1G8MA

Crystal structure of avian atic, a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis at 1.75 ang. resolution
Total Genus 207
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
207
sequence length
590
structure length
590
Chain Sequence
RQQLALLSVSEKAGLVEFARSLNALGLGLIASGGTATALRDAGLPVRDVSDLTGFPEMLGGRVKTLHPAVHAGILARNIPEDNADMNKQDFSLVRVVVCNLYPFVKTVSSPGVTVPEAVEKIDIGGVALLRAAAKNHARVTVVCDPADYSSVAKEMAASKDKDTSVETRRHLALKAFTHTAQYDAAISDYFRKEYSKGVSQLPLRYGMNPHQSPAQLYTTRPKLPLTVVNGSPGFINLCDALNAWQLVKELKQALGIPAAASFKHVSPAGAAVGIPLSEEEAQVCMVHDLHKTLTPLASAYARSRGADRMSSFGDFIALSDICDVPTAKIISREVSDGVVAPGYEEEALKILSKKKNGGYCVLQMDPNYEPDDNEIRTLYGLQLMQKRNNAVIDRSLFKNIVTKNKTLPESAVRDLIVASIAVKYTQSNSVCYAKDGQVIGIGAGQQSRIHCTRLAGDKANSWWLRHHPRVLSMKFKAGVKRAEVSNAIDQYVTGTIGEDEDLVKWQAMFEEVPAQLTEAEKKQWIAKLTAVSLSSDAFFPFRDNVDRAKRIGVQFIVAPSGSAADEVVIEACNELGITLIHTNLRLFHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords AICAR TRANSFORMYLASE-IMP CYCLOHYDROLASE
publication title Crystal structure of a bifunctional transformylase and cyclohydrolase enzyme in purine biosynthesis.
pubmed doi rcsb
source organism Gallus gallus
molecule tags Transferase, hydrolase
total genus 207
structure length 590
sequence length 590
chains with identical sequence B
ec nomenclature ec 2.1.2.3: Phosphoribosylaminoimidazolecarboxamide formyltransferase.
pdb deposition date 2000-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01808 AICARFT_IMPCHas AICARFT/IMPCHase bienzyme
A PF02142 MGS MGS-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.440 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1g8mA01
3.40.50.1380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Methylglyoxal synthase-like domain 1g8mA04
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA03
3.40.140.20 Alpha Beta 3-Layer(aba) Sandwich Cytidine Deaminase; domain 2 Cytidine Deaminase; domain 2 1g8mA02
1S8AA 4A1OA 1OZ0A 2B1IA 2IU0A 1T36A 1CE8A 1B93A 1KEEA 5H3LA 2B1GA 1THZA 1CS0A 1PKXA 4EHIA 1M9NA 1M6VA 1ZCZA 2YVQA 3ZZMA 1PL0A 1C3OA 1G8MA 2X8WA 1EGHA 1S89A 1BXRA 1JDBB 2XW6A 1IK4A 1P4RA 1A9XA 1VMDA 2IU3A 1C30A 1WO8A
chains in the Genus database with same CATH superfamily
3D02A 2JD0A 4RFSB 1R0XA 4QHYA 5DEDA 3ZDYB 1XZJA 5CDUA 3EVEA 1T1EA 1DG9A 2ZE7A 1KQOA 3G5LA 4P5DA 1NTMH 3KSMA 3OZAA 4EATA 2H9YA 2H2HA 4TL9A 5HK8A 1OAOA 2RH8A 4J9VA 1VLHA 2BSXA 3QNMA 5JV5A 5LZ5A 3VPCA 4R2XA 1R66A 1RTKA 5EYPB 5DM4A 1TM1E 4YV2A 3TCKA 4BCBA 5CTJA 2QB5A 2Q2VA 3EVBA 3ENKA 1SUPA 5LGUA 1SU8A 4I50B 2JIOA 5F7OA 3MGBA 1XVUA 1LA2A 4BZQA 2ID8A 1IRIA 1YL7A 2HO4A 3AUUA 4B7XA 1MX3A 5LDHA 3W2GA 5IDXA 2AEJA 2PT5A 4J3JA 3L6UA 4ZT6A 1XXHE 1QP8A 4AZVA 3W7TA 3UPTA 4PIVA 1ICEA 2EILC 3STWA 2AOVA 1K7EB 1TF7A 3FR7A 4G36A 5IW8A 1VLQA 3F71A 5FPYA 1KJNA 1QVFU 1G7TA 1TW2A 5KQMA 1ZCFA 2R6ZA 1M54A 4K05A 4UM9D 3ROMA 1R6XA 5DI3A 4G9GA 4MZDA 3I9JA 4U2CA 3PQ8A 4WN9B 3P9QA 4DIEA 3P0JA 3K79A 5K1PA 2XNSA 3IO3A 3VQTA 4OHUA 2QTAA 4QT4A 1ST3A 3B8EA 2IH5A 3RUIA 3QWIA 4UHKA 4EIWA 2RGDA 1TFRA 2JS3A 1ESCA 1QLNA 4TS1A 4HUQA 2FPIB 2X58A 1J5XA 4ZD5A 1SOAA 2ZBRA 4IIEA 2BM0A 1JAYA 3OU6A 3ML0A 1VIDA 1C9YA 2FB9A 2XYHA 3K32A 1YTFD 2Q4DA 3LUHA 3UTDA 3ZHBA 3I55V 4FR5A 4C04A 1WLYA 1B8OA 2ZITA 5EXTA 1FAFA 1VQLV 2HHHO 3JQDA 2YJGA 3QHAA 2CVOA 4NYJQ 1C7RA 2H1WA 4MRVA 1X1BA 4FFVA 2HAEA 4RZQA 3HA7A 2FP3A 4IIYA 1XVLA 2QLNA 3D2AA 5JALA 3CX8A 4LBWA 5KYXB 4RU1A 4JC5A 3C3SA 1SC4A 1RS0A 4ZJZA 1XP5A 3VR6H 2V7BA 1SY7A 1Z35A 3GVPA 3PEVA 4WLNA 5JSUA 3OTOO 2PSEA 3LT1A 1JH9A 3H5WA 5E2IA 4JKIA 3W5JA 1AQIA 3Q10A 3C48A 5LZ4A 1BA2A 4HNTA 2P4KA 5ARCA 3O38A 4CEJB 1W4CA 1SVLA 2XITA 1XD9A 3GJRA 2ID9A 3W7UA 2JK1A 1LUVA 4KXFB 3W0LB 3QTCA 5KJ1A 2XGMA 2Z6QA 4U63A 2PQMA 2UZ1A 4LZPA 2OLEA 3MTDA 2XYPA 5DM2A 3QE2A 1F5NA 2GPBA 2AN3A 3BA8A 5L3EA 4GOND 3WKAA 4ZYUA 1HLDA 3DMFA 4X1IA 2DLCX 4LBZA 1XXLA 4BTEA 2X2OA 5J58A 2QAJA 2J0UB 3GVXA 5CU7A 1FFDA 3PHGA 1T3TA 1FTNA 3NNSA 4TQGA 4G28B 3N28A 3V2GA 1QQCA 1N1GA 2I1VB 3U4CA 4G23A 4E51A 4M9UA 4W5WA 1MO4A 3AHDA 2H1LA 3ISVA 3M83A 3K8OE 3WL6A 2W6JG 4PPNA 1KO4A 3H2YA 1GDTA 3ZE1B 3NT2A 1K5HA 4LGCA 4YNBA 2X0RA 4JAUA 4F8YA 2NVBA 4RORA 4OX9O 2R5NA 1EN5A 3IE2A 4N4AA 1OJLA 3DF7A 2PQ6A 2PPLA 5F77A 4DUGA 1QVGU 5B58T 4RACA 4IEIA 1JG7A 1MZVA 1ZD5A 2PXAA 1SUAA 3LHFA 1QRSA 4U2FA 4FZRA 1GR0A 3IAFA 1NJ8A 5CYOA 2O2JA 4QL3A 1EFLA 4B45A 2ZDHA 4FQ5A 2BJVA 3U1TA 2LW1A 2J3DA 4BMPB 4D9IA 1RSZA 4RXUA 3SMVA 4BNTA 4BX3A 4DW8A 2R4UA 1YNOA 1EX1A 4HMOA 4MS3B 2BGNA 2GK7A 4QUIA 4JN6B 1W1WA 4R8RA 1SCNE 1Q14A 4RD2A 4ER0A 2Z9BA 3N0TA 4YRNA 1OU0A 1JMKC 3QXCA 3M49A 1JG3A 1U0OC 1RM1B 3ZJTA 4OXQA 3AG5A 1EB9A 5EEGA 4C7UA 3EGCA 3L5OA 4P58A 3SQDA 3A0RB 4JH0A 4BLTA 2YEVB 5J3JA 2IOYA 2DPXA 1XDZA 5FL7A 4BQQA 2JBWA 1E7QA 1O95C 3O0TA 2XD4A 1WZEA 1WSBA 3ZV6A 4D96A 1F2VA 4M1KA 1ZD8A 4S1VA 2ETNA 1HGXA 3T5DA 2VNHA 2GXUA 2PIDA 4LFAO 2GCOA 3M5WA 1UMBB 1XWIA 3X2SA 2ZIUB 2XUZA 1YCIA 1FKAO 3GEDA 4LQCA 4NAHA 3VO8A 4J42A 3EQ7A 3NRJA 1J6UA 4LHYA 2C3MA 2YYYA 5EZYA 4WZAA 1KQFA 1OAAA 2GGSA 4AYWA 4XDZA 2CUGA 1BDHA 2H31A 3OAAA 5GINE 1TAHA 4N54A 4ZYXA 4ND5A 2WVGA 4RNCA 3H65A 3OLVA 3UZUA 3QVXA 4P9PA 4IF4A 5IYZB 1LTQA 4LHSA 1HM5A 3K9GA 4ARCA 3NAMA 3DT8A 3S8YA 3B7PA 3LHIA 1T29A 1JTEA 5J5VA 4KPGA 4DTCA 