1BQZA

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
b'AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bqzA00
2CUGA 2YS8A 4IT5A 2DMXA 2LO1A 3UCSC 1NZ6A 2N05A 2QWPB 2L6LA 2Y4UA 4J80A 2CTRA 1N4CA 2DN9A 2PF4E 3AG7A 2GUZA 1IURA 2QWRB 2QWQB 1BQZA 2LGWA 3APQA 4RWUA 3UO2A 1FAFA 2Y4TA 3BVOA 2QWNB 2KQXA 2QWOB 2CTPA 2GUZB 2CTQA 1HDJA 1FPOA 2YUAA 2QSAA 1GH6A 2CTWA 2EJ7A 4J7ZA 2OCHA 3UO3A 2N04A 1BQ0A 1WJZA 3APOA 1XBLA 2M6YA
chains in the Genus database with same CATH superfamily
2JJ1G 3RYIA 1JCHA 5LMUB 2FYUH 1B3QA 3ZMTA 1S5LZ 4MVRA 3CE2A 1P84F 2JGUA 5LGTA 5B3SB 2F66C 3ZRXA 1WN7A 2DQ0A 3EVKA 4DO2A 5LXTA 5L3DA 4QE7A 2FTKA 4Q6GA 1H2SB 4LR3A 2YEVB 2FMLA 1V9PA 1NH2B 2E5LO 5B1AB 4GKKB 2D2CB 2WSSG 1FD9A 5J2TB 2IM9A 1M56C 1Q86W 1XEQA 2RN9A 1N4CA 1S76D 3M8AA 2XT9A 3GWKC 4B7KA 5HFMA 4X1KB 5LHIA 2BOCC 3VOUA 4QJFB 4O4HA 4U7OA 3U10A 1S0VA 5KAFZ 2EILC 2W6JG 4LF9B 2X6AA 5JVDB 3ZMUA 3K57A 4DV7B 2LP7A 2ZIMA 3CXHF 3CHXA 1K97A 2JGDA 4J80A 5EZYA 1IDSA 1AILA 3HKDB 4JI4O 2Q7EA 3DGEA 4PDLA 2OCCC 4YY3B 5EC2C 5H6QA 4FLZA 1OCZB 2EIMB 1Y67A 1R3JC 3CRCA 1AJNA 4DR5B 1I5YA 2GBOA 4LNUB 3IC7A 1NQTA 4JZGA 3P3NA 2M6YA 1J5EB 1KUQA 4LH7A 3ZRSA 4UB8Z 4D7SA 3T4ZA 1I94O 3W7UA 3SGIA 2CAZC 2UXBB 3KZIZ 3N2GB 1R6NA 4J42A 2AZ0A 3GB7C 3JALA 1BHBA 1PP9H 1Q6UA 1Y4MA 3UT5B 1QQCA 4CBCA 4DYLA 2EJ7A 1MZEA 2QEXV 1FXKC 3E8HA 4IIJB 2OTJV 1VQ8V 2E74B 2F95B 3A0HZ 1EBOA 2CDYA 3RYFB 4WFHA 4JV5O 4O4IB 3O9OA 3L9DA 1FXKA 3IJ4A 3VQWA 4X1YB 4XDLA 3HPLC 1VMGA 4LWSA 2VQFO 5L3CA 1KP2A 3OE7G 1Y76A 3A8TA 1QR8A 4I50A 1VQOV 1PV0A 1AI7A 3T4DA 1K73W 2JDIG 4KP4A 1FJGO 5IYDO 1SRYA 1BS3A 3L74H 3TXSA 2P90A 3FB7C 3JCUZ 1HNZO 2B1IA 4UV9A 5FNVA 3WFVA 4YJ2B 4LF5O 3KCXA 1WA8B 5KUKA 2D3OW 5EYPB 3OEHG 2R9IA 2GUZB 4H33A 1D5AA 2IU0A 1R6KA 4FFKA 1VQLV 3G67A 4WFEA 3SYPA 4JI4B 3AG2C 3AG1C 3K59A 5JWPA 3BFRA 4DR1O 1WAZA 1AR4A 2QKAA 4GX1A 4TV9B 3H1KH 1BSMA 1OCRC 2Z5UA 4X88A 2YI9A 2ZXWC 3K5OA 3ZCCA 2XHBA 5GTIZ 2JJ2G 5KAIZ 1YCIA 1T5EA 1OCOC 2WLJA 1G1XB 1YJ9V 1PKXA 4YJ3A 2EIKB 1W2BU 1XUQA 1BL8A 5CA0B 4FLVA 1YTFB 1I94B 2N05A 4RQFA 1GAXA 2CH7A 4UCSA 5C8YB 1K34A 5KMGA 1IBMO 3N2KB 4MVQA 4MT8A 4DV2O 2QA4V 4WF9V 4PDMA 4X8AA 1X4TA 3W7SA 4HZ3A 4TV8B 1M57B 1JQ0A 4JV5B 4LFBB 4HBNA 2F43G 4YHHO 4BIUA 1WP7A 3ETGA 1VP7A 4CS2A 5KHHA 1NI8A 2CK3G 2HKOA 2VQFB 2Y4TA 2P67A 5J2UA 3DXRA 4O4JB 2UUAO 2XAFA 4X65O 1VQ5V 3E8FA 1V54C 1VQNV 3APOA 1H2MA 1FJGB 4Q20A 4FZ1A 1GRJA 2LO1A 1XMQO 1YJNV 3WG7B 2B1GA 4FIPC 1HNZB 1AI4A 4BW5A 4LF5B 4DR2O 3FB6C 1AJQA 2HHHO 5IDJA 1QU7A 2UXXA 3E83A 5K1PA 5IE9A 3K5LA 3E2EA 2O57A 2W6IG 4CC5A 4K8XA 2KB1A 1VARA 3DTUB 2Q7GA 4DR1B 1L1FA 1ZL8B 3THOA 5FPOA 4U3FH 3TETA 4RWUA 1K5SA 3MD0A 1OZ0A 2Q6AA 4I5SA 3RGBA 1JR9A 2Q67A 3J81N 1IBMB 4DV2B 4WBNB 2XAHA 2JS5A 1LR1A 1ZSPA 4PHZA 2ETNA 1P4RA 4K8ZA 1YF2A 3NR7A 1PNKA 1P7GA 1CXZB 3ABMB 3ZIAG 3SPGA 2G38A 2ZE8A 5DECA 4DV3B 1EZJA 2JEXA 4J9YB 4YHHB 2YXYA 4A5UB 2CTRA 2GSMB 5E1AC 1M93A 2ZR3A 1QNMA 3TGUH 2Z0AA 4BIZA 1JOYA 2LGWA 2EX3A 3ABKB 2UUAB 3QVNA 4X65B 3CC7V 5IY5B 4YIOA 1ENVA 3IGAC 1K7DA 3G4SV 3HKCA 4ZI7A 5JH7A 2GV9A 5D5PA 1U97A 5CBFA 1PM9A 1XOUA 4Z2WA 1XMQB 4JYAO 1L8DA 4AILC 1NVPB 3OUSA 5IT9N 4DR2B 1V55B 4I4TA 2DYSB 4PA4A 3JD3A 4J9ZB 2KG7A 2HHHB 3D8CA 4PI2A 3S3WA 4I0XB 1HDJA 5IJ9B 1G8MA 2VS0A 3JATB 4NR1A 1EN5A 3UO3A 3E8GA 2PZSA 3OAAG 1XMOO 3QF7A 4MS2A 5L3GA 2QE7G 1BGYH 1VQ9V 2IBZH 1H2NA 1I5XA 4CH5A 4HAMA 2QWRB 1DTOA 2V7QG 2BTQB 4QNHB 1SQPH 1N0JA 3RWRD 3JD2A 4WFBV 2HP8A 5H9CA 1E79G 3RYHB 1AR1B 1XNQO 2ZM6O 2Q0OC 2PGGA 4L87A 2NLJC 1GO3F 1K33A 3ZJZA 1NTMH 2WLLA 1TVKA 1SKVA 2CGOA 1M4UA 1US6A 3FB8C 2AHZA 3JAKA 5L3BA 2CE4A 3AK2A 4NKGB 4XDKA 2V1DA 1KKCA 4X20B 2IH1C 4DR4O 1TA8A 2LW7A 2ATKC 2AZ2A 3ZHTA 1IBKO 1VQ7V 2EJRA 2KSDA 1HNWO 2VWKA 3CCSV 1SA0A 2YDEA 4OGQB 4NXMO 3LSSA 2P7TC 2A06H 2EINB 4CH4A 3D36C 4JGSA 1GKFA 1IZ3A 2YIDA 3IFXA 4JYAB 1IBLO 4MTXA 4F6RB 3B09A 1QVFU 3T1YO 2OIGA 4FJCC 