1BQZA

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bqzA00
2N04A 1WJZA 3BVOA 2QWQB 2PF4E 2DMXA 1HDJA 1FPOA 2GUZA 3AG7A 3UCSC 2CTRA 3APOA 2L6LA 2CTQA 4J7ZA 3APQA 2QWNB 1XBLA 2M6YA 1GH6A 2LGWA 2CTWA 2DN9A 4IT5A 2LO1A 4RWUA 2N05A 3UO3A 2QSAA 2QWOB 2OCHA 2GUZB 1BQZA 2CTPA 2Y4TA 2YUAA 2Y4UA 2CUGA 2EJ7A 1BQ0A 2QWPB 2KQXA 1N4CA 4J80A 1NZ6A 3UO2A 1FAFA 1IURA 2QWRB 2YS8A
chains in the Genus database with same CATH superfamily
1Q6UA 5EZYB 4LF9B 1Y74A 4LNUB 3K59A 2HG5C 4LF7B 2XT9A 1NH2D 3VOUA 2AGAA 3H1HH 3A0RA 1M90W 4GX5A 4F6EA 1HNXO 3E86A 1F51A 4FVMA 2VQEO 1BQ0A 2IU3A 1A32A 3SYAA 4PV1B 3SYQA 1AILA 4B08A 3SJQC 1L0NH 3H1IH 1YIJV 5FPRA 2A0LA 3QTCA 1YTFD 2W6IG 5FPOA 3ABMB 4X89A 1AI5A 3UM7A 1PP9H 5KHKA 2Y4TA 4B3SB 1MZEA 5C93A 1SQXH 3JATA 1JCHA 2YIAA 3W7XA 5LOVA 1WJZA 4O4HA 4OPHA 2EIMB 3CSXA 4UUJC 4N21A 4TV9A 4ABMA 1MABG 5LMNO 1N36B 1XL4A 4PA4A 2JDIG 2P6JA 3ETEA 3OGIB 2GTSA 2IH3C 3D3IA 1XREA 4GUNA 4UXNA 5LGUA 2YUAA 3BABA 1URFA 2BTQB 3CCRV 2KG7A 3CCEV 1VF7A 3ABKC 4PJ0Z 4D6TH 2WLIA 2X6BA 2Q4PA 2ZT9B 1IDSA 4PA7A 1YI2V 3OTOB 1W0KG 2WLHA 2QSAA 1IBKO 2BTOA 2OYQA 2JGUA 4DR5B 1E1RG 2WPDG 3UO2A 1NKDA 4UV8A 2IJIA 2NN4A 4JYAB 1S0VA 1RP3B 1HDJA 3K08A 4B3MO 5D5PA 4J42A 3CE2A 4O2BB 1XI1A 4LF6O 2M7WA 3T1YO 3K0GA 4F4LA 1K33A 1FFXB 3M7MX 3FYIB 2PI5A 4XDKA 1PNKA 1J95A 5E79Z 3Q4HB 4GX1A 1NVPB 1G6UA 1PV0A 2M6YA 4LH7A 5JVDA 4FZ1A 4JI1O 1KUQA 3ZIAG 2V7QG 4OX9O 3ZBHA 1ZL8B 1S72V 2LW1A 1TVKB 3ABMC 1RSOB 1EZVH 5JWPA 1OV9A 4AHCA 5F2VO 2QKSA 2UXCB 3VBBA 2DQ3A 2RQ6A 3LDEA 4JI7O 2UU9O 3OD4A 1M4UA 3IAYA 1FXVA 1N34O 1I7FA 2EIMC 2YICA 5EBMC 2XAQA 3ZJZA 2RDCA 3IJ4A 2QEXV 4IHJB 4LF7O 3EVKA 3BPZA 4X1IA 4FLZA 2BCCH 1VQNV 2LGQA 3QO7A 4YJ2A 2ETNA 4AQYB 1JJ2U 3ZHQA 3PN1A 5IDJA 2OCHA 2EJ7A 1NT2B 1GN4A 2DW4A 1M56B 1GM9A 4TUYA 1H2SB 4CS2A 1XMOB 4DV5O 4B3SO 5L3FA 4OPAA 1WP8A 1JQ0A 1US6A 2DYSB 2E74B 3K5LA 4DR7B 4JI8B 3ML0A 2D2CB 4X8AA 3JD2A 3L71H 4LNUA 3A8TA 5LMUO 1R3JC 1HW7A 1N36O 4LCUC 5FLXN 5KA6A 1H38A 3TGUH 4B7EA 5JH7B 5L3EA 4FFBA 2ZQMA 3E83A 5EBWC 3F5TA 3T4ZA 3M99B 2QM8A 4RAIA 3W7WA 2HVJC 2V4DA 3F5WC 3GWKC 3LUTB 4TQDA 1F7YA 3OTOO 2GUZA 3CS5A 1F4NA 2WSSG 4MTGA 2OIGA 2KB1A 2XAJA 4DR5O 4HYOA 4GZRB 2WA4A 3K03A 4YHHB 4IIJA 4JYAO 2CH7A 2YEVA 4K35A 1YF2A 4GCZA 2IJJA 3BEHA 3JAMN 1G4YB 2VQFB 1BL8A 3N27A 3U10A 1BT8A 3K9SA 3CPWU 2ZCEA 3LSUA 1O9GA 2UXBB 5IYDO 1YZBA 3HKBA 5IJ0A 1V55B 4B3RO 4GT1A 1RPOA 3CRQA 3FB7C 4I4TB 4WBNB 3HKDA 3CP1A 5B5EZ 4JYYA 3PJSK 4ASUG 4KUMA 1H2LA 5KHHA 1SA0B 3AG4B 4DUZB 4R8CA 4BR6A 3CCVV 5ITZB 3JYCA 1M56C 1U96A 4DV1B 4KFMA 1JR9A 5JJEB 4G2KA 3ZN0A 3K57A 3AEIA 1Y74B 2UXCO 2ZE8A 3OR7C 3S3XA 2ATKC 4TT3G 1IURA 2Q7HA 3ASOB 3BA8A 1XEQA 4CS3A 4P2ZA 4DR3B 1K5SA 4JV5O 3B8NA 4FM1A 3VQWA 5BR8B 4J9ZB 1S76D 4LFCB 1BZKA 2F66C 3KZIZ 1DGSA 1VF6C 4EFEA 1FD9A 2O57A 1KECA 3OMIB 2XHBA 5KHIA 2DWDC 5EYPB 2YI9A 5J9PC 2Y0PA 1IBMB 1AB3A 2HEPA 3ASNB 2YI8A 1BCCH 2EBOA 2Q8VA 3CMEV 4NYKA 2OTLV 2ZR2A 1P4RA 1NTKH 1P7BA 3ZMUA 4B3TB 4WF9V 1ZL8A 4PDMA 3JATB 2X6AA 4GYCB 1RSOA 4O4HB 1YJ9V 3E8FA 1GRJA 4TV9B 3D36C 1S5JA 2R9IA 1MNGA 2PY5A 2FMLA 2X6CA 4X20B 4JI8O 4Q20A 2OTJV 1GH6A 2YXLA 2KG7B 4CBCA 3C3TA 3FX7A 3CCUV 2WLIB 2R9RB 2E3CA 2OIEA 2Z0AA 1IBLB 4LF8O 1KQSU 3ZCCA 1V55C 2ZE7A 4LP8A 2DYRB 2F95B 2UUAB 4IT5A 3RGBA 4MT8A 2Q73A 1K73W 3L74H 5LMNB 5JCOA 1HWYA 1BE3H 3APQA 3IFXA 4H0LB 3HB3B 1F4MA 1R3KC 5BZBA 5A9GA 1VMGA 1CXZB 1E79G 4NKGB 1TUBA 1DF5A 1WLEA 2QWNB 3SGIA 1FXKC 2LO1A 2QDOA 4FK5C 1GN2A 1FYJA 2HJDA 1ZWIC 1L8DA 3WB2A 4FLWA 2WAMA 2Q6AA 4CC5A 5JVDB 3ETGA 3F7VC 1IBKB 2EZPA 2ZE5A 1N33B 4TSFG 2CTQA 2LGWA 2ITDC 4G27B 3OM3B 5EK0A 1Q43A 3MAQA 4B3MB 4DUZO 1HR0O 3ZX6A 1COWG 5EIBC 2QWPB 3MDSA 1K92A 3W7TA 2BE3A 4LF6B 1QLNA 5LHGA 1R6TA 2P90A 3N2KA 3D36A 2X7RB 3T1CA 3BRCA 4DR1B 3NR7A 5L3CA 4NB5A 3JAWA 3ZMSA 4CH6A 4PELA 4O4JA 1SQVH 2Q7GA 2AZ0A 2ZM6O 4YXWG 3SPIA 2R9AA 2JJ2G 4J9YB 4DR3O 1R73A 4FLXA 4YJ2B 