4DR5O

Crystal structure of the thermus thermophilus (hb8) 30s ribosomal subunit with codon, crystallographically disordered cognate transfer rna anticodon stem-loop and streptomycin bound
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S rRNA
publication title A structural basis for streptomycin-induced misreading of the genetic code.
pubmed doi rcsb
molecule tags Ribosome/antibiotic
total genus 33
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2012-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4dr5O00
2UXCO 1KUQA 4JI8O 3J81N 2AGAA 1AILA 2JRIA 3T1HO 4B3RO 5A2QN 1XNQO 4B3SO 1N33O 1A32A 2UXDO 5FLXN 4GKKO 4DV3O 4GKJO 2FKXA 4A5UB 4JYAO 2Z0AA 4X62O 1IBLO 3J7AU 4NXNO 1I94O 4DR7O 4JI2O 4OPHA 4DR6O 4DV4O 4DV5O 5BR8O 1FYJA 1HNZO 4DV1O 2LW7A 1XMQO 4DR1O 3JAMN 1IBKO 4B3MO 4JI4O 4JI1O 5BY1A 1NS1A 4NXMO 4LF6O 4AQYO 1HNXO 4DR4O 4JI7O 1F7YA 2UUAO 1YZBA 3O65A 1X59A 3R66A 1AB3A 1FKAO 4DV0O 2ZKOA 4X64O 1N36O 3SDLA 2DOSA 5LL6Y 3F5TA 4OPAA 5BXZA 1J5EO 4LF8O 1HNWO 4DUYO 3M8AA 1D2DA 4LFAO 4LF4O 2VQFO 1DK1A 2E5LO 4JI3O 4JI0O 1IBMO 3T1YO 2HHHO 2UUBO 4LF9O 4X65O 4B3TO 3RT3C 1G1XB 4LF7O 1XEQA 4JI6O 4LFBO 5LMUO 4DR5O 4DV2O 4YHHO 5LMNO 4YY3O 1R6TA 4OX9O 4K0KO 4JI5O 1HR0O 4X66O 4JV5O 2VQEO 5IT9N 2UXBO 4DV7O 4KHPO 1XMOO 4LF5O 4DR2O 2F4VO 1R1BA 3J80N 4DUZO 4LFCO 3OTOO 1FJGO 1XNRO 1N34O 2N74A 2ZM6O 4DV6O 2DJVA 2UU9O 2UUCO 1N32O 5H5NA 4DR3O 5IWAO
chains in the Genus database with same CATH superfamily
1ROPA 1EZJA 3ASNB 3E86A 1S5JA 3FAVA 3T4DA 4DV3O 2UXBB 1OCOC 1I5XA 1M56B 2MK3A 2WPDG 4AHCA 2Y0PA 4LF5B 3E8FA 4B7KA 2ZIOA 2PF4E 3ZIAG 4PI0A 3RBZA 2YICA 1IXBA 4DV4B 4DV5B 2RN9A 1RPRA 3TETA 4DV1B 2UUCB 1MG1A 1R3JC 3AK1A 1NTKH 3DGEA 3ABLB 5BY1A 3ZHSA 3ABMB 1Y74A 2R70A 2W6JG 5C8YB 3ZHVA 5EBLC 1BL8A 2K9PA 4K8ZA 2W6IG 2PGGA 1Q43A 1ZTEA 1VQNV 2YXYA 4I7ZB 1VQLV 5KHJA 2Q67A 2EJ7A 4K35A 3X2QC 4AQYB 1VQ6V 5IY5C 1AR1B 3JCZA 4LF7B 3BEHA 3CRAA 4K8XA 2BOCC 3K9SA 3SPHA 3OGCC 1CEZA 4YHHB 2ATKC 2DW4A 2FYUH 3RGBA 5CB4B 1HWYA 2W0XA 2NNUA 4ABMA 2HFEC 4WBNB 5IYZA 2VQEB 4E4EA 1OHHG 1ZL8A 2HVKC 2JGDA 1PKXA 3I55V 4L87A 4LP8A 4I50B 3ZMVA 3OTOO 5LA6A 4WFGA 2B1IA 3RYCB 3C3TA 4O4IB 4JTAB 2QJ1A 2IU0A 5LHIA 4PA7A 4I0XB 4GT1A 4B3SO 2UXDO 1COWG 4CS3A 4DO2A 1RM1C 3TXSA 4OPHA 3WFVA 4PA6A 2EILC 5C8YA 4JAUA 1WLEA 2A3QA 1XMQO 4GX2A 4UXNA 1IBKO 2EINC 1AP6A 1Q5OA 4GCZA 2ZCEA 5IJ9A 4J9YB 3CPWU 3JD0A 2RQ6A 4TT3G 3O65A 3BY6A 1WNSA 2P5OA 1VQOV 5F2VO 1XQ8A 2CTQA 1NTZH 2EBOA 5LL6Y 1MZFA 4ZIBA 4RQEA 3FX7A 2QA4V 4LF4O 4PJ0Z 1IVSA 3T1YB 4X89A 2YXHA 4TWKA 2WWWA 4UVCA 2OTLV 4FLXA 1NVPB 3OMNB 3AG1C 2ZNIA 2YS8A 1SC5B 3ZHTA 3CX5F 4LFBB 1PNLA 5LGUA 2D2CB 5FNVB 1K8AW 2YUAA 4YY3O 4LFAB 3G6EV 1S77D 4JGSA 4O4HA 3CCUV 1IBMB 4O4IA 2ZE7A 3D3QA 1XMOO 4DXWA 3BFRA 2DJVA 4EEQA 3L71H 1GM7A 2GHYA 4FK5C 2AGAA 5JCOA 1AI4A 5IYCO 4TV8B 4EB6A 4JI8O 1K5SA 1Y67A 1GMGA 2L6LA 4DV3B 3QVNA 2ZXWC 2B1GA 3S3WA 1FXHA 4ZHQA 2Z0AA 4X62O 3J7AU 2ZIMA 3CRRA 1I94O 3E8GA 4DR6O 4U3FH 2LW7A 4IT5A 4BW5A 1FFTB 2PTMA 3SPJA 3I56V 2UUAO 2YC0A 4DRXB 1PPJH 4CH6A 3CCEV 1JX9A 4AILC 3G4SV 1THZA 1VIBA 2IU3A 5BMVB 2BE3A 1JJ2U 1OCCB 5GTIZ 4JI0O 5JQGB 2UUBO 1GN6A 4X1YB 3ML0A 3IFXA 4DW0A 3CCLV 1YVWA 1ZX3A 3IGAC 3VQXA 2N04A 4J41A 1SA0B 1VMGA 3OEEG 3AG3B 3BCCH 2EIJC 4B7EA 4W4LA 4FFBB 1OCOB 3K08A 2BSKA 2YEVB 2XHBA 4GX0A 3OAAG 3SR2C 4KHPO 2V1DA 2DQ3A 3SYPA 1QLEB 2Q5ZA 4HYOA 3OTOB 5B66Z 1WJZA 1FJGO 2DYRB 3JD2A 3RWRD 1GTOA 5H5NA 4RQFA 3D3IA 5L3DA 2XAJA 2QR4A 3VQWA 2UXDB 1DLBA 3FD9A 3RW0A 4GKKO 1AJPA 2FKXA 3GWOA 1FXKB 2XAHA 4NXNO 3QO8A 4O2BB 2UXXA 4BR6A 4PDVA 4PDLA 1YEWA 2KG7B 2N05A 2NLJC 2VRZA 1ZUQA 1D5NA 1QR8A 1XMQB 4DRXA 3ASOC 4RUEA 4MW3A 3LNMB 1NS1A 2KB1A 3H01A 1BHBA 5IJ0B 4WFHA 4IL6Z 1OJHA 2KSDA 1OCZB 1H2MA 4UV9A 4MSWC 1FKAO 2QTSA 1B6QA 4X1YA 3TJTA 5B1OA 1N36O 1WA8A 2GUZB 2P22C 4N21A 1SQPH 1D2DA 5LHHA 2ETNA 1VQ9V 5IE9A 5B1BC 4LF4B 1QR9A 2VQFO 4O2AB 1DK1A 4X20B 4JI3O 4LWSB 3IAYA 5J2TB 1Q3EA 1KBHA 4I4TB 4WFAV 1FAFA 4IHJB 4KXRA 1K7DA 5FPOA 2YEVA 2LO1A 4MVOA 3OW2U 3N2GB 3OMIB 4LCUC 4QIWF 1SQQH 4YY3B 3JAWA 2GBOA 1Q90D 1R6TA 2H3OA 4I55A 1TUBB 4R50A 2D3OW 4CC6A 3STLC 5B5EZ 2EULA 1SQFA 2OCHA 2CE4A 3VBBA 1XMOB 3H1KH 3MAQA 1KP2A 4JAAA 2OYQA 1GM9A 3OFNG 1MMMA 4FLTA 3IC9A 2EINB 1YIJV 3TCUA 1NR1A 4O2BA 4JI8B 1U97A 1MSWD 4FVMA 3N2KA 