4DR5O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr5O00
4GKJO 3J81N 3T1YO 4K0KO 5BY1A 1IBKO 1XNRO 4JI8O 3R66A 1HR0O 4LF9O 2N74A 2UUBO 4NXMO 4LF8O 4DV4O 4YY3O 4DV7O 4DR5O 1F7YA 1FKAO 2ZKOA 5BXZA 3M8AA 3SDLA 4JI6O 1N33O 1HNZO 4OPAA 5H5NA 4B3RO 1N32O 2VQFO 1XNQO 4DUZO 2VQEO 1J5EO 5FLXN 1D2DA 4B3SO 4A5UB 2Z0AA 1N34O 1FYJA 4DR2O 1I94O 4DR1O 1X59A 2UXDO 1N36O 1AB3A 4DV1O 1R6TA 3F5TA 4LF6O 2JRIA 4LFAO 4JI2O 4DR7O 4LF4O 2ZM6O 2F4VO 4JV5O 2UXBO 4OPHA 4LFCO 4AQYO 1AILA 1IBLO 1IBMO 3J80N 4LF7O 5LL6Y 4X64O 3JAMN 4DR4O 4DR3O 4JYAO 4JI0O 2LW7A 2UUCO 4X66O 1HNWO 4DR6O 1FJGO 1G1XB 4JI3O 4X65O 1YZBA 4LFBO 4DV0O 1XMOO 4LF5O 1A32A 2UXCO 1NS1A 1XEQA 4JI5O 5A2QN 2UUAO 2UU9O 2E5LO 5LMNO 3O65A 3T1HO 1HNXO 1DK1A 2DJVA 3RT3C 2AGAA 4B3MO 3OTOO 4B3TO 4DV3O 4OX9O 4JI4O 4DV5O 5IT9N 1R1BA 1XMQO 4DV6O 3J7AU 2DOSA 4KHPO 4JI7O 5IWAO 4DV2O 2HHHO 4DUYO 5LMUO 2FKXA 4NXNO 4YHHO 4GKKO 1KUQA 5BR8O 4X62O 4JI1O
chains in the Genus database with same CATH superfamily
2IM9A 5J9PC 3J81N 1SQFA 3JALA 4IT5A 1R6KA 4PA6A 1OCRC 1OV9A 4LP8A 4G2KA 4DV2B 2H8PC 5JCOA 3RYFB 1YSCA 4DUYB 1SRYA 3K03A 2UUBO 2PUSA 4DUZB 3CP1A 3UKMA 3OE7G 1V55B 2YIAA 3AEIA 3M8AA 3JATB 1YI2V 1S76D 4X1IA 1QR9A 2XTAA 2VQFO 4JI8B 1UJWB 2H94A 3ZMUA 1M93A 1R3KC 2JGUA 4X20A 4ASUG 2ZDIC 3ZMVA 3MHSC 1PNLA 2YUAA 2A9HA 2V1DA 4DR1O 1M56C 2G38A 5EBLC 3TCUA 1ZX3A 1Q43A 4JV5B 4WBNB 4ZIBA 5BMVA 1URFA 2K9PA 2DYRC 3H1JH 1PL0A 2WLHA 3W7WA 4LFAO 1I08A 1RPRA 4RUFA 3Q4HB 3TXQA 4PDVA 3CB2A 3ZJZA 2EIKB 1QQCA 3N2GB 2WLIA 2L35A 2ZCEA 5B1BB 4LF6B 1WPXA 5K1XA 3IGAC 4DR7B 5LHHA 3SJCC 4PV1B 1PNKA 2JEUA 4EB6B 4JI5O 2X0LA 4FLYA 2X7RB 1Y74B 2NLJC 3HKEB 5LMNO 1XHZA 1K33A 2WLNA 3RFRA 2MW2B 1I5YA 4WCEV 2OIGA 1XMQO 2JS5A 1NH2D 1S3JA 1ZSPA 5KHIA 3K5MA 3E8GA 5JJEB 2B5UA 1M1KW 2D2CB 3JAKB 3L72H 1RSOB 3R65A 5LA6B 3ABLC 3D36C 5IYDO 4WF9V 1WA8B 2ZXWC 4JAUA 3BFRA 5KMGB 1YJWV 2F43G 1F4NA 1PPJH 4JASA 4I5SA 1RM1C 4CS2A 2IU3A 1NR7A 2YEVB 2E76B 2WLKA 2GUZA 5KLVH 4OPAA 5IJ9A 1N32O 1IBKB 4QNHB 3BA8A 1J5EO 4J42A 3ZX6A 3K0GA 2VQEO 2Q8VA 4NXMB 5L3CA 1RP3B 3ZN0A 4HNAA 4YY3B 5ITZA 2GTSA 5IYCO 1XHXA 3L71H 1SC5B 2A06H 3K9SA 2P4KA 4KP4A 4Z2WA 1AB3A 1YVWA 3A8TA 4JGSA 3OM3B 2V7QG 2EINC 3QG5A 2XNDG 5CN0A 1J95A 4LF4O 2ZM6O 2F4VO 3K58A 4K8ZA 4U3JA 1W0KG 1JJOA 1G6UA 3J80N 2Y4UA 1IXBA 3FD9A 1JFFB 2E74B 3LDCA 5E1AC 4B3MB 4AQYB 3G6BA 2LJ2A 4DV3B 3FYEB 4U7OA 1QNMA 4X1KB 4MVZA 4CH6A 1XEQA 4YIOA 1NVPB 4G27B 4MVRA 2Y69C 1EFRG 2WLLA 2HHHB 4NR1A 4JI3B 4ABMA 4GX0A 1QCEA 3B09A 1SA0B 1Y67A 3OMNB 3OMAB 1F4MA 4P30A 1ZWIC 2ZE7A 4PHZA 2KG7A 2JVDA 5FNVA 1GM9A 2PF4E 4I0XB 4UXNA 1OCZC 4X1YA 3ZRWB 4BR6A 3K0DA 3LSQA 3SJBC 3MHHC 2LGWA 2P22C 2F1MA 3A2FA 2CTWA 4LH7A 1VQ9V 3X2QC 2UXXA 5BR8B 1NQTA 2BSKB 3UCSC 4DO2A 4DR5O 5CBFA 5JQGA 3FB7C 1XNQO 1SS3A 1E79G 1HP8A 3AG1B 3AG2B 3APOA 5IYZA 3ML0A 4RWUA 4CC6A 4DV4B 3BCCH 2HFEC 2YXLA 5LP6C 4J7ZA 4JI6B 1D5AA 1N33B 1Y4MA 3HKBA 1B06A 4LFAB 4ZI7A 3QTCA 4YIPA 3OEEG 4UVBA 5GTHZ 3DC5A 3ZMZA 4DRXB 1PP9H 2JRIA 3MDSA 3P3PA 1NTKH 1OCRB 3DXRB 4PD4F 3I56V 1M57B 3K79A 1HW7A 1N36B 3H9VA 2EIJB 1MZEA 3RYFA 2YI9A 1GO3F 2ZNJA 4FLVA 1SQGA 2Y0PA 1Z5VA 4JTDB 3CMEV 3CCSV 1YZBA 1XI1A 4LFCB 4H13B 2EULA 2QSAA 1WPBA 3CYOA 2PTMA 4CH5A 2RJZA 3JALB 4X65B 2RMKB 2IJJA 4J9ZB 1R3LC 4BAYA 1KQSU 2DYRB 3W7XA 1VF6A 4DV6O 3CC2V 2ILMA 4RO2A 2Q7EA 5L3EA 2QEXV 4DW0A 2KSDA 5FPRA 1K92A 2Q69A 4X8AA 4UCSA 4X1IB 1AI4A 1YTFB 2DE0X 2CDYA 4H44B 1JVMA 1K4CC 1PD3A 4HAMA 5BY1A 2QM8A 1XNRO 4YHHB 2LQTA 3FKSG 1NVPD 3GB7C 1X4TA 1MNGA 5B1AC 2BTQA 1XREA 2CE4A 1FXKA 2PI5A 4EB6A 4KUMA 2Q7HA 3QO7A 3UO2A 1HNZB 4MW3A 1I5XA 3AG3B 2F4VB 4J9YB 4TQFA 3RBZA 2R72A 3ABLB 3JAKA 4NKGB 3F5TA 2AHZA 1RPOA 1N34B 1I94B 1SQPH 3OAAG 1MMMA 4N23A 3B2EE 1MG1A 2LW1A 1GM7A 1AILA 4R50A 1KD1W 5A9GA 5EK0A 4JZGA 5LGTA 5KMGA 4L87A 1IDSA 5LHGA 1SESA 1T5EA 2YEVA 3JD1A 4XDJA 3LUTB 2HJDA 4DR6O 2VS0A 4XBFA 3M99B 1DF4A 2VWKA 2DQ0A 3VQXA 1TUBB 1V54C 2JEXA 2QWNB 5LYJA 1P84F 1HNWB 3BVOA 1JMKC 2Q73A 2Q0OC 4LNUB 4LWSB 5J2TA 3FAVB 1AJPA 2F23A 5GONA 1S0VA 4QGPA 2FKXA 1YHQV 2Q68A 4PA3A 5IJ9B 1MOFA 3JAWA 1GK9A 1FD9A 1M90W 2F93B 4CZZA 4X62O 4UCVA 2OCHA 4GKJO 3A0RA 5B3SC 5IWAB 5ITZB 2W0XA 4LF9O 2ITDC 3A0BZ 1OCOB 1YXBA 2JIZG 4N21A 3T1YB 2CTPA 2Y69B 2ADQB 