4CL8A 3EFBA 4V0RA 1KJWA 4DNQA 3TW0A 1PGOA 3AINA 1OZAA 5DCWA 4R9VA 1QTNA 4KQFA 2BL4A 2JIZD 2PKRA 4FOSA 1SQVH 4RLQA 3MPUA 2AMLA 1II0A 3MWEB 2IHJA 4K7JA 4C43A 2O8BA 3DFMA 1MX1A 4XQGA 2P2YA 3TMYA 1ZVQA 3IMCA 4WZBB 4A27A 2AJDA 1W46A 2A9OA 1V1JA 1BL8A 2G8NA 2OIGA 1KI6B 5LBTA 4ZAGA 3IQHX 2F4VO 2L82A 3NATA 4HXGA 4R71A 3NIWA 5EUQB 4FB5A 2DF8A 2ZVJA 1Z6GA 3D8CA 1O6CA 3FYUC 4QYIB 5ALNA 2VJMA 3L7MA 4LMPA 5C8YA 4AQYB 4W9MC 5A5EA 4FN5A 1UKBA 3NVMB 1WUHS 3ADKA 2I1LA 5D1NA 1XZ8A 3HPQA 1XMXA 1AP6A 2L2QA 2LCFA 3H19A 4P7JA 4ZICA 2XUIA 3H11A 2IV3A 2J3EA 2Y4TA 5EZYF 3NHSA 3G5AA 2NIPA 3T99A 1R3IC 1ODCA 4R1SA 4RY8A 2A9RA 4ER5A 4Y2RA 3QA3E 2GSWA 2XDQA 1ZN7A 4MA4A 4BAGA 5FNZA 3JAKA 3DTTA 4CCWA 4I6EA 4FMBB 4F11A 3CWZA 2R9VA 1F0PA 2YH2A 1WRBA 4W4LA 4A0GA 5FTKA 2WUDA 4HEJA 3S7ZA 4RXMA 2CLHB 2ZRDA 4ENSA 1E4EA 2AFIB 4UMEA 2REQA 1USIA 2V54A 4PHFA 1D04A 3U4AA 2RI6A 3NS7A 4ZKEA 1H8HA 4L9WA 4PICA 3DHVA 5FOTA 1XNQO 2CNKA 1PZEA 2F48A 4GXTA 2I62A 3EXAA 2YYSA 1A98A 4LYFA 2IEIA 1QU7A 3BRSA 1YE3A 1DJLA 2VQEB 3E8GA 4PZCA 2WYVA 4MYTA 3VZDA 2G6TA 2VUSA 1F2TB 4OBBA 1NM5C 1YIJV 4B7AA 4HQ6A 1DJQA 3LH5A 3CEMA 4OBWA 4JBYA 2RCYA 3WJ2A 1WUIS 4P3OA 1TIBA 2PIAA 3DOUA 2WKRA 5IUKC 1KI2A 1NQTA 5C8YF 3LF1A 3V4OA 3FZYA 1U1CA 1GKUB 4UVAA 1UMCB 4KAAA 2V0GA 1L3BA 3QMPA 2FDRA 3AEXA 4UKDA 4EJ2A 4RY2A 1L0BA 2WQ6A 3AKCA 4A03A 1A82A 4DHWA 3WLHA 3O9MA 1D0IA 1SELA 3D7MA 2P6JA 2CYAA 2G76A 1KJ9A 4BN0A 4DBVO 4TV9A 4E1VA 4XQEA 1Y4AE 3JYQA 2J0SA 1W4AA 5CB0A 4GG1A 4PA7A 4TQDA 2H17A 3MG9A 4INAA 5IN5A 3T7IA 3PNPA 1U1FA 4KMMA 3AUKA 4IWXA 2RK6A 3MLBA 4BNLA 3WMXA 3TXSA 4WD3A 2AZ2A 3FPJA 3OO1A 4TL7A 1JB1A 3L40A 4PQGA 3R74A 1EZ4A 4MVQA 2RAPA 2NNWB 4AT1A 2I3DA 2FR8C 3JZIA 3KDAA 1M2VA 4NDNE 3QO5A 1XN1A 5JXGA 1CF4A 1N77A 3WJ7A 4X1OA 1C1DA 3QVTA 3O8DA 2Y9PB 5F12A 2BEWA 2W48A 1P39A 1P7BA 3WDSA 2LD4A 3ZWOA 4HN9A 4QSMA 4FJ2A 1PTKA 4DANA 3JZMA 3K1YA 1XYVA 3W4JA 3J81k 2IYUA 1Z4JA 2AB0A 4EA6A 4COOA 5BMVA 3EGXA 1AI5A 3TCXB 2G38A 3ZWPA 4RJIA 1A2KC 4ZJPA 4UUOA 3FUCA 1IX9A 3SOPA 1JG6A 4K1XA 3HXPA 4DMCA 2FZCA 4WK4B 3UENA 2B82A 1E2BA 4ACAA 2AD1A 4CMIA 2VWQA 1XTUA 3F1LA 2O2CA 3W3ZB 1W19A 3DHWC 1FYFA 1YZVA 3NM6B 4LTNA 5GW7A 2Z3GA 5CDHA 3E0XA 4NQLA 3N8HA 3R76A 5FUBA 3CM0A 1TLFA 3NXKA 2AFHE 3O2QB 1K8YB 1D1PA 1HX7A 1HT2E 4DR2O 3NFYA 3TQTA 5KHHA 4HWOA 4HGOA 3S5UA 4OVKA 3DC6A 2Q5EA 3IOEA 3NDIA 2E4AA 3M5DA 4UUMA 1QG4A 3GFPA 1KMNA 4EHJA 4Z9YA 1SK8A 3VU9A 4K0RA 1TA9A 2EL9A 4K3VA 1W0KA 3FB5C 3QKIA 3ORHA 1GYQA 2O1SA 2YUAA 2QD2A 2OL4A 5M3BA 2ZIAA 3PGMA 3ETDA 3KHSA 3DTNA 1COWD 3R0IA 2O96A 2NPOA 5ALDA 3LUDA 1QAOA 3UK0A 3U19A 1L5VA 1K8AW 5ICEA 1Z5UA 4O4IB 3UBTA 4JI3B 5G1NA 2WPDA 1SRYA 1I3KA 3CZ4A 2V9ZA 2HF9A 4GKBA 2F66C 3ZWVA 2HLHA 1O2DA 5JSHA 3ZVKA 3NP9A 3TRJA 2ZYGA 1V5EA 1KNQA 3KQHA 1VRCA 4ICIA 3SSNA 4YA6A 3BTVA 1D8TA 4ZOLB 2ZYSA 2F23A 2CJXA 4X92A 1N6PA 4KO1S 5BMVF 3VM6A 4RLHA 1NVWQ 4S1NA 1KMCA 3SYLA 1S3FA 3M33A 2RH4A 2I2FA 2R96A 3IR5A 4QE9A 7REQB 1DUVG 3GNTA 3SFVA 3B9PA 4J6FA 5HILA 3R5FA 5CD9A 4PTLA 3DE7X 4E1AA 1F23A 2YJ4A 3CPSA 3UT6A 2ECOA 2CKDA 1R5TA 1LPPA 5T8KC 4XUGB 3QI2A 5JAOA 1WXIA 3T9BA 4GD3Q 4O8YB 3JQPA 1GNPA 1XEWY 2E4WA 1JEAA 3L1JA 4I4TB 1P7PA 3TLZA 2IZZA 5ESRA 5HMMA 2ZXEA 3RJTA 4EZEA 2P4EA 1DWUA 5E3JA 4IOJA 1NIJA 1PWEA 3QBDA 5IXJA 4UHEA 4NYJR 1O4VA 1HNZO 1UZNA 3AQ4A 3R2NA 5MDHA 4BCDA 2NSHA 1TT5B 3DP9A 1NVPD 5FOXA 1D6MA 4CKBA 3CR3C 2CVZA 4TKZA 3H6HA 3D0OA 2HA0A 2PX8A 3ONDA 3NBZC 1R4MB 4CF6A 3KOXA 1Y74A 1WCYA 4X8MA 4MTFA 1POWA 1JHQA 2VCYA 4TZ6A 2JFWA 3EFHA 1XGKA 1NXWA 4ARSA 4MRMA 1Z2EA 1APBA 2XCUA 3A3OA 3TW8A 3UV7A 4WVLA 4MUEA 2M6YA 1DE0A 2B98A 3HUFA 1RP3B 2GWRA 1Y9EA 4MSQA 4DLAA 3RFTA 3KB8A 1ZM7A 4A2WA 2E18A 1T8UA 2PRYA 2HMVA 1DC8A 1YQTA 4FKBA 2H4XA 4P5EA 3K0CA 1STOA 3CHYA 4BKUA 5IYCO 4BNXA 4QO7A 1NJ1A 4NK4A 4QICA 2Z2ZA 1UKAA 4DQUA 3TZEA 1PR3A 2VCHA 4N0QA 4Q03A 1C0EA 1AKTA 3DUFB 4PXAA 4KDFA 5BRAA 4PONA 2DPYA 5HIMA 4UHHA 1SCJA 1FFBA 3A9TA 1GPDG 1DFIA 1YRQA 4B5KA 1K3EA 5F64A 4X3CA 5LBQA 3ZVMA 1PL8A 2BFEA 1TYDE 4I99A 1RHRA 1JR3E 3DA8A 1HE1C 1NBAA 5LJIA 3EXIA 3LPMA 1XD2A 1UQUA 2Q5ZA 3KZXA 4JHXA 1Y0BA 2A0YA 4PGMA 2VK4A 2XTJA 3K58A 1DARA 2WT9A 2HIGA 3EZ6A 3NHBA 4UU0A 4CL3A 3D2LA 2JHPA 3DQPA 3T1TA 2J9RA 5HNKA 3R5XA 4G27B 4BHTA 2F6RA 3LCVB 4BO7A 1QORA 4E22A 3V34A 2YV3A 5I9TA 2QIPA 4W99A 4LTMA 3BA9A 4WLEA 1XKQA 1Z0IA 5K7SA 1YIDA 5CFNA 3OWOA 2GLTA 1WVMA 3JVDA 3VSAA 3UJAA 3TVTA 4DIKA 2OCLA 3FBWA 4PS1A 4ZPXA 1TC1A 4HDNB 1NSTA 3PQCA 1PX2A 2WWFA 3O74A 4HZUA 2GF2A 1DEOA 4WACA 4DUZO 1TEVA 2FTKE 3WNVA 4EUEA 4LF6O 1RADA 5EJMA 2W6PA 2JGAA 1X0XA 2P78A 5K0BA 1PQPA 3A1CA 5ESWA 3OE5A 4ISCA 4R4JA 4RVGA 1KMMA 5DBGA 4NENA 2BELA 1VQ6V 1X87A 3PR1A 1DUSA 3RTDA 1DB3A 2NU9B 3RGBA 3I4FA 1QR6A 3FMFA 4LHXA 5DM60 3OF5A 1X2BA 4C07A 3LC0A 1HYGA 2QLFA 3W7AA 2OLJA 1K9SA 3K16A 4F71A 5M29A 4R3UC 4TKLA 3ZDEA 2EEPA 4GPD1 2XCRB 3HRKA 4GX2A 2PNJA 3HBJA 1Q1EA 4P7BA 3KR1A 2YWBA 2HB6A 3L07A 4V0KA 1JP7A 4WFIA 3C43A 3I8SA 2A1UA 3VR4A 2O8NA 3UJ8A 4NFHA 4WCVA 4X8AA 1S2IA 1UBFA 3ET5A 2RAFA 2Y1KA 4E1BA 3CD6V 4HHEA 2BMFA 2F8TA 5LP1A 1XJWA 3AX6A 1CDEA 4P4GA 1BYIA 4RIHA 3ROXA 1I5RA 2V1UA 1PZGA 4HG2A 4EP1A 4L57A 1PFUA 2ZJ3A 1SUWA 5EGNA 2NNLD 1PWZA 3PC2A 3SFTA 3UFBA 4QRHA 2D8MA 3X1DA 4M6WA 4Y2QA 4M21A 1DTWB 3DWEX 3I04M 4UAGA 1RQGA 4EI7A 5KVCA 