1BQZA

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bqzA00
2CTQA 1FAFA 4J80A 1HDJA 2CUGA 3BVOA 2YS8A 2N04A 3UO3A 3APQA 1XBLA 2Y4TA 2QWOB 4IT5A 2QWNB 1BQ0A 3AG7A 1NZ6A 2PF4E 2QWRB 2N05A 4J7ZA 2M6YA 3UCSC 1BQZA 2DN9A 2QWPB 2LGWA 2GUZA 2KQXA 2CTPA 2GUZB 1N4CA 2QWQB 2Y4UA 1WJZA 2CTRA 3APOA 4RWUA 2OCHA 2L6LA 2YUAA 2DMXA 2QSAA 2CTWA 2LO1A 3UO2A 1GH6A 1FPOA 1IURA 2EJ7A
chains in the Genus database with same CATH superfamily
1I08A 3J7AU 1OZ0A 3G6BA 2H94A 4U3JA 3TETA 5EC2C 3K0GA 5GONA 4H33A 3BPZA 1SC5B 4XDKA 1WAZA 4O2AA 1P49A 4EKWA 1SQBH 4CZZA 4CC5A 1IXBA 1QBZA 1V55C 4MSWC 3RYHA 3CWBH 1PPJH 2WLLB 4P30A 1NR1A 1GO3F 1N36O 4QGPA 2HKOA 3JD1A 1HWYA 1AR5A 4MVMA 3BAAA 1M56B 5LXTA 3JAKA 3OR6C 4HZ3A 2QA4V 1HW7A 2FB5A 2ILMA 4PELA 3BEHA 2L35A 1SQGA 4R7CA 5H2FZ 3BHPA 1MNGA 4X20A 1JJOA 2A7WA 5JVDA 1K5QA 1AJPA 2EINB 3DXRB 4WFAV 3UKMA 2WA3A 3FB6C 1N32O 2YIBD 3CYOA 5L3EA 3GWKC 4UFZA 5KA5A 1SQPH 2DWDC 1F7YA 1VIBA 1KKCA 3IC9A 2JJ2G 4XDJA 1VQPV 3VOUA 4QPJA 2V7QG 3HKEB 3K57A 3HKDB 4CS2A 3KKYA 1N36B 2WLNA 4X88A 1H2SB 3SPHA 3CXHF 2XAFA 1LUWA 1S5JA 1SF9A 2EX3A 1BCCH 4JAVA 5FPRA 2Z0AA 4CS3A 4PA4A 1SRYA 3AK1A 3X2QB 1NTMH 4IHJB 1XMOO 5BR8B 4MW3A 3W7TA 4GT1A 2FL4A 4QE7A 3GVMA 3CCUV 4MW8A 2Y0PA 1S5HC 3L72H 1VF6A 1ZAUA 1N32B 1FXHA 4MVUA 2BOBC 4J9YB 4FLXA 4JTAB 4I7ZB 1XMQO 4UCRA 1Q8IA 3L73H 1SQVH 2QR4A 1EZJA 1BHBA 4KFMA 1JR9A 3KZIZ 4EB6B 1OCRB 2RJZA 1M4UA 3RGBA 3QO8A 2KG7B 3CCMV 5IYDO 5GTIZ 5L3CA 4K0KB 4LFAB 2PYLA 4FLVA 1EN6A 4LNUB 5FNVB 5EC1C 1SS3A 5J9PC 4PDRA 1QU7A 3C3SA 3MHHC 1K4CC 2JS3A 3I56V 1F51A 1XMOB 4DV2O 4JI7O 2GBOA 1QLEB 3E8BA 2Q6AA 1VQ6V 5DN6G 1XNQO 1Y4MA 4PD4F 2UU9O 1XL6A 3STLC 3OR7C 4J41A 3OEEG 4FMTA 4C7UA 1XMQB 2HLDG 2JEUA 1Y76A 2QGNA 4PA7A 4DUYO 1S72V 1SZTA 2PZSA 2VQEB 3FAVA 4UVAA 2GTAA 5KHHA 3K9SA 3L75H 3E8FA 2A9HA 1KP2A 3E22B 3ZIAG 1W2BU 3SJAC 2YIAA 5CMUA 4AILC 4QNHB 1NI8A 5GW7A 4B7KA 2OIGA 3A8TA 2XNDG 1H2MA 1XQ8A 5BMVA 1I7FA 4ZI7B 2YC0A 4DV2B 4JI7B 2HP8A 4YJ2B 3P3PA 2Q7HA 4BIZA 3EFFK 1H38A 4I0XB 3CRRA 1QVFU 2UU9B 3BABA 1AI5A 4LBEC 5BXZA 2LO1A 2FTKA 3JD4A 3K03A 3ZHVA 2YXLA 1GN4A 4DRXA 1L1FA 3BVOA 3I5DA 2N04A 3AG1B 2B1IA 4NVPA 3R66A 4DUYB 1RSOA 3H1JH 4FLWA 3OMIB 4FFBB 3WB2A 4LH7A 4LC1A 2PUSA 4IYIA 3UM7A 4PI2A 3ABKB 1K97A 5KUKA 1MA1A 1JMKC 2XHBA 4DR6O 3GB7C 3BFRA 4FLUA 4LR3A 4LWSA 1LNQA 5LA6B 1XOUA 5C8YB 5EK0A 5EBMC 1WA8A 4JZ2A 2B1GA 2WLMA 3ABLC 1R3JC 5IYCO 1Q7YW 1WJZA 3EHBB 4A5UB 2MK3A 4B3MO 5EZYA 1OV9A 4FZ1A 3N27A 3D8CA 1S3JA 3FB8C 3TGUH 3K58A 3JAWA 2HHHO 2F66C 1P7BA 2UXBO 3N2KB 1QCEA 5L3FA 1RFYA 2M7WA 2D2CB 3DGEA 4X62O 3ASNC 4H13B 1QR8A 2GHYA 1UJWB 2UXCO 5LOVA 2N74A 4ZHQB 3SYQA 1Q86W 1XILA 3H1HH 4DR6B 5TISZ 4HAMA 2ZE6A 1Y74B 2A06H 3SJCC 2OTJV 4AQYO 5KHKA 1WNSA 3OEHG 4PHZA 3KG2A 1JX9A 1VP7A 3D36C 4LF8O 1XUQA 1FFXB 3MHSC 2AGAA 4FLTA 1VQ9V 1CPYA 3UO2A 4B3MB 4DK0A 4QPKA 1IVSA 2YI8A 3UO3A 4J10A 2XT9A 3ZMSA 2OTLV 2HHHB 1VQNV 2UXBB 1M57B 4FM1A 3BY6A 4D6TH 4LH6A 1KYOF 1K9MW 2DQ0A 4X62B 4WF9V 5LP6C 4IL6Z 1ZL8A 2X6AA 2UXCB 4HYOA 5LP6B 2ZQMA 2FMLA 2VS0A 4EFBA 3OTOO 4I9WA 4O4LA 3LSSA 2EBOA 2E74B 5A9GA 3ZMZA 1N33O 4FK5C 1J5EO 2QWPB 3JD2A 4AQYB 2QKSA 5KUMA 4LF9O 5D5PA 2E3CA 4FPPA 4DK1A 2P06A 1QQCA 2JVDA 4LF8B 1WLEA 1N8RW 3CCRV 5B3SC 5HFLA 3SYPA 2DE0X 4UB6Z 4DUZO 4JPRA 3ETEA 4BIUA 5LYJB 5B3SB 3VQXA 4FM0A 1PNMA 2JGDB 5GTHZ 3ETDA 3JCZA 1Q6UA 2LFRA 2K9PA 1AVMA 1NR7A 5B1BC 4UVBA 2WPDG 4KP4A 3K79A 1AP5A 2F4VO 5B1BB 2F93B 1KD1W 3W7WA 2EIMC 3OTOB 1KUQA 5GONB 1TUBA 4PDMA 2VWJA 2X7RB 3E83A 2EZPA 1J5EB 4GCZA 1AJNA 4N23A 4B3RO 3LUTB 1I94B 4LF9B 1P4RA 1MOFA 3RYHB 3T1YO 5DEDA 2YSUB 3BA8A 4KHPO 1N0JA 1VQ5V 4ZOLB 2P67A 4DUZB 1IDSA 4W4LA 2ZNIA 1O9GA 4IGGA 2IU0A 3S3WA 4NR1A 2UUBO 2ZIOA 3K5MA 4U3FH 1GKFA 2NN4A 4H0LB 3FYIB 2O57A 3NR7A 2FYUH 2GDSA 1X4TA 3B40A 1FKAO 2F4VB 4U7NA 1DF4A 5KMGA 4K8ZA 3CC2V 5LMUO 2DYSB 5BZBA 4NKGB 5FL7G 1QNMA 2Q9LA 1L0NH 2EIJC 1GK9A 3T1CA 