1BQ0A

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bq0A00
1FPOA 1BQ0A 2GUZA 1HDJA 2CTWA 1N4CA 3UO2A 3BVOA 2LGWA 2Y4TA 1FAFA 2DMXA 1IURA 2DN9A 2GUZB 4J80A 2QWRB 3UO3A 2QWPB 1NZ6A 2CUGA 1BQZA 2YUAA 1WJZA 2QWNB 2KQXA 2EJ7A 4IT5A 2OCHA 4J7ZA 2QWQB 2CTRA 3APQA 2QWOB 2Y4UA 2LO1A 2CTQA 4RWUA 2L6LA 2M6YA 2PF4E 2CTPA 1XBLA 1GH6A 2N05A 3APOA 2QSAA 2YS8A 3AG7A 2N04A 3UCSC
chains in the Genus database with same CATH superfamily
1R6KA 3P3PA 4OX9B 3FAVB 1TVKA 3RGBA 2HKOA 1KQSU 4DR2O 2E5LO 1KP3A 2CK3G 2GBOA 3M8AA 4K0KB 3FB7C 3JARB 4GX2A 2A3QA 4TV9B 5ITZB 4IHJB 3I55V 2GV9A 3MDSA 2YI8A 1NVPB 5L3FA 3JD1A 2EINB 1PP9H 1XMQB 4LCUC 3S3WA 3X2QB 3EXAA 4CZZA 2C2AA 4KHPB 3UKMA 5KMGB 4I5SA 2RQ6A 2BSKB 2AZ2A 2EULA 2ZDIC 1XEQA 3HR0A 3B77A 3RYHA 1P7BA 5CBGA 5KA5A 2VQFO 2GTAA 4J9YB 1IDSA 2QM4A 4DR5B 3AK2A 3BY6A 1NR7A 1AP6A 1WLEA 1Y6XA 3Q4HB 4FLUA 1K5SA 4O4LA 3TETA 3D36C 3SYCA 2CH7A 3QO5A 2Z3YA 4I55B 4LF4B 4Z1MG 2DW4A 4ABMA 3JAKB 4KL1A 4KUMA 3CX5F 1BQZA 4YHHB 3HKBB 2KQXA 2IJJA 4QE7A 1NR1A 4DUZB 4J9ZB 1VQPV 4LC1A 3CCEV 4U3JB 3OEHG 1E1QG 4X1YA 3W7UA 4DR1O 1IXMA 2NLJC 1K8AW 1WB7A 3ZRSA 3CEIA 2CGNA 3STZC 3ZN1A 4DW1A 3RYFB 2JJ1G 3BVOA 1H2SB 4FFBB 2A7WA 2UUAO 1RM1B 4JTAB 5H2FZ 2KG7A 2DWDC 3ZMUA 2D3OW 4GLXA 3CCJV 2N05A 1WP7A 3OW2U 4CH4A 4DRXB 4DV2O 1TAEA 2Y69B 4X66O 2HVJC 2R9AA 1KB9F 5BR8B 1QU7A 3FB5C 3RN4A 3DC5A 3DC6A 1NT2B 1I08A 1QLEC 5J2UB 2OCHA 1XL6A 3CSXA 3ZIAG 1Q43A 4F4LA 2UXCB 1TA8A 3PN1A 1KKDA 1F4MA 1IVSA 1OCZB 4JYBA 4I55A 3E83A 3ZHTA 1THZA 3K0DA 3JAKA 3ETGA 4JI7B 4LBEC 3ABUA 3E89A 2QA4V 4DV6B 4HYOA 4FM0A 1S5LZ 2HHHB 1DF4A 3KG2A 1K34A 4E2LA 5A2QN 4JI5B 1HDJA 4PA3A 3GB7C 4TSFG 3CJHB 3JAWB 1TUBB 4D6TH 3VQYA 1K73W 3JD3A 1EBOA 4YY3B 3B4SA 1Q7YW 4LF9O 2AZ0A 4AHCA 2UUBB 5EIBD 5JQGB 1YJNV 1RPRA 2QEXV 4BW9A 5FNVB 2ODMA 2P4KA 2ZM6B 5IWAO 5A9GA 3QG5A 5EYPA 3ZCCA 4AI8A 4K8ZA 5B1BB 2PI4A 4B3SO 1Q6IA 2OWOA 4JF3A 1MSDA 5HFLA 1G1XB 1W0JG 1J5EO 2EJ7A 1XI1A 2QWQB 4O2BB 4RUEA 3BFRA 3W7TA 3CS5A 1M56B 3RT3C 4CC5A 5IY5B 4JASA 3SGIA 4DR2B 3UCSC 1S72V 3CRCA 3ZMSA 3JALB 3OT7A 1R3IC 1D2DA 3M7MX 1S76D 4K8XA 3CC2V 2Q0AA 2FMLA 3E86A 4OGQB 5BZBA 1UJWB 4B3RB 4AILC 1SERA 3P3NA 4GX1A 4O4HA 5CN0A 2GTSA 3P32A 3ABTA 1Q86W 4U3FH 1FPOA 3CJHA 1K4DC 1YI2V 3L74H 2OYQA 5LGTA 1W2BU 1GN2A 4X62O 4GKKO 4B7EA 3BEHA 1WAZA 3LDEA 3CHXA 1Q6UA 2EILC 1Z5WA 2M7WA 3VQVA 4NB5A 4X1KB 4TV8A 2VQFB 4I9QA 1NH2D 2NR5A 2PI5A 2Y0PA 4ICGA 2CAZC 2IJKA 1PD3A 5LGNA 1WP8A 1V55B 2ZE5A 4FZ0A 1RSOB 2DQ3A 3DSQA 4EEQA 2OIGA 3AG1C 1K7DA 2R72A 4B3MB 2AGAA 4WFEA 1N8RW 4WBNB 1S5JA 3JAMN 3CRRA 3HKDA 3W7XA 2VWJA 1VF5B 3AG3C 4L8JA 4J11A 2F43G 3KKYA 2PTMA 4JI8O 3T4DA 4DR1B 4JI4O 4PJ0Z 3AG4C 5JCOC 4MTOA 1GMGA 4J41A 3LNNA 5B1NA 4FLTA 2E76B 2QWOB 1WA8A 1WPXA 3B40A 2GSMB 1U96A 4JYAO 3H1LH 2UUAB 1JOYA 4YJ2B 1UFIA 2ZCEA 1G6UA 4AQYB 3OTFA 3FKSG 1WPBA 1Q90D 3A8TA 3K08A 1BQ0A 1VQOV 4MW3A 4KP4A 2VRZA 1BZKA 3K5MA 1AJPA 1KC8W 2WLLB 1G8MA 4X1KA 4GX0A 4X66B 2LFRA 4UUJC 2WA4A 4PA7A 2UXXA 2IH1C 3CE2A 1OCCC 5J9PC 2N74A 1OCRC 4JI0B 5GW7A 4X64O 1OJHA 2ZD9A 1LUVA 5LHIA 4X9QA 5IYCO 1V54B 1XUQA 5CMUA 3FYEB 4FLVA 4RUFA 4UB8Z 3SJCC 4ZHQB 1CEZA 1MG1A 4UCVA 4W4KA 1K33A 1GN6A 1KUQA 1AI6A 1YSCA 1MSWD 2D2CB 3TJTA 2YS8A 3MHSC 1BHAA 1Q5OA 3L72H 4YJ3B 2KB1A 1K92A 4BIZA 1I5XA 3H1JH 2ZR2A 1FAFA 2XAHA 3R65A 4CC6A 1YTFD 2F23A 3D8CA 5LHHA 5KAIZ 5EBLC 3ZHRA 2B5UA 1T5EA 4YJ2A 4JAAA 3TXSA 1H38A 3ZHSA 4GX5A 2K9PA 1AJNA 4LF9B 2JEUA 3OAAG 2PYLA 5KHGA 3JSLA 4QE9A 3RYCB 4ZOLB 2YDEA 4MTGA 5CA0B 2ITCC 3D3QA 3K03A 2DOSA 4JYCA 2ZT9B 5IWAB 1HP8A 1XDCA 4XBFA 1QLNA 3JCUZ 1D5NA 5EZYB 4U7NA 1J5EB 1H8EG 4PV1B 2X0LA 3VOUA 1K3EA 5DECA 5KHIA 2XASA 4ZHQA 1FS0G 3STLC 3OMIB 2PGGA 1N33O 2CE4A 4H0LB 3RVYA 3LDDA 1YXBA 4PELA 3ZRWA 1FXHA 4YIPA 3D3IA 3DGEA 4JI2O 3HPLC 5BR8O 1JA8A 3JASA 4I9WA 4NTWA 4NYKA 3RYIB 3G6BA 4X65B 1K97A 1CPYA 4JI6O 1ZL8A 4GT1A 1FD9A 1OV9A 1TGOA 4CH5A 3ZMTA 5AG2A 