4DR5O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ribosome/antibiotic
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr5O00
4GKJO 4JI5O 4DR2O 3M8AA 1X59A 4LFCO 4K0KO 4DR3O 1FYJA 4DR1O 4JI0O 4LFAO 2ZKOA 4X66O 5LMUO 4OPAA 3J81N 2AGAA 4DV0O 1IBLO 1XNQO 5A2QN 1DK1A 4DUZO 1XMQO 4DR7O 3SDLA 5LL6Y 4YHHO 2JRIA 5LMNO 4B3RO 4DV2O 1G1XB 1YZBA 4A5UB 4LF8O 4B3SO 2Z0AA 4NXMO 5H5NA 4DV1O 4LFBO 4KHPO 3RT3C 4DV4O 2E5LO 1N33O 1AILA 2UUAO 4JI7O 2VQFO 4YY3O 4LF5O 3T1HO 1IBMO 4DUYO 1HNWO 4X64O 4B3TO 5BY1A 2UU9O 2FKXA 4X62O 1IBKO 4NXNO 2HHHO 3O65A 1D2DA 3JAMN 4LF4O 2UXBO 1AB3A 4DR5O 5BXZA 3J7AU 3F5TA 2F4VO 4OX9O 1R6TA 1R1BA 1NS1A 3R66A 4LF7O 1I94O 1HNZO 1XEQA 4X65O 3OTOO 4JI8O 1XMOO 2LW7A 4DV5O 4DR4O 4JI1O 2N74A 4DV6O 4LF9O 1HR0O 5IT9N 2UUCO 5IWAO 1A32A 1F7YA 2UUBO 4GKKO 1N32O 2DOSA 4DR6O 5BR8O 3T1YO 1N34O 4JI6O 2DJVA 5FLXN 4B3MO 4JI2O 1N36O 4JV5O 1KUQA 4DV7O 4DV3O 1HNXO 1XNRO 2UXCO 3J80N 1FJGO 4JI3O 1FKAO 2UXDO 4JI4O 4LF6O 4OPHA 2ZM6O 1J5EO 4JYAO 2VQEO 4AQYO
chains in the Genus database with same CATH superfamily
3TXQA 1M93A 4JI1B 1S77D 2VWJA 3E35A 2QJ1A 1VMGA 2Y4UA 5FNVA 3QF7A 4CBCA 4LFAO 1OCCC 1RM1C 4JYCA 4MTXA 4MTOA 2EIJB 2ADQB 4FLZA 1QQCA 2Z3YA 3AG7A 4GUNA 1SRYA 1NBMG 2DE0X 3E8FA 2R9IA 3T4ZA 2RJZA 1G1XB 4AILC 2QDOA 2BCCH 2WA3A 1R6KA 2Q7HA 2Z0AA 5IJ0A 2Y0PA 2K9PA 1K73W 2HG5C 3E22A 1QNMA 3FYIB 4LF5O 2WAMA 4K8XA 5B1AB 5DECA 1QVGU 5KAFZ 1L0LH 1D5AA 1IURA 4MVSA 3M99B 2YXYA 1GN2A 5H6QA 1KD1W 5CMUA 2F95B 1NJIW 3OM3B 4DV1B 2WLLB 2YIBA 4JI8O 1EM1A 2OT5A 4UVAA 3CXCU 3RYFA 4LF9O 1AR5A 2MK3A 4UV9A 4DUYB 5B5EZ 2LP7A 5TISZ 2QWRB 5C8YB 4JI2O 4JV5O 4NYKA 4FZ1A 3QO8A 3BAAA 4MVOA 2X6BA 4W4KA 4U3FH 4X65B 4JI5O 2LW1A 4K0KO 3ASNB 3ZN0A 3H1KH 3Q4HB 2ZKOA 5KMGA 3CRCA 3QO7A 5CBFA 5KX5A 4WFFA 2WLIA 2GV9A 2XAGA 2MW2B 1QLEC 2BSKB 3P30A 3H1JH 3ABLB 1AJNA 4DUZB 4DV2O 3ZMTA 5ITZB 1K4DC 3SJCC 2DYSB 4TV9B 2YIAA 3WB0A 3DTUB 5KUMA 4I0XB 1S76D 5JH7A 3FYEB 2WA4A 2EJ7A 2QWQB 2XUMA 5BY1A 3CP1A 4CC5A 1XI1A 2HHHO 2YSUB 4UFZA 1JVMA 2UU9B 1W2BU 4I50B 1FFXA 3FAVB 1FD9A 2QM7A 2ZE8A 3FB5C 4MW3A 5BXZA 1WB8A 2CK3G 2GBOA 4O2BA 4P9OA 2LJ2A 1XMOO 1KBHA 4G2KA 1VIBA 2WLHA 4EFEA 2ITCC 1AJPA 2VQFB 4CH3A 5LP6A 1AR1B 2AW9A 1ORQC 3X2QB 1EZVH 1IXMA 4FK5C 4N23A 4I9QA 1SQXH 2W6JG 5L3DA 1AI7A 3D36A 5IJ0B 4OPHA 2HR3A 3E8HA 4J11A 2QKAA 4LF7B 4BIOA 4WFEA 3LUTB 1H2LA 3E22B 2IU0A 3EFFK 4W4LA 3LDDA 3G6BA 3FB8C 4X66O 1YCIA 3APQA 3GWKC 1W59A 4D6TH 1VQLV 2YIBD 2ZCEA 1H2NA 5A2QN 3CEIA 3STLC 1HNXB 4GCZA 5FPOA 4ASUG 3DXRA 3JATB 5L3GA 2QKCA 1SQBH 4LR3A 3I5DA 2Y69B 1MMMA 3ASNC 4WBNA 4LF8O 4B3SO 2LGWA 3RYFB 2HVKC 5IYBO 3AG3B 4IIJA 3L70H 2JEXA 1N4CA 4U7NA 2PZSA 1GM8A 3CXHF 4UCTA 4ZBMA 1XOUA 2GUZA 4JZGA 3ABLC 2Q7EA 1K4CC 1OCRB 1GN6A 3UT5B 3LNNA 1Q90D 4NTXA 2JEUA 4X62O 1WNSA 4Q20A 5E1AC 4ZI7A 4B08A 3MHHC 2DYSC 2F93B 2AXTZ 4JTDB 3R66A 1VF5B 4DR5B 1YSCA 1YI2V 2B1IA 4JI7B 1UFIA 2WLIB 4X8AA 2DOSA 3K79A 2P90A 2B5UA 4PV1B 2O57A 2AZ2A 4GKKB 1HDJA 3ABMB 4IYIA 3ICXA 4DV3O 2X0LA 4LF4B 1EN4A 4MVRA 2IJKA 4R7CA 5IJ9A 3IFXA 4YJ2A 2VQEO 4K8ZA 2ARHA 2OIEA 2ZM6B 4HNAA 4KXRA 5H9CA 5JH7B 3CWBH 2LO1A 1K7DA 1B04A 2EINC 2KG7A 3O9OA 1XHZA 1O9GA 5LMUO 3RFRA 1ZLZA 1N34B 5E79Z 5LHGA 2IW5A 4LH7A 4R8CA 1FFXB 2XNDG 4JYBA 3K0GA 4GX1A 3K03A 5EYPB 4O2BB 1AP5A 3AG4B 3OGCC 2IU3A 2ZD9A 5LP6B 2BOBC 2QA4V 4JI0B 2N04A 4RAIA 4IGGA 2ATKC 4FFBA 4FVMA 1M5IA 5LHIA 1HNWO 2OWOA 1V55C 3RYCA 1SETA 2HKOA 3OMNB 4IT5A 5GTIZ 1YIJV 1GN3A 4K35A 4ZHQA 4UB6Z 4NTWA 2F4VO 4J9YB 3OAAG 4MVQA 4NKGB 1FXKC 3LSQA 3G80A 1BE3H 1WN7A 1XEQA 1Y67A 1TAEA 1I7FA 4JI1O 5IYCO 1BL8A 1ZWIC 2CH7B 1AI4A 4QPKA 3H9VA 1NTKH 4UCRA 2ZE5A 5KA5A 1VQ8V 5KA6A 3DXRB 2E3CA 3SPJA 2XAFA 4MS2A 2M6YA 2M7WA 1MSDA 3EVKA 4B3MB 1OCZC 2HVJC 4U7OA 2XASA 4UXNA 4P9PA 3CCVV 2ZQMA 3BRCA 3JAKA 4IIJB 3OTOB 2RQ6A 4AHCA 3WB2A 3M8AA 4AQYB 2XHBA 2B1GA 2GUZB 1HR0B 2CGOA 3ETQA 1Y66A 2YXHA 1OCCB 5L3EA 1RM1B 5J2TB 3M7MX 4RUFA 3T1CA 1TUBA 1WPXA 4TQDA 3NXSA 1KQSU 3FB6C 2BTQA 4FLUA 2W0FC 4JI4B 4LF6B 3I56V 1J5EB 1YJNV 3N2GA 1GTOA 4B3RB 3CSXA 4NXMO 1VP7A 2H3OA 5KHIA 2EILB 4DV1O 5LXTB 2DMXA 3RT3C 3LNMB 3DGEA 1RSOB 4XBFA 5AG2A 3ZHRA 5JCOA 5KLVH 1GN4A 4DUYO 1IBLB 2C2AA 3ZIAG 1Q3EA 4PA3A 1OHHG 2A7WA 4QE7A 3AG4C 3OR7C 1SQGA 2DQ0A 2X7RB 2CUGA 5IJ9B 