1FXKB 1HR0B 1OCOC 2EIJB 3CB2A 3RVYA 1HNZO 3JD3A 2IJJA 3H1KH 4KHPB 2P90A 3ZEDA 2A0LA 3OT7A 1I5YA 1PL0A 3FB7C 1OCZC 2E5LB 3LDCA 2UUBB 4TUYA 4X64B 4JYCA 4DW0A 3J81N 4Z1VA 2WLIA 2DQ3A 2Y69C 5JCOA 1OCZB 3S3XA 5KX5B 3CCLV 2Y69B 1JFFB 1US6A 2P7TC 1W59A 2B9ZA 5EBWC 3MAQA 4RAIA 3AK3A 1VF6C 1Q3EA 3A0RA 3T4DA 3HKBA 5JQGB 5B1AC 1PNKA 4GLXA 2ADPA 5B1AB 3G67A 2UUCO 4ABMA 1IZ3A 2CH7A 2P6JA 1U97A 4AHCA 2GV9A 3EVKA 2AZ2A 4UXNA 2Q0OC 4O4IA 1NU1H 2RDCA 3JARB 4DW1A 5CA1A 5EIBC 2Q67A 1HNZB 1YI2V 1R73A 1H2LA 3W7SA 3SYOA 5IYBO 2IH1C 1WP8A 2OCHA 5CN0A 5ITZA 2OYQA 4DV0O 2F23A 5JJEB 1ORQC 1V55B 4KXRA 4P9OA 4IT5A 5KHGA 1YTFD 1KC8W 3OUSA 4OPHA 4DR1B 5CA0A 3IJ4A 3CCQV 3QVNA 5C93A 2JJ1G 2UUCB 2DYRC 2YEVA 3RYFA 2YXHA 1SESA 2YIDA 1K4DC 3TCUA 5H6QA 2QSAA 3FX7A 2EJRA 4HNAA 2DYRB 1F4NA 1FAFA 4F6EA 5IY5C 2CUGA 3CS5A 4TV8A 3OGIB 1Y76B 5BR8O 1SA0B 1EN5A 2Q8VA 5IY5B 3TJTA 3FAVB 2IH3C 1TVKA 3AG2C 1YHQV 4KL1A 3CMAV 4DR3O 3KCYA 4QE9A 3AG2B 2GUZB 1T5EA 1KECA 4O4JA 1VQ4V 3D3QA 2BTOA 4I4TA 3A0HZ 3QG5A 4JI8B 2EULA 3CJHA 2LGQA 1RM1C 2ZR2A 3RW0A 3K59A 4DV0B 3HPLC 1AROP 4I50A 4DV3O 3B77A 5BMVB 3M7MX 3E8GA 2JS5A 2MW2B 3SYAA 5DM6V 2N05A 2A79B 4K0KO 3J80N 2IJHA 4LFAO 4UV8A 4UCOA 3ZMTA 3HR0A 1ZX3A 3G6EV 4JAAA 1VQLV 3HKCA 3VQVA 2RCVA 5CBHA 3ETQA 4DV7B 3RYCA 2BE3A 1SERA 1LUVA 1R6NA 3OMNB 3RYIA 1YIJV 4DR3B 5H6RA 3JALB 4TV9A 4TQDA 3LNMB 1QVGU 3DC6A 3JYCA 5IWAB 3JASA 4WBNB 5IYZA 1Z5VA 3D3IA 2VQEO 4DV3B 2IJKA 2BSKB 3B8NA 3ZS8C 3K06A 4JI6O 2HJFC 1GRJA 4DYLA 3N2GA 1GN2A 1EM1A 1THZA 4X8AA 3UT5A 3WG7C 5CA3A 3CC7V 5KAFZ 3E89A 4RO2A 3ZRWB 5CB4B 3H9VA 1R3LC 2AHYA 3JAWB 5CBGA 4WFEA 1NTKH 4OXSA 4Z2WA 1VQKV 5JH7A 3K5LA 3K04A 1AR1B 2KKWA 2QM7A 4MTGA 3IAYA 4MS2A 3F7VC 4I55B 3JSLA 4JYYA 5LOVB 2VWKA 1RPRA 2WA4A 4J42A 1PD3A 2WLLA 3E2EA 1G4YB 3JD0A 4JASA 4UCSA 4YHHB 2QWNB 5KHJA 3CRQA 3ZRVA 3P3NA 5L3DA 5K1PA 2DN9A 2B5UA 4LF6B 3OMAB 1XHZA 1NS1A 4JGSA 2ZR3A 1XNRO 3FB5C 4UCVA 4JI6B 1IBKO 3CP1A 1H8EG 2CTQA 4DR4O 3ZHSA 5E1AC 2Q5ZA 4MVZA 3ABMC 3I55V 3ZN0A 2W6IG 4DR2B 4K3AA 2ZM6O 4JV5O 2XAJA 5B66Z 1ZL8B 2NNUA 4WFBV 4IIJA 4LFCO 3HKDA 3QF7A 3SJQC 4MTOA 4R50A 2LW1A 2QDOA 2QM4A 3FD9A 3F5WC 2K1EA 2X6CA 4J7KA 1G6UA 3WB1A 2KSDA 3SGIA 2KQXA 4MVQA 1QR9A 4TWKA 1YSCA 5AG2A 2JEXA 1XNRB 2NLJC 5J2UA 2OWOA 4LF5O 1O9HA 1YDXA 4UB8Z 5FPOA 1IBKB 5IJ9B 4LF7O 2R9IA 4IHJA 1YJ9V 4DR4B 3H1LH 5EIBD 2UXXA 2DOSA 4O4HB 2YDEA 1SQQH 2PTMA 1ZSPA 3H1IH 4BWAA 2F95B 2V4DA 3QO5A 4Q6GA 4YY3O 1QHTA 3SJBC 2ZM6B 4LCUC 4JV5B 3LDEA 3ABLB 3UQ8A 3Q4HB 2DW4A 1F23A 4OX9O 2ODMA 2IU3A 1GM7A 2QE7G 4LFCB 2ETNA 5KHIA 4KUMA 1VEWA 3AG4C 1KP3A 3AG4B 4X65O 1IX9A 2YICA 4L87A 3ASNB 4RWUA 3OE7G 4LNUA 5FNVA 4F4LA 1YJWV 1GH6A 3LSUA 4LF5B 4F6RA 4PA9A 4LF7B 4D7SA 3IGAC 2E75B 1XL4A 3F7YC 3RFRA 1EFRG 3CRCA 1MG1A 1BGYH 1PNLA 1SKVA 1YTFB 4YY3B 3K5NA 2GSMB 5JWPA 2HJDA 1DGSA 2DWEC 2JDIG 1ENVA 4LF4O 3SPJA 5H5NA 1UPGA 3JSNA 1JOYA 4FJCC 4OX9B 4YXWG 1XBLA 5EBLC 3FYEB 5L3GA 1R3IC 4DV6O 3DC5A 4DV1B 1Q5OA 1NBMG 3E22A 2H8PC 3E35A 4X65B 2ITCC 4DR7O 4GX2A 3WB0A 2OCCC 1HP8A 4Z1MG 5J2TA 1AJQA 2OCCB 1K5SA 4JF3A 5IE9A 2G38A 1ZTEA 4ZI7A 1LR1A 3SPCA 4YJ2A 1BQZA 3OD4A 1VARA 5JCOC 4WFFA 4RUEA 1V54C 1RPOA 4X1KB 1NVPD 1I94O 1EZVH 3ZMVA 4I0XA 2WLIB 1DK1A 2PGGA 4X1YA 3CRMA 4PV1B 4LF4B 2R9AA 4U7OA 4CBCA 3JATB 4NXNO 5A2QN 1JJ2U 4WFGA 4DV6B 1MSWD 4GX0A 4R6ZA 4ZBMA 3CD6V 1WP7A 2CTWA 4YJ3B 3T2MA 2CK3G 4DR7B 1ROPA 4DXWA 4RQFA 5LHHA 5LA6A 2XASA 3RT3C 3CSXA 4U3JB 5C8YA 2D3OW 4CH4A 1HNWO 3ZJZA 2M6YA 1KB9F 2EIMB 3ETGA 4UUJC 1AI6A 4PA3A 2HG5C 2Y48A 3M99B 2IW5A 4O2AB 1L0LH 4ICGA 5B1NA 4UCUA 4JI3O 1HR0O 2IM9A 2WLHA 1GTOA 2OT5A 3CCJV 5L3BA 3N2KA 1MZFA 1SQXH 3KCXA 2QKCA 1IXMA 4GYCB 2CE4A 4NXNB 1NTZH 4J7ZA 3ASOC 3T4ZA 5LXTB 3JAKB 5CA0B 2E5LO 2LW7A 4X64O 2CTPA 1N4CA 2IJIA 3L74H 3U0ZA 1PM9A 4X20B 5JVDB 1N34O 3QO7A 4TV8B 2RMKB 3RN4A 1BS3A 2QWOB 5EYPA 3JCUZ 1K7DA 1JA8A 2CGNA 5LGTA 2RQ6A 4FFKA 2ZDIA 1HNWB 