5BR8O 5FNVA 3JARA 1NZ6A 4MVSA 2YDEA 2AHYA 5CA1B 2F93B 4WFBV 1VARA 2OT5A 1GM7A 4I4TA 4DR6B 4OX9B 4QJFB 1IXMA 4IYIA 3ZHTA 4UVCA 3OT7A 1IBMO 4E2LA 1PPJH 4K3AA 3VQYA 2JJ1G 4TUYB 2IBZH 1QNMA 3K04A 4JI7B 2WLMA 1N4CA 1NR7A 4B3TO 1VQ4V 1N34B 3QNEA 1Y6XA 4GKJB 4I50B 3DSQA 4P30A 4DV4O 2QE7G 4HBNA 4DUYB 1FS0G 2R70A 4BW5A 1FXKA 2Q9LA 1HNWB 2QR4A 4BWAA 4DV7O 2PUSA 3ICXA 2XUMA 4FFBB 2H8PC 1BHBA 3SYPA 1BS3A 4WFAV 4JYBA 4MTOA 5EYPA 4O4LA 3CMAV 1QCEA 5LA6A 1P84F 3U11A 5H6QA 3CC4V 1IBLO 5CBGA 1JVMA 3F7YC 1G1XB 4KHPO 2GUZB 4DV5B 1GN3A 1QQCA 2FB5A 1LR1A 2KSDA 4CH3A 2A9HA 1FAFA 4IL6Z 3DXRB 1M93A 2UUAO 3H1KH 2K9PA 1AP6A 1OHHG 4IIJB 4B7KA 3FFQA 3CJHA 4F6RB 4NR1A 4NVPA 2CH7B 2YEVB 5LMUB 4PDLA 1I08A 2QM7A 2Q5ZA 1ZAUA 1TAEA 4X20A 3ZRXA 2EJRA 1YVWA 4YY3B 3WB1A 1UJWB 3HKBB 2P4KA 5H6RA 2ODMA 5IJ0B 2XAGA 1JFFB 4YIOA 2PYJA 3HKDB 1AROP 5LYJA 1T5EA 1XNQO 1XHXA 2UUBB 1U97A 5EC2C 3E22A 4JAVA 1N33O 4ZIBA 4X66B 4PA3A 3BVOA 1JPXA 1D5NA 5JJNB 4JI5B 1NJIW 2IM9A 5IY5C 2IW5A 4ZOLA 3BY6A 4WCEV 3CRRA 1BQZA 3CXCU 2Y4UA 3DGEA 4DR1O 4DR2O 2JGDA 2WA3A 3E8BA 2FYUH 4B3RB 3JSNA 2LQTA 2VWKA 1FPOA 2E5LB 1L0LH 3UCSC 4CH5A 2Q0OC 5BXZA 4J7KA 2IJKA 4X64O 3MHSC 3H9VA 1KP3A 2AXTZ 4BIZA 3RYCA 4DR6O 1NU1H 1KYOF 3WB0A 2VWJA 1WP7A 4PDRA 4GKKB 1B6QA 2OCCB 1O9HA 2JS3A 2EIKC 1IVSA 1K4CC 3O65A 2ZD9A 4EEQA 4R50A 3B09A 4DK0A 5DECA 4UCRA 3OE7G 4JV5B 1K5QA 1D5AA 4HAMA 3CC7V 3AG3C 1PM9A 4LF4O 4DV3O 4GKJO 3UT5A 3P3PA 2B9ZA 3ZMVA 4GX0A 1ZX3A 2F4VB 2YS8A 2YC0A 3JD1A 2YIBD 4DUYO 4LF5O 4I9WA 3SJAC 5C8YA 1HNWO 4Z1MG 4UFZA 2W6JG 5IYZA 1QBZA 4AI8A 1R1BA 4EKWA 3DC5A 3QO5A 5CA1A 1YSCA 4Z2WA 1BHAA 5IE9A 4JF3A 3LDCA 1SETA 4LC1A 4JI3B 4LFBO 1TUEB 1Q3EA 4DV2O 3G6BA 3OTFA 1H2NA 5BMVA 5KHJA 4FM0A 2HR3A 2XAHA 4MW3A 1VQ9V 1SESA 3TXSA 3BAAA 5LGNA 2ADQB 4GLXA 1YCIA 4H33A 3B4SA 4QIWF 1Q90D 1EN5A 2NNUA 1SS3A 2PGGA 2L35A 4I50A 5B3SC 2AZ2A 1TUBB 2QM4A 1QVGU 2MK3A 4I55A 2Y0IA 3H1JH 1S77D 3R65A 3CRMA 2QJ1A 1VQKV 4PA9A 4DW0A 4LF8B 2Q69A 3STLC 4YY3O 3FKSG 1XDCA 3H1LH 4DRXB 3TJTA 4Z1VA 5J2UA 2ZINA 1YEWA 2PZSA 2UUBO 4X65O 4J7JA 4CH4A 3K0DA 1GTOA 3RN4A 3SPHA 4OGQB 3DC6A 1N32B 2OCCC 3DXRA 3UO3A 3N2KB 4X66O 1NVPD 1SQQH 1EN4A 4L8JA 1GKFA 5LGTA 3JAWB 4F6RA 3DTUB 4FFKA 4JI5O 4O4JB 3TK1A 2B5UA 3K5NA 1VQ7V 3P32A 2DMXA 3NXSA 4HNAB 1Q7YW 2L6LA 3RVYA 1SQGA 3ZN1A 5FNVB 3JARB 2DN9A 4UB8Z 2XTAA 2RJZA 4BAYA 1JFFA 3E8HA 4MVZA 2H94A 4NTXA 2E5LO 5H5NA 5B1AB 4NXNO 4BW9A 1WB7A 2Y69B 3JD0A 3FYEB 1TA8A 3CWBH 1HR0B 2P67A 3JD4A 5KLVH 4FLYA 4GKKO 1V9PA 4I7ZB 1YITV 4PHZA 1I5YA 1Y76B 5JCOC 2WLJA 3ZMTA 1HNZO 4JI0O 1OJHA 4O2AA 5KA5A 1SC5B 2ZM6B 3ZRWA 1WN7A 1FXKB 4O4IB 5KAIZ 1J5EB 1L1FA 4D7TA 3AG7A 3APOA 2FL4A 4FLTA 1PNMA 1VQPV 2QGNA 1WAZA 1QHTA 3JALA 2F4VO 4TQFA 2HKOA 3J81N 4J10A 5IYCO 1ZTEA 4O4LB 2YSUB 1MOFA 5LA6B 1SZXA 4DV0B 2CDYA 5CB4A 4I5SA 3ZMZA 2QKCA 4K0KO 1DF4A 4K8XA 2WLLA 2EINB 5CA0A 4JI3O 2BOBC 1SKVA 1BGYH 3IGAC 4QE7A 1ROPA 5K1PA 4DV4B 4R7CA 3N2GB 3FAVA 3FD9A 3CJHB 1JJOA 4KXRA 3A2FA 4A5UB 1EN6A 1XNRO 4AILC 4DV7B 1N0JA 4U7OA 3CCMV 3JD3A 2LW7A 1H2KA 2Z3YA 1XMQO 2UXNA 1AR1B 3G71V 5KUKA 5L3DA 1OZ0A 4UCTA 1JMKC 3CRCA 4FZ0A 2E76B 5LYJB 4JAAA 1KKDA 4MVOA 2LFRA 3CB2A 1MA1A 4YJ3A 4KHPB 3GWOA 4JI4O 5BY1A 2RCVA 3OUFA 3E22B 3B40A 4N23A 4ZKIA 2XOKG 5B1AC 4PI0A 1SF9A 2Y69C 1NR1A 1GM8A 4H37A 1RM1C 2QWOB 3C3SA 4ZBMA 5GTIZ 5JJJB 3OMNB 3FB8C 2F23A 1VQ8V 3HKCA 1XOUA 3OEHG 1N32O 4ZOLB 1NH2B 3JCUZ 1CP9A 3G67A 2GV9A 2R72A 4X9QA 1GAXA 2JGDB 3SPJA 4MSWC 1R3LC 1NS1A 2ITCC 2WLNA 4W4KA 2RN9A 4JGSA 1Z5WA 1H8EG 3S3WA 1XNQB 4PI2A 5CA3A 2ZR3A 3OW2U 3U0ZA 1TGOA 1AJPA 1JA8A 4DRXA 2LJ2A 1PKXA 1XQ8A 3GB7C 5H9CA 3RYCB 2EX3A 4JTDB 4J7ZA 2G38A 4NXMB 3K9AA 3LSSA 3HR0A 1GN6A 3WG7B 2N05A 2D3OW 4MVQA 1N8RW 2VRZA 3RT3C 2EINC 4P9PA 4U7NA 1MG1A 3X2QC 4X62O 1R3IC 1EZJA 1OCRC 2BOCC 3RBZA 4QE9A 1KKCA 1AVMA 2YXHA 4R6ZA 1G8MA 2HHHB 3I56V 4DR2B 3UT5B 4PDVA 1AI6A 4QPKA 2JS5A 2EULA 4WFFA 