5EIBD 2Q67A 4JYCA 1JOYA 3VBBA 5IDJA 4H33A 1AP6A 3VQWA 1KB9F 2WAMA 1K97A 3U0ZA 1YTFD 3ICXA 1GN6A 4GUNA 2EIMB 1SQQH 1YIJV 2UXDO 4J80A 5IJ0B 1R6TA 2QKCA 3ZRWA 4P9OA 1W2BU 1VQOV 4WFHA 2QE7G 3X2QB 2CK3G 1OCCC 3GVMA 3CRMA 4MSWC 5K1PA 1IVSA 1DGSA 3IJ4A 4MTFA 1QLEC 3ASOC 2D3OW 5LL6Y 5FPOA 2BSKA 4JYAO 1BHBA 2UUCO 3OTFA 2P06A 2IU0A 2KG7B 5FNVB 1SQXH 1IXMA 4LF5O 1XUQA 2LFRA 2QDOA 1QVFU 1VQNV 1GKFA 3E8BA 1QBZA 4QE9A 3ZIAG 2DN9A 2NR5A 3SJAC 1XDCA 1YJ9V 4MT8A 3W7TA 4H37A 2DOSA 3F7YC 3QO8A 2K1EA 3PJSK 5B5EZ 5JQGB 4B3TB 2ZINA 1PV0A 3E86A 2OIEA 2ZNIA 5EBMC 4UFZA 5IYZB 1M4UA 3C3SA 5KX5B 4RQFA 2HP8A 3KKYA 3OUSA 4AILC 4GX1A 4ZHQB 4MVMA 3ETGA 2YXHA 4ZI7B 4P2ZA 1Z2GA 2OCCC 2ZDIA 1WJZA 4FZ0A 1Q6IA 1BE3H 1SQBH 2GTAA 3B77A 3SYCA 4K35A 2ARHA 2WLMA 3KCXA 1BCCH 2EILC 1EN5A 1H8HG 2ODMA 3RYIB 3MAQA 2IBZH 5EC1C 1DLBA 2IW5A 2KQXA 5IY5C 1NT2B 2Q0AA 4FLZA 4PELA 4P9PA 5HFMA 3K59A 3LDEA 2QM7A 3K04A 3O9OA 1AJQA 1D5NA 1EN4A 1IBLO 5B1AB 5BZBA 1S5HC 2ZD9A 4PDRA 4GYCB 2W0FC 3SYQA 1VQ8V 2UXBB 2JJ2G 3ABMC 4B08A 1XMOO 1ZL8A 1VQKV 2EBOA 4TSFG 3VOUA 1ZTEA 4DR3B 2JS3A 2BOCC 1H2LA 2V4DA 3JSLA 2YIBA 4LFBB 4DV0B 1VARA 1SERA 1IX9A 2BTOA 4IYHA 4X62B 3OEHG 2Q9LA 4KHPO 2UU9B 2IH1C 2YIDA 5H2FZ 1HNXB 2KKWA 3D36A 3APQA 4NXNO 2BTQB 1EBOA 1FXKB 3L74H 2ZQMA 1KECA 4L8JA 2M7WA 2BE3A 3LSSA 4ZBMA 2EJRA 1YF2A 5LGUA 4UVAA 4CH4A 1H2GA 2XAQA 3FB5C 2R9AA 5JH7B 4ZOLA 4TQDA 4KL1A 4JI1B 2DWEC 3RWRD 3JARA 1TUBA 3VQYA 3AG4B 3IAYA 1LUVA 1QHTA 1K5QA 4DR2O 2OT5A 4LNUA 4LWSA 3T2MA 4DXWA 4B3RB 3FAVA 3NR7A 3ZRXA 4O2BA 2CH7B 3WB1A 3RVYA 1FXHA 3CXCU 3N27A 3H1KH 4PJ0Z 1PL4A 1Y6XA 2HLDG 5LYJB 3UM7A 4LR3A 4EFEA 1R3JC 3ZN1A 4CS3A 3D8CA 3G6EV 4LF7O 4GT1A 1U97A 4JI2B 3NXSA 2LW7A 4MW8A 1P7GA 5J2TB 4NB5A 5GONB 1PM9A 5C8YB 3JAWB 2R9RB 3ASNC 4I55A 4JI0B 1CEZA 4I9WA 1FS0G 4CH3A 1OHHG 4FLXA 4JI4O 3HKCA 4DV5O 5IJ0A 2MK3A 3SPGA 3PN1A 1AI5A 2IH3C 4YXWG 4JI7O 4F6RA 1KBHA 2F66C 3JCZA 5LMUO 5GW7A 2VWJA 1QLEB 1O9GA 3ASOB 4O4JA 4YJ2B 1BMFG 2LO1A 3EXAA 4JAVA 2HEPA 3CC4V 1XILA 1JPXA 3OT7A 4HBNA 2FB5A 2JDIG 3IC7A 1FXVA 3FX7A 1F7YA 1PNMA 1ZAUA 4I4TB 3ABKB 4JYYA 3JD4A 2Y48A 2FMLA 1N0JA 5LXTB 1K73W 5LP6A 2KB1A 2UUBB 5EYPB 4B3SO 3ZHTA 5CA3A 2PI4A 3ETQA 3EFFK 1AP5A 4UCRA 4UUJC 2VQFB 5GTIZ 4UB8Z 3P32A 2OTLV 4DV1O 2R70A 1GN4A 3BHPA 1K5SA 1GMGA 2PYJA 4I7ZB 4DR1B 2ZT9B 1L0LH 5KX5A 3DGEA 1VF7A 4ZHQA 5CB4B 4UB6Z 5LGNA 3JAMN 4X64O 4KXRA 5KA6A 1FFXB 3CRCA 1M5IA 3M7MX 3QF7A 3OR7C 1WB7A 1MSWD 2XAJA 2N05A 1F23A 3D3IA 3JSNA 3CCEV 5IYBO 1VQPV 3T1HO 4O4IA 1NBMG 2GV9A 2O57A 2DJVA 3L70H 3CCVV 4KHPB 4X9QA 2EILB 3SPHA 3JCUZ 4NXNB 3H1HH 4UCTA 4IHJA 1WAZA 1KP3A 4JI5B 2JJ1G 3RYIA 5IY5B 1K4DC 1UPGA 5LMNB 4B7EA 4MVQA 2CTRA 1QVGU 3UT5A 3ZBHA 2N04A 4UV8A 1XMQB 3K3WA 5KAIZ 1M56B 4DYLA 4TOIA 3K9AA 1NU1H 2HKOA 4CC5A 2P5OA 3CJHB 4C7UA 3QO5A 1K3EA 1FKAO 2IJHA 4DR2B 1IURA 2RCVA 4PA9A 4HYOA 2XAHA 1BL8A 1PKXA 4MTXA 1H8EG 2AXTZ 1N32B 1X59A 1L8DA 2QWRB 2DQ3A 1J5EB 2VQEB 2FYUH 5DEDA 3ZRVA 2GHYA 4LF7B 1V55C 1AI7A 4X89A 1ZL8B 4UCOA 2YSUB 3ZEDA 4JF3A 1S5LZ 1O9HA 1B3QA 5TISZ 2JGDA 5FL7G 3E2EA 1GM8A 5JH7A 2ZIOA 4X66O 4LF4B 2AHYA 2ZM6B 1FJGO 4BW5A 1JA8A 3W7UA 3G4SV 2M6YA 2UUAO 2ETNA 3FB8C 3CSXA 3CS5A 1Q86W 2E5LO 2ZXWB 4K8XA 2WA3A 3K08A 3OGIB 1RM1B 1NTMH 2ATKC 1L1FA 3SJQC 5E79Z 3E8FA 2QGNA 2QTOA 1YJNV 3SPJA 4Q6GA 4OX9O 2QWOB 3SYAA 2CH7A 3J7AU 1Y76A 4KFMA 5B1BC 4DV2O 4ZOLB 3UO3A 4DUYO 2HJFC 2WA4A 1JJ2U 3JARB 5LBQA 1LUWA 1VQ7V 1FFTB 4JI8O 3CMAV 3ZMTA 3DTUB 4LF8O 4O2BB 1KYOF 3GWOA 3K06A 2EINB 4J7KA 2XHBA 5C8YA 5H5NA 2R9IA 4GCZA 3B8NA 5D5PA 5DECA 3FB6C 3ZHVA 2RNBA 2WLJA 4RUEA 5FLXN 1KKDA 3F7VC 2AZ2A 1BQ0A 2Z0AA 4DR5B 4WFBV 2OYQA 4IIJA 2DYSC 2FL4A 5B66Z 3CEIA 1XNQB 1SETA 4MTOA 1S77D 1GN3A 2CGOA 4I50B 4X88A 3JASA 2HVKC 4LF6O 1VIBA 5EZYA 4EKWA 5CBHA 1H2SB 4YJ2A 4DR7O 5B1OA 3LNNA 4F4LA 3P30A 4LC1A 4I55B 3SPIA 4BWAA 3OW2U 3HKCB 3OMIB 1OCZB 3W7SA 4I4TA 3T1HB 1G1XB 3LNMB 3E8HA 1TAEA 4O4LB 4HZ3A 3U10A 4F6RB 4UCUA 5LXTA 1P49A 1NS1A 3VQVA 3C90A 3RYHA 5EYPA 3AK3A 4O4JB 1YCIA 4JZ2A 1WNSA 2ZE8A 4R6ZA 3N2KA 1Q5OA 2ZR2A 2YS8A 2QWPB 1R1BA 4NTXA 3SGIA 3G67A 5CA1A 4J7JA 2CTQA 1GH6A 4OXSA 1TGOA 1XQ8A 2X6CA 2NN4A 3B8MA 2B1GA 5JWPA 2YIBD 2YI8A 5LP6B 3CCUV 4LCUC 4DV6B 4K0KO 4JYBA 4YJ3A 3I5DA 3STZC 1IBKO 1BSMA 5KUMA 