1BQZA

J-domain (residues 1-77) of the escherichia coli n-terminal fragment (residues 1-78) of the molecular chaperone dnaj, nmr, 20 structures
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
77
structure length
77
Chain Sequence
AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDSQKRAAYDQYGHAAFEQGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The influence of C-terminal extension on the structure of the "J-domain" in E. coli DnaJ.
pubmed rcsb
source organism Escherichia coli
molecule tags Chaperone
molecule keywords DNAJ
total genus 11
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 1998-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 1bqzA00
1NZ6A 2DN9A 2YS8A 1IURA 2GUZA 4RWUA 2CTPA 3AG7A 2QWQB 4IT5A 1FAFA 2QWOB 1N4CA 1GH6A 2CTQA 3BVOA 2DMXA 1BQZA 2Y4TA 2CUGA 3UO3A 4J7ZA 2OCHA 2Y4UA 1HDJA 4J80A 2QWNB 2QSAA 1XBLA 2QWRB 1BQ0A 2QWPB 2GUZB 2YUAA 2EJ7A 2M6YA 2PF4E 2KQXA 3APOA 1WJZA 1FPOA 2N05A 2LGWA 2CTWA 2LO1A 3APQA 2N04A 3UO2A 3UCSC 2CTRA 2L6LA
chains in the Genus database with same CATH superfamily
3ABLB 1N33O 1P7BA 2QEXV 2EX3A 3SPCA 2PY5A 3BRCA 1YI2V 4J11A 1GMGA 4UCSA 3B8NA 5DEDA 3DC6A 1QHTA 1QVGU 1PKXA 2KG7B 2QM7A 5J9PC 4FM1A 1I7FA 1XILA 4D7SA 4TOIA 4B3TO 4X20B 3CMEV 3MDSA 3RYIA 2IH1C 4UV9A 1QLNA 3SDLA 2EIKB 3HB3B 4OGQB 3H9VA 3CRAA 5JVDB 1VQLV 2HKOA 4EKWA 2NLJC 2GTAA 4HYOA 2Q8VA 2IU3A 2V7QG 5KUKA 1Z2GA 2F95B 3CB2A 1I08A 3HKEB 1PV0A 5GONB 2NR5A 1AI4A 5GTIZ 5HFMA 2GDSA 4PDLA 4BIZA 2YICA 4JTDB 4PA3A 1JMKC 4DR3B 4GX0A 4J80A 3MHSC 1D2DA 1WP8A 4TT3G 3LNMB 1L0LH 1EZVH 4CH6A 1TA8A 3P3NA 3RGBA 1Q3EA 3N27A 2UXDB 4RQEA 1K97A 5BMVB 3SGIA 1SZXA 1GN3A 2MW2B 1FFTB 3WG7B 2VQFO 1SQGA 3LDDA 4X64O 3BPZA 2QSAA 4U3FH 2XOKG 4LF8B 3JD0A 2JGUA 1R3LC 1NS1A 1FXKB 3RYCA 2X6CA 4DUZB 2BE3A 1FJGO 3UO2A 3OD4A 2XNDG 1W59A 1KU9A 4TWKA 4RWUA 4WFGA 3E8GA 3CE2A 1Y6XA 1R6TA 2E75B 4DR6B 5IE9A 5LBQA 3TGUH 2P7TC 1E1QG 4JTCB 2OCHA 4QPJA 1BQ0A 4JI7B 3W7SA 5KHHA 2ZKOA 3CCJV 1N34O 2AHZA 5B1NA 3ZEDA 1J5EO 5JCOC 2XAFA 1NQTA 5LL6Y 1G4YB 4MVRA 4LFBO 2XASA 3SJAC 3B2EE 3R66A 2ZDIC 4X65B 2VS0A 1OCRB 3CSXA 2YUAA 4OX9B 1ZUQA 3L72H 3QO8A 1Q86W 3MHHC 2JEXA 3ZHUA 5DM6V 5LHHA 1VQ5V 3M99B 1H2MA 2HLDG 5CBGA 2RCVA 3FB8C 5CA1B 3JARA 4J10A 2YEVB 1F51A 1F4NA 4I50A 1TVKB 1GTOA 3K5NA 5DN6G 3EXAA 1N32B 4WCEV 1BHBA 3JYCA 5JQGB 2ZR2A 5BXZA 4H13B 2Z5UA 2F4VO 1XMQO 2AXTZ 2DWDC 4HNAB 1JPXA 5KA5A 4JI0O 5LP6C 3FFQA 3RT3C 1K73W 2W0XA 4LF5B 1O9HA 3E8BA 1NR1A 3ZRXA 2N74A 1M56C 1FPOA 4YY3B 1QBZA 4LP8A 4LH7A 1RPRA 3CD6V 4R7CA 2N04A 3CYOA 1S77D 2A06H 2KG7A 3JASB 4UUJC 5LYJB 1RSOB 4JI6B 4J9ZB 4WBNA 4MT8A 5LXTB 5CBHA 1D5NA 2HVJC 1MOFA 3MD0A 1H2LA 1G1XB 4JI3O 2UXCB 1R73A 2L6LA 4ZI7B 1JCHA 4DXWA 1IXBA 4DV2B 2LP7A 5LMNB 2BOCC 1S5JA 4JYCA 1QVFU 2BOBC 3ZRSA 4DV6O 3CMAV 2UUAB 3Q4HB 4ZIBA 3OUSA 1SQXH 4UCRA 3L70H 1FXVA 3SPIA 3STLC 5IY5C 5KA6A 4P2ZA 1URFA 4O4IB 4WFFA 1NZ6A 3CRRA 4DO2A 2FYUH 4H37A 4JPRA 4UXNA 1K34A 2EILC 3JAKA 4PI0A 4X1KB 5KAFZ 5KHJA 3OFNG 4H0LB 1EN5A 2OIEA 4TUYB 3JD3A 3QO5A 1V9PA 4H44B 1RSOA 4UVBA 4WBNB 4PA6A 1JA8A 5JJNB 3W7TA 1R3KC 2RMKB 3GWOA 3LNNA 4NTYA 1QU7A 4AQYB 3OMNB 4B08A 4YHHB 1JQ0A 4LR3A 1AR1B 4DR4O 5B5EZ 4IL6Z 4GYCB 4DV4O 1XHXA 2YSUB 4DV0B 2HJDA 4DR1B 3AG3B 2ITCC 1X4TA 2ETNA 3E35A 1AJQA 1LR1A 3HKBA 4FLXA 5L3EA 1VQ8V 5IYZB 2KB1A 4IT5A 1YJNV 1N0JA 3A0BZ 2LW1A 4IIJB 1VEWA 1M4UA 1F4MA 5GW7A 3K59A 2NNUA 3D3IA 4JI4B 5EC1C 5IJ9A 1I94O 3D36C 4CZZA 4L8JA 4X62B 4WFBV 2ADPA 2P67A 1COWG 4B3RB 5JWPA 4GZRB 2P22C 4I4TA 5LA6B 1TUEB 4LF7B 1LUVA 1T5EA 3HPLC 3QNEA 4EEQA 5BR8B 3JARB 2WLJA 2JGDB 2W0FC 1EBOA 2ZE8A 3CRCA 3TETA 3U10A 4GKJB 2PGGA 4FK5C 3A2FA 5AG2A 3AK2A 1V55B 1WA8B 2RN9A 3E83A 2Q7GA 1HW7A 3OEHG 1TUBA 1OCOB 2Z3YA 3JD2A 3TXSA 4N21A 4TV8B 3QG5A 1IX9A 2QWRB 2V1DA 1GN2A 2CDYA 3AG3C 4A5UB 4PA4A 3OTOB 3HKDB 4I0XB 4I55A 1IVSA 2BCCH 3BVOA 1QLEC 2GV9A 1KYOF 3SYOA 3JATB 2QA4V 2UXXA 3UKMA 4DV7O 2YDEA 3STZC 2DE0X 2UXBO 3OUFA 3UM7A 2WLHA 4MVZA 