2ZNIA 1PNLA 4PD4F 5EIBD 5C8YB 3I55V 2ZDIA 2ZNJA 4HNAA 4UV9A 1J5EO 2HVKC 1VEWA 3H01A 1HP8A 3CXHF 4XDLA 4X64B 5IYZB 4W4LA 2IH1C 4DK1A 1P49A 3A0HZ 3SPCA 1S3JA 5BMVB 3L73H 3FB5C 4J11A 2P7TC 4FM2A 4UVAA 4DV0O 1AJNA 3ZEDA 3JCZA 1KP2A 1UFIA 5KMGB 4KP4A 4TWKA 4TOIA 4EB6B 4JASA 2JVDA 5IY5B 3J7AU 3ZRVA 3EFFK 2RNBA 3RYHA 4LF4B 4DV3B 1Y76A 1KU9A 2C2AA 2MW2B 1I94B 2ZIOA 1GK9A 1SERA 3JASA 2HFEC 1B3QA 4I55B 1IZ3A 4LF5B 2E75B 4G28B 4O4IA 3P3NA 1K3EA 1VP7A 2QKAA 3MHHC 3D3QA 3BFRA 1QR8A 3CYOA 3WU2Z 4D7SA 1SQBH 4YIPA 1NTMH 4ZI7A 1OCZB 4MVUA 2PTMA 1MMMA 3HKEB 3LSQA 3CCQV 1S5HC 2CTRA 3QO8A 4LFBB 3JSLA 4DV2B 5J2UB 1B06A 4RO2A 4I0XB 3QF7A 4TV8B 1FJGB 5JQGA 2P06A 1QR9A 1OCCC 2EIKB 3P30A 4HZ3A 4DR4O 2HP8A 3CHXA 3IC7A 5IWAB 3WG7C 3SJCC 5EBLC 3D8CA 3AG3B 3N2GA 5CMUA 1W59A 1WB8A 1SRYA 1JOYA 4C7UA 3ZHRA 3B8MA 3AG2B 3OUSA 4X88A 2VS0A 2F43G 1KMIZ 3T2MA 5KX5A 5A2QN 4WFGA 4L87A 1K97A 1B04A 1BMFG 1WPBA 2ZXWB 2HLDG 2B1GA 4KL1A 1Y67A 3LNNA 5B1OA 4X65B 4I9QA 5LHHA 1M57B 2UXDO 4JAUA 5CBFA 3J80N 4NXMO 5LP6C 2GTAA 1P7GA 1PL0A 2JK5C 5B3SB 5B66Z 4O2AB 3ZRWB 3K58A 2W0XA 3IC9A 2BSKA 1LUWA 2EZOA 2HHHO 2QWRB 3JALB 1I0HA 3O9OA 2EILC 4NXNB 3L9DA 3RWRD 1OCZC 1AR4A 1AI7A 3ZRSA 4CC6A 5CB4B 1K8AW 4JTCB 1PD3A 3E89A 4H44B 4EFBA 4UCUA 2WLLB 4JZGA 2A3QA 5B1BB 5CA0B 3EHBB 4JTAB 4P9OA 3B2EE 1HNZB 3G4SV 4JI0B 2DOSA 2XNDG 3FAVB 3AK1A 1H8HG 4FJCC 4ZHQB 1W0JG 2W0FC 4WFHA 4JI6B 4LWSA 1Z5VA 5KHGA 1Z2GA 5LXTA 2XASA 2IJHA 1Q6HA 1I94O 3TETA 5L3GA 3G6EV 3UKMA 3BHPA 3AG1B 3AG2C 1ZLZA 1WA8B 3CEIA 3W7SA 1YXBA 1NBMG 2YXYA 4JI2B 1XBLA 3JAKA 4UCOA 4E4EA 2A79B 3E8GA 3GVMA 4X1YB 3L70H 5DEDA 4K0KB 4YJ3B 1V54B 4LF9O 2CTPA 5GW7A 2ZXWC 3VQVA 3A0BZ 1THZA 5B1NA 4DW1A 5LP6A 2LP7A 4RUEA 1M57C 2DJVA 3LNMB 1FJGO 4WFEA 1IX9A 4UCSA 4XDJA 5J2TA 5KMGA 3RYIA 3HKCB 4QPJA 1XNRB 4EB6A 4X1KA 4BIOA 2QTSA 5IYBO 1ZSPA 3BA9A 1M9NA 5IWAO 1XMQB 5FL7G 4LFAB 2F1MA 4U3JA 2CGNA 3KCXA 1YJWV 4FLUA 4FMTA 1AJQA 1KD1W 1VQOV 1XUQA 2CAZC 5LL6Y 5DN6G 1S5LZ 1MZFA 4PA6A 4CS4A 3HKEA 5EZYA 4JI4B 1XL6A 4MTFA 1H2GA 2HJFC 2Q67A 2Z5UA 5IJ9B 4Q6GA 1FFTB 4IGGA 1M5IA 2NLJC 2CK3G 1MSWD 4I0XA 3CCLV 3RW0A 4TV8A 1VIBA 3OMAB 3RYFB 3T1HB 1EM1A 5B1BC 1Q86W 2ZIMA 3ABUA 2JRIA 1NQTA 2KQXA 5GONB 3UQ8A 2A06H 3ABTA 1W2BU 3L72H 1K4DC 4H13B 1FXHA 2YIBA 1K9MW 2DE0X 3CRAA 2Q0AA 3SDLA 5CN0A 2PI4A 1ORQC 1X59A 3AG1C 2NR5A 4QNHB 3ETDA 3QG5A 2QTOA 1IXBA 1OCOB 4MTXA 1QU7A 3LDDA 2A7WA 1NI8A 1E1QG 1V54C 1RM1B 2QA4V 1KC8W 2BTQA 4X62B 1FKAO 2DQ0A 3SYOA 2WWWA 4FPPA 2CE4A 2P4VA 5LHIA 1AI4A 2JEXA 3RYHB 1DK1A 1CPYA 2UUCB 2EIJB 3JASB 2DWEC 4FIPC 1VQ6V 2N04A 4IYHA 4DO2A 1D2DA 4JYCA 4JI6O 2PYLA 1DLBA 4ZI7B 4DXWA 4K8ZA 1Q5OA 3OEEG 4CZZA 4LBEC 1Q8IA 1K34A 1N0NA 1XHZA 1Q81W 5TISZ 1SQFA 4JI2O 4O2BA 2DYSC 2Q68A 2FTKA 5JQGB 1ZUQA 3K79A 2ILMA 3WFVA 1FFXA 2Y48A 3X2QB 2CTWA 3EXAA 1JX9A 3BCCH 1MSDA 3OFNG 1OCRB 2H3OA 2LFSA 3K5MA 2GDSA 4DV6B 3ZHUA 1Y4MA 3Q4HA 2GSMB 5HFLA 3W7UA 1QLEB 3HPLC 3CCJV 1VF5B 2UXXA 4ZHQA 1Q82W 4AQYO 3ZHSA 2V1DA 2N74A 3CCSV 5LBQA 4RQFA 4LFAO 3FB6C 1LNQA 2KKWA 5D5QA 1TVKA 1QVFU 5KX5B 5LOVB 5K1XA 3E2EA 2ZDIC 2P5OA 1WA8A 2IU0A 2JEUA 1SZTA 1XMOO 3OAAG 4JPRA 3MD0A 3KG2A 2X0LA 1SQPH 1DTOA 3TXQA 4X1YA 5HFMA 1HNXB 4DR4B 4DR7O 4GX2A 5KUMA 1XILA 3L75H 2VQEB 1EBOA 4NTYA 2GBOA 1OCOC 4IHJA 1PL4A 2JIZG 4NTWA 3I5DA 1I5XA 2CUGA 3T4DA 5GTHZ 3AK2A 4OXSA 3T1HO 1NTZH 2QWQB 2BSKB 4UVBA 3THOA 3OR6C 4MW8A 3SYCA 1KB9F 4JZ2A 1VQLV 2EIJC 3ZS8C 3ABLB 1VQMV 1YHQV 3AG4C 2P22C 3K06A 4MVRA 3K5OA 4QGPA 4ICGA 4J80A 3SPGA 4DYLA 2OWOA 2UXDB 2Q7EA 2PF4E 1YTFB 3CD6V 2ZE6A 4UB6Z 2XAFA 1OCCB 4YHHO 1UPGA 5IJ9A 5KAFZ 1VF6A 4BIUA 3ASOC 1BSMA 3C90A 2AW9A 3KKYA 1EFRG 4RQEA 4FLVA 2ZKOA 2VQFO 1R6KA 1ENVA 2K1EA 3QVNA 3RYFA 5JH7A 5L3BA 5CBHA 1K7DA 4LR3A 2UXBO 1VQ5V 1RPRA 5AG2A 4LWSB 2ARHA 2WLKA 3ASNC 1QLEC 3ZHVA 5GONA 2GHYA 5LXTB 4RUFA 1AP5A 4RWUA 2UUCO 1WNSA 3CX5F 3G80A 3VQXA 2CGOA 3JAKB 3T1YB 1YDXA 1KBHA 5E1AC 4DV1O 4MVMA 5DM6V 3M8AA 4XBFA 5EC1C 4LH6A 3STZC 1M1KW 2B1IA 1CEZA 3SR2C 2YIDA 3RFRA 1RFYA 3ABKB 4J41A 3B77A 5H2FZ 5LP6B 1Q6IA 1YJNV 4X1IB 1X4TA 1H2MA 1WPXA 3ETQA 3K3WA 1AR5A 4LFCO 5J2TB 2RMKB 4JI1B 3RVZA 3RYIB 2FKXA 3E35A 4WBNA 4X1KB 4DV6O 1F23A 5IT9N 3KCYA 3OGCC 3CC2V 1Y66A 1GMGA 2ADPA 4U3JB 3SJBC 3R66A 1SA0A 4MS2A 3TCUA 1GO3F 1R6NA 2DYRC 4UCVA 2EILB 5ITZA 2UU9B 1LUVA 4U3FH 2AHZA 3AK3A 3ABLC