1Q82W 3TJTA 5CB4A 1GAXA 1BT8A 2N74A 4BW9A 4NXMO 1FFXA 4YY3O 3JD0A 1N8RW 4CS4A 4DV7O 3ZMSA 3CCLV 2GBOA 1XNRB 3ZRSA 3H1LH 5JVDA 1NR1A 1D2DA 4TV9B 1NH2B 4LH6A 1TVKB 3OGCC 3FYIB 1MSDA 3L9DA 5AG2A 1JR9A 2A7WA 1E1RG 3DC6A 3B40A 4OGQB 2BCCH 3E22A 2Y0IA 3ZHSA 2BOBC 3QVNA 4PA4A 2LGQA 4PA7A 3TXSA 3WB2A 1ZUQA 4MVSA 2ITCC 5H6RA 4AQYO 1G4YB 4O4IB 1LR1A 3AG1C 3AG2C 1IBMO 1P7BA 5KHJA 3C3TA 1WLEA 3CJHA 4IHJB 3I55V 3AK1A 4XDLA 4JI3O 3TK1A 1EZJA 4JAAA 1F51A 1H38A 4UV9A 2Q4PA 1N0NA 2LFSA 1FPOA 3UT5B 4OX9B 4IGGA 4FPPA 2PGGA 2Q7GA 4DR6B 1MABG 3OTOO 1AR1B 1M57C 2EIJC 5JJNB 3LSUA 5IT9N 3L75H 4MTGA 3RGBA 3WB0A 2CGNA 4TWKA 1W0JG 2RDCA 1CP9A 2PY5A 4FLUA 2PZSA 1DF5A 5BR8O 4U3FH 4G28B 3MD0A 3EVKA 3KZIZ 3SPCA 4LF8B 4BIUA 1ZLZA 1THZA 1B04A 3HB3B 3ETEA 3OUFA 4TV8A 2A79B 2QKSA 4DV4O 1CXZB 2F95B 1CPYA 1H2KA 3BY6A 2WSSG 5JCOC 4JI6O 4GKJB 1N33O 5EIBC 5EBWC 4NYKA 4NVPA 2XAFA 1AR5A 4LF9B 1GTOA 4B7KA 1K8AW 1I0HA 1BZKA 1SZTA 2JGDB 1IZ3A 2RN9A 1VQMV 2RQ6A 1N36O 3CE2A 1NJIW 1K34A 4JTCB 4NTWA 2E75B 3TGUH 1V54B 2WPDG 2UXDB 1V9PA 2EX3A 4LFCO 2PYLA 4FM0A 1VQ6V 1KC8W 3U11A 3RYCA 2L6LA 3ABTA 1LNQA 1Y76B 4X65O 5B1NA 2YXYA 3AG3C 3BEHA 4PDMA 5B3SB 3CC7V 4FMTA 4WFGA 1R3IC 4JYAB 4JPRA 2DYSB 2UUCB 3RT3C 2P6JA 2ZIMA 4E2LA 1AJNA 4FM1A 2UXNA 2B9ZA 4LF5B 3CHXA 2P4VA 5D5QA 4I50A 4K0KB 4J10A 1N4CA 1JCHA 4YHHO 4O2AB 4QE7A 1COWG 1SQVH 4DV7B 3T1CA 1Q8IA 3WU2Z 1HR0O 4IYIA 3S3XA 1AR4A 4IIJB 1NTZH 5J2UB 2LP7A 1KKCA 4O4LA 5BXZA 1U96A 1WB8A 5KAFZ 4PDLA 1HNZO 1EZVH 1OCCB 4FVMA 3KG2A 3JASB 3OFNG 3BPZA 5EZYB 3SR2C 3OD4A 4CBCA 4A5UB 3K5OA 1VP7A 2Q6AA 1N34O 1FYJA 1I94O 1JQ0A 5DN6G 3D3QA 5HFLA 1VQ4V 3E89A 4K3AA 1OCOC 4ZKIA 4W4LA 5H6QA 1TUEB 1IBMB 3HKDB 3RYHB 4DK1A 2P90A 4FIPC 2Y4TA 2HVJC 2Z5UA 1K9MW 1EM1A 5KHKA 3CWBH 3N2KB 1Q90D 1HNWO 1Q6UA 4WFAV 2IJIA 2EIMC 5CA1B 4FLTA 2W6JG 3OTOB 1XOUA 2UXCO 4O4HB 1IBLB 1VQLV 3G80A 5A2QN 1XL4A 3ZS8C 1P4RA 4TV9A 3BAAA 1VMGA 1TVKA 2AGAA 4FK5C 3BA9A 4RAIA 2CUGA 1JX9A 3CXHF 3EHBB 4YJ3B 4EFBA 1XMOB 3RVZA 2OTJV 2OCCB 3K57A 5IWAO 2XUMA 1L0NH 4LBEC 2GSMB 3CCRV 4TUYA 5LOVB 1ROPA 1TA8A 3T1YO 5JVDB 4I9QA 4JTAB 1XBLA 4BIOA 5CA0A 3TETA 1EN6A 1W59A 3K5LA 5CMUA 2EZOA 1NZ6A 3IFXA 3E22B 1QLNA 1Q3EA 2X6BA 1FAFA 1KP2A 5JJJB 4AHCA 1GRJA 1OZ0A 4FFBB 3QNEA 3ABMB 2XASA 4NTYA 3JATA 3CPWU 1Y66A 4UVCA 4GX2A 2P7TC 2W6IG 3E83A 3UQ8A 3WG7C 1H2MA 5F2VO 3F5WC 4GLXA 3OR6C 3GWKC 3G71V 1B6QA 5L3FA 3ZHRA 4FLWA 1Z5WA 4DR4O 4DK0A 4WBNA 3KCYA 4Z1MG 1RFYA 4R8CA 4QPJA 1S5JA 2AZ0A 1GN2A 1SF9A 1A32A 1HDJA 3Q4HA 3CCQV 5EC2C 3P3NA 2FTKA 1OJHA 1S72V 3AK2A 4X20B 5DM6V 1DK1A 3T4ZA 4EEQA 4FFKA 3BRCA 3N2GA 4B3TO 2JK5C 3CRQA 2C2AA 3CD6V 4J41A 3H1IH 4TT3G 1SKVA 1QR8A 4XDKA 4J11A 1Q6HA 4TV8B 3SYOA 4Q20A 3ZCCA 4GKKO 2IJKA 5BMVB 1VF6C 1HR0B 1K7DA 1Y74A 3HKEA 3T4DA 5H9CA 3ABUA 4JI4B 4DV5B 4MVOA 3RW0A 4JI7B 5CBGA 3R66A 2WLIB 5LMUB 5IE9A 1BGYH 3HR0A 2HG5C 3CCJV 3RN4A 2EIKC 3CX5F 4GZRB 5L3GA 1Q81W 4RQEA 2ZKOA 1RSOA 1SZXA 1R6NA 1DTOA 4WFEA 1WP7A 5LA6A 4DUZO 1BS3A 1KU9A 4FZ1A 1VQ5V 2DW4A 5L3DA 1WA8A 5LHIA 2XOKG 1FXKC 3E35A 5KA5A 1BHAA 2CAZC 4MVUA 3STLC 3RYCB 1YITV 2QR4A 3JD2A 4Z1VA 4B3SB 2DWDC 3ASNB 1WN7A 4O2AA 2X6AA 1BQZA 3CRAA 1YDXA 4JV5O 2EZPA 2UXBO 3CCMV 4PI0A 2GDSA 4DV1B 4IL6Z 2A0LA 4FJCC 1I7FA 2UXCB 2NNUA 3AG4C 4DR3O 5J2UA 4R7CA 3DSQA 4LFBO 2GUZB 4DV0O 1VEWA 3H01A 2ZE6A 4QJFB 2UU9O 4X64B 1WP8A 3FFQA 3K5NA 3O65A 1HNXO 1HWYA 4HNAB 2YDEA 2HR3A 2EJ7A 1YEWA 3B4SA 2QM4A 3JD3A 1JFFA 1AROP 1H2NA 1G8MA 1NI8A 2ADPA 1KUQA 1ORQC 2DMXA 4X1KA 3BABA 5C93A 2P67A 2ZR3A 3HKDA 4JI1O 2A3QA 1R73A 4U3JB 2WWWA 3ZHUA 2VRZA 1SA0A 4H0LB 2QKAA 5KHGA 4E4EA 2AW9A 4I0XA 3L73H 4AI8A 3SDLA 1XL6A 4QPKA 4B3RO 1MZFA 4O4HA 2XAGA 3S3WA 2QA4V 2H3OA 2YC0A 2QTSA 2WLLB 3HPLC 4WFFA 1ENVA 2E3CA 3ZHQA 4MS2A 4PI2A 1QU7A 2OWOA 4W4KA 1VF5B 1Q7YW 4X1YB 4JI2O 5LOVA 3ABKC 3CRRA 1US6A 4D7SA 1KMIZ 4DR4B 3WFVA 2Q5ZA 3ETDA 2QJ1A 4OPHA 2B1IA 1MA1A 4JI0O 4DRXA 2ZE5A 4U7NA 1E1QG 3JYCA 3DXRA 3A0HZ 4ICGA 5L3BA 2Z3YA 4TUYB 5KUKA 4D6TH 1M9NA 4X66B 3LDDA 4QIWF 3IC9A 4B3MO 1FJGB 4DV3O 4FFBA 3THOA 4GKKB 4D7TA 1UFIA 3HKBB 4GX5A 4BIZA 3AG7A 2UUAB 1AI6A 5KHHA 5CA0B 1NKDA 2E5LB 3WG7B 2HHHO 1AVMA 4F6EA 2QWQB 3SYPA 2XT9A 2YICA 4DW1A 4FM2A
chains in the Genus database with same CATH topology
