1BQ0A

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-104) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 10
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bq0A00
2QWPB 2CTWA 2YUAA 2GUZB 2CUGA 1IURA 2M6YA 3UO2A 2LGWA 1GH6A 2DN9A 2L6LA 2LO1A 2Y4UA 1BQ0A 4IT5A 1N4CA 2N05A 2QSAA 2YS8A 1NZ6A 1BQZA 2DMXA 2QWRB 1WJZA 2Y4TA 3UO3A 3APQA 2CTRA 3UCSC 2GUZA 2QWQB 3AG7A 1FPOA 2QWOB 3BVOA 1FAFA 1HDJA 2KQXA 1XBLA 4J7ZA 2PF4E 4J80A 2CTQA 2OCHA 2N04A 3APOA 2EJ7A 4RWUA 2CTPA 2QWNB
chains in the Genus database with same CATH superfamily
1G4YB 2EULA 2IH1C 2JGUA 4JV5O 4P2ZA 1ZL8B 5JVDB 1KKCA 3ETGA 2WLLA 4HNAB 4DRXA 4P9OA 1KD1W 1TA8A 5EIBD 3LDEA 1VF5B 2RMKB 5LHGA 1H2GA 2ARHA 3H1HH 3UQ8A 1AILA 1K92A 4FM0A 4GT1A 1N33B 3K9SA 5ITZA 3CJHA 3D3IA 5D5QA 4F4LA 4IIJA 1L0LH 3CB2A 1SF9A 2P06A 5D5PA 1BHBA 4UVAA 1TVKA 2BCCH 2KQXA 4JTAB 2PZSA 3ZMSA 5BMVA 4ZKIA 3CSXA 4PV1B 1SQQH 2W0FC 4DV4O 2ZE7A 2XASA 1A32A 2ITDC 2DOSA 1IBLO 4B3SO 4X9QA 1HR0B 2ZM6B 2PYJA 5JJEB 2XUMA 4LF4B 4BAYA 2V4DA 2QTOA 1R3LC 1W59A 3RYHB 3OTFA 2GTAA 3PJSK 4CZZA 5EYPB 2CUGA 1ENVA 4B08A 1N0NA 4TWKA 3F7VC 3B4SA 4UXNA 3BA9A 3UO3A 2GTSA 4TV8A 2B9ZA 1TUBA 1MSDA 3ZHQA 1XMOO 2X6CA 5JQGB 1MNGA 1YIJV 4DV5B 2UUBB 1K73W 3U0ZA 3I5DA 3M99B 4Q20A 1S0VA 3RYIA 3HKEA 4FIPC 4JTCB 3ZMZA 5B66Z 2F23A 4B3MB 1KMIZ 4WCEV 1IVSA 5IYBO 1V55C 3TK1A 3K57A 2ZCEA 1PL4A 5KMGA 4TUYA 3S3XA 1XBLA 4I9QA 1V55B 1XNQB 1N32B 1SQPH 1EN5A 3VOUA 2V1DA 1QQCA 3E86A 5J2UB 4YJ3B 3OGIB 3ZMUA 2LO1A 4R8CA 1SS3A 1N33O 1KKDA 1SETA 5CN0A 1HNXB 3JAKA 3THOA 4NXMB 2FKXA 1IZ3A 1IXBA 4MVMA 3N2GB 2ZR3A 4N21A 3WG7C 3ABMC 1JVMA 2UXCO 1ROPA 3LUTB 4GX0A 4AHCA 3SYCA 4FJCC 3WG7B 3L70H 4DR4O 3ABMB 3BFRA 4MVSA 4NYKA 2EIMC 4B3TB 1K5SA 1NTZH 2Q7GA 2ZXWC 1WN7A 5E1AC 5B1NA 1IBKO 1NTMH 1FFXA 5EZYB 3HKDA 2EIMB 1NKDA 2EZPA 1XHZA 3W7WA 4QPJA 3W7TA 2ZXWB 4J80A 3CC7V 2WLJA 1IX9A 1K7DA 1W0KG 2WLIB 2BSKA 4U3FH 1VQ5V 4X20B 4LFAO 2FB5A 5FNVA 1JJ2U 4GKKO 1YJWV 2JIZG 1NQTA 5LOVB 2VWKA 4O4IA 3IJ4A 1TUEB 4QNHB 2WA3A 1YJ9V 1Y74B 4TSFG 3M8AA 2OTLV 4Q6GA 3R66A 2OCCC 3T1HB 2Z0AA 1Q7YW 2CGNA 4PA9A 1EFRG 2OCCB 3K9AA 4JYBA 5IJ9B 3CCJV 4WFBV 3CC4V 4QE7A 1YI2V 1BL8A 1NTKH 2EIJC 2PF4E 1VMGA 2WSSG 3ZIAG 2EIJB 2VQEB 4FLWA 4IL6Z 2XNDG 2MK3A 4CBCA 3FB7C 3G67A 1R3JC 1ORQC 2JGDA 1XL6A 1QVGU 1XQ8A 1QVFU 3RYFA 3T1YB 1JFFA 1HP8A 3JYCA 1VEWA 3DXRA 4FFBB 3SGIA 1S76D 3CX5F 2JVDA 3UM7A 1T5EA 3ZRWA 1LR1A 3G4SV 3SYPA 1F23A 4O2AA 3CP1A 4MT8A 4B3TO 2EBOA 1KQSU 2E75B 2AZ2A 4BWAA 3L74H 1VQOV 4BIZA 4WBNB 5BR8B 3AG4C 2UUCB 3T4ZA 2GBOA 4B3RB 4PI2A 4X1YB 3AG4B 2QKSA 4DW0A 1LUWA 5JWPA 2F93B 4J41A 4UCRA 5IYZB 1Q6UA 2QWNB 3SPCA 5JH7B 1WA8B 4QPKA 5EBWC 1AB3A 1WP7A 1PV0A 1VQ7V 3ML0A 3ZEDA 4U3JA 2E74B 1OCCC 2PI4A 1H8HG 1D5AA 5B1BC 5HFMA 2AHYA 4MTOA 4BIUA 5IYDO 1OCCB 4PHZA 3T2MA 4J11A 2EJ7A 1OV9A 2IU0A 5B1BB 1M90W 4G2KA 2PYLA 5CA0B 1VQPV 2FMLA 3OMIB 1M56C 4R7CA 1VQ8V 4LCUC 3CCSV 3E8BA 1Z5WA 1M56B 2FYUH 2Q68A 4UCVA 1J5EB 3U11A 3E22A 5JJJB 4FZ1A 4I55B 2QKCA 5B1AC 4F6RA 4IYHA 3CS5A 3K5LA 2HVKC 3K79A 3BABA 5B1AB 1SKVA 4DV0B 1I5YA 3LDDA 3E8GA 1P84F 1VQ4V 2R9IA 3OAAG 1H8EG 1URFA 5LHIA 2C2AA 4LF7B 4I4TA 4DR3B 2X6BA 3ZRSA 3RT3C 2AW9A 1JR9A 4L87A 4TV9B 1Q81W 1R6NA 2YI8A 4CH3A 2ZR2A 2OTJV 1K97A 3F7YC 2GUZB 2XAGA 5CBGA 3VQXA 2DN9A 5BR8O 5LMNB 2UUCO 5JJNB 5DN6G 1Q6HA 5H9CA 4U7NA 4B3RO 4JI7B 2WA4A 3X2QC 3SPHA 4ZOLA 1NS1A 2QM7A 1SQBH 1JJOA 3E89A 1VIBA 1CPYA 4H37A 4PA3A 2FTKA 2P4KA 2GHYA 1R73A 3X2QB 4DR1B 1X4TA 2Q8VA 4DV2B 2RCVA 1NVPB 3JALA 4YJ2A 4JTDB 3N27A 1NBMG 3AEIA 4TQDA 1RSOB 2KG7B 1UFIA 3RGBA 2Y48A 2UXBB 3JAWA 1QLNA 2A06H 2XT9A 3AK1A 1XOUA 1VQMV 1Q3EA 2W0XA 1FKAO 3SPJA 3ZHTA 3OE7G 2YIBD 3P30A 1GM9A 4FZ0A 5C8YB 1KBHA 2A9HA 3GVMA 3JARA 1ZLZA 4UVCA 1K4DC 1MA1A 2WLNA 4ZI7A 4DV0O 2ADPA 4DV1O 2HG5C 1ZL8A 5JVDA 1VF6C 4JYYA 4O4JA 1VQNV 4DV4B 5KX5A 2QDOA 2H3OA 4HNAA 1NT2B 3OW2U 1M5IA 1WP8A 3SJQC 1ZWIC 1WAZA 2OWOA 4KUMA 