2F1MA 4I55B 5KHGA 2PTMA 2Y69B 1H2LA 3HKEB 1BQZA 1VF7A 4GX0A 4R6ZA 1SESA 2RMKB 2BCCH 2ZINA 3K9SA 4LBEC 1YITV 2QSAA 4FLWA 1RSOB 2YI8A 2BSKB 1EN4A 5KX5B 1G6UA 4H13B 4DRXA 1SQQH 1BMFG 3JD0A 3PJSK 1SQBH 4IHJA 5AG2A 4DK1A 3ABLC 4QE9A 5CBGA 4BWAA 3W7TA 4RO2A 1W59A 3AG3C 1XNQB 2WLIA 2ZM6B 4UV8A 1HP8A 4U3JA 4GT1A 5JQGA 3IAYA 1Q90D 2DYRB 1QCEA 3A0BZ 3IC9A 3BRCA 4PA9A 1TUEB 2WLKA 4FFBB 4JI0O 4XBFA 1FXVA 5LHHA 2UXNA 3WU2Z 4DR4B 1YI2V 1XL4A 3NXSA 4RAIA 1IBKB 3E35A 1HNWB 3QO7A 1J5EO 2UXDO 1OCCB 1VQPV 1LUVA 3P32A 1CP9A 1SQXH 3RYCB 4NXMB 4TSFG 2XUMA 2UUBO 1M9NA 3JD4A 4NB5A 3K5NA 4LF8O 4KHPO 1IBLB 1QLEB 1QR9A 3OR6C 4G28B 4CH3A 3WB1A 1WLEA 1VIBA 3CS5A 2HFEC 2Q0AA 5IYZB 4FLUA 2Y0IA 3GVMA 4MW8A 3FYIB 1XI1A 3RVZA 4TUYB 1H2GA 4IYIA 5B1OA 4CZZA 2A0LA 2AGAA 4G27B 5IJ0A 2DJVA 3K3WA 3CYOA 3JD1A 2MW2B 1VQ4V 2EIMC 2HLDG 4UB6Z 1GM7A 1HNXB 1AB3A 3E22B 1Z2GA 1WNSA 4O2AA 4WFGA 5EBLC 2Y48A 5TISZ 4EB6B 3KCYA 3ZRWA 2Z3YA 3VBBA 2QM7A 4MVZA 1DK1A 3JARA 3SJCC 3T1HO 1RM1B 3QO5A 5LP6C 3FAVA 3B77A 1EN6A 3CC2V 1COWG 5A2QN 3KG2A 3SYAA 5LP6A 3CEIA 4JI1O 3K03A 1GN3A 3ABUA 2ZCEA 3RYIB 4BIOA 4JI0B 1I0HA 2JRIA 3OW2U 4MW3A 2ZE5A 2IJKA 3K58A 2R70A 3ZHSA 2ITDC 3EHBB 1R3KC 4PELA 5LXTB 2UXDB 4JAUA 4UVAA 3RW0A 3AG4C 1UFIA 3RBZA 3K04A 1N0NA 1FFXA 2UUBB 1F4MA 2GHYA 4J41A 2RQ6A 4LF8B 4GCZA 4KHPB 3CJHA 4OXSA 4PA6A 3L75H 3ZMSA 1M56B 4O4HB 4ZOLA 4W4KA 1Q82W 2E3CA 1JVMA 1KD1W 4LFBO 4X66B 5ITZA 3CP1A 5DM6V 3UM7A 1PD3A 3LDCA 2Y0PA 2EILB 2JGDB 3M7MX 5EZYB 2WLNA 3BY6A 4TOIA 2ZE7A 5KHIA 4RQEA 4ZBMA 2EIKC 1YEWA 2K1EA 1JJOA 4GX5A 3C90A 1WB7A 1HR0B 3OTOO 1B6QA 5GW7A 1N8RW 3J7AU 4TT3G 2OWOA 2YIBA 3T1HB 4DV4O 2YUAA 4J10A 1D2DA 4TWKA 4QIWF 2ZR2A 4B3RO 3JALB 3RT3C 5BXZA 1M57C 1RPRA 4P9PA 2DN9A 4GZRB 4K0KO 4JI1B 2E75B 1K4CC 2QKCA 3D3QA 4MSWC 3JSLA 1FXKB 3OGCC 2V4DA 4JPRA 2H3OA 2ADPA 4LWSB 1GH6A 2NR5A 5GONA 5EIBD 1FXHA 1Y76B 1MA1A 4I50B 4FMTA 3WG7C 4WFAV 4DV6O 5DN6G 1GN4A 3CSXA 3H1IH 1SQFA 1ZUQA 4UCTA 1IX9A 1SZXA 4DR6O 4TQDA 3G80A 5FNVB 3JYCA 2PI4A 2IH3C 2DW4A 1E1RG 1S3JA 4I7ZB 3CCMV 4JI8O 4NYKA 4DV3O 2ZIOA 3LUTB 3PN1A 1Q81W 4PV1B 1FYJA 3E8BA 3K9AA 3SPCA 5LGUA 4AHCA 3CX5F 4DW1A 4NTWA 3CRQA 1NTKH 4B3TO 2ZQMA 1R73A 2ZD9A 1ZAUA 2A7WA 3OTOB 1VF6C 4FK5C 1DGSA 4YJ3B 3G71V 1TGOA 1TUBA 2AW9A 2QWQB 3U11A 3Q4HA 5CMUA 4DV4B 2CH7B 1VQMV 5KMGB 3I5DA 1R3LC 2UU9O 1K3EA 4B3RB 3E89A 3T1CA 3I55V 3ABMC 5LMNB 3JASA 3SJAC 4I9QA 4JYCA 5LBQA 4K0KB 4NTXA 1SC5B 3L73H 5EK0A 4NXNO 4YIPA 3OM3B 4O4LA 1J95A 4JAVA 3EFFK 5LOVA 1KC8W 3K79A 5B66Z 3ABKC 1VQKV 5IY5C 2P4KA 3STLC 3CPWU 2IU3A 1XDCA 5CBHA 2ZT9B 5L3EA 5J2UB 1XQ8A 3DXRB 2JIZG 2P4VA 2F23A 2L35A 4D7TA 4FVMA 4DV6B 3SJBC 1LNQA 1NBMG 4NVPA 1V55C 4U7NA 4Z1MG 3GWOA 5KLVH 4DR6B 4H0LB 3AK1A 3K06A 3JAWA 1X59A 4JI8B 4UVBA 3OMNB 2RNBA 4X89A 4CS4A 1F51A 3SPIA 2F93B 2E76B 3HR0A 2ODMA 3RVYA 2X7RB 3F5TA 3CCUV 2Q8VA 3TK1A 4JI7O 1QBZA 2QTSA 3LNMB 1H2KA 3OR7C 3WB0A 4X1IA 2IW5A 3ASNB 2ZE6A 2Q73A 4B3TB 1BQ0A 4JI6O 5EBWC 4PDVA 1QHTA 3H9VA 2Q9LA 3B2EE 4LCUC 3SPHA 1GTOA 3O65A 2UU9B 2PUSA 4JTCB 1YDXA 4UCRA 4I9WA 4ZHQA 4WFFA 2DMXA 1YSCA 2JVDA 4NXNB 3OTFA 4FZ0A 4J11A 4BW9A 5BMVA 2YC0A 2FL4A 4G2KA 4F4LA 1KECA 1JX9A 2PYJA 2EINC 1D5NA 3LNNA 4KL1A 1M1KW 2Q5ZA 5CB4A 3H1HH 3LSQA 3N27A 1FS0G 1JPXA 3HKCB 4ZI7B 5JH7B 3S3XA 2EIJC 3FKSG 2Y69C 4UCVA 2EZPA 3UO2A 5IYBO 3ICXA 4HNAA 2HG5C 3SJQC 2WWWA 4I4TB 2LGQA 2QR4A 2ZKOA 5FLXN 3CCJV 4DV0O 2KG7B 4GX2A 3ZS8C 5GTHZ 2YS8A 4R8CA 4RUEA 4PA3A 5B1BB 1ZX3A 2HJDA 4B08A 3CCRV 2QTOA 4JI7B 4GUNA 2BTOA 5CA1A 4IYHA 1AI6A 3H1JH 3ML0A 3VQYA 5LYJA 3HKBA 2HJFC 4JI6B 3SPJA 4R7CA 2GTSA 4PD4F 3ETEA 4RUFA 3D36A 2P22C 1GMGA 2JEUA 5L3FA 2WLHA 2X6CA 2DYRC 4CS3A 2WLLB 3MDSA 4B7EA 1TVKB 1KB9F 3BAAA 1OJHA 3RFRA 1MG1A 3JAKB 1OHHG 5LA6A 2ILMA 3FFQA 1WJZA 3F7VC 2QKSA 3TJTA 1S77D 2VWJA 4MVMA 3D3IA 4FLYA 1HNXO 2AHYA 2X0LA 4O2BA 2QM8A 1OCCC 4K3AA 3AEIA 3ZHRA 1DLBA 4AQYO 4DW0A 3QNEA 1Q8IA 2EZOA 3ASOB 