2RN9A

Solution structure of human apocox17
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
b'GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rn9A00
2LQTA 2RN9A 1U96A 1Z2GA 1U97A 2RNBA 2HP8A 1HP8A 2LGQA
chains in the Genus database with same CATH superfamily
1FXKA 3OFNG 3CCSV 4LP8A 3L74H 3UO2A 4F4LA 3NR7A 3DGEA 2XAGA 4YJ3B 2XAQA 2LGQA 4IYIA 4LF4O 2QE7G 2EINC 4GKKB 4LF8O 1FXHA 4A5UB 3C3TA 4X8AA 1Y74B 4UCRA 3B2EE 2ITCC 2E74B 2DW4A 4MW3A 3K58A 5LMNO 1ZUQA 3ETDA 4HBNA 3F5WC 1SZTA 4AILC 1H8EG 3B09A 2DN9A 3SYOA 3STLC 1HR0B 1MA1A 2CK3G 4JYYA 4LFAO 2JRIA 4EB6B 3FB8C 3ZRWB 1FJGO 1EN4A 1JVMA 1XNQO 5L3CA 4FLVA 1S77D 1N4CA 1AROP 2PZSA 2G38A 3SPGA 2JS5A 3FFQA 4XDLA 5H2FZ 5EK0A 1M57B 4D6TH 1ZX3A 1I7FA 2GUZB 2GSMB 5B1BB 1SQFA 3DXRB 1XI1A 3U11A 1S76D 4XDJA 3CXHF 3OAAG 2EJ7A 5CBFA 5JJEB 1NR1A 4DV6O 1X59A 4F6EA 2DWDC 4JAVA 3HKCA 3SPJA 5BR8O 1ZWIC 1JPXA 3DC6A 4I5SA 1PL4A 2DMXA 2YXYA 1OHHG 3OW2U 4YJ2A 4DR6B 1NVPB 1FS0G 2UXCO 3ASNB 4IGGA 5KAIZ 2WWWA 3FYEB 2QWQB 5EBMC 5JCOA 2ZXWC 4DR2O 1D5NA 3CB2A 1JMKC 1JQ0A 3RW0A 4UUJC 1H2MA 3D36A 4Q6GA 2UUCB 1KECA 4UV8A 1V9PA 5LOVB 1KC8W 3SJQC 3CRAA 3ABMB 3G6BA 3K06A 1N0JA 2QM4A 1KU9A 3QG5A 4DV2B 4LFCB 2QKSA 1FFXB 3N2KB 3ETEA 2EX3A 1JFFB 2D2CB 5KA6A 1BHAA 1M9NA 2P5OA 1URFA 4FFBA 3O65A 4NB5A 4BIOA 4JI7B 2LGWA 3NXSA 4H33A 4WFGA 1FXKB 1YZBA 2XTAA 2UXBO 2YIBD 2DYSC 4MT8A 1SS3A 5LYJA 4LR3A 2PYJA 1YEWA 4JI3B 4GKJB 5KA5A 2YS8A 4JF3A 1QVFU 2P7TC 3H01A 2AHYA 3VQWA 5IWAB 4FLZA 4LF6O 2WA4A 3OGCC 1BHBA 2H94A 2R9AA 2YC0A 5IYCO 2OT5A 1AP5A 3ZRVA 3CCVV 3J80N 1OCRB 2Q73A 1SZXA 2XAFA 3RN4A 3K5MA 1V54B 3LDDA 2UXDO 5IYZA 5LGTA 3OMAB 2VWJA 5LL6Y 4QPKA 1L1FA 3CMEV 1VF6C 4YIPA 1IBLO 5C8YA 3K5NA 5EIBD 1WPBA 4FFKA 1GM9A 1W0JG 2UXNA 5L3GA 5B3SC 2Q69A 4P9PA 2YEVA 4DV4B 4TUYA 1PNLA 4O4JA 3G80A 3H1IH 3A0HZ 2Z5UA 1YIJV 2ZQMA 4LF7B 3HKCB 2EIMB 2P67A 1FYJA 4BR6A 2WLMA 4WBNA 2QEXV 4YJ2B 3ETQA 3L9DA 1I08A 1Y66A 1JJOA 2RCVA 2BTOA 2X6BA 1PPJH 2CTWA 3H1HH 3ZMVA 1Q90D 1RM1B 3ABLC 3CC2V 2W6IG 2A3QA 3IFXA 5GW7A 1Z5VA 3O9OA 2RMKB 2A7WA 5DECA 1RPRA 4X1IA 2CTQA 4H13B 4B3TB 3CCRV 5FLXN 1G8MA 4D7SA 1O9GA 2OTLV 3ZHRA 5J2UA 3JALA 1XBLA 2F43G 3FB7C 4NR1A 3AK3A 1EBOA 2HJDA 1PM9A 3HKEA 1XHZA 1YI2V 2Q5ZA 4FFBB 4H0LB 3HR0A 2Y48A 4YY3B 3EXAA 4R6ZA 2LO1A 2V1DA 3X2QB 5IE9A 2ZINA 4DR5O 2V7QG 1M4UA 4W4KA 5LYJB 2JGDA 2KG7A 1VQOV 4X64O 1NZ6A 1W2BU 4FZ1A 5KHKA 3CXCU 4DW1A 1Q82W 3TETA 1HW7A 2IJIA 5JQGA 4H37A 3CCLV 4LFBO 1Q6HA 1IBMB 2OTJV 1VQKV 2E5LB 3KZIZ 2OYQA 2F95B 4DUZO 2RDCA 5LXTA 3E8BA 1HNXO 2VQFB 4FM1A 2CDYA 3E8GA 2P6JA 5H6QA 5IYZB 1L0LH 4BWAA 3SYCA 3AG4B 3ZS8C 2VQEO 4JGSA 1BE3H 2QA4V 5BMVA 5J9PC 3BABA 3E35A 2HVJC 3T1HB 4WFBV 4LCUC 4PA6A 2ZE8A 1S5HC 5C8YB 4QE9A 4OPHA 1KYOF 1N36B 1KKDA 3E22A 1DGSA 1XILA 5CN0A 2QKCA 1E79G 5IYBO 2GTSA 4JZ2A 2FL4A 3GWKC 1PNMA 2YEVB 4TUYB 4WFAV 4O4JB 1CP9A 1XNRO 3U0ZA 2BCCH 4X65B 4AI8A 2JDIG 3ZN0A 4DXWA 3ASNC 4JASA 2ZDIC 3LSUA 4WBNB 4K3AA 1K4CC 3ABMC 3LNNA 3SPHA 1VF6A 4B3MB 1PNKA 2X7RB 3IAYA 2X0LA 3CWBH 5CA0A 4X1IB 1PL0A 5IY5B 4U3FH 4K0KO 3GVMA 5LMUB 3W7SA 2CTRA 1K97A 1JX9A 5J2UB 3JALB 2B9ZA 1YDXA 2ITDC 3HPLC 1FXKC 5C93A 1QHTA 3BCCH 4I9QA 3HKEB 3BA8A 4O2BA 1WLEA 4O2AA 1FKAO 3UO3A 4KP4A 4ZIBA 4LWSA 4LF4B 4E2LA 4X62B 5LGNA 4GCZA 2JGDB 2KG7B 4LF8B 1SF9A 3JD1A 2BSKA 4KHPB 3SYQA 3QVNA 5JQGB 4FLXA 1JOYA 1VEWA 2PI5A 1S5LZ 5KX5A 2FYUH 5LMNB 1OCRC 2QM8A 1GM7A 2LFRA 3OT7A 2ZR2A 1K3EA 1IBKB 2CGNA 4NXMO 5LXTB 3E83A 3RGBA 2AZ2A 1AI4A 3H1LH 4I50A 1XNQB 3TXSA 3LDCA 1AI6A 2WLKA 2HHHO 3LSSA 4J7KA 3T2MA 5BMVB 1R6NA 5L3DA 4PDRA 1GMGA 2UUAO 3E22B 4O4HA 3IC9A 3UM7A 1Y6XA 2FMLA 1H2LA 1YJWV 2EIMC 3DC5A 2L6LA 1NJIW 4RUEA 1QR8A 2XNDG 4KL1A 2UXCB 4WFHA 1KKCA 1ZLZA 5JCOC 2JJ1G 3G4SV 1J95A 2YICA 4DR2B 