chains in the Genus database with same CATH topology
2N04A 1WJZA 3BVOA 2QWQB 2PF4E 2DMXA 1HDJA 1FPOA 2GUZA 3AG7A 3UCSC 2CTRA 3APOA 2L6LA 2CTQA 4J7ZA 3APQA 2QWNB 1XBLA 2M6YA 1GH6A 2LGWA 2CTWA 2DN9A 4IT5A 2LO1A 4RWUA 2N05A 3UO3A 2QSAA 2QWOB 2OCHA 2GUZB 1BQZA 2CTPA 2Y4TA 2YUAA 2Y4UA 2CUGA 2EJ7A 1BQ0A 2QWPB 2KQXA 1N4CA 4J80A 1NZ6A 3UO2A 1FAFA 1IURA 2QWRB 2YS8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N04 A;  1WJZ A;  3BVO A;  2QWQ B;  2PF4 E;  2DMX A;  1HDJ A;  1FPO A;  2GUZ A;  3AG7 A;  3UCS C;  2CTR A;  3APO A;  2L6L A;  2CTQ A;  4J7Z A;  3APQ A;  2QWN B;  1XBL A;  2M6Y A;  1GH6 A;  2LGW A;  2CTW A;  2DN9 A;  4IT5 A;  2LO1 A;  4RWU A;  2N05 A;  3UO3 A;  2QSA A;  2QWO B;  2OCH A;  2GUZ B;  1BQZ A;  2CTP A;  2Y4T A;  2YUA A;  2Y4U A;  2CUG A;  2EJ7 A;  1BQ0 A;  2QWP B;  2KQX A;  1N4C A;  4J80 A;  1NZ6 A;  3UO2 A;  1FAF A;  1IUR A;  2QWR B;  2YS8 A; 
#chains in the Genus database with same CATH topology
 1Q6U A;  5EZY B;  4LF9 B;  1Y74 A;  4LNU B;  3K59 A;  2HG5 C;  4LF7 B;  2XT9 A;  1NH2 D;  3VOU A;  2AGA A;  3H1H H;  3A0R A;  1M90 W;  4GX5 A;  4F6E A;  1HNX O;  3E86 A;  1F51 A;  4FVM A;  2VQE O;  1BQ0 A;  2IU3 A;  1A32 A;  3SYA A;  4PV1 B;  3SYQ A;  1AIL A;  4B08 A;  3SJQ C;  1L0N H;  3H1I H;  1YIJ V;  5FPR A;  2A0L A;  3QTC A;  1YTF D;  2W6I G;  5FPO A;  3ABM B;  4X89 A;  1AI5 A;  3UM7 A;  1PP9 H;  5KHK A;  2Y4T A;  4B3S B;  1MZE A;  5C93 A;  1SQX H;  3JAT A;  1JCH A;  2YIA A;  3W7X A;  5LOV A;  1WJZ A;  4O4H A;  4OPH A;  2EIM B;  3CSX A;  4UUJ C;  4N21 A;  4TV9 A;  4ABM A;  1MAB G;  5LMN O;  1N36 B;  1XL4 A;  4PA4 A;  2JDI G;  2P6J A;  3ETE A;  3OGI B;  2GTS A;  2IH3 C;  3D3I A;  1XRE A;  4GUN A;  4UXN A;  5LGU A;  2YUA A;  3BAB A;  1URF A;  2BTQ B;  3CCR V;  2KG7 A;  3CCE V;  1VF7 A;  3ABK C;  4PJ0 Z;  4D6T H;  2WLI A;  2X6B A;  2Q4P A;  2ZT9 B;  1IDS A;  4PA7 A;  1YI2 V;  3OTO B;  1W0K G;  2WLH A;  2QSA A;  1IBK O;  2BTO A;  2OYQ A;  2JGU A;  4DR5 B;  1E1R G;  2WPD G;  3UO2 A;  1NKD A;  4UV8 A;  2IJI A;  2NN4 A;  4JYA B;  1S0V A;  1RP3 B;  1HDJ A;  3K08 A;  4B3M O;  5D5P A;  4J42 A;  3CE2 A;  4O2B B;  1XI1 A;  4LF6 O;  2M7W A;  3T1Y O;  3K0G A;  4F4L A;  1K33 A;  1FFX B;  3M7M X;  3FYI B;  2PI5 A;  4XDK A;  1PNK A;  1J95 A;  5E79 Z;  3Q4H B;  4GX1 A;  1NVP B;  1G6U A;  1PV0 A;  2M6Y A;  4LH7 A;  5JVD A;  4FZ1 A;  4JI1 O;  1KUQ A;  3ZIA G;  2V7Q G;  4OX9 O;  3ZBH A;  1ZL8 B;  1S72 V;  2LW1 A;  1TVK B;  3ABM C;  1RSO B;  1EZV H;  5JWP A;  1OV9 A;  4AHC A;  5F2V O;  2QKS A;  2UXC B;  3VBB A;  2DQ3 A;  2RQ6 A;  3LDE A;  4JI7 O;  2UU9 O;  3OD4 A;  1M4U A;  3IAY A;  1FXV A;  1N34 O;  1I7F A;  2EIM C;  2YIC A;  5EBM C;  2XAQ A;  3ZJZ A;  2RDC A;  3IJ4 A;  2QEX V;  4IHJ B;  4LF7 O;  3EVK A;  3BPZ A;  4X1I A;  4FLZ A;  2BCC H;  1VQN V;  2LGQ A;  3QO7 A;  4YJ2 A;  2ETN A;  4AQY B;  1JJ2 U;  3ZHQ A;  3PN1 A;  5IDJ A;  2OCH A;  2EJ7 A;  1NT2 B;  1GN4 A;  2DW4 A;  1M56 B;  1GM9 A;  4TUY A;  1H2S B;  4CS2 A;  1XMO B;  4DV5 O;  4B3S O;  5L3F A;  4OPA A;  1WP8 A;  1JQ0 A;  1US6 A;  2DYS B;  2E74 B;  3K5L A;  4DR7 B;  4JI8 B;  3ML0 A;  2D2C B;  4X8A A;  3JD2 A;  3L71 H;  4LNU A;  3A8T A;  5LMU O;  1R3J C;  1HW7 A;  1N36 O;  4LCU C;  5FLX N;  5KA6 A;  1H38 A;  3TGU H;  4B7E A;  5JH7 B;  5L3E A;  4FFB A;  2ZQM A;  3E83 A;  5EBW C;  3F5T A;  3T4Z A;  3M99 B;  2QM8 A;  4RAI A;  3W7W A;  2HVJ C;  2V4D A;  3F5W C;  3GWK C;  3LUT B;  4TQD