4DV7O 4GKKB 1AR4A 2F4VO 4OPAA 4RO2A 2H8PC 1XBLA 3E22A 1SQBH 1SRYA 3RYCA 4MTXA 2JRIA 1BGYH 2P4VA 4X20B 5CA0A 2WAMA 4NXNO 2ZE7A 4D7SA 1GN4A 1Z5VA 2LW1A 4R8CA 2LGWA 1KYOF 4E4EA 2IW5A 2QWRB 1B6QA 3IJ4A 2ITDC 5IT9N 1I7FA 4RWUA 1HW7A 2EIKC 1I94B 4JAVA 1QR8A 1R73A 1GO3F 4YY3O 3MAQA 3UQ8A 4JI8B 1X59A 1FXKB 5IYZA 4BWAA 4UCRA 4JI4B 2BOCC 3N2KB 5D5PA 3QF7A 3KCXA 3L9DA 4G27B 3RYIA 4JAUA 1KBHA 1E79G 3QNEA 4X88A 3TCUA 4UCSA 1VQ6V 4JYAB 4DR4B 4DV1B 3CRMA 5GONB 4B3TO 2L35A 1AI7A 1HNXO 2V1DA 4P9PA 5LGUA 1YJWV 4X20A 1OCOC 1BCCH 4EB6B 2OTJV 4X8AA 5JJJB 2FB5A 4B3RO 1US6A 4Q20A 3OE7G 4X64B 3ABLC 2DYRC 3SJQC 1NTMH 1BSMA 2ZR3A 4KXRA 1QLEB 1Y76A 1BE3H 4B7KA 1BL8A 3EFFK 4I50A 1NQTA 1FXKA 1PNLA 5JH7A 3ABMC 3OUSA 3WB0A 4WFBV 3DXRA 3ASOC 1JFFA 4R7CA 4X89A 4HZ3A 5H5NA 2DYSB 1GH6A 1N34O 5KHJA 1R1BA 3ZHUA 4B3MO 4O2AB 1SQPH 3FAVA 5GONA 3E2EA 3RBZA 4UB6Z 4IGGA 1H2NA 5EIBC 3JARA 2GDSA 2M6YA 4TV9A 3S3XA 4IHJA 5ITZA 1IBLB 1H2KA 4ZKIA 1SQXH 1VMGA 4PA9A 2QGNA 4K35A 5KAFZ 1N32O 3KZIZ 1SA0B 2YXLA 3A2FA 4BIOA 3F5WC 5L3EA 3CMEV 3OGCC 4QNHB 3ZN0A 1NTZH 3LSSA 3IGAC 2LO1A 4IIJB 4AQYO 4BR6A 4DYLA 1GRJA 5KMGA 1ZLZA 1VQKV 1N33B 2BSKA 2BOBC 1GM9A 1G4YB 5F2VO 4O4IB 1NS1A 1SESA 1DF5A 4JI2B 4J42A 1B06A 4WFFA 4PA4A 3RWRD 4JI6B 1VQLV 2UXNA 4MSWC 3ZHQA 3Q4HA 2ZIMA 2E74B 4JI0O 2JS5A 3I56V 3ZX6A 2WPDG 3UT5B 2IU3A 4DV7B 1CXZB 2F4VB 1MZFA 2RMKB 2EINC 4FMTA 1GM8A 3UO3A 3HKBA 2ZIOA 3CCQV 3OUFA 4NXNB 1H8HG 3X2QC 3E8GA 1LNQA 2X7RB 4U3JA 2CDYA 4J7KA 1R3LC 5JWPA 5JJEB 1KU9A 4PDVA 4OPHA 3AK3A 4J10A 3QO8A 1SC5B 1O9GA 1NI8A 5BMVB 2ARHA 3L70H 1PM9A 3RYFA 3ZEDA 1R3JC 3CP1A 3LDCA 2Y4TA 4FFBA 3AG2C 4FLYA 3OTOO 4RQEA 4OXSA 2RJZA 1FFXB 4MVMA 4BW5A 1ZSPA 2WLKA 3P30A 4MTFA 5B5EZ 1HNWO 2W6IG 4DRXA 3WB2A 5CA1B 2QTSA 3G80A 3CC7V 1LUWA 4WF9V 2WWWA 1VEWA 2YICA 3K5OA 3HKEB 2K1EA 3QO7A 2LQTA 4UVAA 3SDLA 3SPJA 3AEIA 2FTKA 5FLXN 5J2UA 1J95A 2KSDA 1AI4A 4LNUB 2LFSA 4QGPA 1HNZB 3AG4B 5B1OA 4HAMA 2QKAA 3W7WA 1PKXA 3UT5A 4B3TB 1IXBA 1HNXB 2Q6AA 4GKJO 1KECA 1Q6HA 1PL4A 1RM1C 1Q81W 2BE3A 2YC0A 1U97A 1JMKC 1VF6A 2Q7GA 1L1FA 5LA6B 3UM7A 1AP5A 3U0ZA 2ZINA 4G28B 2VQEB 5IE9A 1YJ9V 1DTOA 1F7YA 2Y69C 4X65O 3H1HH 2HLDG 3U10A 2YEVB 1P84F 5LOVB 1XREA 4PI2A 1XILA 2WA3A 3JAWA 1TUBA 1OCCB 2EIJB 1FFXA 2OCCC 4UXNA 4FM1A 2IH3C 2YUAA 2RCVA 4F6EA 1MMMA 3A0BZ 5JQGA 2E3CA 2DQ0A 2CTQA 5FNVA 5CA1A 1VQ7V 2RN9A 1BMFG 3BA9A 2AXTZ 4FPPA 4PDMA 3SR2C 1N34B 1GK9A 4DV4O 3K79A 1PNMA 2B1GA 1QVFU 4P9OA 2BTQB 4LNUA 4WCEV 3CCSV 4LR3A 1S5HC 2Z5UA 4O2BA 5KX5B 5KHHA 4BAYA 1I94O 2Q0OC 1SQQH 3PJSK 5KUKA 3MHHC 1TUEB 1VQ8V 3BPZA 3JALA 1N0NA 4DR7B 3JCZA 4JI1O 3SPCA 5LA6A 4XDJA 4JTDB 5EBWC 1QVGU 5IDJA 3FFQA 1FXVA 4RAIA 5E1AC 4LFBO 3OMNB 2DWEC 1N32B 4WFAV 4X1IB 5LOVA 5KHKA 3JYCA 4DR4O 2N04A 2QR4A 1FKAO 4IYHA 2EX3A 5B1AB 4LF6O 4DV1O 3JATB 3IFXA 1XHXA 2WLMA 1LR1A 4MVSA 5KLVH 5L3GA 2Q8VA 4UCOA 5H6RA 1Q8IA 5GTHZ 5LYJB 1BT8A 4FLWA 4FLZA 3CD6V 2AHZA 1Y74B 2BTOA 4LWSB 4QIWF 2CTWA 1RSOA 2BTQA 4DR6O 3H01A 3ZHVA 2O57A 2UXBO 1Y66A 1UPGA 4J80A 5IJ0B 1SZTA 3G67A 2EIMC 5K1XA 4WBNA 1PV0A 4EFEA 1IBKB 2YI9A 5L3CA 2EJRA 3OEEG 3RVZA 1O9HA 3J80N 4JYYA 1QCEA 3JD4A 4DV0B 1SQFA 4NKGB 1BHBA 4CH3A 1QBZA 4I0XB 4DK0A 1COWG 3W7SA 5J2TB 2P5OA 4J7ZA 4H37A 3APQA 4C7UA 1NBMG 3T1YB 3OTOB 4DR3O 4DXWA 2Q73A 3B2EE 3BABA 1M1KW 3JATA 5LP6C 3B8NA 2X6BA 1SF9A 1HNWB 1N0JA 1YHQV 3ASNB 3H1IH 4RQFA 1YVWA 2DN9A 3HKCB 2WLLA 3O65A 1IBLO 4QPJA 5LYJA 3FYIB 3JSNA 3SJAC 3I5DA 4DK1A 3HB3B 1ENVA 4GZRB 1N36B 1GTOA 2Q68A 3CB2A 1XNRB 3J81N 3A0HZ 2V4DA 4O4JB 1F4NA 4GKJB 1M5IA 3QVNA 1MOFA 1M57B 2WLIB 4DUYO 3TK1A 2XHBA 2CUGA 1R3KC 1XQ8A 3SYPA 2PUSA 5KA6A 2WSSG 1V9PA 2RNBA 1YZBA 2JVDA 4YJ3A 3CCMV 1H2MA 3ZRVA 3ABKC 1OCOB 4PHZA 3E35A 2HJFC 2ZKOA 4LH6A 4YIOA 1VIBA 3GWOA 3ABLB 4ZOLA 3B8MA 3CXHF 3CYOA 4CS2A 3HKCA 1N4CA 4MVZA 3WB1A 2YIBA 4MVQA 3WG7C 5C8YB 2QWNB 1TVKB 4DV3B 4P30A 5EZYA 5LHGA 4DV4B 1ZTEA 1XOUA 2ILMA 