1RM1C 3D36C 1SESA 4JI6O 4DK1A 2JS3A 4PA7A 5B66Z 1S72V 2Q7EA 4PV1B 4RO2A 3MHSC 3J7AU 3RVZA 4B3RO 2M7WA 2LW7A 1H38A 5CA0B 3OUFA 4NXNO 1HNWO 5IJ0A 1VARA 4PA4A 4FVMA 4FLWA 2CH7A 4AQYB 2JK5C 1QVGU 2OIEA 2UXBB 4JAUA 1IURA 2YIDA 1H2SB 4O2BB 2P4VA 3K0DA 3VOUA 4O2AB 4UFZA 3K57A 2ZDIA 4MS2A 1BT8A 1N32B 4LWSB 3MHHC 4EFEA 5DN6G 3WG7C 1RSOA 1GK9A 1VMGA 2A79B 2QWPB 2BSKB 3C90A 3Q4HA 3KCXA 2R72A 4LF6B 3K5LA 4XDKA 3ABLB 3WB1A 3P3PA 1NTZH 3SJAC 4MVSA 3F7YC 5KX5B 1P84F 3OEHG 3FX7A 3JCUZ 2UXDB 1MOFA 3AG4C 5HFLA 2C2AA 4CC5A 2AGAA 4I50B 4JV5O 4WCEV 4TT3G 1XEQA 1IBLB 5B1NA 2Q67A 1QNMA 4J7ZA 2A0LA 4O4HB 1J5EO 1R3KC 1OCCB 1WNSA 3THOA 3CD6V 1K34A 3H9VA 4CH6A 1MSDA 2M6YA 1NH2D 5KHGA 3E2EA 2YXHA 3P30A 3EVKA 5KAFZ 4DRXA 1K5QA 3L73H 4DO2A 4CH3A 2YI9A 2DYRC 1IZ3A 3CMAV 4ZKIA 3A0BZ 3ZHQA 3JD3A 3KCYA 2Q7HA 5JH7A 1AP6A 1NKDA 2R9IA 3ABKC 4MTXA 3ZRXA 3SPCA 2CAZC 5IY5C 3EHBB 1L8DA 2IJJA 2YI8A 4X89A 3CJHA 3UCSC 4EKWA 3E8FA 3A0RA 3RYFA 2CUGA 5HFMA 3JD0A 1BZKA 3KG2A 4MTFA 5IJ0B 2VS0A 4LH6A 5LHGA 3F5TA 5GTHZ 2CH7B 4HYOA 4D7TA 3OE7G 4JZGA 1VIBA 4B08A 3CSXA 2ZNIA 1Q6IA 4PELA 3LSQA 4R50A 1SQQH 4HAMA 3OM3B 3ZRSA 2ZIMA 1YTFB 2Q9LA 1GTOA 3SR2C 4DR5B 1B6QA 1ZL8A 3JD2A 4X66O 3OGIB 4B3SO 1RSOB 2ADPA 1ZSPA 3LUTB 3OMNB 4BW5A 4PI2A 3QF7A 1VQPV 2QWOB 3OR7C 4LFBB 2PF4E 3Q4HB 3ZCCA 4OX9O 3HKDA 1PV0A 3ZJZA 5JJNB 2ADQB 1XOUA 5EC1C 4DUZB 3LNMB 2EULA 4JI0O 1KMIZ 4MVZA 1PKXA 4LH7A 4F6RA 1SQPH 2F93B 3ZHVA 1SQVH 1XDCA 4LC1A 1OJHA 4N23A 4DV7O 4YIOA 4JI5O 4E4EA 2VQEB 1OV9A 3H1JH 4JI4O 1VQLV 2H3OA 2DOSA 4DUYO 3QO5A 4DV0O 1K33A 2KQXA 4UV9A 4J9YB 3D3IA 5TISZ 1R3JC 2QTOA 1HP8A 3WU2Z 2P4KA 5LHHA 1AR5A 1DF5A 1KP3A 3K04A 2EBOA 2N74A 4DR1O 5KUKA 4H44B 2B5UA 4DRXB 1OZ0A 3K9AA 3HB3B 3GWOA 3K0GA 1TUBA 3ASOB 2RQ6A 2K9PA 5LA6A 2P90A 5JH7B 3ZHSA 1Q43A 3SGIA 3VQXA 4DV3O 3G6EV 2UUBB 1SETA 2E76B 4YHHO 1U97A 4J10A 1JJ2U 4RWUA 4JI1B 3CJHB 2GBOA 1N34O 4NKGB 1YCIA 3RYFB 5FPOA 2Q0AA 5LHIA 1XQ8A 2F66C 3S3XA 1Y67A 3RYHA 3C3SA 4I4TA 1PP9H 2DQ0A 2JGUA 1HNZO 4ZOLA 3ETGA 4NTXA 4MVQA 2OCCC 1RPOA 4BIZA 4TV8A 1K8AW 5GONA 3W7UA 1GN6A 1KQSU 4R7CA 1P49A 1ZL8B 4FLYA 3ZBHA 3G67A 4GX1A 1LNQA 5KHJA 4FM0A 4AHCA 1VQ7V 4CS3A 2WLIA 1OCOB 4U3JA 3D3QA 2PGGA 2HP8A 3RVYA 1NVPD 1N33B 3HKDB 1DK1A 3N27A 3ABUA 1UJWB 4IIJA 4PHZA 2YSUB 3QNEA 3P32A 4NXMB 3E8HA 4F6RB 4PDLA 3JASA 1KBHA 3ZMZA 4DV1O 1UPGA 1K92A 2ZD9A 2OCHA 3M7MX 2UUAB 1F4NA 1OCCC 2YXLA 2F23A 2KKWA 2CE4A 3WG7B 3FB5C 1G6UA 2MW2B 3I56V 1DF4A 4DR6O 4KUMA 3JAWA 2K1EA 1R3LC 2FTKA 2IM9A 1BQ0A 1U96A 4IL6Z 2EILB 1SA0A 3DTUB 4QIWF 4MW8A 2UUCO 3BVOA 1MZEA 3BEHA 3RWRD 2Q0OC 1P4RA 1TUBB 4K8XA 4RAIA 4JI6B 4N21A 3W7TA 4UVCA 1ORQC 2H8PC 5LA6B 1VF5B 4DV2O 3B8MA 2E3CA 5JWPA 2Y0PA 4JI2B 3JSLA 2ATKC 4TQFA 3R66A 3STZC 1HNWB 3AK2A 1G4YB 2JEUA 2ZT9B 3JATA 1YSCA 4P30A 1SRYA 2HEPA 2ZR3A 1PD3A 3T4DA 4DK0A 1BSMA 4UVAA 3P3NA 4PJ0Z 5D5PA 3RYHB 3FAVA 4IT5A 1WPXA 4I4TB 2PYLA 1VQ6V 1XL4A 3VQYA 1Z2GA 1I5YA 4TWKA 4J42A 4ZOLB 4JI3O 5CBGA 4GKJO 2LJ2A 4BIUA 4TV8B 4PD4F 2WLHA 1S5JA 2P06A 5GONB 3CCUV 1W0KG 2CTPA 2DYRB 3OD4A 3TJTA 2BOCC 3WB0A 1IXBA 3SPIA 2X6AA 2QKAA 2WLIB 3B77A 3CS5A 4CH5A 3ABKB 3AG1B 4U3JB 4DR3B 1IDSA 3D8CA 1VQ8V 2KB1A 4I55A 4UXNA 3ZHTA 3BAAA 1DTOA 4IIJB 4MVRA 2WLLA 1S0VA 2N04A 1H8HG 1VQMV 4K8ZA 2JEXA 1VQNV 2CGOA 2IU3A 1W59A 3JSNA 4MTGA 3JASB 3CYOA 4JV5B 4HNAA 2Z3YA 4FLUA 3OUSA 1XMQO 4FIPC 1TUEB 1BMFG 3T1YO 2HJFC 4Z1VA 3A8TA 4UCOA 1J5EB 4CH4A 1M90W 2VWKA 1MNGA 2YDEA 2QTSA 1E1RG 1FD9A 1YITV 4QJFB 1Y4MA 2W6JG 4KXRA 3JAWB 5DM6V 5EYPA 2XUMA 4GZRB 1Q8IA 4R8CA 1OCZB 3ASOC 1SA0B 4JYBA 1K73W 1QU7A 4LFAB 4FM2A 1FJGB 1O9HA 2YIBA 4CBCA 4B3TO 1ZTEA 3WFVA 4JTCB 4XBFA 4CZZA 4MSWC 1AR4A 4GLXA 4X9QA 2Z0AA 4Q20A 1NU1H 1AI5A 4DV6B 2GTAA 1QQCA 4YY3O 3JATB 1I0HA 1AJQA 