4LWSB 1AR1B 1L8DA 4ZHQA 4UUJC 2JDIG 2CH7A 2OIEA 4JI7O 3FAVB 3OR7C 4MVQA 5CB4B 1XEQA 3SJCC 5LA6A 5GTIZ 4G27B 4U7OA 1MABG 2PTMA 4HAMA 4YHHB 1BSMA 2UU9O 2K1EA 5CA1B 4IGGA 4J42A 3AK2A 2DQ0A 4DR7B 4O4LA 2YICA 4DR1O 1XMOB 1TAEA 2CGOA 2Z5UA 2EIKC 4JI6B 3W7UA 1Q86W 5JCOA 4JYCA 5KHHA 1UPGA 5K1XA 2IBZH 4CH4A 1RPOA 2EIKB 3KZIZ 5LXTB 3ZS8C 2LGQA 1NR7A 4LF5O 2UXNA 3BCCH 3GWOA 2UXBO 1AI5A 3ZRXA 4BIOA 5B5EZ 1SA0A 5LMUB 3F5TA 3PN1A 2ADQB 2BOBC 2QM4A 4I50A 2Y0IA 3D8CA 3ZN0A 3RFRA 1L0NH 2DE0X 1IBMO 1GO3F 2CTQA 2XOKG 1GK9A 4MTFA 3Q4HB 1KC8W 1PL0A 3MHHC 2W6IG 2BTQB 1NVPD 4I5SA 1V9PA 1S5JA 4O2BB 1F4MA 2N74A 3K59A 5E79Z 2UXCB 1G6UA 3E35A 4HZ3A 3JD4A 1P7GA 2Q9LA 5IY5C 4DR4B 3BRCA 4KHPO 1QU7A 4NXNB 3CEIA 1PNKA 3KG2A 5IY5B 3CCQV 2IJHA 3UT5B 3HKBB 3A8TA 4XDKA 1DF4A 4B7EA 1IBKB 1MOFA 4UCUA 4CS3A 4DO2A 5J2UA 4UVBA 3N2KB 2X0LA 4JI8B 1I7FA 4JYAB 2Q67A 4GUNA 4RAIA 3OUFA 1L1FA 5CBFA 4LFAB 1WLEA 4I7ZB 4GKKB 3N2GA 4DUYB 4YHHO 5B1OA 1GN6A 2YXYA 3HKCB 3H01A 4DR7O 3K08A 4JI5B 2XAQA 3SYOA 3OGCC 1ZTEA 2WLLB 2NN4A 4JI6O 1KU9A 4ZIBA 2LJ2A 4LP8A 3RYCA 1Q90D 4FLYA 3ZHRA 4JAAA 4DRXB 5CBHA 5EZYA 4X1IA 4JAUA 1RP3B 3DTUB 3B2EE 1N4CA 3C3TA 3ZN1A 5LMUO 5ITZB 3CJHB 3E8FA 1HNZO 5HFLA 1F7YA 1JMKC 4IIJB 2P6JA 3SYQA 5GONA 3ABKC 1M93A 3ZMTA 1B3QA 1XILA 3FX7A 1K5QA 1KP3A 4CH5A 2Y69C 3ZHVA 1AI6A 1PD3A 2ZT9B 3ABKB 1Y74A 2Y69B 3L75H 3CCRV 1EN6A 4RWUA 3D36A 1VARA 2A7WA 1PPJH 2D2CB 1S3JA 4J7JA 1H2SB 2ZIOA 4LFCB 1S5LZ 4WFAV 1GKFA 4Z1MG 4LF9B 4NXNO 4CC5A 2QE7G 2AGAA 4JI0B 1W0JG 3SDLA 4FLZA 5H5NA 3P3PA 5FPOA 2ZINA 3P32A 4YIOA 2H94A 4K0KB 1RFYA 1Q43A 3KCYA 5LHHA 4JI8O 2Q0AA 1E79G 3RW0A 2YIDA 2E5LO 1AROP 4JYAO 5EK0A 1YCIA 2X7RB 2EINC 2LP7A 4UB6Z 4DUYO 5H6RA 4O4HA 1QCEA 3HKEB 5KUKA 4GLXA 1K34A 2QWQB 1HDJA 2EINB 4FFBA 1EBOA 2PGGA 1QNMA 5EC2C 3TXQA 1G1XB 4JI5O 2HEPA 2LFSA 1D2DA 1KP2A 2HFEC 1UJWB 5KMGB 1O9GA 4TUYB 4UCTA 1GN2A 1YXBA 2VS0A 4XDJA 2WAMA 4IT5A 2HHHO 4LF8O 1YF2A 4FLUA 4WBNA 1PP9H 1Y76A 2CTRA 2QEXV 4P9PA 5BY1A 3CXCU 4PDVA 3W7SA 1SRYA 1AR5A 2JS5A 3E83A 1JOYA 2F66C 4RUEA 2UXDB 1FXKA 3MAQA 1N8RW 2JJ2G 1JPXA 4A5UB 2P22C 5CA3A 5LGUA 2YS8A 5IYZA 4FVMA 3RVYA 3ZMVA 4LR3A 5JH7A 3IFXA 1BS3A 3F5WC 4TT3G 5LP6C 3B8NA 5DECA 1Q82W 1WPXA 3JSNA 5LP6B 1FFXB 3CPWU 3HKDB 2VWJA 1WB7A 4MVUA 3TXSA 2DMXA 1I0HA 2BSKB 4BW9A 3ZX6A 1SQFA 5KLVH 3JAMN 4LFCO 2B1IA 3QG5A 4LF9O 4IHJA 1FFTB 1GMGA 2HVJC 4RUFA 4FPPA 2P4VA 5FNVB 5L3CA 4JI0O 3OUSA 2JJ1G 3K0GA 4QE9A 4CC6A 3B77A 3ASNC 1N0JA 3AG1C 4I55A 4K0KO 4JI3O 4KFMA 1YVWA 3JCUZ 3R65A 2ZDIA 4UV8A 3DSQA 3ASNB 3KKYA 4OPHA 4Z1VA 5L3FA 3AG1B 4PELA 5KHKA 2JK5C 1KECA 2W6JG 3RN4A 3ETDA 2UUAB 1K9MW 4RO2A 4NTWA 2BOCC 2CTWA 2DYSC 1SERA 2E76B 4LFBB 5IWAB 3LNMB 4LBEC 4DR2O 2GDSA 3ZBHA 2RQ6A 2DYSB 1AP6A 3IC7A 5IJ0A 1DF5A 4F6EA 2A0LA 2GUZA 1AP5A 3L73H 3VBBA 3QO5A 2BE3A 3QO8A 3RYFB 4AI8A 5FL7G 2UXDO 2R9RB 1MZEA 2JS3A 4LNUB 2P7TC 4Z2WA 2E3CA 1IXMA 1P4RA 3DC5A 4JF3A 3G6EV 3BVOA 3ZRWB 3BAAA 1KUQA 4O2AB 5EC1C 3OEHG 1RM1C 5LYJB 4DV1B 4NTYA 3ZHSA 2Q6AA 3UO2A 4MS2A 3H1JH 1RM1B 3LNNA 4D7SA 2FL4A 3O9OA 2YEVB 1XMQO 3STLC 3BA8A 1BMFG 2A3QA 3LSUA 1BT8A 1YEWA 5IE9A 1YHQV 4TOIA 2Q7HA 1WB8A 2R70A 1FXHA 1N36O 3B09A 1GRJA 3FYIB 2B5UA 3UCSC 3OT7A 5F2VO 4FM2A 2UU9B 1NU1H 4X64B 3LDCA 2H8PC 1XDCA 2UUAO 3CWBH 4QJFB 2M6YA 4WFEA 3JASA 1O9HA 1XNRO 4LFBO 5IWAO 3G6BA 4FLVA 4J10A 1VF6A 1NI8A 3SPGA 2XTAA 3JD1A 1DGSA 1Z5VA 4LF5B 3OM3B 3O65A 5L3EA 4LC1A 1ZSPA 1MMMA 3FKSG 1YITV 1PM9A 3ZRVA 2IM9A 1EZVH 1VQKV 1R6TA 1ZUQA 3FAVA 5CB4A 1VF7A 3LSSA 3DC6A 2RDCA 1QBZA 1GM8A 5H2FZ 2GSMB 5CA1A 1QR8A 1IBMB 1VQ9V 1N34O 4MW3A 5FLXN 2OCHA 3CRAA 3IC9A 3SYAA 1JX9A 3JD2A 4JI2O 4LF6B 3RWRD 1AI7A 1QHTA 3ETEA 5LXTA 3HB3B 4EB6B 2Z3YA 4OPAA 2DYRC 2ITCC 3J80N 4KHPB 3L9DA 5C93A 5CMUA 3E2EA 3BHPA 2DYRB 1VP7A 3ZCCA 4DV3O 4ZOLB 3M7MX 1M57C 2EZOA 2LQTA 2EJRA 3Q4HA 4DV6O 2Q5ZA 2BTQA 1M57B 1FPOA 1PNMA 2QM8A 4ABMA 3CD6V 1E1RG 3JALB 3HR0A 4OGQB 4PA6A 2LW7A 