2RN9A

Solution structure of human apocox17
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
67
structure length
67
Chain Sequence
GSFTMPGLVDSNPAPPESQEKKPLKPCCACPETKKARDACIIEKGEEHCGHLIEAHKECMRALGFKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cytochrome c oxidase copper chaperone
publication title A structural-dynamical characterization of human cox17
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 11
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2007-12-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05051 COX17 Cytochrome C oxidase copper chaperone (COX17)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1130 Mainly Alpha Orthogonal Bundle Helix Hairpins CytochromE C oxidase copper chaperone 2rn9A00
2HP8A 2LQTA 1Z2GA 2RNBA 1HP8A 1U96A 2LGQA 1U97A 2RN9A
chains in the Genus database with same CATH superfamily
4J41A 3RFRA 1VF6A 2V1DA 4XBFA 3MDSA 2OCCB 2EIMB 1HP8A 4B3TO 4DV2O 1YTFD 1IXBA 2OIGA 3NR7A 3CEIA 2JS3A 1JX9A 4TQDA 1N8RW 1Z5WA 1FXVA 2R9AA 2AW9A 1QVGU 4RUEA 4OX9B 4LH7A 3W7SA 2YEVB 3W7UA 2R9RB 3LSUA 1GM8A 4JV5B 5A2QN 3N2KB 5LMNB 1FXHA 2Y0PA 3SGIA 1QU7A 4FFBB 4KFMA 2ZR2A 3ZHQA 2P90A 4UVBA 4X62B 1N34B 4CS3A 5KHHA 1SA0A 2F66C 1FJGB 2GV9A 3N2GA 5JWPA 1BMFG 4H37A 3K08A 5H6QA 3TXQA 1ZLZA 4DV6O 3E89A 4PA4A 2PZSA 1GMGA 3OUFA 4BAYA 4DR7B 3NXSA 3CMAV 3I56V 2ZXWC 4LF4B 1IBMB 5IT9N 1AI5A 4FM0A 2DWEC 4FJCC 2JJ1G 2YXYA 3AK1A 2RDCA 1SERA 4JASA 2PUSA 5BR8O 3THOA 3AG4B 2EZPA 4K3AA 3HKDA 1J5EB 3G4SV 1SA0B 2LGQA 4GLXA 2ITDC 3N2GB 3RWRD 1SQGA 2IJIA 1FD9A 3T1YO 3AG1C 3FFQA 3LNMB 1WN7A 2ADQB 2EZOA 3UM7A 4GYCB 3E2EA 1H2MA 2V7QG 3P3PA 4NTXA 2G38A 2QKAA 1AI4A 4GKKO 2Q7HA 4B7EA 4ABMA 2ZNJA 3K58A 4WFAV 3QVNA 5AG2A 4TQFA 1YIJV 4UCVA 2QTOA 5HFLA 2ATKC 4R8CA 1HR0O 1Z2GA 1XHZA 4YY3O 1XBLA 3BAAA 5K1PA 3DC6A 2AZ0A 2HEPA 1NS1A 4JI2B 2GTSA 3ZEDA 1YF2A 1DLBA 2Q7EA 1XQ8A 4J7KA 5EYPA 3BFRA 3N27A 4K0KB 1SQVH 3H1KH 5KLVH 1SETA 3CCMV 1NTZH 2FB5A 5B3SC 1Y6XA 4YHHO 4WFEA 4LNUB 4DUYB 1F4MA 3WFVA 2QTSA 1K5SA 4JYBA 4XDKA 4O2AB 4FLWA 3OMIB 3CRMA 1EBOA 4UV9A 5JQGA 1W0JG 3GWKC 4PDRA 2WSSG 3TETA 1TA8A 4I4TB 1ZSPA 3RYIA 2HVKC 1YI2V 1EZJA 4OPAA 2W6JG 1IZ3A 4JI3B 4JV5O 4ASUG 2YIAA 1SZTA 2BOBC 4B3RB 4JI5O 3LNNA 2RJZA 4X66B 4O2BB 2ZXWB 2X6CA 4DV3B 1VQ6V 5EYPB 4PDMA 5LGUA 4QPKA 2MK3A 1H8EG 2WLLB 3JASA 3AK3A 3W7TA 4WFFA 1KECA 3K0GA 3VQXA 1COWG 4CC6A 4WBNA 4LP8A 4YJ3A 3DC5A 2IM9A 1I08A 5JQGB 4GX5A 2QDOA 3VQYA 4LF4O 4L87A 1B06A 1PNLA 1W0KG 2EIJB 3SJQC 1T5EA 1TUBA 2H3OA 2W0XA 3ZRVA 5EK0A 4FLZA 3JD2A 1VQMV 2PYJA 1FKAO 1FAFA 3RYIB 4UB8Z 3P3NA 4BR6A 1VQ8V 1AILA 2WLJA 2LO1A 2QSAA 4AQYB 5IY5C 5B1BB 4DR6B 1XILA 2CTQA 1X4TA 2ADPA 4O4HA 4K35A 2JGUA 1AP6A 2EULA 1R3IC 3FB7C 4A5UB 4ZOLA 3X2QC 1L0LH 2VWJA 1AP5A 3T2MA 1O9HA 1Y67A 4JI4B 2BE3A 4DRXA 5GTHZ 3AG3B 5J2TA 5EIBD 1JFFB 2XOKG 2EIKC 1VARA 3ABKC 1Q8IA 2R9IA 3W7WA 4WBNB 2LJ2A 3A0BZ 2UUCB 4YJ3B 4G28B 4EEQA 3EFFK 2EX3A 4PI2A 1PNMA 3OR6C 1WJZA 2VS0A 4PHZA 4YXWG 1TUBB 1N32B 5LHHA 4QPJA 1R6TA 2VQEB 4DV4B 5EZYA 2R72A 5IDJA 4ZBMA 4MSWC 2B5UA 2CTPA 2XUMA 2YC0A 1H2SB 3FB8C 4RWUA 4JI7B 1YVWA 2OIEA 2Y0IA 1Q81W 1K7DA 3K04A 5GTIZ 5IWAB 5JCOC 4JI2O 1GO3F 1BS3A 1YSCA 1QBZA 1MSDA 3CRQA 3ZHVA 3J81N 1X59A 4GX2A 1IBLO 3CS5A 2FTKA 3G71V 1N36B 1A32A 4GX1A 2DW4A 4F6RA 4ZOLB 2QA4V 2UXBO 2JGDA 4LFCB 4X65B 1GN4A 2QWRB 4DUYO 3DSQA 5J2TB 5K1XA 5C93A 3BA9A 2UUAB 1OJHA 2W0FC 3G6BA 1SQBH 3RGBA 4XDLA 1JJ2U 5CBHA 3ZMVA 2UXDB 4UVCA 1SC5B 4D7TA 3CE2A 3RW0A 2HP8A 3JCUZ 3QF7A 2A79B 5FL7G 3GWOA 3DGEA 1DGSA 5EZYB 4JI1B 5KMGA 4DV2B 3LDEA 2L35A 4DK1A 4JI3O 4TSFG 3CCVV 2CGOA 4HNAA 4LH6A 3T4ZA 4HAMA 1ZUQA 1AJQA 5BMVA 4MTGA 1UFIA 1WP8A 1PP9H 2BSKA 4PA7A 3MD0A 4F6RB 4EB6A 1HWYA 4UCUA 2IU3A 5LBQA 2UU9O 5CA1A 2JGDB 3UT5A 2DOSA 1FFXA 4TWKA 4DV0O 4TV9A 5JCOA 3R66A 3SYQA 2DN9A 