1QLEC 1JFFA 1SA0B 1F23A 1YZBA 4UCUA 4ASUG 2ZDIC 3SYCA 1AJPA 1Y74A 4JTAB 4JI5O 4Z1VA 5E79Z 1P7BA 5B3SC 1F4NA 4DV0B 2XNDG 1MZFA 2QM4A 1IVSA 1JA8A 3JCZA 2QGNA 3X2QB 1XBLA 1PPJH 2YXLA 3ZHVA 4EFEA 5B1AC 1ZTEA 3BA8A 3OD4A 4JYYA 2YEVA 1N34O 1A32A 1CPYA 4DRXB 4DUYO 5J2TA 1SETA 4MTOA 2OT5A 4HYOA 4IHJB 3BA9A 3G6EV 5A9GA 1Q6HA 3CRRA 1S5JA 4X1KA 3E86A 3B8MA 1RM1C 2P06A 4JI2O 4PI0A 3ABLB 2WLIB 2DQ3A 1Q5OA 4U3JB 2KKWA 5JVDA 4X66O 5JQGB 4ZIBA 3AG3B 1NH2D 2CTQA 4ZKIA 3EXAA 4LFAO 3HKDA 1NU1H 1NKDA 3H01A 4QPJA 1OCZC 2C2AA 2ITCC 4IT5A 2WLMA 4IL6Z 4K35A 3ZEDA 1NT2B 3OT7A 5LL6Y 1YIJV 3CD6V 1KMIZ 4DR7O 1Y6XA 2BOBC 1PNMA 2GDSA 1NTZH 1SZTA 4LNUA 1HR0O 2HVJC 4AQYB 2XTAA 2H8PC 2QWOB 1WPXA 2P5OA 3A2FA 2QDOA 2FKXA 1YXBA 3N2GA 3FB5C 1K8AW 1N33O 4JI5B 1EM1A 4GLXA 4X62O 3UT5A 4B3MO 4IGGA 3R65A 4IIJA 3CXCU 3B40A 4MVOA 4UUJC 3C3SA 2KQXA 3RYFA 4O4IA 1YJWV 1S5HC 1NJIW 4X1YA 1PL0A 3BEHA 3ZMVA 1M90W 4D6TH 2WAMA 5IJ0B 2L6LA 1N34B 2YXHA 2B9ZA 2YIAA 4DUYB 2A79B 3CCVV 3CCLV 5B1NA 4R50A 3ZRVA 3WB2A 1FPOA 4O2AB 3RN4A 1H38A 5EC1C 2W0FC 1XREA 4L8JA 3ZRWB 1KQSU 4JI2B 1NR1A 4YJ2A 3L70H 3UCSC 1WA8A 2LJ2A 5EYPA 2HR3A 3JARB 3DSQA 2GUZA 3ZHUA 1ROPA 3FAVB 3G6BA 3K0DA 1MOFA 1R6TA 2YICA 3F7YC 4P2ZA 3CMEV 2XAGA 4LFAB 1MNGA 3LDDA 5BZBA 1XL6A 4JF3A 5LP6B 4TV9A 5C93A 1B06A 4FLXA 1LUWA 1F7YA 4PA7A 4DR7B 5J9PC 5D5QA 1ZLZA 1IURA 3BCCH 2OCCB 3CCEV 3FX7A 5CA0A 1OV9A 2E5LB 1S72V 5HFLA 4KFMA 4LF7O 4BR6A 2LW1A 3OMAB 5C8YA 1FFXB 3N2KA 4TQFA 1N33B 1VF5B 3AG4B 2A3QA 3CJHB 4X62B 4B3MB 3ZHQA 4LFCO 5LMNO 3B8NA 1KKDA 3ZN0A 4KXRA 1KYOF 1YVWA 4ZOLB 1MSDA 1W0KG 4TV8A 5EIBC 2VRZA 1GN6A 2LFRA 4PDRA 1MABG 1R3IC 5ITZB 4P30A 2YIBD 1YTFD 2UUCO 2OCHA 2LFSA 3TCUA 5B5EZ 1GN2A 3LSUA 4O4JA 2FB5A 1Q43A 1AI5A 1U96A 1AP5A 4UCOA 4CH6A 4JTDB 1P49A 1M5IA 4AI8A 1L0LH 3W7XA 2Q7HA 4EEQA 2RDCA 4GYCB 5IWAO 3T2MA 2AXTZ 1THZA 4C7UA 1O9GA 2MK3A 1WB8A 1IXMA 1NS1A 2K9PA 3SDLA 2N74A 1I08A 1NR7A 2QJ1A 3L72H 2M7WA 1ZL8A 1GK9A 1JJ2U 1MMMA 2N04A 4UFZA 1QVGU 3AG2B 3AG1B 1NZ6A 1BHAA 5CN0A 1KBHA 1OCRB 3DC5A 5BR8O 2ZXWB 2LQTA 3BABA 5GONB 5JCOC 4LF7B 4QPKA 1YHQV 1E1QG 1OCOB 1VF6A 4DK0A 1GM8A 4WBNA 5JCOA 1PL4A 4LFCB 1W0JG 5KHKA 3AG7A 3SR2C 2A9HA 2DWDC 3MAQA 1RFYA 1WP8A 2F4VO 3ZN1A 5K1XA 3P30A 4J7JA 4GKJO 1K4DC 4UVCA 4OPAA 4LH6A 2GTAA 2DOSA 2UUCB 5JJNB 2OYQA 3OEEG 3ASNC 3F5WC 1EFRG 1AROP 2W0XA 4W4LA 5LHGA 3ETDA 5JJJB 5FL7G 3MHHC 2Q69A 4MTGA 2IJHA 3LDEA 1H8HG 2WA4A 4H44B 3A0RA 1BT8A 3APQA 1FFTB 2BE3A 4MVUA 2DYSC 2ARHA 3ETQA 5H2FZ 1HWYA 5IWAB 2WPDG 2DWEC 1V54B 3TXQA 1IXBA 1TUBB 1QLNA 2XAQA 1VEWA 3Q4HB 5DEDA 4MVSA 1HW7A 1AVMA 4YXWG 1L0NH 2NN4A 2ZNJA 1Z5VA 2PF4E 4I0XA 5IJ9A 4F6EA 4N23A 1AP6A 2R9AA 3K5MA 4FM0A 3JATA 3UKMA 4LF6O 4LF4O 3JASB 1ZWIC 4DUZO 3QTCA 3R66A 1Y66A 4FLTA 2CTWA 3BHPA 1EZVH 5BY1A 4O4LB 4BAYA 3VQXA 1FKAO 1NVPD 2BTQA 4JASA 5LOVB 2JS3A 4OX9O 4FM1A 5KA6A 5LGNA 4X9QA 2YSUB 5BR8B 1XNRO 5H5NA 1Q6IA 3ZBHA 3RYHA 1R1BA 2Q4PA 1RPOA 3ABTA 2OTLV 2DE0X 3MHSC 2VQEO 4X64O 3CCQV 2QWNB 2QWPB 4N21A 1G4YB 1H8EG 2R72A 3JAWB 3W7WA 2F4VB 3ZX6A 1Z5WA 4B3SO 5B1BC 4GKJB 5JJEB 2PYLA 3UQ8A 4X20A 1WPBA 5FPRA 4OPHA 2CTPA 2HEPA 2NNUA 2XAJA 4LC1A 4X1IB 5CA3A 4JAAA 4DXWA 4ICGA 3L71H 2Q68A 2RJZA 2RCVA 3STZC 1N36O 1SERA 3OMIB 3I56V 1KP3A 4F6RA 1Q7YW 3BVOA 1JMKC 1K92A 4NTYA 4KUMA 4I55A 1XHXA 4EKWA 3AK3A 3HKEA 1CEZA 3OUFA 3BPZA 4EFBA 2Y4UA 3VQVA 3CMAV 3K0GA 1TAEA 4FM2A 4LF6B 4LF4B 1RSOA 4DUZB 1XILA 4ZHQB 2BSKA 2B5UA 3DC6A 5KX5A 3JSNA 4DR3O 3KKYA 2PI5A 4DV5O 3M99B 3C3TA 2WA3A 4XDJA 3QG5A 4JI3O 5EBMC 3ASOC 1URFA 3SYQA 4OX9B 5BMVB 1I7FA 3CWBH 2IJJA 1XNRB 2CGNA 4E4EA 1DF5A 5KUMA 3K08A 1PNLA 5CB4B 4E2LA 2H94A 1N32O 4J7KA 3OFNG 2VQEB 3JAMN 4X64B 4J7ZA 1SQGA 3B4SA 1SQVH 4HNAB 2UXCO 2EIJB 1UJWB 3X2QC 4DV1O 4B3SB 1ORQC 4FFBA 5LMUO 4WCEV 2P6JA 1FAFA 2PY5A 4FPPA 1VQ6V 1BCCH 1UPGA 3U0ZA 1XMOB 3ZMZA 3HB3B 1SF9A 2XASA 3RYCA 4GKKO 5CA1B 2CUGA 1KU9A 5H6RA 1XHZA 1RP3B 3P3PA 4PJ0Z 4QGPA 1GM9A 5LYJB 3HKBB 1N36B 1K9MW 2XOKG 2EULA 5IYCO 2ZDIA 1SS3A 4LP8A 1DF4A 2R9RB 5IYZA 3CC4V 2ZNIA 2HVKC 2ADQB 4H37A 4JYBA 4LF9O 4DV7O 4TUYA 2IJIA 4JZ2A 3FYEB 5KA5A 5KHJA 4MTFA 5LA6B 3J80N 3CB2A 4DR3B 3OGIB 2JK5C 4DV5B 4ABMA 4YY3O 3E22A 4JI3B 4O2BB 3CRMA 4CC6A 2X6BA 4P9OA 4DR5O 4EB6A 5F2VO 1Q3EA 2OIEA 4UXNA 2EBOA 1B04A 3H1LH 1JFFB 1MSWD 2UXBO 1O9HA 1N32B 1BE3H 1K5QA 1BZKA 1Y74B 3FD9A 1AR5A 3QO8A 3T1YB 2UXCB 3SYOA 3CRAA 4DV1B