3MHSC 1NR1A 4I0XB 4X1KB 4O2BA 1G8MA 1YDXA 3NR7A 2CK3G 5K1PA 4X64O 3U10A 2F1MA 3JAWB 2O57A 3FB5C 2LW1A 3K5OA 3WU2Z 4ICGA 1XUQA 3UT5A 3WB2A 3JSLA 2HJDA 3QTCA 1BE3H 5BXZA 1DTOA 3ABUA 5KAFZ 3I56V 1SZXA 4X66O 4UFZA 4I9WA 3N2KA 1SQXH 4CS2A 4GKJO 3RYHA 1HNZB 2ETNA 3QF7A 3K0DA 2ZE8A 3JD3A 1YSCA 5EYPA 4ZI7B 3EVKA 4UCOA 2KSDA 1XHXA 3HKCA 3LSQA 2QKAA 4JI1O 3CXHF 1MZFA 1R6KA 4O4JB 5JQGA 2L6LA 1R1BA 5LGNA 2VQFB 4LF6O 4FLTA 2QSAA 1NZ6A 3HPLC 4MTXA 5KX5B 1AJQA 1R3KC 1MG1A 3CMEV 1Z2GA 5IDJA 1NJIW 2QWOB 4L8JA 3CE2A 1S5HC 4ASUG 1S72V 4D6TH 5IT9N 2WWWA 1GTOA 4ZHQB 1FYJA 1Y66A 1JA8A 4HBNA 2CH7B 2LFRA 5KUMA 2DQ3A 5LA6B 3L71H 1D5NA 1JCHA 3ABLC 4P30A 3IAYA 2IU3A 2M7WA 2G38A 5JCOC 4YJ3A 4O4LB 5DM6V 5J2TB 4PI0A 3ABLB 3JATB 3T1CA 1XI1A 4DR5B 2E5LB 1AJNA 2ZNJA 1SQVH 2PI5A 3VQVA 4H0LB 3EXAA 1FD9A 1B06A 2ODMA 4X89A 3SJAC 4PDLA 1SA0B 1OJHA 4WFGA 2DJVA 4H44B 4I50B 4QGPA 2QTSA 5KHIA 1F51A 1LNQA 1ZAUA 2HHHB 4E2LA 4LF8B 3H1LH 3ICXA 3UKMA 2Y4UA 4OX9B 2QWRB 1SQGA 1NH2B 4DR6O 5BZBA 3APQA 1HNWB 2WLIA 2YIAA 1XL4A 2R9AA 3OD4A 1VQLV 4JAVA 1BZKA 2RNBA 4X20A 3GWKC 2F4VO 4UCSA 4KXRA 3VQYA 1M1KW 2EX3A 3FFQA 5J9PC 5L3DA 5LOVA 1I5XA 4BR6A 1TVKB 1GH6A 3W7XA 4PA7A 2N05A 2Q73A 4WF9V 5BMVB 1H2LA 5KA5A 1HWYA 3MD0A 2VQFO 4MVZA 2NLJC 1AVMA 1Q5OA 3A0BZ 5A9GA 3TCUA 1HW7A 1QR9A 4FMTA 2WLMA 1Q8IA 1J95A 2YC0A 5A2QN 3OEEG 1K33A 5IJ9A 2KB1A 5EBLC 4NVPA 2YI9A 5KA6A 3JD0A 3CYOA 3CCLV 2F43G 4R50A 2NNUA 4DW1A 1U97A 5B3SC 4JI4B 3A0RA 4EFBA 2QWPB 4TV8B 4JI3B 4X88A 1TUBB 4AQYB 1W2BU 1GN4A 3FD9A 5B3SB 4DR5O 1IURA 5LGTA 4NTXA 4QIWF 4DYLA 3RYCB 2D3OW 4YXWG 2K9PA 3RYIB 5LP6A 4IYIA 1IDSA 4MVRA 4X1IB 4E4EA 1HR0O 4EFEA 2ZM6O 2HJFC 3JCZA 2ZD9A 4LF4O 2IJKA 4NKGB 4DR2B 1EN4A 3CMAV 1GN3A 1M9NA 2Q4PA 1BQ0A 1BQZA 5LBQA 2B1GA 4YIPA 3RVZA 5GONB 4OX9O 5KHJA 3C3SA 4H13B 1HNWO 4K8XA 3L72H 4DUZB 4WFHA 4WFFA 4X1YA 2N04A 3C90A 3WB1A 2YIBA 4DV5O 3JAKB 1OCZC 1ZX3A 2UUBO 1WNSA 3D36C 1OCZB 2QR4A 3CCEV 4KP4A 2NR5A 4B3MO 2OT5A 2OIGA 1WA8A 4TQFA 2WLKA 3EFFK 1OHHG 3OMAB 3MDSA 1AI4A 3SJBC 3RBZA 1TGOA 3AG2C 1SC5B 1XNQO 1N32O 3CCUV 2IH3C 1CXZB 4JASA 2XAFA 3AG2B 2AXTZ 4PDRA 1AJPA 2P5OA 1US6A 4K35A 4NB5A 4GX5A 2CDYA 1XMQB 1K4CC 4GX1A 1B6QA 1NH2D 3KCXA 5CA0A 1HNXO 5DEDA 4NXMO 2HLDG 4KL1A 4JZ2A 2DWEC 2CTPA 2WLHA 4LNUA 4O4HB 2ATKC 1I08A 4RQEA 4JI4O 1N36B 2ILMA 4O4IB 2ZE6A 3BEHA 3WFVA 3K06A 3CHXA 4AQYO 4PDMA 3CRQA 1WJZA 3T4DA 2Y4TA 1OCOC 4MVOA 5LYJA 3S3WA 4ZBMA 5KAIZ 1OCOB 4FLXA 1KB9F 1KYOF 1SZTA 2ZE5A 1DLBA 4DK0A 4GZRB 1YTFB 1VQ6V 1Y76B 4K8ZA 4X8AA 2YEVA 1XNRB 1FXKC 4W4LA 4TV9A 2QA4V 2IJIA 3STZC 1MSWD 3BY6A 1E1QG 1FXKB 1P49A 1V54C 4JZGA 2MW2B 3AG7A 3ASOC 3TJTA 2V7QG 4J7ZA 2RJZA 1FS0G 2JEUA 3G80A 2ZNIA 3QNEA 1V54B 3H1IH 3ASOB 4DUZO 4GX2A 2JGDB 1PKXA 1JFFB 3T1HO 4CH6A 1N34B 2EILC 3FB6C 3AG3C 4XDLA 3A0HZ 3DXRB 4JI2B 2EILB 4GYCB 2P90A 5EBMC 3AG3B 2Y0PA 2RN9A 4C7UA 2ZQMA 2QGNA 3CRRA 4IHJB 1RSOA 2KG7A 1Y4MA 4JGSA 4X62B 3DGEA 1FXVA 4RQFA 3CC2V 3P3NA 4X65B 2IW5A 2YXHA 2VQEO 2IJJA 1R3IC 1DK1A 2ZDIC 4UB8Z 2Q7EA 3NXSA 1H2KA 1JQ0A 2HKOA 2GV9A 2A79B 1EM1A 1LUVA 4GCZA 3BPZA 3OTOB 3I55V 1BGYH 4DXWA 1I94B 4XBFA 4BW5A 1K3EA 1GAXA 1B04A 5LL6Y 4DV3B 3T1YO 1K8AW 4MTGA 2XAHA 3VQWA 2QJ1A 3ABTA 1H38A 5C8YA 3QVNA 2HP8A 1GM7A 4DV6B 3H1KH 3J7AU 1COWG 1SESA 2R72A 1FJGB 3FB8C 2OYQA 4J9YB 3QO7A 3H9VA 5IJ0B 2JEXA 4U3JB 4EB6A 1QLEC 1PNLA 2DWDC 3IGAC 3B8MA 4G28B 4AILC 4YY3B 5EIBC 1QLEB 2AHZA 1U96A 3SPIA 1AR4A 2JRIA 2ZIMA 5L3BA 1Q6IA 2YSUB 2UXXA 2P67A 1X59A 2YDEA 4PD4F 4X66B 3E22B 4LWSA 1YJNV 3EHBB 4PA4A 4GKJB 1S77D 2XHBA 4F6RB 4X1KA 4I0XA 3A2FA 3D3QA 3ZHUA 1XREA 2CE4A 3K03A 4DV7B 1Y67A 1FAFA 3K5NA 4LH6A 3K3WA 4FK5C 4JI1B 4EKWA 5GTHZ 4JV5B 3K04A 5FPRA 5GW7A 3ZJZA 4J7KA 4LH7A 1BCCH 2PUSA 4I4TB 3WB0A 3SR2C 5AG2A 1YTFD 3OMNB 4JPRA 4EEQA 3K5MA 3TGUH 2LGWA 4R6ZA 1WPBA 3CCMV 4OXSA 4X62O 2YXLA 4J9ZB 4CS4A 1THZA 2KKWA 4X65O 4NR1A 2Q0OC 3CRMA 4H33A 1CEZA 1J5EO 2Q69A 3CRCA 3APOA 2AZ0A 1Y6XA 3OTOO 1I94O 4K3AA 2YUAA 4DK1A 4PJ0Z 1H2NA 2WPDG 5H6QA 5TISZ 4MSWC 3CCVV 2HR3A 2BTOA 3OR6C 1OZ0A 3GB7C 3K58A 3JASB 4LF7O 3AK3A 4DR3O 1OCRC 2X6AA 4YJ2B 3TETA 4FM1A 1F4NA 2F95B 1M4UA 1FJGO 1RPRA 1IBLB 1OCRB 4B3SB 2ZKOA 2XAJA 5KHGA 2CAZC 4W4KA 4FFKA 4YY3O 5LMNO 4B7KA 4UV9A 3FYEB 3G71V 1YZBA 4D7TA 2PY5A 3HKBA 4HYOA 3ETQA 3E8HA 4N23A 5L3GA 4DR6B 2L35A 3B40A 5J2TA 1CP9A 3JARB 3J81N 2DW4A 4DV2O 3JATA 5IYCO 1P7BA 4MW8A 2F4VB 1H2MA 3OFNG 1BHAA 2VRZA 4DV7O 1EZJA
