 5DIZA 3KQSA 2I6FA 1X7WB 2YJTD 2E48A 4S1PA 2UYHA 4RKFA 2ZBRA 5LKRA 2KKWA 4HNAB 5K6AA 3NHUA 2QNBA 4OHWA 5AM1A 4LJYA 4N5IX 1G5HA 1P1BA 2YYSA 1JTVA 1S3JA 3TINA 5IN4A 2AZXA 1T4MA 4YIOA 3A9WA 3GJTA 3ZEDA 3VYUB 3L05A 4F0JA 4IX1A 4QTYA 4X1IB 3GEBA 2L18A 4XIFA 3L79A 4PNEA 4Z7NB 2XASA 3FYCA 4AG5A 4PCVA 5B5SA 4L0QA 1IPHA 4KQCA 4GKAA 4H1TA 4B3HA 3Q7PA 4KOEC 4N48A 4PVDA 4B0PA 1TW2A 5IC4A 1WCXA 2M1XA 1WOYA 5D1HA 1XQVA 3T5BA 4MA0A 1VF5B 1OFHA 2PZ8A 2W2OA 1NXPA 5LU9A 1W5SA 3IGFA 2RG1A 3NHYA 1W36B 1NJSA 3IEUA 2H9IA 4J6EA 3VKVA 4KUMA 1X7ZA 2X8JB 1U9CA 1OH5A 2J0VA 1X0VA 3CLTD 4JR1A 2FP4A 4DREA 4WPGA 2DFVA 2YY7A 2X9QA 2EFHB 2VQ6A 1CNMA 2B20A 4MEJA 4WN9B 4L9WA 5LQRA 1N1EA 3IP9A 4MUEA 4QKQA 5CX1B 1OU4A 4V1CA 1QTIA 1CDZA 4JV5B 1JR3A 4FMDF 4W99A 1SFRA 4QG7A 4MVXA 1Z8DA 3C6XA 4YAEA 4X24A 2GDJA 5GP1A 3WWYA 2ZM6B 2RHBA 3U09A 4D82A 1HE5A 2DLDA 2V4DA 5EN4A 4ZVTA 4BKRA 2CHEA 4GQBA 4QODA 2C2YA 5H9WA 5H82A 2AEMA 3BN3A 1UAGA 4DV0O 4R2MA 4U4AA 1V37A 3MHTA 2YEVA 3VGPA 3SHVA 1ACJA 1E9EA 1V47A 4EUNA 1W94A 1IDSA 2LGQA 3PLNA 5A2GA 5B58C 1E61A 5JSUA 3GVHA 5IXSA 4X62O 3H1EA 4LWPA 3R7AA 2FMUA 1Q0ZA 3C4VA 4ZV7A 2JDIA 1ODFA 1N8NA 4DQVA 4QGAA 1JSXA 5HSGA 1YUMA 1MPXA 2XT9A 2ZRNA 1C5KA 4G0VA 3KALA 3USCS 4PYKA 3X44A 2YH2A 3GMTA 1ZK3A 5EJ9A 4M53A 1OTHA 1UWKA 2GD6A 4QBIA 4RPGA 2ZAIA 2CXPA 3F97A 2OV6A 3CUUA 1MFZA 1V8ZA 2O48X 3NEJA 3DHEA 2OZLB 3FFWA 1DCFA 4S1TA 1R6VA 4EUFA 3JRNA 4DTCA 3JQFA 2CV1A 1RS0A 4KFUA 3RFVA 5CLQA 4OB6A 5KVAA 5JJBA 3MRVA 2OWDA 4GI5A 2HMYB 2AQKA 1QYXA 5DHPA 2JKYA 1Y8RB 4DR2O 2QUKA 2WF6A 2R8BA 4BS9A 4DZRA 1HWYA 4IMIB 3X1XA 1U8FO 4PN3A 3LRXA 3C3AA 5J43A 3O8BA 3VV2A 5JSFA 2J9XB 2DE0X 5EIHA 5WRFA 1F1JA 1GUFA 4R1PA 2UXXA 3S3WA 5D6OA 4KQ1A 4NMWA 1RQNA 4MKFA 2C3UA 4D74A 1RWNA 1MABA 5GM1A 1IEQA 2W6IA 3AB3A 3QPWA 5IAEA 5IVHA 4KXUA 2NZ2A 2FZ4A 5A7GA 2A3QA 5IYCO 2Z1NA 4HWSA 2R2AA 5BV2P 3ZXYA 2ITCC 4HBNA 1FKAO 4QYIA 3U3JA 2I66A 1JEJA 4TT3G 2DPYA 1V5EA 4ZQBA 4K81B 4U0JA 4RHEA 3JQGB 4KPUA 1PWYE 2ZDHA 5L3QA 1BN7A 1OTYA 2FN9A 2BFDA 5F7ZA 2ECPA 3GVIA 2XUMA 1E2KA 4NBSA 4M9UA 3ICPA 1ISGA 2GK3A 3HDJA 5GZ6A 3L92A 4LJRA 3AIOA 4UCRA 1XTZA 2EKDA 3GMIA 2RGYA 2Q9CA 4CLOB 4U63A 5FD8A 1PJ8A 3OUUA 3QVKA 2QUJA 4ITRC 3MNFA 1ZM9A 3GRPA 1K9VF 2B2XA 2PH5A 1V1RA 1WSBA 4I9UA 3SR4A 1RZRA 1DO8A 3AINA 3PL1A 3QVGA 5DWVA 1NUUA 5CT8A 3A4IA 3WR5A 3V4LA 2Q2NA 5LM3A 3GJZA 3ABQB 1AG9A 4IS2A 5TDHA 1OIWA 3P0FA 1GKYA 1FS5A 1DKPA 1ZN9A 2AN5A 3P4YA 4O02B 3AFOA 2AR0A 4CTMA 4DIFA 3BA1A 4RPIA 2REQB 1Z37A 5H9VA 3Q8KA 4WIAA 2IM9A 1TUEB 3LC7O 3H11A 2KLHA 3UM7A 2ES4A 2ODNA 5K99A 1GN4A 1EFCA 4YRGA 4MDEA 3N53A 4LXXA 4K9NA 5JEDA 1XYVA 4TYYA 3L1KA 5AIAA 2RK3A 1QXSA 3PICA 3RQSA 4R98A 3U4HA 4TV9A 3B85A 4UHCA 3B9QA 1RU3A 3OCXA 3BH6A 3IP3A 1TXGA 2DJVA 1N34O 1SXJD 3DF9A 1BE0A 1DCMA 4FDMA 4X64O 4FLXA 1KI9A 1VG9B 3WY9A 2QWQB 2YJZA 4RMNA 4EGAA 1EX7A 3DEFA 4E4EA 1GGFA 4KQEA 5EXTA 2EW8A 2H8KA 3CE9A 4QTUB 4ZCRA 2CLOB 1IYZA 3HZOA 4Q1CA 5HR5A 3A3NA 2YW2A 1NG1A 4RW0A 5JDIC 2WV7A 1E9CA 