1BQZA

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNAJ
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bqzA00
2DMXA 1HDJA 4J80A 2CTPA 2CTWA 2GUZB 1BQZA 2QWOB 3AG7A 3UCSC 4RWUA 2YUAA 1GH6A 3BVOA 2N05A 3APQA 3APOA 1FAFA 2QSAA 2CTQA 2YS8A 4J7ZA 3UO3A 2DN9A 2Y4TA 1WJZA 3UO2A 2QWPB 2L6LA 2M6YA 2QWQB 2EJ7A 2CTRA 1N4CA 1IURA 2OCHA 2GUZA 2QWRB 2PF4E 2LGWA 2KQXA 1FPOA 1BQ0A 2CUGA 2N04A 2Y4UA 4IT5A 1XBLA 2LO1A 1NZ6A 2QWNB
chains in the Genus database with same CATH superfamily
3DGEA 4KUMA 2XAQA 2JK5C 4WCEV 4OXSA 3M7MX 1MA1A 4Z1VA 4DR3O 4A5UB 2M6YA 2BTQB 2EIJC 5LYJA 2IH3C 3K0GA 4B3SB 2JEUA 3RN4A 2WLKA 1EN6A 1DTOA 4OPAA 4JV5B 1NU1H 3CXHF 1AR5A 4UV9A 3KZIZ 1UJWB 2YIBD 3OTOB 4I0XB 2F4VB 4IIJA 3SPHA 4DUYO 4LF7B 2YS8A 3K08A 4WBNB 1JCHA 2YEVB 1FXHA 5LHIA 1M9NA 1PKXA 4JTDB 4JYYA 4AHCA 1HP8A 4CS2A 5EBMC 2HEPA 4K35A 3F5TA 5JCOA 1OCRB 4J7KA 1VQKV 2YIDA 3ZMVA 1Q3EA 5CA1B 4JASA 2ZE6A 3JD3A 1DF4A 3J81N 5JH7B 4GZRB 2UUCB 4NYKA 2QR4A 2MK3A 5KHHA 2F23A 1PNLA 4JYAB 3RFRA 1SA0A 1VQ7V 2LP7A 5H6RA 3AG3B 5DN6G 3OE7G 2A9HA 4TQDA 5JJNB 2O57A 5LMUO 2OCCB 1K5QA 4I7ZB 4BWAA 1BT8A 1V9PA 1NTKH 2ZM6O 1SZTA 1BGYH 1VQOV 4H0LB 5JVDB 3JAMN 2ZINA 3E8BA 2AGAA 1T5EA 2ADQB 1KUQA 1NI8A 1HDJA 1J5EO 2R9IA 4FZ0A 4Q20A 4JPRA 1R1BA 1RP3B 3MHHC 1FXKB 2DYRB 5LA6A 4DV6B 5LHGA 5IJ9B 3AG1C 1M93A 1IBMB 2ETNA 4LH7A 2QWNB 2BSKB 1FFXA 1WA8A 4CC6A 3QO8A 4DUZB 1AJPA 3ZHUA 4B3SO 1AROP 4PDVA 5C8YA 3HKCA 5LP6A 1TVKA 2QSAA 4DW0A 4JV5O 3GWOA 1XILA 2IU3A 3JD4A 3STZC 3N2GB 4YY3B 3OTOO 1YF2A 2DOSA 2F4VO 1OCZC 1F7YA 3L72H 3STLC 4LF7O 3UT5B 1JFFA 5BY1A 1KBHA 1B04A 4DV5B 1L0NH 1M90W 1OJHA 2EZOA 2E5LB 5E1AC 1KC8W 1M57C 5KAFZ 5GONA 1XOUA 1N36B 4OPHA 4O4HB 3W7TA 2KG7B 3C3SA 2JJ1G 4MVUA 2LO1A 1RM1C 4EB6A 5CMUA 2NNUA 2UUCO 3CRAA 1DGSA 1NJIW 3CRMA 1K3EA 2OT5A 4JYAO 3OMNB 3ASNC 4DXWA 2N74A 1WNSA 4E4EA 1G8MA 2QWQB 4RAIA 3K5NA 3LNNA 1Z5WA 5IDJA 1AI7A 1FYJA 3SDLA 2Q69A 2A0LA 4ZOLA 3OEHG 2BTOA 4JYBA 1JQ0A 4PELA 3ZMSA 2F93B 1HNZB 2FTKA 3OW2U 3CEIA 4N23A 4O4LB 4CH5A 2KKWA 2DN9A 3BCCH 4FVMA 3FAVA 1K33A 3X2QC 1DLBA 4D7SA 3WB2A 1K5SA 4TOIA 4CH6A 2QTSA 5B66Z 3JATA 3SPGA 4F6RB 4R50A 1F4MA 2D2CB 1KKCA 4U3FH 2HLDG 4FLZA 2WLJA 2YICA 4I9WA 4FLUA 5B1AC 3L70H 1N32B 5J9PC 5IJ0A 2Q68A 1QLEB 3CB2A 4DUZO 4MS2A 4UV8A 1AP6A 3PN1A 5L3FA 3BY6A 2R72A 4DR1B 5KAIZ 4YY3O 3RYHA 3VQVA 3JCUZ 4L8JA 2UUBO 3CCRV 4GX2A 1EZJA 3EHBB 2L6LA 1XUQA 4JI7B 4DV5O 4FFBA 3BHPA 2PYLA 1XL4A 2HFEC 4K3AA 4B3TB 1OCOB 1TA8A 4MW8A 1Q6HA 1E79G 1YXBA 4I50A 1P4RA 4O4JB 1L0LH 4GLXA 1N36O 3P30A 3QTCA 5DECA 4LF5O 3JAKB 3JSLA 3CX5F 1KD1W 3W7XA 4PDRA 4OX9B 1PV0A 3CRRA 4GUNA 2YXHA 2ITCC 2B1IA 1JJOA 2UXDB 3E8FA 1GM7A 2JGDA 4F4LA 2UXNA 4JGSA 3UM7A 1K9MW 1Y4MA 2DE0X 4AILC 2EIMB 4X62B 4X20A 3L74H 3ETGA 5KX5A 2EJ7A 2HKOA 4I5SA 1Q86W 1H38A 1HNZO 4TUYA 2LGWA 1M1KW 1D5NA 3ZRXA 4O2AB 2GDSA 1AP5A 4QPJA 3LSSA 1YCIA 1RSOA 1I0HA 3TXSA 4YIPA 1KP2A 4MTFA 3D36C 2QE7G 1AVMA 4R8CA 1NR1A 3MAQA 1TUBB 5LXTB 2GUZA 1HR0B 2JEXA 4QJFB 5BR8B 4YXWG 5H9CA 2HP8A 2Z5UA 3WG7B 1ZL8A 1TUEB 1XEQA 3SGIA 5B5EZ 4WFHA 2W6JG 3OEEG 1V55B 1WLEA 4BW5A 2YUAA 1Y67A 3B2EE 4H13B 3ZIAG 4DR1O 2YC0A 4LWSA 1SS3A 3DXRA 4XDKA 4DV2B 1FXVA 1OCRC 4J9ZB 1GM8A 4RQFA 1BQ0A 2W0XA 1VEWA 5IWAO 4IHJA 4MVMA 3CP1A 4JI7O 1FJGB 4B3TO 1UPGA 2ZDIA 2YI8A 3J80N 5JQGA 3ASOC 4PI0A 1NS1A 4DW1A 2YSUB 2B5UA 3M8AA 3ABLB 2XAGA 3AG3C 5J2UA 5EBLC 4UXNA 5KHKA 3FB6C 3AG2B 4ASUG 2UUAB 4OX9O 3IC7A 1SESA 4I4TB 2B9ZA 2EULA 2UXDO 3APOA 4FLYA 2GBOA 4KHPB 2X6CA 1R6NA 4YJ3A 5EBWC 2P22C 3TK1A 1TAEA 3T1YB 1FFTB 5B1OA 1ZUQA 4ZI7A 4TQFA 2PYJA 2AZ0A 1S5HC 1GTOA 4X1KA 2P06A 4DV3B 3RT3C 4CH3A 4DO2A 4DK1A 1L1FA 1N0JA 1FXKC 4ABMA 5EZYA 5B3SB 1KQSU 4YHHB 4X64B 2PGGA 4NKGB 3K58A 4WFBV 1P7BA 3A8TA 1V54B 1KKDA 3E22A 2OCHA 3CE2A 2BE3A 2X7RB 1XQ8A 3P3NA 4X1IA 3Q4HA 2Y4UA 4P2ZA 1J95A 1URFA 4GKKB 5L3DA 4O4IA 1COWG 1K7DA 2NR5A 5LOVA 1HR0O 2XAJA 4CZZA 5BR8O 1CXZB 