3NXSA 1KQSU 3LDCA 2XT9A 3ETDA 3ABTA 2VWJA 1HWYA 5EYPB 5CB4B 1IBMO 4DUYO 1GAXA 4J9YB 2ZM6B 3K04A 4QPKA 3T4ZA 1U97A 3ABLC 3K03A 2OWOA 1TUBB 1K9MW 5FPOA 2YI8A 1IURA 2YS8A 3UT5B 1HNWB 3KCXA 1BSMA 5IJ0A 5IY5B 4JI1O 4X66O 2WLKA 4DV5O 4B3MO 1CEZA 2O57A 2EILB 3H1HH 4DR2O 2P6JA 1K7DA 3HKEA 4KFMA 1PNMA 5GONA 2CTRA 4TUYA 3R65A 1Y4MA 1M56B 1EN6A 4MTXA 3P32A 2H94A 3G6BA 3ZMVA 3CRQA 3AEIA 1IBKB 1YJWV 4LF7O 1P84F 4IHJA 1N8RW 2M6YA 4EB6B 4LFCB 3APOA 4WF9V 1ZX3A 2ZNJA 3T1CA 4JI5O 3SPGA 3ABUA 1QQCA 1XMOO 4DR7B 4F6RA 3CJHA 1XNQO 1P49A 4I5SA 1AI7A 1LUWA 1OV9A 1EM1A 4HZ3A 2BTQA 4MTOA 5LGTA 4FFBB 3FB7C 4IIJA 2MK3A 1F7YA 4K3AA 1Q6IA 4DK0A 5KHGA 3C90A 3LSQA 1R3JC 4E4EA 1TVKA 1GN6A 4O4LA 1AP6A 3K79A 4CS4A 3RBZA 4DV4B 2NN4A 3OMIB 2A7WA 1Y67A 4MVUA 2EJRA 2HP8A 4LNUB 4LFAB 1BS3A 5CA3A 1HNZB 2DQ0A 1BCCH 3AG1B 4GCZA 2LGQA 3RFRA 1X59A 1VQKV 1GKFA 1VF6A 3WB1A 3ZBHA 4WFAV 3OGIB 1H8EG 3M8AA 1DLBA 4UB6Z 2IW5A 5KHKA 3ZX6A 4FM0A 1FD9A 2Z0AA 4XDKA 1S76D 2Q5ZA 1WJZA 1U96A 4ZOLB 3K0DA 4O2AB 4RAIA 1R3IC 4JZGA 2ZDIA 4CH5A 2OCCB 5B1BB 5CA0A 4DYLA 3J7AU 2QR4A 1Y66A 1GH6A 1K5QA 2B1GA 3L74H 4CC6A 2R72A 4BW5A 3O65A 2LFSA 1J95A 1A32A 1JFFB 1KKCA 1HNZO 2JS5A 1S3JA 3X2QB 1L8DA 4LFAO 1KECA 1XL4A 4PDRA 3ZRVA 1FS0G 5K1XA 1PD3A 5IYDO 3ASNC 2WWWA 1ROPA 3HKCB 2V4DA 3H1IH 5FPRA 1PNLA 2JVDA 4NKGB 1YIJV 2JRIA 2PUSA 1QR9A 4DR2B 4YY3O 3BY6A 1MZFA 1ZSPA 3AG7A 2B1IA 4ASUG 4FZ0A 1SA0A 3E8HA 4ZOLA 4LF5O 4BW9A 2IH3C 1HNXB 2EIJB 2AZ0A 1DF5A 1XEQA 4E2LA 1P4RA 4JI0B 4QIWF 2ZE6A 1XNQB 4DR7O 1XMQB 3CRMA 1Q81W 3G6EV 1VQ6V 2PI4A 3RVZA 2AW9A 4JI5B 2XAHA 1OCZC 3IFXA 2IJIA 3DGEA 3JCZA 2YXYA 5EBMC 5KAIZ 3JALB 3FAVB 3HKBB 2EINB 1LNQA 2IJKA 3FYEB 2QTSA 3AG2B 3KZIZ 1BL8A 4Q20A 4FLVA 1S5LZ 5B1AC 1ZLZA 2UXBB 2DYRC 2Q0OC 3HR0A 3O9OA 4DV7B 2DYRB 1OJHA 5C93A 1H8HG 3E22B 3ZRWA 5IT9N 1NTMH 4W4KA 5L3GA 1MABG 2OYQA 4JI1B 4O4JB 2QKAA 4LFBB 1H2GA 4BR6A 4C7UA 2BTQB 4GT1A 2DJVA 2ZE7A 3K5LA 2JDIG 2ZIOA 3IC9A 2ATKC 1OCRC 4JI7O 1NTKH 2WA4A 5ITZB 2LW7A 4RQFA 2ZM6O 2E76B 2B9ZA 1Q82W 4HAMA 2A79B 5KLVH 5EIBD 5J2UB 2F66C 3GVMA 4LWSB 4PV1B 1KBHA 4K8ZA 4DUZO 4QGPA 2IBZH 5IYZA 3BA8A 1H2NA 4GX5A 1EZJA 5JCOA 1AJPA 4J7ZA 2XAJA 3OR7C 4YJ3B 1Q5OA 3KG2A 1G6UA 4B3RO 1NBMG 3OW2U 1AP5A 4UVCA 1SQFA 1I0HA 3FD9A 3OTOO 1I94B 1BMFG 5B1AB 3THOA 1ZL8A 2Q7EA 4OXSA 2LFRA 2QKCA 1FKAO 1HNXO 3E2EA 1XREA 1YVWA 2XHBA 1YDXA 4UCUA 4X1YB 2VRZA 3AG4B 4MW8A 2DYSB 2P06A 3ZHSA 3B09A 3TK1A 4JF3A 2DW4A 1CPYA 3ABMB 1Z5WA 2EZOA 1VARA 1YZBA 2YIAA 4GKJO 1K4CC 3B40A 3CXHF 3OMAB 4J7KA 4QE9A 4DR4B 1ZAUA 3CCEV 5BR8O 2Q6AA 3KCYA 3S3WA 4LBEC 1DF4A 3X2QC 2IU0A 4PDMA 4JTAB 1NI8A 2XAQA 2YC0A 3N2KB 1G8MA 5LXTA 5A9GA 1AROP 3M7MX 5FNVA 2R9RB 1FXHA 4JI4O 2QWQB 4I0XA 4I55B 4CBCA 2CTQA 3BFRA 3SYQA 1YTFB 3CHXA 1SZTA 1BE3H 3C3TA 1ZL8B 3JAWA 4TV9B 2EIJC 4DK1A 1NTZH 3H1KH 2BSKB 4DR1O 3BAAA 4DV0O 1SQBH 2D3OW 4G2KA 2DMXA 1RM1B 4PA9A 4ZHQB 3RYHA 3VQWA 4ZBMA 4YHHO 2X6BA 4IYHA 2DYSC 3QO7A 2PF4E 3CCVV 2E3CA 3ZCCA 4HNAA 2Q0AA 2LO1A 4MSWC 2DQ3A 5LGNA 4EFBA 1WAZA 1H2SB 3LDEA 5JVDA 4G27B 2FL4A 4MS2A 5CN0A 4JZ2A 2JJ2G 3IGAC 1XOUA 2F43G 1XBLA 3EFFK 2E5LO 4O4HA 1M90W 3ML0A 4JAUA 3ASNB 3U11A 2YIBA 4I9WA 1JVMA 1MG1A 5LYJA 5B1OA 5K1PA 2UUAO 4DV6B 3K9SA 2EULA 4GLXA 2CGNA 1XNRO 1VF5B 5LMNO 3OTFA 2PYJA 1JOYA 2DOSA 2Y48A 3EVKA 5L3DA 3B77A 4IYIA 2ITDC 3H1LH 3LSUA 1XMOB 4XDJA 4DV1O 2H8PC 2LGWA 1GM7A 5C8YB 4LFCO 4JI3B 1NT2B 1NR7A 1PM9A 2KKWA 1KC8W 5E79Z 2K1EA 2F23A 4FMTA 1IBKO 1EN4A 4DRXB 5IYBO 3T1HB 1XQ8A 3A8TA 2JEUA 1M57B 4O2AA 3FKSG 1D5AA 1NKDA 1YJ9V 2QWNB 2L35A 4MVOA 2AZ2A 5L3CA 2FKXA 2YXLA 4N23A 2XUMA 1Y74A 4EFEA 1JJOA 5E1AC 1MNGA 2IJHA 3G71V 1BT8A 1WNSA 1OCCC 2F1MA 3VQVA 4X1KA 5IJ9B 4YXWG 1BQZA 4B3MB 1OZ0A 4DV5B 2X7RB 4X66B 3ZHTA 2WLIB 2ODMA 4UFZA 4PI2A 1HNWO 3OR6C 4CS3A 1J5EB 5FL7G 2F4VB 1XUQA 1VQ9V 3TJTA 4DUYB 4I9QA 1IBMB 3EHBB 4DR6O 1N32O 4OPHA 5LMUB 1IZ3A 5DECA 4ICGA 2WA3A 4TV8A 4G28B 2B5UA 2P4VA 4YJ2A 2HEPA 3SYPA 3JAMN 2YI9A 2JS3A 2XTAA 3ZMSA 2QWOB 4X64B 4OX9O 