4DR5O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr5O00
2F4VO 4LF6O 3O65A 1I94O 4X65O 4B3RO 2UU9O 3T1HO 3R66A 4DUYO 2DOSA 4K0KO 1J5EO 1N32O 1R1BA 1YZBA 4GKJO 3J7AU 1XNQO 4NXNO 4B3SO 1A32A 1R6TA 2LW7A 4LFCO 2UUCO 4DR6O 4DR1O 2DJVA 1XMOO 3F5TA 2UXCO 4DR2O 4JI3O 4LF4O 2UXDO 4AQYO 4JI0O 5FLXN 1AILA 3RT3C 4A5UB 4DR5O 2AGAA 2VQFO 1FYJA 4YY3O 1XEQA 5IWAO 4DV1O 2UXBO 4OX9O 1HNWO 4JI5O 1F7YA 4LFAO 3T1YO 2HHHO 4B3TO 5H5NA 4OPHA 4DV6O 4DUZO 3OTOO 5LMNO 4DR3O 2Z0AA 3J81N 5LL6Y 3JAMN 4B3MO 1D2DA 4DV2O 1HNZO 2N74A 5BR8O 4DV5O 1FKAO 2UUAO 2FKXA 4DR7O 4JI4O 3M8AA 4JI1O 5BY1A 2JRIA 4LFBO 1KUQA 1N36O 4KHPO 2ZM6O 4LF5O 4JV5O 1NS1A 4X66O 4DV0O 4OPAA 4DV3O 4LF7O 1IBLO 4YHHO 4JI6O 2VQEO 1XNRO 4JI7O 5LMUO 1X59A 1G1XB 4GKKO 1FJGO 4DV7O 4LF8O 2ZKOA 1IBKO 1N34O 5A2QN 2UUBO 2E5LO 1N33O 4JI2O 5BXZA 3SDLA 4X64O 1XMQO 4DV4O 1IBMO 3J80N 4JYAO 1AB3A 4JI8O 4X62O 1HR0O 4DR4O 1HNXO 4LF9O 4NXMO 1DK1A 5IT9N
chains in the Genus database with same CATH superfamily
4L8JA 1Z5VA 3FB8C 5J2UA 1VQOV 2RN9A 4K8XA 5BZBA 3OR6C 1VIBA 2BTOA 5JCOC 3SYPA 3DC5A 2X6AA 2OT5A 1RM1B 3K59A 5J2UB 2M7WA 1SQPH 4JYCA 3MDSA 2HEPA 3LDEA 4B3MB 2WLIA 2VWJA 1QVFU 4J7KA 3ABUA 5B1OA 4J9YB 2B9ZA 4DV2B 4I5SA 4YY3O 2WLLA 5D5QA 5LHIA 3AEIA 1N0NA 1QQCA 1UFIA 4JI1B 4FFBA 4PDVA 4YXWG 2WPDG 2WLIB 5LA6A 4J9ZB 3VQWA 4YIOA 1BHAA 2RNBA 4ZBMA 2WLLB 4FFBB 1XNRB 4JI7B 5LMUB 4J80A 5LA6B 4FZ1A 3MHSC 2ILMA 4PDMA 1QNMA 5IY5B 1R6KA 1NJIW 4LWSA 2XNDG 4MVQA 5JQGA 2YXYA 4DR4B 5LBQA 1X59A 2RCVA 1OCCC 5B1NA 1SZTA 2BTQA 1PL0A 3EFFK 4LWSB 2WLJA 2A79B 5JQGB 4X65B 4JGSA 4GT1A 5KUMA 2UU9B 1IBMO 4DUYB 4JI8O 2BTQB 1DK1A 2HG5C 3RGBA 4FIPC 3K9AA 3HB3B 1P7GA 1Q3EA 4OXSA 1XMOB 4B3RO 2WSSG 4K0KO 1R1BA 4DRXA 1VARA 2D3OW 3UO2A 1KP3A 3CMAV 3CCEV 3ABLB 3UKMA 3ZMTA 4DRXB 3LSSA 1GH6A 1NTKH 4X89A 3SJQC 1M93A 2PI4A 3X2QB 2HLDG 3WB2A 2V4DA 4L87A 1Y76A 3B77A 1WP7A 3IC9A 4R50A 4JI4B 1SQFA 4RUFA 3ZMZA 1CEZA 5IYCO 2ZQMA 1M56B 4WFAV 4B3MO 1Y76B 2Y69B 2ADQB 3G6EV 3GWKC 1K5SA 4MVRA 4DV2O 1ZAUA 3S3XA 4PI2A 2WLKA 1CXZB 1JPXA 4JI1O 4GKKB 2X6CA 4I0XA 4RO2A 5L3DA 2ARHA 4MW8A 4MVUA 4JI2B 4I9WA 1Q7YW 1WA8B 5EIBC 4JYAB 1XNRO 4JI7O 5LMUO 1VQMV 4I0XB 5KHKA 2F93B 4I4TA 2EJRA 4NXMB 1R6NA 1OCRB 4FK5C 3STLC 1SERA 2ZT9B 3U10A 2PI5A 3SDLA 1K4CC 2EIMC 1KB9F 3CRCA 3J80N 4DR4O 3D3QA 4B7EA 2ZINA 2Y48A 1KU9A 4MVSA 2ZNIA 4X88A 2XUMA 1FS0G 1NU1H 3CS5A 1G6UA 2Q7EA 2GUZA 4DR1B 4X65O 2UU9O 3ZRSA 4JAAA 4J41A 4DUYO 2DOSA 3JD4A 2F66C 1LR1A 1QLEB 2XTAA 2ZR3A 2EILB 4DR5B 2LFSA 3TJTA 3SPCA 1Q6UA 1XMOO 4BIOA 2HJDA 2PF4E 4LFAB 1DF4A 2W0FC 1WAZA 4DXWA 1P7BA 1RPOA 3C3SA 3E89A 4O4HA 1AILA 2ZXWB 4A5UB 1T5EA 2Y0PA 3GVMA 1OCOB 4NTWA 4J10A 3ASOC 4O4HB 5L3FA 1JMKC 3KG2A 2OTJV 5LL6Y 3JALA 3OMAB 5HFMA 2GTAA 2RDCA 4LF7B 1FKAO 2K9PA 4JI4O 1H38A 2CTRA 1WNSA 1FJGB 4DV7B 1RM1C 3SPJA 1OZ0A 3JALB 1X4TA 2FL4A 2HP8A 4IL6Z 4H0LB 3QF7A 1DLBA 2IU0A 1GTOA 4H33A 2Q68A 3I56V 1AJNA 4GKKO 4HYOA 4R8CA 3OGIB 3ASNB 3KCXA 2XOKG 4PA6A 2A0LA 2ZNJA 2CAZC 2O57A 5B5EZ 4KFMA 3D36C 4JI2O 5KLVH 4JYAO 3APOA 3ETGA 4J7JA 3ZMUA 1AROP 4EFEA 4NXMO 2YIBD 2E75B 3FFQA 4D6TH 2EZOA 5F2VO 3OFNG 2R9IA 1N4CA 4O4JA 2YEVA 3TXSA 4ZKIA 3IJ4A 3RWRD 4DK0A 4QPJA 1PKXA 2VQFB 2YSUB 5CA1A 4O4JB 3WG7B 4BW5A 4DR1O 4JTDB 3H01A 3T1YB 3ETQA 3TETA 1Q90D 4FVMA 3CHXA 4Z1MG 4JTAB 4C7UA 3BY6A 4DR5O 1AI4A 4U3FH 1XUQA 4FLZA 5B3SB 5L3GA 5K1PA 2XAHA 5KAIZ 4LFAO 3OEEG 1H2MA 2C2AA 3WB1A 1N0JA 5JJJB 1TAEA 2DW4A 4PDRA 1VQKV 3H1KH 1JX9A 2Y4UA 1NQTA 3M99B 3SYOA 3OE7G 1QHTA 4MVOA 4O2AA 3FX7A 4NYKA 3LSUA 3ABLC 2F1MA 2QM8A 2CUGA 2GDSA 3AG4B 4LF7O 5KMGA 4O2AB 1HR0B 5J2TA 1G1XB 3X2QC 5EBLC 1FJGO 1YJWV 1EBOA 3QNEA 4DV7O 3I55V 3OM3B 3CC7V 4LC1A 3CSXA 5FNVB 5KMGB 2R72A 5J2TB 3IC7A 5B1AC 2CGNA 3OGCC 2LFRA 1M56C 3L75H 3W7SA 2Y69C 2AZ2A 1R73A 2Q9LA 4DR6B 3O65A 1VF6C 1L0LH 2UXCB 1YF2A 3T1HO 2ITCC 4CZZA 1S5HC 4LF4B 1JJOA 2G38A 4O4IA 1NTZH 2M6YA 3EXAA 3OAAG 2JEUA 5LGUA 1GN3A 2EIJC 2DJVA 1M9NA 1U96A 1GMGA 4O4IB 2RJZA 4B3TB 2PYLA 5B1BB 3SPHA 1OV9A 2LJ2A 5LYJA 2AGAA 2VQFO 4JASA 4UCRA 4DR7B 4K35A 1L8DA 3BA9A 1LUWA 3N2GA 3T1YO 2X6BA 4LFBB 4X1KA 1XILA 5LYJB 1XQ8A 2QSAA 1FXHA 3F7YC 1KC8W 4G27B 1WB8A 1B04A 1W2BU 4JTCB 4DV3B 3N2GB 4DK1A 2VQEB 1ZUQA 4GX5A 4X1KB 2DYRB 2CK3G 4HNAA 1LNQA 2EINB 