2RN9A

Solution structure of human apocox17
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Cytochrome c oxidase copper chaperone
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rn9A00
2RN9A 2LQTA 2HP8A 1U96A 2LGQA 2RNBA 1HP8A 1Z2GA 1U97A
chains in the Genus database with same CATH superfamily
5CN0A 4H33A 2ETNA 5JJJB 4O4LA 2EIKB 3ETQA 2Q8VA 3EXAA 3DXRA 1KYOF 4RAIA 2KKWA 1XMQB 5E79Z 1O9HA 3CC4V 4TWKA 1VQ8V 4NKGB 4GYCB 4X1IA 1X59A 3J81N 4DV3B 3B2EE 3CCLV 4RQEA 1BQZA 2OIGA 4O4HB 4EFEA 1H2KA 3T1YO 2E75B 1ZX3A 1NJIW 2DWEC 4B3MO 2H94A 1KKDA 3CCVV 3ABLC 4Z2WA 3SYOA 4NXMB 4CBCA 1RPOA 4JI2B 1Q8IA 1AR1B 5H9CA 1XREA 1RFYA 5LYJA 4JTCB 2H3OA 2K1EA 3H1JH 3L74H 2EZPA 3J7AU 5FLXN 1XOUA 1E79G 3TETA 5CBFA 2IJHA 3KCXA 2GBOA 1JCHA 3OM3B 4P2ZA 4Z1MG 1SQQH 2YS8A 3K57A 2WLHA 3L73H 3MHSC 2X7RB 2OWOA 4P9OA 2P67A 2E5LB 2Y4UA 1OCRC 4DR7O 2EULA 4J10A 2YIDA 4XDJA 2NN4A 5IT9N 3J80N 4LF5O 4PI0A 1BCCH 1WA8B 3CS5A 2IJJA 1XHXA 1W2BU 1U97A 4CS3A 3U0ZA 4LF7O 5EZYA 4K3AA 5L3BA 4X89A 1KMIZ 4TOIA 4MTGA 2V4DA 3JSNA 3AG7A 2Q0AA 1ZWIC 2A06H 3E22A 1HR0O 2UXDB 1ROPA 2UU9O 4EB6B 3ASOB 3QVNA 1KBHA 2HJDA 1EZJA 4UCSA 1WLEA 4MVZA 2CTWA 1YTFB 2LGQA 1SQGA 4UCVA 3B4SA 5L3FA 4DW0A 2LO1A 2C2AA 4R6ZA 5KA6A 3FB7C 4YY3O 5K1PA 1GRJA 5IYDO 4KP4A 5DEDA 1Q90D 3CRCA 3JD4A 4DR3B 1OCZC 5JH7B 2UXCO 1RM1B 4FM1A 2GTSA 1N33B 5LXTB 4JTDB 3RYCA 4OPAA 4MVQA 1ZLZA 3JASB 3RYFB 2CGNA 1NBMG 3OMNB 1VARA 4LFBO 4MVRA 4DV5B 1HP8A 3ETDA 5B3SC 1K4DC 1H2LA 4QNHB 3LSUA 4B7EA 5AG2A 5IDJA 1JQ0A 1H38A 3G67A 2RDCA 5F2VO 1M56B 5JWPA 3QF7A 1KP3A 3JATB 4D6TH 2KG7A 4DR2B 2HJFC 3IAYA 2JIZG 3E8FA 4I9WA 2VWKA 4LWSB 1GKFA 1H8EG 3CCQV 3OAAG 3ZS8C 4LF8B 1V54B 4JI4O 4ZBMA 1I5YA 3APQA 5LMUO 3AG4C 1JMKC 1P84F 2Q68A 1S0VA 4N23A 2VQEB 4DR4B 4JI1B 1KC8W 4BAYA 2CE4A 3HKCB 2N74A 3BRCA 3OT7A 4WFGA 3DSQA 4OX9B 4DXWA 1Q5OA 3W7SA 1AP6A 5KHKA 3M7MX 1QQCA 3ZIAG 1JFFB 1LR1A 1ORQC 2X6AA 1Q6UA 3W7TA 1S77D 1EM1A 2LJ2A 3CC2V 2Q0OC 4FFBA 2VQFB 4DYLA 1G8MA 2GUZB 1Y74B 5KUKA 1MSWD 3K58A 2OCCB 5EYPB 3K9SA 2ZDIC 3QTCA 3BCCH 3BFRA 3STZC 3JD1A 4UVCA 1K7DA 4UUJC 2LW1A 1FAFA 3AK3A 2FL4A 3CRMA 3F5TA 5LGTA 2UUCB 2ZE7A 3K59A 1JPXA 4PA7A 2ZIMA 2ZXWB 1N34B 2UUAO 1K9MW 3JARA 5B5EZ 4DK0A 3ZRVA 3ZEDA 4GT1A 2ZDIA 3GB7C 3HKEA 2Y48A 3ZHVA 4DV0O 3DTUB 3TXQA 1YIJV 4KHPB 1GMGA 3LSSA 3UM7A 3QG5A 2QEXV 3WG7C 5BZBA 1H8HG 2RQ6A 2JEUA 3TXSA 1SRYA 1DTOA 4LNUA 4UB8Z 4R50A 1FXKC 2AHYA 3CRQA 3RYIA 1BGYH 2Q67A 4WBNB 4JAVA 4JZ2A 4MVUA 4JI6O 4HNAA 4X62O 3CEIA 5IY5B 2Q73A 2HHHO 2GV9A 4UV8A 1XQ8A 1O9GA 3AG2B 3TGUH 4I5SA 2XNDG 1IDSA 4FFKA 4GX5A 5BMVA 2P22C 1QLEC 3ABUA 1FXKA 3WB2A 1B6QA 1PNMA 5B1OA 4F4LA 2PZSA 1R3JC 1VQKV 1GN3A 3HB3B 4O4JA 1J5EB 2F4VO 2ARHA 1Y6XA 4WFEA 3MAQA 4QGPA 3UT5B 3OUFA 1VQ4V 1YCIA 3RW0A 4GUNA 2Q5ZA 3AG1C 2ATKC 1K5SA 2ZT9B 1YVWA 1BHAA 4O2BA 3FKSG 4WF9V 2WLMA 1JJOA 4BWAA 3VQWA 3H9VA 3K03A 1H2GA 4XDKA 5E1AC 2OCHA 4F6EA 4LR3A 4JI5B 1Q81W 5EC1C 4BIZA 4DV6O 1QLNA 3ABKC 3E22B 4B3RB 4DRXA 4W4LA 4GKJB 4KUMA 4YJ3A 2FTKA 1T5EA 1I94B 3W7XA 1D5NA 4X64O 4B08A 1N36B 1B04A 1OCOB 1SA0A 2QTSA 1XNQB 3VBBA 1JA8A 4ZHQA 2ZE5A 4UV9A 1DGSA 5H6RA 3X2QC 1VIBA 4ZI7B 2QM7A 5KHHA 2L35A 4PDLA 1MZFA 4YXWG 4JYAB 2HG5C 4NYKA 2YIAA 1BHBA 4JF3A 1YJWV 3FFQA 5HFLA 4Z1VA 3L72H 1EN4A 3RYCB 3JAKB 4B3TO 4R8CA 1GN6A 4MVSA 2FB5A 1LUVA 3DC6A 2PYJA 2HEPA 2ZM6O 5LP6C 2WPDG 1WJZA 2V1DA 4WFAV 3A0BZ 1HDJA 4E2LA 1NTZH 2JDIG 2PF4E 4J11A 4B3SB 2LP7A 2PUSA 5EBMC 5GW7A 4CH6A 1IXMA 2UXBB 4FLTA 4QE7A 1SC5B 2WLNA 1W0KG 4DUYO 2WSSG 4C7UA 4F6RB 2Q7GA 2A3QA 1VQ9V 1FKAO 2OYQA 4KL1A 4DO2A 5GONA 4MW3A 5FL7G 3HKBB 4B7KA 4JI7O 4GX1A 2LGWA 5LA6B 4EKWA 2YC0A 5LMNO 3WB1A 1ZL8A 1R3IC 3QNEA 1AB3A 5LBQA 1OJHA 4PA6A 4UCTA 1NR1A 5L3EA 1AI4A 5J9PC 3WB0A 2IJIA 5DM6V 2UUBO 