2M7WA 4KHPO 1Y74B 1SQQH 4X65O 1SC5B 3CCMV 5JJJB 2LQTA 5EYPA 3T1YB 1M57C 3CCSV 2W6JG 3ABKC 3CP1A 3JCUZ 1UPGA 1CP9A 1V55C 2WSSG 5CBFA 1VQNV 1I5XA 3ZN0A 1SF9A 2QJ1A 5BY1A 1L1FA 1TGOA 4TV9A 5IYCO 1N34B 3BHPA 1YEWA 1DK1A 2GUZA 1DTOA 2VWKA 1PNKA 4FZ1A 2Y0IA 2WAMA 2Y4TA 3RYIB 1SESA 3C3SA 3K08A 2CGOA 3ZMZA 4U7NA 3CWBH 1V54B 1BHAA 4FLYA 2GSMB 3N2GA 3L71H 2ZE5A 5L3BA 3RYHB 2RQ6A 4U7OA 4KL1A 2GHYA 2FB5A 5KMGB 2GTSA 4DW1A 1YSCA 1BGYH 1VQMV 1L0NH 1FJGB 4TSFG 3VOUA 2EBOA 3ZHRA 3K0GA 2WLLA 4LF8O 4LCUC 3J81N 1XI1A 1E1RG 4NYKA 2G38A 4JYAB 3SYAA 2RNBA 4X62O 1Q7YW 2UXDO 5F2VO 1R6NA 4WFEA 2YIBD 4BWAA 3WB0A 4PJ0Z 1KMIZ 1RP3B 4FLZA 2CH7B 1NJIW 3BA9A 3UO3A 4NVPA 1VF7A 3W7UA 4QNHB 5B3SC 1SRYA 1PL4A 4XDLA 1M93A 4DR3O 4GUNA 3AK3A 3Q4HA 2GUZB 3LUTB 4FFBA 4JV5O 4YJ3A 1H2KA 1FXKA 3L73H 2QDOA 4D6TH 4EB6A 1K33A 2QGNA 3FB5C 1KD1W 5C8YA 1N36O 1Q90D 2RDCA 1Q8IA 2HJFC 2QM4A 2LJ2A 3ETEA 3AG2C 4NB5A 2Y4UA 4X1IA 3S3XA 2UUBB 4AQYO 4LH6A 5D5PA 3AK1A 4K8XA 5CMUA 3JSNA 4X20A 4AI8A 3VQXA 2CTWA 4B3TB 1KKDA 1YTFD 2Q68A 3ICXA 2JK5C 2FTKA 1TAEA 4RUFA 3K5MA 4FLUA 2PI5A 2P90A 1OCOC 4HBNA 2CUGA 3IAYA 2Q4PA 2H3OA 5D5QA 4NXMB 4B7EA 2IM9A 1XHZA 4MVSA 1N33B 5EZYA 1US6A 2X6AA 3SJCC 2ARHA 4LF4B 4I7ZB 3RVYA 1FAFA 1K3EA 1NVPB 4DV2O 2WPDG 1VQ7V 4GX2A 3RN4A 3RYCB 1VF6C 5EC2C 4ABMA 5B3SB 4GKKB 2AHYA 4MTGA 5A2QN 2UXCO 5EIBC 3I55V 4FLWA 5TISZ 1PPJH 3F7YC 4LF6O 3E89A 2BTOA 4MW3A 1EFRG 1WP7A 5IWAO 1THZA 1MZEA 2A3QA 4JI6O 4YIOA 1UFIA 3ZHQA 3CXCU 3DTUB 2JGDA 3OGCC 1M5IA 1JJ2U 1KUQA 2OCCC 2AGAA 2DWEC 3AG4C 4RUEA 1WA8A 1N0NA 1RPOA 3ZMTA 4KP4A 4D7TA 1NH2B 2Q9LA 3ZHVA 5KHIA 1HDJA 3TXQA 1SA0B 3ETQA 2Q7HA 3F5WC 2WLMA 4P9PA 3T4DA 1ORQC 2PYLA 4R8CA 4F6EA 2DN9A 1Q43A 1QR8A 4JI2B 3SJBC 3SPJA 1I5YA 2W6IG 4FVMA 1F23A 4DR5O 2VQEB 4K0KB 4R6ZA 3LSSA 5JQGA 5LHIA 3ZS8C 2HFEC 5EBLC 4Z2WA 3BCCH 5EK0A 1AI5A 4U3JB 5LP6A 2UUCB 4RO2A 5H5NA 1HR0O 1VP7A 3UQ8A 4BIOA 2EIMC 2GBOA 4OPAA 3CX5F 1PP9H 4ZHQA 2CH7A 3ZRWB 4MVMA 3FAVA 1MSWD 4FPPA 3OE7G 4O4JA 2ILMA 2RJZA 3WG7C 2ZINA 1RM1C 1OHHG 1IDSA 3UT5A 5IJ0B 3KKYA 3OAAG 3FB6C 1H38A 2EINC 5JH7B 3MAQA 5ITZA 3DXRB 3K06A 4JGSA 1PL0A 4O4HB 1WPXA 2OIGA 5KUMA 1OCZB 4ZI7A 2QM8A 2CK3G 3TCUA 5J2UA 1GM9A 2ZQMA 1ENVA 1UJWB 2HHHB 5H2FZ 2ZT9B 3H1JH 3BEHA 3K57A 4LC1A 3NR7A 2VQFB 4U3JA 4FJCC 5LP6B 4B3SO 1IBLB 2PTMA 3QVNA 4FIPC 4IHJB 3K9AA 3DSQA 4Q6GA 4PD4F 3G4SV 1CXZB 1VQ4V 4LWSA 1E79G 5B1BC 4R50A 1RFYA 2CAZC 1O9GA 2EIMB 1S5HC 5EZYB 3I5DA 1Q6HA 3E86A 3ABMC 4FFKA 1B06A 1Y76A 2Y0PA 1M1KW 4KXRA 4X1YA 4O4IA 2ZXWC 1MSDA 3JD4A 5B66Z 4O4LB 3JAKB 4CH4A 3ASOB 3E22A 3ASOC 1WLEA 3F5TA 4IGGA 2FMLA 3D36A 3JSLA 4NXMO 1NH2D 2HG5C 2WLIA 1VQOV 2Y69C 5KX5B 1B04A 3OEEG 4J42A 3A0RA 2ZCEA 2N05A 3SJQC 1GM8A 3N2KA 3N2GB 1JR9A 1K92A 4AHCA 5FNVB 2P5OA 2UUBO 1GO3F 3PN1A 4YIPA 1SQVH 1GK9A 3D3QA 5H6RA 3K58A 3JATA 4NXNB 2KQXA 1B3QA 1GN4A 4YJ2B 1FFXB 3BABA 1WB7A 2WLNA 3APQA 3GB7C 2YXHA 4TQDA 1S72V 3CEIA 1R6KA 3P30A 4BAYA 4W4LA 1K8AW 2ZD9A 4JAAA 3CCLV 4L87A 1NU1H 4UCTA 5J2TB 4QE7A 4QJFB 1V54C 4CS2A 4FM2A 3CPWU 3OM3B 3A0HZ 5FLXN 4I4TB 4DV3B 3CCRV 1JFFA 5LA6A 3F7VC 4UB8Z 4Z1VA 3D8CA 3JD1A 4B3SB 4JYAO 3SR2C 1W2BU 2Q69A 3IC7A 5LGUA 1AR5A 3ETGA 2HHHO 3ZN1A 5LOVA 1SERA 5KMGA 3L9DA 1YXBA 5H9CA 1MA1A 4X1IB 1YF2A 4JI8B 1BZKA 2JIZG 4B7KA 4JYBA 2C2AA 1R1BA 1FFXA 1S0VA 3E8FA 1W0JG 3G67A 4X89A 2Q67A 2ZR3A 1WPBA 3W7XA 3SPHA 3ZJZA 2XAGA 1YITV 2R70A 4TQFA 5CA1A 3J80N 3QTCA 2Q73A 4MTFA 3HKDA 2UU9O 3DXRA 4I50B 3IJ4A 4XBFA 4CC5A 4PA7A 2EIKC 2YIDA 1N4CA 4F6RB 3CJHB 3ZIAG 2HR3A 4NR1A 4H33A 3JALA 1VQPV 2A9HA 2QE7G 4JYYA 1IBLO 3T1YO 1GRJA 1KP3A 4KHPB 3P3PA 4P30A 2E74B 4JASA 2EJ7A 1QLEB 4UCOA 1YCIA 4NTWA 1HR0B 2UUCO 2UXNA 4J7JA 1W0KG 1FYJA 5CB4A 1AI6A 3WB2A 3K5OA 2D2CB 4KUMA 1Q6UA 4F4LA 5HFLA 4BIUA 1DGSA 5LMUO 4K0KO 4Z1MG 4PELA 4X8AA 2F93B 4DRXA 3JASA 4ZKIA 2PZSA 4LF9B 4UVAA 1Y76B 3U0ZA 3PJSK 4LF9O 1AR4A 2P4KA 5EBWC 2QKSA 2CTPA 1P7GA 3SYCA 2KSDA 3L75H 4FLTA 1SQPH 3CC7V 5JJEB 3OT7A 3ABKB 1IXMA 3K3WA 2CE4A 3WU2Z 3CC2V 