chains in the Genus database with same CATH topology
2QWPB 2CTWA 2YUAA 2GUZB 2CUGA 1IURA 2M6YA 3UO2A 2LGWA 1GH6A 2DN9A 2L6LA 2LO1A 2Y4UA 1BQ0A 4IT5A 1N4CA 2N05A 2QSAA 2YS8A 1NZ6A 1BQZA 2DMXA 2QWRB 1WJZA 2Y4TA 3UO3A 3APQA 2CTRA 3UCSC 2GUZA 2QWQB 3AG7A 1FPOA 2QWOB 3BVOA 1FAFA 1HDJA 2KQXA 1XBLA 4J7ZA 2PF4E 4J80A 2CTQA 2OCHA 2N04A 3APOA 2EJ7A 4RWUA 2CTPA 2QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QWP B;  2CTW A;  2YUA A;  2GUZ B;  2CUG A;  1IUR A;  2M6Y A;  3UO2 A;  2LGW A;  1GH6 A;  2DN9 A;  2L6L A;  2LO1 A;  2Y4U A;  1BQ0 A;  4IT5 A;  1N4C A;  2N05 A;  2QSA A;  2YS8 A;  1NZ6 A;  1BQZ A;  2DMX A;  2QWR B;  1WJZ A;  2Y4T A;  3UO3 A;  3APQ A;  2CTR A;  3UCS C;  2GUZ A;  2QWQ B;  3AG7 A;  1FPO A;  2QWO B;  3BVO A;  1FAF A;  1HDJ A;  2KQX A;  1XBL A;  4J7Z A;  2PF4 E;  4J80 A;  2CTQ A;  2OCH A;  2N04 A;  3APO A;  2EJ7 A;  4RWU A;  2CTP A;  2QWN B; 
#chains in the Genus database with same CATH topology
 1G4Y B;  2EUL A;  2IH1 C;  2JGU A;  4JV5 O;  4P2Z A;  1ZL8 B;  5JVD B;  1KKC A;  3ETG A;  2WLL A;  4HNA B;  4DRX A;  4P9O A;  1KD1 W;  1TA8 A;  5EIB D;  3LDE A;  1VF5 B;  2RMK B;  5LHG A;  1H2G A;  2ARH A;  3H1H H;  3UQ8 A;  1AIL A;  1K92 A;  4FM0 A;  4GT1 A;  1N33 B;  3K9S A;  5ITZ A;  3CJH A;  3D3I A;  5D5Q A;  4F4L A;  4IIJ A;  1L0L H;  3CB2 A;  1SF9 A;  2P06 A;  5D5P A;  1BHB A;  4UVA A;  1TVK A;  2BCC H;  2KQX A;  4JTA B;  2PZS A;  3ZMS A;  5BMV A;  4ZKI A;  3CSX A;  4PV1 B;  1SQQ H;  2W0F C;  4DV4 O;  2ZE7 A;  2XAS A;  1A32 A;  2ITD C;  2DOS A;  1IBL O;  4B3S O;  4X9Q A;  1HR0 B;  2ZM6 B;  2PYJ A;  5JJE B;  2XUM A;  4LF4 B;  4BAY A;  2V4D A;  2QTO A;  1R3L C;  1W59 A;  3RYH B;  3OTF A;  2GTA A;  3PJS K;  4CZZ A;  5EYP B;  2CUG A;  1ENV A;  4B08 A;  1N0N A;  4TWK A;  3F7V C;  3B4S A;  4UXN A;  3BA9 A;  3UO3 A;  2GTS A;  4TV8 A;  2B9Z A;  1TUB A;  1MSD A;  3ZHQ A;  1XMO O;  2X6C A;  5JQG B;  1MNG A;  1YIJ V;  4DV5 B;  2UUB B;  1K73 W;  3U0Z A;  3I5D A;  3M99 B;  4Q20 A;  1S0V A;  3RYI A;  3HKE A;  4FIP C;  4JTC B;  3ZMZ A;  5B66 Z;  2F23 A;  4B3M B;  1KMI Z;  4WCE V;  1IVS A;  5IYB O;  1V55 C;  3TK1 A;  3K57 A;  2ZCE A;  1PL4 A;  5KMG A;  4TUY A;  3S3X A;  1XBL A;  4I9Q A;  1V55 B;  1XNQ B;  1N32 B;  1SQP H;  1EN5 A;  3VOU A;  2V1D A;  1QQC A;  3E86 A;  5J2U B;  4YJ3 B;  3OGI B;  3ZMU A;  2LO1 A;  4R8C A;  1SS3 A;  1N33 O;  1KKD A;  1SET A;  5CN0 A;  1HNX B;  3JAK A;  3THO A;  4NXM B;  2FKX A;  1IZ3 A;  1IXB A;  4MVM A;  3N2G B;  2ZR3 A;  4N21 A;  3WG7 C;  3ABM C;  1JVM A;  2UXC O;  1ROP A;  3LUT B;  4GX0 A;  4AHC A;  3SYC A;  4FJC C;  3WG7 B;  3L70 H;  4DR4 O;  3ABM B;  3BFR A;  4MVS A;  4NYK A;  2EIM C;  4B3T B;  1K5S A;  1NTZ H;  2Q7G A;  2ZXW C;  1WN7 A;  5E1A C;  5B1N A;  1IBK O;  1NTM H;  1FFX A;  5EZY B;  3HKD A;  2EIM B;  1NKD A;  2EZP A;  1XHZ A;  3W7W A;  4QPJ A;  3W7T A;  2ZXW B;  4J80 A;  3CC7 V;  2WLJ A;  1IX9 A;  1K7D A;  1W0K G;  2WLI B;  2BSK A;  4U3F H;  1VQ5 V;  4X20 B;  4LFA O;  2FB5 A;  5FNV A;  1JJ2 U;  4GKK O;  1YJW V;  2JIZ G;  1NQT A;  5LOV B;  2VWK A;  4O4I A;  3IJ4 A;  1TUE B;  4QNH B;  2WA3 A;  1YJ9 V;  1Y74 B;  4TSF G;  3M8A A;  2OTL V;  4Q6G A;  3R66 A;  2OCC C;  3T1H B;  2Z0A A;  1Q7Y W;  2CGN A;  4PA9 A;  1EFR G;  2OCC B;  3K9A A;  4JYB A;  5IJ9 B;  3CCJ V;  4WFB V;  3CC4 V;  4QE7 A;  1YI2 V;  1BL8 A;  1NTK H;  2EIJ C;  2PF4 E;  