5MN4A 4NC9A 3KYJB 2QL6A 2R86A 5BUZA 4XCQA 4MV5A 4CM6A 4F4UA 1JXAA 3K2BA 2KB1A 1HYBA 2QVXX 1HMPA 1WDWB 1THZA 4GPBA 5ITZB 3P2IA 3INYA 4E14A 4TYPA 1Y1KE 2EFCB 3Q0EA 3UMFA 2WV7A 1M0EA 3V8PA 2Q0SA 5D01A 1ZOOA 3APQA 1RM3A 2CLIB 5LYJB 4DKJA 2V5UA 3WKBA 5IZCC 2CV0A 1NQ5A 3TD2A 2V3VA 3WLPA 4G1UC 4JUCA 1Z5OA 4K26A 2NU8B 1XTIA 4A9AA 3NTRA 3NTVA 4LGMA 3PUZA 1QNMA 2GZAA 4FCWA 2EP5A 3CG0A 1N7IA 4IYIA 1OAKA 2XZLA 2I4MA 4UTNA 1I2DA 1PL0A 2QZ9A 3SYAA 2P62A 3F49S 4QSHA 1GL7A 3KPJA 1JNXX 4BVAA 3EXFA 5FUYA 4PAWA 3CIFA 1U97A 5AXAA 4O4JB 2DT8A 3VI4B 1EI9A 2E4VA 4HNHA 3GK3A 3I9NA 3FRJA 2R66A 1K8QA 2NUPB 1FNBA 1QE0A 3OLQA 4UFNA 2GCEA 2P2CA 2V8BA 5B1DA 5CGZA 4B43A 3E5NA 4BMSA 3L0CA 1WNSA 4YB8A 2H2DA 5FP0A 2G28A 2Y67A 3HDHA 2QAGC 1BWRA 2DPMA 1PGJA 1UXJA 4KH0A 3OLYA 2PRIA 3ELUA 3REGA 5LQUA 4OMDA 4CQMB 5B1AC 1H0RA 5LXTB 1FIUA 4BQSA 4WFAV 1VSQA 1M3SA 3IIEA 4DM7A 1QHHA 3KWLA 1L5HB 4YRGA 2ZSFA 1VHQA 2C7PA 4ALLA 5AM3A 4D41A 1XDSA 2WSIA 1ND6A 3F97A 1FRVA 1RCFA 1JSXA 5U4XA 1JR4A 1KMHB 3KQMA 1J8YF 2VNIA 1GHTA 4FCTA 1E2JA 2R2AA 1KZ9A 2EX3A 2NNUA 2IFTA 3VUFA 2GNOA 4EG6A 4FSDA 1JLKA 3GT4A 3A4YA 3KC2A 5T6MA 2GI4A 2F2TA 1H3FA 4GQIA 1M2OA 2HTEA 1GH6A 3WFZA 2E7ZA 2ZAOA 1WCXA 3HJGA 3ON5A 3HJTA 3LX4A 3O26A 5LL6Y 1N8SA 2QTRA 4W5NA 1KC8W 2CK3G 3Q1KA 4M86A 4JI1B 1R64A 3IBYA 1IXYA 3JQ9C 2YWRA 3S2IA 1Y9AA 3GUUA 5EKXA 4IKOA 4BO3A 4R98A 3WSTA 1T15A 2BCCH 3WADA 1NP3A 3IV9A 2REXB 3PL5A 5AKXA 3JQAA 1C4OA 3AIIA 5U9CA 2Z57A 5ENVA 4TRMA 3TPFA 4MR7A 5KJCA 4J10A 3B2NA 5H16A 1ZJ5A 1UBKS 4EGSA 1XAJA 4TMWA 1OBCA 3DAPA 2PMFA 4IIFA 4QECA 1AHHA 4XI9A 5DYNA 2MSDB 1Z0UA 3IX7A 2EILB 1QYCA 1U0EA 3UK1A 1FA9A 3JQBA 2GRUA 1H0KA 5KTNA 1NMXA 2HV8A 3VA7A 3OFSA 2HSGA 4QEZA 1ZUQA 1RRFA 4BQPA 1DC5A 3N5KA 4E08A 2IOQA 2HSZA 2J59A 3D81A 3ME5A 1KHTA 5GVSA 2LGJA 1MQAA 5G3YA 1Y1LA 3ZDQA 4BB6A 1T5LA 1XMQO 3ESYA 4MDFA 5DECA 2Z2XA 3BHJA 3IV6A 3L6CA 4KB5A 4CMAA 1C5KA 4M7WA 2ZUVA 2BONA 2GCIA 5TS3A 2CL6X 1NLUA 4EM6A 2R11A 1UPBA 4TUYB 5KQRA 3JQFC 1Z2PX 1VHJA 1I33A 1KJZA 4B7ZA 2HRZA 3S2YA 3RU3A 4PHZA 2CDYA 1FMTA 2H4ZA 3DMDA 4ZZ2A 4GR5A 4P7GA 1UAAA 4WA8A 5BV8A 3W5DA 5CVEA 4QPPA 4MGEA 3R77A 4LZWA 2F9FA 4YT8A 1N4DA 1ZK3A 5KTTA 2BKXA 1X7WB 4OSPA 4UVGA 5H4GA 3PD7A 5EQJB 3MD9A 4RA6A 3MHPA 1O03A 2V97A 1R0LA 2I76A 3RSGA 2CGEA 4J0JA 1JB9A 5E6UA 3ZLTA 1UDCA 2NXEA 4P54A 1QGDA 2R6AA 3RNOA 3HJUA 1SIWA 3UJBA 1E92A 1PR4A 2JGDB 3FFXA 3I9LA 5K9ZA 1NU1H 4WIGA 2RGRA 3TMAA 3I5UA 2RN9A 2OB2A 2H3EA 3RRNA 3UTCA 2FW7A 5AQEA 1VQ9V 3EAQA 3LT5A 2VDPB 4RGQA 4JAVC 5F7JA 4DJTA 1V5IA 1XF9A 4W82A 4MYDA 3UMVA 4BQNA 1N32O 4QU0A 3DVQX 1Z6PA 4MW7A 4YJ2A 2Q73A 3KVYA 4LJSA 3H7IA 3IQXA 4FLMA 2I8CA 3B7WA 2AFRA 4MEBA 2XOEA 3RAEC 2BM8A 3T7RA 3L8ZA 3V4LA 2BZ1A 2IYLD 3TGLA 1P2SA 4DT1B 3AZOA 3IUSA 3G17A 1SOWA 1HQYE 1E79A 1Y1TA 1MOPA 4OKIA 4LVOA 2KSQA 3GNQA 3QJGA 3NHYA 3I83A 2IP2A 1C9EA 1TW3A 2AKYA 4R1MA 1R5XA 1R27A 3O2NA 4BVLA 4FYJA 1RHMA 1X59A 2JAUA 2QJTA 3X1ZA 4J7ZA 2BHTA 3WYCA 2XXBA 4X66B 5A4JA 4HYEA 4DMRA 3V7UA 2J87A 5HTKA 4J0QA 1B6RA 5A2GA 1TU4A 4RQUA 4O59O 3CN7A 3OJFA 5C2OA 2CTQA 2PLNA 4PX5A 4IPTA 1VF7A 2I33A 4XM0A 1VLLA 2R62A 5IAGA 2B4TO 2UUCO 3E8HA 3ZS8C 2FRDA 2NO7A 3IBFA 2OHHA 3A0HZ 4A8TA 4DZTA 4F3YA 1A9QA 3FFBA 1P7WA 3T0FA 3C2QA 4YALA 4EY7A 1LUAA 4N9WA 1EDBA 3KUXA 5AK3A 3DOHA 2EIKB 3SS7X 2ZIGA 1A9PA 4CG3A 3PJRA 1VF6A 1P45A 2X14A 1K73W 1UL1X 1MA0A 1CIJA 1G8SA 3QWAA 3FAVB 1FZQA 4E3ZA 4TQAA 5L3SB 1GZ5A 2B3DA 4KMRA 1FFGA 4XTCS 1Y3AA 4RJKA 3CVOA 4ANFA 1RHKA 1GV1A 1ALNA 4YJ2F 2AKEA 3CR8A 4C05A 2CN1A 5DX0A 3VQWA 1U5CA 4BVGA 3HVJA 2PWAA 1E8NA 1W0JD 3TGWA 5EVCA 1XDBA 4K9MA 2C2MA 1F3LA 2ZBVA 2ZYVX 2BDEA 2P11A 2Z5FA 1X7ZA 2C59A 1YXMA 1R37A 1GNQA 3BTOA 2FQQA 2LV8A 1EE1A 2QLJA 1SD1A 1IN6A 5AOBA 2YXNA 2CHFA 4XVQA 4JYPA 1VQ5V 4R01A 3HM2A 3BH6A 4V38A 1UC8A 1RWQA 3BL8A 1FFHA 1BHSA 3GHYA 3BMCA 3HYLA 3KLOA 5TVKA 3CIOA 3HFGA 3WK9A 1ZM3A 3ELWA 3P3PA 3T3GA 3O92A 2H1HA 3NPAA 1H0HA 4OK5A 1B15A 2MYUA 1Z13A 4MVJA 2N46A 2YY5A 2JJ1A 3COYA 1N2CE 2DR3A 3R7FA 4Q3CA 1CEYA 1Q77A 1ECCA 4JJZA 3KXKA 4IXDA 3L74H 1M1KW 2C03A 1TEHA 2FXVA 3EIWA 2ZUDA 3FZGA 2Q49A 3NIFB 3O93A 1J20A 2RHOA 1JEJA 2CEKA 2I4NA 3P9ZA 3IHLA 3MEQA 3RD5A 3AG4C 2CJYA 3D31A 2PUGA 2GK4A 1DXQA 2YFYA 3PQFA 3TIIA 4QYWA 4CKYA 2V6BA 1XZAA 1EK5A 2NXCA 5CFRA 3A6EA 2DW4A 4F97A 3TECE 2MMGA 1U9ZA 1MJGM 4IICA 2AMVA 4FONA 3VNAA 1FX0A 1JQDA 1U0NA 3ELYA 3D6TB 3LQYA 3E22B 3HK2A 1DAHA 1XU9A 3MDSA 5H68A 1CZUA 3MYYA 3Q3EA 1LI4A 1VE1A 3ZIAA 4LMAA 3OU2A 4GLLA 3B5IA 1EWRA 4EG8A 1OY1A 3OLZA 3AIMA 5JCOC 4IWNA 4QOFA 2BBWA 2PUEA 3P52A 1H2MA 4MUYA 1O58A 3PFKA 3ND5A 1K5SA 3S2GA 4Y7DA 2RSLA 4QFTA 3I0ZA 3J81N 1U31A 1PSZA 3MNFA 4ASUA 1ZUD1 2GFHA 3AFIA 3CVVA 3BTSA 1Z7YA 5LYYA 2IYTA 3EA0A 1CR2A 5IAOA 2Q4PA 3TNLA 2AOTA 1MTZA 2WHYA 2HW8A 2IHNA 2BOCC 1KY2A 4WJKB 4MVJF 1ATIA 3QPDA 3DMRA 5ALZA 4A4DA 3B6JA 3SAJA 4RAIA 1N9ZA 3IRUA 3QX7A 2YIDA 3ZE7A 3CY6A 1OXBB 4RXTA 1E3DA 2Y6UA 3O95A 1G3RA 3JZFA 3CCVV 2IBTA 1KU9A 3WU2Z 4JYZA 3G0OA 2IU6A 1L7QA 5KVQA 2B5UA 4OQXA 4LVUA 3R8FA 2AOUA 4D6PA 1Y8QA 4N1AA 3WGOA 2Q3HA 5ALLA 2W8BA 1F51A 1MAVA 2NZJA 4LJ6A 1OLXB 3DVAB 2HEPA 3KSZO 3F4BA 3KEQA 1D3AA 1I5EA 5ALFA 2FK8A 4WE3A 1IDOA 3DZFA 4IUDS 5JEEA 5JSZA 1X1DA 1L1EA 1M1YE 1EBOA 5A3VA 5EMKA 1S9HA 3F0TA 3LP6A 1FXKA 4Q3NA 1FVOA 3KSRA 3OQ1A 