2RCVA 3KZIZ 4JYBA 2EIMC 4TV8A 1VQ5V 4AILC 2RJZA 2DQ3A 1HNWB 1SQPH 1YF2A 4GLXA 1IBKB 3SPJA 4DV4B 4LFCB 2M7WA 4TV9A 4EEQA 3RT3C 3TJTA 4LF9O 1J95A 2F93B 1HNXO 2B1GA 5LHIA 2CH7B 5KHJA 3B8MA 1Y4MA 3L9DA 4PDMA 2W6IG 1PP9H 4JAAA 4CH3A 4AQYB 3AG3C 4CC6A 2G38A 2WLIA 4JV5B 1IZ3A 4CZZA 5CA1B 1TGOA 1AI6A 3CHXA 3LNMB 1XEQA 3UO3A 4FM0A 1BQ0A 1SF9A 1ENVA 4D7SA 2AGAA 3EHBB 4IYIA 3P3PA 2Q4PA 2ZR2A 4DK1A 1GN2A 2ZD9A 1JR9A 3RYIB 1XDCA 3CRRA 3N27A 1FPOA 5FPRA 5CBHA 2E74B 5KAFZ 4FJCC 1MSDA 2JJ1G 2YEVB 2F43G 1QCEA 1WP8A 4LH6A 1RSOA 1S5LZ 5B66Z 3FYIB 1M93A 1Y67A 4DUZB 1K73W 3JAWA 1XNRB 3F7VC 1FXKB 4RUEA 3JSLA 1Q7YW 5H6QA 2D2CB 1MA1A 3K5LA 4JZGA 2AHZA 4OGQB 4NXNB 5ITZA 1MABG 2LW7A 5JCOC 2P4KA 1PL0A 4X65B 1YDXA 2GTAA 2DYSC 3UCSC 2JGDB 4I55B 3C90A 5BR8O 3ZHQA 2P06A 1W0JG 4DR5O 2BSKA 2WLJA 4TQDA 3N2KA 4X1YB 4N21A 4AI8A 4FM2A 1N4CA 3I55V 1M1KW 3CRAA 1IBMB 4X66O 1K4CC 5JCOA 2DWDC 4DV7O 4DRXB 5B1NA 1XUQA 3NR7A 5JJNB 1GM9A 1THZA 4GX0A 1VQOV 4FLVA 1XI1A 3G80A 3D36C 1SA0B 4NTWA 5IYBO 1KD1W 1QNMA 4X8AA 1V9PA 2Y0IA 5KHIA 4YHHB 1S5JA 3FX7A 1BZKA 3CB2A 3TK1A 5KAIZ 1IVSA 5A2QN 3ZMZA 3ZRWA 3SR2C 3BVOA 3JCZA 3M99B 2ZCEA 1YJNV 4X20B 5J2UA 4HAMA 2AZ0A 3R65A 1NH2B 1NR7A 3I56V 3QO5A 4JI8O 3OTOB 3K0GA 1AJQA 2VRZA 3G6BA 2R9AA 2VS0A 2Q7HA 1N32B 1G4YB 4P30A 4QPJA 5IJ0A 3JALA 4X88A 3CC7V 3X2QB 2GHYA 2VQEO 1AI7A 2IBZH 1L0LH 2EJRA 1G6UA 1GTOA 5CB4B 1FJGB 4I7ZB 2XASA 3ZBHA 5L3GA 4IHJA 2R9IA 3O9OA 2JEXA 1Q82W 5FPOA 1OCCC 4TT3G 2IJKA 4LF6O 1NVPB 4DR6O 1VP7A 2BOBC 1Q86W 4ZOLB 1QU7A 4YIPA 5JVDB 3OGIB 5LGNA 5KLVH 2Y0PA 4DR1O 3JYCA 1NKDA 5GONB 4NR1A 5IYZA 1N0NA 3JD3A 1Q3EA 4BIOA 5LOVA 2Q6AA 3G6EV 1SKVA 2UUCO 3QO8A 2NNUA 1MZEA 3DC5A 1PV0A 2F23A 3T4ZA 1F4NA 5IWAO 1Y76A 1X4TA 3P30A 4B3MB 2QKSA 3CP1A 2YIBD 3VQVA 1OHHG 3ASNB 2QDOA 2YICA 3GWKC 2Y69C 3IJ4A 1YITV 2DYRC 4MVOA 4PDRA 4LCUC 2QM4A 4O4IB 4L87A 3ZHSA 1YJ9V 2QWNB 1VQMV 1HWYA 2JGUA 3OEEG 3THOA 1AI5A 4JI3O 2EILC 2QSAA 4PA4A 2KSDA 5B1AB 4GX2A 5BY1A 1RPRA 3H1HH 4DR7B 1EZVH 2AW9A 4I4TB 3EVKA 3CXHF 2IU0A 5C8YA 2PI4A 2JRIA 1FFXA 5CA3A 2ITDC 2WLLA 1I7FA 4LP8A 4MS2A 5B1BC 5KX5A 2YSUB 1H2SB 2EINC 1GH6A 2IW5A 3KG2A 1DLBA 1WPXA 3HR0A 2PGGA 5K1XA 4IL6Z 3T1HO 1XILA 1HR0B 2WA4A 4LF4O 1RSOB 1VQPV 2UU9B 1VMGA 2DOSA 3ZN0A 4PI2A 3SPIA 4I0XB 5BXZA 1VQLV 3CD6V 4K0KO 4JI5O 2F1MA 1Y66A 4O4LB 4LFAO 4B3RO 1XMOO 1BS3A 3OW2U 1R6NA 4BR6A 4BIUA 2R70A 4YY3B 2CGOA 1A32A 3DXRB 5ITZB 3FB6C 3LDCA 1K5QA 3ZRXA 4FLWA 5FNVA 3FD9A 2UXCB 3FAVA 2A79B 4X1IB 1Z5VA 3MHHC 4YJ2A 3BEHA 3LNNA 4LFBB 4TUYA 1WN7A 1TAEA 3L70H 1F4MA 2QJ1A 1IBLB 4MTXA 2EIJC 3K08A 3HKDA 1QVGU 1SESA 5C93A 4G28B 3H1KH 2IM9A 4IGGA 4FMTA 3CCRV 5LYJB 1URFA 1M57C 3P32A 4Q6GA 1K8AW 4HBNA 1B3QA 2EIKC 4HYOA 2NR5A 5KMGA 1CXZB 3BABA 1VQ6V 4JI4B 3ABLB 5LMUB 3ZRWB 2EJ7A 3T2MA 4J42A 3ZRSA 3ZMVA 5J2UB 3G4SV 2JS5A 3GVMA 4K35A 1LUWA 3RYHA 2RNBA 2XAFA 1WAZA 2ZQMA 4PV1B 2GSMB 3SJBC 2DJVA 1SS3A 1K3EA 1NS1A 3STLC 2HP8A 3RBZA 1B06A 1NTKH 5EZYB 2CK3G 4NVPA 1OCRB 3N2GA 4DV2O 3S3XA 4OXSA 1SQBH 4HZ3A 4PELA 1VQ7V 1L8DA 3O65A 2ZIOA 2ODMA 2XOKG 2ADQB 3SYPA 4O4HA 2X6BA 3S3WA 1GK9A 3W7WA 2ZE6A 2JVDA 1FXVA 2JK5C 1S5HC 3BY6A 4E4EA 3OD4A 1JVMA 2E3CA 3B8NA 1HNZO 2B5UA 2UUAB 2P5OA 2DN9A 2CAZC 4DV0B 3OFNG 3W7UA 4FLUA 4I9QA 1MG1A 4GKKB 4NTYA 1R1BA 5D5PA 4JPRA 4UCRA 1PNLA 1XBLA 2XTAA 3RVYA 4AQYO 2RN9A 4UVBA 2P90A 1PPJH 5JQGA 4JI6B 3E89A 2N05A 4JTAB 2P6JA 4X62B 1WA8A 4FLYA 4WCEV 2HHHB 3SDLA 1OCZB 1AROP 3ASOC 3T1CA 1L1FA 1VF6C 5DN6G 2JJ2G 2KG7B 2A7WA 3CCUV 3VQXA 5LP6A 1YEWA 2CDYA 4CS4A 3K04A 3IC7A 5B3SB 4JI0O 1EN6A 2OTLV 2FYUH 2F4VB 2B1IA 5H2FZ 3CMAV 2YDEA 1ZAUA 3F5WC 3L71H 1F23A 4DV1O 2UXXA 2GDSA 2MK3A 4A5UB 1FFXB 2IH3C 3AK1A 4QIWF 2WLLB 4RWUA 1SETA 2EZOA 1K92A 1SQVH 5LHGA 4MT8A 2M6YA 4FFBB 1I0HA 