3H01A 1AILA 5BMVA 5KX5A 1OCCB 2ZXWB 3GWKC 3FYIB 1NVPD 3RWRD 1AVMA 1ZTEA 3QF7A 4O2BB 3CCQV 4CH3A 1JX9A 1XL6A 2R9IA 5GTHZ 4PHZA 1FXKC 3T2MA 1WN7A 5L3FA 2VQEO 4PDVA 4AILC 1QNMA 4DR5B 3B8MA 3T1HO 3CCUV 3RW0A 3W7WA 4JI2O 1VMGA 1SKVA 2OTJV 4NTXA 2UU9B 1Z5VA 3VQYA 2QTOA 4DV1B 3RYFA 3WFVA 3CS5A 2K9PA 4GX1A 2A0LA 4DW0A 1VIBA 2R9AA 4UV8A 1XNRB 4WFHA 5LHGA 2ZIMA 4LF4O 1YHQV 4JI8O 2IJJA 2X0LA 2OTLV 3HKCA 3G80A 1XDCA 5J2TA 1AJNA 1ZWIC 1B6QA 1K4DC 2E5LB 4JAVA 4UCVA 4LNUA 4J41A 2JJ1G 3CC4V 3FX7A 1KB9F 2EZPA 1AB3A 5H6QA 2QWPB 1SS3A 4O2BA 4DV3O 5IWAB 1MMMA 5BZBA 4MVQA 2Y69B 4LF6B 3I56V 1HP8A 5JH7A 3ZMUA 3UCSC 5IDJA 4X9QA 2YEVA 5LOVB 2OT5A 2ADQB 4GKKO 1KP2A 1M9NA 3VBBA 2HVKC 3B4SA 1SETA 1N36B 1QCEA 2WLLB 3RYFB 2ZNIA 1WB8A 3DC5A 3JAWB 4P9OA 3AG1C 4X88A 4JV5B 4K35A 2BSKA 5CA0B 4NXNO 1K5SA
chains in the Genus database with same CATH topology
1NZ6A 2DN9A 2YS8A 1IURA 2GUZA 4RWUA 2CTPA 3AG7A 2QWQB 4IT5A 1FAFA 2QWOB 1N4CA 1GH6A 2CTQA 3BVOA 2DMXA 1BQZA 2Y4TA 2CUGA 3UO3A 4J7ZA 2OCHA 2Y4UA 1HDJA 4J80A 2QWNB 2QSAA 1XBLA 2QWRB 1BQ0A 2QWPB 2GUZB 2YUAA 2EJ7A 2M6YA 2PF4E 2KQXA 3APOA 1WJZA 1FPOA 2N05A 2LGWA 2CTWA 2LO1A 3APQA 2N04A 3UO2A 3UCSC 2CTRA 2L6LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NZ6 A;  2DN9 A;  2YS8 A;  1IUR A;  2GUZ A;  4RWU A;  2CTP A;  3AG7 A;  2QWQ B;  4IT5 A;  1FAF A;  2QWO B;  1N4C A;  1GH6 A;  2CTQ A;  3BVO A;  2DMX A;  1BQZ A;  2Y4T A;  2CUG A;  3UO3 A;  4J7Z A;  2OCH A;  2Y4U A;  1HDJ A;  4J80 A;  2QWN B;  2QSA A;  1XBL A;  2QWR B;  1BQ0 A;  2QWP B;  2GUZ B;  2YUA A;  2EJ7 A;  2M6Y A;  2PF4 E;  2KQX A;  3APO A;  1WJZ A;  1FPO A;  2N05 A;  2LGW A;  2CTW A;  2LO1 A;  3APQ A;  2N04 A;  3UO2 A;  3UCS C;  2CTR A;  2L6L A; 
#chains in the Genus database with same CATH topology
 3ABL B;  1N33 O;  1P7B A;  2QEX V;  2EX3 A;  3SPC A;  2PY5 A;  3BRC A;  1YI2 V;  4J11 A;  1GMG A;  4UCS A;  3B8N A;  5DED A;  3DC6 A;  1QHT A;  1QVG U;  1PKX A;  2KG7 B;  2QM7 A;  5J9P C;  4FM1 A;  1I7F A;  1XIL A;  4D7S A;  4TOI A;  4B3T O;  4X20 B;  3CME V;  3MDS A;  3RYI A;  2IH1 C;  4UV9 A;  1QLN A;  3SDL A;  2EIK B;  3HB3 B;  4OGQ B;  3H9V A;  3CRA A;  5JVD B;  1VQL V;  2HKO A;  4EKW A;  2NLJ C;  2GTA A;  4HYO A;  2Q8V A;  2IU3 A;  2V7Q G;  5KUK A;  1Z2G A;  2F95 B;  3CB2 A;  1I08 A;  3HKE B;  1PV0 A;  5GON B;  2NR5 A;  1AI4 A;  5GTI Z;  5HFM A;  2GDS A;  4PDL A;  4BIZ A;  2YIC A;  4JTD B;  4PA3 A;  1JMK C;  4DR3 B;  4GX0 A;  4J80 A;  3MHS C;  1D2D A;  1WP8 A;  4TT3 G;  3LNM B;  1L0L H;  1EZV H;  4CH6 A;  1TA8 A;  3P3N A;  3RGB A;  1Q3E A;  3N27 A;  2UXD B;  4RQE A;  1K97 A;  5BMV B;  3SGI A;  1SZX A;  1GN3 A;  2MW2 B;  1FFT B;  3WG7 B;  2VQF O;  1SQG A;  3LDD A;  4X64 O;  3BPZ A;  2QSA A;  4U3F H;  2XOK G;  4LF8 B;  3JD0 A;  2JGU A;  1R3L C;  1NS1 A;  1FXK B;  3RYC A;  2X6C A;  4DUZ B;  2BE3 A;  1FJG O;  3UO2 A;  3OD4 A;  2XND G;  1W59 A;  1KU9 A;  4TWK A;  4RWU A;  4WFG A;  3E8G A;  3CE2 A;  1Y6X A;  1R6T A;  2E75 B;  4DR6 B;  5IE9 A;  5LBQ A;  3TGU H;  2P7T C;  1E1Q G;  4JTC B;  2OCH A;  4QPJ A;  1BQ0 A;  4JI7 B;  3W7S A;  5KHH A;  2ZKO A;  3CCJ V;  1N34 O;  2AHZ A;  5B1N A;  3ZED A;  1J5E O;  5JCO C;  2XAF A;  1NQT A;  5LL6 Y;  1G4Y B;  4MVR A;  4LFB O;  2XAS A;  3SJA C;  3B2E E;  3R66 A;  2ZDI C;  4X65 B;  2VS0 A;  1OCR B;  3CSX A;  2YUA A;  4OX9 B;  1ZUQ A;  3L72 H;  3QO8 A;  1Q86 W;  3MHH C;  2JEX A;  3ZHU A;  5DM6 V;  5LHH A;  1VQ5 V;  3M99 B;  1H2M A;  2HLD G;  5CBG A;  2RCV A;  3FB8 C;  5CA1 B;  3JAR A;  4J10 A;  2YEV B;  1F51 A;  1F4N A;  4I50 A;  1TVK B;  1GTO A;  3K5N A;  5DN6 G;  3EXA A;  1N32 B;  4WCE V;  1BHB A;  3JYC A;  5JQG B;  2ZR2 A;  5BXZ A;  4H13 B;  2Z5U A;  2F4V O;  1XMQ O;  2AXT Z;  2DWD C;  4HNA B;  1JPX A;  5KA5 A;  4JI0 O;  5LP6 C;  3FFQ A;  3RT3 C;  1K73 W;  2W0X A;  4LF5 B;  1O9H A;  3E8B A;  1NR1 A;  3ZRX A;  2N74 A;  1M56 C;  1FPO A;  4YY3 B;  1QBZ A;  4LP8 A;  4LH7 A;  1RPR A;  3CD6 