4GKJO 3J81N 3T1YO 4K0KO 5BY1A 1IBKO 1XNRO 4JI8O 3R66A 1HR0O 4LF9O 2N74A 2UUBO 4NXMO 4LF8O 4DV4O 4YY3O 4DV7O 4DR5O 1F7YA 1FKAO 2ZKOA 5BXZA 3M8AA 3SDLA 4JI6O 1N33O 1HNZO 4OPAA 5H5NA 4B3RO 1N32O 2VQFO 1XNQO 4DUZO 2VQEO 1J5EO 5FLXN 1D2DA 4B3SO 4A5UB 2Z0AA 1N34O 1FYJA 4DR2O 1I94O 4DR1O 1X59A 2UXDO 1N36O 1AB3A 4DV1O 1R6TA 3F5TA 4LF6O 2JRIA 4LFAO 4JI2O 4DR7O 4LF4O 2ZM6O 2F4VO 4JV5O 2UXBO 4OPHA 4LFCO 4AQYO 1AILA 1IBLO 1IBMO 3J80N 4LF7O 5LL6Y 4X64O 3JAMN 4DR4O 4DR3O 4JYAO 4JI0O 2LW7A 2UUCO 4X66O 1HNWO 4DR6O 1FJGO 1G1XB 4JI3O 4X65O 1YZBA 4LFBO 4DV0O 1XMOO 4LF5O 1A32A 2UXCO 1NS1A 1XEQA 4JI5O 5A2QN 2UUAO 2UU9O 2E5LO 5LMNO 3O65A 3T1HO 1HNXO 1DK1A 2DJVA 3RT3C 2AGAA 4B3MO 3OTOO 4B3TO 4DV3O 4OX9O 4JI4O 4DV5O 5IT9N 1R1BA 1XMQO 4DV6O 3J7AU 2DOSA 4KHPO 4JI7O 5IWAO 4DV2O 2HHHO 4DUYO 5LMUO 2FKXA 4NXNO 4YHHO 4GKKO 1KUQA 5BR8O 4X62O 4JI1O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  3J81 N;  3T1Y O;  4K0K O;  5BY1 A;  1IBK O;  1XNR O;  4JI8 O;  3R66 A;  1HR0 O;  4LF9 O;  2N74 A;  2UUB O;  4NXM O;  4LF8 O;  4DV4 O;  4YY3 O;  4DV7 O;  4DR5 O;  1F7Y A;  1FKA O;  2ZKO A;  5BXZ A;  3M8A A;  3SDL A;  4JI6 O;  1N33 O;  1HNZ O;  4OPA A;  5H5N A;  4B3R O;  1N32 O;  2VQF O;  1XNQ O;  4DUZ O;  2VQE O;  1J5E O;  5FLX N;  1D2D A;  4B3S O;  4A5U B;  2Z0A A;  1N34 O;  1FYJ A;  4DR2 O;  1I94 O;  4DR1 O;  1X59 A;  2UXD O;  1N36 O;  1AB3 A;  4DV1 O;  1R6T A;  3F5T A;  4LF6 O;  2JRI A;  4LFA O;  4JI2 O;  4DR7 O;  4LF4 O;  2ZM6 O;  2F4V O;  4JV5 O;  2UXB O;  4OPH A;  4LFC O;  4AQY O;  1AIL A;  1IBL O;  1IBM O;  3J80 N;  4LF7 O;  5LL6 Y;  4X64 O;  3JAM N;  4DR4 O;  4DR3 O;  4JYA O;  4JI0 O;  2LW7 A;  2UUC O;  4X66 O;  1HNW O;  4DR6 O;  1FJG O;  1G1X B;  4JI3 O;  4X65 O;  1YZB A;  4LFB O;  4DV0 O;  1XMO O;  4LF5 O;  1A32 A;  2UXC O;  1NS1 A;  1XEQ A;  4JI5 O;  5A2Q N;  2UUA O;  2UU9 O;  2E5L O;  5LMN O;  3O65 A;  3T1H O;  1HNX O;  1DK1 A;  2DJV A;  3RT3 C;  2AGA A;  4B3M O;  3OTO O;  4B3T O;  4DV3 O;  4OX9 O;  4JI4 O;  4DV5 O;  5IT9 N;  1R1B A;  1XMQ O;  4DV6 O;  3J7A U;  2DOS A;  4KHP O;  4JI7 O;  5IWA O;  4DV2 O;  2HHH O;  4DUY O;  5LMU O;  2FKX A;  4NXN O;  4YHH O;  4GKK O;  1KUQ A;  5BR8 O;  4X62 O;  4JI1 O; 
#chains in the Genus database with same CATH topology
 2IM9 A;  5J9P C;  3J81 N;  1SQF A;  3JAL A;  4IT5 A;  1R6K A;  4PA6 A;  1OCR C;  1OV9 A;  4LP8 A;  4G2K A;  4DV2 B;  2H8P C;  5JCO A;  3RYF B;  1YSC A;  4DUY B;  1SRY A;  3K03 A;  2UUB O;  2PUS A;  4DUZ B;  3CP1 A;  3UKM A;  3OE7 G;  1V55 B;  2YIA A;  3AEI A;  3M8A A;  3JAT B;  1YI2 V;  1S76 D;  4X1I A;  1QR9 A;  2XTA A;  2VQF O;  4JI8 B;  1UJW B;  2H94 A;  3ZMU A;  1M93 A;  1R3K C;  2JGU A;  4X20 A;  4ASU G;  2ZDI C;  3ZMV A;  3MHS C;  1PNL A;  2YUA A;  2A9H A;  2V1D A;  4DR1 O;  1M56 C;  2G38 A;  5EBL C;  3TCU A;  1ZX3 A;  1Q43 A;  4JV5 B;  4WBN B;  4ZIB A;  5BMV A;  1URF A;  2K9P A;  2DYR C;  3H1J H;  1PL0 A;  2WLH A;  3W7W A;  4LFA O;  1I08 A;  1RPR A;  4RUF A;  3Q4H B;  3TXQ A;  4PDV A;  3CB2 A;  3ZJZ A;  2EIK B;  1QQC A;  3N2G B;  2WLI A;  2L35 A;  2ZCE A;  5B1B B;  4LF6 B;  1WPX A;  5K1X A;  3IGA C;  4DR7 B;  5LHH A;  3SJC C;  4PV1 B;  1PNK A;  2JEU A;  4EB6 B;  4JI5 O;  2X0L A;  4FLY A;  2X7R B;  1Y74 B;  2NLJ C;  3HKE B;  5LMN O;  1XHZ A;  1K33 A;  2WLN A;  3RFR A;  2MW2 B;  1I5Y A;  4WCE V;  2OIG A;  1XMQ O;  2JS5 A;  1NH2 D;  1S3J A;  1ZSP A;  5KHI A;  3K5M A;  3E8G A;  5JJE B;  2B5U A;  1M1K W;  2D2C B;  3JAK B;  3L72 H;  1RSO B;  3R65 A;  5LA6 B;  3ABL C;  3D36 C;  5IYD O;  4WF9 V;  1WA8 B;  2ZXW C;  4JAU A;  3BFR A;  5KMG B;  1YJW V;  2F43 G;  1F4N A;  1PPJ H;  4JAS A;  4I5S A;  1RM1 C;  4CS2 A;  2IU3 A;  1NR7 A;  2YEV B;  2E76 B;  2WLK A;  2GUZ A;  5KLV H;  4OPA A;  5IJ9 A;  1N32 O;  1IBK B;  4QNH B;  3BA8 A;  1J5E O;  4J42 A;  3ZX6 A;  3K0G A;  2VQE O;  2Q8V A;  4NXM B;  5L3C A;  1RP3 B;  3ZN0 A;  4HNA A;  4YY3 B;  5ITZ A;  2GTS A;  5IYC O;  1XHX A;  3L71 H;  1SC5 B;  2A06 H;  3K9S A;  2P4K A;  4KP4 A;  4Z2W A;  1AB3 A;  1YVW A;  3A8T A;  4JGS A;  3OM3 B;  2V7Q G;  2EIN C;  3QG5 A;  2XND G;  5CN0 A;  1J95 A;  4LF4 O;  2ZM6 O;  2F4V O;  3K58 A;  4K8Z A;  4U3J A;  1W0K G;  1JJO A;  1G6U A;  3J80 