4CS3A 2EIKB 3ABKB 2EZPA 1QBZA 2IU3A 3APQA 4KL1A 4CC6A 1H2SB 1W59A 1O9GA 1XBLA 2YXLA 4HNAB 4QIWF 3RYHA 4K3AA 2JEXA 2ZXWC 1H8HG 3AK1A 1GO3F 3OD4A 2ADPA 3OW2U 2FB5A 3LNMB 1DTOA 1XL6A 1FXKB 4ABMA 1NBMG 1L0NH 4R7CA 1PV0A 3RYHB 3SR2C 1HR0O 5L3CA 1N32B 3S3WA 2ITDC 3BA8A 2A9HA 1WB7A 2UUCB 3HKDA 3ML0A 1URFA 3QO8A 4Z1VA 4I55B 3K0GA 1TVKA 2JGDA 2CTPA 2UXDB 1QU7A 3J7AU 3JASA 4BR6A 3HKDB 5LHGA 3ABTA 4DR6O 3LUTB 2F95B 3F5TA 1TVKB 2UXCO 1NTMH 5JJEB 4IIJB 3JASB 4LF4O 3ASNC 1ENVA 1I0HA 2EBOA 3P3PA 5CB4A 3BAAA 1V54B 4ZIBA 3ETDA 3CPWU 2B1IA 4J7ZA 1VQ9V 3E35A 3G71V 2JGUA 2QM4A 4Q20A 3G6BA 4B3TO 5CB4B 4MTXA 2Q7HA 3KCYA 2Z0AA 2ZDIC 2Z3YA 4JYYA 3ZEDA 3ICXA 4DR7O 1IURA 4TV9A 2HVKC 3A2FA 4JYBA 3G4SV 4LFBO 3ABMB 2DWEC 1SA0A 3K58A 3CCQV 2AHZA 2YIDA 2XAJA 4DV3O 1XMQB 2VQEO 5H2FZ 1SA0B 2YDEA 1K34A 5CA0A 4WF9V 4N21A 1YXBA 4CBCA 2HKOA 1S76D 1FD9A 5FL7G 1J5EB 4O2BA 5CA0B 1D5AA 4NXNB 4W4KA 3SJBC 4I50A 1XDCA 5J9PC 4LP8A 3RW0A 1KKDA 1US6A 2QWPB 4PV1B 3B8MA 3E8GA 4O2BB 2ZIOA 3A8TA 3SPGA 1N32O 4X20A 4I50B 3G67A 2LO1A 2GV9A 2YC0A 2UUCO 1BMFG 2PGGA 3FAVA 2ZCEA 4YJ3A 4DV6B 2N05A 2UXDO 5KHIA 1NH2B 3OTOB 2YS8A 4B08A 1SQXH 3SYCA 3U11A 1FYJA 3FAVB 2PTMA 1IDSA 2DMXA 2LGQA 4CS4A 3K03A 4NB5A 4LF5B 2WA4A 4B7KA 3JAMN 3CCJV 2Q0OC 3QTCA 4DV0B 1XOUA 3FKSG 5CBGA 1FAFA 1EZJA 4TT3G 2B5UA 1HWYA 1ZSPA 2ETNA 4LF8B 5IDJA 4JAVA 4WFBV 2UUBB 3FYEB 5FPRA 2EULA 3CRQA 5IYBO 3B2EE 2QWNB 5H6RA 3ZCCA 2AZ0A 3R65A 2ZKOA 4X8AA 1G4YB 1XMQO 1AB3A 4QE7A 4FLXA 2DYSB 3TXQA 2ZE8A 4KP4A 5EC1C 1EN5A 2P4VA 1J5EO 3VOUA 1YZBA 3CB2A 1AI6A 4NXNO 4JI0B 5LP6C 2EIKC 1AJPA 2GHYA 3A0BZ 3FB5C 1SQVH 4I4TB 3ZMSA 4CC5A 3ZHRA 2A06H 1F51A 1F23A 3AG2C 4MTFA 1BCCH 3ZMVA 1R3IC 1W0KG 3CCVV 3LDDA 1FXKC 4ZI7A 3ZN1A 4GX0A 1B3QA 3MAQA 1I08A 4TQDA 1VQLV 5E1AC 1V55B 2GUZB 1M90W 2FYUH 4RAIA 4QJFB 5BMVA 5DM6V 4OPHA 4DV6O 3CCUV 1MA1A 1ZL8A 4WBNA 3OTOO 4GLXA 3NR7A 4ZI7B 5LXTA 3J81N 4XDLA 4WFFA 1GM8A 4PD4F 4HZ3A 1VQ8V 4N23A 5BMVB 3CCSV 1ZL8B 3SPIA 4WBNB 3THOA 2P90A 3W7TA 1WLEA 5LXTB 2P06A 4LF5O 3ZHSA 4GZRB 2OWOA 4CH4A 1N33B 4DV0O 4OPAA 2BOCC 4AI8A 4KXRA 1JFFA 4IHJA 3U0ZA 2P5OA 2YUAA 5H6QA 3CMEV 4LF8O 3OMIB 5A2QN 3LNNA 2UUBO 1Q82W 1QR8A 1JFFB 4LCUC 4IHJB 1SESA 3JATA 4NKGB 1E79G 4MTGA 1ZX3A 4XBFA 3P32A 3CRMA 1WPXA 2BCCH 2QWOB 2OCCB 4UVCA 3ZRXA 3BCCH 1KECA 3JATB 3R66A 4JI3B 4NR1A 1U97A 2QEXV 5HFLA 3RYCA 1Q5OA 1A32A 5KA5A 1YDXA 4BIUA 3SYQA 1R3JC 1SC5B 1K8AW 1EN6A 5LHHA 4GX1A 4DV1B 1GN2A 1Q81W 3L74H 3P3NA 2LQTA 3AK3A 3RYCB 1SS3A 4JI0O 3UO3A 3E22A 1FXVA 4GCZA 3MHHC 2P6JA 1ZTEA 3SJAC 4FFKA 5IJ9A 1AR5A 3CCLV 5IY5C 3TCUA 1KQSU 1PD3A 3CXHF 3E22B 3UT5A 2Q0AA 1O9HA 1P49A 2YEVB 3FD9A 2FMLA 4EKWA 4TSFG 3BHPA 4PI0A 1FFTB 2Q8VA 4QGPA 5IJ9B 3RYIA 3CEIA 2KKWA 4IT5A 3UQ8A 4LH7A 5CA1B 2XAFA 3UT5B 5BY1A 1SQQH 2HVJC 2JRIA 5TISZ 2RQ6A 1IBKB 1MOFA 3RYIB 2WLMA 2Z5UA 2DN9A 3CC4V 2CE4A 1YEWA 2XT9A 4PA4A 4X1IA 3AG1B 4ICGA 1PP9H 2MW2B 2F4VB 1IVSA 4XDKA 4GUNA 4J42A 2JDIG 1N33O 2GTSA 5KAFZ 2A3QA 1M1KW 4X1IB 5EK0A 4AHCA 4U3JA 4BIZA 1RSOA 1XI1A 2CTWA 1YIJV 5IYZA 4B3SB 5IYDO 3SGIA 3B09A 3ZS8C 5KX5A 4U3JB 4G28B 3RBZA 1EN4A 1RSOB 1BSMA 5A9GA 1YTFD 4DR2B 1VMGA 1SRYA 3ZX6A 5IYZB 2AXTZ 5CBFA 4MVMA 2QKAA 3K5MA 2XAQA 2L6LA 2IJJA 5DEDA 4IGGA 1W0JG 5LOVA 3KKYA 5IWAB 3CCMV 1AI7A 2UXBB 4H13B 4JI3O 2PY5A 1Y74A 3VQVA 1XHZA 4R6ZA 3QO5A 2CTQA 5LOVB 3RYFA 3CP1A 2QTSA 2UUAB 2KQXA 3OMNB 1XEQA 1NI8A 1Y66A 4DV1O 4GYCB 1Y74B 4DYLA 2DYSC 3H1IH 1N36B 2XAGA 3WB0A 4RQEA 2YIAA 3RYFB 4JV5B 1M4UA 4X66B 4JPRA 3E2EA 1JA8A 2JVDA 2R9RB 3CCRV 1OCRC 3RFRA 1P4RA 1F4MA 3CC2V 1TA8A 4PELA 3K5OA 3C90A 3ZBHA 4FJCC 1WP8A 2CH7A 3HKEA 2KB1A 1EZVH 1YTFB 5FPOA 1S72V 2XASA 3ZJZA 1XREA 4X62B 1RFYA 1HNXB 4LF9B 1H2KA 2CH7B 1I7FA 3HKEB 3BRCA 1L1FA 3ZN0A 4LF6B 1IBKO 1I5XA 1QLEC 3SJCC 4Z2WA 2EILC 1MABG 3JD3A 1Q86W 1K3EA 3E8BA 3O9OA 1BE3H 1BQ0A 1PNMA 1IXBA 2DQ0A 3A0HZ 4LFCB 1PL4A 1Z2GA 2F4VO 3Q4HA 1YCIA 3ZIAG 2D2CB 2UXXA 3CE2A 4FMTA 2IBZH 3IAYA 4MS2A 4EFBA 1RP3B 4B3SO 1OCOC 3BABA 1S77D 3Q4HB 2GSMB 4I9QA 2E74B 2N04A 1SZXA 3K04A 1Q43A 1MZEA 1PM9A 2IH1C 1SQGA 4DR2O 4J11A 5JWPA 4XDJA 1NR7A 3B40A 2Q67A 2JJ2G 3RN4A 3NXSA 4FLTA 1ROPA 1Y6XA 4NTYA 4F6EA 2ZD9A 1NR1A 1HNZB 5IWAO 5EYPA 5KUKA 2UXBO 1EFRG 1FPOA 3PN1A 2ZR2A 2QA4V 4TUYA 4W4LA 