2AW9A 3L74H 3K9AA 1TVKB 3CXHF 1EBOA 4J11A 3RYHA 4EFBA 3K5MA 3JYCA 5CMUA 4PHZA 4X62B 4DR2B 4F4LA 1L0LH 1I94B 5IJ0A 4PI2A 3AG4B 4DR6B 3G67A 5BR8O 3I5DA 1WPBA 3L72H 2UU9B 4UV8A 3CCVV 1R73A 4TSFG 2QTOA 2LQTA 4XDKA 1RP3B 2QM4A 4EKWA 4F6RB 1YSCA 1ORQC 2M7WA 2UUAB 5B3SC 1JFFB 3W7UA 2WLIB 4JYAB 1K4DC 2P7TC 4X20A 2RCVA 4IIJB 3KZIZ 4BW9A 3LDCA 1YCIA 5J2TA 2EIMC 1BT8A 3LSSA 4Z1VA 3FAVB 4I4TA 1V55C 2AHYA 5L3CA 4DUYO 3N27A 1YI2V 1SZXA 3D36C 4W4KA 3CJHA 4JI0B 2UUBB 4GUNA 3N2GA 1SQVH 4HAMA 3GVMA 3HKDA 4YIOA 5KUKA 1AI5A 1S72V 1R6NA 2X7RB 4B08A 4TQFA 4U7OA 2Q7EA 4PDRA 3ZMTA 1NKDA 2JIZG 1VARA 1QU7A 3F5WC 1RPOA 2ZXWB 4KHPB 4FMTA 3UO3A 3AG2C 1R1BA 2XNDG 4AI8A 3A0RA 4NKGB 3ZCCA 1FJGB 2WLNA 1S5HC 3CEIA 3ETGA 1TVKA 3BAAA 5J9PC 3E83A 3K5LA 4DR3O 1QQCA 3OEHG 4UVBA 2WLJA 4H0LB 4B3RO 1N33O 4GKKB 2EJRA 1YHQV 2H8PC 2IJJA 4FFKA 1H2LA 3CCSV 4NTWA 4NXNB 3OR7C 5EZYA 2DYSB 4F6RA 2C2AA 2F1MA 5LOVA 3ZBHA 5IYZB 1YTFB 2WAMA 1PNKA 1ZL8B 1VF6C 2UXCB 4JI4O 4IIJA 4ZI7A 4JI1O 1JA8A 1H38A 2HG5C 1OCRC 3T1HB 3OTFA 3ZMUA 5LA6B 3DC6A 3CYOA 1WB8A 3ZEDA 4Z1MG 1SS3A 4CZZA 1X59A 1NVPD 2X6CA 1ZSPA 1Q8IA 4ZBMA 3HKEB 4FM2A 2EIJB 2E3CA 1N36B 2LGWA 4UB6Z 1N4CA 3HPLC 2CAZC 2IJHA 2IJKA 4MTFA 1YXBA 1M57C 2FB5A 1H2GA 2YI8A 3CCJV 2A9HA 4TQDA 4JI3B 2HEPA 1E1QG 2QSAA 2YXLA 3FYIB 5DEDA 2ITDC 3CCQV 4CS4A 2WA3A 1KB9F 3ZJZA 3AEIA 4JI6O 3FKSG 5LMUO 2YSUB 2FTKA 2QM8A 4F6EA 5IJ9B 3AK2A 5EYPA 3VOUA 4FLVA 5LMNO 3TXQA 3AK3A 3BHPA 4JV5O 4CBCA 3OE7G 2R9AA 1P7GA 1SF9A 2JS5A 1IURA 2RNBA 1ZLZA 2DE0X 1YITV 2BCCH 1CPYA 3P30A 3K5OA 4JI5B 1HR0B 4X1IA 1WB7A 1VQKV 2XAQA 4NTXA 3E35A 1YF2A 1MNGA 1IZ3A 4PD4F 4X88A 2H94A 3A0BZ 2JS3A 1JR9A 3SGIA 1KYOF 3RYIA 4DR7O 5H9CA 1N0JA 3PJSK 4O4HB 3C90A 2L35A 1N32B 3HKEA 4B3MO 4FLZA 1Y76B 3CS5A 1BS3A 4LF6O 1ZAUA 1F7YA 4PA9A 3B40A 1V54B 3JSLA 1K73W 2ZE5A 1M90W 4LR3A 2AZ0A 5EBMC 4EB6B 3KCYA 3JARA 1SRYA 3K59A 2WLLB 3T1CA 1GAXA 4DUYB 4G28B 2WLHA 4ZHQB 1Q6IA 3QNEA 3Q4HA 2HHHO 5JJEB 4RWUA 2YIAA 2Z3YA 4DR4B 5KAFZ 3K57A 4JASA 3A0HZ 1JJOA 4UCTA 5JJJB 5K1PA 3L73H 4P30A 1M4UA 3ICXA 3JATA 4FZ1A 2R9RB 1W2BU 1SESA 2QM7A 3B4SA 1L1FA 4X66O 4P9OA 5AG2A 4DV7O 3UT5A 4FLUA 1YJWV 2ZR2A 4UCRA 1SETA 2M6YA 4UB8Z 1YJ9V 1N34O 4DV6O 3P3NA 2P4VA 1H8HG 3WB2A 4DR3B 3ABUA 4B3RB 5TISZ 1XNQO 1N33B 5CBGA 1AROP 3ETDA 3B8MA 3HKCB 4A5UB 1SERA 1Y76A 4YIPA 4WF9V 4XDJA 4CH5A 1XILA 2HR3A 3C3SA 5LP6C 1PL4A 3MHSC 3MHHC 3BA8A 2BSKB 1FYJA 3QO7A 1X4TA 2YIBA 4DR1O 1VQ4V 1TUEB 4JI4B 2BOBC 4JI1B 5JJNB 2QEXV 1IX9A 2FL4A 1NH2B 1HNXO 2WLLA 2BTQB 3ZRXA 2JDIG 2ZD9A 1EN5A 5L3GA 1GKFA 1GM8A 4DV0O 1TGOA 1Q81W 1PNMA 4QGPA 1J5EO 2Y69C 4QNHB 4U3JB 3CRCA 1JOYA 1KKDA 4P9PA 2K1EA 2LW1A 5CA3A 2JK5C 5LXTB 4JYCA 1SQBH 1XEQA 3ZN1A 5D5QA 3KCXA 4JI6B 4H13B 5LMUB 4H37A 3CD6V 2ADPA 3SPIA 5LMNB 3ABKB 1NU1H 3E22B 4OX9O 4FM1A 2JVDA 4TOIA 4JV5B 3JSNA 3UM7A 2ITCC 1S0VA 3JALA 1W59A 2F66C 1WA8B 5KA6A 1GN4A 3TK1A 1XHZA 3JD4A 5JWPA 1XNRO 1P84F 3CRMA 1ENVA 1MZEA 5KHKA 3HKCA 3CCRV 2IM9A 1XHXA 1JMKC 5KX5A 4G27B 1OCRB 3EHBB 1D5AA 3ZHQA 1NTMH 3H1HH 1CP9A 1SQXH 2HVJC 3SYOA 1VQPV 4GKJO 3ASNC 3D36A 4BIZA 3F7YC 5JVDB 4Q6GA 1S76D 3W7TA 1IBLO 2Q4PA 3JAWB 1M56C 4DR7B 4I55B 2Q7GA 1K5QA 1WN7A 3SYQA 1G6UA 2BTQA 4JYBA 3SYCA 1V9PA 2ZDIC 1Q86W 4FM0A 4B3MB 3THOA 1DTOA 1E79G 3K03A 1FXVA 4B3SB 3ABLC 1AJNA 3ABMC 2RMKB 4U3JA 2OCCC 1YZBA 4DK0A 3IJ4A 2A0LA 5DECA 1KECA 4ZKIA 1AB3A 1NI8A 3K06A 1P49A 5E79Z 3OMAB 3N2KB 3SDLA 5LXTA 3QTCA 5J2UA 4K3AA 1HNWO 1FFXA 2CK3G 3RYHB 5CBHA 2P06A 3X2QB 5KHIA 5LHGA 1IBKB 2Z5UA 4JPRA 1LR1A 5IDJA 2HHHB 5IY5B 1R3KC 3H9VA 4CS2A 4X65O 3E22A 4MW8A 5LGNA 3CC2V 1Z5VA 3E89A 3L9DA 2G38A 2ODMA 2OWOA 3ETEA 3ZRWA 2AZ2A 1G8MA 3RFRA 2YDEA 1GN3A 3MD0A 3CCMV 1AR4A 4XDLA 2EZOA 1Q6HA 2GTAA 2PYLA 1FS0G 2EZPA 1US6A 3FB8C 5L3FA 5CA0A 2UXBO 1VF6A 4FIPC 4DV7B 1GH6A 4MTGA 4BIUA 4LF5O 3LDEA 2AHZA 3LSQA 3RVZA 1W0JG 1K33A 4KFMA 3T2MA 2A7WA 1HDJA 3M99B 4DV6B 1SKVA 3CMEV 3BRCA 1L8DA 3CJHB 3JD3A 2UUCO 1YTFD 1BHAA 5JVDA 1NT2B 3ZX6A 4IYIA 3HKDB 2WSSG 5A2QN 1N8RW 5FLXN 3CE2A 3VQVA 1QVFU 1RM1B 1BMFG 5CBFA 2EILB 3DC5A 3O9OA 4UVAA 5JCOC 1SZTA 1HNZO 2CTPA 2ZT9B 2QDOA 4DW1A 1W0KG 3LSUA 4GX5A 3EXAA 4FPPA 4ZOLA 3FB6C 3OR6C 4AQYO 1AJQA 1HNXB 2YIDA 4JZ2A 2F43G 4IYHA 4XBFA 2AXTZ 5DN6G 4DV0B 3ZMZA 2VS0A 2ADQB 3OUSA 1J5EB 4MVSA 5BXZA 5EIBD 3CXCU 2ZR3A 4FZ0A 