1OCZB 2C2AA 1AI7A 1EFRG 5KHKA 3ASOC 3CCQV 1IBKB 5LL6Y 3J80N 3X2QB 1AI6A 3C3SA 2BCCH 2OCHA 1U96A 4B7KA 1AR5A 3ZHSA 1RM1C 5KMGB 1VQ5V 3ABLB 4GT1A 1WAZA 3ABKB 1GAXA 2AHYA 1VQPV 1DF4A 5BY1A 4HNAB 1ZX3A 1L1FA 1H38A 4UV8A 5BMVB 2A7WA 1NQTA 2Q7GA 4MTFA 4DR5B 3E22A 1XNRO 4EB6B 5B1NA 1OCOC 2Z3YA 1Q43A 3BEHA 5CA1B 5BR8B 1M57C 4K8XA 1FFXB 5BZBA 4G2KA 1P4RA 5L3GA 4CBCA 5KX5B 3B8MA 5LOVA 4IHJA 3T1YB 4R50A 1V54B 2F1MA 5EC1C 4UXNA 1AVMA 5FPOA 4QE7A 4D7SA 3H01A 1W59A 3CC7V 2VQEO 4DV4O 1AB3A 3RT3C 1LUVA 4GKKB 4JI7O 3CHXA 1RSOA 2UUBB 3ETEA 4JPRA 4JI8B 5IWAO 4P2ZA 5CBGA 2ZDIA 5KUKA 1PL4A 4H13B 2CGNA 1JCHA 3K0DA 1N36O 3FYEB 1YHQV 3UO3A 2AXTZ 4W4KA 4FM1A 1K3EA 4UB6Z 4X65O 3BY6A 1N0NA 2Q68A 2V4DA 1AJNA 4B3SB 1KC8W 1SQFA 2Q9LA 4FMTA 3ABTA 3L74H 2N74A 2QJ1A 4X89A 2Z5UA 5LOVB 2JVDA 4IHJB 4YHHB 2UXDO 4X1KA 2R70A 3CSXA 3SPIA 3AK2A 1H2KA 1HDJA 1QLEB 5IJ0B 1ZAUA 4JI1O 5IJ9A 5JJEB 3FAVB 4P30A 3OTFA 2F4VB 1RSOB 1B6QA 3BHPA 4FVMA 3T1HB 3S3WA 4JYCA 1NI8A 4GKJB 3ASOB 2DYSC 2H8PC 4CS4A 1R3KC 1GKFA 3JAMN 3FYIB 1H2LA 4LC1A 2OYQA 4UCRA 4JI5B 5ITZA 3SYCA 3D36C 1G6UA 2ZR3A 1K4CC 3CCJV 5CB4A 1NT2B 2E75B 3HR0A 3ABMC 4LBEC 3QO8A 3VQWA 4X1KB 3QNEA 1QNMA 1IBKO 1EN5A 2JS5A 2FYUH 3P30A 1OCOB 4PA6A 2DQ3A 3VQVA 5IJ9B 5EBMC 1NR1A 1CXZB 3KKYA 3GVMA 3OE7G 1S77D 4LWSA 2ODMA 1Q82W 5L3CA 4D6TH 4TOIA 3WB0A 2RNBA 2X0LA 1O9GA 4JTAB 3ASNC 1Q90D 3CRCA 3JATA 4DR5O 2CUGA 5D5PA 5B5EZ 3SYPA 1CPYA 1LUWA 1MA1A 1M90W 2OTLV 1IDSA 4JGSA 5L3DA 5ITZB 1YJNV 4PV1B 3RN4A 4DV1B 3ZMZA 1G1XB 1WPXA 3L75H 5CB4B 2UXNA 3WB2A 3K5NA 3ETQA 3IJ4A 4NXMB 1E1RG 3SDLA 1S3JA 4Q6GA 1THZA 2ILMA 2HFEC 2XASA 1IX9A 1I7FA 3F7VC 4MTOA 4IL6Z 4RAIA 3SYOA 3E8HA 2ZQMA 3D36A 2UUBO 4JI8O 3BVOA 1OCCC 4LF8B 3ZRXA 3CMEV 1M56C 4FLVA 1L0NH 2IJHA 1K97A 4I5SA 4QNHB 2XTAA 3H9VA 4NYKA 1G4YB 3JATB 4EFEA 2IU0A 1Q7YW 4NVPA 1R6KA 2Q6AA 5LMUO 2IH3C 1VIBA 4B3SO 3HKDB 3T4DA 2GUZA 4NXNB 4E2LA 1IBLB 3SPCA 3F5TA 3JD3A 2OT5A 1B04A 2Z0AA 2UXBB 1BGYH 1M4UA 2ZE6A 2Y69C 1AR4A 4CZZA 1VQ7V 2M7WA 2A06H 1V55C 2ETNA 3U11A 2BTOA 2Q5ZA 3QO7A 3SJAC 4AILC 3B77A 5H6RA 5FLXN 2PYLA 3G80A 1PNKA 4PI0A 3JSLA 4DR4B 3AG2C 2F4VO 2X7RB 1ZWIC 4N21A 1M9NA 1S5HC 2IJJA 1H8HG 4UCOA 3CB2A 3WG7C 1NZ6A 3RYFA 2X6AA 3UO2A 1P84F 3T1HO 3ZN0A 1CEZA 3ZMSA 4GKJO 1I0HA 2H94A 5LHIA 1YZBA 3C90A 4UFZA 1RPOA 2Q8VA 4MVOA 3G6EV 3K9AA 4JZGA 3TCUA 4JZ2A 2Q0OC 1F7YA 5LP6C 2WLMA 1PM9A 2F43G 5EBLC 1ENVA 3G67A 1WNSA 5KAFZ 1DTOA 1H2NA 4PA9A 4CH3A 4R7CA 3IGAC 2UU9B 1R73A 1RPRA 3RBZA 4X1IA 5L3EA 3OGIB 4DV0B 4MW3A 3OFNG 4EKWA 2EJ7A 1NR7A 1R3JC 4X20A 1QR9A 3CYOA 2PI4A 3EHBB 5EC2C 1BQZA 1OCRC 3UKMA 3JSNA 2EINC 2QWNB 3FB6C 3RYFB 2F95B 2XAFA 1VMGA 3AG1B 2JJ2G 4BW9A 1VF7A 1VEWA 3QG5A 1N33O 3ZX6A 1W2BU 2HHHB 3H1LH 2L6LA 3D3IA 1QHTA 4EFBA 3DXRA 3DTUB 3K3WA 4JF3A 3STLC 4YIOA 3C3TA 1OCCB 3E8GA 1Y76A 1LNQA 2NLJC 2ZE8A 4DV1O 1M56B 2P4VA 3JASB 4DW0A 1XNRB 1PL0A 1SF9A 1NVPB 4J7ZA 1K5QA 2HG5C 4NXMO 3ML0A 3S3XA 4X1IB 2WA3A 4YJ2A 1WP7A 2XHBA 5KHJA 2WA4A 3ZMUA 1LR1A 2QWPB 4X20B 2PY5A 5CA0A 1K73W 3OM3B 3RYCA 2LW7A 3SYAA 1SQPH 4MVQA 3CXCU 1Q86W 4LF8O 1HNZO 1TGOA 3JD4A 3ZN1A 5B3SB 2QM7A 1GN6A 1BHAA 5E1AC 2NNUA 1HNXO 1V55B 1P49A 1N0JA 4JI0O 3IAYA 2WWWA 4PDLA 2JDIG 2VRZA 1QVFU 4DR1O 4G27B 1XNQB 4O4HB 3BABA 3T1CA 3ZIAG 1NBMG 3UCSC 4PA3A 3WB1A 4BIOA 3SJBC 2Q73A 4DXWA 4NXNO 3OD4A 4MVUA 1FPOA 3CRRA 1XDCA 1FFTB 1KU9A 1BZKA 1XL6A 1QR8A 4DRXB 1I94B 5D5QA 4YJ2B 5IE9A 1DF5A 2HKOA 4UUJC 3SR2C 4NKGB 2P67A 4RQEA 2WLKA 3OMAB 1WA8A 2CDYA 1F23A 2W6IG 5CA0B 4DR4O 1MMMA 1J95A 3RYCB 2ZKOA 4LF7O 3HB3B 2XAGA 5JVDA 4DV7B 3OAAG 3A8TA 3D3QA 2KG7A 4TT3G 3K57A 2AGAA 1FYJA 1JMKC 3HPLC 4B3MB 4K8ZA 4LF5B 1HNWO 1KP3A 5J2UA 4JYYA 3RVZA 2RN9A 4ZKIA 1KD1W 1SS3A 4DV5O 1BHBA 4KXRA 2QWQB 4WF9V 3TGUH 1OCRB 4U3JA 3FX7A 1S72V 4U3FH 1VQOV 2DJVA 1AR1B 1KKCA 3SPGA 1NU1H 3BPZA 1H2GA 