1B6QA 2Q7GA 1FFXA 1E1RG 4BW5A 4I4TB 1M5IA 5IJ0A 3G4SV 4G28B 3ZX6A 4JI3B 3CJHB 2X6BA 1OCOB 2IBZH 1JCHA 3MDSA 4JI2O 4PI0A 3CXCU 1E79G 2YIBA 1Q81W 4YIPA 2W6JG 4B08A 1DLBA 3BCCH 2ZXWC 1D5AA 5LP6A 2DMXA 1AP6A 1G1XB 4GKKO 2X0LA 3FFQA 1N34B 1M9NA 3C3TA 3RYCB 4PA6A 1B06A 2VRZA 4JYBA 4DR1O 3T1HO 1TA8A 5LMNB 1S0VA 2AW9A 2BOCC 2Q0AA 1P7GA 4L8JA 3QNEA 2YI9A 3OM3B 1K34A 2P4KA 3K0DA 2BTQA 5IYZB 2AZ0A 4MVRA 1FJGB 1CXZB 2XOKG 2JGDA 1K33A 3P30A 4LFBO 2ATKC 1W0KG 3CC4V 2RNBA 4DV5B 1K73W 4JI2B 4JYAO 3SYCA 2LP7A 3ZRSA 4JI8O 2YUAA 1EBOA 1YITV 1X59A 2CGOA 5IDJA 1OCCC 2A3QA 4GKKB 1JVMA 4H44B 2GTSA 1YJNV 1OCCB 4GKJO 2C2AA 5JH7B 3ML0A 1GN3A 1WB8A 1BMFG 3T1HB 3SPIA 1M1KW 2ADQB 2AHZA 3LSQA 1Z5WA 4DV7O 1M56C 4ZOLA 1AI4A 1FS0G 1VQMV 2RN9A 2Z3YA 3ABTA 1M93A 1NKDA 4LFBB 1V9PA 2ZKOA 1Q6IA 4O2BA 2EINC 4JYAB 3ZHQA 1AI7A 3W7XA 1MZEA 2CDYA 4GX5A 3RWRD 4NXMO 5IWAO 4MTFA 4JI4O 3L70H 4CH3A 1G8MA 3ICXA 4EEQA 4J7JA 4JTDB 1R1BA 1RM1B 1ZWIC 4NTWA 4FZ0A 4FVMA 1R6KA 2JK5C 2JRIA 5K1XA 2UUAO 2PI4A 3M8AA 1GM9A 4GKJB 1K3EA 1CP9A 3AK2A 4OPAA 4IIJB 1FXKA 1WPBA 4PJ0Z 4D7TA 2LFSA 2PY5A 1IBLO 4IYHA 1I0HA 5CBFA 4DRXB 3W7UA 2R72A 4ZKIA 1RSOB 4FM2A 4X1IA 1MABG 3CHXA 3B4SA 2YXYA 4UV9A 4XBFA 1KU9A 1WPXA 5JJNB 1E1QG 2BCCH 2ZINA 3FKSG 3X2QC 5KX5A 5J2UB 1COWG 1JFFA 1NVPB 5KA6A 3ZHUA 5LL6Y 2R9RB 1Q43A 4NXMB 3PN1A 4JI4B 1L8DA 4YHHO 2QTSA 1NH2D 2PF4E 4MT8A 5JQGA 4LWSB 1HNXO 4LF6O 2ZNJA 1WA8B 2UUAB 1QLNA 3E86A 2CTRA 1K92A 4TSFG 1F4MA 5EZYB 1D2DA 1OCRC 3WG7B 3JARA 3K9AA 1IBLB 3U11A 1VQOV 2F1MA 4G27B 3K08A 4DR2O 1GMGA 2QJ1A 5F2VO 1KBHA 4E2LA 1ZUQA 1YF2A 4UVCA 3VBBA 1JQ0A 4CC6A 2EILC 3A2FA 4CS4A 4F6RB 4ZIBA 1OJHA 1SQFA 3CCVV 2EILB 1QLEC 1VF5B 3CX5F 2QWRB 5LGUA 4X89A 1HNXB 2Q69A 1AR4A 4JI0O 1XI1A 2Y4UA 1Y6XA 1YEWA 2W0XA 3AG7A 1UFIA 3DXRA 2XTAA 1TUEB 4R8CA 1SA0A 1B3QA 3SR2C 1ZLZA 4ASUG 3VQYA 1NZ6A 1BL8A 1VF7A 4AI8A 1Y67A 2GUZA 4BIOA 4X9QA 3ABMB 1YCIA 4J9ZB 5H9CA 3E8HA 1Q90D 4CH5A 1BHAA 3ZRXA 3HKEA 5J2TB 3APQA 4O4LB 3TXQA 4TOIA 3QTCA 1RP3B 1KMIZ 4NTXA 1NT2B 3CCSV 2ZE5A 3BRCA 1XNQB 4PDVA 3ABUA 1BSMA 4JI0B 1VMGA 5E79Z 3PJSK 1I5XA 5JJJB 2Q68A 4X1YB 4JI1O 3AG1C 2Z5UA 2HVJC 4K8XA 3DTUB 1VQ8V 4Q20A 3OGCC 1BT8A 4I5SA 3UCSC 3ABKC 1FD9A 3B8MA 3JALA 4BR6A 1H8HG 4WCEV 4DV4O 2VQFO 1P84F 2P4VA 4WBNA 4G2KA 4DV1O 4EB6A 2HEPA 4NYKA 1H2NA 3RBZA 5DECA 2BSKA 3A0BZ 3ZBHA 2UXNA 2KG7A 1S5LZ 1TUBB 2UXDO 1Q6HA 1JPXA 3GWOA 3P32A 3O9OA 3OW2U 2WAMA 4YIOA 3CRAA 2AXTZ 3OUFA 1FPOA 3ZRWA 5CB4A 4JI1B 2XAGA 5LHIA 3OAAG 4GUNA 3WFVA 2HVKC 3IC7A 5B5EZ 4GX1A 1TGOA 2DJVA 2H3OA 2XAHA 4I55A 1GN6A 4XDLA 4FLZA 3H01A 1KQSU 2EIKC 2P22C 4DV4B 2VQFB 1MSDA 1J95A 3B09A 3STZC 2EIKB 2Q4PA 4JZGA 5EYPB 5KMGB 1MMMA 2ZDIC 1SETA 3BA9A 4EFEA 2OIEA 2XAQA 4JI5O 3THOA 3CEIA 4H37A 2E76B 2LJ2A 1AILA 3C90A 4NB5A 2UXDB 3LNNA 3G71V 3OTFA 3AEIA 3K5OA 2L6LA 2WLKA 4B7EA 5IJ0B 1Y66A 1FFTB 2EJ7A 1H2KA 5BY1A 2HR3A 2P5OA 1M57C 2QTOA 2V1DA 4OGQB 2F43G 1XREA 1S77D 1M90W 3K3WA 1YXBA 1S76D 1PKXA 1DF5A 3F5TA 2ZE8A 3IFXA 2ZT9B 4TUYB 1Z2GA 3L9DA 4DO2A 4B3SO 1V54B 4RUFA 4X66O 2YS8A 4W4KA 2QKAA 3EXAA 3HKBB 3OFNG 4JI5B 4FFBA 1SZXA 2R70A 2XUMA 4FIPC 4TQFA 4J11A 2CH7B 3ZMUA 5IJ9A 2CAZC 1EN4A 2BTQB 1GAXA 4O4IB 2PYJA 2Y4TA 5CA1B 4MVOA 3ZHRA 3WU2Z 4RQEA 1FYJA 4O4HA 3LDDA 1PL4A 4PDLA 1NH2B 1XEQA 5LGNA 3B2EE 1XDCA 1YZBA 1BE3H 3Q4HA 3CCEV 5ITZB 4BAYA 1CEZA 4B3SB 4X66B 5LHGA 2PI5A 2WSSG 1VQ7V 1U96A 2WLJA 3L71H 1DTOA 3AG3C 1D5NA 3DSQA 2ZCEA 1PV0A 5KAIZ 3AG3B 3G80A 1A32A 1N33B 2ZD9A 4QIWF 2EZOA 2Q7EA 3CPWU 1PP9H 2QWQB 3ASOB 3JAMN 4ZHQA 4P9PA 5B1OA 2YEVB 1W0JG 3RYFB 3R65A 1NQTA 1OHHG 4QJFB 4HNAB 4J80A 4NTYA 5LBQA 3HB3B 1Y74A 3SDLA 1BQ0A 2LQTA 1TVKB 4N21A 5LMNO 1NJIW 5IT9N 4O2BB 5D5QA 4O4JB 3MD0A 1K8AW 3SPGA 3VQWA 2W0FC 2WWWA 3D36A 4P2ZA 2Y0IA 1IBMO 3RVZA 2DYSC 4BW9A 1FJGO 4I50B 1R3KC 3NXSA 1FXVA 4MTXA 2JGUA 4DR5O 4DV5O 3TXSA 2LGWA 1N0NA 1R6TA 2ZIMA 1FXKC 4FLYA 4B3RB 4B3TO 2ZE7A 5FLXN 2ITDC 3HKCB 3T1YB 2ZXWB 4TT3G 5HFMA 1BZKA 3CE2A 1XHXA 3O65A 2ARHA 4HBNA 3RYIB 4X1KA 4X1IB 4LP8A 4CH6A 3ZHTA 3TK1A 4E4EA 3ZCCA 2QEXV 4TV9B 4GZRB 1H2GA 1YVWA 3ZN1A 4JAUA 4UCTA 1IURA 1WN7A 1GM8A 1AB3A 1HDJA 2FKXA 3JASB 1IBMB 2JIZG 3JATA 4JTCB 3CMEV 5LYJA 4K35A 1B04A 4WFHA 2Q73A 5LMUB 2QM8A 4DR5B 1TAEA 1URFA 1KKDA 2HFEC 4MVSA 2NR5A 3APOA 2KB1A 3N2GB 4I9QA 1WB7A 3UT5B 5KLVH 4YJ3A 3U10A 4B3TB 1Q82W