2P7TC 4YJ2B 4RO2A 5GTHZ 5EBWC 4FLXA 4HNAB 5CA1A 3VOUA 3FD9A 4J41A 5KUKA 4X65O 1Q82W 1TVKA 3ZRWA 4KUMA 2UUAB 1I94B 4YXWG 2KG7B 3K9SA 3GWOA 3TK1A 1NU1H 2R9RB 1AR4A 2LGQA 3VQVA 3E89A 2JJ1G 4EB6A 2A79B 4GX0A 2FB5A 4DK0A 1SKVA 5EC1C 2A0LA 2UXCO 3N27A 1I5YA 2ZXWC 2UXBB 1RPRA 4JAAA 3JYCA 2WLNA 1E1RG 2LQTA 2Y4TA 5JJJB 3SJBC 2JS5A 4NVPA 1NZ6A 3CCUV 2EIMB 2OCHA 2QTSA 3KZIZ 4FFBB 1XL6A 2JGUA 2GHYA 5L3CA 5KHHA 2DWDC 3I55V 2ZIMA 3K0DA 2JDIG 3FX7A 1IZ3A 5BR8B 4E4EA 5CB4A 3F7VC 3LDCA 1DLBA 3RWRD 1DK1A 3SJAC 1KP3A 4K3AA 4MVZA 3SDLA 4ZHQB 1Z5WA 2P4KA 1TUEB 1PPJH 3ABUA 2QTOA 1YZBA 1D5NA 5A9GA 4GKJB 4Z2WA 4TT3G 1YHQV 1JMKC 4X20A 4DV4O 3U10A 1AILA 2VQFO 1Q6IA 2YDEA 1ZUQA 5BZBA 2EIKC 1XMQB 3U11A 2QWNB 4DW1A 1SC5B 2Q0AA 3IC7A 1GKFA 2OIGA 2EILC 3JAKB 3CPWU 1ZL8A 5KHJA 1R6TA 2P4VA 1R1BA 2EJRA 4LF7O 1PM9A 1EN6A 2YEVA 4PHZA 3K3WA 4JAVA 2ZE7A 4UV8A 4BWAA 1F7YA 1T5EA 4J10A 1O9HA 4LWSB 4X64B 1H8EG 1WA8A 2BTQB 2DJVA 3BA9A 3B8NA 2YUAA 2YC0A 5JVDA 1HNXO 1Y74A 3JCZA 4FJCC 4FZ0A 4OGQB 4TWKA 1FJGB 3OE7G 3JAWA 1R3IC 1CPYA 1QR9A 1VQ7V 3F7YC 3U0ZA 3RN4A 5J2UA 4LFCO 2WWWA 1WP8A 4DO2A 4E2LA 3NR7A 3DC5A 5LHHA 1VQ4V 4TOIA 2UUCB 1FXKA 3H01A 3E2EA 4H13B 4X88A 3JD0A 4DR1B 4LCUC 3ABKC 3ZS8C 2X6AA 5L3BA 4JAUA 5CA0B 3OGIB 2PUSA 2IJIA 2XTAA 2EIMC 2F23A 5FL7G 2B9ZA 4F4LA 1TVKB 1PKXA 3ZRWB 3QVNA 4O4IA 2PI5A 4PDMA 4RWUA 2V1DA 1W0JG 4TSFG 1K8AW 1IX9A 1KU9A 2E5LO 4JI7O 4G28B 4H37A 1R3JC 4EB6B 2QWOB 5B1NA 1L0NH 4DV0B 1Q81W 2FYUH 5LYJA 1JJOA 1ZTEA 2EULA 4TV8A 1OCOB 1IXBA 1NR1A 4LF4O 2XAHA 3ETDA 3HKDA 2Q6AA 2ZR2A 1HNZO 2XAJA 2FL4A 4UUJC 5EK0A 2N74A 3JD3A 3UO3A 3FB7C 3D8CA 3HKEB 1MZEA 3CCMV 5CB4B 2GTAA 1H2SB 3BEHA 1H2KA 3RGBA 3CMAV 2GSMB 1N34O 1P49A 4B3TB 1IBKB 4P30A 3CCRV 3MDSA 4U3JA 3SYOA 2VWKA 2YI8A 3BABA 1P7BA 1BHAA 5FNVB 2CTPA 4DR4B 4PDLA 1FAFA 2LFSA 3QG5A 2V4DA 5JWPA 4PA7A 4JI0O 1JCHA 1GH6A 1OZ0A 1K34A 3IC9A 2EINB 5JJEB 1VF6A 3RBZA 2JK5C 3ETEA 1XNRB 1ZL8B 3CHXA 1KB9F 3SYCA 2A3QA 4MT8A 3UO2A 4HZ3A 5HFLA 5JCOC 3OMAB 4MVMA 1YJ9V 2YEVB 4DR3B 4JYYA 1KMIZ 1N33O 4KL1A 1VQ6V 1M4UA 2P67A 2WLJA 1WA8B 4CC6A 4I4TA 5JVDB 1Y74B 3ZHVA 4YHHB 1H2MA 1V55B 5LMNB 4PD4F 4RQFA 2ZINA 1JFFA 1K92A 3SJQC 4WFAV 5CA3A 3OW2U 2W0XA 3ZHTA 1S5HC 4N21A 5CBGA 1VEWA 2L35A 1R73A 2ZIOA 5J2UB 1GAXA 2PY5A 4LFBB 4CH4A 4GZRB 1SQVH 1CP9A 3OTOO 1FXKB 2QKSA 4FLTA 1EZJA 1ZX3A 3HR0A 1U97A 1S0VA 4RQEA 1HR0O 3K06A 3OEEG 4UCVA 5BMVA 2KKWA 4D7TA 1OCOC 1ZSPA 4NXNB 5FLXN 1MA1A 4LBEC 2GTSA 1BQ0A 4J7ZA 3J80N 1OCZB 4JI4O 4LF6O 1J5EO 2CAZC 1BHBA 5KMGB 5H6RA 5KX5B 4X9QA 4IHJA 3JALA 3ZHQA 2JS3A 2FTKA 3W7TA 4JI5B 3L73H 1ROPA 1VF7A 3KKYA 2RNBA 5KHGA 3N2KA 1IBLO 4O4HA 3E8BA 3P32A 1UPGA 1N36B 4DRXA 1BCCH 4GX2A 2UXDB 4FM0A 4JTAB 3TJTA 3HKDB 1Q6UA 2F1MA 1X4TA 3T2MA 4WFGA 4FIPC 4Z1MG 1F51A 2UUAO 1QBZA 4D7SA 3CCEV 3G4SV 3CCQV 4CS2A 2JGDA 3AK3A 4TUYA 3AG2B 1H8HG 3RW0A 2HP8A 1YXBA 1XBLA 3BFRA 2FKXA 2P5OA 1N8RW 3O65A 5LBQA 3TCUA 2UXBO 2HHHB 3KCXA 3SR2C 1AB3A 3CRAA 3K5OA 3BVOA 1R3KC 5K1XA 3RVZA 2KSDA 2CTQA 4DV6O 2OCCC 1XMOB 1Y6XA 2DQ3A 2YIDA 1IBMB 3WFVA 5HFMA 1N32O 1A32A 3CS5A 4G27B 2QM8A 3LDEA 1HW7A 2PF4E 2Q69A 4YIOA 5BR8O 3CCSV 2QGNA 4CS3A 1GK9A 3SPCA 1Q6HA 1IDSA 3SGIA 1DTOA 4CS4A 3KG2A 3LSSA 1NQTA 1B6QA 1MSWD 4PJ0Z 4WCEV 3IJ4A 5EC2C 2ZXWB 3RVYA 4LNUA 1SERA 1M9NA 2CDYA 3B40A 4BW9A 5KHKA 4GKJO 1EBOA 3JD1A 4I7ZB 4I5SA 1P7GA 3CJHA 4JGSA 5IDJA 1THZA 4I4TB 2UUBB 1PNMA 2DN9A 2IM9A 3T1YB 3KCYA 2A06H 3PJSK 4JI6B 4WBNB 1S5LZ 1JFFB 3HB3B 1VQKV 1V54C 1PNKA 1XMQO 1VQOV 5LL6Y 4JI3B 3K04A 5EBLC 1PL4A 3SPHA 3ZMZA 1P4RA 2ZT9B 1MNGA 3L72H 3ZRVA 3RYHA 1BGYH 5IE9A 3D3QA 4KFMA 3R65A 5LGUA 3ETGA 4ZI7B 1JR9A 1Q43A 4X64O 2EIKB 3RYIA 3CYOA 2XOKG 1KECA 1COWG 3VQXA 3JAMN 2PI4A 3W7WA 4FLYA 2YICA 1M90W 4IHJB 3JALB 2HFEC 4F6EA 1J95A 3C3SA 1ENVA 4YY3B 4ABMA 3AG2C 1NTZH 3OTFA 4UVCA 4FM1A 2UUCO 3N2KB 5D5QA 4ZOLA 1US6A 2FMLA 2Q9LA 1LUWA 2K1EA 2D2CB 4DYLA 1S3JA 2Q8VA 2DW4A 2Q73A 4QE9A 2QE7G 4JZ2A 3JSNA 4F6RA 1K3EA 2WPDG 3ZRXA 3S3XA 1VF6C 3ZMUA 2VQEB 3F5WC 1JPXA 3A2FA 3A0BZ 3FKSG 1FYJA 5IWAB 4NTYA 4TUYB 1WP7A 2IBZH 2AGAA 3ABKB 4DV0O 5LMUB 1L8DA 1Z5VA 2ILMA 4CZZA 5L3FA 4DUZO 4NR1A 2R72A 4MVUA 1SA0A 1G4YB 3ZHUA 5B3SC 1VQ5V 4BAYA 3W7UA 4DR2B 1NR7A 2AHYA 5EIBC 1E1QG 4P2ZA 1VQ9V 4UVBA 3RYCB 1TA8A 3SPIA 