1F4NA 5IY5B 1S5LZ 2LFRA 1D5NA 4J11A 1WA8B 4HBNA 4MS2A 5EBWC 4LF6B 1YJ9V 5LYJA 2OCCC 5JVDB 2K1EA 4DR2B 2KG7B 1GM7A 4MT8A 3B09A 2A3QA 3LDDA 1VQ9V 5B1OA 3JALA 1KP2A 2EIKB 4XDJA 5J2UB 4JAAA 2HHHO 2RQ6A 3EXAA 2BTQA 2UXCB 2N05A 2EILC 1YITV 1Z5VA 2ZIOA 1V9PA 2JEUA 2BSKB 1XMOO 4CH5A 4J7JA 4GX0A 3IC7A 5F2VO 3UT5B 4RQFA 2HJDA 2N04A 3ZMTA 2OWOA 5KA6A 4PDVA 2RCVA 5DN6G 4TV9B 4WFGA 4QJFB 3OR7C 2P7TC 2GSMB 4R6ZA 1KQSU 5LA6A 1TAEA 2BOCC 2QEXV 4BIUA 3GB7C 3OTOO 3M99B 5LYJB 2XNDG 4UVAA 2GHYA 4FIPC 1MG1A 1M1KW 3R65A 4PJ0Z 4OGQB 2PI5A 4MVMA 4HZ3A 2QM4A 5IYBO 3JALB 2QE7G 1URFA 3B8NA 3IFXA 2P4KA 3RVYA 1EN4A 2P6JA 3ZCCA 3TK1A 1XNQO 1MZEA 1VQKV 5H2FZ 1YEWA 1R1BA 3VBBA 1NVPD 1BSMA 3AG4C 4CH6A 1IURA 3E22B 5B1AC 1XOUA 1K4DC 1M5IA 2LW1A 4CH4A 4CS2A 1MZFA 3AG7A 5LMUB 1I94O 4LFBB 2YUAA 4KL1A 5C8YA 5JJNB 3MHHC 3CCUV 2QKCA 1R3LC 3M8AA 5DECA 5GONA 2Y48A 4DK0A 4DV7O 2QGNA 5L3BA 4FFBA 4I9QA 2ARHA 1N4CA 2IBZH 1SKVA 2JEXA 2OTJV 3E35A 4JAUA 3HKBA 1BQ0A 2JK5C 1WB8A 4B3MO 3E83A 4LF5O 3CWBH 1BE3H 1RFYA 5TISZ 1JVMA 1AROP 4FLUA 2YIBD 4TUYA 4BIZA 2CTWA 2YDEA 2ZIMA 2ZE5A 2M6YA 2B1GA 1NJIW 1GK9A 2XAQA 3ZHRA 1UJWB 3HKCA 4JYAO 2QKSA 5BXZA 2Q4PA 2WLHA 5KAIZ 2YS8A 4QE9A 4UCSA 5GW7A 1RM1B 2LQTA 5LXTA 3BA8A 5C8YB 3OW2U 5J9PC 3OEEG 2EILB 4B08A 2DMXA 4LF6O 3CC2V 2QWOB 5GONB 3K9SA 4N23A 4LFAO 4DR2O 2P22C 3CX5F 4ICGA 1FXKC 2FL4A 3K5MA 3ICXA 2KSDA 3U10A 2CAZC 3HKBB 1M57B 3JCZA 5E79Z 4ZI7A 2XAJA 4IYIA 3BCCH 1Q5OA 2FMLA 4L8JA 2UXCO 1EN6A 1WPBA 4P9OA 1NH2D 4TUYB 3A0RA 2JIZG 4O4LA 3ZBHA 1US6A 1N33B 3HKCB 3TJTA 1K33A 4KHPB 2JRIA 3H1IH 5LXTB 4MVSA 2KB1A 4DUZO 4I55A 1Q6HA 5FPRA 1MABG 2CK3G 4IGGA 4X64O 4PD4F 2P06A 2VWKA 2HR3A 4MW8A 4WFBV 4F6EA 2WLIA 1E1QG 2DYRC 4TV8A 2B1IA 4DR3B 3LUTB 2IW5A 5B1AB 3KCXA 4FK5C 3JD0A 2FKXA 2EIJC 1R6NA 4ZI7B 1K92A 3CJHA 4MVRA 2UXXA 3W7XA 4LWSB 2XT9A 2YXLA 4LNUA 3B2EE 1HNZB 2Y4TA 1KMIZ 2VQFB 3KCYA 2K9PA 3J7AU 4O4LB 4O2AA 4UCTA 5B1BC 1HNXB 1FXKA 4JI0B 1XEQA 1SZXA 1GH6A 1OHHG 2AHZA 5LGTA 5H9CA 1XMQO 4DR1B 3OT7A 1JA8A 4LFBO 1XHXA 4RO2A 1JQ0A 3LSSA 2RMKB 2ZM6B 2IJKA 4I4TA 3IC9A 3I55V 4I55B 1YXBA 1ZL8A 1EM1A 3AG3C 3ZRWA 1MNGA 2DYSB 4IYHA 2EBOA 1K8AW 1BL8A 2WLIB 4TV8B 3Q4HA 3E8BA 1IVSA 1RP3B 4O2BA 1Y66A 4W4LA 5CA3A 3JD1A 2ZT9B 3H1JH 4F4LA 5CBFA 4JTCB 4Z2WA 4X1YA 2WLLA 4LF9B 1Q6IA 3H1HH 4LF7B 4NTWA 3CJHB 4FLYA 2ZCEA 3CXHF 2E76B 1Y74A 4JAVA 1K9MW 1Q6UA 3ABMB 4I7ZB 3LSQA 3APOA 3E86A 5CMUA 4WCEV 1UPGA 1HNWB 2WLNA 4AHCA 1FXKB 2HVJC 3A0HZ 2LGWA 3SPHA 1KUQA 2KKWA 1NKDA 1VP7A 4LR3A 4DV5B 3CD6V 4OX9O 1I5XA 3M7MX 2GUZB 3KG2A 1MSWD 4CC5A 2NR5A 1ZL8B 3HKEA 3U0ZA 5LMNO 3P32A 5JJJB 1VF5B 3ZRWB 3CCEV 3ASNB 2KQXA 4J9ZB 4FPPA 5DM6V 1D2DA 2YIDA 4NTYA 3Q4HB 4X62O 2E5LB 1N34O 4RUFA 1P7GA 3O9OA 3FB5C 4H33A 5KUMA 4H44B 1FJGO 4X1YB 3VOUA 2WAMA 1TUEB 5IYZA 3ETGA 1P7BA 1Y74B 1DK1A 3ZJZA 1JFFA 3OMNB 3OEHG 2E3CA 4PELA 1U97A 5DEDA 2DYRB 2GDSA 4DR7O 4P9PA 1GN2A 3L70H 1YDXA 4X9QA 3ABUA 1GTOA 3K5LA 1IBMO 4KHPO 2LP7A 1I5YA 2YIBA 2CE4A 3F7YC 1PD3A 2D3OW 1K34A 1XMOB 1TVKA 3HKEB 3F5WC 3CCSV 4DR3O 3PJSK 1S76D 2P5OA 1OCZC 1SQXH 3JAKA 3L73H 5LP6A 1J5EO 3STZC 3CRAA 2F23A 4GUNA 5IYDO 3ETDA 1HW7A 4X88A 3OTOB 4FFKA 3CCRV 4JI6B 2ZINA 4E4EA 1PPJH 5IYZB 2YI8A 3OGCC 4YIPA 1Y4MA 3B40A 3ABLC 2VQFO 4ZIBA 2Y69B 4BWAA 1QLNA 4ZHQA 1L8DA 4GZRB 4AI8A 3D8CA 3CP1A 1XI1A 4JTDB 4Z1VA 1S0VA 3DXRB 3AG2B 3K5OA 4C7UA 2IH1C 2ZM6O 3BRCA 2GBOA 3WG7B 1Y76B 3K79A 4J9YB 1TVKB 5HFMA 2YXHA 4IIJA 1YTFB 4DW1A 3L72H 2LFSA 2QM8A 4H0LB 1M93A 3JAKB 5LP6B 4KUMA 5FNVA 1V54C 1B3QA 4K0KO 1Q3EA 1WLEA 4LF9O 2NN4A 1OV9A 1ZTEA 5KA5A 1CP9A 2ZE7A 3L9DA 4U7NA 2CH7A 2X6BA 1G8MA 4ZHQB 3A2FA 5KHIA 4J10A 4OPHA 3CPWU 3K06A 2DWDC 1KBHA 4Z1MG 1NH2B 4U7OA 4B3TB 4GCZA 2EINB 1JPXA 1XL4A 2EJRA 3AEIA 4JYAB 3LDCA 1F51A 4IIJB 1ROPA 1EZVH 4B3RO 2XAHA 2E5LO 3ZRSA 2WPDG 4I0XA 4X66O 4DV3O 