1SHZA 1RAGA 3W7SA 4P84A 6AT1A 2ZBGA 5JLJA 1OOEA 3B8MA 3F7VC 3S1LA 4OXSA 3F3MA 3PHLA 4H60A 4ACBA 3KWMA 1RYBA 2P35A 1IVNA 2P91A 3ECAA 4TZTA 1RADA 3CXRA 1WA8B 1R7RA 3C97A 1AO0A 3S40A 2KYRA 4ZVPA 2ZIXB 2IGTA 2O57A 1K4DC 3PQEA 3KSZO 5TRTA 4DMMA 5ALYA 4JC0A 4LQ4A 2KS6A 1PNTA 4IEIA 1YVEI 2FUCA 4PI0A 5JEEA 2I2FA 4RD0A 3EF0A 3KTOA 3ZE6A 2WD9A 5GPBA 2YOFA 3ZGLA 2GPJA 1KSGA 5I4CA 4PIVA 3DAHA 1P2UA 3EMVA 2RC5A 4RCYA 4O4IB 5C81A 3OO0A 2CXXA 3CR8A 2ECOA 1WP9A 2UXDB 3WLSA 1PJCA 3D0KA 3LFTA 4B7UA 4XX0B 2JAHA 2H2HA 3CRCA 1KO5A 1GM9A 4KI0A 4HZGA 1LTQA 2RH9B 3LSUA 2C83A 3RFUA 5F33A 1Z6TA 4C21A 1WZIA 3WHIA 2WD7B 2EEZA 4GF5A 4Y8VA 1EXVA 3A4NA 1IURA 4XUEA 1A9PA 1B15A 2ZR7A 3LYHA 1XCOA 4OMCA 5KYUA 3O3CA 1NW7A 6REQB 3R24A 1UDXA 5GV7A 2HA6A 1KAOA 2GESA 1GR0A 1ZKDA 5BWCA 4F8YA 3N7AA 1B1CA 3V9PA 4NNJA 4QXQA 4B9EA 5FTNA 3OUFA 3ZVKA 5KYYA 1TIKA 3UPTA 3FDFA 4J3FA 2C5LA 5FPPA 2OXEA 4XJVA 1V2HE 4HRQA 3PUJA 4BMZA 4H7IA 4FYWA 2J0UB 5CVVA 3AUAA 3GEEA 4FTWA 4O5OA 1EUQA 2GRJA 1O6FA 4F84A 2GRAA 1KBQA 2SKCA 1GPLA 1U3CA 4DEYA 3CG4A 1VLHA 2RGGA 2IHKA 2Q7GA 3QMWA 1M6NA 2I8LA 5IJ9A 4GBED 2ZCVA 4R1SA 5F3DA 1RABA 1E0SA 1H9AA 3GW8A 2OYSA 4ASUD 4C2AA 3MTIA 5BN5A 1EJ2A 5DX1A 4AX4A 4LOLA 4D6XA 1SUAA 1F9EA 4DSAA 5TARA 1AX9A 1D4AA 1DX6A 4D25A 1MEJA 4C0BA 2A94A 3H9VA 2NVUA 3CX4A 3GWGA 3IKTA 1JPVA 5C8DA 1DCKA 1OV4A 2CHGA 1XZFA 1RWVA 4M0LA 4FDTA 3OTGA 1AKNA 1GCUA 4F97A 3T95A 1P9RA 1H2MA 3KTAA 4ZRNA 4ZK6A 1BN6A 5K3FA 1K7YA 1UMDA 3OQMA 1THGA 2C2WA 3OX4A 2JGJA 4O2AF 3RR2A 4IFEA 4QOSA 3N87A 2IIVA 3MZ0A 1GN6A 2BEWA 1FP4A 3JD3A 2Q1TA 4EW6A 2G0NA 2JBAB 2IDJA 1T0HB 5FOWA 4BNUA 1YJNV 4Z99A 5KTKA 1IVSA 4AF7A 4ZI5A 3SR3A 4BO0A 1OFIA 4GC9A 3NIBA 4H4CA 5BW8A 2AZ2A 1Y89A 4G1FA 3FKSA 1KK0A 4KCGA 1W9MA 4X84A 5E6UA 5I51A 3H01A 3MRTA 1CR4A 4Y6SA 3RKRA 2WWYA 4LSWA 1GAJA 5C51B 2VJYA 2DC1A 1WZNA 621PA 2V7UA 3DB2A 3QX8A 2PY6A 3V8VA 3MN1A 1WY7A 2HA3A 3VZQA 4KMSA 1UKEA 2N05A 3JWPA 3LF2A 1Z2EA 3Q5GA 4G2KA 1JJIA 3TXXA 3W05A 1N0NA 1H8ED 1UJ6A 1XF9A 2BTEA 4Z2YA 3CEJA 5MDHA 3MJHA 4Z6KA 4N5MA 3CZPA 4NYIR 1UPAA 3OLXA 1PWHA 1MIOB 3R23A 3HTXA 5EZYB 3ZHTA 5L4SA 4N01A 1U99A 1BT8A 5E2BA 3MAGA 1LEHA 2PUDA 3R40A 5JDIA 2PKEA 4FSHA 2ZS8A 1LPSA 4QLAA 1LSJA 4BO7A 4OYYA 2EJ7A 2EX3A 1VQ7V 3UICA 2Y0CA 1UBSB 3PNPA 9ATCA 4IM7A 1VARA 4PCUA 3GLRA 5IANA 1P18A 4ZU1X 4L2IA 5C4GB 3VAAA 4UBLA 3LMKA 4XJSA 3U7QA 3RFTA 4L78A 4BP9A 3U48A 5AJHA 1GFWA 3GDWA 2DPLA 5DW0A 3LUGA 4FFNA 3FOEC 4NZOA 3W3AD 3DWIA 1U0SY 4YCMA 2JFQA 4AMUA 3AVTA 5J5VA 4FEGA 4B79A 2Q5EA 4BNZA 1KYYA 4K8ZA 2X76A 2GD2A 4EJFA 1GRCA 5TQ2B 3QKWA 3T3GA 3GDOA 3S8YA 1DTWA 1LFDB 3L0CA 1Q1BA 1KQPA 4Z2AA 1W0JD 3AEQB 4TL8A 3E1SA 3QEOA 3PRYA 2DWOA 1XZGA 1QHSA 4I2NA 1PM9A 2CV2A 1TADA 4FOTA 4ZRDA 2MJLA 2P4QA 4EY6A 2FHPA 3DNMA 1IUOA 3CNNA 4LGMA 2Q07A 2OCXA 3PQ2A 1NZDA 5F64A 5FOTA 1X92A 2CUGA 4JI6O 1Z0FA 1R1BA 1CUAA 3PC3A 3WWDA 4M1OA 3NFYA 3R9WA 3IFXA 1RMQA 4EA8A 3WGKA 5L51A 4YJGA 1Q92A 3GRVA 3IVGA 2A30A 4PGHA 2K2QB 1HL7A 2GZ2A 5CDGA 2D1FA 