3UAXA 3MTAA 1L5GB 2OQ2A 4TPKA 2QTZA 4EJ6A 2D0OB 5AVWA 3AG3C 2FN7A 1IUKA 1OFHA 4QRIA 3ND9A 4DCGA 3D9QX 1GT6A 1QB8A 3FHOA 3KO8A 3SDLA 4C4ZA 4X1KA 1MXHA 3M6XA 3HA5A 3OIVA 4YJFB 2XQKA 1DAPA 3A6LA 4MQEB 4IFTA 3C3AA 3GIWA 4JJAA 1RPZA 1X1EA 5J23A 4C4TA 3PF8A 2X5KO 2Q9AA 5J2UB 3DE1X 4QGSA 4JENA 5CYGA 2C00A 4UBLA 3L7DA 2IITA 3JQQA 2XODA 5DRTA 4JYMA 2JAXA 2AW3A 3SI7A 2WJAA 4JYAO 1O89A 1G20B 4Z9BA 2F7SA 1KPHA 4B3TO 1YR1A 5LMZA 3QRWA 3FLEA 4WOJA 1ORTA 1LBSA 3K57A 4BKRA 2WTEA 1WSWA 3CH5A 5IT4A 1KKCA 1TC2A 2RAVA 2VDJA 3X2QC 1A4XA 3AYZB 1ND5A 4YRIA 1IJKA 4H9GA 1V3QE 3ABMC 1XJQA 4GX1A 3LCMA 1L7RA 2X3FA 1NBMD 1UAGA 4U6NA 1U98A 3Q8MA 4WLFA 4F2PA 2P2LA 4UUAA 1IH8A 2A5JA 1DG3A 5B66Z 3VYSB 1W2GA 1GN8A 1CUBA 5GTHZ 3TH5A 1KTVA 5MFPA 1GSAA 1HDEA 1M56B 4GZLA 1GRCA 4B46A 1ZS9A 5F5NA 1N4CA 3L75H 3SIPA 3K72B 2ZXFA 3GA0A 2QV0A 1WQ3A 2FHSA 1GTJ1 4A6PA 1QF9A 4DDHA 1TJYA 4UVIA 4CKWA 2QTLA 4Q7LA 1IJBA 3NYRA 4BO5A 1QUEA 2IDJA 4W6QA 2CVHA 1J8QA 1G59A 4E2YA 1CXZB 1OT3A 3L0YA 3D4NA 2QE7D 3B38A 3I30X 2AUMA 4I0WB 4G1CA 3HN7A 3PZRA 2FFBA 5SV2A 5K20A 2ZFUA 2Q45A 4LDNA 2DHEA 2IUTA 2UXBO 5BSGA 1G4YB 4P0PB 5TLSA 1H3EA 3USZA 4HAUA 4I36A 2D1RA 2B20A 3RC7A 1HT0A 1JQ5A 4PDMA 1GU7A 1NASA 3GD7A 2G1KA 5T4HA 4R2WA 2DJIA 4HN4B 1KBOA 1DC3A 3WG9A 3T7KA 1L2TA 3TAHA 4NZMA 2W70A 2R4QA 1ONNA 1DSSG 3Q6IA 1TQ6A 4YCNA 2Z3VA 3LL7A 1PZHA 4AF6A 5EXEA 3TZHA 3DS8A 4F6LA 4BLRA 4ZIRA 4HH3C 2KPOA 2PZ8A 1BMFG 3P4UA 1H6DA 4EBBA 1NBHA 2W6ZA 1HEUA 2C4HA 3LLVA 3IJPA 2GZMA 1K4YA 3NAQA 1OUMA 4ZRDA 4BW5A 3P32A 3Q2IA 2C0PA 4IZHA 3OIUA 3F73A 3VNSA 4YMVA 2B2NA 4ZVRA 1OXKB 2PL5A 4REQB 1LF5A 4RZUA 4F2DA 4CYMA 1DV1A 2PO5A 4GMKA 4DBLE 2ZIWB 1JJ2U 4DB4A 1TVKB 1GGVA 1W30A 4OCLA 4JEIA 1PZNA 4G86A 4ZDIA 3T4ZA 3EDRA 4Q1DA 3T4EA 3LWZA 4XA8A 3VZCA 3SPCA 2UZ0A 2TYSB 2QRQA 5IXSA 4LV6A 3RWBA 3DGFC 2P9TA 1RXWA 1DZIA 4QREA 2QL9A 2E89A 4PBTA 5DM70 1E2PA 3ICQB 2ZB4A 2VH5R 3HB7A 2J7KA 1AJQA 4IHJA 1KSJA 3MJVA 3U2QA 1U2PA 1UP7A 3CUWA 4BCCA 5B1IA 3QK7A 4UAVA 4UD6A 1N6OA 2VDNB 3IBGA 2X77A 1XZIA 4WX2B 1CWUA 4O8CA 3C1TA 2OFWA 2IDMA 4IGKA 1LLFA 4DJ5X 4MRPA 1Q91A 1M8GA 3RUCA 3WV4A 3QENA 4YV0A 2Z3JA 3MCWA 2WJZB 4E6PA 4D8TA 4A0RA 2PKXA 4EW6A 3PDHA 4OHZA 2WRZA 5HIAA 2J09A 4UCFA 2WFMA 1GN6A 1PFKA 3TLEA 3QPAA 1K8RA 1MVLA 3LZDA 3TRKA 4YBRA 1ZKMA 3AL2A 4JR1A 1RQ7A 1EK6A 2BUCA 2E1PA 4XJSA 2A7XA 1MNAA 2QT9A 3W34A 4BIOA 1K66A 1QO9A 1Y4DE 3X1JA 5AVSA 4F4IA 4YMTA 2IOFK 3GLIE 1M5IA 3ZGZA 4IMRA 1RMYA 2EJCA 2Y1DA 1R3KC 1GSOA 3D4LA 4YBZA 2QM0A 5AK5A 2X8AA 2GKOA 6GPBA 4K8RB 1A1SA 4B85A 3R7NA 4Q47A 1V4BA 4OSEA 1EUZA 5JS8A 3FAKA 1RWMA 2HKIA 2I7DA 3ZWYA 4CVNA 1BNCA 4PZLA 2BGMA 2O4CA 1REQB 2MSWA 4LQLA 3KXDA 1RDFA 4HH1A 3RS0A 4J75A 4IRUB 2AN9A 5LNK1 2JIQA 3PSAA 2J5BA 4K87A 5KAMA 1EVJA 4JMLA 1B06A 3G0IA 3PSHA 1GPMA 3E1GA 3IRVA 4DXHA 4BEWA 4N6OA 5T4BA 3LDCA 5EIBD 1P2BA 1YQ9A 5HS6A 4EY3A 4KQKA 1KSHA 4D9HA 4IJUA 5GZ6A 4QBTA 3K0SA 4KYIB 3EXG2 3ESZA 4CDMA 3FKQA 1SN7A 2QMOA 1EZZA 2XJ4A 4YXWA 3E83A 1N6KA 1TA0A 4PQEA 2LUOA 2UZ4A 3RFFA 1P60A 2NZXA 1X1CA 4DIBA 4OD0A 1U2DC 3WAGA 4ZOQI 4L0CA 3SWWA 4RTSA 3WGJA 3F6BX 3OMLA 3T0IA 4XGIA 1W52X 2IEDA 4OK3A 2PMCA 4QXOA 2FPPA 5DLEA 1MA1A 3B82A 1KECA 3QA9A 5HE8A 2ODBA 1ORDA 5EMNA 1LF0A 2XKJE 2CVPA 3WIVA 3THRA 5I5GA 1JLMA 1B3RA 3TYXA 2ZUUA 4DY6A 2O8EA 3ENVA 3PX3A 3AVWA 3LUCA 3TZ6A 5ECWA 1VQNV 2AV6A 5L9AA 1PT9A 2H85A 1U1GA 1ZX1A 1Z0DA 1O77A 2IP4A 2ODTX 3GFBA 4M37A 4UHFA 3KSAC 4J0DA 5KJFA 1E0DA 3F2IA 1N5LA 2WIGA 1KH2A 4IIHA 5IZ4A 3GP5A 3S1AB 1J39A 1P7VA 5J4VA 2WVHA 1LBEA 1E2MA 3LBFA 3ZY6A 5FWXB 1GPJA 3F3YA 2X0JA 3NCTA 1L3CA 2VA8A 5FF9A 1VTKA 1MABB 2BJWA 2AVDA 3PC8A 2IKSA 2IX9A 2C7BA 2KCQA 1A9XA 1OCCC 1TM2A 3GHHA 3WGZA 4URHA 4MS2A 1D8AA 2I2XB 3PGVA 1LLDA 3VHRA 2EKLA 5M34A 3HP4A 4ER7A 3S4YA 1UIRA 3VR0A 2JVIA 2H0AA 4MSWC 3NEAA 1G64A 2I1QA 4YP7A 4JSRA 4IQ4A 1G41A 1AZTA 3A1FA 2VHWA 1QG6A 4H44B 1YASA 3CJTA 3Q8WA 3QLTA 3BL6A 2XDYA 3G9TA 2F4NA 5FPQA 3SJCA 4QUGA 2KB0A 2O52A 1RI4A 2VOJA 1MA3A 2NSDA 4KP7A 1HQKA 2ODWA 1VP7A 1P4AA 2ASEA 1URPA 3W2FA 2DERA 2WTMA 2Z5GA 3R3ZA 1QDUA 3A6GA 1I7QB 3C3WA 3H6GA 5FD8A 3DONA 2XGGA 1SOMA 3OD5A 3UGJA 3ADCA 5ER9A 1Y9DA 4LISA 5K99A 2LP7A 1WZIA 3HPLC 3BMOB 3TGUH 3JTEA 3WQSB 2WLIB 2A9KA 4K86A 3P9CA 1X1AA 3EARA 1PAUA 2C3YA 4HDRA 3TI9A 3GEBA 3G2PA 1VOTA 4N76A 1F2UB 4WCFB 5JXIA 1SCQA 2FR0A 1CSEE 4M7PA 1G291 4IIGA 1ZEJA 3BUSA 4BO9A 4QODA 2GILA 5FLEX 5HVNA 2C42A 5HMLA 1IY9A 3A6ZA 3JYLA 5DTQA 1XUOA 3CO5A 2ZRBA 1OLSB 1I6KA 1ULZA 4MUNA 1O97D 2ZRMA 3WGTA 5H59A 1VHLA 3H2ZA 4OBXA 1SXJD 1XK7A 1KXJA 3PUWA 2YQ5A 4M1EA 3A7EA 5JBNA 2G7MC 2I4IA 1XKXA 4LWSA 1GT91 4FXPA 4NBTA 4HFNA 3BDAA 1YRAA 2IHTA 3PPYA 2VRWA 1OX4B 4DNXA 5KYUB 3QFCA 4AL4A 1PK7A 2ZR2A 4X62O 5IT9N 4FVMA 2FMHA 2OUKA 3RYHA 2RGEA 3EGIA 2DJVA 3H5VA 1YU6A 2QJWA 2HMUA 3IUPA 1J0XO 1CJVC 1DMSA 1JRLA 4TQ9A 3VR2A 2Z2JA 4LJ4A 1JKXA 3OURA 4XQ9A 2JGLA 2ZWAA 5FEMA 3OJWA 1EFHA 3H2SA 1IXBA 4U7FA 4ZHSA 5BVHA 1EFVA 1DOZA 4GLJA 2OUIA 5HS4A 5K6RA 3C4VA 1H2SB 2QAGB 2IYRA 1ISIA 3LHDA 4J3NA 2FZGA 1Q16A 4X54A 2JASA 1QLEC 1W87A 2OHGA 2BKLA 2VBGA 4GAEA 3F78A 4OX9Y 1Z29A 3G7SA 3WA6A 3Q15C 3CEAA 1WZCA 3IP1A 3A4LA 4CKCB 1M34A 2CWDA 1SBNE 3L2OB 5HDQA 1RBZA 1Z73A 3C45A 8LDHA 3JYCA 2BP7A 4B71A 3OJ6A 2V7PA 1Y76A 5FAKA 2MJLA 1V4VA 4JSYA 3ADOA 3AFOA 5A6VA 