3RYHA 2O57A 5FNVB 2D2CB 2QR4A 3CCLV 2EIMC 4BW5A 4LFAB 1QLEC 4KP4A 4DO2A 4I50A 1ORQC 2DE0X 3CC4V 1AJPA 4MVZA 1JR9A 1FS0G 2CH7B 4LCUC 4O4IA 1JJOA 4WFHA 5KX5A 2GTAA 1JOYA 2B9ZA 1E79G 3B4SA 4OXSA 3OUSA 2ZDIC 3MAQA 5CN0A 1BT8A 2E74B 2ITCC 4DV6B 4FZ1A 4FZ0A 2A9HA 4J80A 4U3JB 3QTCA 1YCIA 1BCCH 1NTMH 1SESA 2ZD9A 5IYCO 2ZNIA 4DYLA 2DQ0A 1GM9A 3TXSA 3SPJA 4AQYO 4DR6O 4FLTA 4FM2A 2PF4E 3UQ8A 4DUZB 4IT5A 4I0XB 1VQ4V 3JYCA 1KKDA 3JAWA 2AZ2A 3RYHB 3JARA 2CTRA 4I9WA 5A9GA 4NR1A 1KB9F 4X64B 1VQLV 4Q20A 5LHGA 1VF6C 3EVKA 1WB7A 4JI6O 1PV0A 1XREA 3QO5A 1YJWV 5EIBC 4JI4O 1S5JA 4HYOA 1MOFA 3I5DA 4I50B 3APQA 1XUQA 2Q67A 2HJFC 3O65A 2YI9A 4O4JA 4X8AA 3MHSC 2YSUB 3K59A 2Y4UA 4FLXA 4O4IB 2MW2B 5JH7A 2HLDG 2PGGA 2UUCO 2BTQB 4J42A 2A0LA 4NB5A 4QIWF 2Q69A 1GN3A 1N32O 5IJ0A 2PTMA 5LGNA 1SRYA 3FAVA 4QGPA 3K03A 1IXMA 5L3FA 1D5AA 1XMQB 5B66Z 4MTXA 1QQCA 3WU2Z 2YEVA 2F93B 3JAWB 3ZHUA 1VQNV 1QCEA 3JARB 5LA6B 1HR0B 1GRJA 3ZHTA 1OZ0A 3N2KA 4YY3B 1SQQH 1NTKH 3E8FA 3KZIZ 5H5NA 4LFCO 2Q0AA 5KHGA 1KYOF 3SJCC 3FD9A 3PN1A 1PKXA 2YICA 4O4JB 3ZS8C 3L71H 2UUAO 3FKSG 5JH7B
chains in the Genus database with same CATH topology
2HP8A 2LQTA 1Z2GA 2RNBA 1HP8A 1U96A 2LGQA 1U97A 2RN9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HP8 A;  2LQT A;  1Z2G A;  2RNB A;  1HP8 A;  1U96 A;  2LGQ A;  1U97 A;  2RN9 A; 
#chains in the Genus database with same CATH topology
 4J41 A;  3RFR A;  1VF6 A;  2V1D A;  4XBF A;  3MDS A;  2OCC B;  2EIM B;  1HP8 A;  4B3T O;  4DV2 O;  1YTF D;  1IXB A;  2OIG A;  3NR7 A;  3CEI A;  2JS3 A;  1JX9 A;  4TQD A;  1N8R W;  1Z5W A;  1FXV A;  2R9A A;  2AW9 A;  1QVG U;  4RUE A;  4OX9 B;  4LH7 A;  3W7S A;  2YEV B;  3W7U A;  2R9R B;  3LSU A;  1GM8 A;  4JV5 B;  5A2Q N;  3N2K B;  5LMN B;  1FXH A;  2Y0P A;  3SGI A;  1QU7 A;  4FFB B;  4KFM A;  2ZR2 A;  3ZHQ A;  2P90 A;  4UVB A;  4X62 B;  1N34 B;  4CS3 A;  5KHH A;  1SA0 A;  2F66 C;  1FJG B;  2GV9 A;  3N2G A;  5JWP A;  1BMF G;  4H37 A;  3K08 A;  5H6Q A;  3TXQ A;  1ZLZ A;  4DV6 O;  3E89 A;  4PA4 A;  2PZS A;  1GMG A;  3OUF A;  4BAY A;  4DR7 B;  3NXS A;  3CMA V;  3I56 V;  2ZXW C;  4LF4 B;  1IBM B;  5IT9 N;  1AI5 A;  4FM0 A;  2DWE C;  4FJC C;  2JJ1 G;  2YXY A;  3AK1 A;  2RDC A;  1SER A;  4JAS A;  2PUS A;  5BR8 O;  3THO A;  3AG4 B;  2EZP A;  4K3A A;  3HKD A;  1J5E B;  3G4S V;  1SA0 B;  2LGQ A;  4GLX A;  2ITD C;  3N2G B;  3RWR D;  1SQG A;  2IJI A;  1FD9 A;  3T1Y O;  3AG1 C;  3FFQ A;  3LNM B;  1WN7 A;  2ADQ B;  2EZO A;  3UM7 A;  4GYC B;  3E2E A;  1H2M A;  2V7Q G;  3P3P A;  4NTX A;  2G38 A;  2QKA A;  1AI4 A;  4GKK O;  2Q7H A;  4B7E A;  4ABM A;  2ZNJ A;  3K58 A;  4WFA V;  3QVN A;  5AG2 A;  4TQF A;  1YIJ V;  4UCV A;  2QTO A;  5HFL A;  2ATK C;  4R8C A;  1HR0 O;  1Z2G A;  1XHZ A;  4YY3 O;  1XBL A;  3BAA A;  5K1P A;  3DC6 A;  2AZ0 A;  2HEP A;  1NS1 A;  4JI2 B;  2GTS A;  3ZED A;  1YF2 A;  1DLB A;  2Q7E A;  1XQ8 A;  4J7K A;  5EYP A;  3BFR A;  3N27 A;  4K0K B;  1SQV H;  3H1K H;  5KLV H;  1SET A;  3CCM V;  1NTZ H;  2FB5 A;  5B3S C;  1Y6X A;  4YHH O;  4WFE A;  4LNU B;  4DUY B;  1F4M A;  3WFV A;  2QTS A;  1K5S A;  4JYB A;  4XDK A;  4O2A B;  4FLW A;  3OMI B;  3CRM A;  1EBO A;  4UV9 A;  5JQG A;  1W0J G;  3GWK C;  4PDR A;  2WSS G;  3TET A;  1TA8 A;  4I4T B;  1ZSP A;  3RYI A;  2HVK C;  1YI2 V;  1EZJ A;  4OPA A;  2W6J G;  1IZ3 A;  4JI3 B;  4JV5 O;  4ASU G;  2YIA A;  1SZT A;  2BOB C;  4B3R B;  4JI5 O;  3LNN A;  2RJZ A;  4X66 B;  4O2B B;  2ZXW B;  2X6C A;  4DV3 B;  1VQ6 V;  5EYP B;  4PDM A;  5LGU A;  4QPK A;  2MK3 A;  1H8E G;  2WLL B;  3JAS A;  3AK3 A;  3W7T A;  4WFF A;  1KEC A;  3K0G A;  3VQX A;  1COW G;  4CC6 A;  4WBN A;  4LP8 A;  4YJ3 A;  3DC5 A;  2IM9 A;  1I08 A;  5JQG B;  4GX5 A;  2QDO A;  3VQY A;  4LF4 O;  4L87 A;  1B06 A;  1PNL A;  1W0K G;  2EIJ B;  3SJQ C;  