3AG4B 3H01A 2YUAA 3E86A 4DV6B 3OMIB 3Q4HA 1XMQO 1M56C 3RN4A 1P7GA 5LXTA 4JGSA 1R6KA 3JASA 4JASA 5EBWC 5TISZ 3RYFA 4DV3O 3RGBA 4X9QA 3K9AA 3CE2A 3K3WA 4CS2A 2F95B 3CMEV 3AEIA 4FLXA 1AJNA 1S76D 1V54C 4NXMO 3D3IA 4JI2O 2BTQA 4WFBV 3ZMSA 1YSCA 3JARB 4MTOA 5DECA 3JATA 1Q6HA 3H1LH 3HKEB 1PD3A 1UFIA 5FNVB 3UQ8A 4LWSA 3B77A 4Q20A 4U3JA 3K0DA 2QKCA 4H44B 3E2EA 3QO7A 3FAVB 4B3TB 4WFFA 4YJ2B 3D8CA 1OV9A 5J2TA 2HVKC 2JS3A 2W0FC 3CWBH 4LNUB 1AVMA 2FKXA 2E5LO 1YTFD 5KUMA 1NT2B 1M4UA 2HLDG 1K33A 3ETEA 4HNAB 1KQSU 2OCCC 1ZTEA 4W4KA 2XHBA 1LNQA 3ZHTA 2Y4TA 4JYCA 3LUTB 4GZRB 1N32O 3WG7B 1YXBA 1TVKA 3APOA 5BMVB 4RQFA 2GUZA 3K79A 4DUYB 5KMGB 1E1QG 2ZXWC 3R66A 2UXDO 2ZR3A 3C3SA 2WLKA 4O4JB 5EYPA 1YI2V 3SYQA 3UO2A 4JI7B 3FB8C 4XBFA 3RYHB 1V55C 5LMNB 4I50A 1QLEB 1QR8A 4OPHA 5GTHZ 3CCSV 1G1XB 4O2BB 3ABMC 2VWJA 4MSWC 4PHZA 4ZKIA 1GM7A 2XAGA 3PN1A 1DF4A 1KKCA 1SZXA 1IX9A 4R7CA 1FS0G 3N2GB 2H8PC 5IY5C 2UUBB 4DR3O 1PKXA 3MDSA 1N33O 3ETGA 3SPGA 2Z5UA 3K06A 2FMLA 3AG2C 4YJ3B 1KP2A 3AG1B 5CBGA 2L6LA 4P9PA 4DV5O 3P3NA 1Z2GA 2QWQB 4LF9B 4J9ZB 4WBNA 1SZTA 4ZHQB 1HNXB 3RFRA 4X1KA 2QWRB 1HW7A 3ABKB 3E8HA 4CC5A 2HFEC 1N8RW 4DW1A 1EBOA 4UCUA 4DR2O 1NZ6A 2ZNIA 1R6TA 4MTFA 4J80A 3D36A 2BOCC 4LF8O 4FVMA 1BT8A 1WB7A 2YIBA 3K5NA 3CXCU 1DF5A 5JJEB 4YIOA 1FYJA 2Q69A 5JQGB 4DR4O 4JI1O 1AP5A 2QA4V 1FFTB 3C3TA 3UT5A 1IXBA 4OX9O 5LHHA 3OTFA 1R3KC 5IYCO 4IIJA 1SQFA 4PA9A 3ZHUA 2ZKOA 3RVZA 2HVJC 1U96A 3OMAB 2QKAA 1OCOC 3ZJZA 2QR4A 2IU3A 2PYLA 4ASUG 2VQFO 5LP6B 2Q7EA 4CH4A 1Q43A 1VF7A 2DMXA 5EBLC 1VQNV 3JD0A 4ICGA 1IURA 4O2AA 1WPBA 2OT5A 1M90W 5LGUA 1VF5B 2V7QG 5KHGA 1SQXH 4FIPC 4FK5C 4UFZA 1ZL8B 4PA3A 5BR8B 1KECA 5EIBC 3CCMV 1YZBA 1SERA 4DR5B 3OR7C 4ZI7A 2EX3A 1UPGA 1N34O 3T1YB 1H2MA 1KU9A 1NTMH 2QWOB 1P4RA 5A9GA 4H13B 2ITCC 1BMFG 4X66B 3Q4HB 1KUQA 1QHTA 4DV7B 4KHPO 2RMKB 2XUMA 2O57A 4TV8B 3I5DA 2MW2B 3OGCC 3JAKA 2Z0AA 4PJ0Z 3E83A 4TV9B 3UKMA 1NU1H 3CYOA 1IBLO 1KB9F 1GM8A 4FZ1A 3BHPA 2YI8A 4XDLA 4KXRA 2BTQB 1H2NA 2Q9LA 2EIMB 3CJHA 1P49A 1TA8A 4H0LB 4UXNA 4U3JB 3K5OA 2WLIB 4KFMA 1S72V 4LF5B 3OEHG 3G71V 4JI8B 5IJ9A 4F6RA 2HR3A 5J2TB 4LF7B 1NQTA 1J5EO 1UJWB 2XAQA 3HKBA 1R3LC 4QPKA 1EN5A 3AG3B 5LA6A 3TCUA 3CX5F 1F7YA 1E1RG 4ZIBA 3JAWB 1TVKB 5LL6Y 2LFRA 4LF6B 4DR6B 2XAJA 2NLJC 3H1IH 1PNKA 2XT9A 3CCEV 3E8GA 2OTJV 3LSQA 4QE9A 5EIBD 3A8TA 4MW8A 3F7YC 4LBEC 4DR1B 1TUBA 4GKJO 3U11A 4G2KA 1I94O 3A0RA 3EFFK 2X0LA 3ZMUA 2ADPA 4U7NA 2YXYA 1N36O 2WA3A 4J7ZA 1XNQO 4I50B 5H5NA 2CH7A 2P7TC 3SPHA 4IT5A 3SGIA 2BSKB 3E8BA 3BA9A 3N2KB 3MD0A 2PY5A 1COWG 5IWAB 3OE7G 4JYAO 1BSMA 1AR5A 1W59A 4K8XA 2EBOA 4J7KA 4FPPA 5CA1A 3ABTA 2BCCH 3DGEA 4AHCA 1N0JA 1V55B 3ML0A 5EC2C 2DYSB 4RUFA 1PL4A 4GKKO 2LFSA 3LDDA 2CTRA 2CUGA 3ABMB 5L3CA 1WNSA 3IC9A 4ABMA 3B09A 2Z3YA 3CPWU 5CA0A 2BTOA 2QTOA 4X1KB 4K8ZA 4UVAA 2YEVA 4JI3B 2QGNA 2E76B 2IH1C 4WFHA 4B3SO 2UXBO 3KKYA 4J7JA 2CTQA 1WB8A 2W0XA 1ZSPA 2DE0X 2CTPA 2AZ2A 4NB5A 3ZMTA 1GN4A 4D7TA 4U7OA 3ICXA 3JALB 5IJ0B 3OR6C 2PI5A 1EFRG 3A2FA 5EK0A 3B40A 3T1HB 3BA8A 2P4VA 3K5MA 4IHJB 2JGDA 4I55A 4IIJB 3SYAA 4LF4B 2ZNJA 1D2DA 3A0HZ 2KB1A 4X1YA 4EFBA 1ZUQA 1GO3F 3ZN1A 1OZ0A 4K0KB 3VQYA 3JAMN 1JX9A 4TQFA 2R72A 2BE3A 3LDEA 4LFAB 1CP9A 1XMOB 1R73A 5CMUA 2B9ZA 4O2AB 1Q6IA 3U10A 4NTXA 1HNWO 3ZCCA 4LC1A 2F66C 5IYZB 1IBKO 4DV4O 1AILA 4LFCO 4UB6Z 1OCCB 5HFMA 5IE9A 1I08A 1L0NH 1QR9A 4FLZA 1MNGA 5LOVB 4TSFG 2AXTZ 3NXSA 4L8JA 1XHZA 1BE3H 1Y76B 4X20A 4JV5O 1S3JA 2X6CA 2PTMA 2YXHA 3KCYA 2DQ0A 4MVMA 4H37A 3ZX6A 1QBZA 4J41A 1VEWA 3SJQC 1DK1A 4J9YB 3RWRD 4U3FH 5CB4A 1P7BA 2K9PA 3D3QA 1K34A 3BPZA 3SJCC 3CJHB 2A0LA 4EB6A 5GTIZ 3JCUZ 4DUZO 2Y69B 4LH7A 1TUEB 1XNRO 1VF6A 1RM1C 2DYRB 2ILMA 5KA5A 1F51A 4IYHA 2UXNA 4ZOLA 5IJ9B 1MMMA 5C8YB 5JVDA 4PD4F 