1KYOF 4CH6A 2JGDB 2OCCC 3CWBH 1BL8A 4UCTA 5EYPB 3AK2A 4X9QA 2IM9A 2UUAO 2UXNA 1E1RG 4TUYB 1F4NA 4F6RA 4D7TA 1FFXA 5EBWC 1YI2V 1N36O 1Z5WA 1AJQA 1K4DC 5DECA 2PZSA 1HW7A 1Y67A 4JV5O 2NLJC 3ASOB 4LNUA 4EB6A 5IJ0A 1WJZA 4X66O 4H44B 1JR9A 2YI9A 4F6RB 4NTXA 5CBHA 1FFXB 2QM7A 3AG3B 1NZ6A 1UPGA 2JIZG 3CX5F 2W6JG 3JSNA 4LNUB 1P84F 4EB6B 5IJ0B 5EC2C 5AG2A 1NH2D 4JZ2A 5JJNB 3AG7A 3QO7A 4X62O 5C93A 1JCHA 3G80A 4RUEA 3WG7C 1HNXO 4LF9O 1XNQB 4FLUA 4TV9B 1OCZB 2R9AA 4LF6O 3D36A 5CA3A 3ETEA 3ZHVA 2P7TC 1GM7A 1K5QA 4PJ0Z 3A0RA 4UVAA 2QTOA 3JCZA 5IE9A 4FM0A 5B3SC 2F23A 1R6TA 1XL4A 5EBMC 4LFCO 4UFZA 2IJKA 3JD0A 1H8EG 4H37A 2QKCA 2CDYA 2ATKC 3BEHA 1HNWB 3AG1C 3H1LH 1YHQV 2HHHB 3UCSC 4LBEC 4WFEA 3D3IA 2Q4PA 1H2LA 4UVBA 4DUZB 2QWQB 5L3BA 2NNUA 1K9MW 4UCUA 2Y4TA 1SQBH 4PA7A 1NT2B 5E79Z 1BS3A 3ZRVA 1ORQC 1CP9A 1KP2A 3AG4C 2ZM6B 1QVGU 2OCHA 3HKBA 2ZE7A 3H9VA 4MTOA 4X20B 4BW9A 3JD2A 1HNZO 1IBLB 2VWKA 5JVDA 4GX2A 3DTUB 3PJSK 1K33A 3HKBB 1KUQA 3E86A 1IXMA 4CH3A 1UJWB 3OUFA 4YJ3B 1NS1A 1TUEB 4WFHA 2QJ1A 5JVDB 3W7XA 4X64B 3WFVA 3LSQA 2JJ1G 1AP6A 2KG7A 4FLWA 1JJ2U 1VQPV 1LUVA 1OHHG 2QWRB 1BHBA 1K7DA 3F7VC 4OGQB 2DWDC 1V9PA 1QR9A 4FLVA 3T4DA 1K73W 2KG7B 2YICA 3IFXA 1COWG 3F5WC 2DE0X 2IJHA 5B1BC 3CJHA 4TQFA 2RMKB 2Q69A 1M57B 4ZOLA 3JCUZ 2WAMA 3QG5A 4NVPA 4AQYB 1XNQO 1Y4MA 4P2ZA 3T4ZA 5LGTA 4E2LA 3E8HA 3CJHB 1VF6A 5B1AB 1HP8A 3C3TA 3DGEA 4Q6GA 1GK9A 4RQFA 4ZOLB 3QVNA 4JI5B 3JSLA 2HR3A 3TK1A 2P67A 3L73H 2F43G 2WWWA 4U7NA 1WA8A 2DYRC 5L3EA 3BVOA 1R3LC 2X7RB 3SYAA 2EINC 4WFGA 1HNWO 2AHYA 2CGOA 2QKSA 1AP5A 3K0DA 2HHHO 3ABKC 3H1HH 4DUZO 2EIJB 1AI5A 2WLHA 2P4KA 1DGSA 1THZA 4FLYA 5CMUA 4FZ0A 1KKCA 4ZHQA 3B8NA 1BT8A 2NR5A 4P9PA 2L35A 1E1QG 3L72H 1GKFA 3ZHTA 4YHHB 4JI6B 3LDCA 3FB7C 3ZHUA 4E4EA 4ZHQB 2ZM6O 1VP7A 4EEQA 1Q8IA 5KHGA 1GAXA 1IBLO 4D7SA 4PA3A 4DV4B 4ASUG 1DF5A 1H2GA 3GB7C 3E83A 3K5LA 4TWKA 1XHXA 1WPBA 3FYIB 1VQNV 1GN4A 1J95A 1JVMA 2LGWA 1B6QA 4I7ZB 5GTHZ 2JS5A 1I94B 2JK5C 1NVPD 5BXZA 4X64O 5EZYA 4MVZA 5KHJA 4BWAA 3K08A 2OTLV 2QE7G 4FPPA 5B66Z 5IT9N 1PNKA 3H1JH 5EZYB 4PHZA 4TV8A 1V54C 3JYCA 2Y0IA 2H3OA 2H8PC 1PPJH 1AR4A 1GN6A 1YJNV 4MT8A 1ZLZA 2LW7A 1VQ4V 4UB6Z 1K92A 4TV8B 3JAKA 3I5DA 2E76B 3AG3C 5CN0A 2IJIA 4QPKA 3DC6A 4AQYO 3CRRA 3VQYA 2GBOA 2HJFC 3ABMC 3JAKB 4P9OA 1IX9A 3K06A 1YSCA 4JI5O 2OYQA 1MMMA 2IH3C 1YITV 1OCZC 2Q73A 1MG1A 1AVMA 2EJ7A 4K8ZA 1QLNA 1D2DA 4UCSA 5JCOA 5ITZA 1NVPB 3CRAA 2LW1A 5GW7A 1SETA 2BSKA 4U7OA 1YVWA 2ZDIA 1IZ3A 3K3WA 3T1HB 5K1XA 5ITZB 1N34B 3STZC 3CXCU 2FTKA 2Q6AA 3EHBB 4YHHO 4JI6O 1S3JA 1MZFA 2BSKB 1S0VA 4HBNA 1JOYA 2HFEC 5LGNA 2JS3A 1TUBA 1MNGA 1BGYH 4MW3A 2BOBC 3OR7C 3FB6C 2A7WA 4DV4O 3VBBA 4GKJB 5GTIZ 1R3KC 3MD0A 4WCEV 2X0LA 1I5YA 1TUBB 1H2NA 4UB8Z 3JAWA 1I94O 1Q6IA 1VQ7V 2ZIMA 3E8FA 2IW5A 4HAMA 1KD1W 5GONA 4YJ2A 2V7QG 3B4SA 1B06A 2PUSA 3JAWB 4QE9A 2Q5ZA 1VQ5V 3M7MX 3L71H 2YIBA 4OX9B 2KSDA 4BAYA 5GONB 1AR1B 3W7WA 3K5NA 4KUMA 3HKCA 2P22C 4YJ2B 3DXRA 5LMNB 5FLXN 4DR3B 1OCCB 3CD6V 1BZKA 3T2MA 3P30A 5KHHA 5BR8B 4DV5B 3DSQA 4TOIA 4FM1A 2EX3A 1VQ6V 1TGOA 1HDJA 3HKCB 1BQZA 1GM9A 2WA3A 4DW0A 3DXRB 5KX5B 3T1CA 4KHPB 5FNVA 4X1YA 5H9CA 2B1GA 3D8CA 4F4LA 2W6IG 1S5JA 2N74A 1M57C 2FKXA 2YI8A 3K9SA 2OIEA 2ZE5A 1MSDA 4UV9A 4X1YB 5EIBD 2DQ3A 3TGUH 2E3CA 1PNLA 3CYOA 2E5LB 5JH7A 1MSWD 3HR0A 4CS2A 3ZHQA 2ODMA 3EVKA 4RWUA 4UCOA 3ZRWA 5C8YA 4JZGA 2OIGA 2BE3A 4MSWC 5JH7B 3JARA 1N34O 1KMIZ 2VS0A 4UXNA 2LP7A 1N8RW 2QGNA 3ZRWB 5C8YB 2MK3A 4IYHA 1VEWA 3N27A 3L70H 3RVZA 3JARB 1KBHA 2V1DA 1OJHA 3KZIZ 2H94A 4AILC 1S5LZ 3RVYA 1WN7A 1ZWIC 3K57A 4GKJO 3BPZA 1V55C 4PA9A 3WU2Z 4UV8A 5D5PA 4YY3B 4G2KA 4LR3A 1QCEA 3BFRA 1GRJA 2YXHA 5LP6A 3VQXA 2WLNA 2Q7GA 2ZE6A 3RT3C 4DO2A 1RPRA 1SKVA 4DW1A 2QR4A 3OTFA 2XHBA 1D5NA 5LP6B 4OX9O 3GWOA 1F7YA 2EIMB 4UCVA 5H5NA 4CH5A 1FXKA 5KA6A 5LMNO 4DR3O 2K1EA 2AW9A 2W0XA 4PDLA 3AG2B 1CPYA 5BR8O 4UUJC 4DV5O 5DN6G 3N2KA 2VRZA 3M8AA 4JAUA 1VF7A 4IYIA 4KHPO 3OT7A 1NKDA 4I55A 4FM2A 3N2KB 3K79A 4LH6A 4QNHB 1JQ0A 1IBMB 3OEHG 1EM1A 4JI8B 1G8MA 1Q6HA 3HPLC 3L9DA 2NN4A 4JF3A 3IGAC 4O4LA 4IIJA 1YJ9V 3OUSA 2E5LO 2R70A 4B3RB 1K97A 1VF5B 4K0KB 3JD1A 4P30A 2PYJA 4YIPA 1M5IA 3W7UA 4O4LB 3UM7A 1SF9A 2QDOA
chains in the Genus database with same CATH topology