1T5E A;  1TUB A;  2H3O A;  2W0X A;  3ZRV A;  5EK0 A;  4FLZ A;  3JD2 A;  1VQM V;  2PYJ A;  1FKA O;  1FAF A;  3RYI B;  4UB8 Z;  3P3N A;  4BR6 A;  1VQ8 V;  1AIL A;  2WLJ A;  2LO1 A;  2QSA A;  4AQY B;  5IY5 C;  5B1B B;  4DR6 B;  1XIL A;  2CTQ A;  1X4T A;  2ADP A;  4O4H A;  4K35 A;  2JGU A;  1AP6 A;  2EUL A;  1R3I C;  3FB7 C;  4A5U B;  4ZOL A;  3X2Q C;  1L0L H;  2VWJ A;  1AP5 A;  3T2M A;  1O9H A;  1Y67 A;  4JI4 B;  2BE3 A;  4DRX A;  5GTH Z;  3AG3 B;  5J2T A;  5EIB D;  1JFF B;  2XOK G;  2EIK C;  1VAR A;  3ABK C;  1Q8I A;  2R9I A;  3W7W A;  4WBN B;  2LJ2 A;  3A0B Z;  2UUC B;  4YJ3 B;  4G28 B;  4EEQ A;  3EFF K;  2EX3 A;  4PI2 A;  1PNM A;  3OR6 C;  1WJZ A;  2VS0 A;  4PHZ A;  4YXW G;  1TUB B;  1N32 B;  5LHH A;  4QPJ A;  1R6T A;  2VQE B;  4DV4 B;  5EZY A;  2R72 A;  5IDJ A;  4ZBM A;  4MSW C;  2B5U A;  2CTP A;  2XUM A;  2YC0 A;  1H2S B;  3FB8 C;  4RWU A;  4JI7 B;  1YVW A;  2OIE A;  2Y0I A;  1Q81 W;  1K7D A;  3K04 A;  5GTI Z;  5IWA B;  5JCO C;  4JI2 O;  1GO3 F;  1BS3 A;  1YSC A;  1QBZ A;  1MSD A;  3CRQ A;  3ZHV A;  3J81 N;  1X59 A;  4GX2 A;  1IBL O;  3CS5 A;  2FTK A;  3G71 V;  1N36 B;  1A32 A;  4GX1 A;  2DW4 A;  4F6R A;  4ZOL B;  2QA4 V;  2UXB O;  2JGD A;  4LFC B;  4X65 B;  1GN4 A;  2QWR B;  4DUY O;  3DSQ A;  5J2T B;  5K1X A;  5C93 A;  3BA9 A;  2UUA B;  1OJH A;  2W0F C;  3G6B A;  1SQB H;  3RGB A;  4XDL A;  1JJ2 U;  5CBH A;  3ZMV A;  2UXD B;  4UVC A;  1SC5 B;  4D7T A;  3CE2 A;  3RW0 A;  2HP8 A;  3JCU Z;  3QF7 A;  2A79 B;  5FL7 G;  3GWO A;  3DGE A;  1DGS A;  5EZY B;  4JI1 B;  5KMG A;  4DV2 B;  3LDE A;  2L35 A;  4DK1 A;  4JI3 O;  4TSF G;  3CCV V;  2CGO A;  4HNA A;  4LH6 A;  3T4Z A;  4HAM A;  1ZUQ A;  1AJQ A;  5BMV A;  4MTG A;  1UFI A;  1WP8 A;  1PP9 H;  2BSK A;  4PA7 A;  3MD0 A;  4F6R B;  4EB6 A;  1HWY A;  4UCU A;  2IU3 A;  5LBQ A;  2UU9 O;  5CA1 A;  2JGD B;  3UT5 A;  2DOS A;  1FFX A;  4TWK A;  4DV0 O;  4TV9 A;  5JCO A;  3R66 A;  3SYQ A;  2DN9 A;  1OCZ B;  2C2A A;  1AI7 A;  1EFR G;  5KHK A;  3ASO C;  3CCQ V;  1IBK B;  5LL6 Y;  3J80 N;  3X2Q B;  1AI6 A;  3C3S A;  2BCC H;  2OCH A;  1U96 A;  4B7K A;  1AR5 A;  3ZHS A;  1RM1 C;  5KMG B;  1VQ5 V;  3ABL B;  4GT1 A;  1WAZ A;  3ABK B;  1GAX A;  2AHY A;  1VQP V;  1DF4 A;  5BY1 A;  4HNA B;  1ZX3 A;  1L1F A;  1H38 A;  4UV8 A;  5BMV B;  2A7W A;  1NQT A;  2Q7G A;  4MTF A;  4DR5 B;  3E22 A;  1XNR O;  4EB6 B;  5B1N A;  1OCO C;  2Z3Y A;  1Q43 A;  3BEH A;  5CA1 B;  5BR8 B;  1M57 C;  4K8X A;  1FFX B;  5BZB A;  4G2K A;  1P4R A;  5L3G A;  4CBC A;  5KX5 B;  3B8M A;  5LOV A;  4IHJ A;  3T1Y B;  4R50 A;  1V54 B;  2F1M A;  5EC1 C;  4UXN A;  1AVM A;  5FPO A;  4QE7 A;  4D7S A;  3H01 A;  1W59 A;  3CC7 V;  2VQE O;  4DV4 O;  1AB3 A;  3RT3 C;  1LUV A;  4GKK B;  4JI7 O;  3CHX A;  1RSO A;  2UUB B;  3ETE A;  4JPR A;  4JI8 B;  5IWA O;  4P2Z A;  5CBG A;  2ZDI A;  5KUK A;  1PL4 A;  4H13 B;  2CGN A;  1JCH A;  3K0D A;  1N36 O;  3FYE B;  1YHQ V;  3UO3 A;  2AXT Z;  4W4K A;  4FM1 A;  1K3E A;  4UB6 Z;  4X65 O;  3BY6 A;  1N0N A;  2Q68 A;  2V4D A;  1AJN A;  4B3S B;  1KC8 W;  1SQF A;  2Q9L A;  4FMT A;  3ABT A;  3L74 H;  2N74 A;  2QJ1 A;  4X89 A;  2Z5U A;  5LOV B;  2JVD A;  4IHJ B;  4YHH B;  2UXD O;  4X1K A;  2R70 A;  3CSX A;  3SPI A;  3AK2 A;  1H2K A;  1HDJ A;  1QLE B;  5IJ0 B;  1ZAU A;  4JI1 O;  5IJ9 A;  5JJE B;  3FAV B;  4P30 A;  3OTF A;  2F4V B;  1RSO B;  1B6Q A;  3BHP A;  4FVM A;  3T1H B;  3S3W A;  4JYC A;  1NI8 A;  4GKJ B;  3ASO B;  2DYS C;  2H8P C;  4CS4 A;  1R3K C;  1GKF A;  3JAM N;  3FYI B;  1H2L A;  4LC1 A;  2OYQ A;  4UCR A;  4JI5 B;  5ITZ A;  3SYC A;  3D36 C;  1G6U A;  2ZR3 A;  1K4C C;  3CCJ V;  5CB4 A;  1NT2 B;  2E75 B;  3HR0 A;  3ABM C;  4LBE C;  3QO8 A;  3VQW A;  4X1K B;  3QNE A;  1QNM A;  1IBK O;  1EN5 A;  2JS5 A;  2FYU H;  3P30 A;  1OCO B;  4PA6 