chains in the Genus database with same CATH topology
2CUGA 2YS8A 4IT5A 2DMXA 2LO1A 3UCSC 1NZ6A 2N05A 2QWPB 2L6LA 2Y4UA 4J80A 2CTRA 1N4CA 2DN9A 2PF4E 3AG7A 2GUZA 1IURA 2QWRB 2QWQB 1BQZA 2LGWA 3APQA 4RWUA 3UO2A 1FAFA 2Y4TA 3BVOA 2QWNB 2KQXA 2QWOB 2CTPA 2GUZB 2CTQA 1HDJA 1FPOA 2YUAA 2QSAA 1GH6A 2CTWA 2EJ7A 4J7ZA 2OCHA 3UO3A 2N04A 1BQ0A 1WJZA 3APOA 1XBLA 2M6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CUG A;  2YS8 A;  4IT5 A;  2DMX A;  2LO1 A;  3UCS C;  1NZ6 A;  2N05 A;  2QWP B;  2L6L A;  2Y4U A;  4J80 A;  2CTR A;  1N4C A;  2DN9 A;  2PF4 E;  3AG7 A;  2GUZ A;  1IUR A;  2QWR B;  2QWQ B;  1BQZ A;  2LGW A;  3APQ A;  4RWU A;  3UO2 A;  1FAF A;  2Y4T A;  3BVO A;  2QWN B;  2KQX A;  2QWO B;  2CTP A;  2GUZ B;  2CTQ A;  1HDJ A;  1FPO A;  2YUA A;  2QSA A;  1GH6 A;  2CTW A;  2EJ7 A;  4J7Z A;  2OCH A;  3UO3 A;  2N04 A;  1BQ0 A;  1WJZ A;  3APO A;  1XBL A;  2M6Y A; 
#chains in the Genus database with same CATH topology
 2JJ1 G;  3RYI A;  1JCH A;  5LMU B;  2FYU H;  1B3Q A;  3ZMT A;  1S5L Z;  4MVR A;  3CE2 A;  1P84 F;  2JGU A;  5LGT A;  5B3S B;  2F66 C;  3ZRX A;  1WN7 A;  2DQ0 A;  3EVK A;  4DO2 A;  5LXT A;  5L3D A;  4QE7 A;  2FTK A;  4Q6G A;  1H2S B;  4LR3 A;  2YEV B;  2FML A;  1V9P A;  1NH2 B;  2E5L O;  5B1A B;  4GKK B;  2D2C B;  2WSS G;  1FD9 A;  5J2T B;  2IM9 A;  1M56 C;  1Q86 W;  1XEQ A;  2RN9 A;  1N4C A;  1S76 D;  3M8A A;  2XT9 A;  3GWK C;  4B7K A;  5HFM A;  4X1K B;  5LHI A;  2BOC C;  3VOU A;  4QJF B;  4O4H A;  4U7O A;  3U10 A;  1S0V A;  5KAF Z;  2EIL C;  2W6J G;  4LF9 B;  2X6A A;  5JVD B;  3ZMU A;  3K57 A;  4DV7 B;  2LP7 A;  2ZIM A;  3CXH F;  3CHX A;  1K97 A;  2JGD A;  4J80 A;  5EZY A;  1IDS A;  1AIL A;  3HKD B;  4JI4 O;  2Q7E A;  3DGE A;  4PDL A;  2OCC C;  4YY3 B;  5EC2 C;  5H6Q A;  4FLZ A;  1OCZ B;  2EIM B;  1Y67 A;  1R3J C;  3CRC A;  1AJN A;  4DR5 B;  1I5Y A;  2GBO A;  4LNU B;  3IC7 A;  1NQT A;  4JZG A;  3P3N A;  2M6Y A;  1J5E B;  1KUQ A;  4LH7 A;  3ZRS A;  4UB8 Z;  4D7S A;  3T4Z A;  1I94 O;  3W7U A;  3SGI A;  2CAZ C;  2UXB B;  3KZI Z;  3N2G B;  1R6N A;  4J42 A;  2AZ0 A;  3GB7 C;  3JAL A;  1BHB A;  1PP9 H;  1Q6U A;  1Y4M A;  3UT5 B;  1QQC A;  4CBC A;  4DYL A;  2EJ7 A;  1MZE A;  2QEX V;  1FXK C;  3E8H A;  4IIJ B;  2OTJ V;  1VQ8 V;  2E74 B;  2F95 B;  3A0H Z;  1EBO A;  2CDY A;  3RYF B;  4WFH A;  4JV5 O;  4O4I B;  3O9O A;  3L9D A;  1FXK A;  3IJ4 A;  3VQW A;  4X1Y B;  4XDL A;  3HPL C;  1VMG A;  4LWS A;  2VQF O;  5L3C A;  1KP2 A;  3OE7 G;  1Y76 A;  3A8T A;  1QR8 A;  4I50 A;  1VQO V;  1PV0 A;  1AI7 A;  3T4D A;  1K73 W;  2JDI G;  4KP4 A;  1FJG O;  5IYD O;  1SRY A;  1BS3 A;  3L74 H;  3TXS A;  2P90 A;  3FB7 C;  3JCU Z;  1HNZ O;  2B1I A;  4UV9 A;  5FNV A;  3WFV A;  4YJ2 B;  4LF5 O;  3KCX A;  1WA8 B;  5KUK A;  2D3O W;  5EYP B;  3OEH G;  2R9I A;  2GUZ B;  4H33 A;  1D5A A;  2IU0 A;  1R6K A;  4FFK A;  1VQL V;  3G67 A;  4WFE A;  3SYP A;  4JI4 B;  3AG2 C;  3AG1 C;  3K59 A;  5JWP A;  3BFR A;  4DR1 O;  1WAZ A;  1AR4 A;  2QKA A;  4GX1 A;  4TV9 B;  3H1K H;  1BSM A;  1OCR C;  2Z5U A;  4X88 A;  2YI9 A;  2ZXW C;  3K5O A;  3ZCC A;  2XHB A;  5GTI Z;  2JJ2 G;  5KAI Z;  1YCI A;  1T5E A;  1OCO C;  2WLJ A;  1G1X B;  1YJ9 V;  1PKX A;  4YJ3 A;  2EIK B;  1W2B U;  1XUQ A;  1BL8 A;  5CA0 B;  4FLV A;  1YTF B;  1I94 B;  2N05 A;  4RQF A;  1GAX A;  2CH7 A;  4UCS A;  5C8Y B;  1K34 A;  5KMG A;  1IBM O;  3N2K B;  4MVQ A;  4MT8 A;  4DV2 O;  2QA4 