2JFNA 3B1ZA 4YCBA 1D2EA 2ZBDA 1PDWA 2JGUA 2DY0A 1VYUA 5C52B 5EIEA 2Z0AA 4HFRA 4YQYA 5EPEA 4OLBA 3T7SA 1ZQ1A 1V5GA 2FB5A 2XT9A 2BFCA 3UICA 4YRBA 4OYYA 5HKKD 4WLOA 5JBQA 2AG6A 5J63A 5CK4A 3SE7A 4Q82A 3LWNA 3SC2A 1YE5A 4A8JC 2IH4A 2Q1SA 4BPRA 2W9XA 4NWIA 4Q93A 3FM9A 1LVUA 4HDKB 3OZTA 4B80A 4CN8A 1OU4A 4LCPA 2IYNA 5JD3A 1VL1A 5KWVA 4TV9F 4NSNA 1E5LA 2IPXA 2W7TA 3KSUA 4Q39A 2UZ3A 5TMDA 4PELA 3OP4A 1PJ8A 3R65A 3WJ1A 4N82A 4CMBA 2GBCA 3WLLA 1A72A 3AJRA 2PF4E 6REQB 1BZKA 2HA5A 4NV0A 3JTMA 2D7DA 3KFLA 3I9KA 1IBKB 3TZQA 4JL5A 3HBNA 1F4PA 1O0SA 4DCVA 1BGWA 3FPLA 1T36B 1K97A 1EKXA 1L8XA 3PIRA 2VBFA 1GPNA 1HRDA 3PDIB 2GTHA 2JLQA 1RXEA 1XZQA 3GCDA 4C4YA 1YQXA 2G25A 2B92A 1CJCA 1OOEA 3T38A 4Q9IA 1PYGA 3CTMA 2G82A 4YUWA 3J80N 2G04A 2HA7A 4F4FA 3DZJA 3GEPA 3V42A 5EYPA 3ZV3A 1K98A 4AICA 1KY4A 3B1FA 3C7DB 3O8BA 2C4NA 5CB6A 3COPA 1K89A 1ZMTA 3NT4A 1YBHA 1E59A 4R41A 4I50A 3SZOA 2FQYA 5FYQA 2BMDA 1IONA 3PUJA 2GD2A 1PSWA 2QLMA 1SHJA 3I4CA 4YT5A 4NK5A 3ZX6A 4INJA 4G2KA 1U2RA 4DCSA 4LYDA 4X0EA 1KBQA 3P0HA 5KWIA 1IVYA 1UFKA 4YCAA 3IOMA 5B37A 2X6AA 1TLTA 3QE3A 3C8ZA 4XDLA 2XCQA 2DPHA 3QUSA 3DZHA 3BJIC 3RBAA 7ABPA 4C1BA 3FCSB 1W44A 1G8PA 4WN9A 2O48X 3RKRA 1KZ4A 1WM1A 2EINC 1Y8RB 4UU1A 2H8GA 5HZGA 2JVKA 5HM6A 3U7RA 5AT1A 1K7CA 2WD8A 4JB0A 4TWBA 2FPIA 3AG1B 3RYIA 1KC1A 5L4LA 1KSFX 1OA0A 4B87A 2HLDG 3TGPA 4PZ0A 1E3WB 2HT6A 2HR1A 3VVMA 3CRCA 5JJBA 1XHXA 1ISPA 4IO1A 2OC4A 2RCVA 1QTIA 1JS1X 4YAGA 4C6TA 3OE7G 1T8WA 4JGIA 3E2EA 3P9RA 3NIGB 3TZLA 3AJ8A 4TXMA 2C4WA 3QXJA 2GZDA 1UINA 3FNHA 4PZ9A 3G71V 3UK7A 1H8ED 2HIAA 3RZVA 1Z2NX 4KDEA 5DNEA 2XOKG 3FYEB 4YUYA 1ZD3A 1OB5A 3ZH2A 1NNSA 3QI7A 1U8XX 1SU4A 2ZLBA 3AF1A 2SCUB 5THQA 3SYQA 3DZIA 5CIYA 2EX1A 4I50F 2QL5A 5KYXA 1X7YB 2VRBA 4GKKO 1AXGA 2FQWA 5F1OA 2ZQZA 2XUJA 3BAZA 4FLVA 2IU4A 5E7JA 2D5BA 5F2OA 1CEQA 4PX2A 2WOOA 1IPHA 1EGHA 4GVXA 1MVOA 3LLCA 1VKZA 4TWKA 1MTOA 3EW7A 3ZJVA 2ZSBA 3LX5A 1MB0A 3NTUA 1Q21A 4QJ4A 4CEJA 3E89A 2VDLB 3OCCA 1CJUC 4OHKA 3IXQA 4KWEA 5SYAA 2D4HA 4IL5A 3Q9SA 2BTEA 4U3FH 2NACA 4BO4A 4I1OA 3P0EA 4BIUA 1TX4B 2PWBA 4CG0A 1G16A 3BE6A 3E82A 3KYDA 3UEOA 3H86A 4RVNA 3DCNA 3SDBA 1CUEA 2WIFA 1W94A 3M1IA 3O94A 1JU4A 4UDYX 3E58A 1XU4A 5AVJA 3PTLA 4HUTA 5FJIA 4FWIB 1QBGA 3ABRB 4EY5A 2G9NA 4EFBA 3OCZA 1RYBA 4YAOA 4GX5A 1PNOA 3ET4A 2X0KA 2D06A 3EFOB 4CUKA 1NQAO 5A3RA 3LDUA 2I80A 5IX8A 1AF7A 1YOVA 3GGOA 1GADO 1JDPA 3T3DA 2J3JA 4DLUA 1EJBA 3OUUA 2RHHA 1FSPA 4LFBB 5ITVA 3T4UA 4GMXA 3ROGA 3GGDA 3PEEA 1LJ8A 4D7SA 3MJTA 4N40A 5C1PA 1GKLA 1GMGA 1OE0A 2UYOA 3L7CA 2FMKA 2I54A 1XU7A 3WQRA 1MF7A 1VE9A 1S3IA 3FYSA 5C3UA 2K7FA 1DJPA 3CX4A 1C1YA 5FT9A 4ZXPA 3JATA 1IEWA 4JVNA 3FPSA 3JAMA 4GMDA 4Q4AB 2GRJA 4MW1A 2AUTA 3L4BA 1GKIA 1U1DA 2FSVC 4J0CA 2RFLA 4ILEA 2J4FA 4OFWA 3W90A 1U1EA 1VPDA 1P62B 2Q62A 3D36A 4C3UA 3E2IA 3GVHA 3RJ5A 4DIFA 1H2AS 3E03A 5JAZA 4GWKA 4LI0A 5CN0A 2PUCA 1OI0A 4IS3A 2B1JA 2QNBA 4Q24A 1K7FB 3Q6MA 4DQKA 2PTGA 3V7YA 4JP5A 4P3XA 3I2HA 2WA4A 2CCKA 2C7VA 1YS7A 3K30A 1ONBA 4GECA 4MS3A 1U28A 1F0YA 3PN1A 1YGPA 4G0PA 1YC2A 3UWPA 1HXHA 3F1KA 5DEIA 2OBLA 2ZYIA 3W3AD 4BFSA 2PR2A 4KFUA 4LMBA 1UBEA 1B42A 2TS1A 4UJ3A 5AVZA 1FU4A 3SMQA 3UY4A 2I65A 2X86A 2YEVA 3AG4B 4L16A 1JWBB 4E15A 2GUWA 2YRFA 1W4ZA 1L7XA 3O47A 1JFRA 1ML4A 2GVZC 3KQUA 2C5BA 3IAEA 4I66A 4GH5A 3H1IH 2PFSA 4V0SA 5IBQA 4GBMA 1Y3DE 3A9RA 1HNXB 1UMBA 2J4CA 3WYNA 3CCUV 4UCQA 4CL2A 4BMXA 2DYSB 1CEXA 4CLHA 2ZKIA 4W9NC 3ILHA 3VNUA 4XUEA 3SHQA 2G5CA 3IAS1 2O7NA 2Q3DA 3PGJA 3NTQA 4BMCA 5KYGA 5CFZA 1I7PA 2EIXA 1H66A 5TPZD 2RKBA 3KQYA 2BYTA 1CNMA 3KLNA 2UUBO 3S40A 1E1CB 3K20A 5IYZA 5IJ9B 1QSGA 2ZUSA 3NNDA 5IF3A 3BTUA 2FKNA 3BBLA 5E9QA 4B6QA 2R8EA 2PFGA 2WLKA 3RVQA 3WKEA 1XMQB 3INRA 3QJYA 3RC9A 3GWOA 4DAOA 4CF3A 5BV7A 1LDBA 2Q7DA 3V7FA 4RYDA 2B4KA 1LUWA 4MVRA 2QQFA 2WQZA 3H9GA 3FVQA 3MUOA 1WD7A 1G2PA 4YY3B 4UCWA 5A4AA 4PVCA 3BRWA 3OT5A 1OCOC 5CDFE 1ARZA 2VRZA 1SUEA 1TVCA 3MWEA 3S68A 3YASA 4BJ3A 4NTXA 5CPBA 1BQ3A 4M0CA 2HJDA 4HNAB 1BJKA 1P1BA 2OOKA 1ZC3A 1CUFA 4WZBA 4MSJA 3TLGB 3VUEA 3PL1A 2GFQA 3C5WP 2C88A 3Q8XB 4LXGA 4EB0A 3LX8A 2W2VA 1Y3CE 1S8NA 2G70A 3AKYA 2XH8A 4JOQA 4CKXA 2PGNA 1RKQA 3MRXA 2WW8A 1UK8A 2R00C 2HGZA 4J07A 3OQPA 4QYIA 5K05A 1EQAA 1ORRA 1NBWB 2I2CA 5CHYA 2C99A 5FFMA 5I8ZA 3ZE8A 1IHUA 5FULA 1E3LA 3AOGA 1G1AA 2Y1LA 3NWPA 1L6IA 2JHGA 4JXKA 4XM2A 1UX1A 1IN4A 3KR2A 4UCTA 4ZO7A 5CH5A 1F0KA 1GPUA 4FFBB 1O97C 5LZ8A 1VIBA 4D3DA 4G37A 3U10A 1F2DA 3C3YA 4HGYA 3L0IB 2OSBA 1GPH1 4F4CA 2H4WA 4XYEA 4ZHQB 3SFZA 1KDOA 1R0RE 5IYZF 2QLTA 4FYVA 3W3AH 4TT3G 5ELXA 1NKDA 2ZJ5A 5BR8O 4LBEC 5T3UA 4ZT4A 4U7HA 1EE2A 5F5XA 4HNQA 4C21A 4COKA 4Z8XA 5JDCA 2W6JD 2NZYA 3SZ3A 1TE2A 5EI5A 1SCDA 4R9SA 2OCHA 5JH7A 3HWX1 1DKUA 3FJOA 1TYAE 4AQDA 1TQ4A 4RZXA 4ZQCB 4C7XA 3CISA 4FFKA 1FQJA 3PHBE 1DI0A 1DUIA 3MJHA 1OFVA 1ZW1A 3TTUA 3G85A 2V6FA 4JROA 2FLWA 2WA2A 1Q3KA 2OD9A 1GOTA 1Q86W 2PEYA 4I6JA 3RAPR 3X2QB 4PG5A 2MCFA 2ZBPA 3FF1A 4NZ9A 3EODA 2E21A 2VJNA 4FINA 3QW2A 4F8EA 5B3SC 4NNPA 1PJQA 4KLAA 3DEHA 1Q19A 4JJ8A 4OYHA 2J9ZB 3LUFA 3RVBA 5TQ2B 4URFA 5CFPA 1IULA 3D2BA 1AIPA 2G4LA 3GROA 4YQEA 1JVSA 4FKZA 3A28A 1OROA 2SICE 3T35A 2GARA 1BS1A 2NU7B 3B9RA 3DC2A 4MTGA 4C4OA 2IXBA 4IKPA 3U4GA 3WLRA 3BFXA 4URXR 3BKWA 2WB4A 1QAQA 3UJ9A 4AJOA 4MKHA 1NP7A 2VF5X 