1BS3A 2YXYA 4Q6GA 5JWPA 3ZJZA 4AQYB 1WPXA 4JI1B 3QO7A 3RYIA 3QG5A 3ZHTA 3LSUA 2K9PA 2WLIB 4LP8A 2OIEA 1IZ3A 5LGTA 1RFYA 3EFFK 2Y0PA 3R66A 3HPLC 2EJRA 4JAVA 3SJQC 4B7EA 2PI5A 2WLLA 4DV2O 5L3GA 3RYCB 1Y74B 1FAFA 2QKAA 3RYFA 3LDEA 5GTHZ 3GB7C 4EFBA 4XBFA 5GW7A 1R3LC 4PDMA 2BOBC 1FJGO 4LF9B 4IGGA 4MVSA 5LP6B 1Y66A 3A0HZ 3AG4B 3IAYA 3T1CA 4H33A 5JJEB 3F7VC 3FB5C 3E35A 4HAMA 1JMKC 2LGQA 2VS0A 4X1YB 1CPYA 4U3JA 4WFGA 3BAAA 4IYHA 4X89A 4YJ2A 3JAWA 2K1EA 3N27A 1QQCA 3LNMB 3VOUA 1WN7A 2CH7A 2UUAO 1AR4A 2P90A 1SERA 1B06A 4LF4B 1BHBA 3MDSA 1I94B 1X4TA 5GONB 4KHPO 5H5NA 1SQQH 1JOYA 4MT8A 3ML0A 3T1YO 5ITZB 3C90A 3CSXA 4QNHB 2IJKA 2VQEO 4DV3O 1B3QA 4NTXA 4P9PA 3UQ8A 4KP4A 2QEXV 4LNUA 1YTFD 4K8ZA 4LF6B 1H2GA 4YHHO 4X64O 1GMGA 2PTMA 3CJHA 3OTFA 2ZE7A 5CB4B 2H8PC 5IYZA 4ZOLB 3ZMTA 4PA7A 1QLEC 2QM8A 1YITV 1U96A 1VQ6V 1QCEA 4GKKO 1OCCB 3JALB 4FM2A 3WU2Z 2KQXA 1D5AA 4RUEA 1VQPV 4R7CA 2Q67A 4XDLA 1HNXB 2H3OA 4TT3G 3OAAG 4AQYO 1PD3A 1QVFU 4JI1O 1WB8A 1L8DA 1BL8A 3SJBC 1BCCH 3JYCA 3ZHVA 5J2TA 1OCOC 3S3XA 3ZHQA 1KU9A 2HG5C 2YIAA 2A7WA 2ATKC 1GRJA 3HKDB 1F4NA 3JARB 3K04A 1K92A 5EC2C 4DYLA 4TV9A 4TV8A 3NXSA 4LF9O 2A3QA 2ARHA 3TGUH 3SYPA 4O2BA 1NT2B 5B1BB 2DWDC 1PPJH 3T4DA 1IURA 4BAYA 2ZE8A 4X8AA 2ZKOA 1D2DA 4MTGA 1OHHG 3AK2A 2Q6AA 3K57A 2ZE5A 2ZQMA 3VQWA 3ABKB 5EYPA 2KSDA 3CPWU 4QE7A 1Y76B 2IU0A 4LF4O 3H1LH 3ZS8C 2XHBA 2CTQA 3SYCA 1EBOA 1I94O 4GX5A 4JI6B 4JI0B 4PHZA 4P9OA 2V1DA 1N34B 3ETQA 1PP9H 2EINB 3U0ZA 3CD6V 2VQFB 2AW9A 4J10A 1OZ0A 3W7SA 4DR7B 3BEHA 2Q7HA 1QR9A 3JD1A 3M99B 4ZHQA 1S77D 4LFAB 1DF5A 3D3IA 3O9OA 2F43G 4LF6O 3BPZA 1SQVH 3RVZA 3ZHSA 3ZRVA 2Q9LA 1QU7A 5A9GA 5FPRA 2F1MA 5CA0A 3CCSV 3H01A 4RO2A 2UUBB 4GT1A 3I55V 1V55C 3WFVA 4B3MB 2QA4V 4GYCB 2EX3A 3K3WA 4L87A 2JVDA 4ZIBA 1QBZA 1WB7A 4HNAB 3CC2V 2JRIA 3G80A 2P7TC 4FFKA 5BMVB 3CCVV 1HNXO 1AJQA 4J9YB 3CCEV 1I5XA 1PL4A 3RWRD 3SYOA 3SR2C 4H44B 2IH1C 4UFZA 4K8XA 1XNRB 2PF4E 2GTAA 3GWKC 4LF5B 4PD4F 3B40A 2DMXA 4EFEA 4J42A 1S5JA 1XL6A 4PDLA 1FKAO 1BQZA 2E3CA 2P4KA 1AI5A 1ZL8B 4RUFA 4J11A 2IJJA 3ABLC 1N4CA 4I55B 5FNVB 2ZR2A 3K5MA 2ZIMA 4BIZA 3AG2C 5KA5A 2OIGA 1KYOF 3D36A 5IYCO 1M5IA 4DR4B 3H1IH 3K9SA 4MVQA 5CBGA 1IVSA 3K5LA 2PI4A 4FZ1A 3B4SA 4DRXB 1XHXA 2YXLA 1KMIZ 3MHSC 4I0XA 3ZMUA 2CGOA 4BIOA 1VMGA 4WBNA 2UXXA 5JQGB 1IXBA 1GKFA 4JI6O 4JI0O 5B3SC 3CRQA 2YEVA 3C3TA 3ZBHA 1Q82W 2Z0AA 2ZNIA 1YEWA 5FPOA 5KA6A 1HNWB 1N34O 2E76B 4PJ0Z 2VQFO 1V54C 3KCXA 4DR7O 4CC5A 5LHHA 4P30A 4JZ2A 5FLXN 4LFAO 1NBMG 2PZSA 1ZAUA 2JIZG 5CA1A 3S3WA 1QVGU 3CHXA 1WAZA 1NZ6A 1VQ8V 5JH7A 5E79Z 2R9AA 2AHYA 4CH4A 3LUTB 4X1KB 3G4SV 5EC1C 5IT9N 1TGOA 5IWAB 4B3MO 4G2KA 1EFRG 2Y69B 4NXNB 3DSQA 4FIPC 3R65A 2CAZC 4FMTA 4XDJA 2LQTA 1WPBA 2A79B 2EIKB 2Q0AA 2GTSA 1PL0A 1NH2B 2RMKB 1XNRO 3TETA 4UVCA 4DR5B 5JVDA 1VF7A 1X59A 1LUVA 3JASB 1EM1A 4JI2B 2BCCH 1WP7A 4LF8O 1JPXA 3CCQV 2N04A 1FXKA 1VF5B 2Q0OC 5KMGB 1IBLB 5IJ9A 4ZKIA 3N2KA 1GH6A 1GAXA 3BRCA 2WLHA 1AILA 4FM1A 2CTRA 4DR4O 4NB5A 1SQXH 2CUGA 1GN4A 2DJVA 1NQTA 2AZ2A 3FX7A 3G67A 3N2GA 3DTUB 1US6A 1QHTA 2BOCC 3UT5A 1BMFG 5DEDA 2JS3A 2IM9A 4E2LA 4U3JB 1HNWO 2LW7A 3JAWB 3W7UA 1R6KA 2UXCB 4YIOA 5HFMA 4ICGA 1EN4A 1Q81W 3SPJA 1LR1A 2DQ0A 3HKBB 1OCCC 1MNGA 5LGNA 3K59A 4O4HA 1IXMA 2N05A 3ZRWB 1Z5VA 3G6BA 4KXRA 1MABG 1Q7YW 3ZX6A 5DM6V 1VQ5V 1IBKB 1S76D 1NKDA 1SF9A 1OCZB 2QKSA 5GTIZ 2CK3G 3A2FA 2NN4A 1YTFB 4NXNO 5LYJB 1W0KG 3FYEB 1XHZA 2ODMA 5D5QA 3ABUA 1GM9A 3LSQA 4GCZA 2WAMA 2UU9B 5KUKA 4IIJB 2ZXWB 1NVPD 3LDDA 4O4LA 4DR5O 4NTWA 1QLNA 4G27B 1YI2V 2W0FC 2HVKC 2QDOA 1WP8A 3O65A 1RM1B 1EZVH 4BW9A 4JI2O 3OMIB 2OWOA 4PA9A 5B1BC 2OCCC 4MVRA 1AJNA 2EILB 1OV9A 1YJ9V 1XREA 2OTLV 4WF9V 2XUMA 3QO5A 3CCUV 1IBLO 4GKJB 3ABKC 4OGQB 1SRYA 3K79A 4U7OA 1GO3F 5IE9A 4F6EA 4Z1MG 2RN9A 2VQEB 3FB7C 3BABA 1VIBA 1XMQB 3KCYA 2DYRC 5EIBC 1VQLV 1N0NA 1SA0B 1GK9A 4HYOA 2HJDA 2EINC 4FLVA 4TV8B 2OYQA 2R70A 2QJ1A 4N21A 4J41A 