V;  4WF9 V;  4PDM A;  4X8A A;  1X4T A;  3W7S A;  4HZ3 A;  4TV8 B;  1M57 B;  1JQ0 A;  4JV5 B;  4LFB B;  4HBN A;  2F43 G;  4YHH O;  4BIU A;  1WP7 A;  3ETG A;  1VP7 A;  4CS2 A;  5KHH A;  1NI8 A;  2CK3 G;  2HKO A;  2VQF B;  2Y4T A;  2P67 A;  5J2U A;  3DXR A;  4O4J B;  2UUA O;  2XAF A;  4X65 O;  1VQ5 V;  3E8F A;  1V54 C;  1VQN V;  3APO A;  1H2M A;  1FJG B;  4Q20 A;  4FZ1 A;  1GRJ A;  2LO1 A;  1XMQ O;  1YJN V;  3WG7 B;  2B1G A;  4FIP C;  1HNZ B;  1AI4 A;  4BW5 A;  4LF5 B;  4DR2 O;  3FB6 C;  1AJQ A;  2HHH O;  5IDJ A;  1QU7 A;  2UXX A;  3E83 A;  5K1P A;  5IE9 A;  3K5L A;  3E2E A;  2O57 A;  2W6I G;  4CC5 A;  4K8X A;  2KB1 A;  1VAR A;  3DTU B;  2Q7G A;  4DR1 B;  1L1F A;  1ZL8 B;  3THO A;  5FPO A;  4U3F H;  3TET A;  4RWU A;  1K5S A;  3MD0 A;  1OZ0 A;  2Q6A A;  4I5S A;  3RGB A;  1JR9 A;  2Q67 A;  3J81 N;  1IBM B;  4DV2 B;  4WBN B;  2XAH A;  2JS5 A;  1LR1 A;  1ZSP A;  4PHZ A;  2ETN A;  1P4R A;  4K8Z A;  1YF2 A;  3NR7 A;  1PNK A;  1P7G A;  1CXZ B;  3ABM B;  3ZIA G;  3SPG A;  2G38 A;  2ZE8 A;  5DEC A;  4DV3 B;  1EZJ A;  2JEX A;  4J9Y B;  4YHH B;  2YXY A;  4A5U B;  2CTR A;  2GSM B;  5E1A C;  1M93 A;  2ZR3 A;  1QNM A;  3TGU H;  2Z0A A;  4BIZ A;  1JOY A;  2LGW A;  2EX3 A;  3ABK B;  2UUA B;  3QVN A;  4X65 B;  3CC7 V;  5IY5 B;  4YIO A;  1ENV A;  3IGA C;  1K7D A;  3G4S V;  3HKC A;  4ZI7 A;  5JH7 A;  2GV9 A;  5D5P A;  1U97 A;  5CBF A;  1PM9 A;  1XOU A;  4Z2W A;  1XMQ B;  4JYA O;  1L8D A;  4AIL C;  1NVP B;  3OUS A;  5IT9 N;  4DR2 B;  1V55 B;  4I4T A;  2DYS B;  4PA4 A;  3JD3 A;  4J9Z B;  2KG7 A;  2HHH B;  3D8C A;  4PI2 A;  3S3W A;  4I0X B;  1HDJ A;  5IJ9 B;  1G8M A;  2VS0 A;  3JAT B;  4NR1 A;  1EN5 A;  3UO3 A;  3E8G A;  2PZS A;  3OAA G;  1XMO O;  3QF7 A;  4MS2 A;  5L3G A;  2QE7 G;  1BGY H;  1VQ9 V;  2IBZ H;  1H2N A;  1I5X A;  4CH5 A;  4HAM A;  2QWR B;  1DTO A;  2V7Q G;  2BTQ B;  4QNH B;  1SQP H;  1N0J A;  3RWR D;  3JD2 A;  4WFB V;  2HP8 A;  5H9C A;  1E79 G;  3RYH B;  1AR1 B;  1XNQ O;  2ZM6 O;  2Q0O C;  2PGG A;  4L87 A;  2NLJ C;  1GO3 F;  1K33 A;  3ZJZ A;  1NTM H;  2WLL A;  1TVK A;  1SKV A;  2CGO A;  1M4U A;  1US6 A;  3FB8 C;  2AHZ A;  3JAK A;  5L3B A;  2CE4 A;  3AK2 A;  4NKG B;  4XDK A;  2V1D A;  1KKC A;  4X20 B;  2IH1 C;  4DR4 O;  1TA8 A;  2LW7 A;  2ATK C;  2AZ2 A;  3ZHT A;  1IBK O;  1VQ7 V;  2EJR A;  2KSD A;  1HNW O;  2VWK A;  3CCS V;  1SA0 A;  2YDE A;  4OGQ B;  4NXM O;  3LSS A;  2P7T C;  2A06 H;  2EIN B;  4CH4 A;  3D36 C;  4JGS A;  1GKF A;  1IZ3 A;  2YID A;  3IFX A;  4JYA B;  1IBL O;  4MTX A;  4F6R B;  3B09 A;  1QVF U;  3T1Y O;  2OIG A;  4FJC C;  2F1M A;  4I55 B;  5KHG A;  2PTM A;  2Y69 B;  1H2L A;  3HKE B;  1BQZ A;  1VF7 A;  4GX0 A;  4R6Z A;  1SES A;  2RMK B;  2BCC H;  2ZIN A;  3K9S A;  4LBE C;  1YIT V;  2QSA A;  4FLW A;  1RSO B;  2YI8 A;  2BSK B;  1EN4 A;  5KX5 B;  1G6U A;  4H13 B;  4DRX A;  1SQQ H;  1BMF G;  3JD0 A;  3PJS K;  1SQB H;  4IHJ A;  5AG2 A;  4DK1 A;  3ABL C;  4QE9 A;  5CBG A;  4BWA A;  3W7T A;  4RO2 A;  1W59 A;  3AG3 C;  1XNQ B;  2WLI A;  2ZM6 B;  4UV8 A;  1HP8 A;  4U3J A;  4GT1 A;  5JQG A;  3IAY A;  1Q90 D;  2DYR B;  1QCE A;  3A0B Z;  3IC9 A;  3BRC A;  4PA9 A;  1TUE B;  2WLK A;  4FFB B;  4JI0 O;  4XBF A;  1FXV A;  5LHH A;  2UXN A;  3WU2 Z;  4DR4 B;  1YI2 V;  1XL4 A;  3NXS A;  4RAI A;  1IBK B;  3E35 A;  1HNW B;  3QO7 A;  1J5E O;  2UXD O;  1OCC B;  1VQP V;  1LUV A;  3P32 A;  1CP9 A;  1SQX H;  3RYC B;  4NXM B;  4TSF G;  2XUM A;  2UUB O;  1M9N A;  3JD4 A;  4NB5 A;  3K5N A;  4LF8 O;  4KHP O;  1IBL B;  1QLE B;  1QR9 A;  3OR6 C;  4G28 B;  4CH3 A;  3WB1 A;  1WLE A;  1VIB A;  3CS5 A;  2HFE C;  2Q0A A;  5IYZ B;  4FLU A;  2Y0I A;  3GVM A;  4MW8 A;  3FYI B;  1XI1 A;  3RVZ A;  4TUY B;  1H2G A;  4IYI A;  5B1O A;  4CZZ A;  2A0L A;  2AGA A;  4G27 B;  5IJ0 A;  2DJV A;  3K3W A;  3CYO A;  3JD1 A;  2MW2 B;  1VQ4 V;  2EIM C;  2HLD G;  4UB6 Z;  1GM7 