4AD8A 2D1SA 5A5FA 4RUEA 5J5CA 3BE5A 1ZH4A 1XCLA 1OSNA 2NSLA 3TD6A 1WPRA 2YQ5A 4KOAA 1SVIA 1IRXA 3I8XA 4MSWC 1WHTB 2CXUA 4X9XA 4IGFA 3AL3A 1DAGA 2VWHA 1E6WA 3ETEA 4FBMA 3UWDA 4N8EA 1MZVA 4D4KA 4KNWA 4V0NA 2NZWA 3PZRA 2MINB 1X39A 3PSAA 3AT1A 1WZ2A 4PYQA 4NXMB 5GM2A 1XE3A 2CDNA 2AX3A 2G4VA 2VDWA 2W4QA 2WPDD 5M3BA 2X8JA 2BR4A 3IMGA 3DSRA 4RXUA 3E81A 3FFXA 4G4JA 4O2BB 4BU1A 1PNVA 4WK6A 5I01A 4RPJA 4HF7A 4GI7A 1M8KA 4D7TA 3WGNA 1G42A 3WGHA 5FI0B 3MXOA 2RBEA 3RC7A 1H0KA 3NETA 2R72A 1DBVO 3A4VA 1CQJA 3UW3A 3ESZA 3UJCA 1NS1A 3G8YA 4BWYA 2DT8A 3RVRA 2Q27A 1H05A 3ZRXA 2HLDD 3K1AB 4INAA 4HXYA 1MG0A 5ES4B 1TL7C 1LPPA 4RKQA 3MTQA 4AROA 3WZLA 4HAWA 4MUYA 2VAPA 2A9KA 4HNQA 4UTZA 3K9BA 2XHBA 3IE0A 1QG0A 5DGTA 2C82A 4LFBO 3ITKA 4O1HA 2HHHO 5HZMA 3EZ9A 2I7TA 4TN5A 1BH6A 3WBFA 3FD9A 1X9IA 3BXHA 4BFZA 2AR7A 1T2UA 3PLRA 1DIGA 3OSUA 4LYGA 5HMLA 5BNFA 3PIDA 4QTZA 1QQBA 3LKBA 1UQTA 4UHDA 3M34A 2GI4A 1TVEA 5FYDA 1T5HX 4KAFA 5LYJF 3VMFA 3FAVB 1AQJA 2OZLA 4ZVLA 3RZUA 1NYTA 2TMKA 1KECA 1BXRA 4ZU6X 2UXBO 1PU2A 4CKXA 2HIHA 4XBFA 5I7RA 5FWXB 4PFJA 3NGLA 1TTTA 1KI7A 2XCLA 3TMAA 2C4KA 2YWGA 1QR8A 1Y8RA 4O3FA 4YAUA 4MS3A 3WGIA 2A7QA 1YGYA 2RH4A 1ND6A 4MI9A 3INGA 1TEZA 2I67A 1SJ9A 1EHYA 2W43A 1AHNA 1B0UA 1P7ZA 1GM5A 2RKWA 1BX1A 1J1IA 3LCVB 4W4KA 2EG9A 1T4CA 3KFVA 5JAQA 3SMQA 3QMVA 3I56V 4FFBB 1KH2A 2D5IA 4JDUA 3T61A 2M98A 1I10A 5JVDB 3OTIA 3WGTA 5BNWA 3NTQA 3W2HA 1OXVA 2PSJA 4LFAO 1E7YA 2WJZB 2G1UA 3TL3A 4LKOA 1B23P 3PYXA 3NOVA 5HE8A 2R85A 3WWEA 4A03A 5A9GA 4E6PA 2YYZA 4MYDA 3DLHA 1O6CA 1JX6A 2NPIA 3BSYA 1DVRA 4KRGA 3TGPA 4MR8B 4HYQA 4INOA 4BZWA 3IC9A 1XEWX 4O08A 4NH0A 4MVOA 2DPMA 5L95A 3V80A 2V5VA 4FYHA 1HLDA 4CTJA 3EMBA 2V7QG 2EW2A 1GXSB 1HFWA 2GD1O 2PXXA 1E2EA 1W6UA 3M1IA 2RCVA 2ZRAA 1YB2A 4W1SA 1SUDA 4B81A 1ISIA 3BK1A 5KLVH 4BTLA 2DUUA 1QYRA 4HLNA 1WDLA 3QF4A 3N0VA 3SPXA 5FXMA 2IVZA 4EEQA 3OETA 1G0OA 1XZLA 3Q7EA 3GGCA 2RFLA 5JATA 1WUTA 3EQ6A 4XA8A 3JQQA 2FFRA 1JTKA 2QWNB 4JB3A 3LWNA 1DLIA 3ADOA 2W6NA 3UJ3X 4BO5A 4J4HA 4XPZA 4DSNA 4FGSA 5DOZA 2E2WA 1SC5B 1MX3A 4BRSA 1WSWA 4O0MA 2IYSA 1UBKS 1F06A 5FDFA 2YVAA 4HL6A 4BX9A 4W1QA 3DV9A 3ETDA 3OX1A 3RRFA 4UZSA 1G5TA 2H9YA 4CNQA 4LNAA 4XCVA 3ONVA 3GDFA 4DN6A 4LY9A 1G18A 3N74A 3O6VA 1RE1A 1VL2A 3QUQA 2QB5A 2AI3A 4ER0A 4FIZA 2JIPA 4PO8A 2QL5A 1DE0A 1Y3HA 1EFAA 2F17A 4QRDA 4NNOA 5IXYA 4C87A 3KP1A 3J81k 2F4VO 4PICA 3TQCA 1W5BA 1YVPA 1BHJA 3GP8A 2EGUA 2WDZA 1S2DA 5LQSA 1CRWG 3NHWA 2VNJA 2IUUA 3W5BA 3GFBA 1KDYA 5IPFA 3FNBA 2DHCA 1T26A 4QE9A 2ZYIA 1AKYA 3RC3A 2GNPA 3UY4A 5HKOA 4X20B 2G04A 3I2FA 1WXFA 1BQEA 1K92A 3C3YA 3T0GA 1MPTA 4F04A 1RBQA 4ID3A 2CB9A 1BYIA 5L6LB 2Q5CA 1UZNA 4Q1BA 2BGWA 2FCAA 4BN5A 3JR7A 5CHYA 4L5JA 1R5OA 3U7HB 3H5RA 1GG9A 1Z73A 2CLKB 2QTWB 1L8LA 3PFIA 2X5JO 1FTGA 3WLFA 1JLHA 4P08A 4G1EB 4PDVA 1EE9A 3BZUA 3CP1A 3CPWU 2Q7OE 4IHKA 3ZJ4A 1Y1PA 1HT1E 1Z8FA 2ZIXA 4RSHA 2QW8A 5AKYA 3LD9A 1QH8B 4WJLA 3OM0A 2YBEA 1E2LA 1KAHA 3C24A 2G7ZA 3BHMA 3PX7A 1RFLA 1W0CA 3JVUA 