N;  2Y4U A;  1IXB A;  3FD9 A;  1JFF B;  2E74 B;  3LDC A;  5E1A C;  4B3M B;  4AQY B;  3G6B A;  2LJ2 A;  4DV3 B;  3FYE B;  4U7O A;  1QNM A;  4X1K B;  4MVZ A;  4CH6 A;  1XEQ A;  4YIO A;  1NVP B;  4G27 B;  4MVR A;  2Y69 C;  1EFR G;  2WLL A;  2HHH B;  4NR1 A;  4JI3 B;  4ABM A;  4GX0 A;  1QCE A;  3B09 A;  1SA0 B;  1Y67 A;  3OMN B;  3OMA B;  1F4M A;  4P30 A;  1ZWI C;  2ZE7 A;  4PHZ A;  2KG7 A;  2JVD A;  5FNV A;  1GM9 A;  2PF4 E;  4I0X B;  4UXN A;  1OCZ C;  4X1Y A;  3ZRW B;  4BR6 A;  3K0D A;  3LSQ A;  3SJB C;  3MHH C;  2LGW A;  2P22 C;  2F1M A;  3A2F A;  2CTW A;  4LH7 A;  1VQ9 V;  3X2Q C;  2UXX A;  5BR8 B;  1NQT A;  2BSK B;  3UCS C;  4DO2 A;  4DR5 O;  5CBF A;  5JQG A;  3FB7 C;  1XNQ O;  1SS3 A;  1E79 G;  1HP8 A;  3AG1 B;  3AG2 B;  3APO A;  5IYZ A;  3ML0 A;  4RWU A;  4CC6 A;  4DV4 B;  3BCC H;  2HFE C;  2YXL A;  5LP6 C;  4J7Z A;  4JI6 B;  1D5A A;  1N33 B;  1Y4M A;  3HKB A;  1B06 A;  4LFA B;  4ZI7 A;  3QTC A;  4YIP A;  3OEE G;  4UVB A;  5GTH Z;  3DC5 A;  3ZMZ A;  4DRX B;  1PP9 H;  2JRI A;  3MDS A;  3P3P A;  1NTK H;  1OCR B;  3DXR B;  4PD4 F;  3I56 V;  1M57 B;  3K79 A;  1HW7 A;  1N36 B;  3H9V A;  2EIJ B;  1MZE A;  3RYF A;  2YI9 A;  1GO3 F;  2ZNJ A;  4FLV A;  1SQG A;  2Y0P A;  1Z5V A;  4JTD B;  3CME V;  3CCS V;  1YZB A;  1XI1 A;  4LFC B;  4H13 B;  2EUL A;  2QSA A;  1WPB A;  3CYO A;  2PTM A;  4CH5 A;  2RJZ A;  3JAL B;  4X65 B;  2RMK B;  2IJJ A;  4J9Z B;  1R3L C;  4BAY A;  1KQS U;  2DYR B;  3W7X A;  1VF6 A;  4DV6 O;  3CC2 V;  2ILM A;  4RO2 A;  2Q7E A;  5L3E A;  2QEX V;  4DW0 A;  2KSD A;  5FPR A;  1K92 A;  2Q69 A;  4X8A A;  4UCS A;  4X1I B;  1AI4 A;  1YTF B;  2DE0 X;  2CDY A;  4H44 B;  1JVM A;  1K4C C;  1PD3 A;  4HAM A;  5BY1 A;  2QM8 A;  1XNR O;  4YHH B;  2LQT A;  3FKS G;  1NVP D;  3GB7 C;  1X4T A;  1MNG A;  5B1A C;  2BTQ A;  1XRE A;  2CE4 A;  1FXK A;  2PI5 A;  4EB6 A;  4KUM A;  2Q7H A;  3QO7 A;  3UO2 A;  1HNZ B;  4MW3 A;  1I5X A;  3AG3 B;  2F4V B;  4J9Y B;  4TQF A;  3RBZ A;  2R72 A;  3ABL B;  3JAK A;  4NKG B;  3F5T A;  2AHZ A;  1RPO A;  1N34 B;  1I94 B;  1SQP H;  3OAA G;  1MMM A;  4N23 A;  3B2E E;  1MG1 A;  2LW1 A;  1GM7 A;  1AIL A;  4R50 A;  1KD1 W;  5A9G A;  5EK0 A;  4JZG A;  5LGT A;  5KMG A;  4L87 A;  1IDS A;  5LHG A;  1SES A;  1T5E A;  2YEV A;  3JD1 A;  4XDJ A;  3LUT B;  2HJD A;  4DR6 O;  2VS0 A;  4XBF A;  3M99 B;  1DF4 A;  2VWK A;  2DQ0 A;  3VQX A;  1TUB B;  1V54 C;  2JEX A;  2QWN B;  5LYJ A;  1P84 F;  1HNW B;  3BVO A;  1JMK C;  2Q73 A;  2Q0O C;  4LNU B;  4LWS B;  5J2T A;  3FAV B;  1AJP A;  2F23 A;  5GON A;  1S0V A;  4QGP A;  2FKX A;  1YHQ V;  2Q68 A;  4PA3 A;  5IJ9 B;  1MOF A;  3JAW A;  1GK9 A;  1FD9 A;  1M90 W;  2F93 B;  4CZZ A;  4X62 O;  4UCV A;  2OCH A;  4GKJ O;  3A0R A;  5B3S C;  5IWA B;  5ITZ B;  2W0X A;  4LF9 O;  2ITD C;  3A0B Z;  1OCO B;  1YXB A;  2JIZ G;  4N21 A;  3T1Y B;  2CTP A;  2Y69 B;  2ADQ B;  5EIB D;  2Q67 A;  4JYC A;  1JOY A;  3VBB A;  5IDJ A;  4H33 A;  1AP6 A;  3VQW A;  1KB9 F;  2WAM A;  1K97 A;  3U0Z A;  1YTF D;  3ICX A;  1GN6 A;  4GUN A;  2EIM B;  1SQQ H;  1YIJ V;  2UXD O;  4J80 A;  5IJ0 B;  1R6T A;  2QKC A;  3ZRW A;  4P9O A;  1W2B U;  1VQO V;  4WFH A;  2QE7 G;  3X2Q B;  2CK3 G;  1OCC C;  3GVM A;  3CRM A;  4MSW C;  5K1P A;  1IVS A;  1DGS A;  3IJ4 A;  4MTF A;  1QLE C;  3ASO C;  2D3O W;  5LL6 Y;  5FPO A;  2BSK A;  4JYA O;  1BHB A;  2UUC O;  3OTF A;  2P06 A;  2IU0 A;  2KG7 B;  5FNV B;  1SQX H;  1IXM A;  4LF5 O;  1XUQ A;  2LFR A;  2QDO A;  1QVF U;  1VQN V;  1GKF A;  3E8B A;  1QBZ A;  4QE9 A;  3ZIA G;  2DN9 A;  2NR5 A;  3SJA C;  1XDC A;  1YJ9 V;  4MT8 A;  3W7T A;  4H37 A;  2DOS A;  3F7Y C;  3QO8 A;  2K1E A;  3PJS K;  5B5E Z;  5JQG B;  4B3T B;  2ZIN A;  1PV0 A;  3E86 A;  2OIE A;  2ZNI A;  5EBM C;  4UFZ A;  5IYZ B;  1M4U A;  3C3S A;  5KX5 B;  4RQF A;  2HP8 A;  3KKY A;  3OUS A;  4AIL C;  4GX1 A;  4ZHQ B;  4MVM A;  3ETG A;  2YXH A;  4ZI7 B;  4P2Z A;  1Z2G A;  2OCC C;  2ZDI A;  1WJZ A;  4FZ0 A;  1Q6I A;  1BE3 H;  1SQB H;  2GTA A;  3B77 A;  3SYC A;  4K35 A;  2ARH A;  2WLM A;  3KCX A;  1BCC H;  2EIL C;  1EN5 A;  1H8H G;  2ODM A;  3RYI B;  3MAQ A;  2IBZ H;  5EC1 C;  1DLB A;  2IW5 A;  2KQX A;  5IY5 C;  1NT2 B;  2Q0A A;  4FLZ A;  4PEL A;  