3K58A 3ZBHA 2DWEC 4MSWC 5K1PA 4B3TO 3ZMVA 4DR7B 5DM6V 2UU9O 1SESA 4TQFA 1IBKO 3OT7A 3CC4V 2ZDIA 1LNQA 1M56C 2RN9A 4LNUB 3G71V 1GO3F 1VARA 3J7AU 2H94A 3ASOB 3VQYA 3CJHB 1TGOA 4DR4O 3B77A 2RCVA 2ADPA 2BTOA 3QTCA 2Q7GA 2H8PC 3BHPA 2Q68A 1K5QA 4C7UA 3ZX6A 2F66C 5LGTA 1XNRO 1MOFA 2UXXA 2NR5A 3K08A 5IYZA 3RYHB 1BMFG 3CRMA 2NNUA 5LGNA 3K9AA 3TGUH 4DV5B 3CRRA 1H2GA 1I0HA 1G6UA 4J7KA 5J9PC 4DR3O 1TUBB 3QNEA 3JARA 1DGSA 1JX9A 2BOCC 3OEHG 2QM4A 1QU7A 2IJHA 4B7KA 5GONA 2ZNJA 1KKCA 3RYIB 4BR6A 1BZKA 1W0KG 3N2GB 5B1BC 1K97A 4QIWF 1JOYA 4YHHO 1YITV 5LMNO 1KKDA 4J9ZB 2P6JA 3EXAA 5H2FZ 1MZFA 4LFBO 3WB1A 3JATA 4NXMB 4LC1A 4ZOLB 3BCCH 4HYOA 3APOA 4RUEA 4ZIBA 4WFBV 2HJDA 1GRJA 2EX3A 1XNQB 3SPGA 3VBBA 1YTFD 2ZE6A 4Q6GA 5CA1B 2NLJC 1H38A 4NXNO 4F6RB 2DYRC 3D3IA 1K9MW 4JPRA 4QGPA 3UT5A 4DR5O 3JD4A 1YTFB 4H0LB 4KHPB 3W7XA 2LW7A 1KYOF 1QR8A 3TXSA 4OXSA 2JIZG 1SQQH 3EHBB 3T1HB 2X6CA 1KC8W 1SQPH 4GKKO 5DEDA 3ML0A 2HEPA 1SA0B 4GX5A 2NN4A 2G38A 4H44B 1N36O 1KUQA 1PL0A 3ASOC 2UXDO 1PV0A 2UXCB 4OX9B 5IY5C 2QSAA 4O2AA 2ZM6O 3WG7B 3JD2A 3AK2A 2P06A 2WSSG 1X59A 3HKCA 3UKMA 2XT9A 3L75H 1G8MA 1XILA 2PTMA 1NTMH 4PA4A 4X1KA 3OD4A 4DR6B 2EIJC 3WU2Z 4XDJA 3P3NA 4MW8A 1NKDA 1NT2B 1XDCA 5GW7A 4O4LA 3G6EV 4PA6A 3T4DA 3G67A 3MAQA 4DV7B 1K5SA 3E8GA 3CX5F 4J80A 3W7SA 4X20B 4JYAB 5B1OA 4LP8A 1RP3B 1EFRG 4X1IA 1YEWA 2QWPB 1FXVA 1SZXA 1AJQA 1R3LC 4IYHA 1B3QA 4HAMA 3CC2V 1AI5A 4LH6A 3A0HZ 4PI0A 5EYPA 4LFAB 2IH1C 4DV4B 1IBMO 1Y4MA 5B1AC 3DC6A 3HKBA 4BW5A 1MG1A 3LSUA 3SYQA 1NH2D 1GM7A 5IYZB 2R70A 3K5NA 2CTRA 2KQXA 3E86A 1FS0G 1WAZA 1NS1A 1NH2B 1CXZB 1Y76A 3A0RA 3OFNG 4L8JA 3JARB 1DF5A 1VQMV 3OR6C 3HPLC 4ZKIA 2OCCB 5GONB 4LF5B 2UUBO 4CH5A 4H33A 3T1YO 3B09A 1QHTA 4XDKA 1YJWV 4JI6O 2CE4A 4O4JA 1XHXA 3JAWB 5LA6A 4B3MO 4UCUA 4MTFA 2CH7A 1VQPV 2OYQA 3ZRSA 1BT8A 3OUFA 1Q5OA 4PA9A 3GB7C 4JI3O 1SS3A 1FKAO 2LFRA 2PYLA 4DXWA 1AVMA 3ZN1A 3ABTA 1WPBA 4UCOA 1GMGA 2VRZA 3VQWA 1FPOA 4AQYO 4JI8B 1F4NA 3UQ8A 1MABG 4GT1A 4J7JA 4LF9B 2IJJA 4I55A 2HJFC 4LFCB 5DN6G 3H1IH 3BA8A 3P3PA 4XDLA 2Y48A 1Q7YW 4OPAA 2QEXV 1YF2A 4UB8Z 5JQGA 4JI2B 4JV5B 4FFKA 4O4IB 1HWYA 2Q0OC 3WG7C 1V54B 1AROP 2OTLV 5LOVA 5J2TA 3K57A 5CBHA 4YIPA 4B3RO 4A5UB 1ZAUA 3B8MA 3CRQA 5H5NA 4K0KB 5B66Z 1HP8A 1M1KW 5KAIZ 5EZYA 1URFA 3MD0A 1SZTA 2ZDIC 3IGAC 4YY3O 2E5LB 5LYJB 1JJ2U 5EBMC 2E75B 4TV8B 2BE3A 5LXTA 3CD6V 1RSOA 5D5PA 4EKWA 4PDVA 4O2AB 4DV2B 3L74H 4JASA 3STZC 4DW0A 3TETA 2WLKA 1IVSA 2GDSA 2W6IG 3AK1A 3HKCB 1BSMA 1I94O 4QPJA 4JF3A 4X1KB 3AG1B 5F2VO 1AP6A 1BQZA 4X1YA 1HNZB 2ZNIA 1XREA 1QLNA 1K33A 4GLXA 4NB5A 3X2QC 1JA8A 1YVWA 1XQ8A 4U3JB 3UCSC 5IWAO 4O4LB 3FFQA 3CE2A 4I9WA 2AHZA 2RDCA 2KB1A 4R50A 4GYCB 3MHSC 1P84F 4FPPA 3L9DA 3ZCCA 4X1IB 2L6LA 3S3WA 2ZR3A 2PGGA 1GM9A 4EFBA 4DR2O 4PI2A 1M57B 2WLMA 2Q5ZA 4AI8A 5CN0A 1WB7A 5FPRA 2N05A 2CTWA 3AEIA 3H1HH 3HKBB 2OTJV 3OMIB 1RFYA 2Z5UA 4UCSA 2VS0A 3K59A 2YS8A 4DR7O 2Q67A 1Z2GA 1PNLA 5EIBD 1NVPD 2Y69C 4YJ3A 4X89A 1RPOA 3OUSA 1Y76B 1E79G 2Y0IA 5B3SB 1VQNV 3AG3C 1B06A 1V9PA 3JASA 3A8TA 1WLEA 4BIZA 1NVPB 3GVMA 3JSLA 4X66B 1I08A 1N33B 3H1LH 1OCRC 1N0JA 3L71H 4O4JB 1SF9A 3JCUZ 5LA6B 4QJFB 3B2EE 4EEQA 3ZEDA 1CEZA 2QR4A 1U96A 1EN5A 2RMKB 1D2DA 1M56B 3BY6A 4LF8B 2V7QG 4B3SB 1F23A 3ZHSA 4ICGA 4I55B 1UJWB 5BMVB 1WJZA 4HBNA 3SYPA 4DV5O 1NI8A 4QNHB 2UXNA 2EBOA 2YXLA 5IYDO 1QVFU 1JQ0A 1PP9H 3C90A 1FFTB 4KP4A 5JQGB 2D3OW 4B7EA 3ABMC 4IL6Z 2YI9A 4X62B 5LOVB 3QO5A 2IH3C 4L87A 2EZPA 3CMEV 1L1FA 2PYJA 1S5JA 1FJGO 2E74B 4MTGA 3AG1C 4LWSA 3CB2A 5EZYB 1F4MA 2E76B 4O4HB 2WLLA 5C93A 3C3TA 4CH6A 4Z1VA 4DR1O 4DRXB 4WF9V 1DF4A 1YDXA 4WFHA 1LR1A 1KP2A 3J81N 3SYAA 2ETNA 3THOA 1XL4A 1XNQO 4FMTA 5B1BB 4DV3B 5C8YA 3CCJV 2JRIA 3PN1A 1AI6A 2P22C 4PDRA 1Q86W 4PELA 1M57C 4FLWA 4DK1A 3E83A 2A9HA 1XUQA 2F43G 1Q8IA 5CA0A 4X1YB 5LP6C 4FLVA 3IAYA 3CCLV 1PD3A 2JGDB 2ODMA 4KHPO 2Q4PA 3UM7A 4J42A 3T1HO 1S72V 3Q4HA 1SQFA 1R6NA 3BPZA 1FXHA 3D36C 1BS3A 2BSKA 2DYRB 2JVDA 3F5TA 4OX9O 1N0NA 3K5MA 4JTCB 2XAQA 2JJ2G 5ITZA 2EZOA 5JJNB 5IT9N 4TV9A 3K5LA 4DV6B 3CC7V 4I0XA 4FM2A 4DR6O 2HLDG 2AZ0A 1HNWB 1N32B 3HKEA 4BIUA 1OJHA 1QCEA 4YJ3B 3ZJZA 3DSQA 4DV7O 2R9AA 2CGNA 2ITDC 3B4SA 1I5XA 1OV9A 2F4VB 1QLEB 3ZMSA 4R6ZA 4JYAO 4I50A 5IY5B 3JASB 3FAVA 1LUVA
