2RN9A

Solution structure of human apocox17
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rn9A00
2LQTA 1U96A 2RN9A 1U97A 2LGQA 1HP8A 2HP8A 2RNBA 1Z2GA
chains in the Genus database with same CATH superfamily
1KUQA 4UB6Z 4KL1A 2VQEO 3I55V 1V9PA 4I4TA 1A32A 4LFBO 3GVMA 2EIMC 4DV6B 1KQSU 4MVRA 2QWPB 4UCSA 1ENVA 1N0JA 5KHJA 4BIZA 1XL4A 2EULA 1S76D 2RMKB 4IGGA 2ITCC 5BMVB 1M9NA 1YSCA 2F95B 4J9ZB 2HR3A 4XDKA 2ARHA 3JALB 2Y4TA 4X65O 5JVDB 5FPRA 3JARA 3VQXA 1XNQB 1NR1A 3UO3A 4PDRA 2CTWA 3JAWB 4KP4A 4JAUA 2LO1A 4IYIA 3BVOA 4GX2A 5ITZA 3FKSG 3S3XA 4F6RA 5J9PC 3ZRXA 1XOUA 1AR4A 3QO7A 2JJ1G 5F2VO 3RN4A 4DV4B 4DR7O 4X1IB 4X20B 1JJ2U 2LFRA 2YI9A 3ZHRA 1ZX3A 2WLMA 1MSDA 4IIJA 2YEVB 1OHHG 4WFEA 4DW0A 1IBKB 2QTSA 3JCZA 2OTJV 3KCYA 3L9DA 3E22B 2CTPA 4DV3O 1BE3H 1QHTA 4DV7O 4Z1MG 3ZBHA 2V7QG 1XREA 5KHIA 3RVYA 5HFMA 4TQFA 4RQEA 1K33A 4F4LA 3CRAA 2UU9O 1DLBA 5CA0A 4DR5O 5CA1B 1N34B 3RYIB 4R50A 5B1OA 4HNAB 3DC6A 2YEVA 3L71H 3K5NA 4DV5O 2WLNA 4YIPA 1EZVH 3RYHB 4JTAB 4FLUA 1MSWD 1WP8A 2Y0PA 5C8YB 1FS0G 2ILMA 3A0BZ 1S5JA 2ZNJA 1SERA 3R66A 1YITV 2DE0X 4DUZB 4KUMA 4R7CA 3U0ZA 4DYLA 2EZPA 2HLDG 5JJNB 4O2BB 4DV2O 3SYAA 3PN1A 1R6KA 3JD0A 5JVDA 2GHYA 3JALA 3IC9A 3H1JH 5BR8B 2DWEC 2YXHA 5LA6B 5LXTB 1YJNV 1MZFA 1FXVA 2P22C 3JYCA 4GT1A 3W7SA 3O9OA 3FB8C 2V1DA 3W7WA 1M56C 3OTFA 2VS0A 1HNZB 1CEZA 4QE9A 2ZT9B 2N74A 2AHYA 1L0NH 5EBWC 2CK3G 3PJSK 5EIBC 1IBMO 3CC4V 2VWKA 2Q5ZA 3GWKC 2FL4A 2F93B 4UVBA 3MHSC 1KP3A 4HZ3A 5GTHZ 4E4EA 1R3IC 5IYBO 2Q4PA 3FAVA 4B3RB 1KMIZ 4DR4B 3FB6C 2HFEC 1K7DA 2KQXA 3CJHA 3EVKA 1U96A 3TJTA 4I50A 4GZRB 3E8BA 4X1YA 1Q43A 1DTOA 1IBMB 3L72H 1GMGA 2CE4A 5CB4B 3QVNA 4R6ZA 1G4YB 4MTGA 5FPOA 1NI8A 4DW1A 3KKYA 5L3GA 1IBLB 5LXTA 4E2LA 2P5OA 3T1YB 3VBBA 5EIBD 3FFQA 3O65A 1DGSA 4W4LA 1VQOV 1B04A 3L73H 2N05A 3FYEB 1HWYA 2Y69B 1HR0O 1KYOF 5A9GA 4D6TH 3C3TA 1YTFB 5J2TA 4DR6B 2ZE8A 3J7AU 3ABUA 2FKXA 1IURA 2QDOA 1QQCA 1XHZA 3OAAG 3K5OA 5CB4A 4B3SO 2R72A 2YDEA 4FM1A 1H8EG 2N04A 4EB6B 5C8YA 3CRMA 4DR2O 1VF6C 2ZE5A 3E8GA 3KG2A 2YXLA 2H3OA 2UUBO 2C2AA 1YIJV 5EC1C 3P3NA 1SZTA 4PD4F 1ZUQA 1JQ0A 1YF2A 1V54C 2P4KA 3BPZA 4ZI7B 4HNAA 4JV5B 2ZIOA 4JYAO 5GW7A 3OUFA 1H2SB 1R6TA 1OCRB 2IH1C 4DRXB 1R1BA 1BZKA 3AG1B 2CGNA 2Q0AA 5D5QA 4X62B 4ICGA 4UUJC 4N21A 4Z2WA 1XMOB 3E2EA 1Y67A 1GN3A 4K0KB 2GBOA 3E83A 3E22A 3D36C 1Q6IA 3CE2A 2ETNA 1Y74A 2EINB 4JI5O 1NKDA 3HKEB 2E75B 2F66C 3WB0A 1SA0A 2ZKOA 1R3LC 4BAYA 3L74H 4JYYA 3CB2A 3IAYA 1ZWIC 3C90A 1TGOA 5LMUO 4UVCA 1E1QG 1MABG 1Q3EA 3LUTB 4O2BA 3L75H 2BOBC 1LR1A 2DOSA 3HR0A 4EB6A 5B1AB 5H9CA 1GM7A 1FYJA 3AG3C 3ZMSA 5J2UB 4KHPB 3K58A 4JI8O 4K3AA 1GM9A 1QNMA 1N4CA 3JD2A 2XNDG 4J7JA 4CZZA 1SQVH 4FFKA 4JI1B 1KU9A 3ZRVA 3H9VA 3SDLA 4H37A 4ZOLB 5JH7B 5JWPA 3MHHC 1VQ7V 5C93A 3H1IH 4JI4B 4TSFG 4B3SB 1AJPA 4O4LA 1QLNA 4ASUG 2PI5A 3I56V 3SR2C 2OCCB 2CTQA 3ABLB 3G67A 4FM2A 3BRCA 1RPOA 2IM9A 2IH3C 2WLHA 3HPLC 1N8RW 2X6CA 4ZI7A 4B3TB 3T4DA 2A3QA 2ATKC 4RUEA 4O4IA 4CC6A 5LHGA 3CCLV 1FFXB 3OMNB 4LP8A 2EBOA 1VARA 1SETA 4RAIA 4X62O 1P7BA 2F43G 3FYIB 4YHHO 3CSXA 1J5EO 5L3FA 2AHZA 4GKKB 2WSSG 2UUAB 1PNKA 4FLYA 3OFNG 2RJZA 1J5EB 4MW8A 2IJKA 1JX9A 3B77A 5LA6A 1WAZA 1M5IA 4LF7O 3HKBB 1P84F 1VQKV 2Q7GA 2UXBB 4I9QA 1CPYA 4NVPA 2E5LB 4LF9O 4TV9A 4JAAA 2UXBO 2YIAA 1NT2B 2QJ1A 4O4HB 1XHXA 5KA6A 1H2LA 2IJHA 3SPHA 5L3BA 4YXWG 2Z5UA 3UKMA 3CCSV 4HAMA 3K0GA 3STZC 4RUFA 1QLEC 1N36O 2WWWA 2WLLA 3ASNC 1AB3A 5BY1A 5AG2A 3VOUA 4MVZA 1M57C 1VF6A 4NR1A 1EFRG 1I5YA 3WG7B 1NTKH 1NTMH 1Y76B 4UVAA 5DEDA 1XNRO 3BHPA 4PELA 4WFHA 1K73W 3OTOO 5KHGA 2E74B 1Z2GA 4CC5A 4I55B 2DW4A 1BMFG 5CBFA 1S5LZ 4K8XA 1HW7A 1Y74B 3WB1A 2AZ2A 5FLXN 4JI0O 4CS4A 2CUGA 2L35A 4DR3O 4JI0B 3E86A 5KHKA 2Q9LA 3CS5A 1WN7A 1AI5A 3GB7C 