3LC1O 3BL5A 3QFRA 4JC0A 3C39A 3NJ8A 2TMYA 1T8RA 2PCLA 2N1BA 3V2IA 5A4MS 3AUXA 4PGAA 4HJRA 3AI2A 2DECA 5AXDA 1FMJA 1GEEA 3FUXA 6LDHA 5AOAA 3OT4A 2D2FA 2R72A 4F46A 4WJLA 3FOAA 2NV6A 2PVSA 3P9NA 1X80B 1E61A 4X00A 4IZIA 3E7DA 3EOBI 3RIMA 3EWIA 4FYHA 2F64A 2Y93A 5JH7F 4BS9A 4ZCSA 4FGJA 4G01B 3DKRA 3MINB 1KF0A 2PSHA 4TLAA 3N75A 3QJ5A 2FETA 5FUVA 3FNRA 5EJGA 5D6NA 3OFVA 2Z3HA 4HWRA 2ILMA 4DIMA 4C2AA 4II7A 2Q68A 1SC3A 2AF3C 3EIEA 4IO0A 4ZEOA 3PT9A 3F6RA 1VARA 1DO2A 2PY6A 2NTNA 3RS9A 5ADUS 1BEEA 4K6MA 1PIWA 4NY1A 1Q8IA 3KZKA 3WZLA 3H1JH 4HNGA 1OI2A 1NHGA 1P18A 1XRMA 4NMXB 2REBA 3CRVA 3BXEA 5KPJA 5ESDA 3UKOA 5LA6B 5K1XA 4R1PA 3ZJYA 4L78A 1U9IC 3B85A 1EFRG 1C3EA 4YFYA 4MJ3A 3VKFA 2JFZA 4CDRA 3QFTA 4YCSA 3AC0A 2YKGA 5EXXA 4GI2A 1PUJA 5C51B 1IVSA 2RH5A 1K3FA 4AHCA 4DV7O 2QU8A 2PXXA 2JFYA 2QX4A 1ABEA 1RLJA 4TLCA 4K5QA 4KWIA 2IJJA 1UKYA 4G8BA 3OM1A 4E09A 1CYEA 1PJAA 1TK3A 2IW1A 3FNEA 4DWOA 4EKEA 2QYSA 1E6MA 2OXTA 4LYYA 4P4UA 1AGXA 5AVOA 1Z0JA 2H9AA 4A82A 1KWKA 3FZNA 4AY6A 4FFOA 4JOBA 3ZWDA 1LC0A 2FPMA 1UQRA 4GM0A 2VS0A 1KRXA 3I64A 3M3PA 5EL0A 2IF0A 5AHKA 2GCGA 2XF8A 3BFVA 1ZD1A 1TXGA 2XHEA 3KT8A 1GYRA 4B32A 5ALSA 3LVFO 3FDZA 4O4IA 4HMPA 2WFLB 2IVZA 4A2PA 2PVCA 3DV9A 3D3IA 2X9LA 4U7TB 3DLPX 4UVEA 1M93A 2I7TA 1NJ5A 3ZN1A 3ZLBA 2J3QA 5IUNC 4ZOLA 1TVMA 3A4NA 1NAHA 3ZKWB 2YNMD 3DMTA 2LGQA 1N7GA 4E2FA 3HZZA 4JA2A 4B40A 5K6TA 4OGFA 5AKJA 4UQPA 1C2YA 2AKAB 2JFXA 3G2OA 2PAAA 7REQA 3NR2A 3AILA 4OUDB 1E96A 2ZVDA 5I4KA 4PAMA 4A6EA 3OFNG 2BMWA 2NXNA 4IUCS 1VHTA 1KYZA 2Z1NA 4AI8A 2NOAA 2QD3A 8AT1A 4RVDA 2MSNA 2YOHA 1OI7A 1NI3A 3CCFA 4FYKA 1FDSA 4Y6RA 1XDGA 2QRVB 2ZM5A 3GLRA 1GZ6A 3BH1A 2OZVA 1T5EA 4MPJA 3ZMTA 4TYNA 4O8YA 4RGVA 4BFYA 3E9MA 3UAOA 1NI4B 3VNBA 3Q6NA 3VPAA 5K45A 3JZAA 4FFLA 4I4TA 3JZDA 3L4SO 4FOLA 2KX7A 5KSYA 2J1LA 3ANYB 3AWDA 1ZU4A 2BBTA 3DBHA 5HHTA 1EEXB 5F2NA 4UVBA 2EF0A 3A31A 1BQEA 2FZ5A 2XWSA 3UANA 4EI8A 3OOSA 3QYFA 3D1JA 1J1UA 3A6KA 1ADCA 1TT5A 1L4BA 3HUUA 4U3JA 1U63A 1F4LA 2WHQA 4QDJA 1ODSA 2Y1EA 2OQRA 1O8CA 2XKKA 4O4IF 2YZ7A 4BLOA 5EIFA 3CB4A 1ANKA 1RIFA 2FWMX 1R4MA 1QP0A 1OV9A 3N8GA 4CNBA 4BE7B 2GHTA 1IXSB 2QMYA 4BKOA 1UDWA 3IALA 3HVIA 1JHMA 3FBTA 3DQQA 3L0OA 4ZOLF 3OUZA 4JQZA 1YZKA 3LYUA 2WUFA 1RXCA 1ID8A 3EMVA 3R3WA 4FM1A 3KD2A 3DE2X 3RN4A 4LFCO 2QTVA 4H1TA 5KX5A 3SPGA 2QUZA 3PP8A 4RDIA 2OHIA 3RRBA 4YROA 3AL0C 3RG2A 5JWPA 3N7AA 2BFOA 4KFSA 1OBVA 3DAHA 2APJA 4DQVA 1XOIA 5LBIA 1AURA 1WB9A 2WJ3A 4UNIA 4PLTA 1BX3A 4DGSA 3LA6A 4UASA 5FO1A 3FJYA 1DVRA 3WGYA 4UOEA 1L7DA 4G25A 3UMMA 1U8YA 2BEVB 3ZY3A 1PS8A 2AQ8A 4I4TF 3FYUB 1D0VA 2M1ZA 4YDQA 4G1FA 1UFVA 1PR2A 3P7MA 3B70A 5DYTA 2AQKA 1PWXA 1CZNA 5KYTA 4H6PA 4ZT3A 2BZSA 4U7GA 3UXEA 4TMVA 1JWLA 4XLTA 3LGAA 4OA8A 1JKFA 2ATKC 2FMXA 2BR3A 2G36A 5K3CA 2NTYC 2BOVA 3C5EA 1GFIA 3EFEA 4YCJA 2PO7A 5H8WA 2HHHB 4PDVA 2PUSA 1BN6A 2IY7A 4P86A 2XLCA 3GEIA 1DEHA 3CLSD 1E8DA 4N18A 4QAQA 2QVGA 1C0PA 1P29A 2Q0HA 1D2GA 4N0EA 3OW2U 4N6GA 4HDNA 3GOQA 3QYJA 3G82C 3CXCU 4QPCA 2I2BA 2ZIVB 1QFZA 1H23A 2C5GA 1QZXA 1CQZA 4PGHA 1AS2A 1P84F 3CF2A 5EE5B 3VDRA 1Z2CA 3A1EA 5KX5F 3OTOB 4G07A 3DOEA 1YMQA 3S3WA 3FSEA 2GTAA 4MV9A 1DOAA 2EZUA 1G5RA 1E20A 2RGYA 3QBEA 3GOHA 2L0XA 2NU9A 4RENA 5ERYA 1WKVA 4CMEA 2X4IA 2Z4SA 3BGOS 5DBEX 5AHOA 1FXVA 2IYOA 1E2FA 2VK2A 1SCBA 2NAFA 1W581 3HSSA 3B1XA 3Q3JB 5ADHA 2OCYC 3GZNB 1DX4A 4EJSC 4N5IX 5CXQA 3NGMA 1PDVA 1KH3A 2G9UA 4RLFA 3JPYA 3TRIA 4JIGA 3PUYA 4IOMA 3HBFA 1JI3A 3AP1A 4IMPA 4GKAA 4J9UE 1YZLA 3QOWA 2QXTA 1IU9A 5ECYA 4TXHA 2P87A 4PWZA 1DFHA 1XNJA 1N5MA 3RREA 4P6VF 1LKZA 3V5NA 3K7EA 1OTXA 3JWEA 4G2TA 3R7LA 4J4TA 4BKPA 5LR6A 2F95B 4L4XA 2Q69A 1N5DA 3GPDG 3E2PA 3PPXA 3M6MD 3DDSA 4QBFA 1IHPA 5IP5A 4D82A 1XKTA 5BSFA 1DTWA 1WMEA 3ZWMA 2Y69C 2MYTA 4CFYA 5DDIP 4E2WA 4IEEA 1GXSB 4HXEB 5LHGA 1UKZA 2K87A 2PN1A 4IMIB 1MNGA 5DCUA 4A6XA 4RJ2A 4R0VA 2I9PA 5E1BA 3BK7A 3TW6A 3SPXA 2I29A 1TD1A 3UWSA 4KPYA 4QX6A 3N6VA 1YTLA 4OX9B 5ITZA 3RC8A 2C0CA 3QUBA 1H2HA 3OWXA 3DCIA 1U8FO 2J9FB 5AIBA 2ZNIA 2QNRA 3UO8B 4Q21A 5A5VA 4IX9A 3VHLB 2QWNB 5KSWB 4DB2A 3U3RA 5C0OE 3AHHA 4C0KA 4BMNA 2JLAA 2WAYA 5KAFZ 1NQOA 1TOAA 3C4JA 1DP4A 3FTQA 1QB7A 3CE2A 3QTTA 1XVIA 3TWOA 4O4JA 3AJ9A 3CH6A 3G9UA 4J7AA 1JYSA 4X3OA 5JAUA 2NUPA 1OFIA 5KQLA 1AKYA 2P8JA 3X3HA 5DLYA 4F1JA 4MWEA 1NLZA 4OXXA 1VCIA 4GOXA 4CIAA 2B34A 1Q1GA 1SHUX 4WKOA 3H9UA 4R83A 3KNZA 5AUQA 1JN0A 3CPHA 2HC9A 4C76A 1PFQA 4UXNA 3SYOA 1FDIA 4I55B 3R4VA 4CQMA 2C9MA 5LXTA 3BCRA 4LFAB 5LWHA 3RHSA 4A8JB 5BWCA 2NQ2C 1FS6A 4EI9A 1LPNA 1L5HA 4R1UA 4HDSB 1R6VA 2D1TA 1HFEL 3K5HA 1ZMRA 4W1RA 1AR5A 4YRSA 1I7SB 3Q3HA 4ZKIA 3CGGA 5KYYB 3GX1A 3C3DA 1KMHA 4IDPA 4IGAA 3HCBA 5FFFA 4QG3A 4Y8VA 1NVUQ 4UM9B 4JUAA 1WG8A 1AK9A 4HD8A 3ILVA 4IIJB 4Z9XA 1OTYA 4EY8A 3T3PB 3AR9A 3H87A 3GDOA 4W1SA 1QIEA 2XMZA 2I8LA 1SIUA 4Z4GA 2EARA 1IN1A 5C5DA 2VKTA 2QUJA 1L8AA 1UT5A 1WZ2A 3NHKA 4PA3A 4RUFA 3PPWA 4ER6A 3MWDA 3SJ7A 2A4MA 4JI7O 1YTFB 1CCWA 3KJQA 3ISJA 4HS4A 1JFVA 4L4SA 4CTJA 2CD9A 1P4SA 1DRUA 3U13A 2WAMA 3SJBA 4FMDB 2R47A 4DNPA 5B58C 1MU0A 1XRPA 1ZMOA 4PYLA 1YL5A 4G5XA 3H1AA 2Y6VA 4B3RO 2F4VB 4LVCA 2VWPA 5AKIA 1JJIA 2FN3A 1C3VA 1Z6AA 3ROZA 1GM5A 2E4XA 4I8XA 1XTBA 2O2HA 1A5AB 2PG3A 2OZLB 2C8JA 3ASZA 1KZ6A 4Q9JA 1BVHA 1D5CA 1SOUA 2ZSEA 2VHQA 4OLAA 5LXTF 3Q5DA 