chains in the Genus database with same CATH topology
2CTQA 1FAFA 4J80A 1HDJA 2CUGA 3BVOA 2YS8A 2N04A 3UO3A 3APQA 1XBLA 2Y4TA 2QWOB 4IT5A 2QWNB 1BQ0A 3AG7A 1NZ6A 2PF4E 2QWRB 2N05A 4J7ZA 2M6YA 3UCSC 1BQZA 2DN9A 2QWPB 2LGWA 2GUZA 2KQXA 2CTPA 2GUZB 1N4CA 2QWQB 2Y4UA 1WJZA 2CTRA 3APOA 4RWUA 2OCHA 2L6LA 2YUAA 2DMXA 2QSAA 2CTWA 2LO1A 3UO2A 1GH6A 1FPOA 1IURA 2EJ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTQ A;  1FAF A;  4J80 A;  1HDJ A;  2CUG A;  3BVO A;  2YS8 A;  2N04 A;  3UO3 A;  3APQ A;  1XBL A;  2Y4T A;  2QWO B;  4IT5 A;  2QWN B;  1BQ0 A;  3AG7 A;  1NZ6 A;  2PF4 E;  2QWR B;  2N05 A;  4J7Z A;  2M6Y A;  3UCS C;  1BQZ A;  2DN9 A;  2QWP B;  2LGW A;  2GUZ A;  2KQX A;  2CTP A;  2GUZ B;  1N4C A;  2QWQ B;  2Y4U A;  1WJZ A;  2CTR A;  3APO A;  4RWU A;  2OCH A;  2L6L A;  2YUA A;  2DMX A;  2QSA A;  2CTW A;  2LO1 A;  3UO2 A;  1GH6 A;  1FPO A;  1IUR A;  2EJ7 A; 
#chains in the Genus database with same CATH topology
 1I08 A;  3J7A U;  1OZ0 A;  3G6B A;  2H94 A;  4U3J A;  3TET A;  5EC2 C;  3K0G A;  5GON A;  4H33 A;  3BPZ A;  1SC5 B;  4XDK A;  1WAZ A;  4O2A A;  1P49 A;  4EKW A;  1SQB H;  4CZZ A;  4CC5 A;  1IXB A;  1QBZ A;  1V55 C;  4MSW C;  3RYH A;  3CWB H;  1PPJ H;  2WLL B;  4P30 A;  1NR1 A;  1GO3 F;  1N36 O;  4QGP A;  2HKO A;  3JD1 A;  1HWY A;  1AR5 A;  4MVM A;  3BAA A;  1M56 B;  5LXT A;  3JAK A;  3OR6 C;  4HZ3 A;  2QA4 V;  1HW7 A;  2FB5 A;  2ILM A;  4PEL A;  3BEH A;  2L35 A;  1SQG A;  4R7C A;  5H2F Z;  3BHP A;  1MNG A;  4X20 A;  1JJO A;  2A7W A;  5JVD A;  1K5Q A;  1AJP A;  2EIN B;  3DXR B;  4WFA V;  3UKM A;  2WA3 A;  3FB6 C;  1N32 O;  2YIB D;  3CYO A;  5L3E A;  3GWK C;  4UFZ A;  5KA5 A;  1SQP H;  2DWD C;  1F7Y A;  1VIB A;  1KKC A;  3IC9 A;  2JJ2 G;  4XDJ A;  1VQP V;  3VOU A;  4QPJ A;  2V7Q G;  3HKE B;  3K57 A;  3HKD B;  4CS2 A;  3KKY A;  1N36 B;  2WLN A;  4X88 A;  1H2S B;  3SPH A;  3CXH F;  2XAF A;  1LUW A;  1S5J A;  1SF9 A;  2EX3 A;  1BCC H;  4JAV A;  5FPR A;  2Z0A A;  4CS3 A;  4PA4 A;  1SRY A;  3AK1 A;  3X2Q B;  1NTM H;  4IHJ B;  1XMO O;  5BR8 B;  4MW3 A;  3W7T A;  4GT1 A;  2FL4 A;  4QE7 A;  3GVM A;  3CCU V;  4MW8 A;  2Y0P A;  1S5H C;  3L72 H;  1VF6 A;  1ZAU A;  1N32 B;  1FXH A;  4MVU A;  2BOB C;  4J9Y B;  4FLX A;  4JTA B;  4I7Z B;  1XMQ O;  4UCR A;  1Q8I A;  3L73 H;  1SQV H;  2QR4 A;  1EZJ A;  1BHB A;  4KFM A;  1JR9 A;  3KZI Z;  4EB6 B;  1OCR B;  2RJZ A;  1M4U A;  3RGB A;  3QO8 A;  2KG7 B;  3CCM V;  5IYD O;  5GTI Z;  5L3C A;  4K0K B;  4LFA B;  2PYL A;  4FLV A;  1EN6 A;  4LNU B;  5FNV B;  5EC1 C;  1SS3 A;  5J9P C;  4PDR A;  1QU7 A;  3C3S A;  3MHH C;  1K4C C;  2JS3 A;  3I56 V;  1F51 A;  1XMO B;  4DV2 O;  4JI7 O;  2GBO A;  1QLE B;  3E8B A;  2Q6A A;  1VQ6 V;  5DN6 G;  1XNQ O;  1Y4M A;  4PD4 F;  2UU9 O;  1XL6 A;  3STL C;  3OR7 C;  4J41 A;  3OEE G;  4FMT A;  4C7U A;  1XMQ B;  2HLD G;  2JEU A;  1Y76 A;  2QGN A;  4PA7 A;  4DUY O;  1S72 V;  1SZT A;  2PZS A;  2VQE B;  3FAV A;  4UVA A;  2GTA A;  5KHH A;  3K9S A;  3L75 H;  3E8F A;  2A9H A;  1KP2 A;  3E22 B;  3ZIA G;  1W2B U;  3SJA C;  2YIA A;  5CMU A;  4AIL C;  4QNH B;  1NI8 A;  5GW7 A;  4B7K A;  2OIG A;  3A8T A;  2XND G;  1H2M A;  1XQ8 A;  5BMV A;  1I7F A;  4ZI7 B;  2YC0 A;  4DV2 B;  4JI7 B;  2HP8 A;  4YJ2 B;  3P3P A;  2Q7H A;  4BIZ A;  3EFF K;  1H38 A;  4I0X B;  3CRR A;  1QVF U;  2UU9 B;  3BAB A;  1AI5 A;  4LBE C;  5BXZ A;  2LO1 A;  2FTK A;  3JD4 A;  3K03 A;  3ZHV A;  2YXL A;  1GN4 A;  4DRX