3ABMC 1X4TA 4FK5C 5LL6Y 1V54B 5A2QN 1AI4A 3W7TA 5KX5B 1G6UA 3BCCH 2BTQA 2XTAA 3ZRWB 3IFXA 5CMUA 2WLKA 4LH6A 3ZMUA 3LSQA 3X2QB 1VQ5V 3ZHSA 3F7YC 3U11A 4DO2A 3UT5B 4G2KA 3ASOC 3OD4A 2YC0A 4BR6A 3QNEA 1SQPH 1SQXH 3SPGA 5KAIZ 2HG5C 2P6JA 3RYFA 4DUYO 4D7SA 1M1KW 4JI4O 4LWSA 4DUYB 4NXMO 2OIGA 3WFVA 4PA4A 3JAWA 1L0LH 4X89A 3OMAB 3G6BA 3KZIZ 4EKWA 2AZ0A 1QVFU 4FM0A 4CS3A 1NVPD 3KCXA 4JI7B 1P7GA 3JSLA 3ABKB 1WNSA 4FMTA 2PYJA 3HKBA 1JR9A 1AILA 3CX5F 3AG7A 3HKEA 4JI2B 3K9AA 2EILB 4B3MB 3SYQA 1B06A 4ZIBA 5IDJA 1B6QA 1TVKA 3Q4HB 3HKDB 1XNQO 3TXQA 3LNNA 1WJZA 4I50B 5KUKA 1T5EA 1XI1A 2DYSC 1PP9H 3AG2C 3APOA 1FFXA 4UCUA 4PI2A 2WA4A 2W0XA 3RYCA 2ZIMA 1ZTEA 2QEXV 2QR4A 4IIJB 1YVWA 3R65A 5B3SC 5FNVA 4X66O 5KHHA 2JVDA 1GO3F 1S3JA 3OE7G 2QKCA 3IJ4A 4LF4B 1SS3A 3UO2A 2QM7A 2ZM6O 3CXHF 5LYJA 1W2BU 4X88A 5LBQA 1UPGA 3CRCA 2QA4V 1VQNV 4Q6GA 3AK2A 3JARB 4DV1B 1THZA 3JCUZ 5JQGA 4LF5O 4OX9O 4X1KB 4PDLA 3BABA 4LF4O 1RM1C 1VQ4V 2EILC 1OV9A 2CH7A 2A06H 5IT9N 2QM8A 1SQQH 4UCTA 5BMVA 2XAQA 1FPOA 3E8FA 2WAMA 2EJRA 3TK1A 1RPRA 2DMXA 4IT5A 1YJ9V 2EJ7A 4DV2B 3H01A 3S3WA 3FB5C 1US6A 1Y4MA 1AJNA 2XAJA 4J9YB 2GSMB 4JI7O 1S5HC 1R3KC 4O4IB 4JYAB 3NR7A 1VQLV 2Q7HA 1KECA 3JAKB 1AR1B 1GN2A 1UFIA 1SA0B 5CA0B 4P30A 4NXMB 1LUWA 4ZHQB 1NJIW 2RCVA 3ASOB 1IXMA 3JAMN 2DYSB 1KP2A 1HNZO 3ZCCA 4HYOA 4LBEC 2B1IA 4FPPA 1M56B 4J42A 3ETQA 1I7FA 3ZHUA 4A5UB 3CMAV 2VQEB 3B4SA 3CCEV 1QU7A 4MVMA 1QCEA 4DK0A 3LDCA 2G38A 4B3MO 1M93A 2BSKB 1HP8A 4DV6O 1SESA 2DJVA 4DV4O 1FAFA 3DSQA 4EEQA 3N2GB 2XAGA 2QWRB 5LYJB 5EZYA 4IHJB 5IYDO 1GTOA 1OCOB 4MTXA 3RT3C 3LNMB 4X64O 1WPXA 2FMLA 3N2KA 1VMGA 3N2GA 1NS1A 1OCZC 3CRRA 4DV0B 2KKWA 3UT5A 2XAHA 4BIOA 1IBKO 1QLEB 3BY6A 4FZ0A 1H2KA 5E1AC 2EIMB 2B1GA 2M6YA 3K5MA 2Q73A 2X6AA 4U7NA 2RN9A 1K97A 1H8HG 1WA8A 5JCOC 2BTQB 2BCCH 3RYCB 3STLC 1PV0A 1K9MW 3H1LH 2GUZB 3UCSC 4YJ2B 4I0XB 1URFA 5IE9A 4I7ZB 2MW2B 3CXCU 4DV3B 1YEWA 4QPJA 3MD0A 1TVKB 4QIWF 1K5SA 2AGAA 3FAVB 3OEHG 2E76B 2EIJC 1B3QA 4QJFB 2RQ6A 3GWOA 4UV9A 1ZSPA 4PA9A 1OCOC 4MW3A 2OWOA 2OCCC 3K79A 2GTSA 2IBZH 5IYZB 5CBGA 4X20A 4X1IA 1N33O 1R6NA 2X7RB 2PUSA 2ZE7A 1JOYA 1Q86W 5L3CA 1EN6A 5KMGB 4IYHA 3K03A 2IU3A 2CH7B 4CBCA 4DR2B 2EINC 3F7VC 4DXWA 1W59A 2NR5A 2ZR3A 2BSKA 2IW5A 3FB7C 1N32O 1NVPB 2PI4A 2YIDA 3WB2A 3VQVA 1PL0A 1SRYA 2LGWA 3WU2Z 1PD3A 5KX5A 2F4VO 1MG1A 4JYCA 4GLXA 1W0JG 4KFMA 4JI8B 1VIBA 3SJAC 3AEIA 2HVJC 5LHHA 1KKCA 2ZDIC 1NH2D 1TUBA 4WFFA 5IJ9A 1KD1W 2KB1A 1FD9A 2PY5A 2AW9A 5CA3A 1FJGO 2YICA 4O2AB 4RWUA 4P2ZA 4PJ0Z 3L70H 3P32A 1Y76A 1E79G 2JDIG 1ROPA 3OMIB 4AQYB 4DR4O 4K8ZA 1FXKB 4O4JA 2L6LA 2IJJA 3OGCC 3K0DA 4TOIA 2WLLB 4JYBA 1RP3B 2LFSA 4BIUA 4B7KA 1L8DA 2LGQA 1DF4A 1XMQO 3P30A 4ZOLA 1SKVA 4WF9V 4EFEA 1ZAUA 4JPRA 1NH2B 2Z0AA 3T1YO 4LFCO 2R70A 5B1NA 5JQGB 3CC7V 1WB8A 3T1CA 3ZHTA 1I94B 5EC2C 4JGSA 2P4VA 4U3FH 5EBMC 4MTOA 2UXDO 1WP7A 2AXTZ 1HNWO 1K4CC 2UU9B 2Q0OC 4LFAO 2Q8VA 2BOCC 3W7UA 1XBLA 1BS3A 3RYFB 3RYHA 4QE7A 4YHHB 3CWBH 4JTCB 2DQ0A 3THOA 1V55B 2P7TC 4DR6O 1HNWB 1MNGA 3EHBB 3W7XA 3CCJV 4GUNA 1GRJA 5D5PA 1GK9A 1Q82W 2CTRA 3JD4A 1JPXA 1XUQA 2UXNA 2OCHA 3ZN0A 3D3QA 3BFRA 1D5AA 1N33B 1AI6A 3K08A 1KB9F 4JASA 5GTIZ 4K0KO 1NR7A 1AVMA 3HKCB 4DRXA 2JGUA 2QWNB 1XMOO 1NBMG 1MZEA 1JFFA 4NKGB 5B3SB 3JASA 4B08A 4X9QA 3OTOB 4U3JA 1HNXB 4LC1A 5IYCO 3JAKA 4KHPO 1IXBA 2Q67A 1PKXA 3UM7A 3CEIA 5IJ9B 2JS3A 1TUBB 2YSUB 4CH3A 1RFYA 2UUCO 4I9WA 1YI2V 2OYQA 5LOVA 1K8AW 1MOFA 1H2GA 1BL8A 5CN0A 3ZHVA 3J81N 1P49A 1CP9A 3DC5A 1VF7A 4MVSA 3ETDA 2OT5A 1QR8A 3AG2B 2H8PC 1Q90D 1PPJH 1XL6A 2HJDA 3NXSA 4FFBB 4UXNA 4OX9B 2Q7EA 2D2CB 1Q81W 1FXHA 2ZCEA 3F5TA 1VQ9V 3K5LA 1I08A 4TV9B 4DR3B 4DR5B 2EX3A 1DK1A 2CAZC 4C7UA 4DR1O 5EBLC 4FLXA 4AQYO 4FLTA 3T1HB 4QGPA 1RSOB 4DR1B 