1US6A 1WP7A 5D5QA 4QJFB 4BW9A 2EILB 3AK2A 4NXNO 5KX5B 2OIEA 3SPCA 3T4DA 3BAAA 5L3DA 4JYYA 2R9RB 4DV2B 4X65O 4FZ0A 3ASNC 4RO2A 5JH7A 3L75H 1JOYA 2ZINA 3SJAC 3WU2Z 3HPLC 1I5XA 1NH2D 2WAMA 4X64B 1FXHA 1BL8A 3WFVA 3FB5C 3M8AA 1GAXA 5B1BB 2QM8A 2LQTA 1IBMO 2EINB 1AJPA 2XAHA 1PM9A 5B1AC 3CSXA 1TUBB 1HNZB 3SYCA 4UCOA 1XL6A 3IGAC 1CEZA 1YHQV 2YXLA 4O4IA 4G27B 3CCJV 2QWPB 4YHHO 4PDVA 3VOUA 4TUYB 2ZM6B 1NVPD 1QVFU 2N04A 1M5IA 2DW4A 4GCZA 1AR4A 3GWOA 3HKDB 2ZE8A 4CH5A 3HKCA 4I4TA 3OTOO 2A9HA 3FYEB 1NI8A 1JFFA 1D5AA 1Z5WA 1M9NA 2HKOA 1K97A 2KQXA 3IFXA 5CA0B 2WWWA 1Y74A 2QE7G 4JAUA 2EIJB 1FJGO 3JD2A 1MOFA 4JI0B 2YI9A 4BW5A 1XL4A 1CPYA 3E35A 3OUSA 3ZHRA 2D3OW 2W6JG 1RP3B 1M57B 1JJ2U 1FD9A 4DV1B 4I0XA 3PJSK
chains in the Genus database with same CATH topology
2RN9A 2LQTA 2HP8A 1U96A 2LGQA 2RNBA 1HP8A 1Z2GA 1U97A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RN9 A;  2LQT A;  2HP8 A;  1U96 A;  2LGQ A;  2RNB A;  1HP8 A;  1Z2G A;  1U97 A; 
#chains in the Genus database with same CATH topology
 5CN0 A;  4H33 A;  2ETN A;  5JJJ B;  4O4L A;  2EIK B;  3ETQ A;  2Q8V A;  3EXA A;  3DXR A;  1KYO F;  4RAI A;  2KKW A;  1XMQ B;  5E79 Z;  1O9H A;  3CC4 V;  4TWK A;  1VQ8 V;  4NKG B;  4GYC B;  4X1I A;  1X59 A;  3J81 N;  4DV3 B;  3B2E E;  3CCL V;  4RQE A;  1BQZ A;  2OIG A;  4O4H B;  4EFE A;  1H2K A;  3T1Y O;  2E75 B;  1ZX3 A;  1NJI W;  2DWE C;  4B3M O;  2H94 A;  1KKD A;  3CCV V;  3ABL C;  4Z2W A;  3SYO A;  4NXM B;  4CBC A;  1RPO A;  4JI2 B;  1Q8I A;  1AR1 B;  5H9C A;  1XRE A;  1RFY A;  5LYJ A;  4JTC B;  2H3O A;  2K1E A;  3H1J H;  3L74 H;  2EZP A;  3J7A U;  5FLX N;  1XOU A;  1E79 G;  3TET A;  5CBF A;  2IJH A;  3KCX A;  2GBO A;  1JCH A;  3OM3 B;  4P2Z A;  4Z1M G;  1SQQ H;  2YS8 A;  3K57 A;  2WLH A;  3L73 H;  3MHS C;  2X7R B;  2OWO A;  4P9O A;  2P67 A;  2E5L B;  2Y4U A;  1OCR C;  4DR7 O;  2EUL A;  4J10 A;  2YID A;  4XDJ A;  2NN4 A;  5IT9 N;  3J80 N;  4LF5 O;  4PI0 A;  1BCC H;  1WA8 B;  3CS5 A;  2IJJ A;  1XHX A;  1W2B U;  1U97 A;  4CS3 A;  3U0Z A;  4LF7 O;  5EZY A;  4K3A A;  5L3B A;  4X89 A;  1KMI Z;  4TOI A;  4MTG A;  2V4D A;  3JSN A;  3AG7 A;  2Q0A A;  1ZWI C;  2A06 H;  3E22 A;  1HR0 O;  2UXD B;  1ROP A;  2UU9 O;  4EB6 B;  3ASO B;  3QVN A;  1KBH A;  2HJD A;  1EZJ A;  4UCS A;  1WLE A;  4MVZ A;  2CTW A;  1YTF B;  2LGQ A;  1SQG A;  4UCV A;  3B4S A;  5L3F A;  4DW0 A;  2LO1 A;  2C2A A;  4R6Z A;  5KA6 A;  3FB7 C;  4YY3 O;  5K1P A;  1GRJ A;  5IYD O;  4KP4 A;  5DED A;  1Q90 D;  3CRC A;  3JD4 A;  4DR3 B;  1OCZ C;  5JH7 B;  2UXC O;  1RM1 B;  4FM1 A;  2GTS A;  1N33 B;  5LXT B;  4JTD B;  3RYC A;  4OPA A;  4MVQ A;  1ZLZ A;  3JAS B;  3RYF B;  2CGN A;  1NBM G;  3OMN B;  1VAR A;  4LFB O;  4MVR A;  4DV5 B;  1HP8 A;  3ETD A;  5B3S C;  1K4D C;  1H2L A;  4QNH B;  3LSU A;  4B7E A;  5AG2 A;  5IDJ A;  1JQ0 A;  1H38 A;  3G67 A;  2RDC A;  5F2V O;  1M56 B;  5JWP A;  3QF7 A;  1KP3 A;  3JAT B;  4D6T H;  2KG7 A;  4DR2 B;  2HJF C;  3IAY A;  2JIZ G;  3E8F A;  4I9W A;  2VWK A;  4LWS B;  1GKF A;  1H8E G;  3CCQ V;  3OAA G;  3ZS8 C;  4LF8 B;  1V54 B;  4JI4 O;  4ZBM A;  1I5Y A;  3APQ A;  5LMU O;  3AG4 C;  1JMK C;  1P84 F;  2Q68 A;  1S0V A;  4N23 A;  2VQE B;  4DR4 B;  4JI1 B;  1KC8 W;  4BAY A;  2CE4 A;  3HKC B;  2N74 A;  3BRC A;  3OT7 A;  4WFG A;  3DSQ A;  4OX9 B;  4DXW A;  1Q5O A;  3W7S A;  1AP6 A;  5KHK A;  3M7M X;  1QQC A;  3ZIA G;  1JFF B;  1LR1 A;  1ORQ C;  2X6A A;  1Q6U A;  3W7T A;  1S77 D;  1EM1 A;  2LJ2 A;  3CC2 V;  2Q0O C;  4FFB A;  2VQF B;  4DYL A;  1G8M A;  2GUZ B;  1Y74 B;  5KUK A;  1MSW D;  3K58 A;  2OCC B;  5EYP B;  3K9S A;  2ZDI C;  3QTC A;  3BCC H;  3BFR A;  3STZ C;  3JD1 A;  4UVC A;  1K7D A;  4UUJ C;  2LW1 A;  1FAF A;  3AK3 A;  2FL4 