4B08A 3BRCA 2PF4E 1S3JA 3ASOB 2W0FC 1W59A 2HR3A 4O4JA 3K57A 1QQCA 2V7QG 1HR0O 4PD4F 4DO2A 4U7OA 4FK5C 5B3SC 4MW8A 3T1HO 3M99B 4LF8O 2JS3A 4D7TA 5EC2C 2H94A 4CBCA 1B04A 4JI1B 4UCUA 1JJOA 3WU2Z 2WLJA 4IL6Z 2CTPA 1H2GA 2XOKG 1AJQA 4BIUA 3T4ZA 4EFBA 4LFBB 1ZX3A 2X6AA 1XMOB 4TUYB 4TQDA 2HVKC 4ZBMA 3EHBB 1L0NH 1JVMA 1HNZO 2JIZG 3C3SA 2DMXA 2YIAA 5EBMC 3ML0A 4LF6B 2XAQA 1I5YA 2HG5C 2PZSA 2QM7A 5JVDB 1I0HA 4R6ZA 2Q67A 4LFAB 2WLNA 3NR7A 4O4LB 3SPHA 5EK0A 1D5AA 2XNDG 5HFMA 3E8FA 2CH7B 4TOIA 2VQEO 2OT5A 4FIPC 2ZDIA 5C8YA 1WNSA 3ZRXA 4JI3O 2LJ2A 1Q3EA 4UVCA 1PPJH 2MK3A 4I7ZB 4KFMA 4FM2A 4DR6B 2UXBB 3K04A 3J7AU 2A9HA 4PDLA 3K5NA 5FPOA 4JZ2A 4X1YB 4FVMA 1R6TA 4TQFA 4Z1VA 3D36A 3CCUV 4A5UB 3H9VA 3SYQA 2YSUB 1XNQO 3N2KA 1KMIZ 2KG7B 2ADPA 4TUYA 3LNMB 2H3OA 1NH2B 3F7VC 1FJGO 4WFGA 4DR3B 5LMNB 2WLHA 4YXWG 1M4UA 5CBHA 3TGUH 1URFA 1MA1A 3VBBA 5IYDO 2ZXWC 3AG2B 4CS3A 1K9MW 5JVDA 4EB6A 3BHPA 1VQ4V 1EM1A 4DR7O 4WFHA 4FJCC 1ORQC 1SQGA 2W6JG 1FXKC 4XDLA 4LF5B 4LF7B 1M9NA 2YIBD 2AHYA 4MVUA 1NZ6A 5BY1A 1AR1B 5LL6Y 2HJDA 1EZJA 3DTUB 1KKCA 5CB4B 4DUYB 4L87A 2UU9O 2QSAA 1RP3B 5EC1C 4DW0A 3LSQA 3E8BA 2ZE6A 3CRQA 1ZAUA 2ZNJA 3SPIA 4NVPA 2NNUA 3LSUA 2Q7EA 4JPRA 1L0LH 1SQVH 3OR7C 2P67A 2W0XA 2E75B 2Y0IA 4O2AA 4IYIA 2ETNA 5EYPB 3EVKA 1VQNV 1IBKO 2IJHA 4UV9A 2LGQA 2JDIG 3AK1A 3OGIB 1F23A 1AVMA 1MABG 3K3WA 3K06A 4IT5A 3G71V 4DV5B 2R9RB 2OCCB 2P90A 5LXTB 2LW7A 1VF7A 2P22C 3G6EV 1L8DA 3ICXA 5BXZA 4DV0O 3RW0A 3SPGA 3TXQA 2EILB 4HNAB 2XTAA 2FYUH 3FD9A 4JV5O 2EZOA 3VQWA 1RPOA 5LMUO 4TT3G 1AI5A 1SA0A 4J7JA 3ETDA 4H13B 3T1YO 2DYSC 4ZIBA 1HR0B 5CB4A 1YTFB 4IIJA 1OZ0A 2CTRA 3T1HB 4LF8B 1H2LA 2GHYA 3OD4A 3C3TA 3AG1B 4O4HB 3L73H 2PYJA 4O4IA 4TWKA 3AG7A 1VARA 2PY5A 5E79Z 2Q69A 3AG3B 1S77D 4Q6GA 3UO2A 1JPXA 1IURA 1EN5A 3OM3B 4EKWA 1ZWIC 2R70A 1XL4A 4H44B 4UCTA 1N36O 2L6LA 1XNRO 1DLBA 2QKSA 5L3BA 4MVOA 4TV8B 3SJBC 1EN4A 3E8HA 3K9AA 4NTXA 2R9IA 1ZUQA 2UUCO 2P7TC 1NJIW 2DE0X 4LFCB 1FYJA 2GUZB 3IC9A 3O9OA 5LXTA 2YXHA 2B9ZA 2QE7G 1GN3A 3A0RA 2FL4A 4JI3B 4HNAA 2RDCA 3HKDB 3THOA 2UXDO 2OTLV 5BMVA 5CBFA 3CC4V 1SETA 1E1RG 3JD2A 2E5LB 3F7YC 1NVPD 4PI0A 1IX9A 1VQ5V 1VP7A 1OCRB 4UV8A 2A79B 2P6JA 3ETQA 3N27A 1AROP 1OCZC 2Y4UA 1DGSA 2YXYA 3FX7A 2EIMB 1WA8B 1XNQB 3F5TA 5CA3A 1JX9A 2JEXA 3HKEA 1VF6C 1BS3A 2XAGA 5KUMA 2JGDB 2IBZH 4DV3O 2XT9A 2MW2B 1EZVH 4JTCB 4F6RB 3U11A 2KKWA 1FFTB 5FPRA 2QJ1A 1AR5A 3L75H 1FJGB 5JCOA 4ZI7B 5IJ9B 3RFRA 2F95B 2HP8A 4MT8A 1IBMO 1K4CC 3N2GB 3JD0A 2Q7HA 1W0KG 4LH7A 2GUZA 3ZMVA 3BCCH 1Y4MA 1KD1W 4NXMO 5LP6B 4W4LA 1IZ3A 2QTOA 3LUTB 1YIJV 2IM9A 1SS3A 2AW9A 3ZMZA 1XMOO 4QJFB 2YEVA 4ASUG 5B1BC 4P2ZA 1DK1A 2Q9LA 1R6NA 3CPWU 2ZQMA 4GCZA 2UU9B 1MZEA 2XUMA 2Z0AA 2Q4PA 3CXCU 1M56C 4MS2A 5IY5C 5IYBO 5DEDA 4LFAO 3CCLV 3GVMA 4PDRA 1P7GA 3CCVV 4OX9O 3NXSA 2JGDA 4G2KA 1WB8A 3L71H 4JGSA 4F6RA 4DV2B 4UVBA 1RFYA 2XAFA 3FB8C 4K0KO 5KX5A 3ABKB 4FFKA 1YEWA 1NU1H 2IU0A 4ZI7A 5IJ9A 4GUNA 3IC7A 1HWYA 1XHZA 2ADQB 3N2GA 3OFNG 1Y67A 2EIJC 2FKXA 5GTIZ 1SZXA 5LP6A 3OR6C 1AB3A 4K3AA 1XMQO 3QTCA 4QPKA 4JV5B 2Q5ZA 4N23A 2QKCA 2ZNIA 2VWKA 3T1CA 4H33A 5LMUB 2YIDA 5D5QA 4KHPO 4X1IA 1F51A 1VQ9V 2NN4A 2XAJA 3WG7B 3H1KH 3GWKC 3ZRWB 2A0LA 3APOA 5LMNO 1X4TA 1V55C 3OMAB 5DN6G 1GKFA 1QNMA 3JASB 2JK5C 2EIKB 4DR5O 3ZS8C 2QWPB 1JCHA 1ZL8B 1S0VA 4LP8A 5B3SB 3CWBH 2BCCH 4N21A 3SYAA 4LF4O 4LF5O 4LF7O 1KP2A 3E22B 1Y74A 4LWSA 1YF2A 4NR1A 1QR9A 5K1PA 4YHHO 1GM7A 4XDKA 4DUZO 4PA6A 2EZPA 5IJ0A 1K5QA 1CP9A 5H9CA 2UUCB 2X6CA 5LBQA 1YITV 4B3SB 5B1AC 3K59A 3B09A 3KCYA 2Y48A 3CCRV 5FL7G 4HBNA 4R50A 4GYCB 1Q82W 3R66A 1B3QA 1VQMV 2P06A 4I0XA 3VQXA 2UXDB 1JJ2U 3T2MA 4JZGA 4I4TB 3K5LA 5J2TA 1YDXA 1PNKA 5B66Z 3FB6C 5IYZB 3ZBHA 4NTYA 1EN6A 2B1IA 3SYOA 1P4RA 5C93A 3IAYA 2EBOA 2DYRB 1EFRG 1AILA 2LP7A 1V54C 1OHHG 2F93B 3BAAA 3WFVA 4DV5O 1M93A 2UXCO 1MNGA 2DJVA 1M90W 3G4SV 1YCIA 4X62B 3K58A 1QHTA 3ABMB 3ZJZA 2HFEC 4JI7O 3BA8A 4CS4A 4UFZA 1JQ0A 2IJIA 5JJNB 3MD0A 2F66C 2VS0A 2JJ2G 1P49A 4DV6O 2WLIA 1Z2GA 1NKDA 1IBMB 2HEPA 1GAXA 4MVRA 2HHHO 3CMAV 3ETEA 1ROPA 4Z2WA 1WJZA 5L3DA 1JR9A 1A32A 2JGUA 4NXMB 3K9SA 4JI5O 2F1MA 1NTKH 1WN7A 2G38A 3ASNC 4FLXA 4CH6A 2ZXWB 1Y76B 2QM8A 5H6QA 2ATKC 2A06H 4I4TA 5DM6V 5TISZ 1PL0A 1SKVA 4I50B 2UUBO 3RYHB 3C90A 2ZE8A 3K0GA 5JH7B 2CGOA 2ZM6O 2OIEA 3DXRB 4FZ1A 1JFFB 4LFCO 2QDOA 1M57C 3CRAA