2E4UA 1KGSA 1P62B 4ENPA 4IQGA 1A8QA 3B1ZA 3T7JA 5IYZF 4HBGA 2XE7A 4DBLC 4LS3A 4G97A 4YRZA 3PGLA 1CUBA 2A1TS 3WFZA 2PZLA 1EVQA 2RCNA 2H07A 1VBFA 4O4IA 2I4RA 3TVYA 2O5CA 3TDNA 4A2CA 4E2ZA 2QV7A 4BNHA 4XX0A 5IE9A 2I6GA 4TZ0A 3KSDO 4NJMA 5IT0A 1YVDA 4P7KA 2AEJA 4ZEXA 3TG8A 1Y0BA 4C6RA 3ZZ1A 4OGWA 3WSWA 2XDQB 2BAGA 4IJQA 1EZJA 1GCOA 4OMDA 1HNXO 3AKEA 4QDUA 2LCIA 2WBLC 2ON6A 3I0MA 4DDKA 3SY8A 3UKJA 4NR1A 3TLGB 3QJ5A 1FX1A 2GHTA 4JBLA 3PE6A 2PFGA 5K0NA 4JZYA 2VQEB 2XUPA 5EJGA 2NNLD 4HH0A 4BN0A 1JMVA 3E5MA 1NUQA 2WA4A 3VAYA 3PPVA 3HB4X 1GZSA 5JXWA 5AHWA 4QDTA 1USUA 1U02A 1Z6YA 4G23A 1W88B 4HH3C 4JBYA 2Z83A 1WXIA 1SEVA 3V2IA 3AL0C 1OCRC 1N1MA 1RYMA 5TGZA 4UUBA 2PJRA 4OSEA 2PZMA 2XD4A 4IJ5A 5T67A 4OCMB 3ZOKA 1K63A 1PHRA 3U37A 3CPHA 4X89A 5C8YF 3HKEA 1QF7A 3GDGA 3WLQA 3IMKA 1UBCA 4F3RA 1IBKO 5FOQA 1V0JA 3PNYA 2FQYA 2COUA 1UT6A 2ZCEA 1IULA 1DUIA 1U2GA 4CMEC 5HUJA 3K9CA 3KJGA 3ZCPA 2Z95A 3QLVC 2F1OA 1S5PA 4YUWA 1UXKA 3HPQA 5F4BA 2IFTA 1ZWIC 2Y0DA 2E1PA 3B3JA 1U0TA 1U28A 2WF9A 3LKDA 3SC4A 2QY9A 2IITA 4N7MA 1H1DA 4TWKA 1ROPA 1TGOA 1RHMA 1T3GA 1HDIA 4J3NA 2QVZX 4F5ZA 5IMSA 2NACA 2JIMA 3CVWA 1TA9A 5BUQA 5AKEA 2JLXA 1G5RA 2FI1A 4X1YB 2VO1A 3DPUA 4HVLA 1GGJA 1HZZA 4OQPA 2OZVA 1KIMA 4QUAA 4YAGA 3QY9A 3FI0A 4BFSA 4AURA 5HM8A 4DB2A 3E4CA 3BY6A 5LBUA 5HKLA 1X42A 1JKMA 1J22A 2BEVA 1OREA 4KW7A 1EJ6A 1GLVA 3WKBA 3T52A 1I4LD 2GASA 3P8ZA 4FLZA 5D86A 3QBTA 2R6CA 3JSNA 1LRJA 4LYJA 1HG0A 1KYXA 4ER3A 1JAIA 4MS1A 2JAOA 1RLIA 3E5RA 5ALKA 3ABKB 2OOSA 3GVPA 3KT8A 3FYIB 1MIOA 4L5BA 3ONWA 4QLBA 4LTMA 1YRYE 1XJQA 4PGAA 5KPJA 2XOEA 4LVCA 1Z6XA 4GP7A 3IV7A 1J1ZA 2VP6A 1G5IA 2BGRA 2XPCA 2YZ2A 1WUKS 1IQUA 1XL0A 1II9A 2W2KA 1QK5A 5U4XA 4ZWNA 1G5FA 2WA2A 1CIPA 2Q8PA 5JD5A 1Q6ZA 1F0PA 4A5SA 1L5ZA 1TKCA 2ZQYA 2C8KA 4QSHA 1WP4A 2RHMA 1NQOA 2OLKA 4Y98A 1GGKA 4GMDA 1QP0A 3JXEA 4GD3Q 1MC8A 3UAGA 4MV8A 3NYIA 1JTEA 5IT5A 1ADCA 1NJFA 5K3EA 2F8SA 3VJRA 2E5LO 2G63A 2EBUA 1G3MA 2QW0X 4Y9DA 2E0IA 5DEIA 5B3KA 4N3GA 5DN6G 3B36A 4JT2A 1N9GA 1AH2A 2KSDA 2FSSA 4JJGA 1G20B 2R9RB 3EWIA 4HNHA 3ZGXA 1FXVA 2UAGA 3AIKA 2A9VA 2XUAA 1SR8A 3SHWA 4TX1A 4JODA 2HSJA 2HG5C 4YLGA 2XKKA 1TYCA 2OESA 3BPSA 3FYUB 2DWQA 1U3DA 1XHXA 1GRQA 3NDPA 3D7NA 3UJ9A 4BNWA 5B1BC 5HQ3A 4R1LA 3AU9A 3GFPA 4W9NC 3WL5A 1G5QA 4MVMA 4RS3A 1GDHA 5IAKA 2KW5A 3AKYA 4FWTA 1JFTA 2FMLA 1HDRA 1I2ZA 4V0OA 3TG2A 4MDFA 5JADA 2LFRA 3EFOB 3KFXA 1F2VA 1JZTA 5F12A 3BBPA 2FWJA 1QTRA 1T3ZA 4ZVRA 2FEKA 1LJLA 4C4RA 3RJ9A 3CVOA 3EEQA 2VAWA 1ZK4A 5EFOA 1T6BY 3LSSA 1EXNA 3CSXA 2Z9CA 1SULA 1PZXA 3F73A 5L4NA 3DTVD 1FXKC 3QX3A 4O8ZA 2I78A 1WRBA 3K9NA 3DW1X 2XE8A 4RK5A 1SBHA 3PC4A 2ILTA 3VPBA 4DRZA 2ZE6A 2ZYUX 2DQKA 4QO8A 1OXBB 5DRYA 1XL4A 2NAFA 3OE7D 1SZTA 1KOGA 2I80A 5ESRA 1E1RA 4ZEWA 4WIGA 2Q8NA 2H29A 4G67A 1M5IA 3RT1A 1Z5PA 1NWCA 1SCIA 4JFAA 4E12A 3RAFC 3MD0A 2NXWA 4DXDA 4ZJZA 3A6LA 4MJ7A 2JC3A 4JB0A 3ZIUA 3AEKA 2UUBB 4WLEA 4FN5A 2V03A 3RGGA 2J7PD 1XAHA 5D87A 4CMEA 3JWGA 4Z53A 5AVTA 1JFSA 1CDOA 3U4IA 