A;  3CRM A;  3F5T A;  5LGT A;  2UUC B;  2ZE7 A;  3K59 A;  1JPX A;  4PA7 A;  2ZIM A;  2ZXW B;  1N34 B;  2UUA O;  1K9M W;  3JAR A;  5B5E Z;  4DK0 A;  3ZRV A;  3ZED A;  4GT1 A;  2ZDI A;  3GB7 C;  3HKE A;  2Y48 A;  3ZHV A;  4DV0 O;  3DTU B;  3TXQ A;  1YIJ V;  4KHP B;  1GMG A;  3LSS A;  3UM7 A;  3QG5 A;  2QEX V;  3WG7 C;  5BZB A;  1H8H G;  2RQ6 A;  2JEU A;  3TXS A;  1SRY A;  1DTO A;  4LNU A;  4UB8 Z;  4R50 A;  1FXK C;  2AHY A;  3CRQ A;  3RYI A;  1BGY H;  2Q67 A;  4WBN B;  4JAV A;  4JZ2 A;  4MVU A;  4JI6 O;  4HNA A;  4X62 O;  3CEI A;  5IY5 B;  2Q73 A;  2HHH O;  2GV9 A;  4UV8 A;  1XQ8 A;  1O9G A;  3AG2 B;  3TGU H;  4I5S A;  2XND G;  1IDS A;  4FFK A;  4GX5 A;  5BMV A;  2P22 C;  1QLE C;  3ABU A;  1FXK A;  3WB2 A;  1B6Q A;  1PNM A;  5B1O A;  4F4L A;  2PZS A;  1R3J C;  1VQK V;  1GN3 A;  3HB3 B;  4O4J A;  1J5E B;  2F4V O;  2ARH A;  1Y6X A;  4WFE A;  3MAQ A;  4QGP A;  3UT5 B;  3OUF A;  1VQ4 V;  1YCI A;  3RW0 A;  4GUN A;  2Q5Z A;  3AG1 C;  2ATK C;  1K5S A;  2ZT9 B;  1YVW A;  1BHA A;  4O2B A;  3FKS G;  4WF9 V;  2WLM A;  1JJO A;  4BWA A;  3VQW A;  3H9V A;  3K03 A;  1H2G A;  4XDK A;  5E1A C;  2OCH A;  4F6E A;  4LR3 A;  4JI5 B;  1Q81 W;  5EC1 C;  4BIZ A;  4DV6 O;  1QLN A;  3ABK C;  3E22 B;  4B3R B;  4DRX A;  4W4L A;  4GKJ B;  4KUM A;  4YJ3 A;  2FTK A;  1T5E A;  1I94 B;  3W7X A;  1D5N A;  4X64 O;  4B08 A;  1N36 B;  1B04 A;  1OCO B;  1SA0 A;  2QTS A;  1XNQ B;  3VBB A;  1JA8 A;  4ZHQ A;  2ZE5 A;  4UV9 A;  1DGS A;  5H6R A;  3X2Q C;  1VIB A;  4ZI7 B;  2QM7 A;  5KHH A;  2L35 A;  4PDL A;  1MZF A;  4YXW G;  4JYA B;  2HG5 C;  4NYK A;  2YIA A;  1BHB A;  4JF3 A;  1YJW V;  3FFQ A;  5HFL A;  4Z1V A;  3L72 H;  1EN4 A;  3RYC B;  3JAK B;  4B3T O;  4R8C A;  1GN6 A;  4MVS A;  2FB5 A;  1LUV A;  3DC6 A;  2PYJ A;  2HEP A;  2ZM6 O;  5LP6 C;  2WPD G;  1WJZ A;  2V1D A;  4WFA V;  3A0B Z;  1HDJ A;  4E2L A;  1NTZ H;  2JDI G;  2PF4 E;  4J11 A;  4B3S B;  2LP7 A;  2PUS A;  5EBM C;  5GW7 A;  4CH6 A;  1IXM A;  2UXB B;  4FLT A;  4QE7 A;  1SC5 B;  2WLN A;  1W0K G;  4DUY O;  2WSS G;  4C7U A;  4F6R B;  2Q7G A;  2A3Q A;  1VQ9 V;  1FKA O;  2OYQ A;  4KL1 A;  4DO2 A;  5GON A;  4MW3 A;  5FL7 G;  3HKB B;  4B7K A;  4JI7 O;  4GX1 A;  2LGW A;  5LA6 B;  4EKW A;  2YC0 A;  5LMN O;  3WB1 A;  1ZL8 A;  1R3I C;  3QNE A;  1AB3 A;  5LBQ A;  1OJH A;  4PA6 A;  4UCT A;  1NR1 A;  5L3E A;  1AI4 A;  5J9P C;  3WB0 A;  2IJI A;  5DM6 V;  2UUB O;  2RCV A;  3KZI Z;  4JYB A;  2EIM C;  4TV8 A;  1VQ5 V;  4AIL C;  2RJZ A;  2DQ3 A;  1HNW B;  1SQP H;  1YF2 A;  4GLX A;  1IBK B;  3SPJ A;  4DV4 B;  4LFC B;  2M7W A;  4TV9 A;  4EEQ A;  3RT3 C;  3TJT A;  4LF9 O;  1J95 A;  2F93 B;  1HNX O;  2B1G A;  5LHI A;  2CH7 B;  5KHJ A;  3B8M A;  1Y4M A;  3L9D A;  4PDM A;  2W6I G;  1PP9 H;  4JAA A;  4CH3 A;  4AQY B;  3AG3 C;  4CC6 A;  2G38 A;  2WLI A;  4JV5 B;  1IZ3 A;  4CZZ A;  5CA1 B;  1TGO A;  1AI6 A;  3CHX A;  3LNM B;  1XEQ A;  3UO3 A;  4FM0 A;  1BQ0 A;  1SF9 A;  1ENV A;  4D7S A;  2AGA A;  3EHB B;  4IYI A;  3P3P A;  2Q4P A;  2ZR2 A;  4DK1 A;  1GN2 A;  2ZD9 A;  1JR9 A;  3RYI B;  1XDC A;  3CRR A;  3N27 A;  1FPO A;  5FPR A;  5CBH A;  2E74 B;  5KAF Z;  4FJC C;  1MSD A;  2JJ1 G;  2YEV B;  2F43 G;  1QCE A;  1WP8 A;  4LH6 A;  1RSO A;  1S5L Z;  5B66 Z;  3FYI B;  1M93 A;  1Y67 A;  4DUZ B;  1K73 W;  3JAW A;  1XNR B;  3F7V C;  1FXK B;  4RUE A;  3JSL A;  1Q7Y W;  5H6Q A;  2D2C B;  1MA1 A;  3K5L A;  4JZG A;  2AHZ A;  4OGQ B;  4NXN B;  5ITZ A;  1MAB G;  2LW7 A;  5JCO C;  2P4K A;  1PL0 A;  4X65 B;  1YDX A;  2GTA A;  2DYS C;  3UCS C;  2JGD B;  4I55 B;  3C90 A;  5BR8 O;  3ZHQ A;  2P06 A;  1W0J G;  4DR5 O;  2BSK A;  2WLJ A;  4TQD A;  3N2K A;  4X1Y B;  4N21 A;  4AI8 A;  4FM2 A;  1N4C A;  3I55 V;  1M1K