3SPCA 3OGIB 1JR9A 4JI4B 2GHYA 1RPRA 2PUSA 4KFMA 3BFRA 3H1HH 4J80A 1JJ2U 1H2LA 3VBBA 1MMMA 3LDCA 2WSSG 1VQ9V 3U10A 2UXCO 4O4JA 3OD4A 2PY5A 1S5LZ 5B1AB 3B8NA 1E1RG 4DR6B 4NXMB 1S3JA 1P84F 1ZSPA 1YDXA 2HR3A 2EZPA 1AI4A 1ZX3A 3QNEA 3JAKA 4KL1A 2ZIOA 1XNQB 5LA6B 2IBZH 5KLVH 1K8AW 2JGUA 4JZGA 3MD0A 1IBKO 5L3CA 3KG2A 2WA3A 3HKEA 1FFXB 1CP9A 2LFSA 3JCZA 3IJ4A 1WA8B 4DV0B 4DV4B 2OTJV 5H6QA 1JVMA 5C8YB 3HKCB 5IYBO 1TVKB 4K0KB 4MVZA 1Q5OA 3BA9A 1BZKA 2UU9O 4X66O 1P7GA 3T1HO 2MW2B 1JFFB 3TXQA 5KHIA 5D5PA 4HBNA 2JS5A 4TWKA 2ZT9B 1Q6IA 3QF7A 4WFEA 1YJNV 3NR7A 4DV7B 1XMOB 1TUBA 5LXTA 4PI2A 4GKJO 1VP7A 4LFBB 3ICXA 5F2VO 3D8CA 2LFRA 1KECA 3ETDA 2C2AA 3DC6A 3E8HA 4EB6B 5LBQA 1O9HA 3WB0A 1XMQO 1FPOA 2M7WA 2GSMB 4G28B 3A0RA 1MG1A 1H2NA 4UCVA 3G71V 3ZN0A 3K9AA 3FYIB 1VQMV 4UCTA 1FD9A 4J7ZA 4JI4O 2WWWA 4FPPA 3L71H 1SC5B 1SQGA 4FK5C 4QGPA 3HR0A 4X88A 2QWRB 4C7UA 3TJTA 2X6BA 1MSWD 3FAVB 3OGCC 4D6TH 1AB3A 4DR6O 4NXMO 2YIBA 3F5WC 3K03A 4I9QA 1G4YB 2Z3YA 3AG7A 3UCSC 4LH6A 3AK1A 2RCVA 3JATB 1ZTEA 2CGNA 2Y69C 3JD0A 4JTCB 3FKSG 2Y4TA 1UFIA 2CDYA 1XNQO 4B7KA 1GN2A 1N33O 3I56V 4I4TA 2EIKC 2ZR3A 3ZHRA 4JI5O 5K1XA 2WLMA 4UCSA 5IJ0B 4DV0O 4DV4O 1ENVA 3I5DA 4LR3A 2JDIG 5KUMA 2LJ2A 5JJJB 2UXBB 2R9RB 4K0KO 1M56B 3RVYA 4WFAV 4UCRA 1K4DC 5IYDO 3RYHB 3T2MA 3SYQA 2Q73A 4DK0A 3E2EA 3J7AU 2P4VA 3ASOB 2YI9A 3BVOA 4FFBB 2EIMC 3P32A 2EBOA 2IJHA 4JAUA 3ABMB 4I50B 5A2QN 4DV7O 1XMOO 1VF6C 1Z2GA 3A0BZ 3CCLV 4LFBO 3F7YC 4EEQA 2WLNA 3CCMV 3EVKA 4NTYA 2KB1A 2XAFA 2P6JA 4EKWA 3CMEV 2CTPA 3CWBH 3UKMA 4CBCA 4CS4A 4WFFA 1I08A 1QNMA 1NR7A 2WLIA 3OM3B 1PM9A 2JGDB 5B1NA 1SZXA 1K97A 1Q43A 3N2KB 3WG7C 1VARA 4H37A 3RYCA 4X20B 1Y74A 2P5OA 3K5OA 2W6IG 1CEZA 5KX5B 3CCJV 2A06H 2X0LA 2DYSB 4TUYB 4RWUA 4NR1A 3APQA 4BIUA 5CBHA 1ZWIC 1W0JG 1RSOB 4DV1B 2VWKA 4X1YA 4W4KA 4DR2B 3QVNA 1PNKA 2FKXA 4U7NA 3ZEDA 4JI8B 2NLJC 2GUZB 4B3RB 1F51A 3CS5A 1YVWA 1JA8A 2ZCEA 1ROPA 2B1GA 2WPDG 1KB9F 3UO2A 4LF8B 4BR6A 5BXZA 2QGNA 3CXCU 2ZXWC 4PV1B 4FM0A 5ITZA 2XT9A 2UXBO 2ITDC 3W7WA 4IT5A 2Y48A 4LWSB 3RW0A 1XDCA 2EILC 1R3JC 2BTQA 3WB1A 3DXRB 4MW3A 5JCOC 2WA4A 4FLWA 1LUWA 2YDEA 1S0VA 4IHJB 5IY5B 5CB4A 1SQFA 4NVPA 3ABTA 4LCUC 1Y6XA 3L9DA 3IC9A 1DK1A 3JALA 3VQYA 2FL4A 1B6QA 2QWOB 4JYCA 1IDSA 1NVPB 2AHZA 5J2UB 2RNBA 5KHJA 3SJCC 4PA6A 1G6UA 2XOKG 4QE9A 1H2KA 4CS3A 1H2SB 2EIJB 3ZMZA 1BE3H 2Q7EA 1R73A 4YJ3B 4QPKA 1NTMH 4DV6O 4FJCC 1U97A 3SYAA 5LGUA 4ZI7B 3RBZA 3HKDA 1IBMO 3JARA 3IFXA 1YSCA 3ZCCA 3L73H 4MVOA 5K1PA 2P67A 5TISZ 5EZYB 2XTAA 1KP3A 4X65B 1Q8IA 3FD9A 2XAHA 5LMNB 3D3QA 3OR6C 4PA4A 5C93A 4DV1O 3E22B 4AI8A 1M4UA 2CE4A 4JI3B 2E75B 4X1IB 3Q4HB 4DR2O 3K0DA 2Q5ZA 4MTXA 4O4IB 1VQ4V 4JI8O 5LP6C 5CBFA 3OR7C 1Y76A 3AG4C 4B3RO 4LFCB 5LOVB 2E5LO 4JAAA 2V4DA 2DQ3A 2Y0IA 4GX0A 4IL6Z 5EIBD 1NTZH 1YHQV 2RDCA 3KKYA 2VWJA 3RYIB 1ORQC 1I7FA 5AG2A 4PA3A 4FLXA 1YIJV 2BSKA 4UCOA 2WLLB 2RJZA 2E74B 3RYFB 3JSNA 3EXAA 3HKEB 3FFQA 4X9QA 4UB6Z 3ETEA 3VQXA 2GV9A 3FB8C 2H94A 1MOFA 2F66C 2V7QG 3B09A 1W2BU 2HHHB 2IW5A 1N8RW 1EN5A 4HNAA 5H2FZ 4W4LA 4RQEA 4YJ2B 3H1JH 5BMVA 2Q8VA 4FLTA 3AG1B 3OT7A 5L3BA 2CH7B 3IGAC 1K4CC 1IX9A 1RPOA 1SQPH 2KG7A 3E86A 1BSMA 3AEIA 2LW1A 1Q6UA 2HVJC 1ZLZA 3G6EV 1FS0G 3CMAV 1H8HG 1YJWV 2F95B 1N32O 4D7TA 1F23A 2QM4A 1R3KC 5FNVA 4I55A 2ADPA 4LNUB 5BZBA 1HW7A 4R6ZA 2L35A 4X65O 3CC7V 5LMNO 2HJFC 4UB8Z 3CJHB 5IYZB 1M57B 4JI3O 2X6AA 4X66B 3B77A 1S72V 4DRXA 3T1HB 3U11A 1JX9A 1G1XB 2QTOA 3BA8A 1R3IC 4UUJC 4LBEC 4QIWF 5FL7G 1M56C 4LFCO 3P3PA 3ZN1A 1H2MA 2QM7A 2DW4A 3RGBA 4LC1A 3UO3A 4F6RA 3OUFA 3ZRSA 4B08A 2IJIA 3JD2A 1MZFA 3ASNB 2FMLA 3E83A 5J2TB 3PJSK 3K06A 1LNQA 4JTAB 3ABMC 1K73W 1W59A 1K34A 5KHGA 4MTOA 5EK0A 3OMAB 1WJZA 4TV9B 3OFNG 1A32A 1GN3A 2D3OW 4TSFG 1HWYA 1MZEA 5L3EA 4JF3A 4X62O 2AXTZ 2FYUH 3X2QB 4GX1A 2ZD9A 4O2BB 1XI1A 2JJ2G 4DR3B 4ZBMA 3E89A 3AK3A 3T4ZA 2HHHO 4UVBA 1GN6A 3HB3B 1BHAA 4HZ3A 1O9GA 1AR1B 5EYPB 1NH2D 1SETA 4UCUA 3H9VA 4DUYB 1YZBA 1I5YA 2ILMA 2DYSC 4MSWC 3CRCA 3JASA 1H8EG 1N33B 1SQBH 1AI6A 3CC4V 4JI5B 2Q4PA 3E8GA 4ZHQB 1PNMA 5KMGA 3CYOA 4J7JA 2ZNJA 2QKCA 2Q7GA 2RQ6A 1MSDA 3H1KH 5HFLA 5CA3A 1R6TA 1VQNV 3SPIA 2XASA 3DC5A 5CA0B 4Z2WA 1THZA 1VF6A 5LL6Y 1Q90D 2DWEC 1E1QG 3OUSA 2QWPB 4IYIA 5CN0A 4O2AA 1SKVA 4UVAA 2FB5A 1QR8A 5LMUB 3B8MA 2CTWA 2VRZA 2ZM6B 2XNDG 5IY5C 3SJAC 3GVMA 1P49A 1J5EB 2ZDIC 2G38A 3HKBA 3TCUA 1XBLA 3L75H 3ZRWA 3THOA