1NR7A 1MABG 2JIZG 2F4VO 2ZM6O 5BR8B 2Q6AA 2QSAA 5IJ9A 2EJRA 3FAVB 3B8NA 3B4SA 3ABTA 5H6RA 1G1XB 2MK3A 1H2GA 4ZI7A 1GO3F 3MD0A 1Q86W 1AJNA 5E79Z 4DV5O 4X66B 1D5AA 1OCOC 3K3WA 4B3SB 2V4DA 2LW1A 1WJZA 1GAXA 2E5LO 1WP7A 3CRRA 4WFEA 4UVBA 4OX9B 4TV9A 3I55V 2EIKB 4I55B 4WF9V 4ASUG 3L72H 4JI0B 1TVKA 4JI8O 1M1KW 1M5IA 2WLLB 1WP8A 3T1HO 1F7YA 2Q4PA 3N2GA 1NI8A 4JI5B 1N36O 3K08A 5BZBA 3SYAA 1SQBH 1Y76A 3FKSG 1JCHA 4FK5C 4J41A 3ZEDA 4JI4B 2YIAA 2OCCB 4HNAB 3CPWU 2N05A 4DUYB 3CE2A 3TCUA 1YJ9V 4UCSA 5JVDA 3RYIA 1M56C 4I0XA 3L71H 4LBEC 1QLEC 3OMIB 1VQ5V 1F23A 4JTDB 1B04A 1Q5OA 3W7WA 3LDEA 3QTCA 2EILC 3OR6C 2Q7GA 4JPRA 3K03A 1VF7A 5EYPB 1NTMH 3A2FA 4GUNA 4U7OA 2WA3A 1GN2A 4B3MO 2L35A 4CS4A 2LFSA 4DV3B 4CC6A 2NR5A 4HZ3A 1BGYH 1B3QA 1CXZB 1QR9A 4X20A 2AHZA 2XOKG 4J9ZB 1N34B 1SKVA 1XREA 2Y69C 1K7DA 1IVSA 2AW9A 3UT5A 2HFEC 2DWEC 1HNZB 3OTOO 1AJPA 2ETNA 5IJ9B 4X62O 1CEZA 4UCVA 2EZPA 1SQXH 4NTYA 3OEEG 3GB7C 4LNUA 2IU0A 4ZI7B 1IX9A 4GYCB 3QO7A 4G28B 1V55B 2AZ0A 4KHPO 4FPPA 5CMUA 4NTWA 1XMOO 1FXVA 4U7NA 3CEIA 1LR1A 3AG1C 3JYCA 5FPRA 2QDOA 4OXSA 4IHJA 4L8JA 4X1YA 1NBMG 3BY6A 1B06A 2RN9A 4QPJA 4TV9B 1IBKO 4NVPA 4ICGA 1I94O 5AG2A 2IJKA 3CRMA 4BW9A 4OGQB 4RUFA 5DEDA 1TVKB 1FFTB 1S3JA 2UU9O 2HVKC 4QGPA 2BE3A 4ABMA 3VBBA 3IJ4A 1R6TA 1AVMA 3SYPA 4DYLA 1RFYA 3F7VC 1L0NH 4DV1B 1AB3A 3N2GB 5LGUA 3CP1A 3ZX6A 3ML0A 1Y76B 2NNUA 1Q6UA 3E89A 2BOBC 4X64B 1AI7A 5L3EA 3AG7A 5JVDB 3SJCC 4IYHA 3RYIB 4DR7O 4I0XB 1FAFA 3S3WA 3UKMA 1US6A 3JAKA 1OCZC 5CB4A 3ZIAG 2W0XA 1THZA 1HNXB 3BFRA 2PY5A 4P2ZA 3L70H 2PUSA 5CA1A 3IGAC 5FNVA 2Y4UA 4UB6Z 2QJ1A 4I9WA 1CPYA 1N0NA 4X1KA 2WPDG 4LF9O 1GRJA 3M8AA 4ZHQA 2DE0X 4QE7A 4AQYO 2XASA 2XHBA 1HDJA 4X20B 1P7BA 4Z2WA 1XHXA 1Z5WA 4O4IA 1K4DC 3AG3C 4GT1A 1XNRB 1AILA 3UT5B 3CCEV 1N32O 4K35A 1GN4A 5FL7G 3RT3C 2QWRB 1TAEA 4MVUA 2ZE6A 1Q3EA 2XAJA 4LNUB 1YF2A 4LF5O 1H2NA 1BCCH 4JYAO 2D3OW 1RP3B 1XL6A 3APQA 3TXQA 3QO8A 3L75H 2IH3C 2ZE7A 3IC7A 4DR4O 4P9OA 2EIKC 5EBWC 5K1PA 4IHJB 1IXMA 4X1YB 2ODMA 4EEQA 4ZBMA 4WFFA 1T5EA 4FLTA 4K0KB 5LP6A 1KP2A 1ROPA 3AG2B 1QLNA 2UXXA 1NT2B 5B1AB 2OWOA 2GV9A 1EZJA 1KB9F 5KMGA 2O57A 3JAMN 3VQVA 4GKKO 3APOA 2LQTA 1XMQB 3SJBC 1EN5A 2DQ3A 2Y0IA 3K5OA 3T1YB 1WA8A 4GX5A 1SERA 1YXBA 3ZN1A 1Q7YW 2EIJB 3BPZA 3W7XA 2R70A 4PA3A 2B1IA 1A32A 2HLDG 1YTFD 4UCUA 1YHQV 3CCQV 5IDJA 2OIGA 3JAKB 3JARA 3RYCA 1HR0O 5CB4B 4J7JA 4J80A 2E75B 3K79A 2WSSG 4GX2A 3U10A 1R1BA 1NQTA 1X4TA 2ILMA 5CA1B 4BAYA 5FNVB 1MSWD 1JA8A 2HHHB 3HKBA 4X1KB 4B7EA 2R9RB 2FB5A 4O4LA 2WLJA 4ZHQB 2JVDA 4CS2A 5H5NA 4KFMA 5A9GA 3OTFA 2JJ2G 1M56B 1FPOA 3TK1A 1QLEB 3CC7V 4O4IB 3M99B 2F4VB 2ZM6B 4MTOA 3MDSA 3G71V 1DLBA 2GDSA 1F4MA 3K9SA 1V55C 3ZMUA 4L87A 2FKXA 2IBZH 5B1OA 1AR1B 4DV5B 3FYIB 3CCMV 1K5SA 4YXWG 5L3FA 4TSFG 4LFCO 2P22C 5EIBC 3RFRA 4B3RB 3WB2A 5EZYA 3KKYA 4NXNB 1YJNV 1N8RW 3AK1A 3T1CA 3EFFK 2HR3A 5L3BA 4JI7O 4JI8B 3UQ8A 5LP6B 1M57C 5B1BC 3CX5F 2Y69B 2KSDA 3PJSK 1ZAUA 1SQGA 5CA3A 5KMGB 4JYCA 2F1MA 4EFBA 2NN4A 3BRCA 4UCTA 2EINB 4J11A 1UFIA 1QCEA 5ITZA 4PA9A 1D2DA 5IWAO 1TA8A 1WA8B 2AXTZ 2IH1C 2ZCEA 3T4ZA 5A2QN 1F51A 2BTQA 3E86A 2B1GA 4UB8Z 3AEIA 4MVOA 1K9MW 1H2KA 3JARB 1R73A 3RYCB 1M93A 2Q8VA 1NS1A 3DSQA 4G27B 5KLVH 2Q68A 5J2TA 4G2KA 2UUBO 2ZNJA 3PN1A 5EBLC 2DJVA 4RQEA 3CRCA 4JI1O 3HKBB 4DV4O 1KD1W 4NYKA 1WB8A 1BQZA 4O4LB 1LUVA 1WAZA 1VQ9V 5D5QA 2W0FC 2XAHA 4LF7O 3CHXA 2RJZA 1TGOA 4JTAB 2QGNA 4FJCC 1BS3A 3OTOB 3ZMTA 1GM8A 1MZFA 4B7KA 5JJJB 2RNBA 2YUAA 4TQDA 4PI0A 2ZXWB 4FMTA 2Y4TA 2A06H 1XMOB 5KHIA 4QNHB 1N33O 1EN6A 2X6CA 1SC5B 1V54C 1EFRG 2WLNA 4TOIA 1I94B 5EZYB 3AG2C 1VQ4V 1LUWA 1I5XA 4OPAA 5B1AC 4DW0A 5GTIZ 2UU9B 4YJ3A 1NTKH 2NLJC 3AG3B 1NH2B 4MVMA 2DYSB 3RBZA 2ARHA 1XUQA 1GKFA 1COWG 3H1KH 3MAQA 1Y74A 5LBQA 