W;  3CRA A;  1IBM B;  4X66 O;  1K4C C;  5JCO A;  2DWD C;  4DV7 O;  4DRX B;  5B1N A;  1XUQ A;  3NR7 A;  5JJN B;  1GM9 A;  1THZ A;  4GX0 A;  1VQO V;  4FLV A;  1XI1 A;  3G80 A;  3D36 C;  1SA0 B;  4NTW A;  5IYB O;  1KD1 W;  1QNM A;  4X8A A;  1V9P A;  2Y0I A;  5KHI A;  4YHH B;  1S5J A;  3FX7 A;  1BZK A;  3CB2 A;  3TK1 A;  5KAI Z;  1IVS A;  5A2Q N;  3ZMZ A;  3ZRW A;  3SR2 C;  3BVO A;  3JCZ A;  3M99 B;  2ZCE A;  1YJN V;  4X20 B;  5J2U A;  4HAM A;  2AZ0 A;  3R65 A;  1NH2 B;  1NR7 A;  3I56 V;  3QO5 A;  4JI8 O;  3OTO B;  3K0G A;  1AJQ A;  2VRZ A;  3G6B A;  2R9A A;  2VS0 A;  2Q7H A;  1N32 B;  1G4Y B;  4P30 A;  4QPJ A;  5IJ0 A;  3JAL A;  4X88 A;  3CC7 V;  3X2Q B;  2GHY A;  2VQE O;  1AI7 A;  2IBZ H;  1L0L H;  2EJR A;  1G6U A;  1GTO A;  5CB4 B;  1FJG B;  4I7Z B;  2XAS A;  3ZBH A;  5L3G A;  4IHJ A;  2R9I A;  3O9O A;  2JEX A;  1Q82 W;  5FPO A;  1OCC C;  4TT3 G;  2IJK A;  4LF6 O;  1NVP B;  4DR6 O;  1VP7 A;  2BOB C;  1Q86 W;  4ZOL B;  1QU7 A;  4YIP A;  5JVD B;  3OGI B;  5LGN A;  5KLV H;  2Y0P A;  4DR1 O;  3JYC A;  1NKD A;  5GON B;  4NR1 A;  5IYZ A;  1N0N A;  3JD3 A;  1Q3E A;  4BIO A;  5LOV A;  2Q6A A;  3G6E V;  1SKV A;  2UUC O;  3QO8 A;  2NNU A;  1MZE A;  3DC5 A;  1PV0 A;  2F23 A;  3T4Z A;  1F4N A;  5IWA O;  1Y76 A;  1X4T A;  3P30 A;  4B3M B;  2QKS A;  3CP1 A;  2YIB D;  3VQV A;  1OHH G;  3ASN B;  2QDO A;  2YIC A;  3GWK C;  2Y69 C;  3IJ4 A;  1YIT V;  2DYR C;  4MVO A;  4PDR A;  4LCU C;  2QM4 A;  4O4I B;  4L87 A;  3ZHS A;  1YJ9 V;  2QWN B;  1VQM V;  1HWY A;  2JGU A;  3OEE G;  3THO A;  1AI5 A;  4JI3 O;  2EIL C;  2QSA A;  4PA4 A;  2KSD A;  5B1A B;  4GX2 A;  5BY1 A;  1RPR A;  3H1H H;  4DR7 B;  1EZV H;  2AW9 A;  4I4T B;  3EVK A;  3CXH F;  2IU0 A;  5C8Y A;  2PI4 A;  2JRI A;  1FFX A;  5CA3 A;  2ITD C;  2WLL A;  1I7F A;  4LP8 A;  4MS2 A;  5B1B C;  5KX5 A;  2YSU B;  1H2S B;  2EIN C;  1GH6 A;  2IW5 A;  3KG2 A;  1DLB A;  1WPX A;  3HR0 A;  2PGG A;  5K1X A;  4IL6 Z;  3T1H O;  1XIL A;  1HR0 B;  2WA4 A;  4LF4 O;  1RSO B;  1VQP V;  2UU9 B;  1VMG A;  2DOS A;  3ZN0 A;  4PI2 A;  3SPI A;  4I0X B;  5BXZ A;  1VQL V;  3CD6 V;  4K0K O;  4JI5 O;  2F1M A;  1Y66 A;  4O4L B;  4LFA O;  4B3R O;  1XMO O;  1BS3 A;  3OW2 U;  1R6N A;  4BR6 A;  4BIU A;  2R70 A;  4YY3 B;  2CGO A;  1A32 A;  3DXR B;  5ITZ B;  3FB6 C;  3LDC A;  1K5Q A;  3ZRX A;  4FLW A;  5FNV A;  3FD9 A;  2UXC B;  3FAV A;  2A79 B;  4X1I B;  1Z5V A;  3MHH C;  4YJ2 A;  3BEH A;  3LNN A;  4LFB B;  4TUY A;  1WN7 A;  1TAE A;  3L70 H;  1F4M A;  2QJ1 A;  1IBL B;  4MTX A;  2EIJ C;  3K08 A;  3HKD A;  1QVG U;  1SES A;  5C93 A;  4G28 B;  3H1K H;  2IM9 A;  4IGG A;  4FMT A;  3CCR V;  5LYJ B;  1URF A;  1M57 C;  3P32 A;  4Q6G A;  1K8A W;  4HBN A;  1B3Q A;  2EIK C;  4HYO A;  2NR5 A;  5KMG A;  1CXZ B;  3BAB A;  1VQ6 V;  4JI4 B;  3ABL B;  5LMU B;  3ZRW B;  2EJ7 A;  3T2M A;  4J42 A;  3ZRS A;  3ZMV A;  5J2U B;  3G4S V;  2JS5 A;  3GVM A;  4K35 A;  1LUW A;  3RYH A;  2RNB A;  2XAF A;  1WAZ A;  2ZQM A;  4PV1 B;  2GSM B;  3SJB C;  2DJV A;  1SS3 A;  1K3E A;  1NS1 A;  3STL C;  2HP8 A;  3RBZ A;  1B06 A;  1NTK H;  5EZY B;  2CK3 G;  4NVP A;  1OCR B;  3N2G A;  4DV2 O;  3S3X A;  4OXS A;  1SQB H;  4HZ3 A;  4PEL A;  1VQ7 V;  1L8D A;  3O65 A;  2ZIO A;  2ODM A;  2XOK G;  2ADQ B;  3SYP A;  4O4H A;  2X6B A;  3S3W A;  1GK9 A;  3W7W A;  2ZE6 A;  2JVD A;  1FXV A;  2JK5 C;  1S5H C;  3BY6 A;  4E4E A;  3OD4 A;  1JVM A;  2E3C A;  3B8N A;  1HNZ O;  2B5U A;  2UUA B;  2P5O A;  2DN9 A;  2CAZ C;  4DV0 B;  3OFN G;  3W7U A;  4FLU A;  4I9Q A;  1MG1 A;  4GKK B;  4NTY A;  1R1B A;  5D5P A;  4JPR A;  4UCR A;  1PNL A;  1XBL A;  2XTA A;  3RVY A;  4AQY O;  2RN9 A;  4UVB A;  2P90 A;  1PPJ H;  5JQG A;  4JI6 B;  3E89 A;  2N05 A;  