2F4VO 4LF6O 3O65A 1I94O 4X65O 4B3RO 2UU9O 3T1HO 3R66A 4DUYO 2DOSA 4K0KO 1J5EO 1N32O 1R1BA 1YZBA 4GKJO 3J7AU 1XNQO 4NXNO 4B3SO 1A32A 1R6TA 2LW7A 4LFCO 2UUCO 4DR6O 4DR1O 2DJVA 1XMOO 3F5TA 2UXCO 4DR2O 4JI3O 4LF4O 2UXDO 4AQYO 4JI0O 5FLXN 1AILA 3RT3C 4A5UB 4DR5O 2AGAA 2VQFO 1FYJA 4YY3O 1XEQA 5IWAO 4DV1O 2UXBO 4OX9O 1HNWO 4JI5O 1F7YA 4LFAO 3T1YO 2HHHO 4B3TO 5H5NA 4OPHA 4DV6O 4DUZO 3OTOO 5LMNO 4DR3O 2Z0AA 3J81N 5LL6Y 3JAMN 4B3MO 1D2DA 4DV2O 1HNZO 2N74A 5BR8O 4DV5O 1FKAO 2UUAO 2FKXA 4DR7O 4JI4O 3M8AA 4JI1O 5BY1A 2JRIA 4LFBO 1KUQA 1N36O 4KHPO 2ZM6O 4LF5O 4JV5O 1NS1A 4X66O 4DV0O 4OPAA 4DV3O 4LF7O 1IBLO 4YHHO 4JI6O 2VQEO 1XNRO 4JI7O 5LMUO 1X59A 1G1XB 4GKKO 1FJGO 4DV7O 4LF8O 2ZKOA 1IBKO 1N34O 5A2QN 2UUBO 2E5LO 1N33O 4JI2O 5BXZA 3SDLA 4X64O 1XMQO 4DV4O 1IBMO 3J80N 4JYAO 1AB3A 4JI8O 4X62O 1HR0O 4DR4O 1HNXO 4LF9O 4NXMO 1DK1A 5IT9N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V O;  4LF6 O;  3O65 A;  1I94 O;  4X65 O;  4B3R O;  2UU9 O;  3T1H O;  3R66 A;  4DUY O;  2DOS A;  4K0K O;  1J5E O;  1N32 O;  1R1B A;  1YZB A;  4GKJ O;  3J7A U;  1XNQ O;  4NXN O;  4B3S O;  1A32 A;  1R6T A;  2LW7 A;  4LFC O;  2UUC O;  4DR6 O;  4DR1 O;  2DJV A;  1XMO O;  3F5T A;  2UXC O;  4DR2 O;  4JI3 O;  4LF4 O;  2UXD O;  4AQY O;  4JI0 O;  5FLX N;  1AIL A;  3RT3 C;  4A5U B;  4DR5 O;  2AGA A;  2VQF O;  1FYJ A;  4YY3 O;  1XEQ A;  5IWA O;  4DV1 O;  2UXB O;  4OX9 O;  1HNW O;  4JI5 O;  1F7Y A;  4LFA O;  3T1Y O;  2HHH O;  4B3T O;  5H5N A;  4OPH A;  4DV6 O;  4DUZ O;  3OTO O;  5LMN O;  4DR3 O;  2Z0A A;  3J81 N;  5LL6 Y;  3JAM N;  4B3M O;  1D2D A;  4DV2 O;  1HNZ O;  2N74 A;  5BR8 O;  4DV5 O;  1FKA O;  2UUA O;  2FKX A;  4DR7 O;  4JI4 O;  3M8A A;  4JI1 O;  5BY1 A;  2JRI A;  4LFB O;  1KUQ A;  1N36 O;  4KHP O;  2ZM6 O;  4LF5 O;  4JV5 O;  1NS1 A;  4X66 O;  4DV0 O;  4OPA A;  4DV3 O;  4LF7 O;  1IBL O;  4YHH O;  4JI6 O;  2VQE O;  1XNR O;  4JI7 O;  5LMU O;  1X59 A;  1G1X B;  4GKK O;  1FJG O;  4DV7 O;  4LF8 O;  2ZKO A;  1IBK O;  1N34 O;  5A2Q N;  2UUB O;  2E5L O;  1N33 O;  4JI2 O;  5BXZ A;  3SDL A;  4X64 O;  1XMQ O;  4DV4 O;  1IBM O;  3J80 N;  4JYA O;  1AB3 A;  4JI8 O;  4X62 O;  1HR0 O;  4DR4 O;  1HNX O;  4LF9 O;  4NXM O;  1DK1 A;  5IT9 N; 
#chains in the Genus database with same CATH topology
 4L8J A;  1Z5V A;  3FB8 C;  5J2U A;  1VQO V;  2RN9 A;  4K8X A;  5BZB A;  3OR6 C;  1VIB A;  2BTO A;  5JCO C;  3SYP A;  3DC5 A;  2X6A A;  2OT5 A;  1RM1 B;  3K59 A;  5J2U B;  2M7W A;  1SQP H;  4JYC A;  3MDS A;  2HEP A;  3LDE A;  4B3M B;  2WLI A;  2VWJ A;  1QVF U;  4J7K A;  3ABU A;  5B1O A;  4J9Y B;  2B9Z A;  4DV2 B;  4I5S A;  4YY3 O;  2WLL A;  5D5Q A;  5LHI A;  3AEI A;  1N0N A;  1QQC A;  1UFI A;  4JI1 B;  4FFB A;  4PDV A;  4YXW G;  2WPD G;  2WLI B;  5LA6 A;  4J9Z B;  3VQW A;  4YIO A;  1BHA A;  2RNB A;  4ZBM A;  2WLL B;  4FFB B;  1XNR B;  4JI7 B;  5LMU B;  4J80 A;  5LA6 B;  4FZ1 A;  3MHS C;  2ILM A;  4PDM A;  1QNM A;  5IY5 B;  1R6K A;  1NJI W;  4LWS A;  2XND G;  4MVQ A;  5JQG A;  2YXY A;  4DR4 B;  5LBQ A;  1X59 A;  2RCV A;  1OCC C;  5B1N A;  1SZT A;  2BTQ A;  1PL0 A;  3EFF K;  4LWS B;  2WLJ A;  2A79 B;  5JQG B;  4X65 B;  4JGS A;  4GT1 A;  5KUM A;  2UU9 B;  1IBM O;  4DUY B;  4JI8 O;  2BTQ B;  1DK1 A;  2HG5 C;  3RGB A;  4FIP C;  3K9A A;  3HB3 B;  1P7G A;  1Q3E A;  4OXS A;  1XMO B;  4B3R O;  2WSS G;  4K0K O;  1R1B A;  4DRX A;  1VAR A;  2D3O W;  3UO2 A;  1KP3 A;  3CMA V;  3CCE V;  3ABL B;  3UKM A;  3ZMT A;  4DRX B;  3LSS A;  1GH6 A;  1NTK H;  4X89 A;  3SJQ C;  1M93 A;  2PI4 A;  3X2Q B;  2HLD G;  3WB2 A;  2V4D A;  4L87 A;  1Y76 A;  3B77 A;  1WP7 A;  3IC9 A;  4R50 A;  4JI4 B;  1SQF A;  4RUF A;  3ZMZ A;  1CEZ A;  5IYC O;  2ZQM A;  1M56 B;  4WFA V;  4B3M O;  1Y76 B;  2Y69 B;  2ADQ B;  3G6E V;  3GWK C;  1K5S A;  4MVR A;  4DV2 O;  1ZAU A;  3S3X A;  4PI2 A;  2WLK A;  1CXZ B;  1JPX A;  4JI1 O;  4GKK B;  2X6C A;  4I0X A;  4RO2 A;  5L3D A;  2ARH A;  4MW8 A;  4MVU A;  4JI2 B;  4I9W A;  1Q7Y W;  1WA8 B;  5EIB C;  4JYA B;  1XNR O;  4JI7 O;  5LMU O;  1VQM V;  4I0X B;  5KHK A;  2F93 B;  4I4T A;  2EJR A;  4NXM B;  1R6N A;  1OCR B;  4FK5 C;  3STL C;  1SER A;  2ZT9 B;  3U10 A;  2PI5 A;  3SDL A;  1K4C C;  2EIM C;  1KB9 F;  3CRC A;  3J80 N;  