4P9P A;  5HFM A;  3K59 A;  3LDE A;  2QM7 A;  3K04 A;  3O9O A;  1AJQ A;  1D5N A;  1EN4 A;  1IBL O;  5B1A B;  5BZB A;  1S5H C;  2ZD9 A;  4PDR A;  4GYC B;  2W0F C;  3SYQ A;  1VQ8 V;  2UXB B;  2JJ2 G;  3ABM C;  4B08 A;  1XMO O;  1ZL8 A;  1VQK V;  2EBO A;  4TSF G;  3VOU A;  1ZTE A;  4DR3 B;  2JS3 A;  2BOC C;  1H2L A;  2V4D A;  3JSL A;  2YIB A;  4LFB B;  4DV0 B;  1VAR A;  1SER A;  1IX9 A;  2BTO A;  4IYH A;  4X62 B;  3OEH G;  2Q9L A;  4KHP O;  2UU9 B;  2IH1 C;  2YID A;  5H2F Z;  1HNX B;  2KKW A;  3D36 A;  3APQ A;  4NXN O;  2BTQ B;  1EBO A;  1FXK B;  3L74 H;  2ZQM A;  1KEC A;  4L8J A;  2M7W A;  2BE3 A;  3LSS A;  4ZBM A;  2EJR A;  1YF2 A;  5LGU A;  4UVA A;  4CH4 A;  1H2G A;  2XAQ A;  3FB5 C;  2R9A A;  5JH7 B;  4ZOL A;  4TQD A;  4KL1 A;  4JI1 B;  2DWE C;  3RWR D;  3JAR A;  1TUB A;  3VQY A;  3AG4 B;  3IAY A;  1LUV A;  1QHT A;  1K5Q A;  4DR2 O;  2OT5 A;  4LNU A;  4LWS A;  3T2M A;  4DXW A;  4B3R B;  3FAV A;  3NR7 A;  3ZRX A;  4O2B A;  2CH7 B;  3WB1 A;  3RVY A;  1FXH A;  3CXC U;  3N27 A;  3H1K H;  4PJ0 Z;  1PL4 A;  1Y6X A;  2HLD G;  5LYJ B;  3UM7 A;  4LR3 A;  4EFE A;  1R3J C;  3ZN1 A;  4CS3 A;  3D8C A;  3G6E V;  4LF7 O;  4GT1 A;  1U97 A;  4JI2 B;  3NXS A;  2LW7 A;  4MW8 A;  1P7G A;  5J2T B;  4NB5 A;  5GON B;  1PM9 A;  5C8Y B;  3JAW B;  2R9R B;  3ASN C;  4I55 A;  4JI0 B;  1CEZ A;  4I9W A;  1FS0 G;  4CH3 A;  1OHH G;  4FLX A;  4JI4 O;  3HKC A;  4DV5 O;  5IJ0 A;  2MK3 A;  3SPG A;  3PN1 A;  1AI5 A;  2IH3 C;  4YXW G;  4JI7 O;  4F6R A;  1KBH A;  2F66 C;  3JCZ A;  5LMU O;  5GW7 A;  2VWJ A;  1QLE B;  1O9G A;  3ASO B;  4O4J A;  4YJ2 B;  1BMF G;  2LO1 A;  3EXA A;  4JAV A;  2HEP A;  3CC4 V;  1XIL A;  1JPX A;  3OT7 A;  4HBN A;  2FB5 A;  2JDI G;  3IC7 A;  1FXV A;  3FX7 A;  1F7Y A;  1PNM A;  1ZAU A;  4I4T B;  3ABK B;  4JYY A;  3JD4 A;  2Y48 A;  2FML A;  1N0J A;  5LXT B;  1K73 W;  5LP6 A;  2KB1 A;  2UUB B;  5EYP B;  4B3S O;  3ZHT A;  5CA3 A;  2PI4 A;  3ETQ A;  3EFF K;  1AP5 A;  4UCR A;  4UUJ C;  2VQF B;  5GTI Z;  4UB8 Z;  3P32 A;  2OTL V;  4DV1 O;  2R70 A;  1GN4 A;  3BHP A;  1K5S A;  1GMG A;  2PYJ A;  4I7Z B;  4DR1 B;  2ZT9 B;  1L0L H;  5KX5 A;  3DGE A;  1VF7 A;  4ZHQ A;  5CB4 B;  4UB6 Z;  5LGN A;  3JAM N;  4X64 O;  4KXR A;  5KA6 A;  1FFX B;  3CRC A;  1M5I A;  3M7M X;  3QF7 A;  3OR7 C;  1WB7 A;  1MSW D;  2XAJ A;  2N05 A;  1F23 A;  3D3I A;  3JSN A;  3CCE V;  5IYB O;  1VQP V;  3T1H O;  4O4I A;  1NBM G;  2GV9 A;  2O57 A;  2DJV A;  3L70 H;  3CCV V;  4KHP B;  4X9Q A;  2EIL B;  3SPH A;  3JCU Z;  4NXN B;  3H1H H;  4UCT A;  4IHJ A;  1WAZ A;  1KP3 A;  4JI5 B;  2JJ1 G;  3RYI A;  5IY5 B;  1K4D C;  1UPG A;  5LMN B;  4B7E A;  4MVQ A;  2CTR A;  1QVG U;  3UT5 A;  3ZBH A;  2N04 A;  4UV8 A;  1XMQ B;  3K3W A;  5KAI Z;  1M56 B;  4DYL A;  4TOI A;  3K9A A;  1NU1 H;  2HKO A;  4CC5 A;  2P5O A;  3CJH B;  4C7U A;  3QO5 A;  1K3E A;  1FKA O;  2IJH A;  4DR2 B;  1IUR A;  2RCV A;  4PA9 A;  4HYO A;  2XAH A;  1BL8 A;  1PKX A;  4MTX A;  1H8E G;  2AXT Z;  1N32 B;  1X59 A;  1L8D A;  2QWR B;  2DQ3 A;  1J5E B;  2VQE B;  2FYU H;  5DED A;  3ZRV A;  2GHY A;  4LF7 B;  1V55 C;  1AI7 A;  4X89 A;  1ZL8 B;  4UCO A;  2YSU B;  3ZED A;  4JF3 A;  1S5L Z;  1O9H A;  1B3Q A;  5TIS Z;  2JGD A;  5FL7 G;  3E2E A;  1GM8 A;  5JH7 A;  2ZIO A;  4X66 O;  4LF4 B;  2AHY A;  2ZM6 B;  1FJG O;  4BW5 A;  1JA8 A;  3W7U A;  3G4S V;  2M6Y A;  2UUA O;  2ETN A;  3FB8 C;  3CSX A;  3CS5 A;  1Q86 W;  2E5L O;  2ZXW B;  4K8X A;  2WA3 A;  3K08 A;  3OGI B;  1RM1 B;  1NTM H;  2ATK C;  1L1F A;  3SJQ C;  5E79 Z;  3E8F A;  2QGN A;  2QTO A;  1YJN V;  3SPJ A;  4Q6G A;  4OX9 O;  2QWO B;  3SYA A;  2CH7 A;  3J7A U;  1Y76 A;  4KFM A;  5B1B C;  4DV2 O;  4ZOL B;  3UO3 A;  4DUY O;  2HJF C;  2WA4 A;  1JJ2 U;  3JAR B;  5LBQ A;  1LUW A;  1VQ7 V;  1FFT B;  4JI8 O;  3CMA V;  3ZMT A;  3DTU B;  4LF8 O;  4O2B B;  1KYO F;  3GWO A;  3K06 A;  2EIN B;  4J7K A;  2XHB A;  5C8Y A;  5H5N A;  2R9I A;  4GCZ A;  3B8N A;  5D5P A;  5DEC A;  3FB6 C;  3ZHV A;  2RNB A;  2WLJ A;  4RUE A;  5FLX N;  1KKD A;  3F7V C;  2AZ2 A;  1BQ0 A;  2Z0A A;  4DR5 B;  4WFB V;  2OYQ A;  4IIJ A;  2DYS C;  2FL4 A;  5B66 Z;  3CEI A;  1XNQ B;  1SET A;  4MTO A;  1S77 D;  1GN3 A;  2CGO A;  4I50 B;  4X88 