chains in the Genus database with same CATH topology
1FPOA 1BQ0A 2GUZA 1HDJA 2CTWA 1N4CA 3UO2A 3BVOA 2LGWA 2Y4TA 1FAFA 2DMXA 1IURA 2DN9A 2GUZB 4J80A 2QWRB 3UO3A 2QWPB 1NZ6A 2CUGA 1BQZA 2YUAA 1WJZA 2QWNB 2KQXA 2EJ7A 4IT5A 2OCHA 4J7ZA 2QWQB 2CTRA 3APQA 2QWOB 2Y4UA 2LO1A 2CTQA 4RWUA 2L6LA 2M6YA 2PF4E 2CTPA 1XBLA 1GH6A 2N05A 3APOA 2QSAA 2YS8A 3AG7A 2N04A 3UCSC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FPO A;  1BQ0 A;  2GUZ A;  1HDJ A;  2CTW A;  1N4C A;  3UO2 A;  3BVO A;  2LGW A;  2Y4T A;  1FAF A;  2DMX A;  1IUR A;  2DN9 A;  2GUZ B;  4J80 A;  2QWR B;  3UO3 A;  2QWP B;  1NZ6 A;  2CUG A;  1BQZ A;  2YUA A;  1WJZ A;  2QWN B;  2KQX A;  2EJ7 A;  4IT5 A;  2OCH A;  4J7Z A;  2QWQ B;  2CTR A;  3APQ A;  2QWO B;  2Y4U A;  2LO1 A;  2CTQ A;  4RWU A;  2L6L A;  2M6Y A;  2PF4 E;  2CTP A;  1XBL A;  1GH6 A;  2N05 A;  3APO A;  2QSA A;  2YS8 A;  3AG7 A;  2N04 A;  3UCS C; 
#chains in the Genus database with same CATH topology
 1R6K A;  3P3P A;  4OX9 B;  3FAV B;  1TVK A;  3RGB A;  2HKO A;  1KQS U;  4DR2 O;  2E5L O;  1KP3 A;  2CK3 G;  2GBO A;  3M8A A;  4K0K B;  3FB7 C;  3JAR B;  4GX2 A;  2A3Q A;  4TV9 B;  5ITZ B;  4IHJ B;  3I55 V;  2GV9 A;  3MDS A;  2YI8 A;  1NVP B;  5L3F A;  3JD1 A;  2EIN B;  1PP9 H;  1XMQ B;  4LCU C;  3S3W A;  3X2Q B;  3EXA A;  4CZZ A;  2C2A A;  4KHP B;  3UKM A;  5KMG B;  4I5S A;  2RQ6 A;  2BSK B;  2AZ2 A;  2EUL A;  2ZDI C;  1XEQ A;  3HR0 A;  3B77 A;  3RYH A;  1P7B A;  5CBG A;  5KA5 A;  2VQF O;  2GTA A;  4J9Y B;  1IDS A;  2QM4 A;  4DR5 B;  3AK2 A;  3BY6 A;  1NR7 A;  1AP6 A;  1WLE A;  1Y6X A;  3Q4H B;  4FLU A;  1K5S A;  4O4L A;  3TET A;  3D36 C;  3SYC A;  2CH7 A;  3QO5 A;  2Z3Y A;  4I55 B;  4LF4 B;  4Z1M G;  2DW4 A;  4ABM A;  3JAK B;  4KL1 A;  4KUM A;  3CX5 F;  1BQZ A;  4YHH B;  3HKB B;  2KQX A;  2IJJ A;  4QE7 A;  1NR1 A;  4DUZ B;  4J9Z B;  1VQP V;  4LC1 A;  3CCE V;  4U3J B;  3OEH G;  1E1Q G;  4X1Y A;  3W7U A;  4DR1 O;  1IXM A;  2NLJ C;  1K8A W;  1WB7 A;  3ZRS A;  3CEI A;  2CGN A;  3STZ C;  3ZN1 A;  4DW1 A;  3RYF B;  2JJ1 G;  3BVO A;  1H2S B;  4FFB B;  2A7W A;  2UUA O;  1RM1 B;  4JTA B;  5H2F Z;  2KG7 A;  2DWD C;  3ZMU A;  2D3O W;  4GLX A;  3CCJ V;  2N05 A;  1WP7 A;  3OW2 U;  4CH4 A;  4DRX B;  4DV2 O;  1TAE A;  2Y69 B;  4X66 O;  2HVJ C;  2R9A A;  1KB9 F;  5BR8 B;  1QU7 A;  3FB5 C;  3RN4 A;  3DC5 A;  3DC6 A;  1NT2 B;  1I08 A;  1QLE C;  5J2U B;  2OCH A;  1XL6 A;  3CSX A;  3ZIA G;  1Q43 A;  4F4L A;  2UXC B;  1TA8 A;  3PN1 A;  1KKD A;  1F4M A;  1IVS A;  1OCZ B;  4JYB A;  4I55 A;  3E83 A;  3ZHT A;  1THZ A;  3K0D A;  3JAK A;  3ETG A;  4JI7 B;  4LBE C;  3ABU A;  3E89 A;  2QA4 V;  4DV6 B;  4HYO A;  4FM0 A;  1S5L Z;  2HHH B;  1DF4 A;  3KG2 A;  1K34 A;  4E2L A;  5A2Q N;  4JI5 B;  1HDJ A;  4PA3 A;  3GB7 C;  4TSF G;  3CJH B;  3JAW B;  1TUB B;  4D6T H;  3VQY A;  1K73 W;  3JD3 A;  1EBO A;  4YY3 B;  3B4S A;  1Q7Y W;  4LF9 O;  2AZ0 A;  4AHC A;  2UUB B;  5EIB D;  5JQG B;  1YJN V;  1RPR A;  2QEX V;  4BW9 A;  5FNV B;  2ODM A;  2P4K A;  2ZM6 B;  5IWA O;  5A9G A;  3QG5 A;  5EYP A;  3ZCC A;  4AI8 A;  4K8Z A;  5B1B B;  2PI4 A;  4B3S O;  1Q6I A;  2OWO A;  4JF3 A;  1MSD A;  5HFL A;  1G1X B;  1W0J G;  1J5E O;  2EJ7 A;  1XI1 A;  2QWQ B;  4O2B B;  4RUE A;  3BFR A;  3W7T A;  3CS5 A;  1M56 B;  3RT3 C;  4CC5 A;  5IY5 B;  4JAS A;  3SGI A;  4DR2 B;  3UCS C;  1S72 V;  3CRC A;  3ZMS A;  3JAL B;  3OT7 A;  1R3I C;  1D2D A;  3M7M X;  1S76 D;  4K8X A;  3CC2 V;  2Q0A