A;  1F7Y A;  3OTO O;  2GUZ A;  3CS5 A;  1F4N A;  2WSS G;  4MTG A;  2OIG A;  2KB1 A;  2XAJ A;  4DR5 O;  4HYO A;  4GZR B;  2WA4 A;  3K03 A;  4YHH B;  4IIJ A;  4JYA O;  2CH7 A;  2YEV A;  4K35 A;  1YF2 A;  4GCZ A;  2IJJ A;  3BEH A;  3JAM N;  1G4Y B;  2VQF B;  1BL8 A;  3N27 A;  3U10 A;  1BT8 A;  3K9S A;  3CPW U;  2ZCE A;  3LSU A;  1O9G A;  2UXB B;  5IYD O;  1YZB A;  3HKB A;  5IJ0 A;  1V55 B;  4B3R O;  4GT1 A;  1RPO A;  3CRQ A;  3FB7 C;  4I4T B;  4WBN B;  3HKD A;  3CP1 A;  5B5E Z;  4JYY A;  3PJS K;  4ASU G;  4KUM A;  1H2L A;  5KHH A;  1SA0 B;  3AG4 B;  4DUZ B;  4R8C A;  4BR6 A;  3CCV V;  5ITZ B;  3JYC A;  1M56 C;  1U96 A;  4DV1 B;  4KFM A;  1JR9 A;  5JJE B;  4G2K A;  3ZN0 A;  3K57 A;  3AEI A;  1Y74 B;  2UXC O;  2ZE8 A;  3OR7 C;  3S3X A;  2ATK C;  4TT3 G;  1IUR A;  2Q7H A;  3ASO B;  3BA8 A;  1XEQ A;  4CS3 A;  4P2Z A;  4DR3 B;  1K5S A;  4JV5 O;  3B8N A;  4FM1 A;  3VQW A;  5BR8 B;  4J9Z B;  1S76 D;  4LFC B;  1BZK A;  2F66 C;  3KZI Z;  1DGS A;  1VF6 C;  4EFE A;  1FD9 A;  2O57 A;  1KEC A;  3OMI B;  2XHB A;  5KHI A;  2DWD C;  5EYP B;  2YI9 A;  5J9P C;  2Y0P A;  1IBM B;  1AB3 A;  2HEP A;  3ASN B;  2YI8 A;  1BCC H;  2EBO A;  2Q8V A;  3CME V;  4NYK A;  2OTL V;  2ZR2 A;  1P4R A;  1NTK H;  1P7B A;  3ZMU A;  4B3T B;  4WF9 V;  1ZL8 A;  4PDM A;  3JAT B;  2X6A A;  4GYC B;  1RSO A;  4O4H B;  1YJ9 V;  3E8F A;  1GRJ A;  4TV9 B;  3D36 C;  1S5J A;  2R9I A;  1MNG A;  2PY5 A;  2FML A;  2X6C A;  4X20 B;  4JI8 O;  4Q20 A;  2OTJ V;  1GH6 A;  2YXL A;  2KG7 B;  4CBC A;  3C3T A;  3FX7 A;  3CCU V;  2WLI B;  2R9R B;  2E3C A;  2OIE A;  2Z0A A;  1IBL B;  4LF8 O;  1KQS U;  3ZCC A;  1V55 C;  2ZE7 A;  4LP8 A;  2DYR B;  2F95 B;  2UUA B;  4IT5 A;  3RGB A;  4MT8 A;  2Q73 A;  1K73 W;  3L74 H;  5LMN B;  5JCO A;  1HWY A;  1BE3 H;  3APQ A;  3IFX A;  4H0L B;  3HB3 B;  1F4M A;  1R3K C;  5BZB A;  5A9G A;  1VMG A;  1CXZ B;  1E79 G;  4NKG B;  1TUB A;  1DF5 A;  1WLE A;  2QWN B;  3SGI A;  1FXK C;  2LO1 A;  2QDO A;  4FK5 C;  1GN2 A;  1FYJ A;  2HJD A;  1ZWI C;  1L8D A;  3WB2 A;  4FLW A;  2WAM A;  2Q6A A;  4CC5 A;  5JVD B;  3ETG A;  3F7V C;  1IBK B;  2EZP A;  2ZE5 A;  1N33 B;  4TSF G;  2CTQ A;  2LGW A;  2ITD C;  4G27 B;  3OM3 B;  5EK0 A;  1Q43 A;  3MAQ A;  4B3M B;  4DUZ O;  1HR0 O;  3ZX6 A;  1COW G;  5EIB C;  2QWP B;  3MDS A;  1K92 A;  3W7T A;  2BE3 A;  4LF6 B;  1QLN A;  5LHG A;  1R6T A;  2P90 A;  3N2K A;  3D36 A;  2X7R B;  3T1C A;  3BRC A;  4DR1 B;  3NR7 A;  5L3C A;  4NB5 A;  3JAW A;  3ZMS A;  4CH6 A;  4PEL A;  4O4J A;  1SQV H;  2Q7G A;  2AZ0 A;  2ZM6 O;  4YXW G;  3SPI A;  2R9A A;  2JJ2 G;  4J9Y B;  4DR3 O;  1R73 A;  4FLX A;  4YJ2 B;  5BR8 O;  5FNV A;  3JAR A;  1NZ6 A;  4MVS A;  2YDE A;  2AHY A;  5CA1 B;  2F93 B;  4WFB V;  1VAR A;  2OT5 A;  1GM7 A;  4I4T A;  4DR6 B;  4OX9 B;  4QJF B;  1IXM A;  4IYI A;  3ZHT A;  4UVC A;  3OT7 A;  1IBM O;  4E2L A;  1PPJ H;  4K3A A;  3VQY A;  2JJ1 G;  4TUY B;  2IBZ H;  1QNM A;  3K04 A;  4JI7 B;  2WLM A;  1N4C A;  1NR7 A;  4B3T O;  1VQ4 V;  1N34 B;  3QNE A;  1Y6X A;  4GKJ B;  4I50 B;  3DSQ A;  4P30 A;  4DV4 O;  2QE7 G;  4HBN A;  4DUY B;  1FS0 G;  2R70 A;  4BW5 A;  1FXK A;  2Q9L A;  1HNW B;  2QR4 A;  4BWA A;  4DV7 O;  2PUS A;  3ICX A;  2XUM A;  4FFB B;  2H8P C;  1BHB A;  3SYP A;  1BS3 A;  4WFA V;  4JYB A;  4MTO A;  5EYP A;  4O4L A;  3CMA V;  1QCE A;  5LA6 A;  1P84 F;  3U11 A;  5H6Q A;  3CC4 V;  1IBL O;  5CBG A;  1JVM A;  3F7Y C;  1G1X B;  4KHP O;  2GUZ B;  4DV5 B;  1GN3 A;  1QQC A;  2FB5 A;  1LR1 A;  2KSD A;  4CH3 A;  2A9H A;  1FAF A;  4IL6 Z;  3DXR B;  1M93 A;  2UUA O;  3H1K H;  2K9P A;  1AP6 A;  1OHH G;  4IIJ B;  4B7K A;  3FFQ A;  3CJH A;  4F6R B;  4NR1 A;  4NVP A;  2CH7 B;  2YEV B;  5LMU B;  4PDL A;  1I08 A;  2QM7 A;  2Q5Z A;  1ZAU A;  1TAE A;  4X20 A;  3ZRX A;  2EJR A;  1YVW A;  4YY3 B;  3WB1 A;  1UJW B;  3HKB B;  2P4K A;  5H6R A;  2ODM A;  