4DR4 O;  3D3Q A;  4B7E A;  2ZIN A;  2Y48 A;  1KU9 A;  4MVS A;  2ZNI A;  4X88 A;  2XUM A;  1FS0 G;  1NU1 H;  3CS5 A;  1G6U A;  2Q7E A;  2GUZ A;  4DR1 B;  4X65 O;  2UU9 O;  3ZRS A;  4JAA A;  4J41 A;  4DUY O;  2DOS A;  3JD4 A;  2F66 C;  1LR1 A;  1QLE B;  2XTA A;  2ZR3 A;  2EIL B;  4DR5 B;  2LFS A;  3TJT A;  3SPC A;  1Q6U A;  1XMO O;  4BIO A;  2HJD A;  2PF4 E;  4LFA B;  1DF4 A;  2W0F C;  1WAZ A;  4DXW A;  1P7B A;  1RPO A;  3C3S A;  3E89 A;  4O4H A;  1AIL A;  2ZXW B;  4A5U B;  1T5E A;  2Y0P A;  3GVM A;  1OCO B;  4NTW A;  4J10 A;  3ASO C;  4O4H B;  5L3F A;  1JMK C;  3KG2 A;  2OTJ V;  5LL6 Y;  3JAL A;  3OMA B;  5HFM A;  2GTA A;  2RDC A;  4LF7 B;  1FKA O;  2K9P A;  4JI4 O;  1H38 A;  2CTR A;  1WNS A;  1FJG B;  4DV7 B;  1RM1 C;  3SPJ A;  1OZ0 A;  3JAL B;  1X4T A;  2FL4 A;  2HP8 A;  4IL6 Z;  4H0L B;  3QF7 A;  1DLB A;  2IU0 A;  1GTO A;  4H33 A;  2Q68 A;  3I56 V;  1AJN A;  4GKK O;  4HYO A;  4R8C A;  3OGI B;  3ASN B;  3KCX A;  2XOK G;  4PA6 A;  2A0L A;  2ZNJ A;  2CAZ C;  2O57 A;  5B5E Z;  4KFM A;  3D36 C;  4JI2 O;  5KLV H;  4JYA O;  3APO A;  3ETG A;  4J7J A;  3ZMU A;  1ARO P;  4EFE A;  4NXM O;  2YIB D;  2E75 B;  3FFQ A;  4D6T H;  2EZO A;  5F2V O;  3OFN G;  2R9I A;  1N4C A;  4O4J A;  2YEV A;  3TXS A;  4ZKI A;  3IJ4 A;  3RWR D;  4DK0 A;  4QPJ A;  1PKX A;  2VQF B;  2YSU B;  5CA1 A;  4O4J B;  3WG7 B;  4BW5 A;  4DR1 O;  4JTD B;  3H01 A;  3T1Y B;  3ETQ A;  3TET A;  1Q90 D;  4FVM A;  3CHX A;  4Z1M G;  4JTA B;  4C7U A;  3BY6 A;  4DR5 O;  1AI4 A;  4U3F H;  1XUQ A;  4FLZ A;  5B3S B;  5L3G A;  5K1P A;  2XAH A;  5KAI Z;  4LFA O;  3OEE G;  1H2M A;  2C2A A;  3WB1 A;  1N0J A;  5JJJ B;  1TAE A;  2DW4 A;  4PDR A;  1VQK V;  3H1K H;  1JX9 A;  2Y4U A;  1NQT A;  3M99 B;  3SYO A;  3OE7 G;  1QHT A;  4MVO A;  4O2A A;  3FX7 A;  4NYK A;  3LSU A;  3ABL C;  2F1M A;  2QM8 A;  2CUG A;  2GDS A;  3AG4 B;  4LF7 O;  5KMG A;  4O2A B;  1HR0 B;  5J2T A;  1G1X B;  3X2Q C;  5EBL C;  1FJG O;  1YJW V;  1EBO A;  3QNE A;  4DV7 O;  3I55 V;  3OM3 B;  3CC7 V;  4LC1 A;  3CSX A;  5FNV B;  5KMG B;  2R72 A;  5J2T B;  3IC7 A;  5B1A C;  2CGN A;  3OGC C;  2LFR A;  1M56 C;  3L75 H;  3W7S A;  2Y69 C;  2AZ2 A;  1R73 A;  2Q9L A;  4DR6 B;  3O65 A;  1VF6 C;  1L0L H;  2UXC B;  1YF2 A;  3T1H O;  2ITC C;  4CZZ A;  1S5H C;  4LF4 B;  1JJO A;  2G38 A;  4O4I A;  1NTZ H;  2M6Y A;  3EXA A;  3OAA G;  2JEU A;  5LGU A;  1GN3 A;  2EIJ C;  2DJV A;  1M9N A;  1U96 A;  1GMG A;  4O4I B;  2RJZ A;  4B3T B;  2PYL A;  5B1B B;  3SPH A;  1OV9 A;  2LJ2 A;  5LYJ A;  2AGA A;  2VQF O;  4JAS A;  4UCR A;  4DR7 B;  4K35 A;  1L8D A;  3BA9 A;  1LUW A;  3N2G A;  3T1Y O;  2X6B A;  4LFB B;  4X1K A;  1XIL A;  5LYJ B;  1XQ8 A;  2QSA A;  1FXH A;  3F7Y C;  1KC8 W;  4G27 B;  1WB8 A;  1B04 A;  1W2B U;  4JTC B;  4DV3 B;  3N2G B;  4DK1 A;  2VQE B;  1ZUQ A;  4GX5 A;  4X1K B;  2DYR B;  2CK3 G;  4HNA A;  1LNQ A;  2EIN B;  4CS3 A;  2EIK B;  3ABK B;  2EZP A;  1QBZ A;  2IU3 A;  3APQ A;  4KL1 A;  4CC6 A;  1H2S B;  1W59 A;  1O9G A;  1XBL A;  2YXL A;  4HNA B;  4QIW F;  3RYH A;  4K3A A;  2JEX A;  2ZXW C;  1H8H G;  3AK1 A;  1GO3 F;  3OD4 A;  2ADP A;  3OW2 U;  2FB5 A;  3LNM B;  1DTO A;  1XL6 A;  1FXK B;  4ABM A;  1NBM G;  1L0N H;  4R7C A;  1PV0 A;  3RYH B;  3SR2 C;  1HR0 O;  5L3C A;  1N32 B;  3S3W A;  2ITD C;  3BA8 A;  2A9H A;  1WB7 A;  2UUC B;  3HKD A;  3ML0 A;  1URF A;  3QO8 A;  4Z1V A;  4I55 B;  3K0G A;  1TVK A;  2JGD A;  2CTP A;  2UXD B;  1QU7 A;  3J7A U;  3JAS A;  4BR6 A;  3HKD B;  5LHG A;  3ABT A;  4DR6 O;  3LUT B;  2F95 B;  3F5T A;  1TVK B;  2UXC O;  1NTM H;  5JJE B;  4IIJ B;  3JAS B;  4LF4 O;  3ASN C;  1ENV A;  1I0H A;  2EBO A;  3P3P A;  5CB4 A;  3BAA A;  1V54 B;  4ZIB A;  3ETD A;  3CPW U;  2B1I A;  4J7Z A;  1VQ9 V;  3E35 A;  3G71 V;  2JGU A;  2QM4 A;  4Q20 A;  3G6B A;  4B3T O;  5CB4 B;  4MTX A;  2Q7H A;  3KCY A;  2Z0A A;  2ZDI C;  2Z3Y A;  4JYY A;  3ZED A;  3ICX A;  4DR7 O;  1IUR A;  4TV9 A;  2HVK C;  3A2F A;  4JYB A;  3G4S V;  4LFB O;  3ABM B;  2DWE C;  1SA0 A;  3K58 A;  3CCQ V;  2AHZ A;  2YID A;  2XAJ A;  4DV3 O;  1XMQ B;  2VQE O;  5H2F Z;  1SA0 B;  2YDE A;  1K34 A;  5CA0 A;  4WF9 V;  4N21 A;  1YXB A;  4CBC A;  2HKO A;  1S76 D;  1FD9 A;  5FL7 G;  1J5E