A;  2DQ3 A;  3VQV A;  5IJ9 B;  5EBM C;  1NR1 A;  1CXZ B;  3KKY A;  3GVM A;  3OE7 G;  1S77 D;  4LWS A;  2ODM A;  1Q82 W;  5L3C A;  4D6T H;  4TOI A;  3WB0 A;  2RNB A;  2X0L A;  1O9G A;  4JTA B;  3ASN C;  1Q90 D;  3CRC A;  3JAT A;  4DR5 O;  2CUG A;  5D5P A;  5B5E Z;  3SYP A;  1CPY A;  1LUW A;  1MA1 A;  1M90 W;  2OTL V;  1IDS A;  4JGS A;  5L3D A;  5ITZ B;  1YJN V;  4PV1 B;  3RN4 A;  4DV1 B;  3ZMZ A;  1G1X B;  1WPX A;  3L75 H;  5CB4 B;  2UXN A;  3WB2 A;  3K5N A;  3ETQ A;  3IJ4 A;  4NXM B;  1E1R G;  3SDL A;  1S3J A;  4Q6G A;  1THZ A;  2ILM A;  2HFE C;  2XAS A;  1IX9 A;  1I7F A;  3F7V C;  4MTO A;  4IL6 Z;  4RAI A;  3SYO A;  3E8H A;  2ZQM A;  3D36 A;  2UUB O;  4JI8 O;  3BVO A;  1OCC C;  4LF8 B;  3ZRX A;  3CME V;  1M56 C;  4FLV A;  1L0N H;  2IJH A;  1K97 A;  4I5S A;  4QNH B;  2XTA A;  3H9V A;  4NYK A;  1G4Y B;  3JAT B;  4EFE A;  2IU0 A;  1Q7Y W;  4NVP A;  1R6K A;  2Q6A A;  5LMU O;  2IH3 C;  1VIB A;  4B3S O;  3HKD B;  3T4D A;  2GUZ A;  4NXN B;  4E2L A;  1IBL B;  3SPC A;  3F5T A;  3JD3 A;  2OT5 A;  1B04 A;  2Z0A A;  2UXB B;  1BGY H;  1M4U A;  2ZE6 A;  2Y69 C;  1AR4 A;  4CZZ A;  1VQ7 V;  2M7W A;  2A06 H;  1V55 C;  2ETN A;  3U11 A;  2BTO A;  2Q5Z A;  3QO7 A;  3SJA C;  4AIL C;  3B77 A;  5H6R A;  5FLX N;  2PYL A;  3G80 A;  1PNK A;  4PI0 A;  3JSL A;  4DR4 B;  3AG2 C;  2F4V O;  2X7R B;  1ZWI C;  4N21 A;  1M9N A;  1S5H C;  2IJJ A;  1H8H G;  4UCO A;  3CB2 A;  3WG7 C;  1NZ6 A;  3RYF A;  2X6A A;  3UO2 A;  1P84 F;  3T1H O;  3ZN0 A;  1CEZ A;  3ZMS A;  4GKJ O;  1I0H A;  2H94 A;  5LHI A;  1YZB A;  3C90 A;  4UFZ A;  1RPO A;  2Q8V A;  4MVO A;  3G6E V;  3K9A A;  4JZG A;  3TCU A;  4JZ2 A;  2Q0O C;  1F7Y A;  5LP6 C;  2WLM A;  1PM9 A;  2F43 G;  5EBL C;  1ENV A;  3G67 A;  1WNS A;  5KAF Z;  1DTO A;  1H2N A;  4PA9 A;  4CH3 A;  4R7C A;  3IGA C;  2UU9 B;  1R73 A;  1RPR A;  3RBZ A;  4X1I A;  5L3E A;  3OGI B;  4DV0 B;  4MW3 A;  3OFN G;  4EKW A;  2EJ7 A;  1NR7 A;  1R3J C;  4X20 A;  1QR9 A;  3CYO A;  2PI4 A;  3EHB B;  5EC2 C;  1BQZ A;  1OCR C;  3UKM A;  3JSN A;  2EIN C;  2QWN B;  3FB6 C;  3RYF B;  2F95 B;  2XAF A;  1VMG A;  3AG1 B;  2JJ2 G;  4BW9 A;  1VF7 A;  1VEW A;  3QG5 A;  1N33 O;  3ZX6 A;  1W2B U;  2HHH B;  3H1L H;  2L6L A;  3D3I A;  1QHT A;  4EFB A;  3DXR A;  3DTU B;  3K3W A;  4JF3 A;  3STL C;  4YIO A;  3C3T A;  1OCC B;  3E8G A;  1Y76 A;  1LNQ A;  2NLJ C;  2ZE8 A;  4DV1 O;  1M56 B;  2P4V A;  3JAS B;  4DW0 A;  1XNR B;  1PL0 A;  1SF9 A;  1NVP B;  4J7Z A;  1K5Q A;  2HG5 C;  4NXM O;  3ML0 A;  3S3X A;  4X1I B;  2WA3 A;  4YJ2 A;  1WP7 A;  2XHB A;  5KHJ A;  2WA4 A;  3ZMU A;  1LR1 A;  2QWP B;  4X20 B;  2PY5 A;  5CA0 A;  1K73 W;  3OM3 B;  3RYC A;  2LW7 A;  3SYA A;  1SQP H;  4MVQ A;  3CXC U;  1Q86 W;  4LF8 O;  1HNZ O;  1TGO A;  3JD4 A;  3ZN1 A;  5B3S B;  2QM7 A;  1GN6 A;  1BHA A;  5E1A C;  2NNU A;  1HNX O;  1V55 B;  1P49 A;  1N0J A;  4JI0 O;  3IAY A;  2WWW A;  4PDL A;  2JDI G;  2VRZ A;  1QVF U;  4DR1 O;  4G27 B;  1XNQ B;  4O4H B;  3BAB A;  3T1C A;  3ZIA G;  1NBM G;  3UCS C;  4PA3 A;  3WB1 A;  4BIO A;  3SJB C;  2Q73 A;  4DXW A;  4NXN O;  3OD4 A;  4MVU A;  1FPO A;  3CRR A;  1XDC A;  1FFT B;  1KU9 A;  1BZK A;  1XL6 A;  1QR8 A;  4DRX B;  1I94 B;  5D5Q A;  4YJ2 B;  5IE9 A;  1DF5 A;  2HKO A;  4UUJ C;  3SR2 C;  4NKG B;  2P67 A;  4RQE A;  2WLK A;  3OMA B;  1WA8 A;  2CDY A;  1F23 A;  2W6I G;  5CA0 B;  4DR4 O;  1MMM A;  1J95 A;  3RYC B;  2ZKO A;  4LF7 O;  3HB3 B;  2XAG A;  5JVD A;  4DV7 B;  3OAA G;  3A8T A;  3D3Q A;  2KG7 A;  4TT3 G;  3K57 A;  2AGA A;  1FYJ A;  1JMK C;  3HPL C;  4B3M B;  4K8Z A;  4LF5 B;  1HNW O;  1KP3 A;  5J2U A;  4JYY A;  3RVZ A;  2RN9 A;  4ZKI A;  1KD1 W;  1SS3 A;  4DV5 O;  1BHB A;  4KXR A;  2QWQ B;  4WF9 V;  3TGU H;  1OCR B;  4U3J A;  3FX7 A;  1S72 V;  4U3F H;  1VQO V;  2DJV A;  