5IJ0 B;  2XAG A;  1JFF B;  4YIO A;  2PYJ A;  3HKD B;  1ARO P;  5LYJ A;  1T5E A;  1XNQ O;  1XHX A;  2UUB B;  1U97 A;  5EC2 C;  3E22 A;  4JAV A;  1N33 O;  4ZIB A;  4X66 B;  4PA3 A;  3BVO A;  1JPX A;  1D5N A;  5JJN B;  4JI5 B;  1NJI W;  2IM9 A;  5IY5 C;  2IW5 A;  4ZOL A;  3BY6 A;  4WCE V;  3CRR A;  1BQZ A;  3CXC U;  2Y4U A;  3DGE A;  4DR1 O;  4DR2 O;  2JGD A;  2WA3 A;  3E8B A;  2FYU H;  4B3R B;  3JSN A;  2LQT A;  2VWK A;  1FPO A;  2E5L B;  1L0L H;  3UCS C;  4CH5 A;  2Q0O C;  5BXZ A;  4J7K A;  2IJK A;  4X64 O;  3MHS C;  3H9V A;  1KP3 A;  2AXT Z;  4BIZ A;  3RYC A;  4DR6 O;  1NU1 H;  1KYO F;  3WB0 A;  2VWJ A;  1WP7 A;  4PDR A;  4GKK B;  1B6Q A;  2OCC B;  1O9H A;  2JS3 A;  2EIK C;  1IVS A;  1K4C C;  3O65 A;  2ZD9 A;  4EEQ A;  4R50 A;  3B09 A;  4DK0 A;  5DEC A;  4UCR A;  3OE7 G;  4JV5 B;  1K5Q A;  1D5A A;  4HAM A;  3CC7 V;  3AG3 C;  1PM9 A;  4LF4 O;  4DV3 O;  4GKJ O;  3UT5 A;  3P3P A;  2B9Z A;  3ZMV A;  4GX0 A;  1ZX3 A;  2F4V B;  2YS8 A;  2YC0 A;  3JD1 A;  2YIB D;  4DUY O;  4LF5 O;  4I9W A;  3SJA C;  5C8Y A;  1HNW O;  4Z1M G;  4UFZ A;  2W6J G;  5IYZ A;  1QBZ A;  4AI8 A;  1R1B A;  4EKW A;  3DC5 A;  3QO5 A;  5CA1 A;  1YSC A;  4Z2W A;  1BHA A;  5IE9 A;  4JF3 A;  3LDC A;  1SET A;  4LC1 A;  4JI3 B;  4LFB O;  1TUE B;  1Q3E A;  4DV2 O;  3G6B A;  3OTF A;  1H2N A;  5BMV A;  5KHJ A;  4FM0 A;  2HR3 A;  2XAH A;  4MW3 A;  1VQ9 V;  1SES A;  3TXS A;  3BAA A;  5LGN A;  2ADQ B;  4GLX A;  1YCI A;  4H33 A;  3B4S A;  4QIW F;  1Q90 D;  1EN5 A;  2NNU A;  1SS3 A;  2PGG A;  2L35 A;  4I50 A;  5B3S C;  2AZ2 A;  1TUB B;  2QM4 A;  1QVG U;  2MK3 A;  4I55 A;  2Y0I A;  3H1J H;  1S77 D;  3R65 A;  3CRM A;  2QJ1 A;  1VQK V;  4PA9 A;  4DW0 A;  4LF8 B;  2Q69 A;  3STL C;  4YY3 O;  3FKS G;  1XDC A;  3H1L H;  4DRX B;  3TJT A;  4Z1V A;  5J2U A;  2ZIN A;  1YEW A;  2PZS A;  2UUB O;  4X65 O;  4J7J A;  4CH4 A;  3K0D A;  1GTO A;  3RN4 A;  3SPH A;  4OGQ B;  3DC6 A;  1N32 B;  2OCC C;  3DXR A;  3UO3 A;  3N2K B;  4X66 O;  1NVP D;  1SQQ H;  1EN4 A;  4L8J A;  1GKF A;  5LGT A;  3JAW B;  4F6R A;  3DTU B;  4FFK A;  4JI5 O;  4O4J B;  3TK1 A;  2B5U A;  3K5N A;  1VQ7 V;  3P32 A;  2DMX A;  3NXS A;  4HNA B;  1Q7Y W;  2L6L A;  3RVY A;  1SQG A;  3ZN1 A;  5FNV B;  3JAR B;  2DN9 A;  4UB8 Z;  2XTA A;  2RJZ A;  4BAY A;  1JFF A;  3E8H A;  4MVZ A;  2H94 A;  4NTX A;  2E5L O;  5H5N A;  5B1A B;  4NXN O;  4BW9 A;  1WB7 A;  2Y69 B;  3JD0 A;  3FYE B;  1TA8 A;  3CWB H;  1HR0 B;  2P67 A;  3JD4 A;  5KLV H;  4FLY A;  4GKK O;  1V9P A;  4I7Z B;  1YIT V;  4PHZ A;  1I5Y A;  1Y76 B;  5JCO C;  2WLJ A;  3ZMT A;  1HNZ O;  4JI0 O;  1OJH A;  4O2A A;  5KA5 A;  1SC5 B;  2ZM6 B;  3ZRW A;  1WN7 A;  1FXK B;  4O4I B;  5KAI Z;  1J5E B;  1L1F A;  4D7T A;  3AG7 A;  3APO A;  2FL4 A;  4FLT A;  1PNM A;  1VQP V;  2QGN A;  1WAZ A;  1QHT A;  3JAL A;  2F4V O;  4TQF A;  2HKO A;  3J81 N;  4J10 A;  5IYC O;  1ZTE A;  4O4L B;  2YSU B;  1MOF A;  5LA6 B;  1SZX A;  4DV0 B;  2CDY A;  5CB4 A;  4I5S A;  3ZMZ A;  2QKC A;  4K0K O;  1DF4 A;  4K8X A;  2WLL A;  2EIN B;  5CA0 A;  4JI3 O;  2BOB C;  1SKV A;  1BGY H;  3IGA C;  4QE7 A;  1ROP A;  5K1P A;  4DV4 B;  4R7C A;  3N2G B;  3FAV A;  3FD9 A;  3CJH B;  1JJO A;  4KXR A;  3A2F A;  4A5U B;  1EN6 A;  1XNR O;  4AIL C;  4DV7 B;  1N0J A;  4U7O A;  3CCM V;  3JD3 A;  2LW7 A;  1H2K A;  2Z3Y A;  1XMQ O;  2UXN A;  1AR1 B;  3G71 V;  5KUK A;  5L3D A;  1OZ0 A;  4UCT A;  1JMK C;  3CRC A;  4FZ0 A;  2E76 B;  5LYJ B;  4JAA A;  1KKD A;  4MVO A;  2LFR A;  3CB2 A;  1MA1 A;  4YJ3 A;  4KHP B;  3GWO A;  4JI4 O;  5BY1 A;  2RCV A;  3OUF A;  3E22 B;  3B40 A;  4N23 A;  4ZKI A;  2XOK G;  5B1A C;  4PI0 A;  1SF9 A;  2Y69 C;  1NR1 A;  1GM8 A;  4H37 A;  1RM1 C;  2QWO B;  3C3S A;  4ZBM A;  5GTI Z;  5JJJ B;  3OMN B;  3FB8 C;  2F23 A;  1VQ8 V;  3HKC A;  1XOU A;  3OEH G;  1N32 O;  4ZOL B;  1NH2 B;  3JCU Z;  1CP9 A;  3G67 A;  2GV9 