A;  2FML A;  3E86 A;  4OGQ B;  5BZB A;  1UJW B;  4B3R B;  4AIL C;  1SER A;  3P3N A;  4GX1 A;  4O4H A;  5CN0 A;  2GTS A;  3P32 A;  3ABT A;  1Q86 W;  4U3F H;  1FPO A;  3CJH A;  1K4D C;  1YI2 V;  3L74 H;  2OYQ A;  5LGT A;  1W2B U;  1GN2 A;  4X62 O;  4GKK O;  4B7E A;  3BEH A;  1WAZ A;  3LDE A;  3CHX A;  1Q6U A;  2EIL C;  1Z5W A;  2M7W A;  3VQV A;  4NB5 A;  4X1K B;  4TV8 A;  2VQF B;  4I9Q A;  1NH2 D;  2NR5 A;  2PI5 A;  2Y0P A;  4ICG A;  2CAZ C;  2IJK A;  1PD3 A;  5LGN A;  1WP8 A;  1V55 B;  2ZE5 A;  4FZ0 A;  1RSO B;  2DQ3 A;  3DSQ A;  4EEQ A;  2OIG A;  3AG1 C;  1K7D A;  2R72 A;  4B3M B;  2AGA A;  4WFE A;  1N8R W;  4WBN B;  1S5J A;  3JAM N;  3CRR A;  3HKD A;  3W7X A;  2VWJ A;  1VF5 B;  3AG3 C;  4L8J A;  4J11 A;  2F43 G;  3KKY A;  2PTM A;  4JI8 O;  3T4D A;  4DR1 B;  4JI4 O;  4PJ0 Z;  3AG4 C;  5JCO C;  4MTO A;  1GMG A;  4J41 A;  3LNN A;  5B1N A;  4FLT A;  2E76 B;  2QWO B;  1WA8 A;  1WPX A;  3B40 A;  2GSM B;  1U96 A;  4JYA O;  3H1L H;  2UUA B;  1JOY A;  4YJ2 B;  1UFI A;  2ZCE A;  1G6U A;  4AQY B;  3OTF A;  3FKS G;  1WPB A;  1Q90 D;  3A8T A;  3K08 A;  1BQ0 A;  1VQO V;  4MW3 A;  4KP4 A;  2VRZ A;  1BZK A;  3K5M A;  1AJP A;  1KC8 W;  2WLL B;  1G8M A;  4X1K A;  4GX0 A;  4X66 B;  2LFR A;  4UUJ C;  2WA4 A;  4PA7 A;  2UXX A;  2IH1 C;  3CE2 A;  1OCC C;  5J9P C;  2N74 A;  1OCR C;  4JI0 B;  5GW7 A;  4X64 O;  1OJH A;  2ZD9 A;  1LUV A;  5LHI A;  4X9Q A;  5IYC O;  1V54 B;  1XUQ A;  5CMU A;  3FYE B;  4FLV A;  4RUF A;  4UB8 Z;  3SJC C;  4ZHQ B;  1CEZ A;  1MG1 A;  4UCV A;  4W4K A;  1K33 A;  1GN6 A;  1KUQ A;  1AI6 A;  1YSC A;  1MSW D;  2D2C B;  3TJT A;  2YS8 A;  3MHS C;  1BHA A;  1Q5O A;  3L72 H;  4YJ3 B;  2KB1 A;  1K92 A;  4BIZ A;  1I5X A;  3H1J H;  2ZR2 A;  1FAF A;  2XAH A;  3R65 A;  4CC6 A;  1YTF D;  2F23 A;  3D8C A;  5LHH A;  5KAI Z;  5EBL C;  3ZHR A;  2B5U A;  1T5E A;  4YJ2 A;  4JAA A;  3TXS A;  1H38 A;  3ZHS A;  4GX5 A;  2K9P A;  1AJN A;  4LF9 B;  2JEU A;  3OAA G;  2PYL A;  5KHG A;  3JSL A;  4QE9 A;  3RYC B;  4ZOL B;  2YDE A;  4MTG A;  5CA0 B;  2ITC C;  3D3Q A;  3K03 A;  2DOS A;  4JYC A;  2ZT9 B;  5IWA B;  1HP8 A;  1XDC A;  4XBF A;  1QLN A;  3JCU Z;  1D5N A;  5EZY B;  4U7N A;  1J5E B;  1H8E G;  4PV1 B;  2X0L A;  3VOU A;  1K3E A;  5DEC A;  5KHI A;  2XAS A;  4ZHQ A;  1FS0 G;  3STL C;  3OMI B;  2PGG A;  1N33 O;  2CE4 A;  4H0L B;  3RVY A;  3LDD A;  1YXB A;  4PEL A;  3ZRW A;  1FXH A;  4YIP A;  3D3I A;  3DGE A;  4JI2 O;  3HPL C;  5BR8 O;  1JA8 A;  3JAS A;  4I9W A;  4NTW A;  4NYK A;  3RYI B;  3G6B A;  4X65 B;  1K97 A;  1CPY A;  4JI6 O;  1ZL8 A;  4GT1 A;  1FD9 A;  1OV9 A;  1TGO A;  4CH5 A;  3ZMT A;  5AG2 A;  4DV7 O;  4GKK B;  1AR4 A;  2F4V O;  4OPA A;  4RO2 A;  2H8P C;  1XBL A;  3E22 A;  1SQB H;  1SRY A;  3RYC A;  4MTX A;  2JRI A;  1BGY H;  2P4V A;  4X20 B;  5CA0 A;  2WAM A;  4NXN O;  2ZE7 A;  4D7S A;  1GN4 A;  1Z5V A;  2LW1 A;  4R8C A;  2LGW A;  1KYO F;  4E4E A;  2IW5 A;  2QWR B;  1B6Q A;  3IJ4 A;  2ITD C;  5IT9 N;  1I7F A;  4RWU A;  1HW7 A;  2EIK C;  1I94 B;  4JAV A;  1QR8 A;  1R73 A;  1GO3 F;  4YY3 O;  3MAQ A;  3UQ8 A;  4JI8 B;  1X59 A;  1FXK B;  5IYZ A;  4BWA A;  4UCR A;  4JI4 B;  2BOC C;  3N2K B;  5D5P A;  3QF7 A;  3KCX A;  3L9D A;  4G27 B;  3RYI A;  4JAU A;  1KBH A;  1E79 G;  3QNE A;  4X88 A;  3TCU A;  4UCS A;  1VQ6 V;  4JYA B;  4DR4 B;  4DV1 B;  3CRM A;  5GON B;  4B3T O;  2L35 A;  1AI7 A;  1HNX O;  2V1D A;  4P9P A;  5LGU A;  1YJW V;  4X20 A;  1OCO C;  1BCC H;  4EB6 B;  2OTJ V;  4X8A A;  5JJJ B;  2FB5 A;  4B3R O;  1US6 A;  4Q20 A;  3OE7 G;  4X64 B;  3ABL C;  2DYR C;  3SJQ C;  1NTM H;  1BSM A;  2ZR3 A;  4KXR A;  1QLE B;  1Y76 A;  1BE3 H;  4B7K A;  1BL8 A;  3EFF K;  4I50 A;  1NQT A;  1FXK A;  1PNL A;  5JH7 A;  3ABM C;  3OUS A;  3WB0 A;  4WFB V;  3DXR A;  3ASO C;  1JFF A;  4R7C A;  4X89 A;  4HZ3 A;  5H5N A;  2DYS B;  1GH6 A;  1N34 O;  5KHJ A;  