chains in the Genus database with same CATH topology
4GKJO 4JI5O 4DR2O 3M8AA 1X59A 4LFCO 4K0KO 4DR3O 1FYJA 4DR1O 4JI0O 4LFAO 2ZKOA 4X66O 5LMUO 4OPAA 3J81N 2AGAA 4DV0O 1IBLO 1XNQO 5A2QN 1DK1A 4DUZO 1XMQO 4DR7O 3SDLA 5LL6Y 4YHHO 2JRIA 5LMNO 4B3RO 4DV2O 1G1XB 1YZBA 4A5UB 4LF8O 4B3SO 2Z0AA 4NXMO 5H5NA 4DV1O 4LFBO 4KHPO 3RT3C 4DV4O 2E5LO 1N33O 1AILA 2UUAO 4JI7O 2VQFO 4YY3O 4LF5O 3T1HO 1IBMO 4DUYO 1HNWO 4X64O 4B3TO 5BY1A 2UU9O 2FKXA 4X62O 1IBKO 4NXNO 2HHHO 3O65A 1D2DA 3JAMN 4LF4O 2UXBO 1AB3A 4DR5O 5BXZA 3J7AU 3F5TA 2F4VO 4OX9O 1R6TA 1R1BA 1NS1A 3R66A 4LF7O 1I94O 1HNZO 1XEQA 4X65O 3OTOO 4JI8O 1XMOO 2LW7A 4DV5O 4DR4O 4JI1O 2N74A 4DV6O 4LF9O 1HR0O 5IT9N 2UUCO 5IWAO 1A32A 1F7YA 2UUBO 4GKKO 1N32O 2DOSA 4DR6O 5BR8O 3T1YO 1N34O 4JI6O 2DJVA 5FLXN 4B3MO 4JI2O 1N36O 4JV5O 1KUQA 4DV7O 4DV3O 1HNXO 1XNRO 2UXCO 3J80N 1FJGO 4JI3O 1FKAO 2UXDO 4JI4O 4LF6O 4OPHA 2ZM6O 1J5EO 4JYAO 2VQEO 4AQYO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GKJ O;  4JI5 O;  4DR2 O;  3M8A A;  1X59 A;  4LFC O;  4K0K O;  4DR3 O;  1FYJ A;  4DR1 O;  4JI0 O;  4LFA O;  2ZKO A;  4X66 O;  5LMU O;  4OPA A;  3J81 N;  2AGA A;  4DV0 O;  1IBL O;  1XNQ O;  5A2Q N;  1DK1 A;  4DUZ O;  1XMQ O;  4DR7 O;  3SDL A;  5LL6 Y;  4YHH O;  2JRI A;  5LMN O;  4B3R O;  4DV2 O;  1G1X B;  1YZB A;  4A5U B;  4LF8 O;  4B3S O;  2Z0A A;  4NXM O;  5H5N A;  4DV1 O;  4LFB O;  4KHP O;  3RT3 C;  4DV4 O;  2E5L O;  1N33 O;  1AIL A;  2UUA O;  4JI7 O;  2VQF O;  4YY3 O;  4LF5 O;  3T1H O;  1IBM O;  4DUY O;  1HNW O;  4X64 O;  4B3T O;  5BY1 A;  2UU9 O;  2FKX A;  4X62 O;  1IBK O;  4NXN O;  2HHH O;  3O65 A;  1D2D A;  3JAM N;  4LF4 O;  2UXB O;  1AB3 A;  4DR5 O;  5BXZ A;  3J7A U;  3F5T A;  2F4V O;  4OX9 O;  1R6T A;  1R1B A;  1NS1 A;  3R66 A;  4LF7 O;  1I94 O;  1HNZ O;  1XEQ A;  4X65 O;  3OTO O;  4JI8 O;  1XMO O;  2LW7 A;  4DV5 O;  4DR4 O;  4JI1 O;  2N74 A;  4DV6 O;  4LF9 O;  1HR0 O;  5IT9 N;  2UUC O;  5IWA O;  1A32 A;  1F7Y A;  2UUB O;  4GKK O;  1N32 O;  2DOS A;  4DR6 O;  5BR8 O;  3T1Y O;  1N34 O;  4JI6 O;  2DJV A;  5FLX N;  4B3M O;  4JI2 O;  1N36 O;  4JV5 O;  1KUQ A;  4DV7 O;  4DV3 O;  1HNX O;  1XNR O;  2UXC O;  3J80 N;  1FJG O;  4JI3 O;  1FKA O;  2UXD O;  4JI4 O;  4LF6 O;  4OPH A;  2ZM6 O;  1J5E O;  4JYA O;  2VQE O;  4AQY O; 
#chains in the Genus database with same CATH topology
 3TXQ A;  1M93 A;  4JI1 B;  1S77 D;  2VWJ A;  3E35 A;  2QJ1 A;  1VMG A;  2Y4U A;  5FNV A;  3QF7 A;  4CBC A;  4LFA O;  1OCC C;  1RM1 C;  4JYC A;  4MTX A;  4MTO A;  2EIJ B;  2ADQ B;  4FLZ A;  1QQC A;  2Z3Y A;  3AG7 A;  4GUN A;  1SRY A;  1NBM G;  2DE0 X;  3E8F A;  2R9I A;  3T4Z A;  2RJZ A;  1G1X B;  4AIL C;  2QDO A;  2BCC H;  2WA3 A;  1R6K A;  2Q7H A;  2Z0A A;  5IJ0 A;  2Y0P A;  2K9P A;  1K73 W;  2HG5 C;  3E22 A;  1QNM A;  3FYI B;  4LF5 O;  2WAM A;  4K8X A;  5B1A B;  5DEC A;  1QVG U;  5KAF Z;  1L0L H;  1D5A A;  1IUR A;  4MVS A;  3M99 B;  2YXY A;  1GN2 A;  5H6Q A;  1KD1 W;  5CMU A;  2F95 B;  1NJI W;  3OM3 B;  4DV1 B;  2WLL B;  2YIB A;  4JI8 O;  1EM1 A;  2OT5 A;  4UVA A;  3CXC U;  3RYF A;  4LF9 O;  1AR5 A;  2MK3 A;  4UV9 A;  4DUY B;  5B5E Z;  2LP7 A;  5TIS Z;  2QWR B;  5C8Y B;  4JI2 O;  4JV5 O;  4NYK A;  4FZ1 A;  3QO8 A;  3BAA A;  4MVO A;  2X6B A;  4W4K A;  4U3F H;  4X65 B;  4JI5 O;  2LW1 A;  4K0K O;  3ASN B;  3ZN0 A;  3H1K H;  3Q4H B;  2ZKO A;  5KMG A;  3CRC A;  3QO7 A;  5CBF A;  5KX5 A;  4WFF A;  2WLI A;  2GV9 A;  2XAG A;  2MW2 B;  1QLE C;  2BSK B;  3P30 A;  3H1J H;  3ABL B;  1AJN A;  4DUZ B;  4DV2 O;  3ZMT A;  5ITZ B;  1K4D C;  3SJC C;  2DYS B;  4TV9 B;  2YIA A;  3WB0 A;  3DTU B;  5KUM A;  4I0X B;  1S76 D;  5JH7 A;  3FYE B;  2WA4 A;  2EJ7 A;  2QWQ B;  2XUM A;  5BY1 A;  3CP1 A;  4CC5 A;  1XI1 A;  2HHH O;  2YSU B;  4UFZ A;  1JVM A;  2UU9 B;  1W2B U;  4I50 B;  1FFX A;  3FAV B;  1FD9 A;  2QM7 A;  2ZE8 A;  3FB5 C;  4MW3 A;  5BXZ A;  1WB8 A;  2CK3 G;  2GBO A;  4O2B A;  4P9O A;  2LJ2 A;  1XMO O;  1KBH A;  4G2K A;  1VIB A;  2WLH A;  4EFE A;  2ITC C;  1AJP A;  2VQF B;  4CH3 A;  5LP6 A;  1AR1 B;  2AW9 A;  1ORQ C;  3X2Q B;  1EZV H;  1IXM A;  4FK5 C;  4N23 A;  4I9Q A;  1SQX H;  2W6J G;  5L3D A;  1AI7 A;  3D36 A;  5IJ0 B;  4OPH A;  2HR3 A;  3E8H A;  4J11 A;  2QKA A;  4LF7 B;  4BIO A;  4WFE