4A6EA 1V3TA 3QLVA 3I64A 3DZFA 5D2CA 3CUWA 3L01A 1YDMA 3EBLA 4D9EA 2RBKA 2ZDQA 4EQ6B 2XAQA 1WG8A 3HBFA 2OYRA 4V03A 1W581 5L3BA 5CBPB 2IL1A 2GLXA 1ORTA 1LJUA 1GTZA 4IO1A 3SSNA 4EUEA 4F60A 3IH5A 3AUXA 5KYKA 3GC6A 4L4SA 1VPTA 1VEWA 3LXMA 4OQZA 1PZNA 2O6HA 3MFQA 2PR2A 2RIPA 4JOQA 3P0IA 4U9IS 2C2BA 3TD2A 2H48A 4F21A 2P0AA 4IDOA 3CLVA 1S2MA 4JBHA 4HUQA 2JH3A 2R65A 3BJEA 4JITA 1VE5A 4OU5A 5EK0A 4RJIA 1Q2XA 1RKVA 4GX1A 2EFYA 4Y1FA 5C5DA 1E79D 2B8TA 2GJ4A 3WGYA 2HC9A 2WWFA 1C0IA 1OIVA 1M1YE 1L0NH 4BDSA 1IHYA 1N2BA 4L85A 5AK5A 1QU3A 1K73W 5IDWA 4GI1A 4MI6A 4FQ8A 1PUJA 1W35A 3F6BX 4QUIA 2ZT6A 3SLGA 3H19A 3ZY6A 3NIDB 2CVPA 3A4LA 3CF0A 4EG7A 3WQHA 3O7MA 4QUKA 5G4LA 2QM0A 4MKZA 4FW8A 1A5BB 1GU1A 4DYLA 1QLJA 2FPIB 1OZAA 2DG2A 4U00A 1EQAA 4W63A 2FF5A 2CUKA 4CG0A 5A62A 2QS9A 1SXGA 2WWTA 3D2CA 5B12A 1MZPA 1KD1W 1UX0A 3RS4A 3DP9A 4FFBA 1QFYA 3O21A 5JVDA 3HCDA 4OIMA 3CF6R 4MAMA 3NWOA 3E9RA 4BGDC 1U0HC 4O33A 1QOZA 1EFKA 1Q3KA 3PDJA 3THYA 2C58A 2FX3A 2EYUA 1ADFA 7GPBA 2E5FA 2GJ8A 1EFRG 1XLWA 2ZXWB 4DCTA 2VPTA 1NOIA 3HFGA 3U5ZB 2WLHA 2C2HA 4A15A 4HAMA 4ESOA 3S1AA 4GBMA 4A8TA 3G5TA 1IHOA 1R0KA 5I8ZA 3I52A 1JPXA 2IH5A 1P8JA 1ZCBA 2R9VA 4NDZA 4KQIA 2PQ6A 1PYDA 4RVOA 3PYMA 5DYNA 4LY0A 4XDGA 1A9SA 3ZE1B 1SBQA 5D3ZA 3CX3A 3GAAA 2IRWA 1C3EA 1GVNB 1Y9JA 5LL6P 2O2YA 4JA2A 2VF7A 4YRAA 2H1FA 4GQIA 1OCOB 1MFPA 1EBUA 3IQWA 3L84A 3URKA 4J2OA 1CEQA 4W9NA 4YCJA 3VHXB 5J2TF 4RC9A 1RM5A 2OCPA 4D9CA 1T9BA 4ONEA 5B3AA 3T7RA 4GX0A 3K57A 2CDYA 3L1UA 2XKBA 2ZATA 1B3QA 2OYCA 4F46A 1FNCA 5TY0A 4UVBA 1QP4A 1Q0HA 2H4XA 1B6GA 4HDOB 5F1PA 4G09A 1DJNA 3OPXA 1P7PA 3FKJA 2IZ6A 3C1TA 3WIUA 4DXWA 4XQ9A 2COKA 4WL0A 3MGBA 1JHPA 1TD1A 3U4GA 3EXFB 1BKYA 5D3MB 3OOHA 4CKWB 5JRJA 3MPUA 4ZV4A 3V9AA 1YTFD 4H0LB 2X7JA 4ESHA 5KWJA 1IQ0A 2VPYA 1LLQA 2V97A 1FXKA 3ZMTA 1HRDA 3PE3A 4XIGS 2X6QA 4EKIA 2ZJ6A 4PNZA 3T34A 2DQ4A 3DVQX 2Z1DA 3JARB 4C4XA 1L7BA 1UJMA 4F9FA 1M9NA 3NBZC 1TKRA 3SG0A 2ZAOA 5EC1C 4NB5A 4MEAA 5CX4A 1ST2A 2Y1DA 2NXEA 3FGPA 4MI1A 2BGTA 1KH3A 4PD4F 5ALHA 3ABKC 1N4DA 2AFVA 4NE9A 1EVEA 3MHSC 1YB5A 3AK4A 5IDYA 2NIPA 5D6NA 3KV3O 3ZNPA 4QO7A 4X20A 1C3JA 4J3JA 1SHUX 4OQMA 3EYWA 1KS9A 3OPNA 5LXTA 2PGJA 4R7GA 3IR5A 3EDCA 1FQOA 1GTL1 2HRQA 4P4TA 3UV6A 3ZDRA 1V71A 2V74B 3WBJA 1JAHA 3ADCA 4EW1A 1NRIA 4PYOA 5KQLA 4RAQA 3KQYA 2Q4EA 3GOHA 2MU1A 2GPBA 2PMWB 3AHGA 2AG6A 2X1LA 3AF5A 4OM8A 1CRQA 3ONEA 5IUKC 3BTVA 4PM4A 3TFOA 4MAFA 2ZUUA 1S9HA 4LJ7A 4YHHB 5HZKA 1DL5A 5KNDH 3DE1X 1K4YA 3Q9SA 5JE8A 2Q6IA 2WNIA 3DEKA 3Q72A 2WLTA 3IP8A 3QVXA 4S0ZA 1G38A 5JCOC 1FP7A 3F9RA 1UC4B 1IAVA 1UPGA 1KFEB 2RGEA 3PUXA 1JH9A 3SX4A 4PA3A 1U1EA 2WTAA 4E46A 4DNXA 3L6CA 1BRTA 2V4ZA 2P2NA 2D0IA 5CBFA 4FFLA 2C3MA 3O65A 1O54A 1VTKA 2HR1A 4BNMA 2ZIEA 2OBLA 4Y2QA 4F2GA 2WFLA 2IU3A 1QCZA 3HS3A 4LYFA 1EA7A 3EVBA 4MQFB 1B4DA 1HE8B 3PUIA 4MQUA 3G0IA 2BMDA 3IPAA 2O3UA 3P32A 4J75A 2QVYX 2X6RA 3NHFA 4BZZA 4Q9DA 3TLGA 1DC3A 5LDGA 4R7CA 1QIKA 1TM1E 2FL4A 3ZHXA 3LY7A 1OTXA 2VRCD 1P77A 2QVXX 