1R1B A;  3ZHU A;  4B3M O;  4O2A B;  1SQP H;  3FAV A;  5GON A;  3E2E A;  3RBZ A;  4UB6 Z;  4IGG A;  1H2N A;  5EIB C;  3JAR A;  2GDS A;  2M6Y A;  4TV9 A;  3S3X A;  4IHJ A;  5ITZ A;  1IBL B;  1H2K A;  4ZKI A;  1SQX H;  1VMG A;  4PA9 A;  2QGN A;  4K35 A;  5KAF Z;  1N32 O;  3KZI Z;  1SA0 B;  2YXL A;  3A2F A;  4BIO A;  3F5W C;  5L3E A;  3CME V;  3OGC C;  4QNH B;  3ZN0 A;  1NTZ H;  3LSS A;  3IGA C;  2LO1 A;  4IIJ B;  4AQY O;  4BR6 A;  4DYL A;  1GRJ A;  5KMG A;  1ZLZ A;  1VQK V;  1N33 B;  2BSK A;  2BOB C;  1GM9 A;  1G4Y B;  5F2V O;  4O4I B;  1NS1 A;  1SES A;  1DF5 A;  4JI2 B;  4J42 A;  1B06 A;  4WFF A;  4PA4 A;  3RWR D;  4JI6 B;  1VQL V;  2UXN A;  4MSW C;  3ZHQ A;  3Q4H A;  2ZIM A;  2E74 B;  4JI0 O;  2JS5 A;  3I56 V;  3ZX6 A;  2WPD G;  3UT5 B;  2IU3 A;  4DV7 B;  1CXZ B;  2F4V B;  1MZF A;  2RMK B;  2EIN C;  4FMT A;  1GM8 A;  3UO3 A;  3HKB A;  2ZIO A;  3CCQ V;  3OUF A;  4NXN B;  1H8H G;  3X2Q C;  3E8G A;  1LNQ A;  2X7R B;  4U3J A;  2CDY A;  4J7K A;  1R3L C;  5JWP A;  5JJE B;  1KU9 A;  4PDV A;  4OPH A;  3AK3 A;  4J10 A;  3QO8 A;  1SC5 B;  1O9G A;  1NI8 A;  5BMV B;  2ARH A;  3L70 H;  1PM9 A;  3RYF A;  3ZED A;  1R3J C;  3CP1 A;  3LDC A;  2Y4T A;  4FFB A;  3AG2 C;  4FLY A;  3OTO O;  4RQE A;  4OXS A;  2RJZ A;  1FFX B;  4MVM A;  4BW5 A;  1ZSP A;  2WLK A;  3P30 A;  4MTF A;  5B5E Z;  1HNW O;  2W6I G;  4DRX A;  3WB2 A;  5CA1 B;  2QTS A;  3G80 A;  3CC7 V;  1LUW A;  4WF9 V;  2WWW A;  1VEW A;  2YIC A;  3K5O A;  3HKE B;  2K1E A;  3QO7 A;  2LQT A;  4UVA A;  3SDL A;  3SPJ A;  3AEI A;  2FTK A;  5FLX N;  5J2U A;  1J95 A;  2KSD A;  1AI4 A;  4LNU B;  2LFS A;  4QGP A;  1HNZ B;  3AG4 B;  5B1O A;  4HAM A;  2QKA A;  3W7W A;  1PKX A;  3UT5 A;  4B3T B;  1IXB A;  1HNX B;  2Q6A A;  4GKJ O;  1KEC A;  1Q6H A;  1PL4 A;  1RM1 C;  1Q81 W;  2BE3 A;  2YC0 A;  1U97 A;  1JMK C;  1VF6 A;  2Q7G A;  1L1F A;  5LA6 B;  3UM7 A;  1AP5 A;  3U0Z A;  2ZIN A;  4G28 B;  2VQE B;  5IE9 A;  1YJ9 V;  1DTO A;  1F7Y A;  2Y69 C;  4X65 O;  3H1H H;  2HLD G;  3U10 A;  2YEV B;  1P84 F;  5LOV B;  1XRE A;  4PI2 A;  1XIL A;  2WA3 A;  3JAW A;  1TUB A;  1OCC B;  2EIJ B;  1FFX A;  2OCC C;  4UXN A;  4FM1 A;  2IH3 C;  2YUA A;  2RCV A;  4F6E A;  1MMM A;  3A0B Z;  5JQG A;  2E3C A;  2DQ0 A;  2CTQ A;  5FNV A;  5CA1 A;  1VQ7 V;  2RN9 A;  1BMF G;  3BA9 A;  2AXT Z;  4FPP A;  4PDM A;  3SR2 C;  1N34 B;  1GK9 A;  4DV4 O;  3K79 A;  1PNM A;  2B1G A;  1QVF U;  4P9O A;  2BTQ B;  4LNU A;  4WCE V;  3CCS V;  4LR3 A;  1S5H C;  2Z5U A;  4O2B A;  5KX5 B;  5KHH A;  4BAY A;  1I94 O;  2Q0O C;  1SQQ H;  3PJS K;  5KUK A;  3MHH C;  1TUE B;  1VQ8 V;  3BPZ A;  3JAL A;  1N0N A;  4DR7 B;  3JCZ A;  4JI1 O;  3SPC A;  5LA6 A;  4XDJ A;  4JTD B;  5EBW C;  1QVG U;  5IDJ A;  3FFQ A;  1FXV A;  4RAI A;  5E1A C;  4LFB O;  3OMN B;  2DWE C;  1N32 B;  4WFA V;  4X1I B;  5LOV A;  5KHK A;  3JYC A;  4DR4 O;  2N04 A;  2QR4 A;  1FKA O;  4IYH A;  2EX3 A;  5B1A B;  4LF6 O;  4DV1 O;  3JAT B;  3IFX A;  1XHX A;  2WLM A;  1LR1 A;  4MVS A;  5KLV H;  5L3G A;  2Q8V A;  4UCO A;  5H6R A;  1Q8I A;  5GTH Z;  5LYJ B;  1BT8 A;  4FLW A;  4FLZ A;  3CD6 V;  2AHZ A;  1Y74 B;  2BTO A;  4LWS B;  4QIW F;  2CTW A;  1RSO A;  2BTQ A;  4DR6 O;  3H01 A;  3ZHV A;  2O57 A;  2UXB O;  1Y66 A;  1UPG A;  4J80 A;  5IJ0 B;  1SZT A;  3G67 A;  2EIM C;  5K1X A;  4WBN A;  1PV0 A;  4EFE A;  1IBK B;  2YI9 A;  5L3C A;  2EJR A;  3OEE G;  3RVZ A;  1O9H A;  3J80 N;  4JYY A;  1QCE A;  3JD4 A;  4DV0 B;  1SQF A;  4NKG B;  1BHB A;  4CH3 A;  1QBZ A;  4I0X B;  4DK0 A;  1COW G;  3W7S A;  5J2T B;  2P5O A;  4J7Z A;  4H37 A;  3APQ A;  4C7U A;  1NBM G;  3T1Y B;  3OTO B;  4DR3 O;  4DXW A;  2Q73 A;  3B2E E;  3BAB A;  1M1K W;  3JAT A;  5LP6 C;  3B8N A;  2X6B A;  1SF9 A;  1HNW B;  1N0J A;  1YHQ V;  3ASN B;  3H1I H;  4RQF A;  1YVW A;  2DN9 A;  3HKC B;  2WLL A;  3O65 A;  1IBL O;  4QPJ A;  5LYJ A;  3FYI B;  