4JTA B;  2P6J A;  4X62 B;  1WA8 A;  4FLY A;  4WCE V;  2HHH B;  3SDL A;  1OCZ B;  1ARO P;  3ASO C;  3T1C A;  1L1F A;  1VF6 C;  5DN6 G;  2JJ2 G;  2KG7 B;  2A7W A;  3CCU V;  3VQX A;  5LP6 A;  1YEW A;  2CDY A;  4CS4 A;  3K04 A;  3IC7 A;  5B3S B;  4JI0 O;  1EN6 A;  2OTL V;  2FYU H;  2F4V B;  2B1I A;  5H2F Z;  3CMA V;  2YDE A;  1ZAU A;  3F5W C;  3L71 H;  1F23 A;  4DV1 O;  2UXX A;  2GDS A;  2MK3 A;  4A5U B;  1FFX B;  2IH3 C;  3AK1 A;  4QIW F;  2WLL B;  4RWU A;  1SET A;  2EZO A;  1K92 A;  1SQV H;  5LHG A;  4MT8 A;  2M6Y A;  4FFB B;  1I0H A;  3AG4 B;  3H01 A;  2YUA A;  3E86 A;  4DV6 B;  3OMI B;  3Q4H A;  1XMQ O;  1M56 C;  3RN4 A;  1P7G A;  5LXT A;  4JGS A;  1R6K A;  3JAS A;  4JAS A;  5EBW C;  5TIS Z;  3RYF A;  4DV3 O;  3RGB A;  4X9Q A;  3K9A A;  3CE2 A;  3K3W A;  4CS2 A;  2F95 B;  3CME V;  3AEI A;  4FLX A;  1AJN A;  1S76 D;  1V54 C;  4NXM O;  3D3I A;  4JI2 O;  2BTQ A;  4WFB V;  3ZMS A;  1YSC A;  3JAR B;  4MTO A;  5DEC A;  3JAT A;  1Q6H A;  3H1L H;  3HKE B;  1PD3 A;  1UFI A;  5FNV B;  3UQ8 A;  4LWS A;  3B77 A;  4Q20 A;  4U3J A;  3K0D A;  2QKC A;  4H44 B;  3E2E A;  3QO7 A;  3FAV B;  4B3T B;  4WFF A;  4YJ2 B;  3D8C A;  1OV9 A;  5J2T A;  2HVK C;  2JS3 A;  2W0F C;  3CWB H;  4LNU B;  1AVM A;  2FKX A;  2E5L O;  1YTF D;  5KUM A;  1NT2 B;  1M4U A;  2HLD G;  1K33 A;  3ETE A;  4HNA B;  1KQS U;  2OCC C;  1ZTE A;  4W4K A;  2XHB A;  1LNQ A;  3ZHT A;  2Y4T A;  4JYC A;  3LUT B;  4GZR B;  1N32 O;  3WG7 B;  1YXB A;  1TVK A;  3APO A;  5BMV B;  4RQF A;  2GUZ A;  3K79 A;  4DUY B;  5KMG B;  1E1Q G;  2ZXW C;  3R66 A;  2UXD O;  2ZR3 A;  3C3S A;  2WLK A;  4O4J B;  5EYP A;  1YI2 V;  3SYQ A;  3UO2 A;  4JI7 B;  3FB8 C;  4XBF A;  3RYH B;  1V55 C;  5LMN B;  4I50 A;  1QLE B;  1QR8 A;  4OPH A;  5GTH Z;  3CCS V;  1G1X B;  4O2B B;  3ABM C;  2VWJ A;  4MSW C;  4PHZ A;  4ZKI A;  1GM7 A;  2XAG A;  3PN1 A;  1DF4 A;  1KKC A;  1SZX A;  1IX9 A;  4R7C A;  1FS0 G;  3N2G B;  2H8P C;  5IY5 C;  2UUB B;  4DR3 O;  1PKX A;  3MDS A;  1N33 O;  3ETG A;  3SPG A;  2Z5U A;  3K06 A;  2FML A;  3AG2 C;  4YJ3 B;  1KP2 A;  3AG1 B;  5CBG A;  2L6L A;  4P9P A;  4DV5 O;  3P3N A;  1Z2G A;  2QWQ B;  4LF9 B;  4J9Z B;  4WBN A;  1SZT A;  4ZHQ B;  1HNX B;  3RFR A;  4X1K A;  2QWR B;  1HW7 A;  3ABK B;  3E8H A;  4CC5 A;  2HFE C;  1N8R W;  4DW1 A;  1EBO A;  4UCU A;  4DR2 O;  1NZ6 A;  2ZNI A;  1R6T A;  4MTF A;  4J80 A;  3D36 A;  2BOC C;  4LF8 O;  4FVM A;  1BT8 A;  1WB7 A;  2YIB A;  3K5N A;  3CXC U;  1DF5 A;  5JJE B;  4YIO A;  1FYJ A;  2Q69 A;  5JQG B;  4DR4 O;  4JI1 O;  1AP5 A;  2QA4 V;  1FFT B;  3C3T A;  3UT5 A;  1IXB A;  4OX9 O;  5LHH A;  3OTF A;  1R3K C;  5IYC O;  4IIJ A;  1SQF A;  4PA9 A;  3ZHU A;  2ZKO A;  3RVZ A;  2HVJ C;  1U96 A;  3OMA B;  2QKA A;  1OCO C;  3ZJZ A;  2QR4 A;  2IU3 A;  2PYL A;  4ASU G;  2VQF O;  5LP6 B;  2Q7E A;  4CH4 A;  1Q43 A;  1VF7 A;  2DMX A;  5EBL C;  1VQN V;  3JD0 A;  4ICG A;  1IUR A;  4O2A A;  1WPB A;  2OT5 A;  1M90 W;  5LGU A;  1VF5 B;  2V7Q G;  5KHG A;  1SQX H;  4FIP C;  4FK5 C;  4UFZ A;  1ZL8 B;  4PA3 A;  5BR8 B;  1KEC A;  5EIB C;  3CCM V;  1YZB A;  1SER A;  4DR5 B;  3OR7 C;  4ZI7 A;  2EX3 A;  1UPG A;  1N34 O;  3T1Y B;  1H2M A;  1KU9 A;  1NTM H;  2QWO B;  1P4R A;  5A9G A;  4H13 B;  2ITC C;  1BMF G;  4X66 B;  3Q4H B;  1KUQ A;  1QHT A;  4DV7 B;  4KHP O;  2RMK B;  2XUM A;  2O57 A;  4TV8 B;  3I5D A;  2MW2 B;  3OGC C;  3JAK A;  2Z0A A;  4PJ0 Z;  3E83 A;  4TV9 B;  3UKM A;  1NU1 H;  3CYO A;  1IBL O;  1KB9 F;  1GM8 A;  4FZ1 A;  3BHP A;  2YI8 A;  4XDL A;  4KXR A;  2BTQ B;  1H2N A;  2Q9L A;  2EIM B;  3CJH A;  1P49 A;  1TA8 A;  4H0L B;  4UXN A;  4U3J B;  3K5O A;  2WLI B;  4KFM A;  1S72 V;  4LF5 B;  3OEH G;  3G71 V;  4JI8 B;  5IJ9 A;  4F6R A;  