2MHCA 2J46A 3CJRA 3GJRA 1BOFA 4BCCA 3IBFA 4LNHA 4A2WA 4YQZA 1NATA 3DKVA 3ABMB 1N6NA 4BGDA 1CS4C 1RCTE 3BB4A 1Z2PX 2FWAA 2C8LA 4H1WA 1RP7A 1SESA 1N6IA 2H3HA 3EHEA 3ZTWA 5K1ZA 1WE2A 1KZHA 4EYKA 2BFMA 4OCMA 4J0GA 2RI1A 4Y67A 4XW2A 4BQEA 1UDCA 4RD3A 2AXEA 4HDNB 2XCOA 1QVRA 2OVFA 1LI4A 3C3CA 2VDPB 1BX0A 3PK0A 4ZZ2A 4E03A 4MVYA 1DIAA 3ZCCA 3DEZA 5BYJA 4FKBA 4PYRA 5JMOA 4P5EA 1VZ2A 4H13B 3FCOA 1DBQA 1SUWA 1USKA 3HADA 4MYTA 4R8RA 5K3CA 2O2SA 3ROTA 5AO9A 4OEHA 1POXA 5BWLA 2WAYA 3MHHC 4KMRA 4QU5A 2Q9BA 3UHFA 1H4VB 3H5AA 3C48A 1HQCA 3ORRA 2RAVA 2BN4A 4KXWA 2VWJA 1Z4KA 3ZNOA 3S70A 3UA3A 4YAIA 4P6VF 3CXHF 3X2EA 1ISSA 3TIGA 1PV0A 4ZGBA 2W2LA 5MGBA 1KETA 1G41A 2RI0A 4ZD6A 3I53A 2F1KA 4Y2VA 1Z5OA 1ORHA 4X1YA 3UUGA 2RKOA 1ML4A 3BWDD 4JY7A 1R4NB 2RGWA 1SRRA 2GYYA 4YO7A 2QDXA 3O91A 2G76A 3FVRA 3LIPA 1XALA 4MUHA 1CSEE 2IYRA 3E7XA 2QSYA 4TT3A 1IM5A 4P2GA 1EVYA 2Q49A 3DB1A 3WLIA 3UMGA 5DHFA 1CE8B 4AG6A 1RJEA 5IWAO 3B78A 2IF2A 3Q6MA 2XNCA 2ECFA 4IGKA 3HE3A 4KQHA 3CCFA 4BP1A 3OQ1A 1KOJA 5CB4B 2ZVQX 5DEOA 3JWHA 1YNOA 4TZKA 3A8TA 1XNJA 2D74A 2H2GA 4DV4B 3GR6A 3HKBA 2XUJA 4NYKA 3U0BA 4CKCA 5GJWC 4GEKA 4IIJF 2ZUDA 3VO2A 1DLBA 3TD9A 2VYFA 3GB7C 2JCVA 2M6KA 2H2FA 5E3HA 3DXXA 2NMVA 1Y5RA 3D6AA 1U0RA 3OH8A 3A9UA 1FMCA 2OAGA 4KG7A 3WICA 2NZUG 1ZXLA 1NX9A 2B25A 3A2LA 3RS2A 5HRUA 1KC1A 3R7WA 4PN7A 3CMCO 4LF6O 3WAGA 1FJGB 2VQ3A 1CULC 3ZPCA 2Q50A 4HZUA 4IINA 4OB7A 3TCUA 1SBIA 3I28A 3D7RA 2ZXWC 1CUXA 4CDNA 4IFBA 1GA1A 1ZCJA 2MK3A 1ZM4A 4NCIA 1AHPA 3AVXA 3TCKA 1U2RA 3OUSA 5DCYA 2PCJA 3DDOA 1P1KA 4QPKA 4BE9A 5JCOA 2ZSFA 1AGPA 3LVBA 2XXBA 1VKJA 4ETWA 3VR3A 3HFRA 5DT9A 2J3KA 4F4DA 1HRKA 4RY2A 1N2JA 1N2ZA 4QARA 3I30X 1QP8A 1ZSNA 2Q3BA 4EG1A 3FMFA 2PVCA 3X1DA 4GG1A 1GY8A 1UMCB 3D59A 1OCOC 3O4VA 3I32A 1QO9A 4LYEA 4TM8A 1XU7A 2G0TA 4JLSA 5EKDA 1Y7HA 1SVSA 3I5YA 4ZVNA 3ESCA 3HCBA 3LBNA 3EXIB 2G71A 1YL7A 4F2DA 1WKQA 1IOVA 5ECWA 2WA3A 1QQ6A 3KZKA 4BMYA 4JELA 3SX0A 1VYHA 3EFOA 2ZETA 5HFMA 2BP7B 1Z35A 2QTAA 2WU0A 3OZTA 5EPUA 1OZGA 5SY6A 5JNUA 3H3FA 4N6NA 2B8EA 5K2MA 4OJMX 4YBZA 4L6CA 3LQ2A 2G38A 1BXGB 1S76D 1MIHA 1P9OA 5PGMA 4RTLA 2QR3A 3ANLA 2EARA 4KHPO 4Z9AA 3HVRA 4B44A 1V55B 2BOCC 4LJ4A 1EWKA 1XD2A 2FSVC 2P4SA 3PFCA 5C93A 2IIPA 3IJRA 3PP8A 2NAPA 1QFZA 3B1KA 5F5LA 4OHUA 3O4GA 3ECSA 5ALWA 1WTCA 1I94B 4IDQA 1PNMA 5CCBA 4S24A 2BONA 3HXTA 1U7WA 1XVAA 4PI2A 1X7YB 5JBIA 1OHHD 3AESB 3BTSA 1I3LA 3LX4A 4LJKA 2A0FA 2X5XA 3VX8A 4MAAA 2X6TA 3B6MA 5JS1A 4K1RA 1ZOOA 3RUFA 5BXQC 5LMNB 5ALOA 1W36C 3EGOA 2NLOA 1DFIA 2OENG 1JKFA 2XYHA 2VOJA 4RMHA 1PK8A 4P3NA 3O4JA 4CZ2A 4DYHA 3TLXA 3PTAA 1JHAA 5KX5B 1NPDA 2P62A 2ZD9A 4RQBA 5DW3A 2B4YA 4I9QA 3NAGA 4IOMA 3DJFA 1YR7A 3ZD6A 2FPGB 1ZI6A 3LBYA 1G98A 4LRWA 1L7VC 3A6KA 3RAEC 1KDRA 2X1HA 4ES6A 2JJ1D 3CCEV 2OUIA 4FK8A 4TWAA 1RHUA 1WEKA 2CFIA 1PWXA 1AURA 4B3CA 1Z0ZA 3OOSA 3QH4A 3EBOA 3WOHA 1Y34E 2VL7A 4NMLA 3DO8A 3Q3GE 5JAIA 2BRUC 1Z3AA 1MAUA 1DQPA 4BCBA 4DXHA 1ES9A 1P74A 3N27A 4L22A 1KF0A 3PPIA 4D0RA 3AVQA 3RU7A 