1WPBA 3SGIA 4BW9A 3ZJZA 1F4NA 4OXSA 3JATA 2EIKC 3EXAA 2JGDB 5EYPA 5BZBA 5K1XA 4FLWA 3ZIAG 3ZMTA 1K5QA 5DM6V 5JJEB 4H13B 4L87A 2XUMA 4B3TO 2WLIA 3APQA 4JI3O 4GKJO 1WB7A 1JCHA 2BE3A 4TQDA 3CC2V 3HKDA 2UXDB 2UUBB 2E3CA 4JI2O 2Z3YA 2GUZA 4I5SA 3B09A 2QWQB 4LCUC 3RGBA 3SYCA 2Y48A 4OPHA 4G27B 1JMKC 1S0VA 1VP7A 4NTXA 1G8MA 4FJCC 1AJQA 4UCVA 5BXZA 2H94A 3T2MA 2KSDA 2KG7B 3CCUV 4FFBA 2GV9A 1L1FA 1QVGU 3ZHQA 3N2KB 5H6QA 1SC5B 1Q5OA 1HDJA 1Q6UA 3TCUA 5KMGA 4MVQA 4PHZA 3RW0A 2JEXA 3QO5A 4DV0O 5B66Z 1COWG 2XASA 3ASNB 4MVUA 3SJCC 3MAQA 2FB5A 2W6JG 2YI8A 4XBFA 2UXCO 4G28B 1AROP 3VQYA 2ZM6B 4WFGA 3ZMZA 4CS2A 2GTAA 3SPCA 4J10A 4X8AA 2YIBD 3SYPA 2HHHB 2XHBA 3CYOA 4H0LB 2JK5C 2DQ3A 3HKCA 4Z1VA 1U97A 1V55C 1RSOA 4UV8A 4O4LB 2UXXA 4RQFA 2B5UA 4I0XA 3BEHA 4ZHQA 1YDXA 1NU1H 2ADQB 1OZ0A 1VF5B 1WA8B 5JH7A 4U7OA 2FYUH 5B1BB 3RWRD 3E35A 4ABMA 3SJQC 1BHAA 3OM3B 5IY5C 3A0HZ 3DXRA 2WA3A 1Q7YW 2PTMA 3CRQA 1EN5A 3M7MX 2V4DA 1YTFD 1AP5A 4Q20A 4ZBMA 4XDLA 5J2UA 2IJIA 5IJ0A 3OR6C 1JVMA 2FTKA 3BAAA 4BWAA 3ETEA 3C3SA 3SJBC 1BGYH 4JTDB 1LNQA 3ABLC 2Y69C 1JA8A 1YHQV 1QBZA 1K92A 4O4HA 4FIPC 5E79Z 1TA8A 3N27A 2PZSA 2A7WA 1OCZB 3K3WA 2X6BA 3ZRWA 4FZ1A 3K04A 3RYIA 1JFFB 1H2MA 5KA5A 1VQ8V 1VQ6V 2F1MA 4YJ3A 2ODMA 1MMMA 5JJJB 2PF4E 4LF9B 2P06A 4X1YB 1KC8W 1BCCH 2W0FC 3CJHB 1K3EA 3B8MA 1XDCA 2ITDC 4I4TB 2NN4A 2OTLV 3J80N 4P9OA 2B9ZA 3M99B 4O2AA 4NTYA 2QE7G 2EIJB 2A9HA 3AG1C 2VQFB 1KBHA 5K1PA 3K57A 3JATB 1DF5A 4DV1O 4PA6A 2VQFO 5B5EZ 1IZ3A 4PDVA 3SYOA 3EFFK 1IDSA 2JIZG 3CHXA 4LR3A 1NQTA 3ETGA 1WLEA 2K1EA 4OPAA 1GM8A 2UXCB 5L3EA 4B3RO 4UFZA 3ZRSA 1ZL8B 5GONA 1ORQC 5JCOA 3K59A 1EM1A 4X66B 5IY5B 3TXSA 2P90A 1BQ0A 4TWKA 3D36A 4DK1A 4GYCB 4EFBA 5GONB 5TISZ 4WCEV 3VQWA 1NTZH 4DV5B 4NTWA 2DYRC 1S72V 2LQTA 1N34O 2O57A 2ZR2A 3ABTA 4J41A 3ZS8C 4O4JB 5LP6C 2ZDIA 3CP1A 4TV8A 3DXRB 1PL4A 2BTOA 1GH6A 4MTFA 4DUZO 4U3JB 1S77D 2OIEA 4MVOA 2DWDC 4AHCA 3JASB 2X0LA 2HKOA 2XAFA 2JGDA 4PV1B 3IGAC 3G80A 4TUYB 1H2NA 1F23A 5L3DA 3H1KH 2ZE6A 1IVSA 4TUYA 4YJ3B 1M4UA 1O9HA 3AK3A 5B1AC 1N32B 4QPKA 4I55A 1RM1B 5FL7G 4RO2A 3LDEA 1F7YA 3JD1A 4D7TA 4W4KA 1BQZA 4X64B 4JZGA 4YY3O 3QO8A 2A79B 2JRIA 2YS8A 5H2FZ 3CCRV 1AI7A 4JI5B 4AILC 5LGUA 3E89A 1TUEB 2CDYA 3QTCA 2Q68A 5ITZB 4LWSB 2ZD9A 5EZYB 1HNXO 4UCOA 1XMQB 2JS5A 2ZXWC 4HBNA 4YY3B 1FKAO 1OCRC 3HB3B 5LGNA 5LMUB 2KG7A 1JJOA 2VRZA 4J7ZA 5DN6G 4IL6Z 1R3JC 3ABKC 1HR0B 1CXZB 3SPJA 4GX1A 4DR7B 3K06A 3CD6V 1M90W 4MSWC 3CMEV 1IBLO 4AI8A 1P4RA 1ZL8A 1XILA 4XDJA 5CA1A 4R8CA 2Q69A 3K9SA 1KKDA 2QKSA 1MA1A 1GAXA 1R73A 1FXKA 4DV7B 2NNUA 3AG4C 3RBZA 1Q8IA 3AG4B 5LMNO 3LDDA 2JJ2G 3ZN1A 4LH7A 4F6EA 2DN9A 3OR7C 4PA7A 4JV5O 2HP8A 1GN6A 3SPIA 3QG5A 4J80A 1J95A 4TV8B 4LF8O 2ZINA 1K4DC 2ZQMA 3JSNA 4OGQB 2HJFC 3ABMB 3DTUB 4F6RB 2DYRB 1FXKC 5HFLA 4LFAB 5EK0A 1VEWA 2CGOA 4JI6O 4FVMA 5KAFZ 4PI0A 3JD3A 1Q6HA 1Y6XA 4LF7B 2ZXWB 3BA9A 1FFTB 4WBNB 3RVZA 1O9GA 2EZOA 3WG7C 1OJHA 5H6RA 5KLVH 4GKKO 3BA8A 1PM9A 2A0LA 2YUAA 4GCZA 3CCMV 4LNUB 4CH5A 5LHIA 3B2EE 5IJ0B 2K9PA 3ZEDA 3G6EV 4KXRA 1ZLZA 2R9IA 4TT3G 1K34A 1N36B 4PDMA 4NXNB 2JEUA 3OEEG 3ICXA 1D2DA 3RFRA 3B40A 2WLIB 1QR9A 5FNVB 1VQMV 2RNBA 2RDCA 4JF3A 2ADPA 2F4VB 5IWAB 1FJGB 3FD9A 3QF7A 2QKAA 5EYPB 1M57B 3E8HA 1N0NA 2QGNA 5LGTA 2MK3A 1EZJA 2P67A 4H44B 1XNRB 5LP6A 1D5NA 4JAVA 1BSMA 2F23A 4LNUA 1W0KG 2VWJA 2QWOB 1XEQA 1Z5WA 2HHHO 4NYKA 1F4MA 1Z5VA 2IU0A 1I0HA 4LF6O 4WBNA 2QTOA 4LFCB 2QM4A 2R9RB 1LUVA 2LW7A 3FX7A 2YXYA 1EN4A 3X2QC 1NZ6A 3P3PA 4IHJA 3DGEA 1OCCB 2GDSA 4GKJB 3G4SV 1EBOA 5J2TB 1AR5A 5DECA 1I94O 3ML0A 1PNLA 2UUAO 3TGUH 4LF8B 5B1BC 4PA3A 4B7EA 5LMNB 1SQFA 3D8CA 5CBHA 2Q6AA 1IX9A 1I5XA 1YJWV 3A8TA 1X59A 2LJ2A 3ZX6A 2WPDG 2M7WA 4BW5A 3Q4HA 4NXNO 2Y0IA 4UB8Z 3CPWU 1UJWB 4YJ2A 