B;  4O2B A;  5CA0 B;  1D5A A;  4NXN B;  4W4K A;  3SJB C;  4I50 A;  1XDC A;  5J9P C;  4LP8 A;  3RW0 A;  1KKD A;  1US6 A;  2QWP B;  4PV1 B;  3B8M A;  3E8G A;  4O2B B;  2ZIO A;  3A8T A;  3SPG A;  1N32 O;  4X20 A;  4I50 B;  3G67 A;  2LO1 A;  2GV9 A;  2YC0 A;  2UUC O;  1BMF G;  2PGG A;  3FAV A;  2ZCE A;  4YJ3 A;  4DV6 B;  2N05 A;  2UXD O;  5KHI A;  1NH2 B;  3OTO B;  2YS8 A;  4B08 A;  1SQX H;  3SYC A;  3U11 A;  1FYJ A;  3FAV B;  2PTM A;  1IDS A;  2DMX A;  2LGQ A;  4CS4 A;  3K03 A;  4NB5 A;  4LF5 B;  2WA4 A;  4B7K A;  3JAM N;  3CCJ V;  2Q0O C;  3QTC A;  4DV0 B;  1XOU A;  3FKS G;  5CBG A;  1FAF A;  1EZJ A;  4TT3 G;  2B5U A;  1HWY A;  1ZSP A;  2ETN A;  4LF8 B;  5IDJ A;  4JAV A;  4WFB V;  2UUB B;  3FYE B;  5FPR A;  2EUL A;  3CRQ A;  5IYB O;  3B2E E;  2QWN B;  5H6R A;  3ZCC A;  2AZ0 A;  3R65 A;  2ZKO A;  4X8A A;  1G4Y B;  1XMQ O;  1AB3 A;  4QE7 A;  4FLX A;  2DYS B;  3TXQ A;  2ZE8 A;  4KP4 A;  5EC1 C;  1EN5 A;  2P4V A;  1J5E O;  3VOU A;  1YZB A;  3CB2 A;  1AI6 A;  4NXN O;  4JI0 B;  5LP6 C;  2EIK C;  1AJP A;  2GHY A;  3A0B Z;  3FB5 C;  1SQV H;  4I4T B;  3ZMS A;  4CC5 A;  3ZHR A;  2A06 H;  1F51 A;  1F23 A;  3AG2 C;  4MTF A;  1BCC H;  3ZMV A;  1R3I C;  1W0K G;  3CCV V;  3LDD A;  1FXK C;  4ZI7 A;  3ZN1 A;  4GX0 A;  1B3Q A;  3MAQ A;  1I08 A;  4TQD A;  1VQL V;  5E1A C;  1V55 B;  2GUZ B;  1M90 W;  2FYU H;  4RAI A;  4QJF B;  5BMV A;  5DM6 V;  4OPH A;  4DV6 O;  3CCU V;  1MA1 A;  1ZL8 A;  4WBN A;  3OTO O;  4GLX A;  3NR7 A;  4ZI7 B;  5LXT A;  3J81 N;  4XDL A;  4WFF A;  1GM8 A;  4PD4 F;  4HZ3 A;  1VQ8 V;  4N23 A;  5BMV B;  3CCS V;  1ZL8 B;  3SPI A;  4WBN B;  3THO A;  2P90 A;  3W7T A;  1WLE A;  5LXT B;  2P06 A;  4LF5 O;  3ZHS A;  4GZR B;  2OWO A;  4CH4 A;  1N33 B;  4DV0 O;  4OPA A;  2BOC C;  4AI8 A;  4KXR A;  1JFF A;  4IHJ A;  3U0Z A;  2P5O A;  2YUA A;  5H6Q A;  3CME V;  4LF8 O;  3OMI B;  5A2Q N;  3LNN A;  2UUB O;  1Q82 W;  1QR8 A;  1JFF B;  4LCU C;  4IHJ B;  1SES A;  3JAT A;  4NKG B;  1E79 G;  4MTG A;  1ZX3 A;  4XBF A;  3P32 A;  3CRM A;  1WPX A;  2BCC H;  2QWO B;  2OCC B;  4UVC A;  3ZRX A;  3BCC H;  1KEC A;  3JAT B;  3R66 A;  4JI3 B;  4NR1 A;  1U97 A;  2QEX V;  5HFL A;  3RYC A;  1Q5O A;  1A32 A;  5KA5 A;  1YDX A;  4BIU A;  3SYQ A;  1R3J C;  1SC5 B;  1K8A W;  1EN6 A;  5LHH A;  4GX1 A;  4DV1 B;  1GN2 A;  1Q81 W;  3L74 H;  3P3N A;  2LQT A;  3AK3 A;  3RYC B;  1SS3 A;  4JI0 O;  3UO3 A;  3E22 A;  1FXV A;  4GCZ A;  3MHH C;  2P6J A;  1ZTE A;  3SJA C;  4FFK A;  5IJ9 A;  1AR5 A;  3CCL V;  5IY5 C;  3TCU A;  1KQS U;  1PD3 A;  3CXH F;  3E22 B;  3UT5 A;  2Q0A A;  1O9H A;  1P49 A;  2YEV B;  3FD9 A;  2FML A;  4EKW A;  4TSF G;  3BHP A;  4PI0 A;  1FFT B;  2Q8V A;  4QGP A;  5IJ9 B;  3RYI A;  3CEI A;  2KKW A;  4IT5 A;  3UQ8 A;  4LH7 A;  5CA1 B;  2XAF A;  3UT5 B;  5BY1 A;  1SQQ H;  2HVJ C;  2JRI A;  5TIS Z;  2RQ6 A;  1IBK B;  1MOF A;  3RYI B;  2WLM A;  2Z5U A;  2DN9 A;  3CC4 V;  2CE4 A;  1YEW A;  2XT9 A;  4PA4 A;  4X1I A;  3AG1 B;  4ICG A;  1PP9 H;  2MW2 B;  2F4V B;  1IVS A;  4XDK A;  4GUN A;  4J42 A;  2JDI G;  1N33 O;  2GTS A;  5KAF Z;  2A3Q A;  1M1K W;  4X1I B;  5EK0 A;  4AHC A;  4U3J A;  4BIZ A;  1RSO A;  1XI1 A;  2CTW A;  1YIJ V;  5IYZ A;  4B3S B;  5IYD O;  3SGI A;  3B09 A;  3ZS8 C;  5KX5 A;  4U3J B;  4G28 B;  3RBZ A;  1EN4 A;  1RSO B;  1BSM A;  5A9G A;  1YTF D;  4DR2 B;  1VMG A;  1SRY A;  3ZX6 A;  5IYZ B;  2AXT Z;  5CBF A;  4MVM A;  2QKA A;  3K5M A;  2XAQ A;  2L6L A;  2IJJ A;  5DED A;  4IGG A;  1W0J G;  5LOV A;  3KKY A;  5IWA B;  3CCM V;  1AI7 A;  2UXB B;  4H13 B;  4JI3 O;  2PY5 A;  1Y74 A;  3VQV A;  1XHZ A;  4R6Z A;  3QO5 A;  2CTQ A;  5LOV B;  3RYF A;  3CP1 A;  2QTS A;  2UUA B;  2KQX A;  3OMN B;  1XEQ A;  1NI8 A;  1Y66 A;  4DV1 O;  4GYC B;  1Y74 B;  4DYL A;  2DYS C;  3H1I H;  1N36 B;  2XAG A;  3WB0 A;  4RQE A;  2YIA A;  3RYF B;  4JV5 B;  1M4U A;  4X66 B;  4JPR A;  3E2E A;  1JA8 A;  2JVD A;  2R9R B;  3CCR V;  1OCR C;  3RFR A;  1P4R A;  1F4M A;  3CC2 V;  1TA8 A;  4PEL A;  3K5O A;  3C90 A;  3ZBH A;  4FJC C;  1WP8 A;  2CH7 A;  3HKE A;  2KB1 A;  1EZV H;  1YTF B;  5FPO A;  1S72 V;  2XAS A;  3ZJZ A;  1XRE A;  4X62 B;  1RFY A;  1HNX B;  4LF9 B;  1H2K A;  2CH7 B;  1I7F A;  3HKE B;  3BRC