1RPTA 1K5SA 3NU1A 3H1HH 2QJTA 2GN4A 1QYIA 3MCTA 4KRFA 4EHBA 3WDSA 3AHFA 4WKNA 4V38A 3OY7A 2ZTLA 3HMQA 2I91A 1VPDA 1MOFA 2JK5C 2GBLC 1IUPA 3EDRA 4LSGA 5J40A 5FPYA 1FRVA 3STTA 3BTUA 4RABA 4L8LA 4X44A 1T9HA 1E3TA 2AJCA 4UNPA 1DIRA 2I29A 3USES 3LRTA 5CA0F 1C7ZA 1NH2D 5TEWA 2YDYA 1Q81W 1F51E 5D7NA 5ICCA 1LDBA 3K8YA 2PS1A 3P2OA 3BD8A 4LGCA 4TLEA 4R7ZA 3IGAC 5BMVB 3KR9A 3R9IA 4I50A 1XEXB 5DHAA 4CTOA 2GB4A 2A5DA 1M8JA 2A67A 3WYDA 4HK4A 4OUDA 1E0KA 2DBVO 2QTZA 1J42A 2I99A 3UMCA 3ABMC 3H7AA 1FDSA 1A7AA 4WDRA 3PITA 5CNMA 2A79B 1ZSYA 1IXKA 4TYQA 3SVTA 1H2WA 3SYLA 3LVFO 1VHQA 1Z2GA 4F2WA 4GGOA 2AC7A 3OEHG 3ZLVA 1M74A 2WUVA 3T0FA 3V4ZA 1RPAA 4NABA 1AD2A 3HVHA 3RADC 2R2GA 3CTPA 2ZWMA 4FLWA 4RTKA 1N0HA 1RBYA 3I4LA 1NL3A 1OXKB 1JLKA 4Q66C 3FB8C 2B1RA 4DLRA 2IPAB 4ROSA 5FPHA 3TI9A 4EDFA 4I7EA 4UCOA 4R1MA 4F1WA 4WADA 1X1RA 3RVZA 4WKPA 4MYCA 4Z1MG 1RD4A 1J5XA 2L0XA 1SCKA 3F4BA 1NJGA 2PD4A 1S96A 3SD7A 2O96A 2B3JA 4B7EA 3I2HA 2VNKA 2XXAB 3H0KA 5GOZA 4U6SA 4DT1A 2HFEC 1J07A 4QASA 3RSGA 3SE0A 4UCWA 4YXWG 3THOA 2P9YA 1US8B 1X7WA 1RJWA 4PG5A 4AY6A 3OBBA 4HNAA 4MVJG 1JWBB 3TQQA 4BQSA 3LG2A 4KDCA 4N9QA 1COZA 2N47A 2ZKIA 3FPGA 4GSLA 3QXGA 1R0WA 1JMYA 1MF7A 5D3MA 2NR5A 2QM3A 4M9ZA 5EERA 4CKWA 1JZSA 1QX4A 1F2DA 2WFZA 2ILMA 1D7AA 4Y0VA 3DC5A 2P8JA 3LUDA 2FXIA 2N0SA 4FFDA 1EGMB 4AZTA 1VKRA 1O0SA 3SIXA 3R7NA 4QOGA 2HYDA 4X1IA 5A05A 4BO3A 5FOVA 1TTQB 1QFSA 1TK3A 4QPZA 1TYAE 4EPRA 4IPTA 2FSVA 3S29A 4FZ0A 3GCGA 1JHMA 1BMFA 2VDLB 5KTPA 4V2UA 2P4VA 3IUBA 3OA0A 1DLJA 3B77A 3DAFA 2R8YA 4ILKA 5C52B 2UUAO 4ARAA 4LCBA 3T9CA 1PFYA 1YS9A 3PRKE 1Q91A 1U5AA 1PQYA 1EBBA 3IB3A 3EQ9A 1K4KA 5AJUA 2R96A 4EHAA 4E13A 4QBKA 4R71A 5L40A 4J0KA 4JI8B 1GGEA 5JC1A 3THRA 1SWWA 1WB5A 3DVLA 5INTA 1TUIA 3KR1A 3UOGA 4XUGB 4M1ZA 1AV6A 5FORA 2WAOA 4BO6A 3G0GA 3IA7A 1XNQO 3QHPA 2HLPA 2XDAA 4GLFA 5JFTA 2P22C 1NW3A 2W22A 4WN9A 5I9TA 3JRWA 5CX1A 5BUSA 5IJ0B 2XTJA 2JJ2G 2OGTA 4Z51A 2XOKA 1R6AA 4WLVA 4D26A 3WRYC 2GPTA 1E3MA 3M3PA 2R97A 3LDHA 2C3OA 3H9JA 2HHCA 1C3LA 4UQOA 1EVKA 1JBKA 3R5FA 2FZEA 4W5OA 4WZBE 3VR0A 3KSBC 2FFBA 2HCBA 5JV5A 1JEOA 3BSWA 5AFSA 3IEPA 1IZYA 2BRUA 2OAP1 2DLNA 2JGIA 1A7KA 2DSTA 1ZCZA 1R88A 1B8PA 3GOQA 1MRSA 4XOUA 2R6R1 3SNHA 1M2GA 4KXXA 1D5WA 4CH3A 3A28A 2JGUA 3SOPA 2WZCA 1QPZA 4DLUA 2VP4A 4B3GA 2GBLA 3BJZA 3A2FA 5C1PA 3KT0A 2FR8C 3HJCA 2YWBA 4GGMX 2AG8A 1ORDA 1JAYA 2PGNA 3M3HA 5G4KB 1J5EB 1N5MA 2ZRGA 3LE8A 4KO2S 2Q6KA 4ZZIA 2XYRA 4NESA 3EMDA 1HLPA 3UB3A 1VQ8V 1DMSA 4MQFA 4UFNA 1MQSA 2X40A 3Q1LA 2XW6A 1V9SA 5MN5A 5ARBA 4CT0A 1AR5A 3GELA 5DBHX 4B47A 3T3EA 3H42B 2VWPA 3IRVA 3EOBI 3GFOA 4LV8B 4HB4A 4B6PA 2YV3A 5F5NA 5DPMA 2WJYA 2B2NA 1JHZA 3ZZTA 2GXAA 2B36A 1QQAA 1HM5A 1EG2A 2YC2C 3BFPA 4JQYA 1V55C 4C2UA 2HBQA 4FHGA 2A0YA 2QE7D 2ETXA 3DXZA 3WGUA 3K04A 1XKTA 4K28A 3KT6A 1L7EA 3IOYA 3OCQA 2WY2D 1CY6A 2FAXA 3CUYA 4U1RA 3B89A 4NHEA 1DDGA 1NQ5A 1XVLA 2QDKA 4ZC1A 3RVJA 2FEAA 3F0TA 1PGJA 3FBWA 3E6AA 4JYAO 3VR1A 1ADJA 4CM6A 1UIRA 1V4VA 1HOTA 