A;  3LUT B;  1H2L A;  3E22 B;  2IU0 A;  3EFF K;  4W4L A;  3LDD A;  3G6B A;  3FB8 C;  4X66 O;  1YCI A;  3APQ A;  3GWK C;  1W59 A;  4D6T H;  1VQL V;  2YIB D;  2ZCE A;  1H2N A;  5A2Q N;  3CEI A;  3STL C;  1HNX B;  4GCZ A;  5FPO A;  4ASU G;  3DXR A;  3JAT B;  5L3G A;  2QKC A;  1SQB H;  4LR3 A;  3I5D A;  2Y69 B;  1MMM A;  3ASN C;  4WBN A;  4LF8 O;  4B3S O;  2LGW A;  3RYF B;  2HVK C;  5IYB O;  3AG3 B;  4IIJ A;  3L70 H;  2JEX A;  1N4C A;  4U7N A;  2PZS A;  1GM8 A;  3CXH F;  4UCT A;  4ZBM A;  1XOU A;  2GUZ A;  4JZG A;  3ABL C;  2Q7E A;  1K4C C;  1OCR B;  1GN6 A;  3UT5 B;  3LNN A;  1Q90 D;  4NTX A;  2JEU A;  4X62 O;  1WNS A;  4Q20 A;  5E1A C;  4ZI7 A;  4B08 A;  3MHH C;  2DYS C;  2F93 B;  2AXT Z;  4JTD B;  3R66 A;  1VF5 B;  4DR5 B;  1YSC A;  1YI2 V;  2B1I A;  4JI7 B;  1UFI A;  2WLI B;  4X8A A;  2DOS A;  3K79 A;  2P90 A;  2B5U A;  4PV1 B;  2O57 A;  2AZ2 A;  4GKK B;  1HDJ A;  3ABM B;  4IYI A;  3ICX A;  4DV3 O;  2X0L A;  4LF4 B;  1EN4 A;  4MVR A;  2IJK A;  4R7C A;  5IJ9 A;  3IFX A;  4YJ2 A;  2VQE O;  4K8Z A;  2ARH A;  2OIE A;  2ZM6 B;  4HNA A;  4KXR A;  5H9C A;  5JH7 B;  3CWB H;  2LO1 A;  1K7D A;  1B04 A;  2EIN C;  2KG7 A;  3O9O A;  1XHZ A;  1O9G A;  5LMU O;  3RFR A;  1ZLZ A;  1N34 B;  5E79 Z;  5LHG A;  2IW5 A;  4LH7 A;  4R8C A;  1FFX B;  2XND G;  4JYB A;  3K0G A;  4GX1 A;  3K03 A;  5EYP B;  4O2B B;  1AP5 A;  3AG4 B;  3OGC C;  2IU3 A;  2ZD9 A;  5LP6 B;  2BOB C;  2QA4 V;  4JI0 B;  2N04 A;  4RAI A;  4IGG A;  2ATK C;  4FFB A;  4FVM A;  1M5I A;  5LHI A;  1HNW O;  2OWO A;  1V55 C;  3RYC A;  1SET A;  2HKO A;  3OMN B;  4IT5 A;  5GTI Z;  1YIJ V;  1GN3 A;  4K35 A;  4ZHQ A;  4UB6 Z;  4NTW A;  2F4V O;  4J9Y B;  3OAA G;  4MVQ A;  4NKG B;  1FXK C;  3LSQ A;  3G80 A;  1BE3 H;  1WN7 A;  1XEQ A;  1Y67 A;  1TAE A;  1I7F A;  4JI1 O;  5IYC O;  1BL8 A;  1ZWI C;  2CH7 B;  1AI4 A;  4QPK A;  3H9V A;  1NTK H;  4UCR A;  2ZE5 A;  5KA5 A;  1VQ8 V;  5KA6 A;  3DXR B;  2E3C A;  3SPJ A;  2XAF A;  4MS2 A;  2M6Y A;  2M7W A;  1MSD A;  3EVK A;  4B3M B;  1OCZ C;  2HVJ C;  4U7O A;  2XAS A;  4UXN A;  4P9P A;  3CCV V;  2ZQM A;  3BRC A;  3JAK A;  4IIJ B;  3OTO B;  2RQ6 A;  4AHC A;  3WB2 A;  3M8A A;  4AQY B;  2XHB A;  2B1G A;  2GUZ B;  1HR0 B;  2CGO A;  3ETQ A;  1Y66 A;  2YXH A;  1OCC B;  5L3E A;  1RM1 B;  5J2T B;  3M7M X;  4RUF A;  3T1C A;  1TUB A;  1WPX A;  4TQD A;  3NXS A;  1KQS U;  3FB6 C;  2BTQ A;  4FLU A;  2W0F C;  4JI4 B;  4LF6 B;  3I56 V;  1J5E B;  1YJN V;  3N2G A;  1GTO A;  4B3R B;  3CSX A;  4NXM O;  1VP7 A;  2H3O A;  5KHI A;  2EIL B;  4DV1 O;  5LXT B;  2DMX A;  3RT3 C;  3LNM B;  3DGE A;  1RSO B;  4XBF A;  5AG2 A;  3ZHR A;  5JCO A;  5KLV H;  1GN4 A;  4DUY O;  1IBL B;  2C2A A;  3ZIA G;  1Q3E A;  4PA3 A;  1OHH G;  2A7W A;  4QE7 A;  3AG4 C;  3OR7 C;  1SQG A;  2DQ0 A;  2X7R B;  2CUG A;  5IJ9 B;  2P7T C;  4YJ2 B;  4RO2 A;  5GTH Z;  5EBW C;  4FLX A;  4HNA B;  5CA1 A;  3VOU A;  3FD9 A;  4J41 A;  5KUK A;  4X65 O;  1Q82 W;  1TVK A;  3ZRW A;  4KUM A;  2UUA B;  1I94 B;  4YXW G;  2KG7 B;  3K9S A;  3GWO A;  3TK1 A;  1NU1 H;  2R9R B;  1AR4 A;  2LGQ A;  3VQV A;  3E89 A;  2JJ1 G;  4EB6 A;  2A79 B;  4GX0 A;  2FB5 A;  4DK0 A;  1SKV A;  5EC1 C;  2A0L A;  2UXC O;  3N27 A;  1I5Y A;  2ZXW C;  2UXB B;  1RPR A;  4JAA A;  3JYC A;  2WLN A;  1E1R G;  2LQT A;  2Y4T A;  5JJJ B;  3SJB C;  2JS5 A;  4NVP A;  1NZ6 A;  3CCU V;  2EIM B;  2OCH A;  2QTS A;  3KZI Z;  4FFB B;  1XL6 A;  2JGU A;  2GHY A;  5L3C A;  5KHH A;  2DWD C;  3I55 V;  2ZIM A;  3K0D A;  2JDI G;  3FX7 A;  1IZ3 A;  5BR8 B;  4E4E A;  5CB4 A;  3F7V C;  3LDC A;  1DLB A;  3RWR D;  1DK1 A;  3SJA C;  1KP3 A;  4K3A A;  4MVZ A;  3SDL A;  4ZHQ B;  1Z5W A;  2P4K A;  1TUE B;  1PPJ H;  3ABU A;  2QTO A;  1YZB A;  1D5N A;  5A9G A;  4GKJ B;  4Z2W A;  4TT3 G;  1YHQ V;  1JMK C;  4X20 A;  4DV4 O;  3U10 A;  1AIL A;  2VQF O;  1Q6I A;  2YDE A;  1ZUQ A;  5BZB A;  2EIK C;  1XMQ B;  3U11 A;  2QWN B;  4DW1 A;  1SC5 B;  2Q0A A;  3IC7 A;  1GKF A;  2OIG A;  2EIL C;  3JAK B;  3CPW U;  1ZL8 A;  5KHJ A;  1R6T A;  2P4V A;  1R1B A;  2EJR A;  4LF7 O;  1PM9 A;  1EN6 A;  2YEV A;  4PHZ A;  3K3W A;  4JAV A;  2ZE7 A;  4UV8 A;  4BWA A;  1F7Y A;  1T5E A;  4J10 A;  1O9H A;  4LWS B;  4X64 B;  1H8E G;  1WA8 