A;  1L1F A;  3BVO A;  3I5D A;  2N04 A;  3AG1 B;  2B1I A;  4NVP A;  3R66 A;  4DUY B;  1RSO A;  3H1J H;  4FLW A;  3OMI B;  4FFB B;  3WB2 A;  4LH7 A;  4LC1 A;  2PUS A;  4IYI A;  3UM7 A;  4PI2 A;  3ABK B;  1K97 A;  5KUK A;  1MA1 A;  1JMK C;  2XHB A;  4DR6 O;  3GB7 C;  3BFR A;  4FLU A;  4LR3 A;  4LWS A;  1LNQ A;  5LA6 B;  1XOU A;  5C8Y B;  5EK0 A;  5EBM C;  1WA8 A;  4JZ2 A;  2B1G A;  2WLM A;  3ABL C;  1R3J C;  5IYC O;  1Q7Y W;  1WJZ A;  3EHB B;  4A5U B;  2MK3 A;  4B3M O;  5EZY A;  1OV9 A;  4FZ1 A;  3N27 A;  3D8C A;  1S3J A;  3FB8 C;  3TGU H;  3K58 A;  3JAW A;  2HHH O;  2F66 C;  1P7B A;  2UXB O;  3N2K B;  1QCE A;  5L3F A;  1RFY A;  2M7W A;  2D2C B;  3DGE A;  4X62 O;  3ASN C;  4H13 B;  1QR8 A;  2GHY A;  1UJW B;  2UXC O;  5LOV A;  2N74 A;  4ZHQ B;  3SYQ A;  1Q86 W;  1XIL A;  3H1H H;  4DR6 B;  5TIS Z;  4HAM A;  2ZE6 A;  1Y74 B;  2A06 H;  3SJC C;  2OTJ V;  4AQY O;  5KHK A;  1WNS A;  3OEH G;  4PHZ A;  3KG2 A;  1JX9 A;  1VP7 A;  3D36 C;  4LF8 O;  1XUQ A;  1FFX B;  3MHS C;  2AGA A;  4FLT A;  1VQ9 V;  1CPY A;  3UO2 A;  4B3M B;  4DK0 A;  4QPK A;  1IVS A;  2YI8 A;  3UO3 A;  4J10 A;  2XT9 A;  3ZMS A;  2OTL V;  2HHH B;  1VQN V;  2UXB B;  1M57 B;  4FM1 A;  3BY6 A;  4D6T H;  4LH6 A;  1KYO F;  1K9M W;  2DQ0 A;  4X62 B;  4WF9 V;  5LP6 C;  4IL6 Z;  1ZL8 A;  2X6A A;  2UXC B;  4HYO A;  5LP6 B;  2ZQM A;  2FML A;  2VS0 A;  4EFB A;  3OTO O;  4I9W A;  4O4L A;  3LSS A;  2EBO A;  2E74 B;  5A9G A;  3ZMZ A;  1N33 O;  4FK5 C;  1J5E O;  2QWP B;  3JD2 A;  4AQY B;  2QKS A;  5KUM A;  4LF9 O;  5D5P A;  2E3C A;  4FPP A;  4DK1 A;  2P06 A;  1QQC A;  2JVD A;  4LF8 B;  1WLE A;  1N8R W;  3CCR V;  5B3S C;  5HFL A;  3SYP A;  2DE0 X;  4UB6 Z;  4DUZ O;  4JPR A;  3ETE A;  4BIU A;  5LYJ B;  5B3S B;  3VQX A;  4FM0 A;  1PNM A;  2JGD B;  5GTH Z;  3ETD A;  3JCZ A;  1Q6U A;  2LFR A;  2K9P A;  1AVM A;  1NR7 A;  5B1B C;  4UVB A;  2WPD G;  4KP4 A;  3K79 A;  1AP5 A;  2F4V O;  5B1B B;  2F93 B;  1KD1 W;  3W7W A;  2EIM C;  3OTO B;  1KUQ A;  5GON B;  1TUB A;  4PDM A;  2VWJ A;  2X7R B;  3E83 A;  2EZP A;  1J5E B;  4GCZ A;  1AJN A;  4N23 A;  4B3R O;  3LUT B;  1I94 B;  4LF9 B;  1P4R A;  1MOF A;  3RYH B;  3T1Y O;  5DED A;  2YSU B;  3BA8 A;  4KHP O;  1N0J A;  1VQ5 V;  4ZOL B;  2P67 A;  4DUZ B;  1IDS A;  4W4L A;  2ZNI A;  1O9G A;  4IGG A;  2IU0 A;  3S3W A;  4NR1 A;  2UUB O;  2ZIO A;  3K5M A;  4U3F H;  1GKF A;  2NN4 A;  4H0L B;  3FYI B;  2O57 A;  3NR7 A;  2FYU H;  2GDS A;  1X4T A;  3B40 A;  1FKA O;  2F4V B;  4U7N A;  1DF4 A;  5KMG A;  4K8Z A;  3CC2 V;  5LMU O;  2DYS B;  5BZB A;  4NKG B;  5FL7 G;  1QNM A;  2Q9L A;  1L0N H;  2EIJ C;  1GK9 A;  3T1C A;  1FXK B;  1HR0 B;  1OCO C;  2EIJ B;  3CB2 A;  3RVY A;  1HNZ O;  3JD3 A;  2IJJ A;  3H1K H;  4KHP B;  2P90 A;  3ZED A;  2A0L A;  3OT7 A;  1I5Y A;  1PL0 A;  3FB7 C;  1OCZ C;  2E5L B;  3LDC A;  2UUB B;  4TUY A;  4X64 B;  4JYC A;  4DW0 A;  3J81 N;  4Z1V A;  2WLI A;  2DQ3 A;  2Y69 C;  5JCO A;  1OCZ B;  3S3X A;  5KX5 B;  3CCL V;  2Y69 B;  1JFF B;  1US6 A;  2P7T C;  1W59 A;  2B9Z A;  5EBW C;  3MAQ A;  4RAI A;  3AK3 A;  1VF6 C;  1Q3E A;  3A0R A;  3T4D A;  3HKB A;  5JQG B;  5B1A C;  1PNK A;  4GLX A;  2ADP A;  5B1A B;  3G67 A;  2UUC O;  4ABM A;  1IZ3 A;  2CH7 A;  2P6J A;  1U97 A;  4AHC A;  2GV9 A;  3EVK A;  2AZ2 A;  4UXN A;  2Q0O C;  4O4I A;  1NU1 H;  2RDC A;  3JAR B;  4DW1 A;  5CA1 A;  5EIB C;  2Q67 A;  1HNZ B;  1YI2 V;  1R73 A;  1H2L A;  3W7S A;  3SYO A;  5IYB O;  2IH1 C;  1WP8 A;  2OCH A;  5CN0 A;  5ITZ A;  2OYQ A;  4DV0 O;  2F23 A;  5JJE B;  1ORQ C;  1V55 B;  4KXR A;  4P9O A;  4IT5 A;  5KHG A;  1YTF D;  1KC8 W;  3OUS A;  4OPH A;  4DR1 B;  5CA0 A;  3IJ4 A;  3CCQ V;  3QVN A;  5C93 A;  2JJ1 G;  2UUC B;  2DYR C;  2YEV A;  3RYF A;  2YXH A;  1SES A;  2YID A;  1K4D C;  3TCU A;  5H6Q A;  2QSA A;  3FX7 A;  2EJR A;  4HNA A;  2DYR B;  1F4N A;  1FAF A;  4F6E A;  