3BHPA 1GH6A 2EIJC 5ITZB 3TGUH 4DR7B 1IBMO 2QM7A 3SDLA 1GN3A 1VP7A 5F2VO 3J81N 2BTQB 1EZVH 2ZIOA 2VRZA 4W4LA 2IW5A 2VQFO 4GX0A 1WN7A 4EB6A 3ZRWA 1KUQA 2QWNB 2WAMA 1YVWA 4PDMA 1MG1A 4JAAA 3JCZA 5J2TB 2GUZA 4JI2O 4DV7B 2HG5C 3DXRA 2XT9A 1P7GA 5EC2C 4LF9B 3K59A 5IT9N 3CCJV 5B3SB 5H9CA 5KUMA 3CRQA 2ZKOA 3B40A 3ZHUA 4PDVA 5CBHA 3FD9A 1BL8A 5IYDO 4DV0B 4X65O 3CC4V 5BY1A 2PI4A 3X2QC 2A9HA 2IJHA 3FB6C 1EM1A 4I7ZB 1QBZA 4DR1B 4FZ0A 5KHHA 3BA9A 2EZOA 3R65A 1E1QG 1ENVA 4RQFA 1JR9A 5LOVA 1WB7A 4LF5B 1MMMA 4JYAB 4DR3O 3I5DA 1Q81W 1R6KA 2HKOA 1R3IC 5E1AC 1FFXA 3N2KA 2LP7A 5B5EZ 5BXZA 4DR4B 4C7UA 4YHHB 4Z1MG 1JFFA 2GHYA 5LMUO 1HWYA 5K1XA 3ICXA 2ZE5A 3JD4A 5LP6C 2PTMA 4X88A 3ZMSA 2QR4A
chains in the Genus database with same CATH topology
2LQTA 2RN9A 1U96A 1Z2GA 1U97A 2RNBA 2HP8A 1HP8A 2LGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LQT A;  2RN9 A;  1U96 A;  1Z2G A;  1U97 A;  2RNB A;  2HP8 A;  1HP8 A;  2LGQ A; 
#chains in the Genus database with same CATH topology
 1FXK A;  3OFN G;  3CCS V;  4LP8 A;  3L74 H;  3UO2 A;  4F4L A;  3NR7 A;  3DGE A;  2XAG A;  4YJ3 B;  2XAQ A;  2LGQ A;  4IYI A;  4LF4 O;  2QE7 G;  2EIN C;  4GKK B;  4LF8 O;  1FXH A;  4A5U B;  3C3T A;  4X8A A;  1Y74 B;  4UCR A;  3B2E E;  2ITC C;  2E74 B;  2DW4 A;  4MW3 A;  3K58 A;  5LMN O;  1ZUQ A;  3ETD A;  4HBN A;  3F5W C;  1SZT A;  4AIL C;  1H8E G;  3B09 A;  2DN9 A;  3SYO A;  3STL C;  1HR0 B;  1MA1 A;  2CK3 G;  4JYY A;  4LFA O;  2JRI A;  4EB6 B;  3FB8 C;  3ZRW B;  1FJG O;  1EN4 A;  1JVM A;  1XNQ O;  5L3C A;  4FLV A;  1S77 D;  1N4C A;  1ARO P;  2PZS A;  2G38 A;  3SPG A;  2JS5 A;  3FFQ A;  4XDL A;  5H2F Z;  5EK0 A;  1M57 B;  4D6T H;  1ZX3 A;  1I7F A;  2GUZ B;  2GSM B;  5B1B B;  1SQF A;  3DXR B;  1XI1 A;  3U11 A;  1S76 D;  4XDJ A;  3CXH F;  3OAA G;  2EJ7 A;  5CBF A;  5JJE B;  1NR1 A;  4DV6 O;  1X59 A;  4F6E A;  2DWD C;  4JAV A;  3HKC A;  3SPJ A;  5BR8 O;  1ZWI C;  1JPX A;  3DC6 A;  4I5S A;  1PL4 A;  2DMX A;  2YXY A;  1OHH G;  3OW2 U;  4YJ2 A;  4DR6 B;  1NVP B;  1FS0 G;  2UXC O;  3ASN B;  4IGG A;  5KAI Z;  2WWW A;  3FYE B;  2QWQ B;  5EBM C;  5JCO A;  2ZXW C;  4DR2 O;  1D5N A;  3CB2 A;  1JMK C;  1JQ0 A;  3RW0 A;  4UUJ C;  1H2M A;  3D36 A;  4Q6G A;  2UUC B;  1KEC A;  4UV8 A;  1V9P A;  5LOV B;  1KC8 W;  3SJQ C;  3CRA A;  3ABM B;  3G6B A;  3K06 A;  1N0J A;  2QM4 A;  1KU9 A;  3QG5 A;  4DV2 B;  4LFC B;  2QKS A;  1FFX B;  3N2K B;  3ETE A;  2EX3 A;  1JFF B;  2D2C B;  5KA6 A;  1BHA A;  1M9N A;  2P5O A;  1URF A;  4FFB A;  3O65 A;  4NB5 A;  4BIO A;  4JI7 B;  2LGW A;  3NXS A;  4H33 A;  4WFG A;  1FXK B;  1YZB A;  2XTA A;  2UXB O;  2YIB D;  2DYS C;  4MT8 A;  1SS3 A;  5LYJ A;  4LR3 A;  2PYJ A;  1YEW A;  4JI3 B;  4GKJ B;  5KA5 A;  2YS8 A;  4JF3 A;  1QVF U;  2P7T C;  3H01 A;  2AHY A;  3VQW A;  5IWA B;  4FLZ A;  4LF6 O;  2WA4 A;  3OGC C;  1BHB A;  2H94 A;  2R9A A;  2YC0 A;  5IYC O;  2OT5 A;  1AP5 A;  3ZRV A;  3CCV V;  3J80 N;  1OCR B;  2Q73 A;  1SZX A;  2XAF A;  3RN4 A;  3K5M A;  1V54 B;  3LDD A;  2UXD O;  5IYZ A;  5LGT A;  3OMA B;  2VWJ A;  5LL6 Y;  4QPK A;  1L1F A;  3CME V;  1VF6 C;  4YIP A;  1IBL O;  5C8Y A;  3K5N A;  5EIB D;  1WPB A;  4FFK A;  1GM9 A;  1W0J G;  2UXN A;  5L3G A;  5B3S C;  2Q69 A;  4P9P A;  2YEV A;  4DV4 B;  4TUY A;  1PNL A;  4O4J A;  3G80 A;  3H1I H;  3A0H Z;  2Z5U A;  1YIJ V;  2ZQM A;  4LF7 B;  3HKC B;  2EIM B;  2P67 A;  1FYJ A;  4BR6 A;  2WLM A;  4WBN A;  2QEX V;  4YJ2 B;  3ETQ A;  3L9D A;  1I08 A;  1Y66 A;  1JJO A;  2RCV A;  2BTO A;  2X6B A;  1PPJ H;  2CTW A;  3H1H H;  3ZMV A;  1Q90 D;  1RM1 B;  3ABL C;  3CC2 V;  2W6I G;  2A3Q A;  3IFX A;  5GW7 A;  1Z5V A;  3O9O A;  2RMK B;  2A7W A;  5DEC A;  1RPR A;  4X1I A;  2CTQ A;  4H13 