A;  2BTQ B;  2DJV A;  3BA9 A;  3B8N A;  2YUA A;  2YC0 A;  5JVD A;  1HNX O;  1Y74 A;  3JCZ A;  4FJC C;  4FZ0 A;  4OGQ B;  4TWK A;  1FJG B;  3OE7 G;  3JAW A;  1R3I C;  1CPY A;  1QR9 A;  1VQ7 V;  3F7Y C;  3U0Z A;  3RN4 A;  5J2U A;  4LFC O;  2WWW A;  1WP8 A;  4DO2 A;  4E2L A;  3NR7 A;  3DC5 A;  5LHH A;  1VQ4 V;  4TOI A;  2UUC B;  1FXK A;  3H01 A;  3E2E A;  4H13 B;  4X88 A;  3JD0 A;  4DR1 B;  4LCU C;  3ABK C;  3ZS8 C;  2X6A A;  5L3B A;  4JAU A;  5CA0 B;  3OGI B;  2PUS A;  2IJI A;  2XTA A;  2EIM C;  2F23 A;  5FL7 G;  2B9Z A;  4F4L A;  1TVK B;  1PKX A;  3ZRW B;  3QVN A;  4O4I A;  2PI5 A;  4PDM A;  4RWU A;  2V1D A;  1W0J G;  4TSF G;  1K8A W;  1IX9 A;  1KU9 A;  2E5L O;  4JI7 O;  4G28 B;  4H37 A;  1R3J C;  4EB6 B;  2QWO B;  5B1N A;  1L0N H;  4DV0 B;  1Q81 W;  2FYU H;  5LYJ A;  1JJO A;  1ZTE A;  2EUL A;  4TV8 A;  1OCO B;  1IXB A;  1NR1 A;  4LF4 O;  2XAH A;  3ETD A;  3HKD A;  2Q6A A;  2ZR2 A;  1HNZ O;  2XAJ A;  2FL4 A;  4UUJ C;  5EK0 A;  2N74 A;  3JD3 A;  3UO3 A;  3FB7 C;  3D8C A;  3HKE B;  1MZE A;  3CCM V;  5CB4 B;  2GTA A;  1H2S B;  3BEH A;  1H2K A;  3RGB A;  3CMA V;  2GSM B;  1N34 O;  1P49 A;  4B3T B;  1IBK B;  4P30 A;  3CCR V;  3MDS A;  4U3J A;  3SYO A;  2VWK A;  2YI8 A;  3BAB A;  1P7B A;  1BHA A;  5FNV B;  2CTP A;  4DR4 B;  4PDL A;  1FAF A;  2LFS A;  3QG5 A;  2V4D A;  5JWP A;  4PA7 A;  4JI0 O;  1JCH A;  1GH6 A;  1OZ0 A;  1K34 A;  3IC9 A;  2EIN B;  5JJE B;  1VF6 A;  3RBZ A;  2JK5 C;  3ETE A;  1XNR B;  1ZL8 B;  3CHX A;  1KB9 F;  3SYC A;  2A3Q A;  4MT8 A;  3UO2 A;  4HZ3 A;  5HFL A;  5JCO C;  3OMA B;  4MVM A;  1YJ9 V;  2YEV B;  4DR3 B;  4JYY A;  1KMI Z;  1N33 O;  4KL1 A;  1VQ6 V;  1M4U A;  2P67 A;  2WLJ A;  1WA8 B;  4CC6 A;  4I4T A;  5JVD B;  1Y74 B;  3ZHV A;  4YHH B;  1H2M A;  1V55 B;  5LMN B;  4PD4 F;  4RQF A;  2ZIN A;  1JFF A;  1K92 A;  3SJQ C;  4WFA V;  5CA3 A;  3OW2 U;  2W0X A;  3ZHT A;  1S5H C;  4N21 A;  5CBG A;  1VEW A;  2L35 A;  1R73 A;  2ZIO A;  5J2U B;  1GAX A;  2PY5 A;  4LFB B;  4CH4 A;  4GZR B;  1SQV H;  1CP9 A;  3OTO O;  1FXK B;  2QKS A;  4FLT A;  1EZJ A;  1ZX3 A;  3HR0 A;  1U97 A;  1S0V A;  4RQE A;  1HR0 O;  3K06 A;  3OEE G;  4UCV A;  5BMV A;  2KKW A;  4D7T A;  1OCO C;  1ZSP A;  4NXN B;  5FLX N;  1MA1 A;  4LBE C;  2GTS A;  1BQ0 A;  4J7Z A;  3J80 N;  1OCZ B;  4JI4 O;  4LF6 O;  1J5E O;  2CAZ C;  1BHB A;  5KMG B;  5H6R A;  5KX5 B;  4X9Q A;  4IHJ A;  3JAL A;  3ZHQ A;  2JS3 A;  2FTK A;  3W7T A;  4JI5 B;  3L73 H;  1ROP A;  1VF7 A;  3KKY A;  2RNB A;  5KHG A;  3N2K A;  1IBL O;  4O4H A;  3E8B A;  3P32 A;  1UPG A;  1N36 B;  4DRX A;  1BCC H;  4GX2 A;  2UXD B;  4FM0 A;  4JTA B;  3TJT A;  3HKD B;  1Q6U A;  2F1M A;  1X4T A;  3T2M A;  4WFG A;  4FIP C;  4Z1M G;  1F51 A;  2UUA O;  1QBZ A;  4D7S A;  3CCE V;  3G4S V;  3CCQ V;  4CS2 A;  2JGD A;  3AK3 A;  4TUY A;  3AG2 B;  1H8H G;  3RW0 A;  2HP8 A;  1YXB A;  1XBL A;  3BFR A;  2FKX A;  2P5O A;  1N8R W;  3O65 A;  5LBQ A;  3TCU A;  2UXB O;  2HHH B;  3KCX A;  3SR2 C;  1AB3 A;  3CRA A;  3K5O A;  3BVO A;  1R3K C;  5K1X A;  3RVZ A;  2KSD A;  2CTQ A;  4DV6 O;  2OCC C;  1XMO B;  1Y6X A;  2DQ3 A;  2YID A;  1IBM B;  3WFV A;  5HFM A;  1N32 O;  1A32 A;  3CS5 A;  4G27 B;  2QM8 A;  3LDE A;  1HW7 A;  2PF4 E;  2Q69 A;  4YIO A;  5BR8 O;  3CCS V;  2QGN A;  4CS3 A;  1GK9 A;  3SPC A;  1Q6H A;  1IDS A;  3SGI A;  1DTO A;  4CS4 A;  3KG2 A;  3LSS A;  1NQT A;  1B6Q A;  1MSW D;  4PJ0 Z;  4WCE V;  3IJ4 A;  5EC2 C;  2ZXW B;  3RVY A;  4LNU A;  1SER A;  1M9N A;  2CDY A;  3B40 A;  4BW9 A;  5KHK A;  4GKJ O;  1EBO A;  3JD1 A;  4I7Z B;  4I5S A;  1P7G A;  3CJH A;  4JGS A;  5IDJ A;  1THZ A;  4I4T B;  2UUB B;  1PNM A;  2DN9 A;  2IM9 A;  3T1Y B;  3KCY A;  2A06 H;  3PJS K;  4JI6 B;  4WBN B;  1S5L Z;  1JFF B;  3HB3 B;  1VQK V;  1V54 C;  1PNK A;  1XMQ O;  1VQO V;  5LL6 Y;  4JI3 B;  3K04 A;  5EBL C;  1PL4 A;  3SPH A;  3ZMZ A;  1P4R A;  2ZT9 B;  1MNG A;  3L72 H;  3ZRV A;  3RYH A;  1BGY H;  5IE9 A;  3D3Q A;  4KFM A;  3R65 A;  5LGU A;  3ETG A;  4ZI7 B;  1JR9 A;  1Q43 A;  4X64 O;  2EIK B;  3RYI A;  3CYO A;  2XOK G;  1KEC A;  1COW G;  3VQX A;  3JAM N;  2PI4 A;  3W7W A;  4FLY A;  2YIC A;  1M90 W;  4IHJ B;  3JAL B;  2HFE C;  4F6E A;  1J95 A;  3C3S A;  1ENV A;  4YY3 