1VMG A;  2WSS G;  3ZIA G;  2EIJ B;  2VQE B;  4FLW A;  4IL6 Z;  2XND G;  2MK3 A;  4CBC A;  3FB7 C;  3G67 A;  1R3J C;  1ORQ C;  2JGD A;  1XL6 A;  1QVG U;  1XQ8 A;  1QVF U;  3RYF A;  3T1Y B;  1JFF A;  1HP8 A;  3JYC A;  1VEW A;  3DXR A;  4FFB B;  3SGI A;  1S76 D;  3CX5 F;  2JVD A;  3UM7 A;  1T5E A;  3ZRW A;  1LR1 A;  3G4S V;  3SYP A;  1F23 A;  4O2A A;  3CP1 A;  4MT8 A;  4B3T O;  2EBO A;  1KQS U;  2E75 B;  2AZ2 A;  4BWA A;  3L74 H;  1VQO V;  4BIZ A;  4WBN B;  5BR8 B;  3AG4 C;  2UUC B;  3T4Z A;  2GBO A;  4B3R B;  4PI2 A;  4X1Y B;  3AG4 B;  2QKS A;  4DW0 A;  1LUW A;  5JWP A;  2F93 B;  4J41 A;  4UCR A;  5IYZ B;  1Q6U A;  2QWN B;  3SPC A;  5JH7 B;  1WA8 B;  4QPK A;  5EBW C;  1AB3 A;  1WP7 A;  1PV0 A;  1VQ7 V;  3ML0 A;  3ZED A;  4U3J A;  2E74 B;  1OCC C;  2PI4 A;  1H8H G;  1D5A A;  5B1B C;  5HFM A;  2AHY A;  4MTO A;  4BIU A;  5IYD O;  1OCC B;  4PHZ A;  3T2M A;  4J11 A;  2EJ7 A;  1OV9 A;  2IU0 A;  5B1B B;  1M90 W;  4G2K A;  2PYL A;  5CA0 B;  1VQP V;  2FML A;  3OMI B;  1M56 C;  4R7C A;  1VQ8 V;  4LCU C;  3CCS V;  3E8B A;  1Z5W A;  1M56 B;  2FYU H;  2Q68 A;  4UCV A;  1J5E B;  3U11 A;  3E22 A;  5JJJ B;  4FZ1 A;  4I55 B;  2QKC A;  5B1A C;  4F6R A;  4IYH A;  3CS5 A;  3K5L A;  2HVK C;  3K79 A;  3BAB A;  5B1A B;  1SKV A;  4DV0 B;  1I5Y A;  3LDD A;  3E8G A;  1P84 F;  1VQ4 V;  2R9I A;  3OAA G;  1H8E G;  1URF A;  5LHI A;  2C2A A;  4LF7 B;  4I4T A;  4DR3 B;  2X6B A;  3ZRS A;  3RT3 C;  2AW9 A;  1JR9 A;  4L87 A;  4TV9 B;  1Q81 W;  1R6N A;  2YI8 A;  4CH3 A;  2ZR2 A;  2OTJ V;  1K97 A;  3F7Y C;  2GUZ B;  2XAG A;  5CBG A;  3VQX A;  2DN9 A;  5BR8 O;  5LMN B;  2UUC O;  5JJN B;  5DN6 G;  1Q6H A;  5H9C A;  4U7N A;  4B3R O;  4JI7 B;  2WA4 A;  3X2Q C;  3SPH A;  4ZOL A;  1NS1 A;  2QM7 A;  1SQB H;  1JJO A;  3E89 A;  1VIB A;  1CPY A;  4H37 A;  4PA3 A;  2FTK A;  2P4K A;  2GHY A;  1R73 A;  3X2Q B;  4DR1 B;  1X4T A;  2Q8V A;  4DV2 B;  2RCV A;  1NVP B;  3JAL A;  4YJ2 A;  4JTD B;  3N27 A;  1NBM G;  3AEI A;  4TQD A;  1RSO B;  2KG7 B;  1UFI A;  3RGB A;  2Y48 A;  2UXB B;  3JAW A;  1QLN A;  2A06 H;  2XT9 A;  3AK1 A;  1XOU A;  1VQM V;  1Q3E A;  2W0X A;  1FKA O;  3SPJ A;  3ZHT A;  3OE7 G;  2YIB D;  3P30 A;  1GM9 A;  4FZ0 A;  5C8Y B;  1KBH A;  2A9H A;  3GVM A;  3JAR A;  1ZLZ A;  4UVC A;  1K4D C;  1MA1 A;  2WLN A;  4ZI7 A;  4DV0 O;  2ADP A;  4DV1 O;  2HG5 C;  1ZL8 A;  5JVD A;  1VF6 C;  4JYY A;  4O4J A;  1VQN V;  4DV4 B;  5KX5 A;  2QDO A;  2H3O A;  4HNA A;  1NT2 B;  3OW2 U;  1M5I A;  1WP8 A;  3SJQ C;  1ZWI C;  1WAZ A;  2OWO A;  4KUM A;  4LWS B;  1AR1 B;  1L8D A;  4ZHQ A;  4UUJ C;  2JDI G;  2CH7 A;  2OIE A;  4JI7 O;  3FAV B;  3OR7 C;  4MVQ A;  5CB4 B;  1XEQ A;  3SJC C;  5LA6 A;  5GTI Z;  4G27 B;  4U7O A;  1MAB G;  2PTM A;  4HAM A;  4YHH B;  1BSM A;  2UU9 O;  2K1E A;  5CA1 B;  4IGG A;  4J42 A;  3AK2 A;  2DQ0 A;  4DR7 B;  4O4L A;  2YIC A;  4DR1 O;  1XMO B;  1TAE A;  2CGO A;  2Z5U A;  2EIK C;  4JI6 B;  3W7U A;  1Q86 W;  5JCO A;  4JYC A;  5KHH A;  1UPG A;  5K1X A;  2IBZ H;  4CH4 A;  1RPO A;  2EIK B;  3KZI Z;  5LXT B;  3ZS8 C;  2LGQ A;  1NR7 A;  4LF5 O;  2UXN A;  3BCC H;  3GWO A;  2UXB O;  1AI5 A;  3ZRX A;  4BIO A;  5B5E Z;  1SA0 A;  5LMU B;  3F5T A;  3PN1 A;  2ADQ B;  2BOB C;  2QM4 A;  4I50 A;  2Y0I A;  3D8C A;  3ZN0 A;  3RFR A;  1L0N H;  2DE0 X;  1IBM O;  1GO3 F;  2CTQ A;  2XOK G;  1GK9 A;  4MTF A;  3Q4H B;  1KC8 W;  1PL0 A;  3MHH C;  2W6I G;  2BTQ B;  1NVP D;  4I5S A;  1V9P A;  1S5J A;  4O2B B;  1F4M A;  2N74 A;  3K59 A;  5E79 Z;  2UXC B;  1G6U A;  3E35 A;  4HZ3 A;  3JD4 A;  1P7G A;  2Q9L A;  5IY5 C;  4DR4 B;  3BRC A;  4KHP O;  1QU7 A;  4NXN B;  3CEI A;  1PNK A;  3KG2 A;  5IY5 B;  3CCQ V;  2IJH A;  3UT5 B;  3HKB B;  3A8T A;  4XDK A;  1DF4 A;  4B7E A;  1IBK B;  1MOF A;  4UCU A;  4CS3 A;  4DO2 A;  5J2U A;  4UVB A;  3N2K B;  2X0L A;  4JI8 B;  1I7F A;  4JYA B;  2Q67 A;  4GUN A;  4RAI A;  3OUF