B;  4B3T B;  3CCR V;  5FLX N;  1G8M A;  4D7S A;  1O9G A;  2OTL V;  3ZHR A;  5J2U A;  3JAL A;  1XBL A;  2F43 G;  3FB7 C;  4NR1 A;  3AK3 A;  1EBO A;  2HJD A;  1PM9 A;  3HKE A;  1XHZ A;  1YI2 V;  2Q5Z A;  4FFB B;  4H0L B;  3HR0 A;  2Y48 A;  4YY3 B;  3EXA A;  4R6Z A;  2LO1 A;  2V1D A;  3X2Q B;  5IE9 A;  2ZIN A;  4DR5 O;  2V7Q G;  1M4U A;  4W4K A;  5LYJ B;  2JGD A;  2KG7 A;  1VQO V;  4X64 O;  1NZ6 A;  1W2B U;  4FZ1 A;  5KHK A;  3CXC U;  4DW1 A;  1Q82 W;  3TET A;  1HW7 A;  2IJI A;  5JQG A;  4H37 A;  3CCL V;  4LFB O;  1Q6H A;  1IBM B;  2OTJ V;  1VQK V;  2E5L B;  3KZI Z;  2OYQ A;  2F95 B;  4DUZ O;  2RDC A;  5LXT A;  3E8B A;  1HNX O;  2VQF B;  4FM1 A;  2CDY A;  3E8G A;  2P6J A;  5H6Q A;  5IYZ B;  1L0L H;  4BWA A;  3SYC A;  3AG4 B;  3ZS8 C;  2VQE O;  4JGS A;  1BE3 H;  2QA4 V;  5BMV A;  5J9P C;  3BAB A;  3E35 A;  2HVJ C;  3T1H B;  4WFB V;  4LCU C;  4PA6 A;  2ZE8 A;  1S5H C;  5C8Y B;  4QE9 A;  4OPH A;  1KYO F;  1N36 B;  1KKD A;  3E22 A;  1DGS A;  1XIL A;  5CN0 A;  2QKC A;  1E79 G;  5IYB O;  2GTS A;  4JZ2 A;  2FL4 A;  3GWK C;  1PNM A;  2YEV B;  4TUY B;  4WFA V;  4O4J B;  1CP9 A;  1XNR O;  3U0Z A;  2BCC H;  4X65 B;  4AI8 A;  2JDI G;  3ZN0 A;  4DXW A;  3ASN C;  4JAS A;  2ZDI C;  3LSU A;  4WBN B;  4K3A A;  1K4C C;  3ABM C;  3LNN A;  3SPH A;  1VF6 A;  4B3M B;  1PNK A;  2X7R B;  3IAY A;  2X0L A;  3CWB H;  5CA0 A;  4X1I B;  1PL0 A;  5IY5 B;  4U3F H;  4K0K O;  3GVM A;  5LMU B;  3W7S A;  2CTR A;  1K97 A;  1JX9 A;  5J2U B;  3JAL B;  2B9Z A;  1YDX A;  2ITD C;  3HPL C;  1FXK C;  5C93 A;  1QHT A;  3BCC H;  4I9Q A;  3HKE B;  3BA8 A;  4O2B A;  1WLE A;  4O2A A;  1FKA O;  3UO3 A;  4KP4 A;  4ZIB A;  4LWS A;  4LF4 B;  4E2L A;  4X62 B;  5LGN A;  4GCZ A;  2JGD B;  2KG7 B;  4LF8 B;  1SF9 A;  3JD1 A;  2BSK A;  4KHP B;  3SYQ A;  3QVN A;  5JQG B;  4FLX A;  1JOY A;  1VEW A;  2PI5 A;  1S5L Z;  5KX5 A;  2FYU H;  5LMN B;  1OCR C;  2QM8 A;  1GM7 A;  2LFR A;  3OT7 A;  2ZR2 A;  1K3E A;  1IBK B;  2CGN A;  4NXM O;  5LXT B;  3E83 A;  3RGB A;  2AZ2 A;  1AI4 A;  3H1L H;  4I50 A;  1XNQ B;  3TXS A;  3LDC A;  1AI6 A;  2WLK A;  2HHH O;  3LSS A;  4J7K A;  3T2M A;  5BMV B;  1R6N A;  5L3D A;  4PDR A;  1GMG A;  2UUA O;  3E22 B;  4O4H A;  3IC9 A;  3UM7 A;  1Y6X A;  2FML A;  1H2L A;  1YJW V;  2EIM C;  3DC5 A;  2L6L A;  1NJI W;  4RUE A;  1QR8 A;  2XND G;  4KL1 A;  2UXC B;  4WFH A;  1KKC A;  1ZLZ A;  5JCO C;  2JJ1 G;  3G4S V;  1J95 A;  2YIC A;  4DR2 B;  1RM1 C;  3D36 C;  1SES A;  4JI6 O;  4DK1 A;  2JS3 A;  4PA7 A;  5B66 Z;  1S72 V;  2Q7E A;  4PV1 B;  4RO2 A;  3MHS C;  3J7A U;  3RVZ A;  4B3R O;  2M7W A;  2LW7 A;  1H38 A;  5CA0 B;  3OUF A;  4NXN O;  1HNW O;  5IJ0 A;  1VAR A;  4PA4 A;  4FVM A;  4FLW A;  2CH7 A;  4AQY B;  2JK5 C;  1QVG U;  2OIE A;  2UXB B;  4JAU A;  1IUR A;  2YID A;  1H2S B;  4O2B B;  2P4V A;  3K0D A;  3VOU A;  4O2A B;  4UFZ A;  3K57 A;  2ZDI A;  4MS2 A;  1BT8 A;  1N32 B;  4LWS B;  3MHH C;  4EFE A;  5DN6 G;  3WG7 C;  1RSO A;  1GK9 A;  1VMG A;  2A79 B;  2QWP B;  2BSK B;  3C90 A;  3Q4H A;  3KCX A;  2R72 A;  4LF6 B;  3K5L A;  4XDK A;  3ABL B;  3WB1 A;  3P3P A;  1NTZ H;  3SJA C;  4MVS A;  3F7Y C;  5KX5 B;  1P84 F;  3OEH G;  3FX7 A;  3JCU Z;  2UXD B;  1MOF A;  3AG4 C;  5HFL A;  2C2A A;  4CC5 A;  2AGA A;  4I50 B;  4JV5 O;  4WCE V;  4TT3 G;  1XEQ A;  1IBL B;  5B1N A;  2Q67 A;  1QNM A;  4J7Z A;  2A0L A;  4O4H B;  1J5E O;  1R3K C;  1OCC B;  1WNS A;  3THO A;  3CD6 V;  1K34 A;  3H9V A;  4CH6 A;  1MSD A;  2M6Y A;  1NH2 D;  5KHG A;  3E2E A;  2YXH A;  3P30 A;  3EVK A;  5KAF Z;  4DRX A;  1K5Q A;  3L73 H;  4DO2 A;  4CH3 A;  2YI9 A;  2DYR C;  1IZ3 A;  3CMA V;  4ZKI A;  3A0B Z;  3ZHQ A;  3JD3 A;  3KCY A;  2Q7H A;  5JH7 A;  1AP6 A;  1NKD