B;  4ABM A;  3AG2 C;  1NTZ H;  3OTF A;  4UVC A;  4FM1 A;  2UUC O;  3N2K B;  5D5Q A;  4ZOL A;  1US6 A;  2FML A;  2Q9L A;  1LUW A;  2K1E A;  2D2C B;  4DYL A;  1S3J A;  2Q8V A;  2DW4 A;  2Q73 A;  4QE9 A;  2QE7 G;  4JZ2 A;  3JSN A;  4F6R A;  1K3E A;  2WPD G;  3ZRX A;  3S3X A;  1VF6 C;  3ZMU A;  2VQE B;  3F5W C;  1JPX A;  3A2F A;  3A0B Z;  3FKS G;  1FYJ A;  5IWA B;  4NTY A;  4TUY B;  1WP7 A;  2IBZ H;  2AGA A;  3ABK B;  4DV0 O;  5LMU B;  1L8D A;  1Z5V A;  2ILM A;  4CZZ A;  5L3F A;  4DUZ O;  4NR1 A;  2R72 A;  4MVU A;  1SA0 A;  1G4Y B;  3ZHU A;  5B3S C;  1VQ5 V;  4BAY A;  3W7U A;  4DR2 B;  1NR7 A;  2AHY A;  5EIB C;  1E1Q G;  4P2Z A;  1VQ9 V;  4UVB A;  3RYC B;  1TA8 A;  3SPI A;  3K58 A;  3ZBH A;  2DWE C;  4MSW C;  5K1P A;  4B3T O;  3ZMV A;  4DR7 B;  5DM6 V;  2UU9 O;  1SES A;  4TQF A;  1IBK O;  3OT7 A;  3CC4 V;  2ZDI A;  1LNQ A;  1M56 C;  2RN9 A;  4LNU B;  3G71 V;  1GO3 F;  1VAR A;  3J7A U;  2H94 A;  3ASO B;  3VQY A;  3CJH B;  1TGO A;  4DR4 O;  3B77 A;  2RCV A;  2ADP A;  2BTO A;  3QTC A;  2Q7G A;  2H8P C;  3BHP A;  2Q68 A;  1K5Q A;  4C7U A;  3ZX6 A;  2F66 C;  5LGT A;  1XNR O;  1MOF A;  2UXX A;  2NR5 A;  3K08 A;  5IYZ A;  3RYH B;  1BMF G;  3CRM A;  2NNU A;  5LGN A;  3K9A A;  3TGU H;  4DV5 B;  3CRR A;  1H2G A;  1I0H A;  1G6U A;  4J7K A;  5J9P C;  4DR3 O;  1TUB B;  3QNE A;  3JAR A;  1DGS A;  1JX9 A;  2BOC C;  3OEH G;  2QM4 A;  1QU7 A;  2IJH A;  4B7K A;  5GON A;  2ZNJ A;  1KKC A;  3RYI B;  4BR6 A;  1BZK A;  1W0K G;  3N2G B;  5B1B C;  1K97 A;  4QIW F;  1JOY A;  4YHH O;  1YIT V;  5LMN O;  1KKD A;  4J9Z B;  2P6J A;  3EXA A;  5H2F Z;  1MZF A;  4LFB O;  3WB1 A;  3JAT A;  4NXM B;  4LC1 A;  4ZOL B;  3BCC H;  4HYO A;  3APO A;  4RUE A;  4ZIB A;  4WFB V;  2HJD A;  1GRJ A;  2EX3 A;  1XNQ B;  3SPG A;  3VBB A;  1YTF D;  2ZE6 A;  4Q6G A;  5CA1 B;  2NLJ C;  1H38 A;  4NXN O;  4F6R B;  2DYR C;  3D3I A;  1K9M W;  4JPR A;  4QGP A;  3UT5 A;  4DR5 O;  3JD4 A;  1YTF B;  4H0L B;  4KHP B;  3W7X A;  2LW7 A;  1KYO F;  1QR8 A;  3TXS A;  4OXS A;  2JIZ G;  1SQQ H;  3EHB B;  3T1H B;  2X6C A;  1KC8 W;  1SQP H;  4GKK O;  5DED A;  3ML0 A;  2HEP A;  1SA0 B;  4GX5 A;  2NN4 A;  2G38 A;  4H44 B;  1N36 O;  1KUQ A;  1PL0 A;  3ASO C;  2UXD O;  1PV0 A;  2UXC B;  4OX9 B;  5IY5 C;  2QSA A;  4O2A A;  2ZM6 O;  3WG7 B;  3JD2 A;  3AK2 A;  2P06 A;  2WSS G;  1X59 A;  3HKC A;  3UKM A;  2XT9 A;  3L75 H;  1G8M A;  1XIL A;  2PTM A;  1NTM H;  4PA4 A;  4X1K A;  3OD4 A;  4DR6 B;  2EIJ C;  3WU2 Z;  4XDJ A;  3P3N A;  4MW8 A;  1NKD A;  1NT2 B;  1XDC A;  5GW7 A;  4O4L A;  3G6E V;  4PA6 A;  3T4D A;  3G67 A;  3MAQ A;  4DV7 B;  1K5S A;  3E8G A;  3CX5 F;  4J80 A;  3W7S A;  4X20 B;  4JYA B;  5B1O A;  4LP8 A;  1RP3 B;  1EFR G;  4X1I A;  1YEW A;  2QWP B;  1FXV A;  1SZX A;  1AJQ A;  1R3L C;  4IYH A;  1B3Q A;  4HAM A;  3CC2 V;  1AI5 A;  4LH6 A;  3A0H Z;  4PI0 A;  5EYP A;  4LFA B;  2IH1 C;  4DV4 B;  1IBM O;  1Y4M A;  5B1A C;  3DC6 A;  3HKB A;  4BW5 A;  1MG1 A;  3LSU A;  3SYQ A;  1NH2 D;  1GM7 A;  5IYZ B;  2R70 A;  3K5N A;  2CTR A;  2KQX A;  3E86 A;  1FS0 G;  1WAZ A;  1NS1 A;  1NH2 B;  1CXZ B;  1Y76 A;  3A0R A;  3OFN G;  4L8J A;  3JAR B;  1DF5 A;  1VQM V;  3OR6 C;  3HPL C;  4ZKI A;  2OCC B;  5GON B;  4LF5 B;  2UUB O;  4CH5 A;  4H33 A;  3T1Y O;  3B09 A;  1QHT A;  4XDK A;  1YJW V;  4JI6 O;  2CE4 A;  4O4J A;  1XHX A;  3JAW B;  5LA6 A;  4B3M O;  4UCU A;  4MTF A;  2CH7 A;  1VQP V;  2OYQ A;  3ZRS A;  1BT8 A;  3OUF A;  1Q5O A;  4PA9 A;  3GB7 C;  4JI3 O;  1SS3 A;  1FKA O;  2LFR A;  2PYL A;  4DXW A;  1AVM A;  3ZN1 A;  3ABT A;  1WPB A;  4UCO A;  1GMG A;  2VRZ A;  3VQW A;  1FPO A;  4AQY O;  4JI8 B;  1F4N A;  3UQ8 A;  1MAB G;  4GT1 A;  4J7J A;  4LF9 B;  2IJJ A;  4I55 A;  2HJF C;  4LFC B;  5DN6 G;  3H1I H;  3BA8 A;  3P3P A;  4XDL A;  2Y48 A;  1Q7Y W;  4OPA A;  2QEX V;  1YF2 A;  4UB8 Z;  5JQG A;  4JI2 B;  4JV5 B;  4FFK A;  4O4I B;  1HWY A;  2Q0O C;  3WG7 C;  1V54 B;  1ARO P;  2OTL V;  5LOV A;  5J2T A;  3K57 A;  5CBH A;  4YIP A;  4B3R O;  4A5U B;  1ZAU A;  3B8M A;  3CRQ A;  5H5N A;  4K0K B;  5B66 Z;  1HP8 A;  1M1K W;  5KAI Z;  5EZY A;  1URF A;  3MD0 A;  1SZT A;  2ZDI C;  3IGA C;  4YY3 O;  2E5L B;  5LYJ B;  1JJ2 U;  5EBM C;  2E75 B;  4TV8 B;  