chains in the Genus database with same CATH topology
2DMXA 1HDJA 4J80A 2CTPA 2CTWA 2GUZB 1BQZA 2QWOB 3AG7A 3UCSC 4RWUA 2YUAA 1GH6A 3BVOA 2N05A 3APQA 3APOA 1FAFA 2QSAA 2CTQA 2YS8A 4J7ZA 3UO3A 2DN9A 2Y4TA 1WJZA 3UO2A 2QWPB 2L6LA 2M6YA 2QWQB 2EJ7A 2CTRA 1N4CA 1IURA 2OCHA 2GUZA 2QWRB 2PF4E 2LGWA 2KQXA 1FPOA 1BQ0A 2CUGA 2N04A 2Y4UA 4IT5A 1XBLA 2LO1A 1NZ6A 2QWNB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMX A;  1HDJ A;  4J80 A;  2CTP A;  2CTW A;  2GUZ B;  1BQZ A;  2QWO B;  3AG7 A;  3UCS C;  4RWU A;  2YUA A;  1GH6 A;  3BVO A;  2N05 A;  3APQ A;  3APO A;  1FAF A;  2QSA A;  2CTQ A;  2YS8 A;  4J7Z A;  3UO3 A;  2DN9 A;  2Y4T A;  1WJZ A;  3UO2 A;  2QWP B;  2L6L A;  2M6Y A;  2QWQ B;  2EJ7 A;  2CTR A;  1N4C A;  1IUR A;  2OCH A;  2GUZ A;  2QWR B;  2PF4 E;  2LGW A;  2KQX A;  1FPO A;  1BQ0 A;  2CUG A;  2N04 A;  2Y4U A;  4IT5 A;  1XBL A;  2LO1 A;  1NZ6 A;  2QWN B; 
#chains in the Genus database with same CATH topology
 3DGE A;  4KUM A;  2XAQ A;  2JK5 C;  4WCE V;  4OXS A;  3M7M X;  1MA1 A;  4Z1V A;  4DR3 O;  4A5U B;  2M6Y A;  2BTQ B;  2EIJ C;  5LYJ A;  2IH3 C;  3K0G A;  4B3S B;  2JEU A;  3RN4 A;  2WLK A;  1EN6 A;  1DTO A;  4OPA A;  4JV5 B;  1NU1 H;  3CXH F;  1AR5 A;  4UV9 A;  3KZI Z;  1UJW B;  2YIB D;  3OTO B;  4I0X B;  2F4V B;  4IIJ A;  3SPH A;  4DUY O;  4LF7 B;  2YS8 A;  3K08 A;  4WBN B;  1JCH A;  2YEV B;  1FXH A;  5LHI A;  1M9N A;  1PKX A;  4JTD B;  4JYY A;  4AHC A;  1HP8 A;  4CS2 A;  5EBM C;  2HEP A;  4K35 A;  3F5T A;  5JCO A;  1OCR B;  4J7K A;  1VQK V;  2YID A;  3ZMV A;  1Q3E A;  5CA1 B;  4JAS A;  2ZE6 A;  3JD3 A;  1DF4 A;  3J81 N;  5JH7 B;  4GZR B;  2UUC B;  4NYK A;  2QR4 A;  2MK3 A;  5KHH A;  2F23 A;  1PNL A;  4JYA B;  3RFR A;  1SA0 A;  1VQ7 V;  2LP7 A;  5H6R A;  3AG3 B;  5DN6 G;  3OE7 G;  2A9H A;  4TQD A;  5JJN B;  2O57 A;  5LMU O;  2OCC B;  1K5Q A;  4I7Z B;  4BWA A;  1BT8 A;  1V9P A;  1NTK H;  2ZM6 O;  1SZT A;  1BGY H;  1VQO V;  4H0L B;  5JVD B;  3JAM N;  2ZIN A;  3E8B A;  2AGA A;  1T5E A;  2ADQ B;  1KUQ A;  1NI8 A;  1HDJ A;  1J5E O;  2R9I A;  4FZ0 A;  4Q20 A;  4JPR A;  1R1B A;  1RP3 B;  3MHH C;  1FXK B;  2DYR B;  5LA6 A;  4DV6 B;  5LHG A;  5IJ9 B;  3AG1 C;  1M93 A;  1IBM B;  2ETN A;  4LH7 A;  2QWN B;  2BSK B;  1FFX A;  1WA8 A;  4CC6 A;  3QO8 A;  4DUZ B;  1AJP A;  3ZHU A;  4B3S O;  1ARO P;  4PDV A;  5C8Y A;  3HKC A;  5LP6 A;  1TVK A;  2QSA A;  4DW0 A;  4JV5 O;  3GWO A;  1XIL A;  2IU3 A;  3JD4 A;  3STZ C;  3N2G B;  4YY3 B;  3OTO O;  1YF2 A;  2DOS A;  2F4V O;  1OCZ C;  1F7Y A;  3L72 H;  3STL C;  4LF7 O;  3UT5 B;  1JFF A;  5BY1 A;  1KBH A;  1B04 A;  4DV5 B;  1L0N H;  1M90 W;  1OJH A;  2EZO A;  2E5L B;  5E1A C;  1KC8 W;  1M57 C;  5KAF Z;  5GON A;  1XOU A;  1N36 B;  4OPH A;  4O4H B;  3W7T A;  2KG7 B;  3C3S A;  2JJ1 G;  4MVU A;  2LO1 A;  1RM1 C;  4EB6 A;  5CMU A;  2NNU A;  2UUC O;  3CRA A;  1DGS A;  1NJI W;  3CRM A;  1K3E A;  2OT5 A;  4JYA O;  3OMN B;  3ASN C;  4DXW A;  2N74 A;  1WNS A;  4E4E A;  1G8M A;  2QWQ B;  4RAI A;  3K5N A;  3LNN A;  1Z5W A;  5IDJ A;  1AI7 A;  1FYJ A;  3SDL A;  2Q69 A;  2A0L A;  4ZOL A;  3OEH G;  2BTO A;  4JYB A;  1JQ0 A;  4PEL A;  3ZMS A;  2F93 B;  1HNZ B;  2FTK A;  3OW2 U;  3CEI A;  4N23 A;  4O4L B;  4CH5 A;  2KKW A;  2DN9 A;  3BCC H;  4FVM A;  3FAV A;  1K33 A;  3X2Q C;  1DLB A;  4D7S A;  3WB2 A;  1K5S A;  4TOI A;  4CH6 A;  2QTS A;  5B66 Z;  3JAT A;  3SPG A;  4F6R B;  4R50 A;  1F4M