3K3WA 5AHXA 3M6VA 4KX3A 1EZJA 1CBUA 1G18A 2Q4BA 4YJKA 1A7AA 4MHTA 1XBLA 1E9EA 5AI8A 4GPIB 4B3JA 2ABWA 2CJFA 1YWGO 1OGJA 5JJIA 4AZ0B 3FGOA 4IF6A 2EINB 5LUBA 1KIAA 1B1CA 1P0MA 3EVAA 1UXGA 2HVJC 1M66A 3LSUA 2P6MA 1WVGA 3DDZX 3CX7A 4C0BA 3BXOA 3R23A 4LOAA 1Q11A 3S2UA 3IURA 4RD6A 1X9GA 3LLMA 5KSPA 4D4MA 2FSPA 2DQ0A 2FE1A 1MORA 2O54A 4EPXA 3O3CA 2VHEA 1F8UA 1O9HA 4EKWA 1V16B 7MDHA 4URWR 3IQFA 1B3BA 1G3QA 1X7WA 4C0JA 3STTA 3CZQA 1I7FA 4BTVA 4EMTA 4Q9KA 3RFXA 3UUWA 3MK31 1LEHA 1XNQB 1FFWA 2L69A 3BQ9A 1JHAA 1U90A 2ZCUA 1UQTA 1GA6A 2DR2A 2Q27A 3JVVA 3WS7A 1NUAA 1T35A 5EN4A 2JGDA 4KIWA 5KTOA 2Y0BA 4JJIA 1EFDN 3LPLA 5LOVA 3T1HO 3D0KA 4IQ0A 2DJ5A 4IHJF 1PNKA 5F2EA 3M3DA 3KHUA 4MVYA 5WRFA 4H1VA 4GXQA 1SHLA 5A0TA 4GLFA 3VTZA 4QD3A 1KMQA 1E58A 1TAQA 5EP1A 2I8AA 4PA9A 4PLGA 4KQCA 3QXGA 2P68A 4PPFA 1V6AA 4L28A 3F7OA 5I4BA 1QBZA 4M1TA 4XCVA 3SVZA 3T9AA 4AF8A 1XZNA 2YNMC 2ZQ5A 3MMNA 1MOFA 1UBOS 3CONA 4ZARA 4QA9A 2V03A 3GJQA 5HCUA 3IMKA 2EQBA 4CBVA 3KTOA 5AM2A 4RD3A 1KPIA 1XHLA 5IC4A 1ZGCA 5EIXA 4PZUA 2YI8A 1T10A 2HRRA 1KS2A 1DAFA 4JNCA 1I10A 4EGCB 3L7NA 3K73O 2ADQB 2GAJA 1YFJA 4YWJA 1UKCA 1K7SN 3U3ZA 4GXNA 5KOIA 3U39A 2YC2C 3C16C 5EQDA 3NDJA 4C22A 4MUAA 2J3KA 1Z33A 1BKDR 2IJGX 3ORYA 1I4DD 1YGYA 4NBRA 5JNSA 4QE7A 2N74A 4YLGA 2V6JA 1CY1A 4CG2A 3QPBA 1LPOA 4QGFA 5HXAA 2RKOA 3EYAA 4H08A 1WY5A 4IJQA 1NYLA 1K9MW 1TZ2A 4YK7A 2GRAA 2J7PA 2W2NA 4JQOA 1Y7IA 4RSHA 1T5BA 2NADA 2VDQB 3DJYA 2AEEA 3ML1A 3BFKA 5D6OA 4EFMA 3ZNPA 1T2DA 1SU7A 1PN3A 3QNWA 4TYWA 2QBYB 1O6GA 5FDFA 2O05A 1PRYA 3F5SA 5LOVF 3TKYA 4F5DA 5HYVA 2CK3D 3ENWA 1HDIA 4XOIA 1W75A 1A04A 3DEFA 5SZKB 5HOEA 2CNLA 5G0TA 1YZGA 2QTWB 5FPKA 4TTRA 5JYBA 5LN1A 3C85A 1E3TA 1RABA 3FB6C 4RO2A 3UJPA 4FLWA 2H1SA 421PA 4I0XB 2YJTD 4KFMA 4B6PA 1KYTA 1VQKV 2OFPA 1M6VB 1EA5A 1J24A 2WNIA 1P6UA 1NVGA 4Q3BA 3NZEA 1WXXA 2DVMA 5F7XA 1Z4PX 5E7MA 4KR9A 2HHCA 2W5UA 2ZWIA 3CUEF 5FTNA 3O1HB 1KQNA 4MVMA 3E9CA 2E4ZA 2IUYA 4MVOA 2EW2A 4DR2B 4XR4A 4LY9A 5KREA 3TL2A 1P6OA 5KO2A 4OHPA 4NB5A 4ZCRA 1FW8A 4DFDA 4FR0A 3AVVA 1SZPA 4BN4A 1P9OA 1GG8A 5D3KA 1DCMA 2PGOA 4ONEA 3UH0A 4PZDA 3F8WA 2BFDA 3URKA 2JGRA 1XQ8A 1RWPA 1IWBB 2CB0A 4KSBA 3I62A 4Y9SA 4FM0A 1HG0A 4M46A 3PVSA 1T6NA 3LDAA 3HYRA 3D4PA 2OV3A 4MCIA 4JLAA 4OBEA 4JS0A 2ZR7A 2FN9A 3GFFA 4JB2A 2P3LA 4RETA 3ASYA 5JS7A 1ZI6A 5AM1A 5DHUA 5HCNA 5J9FA 4BV3A 4MR9B 1Q7CA 2Q9LA 2B7LA 4LNUB 1DRWA 3SOZA 4NFSA 4HQOA 1XVVA 3O91A 3CNOA 4KGDA 2HN9A 1YDWA 4QOSA 4S3MA 2KW5A 2A7QA 2RI0A 5AI0A 2FWPA 2VDRB 5E6RA 3KQLA 4TSFG 1NUPA 3USCS 3RE1A 4I8DA 3OCYA 4ENRA 1WAZA 1P5RA 1P4RA 4KR7A 1PV4A 1XRJA 3RS2A 1KK1A 1X8XA 4V1CB 3U0BA 4MVJP 3KT0A 3E22A 3AHCA 4UTPA 2VF2A 2YMLA 3WLJA 2VP5A 4KQ1A 2D2EA 4AKIA 3SY8A 1ZGZA 3OZUA 1H38A 5E4TA 3RIEA 1DC4A 1Y98A 4ECAA 1OCOB 4CNQA 1OCEA 3ROPA 3W5SA 1H2GA 1DDOA 1Q20A 1BD4A 5AXCA 1S7GA 3F6CA 3ESXA 5B12A 1VMGA 3W5UA 2DTDA 2Q5HA 2EKZA 4RLSA 3F6EX 1N8KA 3CNEA 4OU5A 4A15A 4U0KA 4YQFA 1H1LA 3D6VA 3GLKA 3ONNA 1GAQA 4RM3A 3OMAB 2G5PA 4MYSA 4I2VA 5LMCA 1JR3D 3QY9A 5B1AB 1UMDB 1Q12A 4C06A 4ZT7A 3ESBA 3MJSA 5FWYB 1E2NA 3LO5A 3FWYA 2XAQA 1XELA 4EG5A 4CIXA 1BW9B 2JC3A 3PKJA 1HNZB 4PI2A 5ILQA 1AXRA 3DHEA 4A26A 3G6BA 3DEJA 5KA6A 1Z34A 2HA2A 1E1QA 1UWKA 1UXOA 2ZTHA 2E5LO 4MUKA 1R3UA 2C58A 1XEQA 3KDPA 1QBKC 2ZNRA 2PQ2A 2AX4A 1FTSA 2OCCC 4DLPA 3W7WA 2XNCA 3EY9A 2JATA 4RKWA 3F7NA 2PH3A 1JDNA 1KJ8A 5DEOA 5DGHA 3MRVA 1YU9A 1BKSB 2HU8A 5J2TB 1OLXA 4QHSA 4ZBMA 3JS5A 1KD1W 4DLWA 4C7KA 2IP1A 3ZW8A 2Q29A 4RF2A 3PGXA 1HTWA 4QVKA 4EVQA 1ROPA 4RX1A 3CCQV 3AM3A 1WB4A 4GLBA 3I2KA 4TMXA 4I2NA 2WUEA 4JGBA 2M1XA 1JQ0A 1H69A 3AVXA 2WSBA 1C7JA 1JPVA 5H70A 3EXHC 3BAFA 2FFQA 3FETA 4L74A 4FJ1A 2POQX 5H9VA 4A8HA 3RUEA 4I6GA 4G5FA 4EK9A 4RFSA 1GNTA 2FX2A 3ZQUA 4NR1A 4J8PA 4PW0A 4MQEA 4PSVA 3LUJA 5FLKA 1ZNWA 4JJGA 1CF2O 1PGPA 3GN1A 4RHXA 2HYIC 2VWJA 2QKYA 1FL9A 3GLHE 2BRUC 4Z7QB 1TMKA 1G20A 4WXYB 1B0PA 1QNLA 5ALWA 1ZGBA 1CY2A 3DL0A 4XJVA 1E6UA 4OYRA 2F1OA 2FW1A 2JLYA 4RY0A 3GO4A 2ZOSA 1GU1A 1P33A 4X1YB 3LUBA 1UBHS 3BD9A 1ZX3A 5ES4B 1SVKA 2VP4A 2X7JA 2GA9A 3FDFA 2XNDA 3AQIA 3LQ2A 2Z98A 2B35A 3R2JA 1P1FA 1RBYA 1I4OA 1M73E 3SQLA 1NVXQ 2XUMA 5DSXA 3HKBB 2FWIA 3A6JA 4MWTA 3FWHA 1XCJA 4DSNA 3KHTA 4MCJA 4DUZB 2G08A 4S05A 1RMTA 4LF6B 4GP9A 4ALJA 1VL2A 3WLIA 4HAYA 3W8DA 1TQ8A 1F6BA 4MI3A 1D4ZA 3GUCA 3TRHA 3UO2A 2HCFA 4J0GA 1KC3A 3A6DA 5I9SA 4U9HS 4I3HA 4XDJA 1K8XB 1L7AA 1JIVA 3SHTA 3ITDA 5DYIA 2B0JA 1QPBA 4RJLA 2ZNVA 4LBVA 2ITDC 2QZSA 4D02A 3HB9A 1I2CA 4LJ7A 4C7JA 4YAWA 2FZKA 3ZHXA 2R7KA 3AR8A 3EIQA 1FDWA 3TO5A 1QONA 1KGDA 2O1EA 2X19A 4RK1A 3ROFA 1FNNA 3W5VA 2C2WA 2I6UA 2Q50A 2WM9B 2C5LA 3D3QA 2A86A 2R7MA 4DRYA 3BWDD 5FL3A 1H5QA 1YMVA 1JBEA 4H6XA 1JVMA 2WZCA 1UM8A 3H5RA 4HLUC 4ZRMA 2Z3WA 2G1AA 1Z3IX 5JRJA 4AMGA 2EKBA 2C29D 2GM4A 5M04A 4FPXA 2BHNA 5KQPA 4F38A 3TEJA 1WB5A 4LZOA 5C1BA 2CMFA 5L51A 4XIJA 5IASA 1QJ4A 3A9WA 2J85A 3E05A 3CLKA 1DCTA 1AY0A 3C87A 3ABUA 2PX4A 3ENNA 4M9XA 4ESHA 1FX1A 2J6HA 5C4IA 2A8NA 2MYNA 1CQIB 4HSEA 4BB0A 2O6LA 1O7JA 1VE5A 5IEJA 4A2QA 2EHJA 5JDIC 1P4GA 1OREA 2PUAA 1R16A 4TWZA 2BKEA 4P38A 1GTOA 1ZI8A 2P9GA 4FZ3A 4NF2A 3VOUA 3D3JA 4HNRA 4WLUA 3RVYA 3LHKA 1IIBA 2NO4A 3CGWA 3TL6A 1QKKA 1O94D 2FFHA 2PQ0A 1B04A 4JLNA 3CFYA 3O8QB 4BNZA 4POOA 4REQA 4AJ4A 3U16A 1PJZA 