1AR1 B;  1KKC A;  3SPG A;  1NU1 H;  3BPZ A;  1H2G A;  1F4N A;  5IY5 B;  1S5L Z;  2LFR A;  1D5N A;  4J11 A;  1WA8 B;  4HBN A;  4MS2 A;  5EBW C;  4LF6 B;  1YJ9 V;  5LYJ A;  2OCC C;  5JVD B;  2K1E A;  4DR2 B;  2KG7 B;  1GM7 A;  4MT8 A;  3B09 A;  2A3Q A;  3LDD A;  1VQ9 V;  5B1O A;  3JAL A;  1KP2 A;  2EIK B;  4XDJ A;  5J2U B;  4JAA A;  2HHH O;  2RQ6 A;  3EXA A;  2BTQ A;  2UXC B;  2N05 A;  2EIL C;  1YIT V;  1Z5V A;  2ZIO A;  1V9P A;  2JEU A;  2BSK B;  1XMO O;  4CH5 A;  4J7J A;  4GX0 A;  3IC7 A;  5F2V O;  3UT5 B;  4RQF A;  2HJD A;  2N04 A;  3ZMT A;  2OWO A;  5KA6 A;  4PDV A;  2RCV A;  5DN6 G;  4TV9 B;  4WFG A;  4QJF B;  3OR7 C;  2P7T C;  2GSM B;  4R6Z A;  1KQS U;  5LA6 A;  1TAE A;  2BOC C;  2QEX V;  4BIU A;  3GB7 C;  3OTO O;  3M99 B;  5LYJ B;  2XND G;  4UVA A;  2GHY A;  4FIP C;  1MG1 A;  1M1K W;  3R65 A;  4PJ0 Z;  4OGQ B;  2PI5 A;  4MVM A;  4HZ3 A;  2QM4 A;  5IYB O;  3JAL B;  2QE7 G;  1URF A;  3B8N A;  3IFX A;  2P4K A;  3RVY A;  1EN4 A;  2P6J A;  3ZCC A;  3TK1 A;  1XNQ O;  1MZE A;  1VQK V;  5H2F Z;  1YEW A;  1R1B A;  3VBB A;  1NVP D;  1BSM A;  3AG4 C;  4CH6 A;  1IUR A;  3E22 B;  5B1A C;  1XOU A;  1K4D C;  1M5I A;  2LW1 A;  4CH4 A;  4CS2 A;  1MZF A;  3AG7 A;  5LMU B;  1I94 O;  4LFB B;  2YUA A;  4KL1 A;  5C8Y A;  5JJN B;  3MHH C;  3CCU V;  2QKC A;  1R3L C;  3M8A A;  5DEC A;  5GON A;  2Y48 A;  4DK0 A;  4DV7 O;  2QGN A;  5L3B A;  4FFB A;  4I9Q A;  2ARH A;  1N4C A;  2IBZ H;  1SKV A;  2JEX A;  2OTJ V;  3E35 A;  4JAU A;  3HKB A;  1BQ0 A;  2JK5 C;  1WB8 A;  4B3M O;  3E83 A;  4LF5 O;  3CWB H;  1BE3 H;  1RFY A;  5TIS Z;  1JVM A;  1ARO P;  4FLU A;  2YIB D;  4TUY A;  4BIZ A;  2CTW A;  2YDE A;  2ZIM A;  2ZE5 A;  2M6Y A;  2B1G A;  1NJI W;  1GK9 A;  2XAQ A;  3ZHR A;  1UJW B;  3HKC A;  4JYA O;  2QKS A;  5BXZ A;  2Q4P A;  2WLH A;  5KAI Z;  2YS8 A;  4QE9 A;  4UCS A;  5GW7 A;  1RM1 B;  2LQT A;  5LXT A;  3BA8 A;  5C8Y B;  3OW2 U;  5J9P C;  3OEE G;  2EIL B;  4B08 A;  2DMX A;  4LF6 O;  3CC2 V;  2QWO B;  5GON B;  3K9S A;  4N23 A;  4LFA O;  4DR2 O;  2P22 C;  3CX5 F;  4ICG A;  1FXK C;  2FL4 A;  3K5M A;  3ICX A;  2KSD A;  3U10 A;  2CAZ C;  3HKB B;  1M57 B;  3JCZ A;  5E79 Z;  4ZI7 A;  2XAJ A;  4IYI A;  3BCC H;  1Q5O A;  2FML A;  4L8J A;  2UXC O;  1EN6 A;  1WPB A;  4P9O A;  1NH2 D;  4TUY B;  3A0R A;  2JIZ G;  4O4L A;  3ZBH A;  1US6 A;  1N33 B;  3HKC B;  3TJT A;  1K33 A;  4KHP B;  2JRI A;  3H1I H;  5LXT B;  4MVS A;  2KB1 A;  4DUZ O;  4I55 A;  1Q6H A;  5FPR A;  1MAB G;  2CK3 G;  4IGG A;  4X64 O;  4PD4 F;  2P06 A;  2VWK A;  2HR3 A;  4MW8 A;  4WFB V;  4F6E A;  2WLI A;  1E1Q G;  2DYR C;  4TV8 A;  2B1I A;  4DR3 B;  3LUT B;  2IW5 A;  5B1A B;  3KCX A;  4FK5 C;  3JD0 A;  2FKX A;  2EIJ C;  1R6N A;  4ZI7 B;  1K92 A;  3CJH A;  4MVR A;  2UXX A;  3W7X A;  4LWS B;  2XT9 A;  2YXL A;  4LNU A;  3B2E E;  1HNZ B;  2Y4T A;  1KMI Z;  2VQF B;  3KCY A;  2K9P A;  3J7A U;  4O4L B;  4O2A A;  4UCT A;  5B1B C;  1HNX B;  1FXK A;  4JI0 B;  1XEQ A;  1SZX A;  1GH6 A;  1OHH G;  2AHZ A;  5LGT A;  5H9C A;  1XMQ O;  4DR1 B;  3OT7 A;  1JA8 A;  4LFB O;  1XHX A;  4RO2 A;  1JQ0 A;  3LSS A;  2RMK B;  2ZM6 B;  2IJK A;  4I4T A;  3IC9 A;  3I55 V;  4I55 B;  1YXB A;  1ZL8 A;  1EM1 A;  3AG3 C;  3ZRW A;  1MNG A;  2DYS B;  4IYH A;  2EBO A;  1K8A W;  1BL8 A;  2WLI B;  4TV8 B;  3Q4H A;  3E8B A;  1IVS A;  1RP3 B;  4O2B A;  1Y66 A;  4W4L A;  5CA3 A;  3JD1 A;  2ZT9 B;  3H1J H;  4F4L A;  5CBF A;  4JTC B;  4Z2W A;  4X1Y A;  2WLL A;  4LF9 B;  1Q6I A;  3H1H H;  4LF7 B;  4NTW A;  3CJH B;  4FLY A;  2ZCE A;  3CXH F;  2E76 B;  1Y74 A;  4JAV A;  1K9M W;  1Q6U A;  3ABM B;  4I7Z B;  3LSQ A;  3APO A;  3E86 A;  5CMU A;  4WCE V;  1UPG A;  1HNW B;  2WLN A;  4AHC A;  1FXK B;  2HVJ C;  3A0H Z;  2LGW A;  3SPH A;  1KUQ A;  2KKW A;  1NKD A;  1VP7 A;  4LR3 