A;  2D2C B;  1KKC A;  4U3F H;  2HLD G;  4FLZ A;  2WLJ A;  2YIC A;  4I9W A;  4FLU A;  5B1A C;  3L70 H;  1N32 B;  5J9P C;  5IJ0 A;  2Q68 A;  1QLE B;  3CB2 A;  4DUZ O;  4MS2 A;  4UV8 A;  1AP6 A;  3PN1 A;  5L3F A;  3BY6 A;  2R72 A;  4DR1 B;  5KAI Z;  4YY3 O;  3RYH A;  3VQV A;  3JCU Z;  4L8J A;  2UUB O;  3CCR V;  4GX2 A;  1EZJ A;  3EHB B;  2L6L A;  1XUQ A;  4JI7 B;  4DV5 O;  4FFB A;  3BHP A;  2PYL A;  1XL4 A;  2HFE C;  4K3A A;  4B3T B;  1OCO B;  1TA8 A;  4MW8 A;  1Q6H A;  1E79 G;  1YXB A;  4I50 A;  1P4R A;  4O4J B;  1L0L H;  4GLX A;  1N36 O;  3P30 A;  3QTC A;  5DEC A;  4LF5 O;  3JAK B;  3JSL A;  3CX5 F;  1KD1 W;  3W7X A;  4PDR A;  4OX9 B;  1PV0 A;  3CRR A;  4GUN A;  2YXH A;  2ITC C;  2B1I A;  1JJO A;  2UXD B;  3E8F A;  1GM7 A;  2JGD A;  4F4L A;  2UXN A;  4JGS A;  3UM7 A;  1K9M W;  1Y4M A;  2DE0 X;  4AIL C;  2EIM B;  4X62 B;  4X20 A;  3L74 H;  3ETG A;  5KX5 A;  2EJ7 A;  2HKO A;  4I5S A;  1Q86 W;  1H38 A;  1HNZ O;  4TUY A;  2LGW A;  1M1K W;  1D5N A;  3ZRX A;  4O2A B;  2GDS A;  1AP5 A;  4QPJ A;  3LSS A;  1YCI A;  1RSO A;  1I0H A;  3TXS A;  4YIP A;  1KP2 A;  4MTF A;  3D36 C;  2QE7 G;  1AVM A;  4R8C A;  1NR1 A;  3MAQ A;  1TUB B;  5LXT B;  2GUZ A;  1HR0 B;  2JEX A;  4QJF B;  5BR8 B;  4YXW G;  5H9C A;  2HP8 A;  2Z5U A;  3WG7 B;  1ZL8 A;  1TUE B;  1XEQ A;  3SGI A;  5B5E Z;  4WFH A;  2W6J G;  3OEE G;  1V55 B;  1WLE A;  4BW5 A;  2YUA A;  1Y67 A;  3B2E E;  4H13 B;  3ZIA G;  4DR1 O;  2YC0 A;  4LWS A;  1SS3 A;  3DXR A;  4XDK A;  4DV2 B;  1FXV A;  1OCR C;  4J9Z B;  1GM8 A;  4RQF A;  1BQ0 A;  2W0X A;  1VEW A;  5IWA O;  4IHJ A;  4MVM A;  3CP1 A;  4JI7 O;  1FJG B;  4B3T O;  1UPG A;  2ZDI A;  2YI8 A;  3J80 N;  5JQG A;  3ASO C;  4PI0 A;  1NS1 A;  4DW1 A;  2YSU B;  2B5U A;  3M8A A;  3ABL B;  2XAG A;  3AG3 C;  5J2U A;  5EBL C;  4UXN A;  5KHK A;  3FB6 C;  3AG2 B;  4ASU G;  2UUA B;  4OX9 O;  3IC7 A;  1SES A;  4I4T B;  2B9Z A;  2EUL A;  2UXD O;  3APO A;  4FLY A;  2GBO A;  4KHP B;  2X6C A;  1R6N A;  4YJ3 A;  5EBW C;  2P22 C;  3TK1 A;  1TAE A;  3T1Y B;  1FFT B;  5B1O A;  1ZUQ A;  4ZI7 A;  4TQF A;  2PYJ A;  2AZ0 A;  1S5H C;  1GTO A;  4X1K A;  2P06 A;  4DV3 B;  3RT3 C;  4CH3 A;  4DO2 A;  4DK1 A;  1L1F A;  1N0J A;  1FXK C;  4ABM A;  5EZY A;  5B3S B;  1KQS U;  4YHH B;  4X64 B;  2PGG A;  4NKG B;  3K58 A;  4WFB V;  1P7B A;  3A8T A;  1V54 B;  1KKD A;  3E22 A;  2OCH A;  3CE2 A;  2BE3 A;  2X7R B;  1XQ8 A;  3P3N A;  4X1I A;  3Q4H A;  2Y4U A;  4P2Z A;  1J95 A;  1URF A;  4GKK B;  5L3D A;  4O4I A;  1COW G;  1K7D A;  2NR5 A;  5LOV A;  1HR0 O;  2XAJ A;  4CZZ A;  5BR8 O;  1CXZ B;  1BS3 A;  2YXY A;  4Q6G A;  5JWP A;  3ZJZ A;  4AQY B;  1WPX A;  4JI1 B;  3QO7 A;  3RYI A;  3QG5 A;  3ZHT A;  3LSU A;  2K9P A;  2WLI B;  4LP8 A;  2OIE A;  1IZ3 A;  5LGT A;  1RFY A;  3EFF K;  2Y0P A;  3R66 A;  3HPL C;  2EJR A;  4JAV A;  3SJQ C;  4B7E A;  2PI5 A;  2WLL A;  4DV2 O;  5L3G A;  3RYC B;  1Y74 B;  1FAF A;  2QKA A;  3RYF A;  3LDE A;  5GTH Z;  3GB7 C;  4EFB A;  4XBF A;  5GW7 A;  1R3L C;  4PDM A;  2BOB C;  1FJG O;  4LF9 B;  4IGG A;  4MVS A;  5LP6 B;  1Y66 A;  3A0H Z;  3AG4 B;  3IAY A;  3T1C A;  4H33 A;  5JJE B;  3F7V C;  3FB5 C;  3E35 A;  4HAM A;  1JMK C;  2LGQ A;  2VS0 A;  4X1Y B;  1CPY A;  4U3J A;  4WFG A;  3BAA A;  4IYH A;  4X89 A;  4YJ2 A;  3JAW A;  2K1E A;  3N27 A;  1QQC A;  3LNM B;  3VOU A;  1WN7 A;  2CH7 A;  2UUA O;  1AR4 A;  2P90 A;  1SER A;  1B06 A;  4LF4 B;  1BHB A;  3MDS A;  1I94 B;  1X4T A;  5GON B;  4KHP O;  5H5N A;  1SQQ H;  1JOY A;  4MT8 A;  3ML0 A;  3T1Y O;  5ITZ B;  3C90 A;  3CSX A;  4QNH B;  2IJK A;  2VQE O;  4DV3 O;  1B3Q A;  4NTX A;  4P9P A;  3UQ8 A;  4KP4 A;  2QEX V;  4LNU A;  1YTF D;  4K8Z A;  4LF6 B;  1H2G A;  4YHH O;  4X64 O;  1GMG A;  2PTM A;  3CJH A;  3OTF A;  2ZE7 A;  5CB4 B;  2H8P C;  5IYZ A;  4ZOL B;  3ZMT A;  4PA7 A;  1QLE C;  2QM8 A;  1YIT V;  1U96 A;  1VQ6 V;  