V;  4R7C A;  2N04 A;  3CYO A;  1S77 D;  2A06 H;  2KG7 A;  3JAS B;  4UUJ C;  5LYJ B;  1RSO B;  4JI6 B;  4J9Z B;  4WBN A;  4MT8 A;  5LXT B;  5CBH A;  1D5N A;  2HVJ C;  1MOF A;  3MD0 A;  1H2L A;  1G1X B;  4JI3 O;  2UXC B;  1R73 A;  2L6L A;  4ZI7 B;  1JCH A;  4DXW A;  1IXB A;  4DV2 B;  2LP7 A;  5LMN B;  2BOC C;  1S5J A;  4JYC A;  1QVF U;  2BOB C;  3ZRS A;  4DV6 O;  3CMA V;  2UUA B;  3Q4H B;  4ZIB A;  3OUS A;  1SQX H;  4UCR A;  3L70 H;  1FXV A;  3SPI A;  3STL C;  5IY5 C;  5KA6 A;  4P2Z A;  1URF A;  4O4I B;  4WFF A;  1NZ6 A;  3CRR A;  4DO2 A;  2FYU H;  4H37 A;  4JPR A;  4UXN A;  1K34 A;  2EIL C;  3JAK A;  4PI0 A;  4X1K B;  5KAF Z;  5KHJ A;  3OFN G;  4H0L B;  1EN5 A;  2OIE A;  4TUY B;  3JD3 A;  3QO5 A;  1V9P A;  4H44 B;  1RSO A;  4UVB A;  4WBN B;  4PA6 A;  1JA8 A;  5JJN B;  3W7T A;  1R3K C;  2RMK B;  3GWO A;  3LNN A;  4NTY A;  1QU7 A;  4AQY B;  3OMN B;  4B08 A;  4YHH B;  1JQ0 A;  4LR3 A;  1AR1 B;  4DR4 O;  5B5E Z;  4IL6 Z;  4GYC B;  4DV4 O;  1XHX A;  2YSU B;  4DV0 B;  2HJD A;  4DR1 B;  3AG3 B;  2ITC C;  1X4T A;  2ETN A;  3E35 A;  1AJQ A;  1LR1 A;  3HKB A;  4FLX A;  5L3E A;  1VQ8 V;  5IYZ B;  2KB1 A;  4IT5 A;  1YJN V;  1N0J A;  3A0B Z;  2LW1 A;  4IIJ B;  1VEW A;  1M4U A;  1F4M A;  5GW7 A;  3K59 A;  2NNU A;  3D3I A;  4JI4 B;  5EC1 C;  5IJ9 A;  1I94 O;  3D36 C;  4CZZ A;  4L8J A;  4X62 B;  4WFB V;  2ADP A;  2P67 A;  1COW G;  4B3R B;  5JWP A;  4GZR B;  2P22 C;  4I4T A;  5LA6 B;  1TUE B;  4LF7 B;  1LUV A;  1T5E A;  3HPL C;  3QNE A;  4EEQ A;  5BR8 B;  3JAR B;  2WLJ A;  2JGD B;  2W0F C;  1EBO A;  2ZE8 A;  3CRC A;  3TET A;  3U10 A;  4GKJ B;  2PGG A;  4FK5 C;  3A2F A;  5AG2 A;  3AK2 A;  1V55 B;  1WA8 B;  2RN9 A;  3E83 A;  2Q7G A;  1HW7 A;  3OEH G;  1TUB A;  1OCO B;  2Z3Y A;  3JD2 A;  3TXS A;  4N21 A;  4TV8 B;  3QG5 A;  1IX9 A;  2QWR B;  2V1D A;  1GN2 A;  2CDY A;  3AG3 C;  4A5U B;  4PA4 A;  3OTO B;  3HKD B;  4I0X B;  4I55 A;  1IVS A;  2BCC H;  3BVO A;  1QLE C;  2GV9 A;  1KYO F;  3SYO A;  3JAT B;  2QA4 V;  2UXX A;  3UKM A;  4DV7 O;  2YDE A;  3STZ C;  2DE0 X;  2UXB O;  3OUF A;  3UM7 A;  2WLH A;  4MVZ A;  3NXS A;  1KQS U;  3LDC A;  2XT9 A;  3ETD A;  3ABT A;  2VWJ A;  1HWY A;  5EYP B;  5CB4 B;  1IBM O;  4DUY O;  1GAX A;  4J9Y B;  2ZM6 B;  3K04 A;  4QPK A;  3T4Z A;  1U97 A;  3ABL C;  3K03 A;  2OWO A;  1TUB B;  1K9M W;  5FPO A;  2YI8 A;  1IUR A;  2YS8 A;  3UT5 B;  1HNW B;  3KCX A;  1BSM A;  5IJ0 A;  5IY5 B;  4JI1 O;  4X66 O;  2WLK A;  4DV5 O;  4B3M O;  1CEZ A;  2O57 A;  2EIL B;  3H1H H;  4DR2 O;  2P6J A;  1K7D A;  3HKE A;  4KFM A;  1PNM A;  5GON A;  2CTR A;  4TUY A;  3R65 A;  1Y4M A;  1M56 B;  1EN6 A;  4MTX A;  3P32 A;  2H94 A;  3G6B A;  3ZMV A;  3CRQ A;  3AEI A;  1IBK B;  1YJW V;  4LF7 O;  1P84 F;  4IHJ A;  1N8R W;  2M6Y A;  4EB6 B;  4LFC B;  3APO A;  4WF9 V;  1ZX3 A;  2ZNJ A;  3T1C A;  4JI5 O;  3SPG A;  3ABU A;  1QQC A;  1XMO O;  4DR7 B;  4F6R A;  3CJH A;  1XNQ O;  1P49 A;  4I5S A;  1AI7 A;  1LUW A;  1OV9 A;  1EM1 A;  4HZ3 A;  2BTQ A;  4MTO A;  5LGT A;  4FFB B;  3FB7 C;  4IIJ A;  2MK3 A;  1F7Y A;  4K3A A;  1Q6I A;  4DK0 A;  5KHG A;  3C90 A;  3LSQ A;  1R3J C;  4E4E A;  1TVK A;  1GN6 A;  4O4L A;  1AP6 A;  3K79 A;  4CS4 A;  3RBZ A;  4DV4 B;  2NN4 A;  3OMI B;  2A7W A;  1Y67 A;  4MVU A;  2EJR A;  2HP8 A;  4LNU B;  4LFA B;  1BS3 A;  5CA3 A;  1HNZ B;  2DQ0 A;  1BCC H;  3AG1 B;  4GCZ A;  2LGQ A;  3RFR A;  1X59 A;  1VQK V;  1GKF A;  1VF6 A;  3WB1 A;  3ZBH A;  4WFA V;  3OGI B;  1H8E G;  3M8A A;  1DLB A;  4UB6 Z;  2IW5 A;  5KHK A;  3ZX6 A;  4FM0 A;  1FD9 A;  2Z0A A;  4XDK A;  1S76 D;  2Q5Z A;  1WJZ A;  1U96 A;  4ZOL B;  3K0D A;  4O2A B;  4RAI A;  1R3I C;  4JZG A;  2ZDI A;  4CH5 A;  2OCC B;  5B1B B;  5CA0 A;  4DYL A;  3J7A U;  2QR4 A;  1Y66 A;  1GH6 A;  1K5Q A;  2B1G A;  3L74 H;  4CC6 A;  2R72 A;  4BW5 A;  3O65 A;  2LFS A;  1J95 A;  1A32 A;  1JFF B;  1KKC A;  1HNZ O;  2JS5 A;  1S3J A;  3X2Q B;  1L8D A;  4LFA O;  1KEC A;  1XL4 