4L8JA 2Y4UA 4P9PA 1YZBA 2YIBA 1SQBH 4UCRA 2D3OW 5H5NA 4CH6A 4JI6B 1OCCC 3LSSA 3M8AA 1SZXA 3OGIB 3IC7A 2E5LO 1H38A 3U10A 2UUCB 4GX5A 4J11A 1SQGA 1VQPV 4X65B 3CCQV 3OUSA 1BHBA 4LF5B 3TETA 4WFBV 3I5DA 2NLJC 4JI1O 4K35A 4QNHB 4YIOA 3H1HH 1YCIA 1F51A 4CH4A 2LP7A 2LW1A 5KUMA 2W6IG 2HVKC 3CCVV 2PYLA 2XT9A 5IWAO 2ZNIA 3B8NA 1XQ8A 2R9AA 1Y66A 1PNMA 4JZ2A 2PGGA 4X1KA 2QSAA 3MDSA 2XOKG 4H33A 3AK1A 3UQ8A 1E1RG 1YXBA 2EIKB 4WFAV 4ZKIA 4MS2A 4NB5A 3OW2U 3F5WC 4GX0A 4J7KA 3T4ZA 2WLJA 4N23A 3A0RA 5LP6B 1TAEA 3G71V 1AP6A 1SF9A 3AG3B 5LOVB 4MT8A 4JI3B 1GKFA 4LFBB 3T1HO 3ZMVA 4FLZA 4LF6B 3A2FA 5IYZA 3LSUA 1GN4A 1BT8A 3OT7A 1G1XB 5BR8O 3D3IA 4FLVA 2HEPA
chains in the Genus database with same CATH topology
2LQTA 1U96A 2RN9A 1U97A 2LGQA 1HP8A 2HP8A 2RNBA 1Z2GA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQT A;  1U96 A;  2RN9 A;  1U97 A;  2LGQ A;  1HP8 A;  2HP8 A;  2RNB A;  1Z2G A; 
#chains in the Genus database with same CATH topology
 1KUQ A;  4UB6 Z;  4KL1 A;  2VQE O;  3I55 V;  1V9P A;  4I4T A;  1A32 A;  4LFB O;  3GVM A;  2EIM C;  4DV6 B;  1KQS U;  4MVR A;  2QWP B;  4UCS A;  1ENV A;  1N0J A;  5KHJ A;  4BIZ A;  1XL4 A;  2EUL A;  1S76 D;  2RMK B;  4IGG A;  2ITC C;  5BMV B;  1M9N A;  1YSC A;  2F95 B;  4J9Z B;  2HR3 A;  4XDK A;  2ARH A;  3JAL B;  2Y4T A;  4X65 O;  5JVD B;  5FPR A;  3JAR A;  3VQX A;  1XNQ B;  1NR1 A;  3UO3 A;  4PDR A;  2CTW A;  3JAW B;  4KP4 A;  4JAU A;  2LO1 A;  4IYI A;  3BVO A;  4GX2 A;  5ITZ A;  3FKS G;  3S3X A;  4F6R A;  5J9P C;  3ZRX A;  1XOU A;  1AR4 A;  3QO7 A;  2JJ1 G;  5F2V O;  3RN4 A;  4DV4 B;  4DR7 O;  4X1I B;  4X20 B;  1JJ2 U;  2LFR A;  2YI9 A;  3ZHR A;  1ZX3 A;  2WLM A;  1MSD A;  4IIJ A;  2YEV B;  1OHH G;  4WFE A;  4DW0 A;  1IBK B;  2QTS A;  3JCZ A;  2OTJ V;  3KCY A;  3L9D A;  3E22 B;  2CTP A;  4DV3 O;  1BE3 H;  1QHT A;  4DV7 O;  4Z1M G;  3ZBH A;  2V7Q G;  1XRE A;  5KHI A;  3RVY A;  5HFM A;  4TQF A;  4RQE A;  1K33 A;  4F4L A;  3CRA A;  2UU9 O;  1DLB A;  5CA0 A;  4DR5 O;  5CA1 B;  1N34 B;  3RYI B;  4R50 A;  5B1O A;  4HNA B;  3DC6 A;  2YEV A;  3L71 H;  3K5N A;  4DV5 O;  2WLN A;  4YIP A;  1EZV H;  3RYH B;  4JTA B;  4FLU A;  1MSW D;  1WP8 A;  2Y0P A;  5C8Y B;  1FS0 G;  2ILM A;  3A0B Z;  1S5J A;  2ZNJ A;  1SER A;  3R66 A;  1YIT V;  2DE0 X;  4DUZ B;  4KUM A;  4R7C A;  3U0Z A;  4DYL A;  2EZP A;  2HLD G;  5JJN B;  4O2B B;  4DV2 O;  3SYA A;  3PN1 A;  1R6K A;  3JD0 A;  5JVD A;  2GHY A;  3JAL A;  3IC9 A;  3H1J H;  5BR8 B;  2DWE C;  2YXH A;  5LA6 B;  5LXT B;  1YJN V;  1MZF A;  1FXV A;  2P22 C;  3JYC A;  4GT1 A;  3W7S A;  3O9O A;  3FB8 C;  2V1D A;  3W7W A;  1M56 C;  3OTF A;  2VS0 A;  1HNZ B;  1CEZ A;  4QE9 A;  2ZT9 B;  2N74 A;  2AHY A;  1L0N H;  5EBW C;  2CK3 G;  3PJS K;  5EIB C;  1IBM O;  3CC4 V;  2VWK A;  2Q5Z A;  3GWK C;  2FL4 A;  2F93 B;  4UVB A;  3MHS C;  1KP3 A;  4HZ3 A;  5GTH Z;  4E4E A;  1R3I C;  5IYB O;  2Q4P A;  3FAV A;  4B3R B;  1KMI Z;  4DR4 B;  3FB6 C;  2HFE C;  1K7D A;  2KQX A;  3CJH A;  3EVK A;  1U96 A;  3TJT A;  4I50 A;  4GZR B;  3E8B A;  4X1Y A;  1Q43 A;  1DTO A;  1IBM B;  3L72 H;  1GMG A;  2CE4 A;  5CB4 B;  3QVN A;  4R6Z A;  1G4Y B;  4MTG A;  5FPO A;  1NI8 A;  4DW1 A;  3KKY A;  5L3G A;  1IBL B;  5LXT A;  4E2L A;  2P5O A;  3T1Y B;  3VBB A;  5EIB D;  3FFQ A;  3O65 A;  1DGS A;  4W4L A;  1VQO V;  1B04 A;  3L73 H;  2N05 A;  3FYE B;  1HWY A;  2Y69 B;  1HR0 O;  1KYO F;  5A9G A;  4D6T H;  3C3T A;  1YTF B;  5J2T A;  4DR6 B;  2ZE8 A;  3J7A U;  3ABU A;  2FKX A;  1IUR A;  2QDO A;  1QQC A;  1XHZ A;  3OAA G;  3K5O A;  5CB4 A;  4B3S O;  2R72 A;  2YDE A;  4FM1 A;  1H8E G;  2N04 A;  4EB6 B;  5C8Y A;  3CRM A;  4DR2 O;  1VF6 C;  2ZE5 A;  3E8G A;  3KG2 A;  2YXL A;  2H3O