A;  1HNX B;  1AB3 A;  3E22 B;  1Z2G A;  1WNS A;  4O2A A;  4WFG A;  5EBL C;  2Y48 A;  5TIS Z;  4EB6 B;  3KCY A;  3ZRW A;  2Z3Y A;  3VBB A;  2QM7 A;  4MVZ A;  1DK1 A;  3JAR A;  3SJC C;  3T1H O;  1RM1 B;  3QO5 A;  5LP6 C;  3FAV A;  3B77 A;  1EN6 A;  3CC2 V;  1COW G;  5A2Q N;  3KG2 A;  3SYA A;  5LP6 A;  3CEI A;  4JI1 O;  3K03 A;  1GN3 A;  3ABU A;  2ZCE A;  3RYI B;  4BIO A;  4JI0 B;  1I0H A;  2JRI A;  3OW2 U;  4MW3 A;  2ZE5 A;  2IJK A;  3K58 A;  2R70 A;  3ZHS A;  2ITD C;  3EHB B;  1R3K C;  4PEL A;  5LXT B;  2UXD B;  4JAU A;  4UVA A;  3RW0 A;  3AG4 C;  1UFI A;  3RBZ A;  3K04 A;  1N0N A;  1FFX A;  2UUB B;  1F4M A;  2GHY A;  4J41 A;  2RQ6 A;  4LF8 B;  4GCZ A;  4KHP B;  3CJH A;  4OXS A;  4PA6 A;  3L75 H;  3ZMS A;  1M56 B;  4O4H B;  4ZOL A;  4W4K A;  1Q82 W;  2E3C A;  1JVM A;  1KD1 W;  4LFB O;  4X66 B;  5ITZ A;  3CP1 A;  5DM6 V;  3UM7 A;  1PD3 A;  3LDC A;  2Y0P A;  2EIL B;  2JGD B;  3M7M X;  5EZY B;  2WLN A;  3BY6 A;  4TOI A;  2ZE7 A;  5KHI A;  4RQE A;  4ZBM A;  2EIK C;  1YEW A;  2K1E A;  1JJO A;  4GX5 A;  3C90 A;  1WB7 A;  1HR0 B;  3OTO O;  1B6Q A;  5GW7 A;  1N8R W;  3J7A U;  4TT3 G;  2OWO A;  2YIB A;  3T1H B;  4DV4 O;  2YUA A;  4J10 A;  1D2D A;  4TWK A;  4QIW F;  2ZR2 A;  4B3R O;  3JAL B;  3RT3 C;  5BXZ A;  1M57 C;  1RPR A;  4P9P A;  2DN9 A;  4GZR B;  4K0K O;  4JI1 B;  2E75 B;  1K4C C;  2QKC A;  3D3Q A;  4MSW C;  3JSL A;  1FXK B;  3OGC C;  2V4D A;  4JPR A;  2H3O A;  2ADP A;  4LWS B;  1GH6 A;  2NR5 A;  5GON A;  5EIB D;  1FXH A;  1Y76 B;  1MA1 A;  4I50 B;  4FMT A;  3WG7 C;  4WFA V;  4DV6 O;  5DN6 G;  1GN4 A;  3CSX A;  3H1I H;  1SQF A;  1ZUQ A;  4UCT A;  1IX9 A;  1SZX A;  4DR6 O;  4TQD A;  3G80 A;  5FNV B;  3JYC A;  2PI4 A;  2IH3 C;  2DW4 A;  1E1R G;  1S3J A;  4I7Z B;  3CCM V;  4JI8 O;  4NYK A;  4DV3 O;  2ZIO A;  3LUT B;  3PN1 A;  1Q81 W;  4PV1 B;  1FYJ A;  3E8B A;  3K9A A;  3SPC A;  5LGU A;  4AHC A;  3CX5 F;  4DW1 A;  4NTW A;  3CRQ A;  1NTK H;  4B3T O;  2ZQM A;  1R73 A;  2ZD9 A;  1ZAU A;  2A7W A;  3OTO B;  1VF6 C;  4FK5 C;  1DGS A;  4YJ3 B;  3G71 V;  1TGO A;  1TUB A;  2AW9 A;  2QWQ B;  3U11 A;  3Q4H A;  5CMU A;  4DV4 B;  2CH7 B;  1VQM V;  5KMG B;  3I5D A;  1R3L C;  2UU9 O;  1K3E A;  4B3R B;  3E89 A;  3T1C A;  3I55 V;  3ABM C;  5LMN B;  3JAS A;  3SJA C;  4I9Q A;  4JYC A;  5LBQ A;  4K0K B;  4NTX A;  1SC5 B;  3L73 H;  5EK0 A;  4NXN O;  4YIP A;  3OM3 B;  4O4L A;  1J95 A;  4JAV A;  3EFF K;  5LOV A;  1KC8 W;  3K79 A;  5B66 Z;  3ABK C;  1VQK V;  5IY5 C;  2P4K A;  3STL C;  3CPW U;  2IU3 A;  1XDC A;  5CBH A;  2ZT9 B;  5L3E A;  5J2U B;  1XQ8 A;  3DXR B;  2JIZ G;  2P4V A;  2F23 A;  2L35 A;  4D7T A;  4FVM A;  4DV6 B;  3SJB C;  1LNQ A;  1NBM G;  4NVP A;  1V55 C;  4U7N A;  4Z1M G;  3GWO A;  5KLV H;  4DR6 B;  4H0L B;  3AK1 A;  3K06 A;  3JAW A;  1X59 A;  4JI8 B;  4UVB A;  3OMN B;  2RNB A;  4X89 A;  4CS4 A;  1F51 A;  3SPI A;  2F93 B;  2E76 B;  3HR0 A;  2ODM A;  3RVY A;  2X7R B;  3F5T A;  3CCU V;  2Q8V A;  3TK1 A;  4JI7 O;  1QBZ A;  2QTS A;  3LNM B;  1H2K A;  3OR7 C;  3WB0 A;  4X1I A;  2IW5 A;  3ASN B;  2ZE6 A;  2Q73 A;  4B3T B;  1BQ0 A;  4JI6 O;  5EBW C;  4PDV A;  1QHT A;  3H9V A;  2Q9L A;  3B2E E;  4LCU C;  3SPH A;  1GTO A;  3O65 A;  2UU9 B;  2PUS A;  4JTC B;  1YDX A;  4UCR A;  4I9W A;  4ZHQ A;  4WFF A;  2DMX A;  1YSC A;  2JVD A;  4NXN B;  3OTF A;  4FZ0 A;  4J11 A;  4BW9 A;  5BMV A;  2YC0 A;  2FL4 A;  4G2K A;  4F4L A;  1KEC A;  1JX9 A;  2PYJ A;  2EIN C;  1D5N A;  3LNN A;  4KL1 A;  1M1K W;  2Q5Z A;  5CB4 A;  3H1H H;  3LSQ A;  3N27 A;  1FS0 G;  1JPX A;  3HKC B;  4ZI7 B;  5JH7 B;  3S3X A;  2EIJ C;  3FKS G;  2Y69 C;  4UCV A;  2EZP A;  3UO2 A;  5IYB O;  3ICX A;  4HNA A;  2HG5 C;  3SJQ C;  2WWW A;  4I4T B;  2LGQ A;  2QR4 A;  2ZKO A;  5FLX N;  3CCJ V;  4DV0 O;  2KG7 B;  4GX2 A;  3ZS8 C;  5GTH Z;  2YS8 A;  4R8C A;  4RUE A;  4PA3 A;  5B1B B;  1ZX3 A;  2HJD A;  