5IY5 C;  2CUG A;  3CS5 A;  4TV8 A;  3OGI B;  1Y76 B;  5BR8 O;  1SA0 B;  1EN5 A;  2Q8V A;  5IY5 B;  3TJT A;  3FAV B;  2IH3 C;  1TVK A;  3AG2 C;  1YHQ V;  4KL1 A;  3CMA V;  4DR3 O;  3KCY A;  4QE9 A;  3AG2 B;  2GUZ B;  1T5E A;  1KEC A;  4O4J A;  1VQ4 V;  3D3Q A;  2BTO A;  4I4T A;  3A0H Z;  3QG5 A;  4JI8 B;  2EUL A;  3CJH A;  2LGQ A;  1RM1 C;  2ZR2 A;  3RW0 A;  3K59 A;  4DV0 B;  3HPL C;  1ARO P;  4I50 A;  4DV3 O;  3B77 A;  5BMV B;  3M7M X;  3E8G A;  2JS5 A;  2MW2 B;  3SYA A;  5DM6 V;  2N05 A;  2A79 B;  4K0K O;  3J80 N;  2IJH A;  4LFA O;  4UV8 A;  4UCO A;  3ZMT A;  3HR0 A;  1ZX3 A;  3G6E V;  4JAA A;  1VQL V;  3HKC A;  3VQV A;  2RCV A;  5CBH A;  3ETQ A;  4DV7 B;  3RYC A;  2BE3 A;  1SER A;  1LUV A;  1R6N A;  3OMN B;  3RYI A;  1YIJ V;  4DR3 B;  5H6R A;  3JAL B;  4TV9 A;  4TQD A;  3LNM B;  1QVG U;  3DC6 A;  3JYC A;  5IWA B;  3JAS A;  4WBN B;  5IYZ A;  1Z5V A;  3D3I A;  2VQE O;  4DV3 B;  2IJK A;  2BSK B;  3B8N A;  3ZS8 C;  3K06 A;  4JI6 O;  2HJF C;  1GRJ A;  4DYL A;  3N2G A;  1GN2 A;  1EM1 A;  1THZ A;  4X8A A;  3UT5 A;  3WG7 C;  5CA3 A;  3CC7 V;  5KAF Z;  3E89 A;  4RO2 A;  3ZRW B;  5CB4 B;  3H9V A;  1R3L C;  2AHY A;  3JAW B;  5CBG A;  4WFE A;  1NTK H;  4OXS A;  4Z2W A;  1VQK V;  5JH7 A;  3K5L A;  3K04 A;  1AR1 B;  2KKW A;  2QM7 A;  4MTG A;  3IAY A;  4MS2 A;  3F7V C;  4I55 B;  3JSL A;  4JYY A;  5LOV B;  2VWK A;  1RPR A;  2WA4 A;  4J42 A;  1PD3 A;  2WLL A;  3E2E A;  1G4Y B;  3JD0 A;  4JAS A;  4UCS A;  4YHH B;  2QWN B;  5KHJ A;  3CRQ A;  3ZRV A;  3P3N A;  5L3D A;  5K1P A;  2DN9 A;  2B5U A;  4LF6 B;  3OMA B;  1XHZ A;  1NS1 A;  4JGS A;  2ZR3 A;  1XNR O;  3FB5 C;  4UCV A;  4JI6 B;  1IBK O;  3CP1 A;  1H8E G;  2CTQ A;  4DR4 O;  3ZHS A;  5E1A C;  2Q5Z A;  4MVZ A;  3ABM C;  3I55 V;  3ZN0 A;  2W6I G;  4DR2 B;  4K3A A;  2ZM6 O;  4JV5 O;  2XAJ A;  5B66 Z;  1ZL8 B;  2NNU A;  4WFB V;  4IIJ A;  4LFC O;  3HKD A;  3QF7 A;  3SJQ C;  4MTO A;  4R50 A;  2LW1 A;  2QDO A;  2QM4 A;  3FD9 A;  3F5W C;  2K1E A;  2X6C A;  4J7K A;  1G6U A;  3WB1 A;  2KSD A;  3SGI A;  2KQX A;  4MVQ A;  1QR9 A;  4TWK A;  1YSC A;  5AG2 A;  2JEX A;  1XNR B;  2NLJ C;  5J2U A;  2OWO A;  4LF5 O;  1O9H A;  1YDX A;  4UB8 Z;  5FPO A;  1IBK B;  5IJ9 B;  4LF7 O;  2R9I A;  4IHJ A;  1YJ9 V;  4DR4 B;  3H1L H;  5EIB D;  2UXX A;  2DOS A;  4O4H B;  2YDE A;  1SQQ H;  2PTM A;  1ZSP A;  3H1I H;  4BWA A;  2F95 B;  2V4D A;  3QO5 A;  4Q6G A;  4YY3 O;  1QHT A;  3SJB C;  2ZM6 B;  4LCU C;  4JV5 B;  3LDE A;  3ABL B;  3UQ8 A;  3Q4H B;  2DW4 A;  1F23 A;  4OX9 O;  2ODM A;  2IU3 A;  1GM7 A;  2QE7 G;  4LFC B;  2ETN A;  5KHI A;  4KUM A;  1VEW A;  3AG4 C;  1KP3 A;  3AG4 B;  4X65 O;  1IX9 A;  2YIC A;  4L87 A;  3ASN B;  4RWU A;  3OE7 G;  4LNU A;  5FNV A;  4F4L A;  1YJW V;  1GH6 A;  3LSU A;  4LF5 B;  4F6R A;  4PA9 A;  4LF7 B;  4D7S A;  3IGA C;  2E75 B;  1XL4 A;  3F7Y C;  3RFR A;  1EFR G;  3CRC A;  1MG1 A;  1BGY H;  1PNL A;  1SKV A;  1YTF B;  4YY3 B;  3K5N A;  2GSM B;  5JWP A;  2HJD A;  1DGS A;  2DWE C;  2JDI G;  1ENV A;  4LF4 O;  3SPJ A;  5H5N A;  1UPG A;  3JSN A;  1JOY A;  4FJC C;  4OX9 B;  4YXW G;  1XBL A;  5EBL C;  3FYE B;  5L3G A;  1R3I C;  4DV6 O;  3DC5 A;  4DV1 B;  1Q5O A;  1NBM G;  3E22 A;  2H8P C;  3E35 A;  4X65 B;  2ITC C;  4DR7 O;  4GX2 A;  3WB0 A;  2OCC C;  1HP8 A;  4Z1M G;  5J2T A;  1AJQ A;  2OCC B;  1K5S A;  4JF3 A;  5IE9 A;  2G38 A;  1ZTE A;  4ZI7 A;  1LR1 A;  3SPC A;  4YJ2 A;  1BQZ A;  3OD4 A;  1VAR A;  5JCO C;  4WFF A;  4RUE A;  1V54 C;  1RPO A;  4X1K B;  1NVP D;  1I94 O;  1EZV H;  3ZMV A;  4I0X A;  2WLI B;  1DK1 A;  2PGG A;  4X1Y A;  3CRM A;  4PV1 B;  4LF4 B;  2R9A A;  4U7O A;  4CBC A;  3JAT B;  4NXN O;  5A2Q N;  1JJ2 U;  4WFG A;  4DV6 B;  1MSW D;  4GX0 A;  4R6Z A;  4ZBM A;  3CD6 V;  1WP7 A;  2CTW A;  4YJ3 B;  3T2M A;  2CK3 G;  4DR7 B;  1ROP A;  4DXW A;  4RQF A;  5LHH A;  5LA6 A;  2XAS A;  3RT3 