A;  1L1F A;  5CBF A;  4LFA B;  1WLE A;  4I7Z B;  4GKK B;  3N2G A;  4DUY B;  4YHH O;  5B1O A;  1GN6 A;  2YXY A;  3HKC B;  3H01 A;  4DR7 O;  3K08 A;  4JI5 B;  2XAQ A;  3SYO A;  3OGC C;  1ZTE A;  2WLL B;  2NN4 A;  4JI6 O;  1KU9 A;  4ZIB A;  2LJ2 A;  4LP8 A;  3RYC A;  1Q90 D;  4FLY A;  3ZHR A;  4JAA A;  4DRX B;  5CBH A;  5EZY A;  4X1I A;  4JAU A;  1RP3 B;  3DTU B;  3B2E E;  1N4C A;  3C3T A;  3ZN1 A;  5LMU O;  5ITZ B;  3CJH B;  3E8F A;  1HNZ O;  5HFL A;  1F7Y A;  1JMK C;  4IIJ B;  2P6J A;  3SYQ A;  5GON A;  3ABK C;  1M93 A;  3ZMT A;  1B3Q A;  1XIL A;  3FX7 A;  1K5Q A;  1KP3 A;  4CH5 A;  2Y69 C;  3ZHV A;  1AI6 A;  1PD3 A;  2ZT9 B;  3ABK B;  1Y74 A;  2Y69 B;  3L75 H;  3CCR V;  1EN6 A;  4RWU A;  3D36 A;  1VAR A;  2A7W A;  1PPJ H;  2D2C B;  1S3J A;  4J7J A;  1H2S B;  2ZIO A;  4LFC B;  1S5L Z;  4WFA V;  1GKF A;  4Z1M G;  4LF9 B;  4NXN O;  4CC5 A;  2QE7 G;  2AGA A;  4JI0 B;  1W0J G;  3SDL A;  4FLZ A;  5H5N A;  3P3P A;  5FPO A;  2ZIN A;  3P32 A;  4YIO A;  2H94 A;  4K0K B;  1RFY A;  1Q43 A;  3KCY A;  5LHH A;  4JI8 O;  2Q0A A;  1E79 G;  3RW0 A;  2YID A;  2E5L O;  1ARO P;  4JYA O;  5EK0 A;  1YCI A;  2X7R B;  2EIN C;  2LP7 A;  4UB6 Z;  4DUY O;  5H6R A;  4O4H A;  1QCE A;  3HKE B;  5KUK A;  4GLX A;  1K34 A;  2QWQ B;  1HDJ A;  2EIN B;  4FFB A;  1EBO A;  2PGG A;  1QNM A;  5EC2 C;  3TXQ A;  1G1X B;  4JI5 O;  2HEP A;  2LFS A;  1D2D A;  1KP2 A;  2HFE C;  1UJW B;  5KMG B;  1O9G A;  4TUY B;  4UCT A;  1GN2 A;  1YXB A;  2VS0 A;  4XDJ A;  2WAM A;  4IT5 A;  2HHH O;  4LF8 O;  1YF2 A;  4FLU A;  4WBN A;  1PP9 H;  1Y76 A;  2CTR A;  2QEX V;  4P9P A;  5BY1 A;  3CXC U;  4PDV A;  3W7S A;  1SRY A;  1AR5 A;  2JS5 A;  3E83 A;  1JOY A;  2F66 C;  4RUE A;  2UXD B;  1FXK A;  3MAQ A;  1N8R W;  2JJ2 G;  1JPX A;  4A5U B;  2P22 C;  5CA3 A;  5LGU A;  2YS8 A;  5IYZ A;  4FVM A;  3RVY A;  3ZMV A;  4LR3 A;  5JH7 A;  3IFX A;  1BS3 A;  3F5W C;  4TT3 G;  5LP6 C;  3B8N A;  5DEC A;  1Q82 W;  1WPX A;  3JSN A;  5LP6 B;  1FFX B;  3CPW U;  3HKD B;  2VWJ A;  1WB7 A;  4MVU A;  3TXS A;  2DMX A;  1I0H A;  2BSK B;  4BW9 A;  3ZX6 A;  1SQF A;  5KLV H;  3JAM N;  4LFC O;  2B1I A;  3QG5 A;  4LF9 O;  4IHJ A;  1FFT B;  1GMG A;  2HVJ C;  4RUF A;  4FPP A;  2P4V A;  5FNV B;  5L3C A;  4JI0 O;  3OUS A;  2JJ1 G;  3K0G A;  4QE9 A;  4CC6 A;  3B77 A;  3ASN C;  1N0J A;  3AG1 C;  4I55 A;  4K0K O;  4JI3 O;  4KFM A;  1YVW A;  3JCU Z;  3R65 A;  2ZDI A;  4UV8 A;  3DSQ A;  3ASN B;  3KKY A;  4OPH A;  4Z1V A;  5L3F A;  3AG1 B;  4PEL A;  5KHK A;  2JK5 C;  1KEC A;  2W6J G;  3RN4 A;  3ETD A;  2UUA B;  1K9M W;  4RO2 A;  4NTW A;  2BOC C;  2CTW A;  2DYS C;  1SER A;  2E76 B;  4LFB B;  5IWA B;  3LNM B;  4LBE C;  4DR2 O;  2GDS A;  3ZBH A;  2RQ6 A;  2DYS B;  1AP6 A;  3IC7 A;  5IJ0 A;  1DF5 A;  4F6E A;  2A0L A;  2GUZ A;  1AP5 A;  3L73 H;  3VBB A;  3QO5 A;  2BE3 A;  3QO8 A;  3RYF B;  4AI8 A;  5FL7 G;  2UXD O;  2R9R B;  1MZE A;  2JS3 A;  4LNU B;  2P7T C;  4Z2W A;  2E3C A;  1IXM A;  1P4R A;  3DC5 A;  4JF3 A;  3G6E V;  3BVO A;  3ZRW B;  3BAA A;  1KUQ A;  4O2A B;  5EC1 C;  3OEH G;  1RM1 C;  5LYJ B;  4DV1 B;  4NTY A;  3ZHS A;  2Q6A A;  3UO2 A;  4MS2 A;  3H1J H;  1RM1 B;  3LNN A;  4D7S A;  2FL4 A;  3O9O A;  2YEV B;  1XMQ O;  3STL C;  3BA8 A;  1BMF G;  2A3Q A;  3LSU A;  1BT8 A;  1YEW A;  5IE9 A;  1YHQ V;  4TOI A;  2Q7H A;  1WB8 A;  2R70 A;  1FXH A;  1N36 O;  3B09 A;  1GRJ A;  3FYI B;  2B5U A;  3UCS C;  3OT7 A;  5F2V O;  4FM2 A;  2UU9 B;  1NU1 H;  4X64 B;  3LDC A;  2H8P C;  1XDC A;  2UUA O;  3CWB H;  4QJF B;  2M6Y A;  4WFE A;  3JAS A;  1O9H A;  1XNR O;  4LFB O;  5IWA O;  3G6B A;  4FLV A;  4J10 A;  1VF6 A;  1NI8 A;  3SPG A;  2XTA A;  3JD1 A;  1DGS A;  1Z5V A;  4LF5 B;  3OM3 B;  3O65 A;  5L3E A;  4LC1 A;  1ZSP A;  1MMM A;  3FKS G;  1YIT V;  1PM9 A;  3ZRV A;  2IM9 A;  1EZV H;  1VQK V;  1R6T A;  1ZUQ A;  3FAV A;  5CB4 A;  1VF7 A;  3LSS A;  3DC6 