A;  4PDR A;  3ZRV A;  1FS0 G;  5K1X A;  1PD3 A;  5IYD O;  3ASN C;  2WWW A;  1ROP A;  3HKC B;  2V4D A;  3H1I H;  5FPR A;  1PNL A;  2JVD A;  4NKG B;  1YIJ V;  2JRI A;  2PUS A;  1QR9 A;  4DR2 B;  4YY3 O;  3BY6 A;  1MZF A;  1ZSP A;  3AG7 A;  2B1I A;  4ASU G;  4FZ0 A;  1SA0 A;  3E8H A;  4ZOL A;  4LF5 O;  4BW9 A;  2IH3 C;  1HNX B;  2EIJ B;  2AZ0 A;  1DF5 A;  1XEQ A;  4E2L A;  1P4R A;  4JI0 B;  4QIW F;  2ZE6 A;  1XNQ B;  4DR7 O;  1XMQ B;  3CRM A;  1Q81 W;  3G6E V;  1VQ6 V;  2PI4 A;  3RVZ A;  2AW9 A;  4JI5 B;  2XAH A;  1OCZ C;  3IFX A;  2IJI A;  3DGE A;  3JCZ A;  2YXY A;  5EBM C;  5KAI Z;  3JAL B;  3FAV B;  3HKB B;  2EIN B;  1LNQ A;  2IJK A;  3FYE B;  2QTS A;  3AG2 B;  3KZI Z;  1BL8 A;  4Q20 A;  4FLV A;  1S5L Z;  5B1A C;  1ZLZ A;  2UXB B;  2DYR C;  2Q0O C;  3HR0 A;  3O9O A;  4DV7 B;  2DYR B;  1OJH A;  5C93 A;  1H8H G;  3E22 B;  3ZRW A;  5IT9 N;  1NTM H;  4W4K A;  5L3G A;  1MAB G;  2OYQ A;  4JI1 B;  4O4J B;  2QKA A;  4LFB B;  1H2G A;  4BR6 A;  4C7U A;  2BTQ B;  4GT1 A;  2DJV A;  2ZE7 A;  3K5L A;  2JDI G;  2ZIO A;  3IC9 A;  2ATK C;  1OCR C;  4JI7 O;  1NTK H;  2WA4 A;  5ITZ B;  2LW7 A;  4RQF A;  2ZM6 O;  2E76 B;  2B9Z A;  1Q82 W;  4HAM A;  2A79 B;  5KLV H;  5EIB D;  5J2U B;  2F66 C;  3GVM A;  4LWS B;  4PV1 B;  1KBH A;  4K8Z A;  4DUZ O;  4QGP A;  2IBZ H;  5IYZ A;  3BA8 A;  1H2N A;  4GX5 A;  1EZJ A;  5JCO A;  1AJP A;  4J7Z A;  2XAJ A;  3OR7 C;  4YJ3 B;  1Q5O A;  3KG2 A;  1G6U A;  4B3R O;  1NBM G;  3OW2 U;  1AP5 A;  4UVC A;  1SQF A;  1I0H A;  3FD9 A;  3OTO O;  1I94 B;  1BMF G;  5B1A B;  3THO A;  1ZL8 A;  2Q7E A;  4OXS A;  2LFR A;  2QKC A;  1FKA O;  1HNX O;  3E2E A;  1XRE A;  1YVW A;  2XHB A;  1YDX A;  4UCU A;  4X1Y B;  2VRZ A;  3AG4 B;  4MW8 A;  2DYS B;  2P06 A;  3ZHS A;  3B09 A;  3TK1 A;  4JF3 A;  2DW4 A;  1CPY A;  3ABM B;  1Z5W A;  2EZO A;  1VAR A;  1YZB A;  2YIA A;  4GKJ O;  1K4C C;  3B40 A;  3CXH F;  3OMA B;  4J7K A;  4QE9 A;  4DR4 B;  1ZAU A;  3CCE V;  5BR8 O;  2Q6A A;  3KCY A;  3S3W A;  4LBE C;  1DF4 A;  3X2Q C;  2IU0 A;  4PDM A;  4JTA B;  1NI8 A;  2XAQ A;  2YC0 A;  3N2K B;  1G8M A;  5LXT A;  5A9G A;  1ARO P;  3M7M X;  5FNV A;  2R9R B;  1FXH A;  4JI4 O;  2QWQ B;  4I0X A;  4I55 B;  4CBC A;  2CTQ A;  3BFR A;  3SYQ A;  1YTF B;  3CHX A;  1SZT A;  1BE3 H;  3C3T A;  1ZL8 B;  3JAW A;  4TV9 B;  2EIJ C;  4DK1 A;  1NTZ H;  3H1K H;  2BSK B;  4DR1 O;  3BAA A;  4DV0 O;  1SQB H;  2D3O W;  4G2K A;  2DMX A;  1RM1 B;  4PA9 A;  4ZHQ B;  3RYH A;  3VQW A;  4ZBM A;  4YHH O;  2X6B A;  4IYH A;  2DYS C;  3QO7 A;  2PF4 E;  3CCV V;  2E3C A;  3ZCC A;  4HNA A;  2Q0A A;  2LO1 A;  4MSW C;  2DQ3 A;  5LGN A;  4EFB A;  1WAZ A;  1H2S B;  3LDE A;  5JVD A;  4G27 B;  2FL4 A;  4MS2 A;  5CN0 A;  4JZ2 A;  2JJ2 G;  3IGA C;  1XOU A;  2F43 G;  1XBL A;  3EFF K;  2E5L O;  4O4H A;  1M90 W;  3ML0 A;  4JAU A;  3ASN B;  3U11 A;  2YIB A;  4I9W A;  1JVM A;  1MG1 A;  5LYJ A;  5B1O A;  5K1P A;  2UUA O;  4DV6 B;  3K9S A;  2EUL A;  4GLX A;  2CGN A;  1XNR O;  1VF5 B;  5LMN O;  3OTF A;  2PYJ A;  1JOY A;  2DOS A;  2Y48 A;  3EVK A;  5L3D A;  3B77 A;  4IYI A;  2ITD C;  3H1L H;  3LSU A;  1XMO B;  4XDJ A;  4DV1 O;  2H8P C;  2LGW A;  1GM7 A;  5C8Y B;  4LFC O;  4JI3 B;  1NT2 B;  1NR7 A;  1PM9 A;  2KKW A;  1KC8 W;  5E79 Z;  2K1E A;  2F23 A;  4FMT A;  1IBK O;  1EN4 A;  4DRX B;  5IYB O;  3T1H B;  1XQ8 A;  3A8T A;  2JEU A;  1M57 B;  4O2A A;  3FKS G;  1D5A A;  1NKD A;  1YJ9 V;  2QWN B;  2L35 A;  4MVO A;  2AZ2 A;  5L3C A;  2FKX A;  2YXL A;  4N23 A;  2XUM A;  1Y74 A;  4EFE A;  1JJO A;  5E1A C;  1MNG A;  2IJH A;  3G71 V;  1BT8 A;  1WNS A;  1OCC C;  2F1M A;  3VQV A;  4X1K A;  5IJ9 B;  4YXW G;  1BQZ A;  4B3M B;  1OZ0 A;  4DV5 B;  2X7R B;  4X66 B;  3ZHT A;  2WLI B;  2ODM A;  4UFZ A;  4PI2 A;  1HNW O;  3OR6 C;  4CS3 A;  1J5E B;  5FL7 G;  2F4V B;  1XUQ A;  1VQ9 V;  3TJT A;  4DUY B;  4I9Q A;  1IBM B;  3EHB B;  4DR6 O;  1N32 O;  4OPH A;  5LMU B;  1IZ3 A;  5DEC A;  4ICG A;  2WA3 