1QCE A;  4GKK O;  1OCC B;  3JAL B;  4FM2 A;  3WU2 Z;  2KQX A;  1D5A A;  4RUE A;  1VQP V;  4R7C A;  2Q67 A;  4XDL A;  1HNX B;  2H3O A;  4TT3 G;  3OAA G;  4AQY O;  1PD3 A;  1QVF U;  4JI1 O;  1WB8 A;  1L8D A;  1BL8 A;  3SJB C;  1BCC H;  3JYC A;  3ZHV A;  5J2T A;  1OCO C;  3S3X A;  3ZHQ A;  1KU9 A;  2HG5 C;  2YIA A;  2A7W A;  2ATK C;  1GRJ A;  3HKD B;  1F4N A;  3JAR B;  3K04 A;  1K92 A;  5EC2 C;  4DYL A;  4TV9 A;  4TV8 A;  3NXS A;  4LF9 O;  2A3Q A;  2ARH A;  3TGU H;  3SYP A;  4O2B A;  1NT2 B;  5B1B B;  2DWD C;  1PPJ H;  3T4D A;  1IUR A;  4BAY A;  2ZE8 A;  4X8A A;  2ZKO A;  1D2D A;  4MTG A;  1OHH G;  3AK2 A;  2Q6A A;  3K57 A;  2ZE5 A;  2ZQM A;  3VQW A;  3ABK B;  5EYP A;  2KSD A;  3CPW U;  4QE7 A;  1Y76 B;  2IU0 A;  4LF4 O;  3H1L H;  3ZS8 C;  2XHB A;  2CTQ A;  3SYC A;  1EBO A;  1I94 O;  4GX5 A;  4JI6 B;  4JI0 B;  4PHZ A;  4P9O A;  2V1D A;  1N34 B;  3ETQ A;  1PP9 H;  2EIN B;  3U0Z A;  3CD6 V;  2VQF B;  2AW9 A;  4J10 A;  1OZ0 A;  3W7S A;  4DR7 B;  3BEH A;  2Q7H A;  1QR9 A;  3JD1 A;  3M99 B;  4ZHQ A;  1S77 D;  4LFA B;  1DF5 A;  3D3I A;  3O9O A;  2F43 G;  4LF6 O;  3BPZ A;  1SQV H;  3RVZ A;  3ZHS A;  3ZRV A;  2Q9L A;  1QU7 A;  5A9G A;  5FPR A;  2F1M A;  5CA0 A;  3CCS V;  3H01 A;  4RO2 A;  2UUB B;  4GT1 A;  3I55 V;  1V55 C;  3WFV A;  4B3M B;  2QA4 V;  4GYC B;  2EX3 A;  3K3W A;  4L87 A;  2JVD A;  4ZIB A;  1QBZ A;  1WB7 A;  4HNA B;  3CC2 V;  2JRI A;  3G80 A;  2P7T C;  4FFK A;  5BMV B;  3CCV V;  1HNX O;  1AJQ A;  4J9Y B;  3CCE V;  1I5X A;  1PL4 A;  3RWR D;  3SYO A;  3SR2 C;  4H44 B;  2IH1 C;  4UFZ A;  4K8X A;  1XNR B;  2PF4 E;  2GTA A;  3GWK C;  4LF5 B;  4PD4 F;  3B40 A;  2DMX A;  4EFE A;  4J42 A;  1S5J A;  1XL6 A;  4PDL A;  1FKA O;  1BQZ A;  2E3C A;  2P4K A;  1AI5 A;  1ZL8 B;  4RUF A;  4J11 A;  2IJJ A;  3ABL C;  1N4C A;  4I55 B;  5FNV B;  2ZR2 A;  3K5M A;  2ZIM A;  4BIZ A;  3AG2 C;  5KA5 A;  2OIG A;  1KYO F;  3D36 A;  5IYC O;  1M5I A;  4DR4 B;  3H1I H;  3K9S A;  4MVQ A;  5CBG A;  1IVS A;  3K5L A;  2PI4 A;  4FZ1 A;  3B4S A;  4DRX B;  1XHX A;  2YXL A;  1KMI Z;  3MHS C;  4I0X A;  3ZMU A;  2CGO A;  4BIO A;  1VMG A;  4WBN A;  2UXX A;  5JQG B;  1IXB A;  1GKF A;  4JI6 O;  4JI0 O;  5B3S C;  3CRQ A;  2YEV A;  3C3T A;  3ZBH A;  1Q82 W;  2Z0A A;  2ZNI A;  1YEW A;  5FPO A;  5KA6 A;  1HNW B;  1N34 O;  2E76 B;  4PJ0 Z;  2VQF O;  1V54 C;  3KCX A;  4DR7 O;  4CC5 A;  5LHH A;  4P30 A;  4JZ2 A;  5FLX N;  4LFA O;  1NBM G;  2PZS A;  1ZAU A;  2JIZ G;  5CA1 A;  3S3W A;  1QVG U;  3CHX A;  1WAZ A;  1NZ6 A;  1VQ8 V;  5JH7 A;  5E79 Z;  2R9A A;  2AHY A;  4CH4 A;  3LUT B;  4X1K B;  3G4S V;  5EC1 C;  5IT9 N;  1TGO A;  5IWA B;  4B3M O;  4G2K A;  1EFR G;  2Y69 B;  4NXN B;  3DSQ A;  4FIP C;  3R65 A;  2CAZ C;  4FMT A;  4XDJ A;  2LQT A;  1WPB A;  2A79 B;  2EIK B;  2Q0A A;  2GTS A;  1PL0 A;  1NH2 B;  2RMK B;  1XNR O;  3TET A;  4UVC A;  4DR5 B;  5JVD A;  1VF7 A;  1X59 A;  1LUV A;  3JAS B;  1EM1 A;  4JI2 B;  2BCC H;  1WP7 A;  4LF8 O;  1JPX A;  3CCQ V;  2N04 A;  1FXK A;  1VF5 B;  2Q0O C;  5KMG B;  1IBL B;  5IJ9 A;  4ZKI A;  3N2K A;  1GH6 A;  1GAX A;  3BRC A;  2WLH A;  1AIL A;  4FM1 A;  2CTR A;  4DR4 O;  4NB5 A;  1SQX H;  2CUG A;  1GN4 A;  2DJV A;  1NQT A;  2AZ2 A;  3FX7 A;  3G67 A;  3N2G A;  3DTU B;  1US6 A;  1QHT A;  2BOC C;  3UT5 A;  1BMF G;  5DED A;  2JS3 A;  2IM9 A;  4E2L A;  4U3J B;  1HNW O;  2LW7 A;  3JAW B;  3W7U A;  1R6K A;  2UXC B;  4YIO A;  5HFM A;  4ICG A;  1EN4 A;  1Q81 W;  3SPJ A;  1LR1 A;  2DQ0 A;  3HKB B;  1OCC C;  1MNG A;  5LGN A;  3K59 A;  4O4H A;  1IXM A;  2N05 A;  3ZRW B;  1Z5V A;  3G6B A;  4KXR A;  1MAB G;  1Q7Y W;  3ZX6 A;  5DM6 V;  1VQ5 V;  1IBK B;  1S76 D;  1NKD A;  1SF9 A;  1OCZ B;  2QKS A;  5GTI Z;  2CK3 G;  3A2F A;  2NN4 A;  1YTF B;  4NXN O;  5LYJ B;  1W0K G;  3FYE B;  1XHZ A;  2ODM A;  5D5Q A;  3ABU A;  1GM9 A;  3LSQ A;  4GCZ A;  2WAM A;  2UU9 B;  