A;  1L1F A;  3ZN0 A;  4LF6 B;  1IBK O;  1I5X A;  1QLE C;  3SJC C;  4Z2W A;  2EIL C;  1MAB G;  3JD3 A;  1Q86 W;  1K3E A;  3E8B A;  3O9O A;  1BE3 H;  1BQ0 A;  1PNM A;  1IXB A;  2DQ0 A;  3A0H Z;  4LFC B;  1PL4 A;  1Z2G A;  2F4V O;  3Q4H A;  1YCI A;  3ZIA G;  2D2C B;  2UXX A;  3CE2 A;  4FMT A;  2IBZ H;  3IAY A;  4MS2 A;  4EFB A;  1RP3 B;  4B3S O;  1OCO C;  3BAB A;  1S77 D;  3Q4H B;  2GSM B;  4I9Q A;  2E74 B;  2N04 A;  1SZX A;  3K04 A;  1Q43 A;  1MZE A;  1PM9 A;  2IH1 C;  1SQG A;  4DR2 O;  4J11 A;  5JWP A;  4XDJ A;  1NR7 A;  3B40 A;  2Q67 A;  2JJ2 G;  3RN4 A;  3NXS A;  4FLT A;  1ROP A;  1Y6X A;  4NTY A;  4F6E A;  2ZD9 A;  1NR1 A;  1HNZ B;  5IWA O;  5EYP A;  5KUK A;  2UXB O;  1EFR G;  1FPO A;  3PN1 A;  2ZR2 A;  2QA4 V;  4TUY A;  4W4L A;  1KYO F;  4CH6 A;  2JGD B;  2OCC C;  3CWB H;  1BL8 A;  4UCT A;  5EYP B;  3AK2 A;  4X9Q A;  2IM9 A;  2UUA O;  2UXN A;  1E1R G;  4TUY B;  1F4N A;  4F6R A;  4D7T A;  1FFX A;  5EBW C;  1YI2 V;  1N36 O;  1Z5W A;  1AJQ A;  1K4D C;  5DEC A;  2PZS A;  1HW7 A;  1Y67 A;  4JV5 O;  2NLJ C;  3ASO B;  4LNU A;  4EB6 A;  5IJ0 A;  1WJZ A;  4X66 O;  4H44 B;  1JR9 A;  2YI9 A;  4F6R B;  4NTX A;  5CBH A;  1FFX B;  2QM7 A;  3AG3 B;  1NZ6 A;  1UPG A;  2JIZ G;  3CX5 F;  2W6J G;  3JSN A;  4LNU B;  1P84 F;  4EB6 B;  5IJ0 B;  5EC2 C;  5AG2 A;  1NH2 D;  4JZ2 A;  5JJN B;  3AG7 A;  3QO7 A;  4X62 O;  5C93 A;  1JCH A;  3G80 A;  4RUE A;  3WG7 C;  1HNX O;  4LF9 O;  1XNQ B;  4FLU A;  4TV9 B;  1OCZ B;  2R9A A;  4LF6 O;  3D36 A;  5CA3 A;  3ETE A;  3ZHV A;  2P7T C;  1GM7 A;  1K5Q A;  4PJ0 Z;  3A0R A;  4UVA A;  2QTO A;  3JCZ A;  5IE9 A;  4FM0 A;  5B3S C;  2F23 A;  1R6T A;  1XL4 A;  5EBM C;  4LFC O;  4UFZ A;  2IJK A;  3JD0 A;  1H8E G;  4H37 A;  2QKC A;  2CDY A;  2ATK C;  3BEH A;  1HNW B;  3AG1 C;  3H1L H;  1YHQ V;  2HHH B;  3UCS C;  4LBE C;  4WFE A;  3D3I A;  2Q4P A;  1H2L A;  4UVB A;  4DUZ B;  2QWQ B;  5L3B A;  2NNU A;  1K9M W;  4UCU A;  2Y4T A;  1SQB H;  4PA7 A;  1NT2 B;  5E79 Z;  1BS3 A;  3ZRV A;  1ORQ C;  1CP9 A;  1KP2 A;  3AG4 C;  2ZM6 B;  1QVG U;  2OCH A;  3HKB A;  2ZE7 A;  3H9V A;  4MTO A;  4X20 B;  4BW9 A;  3JD2 A;  1HNZ O;  1IBL B;  2VWK A;  5JVD A;  4GX2 A;  3DTU B;  3PJS K;  1K33 A;  3HKB B;  1KUQ A;  3E86 A;  1IXM A;  4CH3 A;  1UJW B;  3OUF A;  4YJ3 B;  1NS1 A;  1TUE B;  4WFH A;  2QJ1 A;  5JVD B;  3W7X A;  4X64 B;  3WFV A;  3LSQ A;  2JJ1 G;  1AP6 A;  2KG7 A;  4FLW A;  1JJ2 U;  1VQP V;  1LUV A;  1OHH G;  2QWR B;  1BHB A;  1K7D A;  3F7V C;  4OGQ B;  2DWD C;  1V9P A;  1QR9 A;  4FLV A;  3T4D A;  1K73 W;  2KG7 B;  2YIC A;  3IFX A;  1COW G;  3F5W C;  2DE0 X;  2IJH A;  5B1B C;  3CJH A;  4TQF A;  2RMK B;  2Q69 A;  1M57 B;  4ZOL A;  3JCU Z;  2WAM A;  3QG5 A;  4NVP A;  4AQY B;  1XNQ O;  1Y4M A;  4P2Z A;  3T4Z A;  5LGT A;  4E2L A;  3E8H A;  3CJH B;  1VF6 A;  5B1A B;  1HP8 A;  3C3T A;  3DGE A;  4Q6G A;  1GK9 A;  4RQF A;  4ZOL B;  3QVN A;  4JI5 B;  3JSL A;  2HR3 A;  3TK1 A;  2P67 A;  3L73 H;  2F43 G;  2WWW A;  4U7N A;  1WA8 A;  2DYR C;  5L3E A;  3BVO A;  1R3L C;  2X7R B;  3SYA A;  2EIN C;  4WFG A;  1HNW O;  2AHY A;  2CGO A;  2QKS A;  1AP5 A;  3K0D A;  2HHH O;  3ABK C;  3H1H H;  4DUZ O;  2EIJ B;  1AI5 A;  2WLH A;  2P4K A;  1DGS A;  1THZ A;  4FLY A;  5CMU A;  4FZ0 A;  1KKC A;  4ZHQ A;  3B8N A;  1BT8 A;  2NR5 A;  4P9P A;  2L35 A;  1E1Q G;  3L72 H;  1GKF A;  3ZHT A;  4YHH B;  4JI6 B;  3LDC A;  3FB7 C;  3ZHU A;  4E4E A;  4ZHQ B;  2ZM6 O;  1VP7 A;  4EEQ A;  1Q8I A;  5KHG A;  1GAX A;  1IBL O;  4D7S A;  4PA3 A;  4DV4 B;  4ASU G;  1DF5 A;  1H2G A;  3GB7 C;  3E83 A;  3K5L A;  4TWK A;  1XHX A;  1WPB A;  3FYI B;  1VQN V;  1GN4 A;  1J95 A;  1JVM A;  2LGW A;  1B6Q A;  4I7Z B;  5GTH Z;  2JS5 A;  1I94 B;  2JK5 C;  1NVP D;  5BXZ A;  4X64 O;  5EZY A;  4MVZ A;  5KHJ A;  4BWA A;  3K08 A;  2OTL V;  2QE7 G;  4FPP A;  5B66 Z;  5IT9 N;  1PNK A;  3H1J H;  5EZY B;  4PHZ A;  4TV8 A;  1V54 C;  3JYC A;  2Y0I A;  2H3O A;  2H8P C;  1PPJ H;  1AR4 A;  1GN6 A;  1YJN V;  4MT8 A;  1ZLZ A;  2LW7 A;  1VQ4 V;  4UB6 Z;  1K92 A;  4TV8 B;  3JAK A;  3I5D A;  2E76 B;  3AG3 C;  5CN0 A;  2IJI A;  4QPK A;  3DC6 A;  4AQY O;  3CRR A;  3VQY A;  2GBO A;  2HJF C;  3ABM C;  3JAK B;  4P9O A;  1IX9 A;  