4B08 A;  3CCR V;  2QTO A;  4JI7 B;  4GUN A;  2BTO A;  5CA1 A;  4IYH A;  1AI6 A;  3H1J H;  3ML0 A;  3VQY A;  5LYJ A;  3HKB A;  2HJF C;  4JI6 B;  3SPJ A;  4R7C A;  2GTS A;  4PD4 F;  3ETE A;  4RUF A;  3D36 A;  2P22 C;  1GMG A;  2JEU A;  5L3F A;  2WLH A;  2X6C A;  2DYR C;  4CS3 A;  2WLL B;  3MDS A;  4B7E A;  1TVK B;  1KB9 F;  3BAA A;  1OJH A;  3RFR A;  1MG1 A;  3JAK B;  1OHH G;  5LA6 A;  2ILM A;  3FFQ A;  1WJZ A;  3F7V C;  2QKS A;  3TJT A;  1S77 D;  2VWJ A;  4MVM A;  3D3I A;  4FLY A;  1HNX O;  2AHY A;  2X0L A;  4O2B A;  2QM8 A;  1OCC C;  4K3A A;  3AEI A;  3ZHR A;  1DLB A;  4AQY O;  4DW0 A;  3QNE A;  1Q8I A;  2EZO A;  3ASO B;  1QLE C;  1JFF A;  1SA0 B;  1F23 A;  1YZB A;  4UCU A;  4ASU G;  2ZDI C;  3SYC A;  1AJP A;  1Y74 A;  4JTA B;  4JI5 O;  4Z1V A;  5E79 Z;  1P7B A;  5B3S C;  1F4N A;  4DV0 B;  2XND G;  1MZF A;  2QM4 A;  1IVS A;  1JA8 A;  3JCZ A;  2QGN A;  3X2Q B;  1XBL A;  1PPJ H;  2YXL A;  3ZHV A;  4EFE A;  5B1A C;  1ZTE A;  3BA8 A;  3OD4 A;  4JYY A;  2YEV A;  1N34 O;  1A32 A;  1CPY A;  4DRX B;  4DUY O;  5J2T A;  1SET A;  4MTO A;  2OT5 A;  4HYO A;  4IHJ B;  3BA9 A;  3G6E V;  5A9G A;  1Q6H A;  3CRR A;  1S5J A;  4X1K A;  3E86 A;  3B8M A;  1RM1 C;  2P06 A;  4JI2 O;  4PI0 A;  3ABL B;  2WLI B;  2DQ3 A;  1Q5O A;  4U3J B;  2KKW A;  5JVD A;  4X66 O;  5JQG B;  4ZIB A;  3AG3 B;  1NH2 D;  2CTQ A;  4ZKI A;  3EXA A;  4LFA O;  3HKD A;  1NU1 H;  1NKD A;  3H01 A;  4QPJ A;  1OCZ C;  2C2A A;  2ITC C;  4IT5 A;  2WLM A;  4IL6 Z;  4K35 A;  3ZED A;  1NT2 B;  3OT7 A;  5LL6 Y;  1YIJ V;  3CD6 V;  1KMI Z;  4DR7 O;  1Y6X A;  2BOB C;  1PNM A;  2GDS A;  1NTZ H;  1SZT A;  4LNU A;  1HR0 O;  2HVJ C;  4AQY B;  2XTA A;  2H8P C;  2QWO B;  1WPX A;  2P5O A;  3A2F A;  2QDO A;  2FKX A;  1YXB A;  3N2G A;  3FB5 C;  1K8A W;  1N33 O;  4JI5 B;  1EM1 A;  4GLX A;  4X62 O;  3UT5 A;  4B3M O;  4IGG A;  3R65 A;  4IIJ A;  3CXC U;  3B40 A;  4MVO A;  4UUJ C;  3C3S A;  2KQX A;  3RYF A;  4O4I A;  1YJW V;  1S5H C;  1NJI W;  4X1Y A;  1PL0 A;  3BEH A;  3ZMV A;  1M90 W;  4D6T H;  2WAM A;  5IJ0 B;  2L6L A;  1N34 B;  2YXH A;  2B9Z A;  2YIA A;  4DUY B;  2A79 B;  3CCV V;  3CCL V;  5B1N A;  4R50 A;  3ZRV A;  3WB2 A;  1FPO A;  4O2A B;  3RN4 A;  1H38 A;  5EC1 C;  2W0F C;  1XRE A;  4L8J A;  3ZRW B;  1KQS U;  4JI2 B;  1NR1 A;  4YJ2 A;  3L70 H;  3UCS C;  1WA8 A;  2LJ2 A;  5EYP A;  2HR3 A;  3JAR B;  3DSQ A;  2GUZ A;  3ZHU A;  1ROP A;  3FAV B;  3G6B A;  3K0D A;  1MOF A;  1R6T A;  2YIC A;  3F7Y C;  4P2Z A;  3CME V;  2XAG A;  4LFA B;  1MNG A;  3LDD A;  5BZB A;  1XL6 A;  4JF3 A;  5LP6 B;  4TV9 A;  5C93 A;  1B06 A;  4FLX A;  1LUW A;  1F7Y A;  4PA7 A;  4DR7 B;  5J9P C;  5D5Q A;  1ZLZ A;  1IUR A;  3BCC H;  2OCC B;  3CCE V;  3FX7 A;  5CA0 A;  1OV9 A;  2E5L B;  1S72 V;  5HFL A;  4KFM A;  4LF7 O;  4BR6 A;  2LW1 A;  3OMA B;  5C8Y A;  1FFX B;  3N2K A;  4TQF A;  1N33 B;  1VF5 B;  3AG4 B;  2A3Q A;  3CJH B;  4X62 B;  4B3M B;  3ZHQ A;  4LFC O;  5LMN O;  3B8N A;  1KKD A;  3ZN0 A;  4KXR A;  1KYO F;  1YVW A;  4ZOL B;  1MSD A;  1W0K G;  4TV8 A;  5EIB C;  2VRZ A;  1GN6 A;  2LFR A;  4PDR A;  1MAB G;  1R3I C;  5ITZ B;  4P30 A;  2YIB D;  1YTF D;  2UUC O;  2OCH A;  2LFS A;  3TCU A;  5B5E Z;  1GN2 A;  3LSU A;  4O4J A;  2FB5 A;  1Q43 A;  1AI5 A;  1U96 A;  1AP5 A;  4UCO A;  4CH6 A;  4JTD B;  1P49 A;  1M5I A;  4AI8 A;  1L0L H;  3W7X A;  2Q7H A;  4EEQ A;  2RDC A;  4GYC B;  5IWA O;  3T2M A;  2AXT Z;  1THZ A;  4C7U A;  1O9G A;  2MK3 A;  1WB8 A;  1IXM A;  1NS1 A;  2K9P A;  3SDL A;  2N74 A;  1I08 A;  1NR7 A;  2QJ1 A;  3L72 H;  2M7W A;  1ZL8 A;  1GK9 A;  1JJ2 U;  1MMM A;  2N04 A;  4UFZ A;  1QVG U;  3AG2 B;  3AG1 B;  1NZ6 A;  1BHA A;  5CN0 A;  1KBH A;  1OCR B;  3DC5 A;  5BR8 O;  2ZXW B;  2LQT A;  3BAB A;  5GON B;  5JCO C;  4LF7 B;  4QPK A;  1YHQ V;  1E1Q G;  1OCO B;  1VF6 A;  4DK0 A;  1GM8 A;  4WBN A;  5JCO A;  1PL4 A;  4LFC B;  1W0J