A;  2UUB O;  2C2A A;  1YIJ V;  5EC1 C;  3P3N A;  1SZT A;  4PD4 F;  1ZUQ A;  1JQ0 A;  1YF2 A;  1V54 C;  2P4K A;  3BPZ A;  4ZI7 B;  4HNA A;  4JV5 B;  2ZIO A;  4JYA O;  5GW7 A;  3OUF A;  1H2S B;  1R6T A;  1OCR B;  2IH1 C;  4DRX B;  1R1B A;  1BZK A;  3AG1 B;  2CGN A;  2Q0A A;  5D5Q A;  4X62 B;  4ICG A;  4UUJ C;  4N21 A;  4Z2W A;  1XMO B;  3E2E A;  1Y67 A;  1GN3 A;  4K0K B;  2GBO A;  3E83 A;  3E22 A;  3D36 C;  1Q6I A;  3CE2 A;  2ETN A;  1Y74 A;  2EIN B;  4JI5 O;  1NKD A;  3HKE B;  2E75 B;  2F66 C;  3WB0 A;  1SA0 A;  2ZKO A;  1R3L C;  4BAY A;  3L74 H;  4JYY A;  3CB2 A;  3IAY A;  1ZWI C;  3C90 A;  1TGO A;  5LMU O;  4UVC A;  1E1Q G;  1MAB G;  1Q3E A;  3LUT B;  4O2B A;  3L75 H;  2BOB C;  1LR1 A;  2DOS A;  3HR0 A;  4EB6 A;  5B1A B;  5H9C A;  1GM7 A;  1FYJ A;  3AG3 C;  3ZMS A;  5J2U B;  4KHP B;  3K58 A;  4JI8 O;  4K3A A;  1GM9 A;  1QNM A;  1N4C A;  3JD2 A;  2XND G;  4J7J A;  4CZZ A;  1SQV H;  4FFK A;  4JI1 B;  1KU9 A;  3ZRV A;  3H9V A;  3SDL A;  4H37 A;  4ZOL B;  5JH7 B;  5JWP A;  3MHH C;  1VQ7 V;  5C93 A;  3H1I H;  4JI4 B;  4TSF G;  4B3S B;  1AJP A;  4O4L A;  1QLN A;  4ASU G;  2PI5 A;  3I56 V;  3SR2 C;  2OCC B;  2CTQ A;  3ABL B;  3G67 A;  4FM2 A;  3BRC A;  1RPO A;  2IM9 A;  2IH3 C;  2WLH A;  3HPL C;  1N8R W;  2X6C A;  4ZI7 A;  4B3T B;  3T4D A;  2A3Q A;  2ATK C;  4RUE A;  4O4I A;  4CC6 A;  5LHG A;  3CCL V;  1FFX B;  3OMN B;  4LP8 A;  2EBO A;  1VAR A;  1SET A;  4RAI A;  4X62 O;  1P7B A;  2F43 G;  3FYI B;  4YHH O;  3CSX A;  1J5E O;  5L3F A;  2AHZ A;  4GKK B;  2WSS G;  2UUA B;  1PNK A;  4FLY A;  3OFN G;  2RJZ A;  1J5E B;  4MW8 A;  2IJK A;  1JX9 A;  3B77 A;  5LA6 A;  1WAZ A;  1M5I A;  4LF7 O;  3HKB B;  1P84 F;  1VQK V;  2Q7G A;  2UXB B;  4I9Q A;  1CPY A;  4NVP A;  2E5L B;  4LF9 O;  4TV9 A;  4JAA A;  2UXB O;  2YIA A;  1NT2 B;  2QJ1 A;  4O4H B;  1XHX A;  5KA6 A;  1H2L A;  2IJH A;  3SPH A;  5L3B A;  4YXW G;  2Z5U A;  3UKM A;  3CCS V;  4HAM A;  3K0G A;  3STZ C;  4RUF A;  1QLE C;  1N36 O;  2WWW A;  2WLL A;  3ASN C;  1AB3 A;  5BY1 A;  5AG2 A;  3VOU A;  4MVZ A;  1M57 C;  1VF6 A;  4NR1 A;  1EFR G;  1I5Y A;  3WG7 B;  1NTK H;  1NTM H;  1Y76 B;  4UVA A;  5DED A;  1XNR O;  3BHP A;  4PEL A;  4WFH A;  1K73 W;  3OTO O;  5KHG A;  2E74 B;  1Z2G A;  4CC5 A;  4I55 B;  2DW4 A;  1BMF G;  5CBF A;  1S5L Z;  4K8X A;  1HW7 A;  1Y74 B;  3WB1 A;  2AZ2 A;  5FLX N;  4JI0 O;  4CS4 A;  2CUG A;  2L35 A;  4DR3 O;  4JI0 B;  3E86 A;  5KHK A;  2Q9L A;  3CS5 A;  1WN7 A;  1AI5 A;  3GB7 C;  3ABM C;  1X4T A;  4FK5 C;  5LL6 Y;  1V54 B;  5A2Q N;  1AI4 A;  3W7T A;  5KX5 B;  1G6U A;  3BCC H;  2BTQ A;  2XTA A;  3ZRW B;  3IFX A;  5CMU A;  2WLK A;  4LH6 A;  3ZMU A;  3LSQ A;  3X2Q B;  1VQ5 V;  3ZHS A;  3F7Y C;  3U11 A;  4DO2 A;  3UT5 B;  4G2K A;  3ASO C;  3OD4 A;  2YC0 A;  4BR6 A;  3QNE A;  1SQP H;  1SQX H;  3SPG A;  5KAI Z;  2HG5 C;  2P6J A;  3RYF A;  4DUY O;  4D7S A;  1M1K W;  4JI4 O;  4LWS A;  4DUY B;  4NXM O;  2OIG A;  3WFV A;  4PA4 A;  3JAW A;  1L0L H;  4X89 A;  3OMA B;  3G6B A;  3KZI Z;  4EKW A;  2AZ0 A;  1QVF U;  4FM0 A;  4CS3 A;  1NVP D;  3KCX A;  4JI7 B;  1P7G A;  3JSL A;  3ABK B;  1WNS A;  4FMT A;  2PYJ A;  3HKB A;  1JR9 A;  1AIL A;  3CX5 F;  3AG7 A;  3HKE A;  4JI2 B;  3K9A A;  2EIL B;  4B3M B;  3SYQ A;  1B06 A;  4ZIB A;  5IDJ A;  1B6Q A;  1TVK A;  3Q4H B;  3HKD B;  1XNQ O;  3TXQ A;  3LNN A;  1WJZ A;  4I50 B;  5KUK A;  1T5E A;  1XI1 A;  2DYS C;  1PP9 H;  3AG2 C;  3APO A;  1FFX A;  4UCU A;  4PI2 A;  2WA4 A;  2W0X A;  3RYC A;  2ZIM A;  1ZTE A;  2QEX V;  2QR4 A;  4IIJ B;  1YVW A;  3R65 A;  5B3S C;  5FNV A;  4X66 O;  5KHH A;  2JVD A;  1GO3 F;  1S3J A;  3OE7 G;  2QKC A;  3IJ4 A;  4LF4 B;  1SS3 A;  3UO2 A;  2QM7 A;  2ZM6 O;  