A;  2RDC A;  1QBZ A;  1GM8 A;  5H2F Z;  2GSM B;  5CA1 A;  1QR8 A;  1IBM B;  1VQ9 V;  1N34 O;  4MW3 A;  5FLX N;  2OCH A;  3CRA A;  3IC9 A;  3SYA A;  1JX9 A;  3JD2 A;  4JI2 O;  4LF6 B;  3RWR D;  1AI7 A;  1QHT A;  3ETE A;  5LXT A;  3HB3 B;  4EB6 B;  2Z3Y A;  4OPA A;  2DYR C;  2ITC C;  3J80 N;  4KHP B;  3L9D A;  5C93 A;  5CMU A;  3E2E A;  3BHP A;  2DYR B;  1VP7 A;  3ZCC A;  4DV3 O;  4ZOL B;  3M7M X;  1M57 C;  2EZO A;  2LQT A;  2EJR A;  3Q4H A;  4DV6 O;  2Q5Z A;  2BTQ A;  1M57 B;  1FPO A;  1PNM A;  2QM8 A;  4ABM A;  3CD6 V;  1E1R G;  3JAL B;  3HR0 A;  4OGQ B;  4PA6 A;  2LW7 A;  3MHS C;  1NR1 A;  4I0X B;  4X1K B;  4O2B A;  1G8M A;  1YDX A;  3NR7 A;  2CK3 G;  5K1P A;  4X64 O;  3U10 A;  2F1M A;  3JAW B;  2O57 A;  3FB5 C;  2LW1 A;  3K5O A;  3WU2 Z;  4ICG A;  1XUQ A;  3UT5 A;  3WB2 A;  3JSL A;  2HJD A;  3QTC A;  1BE3 H;  5BXZ A;  1DTO A;  3ABU A;  5KAF Z;  3I56 V;  1SZX A;  4X66 O;  4UFZ A;  4I9W A;  3N2K A;  1SQX H;  4CS2 A;  4GKJ O;  3RYH A;  1HNZ B;  2ETN A;  3QF7 A;  3K0D A;  2ZE8 A;  3JD3 A;  1YSC A;  5EYP A;  4ZI7 B;  3EVK A;  4UCO A;  2KSD A;  1XHX A;  3HKC A;  3LSQ A;  2QKA A;  4JI1 O;  3CXH F;  1MZF A;  1R6K A;  4O4J B;  5JQG A;  2L6L A;  1R1B A;  5LGN A;  2VQF B;  4LF6 O;  4FLT A;  2QSA A;  1NZ6 A;  3HPL C;  4MTX A;  5KX5 B;  1AJQ A;  1R3K C;  1MG1 A;  3CME V;  1Z2G A;  5IDJ A;  1NJI W;  2QWO B;  4L8J A;  3CE2 A;  1S5H C;  4ASU G;  1S72 V;  4D6T H;  5IT9 N;  2WWW A;  1GTO A;  4ZHQ B;  1FYJ A;  1Y66 A;  1JA8 A;  4HBN A;  2CH7 B;  2LFR A;  5KUM A;  2DQ3 A;  5LA6 B;  3L71 H;  1D5N A;  1JCH A;  3ABL C;  4P30 A;  3IAY A;  2IU3 A;  2M7W A;  2G38 A;  5JCO C;  4YJ3 A;  4O4L B;  5DM6 V;  5J2T B;  4PI0 A;  3ABL B;  3JAT B;  3T1C A;  1XI1 A;  4DR5 B;  2E5L B;  1AJN A;  2ZNJ A;  1SQV H;  2PI5 A;  3VQV A;  4H0L B;  3EXA A;  1FD9 A;  1B06 A;  2ODM A;  4X89 A;  3SJA C;  4PDL A;  1SA0 B;  1OJH A;  4WFG A;  2DJV A;  4H44 B;  4I50 B;  4QGP A;  2QTS A;  5KHI A;  1F51 A;  1LNQ A;  1ZAU A;  2HHH B;  4E2L A;  4LF8 B;  3H1L H;  3ICX A;  3UKM A;  2Y4U A;  4OX9 B;  2QWR B;  1SQG A;  1NH2 B;  4DR6 O;  5BZB A;  3APQ A;  1HNW B;  2WLI A;  2YIA A;  1XL4 A;  2R9A A;  3OD4 A;  1VQL V;  4JAV A;  1BZK A;  2RNB A;  4X20 A;  3GWK C;  2F4V O;  4UCS A;  4KXR A;  3VQY A;  1M1K W;  2EX3 A;  3FFQ A;  5J9P C;  5L3D A;  5LOV A;  1I5X A;  4BR6 A;  1TVK B;  1GH6 A;  3W7X A;  4PA7 A;  2N05 A;  2Q73 A;  4WF9 V;  5BMV B;  1H2L A;  5KA5 A;  1HWY A;  3MD0 A;  2VQF O;  4MVZ A;  2NLJ C;  1AVM A;  1Q5O A;  3A0B Z;  5A9G A;  3TCU A;  1HW7 A;  1QR9 A;  4FMT A;  2WLM A;  1Q8I A;  1J95 A;  2YC0 A;  5A2Q N;  3OEE G;  1K33 A;  5IJ9 A;  2KB1 A;  5EBL C;  4NVP A;  2YI9 A;  5KA6 A;  3JD0 A;  3CYO A;  3CCL V;  2F43 G;  4R50 A;  2NNU A;  4DW1 A;  1U97 A;  5B3S C;  4JI4 B;  3A0R A;  4EFB A;  2QWP B;  4TV8 B;  4JI3 B;  4X88 A;  1TUB B;  4AQY B;  1W2B U;  1GN4 A;  3FD9 A;  5B3S B;  4DR5 O;  1IUR A;  5LGT A;  4NTX A;  4QIW F;  4DYL A;  3RYC B;  2D3O W;  4YXW G;  2K9P A;  3RYI B;  5LP6 A;  4IYI A;  1IDS A;  4MVR A;  4X1I B;  4E4E A;  1HR0 O;  4EFE A;  2ZM6 O;  2HJF C;  3JCZ A;  2ZD9 A;  4LF4 O;  2IJK A;  4NKG B;  4DR2 B;  1EN4 A;  3CMA V;  1GN3 A;  1M9N A;  2Q4P A;  1BQ0 A;  1BQZ A;  5LBQ A;  2B1G A;  4YIP A;  3RVZ A;  5GON B;  4OX9 O;  5KHJ A;  3C3S A;  4H13 B;  1HNW O;  4K8X A;  3L72 H;  4DUZ B;  4WFH A;  4WFF A;  4X1Y A;  2N04 A;  3C90 A;  3WB1 A;  2YIB A;  4DV5 O;  3JAK B;  1OCZ C;  1ZX3 A;  2UUB O;  1WNS A;  3D36 C;  1OCZ B;  2QR4 A;  3CCE V;  4KP4 A;  2NR5 A;  4B3M O;  2OT5 A;  2OIG A;  1WA8 A;  4TQF A;  2WLK A;  3EFF K;  1OHH G;  3OMA B;  3MDS A;  1AI4 A;  3SJB C;  3RBZ A;  1TGO A;  3AG2 C;  1SC5 B;  1XNQ O;  1N32 O;  3CCU V;  2IH3 C;  1CXZ B;  4JAS A;  2XAF A;  3AG2 B;  2AXT Z;  4PDR A;  1AJP A;  2P5O A;  1US6 A;  4K35 A;  4NB5 A;  4GX5 A;  2CDY A;  1XMQ B;  1K4C C;  4GX1 A;  1B6Q A;  1NH2 