1T1GA 2WU1A 3LSYA 1E18A 2QX4A 3SZRA 4R8KA 5ALGA 3AP3A 1QHFA 1XTSA 3JQGA 4IW3B 3DFIA 4W6ZA 4U3FH 4PLVA 1U31A 3ZK9A 4AKGA 3ZPXA 1PW5A 2ZRLA 4UUQA 4XB1A 4C1NA 1QHEA 4JKOA 1ECJA 3MYRA 3L0ZA 5EHGA 3TGUH 1MOPA 3QOWA 1N8TA 2X5KO 2WHXA 1X59A 5HIIA 4ETNA 3QEJA 5K3AA 2O2ZA 3AJ8A 3IEXA 2PLFA 4P7BA 4CLOA 5DCLA 1JEAA 4P9DA 2C78A 3LLVA 5BN4B 4BE4A 3BVPA 4MKHA 4DTIA 1AGNA 4MGIR 3WLRA 1F6WA 1P61B 2YXDA 3W1EA 1CP3A 4FR2A 3A10A 5IK2D 3HDHA 1I24A 4XVCA 3SYNA 3LDEA 5BQ5A 5JQGB 2HJFC 1C1HA 4HX5A 3LW8A 4CL3A 2XE6A 2R8PA 4L8GA 5E9AA 4ND1A 3K70D 1BU8A 3QMMA 3GEMA 5IZCC 1N1DA 4X3PA 2REQA 4GKKO 2BT4A 3CKLA 1TUEA 4ER6A 2P7TC 1IRIA 5CR9A 4PXSA 4X8OA 1M1XB 1PR0A 4PX5A 5F7OA 3LLUA 2V96A 4BNDB 2C7PA 1XTTA 5JANA 1N2HA 4TLMB 2KG7B 4X65O 4KLRA 1U7TA 4TL7A 1BSVA 3HHEA 4LDRA 4QFMA 2QQFA 2OK7A 4GWLA 1YCHA 1JPNA 4P7FA 4YS6A 4FINA 5CNKA 4LWZA 3SJUA 2J5KA 3THWB 4MQEB 1V8PA 2C7QA 3G5LA 1KI8A 2I1LA 5LQNA 5A5DA 3QE2A 1D0SA 4WZAB 3GCWA 1XC7A 2O0MA 1NLMA 3AR2A 1M6HA 2G1JA 4EHJA 1C3XA 2JKZA 1HY3A 4G5GA 4C7KA 5HS6A 3WRYA 4L74A 4IV0A 3S2UA 4I66A 2BSQA 3DR3A 4YC7A 3N9IA 1M34B 3Q8LA 2AMVA 3T4XA 3RIHA 3EGIA 4HAVA 1N8RW 1E4YA 4HDMB 5NULA 4M0KA 4PIPA 1NXTA 2ECKA 5HOQA 1OILA 2IXGA 3U3RA 1JWAB 3LECA 1LCIA 4I1YA 4MIEA 1Y7IA 4CVNA 3SC6A 4R81A 2AFIB 5CIYA 1A8SA 1P7VA 4YASA 1MVOA 1WA8A 4F3KA 2QWOB 5AJWA 4CLRB 2WJGA 1VSBA 2P68A 1TAUA 2X22A 1E9DA 2XHZA 1MAVA 3JQ7B 3H5IA 3GIDA 3S27A 2JVJA 2C57A 3RUCA 5EUMA 1LNQA 1UOPA 1CY4A 2FR8A 1Z15A 3D1VA 1UMCA 3P0JA 1DOZA 3P52A 4E14A 3IOCA 4J8PA 5IBPA 5FPQA 3BDIA 2IXAA 3A4YA 2WG2A 3D6MA 3TXSA 2F66C 5AICA 2XA2A 2H11A 4B6GA 5DBEX 2DOKA 3LA8A 3EXIA 4DRYA 1QHNA 2HPHA 2NZYA 1I30A 3PFNA 3UV3A 2PJDA 2CFRA 4YDHB 4CGYA 2OKGA 1VP7A 4RA6B 2ZBPA 1CX9B 3G2NA 2WQZA 4K6MA 2JFOA 4RENA 5EJ6A 2PN1A 5JPCA 2WVAA 3G6BA 2BP7A 2QAGB 3LUBA 4JEIA 1PD1A 3W7VA 4K2HA 3VNAA 1KIFA 1L5LA 2G88A 1GHTA 3SHFA 3RVKA 3L7DA 1WMAA 5EZ6B 4Z3KA 1BXGA 2OHVA 1V4BA 3PRJA 2G8NA 4AKTA 1KZ7B 2WD7A 2UYYA 1A04A 2VP9A 2C2GA 3AVYA 1Z33A 3BJMA 4KEAA 5HCNA 4RQAA 5K01A 1Y1SA 6REQA 1YGPA 3DMFA 4V0ME 2FUNB 2QAJA 2XB9A 2BFWA 4C0AC 1DC6A 3ZHCA 3PVZA 4BBJA 1D2NA 4RZ2A 4BEVA 2IW1A 4Z9BA 4BLVA 3KFLA 4HX2A 4OSOA 4EY7A 3RZVA 4MGYR 3L75H 3OF2A 4P82A 2CZQA 4Y18A 1QRRA 4DCNA 4ETIA 3T3OA 4WBNB 1F3OA 3CH4B 1SRQA 1DO2A 3OTOO 4BX8A 3E2MA 4R2XA 2J0UA 3PXCX 4BJ1A 3UZUA 3V00A 4BYGA 1K97A 1WBJB 4LVUA 1D5AA 2XBLA 1B3RA 3S4YA 1M54A 3VX3A 3I39X 1M76A 1L5WA 4V1CI 4P83A 4IIYA 2Q1YA 4HAYA 1J70A 4ZOEA 3ZNQA 3PX2A 3NM6B 2JFBA 2INGX 3Q4GA 1Q7EA 2CL0X 1O97C 5KTTA 5GWXA 3OCYA 2RGUA 4DC9A 4ZD4A 1NNLA 4OGQB 2Z6VA 2QLTA 2FPGA 5CYOA 2JIRA 2Z6QA 3ZIDA 1DU4A 5FUVA 1TAQA 3KVVA 1KYWA 4C0LA 2QN9A 5TC4A 1JXOA 1HR0B 1U94A 2P6JA 1JHDA 5JXGA 3IAM6 1E0AA 3RLFA 4WUVA 3ROKA 5IBQA 4U5XA 2NYVA 4G3MA 1O08A 3RSFA 1JCHA 1GAXA 3ZMZA 2Y3IA 4Q6GA 4HPJB 4DIBA 3C14C 3OIFA 5FAKA 2ZZKA 4DQUA 2R8EA 1QUEA 2JBAA 5IZCA 5ILQA 4Z9YA 1N0UA 4MWEA 3V4FA 3RVNA 3SBOA 4X5OA 1I8TA 5DMXA 4P3OA 3R5HA 2IHYA 3UJ7A 1SHTX 1KK2A 2Q1XA