3CXH F;  5LYJ A;  1W2B U;  4X88 A;  5LBQ A;  1UPG A;  3CRC A;  2QA4 V;  1VQN V;  4Q6G A;  3AK2 A;  3JAR B;  4DV1 B;  1THZ A;  3JCU Z;  5JQG A;  4LF5 O;  4OX9 O;  4X1K B;  4PDL A;  3BAB A;  4LF4 O;  1RM1 C;  1VQ4 V;  2EIL C;  1OV9 A;  2CH7 A;  2A06 H;  5IT9 N;  2QM8 A;  1SQQ H;  4UCT A;  5BMV A;  2XAQ A;  1FPO A;  3E8F A;  2WAM A;  2EJR A;  3TK1 A;  1RPR A;  2DMX A;  4IT5 A;  1YJ9 V;  2EJ7 A;  4DV2 B;  3H01 A;  3S3W A;  3FB5 C;  1US6 A;  1Y4M A;  1AJN A;  2XAJ A;  4J9Y B;  2GSM B;  4JI7 O;  1S5H C;  1R3K C;  4O4I B;  4JYA B;  3NR7 A;  1VQL V;  2Q7H A;  1KEC A;  3JAK B;  1AR1 B;  1GN2 A;  1UFI A;  1SA0 B;  5CA0 B;  4P30 A;  4NXM B;  1LUW A;  4ZHQ B;  1NJI W;  2RCV A;  3ASO B;  1IXM A;  3JAM N;  2DYS B;  1KP2 A;  1HNZ O;  3ZCC A;  4HYO A;  4LBE C;  2B1I A;  4FPP A;  1M56 B;  4J42 A;  3ETQ A;  1I7F A;  3ZHU A;  4A5U B;  3CMA V;  2VQE B;  3B4S A;  3CCE V;  1QU7 A;  4MVM A;  1QCE A;  4DK0 A;  3LDC A;  2G38 A;  4B3M O;  1M93 A;  2BSK B;  1HP8 A;  4DV6 O;  1SES A;  2DJV A;  4DV4 O;  1FAF A;  3DSQ A;  4EEQ A;  3N2G B;  2XAG A;  2QWR B;  5LYJ B;  5EZY A;  4IHJ B;  5IYD O;  1GTO A;  1OCO B;  4MTX A;  3RT3 C;  3LNM B;  4X64 O;  1WPX A;  2FML A;  3N2K A;  1VMG A;  3N2G A;  1NS1 A;  1OCZ C;  3CRR A;  4DV0 B;  2KKW A;  3UT5 A;  2XAH A;  4BIO A;  1IBK O;  1QLE B;  3BY6 A;  4FZ0 A;  1H2K A;  5E1A C;  2EIM B;  2B1G A;  2M6Y A;  3K5M A;  2Q73 A;  2X6A A;  4U7N A;  2RN9 A;  1K97 A;  1H8H G;  1WA8 A;  5JCO C;  2BTQ B;  2BCC H;  3RYC B;  3STL C;  1PV0 A;  1K9M W;  3H1L H;  2GUZ B;  3UCS C;  4YJ2 B;  4I0X B;  1URF A;  5IE9 A;  4I7Z B;  2MW2 B;  3CXC U;  4DV3 B;  1YEW A;  4QPJ A;  3MD0 A;  1TVK B;  4QIW F;  1K5S A;  2AGA A;  3FAV B;  3OEH G;  2E76 B;  2EIJ C;  1B3Q A;  4QJF B;  2RQ6 A;  3GWO A;  4UV9 A;  1ZSP A;  4PA9 A;  1OCO C;  4MW3 A;  2OWO A;  2OCC C;  3K79 A;  2GTS A;  2IBZ H;  5IYZ B;  5CBG A;  4X20 A;  4X1I A;  1N33 O;  1R6N A;  2X7R B;  2PUS A;  2ZE7 A;  1JOY A;  1Q86 W;  5L3C A;  1EN6 A;  5KMG B;  4IYH A;  3K03 A;  2IU3 A;  2CH7 B;  4CBC A;  4DR2 B;  2EIN C;  3F7V C;  4DXW A;  1W59 A;  2NR5 A;  2ZR3 A;  2BSK A;  2IW5 A;  3FB7 C;  1N32 O;  1NVP B;  2PI4 A;  2YID A;  3WB2 A;  3VQV A;  1PL0 A;  1SRY A;  2LGW A;  3WU2 Z;  1PD3 A;  5KX5 A;  2F4V O;  1MG1 A;  4JYC A;  4GLX A;  1W0J G;  4KFM A;  4JI8 B;  1VIB A;  3SJA C;  3AEI A;  2HVJ C;  5LHH A;  1KKC A;  2ZDI C;  1NH2 D;  1TUB A;  4WFF A;  5IJ9 A;  1KD1 W;  2KB1 A;  1FD9 A;  2PY5 A;  2AW9 A;  5CA3 A;  1FJG O;  2YIC A;  4O2A B;  4RWU A;  4P2Z A;  4PJ0 Z;  3L70 H;  3P32 A;  1Y76 A;  1E79 G;  2JDI G;  1ROP A;  3OMI B;  4AQY B;  4DR4 O;  4K8Z A;  1FXK B;  4O4J A;  2L6L A;  2IJJ A;  3OGC C;  3K0D A;  4TOI A;  2WLL B;  4JYB A;  1RP3 B;  2LFS A;  4BIU A;  4B7K A;  1L8D A;  2LGQ A;  1DF4 A;  1XMQ O;  3P30 A;  4ZOL A;  1SKV A;  4WF9 V;  4EFE A;  1ZAU A;  4JPR A;  1NH2 B;  2Z0A A;  3T1Y O;  4LFC O;  2R70 A;  5B1N A;  5JQG B;  3CC7 V;  1WB8 A;  3T1C A;  3ZHT A;  1I94 B;  5EC2 C;  4JGS A;  2P4V A;  4U3F H;  5EBM C;  4MTO A;  2UXD O;  1WP7 A;  2AXT Z;  1HNW O;  1K4C C;  2UU9 B;  2Q0O C;  4LFA O;  2Q8V A;  2BOC C;  3W7U A;  1XBL A;  1BS3 A;  3RYF B;  3RYH A;  4QE7 A;  4YHH B;  3CWB H;  4JTC B;  2DQ0 A;  3THO A;  1V55 B;  2P7T C;  4DR6 O;  1HNW B;  1MNG A;  3EHB B;  3W7X A;  3CCJ V;  4GUN A;  1GRJ A;  5D5P A;  1GK9 A;  1Q82 W;  2CTR A;  3JD4 A;  1JPX A;  1XUQ A;  2UXN A;  2OCH A;  3ZN0 A;  3D3Q A;  3BFR A;  1D5A A;  1N33 B;  1AI6 A;  3K08 A;  1KB9 F;  4JAS A;  5GTI Z;  4K0K O;  1NR7 A;  1AVM A;  3HKC B;  4DRX A;  2JGU A;  2QWN B;  1XMO O;  1NBM G;  1MZE A;  1JFF A;  4NKG B;  5B3S B;  3JAS A;  4B08 A;  4X9Q A;  3OTO B;  4U3J A;  1HNX B;  4LC1 A;  5IYC O;  