1F4MA 1B3QA 1LUWA 2OIEA 1I0HA 2B9ZA 2QWNB 1VEWA 4RO2A 3SYAA 5EZYB 1XBLA 1JQ0A 1Y4MA 1IDSA 5LOVB 4B3TO 3AG1B 4PA3A 2B5UA 2RJZA 3GWKC 5L3EA 5ITZB 2LFRA 4ZI7B 2GDSA 3HKBA 3UQ8A 3BABA 4OX9B 2EIKC 3WG7C 3G6BA 4MVQA 3UKMA 3PN1A 4UFZA 1K3EA 2E74B 1AP5A 2XT9A 2LJ2A 1S3JA 1XNRB 1FPOA 1Y66A 1Q6UA 2JEUA 1BQZA 4E2LA 5KAIZ 2ILMA 3BA9A 5HFLA 1XOUA 4GKJB 3CWBH 2QKSA 3LNNA 5LGTA 2YIBD 1XL6A 5EYPB 1IBLB 2IH1C 5LBQA 1MABG 3DSQA 1MSDA 4X8AA 1KU9A 4PA4A 1RSOA 5C93A 2E75B 1UJWB 3AG7A 1N0NA 3FYEB 4LH6A 1PM9A 3U11A 3E8HA 1KKCA 4CH4A 4ICGA 4NYKA 4X64O 4X1IB 5H2FZ 2Q8VA 1H2NA 1R3IC 3JASA 3F7VC 1R6KA 1HNWB 1I5YA 3CRQA 2PY5A 1KD1W 4LFAO 5ITZA 3RYIB 2Q68A 4J42A 1IBMO 4LF9O 2P90A 1OCCC 3H1LH 4Q20A 1YJNV 3H1IH 3L75H 1VQ5V 4UCOA 3SJQC 4N23A 4QJFB 3MDSA 3LDDA 4P2ZA 1VF7A 4D6TH 5LP6A 2DQ0A 4RAIA 3AG3C 1M5IA 2ZINA 2XTAA 3QF7A 2VQFB 1ZWIC 1JPXA 5B1AC 2F93B 3CP1A 1GO3F 3JARB 5CA1B 3K79A 4MTXA 2CH7B 2OIGA 1QLEC 4I5SA 3JCUZ 4O4LA 3Q4HB 4UCVA 1WP7A 2DYRC 5IWAO 4WFEA 2JEXA 2XAFA 3E2EA 4JAVA 2OCCB 2XAGA 1GN2A 2R9IA 1NH2D 1Q7YW 4MVMA 1PD3A 3JATB 1K34A 1EFRG 3DXRA 1BQ0A 1LNQA 5L3BA 2XASA 1FXKC 2DWDC 3R65A 4UUJC 1HNZB 3ASOB 1WAZA 1AI6A 4GLXA 1KMIZ 3UT5B 2QWQB 3IC7A 1HW7A 1QBZA 3APQA 3OT7A 4J7JA 4I9QA 2Y0IA 3BVOA 3S3XA 2DMXA 2LP7A 3CHXA 3L70H 5A9GA 3P32A 3A8TA 2O57A 1H8EG 4BIOA 2XUMA 1OCZC 3OM3B 1SQGA 4YJ3A 1EN4A 1K97A 2Y4TA 5BR8B 1UPGA 4OPAA 2Q0OC 1CXZB 3JD1A 4J10A 5B1BB 3CC4V 4QPJA 5KMGA 2WA4A 3G71V 4B3TB 3STZC 3RT3C 1J95A 3FFQA 1AVMA 4YXWG 1MA1A 2VWJA 3HR0A 2Q9LA 3RN4A 4FLYA 5CA1A 4PDMA 4K0KO 2CH7A 1VP7A 1BZKA 2ZDIA 1EN6A 3SJBC 3CB2A 3FB5C 1M93A 4JTCB 1O9HA 4L8JA 1EZVH 1M9NA 3CC7V 4PELA 3EFFK 1QNMA 3VQYA 3QG5A 3D8CA 3WB1A 5DM6V 4C7UA 1JCHA 3ZN0A 1VQ7V 4ASUG 3J81N 3K0GA 1R3LC 3W7WA 1I7FA 2ZE8A 5KA5A 1F51A 3P3PA 4J80A 1Y6XA 2ZQMA 1U96A 1JVMA 4JI2O 4NR1A 3AG4C 1B06A 4IGGA 3JALB 4TV9B 2A79B 3APOA 4NXMO 1T5EA 5B3SB 2WLMA 5CB4A 2FMLA 4WBNA 5KX5B 1TA8A 2EIMB 2LFSA 4X64B 2Q69A 1V55B 3ZHRA 1K9MW 1IXMA 1DGSA 2EIKB 3WG7B 4I50A 3SPGA 3ZRSA 4DYLA 3RYCA 4LF9B 4OGQB 2CUGA 2P4KA 3GB7C 4NVPA 3B09A 2QKAA 4I0XA 1NBMG 4H33A 4D7SA 4HZ3A 3W7XA 4DV2O 2PZSA 3RYFB 1PL0A 2JJ2G 5EK0A 4KUMA 1WPXA 4CH3A 2CGNA 3AG2B 2X0LA 4DK1A 2F95B 4DR2O 2F4VO 3NR7A 5J2UB 1FFXB 4DUZO 3K58A 2QKCA 2X6BA 2ZM6O 5IYDO 3WB0A 2UU9O 1YDXA 2X6AA 4HNAB 1QVGU 1LUVA 2CDYA 5IWAB 2UXNA 3H1JH 4YJ2B 1WP8A 1AILA 2JRIA 4JTDB 1A32A 1OZ0A 4PV1B 3ZRWB 5BZBA 1PV0A 1URFA 4JYYA 4R7CA 4JYAO 4TV9A 1VQMV 2Y4UA 1KQSU 1QLNA 5HFMA 1B04A 2DYSC 1XUQA 5CA0B 2PI4A 1GRJA 3KG2A 4G2KA 1XL4A 2F23A 1MOFA 3RVYA 1AI7A 5FNVA 4JI7O 5GW7A 2DN9A 2Q7HA 2GSMB 2ZKOA 3ETQA 5IYBO 1I08A 4QPKA 2PYJA 3OGIB 1M57B 1S5LZ 4OXSA 4LF8O 5B1AB 1XREA 5EC2C 2E5LO 4LF6B 2V4DA 3RYFA 4TV8A 1G1XB 4R6ZA 1OV9A 2HJFC 4TUYB 4U7NA 1UFIA 1RFYA 4ZOLB 1P4RA 4MVUA 4DR5O 2QE7G 5JH7B 1HP8A 4GX1A 1G4YB 1F23A 4JF3A 1O9GA 4KP4A 4K0KB 5EIBC 2KQXA 1AR5A 2PUSA 5CN0A 5IT9N 5GONB 4FJCC 4HNAA 3CSXA 4LC1A 5EC1C 2JJ1G 1Z5WA 4UCSA 3K04A 4YJ2A 1XDCA 4LFCO 3G80A 3FB7C 3WU2Z 1KC8W 2UXCO 1NQTA 3TGUH 5KHGA 3T1HO 4X66B 3M7MX 2E76B 2ARHA 4MT8A 5BMVA 2GV9A 1KP3A 3HKBB 2VWKA 3ZHUA 2IJIA 2HLDG 5JQGA 2A06H 2OT5A 4JI2B 2GTSA 2Q73A 1K92A 2MW2B 3U0ZA 1K4CC 4MVRA 2V7QG 4DV4O 4DV5O 1N34B 2QWPB 1PP9H 4DV1O 4BWAA 2Q6AA 5K1XA 1H2SB 3JAMN 1NZ6A 4MTOA 1TAEA 4H44B 1SA0A 4NXMB 3KKYA 1XNQB 3B8NA 5D5PA 4FFBA 4X9QA 4FLWA 3UO2A 3R66A 1V54C 1VF5B 2IH3C 4UCUA 2NN4A 3UCSC 2ZNJA 3K3WA 4LBEC 4MVZA 4WFFA 4O4JB 3B2EE 3F5TA 3E8BA 4NTYA 3NXSA 2CGOA 4CC5A 4TUYA 4Z2WA 4DR1B 3M8AA 4J7ZA 1FD9A 5JH7A 3K0DA 1GK9A 2YI9A 4LF7O 4WCEV 1RSOB 1F4NA 3SJAC 5KHHA 5GONA 4WFBV 4DV2B 1FXKA 4YHHO 2P6JA 3DTUB 5LYJB 4QE7A 1NR7A 3SPCA 4JI5O 1HR0O 4QE9A 4X1KB 5KLVH 2KG7A 4J7KA 2VQEO 1NJIW 2IW5A 1DF5A 2CTRA 2OTJV 3A2FA 2F4VB 3JASB 3ZS8C 3J80N 3ABTA 3OUFA 4DUZB 5EBWC 2KKWA 2N74A 2R72A 2ZM6B 2QWRB 2WLKA 3U10A 3CMAV 1N32O 1VQ8V 1KUQA 1H2KA 3EVKA 3JAKB 2GUZA 4R8CA 2Y48A 1M1KW 2HKOA 4LNUB 4O2AA 1EM1A 5LP6B 2LGQA 1QCEA 4GZRB 2CTWA 4J9ZB 4D7TA 4LWSA 1BE3H 2P67A 1Q82W 2Q0AA 1QHTA 4IHJA 2BTOA 3B77A 2JGUA 3K5NA 2RDCA 3BPZA 2HJDA 2PI5A 4O4JA 3HB3B 3LUTB 5FL7G 4DR4O 4JI7B 2XOKG 2HP8A 1TUBA 4O4LB 5H6RA 2Y69B 2DOSA 4GYCB 5B1NA 1Y74B 3SJCC 1Z2GA 4LF8B 4MS2A 3DXRB 4JZGA 2E5LB 3T1YO 5FPRA 5GTHZ 5E1AC 5LYJA 4HBNA 2IBZH 2DWEC 1BSMA 4X1KA 4KL1A 4LFBO 4I9WA 2EX3A 1L0NH 4DR5B 4RUFA 2QWOB 1P7BA 3ZRVA 2QGNA 3W7SA 1BCCH 4NB5A 1E1RG 3ABKC 3T4ZA 1DF4A 1BGYH 4YJ3B 3ZMSA 4X65B 4BAYA 3JAKA 4LH7A 4LFCB 4EFEA 5KMGB 1XI1A 2W0FC 1JFFA 2ZE6A 2NR5A 3OD4A 5KUMA 2WLIA 4LNUA 3QO5A 5H6QA 2JGDB