A;  3JAS A;  2HVK C;  4LF6 O;  1VIB A;  5EZY A;  4EKW A;  5CBH A;  1H2S B;  4YJ2 A;  4DR7 O;  5B1O A;  3LNN A;  4F4L A;  3P30 A;  4LC1 A;  4I55 B;  3SPI A;  4BWA A;  3OW2 U;  3HKC B;  3OMI B;  1OCZ B;  3W7S A;  4I4T A;  3T1H B;  1G1X B;  3LNM B;  3E8H A;  1TAE A;  4O4L B;  4HZ3 A;  3U10 A;  4F6R B;  4UCU A;  5LXT A;  1P49 A;  1NS1 A;  3VQV A;  3C90 A;  3RYH A;  5EYP A;  3AK3 A;  4O4J B;  1YCI A;  4JZ2 A;  1WNS A;  2ZE8 A;  4R6Z A;  3N2K A;  1Q5O A;  2ZR2 A;  2YS8 A;  2QWP B;  1R1B A;  4NTX A;  3SGI A;  3G67 A;  5CA1 A;  4J7J A;  2CTQ A;  1GH6 A;  4OXS A;  1TGO A;  1XQ8 A;  2X6C A;  2NN4 A;  3B8M A;  2B1G A;  5JWP A;  2YIB D;  2YI8 A;  5LP6 B;  3CCU V;  4LCU C;  4DV6 B;  4K0K O;  4JYB A;  4YJ3 A;  3I5D A;  3STZ C;  1IBK O;  1BSM A;  5KUM A;  1Q82 W;  3TJT A;  5CB4 A;  1GAX A;  1BT8 A;  2N74 A;  4BW9 A;  4NXM O;  1FFX A;  4YY3 O;  3JD0 A;  1N8R W;  4CS4 A;  4DV7 O;  3ZMS A;  3CCL V;  2GBO A;  1XNR B;  3ZRS A;  3H1L H;  5JVD A;  1NR1 A;  1D2D A;  4TV9 B;  1NH2 B;  4LH6 A;  1TVK B;  3OGC C;  3FYI B;  1MSD A;  3L9D A;  5AG2 A;  1JR9 A;  2A7W A;  1E1R G;  3DC6 A;  3B40 A;  4OGQ B;  2BCC H;  3E22 A;  2Y0I A;  3ZHS A;  2BOB C;  3QVN A;  4PA4 A;  2LGQ A;  4PA7 A;  3TXS A;  3WB2 A;  1ZUQ A;  4MVS A;  2ITC C;  5H6R A;  4AQY O;  1G4Y B;  4O4I B;  1LR1 A;  3AG1 C;  3AG2 C;  1IBM O;  1P7B A;  5KHJ A;  3C3T A;  1WLE A;  3CJH A;  4IHJ B;  3I55 V;  3AK1 A;  4XDL A;  4JI3 O;  3TK1 A;  1EZJ A;  4JAA A;  1F51 A;  1H38 A;  4UV9 A;  2Q4P A;  1N0N A;  2LFS A;  1FPO A;  3UT5 B;  4OX9 B;  4IGG A;  4FPP A;  2PGG A;  2Q7G A;  4DR6 B;  1MAB G;  3OTO O;  1AR1 B;  1M57 C;  2EIJ C;  5JJN B;  3LSU A;  5IT9 N;  3L75 H;  4MTG A;  3RGB A;  3WB0 A;  2CGN A;  4TWK A;  1W0J G;  2RDC A;  1CP9 A;  2PY5 A;  4FLU A;  2PZS A;  1DF5 A;  5BR8 O;  4U3F H;  4G28 B;  3MD0 A;  3EVK A;  3KZI Z;  3SPC A;  4LF8 B;  4BIU A;  1ZLZ A;  1THZ A;  1B04 A;  3HB3 B;  3ETE A;  3OUF A;  4TV8 A;  2A79 B;  2QKS A;  4DV4 O;  1CXZ B;  2F95 B;  1CPY A;  1H2K A;  3BY6 A;  2WSS G;  5JCO C;  4JI6 O;  4GKJ B;  1N33 O;  5EIB C;  5EBW C;  4NYK A;  4NVP A;  2XAF A;  1AR5 A;  4LF9 B;  1GTO A;  4B7K A;  1K8A W;  1I0H A;  1BZK A;  1SZT A;  2JGD B;  1IZ3 A;  2RN9 A;  1VQM V;  2RQ6 A;  1N36 O;  3CE2 A;  1NJI W;  1K34 A;  4JTC B;  4NTW A;  2E75 B;  3TGU H;  1V54 B;  2WPD G;  2UXD B;  1V9P A;  2EX3 A;  4LFC O;  2PYL A;  4FM0 A;  1VQ6 V;  1KC8 W;  3U11 A;  3RYC A;  2L6L A;  3ABT A;  1LNQ A;  1Y76 B;  4X65 O;  5B1N A;  2YXY A;  3AG3 C;  3BEH A;  4PDM A;  5B3S B;  3CC7 V;  4FMT A;  4WFG A;  1R3I C;  4JYA B;  4JPR A;  2DYS B;  2UUC B;  3RT3 C;  2P6J A;  2ZIM A;  4E2L A;  1AJN A;  4FM1 A;  2UXN A;  2B9Z A;  4LF5 B;  3CHX A;  2P4V A;  5D5Q A;  4I50 A;  4K0K B;  4J10 A;  1N4C A;  1JCH A;  4YHH O;  4O2A B;  4QE7 A;  1COW G;  1SQV H;  4DV7 B;  3T1C A;  1Q8I A;  3WU2 Z;  1HR0 O;  4IYI A;  3S3X A;  1AR4 A;  4IIJ B;  1NTZ H;  5J2U B;  2LP7 A;  1KKC A;  4O4L A;  5BXZ A;  1U96 A;  1WB8 A;  5KAF Z;  4PDL A;  1HNZ O;  1EZV H;  1OCC B;  4FVM A;  3KG2 A;  3JAS B;  3OFN G;  3BPZ A;  5EZY B;  3SR2 C;  3OD4 A;  4CBC A;  4A5U B;  3K5O A;  1VP7 A;  2Q6A A;  1N34 O;  1FYJ A;  1I94 O;  1JQ0 A;  5DN6 G;  3D3Q A;  5HFL A;  1VQ4 V;  3E89 A;  4K3A A;  1OCO C;  4ZKI A;  4W4L A;  5H6Q A;  1TUE B;  1IBM B;  3HKD B;  3RYH B;  4DK1 A;  2P90 A;  4FIP C;  2Y4T A;  2HVJ C;  2Z5U A;  1K9M W;  1EM1 A;  5KHK A;  3CWB H;  3N2K B;  1Q90 D;  1HNW O;  1Q6U A;  4WFA V;  2IJI A;  2EIM C;  5CA1 B;  4FLT A;  2W6J G;  3OTO B;  1XOU A;  2UXC O;  4O4H B;  1IBL B;  1VQL V;  3G80 A;  5A2Q N;  1XL4 A;  3ZS8 C;  1P4R A;  4TV9 A;  3BAA A;  1VMG A;  1TVK A;  2AGA A;  4FK5 C;  3BA9 A;  4RAI A;  2CUG A;  1JX9 A;  3CXH F;  3EHB B;  4YJ3 B;  4EFB A;  1XMO B;  3RVZ A;  2OTJ V;  2OCC B;  3K57 A;  5IWA O;  2XUM A;  1L0N H;  4LBE C;  2GSM B;  3CCR V;  4TUY A;  5LOV B;  1ROP A;  1TA8 A;  3T1Y O;  5JVD B;  4I9Q A;  4JTA B;  1XBL A;  4BIO A;  5CA0 A;  3TET A;  1EN6 A;  1W59 A;  3K5L A;  5CMU A;  2EZO A;  1NZ6 A;  3IFX A;  3E22 B;  1QLN A;  1Q3E A;  2X6B A;  1FAF A;  1KP2 A;  5JJJ B;  4AHC A;  1GRJ A;  1OZ0 A;  4FFB B;  3QNE A;  3ABM B;  2XAS A;  4NTY A;  3JAT A;  3CPW U;  1Y66 A;  