A;  4TV8 A;  4G28 B;  2B5U A;  2P4V A;  4YJ2 A;  2HEP A;  3SYP A;  3JAM N;  2YI9 A;  2JS3 A;  2XTA A;  3ZMS A;  2QWO B;  4X64 B;  4OX9 O;  2M7W A;  4KHP O;  1Y74 B;  1SQQ H;  4X65 O;  1SC5 B;  3CCM V;  5JJJ B;  2LQT A;  5EYP A;  3T1Y B;  1M57 C;  3CCS V;  2W6J G;  3ABK C;  3CP1 A;  3JCU Z;  1UPG A;  1CP9 A;  1V55 C;  2WSS G;  5CBF A;  1VQN V;  1I5X A;  3ZN0 A;  1SF9 A;  2QJ1 A;  5BY1 A;  1L1F A;  1TGO A;  4TV9 A;  5IYC O;  1N34 B;  3BHP A;  1YEW A;  1DK1 A;  2GUZ A;  1DTO A;  2VWK A;  1PNK A;  4FZ1 A;  2Y0I A;  2WAM A;  2Y4T A;  3RYI B;  1SES A;  3C3S A;  3K08 A;  2CGO A;  3ZMZ A;  4U7N A;  3CWB H;  1V54 B;  1BHA A;  4FLY A;  2GSM B;  3N2G A;  3L71 H;  2ZE5 A;  5L3B A;  3RYH B;  2RQ6 A;  4U7O A;  4KL1 A;  2GHY A;  2FB5 A;  5KMG B;  2GTS A;  4DW1 A;  1YSC A;  1BGY H;  1VQM V;  1L0N H;  1FJG B;  4TSF G;  3VOU A;  2EBO A;  3ZHR A;  3K0G A;  2WLL A;  4LF8 O;  4LCU C;  3J81 N;  1XI1 A;  1E1R G;  4NYK A;  2G38 A;  4JYA B;  3SYA A;  2RNB A;  4X62 O;  1Q7Y W;  2UXD O;  5F2V O;  1R6N A;  4WFE A;  2YIB D;  4BWA A;  3WB0 A;  4PJ0 Z;  1KMI Z;  1RP3 B;  4FLZ A;  2CH7 B;  1NJI W;  3BA9 A;  3UO3 A;  4NVP A;  1VF7 A;  3W7U A;  4QNH B;  5B3S C;  1SRY A;  1PL4 A;  4XDL A;  1M93 A;  4DR3 O;  4GUN A;  3AK3 A;  3Q4H A;  2GUZ B;  3LUT B;  4FFB A;  4JV5 O;  4YJ3 A;  1H2K A;  1FXK A;  3L73 H;  2QDO A;  4D6T H;  4EB6 A;  1K33 A;  2QGN A;  3FB5 C;  1KD1 W;  5C8Y A;  1N36 O;  1Q90 D;  2RDC A;  1Q8I A;  2HJF C;  2QM4 A;  2LJ2 A;  3ETE A;  3AG2 C;  4NB5 A;  2Y4U A;  4X1I A;  3S3X A;  2UUB B;  4AQY O;  4LH6 A;  5D5P A;  3AK1 A;  4K8X A;  5CMU A;  3JSN A;  4X20 A;  4AI8 A;  3VQX A;  2CTW A;  4B3T B;  1KKD A;  1YTF D;  2Q68 A;  3ICX A;  2JK5 C;  2FTK A;  1TAE A;  4RUF A;  3K5M A;  4FLU A;  2PI5 A;  2P90 A;  1OCO C;  4HBN A;  2CUG A;  3IAY A;  2Q4P A;  2H3O A;  5D5Q A;  4NXM B;  4B7E A;  2IM9 A;  1XHZ A;  4MVS A;  1N33 B;  5EZY A;  1US6 A;  2X6A A;  3SJC C;  2ARH A;  4LF4 B;  4I7Z B;  3RVY A;  1FAF A;  1K3E A;  1NVP B;  4DV2 O;  2WPD G;  1VQ7 V;  4GX2 A;  3RN4 A;  3RYC B;  1VF6 C;  5EC2 C;  4ABM A;  5B3S B;  4GKK B;  2AHY A;  4MTG A;  5A2Q N;  2UXC O;  5EIB C;  3I55 V;  4FLW A;  5TIS Z;  1PPJ H;  3F7Y C;  4LF6 O;  3E89 A;  2BTO A;  4MW3 A;  1EFR G;  1WP7 A;  5IWA O;  1THZ A;  1MZE A;  2A3Q A;  4JI6 O;  4YIO A;  1UFI A;  3ZHQ A;  3CXC U;  3DTU B;  2JGD A;  3OGC C;  1M5I A;  1JJ2 U;  1KUQ A;  2OCC C;  2AGA A;  2DWE C;  3AG4 C;  4RUE A;  1WA8 A;  1N0N A;  1RPO A;  3ZMT A;  4KP4 A;  4D7T A;  1NH2 B;  2Q9L A;  3ZHV A;  5KHI A;  1HDJ A;  3TXQ A;  1SA0 B;  3ETQ A;  2Q7H A;  3F5W C;  2WLM A;  4P9P A;  3T4D A;  1ORQ C;  2PYL A;  4R8C A;  4F6E A;  2DN9 A;  1Q43 A;  1QR8 A;  4JI2 B;  3SJB C;  3SPJ A;  1I5Y A;  2W6I G;  4FVM A;  1F23 A;  4DR5 O;  2VQE B;  4K0K B;  4R6Z A;  3LSS A;  5JQG A;  5LHI A;  3ZS8 C;  2HFE C;  5EBL C;  4Z2W A;  3BCC H;  5EK0 A;  1AI5 A;  4U3J B;  5LP6 A;  2UUC B;  4RO2 A;  5H5N A;  1HR0 O;  1VP7 A;  3UQ8 A;  4BIO A;  2EIM C;  2GBO A;  4OPA A;  3CX5 F;  1PP9 H;  4ZHQ A;  2CH7 A;  3ZRW B;  4MVM A;  3FAV A;  1MSW D;  4FPP A;  3OE7 G;  4O4J A;  2ILM A;  2RJZ A;  3WG7 C;  2ZIN A;  1RM1 C;  1OHH G;  1IDS A;  3UT5 A;  5IJ0 B;  3KKY A;  3OAA G;  3FB6 C;  1H38 A;  2EIN C;  5JH7 B;  3MAQ A;  5ITZ A;  3DXR B;  3K06 A;  4JGS A;  1PL0 A;  4O4H B;  1WPX A;  2OIG A;  5KUM A;  1OCZ B;  4ZI7 A;  2QM8 A;  2CK3 G;  3TCU A;  5J2U A;  1GM9 A;  2ZQM A;  1ENV A;  1UJW B;  2HHH B;  5H2F Z;  2ZT9 B;  3H1J H;  3BEH A;  3K57 A;  4LC1 A;  3NR7 A;  2VQF B;  4U3J A;  4FJC C;  5LP6 B;  4B3S O;  1IBL B;  2PTM A;  3QVN A;  4FIP C;  4IHJ B;  3K9A A;  3DSQ A;  4Q6G A;  4PD4 F;  3G4S V;  1CXZ B;  1VQ4 V;  4LWS A;  1E79 G;  5B1B C;  4R50 A;  1RFY A;  2CAZ C;  1O9G A;  2EIM B;  1S5H C;  5EZY B;  3I5D A;  1Q6H A;  3E86 A;  3ABM C;  4FFK A;  1B06 A;  1Y76 A;  2Y0P A;  1M1K W;  4KXR A;  4X1Y A;  4O4I A;  2ZXW C;  1MSD A;  3JD4 A;  5B66 Z;  4O4L B;  3JAK