chains in the Genus database with same CATH topology
2UXCO 1KUQA 4JI8O 3J81N 2AGAA 1AILA 2JRIA 3T1HO 4B3RO 5A2QN 1XNQO 4B3SO 1N33O 1A32A 2UXDO 5FLXN 4GKKO 4DV3O 4GKJO 2FKXA 4A5UB 4JYAO 2Z0AA 4X62O 1IBLO 3J7AU 4NXNO 1I94O 4DR7O 4JI2O 4OPHA 4DR6O 4DV4O 4DV5O 5BR8O 1FYJA 1HNZO 4DV1O 2LW7A 1XMQO 4DR1O 3JAMN 1IBKO 4B3MO 4JI4O 4JI1O 5BY1A 1NS1A 4NXMO 4LF6O 4AQYO 1HNXO 4DR4O 4JI7O 1F7YA 2UUAO 1YZBA 3O65A 1X59A 3R66A 1AB3A 1FKAO 4DV0O 2ZKOA 4X64O 1N36O 3SDLA 2DOSA 5LL6Y 3F5TA 4OPAA 5BXZA 1J5EO 4LF8O 1HNWO 4DUYO 3M8AA 1D2DA 4LFAO 4LF4O 2VQFO 1DK1A 2E5LO 4JI3O 4JI0O 1IBMO 3T1YO 2HHHO 2UUBO 4LF9O 4X65O 4B3TO 3RT3C 1G1XB 4LF7O 1XEQA 4JI6O 4LFBO 5LMUO 4DR5O 4DV2O 4YHHO 5LMNO 4YY3O 1R6TA 4OX9O 4K0KO 4JI5O 1HR0O 4X66O 4JV5O 2VQEO 5IT9N 2UXBO 4DV7O 4KHPO 1XMOO 4LF5O 4DR2O 2F4VO 1R1BA 3J80N 4DUZO 4LFCO 3OTOO 1FJGO 1XNRO 1N34O 2N74A 2ZM6O 4DV6O 2DJVA 2UU9O 2UUCO 1N32O 5H5NA 4DR3O 5IWAO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UXC O;  1KUQ A;  4JI8 O;  3J81 N;  2AGA A;  1AIL A;  2JRI A;  3T1H O;  4B3R O;  5A2Q N;  1XNQ O;  4B3S O;  1N33 O;  1A32 A;  2UXD O;  5FLX N;  4GKK O;  4DV3 O;  4GKJ O;  2FKX A;  4A5U B;  4JYA O;  2Z0A A;  4X62 O;  1IBL O;  3J7A U;  4NXN O;  1I94 O;  4DR7 O;  4JI2 O;  4OPH A;  4DR6 O;  4DV4 O;  4DV5 O;  5BR8 O;  1FYJ A;  1HNZ O;  4DV1 O;  2LW7 A;  1XMQ O;  4DR1 O;  3JAM N;  1IBK O;  4B3M O;  4JI4 O;  4JI1 O;  5BY1 A;  1NS1 A;  4NXM O;  4LF6 O;  4AQY O;  1HNX O;  4DR4 O;  4JI7 O;  1F7Y A;  2UUA O;  1YZB A;  3O65 A;  1X59 A;  3R66 A;  1AB3 A;  1FKA O;  4DV0 O;  2ZKO A;  4X64 O;  1N36 O;  3SDL A;  2DOS A;  5LL6 Y;  3F5T A;  4OPA A;  5BXZ A;  1J5E O;  4LF8 O;  1HNW O;  4DUY O;  3M8A A;  1D2D A;  4LFA O;  4LF4 O;  2VQF O;  1DK1 A;  2E5L O;  4JI3 O;  4JI0 O;  1IBM O;  3T1Y O;  2HHH O;  2UUB O;  4LF9 O;  4X65 O;  4B3T O;  3RT3 C;  1G1X B;  4LF7 O;  1XEQ A;  4JI6 O;  4LFB O;  5LMU O;  4DR5 O;  4DV2 O;  4YHH O;  5LMN O;  4YY3 O;  1R6T A;  4OX9 O;  4K0K O;  4JI5 O;  1HR0 O;  4X66 O;  4JV5 O;  2VQE O;  5IT9 N;  2UXB O;  4DV7 O;  4KHP O;  1XMO O;  4LF5 O;  4DR2 O;  2F4V O;  1R1B A;  3J80 N;  4DUZ O;  4LFC O;  3OTO O;  1FJG O;  1XNR O;  1N34 O;  2N74 A;  2ZM6 O;  4DV6 O;  2DJV A;  2UU9 O;  2UUC O;  1N32 O;  5H5N A;  4DR3 O;  5IWA O; 
#chains in the Genus database with same CATH topology
 1ROP A;  1EZJ A;  3ASN B;  3E86 A;  1S5J A;  3FAV A;  3T4D A;  4DV3 O;  2UXB B;  1OCO C;  1I5X A;  1M56 B;  2MK3 A;  2WPD G;  4AHC A;  2Y0P A;  4LF5 B;  3E8F A;  4B7K A;  2ZIO A;  2PF4 E;  3ZIA G;  4PI0 A;  3RBZ A;  2YIC A;  1IXB A;  4DV4 B;  4DV5 B;  2RN9 A;  1RPR A;  3TET A;  4DV1 B;  2UUC B;  1MG1 A;  1R3J C;  3AK1 A;  1NTK H;  3DGE A;  3ABL B;  5BY1 A;  3ZHS A;  3ABM B;  1Y74 A;  2R70 A;  2W6J G;  5C8Y B;  3ZHV A;  5EBL C;  1BL8 A;  2K9P A;  4K8Z A;  2W6I G;  2PGG A;  1Q43 A;  1ZTE A;  1VQN V;  2YXY A;  4I7Z B;  1VQL V;  5KHJ A;  2Q67 A;  2EJ7 A;  4K35 A;  3X2Q C;  4AQY B;  1VQ6 V;  5IY5 C;  1AR1 B;  3JCZ A;  4LF7 B;  3BEH A;  3CRA A;  4K8X A;  2BOC C;  3K9S A;  3SPH A;  3OGC C;  1CEZ A;  4YHH B;  2ATK C;  2DW4 A;  2FYU H;  3RGB A;  5CB4 B;  1HWY A;  2W0X A;  2NNU A;  4ABM A;  2HFE C;  4WBN B;  5IYZ A;  2VQE B;  4E4E A;  1OHH G;  1ZL8 A;  2HVK C;  2JGD A;  1PKX A;  3I55 V;  4L87 A;  4LP8 A;  4I50 B;  3ZMV A;  3OTO O;  5LA6 A;  4WFG A;  2B1I A;  3RYC B;  3C3T A;  4O4I B;  4JTA B;  2QJ1 A;  2IU0 A;  5LHI A;  4PA7 A;  4I0X B;  4GT1 A;  4B3S O;  2UXD O;  1COW G;  4CS3 A;  4DO2 A;  1RM1 C;  3TXS A;  4OPH A;  3WFV A;  4PA6 A;  2EIL C;  5C8Y A;  4JAU A;  1WLE A;  2A3Q A;  1XMQ O;  4GX2 A;  4UXN A;  1IBK O;  2EIN C;  1AP6 A;  1Q5O A;  4GCZ A;  2ZCE A;  5IJ9 A;  4J9Y B;  3CPW U;  3JD0 A;  2RQ6 A;  4TT3 G;  3O65 A;  3BY6 A;  1WNS A;  2P5O A;  1VQO V;  5F2V O;  1XQ8 A;  2CTQ A;  1NTZ H;  2EBO A;  5LL6 Y;  1MZF A;  4ZIB A;  4RQE A;  3FX7 A;  2QA4 V;  4LF4 O;  4PJ0 Z;  1IVS A;  3T1Y B;  4X89 A;  2YXH A;  4TWK A;  2WWW A;  4UVC A;  2OTL V;  4FLX A;  1NVP B;  3OMN B;  3AG1 C;  2ZNI A;  2YS8 A;  