5KUK A;  4IIJ B;  2ZXW B;  1NVP D;  3LDD A;  4O4L A;  4DR5 O;  4NTW A;  1QLN A;  4G27 B;  1YI2 V;  2W0F C;  2HVK C;  2QDO A;  1WP8 A;  3O65 A;  1RM1 B;  1EZV H;  4BW9 A;  4JI2 O;  3OMI B;  2OWO A;  4PA9 A;  5B1B C;  2OCC C;  4MVR A;  1AJN A;  2EIL B;  1OV9 A;  1YJ9 V;  1XRE A;  2OTL V;  4WF9 V;  2XUM A;  3QO5 A;  3CCU V;  1IBL O;  4GKJ B;  3ABK C;  4OGQ B;  1SRY A;  3K79 A;  4U7O A;  1GO3 F;  5IE9 A;  4F6E A;  4Z1M G;  2RN9 A;  2VQE B;  3FB7 C;  3BAB A;  1VIB A;  1XMQ B;  3KCY A;  2DYR C;  5EIB C;  1VQL V;  1N0N A;  1SA0 B;  1GK9 A;  4HYO A;  2HJD A;  2EIN C;  4FLV A;  4TV8 B;  2OYQ A;  2R70 A;  2QJ1 A;  4N21 A;  4J41 A;  3SPC A;  3OGI B;  1JR9 A;  4JI4 B;  2GHY A;  1RPR A;  2PUS A;  4KFM A;  3BFR A;  3H1H H;  4J80 A;  1JJ2 U;  1H2L A;  3VBB A;  1MMM A;  3LDC A;  2WSS G;  1VQ9 V;  3U10 A;  2UXC O;  4O4J A;  3OD4 A;  2PY5 A;  1S5L Z;  5B1A B;  3B8N A;  1E1R G;  4DR6 B;  4NXM B;  1S3J A;  1P84 F;  1ZSP A;  1YDX A;  2HR3 A;  2EZP A;  1AI4 A;  1ZX3 A;  3QNE A;  3JAK A;  4KL1 A;  2ZIO A;  1XNQ B;  5LA6 B;  2IBZ H;  5KLV H;  1K8A W;  2JGU A;  4JZG A;  3MD0 A;  1IBK O;  5L3C A;  3KG2 A;  2WA3 A;  3HKE A;  1FFX B;  1CP9 A;  2LFS A;  3JCZ A;  3IJ4 A;  1WA8 B;  4DV0 B;  4DV4 B;  2OTJ V;  5H6Q A;  1JVM A;  5C8Y B;  3HKC B;  5IYB O;  1TVK B;  4K0K B;  4MVZ A;  1Q5O A;  3BA9 A;  1BZK A;  2UU9 O;  4X66 O;  1P7G A;  3T1H O;  2MW2 B;  1JFF B;  3TXQ A;  5KHI A;  5D5P A;  4HBN A;  2JS5 A;  4TWK A;  2ZT9 B;  1Q6I A;  3QF7 A;  4WFE A;  1YJN V;  3NR7 A;  4DV7 B;  1XMO B;  1TUB A;  5LXT A;  4PI2 A;  4GKJ O;  1VP7 A;  4LFB B;  3ICX A;  5F2V O;  3D8C A;  2LFR A;  1KEC A;  3ETD A;  2C2A A;  3DC6 A;  3E8H A;  4EB6 B;  5LBQ A;  1O9H A;  3WB0 A;  1XMQ O;  1FPO A;  2M7W A;  2GSM B;  4G28 B;  3A0R A;  1MG1 A;  1H2N A;  4UCV A;  3G71 V;  3ZN0 A;  3K9A A;  3FYI B;  1VQM V;  4UCT A;  1FD9 A;  4J7Z A;  4JI4 O;  2WWW A;  4FPP A;  3L71 H;  1SC5 B;  1SQG A;  4FK5 C;  4QGP A;  3HR0 A;  4X88 A;  2QWR B;  4C7U A;  3TJT A;  2X6B A;  1MSW D;  3FAV B;  3OGC C;  4D6T H;  1AB3 A;  4DR6 O;  4NXM O;  2YIB A;  3F5W C;  3K03 A;  4I9Q A;  1G4Y B;  2Z3Y A;  3AG7 A;  3UCS C;  4LH6 A;  3AK1 A;  2RCV A;  3JAT B;  1ZTE A;  2CGN A;  2Y69 C;  3JD0 A;  4JTC B;  3FKS G;  2Y4T A;  1UFI A;  2CDY A;  1XNQ O;  4B7K A;  1GN2 A;  1N33 O;  3I56 V;  4I4T A;  2EIK C;  2ZR3 A;  3ZHR A;  4JI5 O;  5K1X A;  2WLM A;  4UCS A;  5IJ0 B;  4DV0 O;  4DV4 O;  1ENV A;  3I5D A;  4LR3 A;  2JDI G;  5KUM A;  2LJ2 A;  5JJJ B;  2UXB B;  2R9R B;  4K0K O;  1M56 B;  3RVY A;  4WFA V;  4UCR A;  1K4D C;  5IYD O;  3RYH B;  3T2M A;  3SYQ A;  2Q73 A;  4DK0 A;  3E2E A;  3J7A U;  2P4V A;  3ASO B;  2YI9 A;  3BVO A;  4FFB B;  2EIM C;  3P32 A;  2EBO A;  2IJH A;  4JAU A;  3ABM B;  4I50 B;  5A2Q N;  4DV7 O;  1XMO O;  1VF6 C;  1Z2G A;  3A0B Z;  3CCL V;  4LFB O;  3F7Y C;  4EEQ A;  2WLN A;  3CCM V;  3EVK A;  4NTY A;  2KB1 A;  2XAF A;  2P6J A;  4EKW A;  3CME V;  2CTP A;  3CWB H;  3UKM A;  4CBC A;  4CS4 A;  4WFF A;  1I08 A;  1QNM A;  1NR7 A;  2WLI A;  3OM3 B;  1PM9 A;  2JGD B;  5B1N A;  1SZX A;  1K97 A;  1Q43 A;  3N2K B;  3WG7 C;  1VAR A;  4H37 A;  3RYC A;  4X20 B;  1Y74 A;  2P5O A;  3K5O A;  2W6I G;  1CEZ A;  5KX5 B;  3CCJ V;  2A06 H;  2X0L A;  2DYS B;  4TUY B;  4RWU A;  4NR1 A;  3APQ A;  4BIU A;  5CBH A;  1ZWI C;  1W0J G;  1RSO B;  4DV1 B;  2VWK A;  4X1Y A;  4W4K A;  4DR2 B;  3QVN A;  1PNK A;  2FKX A;  4U7N A;  3ZED A;  4JI8 B;  2NLJ C;  2GUZ B;  4B3R B;  1F51 A;  3CS5 A;  1YVW A;  1JA8 A;  2ZCE A;  1ROP A;  2B1G A;  2WPD G;  1KB9 F;  3UO2 A;  4LF8 B;  4BR6 A;  5BXZ A;  2QGN A;  3CXC U;  2ZXW C;  4PV1 B;  4FM0 A;  5ITZ A;  2XT9 A;  2UXB O;  2ITD C;  3W7W A;  4IT5 A;  2Y48 A;  4LWS B;  3RW0 A;  1XDC A;  2EIL C;  1R3J C;  2BTQ A;  3WB1 A;  3DXR B;  4MW3 A;  5JCO C;  2WA4 A;  4FLW A;  1LUW A;  2YDE A;  1S0V A;  4IHJ B;  5IY5 B;  5CB4 A;  1SQF A;  4NVP A;  3ABT A;  4LCU C;  1Y6X A;  3L9D A;  3IC9 A;  1DK1 A;  3JAL A;  3VQY A;  2FL4 A;  1B6Q A;  2QWO B;  4JYC A;  1IDS A;  1NVP B;  2AHZ A;  5J2U B;  2RNB A;  5KHJ A;  3SJC C;  4PA6 A;  1G6U A;  2XOK G;  4QE9 A;  1H2K A;  4CS3 A;  1H2S B;  2EIJ B;  3ZMZ A;  1BE3 H;  2Q7E A;  1R73 A;  4YJ3 B;  4QPK A;  1NTM H;  4DV6 O;  4FJC C;  1U97 A;  3SYA A;  5LGU A;  4ZI7 B;  3RBZ A;  3HKD A;  1IBM O;  3JAR A;  3IFX A;  1YSC A;  3ZCC A;  3L73 H;  4MVO A;  5K1P A;  2P67 A;  5TIS Z;  5EZY B;  2XTA A;  1KP3 A;  4X65 B;  1Q8I A;  3FD9 A;  2XAH A;  5LMN B;  3D3Q A;  3OR6 C;  4PA4 A;  5C93 A;  4DV1 O;  3E22 B;  4AI8 A;  1M4U A;  2CE4 A;  4JI3 B;  2E75 B;  4X1I B;  3Q4H B;  4DR2 O;  3K0D A;  2Q5Z A;  4MTX A;  4O4I B;  1VQ4 V;  4JI8 O;  5LP6 C;  5CBF A;  3OR7 C;  1Y76 A;  3AG4 C;  4B3R O;  4LFC B;  5LOV B;  2E5L O;  4JAA A;  2V4D A;  2DQ3 A;  2Y0I A;  4GX0 A;  4IL6 Z;  5EIB D;  1NTZ H;  1YHQ V;  2RDC A;  3KKY A;  2VWJ A;  3RYI B;  1ORQ C;  1I7F A;  5AG2 A;  4PA3 A;  4FLX A;  1YIJ V;  2BSK A;  4UCO A;  2WLL B;  2RJZ A;  2E74 B;  3RYF B;  3JSN A;  3EXA A;  3HKE B;  3FFQ A;  4X9Q A;  4UB6 Z;  3ETE A;  3VQX A;  2GV9 A;  3FB8 C;  2H94 A;  1MOF A;  2F66 C;  2V7Q G;  3B09 A;  1W2B U;  2HHH B;  2IW5 A;  1N8R W;  1EN5 A;  4HNA A;  5H2F Z;  4W4L A;  4RQE A;  4YJ2 B;  3H1J H;  5BMV A;  2Q8V A;  4FLT A;  3AG1 B;  3OT7 A;  5L3B A;  2CH7 B;  3IGA C;  1K4C C;  1IX9 A;  1RPO A;  1SQP H;  2KG7 A;  3E86 A;  1BSM A;  3AEI A;  2LW1 A;  1Q6U A;  2HVJ C;  1ZLZ A;  3G6E V;  1FS0 G;  3CMA V;  1H8H G;  1YJW V;  2F95 B;  1N32 O;  4D7T A;  1F23 A;  2QM4 A;  1R3K C;  5FNV A;  4I55 A;  2ADP A;  4LNU B;  5BZB A;  1HW7 A;  4R6Z A;  2L35 A;  4X65 O;  3CC7 V;  5LMN O;  2HJF C;  4UB8 Z;  3CJH B;  5IYZ B;  1M57 B;  4JI3 O;  2X6A A;  4X66 B;  3B77 A;  1S72 V;  4DRX A;  3T1H B;  3U11 A;  1JX9 A;  1G1X B;  2QTO A;  3BA8 A;  1R3I C;  4UUJ C;  4LBE C;  4QIW F;  5FL7 G;  1M56 C;  4LFC O;  3P3P A;  3ZN1 A;  1H2M A;  2QM7 A;  2DW4 A;  3RGB A;  4LC1 A;  3UO3 A;  4F6R A;  3OUF A;  3ZRS A;  4B08 A;  2IJI A;  3JD2 A;  1MZF A;  3ASN B;  2FML A;  3E83 A;  5J2T B;  3PJS K;  3K06 A;  1LNQ A;  4JTA B;  3ABM C;  1K73 W;  1W59 A;  1K34 A;  5KHG A;  4MTO A;  5EK0 A;  3OMA B;  1WJZ A;  4TV9 B;  3OFN G;  1A32 A;  1GN3 A;  2D3O W;  4TSF G;  1HWY A;  1MZE A;  5L3E A;  4JF3 A;  4X62 O;  2AXT Z;  2FYU H;  3X2Q B;  4GX1 A;  2ZD9 A;  4O2B B;  1XI1 A;  2JJ2 G;  4DR3 B;  4ZBM A;  3E89 A;  3AK3 A;  3T4Z A;  2HHH O;  4UVB A;  1GN6 A;  3HB3 B;  1BHA A;  4HZ3 A;  1O9G A;  1AR1 B;  5EYP B;  1NH2 D;  1SET A;  4UCU A;  3H9V A;  4DUY B;  1YZB A;  1I5Y A;  2ILM A;  2DYS C;  4MSW C;  3CRC A;  3JAS A;  1H8E G;  1N33 B;  1SQB H;  1AI6 A;  3CC4 V;  4JI5 B;  2Q4P A;  3E8G A;  4ZHQ B;  1PNM A;  5KMG A;  3CYO A;  4J7J A;  2ZNJ A;  2QKC A;  2Q7G A;  2RQ6 A;  1MSD A;  3H1K H;  5HFL A;  5CA3 A;  1R6T A;  1VQN V;  3SPI A;  2XAS A;  3DC5 A;  5CA0 B;  4Z2W A;  1THZ A;  1VF6 A;  5LL6 Y;  1Q90 D;  2DWE C;  1E1Q G;  3OUS A;  2QWP B;  4IYI A;  5CN0 A;  4O2A A;  1SKV A;  4UVA A;  2FB5 A;  1QR8 A;  5LMU B;  3B8M A;  2CTW A;  2VRZ A;  2ZM6 B;  2XND G;  5IY5 C;  3SJA C;  3GVM A;  1P49 A;  1J5E B;  2ZDI C;  2G38 A;  3HKB A;  3TCU A;  1XBL A;  3L75 H;  3ZRW A;  3THO A; 
#chains in the Genus database with same CATH homology
 2DMX A;  1HDJ A;  4J80 A;  2CTP A;  2CTW A;  2GUZ B;  1BQZ A;  2QWO B;  3AG7 A;  3UCS C;  4RWU A;  2YUA A;  1GH6 A;  3BVO A;  2N05 A;  3APQ A;  3APO A;  1FAF A;  2QSA A;  2CTQ A;  2YS8 A;  4J7Z A;  3UO3 A;  2DN9 A;  2Y4T A;  1WJZ A;  3UO2 A;  2QWP B;  2L6L A;  2M6Y A;  2QWQ B;  2EJ7 A;  2CTR A;  1N4C A;  1IUR A;  2OCH A;  2GUZ A;  2QWR B;  2PF4 E;  2LGW A;  2KQX A;  1FPO A;  1BQ0 A;  2CUG A;  2N04 A;  2Y4U A;  4IT5 A;  1XBL A;  2LO1 A;  1NZ6 A;  2QWN B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...