D;  3KCX A;  5CA0 A;  1HNX O;  5DED A;  4NXM O;  2HLD G;  4KL1 A;  4JZ2 A;  2DWE C;  2CTP A;  2WLH A;  4LNU A;  4O4H B;  2ATK C;  1I08 A;  4RQE A;  4JI4 O;  1N36 B;  2ILM A;  4O4I B;  2ZE6 A;  3BEH A;  3WFV A;  3K06 A;  3CHX A;  4AQY O;  4PDM A;  3CRQ A;  1WJZ A;  3T4D A;  2Y4T A;  1OCO C;  4MVO A;  5LYJ A;  3S3W A;  4ZBM A;  5KAI Z;  1OCO B;  4FLX A;  1KB9 F;  1KYO F;  1SZT A;  2ZE5 A;  1DLB A;  4DK0 A;  4GZR B;  1YTF B;  1VQ6 V;  1Y76 B;  4K8Z A;  4X8A A;  2YEV A;  1XNR B;  1FXK C;  4W4L A;  4TV9 A;  2QA4 V;  2IJI A;  3STZ C;  1MSW D;  3BY6 A;  1E1Q G;  1FXK B;  1P49 A;  1V54 C;  4JZG A;  2MW2 B;  3AG7 A;  3ASO C;  3TJT A;  2V7Q G;  4J7Z A;  2RJZ A;  1FS0 G;  2JEU A;  3G80 A;  2ZNI A;  3QNE A;  1V54 B;  3H1I H;  3ASO B;  4DUZ O;  4GX2 A;  2JGD B;  1PKX A;  1JFF B;  3T1H O;  4CH6 A;  1N34 B;  2EIL C;  3FB6 C;  3AG3 C;  4XDL A;  3A0H Z;  3DXR B;  4JI2 B;  2EIL B;  4GYC B;  2P90 A;  5EBM C;  3AG3 B;  2Y0P A;  2RN9 A;  4C7U A;  2ZQM A;  2QGN A;  3CRR A;  4IHJ B;  1RSO A;  2KG7 A;  1Y4M A;  4JGS A;  4X62 B;  3DGE A;  1FXV A;  4RQF A;  3CC2 V;  3P3N A;  4X65 B;  2IW5 A;  2YXH A;  2VQE O;  2IJJ A;  1R3I C;  1DK1 A;  2ZDI C;  4UB8 Z;  2Q7E A;  3NXS A;  1H2K A;  1JQ0 A;  2HKO A;  2GV9 A;  2A79 B;  1EM1 A;  1LUV A;  4GCZ A;  3BPZ A;  3OTO B;  3I55 V;  1BGY H;  4DXW A;  1I94 B;  4XBF A;  4BW5 A;  1K3E A;  1GAX A;  1B04 A;  5LL6 Y;  4DV3 B;  3T1Y O;  1K8A W;  4MTG A;  2XAH A;  3VQW A;  2QJ1 A;  3ABT A;  1H38 A;  5C8Y A;  3QVN A;  2HP8 A;  1GM7 A;  4DV6 B;  3H1K H;  3J7A U;  1COW G;  1SES A;  2R72 A;  1FJG B;  3FB8 C;  2OYQ A;  4J9Y B;  3QO7 A;  3H9V A;  5IJ0 B;  2JEX A;  4U3J B;  4EB6 A;  1QLE C;  1PNL A;  2DWD C;  3IGA C;  3B8M A;  4G28 B;  4AIL C;  4YY3 B;  5EIB C;  1QLE B;  2AHZ A;  1U96 A;  3SPI A;  1AR4 A;  2JRI A;  2ZIM A;  5L3B A;  1Q6I A;  2YSU B;  2UXX A;  2P67 A;  1X59 A;  2YDE A;  4PD4 F;  4X66 B;  3E22 B;  4LWS A;  1YJN V;  3EHB B;  4PA4 A;  4GKJ B;  1S77 D;  2XHB A;  4F6R B;  4X1K A;  4I0X A;  3A2F A;  3D3Q A;  3ZHU A;  1XRE A;  2CE4 A;  3K03 A;  4DV7 B;  1Y67 A;  1FAF A;  3K5N A;  4LH6 A;  3K3W A;  4FK5 C;  4JI1 B;  4EKW A;  5GTH Z;  4JV5 B;  3K04 A;  5FPR A;  5GW7 A;  3ZJZ A;  4J7K A;  4LH7 A;  1BCC H;  2PUS A;  4I4T B;  3WB0 A;  3SR2 C;  5AG2 A;  1YTF D;  3OMN B;  4JPR A;  4EEQ A;  3K5M A;  3TGU H;  2LGW A;  4R6Z A;  1WPB A;  3CCM V;  4OXS A;  4X62 O;  2YXL A;  4J9Z B;  4CS4 A;  1THZ A;  2KKW A;  4X65 O;  4NR1 A;  2Q0O C;  3CRM A;  4H33 A;  1CEZ A;  1J5E O;  2Q69 A;  3CRC A;  3APO A;  2AZ0 A;  1Y6X A;  3OTO O;  1I94 O;  4K3A A;  2YUA A;  4DK1 A;  4PJ0 Z;  1H2N A;  2WPD G;  5H6Q A;  5TIS Z;  4MSW C;  3CCV V;  2HR3 A;  2BTO A;  3OR6 C;  1OZ0 A;  3GB7 C;  3K58 A;  3JAS B;  4LF7 O;  3AK3 A;  4DR3 O;  1OCR C;  2X6A A;  4YJ2 B;  3TET A;  4FM1 A;  1F4N A;  2F95 B;  1M4U A;  1FJG O;  1RPR A;  1IBL B;  1OCR B;  4B3S B;  2ZKO A;  2XAJ A;  5KHG A;  2CAZ C;  4W4K A;  4FFK A;  4YY3 O;  5LMN O;  4B7K A;  4UV9 A;  3FYE B;  3G71 V;  1YZB A;  4D7T A;  2PY5 A;  3HKB A;  4HYO A;  3ETQ A;  3E8H A;  4N23 A;  5L3G A;  4DR6 B;  2L35 A;  3B40 A;  5J2T A;  1CP9 A;  3JAR B;  3J81 N;  2DW4 A;  4DV2 O;  3JAT A;  5IYC O;  1P7B A;  4MW8 A;  2F4V B;  1H2M A;  3OFN G;  1BHA A;  2VRZ A;  4DV7 O;  1EZJ A; 
#chains in the Genus database with same CATH homology
 2QWP B;  2CTW A;  2YUA A;  2GUZ B;  2CUG A;  1IUR A;  2M6Y A;  3UO2 A;  2LGW A;  1GH6 A;  2DN9 A;  2L6L A;  2LO1 A;  2Y4U A;  1BQ0 A;  4IT5 A;  1N4C A;  2N05 A;  2QSA A;  2YS8 A;  1NZ6 A;  1BQZ A;  2DMX A;  2QWR B;  1WJZ A;  2Y4T A;  3UO3 A;  3APQ A;  2CTR A;  3UCS C;  2GUZ A;  2QWQ B;  3AG7 A;  1FPO A;  2QWO B;  3BVO A;  1FAF A;  1HDJ A;  2KQX A;  1XBL A;  4J7Z A;  2PF4 E;  4J80 A;  2CTQ A;  2OCH A;  2N04 A;  3APO A;  2EJ7 A;  4RWU A;  2CTP A;  2QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...