A;  2R9I A;  3ABK C;  4MTX A;  3ZRX A;  3SPC A;  2CAZ C;  5IY5 C;  3EHB B;  1L8D A;  2IJJ A;  2YI8 A;  4X89 A;  3CJH A;  3UCS C;  4EKW A;  3E8F A;  3A0R A;  3RYF A;  2CUG A;  5HFM A;  3JD0 A;  1BZK A;  3KG2 A;  4MTF A;  5IJ0 B;  2VS0 A;  4LH6 A;  5LHG A;  3F5T A;  5GTH Z;  2CH7 B;  4HYO A;  4D7T A;  3OE7 G;  4JZG A;  1VIB A;  4B08 A;  3CSX A;  2ZNI A;  1Q6I A;  4PEL A;  3LSQ A;  4R50 A;  1SQQ H;  4HAM A;  3OM3 B;  3ZRS A;  2ZIM A;  1YTF B;  2Q9L A;  1GTO A;  3SR2 C;  4DR5 B;  1B6Q A;  1ZL8 A;  3JD2 A;  4X66 O;  3OGI B;  4B3S O;  1RSO B;  2ADP A;  1ZSP A;  3LUT B;  3OMN B;  4BW5 A;  4PI2 A;  3QF7 A;  1VQP V;  2QWO B;  3OR7 C;  4LFB B;  2PF4 E;  3Q4H B;  3ZCC A;  4OX9 O;  3HKD A;  1PV0 A;  3ZJZ A;  5JJN B;  2ADQ B;  1XOU A;  5EC1 C;  4DUZ B;  3LNM B;  2EUL A;  4JI0 O;  1KMI Z;  4MVZ A;  1PKX A;  4LH7 A;  4F6R A;  1SQP H;  2F93 B;  3ZHV A;  1SQV H;  1XDC A;  4LC1 A;  1OJH A;  4N23 A;  4DV7 O;  4YIO A;  4JI5 O;  4E4E A;  2VQE B;  1OV9 A;  3H1J H;  4JI4 O;  1VQL V;  2H3O A;  2DOS A;  4DUY O;  3QO5 A;  4DV0 O;  1K33 A;  2KQX A;  4UV9 A;  4J9Y B;  3D3I A;  5TIS Z;  1R3J C;  2QTO A;  1HP8 A;  3WU2 Z;  2P4K A;  5LHH A;  1AR5 A;  1DF5 A;  1KP3 A;  3K04 A;  2EBO A;  2N74 A;  4DR1 O;  5KUK A;  4H44 B;  2B5U A;  4DRX B;  1OZ0 A;  3K9A A;  3HB3 B;  3GWO A;  3K0G A;  1TUB A;  3ASO B;  2RQ6 A;  2K9P A;  5LA6 A;  2P90 A;  5JH7 B;  3ZHS A;  1Q43 A;  3SGI A;  3VQX A;  4DV3 O;  3G6E V;  2UUB B;  1SET A;  2E76 B;  4YHH O;  1U97 A;  4J10 A;  1JJ2 U;  4RWU A;  4JI1 B;  3CJH B;  2GBO A;  1N34 O;  4NKG B;  1YCI A;  3RYF B;  5FPO A;  2Q0A A;  5LHI A;  1XQ8 A;  2F66 C;  3S3X A;  1Y67 A;  3RYH A;  3C3S A;  4I4T A;  1PP9 H;  2DQ0 A;  2JGU A;  1HNZ O;  4ZOL A;  3ETG A;  4NTX A;  4MVQ A;  2OCC C;  1RPO A;  4BIZ A;  4TV8 A;  1K8A W;  5GON A;  3W7U A;  1GN6 A;  1KQS U;  4R7C A;  1P49 A;  1ZL8 B;  4FLY A;  3ZBH A;  3G67 A;  4GX1 A;  1LNQ A;  5KHJ A;  4FM0 A;  4AHC A;  1VQ7 V;  4CS3 A;  2WLI A;  1OCO B;  4U3J A;  3D3Q A;  2PGG A;  2HP8 A;  3RVY A;  1NVP D;  1N33 B;  3HKD B;  1DK1 A;  3N27 A;  3ABU A;  1UJW B;  4IIJ A;  4PHZ A;  2YSU B;  3QNE A;  3P32 A;  4NXM B;  3E8H A;  4F6R B;  4PDL A;  3JAS A;  1KBH A;  3ZMZ A;  4DV1 O;  1UPG A;  1K92 A;  2ZD9 A;  2OCH A;  3M7M X;  2UUA B;  1F4N A;  1OCC C;  2YXL A;  2F23 A;  2KKW A;  2CE4 A;  3WG7 B;  3FB5 C;  1G6U A;  2MW2 B;  3I56 V;  1DF4 A;  4DR6 O;  4KUM A;  3JAW A;  2K1E A;  1R3L C;  2FTK A;  2IM9 A;  1BQ0 A;  1U96 A;  4IL6 Z;  2EIL B;  1SA0 A;  3DTU B;  4QIW F;  4MW8 A;  2UUC O;  3BVO A;  1MZE A;  3BEH A;  3RWR D;  2Q0O C;  1P4R A;  1TUB B;  4K8X A;  4RAI A;  4JI6 B;  4N21 A;  3W7T A;  4UVC A;  1ORQ C;  2H8P C;  5LA6 B;  1VF5 B;  4DV2 O;  3B8M A;  2E3C A;  5JWP A;  2Y0P A;  4JI2 B;  3JSL A;  2ATK C;  4TQF A;  3R66 A;  3STZ C;  1HNW B;  3AK2 A;  1G4Y B;  2JEU A;  2ZT9 B;  3JAT A;  1YSC A;  4P30 A;  1SRY A;  2HEP A;  2ZR3 A;  1PD3 A;  3T4D A;  4DK0 A;  1BSM A;  4UVA A;  3P3N A;  4PJ0 Z;  5D5P A;  3RYH B;  3FAV A;  4IT5 A;  1WPX A;  4I4T B;  2PYL A;  1VQ6 V;  1XL4 A;  3VQY A;  1Z2G A;  1I5Y A;  4TWK A;  4J42 A;  4ZOL B;  4JI3 O;  5CBG A;  4GKJ O;  2LJ2 A;  4BIU A;  4TV8 B;  4PD4 F;  2WLH A;  1S5J A;  2P06 A;  5GON B;  3CCU V;  1W0K G;  2CTP A;  2DYR B;  3OD4 A;  3TJT A;  2BOC C;  3WB0 A;  1IXB A;  3SPI A;  2X6A A;  2QKA A;  2WLI B;  3B77 A;  3CS5 A;  4CH5 A;  3ABK B;  3AG1 B;  4U3J B;  4DR3 B;  1IDS A;  3D8C A;  1VQ8 V;  2KB1 A;  4I55 A;  4UXN A;  3ZHT A;  3BAA A;  1DTO A;  4IIJ B;  4MVR A;  2WLL A;  1S0V A;  2N04 A;  1H8H G;  1VQM V;  4K8Z A;  2JEX A;  1VQN V;  2CGO A;  2IU3 A;  1W59 A;  3JSN A;  4MTG A;  3JAS B;  3CYO A;  4JV5 B;  4HNA A;  2Z3Y A;  4FLU A;  3OUS A;  