3JSN A;  3SJA C;  3I5D A;  4DK1 A;  3HB3 B;  1ENV A;  4GZR B;  1N36 B;  1GTO A;  2Q68 A;  3CB2 A;  1XNR B;  3J81 N;  3A0H Z;  2V4D A;  4O4J B;  1F4N A;  4GKJ B;  1M5I A;  3QVN A;  1MOF A;  1M57 B;  2WLI B;  4DUY O;  3TK1 A;  2XHB A;  2CUG A;  1R3K C;  1XQ8 A;  3SYP A;  2PUS A;  5KA6 A;  2WSS G;  1V9P A;  2RNB A;  1YZB A;  2JVD A;  4YJ3 A;  3CCM V;  1H2M A;  3ZRV A;  3ABK C;  1OCO B;  4PHZ A;  3E35 A;  2HJF C;  2ZKO A;  4LH6 A;  4YIO A;  1VIB A;  3GWO A;  3ABL B;  4ZOL A;  3B8M A;  3CXH F;  3CYO A;  4CS2 A;  3HKC A;  1N4C A;  4MVZ A;  3WB1 A;  2YIB A;  4MVQ A;  3WG7 C;  5C8Y B;  2QWN B;  1TVK B;  4DV3 B;  4P30 A;  5EZY A;  5LHG A;  4DV4 B;  1ZTE A;  1XOU A;  2ILM A;  4B08 A;  3BRC A;  2PF4 E;  1S3J A;  3ASO B;  2W0F C;  1W59 A;  2HR3 A;  4O4J A;  3K57 A;  1QQC A;  2V7Q G;  1HR0 O;  4PD4 F;  4DO2 A;  4U7O A;  4FK5 C;  5B3S C;  4MW8 A;  3T1H O;  3M99 B;  4LF8 O;  2JS3 A;  4D7T A;  5EC2 C;  2H94 A;  4CBC A;  1B04 A;  4JI1 B;  4UCU A;  1JJO A;  3WU2 Z;  2WLJ A;  4IL6 Z;  2CTP A;  1H2G A;  2XOK G;  1AJQ A;  4BIU A;  3T4Z A;  4EFB A;  4LFB B;  1ZX3 A;  2X6A A;  1XMO B;  4TUY B;  4TQD A;  2HVK C;  4ZBM A;  3EHB B;  1L0N H;  1JVM A;  1HNZ O;  2JIZ G;  3C3S A;  2DMX A;  2YIA A;  5EBM C;  3ML0 A;  4LF6 B;  2XAQ A;  1I5Y A;  2HG5 C;  2PZS A;  2QM7 A;  5JVD B;  1I0H A;  4R6Z A;  2Q67 A;  4LFA B;  2WLN A;  3NR7 A;  4O4L B;  3SPH A;  5EK0 A;  1D5A A;  2XND G;  5HFM A;  3E8F A;  2CH7 B;  4TOI A;  2VQE O;  2OT5 A;  4FIP C;  2ZDI A;  5C8Y A;  1WNS A;  3ZRX A;  4JI3 O;  2LJ2 A;  1Q3E A;  4UVC A;  1PPJ H;  2MK3 A;  4I7Z B;  4KFM A;  4FM2 A;  4DR6 B;  2UXB B;  3K04 A;  3J7A U;  2A9H A;  4PDL A;  3K5N A;  5FPO A;  4JZ2 A;  4X1Y B;  4FVM A;  1R6T A;  4TQF A;  4Z1V A;  3D36 A;  3CCU V;  4A5U B;  3H9V A;  3SYQ A;  2YSU B;  1XNQ O;  3N2K A;  1KMI Z;  2KG7 B;  2ADP A;  4TUY A;  3LNM B;  2H3O A;  1NH2 B;  3F7V C;  1FJG O;  4WFG A;  4DR3 B;  5LMN B;  2WLH A;  4YXW G;  1M4U A;  5CBH A;  3TGU H;  1URF A;  1MA1 A;  3VBB A;  5IYD O;  2ZXW C;  3AG2 B;  4CS3 A;  1K9M W;  5JVD A;  4EB6 A;  3BHP A;  1VQ4 V;  1EM1 A;  4DR7 O;  4WFH A;  4FJC C;  1ORQ C;  1SQG A;  2W6J G;  1FXK C;  4XDL A;  4LF5 B;  4LF7 B;  1M9N A;  2YIB D;  2AHY A;  4MVU A;  1NZ6 A;  5BY1 A;  1AR1 B;  5LL6 Y;  2HJD A;  1EZJ A;  3DTU B;  1KKC A;  5CB4 B;  4DUY B;  4L87 A;  2UU9 O;  2QSA A;  1RP3 B;  5EC1 C;  4DW0 A;  3LSQ A;  3E8B A;  2ZE6 A;  3CRQ A;  1ZAU A;  2ZNJ A;  3SPI A;  4NVP A;  2NNU A;  3LSU A;  2Q7E A;  4JPR A;  1L0L H;  1SQV H;  3OR7 C;  2P67 A;  2W0X A;  2E75 B;  2Y0I A;  4O2A A;  4IYI A;  2ETN A;  5EYP B;  3EVK A;  1VQN V;  1IBK O;  2IJH A;  4UV9 A;  2LGQ A;  2JDI G;  3AK1 A;  3OGI B;  1F23 A;  1AVM A;  1MAB G;  3K3W A;  3K06 A;  4IT5 A;  3G71 V;  4DV5 B;  2R9R B;  2OCC B;  2P90 A;  5LXT B;  2LW7 A;  1VF7 A;  2P22 C;  3G6E V;  1L8D A;  3ICX A;  5BXZ A;  4DV0 O;  3RW0 A;  3SPG A;  3TXQ A;  2EIL B;  4HNA B;  2XTA A;  2FYU H;  3FD9 A;  4JV5 O;  2EZO A;  3VQW A;  1RPO A;  5LMU O;  4TT3 G;  1AI5 A;  1SA0 A;  4J7J A;  3ETD A;  4H13 B;  3T1Y O;  2DYS C;  4ZIB A;  1HR0 B;  5CB4 A;  1YTF B;  4IIJ A;  1OZ0 A;  2CTR A;  3T1H B;  4LF8 B;  1H2L A;  2GHY A;  3OD4 A;  3C3T A;  3AG1 B;  4O4H B;  3L73 H;  2PYJ A;  4O4I A;  4TWK A;  3AG7 A;  1VAR A;  2PY5 A;  5E79 Z;  2Q69 A;  3AG3 B;  1S77 D;  4Q6G A;  3UO2 A;  1JPX A;  1IUR A;  1EN5 A;  3OM3 B;  4EKW A;  1ZWI C;  2R70 A;  1XL4 A;  4H44 B;  4UCT A;  1N36 O;  2L6L A;  1XNR O;  1DLB A;  2QKS A;  5L3B A;  4MVO A;  4TV8 B;  3SJB C;  1EN4 A;  3E8H A;  3K9A A;  4NTX A;  2R9I A;  1ZUQ A;  2UUC O;  2P7T C;  1NJI W;  2DE0 X;  4LFC B;  1FYJ A;  2GUZ B;  3IC9 A;  3O9O A;  5LXT A;  2YXH A;  2B9Z A;  2QE7 G;  1GN3 A;  3A0R A;  2FL4 A;  4JI3 B;  4HNA A;  2RDC A;  3HKD B;  3THO A;  2UXD O;  2OTL V;  5BMV A;  5CBF A;  3CC4 V;  1SET A;  1E1R G;  3JD2 A;  2E5L