1SC5 B;  3ZHT A;  3CX5 F;  4LFB B;  1PNL A;  5LGU A;  2D2C B;  5FNV B;  1K8A W;  2YUA A;  4YY3 O;  4LFA B;  3G6E V;  1S77 D;  4JGS A;  4O4H A;  3CCU V;  1IBM B;  4O4I A;  2ZE7 A;  3D3Q A;  1XMO O;  4DXW A;  3BFR A;  2DJV A;  4EEQ A;  3L71 H;  1GM7 A;  2GHY A;  4FK5 C;  2AGA A;  5JCO A;  1AI4 A;  5IYC O;  4TV8 B;  4EB6 A;  4JI8 O;  1K5S A;  1Y67 A;  1GMG A;  2L6L A;  4DV3 B;  3QVN A;  2ZXW C;  2B1G A;  3S3W A;  1FXH A;  4ZHQ A;  2Z0A A;  4X62 O;  3J7A U;  2ZIM A;  3CRR A;  1I94 O;  3E8G A;  4DR6 O;  4U3F H;  2LW7 A;  4IT5 A;  4BW5 A;  1FFT B;  2PTM A;  3SPJ A;  3I56 V;  2UUA O;  2YC0 A;  4DRX B;  1PPJ H;  4CH6 A;  3CCE V;  1JX9 A;  4AIL C;  3G4S V;  1THZ A;  1VIB A;  2IU3 A;  5BMV B;  2BE3 A;  1JJ2 U;  1OCC B;  5GTI Z;  4JI0 O;  5JQG B;  2UUB O;  1GN6 A;  4X1Y B;  3ML0 A;  3IFX A;  4DW0 A;  3CCL V;  1YVW A;  1ZX3 A;  3IGA C;  3VQX A;  2N04 A;  4J41 A;  1SA0 B;  1VMG A;  3OEE G;  3AG3 B;  3BCC H;  2EIJ C;  4B7E A;  4W4L A;  4FFB B;  1OCO B;  3K08 A;  2BSK A;  2YEV B;  2XHB A;  4GX0 A;  3OAA G;  3SR2 C;  4KHP O;  2V1D A;  2DQ3 A;  3SYP A;  1QLE B;  2Q5Z A;  4HYO A;  3OTO B;  5B66 Z;  1WJZ A;  1FJG O;  2DYR B;  3JD2 A;  3RWR D;  1GTO A;  5H5N A;  4RQF A;  3D3I A;  5L3D A;  2XAJ A;  2QR4 A;  3VQW A;  2UXD B;  1DLB A;  3FD9 A;  3RW0 A;  4GKK O;  1AJP A;  2FKX A;  3GWO A;  1FXK B;  2XAH A;  4NXN O;  3QO8 A;  4O2B B;  2UXX A;  4BR6 A;  4PDV A;  4PDL A;  1YEW A;  2KG7 B;  2N05 A;  2NLJ C;  2VRZ A;  1ZUQ A;  1D5N A;  1QR8 A;  1XMQ B;  4DRX A;  3ASO C;  4RUE A;  4MW3 A;  3LNM B;  1NS1 A;  2KB1 A;  3H01 A;  1BHB A;  5IJ0 B;  4WFH A;  4IL6 Z;  1OJH A;  2KSD A;  1OCZ B;  1H2M A;  4UV9 A;  4MSW C;  1FKA O;  2QTS A;  1B6Q A;  4X1Y A;  3TJT A;  5B1O A;  1N36 O;  1WA8 A;  2GUZ B;  2P22 C;  4N21 A;  1SQP H;  1D2D A;  5LHH A;  2ETN A;  1VQ9 V;  5IE9 A;  5B1B C;  4LF4 B;  1QR9 A;  2VQF O;  4O2A B;  1DK1 A;  4X20 B;  4JI3 O;  4LWS B;  3IAY A;  5J2T B;  1Q3E A;  1KBH A;  4I4T B;  4WFA V;  1FAF A;  4IHJ B;  4KXR A;  1K7D A;  5FPO A;  2YEV A;  2LO1 A;  4MVO A;  3OW2 U;  3N2G B;  3OMI B;  4LCU C;  4QIW F;  1SQQ H;  4YY3 B;  3JAW A;  2GBO A;  1Q90 D;  1R6T A;  2H3O A;  4I55 A;  1TUB B;  4R50 A;  2D3O W;  4CC6 A;  3STL C;  5B5E Z;  2EUL A;  1SQF A;  2OCH A;  2CE4 A;  3VBB A;  1XMO B;  3H1K H;  3MAQ A;  1KP2 A;  4JAA A;  2OYQ A;  1GM9 A;  3OFN G;  1MMM A;  4FLT A;  3IC9 A;  2EIN B;  1YIJ V;  3TCU A;  1NR1 A;  4O2B A;  4JI8 B;  1U97 A;  1MSW D;  4FVM A;  3N2K A;  2AW9 A;  3L74 H;  3K9A A;  1TVK B;  3CXH F;  1EBO A;  4J11 A;  3RYH A;  4EFB A;  3K5M A;  3JYC A;  5CMU A;  4PHZ A;  4X62 B;  4DR2 B;  4F4L A;  1L0L H;  1I94 B;  5IJ0 A;  4PI2 A;  3AG4 B;  4DR6 B;  3G67 A;  5BR8 O;  3I5D A;  1WPB A;  3L72 H;  2UU9 B;  4UV8 A;  3CCV V;  1R73 A;  4TSF G;  2QTO A;  2LQT A;  4XDK A;  1RP3 B;  2QM4 A;  4EKW A;  4F6R B;  1YSC A;  1ORQ C;  2M7W A;  2UUA B;  5B3S C;  1JFF B;  3W7U A;  2WLI B;  4JYA B;  1K4D C;  2P7T C;  4X20 A;  2RCV A;  4IIJ B;  3KZI Z;  4BW9 A;  3LDC A;  1YCI A;  5J2T A;  2EIM C;  1BT8 A;  3LSS A;  4Z1V A;  3FAV B;  4I4T A;  1V55 C;  2AHY A;  5L3C A;  4DUY O;  3N27 A;  1YI2 V;  1SZX A;  3D36 C;  4W4K A;  3CJH A;  4JI0 B;  2UUB B;  4GUN A;  3N2G A;  1SQV H;  4HAM A;  3GVM A;  3HKD A;  4YIO A;  5KUK A;  1AI5 A;  1S72 V;  1R6N A;  2X7R B;  4B08 A;  4TQF A;  4U7O A;  2Q7E A;  4PDR A;  3ZMT A;  1NKD A;  2JIZ G;  1VAR A;  1QU7 A;  3F5W C;  1RPO A;  2ZXW B;  4KHP B;  4FMT A;  3UO3 A;  3AG2 C;  1R1B A;  2XND G;  4AI8 A;  3A0R A;  4NKG B;  3ZCC A;  1FJG B;  2WLN A;  1S5H C;  3CEI A;  3ETG A;  1TVK A;  3BAA A;  5J9P C;  3E83 A;  3K5L A;  4DR3 O;  1QQC A;  3OEH G;  4UVB A;  2WLJ A;  4H0L B;  4B3R O;  1N33 O;  4GKK B;  2EJR A;  1YHQ V;  2H8P C;  2IJJ A;  4FFK A;  1H2L A;  3CCS V;  4NTW A;  4NXN B;  3OR7 C;  5EZY A;  2DYS B;  4F6R A;  2C2A A;  2F1M A;  5LOV A;  3ZBH A;  5IYZ B;  1YTF B;  2WAM A;  1PNK A;  1ZL8 B;  1VF6 C;  2UXC B;  4JI4 O;  4IIJ A;  4ZI7 A;  4JI1 O;  1JA8 A;  1H38 A;  2HG5 C;  1OCR C;  3T1H B;  3OTF A;  3ZMU A;  5LA6 B;  3DC6 A;  3CYO A;  1WB8 A;  3ZED A;  4Z1M G;  1SS3 A;  4CZZ A;  1X59 A;  1NVP D;  2X6C A;  1ZSP A;  1Q8I A;  4ZBM A;  3HKE B;  4FM2 A;  2EIJ B;  2E3C A;  1N36 B;  2LGW A;  4UB6 Z;  1N4C A;  3HPL C;  2CAZ C;  2IJH A;  2IJK A;  4MTF A;  1YXB A;  1M57 C;  2FB5 A;  1H2G A;  2YI8 A;  3CCJ V;  2A9H A;  4TQD A;  4JI3 B;  2HEP A;  1E1Q G;  2QSA A;  2YXL A;  3FYI B;  5DED A;  2ITD C;  3CCQ V;  4CS4 A;  2WA3 A;  1KB9 F;  3ZJZ A;  3AEI A;  4JI6 O;  3FKS G;  5LMU O;  2YSU B;  2FTK A;  2QM8 A;  4F6E A;  5IJ9 B;  3AK2 A;  5EYP A;  3VOU A;  4FLV A;  5LMN O;  3TXQ A;  3AK3 A;  3BHP A;  4JV5 O;  4CBC A;  3OE7 G;  2R9A A;  1P7G A;  1SF9 A;  2JS5 A;  1IUR A;  2RNB A;  1ZLZ A;  2DE0 X;  1YIT V;  2BCC H;  1CPY A;  3P30 A;  3K5O A;  4JI5 B;  1HR0 B;  4X1I A;  1WB7 A;  1VQK V;  2XAQ A;  4NTX A;  3E35 A;  1YF2 A;  1MNG A;  1IZ3 A;  4PD4 F;  4X88 A;  2H94 A;  3A0B Z;  2JS3 A;  1JR9 A;  3SGI A;  1KYO F;  3RYI A;  4DR7 O;  5H9C A;  1N0J A;  3PJS K;  4O4H B;  3C90 A;  2L35 A;  1N32 B;  3HKE A;  4B3M O;  4FLZ A;  1Y76 B;  3CS5 A;  1BS3 A;  4LF6 O;  1ZAU A;  1F7Y A;  4PA9 A;  3B40 A;  1V54 B;  3JSL A;  1K73 W;  2ZE5 A;  1M90 W;  4LR3 A;  2AZ0 A;  5EBM C;  4EB6 B;  3KCY A;  3JAR A;  1SRY A;  3K59 A;  2WLL B;  3T1C A;  1GAX A;  4DUY B;  4G28 B;  2WLH A;  4ZHQ B;  1Q6I A;  3QNE A;  3Q4H A;  2HHH O;  5JJE B;  4RWU A;  2YIA A;  2Z3Y A;  4DR4 B;  5KAF Z;  3K57 A;  4JAS A;  3A0H Z;  1JJO A;  4UCT A;  5JJJ B;  5K1P A;  3L73 H;  4P30 A;  1M4U A;  3ICX A;  3JAT A;  4FZ1 A;  2R9R B;  1W2B U;  1SES A;  2QM7 A;  3B4S A;  1L1F A;  4X66 O;  4P9O A;  5AG2 A;  4DV7 O;  3UT5 A;  4FLU A;  1YJW V;  2ZR2 A;  4UCR A;  1SET A;  2M6Y A;  4UB8 Z;  1YJ9 V;  1N34 O;  4DV6 O;  3P3N A;  2P4V A;  1H8H G;  3WB2 A;  4DR3 B;  3ABU A;  4B3R B;  5TIS Z;  1XNQ O;  1N33 B;  5CBG A;  1ARO P;  3ETD A;  3B8M A;  3HKC B;  4A5U B;  1SER A;  1Y76 A;  4YIP A;  4WF9 V;  4XDJ A;  4CH5 A;  1XIL A;  2HR3 A;  3C3S A;  5LP6 C;  1PL4 A;  3MHS C;  3MHH C;  3BA8 A;  2BSK B;  1FYJ A;  3QO7 A;  1X4T A;  2YIB A;  4DR1 O;  1VQ4 V;  1TUE B;  4JI4 B;  2BOB C;  4JI1 B;  5JJN B;  2QEX V;  1IX9 A;  2FL4 A;  1NH2 B;  1HNX O;  2WLL A;  2BTQ B;  3ZRX A;  2JDI G;  2ZD9 A;  1EN5 A;  5L3G A;  1GKF A;  1GM8 A;  4DV0 O;  1TGO A;  1Q81 W;  1PNM A;  4QGP A;  1J5E O;  2Y69 C;  4QNH B;  4U3J B;  3CRC A;  1JOY A;  1KKD A;  4P9P A;  2K1E A;  2LW1 A;  5CA3 A;  2JK5 C;  5LXT B;  4JYC A;  1SQB H;  1XEQ A;  3ZN1 A;  5D5Q A;  3KCX A;  4JI6 B;  4H13 B;  5LMU B;  4H37 A;  3CD6 V;  2ADP A;  3SPI A;  5LMN B;  3ABK B;  1NU1 H;  3E22 B;  4OX9 O;  4FM1 A;  2JVD A;  4TOI A;  4JV5 B;  3JSN A;  3UM7 A;  2ITC C;  1S0V A;  3JAL A;  1W59 A;  2F66 C;  1WA8 B;  5KA6 A;  1GN4 A;  3TK1 A;  1XHZ A;  3JD4 A;  5JWP A;  1XNR O;  1P84 F;  3CRM A;  1ENV A;  1MZE A;  5KHK A;  3HKC A;  3CCR V;  2IM9 A;  1XHX A;  1JMK C;  5KX5 A;  4G27 B;  1OCR B;  3EHB B;  1D5A A;  3ZHQ A;  1NTM H;  3H1H H;  1CP9 A;  1SQX H;  2HVJ C;  3SYO A;  1VQP V;  4GKJ O;  3ASN C;  3D36 A;  4BIZ A;  3F7Y C;  5JVD B;  4Q6G A;  1S76 D;  3W7T A;  1IBL O;  2Q4P A;  3JAW B;  1M56 C;  4DR7 B;  4I55 B;  2Q7G A;  1K5Q A;  1WN7 A;  3SYQ A;  1G6U A;  2BTQ A;  4JYB A;  3SYC A;  1V9P A;  2ZDI C;  1Q86 W;  4FM0 A;  4B3M B;  3THO A;  1DTO A;  1E79 G;  3K03 A;  1FXV A;  4B3S B;  3ABL C;  1AJN A;  3ABM C;  2RMK B;  4U3J A;  2OCC C;  1YZB A;  4DK0 A;  3IJ4 A;  2A0L A;  5DEC A;  1KEC A;  4ZKI A;  1AB3 A;  1NI8 A;  3K06 A;  1P49 A;  5E79 Z;  3OMA B;  3N2K B;  3SDL A;  5LXT A;  3QTC A;  5J2U A;  4K3A A;  1HNW O;  1FFX A;  2CK3 G;  3RYH B;  5CBH A;  2P06 A;  3X2Q B;  5KHI A;  5LHG A;  1IBK B;  2Z5U A;  4JPR A;  1LR1 A;  5IDJ A;  2HHH B;  5IY5 B;  1R3K C;  3H9V A;  4CS2 A;  4X65 O;  3E22 A;  4MW8 A;  5LGN A;  3CC2 V;  1Z5V A;  3E89 A;  3L9D A;  2G38 A;  2ODM A;  2OWO A;  3ETE A;  3ZRW A;  2AZ2 A;  1G8M A;  3RFR A;  2YDE A;  1GN3 A;  3MD0 A;  3CCM V;  1AR4 A;  4XDL A;  2EZO A;  1Q6H A;  2GTA A;  2PYL A;  1FS0 G;  2EZP A;  1US6 A;  3FB8 C;  5L3F A;  5CA0 A;  2UXB O;  1VF6 A;  4FIP C;  4DV7 B;  1GH6 A;  4MTG A;  4BIU A;  4LF5 O;  3LDE A;  2AHZ A;  3LSQ A;  3RVZ A;  1W0J G;  1K33 A;  4KFM A;  3T2M A;  2A7W A;  1HDJ A;  3M99 B;  4DV6 B;  1SKV A;  3CME V;  3BRC A;  1L8D A;  3CJH B;  3JD3 A;  2UUC O;  1YTF D;  1BHA A;  5JVD A;  1NT2 B;  3ZX6 A;  4IYI A;  3HKD B;  2WSS G;  5A2Q N;  1N8R W;  5FLX N;  3CE2 A;  3VQV A;  1QVF U;  1RM1 B;  1BMF G;  5CBF A;  2EIL B;  3DC5 A;  3O9O A;  4UVA