1XMQ O;  4FIP C;  1TUE B;  1BMF G;  3T1Y O;  2HJF C;  4Z1V A;  3A8T A;  4UCO A;  1J5E B;  4CH4 A;  1M90 W;  2VWK A;  1MNG A;  2YDE A;  2QTS A;  1E1R G;  1FD9 A;  1YIT V;  4QJF B;  1Y4M A;  2W6J G;  4KXR A;  3JAW B;  5DM6 V;  5EYP A;  2XUM A;  4GZR B;  1Q8I A;  4R8C A;  1OCZ B;  3ASO C;  1SA0 B;  4JYB A;  1K73 W;  1QU7 A;  4LFA B;  4FM2 A;  1FJG B;  1O9H A;  2YIB A;  4CBC A;  4B3T O;  1ZTE A;  3WFV A;  4JTC B;  4XBF A;  4CZZ A;  4MSW C;  1AR4 A;  4GLX A;  4X9Q A;  2Z0A A;  4Q20 A;  1NU1 H;  1AI5 A;  4DV6 B;  2GTA A;  1QQC A;  4YY3 O;  3JAT B;  1I0H A;  1AJQ A;  1NR7 A;  1MAB G;  2JIZ G;  2F4V O;  2ZM6 O;  5BR8 B;  2Q6A A;  2QSA A;  5IJ9 A;  2EJR A;  3FAV B;  3B8N A;  3B4S A;  3ABT A;  5H6R A;  1G1X B;  2MK3 A;  1H2G A;  4ZI7 A;  1GO3 F;  3MD0 A;  1Q86 W;  1AJN A;  5E79 Z;  4DV5 O;  4X66 B;  1D5A A;  1OCO C;  3K3W A;  4B3S B;  2V4D A;  2LW1 A;  1WJZ A;  1GAX A;  2E5L O;  1WP7 A;  3CRR A;  4WFE A;  4UVB A;  4OX9 B;  4TV9 A;  3I55 V;  2EIK B;  4I55 B;  4WF9 V;  4ASU G;  3L72 H;  4JI0 B;  1TVK A;  4JI8 O;  1M1K W;  1M5I A;  2WLL B;  1WP8 A;  3T1H O;  1F7Y A;  2Q4P A;  3N2G A;  1NI8 A;  4JI5 B;  1N36 O;  3K08 A;  5BZB A;  3SYA A;  1SQB H;  1Y76 A;  3FKS G;  1JCH A;  4FK5 C;  4J41 A;  3ZED A;  4JI4 B;  2YIA A;  2OCC B;  4HNA B;  3CPW U;  2N05 A;  4DUY B;  3CE2 A;  3TCU A;  1YJ9 V;  4UCS A;  5JVD A;  3RYI A;  1M56 C;  4I0X A;  3L71 H;  4LBE C;  1QLE C;  3OMI B;  1VQ5 V;  1F23 A;  4JTD B;  1B04 A;  1Q5O A;  3W7W A;  3LDE A;  3QTC A;  2EIL C;  3OR6 C;  2Q7G A;  4JPR A;  3K03 A;  1VF7 A;  5EYP B;  1NTM H;  3A2F A;  4GUN A;  4U7O A;  2WA3 A;  1GN2 A;  4B3M O;  2L35 A;  4CS4 A;  2LFS A;  4DV3 B;  4CC6 A;  2NR5 A;  4HZ3 A;  1BGY H;  1B3Q A;  1CXZ B;  1QR9 A;  4X20 A;  2AHZ A;  2XOK G;  4J9Z B;  1N34 B;  1SKV A;  1XRE A;  2Y69 C;  1K7D A;  1IVS A;  2AW9 A;  3UT5 A;  2HFE C;  2DWE C;  1HNZ B;  3OTO O;  1AJP A;  2ETN A;  5IJ9 B;  4X62 O;  1CEZ A;  4UCV A;  2EZP A;  1SQX H;  4NTY A;  3OEE G;  3GB7 C;  4LNU A;  2IU0 A;  4ZI7 B;  1IX9 A;  4GYC B;  3QO7 A;  4G28 B;  1V55 B;  2AZ0 A;  4KHP O;  4FPP A;  5CMU A;  4NTW A;  1XMO O;  1FXV A;  4U7N A;  3CEI A;  1LR1 A;  3AG1 C;  3JYC A;  5FPR A;  2QDO A;  4OXS A;  4IHJ A;  4L8J A;  4X1Y A;  1NBM G;  3BY6 A;  1B06 A;  2RN9 A;  4QPJ A;  4TV9 B;  1IBK O;  4NVP A;  4ICG A;  1I94 O;  5AG2 A;  2IJK A;  3CRM A;  4BW9 A;  4OGQ B;  4RUF A;  5DED A;  1TVK B;  1FFT B;  1S3J A;  2UU9 O;  2HVK C;  4QGP A;  2BE3 A;  4ABM A;  3VBB A;  3IJ4 A;  1R6T A;  1AVM A;  3SYP A;  4DYL A;  1RFY A;  3F7V C;  1L0N H;  4DV1 B;  1AB3 A;  3N2G B;  5LGU A;  3CP1 A;  3ZX6 A;  3ML0 A;  1Y76 B;  2NNU A;  1Q6U A;  3E89 A;  2BOB C;  4X64 B;  1AI7 A;  5L3E A;  3AG7 A;  5JVD B;  3SJC C;  4IYH A;  3RYI B;  4DR7 O;  4I0X B;  1FAF A;  3S3W A;  3UKM A;  1US6 A;  3JAK A;  1OCZ C;  5CB4 A;  3ZIA G;  2W0X A;  1THZ A;  1HNX B;  3BFR A;  2PY5 A;  4P2Z A;  3L70 H;  2PUS A;  5CA1 A;  3IGA C;  5FNV A;  2Y4U A;  4UB6 Z;  2QJ1 A;  4I9W A;  1CPY A;  1N0N A;  4X1K A;  2WPD G;  4LF9 O;  1GRJ A;  3M8A A;  4ZHQ A;  2DE0 X;  4QE7 A;  4AQY O;  2XAS A;  2XHB A;  1HDJ A;  4X20 B;  1P7B A;  4Z2W A;  1XHX A;  1Z5W A;  4O4I A;  1K4D C;  3AG3 C;  4GT1 A;  1XNR B;  1AIL A;  3UT5 B;  3CCE V;  1N32 O;  4K35 A;  1GN4 A;  5FL7 G;  3RT3 C;  2QWR B;  1TAE A;  4MVU A;  2ZE6 A;  1Q3E A;  2XAJ A;  4LNU B;  1YF2 A;  4LF5 O;  1H2N A;  1BCC H;  4JYA O;  2D3O W;  1RP3 B;  1XL6 A;  3APQ A;  3TXQ A;  3QO8 A;  3L75 H;  2IH3 C;  2ZE7 A;  3IC7 A;  4DR4 O;  4P9O A;  2EIK C;  5EBW C;  5K1P A;  4IHJ B;  1IXM A;  4X1Y B;  2ODM A;  4EEQ A;  4ZBM A;  4WFF A;  1T5E A;  4FLT A;  4K0K B;  5LP6 A;  1KP2 A;  1ROP A;  3AG2 B;  1QLN A;  2UXX A;  1NT2 