G;  5KHK A;  3AG7 A;  3SR2 C;  2A9H A;  2DWD C;  3MAQ A;  1RFY A;  1WP8 A;  2F4V O;  3ZN1 A;  5K1X A;  3P30 A;  4J7J A;  4GKJ O;  1K4D C;  4UVC A;  4OPA A;  4LH6 A;  2GTA A;  2DOS A;  2UUC B;  5JJN B;  2OYQ A;  3OEE G;  3ASN C;  3F5W C;  1EFR G;  1ARO P;  2W0X A;  4W4L A;  5LHG A;  3ETD A;  5JJJ B;  5FL7 G;  3MHH C;  2Q69 A;  4MTG A;  2IJH A;  3LDE A;  1H8H G;  2WA4 A;  4H44 B;  3A0R A;  1BT8 A;  3APQ A;  1FFT B;  2BE3 A;  4MVU A;  2DYS C;  2ARH A;  3ETQ A;  5H2F Z;  1HWY A;  5IWA B;  2WPD G;  2DWE C;  1V54 B;  3TXQ A;  1IXB A;  1TUB B;  1QLN A;  2XAQ A;  1VEW A;  3Q4H B;  5DED A;  4MVS A;  1HW7 A;  1AVM A;  4YXW G;  1L0N H;  2NN4 A;  2ZNJ A;  1Z5V A;  2PF4 E;  4I0X A;  5IJ9 A;  4F6E A;  4N23 A;  1AP6 A;  2R9A A;  3K5M A;  4FM0 A;  3JAT A;  3UKM A;  4LF6 O;  4LF4 O;  3JAS B;  1ZWI C;  4DUZ O;  3QTC A;  3R66 A;  1Y66 A;  4FLT A;  2CTW A;  3BHP A;  1EZV H;  5BY1 A;  4O4L B;  4BAY A;  3VQX A;  1FKA O;  1NVP D;  2BTQ A;  4JAS A;  5LOV B;  2JS3 A;  4OX9 O;  4FM1 A;  5KA6 A;  5LGN A;  4X9Q A;  2YSU B;  5BR8 B;  1XNR O;  5H5N A;  1Q6I A;  3ZBH A;  3RYH A;  1R1B A;  2Q4P A;  1RPO A;  3ABT A;  2OTL V;  2DE0 X;  3MHS C;  2VQE O;  4X64 O;  3CCQ V;  2QWN B;  2QWP B;  4N21 A;  1G4Y B;  1H8E G;  2R72 A;  3JAW B;  3W7W A;  2F4V B;  3ZX6 A;  1Z5W A;  4B3S O;  5B1B C;  4GKJ B;  5JJE B;  2PYL A;  3UQ8 A;  4X20 A;  1WPB A;  5FPR A;  4OPH A;  2CTP A;  2HEP A;  2NNU A;  2XAJ A;  4LC1 A;  4X1I B;  5CA3 A;  4JAA A;  4DXW A;  4ICG A;  3L71 H;  2Q68 A;  2RJZ A;  2RCV A;  3STZ C;  1N36 O;  1SER A;  3OMI B;  3I56 V;  1KP3 A;  4F6R A;  1Q7Y W;  3BVO A;  1JMK C;  1K92 A;  4NTY A;  4KUM A;  4I55 A;  1XHX A;  4EKW A;  3AK3 A;  3HKE A;  1CEZ A;  3OUF A;  3BPZ A;  4EFB A;  2Y4U A;  3VQV A;  3CMA V;  3K0G A;  1TAE A;  4FM2 A;  4LF6 B;  4LF4 B;  1RSO A;  4DUZ B;  1XIL A;  4ZHQ B;  2BSK A;  2B5U A;  3DC6 A;  5KX5 A;  3JSN A;  4DR3 O;  3KKY A;  2PI5 A;  4DV5 O;  3M99 B;  3C3T A;  2WA3 A;  4XDJ A;  3QG5 A;  4JI3 O;  5EBM C;  3ASO C;  1URF A;  3SYQ A;  4OX9 B;  5BMV B;  1I7F A;  3CWB H;  2IJJ A;  1XNR B;  2CGN A;  4E4E A;  1DF5 A;  5KUM A;  3K08 A;  1PNL A;  5CB4 B;  4E2L A;  2H94 A;  1N32 O;  4J7K A;  3OFN G;  2VQE B;  3JAM N;  4X64 B;  4J7Z A;  1SQG A;  3B4S A;  1SQV H;  4HNA B;  2UXC O;  2EIJ B;  1UJW B;  3X2Q C;  4DV1 O;  4B3S B;  1ORQ C;  4FFB A;  5LMU O;  4WCE V;  2P6J A;  1FAF A;  2PY5 A;  4FPP A;  1VQ6 V;  1BCC H;  1UPG A;  3U0Z A;  1XMO B;  3ZMZ A;  3HB3 B;  1SF9 A;  2XAS A;  3RYC A;  4GKK O;  5CA1 B;  2CUG A;  1KU9 A;  5H6R A;  1XHZ A;  1RP3 B;  3P3P A;  4PJ0 Z;  4QGP A;  1GM9 A;  5LYJ B;  3HKB B;  1N36 B;  1K9M W;  2XOK G;  2EUL A;  5IYC O;  2ZDI A;  1SS3 A;  4LP8 A;  1DF4 A;  2R9R B;  5IYZ A;  3CC4 V;  2ZNI A;  2HVK C;  2ADQ B;  4H37 A;  4JYB A;  4LF9 O;  4DV7 O;  4TUY A;  2IJI A;  4JZ2 A;  3FYE B;  5KA5 A;  5KHJ A;  4MTF A;  5LA6 B;  3J80 N;  3CB2 A;  4DR3 B;  3OGI B;  2JK5 C;  4DV5 B;  4ABM A;  4YY3 O;  3E22 A;  4JI3 B;  4O2B B;  3CRM A;  4CC6 A;  2X6B A;  4P9O A;  4DR5 O;  4EB6 A;  5F2V O;  1Q3E A;  2OIE A;  4UXN A;  2EBO A;  1B04 A;  3H1L H;  1JFF B;  1MSW D;  2UXB O;  1O9H A;  1N32 B;  1BE3 H;  1K5Q A;  1BZK A;  1Y74 B;  3FD9 A;  1AR5 A;  3QO8 A;  3T1Y B;  2UXC B;  3SYO A;  3CRA A;  4DV1 B; 
#chains in the Genus database with same CATH homology
 2CUG A;  2YS8 A;  4IT5 A;  2DMX A;  2LO1 A;  3UCS C;  1NZ6 A;  2N05 A;  2QWP B;  2L6L A;  2Y4U A;  4J80 A;  2CTR A;  1N4C A;  2DN9 A;  2PF4 E;  3AG7 A;  2GUZ A;  1IUR A;  2QWR B;  2QWQ B;  1BQZ A;  2LGW A;  3APQ A;  4RWU A;  3UO2 A;  1FAF A;  2Y4T A;  3BVO A;  2QWN B;  2KQX A;  2QWO B;  2CTP A;  2GUZ B;  2CTQ A;  1HDJ A;  1FPO A;  2YUA A;  2QSA A;  1GH6 A;  2CTW A;  2EJ7 A;  4J7Z A;  2OCH A;  3UO3 A;  2N04 A;  1BQ0 A;  1WJZ A;  3APO A;  1XBL A;  2M6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...