A;  5JCO C;  1SZT A;  1HNZ O;  2CTP A;  2ZT9 B;  2QDO A;  4DW1 A;  1W0K G;  3LSU A;  4GX5 A;  3EXA A;  4FPP A;  4ZOL A;  3FB6 C;  3OR6 C;  4AQY O;  1AJQ A;  1HNX B;  2YID A;  4JZ2 A;  2F43 G;  4IYH A;  4XBF A;  2AXT Z;  5DN6 G;  4DV0 B;  3ZMZ A;  2VS0 A;  2ADQ B;  3OUS A;  1J5E B;  4MVS A;  5BXZ A;  5EIB D;  3CXC U;  2ZR3 A;  4FZ0 A;  1F4M A;  1B3Q A;  1LUW A;  2OIE A;  1I0H A;  2B9Z A;  2QWN B;  1VEW A;  4RO2 A;  3SYA A;  5EZY B;  1XBL A;  1JQ0 A;  1Y4M A;  1IDS A;  5LOV B;  4B3T O;  3AG1 B;  4PA3 A;  2B5U A;  2RJZ A;  3GWK C;  5L3E A;  5ITZ B;  2LFR A;  4ZI7 B;  2GDS A;  3HKB A;  3UQ8 A;  3BAB A;  4OX9 B;  2EIK C;  3WG7 C;  3G6B A;  4MVQ A;  3UKM A;  3PN1 A;  4UFZ A;  1K3E A;  2E74 B;  1AP5 A;  2XT9 A;  2LJ2 A;  1S3J A;  1XNR B;  1FPO A;  1Y66 A;  1Q6U A;  2JEU A;  1BQZ A;  4E2L A;  5KAI Z;  2ILM A;  3BA9 A;  5HFL A;  1XOU A;  4GKJ B;  3CWB H;  2QKS A;  3LNN A;  5LGT A;  2YIB D;  1XL6 A;  5EYP B;  1IBL B;  2IH1 C;  5LBQ A;  1MAB G;  3DSQ A;  1MSD A;  4X8A A;  1KU9 A;  4PA4 A;  1RSO A;  5C93 A;  2E75 B;  1UJW B;  3AG7 A;  1N0N A;  3FYE B;  4LH6 A;  1PM9 A;  3U11 A;  3E8H A;  1KKC A;  4CH4 A;  4ICG A;  4NYK A;  4X64 O;  4X1I B;  5H2F Z;  2Q8V A;  1H2N A;  1R3I C;  3JAS A;  3F7V C;  1R6K A;  1HNW B;  1I5Y A;  3CRQ A;  2PY5 A;  1KD1 W;  4LFA O;  5ITZ A;  3RYI B;  2Q68 A;  4J42 A;  1IBM O;  4LF9 O;  2P90 A;  1OCC C;  3H1L H;  4Q20 A;  1YJN V;  3H1I H;  3L75 H;  1VQ5 V;  4UCO A;  3SJQ C;  4N23 A;  4QJF B;  3MDS A;  3LDD A;  4P2Z A;  1VF7 A;  4D6T H;  5LP6 A;  2DQ0 A;  4RAI A;  3AG3 C;  1M5I A;  2ZIN A;  2XTA A;  3QF7 A;  2VQF B;  1ZWI C;  1JPX A;  5B1A C;  2F93 B;  3CP1 A;  1GO3 F;  3JAR B;  5CA1 B;  3K79 A;  4MTX A;  2CH7 B;  2OIG A;  1QLE C;  4I5S A;  3JCU Z;  4O4L A;  3Q4H B;  4UCV A;  1WP7 A;  2DYR C;  5IWA O;  4WFE A;  2JEX A;  2XAF A;  3E2E A;  4JAV A;  2OCC B;  2XAG A;  1GN2 A;  2R9I A;  1NH2 D;  1Q7Y W;  4MVM A;  1PD3 A;  3JAT B;  1K34 A;  1EFR G;  3DXR A;  1BQ0 A;  1LNQ A;  5L3B A;  2XAS A;  1FXK C;  2DWD C;  3R65 A;  4UUJ C;  1HNZ B;  3ASO B;  1WAZ A;  1AI6 A;  4GLX A;  1KMI Z;  3UT5 B;  2QWQ B;  3IC7 A;  1HW7 A;  1QBZ A;  3APQ A;  3OT7 A;  4J7J A;  4I9Q A;  2Y0I A;  3BVO A;  3S3X A;  2DMX A;  2LP7 A;  3CHX A;  3L70 H;  5A9G A;  3P32 A;  3A8T A;  2O57 A;  1H8E G;  4BIO A;  2XUM A;  1OCZ C;  3OM3 B;  1SQG A;  4YJ3 A;  1EN4 A;  1K97 A;  2Y4T A;  5BR8 B;  1UPG A;  4OPA A;  2Q0O C;  1CXZ B;  3JD1 A;  4J10 A;  5B1B B;  3CC4 V;  4QPJ A;  5KMG A;  2WA4 A;  3G71 V;  4B3T B;  3STZ C;  3RT3 C;  1J95 A;  3FFQ A;  1AVM A;  4YXW G;  1MA1 A;  2VWJ A;  3HR0 A;  2Q9L A;  3RN4 A;  4FLY A;  5CA1 A;  4PDM A;  4K0K O;  2CH7 A;  1VP7 A;  1BZK A;  2ZDI A;  1EN6 A;  3SJB C;  3CB2 A;  3FB5 C;  1M93 A;  4JTC B;  1O9H A;  4L8J A;  1EZV H;  1M9N A;  3CC7 V;  4PEL A;  3EFF K;  1QNM A;  3VQY A;  3QG5 A;  3D8C A;  3WB1 A;  5DM6 V;  4C7U A;  1JCH A;  3ZN0 A;  1VQ7 V;  4ASU G;  3J81 N;  3K0G A;  1R3L C;  3W7W A;  1I7F A;  2ZE8 A;  5KA5 A;  1F51 A;  3P3P A;  4J80 A;  1Y6X A;  2ZQM A;  1U96 A;  1JVM A;  4JI2 O;  4NR1 A;  3AG4 C;  1B06 A;  4IGG A;  3JAL B;  4TV9 B;  2A79 B;  3APO A;  4NXM O;  1T5E A;  5B3S B;  2WLM A;  5CB4 A;  2FML A;  4WBN A;  5KX5 B;  1TA8 A;  2EIM B;  2LFS A;  4X64 B;  2Q69 A;  1V55 B;  3ZHR A;  1K9M W;  1IXM A;  1DGS A;  2EIK B;  3WG7 B;  4I50 A;  3SPG A;  3ZRS A;  4DYL A;  3RYC A;  4LF9 B;  4OGQ B;  2CUG A;  2P4K A;  3GB7 C;  4NVP A;  3B09 A;  2QKA A;  4I0X A;  1NBM G;  4H33 A;  4D7S A;  4HZ3 A;  3W7X A;  4DV2 O;  2PZS A;  3RYF B;  1PL0 A;  2JJ2 G;  5EK0 A;  4KUM A;  1WPX A;  4CH3 A;  2CGN A;  3AG2 B;  2X0L A;  4DK1 A;  2F95 B;  4DR2 O;  2F4V O;  3NR7 A;  5J2U B;  1FFX B;  4DUZ O;  3K58 A;  2QKC A;  2X6B A;  2ZM6 O;  5IYD O;  3WB0 A;  2UU9 O;  1YDX A;  2X6A A;  4HNA B;  1QVG U;  1LUV A;  2CDY A;  5IWA B;  2UXN A;  3H1J H;  4YJ2 B;  1WP8 A;  1AIL A;  2JRI A;  4JTD B;  1A32 A;  1OZ0 A;  4PV1 B;  3ZRW B;  5BZB A;  1PV0 A;  1URF A;  4JYY A;  4R7C A;  4JYA O;  4TV9 A;  1VQM V;  2Y4U A;  1KQS U;  1QLN A;  5HFM A;  1B04 A;  2DYS C;  1XUQ A;  5CA0 B;  2PI4 A;  1GRJ A;  3KG2 A;  4G2K A;  1XL4 A;  2F23 A;  1MOF A;  3RVY A;  1AI7 A;  5FNV A;  4JI7 O;  5GW7 A;  2DN9 A;  2Q7H A;  2GSM B;  2ZKO A;  3ETQ A;  5IYB