B;  5B1A B;  2OWO A;  2GV9 A;  1EZJ A;  1KB9 F;  5KMG A;  2O57 A;  3JAM N;  3VQV A;  4GKK O;  3APO A;  2LQT A;  1XMQ B;  3SJB C;  1EN5 A;  2DQ3 A;  2Y0I A;  3K5O A;  3T1Y B;  1WA8 A;  4GX5 A;  1SER A;  1YXB A;  3ZN1 A;  1Q7Y W;  2EIJ B;  3BPZ A;  3W7X A;  2R70 A;  4PA3 A;  2B1I A;  1A32 A;  2HLD G;  1YTF D;  4UCU A;  1YHQ V;  3CCQ V;  5IDJ A;  2OIG A;  3JAK B;  3JAR A;  3RYC A;  1HR0 O;  5CB4 B;  4J7J A;  4J80 A;  2E75 B;  3K79 A;  2WSS G;  4GX2 A;  3U10 A;  1R1B A;  1NQT A;  1X4T A;  2ILM A;  5CA1 B;  4BAY A;  5FNV B;  1MSW D;  1JA8 A;  2HHH B;  3HKB A;  4X1K B;  4B7E A;  2R9R B;  2FB5 A;  4O4L A;  2WLJ A;  4ZHQ B;  2JVD A;  4CS2 A;  5H5N A;  4KFM A;  5A9G A;  3OTF A;  2JJ2 G;  1M56 B;  1FPO A;  3TK1 A;  1QLE B;  3CC7 V;  4O4I B;  3M99 B;  2F4V B;  2ZM6 B;  4MTO A;  3MDS A;  3G71 V;  1DLB A;  2GDS A;  1F4M A;  3K9S A;  1V55 C;  3ZMU A;  4L87 A;  2FKX A;  2IBZ H;  5B1O A;  1AR1 B;  4DV5 B;  3FYI B;  3CCM V;  1K5S A;  4YXW G;  5L3F A;  4TSF G;  4LFC O;  2P22 C;  5EIB C;  3RFR A;  4B3R B;  3WB2 A;  5EZY A;  3KKY A;  4NXN B;  1YJN V;  1N8R W;  3AK1 A;  3T1C A;  3EFF K;  2HR3 A;  5L3B A;  4JI7 O;  4JI8 B;  3UQ8 A;  5LP6 B;  1M57 C;  5B1B C;  3CX5 F;  2Y69 B;  2KSD A;  3PJS K;  1ZAU A;  1SQG A;  5CA3 A;  5KMG B;  4JYC A;  2F1M A;  4EFB A;  2NN4 A;  3BRC A;  4UCT A;  2EIN B;  4J11 A;  1UFI A;  1QCE A;  5ITZ A;  4PA9 A;  1D2D A;  5IWA O;  1TA8 A;  1WA8 B;  2AXT Z;  2IH1 C;  2ZCE A;  3T4Z A;  5A2Q N;  1F51 A;  2BTQ A;  3E86 A;  2B1G A;  4UB8 Z;  3AEI A;  4MVO A;  1K9M W;  1H2K A;  3JAR B;  1R73 A;  3RYC B;  1M93 A;  2Q8V A;  1NS1 A;  3DSQ A;  4G27 B;  5KLV H;  2Q68 A;  5J2T A;  4G2K A;  2UUB O;  2ZNJ A;  3PN1 A;  5EBL C;  2DJV A;  4RQE A;  3CRC A;  4JI1 O;  3HKB B;  4DV4 O;  1KD1 W;  4NYK A;  1WB8 A;  1BQZ A;  4O4L B;  1LUV A;  1WAZ A;  1VQ9 V;  5D5Q A;  2W0F C;  2XAH A;  4LF7 O;  3CHX A;  2RJZ A;  1TGO A;  4JTA B;  2QGN A;  4FJC C;  1BS3 A;  3OTO B;  3ZMT A;  1GM8 A;  1MZF A;  4B7K A;  5JJJ B;  2RNB A;  2YUA A;  4TQD A;  4PI0 A;  2ZXW B;  4FMT A;  2Y4T A;  2A06 H;  1XMO B;  5KHI A;  4QNH B;  1N33 O;  1EN6 A;  2X6C A;  1SC5 B;  1V54 C;  1EFR G;  2WLN A;  4TOI A;  1I94 B;  5EZY B;  3AG2 C;  1VQ4 V;  1LUW A;  1I5X A;  4OPA A;  5B1A C;  4DW0 A;  5GTI Z;  2UU9 B;  4YJ3 A;  1NTK H;  2NLJ C;  3AG3 B;  1NH2 B;  4MVM A;  2DYS B;  3RBZ A;  2ARH A;  1XUQ A;  1GKF A;  1COW G;  3H1K H;  3MAQ A;  1Y74 A;  5LBQ A;  3BHP A;  1GH6 A;  2EIJ C;  5ITZ B;  3TGU H;  4DR7 B;  1IBM O;  2QM7 A;  3SDL A;  1GN3 A;  1VP7 A;  5F2V O;  3J81 N;  2BTQ B;  1EZV H;  2ZIO A;  2VRZ A;  4W4L A;  2IW5 A;  2VQF O;  4GX0 A;  1WN7 A;  4EB6 A;  3ZRW A;  1KUQ A;  2QWN B;  2WAM A;  1YVW A;  4PDM A;  1MG1 A;  4JAA A;  3JCZ A;  5J2T B;  2GUZ A;  4JI2 O;  4DV7 B;  2HG5 C;  3DXR A;  2XT9 A;  1P7G A;  5EC2 C;  4LF9 B;  3K59 A;  5IT9 N;  3CCJ V;  5B3S B;  5H9C A;  5KUM A;  3CRQ A;  2ZKO A;  3B40 A;  3ZHU A;  4PDV A;  5CBH A;  3FD9 A;  1BL8 A;  5IYD O;  4DV0 B;  4X65 O;  3CC4 V;  5BY1 A;  2PI4 A;  3X2Q C;  2A9H A;  2IJH A;  3FB6 C;  1EM1 A;  4I7Z B;  1QBZ A;  4DR1 B;  4FZ0 A;  5KHH A;  3BA9 A;  2EZO A;  3R65 A;  1E1Q G;  1ENV A;  4RQF A;  1JR9 A;  5LOV A;  1WB7 A;  4LF5 B;  1MMM A;  4JYA B;  4DR3 O;  3I5D A;  1Q81 W;  1R6K A;  2HKO A;  1R3I C;  5E1A C;  1FFX A;  3N2K A;  2LP7 A;  5B5E Z;  5BXZ A;  4DR4 B;  4C7U A;  4YHH B;  4Z1M G;  1JFF A;  2GHY A;  5LMU O;  1HWY A;  5K1X A;  3ICX A;  2ZE5 A;  3JD4 A;  5LP6 C;  2PTM A;  4X88 A;  3ZMS A;  2QR4 A; 
#chains in the Genus database with same CATH homology
 2LQT A;  2RN9 A;  1U96 A;  1Z2G A;  1U97 A;  2RNB A;  2HP8 A;  1HP8 A;  2LGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...