2BE3 A;  5LXT A;  3CD6 V;  1RSO A;  5D5P A;  4EKW A;  4PDV A;  4O2A B;  4DV2 B;  3L74 H;  4JAS A;  3STZ C;  4DW0 A;  3TET A;  2WLK A;  1IVS A;  2GDS A;  2W6I G;  3AK1 A;  3HKC B;  1BSM A;  1I94 O;  4QPJ A;  4JF3 A;  4X1K B;  3AG1 B;  5F2V O;  1AP6 A;  1BQZ A;  4X1Y A;  1HNZ B;  2ZNI A;  1XRE A;  1QLN A;  1K33 A;  4GLX A;  4NB5 A;  3X2Q C;  1JA8 A;  1YVW A;  1XQ8 A;  4U3J B;  3UCS C;  5IWA O;  4O4L B;  3FFQ A;  3CE2 A;  4I9W A;  2AHZ A;  2RDC A;  2KB1 A;  4R50 A;  4GYC B;  3MHS C;  1P84 F;  4FPP A;  3L9D A;  3ZCC A;  4X1I B;  2L6L A;  3S3W A;  2ZR3 A;  2PGG A;  1GM9 A;  4EFB A;  4DR2 O;  4PI2 A;  1M57 B;  2WLM A;  2Q5Z A;  4AI8 A;  5CN0 A;  1WB7 A;  5FPR A;  2N05 A;  2CTW A;  3AEI A;  3H1H H;  3HKB B;  2OTJ V;  3OMI B;  1RFY A;  2Z5U A;  4UCS A;  2VS0 A;  3K59 A;  2YS8 A;  4DR7 O;  2Q67 A;  1Z2G A;  1PNL A;  5EIB D;  1NVP D;  2Y69 C;  4YJ3 A;  4X89 A;  1RPO A;  3OUS A;  1Y76 B;  1E79 G;  2Y0I A;  5B3S B;  1VQN V;  3AG3 C;  1B06 A;  1V9P A;  3JAS A;  3A8T A;  1WLE A;  4BIZ A;  1NVP B;  3GVM A;  3JSL A;  4X66 B;  1I08 A;  1N33 B;  3H1L H;  1OCR C;  1N0J A;  3L71 H;  4O4J B;  1SF9 A;  3JCU Z;  5LA6 B;  4QJF B;  3B2E E;  4EEQ A;  3ZED A;  1CEZ A;  2QR4 A;  1U96 A;  1EN5 A;  2RMK B;  1D2D A;  1M56 B;  3BY6 A;  4LF8 B;  2V7Q G;  4B3S B;  1F23 A;  3ZHS A;  4ICG A;  4I55 B;  1UJW B;  5BMV B;  1WJZ A;  4HBN A;  3SYP A;  4DV5 O;  1NI8 A;  4QNH B;  2UXN A;  2EBO A;  2YXL A;  5IYD O;  1QVF U;  1JQ0 A;  1PP9 H;  3C90 A;  1FFT B;  4KP4 A;  5JQG B;  2D3O W;  4B7E A;  3ABM C;  4IL6 Z;  2YI9 A;  4X62 B;  5LOV B;  3QO5 A;  2IH3 C;  4L87 A;  2EZP A;  3CME V;  1L1F A;  2PYJ A;  1S5J A;  1FJG O;  2E74 B;  4MTG A;  3AG1 C;  4LWS A;  3CB2 A;  5EZY B;  1F4M A;  2E76 B;  4O4H B;  2WLL A;  5C93 A;  3C3T A;  4CH6 A;  4Z1V A;  4DR1 O;  4DRX B;  4WF9 V;  1DF4 A;  1YDX A;  4WFH A;  1LR1 A;  1KP2 A;  3J81 N;  3SYA A;  2ETN A;  3THO A;  1XL4 A;  1XNQ O;  4FMT A;  5B1B B;  4DV3 B;  5C8Y A;  3CCJ V;  2JRI A;  3PN1 A;  1AI6 A;  2P22 C;  4PDR A;  1Q86 W;  4PEL A;  1M57 C;  4FLW A;  4DK1 A;  3E83 A;  2A9H A;  1XUQ A;  2F43 G;  1Q8I A;  5CA0 A;  4X1Y B;  5LP6 C;  4FLV A;  3IAY A;  3CCL V;  1PD3 A;  2JGD B;  2ODM A;  4KHP O;  2Q4P A;  3UM7 A;  4J42 A;  3T1H O;  1S72 V;  3Q4H A;  1SQF A;  1R6N A;  3BPZ A;  1FXH A;  3D36 C;  1BS3 A;  2BSK A;  2DYR B;  2JVD A;  3F5T A;  4OX9 O;  1N0N A;  3K5M A;  4JTC B;  2XAQ A;  2JJ2 G;  5ITZ A;  2EZO A;  5JJN B;  5IT9 N;  4TV9 A;  3K5L A;  4DV6 B;  3CC7 V;  4I0X A;  4FM2 A;  4DR6 O;  2HLD G;  2AZ0 A;  1HNW B;  1N32 B;  3HKE A;  4BIU A;  1OJH A;  1QCE A;  4YJ3 B;  3ZJZ A;  3DSQ A;  4DV7 O;  2R9A A;  2CGN A;  2ITD C;  3B4S A;  1I5X A;  1OV9 A;  2F4V B;  1QLE B;  3ZMS A;  4R6Z A;  4JYA O;  4I50 A;  5IY5 B;  3JAS B;  3FAV A;  1LUV A; 
#chains in the Genus database with same CATH homology
 4GKJ O;  4JI5 O;  4DR2 O;  3M8A A;  1X59 A;  4LFC O;  4K0K O;  4DR3 O;  1FYJ A;  4DR1 O;  4JI0 O;  4LFA O;  2ZKO A;  4X66 O;  5LMU O;  4OPA A;  3J81 N;  2AGA A;  4DV0 O;  1IBL O;  1XNQ O;  5A2Q N;  1DK1 A;  4DUZ O;  1XMQ O;  4DR7 O;  3SDL A;  5LL6 Y;  4YHH O;  2JRI A;  5LMN O;  4B3R O;  4DV2 O;  1G1X B;  1YZB A;  4A5U B;  4LF8 O;  4B3S O;  2Z0A A;  4NXM O;  5H5N A;  4DV1 O;  4LFB O;  4KHP O;  3RT3 C;  4DV4 O;  2E5L O;  1N33 O;  1AIL A;  2UUA O;  4JI7 O;  2VQF O;  4YY3 O;  4LF5 O;  3T1H O;  1IBM O;  4DUY O;  1HNW O;  4X64 O;  4B3T O;  5BY1 A;  2UU9 O;  2FKX A;  4X62 O;  1IBK O;  4NXN O;  2HHH O;  3O65 A;  1D2D A;  3JAM N;  4LF4 O;  2UXB O;  1AB3 A;  4DR5 O;  5BXZ A;  3J7A U;  3F5T A;  2F4V O;  4OX9 O;  1R6T A;  1R1B A;  1NS1 A;  3R66 A;  4LF7 O;  1I94 O;  1HNZ O;  1XEQ A;  4X65 O;  3OTO O;  4JI8 O;  1XMO O;  2LW7 A;  4DV5 O;  4DR4 O;  4JI1 O;  2N74 A;  4DV6 O;  4LF9 O;  1HR0 O;  5IT9 N;  2UUC O;  5IWA O;  1A32 A;  1F7Y A;  2UUB O;  4GKK O;  1N32 O;  2DOS A;  4DR6 O;  5BR8 O;  3T1Y O;  1N34 O;  4JI6 O;  2DJV A;  5FLX N;  4B3M O;  4JI2 O;  1N36 O;  4JV5 O;  1KUQ A;  4DV7 O;  4DV3 O;  1HNX O;  1XNR O;  2UXC O;  3J80 N;  1FJG O;  4JI3 O;  1FKA O;  2UXD O;  4JI4 O;  4LF6 O;  4OPH A;  2ZM6 O;  1J5E O;  4JYA O;  2VQE O;  4AQY O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...