4UVC A;  4GX2 A;  2P7T C;  2W6I G;  3E83 A;  3UQ8 A;  3WG7 C;  1H2M A;  5F2V O;  3F5W C;  4GLX A;  3OR6 C;  3GWK C;  3G71 V;  1B6Q A;  5L3F A;  3ZHR A;  4FLW A;  1Z5W A;  4DR4 O;  4DK0 A;  4WBN A;  3KCY A;  4Z1M G;  1RFY A;  4R8C A;  4QPJ A;  1S5J A;  2AZ0 A;  1GN2 A;  1SF9 A;  1A32 A;  1HDJ A;  3Q4H A;  3CCQ V;  5EC2 C;  3P3N A;  2FTK A;  1OJH A;  1S72 V;  3AK2 A;  4X20 B;  5DM6 V;  1DK1 A;  3T4Z A;  4EEQ A;  4FFK A;  3BRC A;  3N2G A;  4B3T O;  2JK5 C;  3CRQ A;  2C2A A;  3CD6 V;  4J41 A;  3H1I H;  4TT3 G;  1SKV A;  1QR8 A;  4XDK A;  4J11 A;  1Q6H A;  4TV8 B;  3SYO A;  4Q20 A;  3ZCC A;  4GKK O;  2IJK A;  5BMV B;  1VF6 C;  1HR0 B;  1K7D A;  1Y74 A;  3HKE A;  3T4D A;  5H9C A;  3ABU A;  4JI4 B;  4DV5 B;  4MVO A;  3RW0 A;  4JI7 B;  5CBG A;  3R66 A;  2WLI B;  5LMU B;  5IE9 A;  1BGY H;  3HR0 A;  2HG5 C;  3CCJ V;  3RN4 A;  2EIK C;  3CX5 F;  4GZR B;  5L3G A;  1Q81 W;  4RQE A;  2ZKO A;  1RSO A;  1SZX A;  1R6N A;  1DTO A;  4WFE A;  1WP7 A;  5LA6 A;  4DUZ O;  1BS3 A;  1KU9 A;  4FZ1 A;  1VQ5 V;  2DW4 A;  5L3D A;  1WA8 A;  5LHI A;  2XOK G;  1FXK C;  3E35 A;  5KA5 A;  1BHA A;  2CAZ C;  4MVU A;  3STL C;  3RYC B;  1YIT V;  2QR4 A;  3JD2 A;  4Z1V A;  4B3S B;  2DWD C;  3ASN B;  1WN7 A;  4O2A A;  2X6A A;  1BQZ A;  3CRA A;  1YDX A;  4JV5 O;  2EZP A;  2UXB O;  3CCM V;  4PI0 A;  2GDS A;  4DV1 B;  4IL6 Z;  2A0L A;  4FJC C;  1I7F A;  2UXC B;  2NNU A;  3AG4 C;  4DR3 O;  5J2U A;  4R7C A;  3DSQ A;  4LFB O;  2GUZ B;  4DV0 O;  1VEW A;  3H01 A;  2ZE6 A;  4QJF B;  2UU9 O;  4X64 B;  1WP8 A;  3FFQ A;  3K5N A;  3O65 A;  1HNX O;  1HWY A;  4HNA B;  2YDE A;  2HR3 A;  2EJ7 A;  1YEW A;  3B4S A;  2QM4 A;  3JD3 A;  1JFF A;  1ARO P;  1H2N A;  1G8M A;  1NI8 A;  2ADP A;  1KUQ A;  1ORQ C;  2DMX A;  4X1K A;  3BAB A;  5C93 A;  2P67 A;  2ZR3 A;  3HKD A;  4JI1 O;  2A3Q A;  1R73 A;  4U3J B;  2WWW A;  3ZHU A;  2VRZ A;  1SA0 A;  4H0L B;  2QKA A;  5KHG A;  4E4E A;  2AW9 A;  4I0X A;  3L73 H;  4AI8 A;  3SDL A;  1XL6 A;  4QPK A;  4B3R O;  1MZF A;  4O4H A;  2XAG A;  3S3W A;  2QA4 V;  2H3O A;  2YC0 A;  2QTS A;  2WLL B;  3HPL C;  4WFF A;  1ENV A;  2E3C A;  3ZHQ A;  4MS2 A;  4PI2 A;  1QU7 A;  2OWO A;  4W4K A;  1VF5 B;  1Q7Y W;  4X1Y B;  4JI2 O;  5LOV A;  3ABK C;  3CRR A;  1US6 A;  4D7S A;  1KMI Z;  4DR4 B;  3WFV A;  2Q5Z A;  3ETD A;  2QJ1 A;  4OPH A;  2B1I A;  1MA1 A;  4JI0 O;  4DRX A;  2ZE5 A;  4U7N A;  1E1Q G;  3JYC A;  3DXR A;  3A0H Z;  4ICG A;  5L3B A;  2Z3Y A;  4TUY B;  5KUK A;  4D6T H;  1M9N A;  4X66 B;  3LDD A;  4QIW F;  3IC9 A;  4B3M O;  1FJG B;  4DV3 O;  4FFB A;  3THO A;  4GKK B;  4D7T A;  1UFI A;  3HKB B;  4GX5 A;  4BIZ A;  3AG7 A;  2UUA B;  1AI6 A;  5KHH A;  5CA0 B;  1NKD A;  2E5L B;  3WG7 B;  2HHH O;  1AVM A;  4F6E A;  2QWQ B;  3SYP A;  2XT9 A;  2YIC A;  4DW1 A;  4FM2 A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  3J81 N;  3T1Y O;  4K0K O;  5BY1 A;  1IBK O;  1XNR O;  4JI8 O;  3R66 A;  1HR0 O;  4LF9 O;  2N74 A;  2UUB O;  4NXM O;  4LF8 O;  4DV4 O;  4YY3 O;  4DV7 O;  4DR5 O;  1F7Y A;  1FKA O;  2ZKO A;  5BXZ A;  3M8A A;  3SDL A;  4JI6 O;  1N33 O;  1HNZ O;  4OPA A;  5H5N A;  4B3R O;  1N32 O;  2VQF O;  1XNQ O;  4DUZ O;  2VQE O;  1J5E O;  5FLX N;  1D2D A;  4B3S O;  4A5U B;  2Z0A A;  1N34 O;  1FYJ A;  4DR2 O;  1I94 O;  4DR1 O;  1X59 A;  2UXD O;  1N36 O;  1AB3 A;  4DV1 O;  1R6T A;  3F5T A;  4LF6 O;  2JRI A;  4LFA O;  4JI2 O;  4DR7 O;  4LF4 O;  2ZM6 O;  2F4V O;  4JV5 O;  2UXB O;  4OPH A;  4LFC O;  4AQY O;  1AIL A;  1IBL O;  1IBM O;  3J80 N;  4LF7 O;  5LL6 Y;  4X64 O;  3JAM N;  4DR4 O;  4DR3 O;  4JYA O;  4JI0 O;  2LW7 A;  2UUC O;  4X66 O;  1HNW O;  4DR6 O;  1FJG O;  1G1X B;  4JI3 O;  4X65 O;  1YZB A;  4LFB O;  4DV0 O;  1XMO O;  4LF5 O;  1A32 A;  2UXC O;  1NS1 A;  1XEQ A;  4JI5 O;  5A2Q N;  2UUA O;  2UU9 O;  2E5L O;  5LMN O;  3O65 A;  3T1H O;  1HNX O;  1DK1 A;  2DJV A;  3RT3 C;  2AGA A;  4B3M O;  3OTO O;  4B3T O;  4DV3 O;  4OX9 O;  4JI4 O;  4DV5 O;  5IT9 N;  1R1B A;  1XMQ O;  4DV6 O;  3J7A U;  2DOS A;  4KHP O;  4JI7 O;  5IWA O;  4DV2 O;  2HHH O;  4DUY O;  5LMU O;  2FKX A;  4NXN O;  4YHH O;  4GKK O;  1KUQ A;  5BR8 O;  4X62 O;  4JI1 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...