C;  3CSX A;  4U3J B;  5C8Y A;  2D3O W;  4CH4 A;  1HNW O;  3ZJZ A;  2M6Y A;  1KB9 F;  2EIM B;  3ETG A;  4UUJ C;  1AI6 A;  4PA3 A;  2HG5 C;  2Y48 A;  3M99 B;  2IW5 A;  4O2A B;  1L0L H;  4ICG A;  5B1N A;  4UCU A;  4JI3 O;  1HR0 O;  2IM9 A;  2WLH A;  1GTO A;  2OT5 A;  3CCJ V;  5L3B A;  3N2K A;  1MZF A;  1SQX H;  3KCX A;  2QKC A;  1IXM A;  4GYC B;  2CE4 A;  4NXN B;  1NTZ H;  4J7Z A;  3ASO C;  3T4Z A;  5LXT B;  3JAK B;  5CA0 B;  2E5L O;  2LW7 A;  4X64 O;  2CTP A;  1N4C A;  2IJI A;  3L74 H;  3U0Z A;  1PM9 A;  4X20 B;  5JVD B;  1N34 O;  3QO7 A;  4TV8 B;  2RMK B;  3RN4 A;  1BS3 A;  2QWO B;  5EYP A;  3JCU Z;  1K7D A;  1JA8 A;  2CGN A;  5LGT A;  2RQ6 A;  4FFK A;  2ZDI A;  1HNW B;  1B6Q A;  2Q7G A;  1FFX A;  1E1R G;  4BW5 A;  4I4T B;  1M5I A;  5IJ0 A;  3G4S V;  4G28 B;  3ZX6 A;  4JI3 B;  3CJH B;  2X6B A;  1OCO B;  2IBZ H;  1JCH A;  3MDS A;  4JI2 O;  4PI0 A;  3CXC U;  1E79 G;  2YIB A;  1Q81 W;  4YIP A;  2W6J G;  4B08 A;  1DLB A;  3BCC H;  2ZXW C;  1D5A A;  5LP6 A;  2DMX A;  1AP6 A;  1G1X B;  4GKK O;  2X0L A;  3FFQ A;  1N34 B;  1M9N A;  3C3T A;  3RYC B;  4PA6 A;  1B06 A;  2VRZ A;  4JYB A;  4DR1 O;  3T1H O;  1TA8 A;  5LMN B;  1S0V A;  2AW9 A;  2BOC C;  2Q0A A;  1P7G A;  4L8J A;  3QNE A;  2YI9 A;  3OM3 B;  1K34 A;  2P4K A;  3K0D A;  2BTQ A;  5IYZ B;  2AZ0 A;  4MVR A;  1FJG B;  1CXZ B;  2XOK G;  2JGD A;  1K33 A;  3P30 A;  4LFB O;  2ATK C;  1W0K G;  3CC4 V;  2RNB A;  4DV5 B;  1K73 W;  4JI2 B;  4JYA O;  3SYC A;  2LP7 A;  3ZRS A;  4JI8 O;  2YUA A;  1EBO A;  1YIT V;  1X59 A;  2CGO A;  5IDJ A;  1OCC C;  2A3Q A;  4GKK B;  1JVM A;  4H44 B;  2GTS A;  1YJN V;  1OCC B;  4GKJ O;  2C2A A;  5JH7 B;  3ML0 A;  1GN3 A;  1WB8 A;  1BMF G;  3T1H B;  3SPI A;  1M1K W;  2ADQ B;  2AHZ A;  3LSQ A;  1Z5W A;  4DV7 O;  1M56 C;  4ZOL A;  1AI4 A;  1FS0 G;  1VQM V;  2RN9 A;  2Z3Y A;  3ABT A;  1M93 A;  1NKD A;  4LFB B;  1V9P A;  2ZKO A;  1Q6I A;  4O2B A;  2EIN C;  4JYA B;  3ZHQ A;  1AI7 A;  3W7X A;  1MZE A;  2CDY A;  4GX5 A;  3RWR D;  4NXM O;  5IWA O;  4MTF A;  4JI4 O;  3L70 H;  4CH3 A;  1G8M A;  3ICX A;  4EEQ A;  4J7J A;  4JTD B;  1R1B A;  1RM1 B;  1ZWI C;  4NTW A;  4FZ0 A;  4FVM A;  1R6K A;  2JK5 C;  2JRI A;  5K1X A;  2UUA O;  2PI4 A;  3M8A A;  1GM9 A;  4GKJ B;  1K3E A;  1CP9 A;  3AK2 A;  4OPA A;  4IIJ B;  1FXK A;  1WPB A;  4PJ0 Z;  4D7T A;  2LFS A;  2PY5 A;  1IBL O;  4IYH A;  1I0H A;  5CBF A;  4DRX B;  3W7U A;  2R72 A;  4ZKI A;  1RSO B;  4FM2 A;  4X1I A;  1MAB G;  3CHX A;  3B4S A;  2YXY A;  4UV9 A;  4XBF A;  1KU9 A;  1WPX A;  5JJN B;  1E1Q G;  2BCC H;  2ZIN A;  3FKS G;  3X2Q C;  5KX5 A;  5J2U B;  1COW G;  1JFF A;  1NVP B;  5KA6 A;  3ZHU A;  5LL6 Y;  2R9R B;  1Q43 A;  4NXM B;  3PN1 A;  4JI4 B;  1L8D A;  4YHH O;  2QTS A;  1NH2 D;  2PF4 E;  4MT8 A;  5JQG A;  4LWS B;  1HNX O;  4LF6 O;  2ZNJ A;  1WA8 B;  2UUA B;  1QLN A;  3E86 A;  2CTR A;  1K92 A;  4TSF G;  1F4M A;  5EZY B;  1D2D A;  1OCR C;  3WG7 B;  3JAR A;  3K9A A;  1IBL B;  3U11 A;  1VQO V;  2F1M A;  4G27 B;  3K08 A;  4DR2 O;  1GMG A;  2QJ1 A;  5F2V O;  1KBH A;  4E2L A;  1ZUQ A;  1YF2 A;  4UVC A;  3VBB A;  1JQ0 A;  4CC6 A;  2EIL C;  3A2F A;  4CS4 A;  4F6R B;  4ZIB A;  1OJH A;  1SQF A;  3CCV V;  2EIL B;  1QLE C;  1VF5 B;  3CX5 F;  2QWR B;  5LGU A;  4X89 A;  1HNX B;  2Q69 A;  1AR4 A;  4JI0 O;  1XI1 A;  2Y4U A;  1Y6X A;  1YEW A;  2W0X A;  3AG7 A;  1UFI A;  3DXR A;  2XTA A;  1TUE B;  4R8C A;  1SA0 A;  1B3Q A;  3SR2 C;  1ZLZ A;  4ASU G;  3VQY A;  1NZ6 A;  1BL8 A;  1VF7 A;  4AI8 A;  1Y67 A;  2GUZ A;  4BIO A;  4X9Q A;  3ABM B;  1YCI A;  4J9Z B;  5H9C A;  3E8H A;  1Q90 D;  4CH5 A;  1BHA A;  3ZRX A;  3HKE A;  5J2T B;  3APQ A;  4O4L B;  3TXQ A;  4TOI A;  3QTC A;  1RP3 B;  1KMI Z;  4NTX A;  1NT2 B;  3CCS V;  2ZE5 A;  3BRC A;  1XNQ B;  4PDV A;  3ABU A;  1BSM A;  4JI0 B;  1VMG A;  5E79 Z;  3PJS K;  1I5X A;  5JJJ B;  2Q68 A;  