3JAK A;  4KHP O;  1IXB A;  2Q67 A;  1PKX A;  3UM7 A;  3CEI A;  5IJ9 B;  2JS3 A;  1TUB B;  2YSU B;  4CH3 A;  1RFY A;  2UUC O;  4I9W A;  1YI2 V;  2OYQ A;  5LOV A;  1K8A W;  1MOF A;  1H2G A;  1BL8 A;  5CN0 A;  3ZHV A;  3J81 N;  1P49 A;  1CP9 A;  3DC5 A;  1VF7 A;  4MVS A;  3ETD A;  2OT5 A;  1QR8 A;  3AG2 B;  2H8P C;  1Q90 D;  1PPJ H;  1XL6 A;  2HJD A;  3NXS A;  4FFB B;  4UXN A;  4OX9 B;  2Q7E A;  2D2C B;  1Q81 W;  1FXH A;  2ZCE A;  3F5T A;  1VQ9 V;  3K5L A;  1I08 A;  4TV9 B;  4DR3 B;  4DR5 B;  2EX3 A;  1DK1 A;  2CAZ C;  4C7U A;  4DR1 O;  5EBL C;  4FLX A;  4AQY O;  4FLT A;  3T1H B;  4QGP A;  1RSO B;  4DR1 B;  1WPB A;  3SGI A;  4BW9 A;  3ZJZ A;  1F4N A;  4OXS A;  3JAT A;  2EIK C;  3EXA A;  2JGD B;  5EYP A;  5BZB A;  5K1X A;  4FLW A;  3ZIA G;  3ZMT A;  1K5Q A;  5DM6 V;  5JJE B;  4H13 B;  4L87 A;  2XUM A;  4B3T O;  2WLI A;  3APQ A;  4JI3 O;  4GKJ O;  1WB7 A;  1JCH A;  2BE3 A;  4TQD A;  3CC2 V;  3HKD A;  2UXD B;  2UUB B;  2E3C A;  4JI2 O;  2Z3Y A;  2GUZ A;  4I5S A;  3B09 A;  2QWQ B;  4LCU C;  3RGB A;  3SYC A;  2Y48 A;  4OPH A;  4G27 B;  1JMK C;  1S0V A;  1VP7 A;  4NTX A;  1G8M A;  4FJC C;  1AJQ A;  4UCV A;  5BXZ A;  2H94 A;  3T2M A;  2KSD A;  2KG7 B;  3CCU V;  4FFB A;  2GV9 A;  1L1F A;  1QVG U;  3ZHQ A;  3N2K B;  5H6Q A;  1SC5 B;  1Q5O A;  1HDJ A;  1Q6U A;  3TCU A;  5KMG A;  4MVQ A;  4PHZ A;  3RW0 A;  2JEX A;  3QO5 A;  4DV0 O;  5B66 Z;  1COW G;  2XAS A;  3ASN B;  4MVU A;  3SJC C;  3MAQ A;  2FB5 A;  2W6J G;  2YI8 A;  4XBF A;  2UXC O;  4G28 B;  1ARO P;  3VQY A;  2ZM6 B;  4WFG A;  3ZMZ A;  4CS2 A;  2GTA A;  3SPC A;  4J10 A;  4X8A A;  2YIB D;  3SYP A;  2HHH B;  2XHB A;  3CYO A;  4H0L B;  2JK5 C;  2DQ3 A;  3HKC A;  4Z1V A;  1U97 A;  1V55 C;  1RSO A;  4UV8 A;  4O4L B;  2UXX A;  4RQF A;  2B5U A;  4I0X A;  3BEH A;  4ZHQ A;  1YDX A;  1NU1 H;  2ADQ B;  1OZ0 A;  1VF5 B;  1WA8 B;  5JH7 A;  4U7O A;  2FYU H;  5B1B B;  3RWR D;  3E35 A;  4ABM A;  3SJQ C;  1BHA A;  3OM3 B;  5IY5 C;  3A0H Z;  3DXR A;  2WA3 A;  1Q7Y W;  2PTM A;  3CRQ A;  1EN5 A;  3M7M X;  2V4D A;  1YTF D;  1AP5 A;  4Q20 A;  4ZBM A;  4XDL A;  5J2U A;  2IJI A;  5IJ0 A;  3OR6 C;  1JVM A;  2FTK A;  3BAA A;  4BWA A;  3ETE A;  3C3S A;  3SJB C;  1BGY H;  4JTD B;  1LNQ A;  3ABL C;  2Y69 C;  1JA8 A;  1YHQ V;  1QBZ A;  1K92 A;  4O4H A;  4FIP C;  5E79 Z;  1TA8 A;  3N27 A;  2PZS A;  2A7W A;  1OCZ B;  3K3W A;  2X6B A;  3ZRW A;  4FZ1 A;  3K04 A;  3RYI A;  1JFF B;  1H2M A;  5KA5 A;  1VQ8 V;  1VQ6 V;  2F1M A;  4YJ3 A;  2ODM A;  1MMM A;  5JJJ B;  2PF4 E;  4LF9 B;  2P06 A;  4X1Y B;  1KC8 W;  1BCC H;  2W0F C;  3CJH B;  1K3E A;  3B8M A;  1XDC A;  2ITD C;  4I4T B;  2NN4 A;  2OTL V;  3J80 N;  4P9O A;  2B9Z A;  3M99 B;  4O2A A;  4NTY A;  2QE7 G;  2EIJ B;  2A9H A;  3AG1 C;  2VQF B;  1KBH A;  5K1P A;  3K57 A;  3JAT B;  1DF5 A;  4DV1 O;  4PA6 A;  2VQF O;  5B5E Z;  1IZ3 A;  4PDV A;  3SYO A;  3EFF K;  1IDS A;  2JIZ G;  3CHX A;  4LR3 A;  1NQT A;  3ETG A;  1WLE A;  2K1E A;  4OPA A;  1GM8 A;  2UXC B;  5L3E A;  4B3R O;  4UFZ A;  3ZRS A;  1ZL8 B;  5GON A;  1ORQ C;  5JCO A;  3K59 A;  1EM1 A;  4X66 B;  5IY5 B;  3TXS A;  2P90 A;  1BQ0 A;  4TWK A;  3D36 A;  4DK1 A;  4GYC B;  4EFB A;  5GON B;  5TIS Z;  4WCE V;  3VQW A;  1NTZ H;  4DV5 B;  4NTW A;  2DYR C;  1S72 V;  2LQT A;  1N34 O;  2O57 A;  2ZR2 A;  3ABT A;  4J41 A;  3ZS8 C;  4O4J B;  5LP6 C;  2ZDI A;  3CP1 A;  4TV8 A;  3DXR B;  1PL4 A;  2BTO A;  1GH6 A;  4MTF A;  4DUZ O;  4U3J B;  1S77 D;  2OIE A;  4MVO A;  2DWD C;  4AHC A;  3JAS B;  2X0L A;  2HKO A;  2XAF A;  2JGD A;  4PV1 B;  3IGA C;  3G80 A;  4TUY B;  1H2N A;  1F23 A;  5L3D A;  3H1K H;  2ZE6 A;  1IVS A;  4TUY A;  4YJ3 B;  1M4U A;  1O9H A;  3AK3 A;  5B1A C;  1N32 