A;  2R72 A;  4X9Q A;  1GAX A;  2JGD B;  3SPJ A;  4MSW C;  1R3L C;  1NS1 A;  2ITC C;  2WLN A;  4W4K A;  2RN9 A;  4JGS A;  1Z5W A;  1H8E G;  3S3W A;  1XNQ B;  4PI2 A;  5CA3 A;  2ZR3 A;  3OW2 U;  3U0Z A;  1TGO A;  1AJP A;  1JA8 A;  4DRX A;  2LJ2 A;  1PKX A;  1XQ8 A;  3GB7 C;  5H9C A;  3RYC B;  2EX3 A;  4JTD B;  4J7Z A;  2G38 A;  4NXM B;  3K9A A;  3LSS A;  3HR0 A;  1GN6 A;  3WG7 B;  2N05 A;  2D3O W;  4MVQ A;  1N8R W;  2VRZ A;  3RT3 C;  2EIN C;  4P9P A;  4U7N A;  1MG1 A;  3X2Q C;  4X62 O;  1R3I C;  1EZJ A;  1OCR C;  2BOC C;  3RBZ A;  4QE9 A;  1KKC A;  1AVM A;  2YXH A;  4R6Z A;  1G8M A;  2HHH B;  3I56 V;  4DR2 B;  3UT5 B;  4PDV A;  1AI6 A;  4QPK A;  2JS5 A;  2EUL A;  4WFF A;  2ZNI A;  1PNL A;  4PD4 F;  5EIB D;  5C8Y B;  3I55 V;  2ZDI A;  2ZNJ A;  4HNA A;  4UV9 A;  1J5E O;  2HVK C;  1VEW A;  3H01 A;  1HP8 A;  3CXH F;  4XDL A;  4X64 B;  5IYZ B;  4W4L A;  2IH1 C;  4DK1 A;  1P49 A;  3A0H Z;  3SPC A;  1S3J A;  5BMV B;  3L73 H;  3FB5 C;  4J11 A;  2P7T C;  4FM2 A;  4UVA A;  4DV0 O;  1AJN A;  3ZED A;  3JCZ A;  1KP2 A;  1UFI A;  5KMG B;  4KP4 A;  4TWK A;  4TOI A;  4EB6 B;  4JAS A;  2JVD A;  5IY5 B;  3J7A U;  3ZRV A;  3EFF K;  2RNB A;  3RYH A;  4LF4 B;  4DV3 B;  1Y76 A;  1KU9 A;  2C2A A;  2MW2 B;  1I94 B;  2ZIO A;  1GK9 A;  1SER A;  3JAS A;  2HFE C;  1B3Q A;  4I55 B;  1IZ3 A;  4LF5 B;  2E75 B;  4G28 B;  4O4I A;  3P3N A;  1K3E A;  1VP7 A;  2QKA A;  3MHH C;  3D3Q A;  3BFR A;  1QR8 A;  3CYO A;  3WU2 Z;  4D7S A;  1SQB H;  4YIP A;  1NTM H;  4ZI7 A;  1OCZ B;  4MVU A;  2PTM A;  1MMM A;  3HKE B;  3LSQ A;  3CCQ V;  1S5H C;  2CTR A;  3QO8 A;  4LFB B;  3JSL A;  4DV2 B;  5J2U B;  1B06 A;  4RO2 A;  4I0X B;  3QF7 A;  4TV8 B;  1FJG B;  5JQG A;  2P06 A;  1QR9 A;  1OCC C;  2EIK B;  3P30 A;  4HZ3 A;  4DR4 O;  2HP8 A;  3CHX A;  3IC7 A;  5IWA B;  3WG7 C;  3SJC C;  5EBL C;  3D8C A;  3AG3 B;  3N2G A;  5CMU A;  1W59 A;  1WB8 A;  1SRY A;  1JOY A;  4C7U A;  3ZHR A;  3B8M A;  3AG2 B;  3OUS A;  4X88 A;  2VS0 A;  2F43 G;  1KMI Z;  3T2M A;  5KX5 A;  5A2Q N;  4WFG A;  4L87 A;  1K97 A;  1B04 A;  1BMF G;  1WPB A;  2ZXW B;  2HLD G;  2B1G A;  4KL1 A;  1Y67 A;  3LNN A;  5B1O A;  4X65 B;  4I9Q A;  5LHH A;  1M57 B;  2UXD O;  4JAU A;  5CBF A;  3J80 N;  4NXM O;  5LP6 C;  2GTA A;  1P7G A;  1PL0 A;  2JK5 C;  5B3S B;  5B66 Z;  4O2A B;  3ZRW B;  3K58 A;  2W0X A;  3IC9 A;  2BSK A;  1LUW A;  2EZO A;  2HHH O;  2QWR B;  3JAL B;  1I0H A;  3O9O A;  2EIL C;  4NXN B;  3L9D A;  3RWR D;  1OCZ C;  1AR4 A;  1AI7 A;  3ZRS A;  4CC6 A;  5CB4 B;  1K8A W;  4JTC B;  1PD3 A;  3E89 A;  4H44 B;  4EFB A;  4UCU A;  2WLL B;  4JZG A;  2A3Q A;  5B1B B;  5CA0 B;  3EHB B;  4JTA B;  4P9O A;  3B2E E;  1HNZ B;  3G4S V;  4JI0 B;  2DOS A;  2XND G;  3FAV B;  3AK1 A;  1H8H G;  4FJC C;  4ZHQ B;  1W0J G;  2W0F C;  4WFH A;  4JI6 B;  4LWS A;  1Z5V A;  5KHG A;  1Z2G A;  5LXT A;  2XAS A;  2IJH A;  1Q6H A;  1I94 O;  3TET A;  5L3G A;  3G6E V;  3UKM A;  3BHP A;  3AG1 B;  3AG2 C;  1ZLZ A;  1WA8 B;  3CEI A;  3W7S A;  1YXB A;  1NBM G;  2YXY A;  4JI2 B;  1XBL A;  3JAK A;  4UCO A;  4E4E A;  2A79 B;  3E8G A;  3GVM A;  4X1Y B;  3L70 H;  5DED A;  4K0K B;  4YJ3 B;  1V54 B;  4LF9 O;  2CTP A;  5GW7 A;  2ZXW C;  3VQV A;  3A0B Z;  1THZ A;  5B1N A;  4DW1 A;  5LP6 A;  2LP7 A;  4RUE A;  1M57 C;  2DJV A;  3LNM B;  1FJG O;  4WFE A;  1IX9 A;  4UCS A;  4XDJ A;  5J2T A;  5KMG A;  3RYI A;  3HKC B;  4QPJ A;  1XNR B;  4EB6 A;  4X1K A;  4BIO A;  2QTS A;  5IYB O;  1ZSP A;  3BA9 A;  1M9N A;  5IWA O;  1XMQ B;  5FL7 G;  4LFA B;  2F1M A;  4U3J A;  2CGN A;  3KCX A;  1YJW V;  4FLU A;  4FMT A;  1AJQ A;  1KD1 W;  1VQO V;  1XUQ A;  2CAZ C;  5LL6 Y;  5DN6 G;  1S5L Z;  1MZF A;  4PA6 A;  4CS4 A;  3HKE A;  5EZY A;  4JI4 B;  1XL6 A;  4MTF A;  1H2G A;  2HJF C;  2Q67 A;  2Z5U A;  5IJ9 B;  4Q6G A;  1FFT B;  4IGG A;  1M5I A;  2NLJ C;  2CK3 G;  1MSW D;  4I0X A;  