2P6UA 3OHSX 3HR0A 4X89A 1YAHA 4ZIBA 2WMDA 3QXSA 1WW2A 2X7HA 2AZMA 4ITUA 4PVDA 3T7DA 1TVKA 5FX2A 1OXVA 5FPOA 3K5NA 1NVPB 1C0IA 2IE0A 2WICA 2CWWA 3EIHA 1S2OA 4R40A 3RTEA 4FE3A 2J0UA 2G17A 1HUQA 1ODJA 4FU0A 2YIVX 4FN4A 3PXEA 2WV9A 4Z1MA 1J9GA 2CSXA 1K33A 4PIPA 1SCAA 1C9DB 1EX9A 3RSHA 2HWKA 3DWIA 3HA3A 2YY6A 3R0QA 4L51A 2BN4A 1GTL1 4OP1A 4RK7A 4PXYA 1U11A 1U9JA 4MW3A 2E49A 2ZSDA 5FBKA 4U7DA 4DPMA 2A67A 4LA4A 5T5QA 1QO0A 2QRZA 5TQ0B 2OQIA 4XFDA 3L6BA 5EWJB 5B7GA 3R7WB 1QVWA 3WK7A 5EIBC 1I94O 1U81A 1R2QA 5G0UA 2PZMA 3OT7A 3A1NA 1P75A 4HF7A 5E0KB 2XA2A 4M22A 2QD5A 3ZI0A 4ND8B 3AUYA 3Q3VA 3NGLA 4R8SA 2D2IA 4HS9A 2DH6A 2PKQO 3AKDA 4GBED 4A6DA 3OCVA 3CF4G 4J9YB 5IVPA 1RFLA 3HFJA 4YRQA 4ZQGA 2IBZH 3AR6A 3P0FA 4EKGA 4PFKA 3VH4A 3ZYZA 1F7VA 3JASB 1QP7A 4JTDB 2JFQA 1NTOA 2LIVA 3QUCA 4L5IA 4CEIB 4OJQA 2YZGA 1LK7A 1J8DA 1Q6YA 3QHPA 2OT3B 2OBCA 2QI9F 2JFFA 2W6IA 3FI0A 5K4AA 3F90A 1T5IA 2AR0A 3V8RA 4QQFA 4PCUA 5EJ9A 5HX7A 1R1DA 4PPYA 5IAJA 4MWOA 3A0RA 3AMVA 2IWRA 2YXHA 2D3TA 2JLUA 2JDIG 4RYLA 4CMGA 4QKQA 3UAYA 4RMNA 4U39A 2CL7X 4XVRA 3S2SA 2W2QA 1REQA 1N2HA 4YJGB 3ZHQA 1Z06A 1OZGA 1L0LH 3EISA 4PA6A 2PD6A 1XQXA 1UXIA 1E5QA 1IVNA 3Q87B 1VE6A 3W2HA 4H59A 4BMDA 2FUG1 4RK0A 1ZC4A 2IZ5A 2XXJA 1N2BA 4LXQA 4RZSA 4OG2A 3DMYA 1AQUA 1P2UA 3CVXA 4L3OA 2CW5A 4K6HA 2Q5JA 1XYYA 1VKHA 1XQVA 2Z56A 4KWTA 5KNCD 4J4BA 3GXOA 4JYYA 1ZSYA 3FOEC 2HT1A 4MQBA 2OGTA 2ZDGA 1EK1A 4PYJA 4UEKA 3CCMV 2ZPAA 3ZCCA 2D5NA 3H1EA 4B83A 4NCHA 1G2QA 1MPXA 4M0DA 5GONB 4KSYA 2UUOA 4BDSA 4Q05A 16PKA 2H5EA 3UCFA 2VDMB 2R6CA 5BYJA 1WF3A 2Z8ZA 9LDBA 4WERA 3NNNA 3RW9A 3AU8A 3CKLA 4D4HA 2QD4A 3IOCA 1BAPA 2AI1A 1UDBA 1A3CA 1KU6A 1DT5A 5H6QA 2A5GA 1EZVH 3JALB 1PV2A 3GJ8A 4WIAA 4E70A 1JF8A 4MROA 2Q5IA 3L92A 1BX1A 1NVTA 1XLTA 1R73A 3ZC3A 2G0TA 1P9NA 2ZJ4A 5J4KA 1KI6A 2QQ0A 3T6KA 1OYWA 4HKTA 1ZCAA 4NU8X 1T1GA 2J6IA 1BMFD 1IEVA 4EECA 5BR4A 1B8NA 4UUNA 3HZHA 1V9PA 2DFKB 3CCRV 4R2KA 2Z0MA 1P4JA 2A59A 2EFDB 4KPFC 3OH8A 1SC6A 2UYQA 1FFYA 1ZUHA 1MABA 5MN5A 1HR0O 3CLVA 2GK6A 3TW4A 2EJRA 4OSOA 4MV3A 3PFFA 1U04A 4IRXA 4NNOA 3AG3B 4NCBA 1NUHA 3JV7A 1N32B 1JPNA 1OHHA 2F3RA 4L6AA 5K8IA 3U49A 3AXSA 2C2XA 1SXJC 2WSLA 1N0JA 3DZ8A 2IEZA 3RV4A 5JO9A 1U7WA 3AVYA 3WYEA 3HM9A 4NH4A 4FFDA 3TPZA 1EB8A 3LZCA 1AQLA 4R3WA 3NCHA 5K0SA 4BOYA 4H77A 2LJ2A 4E30A 1AC5A 1LBQA 5JC8A 3K04A 1VJGA 3C0KA 2GPYA 4QTTB 3S1SA 3MQFA 1N5RA 3IPRA 5L3CA 1DBRA 2JH9A 2QDKA 3PWSA 1Y6RA 1K5QA 5CLGA 2AFIA 2WIKA 3B36A 3IXMA 1ZUNB 2OZPA 3L8YA 3CJQA 5HM8A 1H9BA 3I5XA 2LCQA 5ICFA 5JVDB 4IV5A 1T6YA 1XQ9A 5J9PC 3CNBA 3RT7A 4ZN6A 4RFLA 3X43A 5JJNB 4S1TA 4EG4A 3SS8A 3N2ZB 4G41A 4DA4A 2VG8A 4RZ2A 4JP3A 3RTGA 1OWLA 1F2TA 2UUCB 2WLIA 3UW1A 5EMJA 1WA8B 1PR6A 1EWKA 2VAVA 3ABMB 3FA2A 2Y69B 2P4VA 2V74B 3JQRA 1F2UA 3T7EA 4WCFA 4G0ZA 3HN6A 2G4VA 5KNLA 3PNSA 4FUQA 1OWNA 3NALA 4BEJA 2SECE 4X41A 3EOZA 2XY4A 5J4LA 1WZNA 3ZNOA 1UMCA 1OLSA 1E7MA 3DBRB 3VU0A 4GRAA 1HDGO 2ZREA 3P2KA 2X0NA 2OP0A 2O7RA 4DLSA 2QRPA 2EW1A 4BFVA 3GRCA 3DO6A 4EL5A 2DUUA 2ZGVA 2TRSB 3H2GA 1M1XB 5JCJD 2OORC 3WRVA 4HZGA 1H5NA 2C7GA 5KYUA 1AO3A 3S8MA 1RSOB 4KDCA 4YP6A 3PA8A 3K5MA 1EK0A 2XWJI 3H9JA 4L8YA 2YWCA 1V41E 3QHQA 5IJ0B 2ALJA 2BMEA 1QXSA 4OPHA 1ESEA 2JLWA 5FBZA 2NP7A 1YBFA 2OWOA 2F3SA 3EEYA 3ELBA 2W4QA 5FADA 1UC4B 1WDKA 3EAGA 3HR4A 2IOFA 2PRSA 2WJIA 4Z7OB 2JKVA 5JANA 4DR6O 4HK4A 4KRYA 3ZR4B 3WB2A 4A5UB 2QAGA 1X94A 3S3XA 5KU7A 5IN4A 3ZZ1A 3TLBA 1O9BA 1SG9A 3RVZA 3WFVA 5J1SB 3O4FA 1TCAA 3WQBA 5BSRA 4RADA 2BLNA 4B4DA 4L75A 4KLNA 3ZGYA 4AKHA 4KVAA 1BCRB 2IHVA 1FXHA 3D7SA 3R0ZA 4CKCA 3OE1A 4JX9A 3BCHA 4M54A 4EH1A 4IX1A 2PZLA 2PUFA 3OEHG 4ZO9A 4MV8A 4ZV9A 2I55A 3LC7O 4BNNA 4PG8A 2OY0A 3U61B 1XTQA 4LI3X 4AIRA 3HCOA 3C6KA 5CAEB 2CH7B 2DKFA 2ID4A 2ZIOA 4BP9A 2CXNA 3WLTA 3PJFA 2JLCA 3QVGB 4QU8A 4EHAA 1M57C 4URUR 3K03A 3ORRA 3LC2O 4MVCA 1KVQA 1E18A 5DFAA 3I0NA 2WYWA 5BW6B 2PL3A 4YRDA 4HDKA 3CN9A 1RFGE 4FCVA 3PICA 3ZXSA 1T0UA 4QUEA 1QVAA 4OCZA 2P0AA 3LKZA 2QD1A 5KAPA 3RASA 2ISSD 2HFEC 3F5TA 2I3BA 3QLEA 1GGJA 3RU7A 3LQ1A 4HL6A 3IO5A 4CF5A 3F4KA 5CVCA 4JAAA 1HORA 4HC4A 4BBAA 4F6CA 4IEFB 2OHFA 2VUIB 4OJNA 2V45A 5JY1A 2ZJFA 3RKSA 4DK0A 4OQ4A 4YP9A 1V2GA 3BD7A 4RD0A 4RGYA 5H5JA 1JJFA 2FWJA 2IYVA 3M4XA 4UNRA 2NPFA 5JXWA 1EM1A 2BW0A 1T26A 3K06A 1GPLA 5CDYA 5L6LB 2GEDA 2X9VA 3PNVA 3T9EA 2R7AA 1QQAA 3FROA 2OV4A 5DN6A 1Q6ZA 4WEQA 1QYVA 3UWMA 3RVNA 3ZV5A 3VSDA 3Q2OA 2FEXA 1DKRA 3MJ4A 1PR5A 4CXMA 1R0WA 5TF0A 6Q21A 1MQ9A 2WU1A 3G2MA 5FBHA 1ORHA 4GPTA 4OP3A 1CY0A 3ICXA 3AONB 4AJEA 5H0IA 4AVYA 2H3OA 4L27A 2OAP1 5BZBA 4JI0O 4B0PA 3H9BA 5FPTA 1YUBA 4BXOB 1XI1A 2F59A 2QVLA 1A8PA 1LZLA 4RTJA 4LDRA 3NB0A 1UJ4A 4Y9UA 3FIUA 3K92A 4ARAA 1JJAA 3UH1A 1MDBA 1KP3A 2V7TA 1DAIA 4OXKA 1JEDA 4J1SA 3H0EA 1BH2A 1JJ7A 4M9QA 3PD0A 4ZOCA 2KKSA 3MXOA 2YHIB 1Z6ZA 2Q8NA 3I2GA 3H5NA 3IC9A 1N34O 4KH1A 4M0UA 1JT9A 4I9NA 5FLXA 3O4VA 3JSLA 2MIIA 4MITA 4ZXFA 3CRNA 1R8XA 3KAQA 1C4WA 3VKHA 1VPVA 4B4VA 4BGUA 1WF6A 1Y8RA 3OA2A 4WXHA 2XVXA 4YRTA 1J0EA 5T4FA 2WM8A 1V6CA 4G1VA 3GMDA 1J0DA 2P2NA 1SG6A 2XTNA 3TFOA 2AXPA 2OK8A 4GOMD 1Q7TA 1J2UA 4BFCA 3TCUA 2PZJA 2H1OA 4HRXA 3DDUA 5ULLA 1E3WA 1FNSA 1T5DX 4P7FA 3ZQJA 3HI6A 1MFZA 3OEEG 1BFKA 3NGXA 2QR2A 2ISQA 1YS6A 3C97A 5G3ZA 3F46A 4MSMA 1JWAB 3G0GA 1TGYA 3C3TA 2IC5A