B;  4QPK A;  4I55 A;  1RM1 B;  5FL7 G;  4RO2 A;  3LDE A;  1F7Y A;  3JD1 A;  4D7T A;  4W4K A;  1BQZ A;  4X64 B;  4JZG A;  4YY3 O;  3QO8 A;  2A79 B;  2JRI A;  2YS8 A;  5H2F Z;  3CCR V;  1AI7 A;  4JI5 B;  4AIL C;  5LGU A;  3E89 A;  1TUE B;  2CDY A;  3QTC A;  2Q68 A;  5ITZ B;  4LWS B;  2ZD9 A;  5EZY B;  1HNX O;  4UCO A;  1XMQ B;  2JS5 A;  2ZXW C;  4HBN A;  4YY3 B;  1FKA O;  1OCR C;  3HB3 B;  5LGN A;  5LMU B;  2KG7 A;  1JJO A;  2VRZ A;  4J7Z A;  5DN6 G;  4IL6 Z;  1R3J C;  3ABK C;  1HR0 B;  1CXZ B;  3SPJ A;  4GX1 A;  4DR7 B;  3K06 A;  3CD6 V;  1M90 W;  4MSW C;  3CME V;  1IBL O;  4AI8 A;  1P4R A;  1ZL8 A;  1XIL A;  4XDJ A;  5CA1 A;  4R8C A;  2Q69 A;  3K9S A;  1KKD A;  2QKS A;  1MA1 A;  1GAX A;  1R73 A;  1FXK A;  4DV7 B;  2NNU A;  3AG4 C;  3RBZ A;  1Q8I A;  3AG4 B;  5LMN O;  3LDD A;  2JJ2 G;  3ZN1 A;  4LH7 A;  4F6E A;  2DN9 A;  3OR7 C;  4PA7 A;  4JV5 O;  2HP8 A;  1GN6 A;  3SPI A;  3QG5 A;  4J80 A;  1J95 A;  4TV8 B;  4LF8 O;  2ZIN A;  1K4D C;  2ZQM A;  3JSN A;  4OGQ B;  2HJF C;  3ABM B;  3DTU B;  4F6R B;  2DYR B;  1FXK C;  5HFL A;  4LFA B;  5EK0 A;  1VEW A;  2CGO A;  4JI6 O;  4FVM A;  5KAF Z;  4PI0 A;  3JD3 A;  1Q6H A;  1Y6X A;  4LF7 B;  2ZXW B;  3BA9 A;  1FFT B;  4WBN B;  3RVZ A;  1O9G A;  2EZO A;  3WG7 C;  1OJH A;  5H6R A;  5KLV H;  4GKK O;  3BA8 A;  1PM9 A;  2A0L A;  2YUA A;  4GCZ A;  3CCM V;  4LNU B;  4CH5 A;  5LHI A;  3B2E E;  5IJ0 B;  2K9P A;  3ZED A;  3G6E V;  4KXR A;  1ZLZ A;  2R9I A;  4TT3 G;  1K34 A;  1N36 B;  4PDM A;  4NXN B;  2JEU A;  3OEE G;  3ICX A;  1D2D A;  3RFR A;  3B40 A;  2WLI B;  1QR9 A;  5FNV B;  1VQM V;  2RNB A;  2RDC A;  4JF3 A;  2ADP A;  2F4V B;  5IWA B;  1FJG B;  3FD9 A;  3QF7 A;  2QKA A;  5EYP B;  1M57 B;  3E8H A;  1N0N A;  2QGN A;  5LGT A;  2MK3 A;  1EZJ A;  2P67 A;  4H44 B;  1XNR B;  5LP6 A;  1D5N A;  4JAV A;  1BSM A;  2F23 A;  4LNU A;  1W0K G;  2VWJ A;  2QWO B;  1XEQ A;  1Z5W A;  2HHH O;  4NYK A;  1F4M A;  1Z5V A;  2IU0 A;  1I0H A;  4LF6 O;  4WBN A;  2QTO A;  4LFC B;  2QM4 A;  2R9R B;  1LUV A;  2LW7 A;  3FX7 A;  2YXY A;  1EN4 A;  3X2Q C;  1NZ6 A;  3P3P A;  4IHJ A;  3DGE A;  1OCC B;  2GDS A;  4GKJ B;  3G4S V;  1EBO A;  5J2T B;  1AR5 A;  5DEC A;  1I94 O;  3ML0 A;  1PNL A;  2UUA O;  3TGU H;  4LF8 B;  5B1B C;  4PA3 A;  4B7E A;  5LMN B;  1SQF A;  3D8C A;  5CBH A;  2Q6A A;  1IX9 A;  1I5X A;  1YJW V;  3A8T A;  1X59 A;  2LJ2 A;  3ZX6 A;  2WPD G;  2M7W A;  4BW5 A;  3Q4H A;  4NXN O;  2Y0I A;  4UB8 Z;  3CPW U;  1UJW B;  4YJ2 A;  4L8J A;  2Y4U A;  4P9P A;  1YZB A;  2YIB A;  1SQB H;  4UCR A;  2D3O W;  5H5N A;  4CH6 A;  4JI6 B;  1OCC C;  3LSS A;  3M8A A;  1SZX A;  3OGI B;  3IC7 A;  2E5L O;  1H38 A;  3U10 A;  2UUC B;  4GX5 A;  4J11 A;  1SQG A;  1VQP V;  4X65 B;  3CCQ V;  3OUS A;  1BHB A;  4LF5 B;  3TET A;  4WFB V;  3I5D A;  2NLJ C;  4JI1 O;  4K35 A;  4QNH B;  4YIO A;  3H1H H;  1YCI A;  1F51 A;  4CH4 A;  2LP7 A;  2LW1 A;  5KUM A;  2W6I G;  2HVK C;  3CCV V;  2PYL A;  2XT9 A;  5IWA O;  2ZNI A;  3B8N A;  1XQ8 A;  2R9A A;  1Y66 A;  1PNM A;  4JZ2 A;  2PGG A;  4X1K A;  2QSA A;  3MDS A;  2XOK G;  4H33 A;  3AK1 A;  3UQ8 A;  1E1R G;  1YXB A;  2EIK B;  4WFA V;  4ZKI A;  4MS2 A;  4NB5 A;  3OW2 U;  3F5W C;  4GX0 A;  4J7K A;  3T4Z A;  2WLJ A;  4N23 A;  3A0R A;  5LP6 B;  1TAE A;  3G71 V;  1AP6 A;  1SF9 A;  3AG3 B;  5LOV B;  4MT8 A;  4JI3 B;  1GKF A;  4LFB B;  3T1H O;  3ZMV A;  4FLZ A;  4LF6 B;  3A2F A;  5IYZ A;  3LSU A;  1GN4 A;  1BT8 A;  3OT7 A;  1G1X B;  5BR8 O;  3D3I A;  4FLV A;  2HEP A; 
#chains in the Genus database with same CATH homology
 2LQT A;  1U96 A;  2RN9 A;  1U97 A;  2LGQ A;  1HP8 A;  2HP8 A;  2RNB A;  1Z2G A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...