3CCL V;  3RW0 A;  4TV8 A;  1VIB A;  3OMA B;  3RYF B;  3T1H B;  1EM1 A;  5B1B C;  1Q86 W;  2ZIM A;  3ABU A;  2JRI A;  1NQT A;  2KQX A;  5GON B;  3UQ8 A;  2A06 H;  3ABT A;  1W2B U;  3L72 H;  1K4D C;  4H13 B;  1FXH A;  2YIB A;  1K9M W;  2DE0 X;  3CRA A;  2Q0A A;  3SDL A;  5CN0 A;  2PI4 A;  1ORQ C;  1X59 A;  3AG1 C;  2NR5 A;  4QNH B;  3ETD A;  3QG5 A;  2QTO A;  1IXB A;  1OCO B;  4MTX A;  1QU7 A;  3LDD A;  2A7W A;  1NI8 A;  1E1Q G;  1V54 C;  1RM1 B;  2QA4 V;  1KC8 W;  2BTQ A;  4X62 B;  1FKA O;  2DQ0 A;  3SYO A;  2WWW A;  4FPP A;  2CE4 A;  2P4V A;  5LHI A;  1AI4 A;  2JEX A;  3RYH B;  1DK1 A;  1CPY A;  2UUC B;  2EIJ B;  3JAS B;  2DWE C;  4FIP C;  1VQ6 V;  2N04 A;  4IYH A;  4DO2 A;  1D2D A;  4JYC A;  4JI6 O;  2PYL A;  1DLB A;  4ZI7 B;  4DXW A;  4K8Z A;  1Q5O A;  3OEE G;  4CZZ A;  4LBE C;  1Q8I A;  1K34 A;  1N0N A;  1XHZ A;  1Q81 W;  5TIS Z;  1SQF A;  4JI2 O;  4O2B A;  2DYS C;  2Q68 A;  2FTK A;  5JQG B;  1ZUQ A;  3K79 A;  2ILM A;  3WFV A;  1FFX A;  2Y48 A;  3X2Q B;  2CTW A;  3EXA A;  1JX9 A;  3BCC H;  1MSD A;  3OFN G;  1OCR B;  2H3O A;  2LFS A;  3K5M A;  2GDS A;  4DV6 B;  3ZHU A;  1Y4M A;  3Q4H A;  2GSM B;  5HFL A;  3W7U A;  1QLE B;  3HPL C;  3CCJ V;  1VF5 B;  2UXX A;  4ZHQ A;  1Q82 W;  4AQY O;  3ZHS A;  2V1D A;  2N74 A;  3CCS V;  5LBQ A;  4RQF A;  4LFA O;  3FB6 C;  1LNQ A;  2KKW A;  5D5Q A;  1TVK A;  1QVF U;  5KX5 B;  5LOV B;  5K1X A;  3E2E A;  2ZDI C;  2P5O A;  1WA8 A;  2IU0 A;  2JEU A;  1SZT A;  1XMO O;  3OAA G;  4JPR A;  3MD0 A;  3KG2 A;  2X0L A;  1SQP H;  1DTO A;  3TXQ A;  4X1Y A;  5HFM A;  1HNX B;  4DR4 B;  4DR7 O;  4GX2 A;  5KUM A;  1XIL A;  3L75 H;  2VQE B;  1EBO A;  4NTY A;  2GBO A;  1OCO C;  4IHJ A;  1PL4 A;  2JIZ G;  4NTW A;  3I5D A;  1I5X A;  2CUG A;  3T4D A;  5GTH Z;  3AK2 A;  4OXS A;  3T1H O;  1NTZ H;  2QWQ B;  2BSK B;  4UVB A;  3THO A;  3OR6 C;  4MW8 A;  3SYC A;  1KB9 F;  4JZ2 A;  1VQL V;  2EIJ C;  3ZS8 C;  3ABL B;  1VQM V;  1YHQ V;  3AG4 C;  2P22 C;  3K06 A;  4MVR A;  3K5O A;  4QGP A;  4ICG A;  4J80 A;  3SPG A;  4DYL A;  2OWO A;  2UXD B;  2Q7E A;  2PF4 E;  1YTF B;  3CD6 V;  2ZE6 A;  4UB6 Z;  2XAF A;  1OCC B;  4YHH O;  1UPG A;  5IJ9 A;  5KAF Z;  1VF6 A;  4BIU A;  3ASO C;  1BSM A;  3C90 A;  2AW9 A;  3KKY A;  1EFR G;  4RQE A;  4FLV A;  2ZKO A;  2VQF O;  1R6K A;  1ENV A;  2K1E A;  3QVN A;  3RYF A;  5JH7 A;  5L3B A;  5CBH A;  1K7D A;  4LR3 A;  2UXB O;  1VQ5 V;  1RPR A;  5AG2 A;  4LWS B;  2ARH A;  2WLK A;  3ASN C;  1QLE C;  3ZHV A;  5GON A;  2GHY A;  5LXT B;  4RUF A;  1AP5 A;  4RWU A;  2UUC O;  1WNS A;  3CX5 F;  3G80 A;  3VQX A;  2CGO A;  3JAK B;  3T1Y B;  1YDX A;  1KBH A;  5E1A C;  4DV1 O;  4MVM A;  5DM6 V;  3M8A A;  4XBF A;  5EC1 C;  4LH6 A;  3STZ C;  1M1K W;  2B1I A;  1CEZ A;  3SR2 C;  2YID A;  3RFR A;  1RFY A;  3ABK B;  4J41 A;  3B77 A;  5H2F Z;  5LP6 B;  1Q6I A;  1YJN V;  4X1I B;  1X4T A;  1H2M A;  1WPX A;  3ETQ A;  3K3W A;  1AR5 A;  4LFC O;  5J2T B;  2RMK B;  4JI1 B;  3RVZ A;  3RYI B;  2FKX A;  3E35 A;  4WBN A;  4X1K B;  4DV6 O;  1F23 A;  5IT9 N;  3KCY A;  3OGC C;  3CC2 V;  1Y66 A;  1GMG A;  2ADP A;  4U3J B;  3SJB C;  3R66 A;  1SA0 A;  4MS2 A;  3TCU A;  1GO3 F;  1R6N A;  2DYR C;  4UCV A;  2EIL B;  5ITZ A;  2UU9 B;  1LUV A;  4U3F H;  2AHZ A;  3AK3 A;  3ABL C; 
#chains in the Genus database with same CATH homology
 2N04 A;  1WJZ A;  3BVO A;  2QWQ B;  2PF4 E;  2DMX A;  1HDJ A;  1FPO A;  2GUZ A;  3AG7 A;  3UCS C;  2CTR A;  3APO A;  2L6L A;  2CTQ A;  4J7Z A;  3APQ A;  2QWN B;  1XBL A;  2M6Y A;  1GH6 A;  2LGW A;  2CTW A;  2DN9 A;  4IT5 A;  2LO1 A;  4RWU A;  2N05 A;  3UO3 A;  2QSA A;  2QWO B;  2OCH A;  2GUZ B;  1BQZ A;  2CTP A;  2Y4T A;  2YUA A;  2Y4U A;  2CUG A;  2EJ7 A;  1BQ0 A;  2QWP B;  2KQX A;  1N4C A;  4J80 A;  1NZ6 A;  3UO2 A;  1FAF A;  1IUR A;  2QWR B;  2YS8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...