B;  3F7Y C;  1NVP D;  4PI0 A;  1IX9 A;  1VQ5 V;  1VP7 A;  1OCR B;  4UV8 A;  2A79 B;  2P6J A;  3ETQ A;  3N27 A;  1ARO P;  1OCZ C;  2Y4U A;  1DGS A;  2YXY A;  3FX7 A;  2EIM B;  1WA8 B;  1XNQ B;  3F5T A;  5CA3 A;  1JX9 A;  2JEX A;  3HKE A;  1VF6 C;  1BS3 A;  2XAG A;  5KUM A;  2JGD B;  2IBZ H;  4DV3 O;  2XT9 A;  2MW2 B;  1EZV H;  4JTC B;  4F6R B;  3U11 A;  2KKW A;  1FFT B;  5FPR A;  2QJ1 A;  1AR5 A;  3L75 H;  1FJG B;  5JCO A;  4ZI7 B;  5IJ9 B;  3RFR A;  2F95 B;  2HP8 A;  4MT8 A;  1IBM O;  1K4C C;  3N2G B;  3JD0 A;  2Q7H A;  1W0K G;  4LH7 A;  2GUZ A;  3ZMV A;  3BCC H;  1Y4M A;  1KD1 W;  4NXM O;  5LP6 B;  4W4L A;  1IZ3 A;  2QTO A;  3LUT B;  1YIJ V;  2IM9 A;  1SS3 A;  2AW9 A;  3ZMZ A;  1XMO O;  4QJF B;  2YEV A;  4ASU G;  5B1B C;  4P2Z A;  1DK1 A;  2Q9L A;  1R6N A;  3CPW U;  2ZQM A;  4GCZ A;  2UU9 B;  1MZE A;  2XUM A;  2Z0A A;  2Q4P A;  3CXC U;  1M56 C;  4MS2 A;  5IY5 C;  5IYB O;  5DED A;  4LFA O;  3CCL V;  3GVM A;  4PDR A;  1P7G A;  3CCV V;  4OX9 O;  3NXS A;  2JGD A;  4G2K A;  1WB8 A;  3L71 H;  4JGS A;  4F6R A;  4DV2 B;  4UVB A;  1RFY A;  2XAF A;  3FB8 C;  4K0K O;  5KX5 A;  3ABK B;  4FFK A;  1YEW A;  1NU1 H;  2IU0 A;  4ZI7 A;  5IJ9 A;  4GUN A;  3IC7 A;  1HWY A;  1XHZ A;  2ADQ B;  3N2G A;  3OFN G;  1Y67 A;  2EIJ C;  2FKX A;  5GTI Z;  1SZX A;  5LP6 A;  3OR6 C;  1AB3 A;  4K3A A;  1XMQ O;  3QTC A;  4QPK A;  4JV5 B;  2Q5Z A;  4N23 A;  2QKC A;  2ZNI A;  2VWK A;  3T1C A;  4H33 A;  5LMU B;  2YID A;  5D5Q A;  4KHP O;  4X1I A;  1F51 A;  1VQ9 V;  2NN4 A;  2XAJ A;  3WG7 B;  3H1K H;  3GWK C;  3ZRW B;  2A0L A;  3APO A;  5LMN O;  1X4T A;  1V55 C;  3OMA B;  5DN6 G;  1GKF A;  1QNM A;  3JAS B;  2JK5 C;  2EIK B;  4DR5 O;  3ZS8 C;  2QWP B;  1JCH A;  1ZL8 B;  1S0V A;  4LP8 A;  5B3S B;  3CWB H;  2BCC H;  4N21 A;  3SYA A;  4LF4 O;  4LF5 O;  4LF7 O;  1KP2 A;  3E22 B;  1Y74 A;  4LWS A;  1YF2 A;  4NR1 A;  1QR9 A;  5K1P A;  4YHH O;  1GM7 A;  4XDK A;  4DUZ O;  4PA6 A;  2EZP A;  5IJ0 A;  1K5Q A;  1CP9 A;  5H9C A;  2UUC B;  2X6C A;  5LBQ A;  1YIT V;  4B3S B;  5B1A C;  3K59 A;  3B09 A;  3KCY A;  2Y48 A;  3CCR V;  5FL7 G;  4HBN A;  4R50 A;  4GYC B;  1Q82 W;  3R66 A;  1B3Q A;  1VQM V;  2P06 A;  4I0X A;  3VQX A;  2UXD B;  1JJ2 U;  3T2M A;  4JZG A;  4I4T B;  3K5L A;  5J2T A;  1YDX A;  1PNK A;  5B66 Z;  3FB6 C;  5IYZ B;  3ZBH A;  4NTY A;  1EN6 A;  2B1I A;  3SYO A;  1P4R A;  5C93 A;  3IAY A;  2EBO A;  2DYR B;  1EFR G;  1AIL A;  2LP7 A;  1V54 C;  1OHH G;  2F93 B;  3BAA A;  3WFV A;  4DV5 O;  1M93 A;  2UXC O;  1MNG A;  2DJV A;  1M90 W;  3G4S V;  1YCI A;  4X62 B;  3K58 A;  1QHT A;  3ABM B;  3ZJZ A;  2HFE C;  4JI7 O;  3BA8 A;  4CS4 A;  4UFZ A;  1JQ0 A;  2IJI A;  5JJN B;  3MD0 A;  2F66 C;  2VS0 A;  2JJ2 G;  1P49 A;  4DV6 O;  2WLI A;  1Z2G A;  1NKD A;  1IBM B;  2HEP A;  1GAX A;  4MVR A;  2HHH O;  3CMA V;  3ETE A;  1ROP A;  4Z2W A;  1WJZ A;  5L3D A;  1JR9 A;  1A32 A;  2JGU A;  4NXM B;  3K9S A;  4JI5 O;  2F1M A;  1NTK H;  1WN7 A;  2G38 A;  3ASN C;  4FLX A;  4CH6 A;  2ZXW B;  1Y76 B;  2QM8 A;  5H6Q A;  2ATK C;  2A06 H;  4I4T A;  5DM6 V;  5TIS Z;  1PL0 A;  1SKV A;  4I50 B;  2UUB O;  3RYH B;  3C90 A;  2ZE8 A;  3K0G A;  5JH7 B;  2CGO A;  2ZM6 O;  2OIE A;  3DXR B;  4FZ1 A;  1JFF B;  4LFC O;  2QDO A;  1M57 C;  3CRA A; 
#chains in the Genus database with same CATH homology
 1FPO A;  1BQ0 A;  2GUZ A;  1HDJ A;  2CTW A;  1N4C A;  3UO2 A;  3BVO A;  2LGW A;  2Y4T A;  1FAF A;  2DMX A;  1IUR A;  2DN9 A;  2GUZ B;  4J80 A;  2QWR B;  3UO3 A;  2QWP B;  1NZ6 A;  2CUG A;  1BQZ A;  2YUA A;  1WJZ A;  2QWN B;  2KQX A;  2EJ7 A;  4IT5 A;  2OCH A;  4J7Z A;  2QWQ B;  2CTR A;  3APQ A;  2QWO B;  2Y4U A;  2LO1 A;  2CTQ A;  4RWU A;  2L6L A;  2M6Y A;  2PF4 E;  2CTP A;  1XBL A;  1GH6 A;  2N05 A;  3APO A;  2QSA A;  2YS8 A;  3AG7 A;  2N04 A;  3UCS C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...