4X1Y B;  4JI1 O;  3AG1 C;  2Z5U A;  2HVJ C;  4K8X A;  3DTU B;  1VQ8 V;  4Q20 A;  3OGC C;  1BT8 A;  4I5S A;  3UCS C;  3ABK C;  1FD9 A;  3B8M A;  3JAL A;  4BR6 A;  1H8H G;  4WCE V;  4DV4 O;  2VQF O;  1P84 F;  2P4V A;  4WBN A;  4G2K A;  4DV1 O;  4EB6 A;  2HEP A;  4NYK A;  1H2N A;  3RBZ A;  5DEC A;  2BSK A;  3A0B Z;  3ZBH A;  2UXN A;  2KG7 A;  1S5L Z;  1TUB B;  2UXD O;  1Q6H A;  1JPX A;  3GWO A;  3P32 A;  3O9O A;  3OW2 U;  2WAM A;  4YIO A;  3CRA A;  2AXT Z;  3OUF A;  1FPO A;  3ZRW A;  5CB4 A;  4JI1 B;  2XAG A;  5LHI A;  3OAA G;  4GUN A;  3WFV A;  2HVK C;  3IC7 A;  5B5E Z;  4GX1 A;  1TGO A;  2DJV A;  2H3O A;  2XAH A;  4I55 A;  1GN6 A;  4XDL A;  4FLZ A;  3H01 A;  1KQS U;  2EIK C;  2P22 C;  4DV4 B;  2VQF B;  1MSD A;  1J95 A;  3B09 A;  3STZ C;  2EIK B;  2Q4P A;  4JZG A;  5EYP B;  5KMG B;  1MMM A;  2ZDI C;  1SET A;  3BA9 A;  4EFE A;  2OIE A;  2XAQ A;  4JI5 O;  3THO A;  3CEI A;  4H37 A;  2E76 B;  2LJ2 A;  1AIL A;  3C90 A;  4NB5 A;  2UXD B;  3LNN A;  3G71 V;  3OTF A;  3AEI A;  3K5O A;  2L6L A;  2WLK A;  4B7E A;  5IJ0 B;  1Y66 A;  1FFT B;  2EJ7 A;  1H2K A;  5BY1 A;  2HR3 A;  2P5O A;  1M57 C;  2QTO A;  2V1D A;  4OGQ B;  2F43 G;  1XRE A;  1S77 D;  1M90 W;  3K3W A;  1YXB A;  1S76 D;  1PKX A;  1DF5 A;  3F5T A;  2ZE8 A;  3IFX A;  2ZT9 B;  4TUY B;  1Z2G A;  3L9D A;  4DO2 A;  4B3S O;  1V54 B;  4RUF A;  4X66 O;  2YS8 A;  4W4K A;  2QKA A;  3EXA A;  3HKB B;  3OFN G;  4JI5 B;  4FFB A;  1SZX A;  2R70 A;  2XUM A;  4FIP C;  4TQF A;  4J11 A;  2CH7 B;  3ZMU A;  5IJ9 A;  2CAZ C;  1EN4 A;  2BTQ B;  1GAX A;  4O4I B;  2PYJ A;  2Y4T A;  5CA1 B;  4MVO A;  3ZHR A;  3WU2 Z;  4RQE A;  1FYJ A;  4O4H A;  3LDD A;  1PL4 A;  4PDL A;  1NH2 B;  1XEQ A;  5LGN A;  3B2E E;  1XDC A;  1YZB A;  1BE3 H;  3Q4H A;  3CCE V;  5ITZ B;  4BAY A;  1CEZ A;  4B3S B;  4X66 B;  5LHG A;  2PI5 A;  2WSS G;  1VQ7 V;  1U96 A;  2WLJ A;  3L71 H;  1DTO A;  3AG3 C;  1D5N A;  3DSQ A;  2ZCE A;  1PV0 A;  5KAI Z;  3AG3 B;  3G80 A;  1A32 A;  1N33 B;  2ZD9 A;  4QIW F;  2EZO A;  2Q7E A;  3CPW U;  1PP9 H;  2QWQ B;  3ASO B;  3JAM N;  4ZHQ A;  4P9P A;  5B1O A;  2YEV B;  1W0J G;  3RYF B;  3R65 A;  1NQT A;  1OHH G;  4QJF B;  4HNA B;  4J80 A;  4NTY A;  5LBQ A;  3HB3 B;  1Y74 A;  3SDL A;  1BQ0 A;  2LQT A;  1TVK B;  4N21 A;  5LMN O;  1NJI W;  5IT9 N;  4O2B B;  5D5Q A;  4O4J B;  3MD0 A;  1K8A W;  3SPG A;  3VQW A;  2W0F C;  2WWW A;  3D36 A;  4P2Z A;  2Y0I A;  1IBM O;  3RVZ A;  2DYS C;  4BW9 A;  1FJG O;  4I50 B;  1R3K C;  3NXS A;  1FXV A;  4MTX A;  2JGU A;  4DR5 O;  4DV5 O;  3TXS A;  2LGW A;  1N0N A;  1R6T A;  2ZIM A;  1FXK C;  4FLY A;  4B3R B;  4B3T O;  2ZE7 A;  5FLX N;  2ITD C;  3HKC B;  3T1Y B;  2ZXW B;  4TT3 G;  5HFM A;  1BZK A;  3CE2 A;  1XHX A;  3O65 A;  2ARH A;  4HBN A;  3RYI B;  4X1K A;  4X1I B;  4LP8 A;  4CH6 A;  3ZHT A;  3TK1 A;  4E4E A;  3ZCC A;  2QEX V;  4TV9 B;  4GZR B;  1H2G A;  1YVW A;  3ZN1 A;  4JAU A;  4UCT A;  1IUR A;  1WN7 A;  1GM8 A;  1AB3 A;  1HDJ A;  2FKX A;  3JAS B;  1IBM B;  2JIZ G;  3JAT A;  4JTC B;  3CME V;  5LYJ A;  4K35 A;  1B04 A;  4WFH A;  2Q73 A;  5LMU B;  2QM8 A;  4DR5 B;  1TAE A;  1URF A;  1KKD A;  2HFE C;  4MVS A;  2NR5 A;  3APO A;  2KB1 A;  3N2G B;  4I9Q A;  1WB7 A;  3UT5 B;  5KLV H;  4YJ3 A;  3U10 A;  4B3T B;  1Q82 W; 
#chains in the Genus database with same CATH homology
 2CTQ A;  1FAF A;  4J80 A;  1HDJ A;  2CUG A;  3BVO A;  2YS8 A;  2N04 A;  3UO3 A;  3APQ A;  1XBL A;  2Y4T A;  2QWO B;  4IT5 A;  2QWN B;  1BQ0 A;  3AG7 A;  1NZ6 A;  2PF4 E;  2QWR B;  2N05 A;  4J7Z A;  2M6Y A;  3UCS C;  1BQZ A;  2DN9 A;  2QWP B;  2LGW A;  2GUZ A;  2KQX A;  2CTP A;  2GUZ B;  1N4C A;  2QWQ B;  2Y4U A;  1WJZ A;  2CTR A;  3APO A;  4RWU A;  2OCH A;  2L6L A;  2YUA A;  2DMX A;  2QSA A;  2CTW A;  2LO1 A;  3UO2 A;  1GH6 A;  1FPO A;  1IUR A;  2EJ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...