B;  4CH4 A;  3ASO B;  3E22 A;  3ASO C;  1WLE A;  3F5T A;  4IGG A;  2FML A;  3D36 A;  3JSL A;  4NXM O;  1NH2 D;  2HG5 C;  2WLI A;  1VQO V;  2Y69 C;  5KX5 B;  1B04 A;  3OEE G;  4J42 A;  3A0R A;  2ZCE A;  2N05 A;  3SJQ C;  1GM8 A;  3N2K A;  3N2G B;  1JR9 A;  1K92 A;  4AHC A;  5FNV B;  2P5O A;  2UUB O;  1GO3 F;  3PN1 A;  4YIP A;  1SQV H;  1GK9 A;  3D3Q A;  5H6R A;  3K58 A;  3JAT A;  4NXN B;  2KQX A;  1B3Q A;  1GN4 A;  4YJ2 B;  1FFX B;  3BAB A;  1WB7 A;  2WLN A;  3APQ A;  3GB7 C;  2YXH A;  4TQD A;  1S72 V;  3CEI A;  1R6K A;  3P30 A;  4BAY A;  4W4L A;  1K8A W;  2ZD9 A;  4JAA A;  3CCL V;  4L87 A;  1NU1 H;  4UCT A;  5J2T B;  4QE7 A;  4QJF B;  1V54 C;  4CS2 A;  4FM2 A;  3CPW U;  3OM3 B;  3A0H Z;  5FLX N;  4I4T B;  4DV3 B;  3CCR V;  1JFF A;  5LA6 A;  3F7V C;  4UB8 Z;  4Z1V A;  3D8C A;  3JD1 A;  4B3S B;  4JYA O;  3SR2 C;  1W2B U;  2Q69 A;  3IC7 A;  5LGU A;  1AR5 A;  3ETG A;  2HHH O;  3ZN1 A;  5LOV A;  1SER A;  5KMG A;  3L9D A;  1YXB A;  5H9C A;  1MA1 A;  4X1I B;  1YF2 A;  4JI8 B;  1BZK A;  2JIZ G;  4B7K A;  4JYB A;  2C2A A;  1R1B A;  1FFX A;  1S0V A;  3E8F A;  1W0J G;  3G67 A;  4X89 A;  2Q67 A;  2ZR3 A;  1WPB A;  3W7X A;  3SPH A;  3ZJZ A;  2XAG A;  1YIT V;  2R70 A;  4TQF A;  5CA1 A;  3J80 N;  3QTC A;  2Q73 A;  4MTF A;  3HKD A;  2UU9 O;  3DXR A;  4I50 B;  3IJ4 A;  4XBF A;  4CC5 A;  4PA7 A;  2EIK C;  2YID A;  1N4C A;  4F6R B;  3CJH B;  3ZIA G;  2HR3 A;  4NR1 A;  4H33 A;  3JAL A;  1VQP V;  2A9H A;  2QE7 G;  4JYY A;  1IBL O;  3T1Y O;  1GRJ A;  1KP3 A;  4KHP B;  3P3P A;  4P30 A;  2E74 B;  4JAS A;  2EJ7 A;  1QLE B;  4UCO A;  1YCI A;  4NTW A;  1HR0 B;  2UUC O;  2UXN A;  4J7J A;  1W0K G;  1FYJ A;  5CB4 A;  1AI6 A;  3WB2 A;  3K5O A;  2D2C B;  4KUM A;  1Q6U A;  4F4L A;  5HFL A;  4BIU A;  1DGS A;  5LMU O;  4K0K O;  4Z1M G;  4PEL A;  4X8A A;  2F93 B;  4DRX A;  3JAS A;  4ZKI A;  2PZS A;  4LF9 B;  4UVA A;  1Y76 B;  3U0Z A;  3PJS K;  4LF9 O;  1AR4 A;  2P4K A;  5EBW C;  2QKS A;  2CTP A;  1P7G A;  3SYC A;  2KSD A;  3L75 H;  4FLT A;  1SQP H;  3CC7 V;  5JJE B;  3OT7 A;  3ABK B;  1IXM A;  3K3W A;  2CE4 A;  3WU2 Z;  3CC2 V;  3H01 A;  1AIL A;  5BMV A;  5KX5 A;  1OCC B;  2ZXW B;  3GWK C;  3FYI B;  1NVP D;  3RWR D;  1AVM A;  1ZTE A;  3QF7 A;  4O2B B;  3CCQ V;  4CH3 A;  1JX9 A;  1XL6 A;  2R9I A;  5GTH Z;  4PHZ A;  1FXK C;  3T2M A;  1WN7 A;  5L3F A;  2VQE O;  4PDV A;  4AIL C;  1QNM A;  4DR5 B;  3B8M A;  3T1H O;  3CCU V;  3RW0 A;  3W7W A;  4JI2 O;  1VMG A;  1SKV A;  2OTJ V;  4NTX A;  2UU9 B;  1Z5V A;  3VQY A;  2QTO A;  4DV1 B;  3RYF A;  3WFV A;  3CS5 A;  2K9P A;  4GX1 A;  2A0L A;  4DW0 A;  1VIB A;  2R9A A;  4UV8 A;  1XNR B;  4WFH A;  5LHG A;  2ZIM A;  4LF4 O;  1YHQ V;  4JI8 O;  2IJJ A;  2X0L A;  2OTL V;  3HKC A;  3G80 A;  1XDC A;  5J2T A;  1AJN A;  1ZWI C;  1B6Q A;  1K4D C;  2E5L B;  4JAV A;  4UCV A;  4LNU A;  4J41 A;  2JJ1 G;  3CC4 V;  3FX7 A;  1KB9 F;  2EZP A;  1AB3 A;  5H6Q A;  2QWP B;  1SS3 A;  4O2B A;  4DV3 O;  5IWA B;  1MMM A;  5BZB A;  4MVQ A;  2Y69 B;  4LF6 B;  3I56 V;  1HP8 A;  5JH7 A;  3ZMU A;  3UCS C;  5IDJ A;  4X9Q A;  2YEV A;  5LOV B;  2OT5 A;  2ADQ B;  4GKK O;  1KP2 A;  1M9N A;  3VBB A;  2HVK C;  3B4S A;  1SET A;  1N36 B;  1QCE A;  2WLL B;  3RYF B;  2ZNI A;  1WB8 A;  3DC5 A;  3JAW B;  4P9O A;  3AG1 C;  4X88 A;  4JV5 B;  4K35 A;  2BSK A;  5CA0 B;  4NXN O;  1K5S A; 
#chains in the Genus database with same CATH homology
 1NZ6 A;  2DN9 A;  2YS8 A;  1IUR A;  2GUZ A;  4RWU A;  2CTP A;  3AG7 A;  2QWQ B;  4IT5 A;  1FAF A;  2QWO B;  1N4C A;  1GH6 A;  2CTQ A;  3BVO A;  2DMX A;  1BQZ A;  2Y4T A;  2CUG A;  3UO3 A;  4J7Z A;  2OCH A;  2Y4U A;  1HDJ A;  4J80 A;  2QWN B;  2QSA A;  1XBL A;  2QWR B;  1BQ0 A;  2QWP B;  2GUZ B;  2YUA A;  2EJ7 A;  2M6Y A;  2PF4 E;  2KQX A;  3APO A;  1WJZ A;  1FPO A;  2N05 A;  2LGW A;  2CTW A;  2LO1 A;  3APQ A;  2N04 A;  3UO2 A;  3UCS C;  2CTR A;  2L6L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...