3K06 A;  1YSC A;  4JI5 O;  2OYQ A;  1MMM A;  2IH3 C;  1YIT V;  1OCZ C;  2Q73 A;  1MG1 A;  1AVM A;  2EJ7 A;  4K8Z A;  1QLN A;  1D2D A;  4UCS A;  5JCO A;  5ITZ A;  1NVP B;  3CRA A;  2LW1 A;  5GW7 A;  1SET A;  2BSK A;  4U7O A;  1YVW A;  2ZDI A;  1IZ3 A;  3K3W A;  3T1H B;  5K1X A;  5ITZ B;  1N34 B;  3STZ C;  3CXC U;  2FTK A;  2Q6A A;  3EHB B;  4YHH O;  4JI6 O;  1S3J A;  1MZF A;  2BSK B;  1S0V A;  4HBN A;  1JOY A;  2HFE C;  5LGN A;  2JS3 A;  1TUB A;  1MNG A;  1BGY H;  4MW3 A;  2BOB C;  3OR7 C;  3FB6 C;  2A7W A;  4DV4 O;  3VBB A;  4GKJ B;  5GTI Z;  1R3K C;  3MD0 A;  4WCE V;  2X0L A;  1I5Y A;  1TUB B;  1H2N A;  4UB8 Z;  3JAW A;  1I94 O;  1Q6I A;  1VQ7 V;  2ZIM A;  3E8F A;  2IW5 A;  4HAM A;  1KD1 W;  5GON A;  4YJ2 A;  2V7Q G;  3B4S A;  1B06 A;  2PUS A;  3JAW B;  4QE9 A;  2Q5Z A;  1VQ5 V;  3M7M X;  3L71 H;  2YIB A;  4OX9 B;  2KSD A;  4BAY A;  5GON B;  1AR1 B;  3W7W A;  3K5N A;  4KUM A;  3HKC A;  2P22 C;  4YJ2 B;  3DXR A;  5LMN B;  5FLX N;  4DR3 B;  1OCC B;  3CD6 V;  1BZK A;  3T2M A;  3P30 A;  5KHH A;  5BR8 B;  4DV5 B;  3DSQ A;  4TOI A;  4FM1 A;  2EX3 A;  1VQ6 V;  1TGO A;  1HDJ A;  3HKC B;  1BQZ A;  1GM9 A;  2WA3 A;  4DW0 A;  3DXR B;  5KX5 B;  3T1C A;  4KHP B;  5FNV A;  4X1Y A;  5H9C A;  2B1G A;  3D8C A;  4F4L A;  2W6I G;  1S5J A;  2N74 A;  1M57 C;  2FKX A;  2YI8 A;  3K9S A;  2OIE A;  2ZE5 A;  1MSD A;  4UV9 A;  4X1Y B;  5EIB D;  2DQ3 A;  3TGU H;  2E3C A;  1PNL A;  3CYO A;  2E5L B;  5JH7 A;  1MSW D;  3HR0 A;  4CS2 A;  3ZHQ A;  2ODM A;  3EVK A;  4RWU A;  4UCO A;  3ZRW A;  5C8Y A;  4JZG A;  2OIG A;  2BE3 A;  4MSW C;  5JH7 B;  3JAR A;  1N34 O;  1KMI Z;  2VS0 A;  4UXN A;  2LP7 A;  1N8R W;  2QGN A;  3ZRW B;  5C8Y B;  2MK3 A;  4IYH A;  1VEW A;  3N27 A;  3L70 H;  3RVZ A;  3JAR B;  1KBH A;  2V1D A;  1OJH A;  3KZI Z;  2H94 A;  4AIL C;  1S5L Z;  3RVY A;  1WN7 A;  1ZWI C;  3K57 A;  4GKJ O;  3BPZ A;  1V55 C;  4PA9 A;  3WU2 Z;  4UV8 A;  5D5P A;  4YY3 B;  4G2K A;  4LR3 A;  1QCE A;  3BFR A;  1GRJ A;  2YXH A;  5LP6 A;  3VQX A;  2WLN A;  2Q7G A;  2ZE6 A;  3RT3 C;  4DO2 A;  1RPR A;  1SKV A;  4DW1 A;  2QR4 A;  3OTF A;  2XHB A;  1D5N A;  5LP6 B;  4OX9 O;  3GWO A;  1F7Y A;  2EIM B;  4UCV A;  5H5N A;  4CH5 A;  1FXK A;  5KA6 A;  5LMN O;  4DR3 O;  2K1E A;  2AW9 A;  2W0X A;  4PDL A;  3AG2 B;  1CPY A;  5BR8 O;  4UUJ C;  4DV5 O;  5DN6 G;  3N2K A;  2VRZ A;  3M8A A;  4JAU A;  1VF7 A;  4IYI A;  4KHP O;  3OT7 A;  1NKD A;  4I55 A;  4FM2 A;  3N2K B;  3K79 A;  4LH6 A;  4QNH B;  1JQ0 A;  1IBM B;  3OEH G;  1EM1 A;  4JI8 B;  1G8M A;  1Q6H A;  3HPL C;  3L9D A;  2NN4 A;  4JF3 A;  3IGA C;  4O4L A;  4IIJ A;  1YJ9 V;  3OUS A;  2E5L O;  2R70 A;  4B3R B;  1K97 A;  1VF5 B;  4K0K B;  3JD1 A;  4P30 A;  2PYJ A;  4YIP A;  1M5I A;  3W7U A;  4O4L B;  3UM7 A;  1SF9 A;  2QDO A; 
#chains in the Genus database with same CATH homology
 2F4V O;  4LF6 O;  3O65 A;  1I94 O;  4X65 O;  4B3R O;  2UU9 O;  3T1H O;  3R66 A;  4DUY O;  2DOS A;  4K0K O;  1J5E O;  1N32 O;  1R1B A;  1YZB A;  4GKJ O;  3J7A U;  1XNQ O;  4NXN O;  4B3S O;  1A32 A;  1R6T A;  2LW7 A;  4LFC O;  2UUC O;  4DR6 O;  4DR1 O;  2DJV A;  1XMO O;  3F5T A;  2UXC O;  4DR2 O;  4JI3 O;  4LF4 O;  2UXD O;  4AQY O;  4JI0 O;  5FLX N;  1AIL A;  3RT3 C;  4A5U B;  4DR5 O;  2AGA A;  2VQF O;  1FYJ A;  4YY3 O;  1XEQ A;  5IWA O;  4DV1 O;  2UXB O;  4OX9 O;  1HNW O;  4JI5 O;  1F7Y A;  4LFA O;  3T1Y O;  2HHH O;  4B3T O;  5H5N A;  4OPH A;  4DV6 O;  4DUZ O;  3OTO O;  5LMN O;  4DR3 O;  2Z0A A;  3J81 N;  5LL6 Y;  3JAM N;  4B3M O;  1D2D A;  4DV2 O;  1HNZ O;  2N74 A;  5BR8 O;  4DV5 O;  1FKA O;  2UUA O;  2FKX A;  4DR7 O;  4JI4 O;  3M8A A;  4JI1 O;  5BY1 A;  2JRI A;  4LFB O;  1KUQ A;  1N36 O;  4KHP O;  2ZM6 O;  4LF5 O;  4JV5 O;  1NS1 A;  4X66 O;  4DV0 O;  4OPA A;  4DV3 O;  4LF7 O;  1IBL O;  4YHH O;  4JI6 O;  2VQE O;  1XNR O;  4JI7 O;  5LMU O;  1X59 A;  1G1X B;  4GKK O;  1FJG O;  4DV7 O;  4LF8 O;  2ZKO A;  1IBK O;  1N34 O;  5A2Q N;  2UUB O;  2E5L O;  1N33 O;  4JI2 O;  5BXZ A;  3SDL A;  4X64 O;  1XMQ O;  4DV4 O;  1IBM O;  3J80 N;  4JYA O;  1AB3 A;  4JI8 O;  4X62 O;  1HR0 O;  4DR4 O;  1HNX O;  4LF9 O;  4NXM O;  1DK1 A;  5IT9 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...