A;  4DV5 B;  3CD6 V;  4OX9 O;  1I5X A;  3M7M X;  2GUZ B;  3KG2 A;  1MSW D;  4CC5 A;  2NR5 A;  1ZL8 B;  3HKE A;  3U0Z A;  5LMN O;  3P32 A;  5JJJ B;  1VF5 B;  3ZRW B;  3CCE V;  3ASN B;  2KQX A;  4J9Z B;  4FPP A;  5DM6 V;  1D2D A;  2YID A;  4NTY A;  3Q4H B;  4X62 O;  2E5L B;  1N34 O;  4RUF A;  1P7G A;  3O9O A;  3FB5 C;  4H33 A;  5KUM A;  4H44 B;  1FJG O;  4X1Y B;  3VOU A;  2WAM A;  1TUE B;  5IYZ A;  3ETG A;  1P7B A;  1Y74 B;  1DK1 A;  3ZJZ A;  1JFF A;  3OMN B;  3OEH G;  2E3C A;  4PEL A;  1U97 A;  5DED A;  2DYR B;  2GDS A;  4DR7 O;  4P9P A;  1GN2 A;  3L70 H;  1YDX A;  4X9Q A;  3ABU A;  1GTO A;  3K5L A;  1IBM O;  4KHP O;  2LP7 A;  1I5Y A;  2YIB A;  2CE4 A;  3F7Y C;  1PD3 A;  2D3O W;  1K34 A;  1XMO B;  1TVK A;  3HKE B;  3F5W C;  3CCS V;  4DR3 O;  3PJS K;  1S76 D;  2P5O A;  1OCZ C;  1SQX H;  3JAK A;  3L73 H;  5LP6 A;  1J5E O;  3STZ C;  3CRA A;  2F23 A;  4GUN A;  5IYD O;  3ETD A;  1HW7 A;  4X88 A;  3OTO B;  4FFK A;  3CCR V;  4JI6 B;  2ZIN A;  4E4E A;  1PPJ H;  5IYZ B;  2YI8 A;  3OGC C;  4YIP A;  1Y4M A;  3B40 A;  3ABL C;  2VQF O;  4ZIB A;  2Y69 B;  4BWA A;  1QLN A;  4ZHQ A;  1L8D A;  4GZR B;  4AI8 A;  3D8C A;  3CP1 A;  1XI1 A;  4JTD B;  4Z1V A;  1S0V A;  3DXR B;  3AG2 B;  3K5O A;  4C7U A;  2IH1 C;  2ZM6 O;  3BRC A;  2GBO A;  3WG7 B;  1Y76 B;  3K79 A;  4J9Y B;  1TVK B;  5HFM A;  2YXH A;  4IIJ A;  1YTF B;  4DW1 A;  3L72 H;  2LFS A;  2QM8 A;  4H0L B;  1M93 A;  3JAK B;  5LP6 B;  4KUM A;  5FNV A;  1V54 C;  1B3Q A;  4K0K O;  1Q3E A;  1WLE A;  4LF9 O;  2NN4 A;  1OV9 A;  1ZTE A;  5KA5 A;  1CP9 A;  2ZE7 A;  3L9D A;  4U7N A;  2CH7 A;  2X6B A;  1G8M A;  4ZHQ B;  3A2F A;  5KHI A;  4J10 A;  4OPH A;  3CPW U;  3K06 A;  2DWD C;  1KBH A;  4Z1M G;  1NH2 B;  4U7O A;  4B3T B;  4GCZ A;  2EIN B;  1JPX A;  1XL4 A;  2EJR A;  3AEI A;  4JYA B;  3LDC A;  1F51 A;  4IIJ B;  1ROP A;  1EZV H;  4B3R O;  2XAH A;  2E5L O;  3ZRS A;  2WPD G;  4I0X A;  4X66 O;  4DV3 O;  3RYH A;  2O57 A;  5FNV B;  2D2C B;  2QR4 A;  3CCL V;  2EIM C;  4BW5 A;  4LFA B;  1QLE C;  4KP4 A;  4DO2 A;  4I50 A;  1ORQ C;  2DE0 X;  3CC4 V;  1AJP A;  4MVZ A;  1JR9 A;  1FS0 G;  2CH7 B;  4LCU C;  4O4I A;  1JJO A;  4WFH A;  5KX5 A;  2GTA A;  1JOY A;  2B9Z A;  1E79 G;  3B4S A;  4OXS A;  3OUS A;  2ZDI C;  3MAQ A;  5CN0 A;  1BT8 A;  2E74 B;  2ITC C;  4DV6 B;  4FZ1 A;  4FZ0 A;  2A9H A;  4J80 A;  4U3J B;  3QTC A;  1YCI A;  1BCC H;  1NTM H;  1SES A;  2ZD9 A;  5IYC O;  2ZNI A;  4DYL A;  2DQ0 A;  1GM9 A;  3TXS A;  3SPJ A;  4AQY O;  4DR6 O;  4FLT A;  4FM2 A;  2PF4 E;  3UQ8 A;  4DUZ B;  4IT5 A;  4I0X B;  1VQ4 V;  3JYC A;  1KKD A;  3JAW A;  2AZ2 A;  3RYH B;  3JAR A;  2CTR A;  4I9W A;  5A9G A;  4NR1 A;  1KB9 F;  4X64 B;  1VQL V;  4Q20 A;  5LHG A;  1VF6 C;  3EVK A;  1WB7 A;  4JI6 O;  1PV0 A;  1XRE A;  3QO5 A;  1YJW V;  5EIB C;  4JI4 O;  1S5J A;  4HYO A;  1MOF A;  3I5D A;  4I50 B;  3APQ A;  1XUQ A;  2Q67 A;  2HJF C;  3O65 A;  2YI9 A;  4O4J A;  4X8A A;  3MHS C;  2YSU B;  3K59 A;  2Y4U A;  4FLX A;  4O4I B;  2MW2 B;  5JH7 A;  2HLD G;  2PGG A;  2UUC O;  2BTQ B;  4J42 A;  2A0L A;  4NB5 A;  4QIW F;  2Q69 A;  1GN3 A;  1N32 O;  5IJ0 A;  2PTM A;  5LGN A;  1SRY A;  3FAV A;  4QGP A;  3K03 A;  1IXM A;  5L3F A;  1D5A A;  1XMQ B;  5B66 Z;  4MTX A;  1QQC A;  3WU2 Z;  2YEV A;  2F93 B;  3JAW B;  3ZHU A;  1VQN V;  1QCE A;  3JAR B;  5LA6 B;  1HR0 B;  1GRJ A;  3ZHT A;  1OZ0 A;  3N2K A;  4YY3 B;  1SQQ H;  1NTK H;  3E8F A;  3KZI Z;  5H5N A;  4LFC O;  2Q0A A;  5KHG A;  1KYO F;  3SJC C;  3FD9 A;  3PN1 A;  1PKX A;  2YIC A;  4O4J B;  3ZS8 C;  3L71 H;  2UUA O;  3FKS G;  5JH7 B; 
#chains in the Genus database with same CATH homology
 2HP8 A;  2LQT A;  1Z2G A;  2RNB A;  1HP8 A;  1U96 A;  2LGQ A;  1U97 A;  2RN9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...