O;  1I08 A;  4QPK A;  2PYJ A;  3OGI B;  1M57 B;  1S5L Z;  4OXS A;  4LF8 O;  5B1A B;  1XRE A;  5EC2 C;  2E5L O;  4LF6 B;  2V4D A;  3RYF A;  4TV8 A;  1G1X B;  4R6Z A;  1OV9 A;  2HJF C;  4TUY B;  4U7N A;  1UFI A;  1RFY A;  4ZOL B;  1P4R A;  4MVU A;  4DR5 O;  2QE7 G;  5JH7 B;  1HP8 A;  4GX1 A;  1G4Y B;  1F23 A;  4JF3 A;  1O9G A;  4KP4 A;  4K0K B;  5EIB C;  2KQX A;  1AR5 A;  2PUS A;  5CN0 A;  5IT9 N;  5GON B;  4FJC C;  4HNA A;  3CSX A;  4LC1 A;  5EC1 C;  2JJ1 G;  1Z5W A;  4UCS A;  3K04 A;  4YJ2 A;  1XDC A;  4LFC O;  3G80 A;  3FB7 C;  3WU2 Z;  1KC8 W;  2UXC O;  1NQT A;  3TGU H;  5KHG A;  3T1H O;  4X66 B;  3M7M X;  2E76 B;  2ARH A;  4MT8 A;  5BMV A;  2GV9 A;  1KP3 A;  3HKB B;  2VWK A;  3ZHU A;  2IJI A;  2HLD G;  5JQG A;  2A06 H;  2OT5 A;  4JI2 B;  2GTS A;  2Q73 A;  1K92 A;  2MW2 B;  3U0Z A;  1K4C C;  4MVR A;  2V7Q G;  4DV4 O;  4DV5 O;  1N34 B;  2QWP B;  1PP9 H;  4DV1 O;  4BWA A;  2Q6A A;  5K1X A;  1H2S B;  3JAM N;  1NZ6 A;  4MTO A;  1TAE A;  4H44 B;  1SA0 A;  4NXM B;  3KKY A;  1XNQ B;  3B8N A;  5D5P A;  4FFB A;  4X9Q A;  4FLW A;  3UO2 A;  3R66 A;  1V54 C;  1VF5 B;  2IH3 C;  4UCU A;  2NN4 A;  3UCS C;  2ZNJ A;  3K3W A;  4LBE C;  4MVZ A;  4WFF A;  4O4J B;  3B2E E;  3F5T A;  3E8B A;  4NTY A;  3NXS A;  2CGO A;  4CC5 A;  4TUY A;  4Z2W A;  4DR1 B;  3M8A A;  4J7Z A;  1FD9 A;  5JH7 A;  3K0D A;  1GK9 A;  2YI9 A;  4LF7 O;  4WCE V;  1RSO B;  1F4N A;  3SJA C;  5KHH A;  5GON A;  4WFB V;  4DV2 B;  1FXK A;  4YHH O;  2P6J A;  3DTU B;  5LYJ B;  4QE7 A;  1NR7 A;  3SPC A;  4JI5 O;  1HR0 O;  4QE9 A;  4X1K B;  5KLV H;  2KG7 A;  4J7K A;  2VQE O;  1NJI W;  2IW5 A;  1DF5 A;  2CTR A;  2OTJ V;  3A2F A;  2F4V B;  3JAS B;  3ZS8 C;  3J80 N;  3ABT A;  3OUF A;  4DUZ B;  5EBW C;  2KKW A;  2N74 A;  2R72 A;  2ZM6 B;  2QWR B;  2WLK A;  3U10 A;  3CMA V;  1N32 O;  1VQ8 V;  1KUQ A;  1H2K A;  3EVK A;  3JAK B;  2GUZ A;  4R8C A;  2Y48 A;  1M1K W;  2HKO A;  4LNU B;  4O2A A;  1EM1 A;  5LP6 B;  2LGQ A;  1QCE A;  4GZR B;  2CTW A;  4J9Z B;  4D7T A;  4LWS A;  1BE3 H;  2P67 A;  1Q82 W;  2Q0A A;  1QHT A;  4IHJ A;  2BTO A;  3B77 A;  2JGU A;  3K5N A;  2RDC A;  3BPZ A;  2HJD A;  2PI5 A;  4O4J A;  3HB3 B;  3LUT B;  5FL7 G;  4DR4 O;  4JI7 B;  2XOK G;  2HP8 A;  1TUB A;  4O4L B;  5H6R A;  2Y69 B;  2DOS A;  4GYC B;  5B1N A;  1Y74 B;  3SJC C;  1Z2G A;  4LF8 B;  4MS2 A;  3DXR B;  4JZG A;  2E5L B;  3T1Y O;  5FPR A;  5GTH Z;  5E1A C;  5LYJ A;  4HBN A;  2IBZ H;  2DWE C;  1BSM A;  4X1K A;  4KL1 A;  4LFB O;  4I9W A;  2EX3 A;  1L0N H;  4DR5 B;  4RUF A;  2QWO B;  1P7B A;  3ZRV A;  2QGN A;  3W7S A;  1BCC H;  4NB5 A;  1E1R G;  3ABK C;  3T4Z A;  1DF4 A;  1BGY H;  4YJ3 B;  3ZMS A;  4X65 B;  4BAY A;  3JAK A;  4LH7 A;  4LFC B;  4EFE A;  5KMG B;  1XI1 A;  2W0F C;  1JFF A;  2ZE6 A;  2NR5 A;  3OD4 A;  5KUM A;  2WLI A;  4LNU A;  3QO5 A;  5H6Q A;  2JGD B; 
#chains in the Genus database with same CATH homology
 2UXC O;  1KUQ A;  4JI8 O;  3J81 N;  2AGA A;  1AIL A;  2JRI A;  3T1H O;  4B3R O;  5A2Q N;  1XNQ O;  4B3S O;  1N33 O;  1A32 A;  2UXD O;  5FLX N;  4GKK O;  4DV3 O;  4GKJ O;  2FKX A;  4A5U B;  4JYA O;  2Z0A A;  4X62 O;  1IBL O;  3J7A U;  4NXN O;  1I94 O;  4DR7 O;  4JI2 O;  4OPH A;  4DR6 O;  4DV4 O;  4DV5 O;  5BR8 O;  1FYJ A;  1HNZ O;  4DV1 O;  2LW7 A;  1XMQ O;  4DR1 O;  3JAM N;  1IBK O;  4B3M O;  4JI4 O;  4JI1 O;  5BY1 A;  1NS1 A;  4NXM O;  4LF6 O;  4AQY O;  1HNX O;  4DR4 O;  4JI7 O;  1F7Y A;  2UUA O;  1YZB A;  3O65 A;  1X59 A;  3R66 A;  1AB3 A;  1FKA O;  4DV0 O;  2ZKO A;  4X64 O;  1N36 O;  3SDL A;  2DOS A;  5LL6 Y;  3F5T A;  4OPA A;  5BXZ A;  1J5E O;  4LF8 O;  1HNW O;  4DUY O;  3M8A A;  1D2D A;  4LFA O;  4LF4 O;  2VQF O;  1DK1 A;  2E5L O;  4JI3 O;  4JI0 O;  1IBM O;  3T1Y O;  2HHH O;  2UUB O;  4LF9 O;  4X65 O;  4B3T O;  3RT3 C;  1G1X B;  4LF7 O;  1XEQ A;  4JI6 O;  4LFB O;  5LMU O;  4DR5 O;  4DV2 O;  4YHH O;  5LMN O;  4YY3 O;  1R6T A;  4OX9 O;  4K0K O;  4JI5 O;  1HR0 O;  4X66 O;  4JV5 O;  2VQE O;  5IT9 N;  2UXB O;  4DV7 O;  4KHP O;  1XMO O;  4LF5 O;  4DR2 O;  2F4V O;  1R1B A;  3J80 N;  4DUZ O;  4LFC O;  3OTO O;  1FJG O;  1XNR O;  1N34 O;  2N74 A;  2ZM6 O;  4DV6 O;  2DJV A;  2UU9 O;  2UUC O;  1N32 O;  5H5N A;  4DR3 O;  5IWA O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...