2HR3 A;  5J2T B;  4LF7 B;  1NQT A;  1J5E O;  1UJW B;  2XAQ A;  3HKB A;  1R3L C;  4QPK A;  1EN5 A;  3AG3 B;  5LA6 A;  3TCU A;  3CX5 F;  1F7Y A;  1E1R G;  4ZIB A;  3JAW B;  1TVK B;  5LL6 Y;  2LFR A;  4LF6 B;  4DR6 B;  2XAJ A;  2NLJ C;  3H1I H;  1PNK A;  2XT9 A;  3CCE V;  3E8G A;  2OTJ V;  3LSQ A;  4QE9 A;  5EIB D;  3A8T A;  4MW8 A;  3F7Y C;  4LBE C;  4DR1 B;  1TUB A;  4GKJ O;  3U11 A;  4G2K A;  1I94 O;  3A0R A;  3EFF K;  2X0L A;  3ZMU A;  2ADP A;  4U7N A;  2YXY A;  1N36 O;  2WA3 A;  4J7Z A;  1XNQ O;  4I50 B;  5H5N A;  2CH7 A;  2P7T C;  3SPH A;  4IT5 A;  3SGI A;  2BSK B;  3E8B A;  3BA9 A;  3N2K B;  3MD0 A;  2PY5 A;  1COW G;  5IWA B;  3OE7 G;  4JYA O;  1BSM A;  1AR5 A;  1W59 A;  4K8X A;  2EBO A;  4J7K A;  4FPP A;  5CA1 A;  3ABT A;  2BCC H;  3DGE A;  4AHC A;  1N0J A;  1V55 B;  3ML0 A;  5EC2 C;  2DYS B;  4RUF A;  1PL4 A;  4GKK O;  2LFS A;  3LDD A;  2CTR A;  2CUG A;  3ABM B;  5L3C A;  1WNS A;  3IC9 A;  4ABM A;  3B09 A;  2Z3Y A;  3CPW U;  5CA0 A;  2BTO A;  2QTO A;  4X1K B;  4K8Z A;  4UVA A;  2YEV A;  4JI3 B;  2QGN A;  2E76 B;  2IH1 C;  4WFH A;  4B3S O;  2UXB O;  3KKY A;  4J7J A;  2CTQ A;  1WB8 A;  2W0X A;  1ZSP A;  2DE0 X;  2CTP A;  2AZ2 A;  4NB5 A;  3ZMT A;  1GN4 A;  4D7T A;  4U7O A;  3ICX A;  3JAL B;  5IJ0 B;  3OR6 C;  2PI5 A;  1EFR G;  3A2F A;  5EK0 A;  3B40 A;  3T1H B;  3BA8 A;  2P4V A;  3K5M A;  4IHJ B;  2JGD A;  4I55 A;  4IIJ B;  3SYA A;  4LF4 B;  2ZNJ A;  1D2D A;  3A0H Z;  2KB1 A;  4X1Y A;  4EFB A;  1ZUQ A;  1GO3 F;  3ZN1 A;  1OZ0 A;  4K0K B;  3VQY A;  3JAM N;  1JX9 A;  4TQF A;  2R72 A;  2BE3 A;  3LDE A;  4LFA B;  1CP9 A;  1XMO B;  1R73 A;  5CMU A;  2B9Z A;  4O2A B;  1Q6I A;  3U10 A;  4NTX A;  1HNW O;  3ZCC A;  4LC1 A;  2F66 C;  5IYZ B;  1IBK O;  4DV4 O;  1AIL A;  4LFC O;  4UB6 Z;  1OCC B;  5HFM A;  5IE9 A;  1I08 A;  1L0N H;  1QR9 A;  4FLZ A;  1MNG A;  5LOV B;  4TSF G;  2AXT Z;  3NXS A;  4L8J A;  1XHZ A;  1BE3 H;  1Y76 B;  4X20 A;  4JV5 O;  1S3J A;  2X6C A;  2PTM A;  2YXH A;  3KCY A;  2DQ0 A;  4MVM A;  4H37 A;  3ZX6 A;  1QBZ A;  4J41 A;  1VEW A;  3SJQ C;  1DK1 A;  4J9Y B;  3RWR D;  4U3F H;  5CB4 A;  1P7B A;  2K9P A;  3D3Q A;  1K34 A;  3BPZ A;  3SJC C;  3CJH B;  2A0L A;  4EB6 A;  5GTI Z;  3JCU Z;  4DUZ O;  2Y69 B;  4LH7 A;  1TUE B;  1XNR O;  1VF6 A;  1RM1 C;  2DYR B;  2ILM A;  5KA5 A;  1F51 A;  4IYH A;  2UXN A;  4ZOL A;  5IJ9 B;  1MMM A;  5C8Y B;  5JVD A;  4PD4 F;  1US6 A;  1WP7 A;  5D5Q A;  4QJF B;  4BW9 A;  2EIL B;  3AK2 A;  4NXN O;  5KX5 B;  2OIE A;  3SPC A;  3T4D A;  3BAA A;  5L3D A;  4JYY A;  2R9R B;  4DV2 B;  4X65 O;  4FZ0 A;  3ASN C;  4RO2 A;  5JH7 A;  3L75 H;  1JOY A;  2ZIN A;  3SJA C;  3WU2 Z;  3HPL C;  1I5X A;  1NH2 D;  2WAM A;  4X64 B;  1FXH A;  1BL8 A;  3WFV A;  3FB5 C;  3M8A A;  1GAX A;  5B1B B;  2QM8 A;  2LQT A;  1IBM O;  2EIN B;  1AJP A;  2XAH A;  1PM9 A;  5B1A C;  3CSX A;  1TUB B;  1HNZ B;  3SYC A;  4UCO A;  1XL6 A;  3IGA C;  1CEZ A;  1YHQ V;  2YXL A;  4O4I A;  4G27 B;  3CCJ V;  2QWP B;  4YHH O;  4PDV A;  3VOU A;  4TUY B;  2ZM6 B;  1NVP D;  1QVF U;  2N04 A;  1M5I A;  2DW4 A;  4GCZ A;  1AR4 A;  3GWO A;  3HKD B;  2ZE8 A;  4CH5 A;  3HKC A;  4I4T A;  3OTO O;  2A9H A;  3FYE B;  1NI8 A;  1JFF A;  1D5A A;  1Z5W A;  1M9N A;  2HKO A;  1K97 A;  2KQX A;  3IFX A;  5CA0 B;  2WWW A;  1Y74 A;  2QE7 G;  4JAU A;  2EIJ B;  1FJG O;  3JD2 A;  1MOF A;  4JI0 B;  2YI9 A;  4BW5 A;  1XL4 A;  1CPY A;  3E35 A;  3OUS A;  3ZHR A;  2D3O W;  2W6J G;  1RP3 B;  1M57 B;  1JJ2 U;  1FD9 A;  4DV1 B;  4I0X A;  3PJS K; 
#chains in the Genus database with same CATH homology
 2RN9 A;  2LQT A;  2HP8 A;  1U96 A;  2LGQ A;  2RNB A;  1HP8 A;  1Z2G A;  1U97 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...